data_2DGZ
# 
_entry.id   2DGZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2DGZ         
RCSB  RCSB025407   
WWPDB D_1000025407 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hsk003001883.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2DGZ 
_pdbx_database_status.recvd_initial_deposition_date   2006-03-16 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Abe, C.'                                                1 
'Muto, Y.'                                               2 
'Inoue, M.'                                              3 
'Kigawa, T.'                                             4 
'Terada, T.'                                             5 
'Shirouzu, M.'                                           6 
'Yokoyama, S.'                                           7 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 
# 
_citation.id                        primary 
_citation.title                     
'Solution structure of the Helicase and RNase D C-terminal domain in Werner syndrome ATP-dependent helicase' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Abe, C.'      1 
primary 'Muto, Y.'     2 
primary 'Inoue, M.'    3 
primary 'Kigawa, T.'   4 
primary 'Terada, T.'   5 
primary 'Shirouzu, M.' 6 
primary 'Yokoyama, S.' 7 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Werner syndrome protein variant' 
_entity.formula_weight             12081.733 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    3.6.1.- 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'Helicase and RNase D C-terminal domain' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Werner syndrome ATP-dependent helicase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGSSQPVISAQEQETQIVLYGKLVEARQKHANKMDVPPAILATNKILVDMAKMRPTTVENVKRIDGVSEGKAAML
APLWEVIKHFCQTNSVQTDLFSSTKPQSGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGSSQPVISAQEQETQIVLYGKLVEARQKHANKMDVPPAILATNKILVDMAKMRPTTVENVKRIDGVSEGKAAML
APLWEVIKHFCQTNSVQTDLFSSTKPQSGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hsk003001883.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   SER n 
1 9   SER n 
1 10  GLN n 
1 11  PRO n 
1 12  VAL n 
1 13  ILE n 
1 14  SER n 
1 15  ALA n 
1 16  GLN n 
1 17  GLU n 
1 18  GLN n 
1 19  GLU n 
1 20  THR n 
1 21  GLN n 
1 22  ILE n 
1 23  VAL n 
1 24  LEU n 
1 25  TYR n 
1 26  GLY n 
1 27  LYS n 
1 28  LEU n 
1 29  VAL n 
1 30  GLU n 
1 31  ALA n 
1 32  ARG n 
1 33  GLN n 
1 34  LYS n 
1 35  HIS n 
1 36  ALA n 
1 37  ASN n 
1 38  LYS n 
1 39  MET n 
1 40  ASP n 
1 41  VAL n 
1 42  PRO n 
1 43  PRO n 
1 44  ALA n 
1 45  ILE n 
1 46  LEU n 
1 47  ALA n 
1 48  THR n 
1 49  ASN n 
1 50  LYS n 
1 51  ILE n 
1 52  LEU n 
1 53  VAL n 
1 54  ASP n 
1 55  MET n 
1 56  ALA n 
1 57  LYS n 
1 58  MET n 
1 59  ARG n 
1 60  PRO n 
1 61  THR n 
1 62  THR n 
1 63  VAL n 
1 64  GLU n 
1 65  ASN n 
1 66  VAL n 
1 67  LYS n 
1 68  ARG n 
1 69  ILE n 
1 70  ASP n 
1 71  GLY n 
1 72  VAL n 
1 73  SER n 
1 74  GLU n 
1 75  GLY n 
1 76  LYS n 
1 77  ALA n 
1 78  ALA n 
1 79  MET n 
1 80  LEU n 
1 81  ALA n 
1 82  PRO n 
1 83  LEU n 
1 84  TRP n 
1 85  GLU n 
1 86  VAL n 
1 87  ILE n 
1 88  LYS n 
1 89  HIS n 
1 90  PHE n 
1 91  CYS n 
1 92  GLN n 
1 93  THR n 
1 94  ASN n 
1 95  SER n 
1 96  VAL n 
1 97  GLN n 
1 98  THR n 
1 99  ASP n 
1 100 LEU n 
1 101 PHE n 
1 102 SER n 
1 103 SER n 
1 104 THR n 
1 105 LYS n 
1 106 PRO n 
1 107 GLN n 
1 108 SER n 
1 109 GLY n 
1 110 PRO n 
1 111 SER n 
1 112 SER n 
1 113 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 WRN 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Cell free synthesis' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P051212-13 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    WRN_HUMAN 
_struct_ref.pdbx_db_accession          Q14191 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           1140 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2DGZ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 107 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q14191 
_struct_ref_seq.db_align_beg                  1140 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1239 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1140 
_struct_ref_seq.pdbx_auth_seq_align_end       1239 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2DGZ GLY A 1   ? UNP Q14191 ? ? 'CLONING ARTIFACT' 1133 1  
1 2DGZ SER A 2   ? UNP Q14191 ? ? 'CLONING ARTIFACT' 1134 2  
1 2DGZ SER A 3   ? UNP Q14191 ? ? 'CLONING ARTIFACT' 1135 3  
1 2DGZ GLY A 4   ? UNP Q14191 ? ? 'CLONING ARTIFACT' 1136 4  
1 2DGZ SER A 5   ? UNP Q14191 ? ? 'CLONING ARTIFACT' 1137 5  
1 2DGZ SER A 6   ? UNP Q14191 ? ? 'CLONING ARTIFACT' 1138 6  
1 2DGZ GLY A 7   ? UNP Q14191 ? ? 'CLONING ARTIFACT' 1139 7  
1 2DGZ SER A 108 ? UNP Q14191 ? ? 'CLONING ARTIFACT' 1240 8  
1 2DGZ GLY A 109 ? UNP Q14191 ? ? 'CLONING ARTIFACT' 1241 9  
1 2DGZ PRO A 110 ? UNP Q14191 ? ? 'CLONING ARTIFACT' 1242 10 
1 2DGZ SER A 111 ? UNP Q14191 ? ? 'CLONING ARTIFACT' 1243 11 
1 2DGZ SER A 112 ? UNP Q14191 ? ? 'CLONING ARTIFACT' 1244 12 
1 2DGZ GLY A 113 ? UNP Q14191 ? ? 'CLONING ARTIFACT' 1245 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY 1 
2 1 3D_13C-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      100mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '20mM d-Tris-HCl(pH7.0), 100mM NaCl, 1mM d-DTT, 0.02% NaN3, 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           2DGZ 
_pdbx_nmr_refine.method             'torsion angle dynamics,restrainted molecular dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2DGZ 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'target function, structures with the lowest energy, structures with the least restraint violations' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2DGZ 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           XWINNMR 3.5      Bruker      1 
processing           NMRPipe 20030801 Delaglio,F  2 
'data analysis'      NMRview 5.0.4    Johnson,B.A 3 
'data analysis'      kujira  0.932    Kobayashi,N 4 
'structure solution' CYANA   2.0      Guntert,P   5 
refinement           CYANA   2.0      Guntert,P   6 
# 
_exptl.entry_id          2DGZ 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2DGZ 
_struct.title                     
'Solution structure of the Helicase and RNase D C-terminal domain in Werner syndrome ATP-dependent helicase' 
_struct.pdbx_descriptor           'Werner syndrome protein variant (E.C.3.6.1.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2DGZ 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN' 
_struct_keywords.text            
;HRDC domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 14 ? MET A 39 ? SER A 1146 MET A 1171 1 ? 26 
HELX_P HELX_P2 2 PRO A 42 ? ALA A 47 ? PRO A 1174 ALA A 1179 1 ? 6  
HELX_P HELX_P3 3 THR A 48 ? ARG A 59 ? THR A 1180 ARG A 1191 1 ? 12 
HELX_P HELX_P4 4 THR A 62 ? ILE A 69 ? THR A 1194 ILE A 1201 1 ? 8  
HELX_P HELX_P5 5 GLY A 75 ? MET A 79 ? GLY A 1207 MET A 1211 5 ? 5  
HELX_P HELX_P6 6 LEU A 80 ? THR A 93 ? LEU A 1212 THR A 1225 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          2DGZ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2DGZ 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? 38.244  -21.154 3.001   1.00 0.00 ? 1133 GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? 37.294  -20.161 3.467   1.00 0.00 ? 1133 GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? 36.968  -19.127 2.407   1.00 0.00 ? 1133 GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? 37.365  -19.269 1.250   1.00 0.00 ? 1133 GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? 38.238  -22.055 3.388   1.00 0.00 ? 1133 GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? 36.383  -20.660 3.761   1.00 0.00 ? 1133 GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? 37.711  -19.657 4.327   1.00 0.00 ? 1133 GLY A HA3  1  
ATOM 8     N N    . SER A 1 2   ? 36.242  -18.086 2.801   1.00 0.00 ? 1134 SER A N    1  
ATOM 9     C CA   . SER A 1 2   ? 35.858  -17.028 1.874   1.00 0.00 ? 1134 SER A CA   1  
ATOM 10    C C    . SER A 1 2   ? 36.046  -15.654 2.511   1.00 0.00 ? 1134 SER A C    1  
ATOM 11    O O    . SER A 1 2   ? 36.282  -15.542 3.714   1.00 0.00 ? 1134 SER A O    1  
ATOM 12    C CB   . SER A 1 2   ? 34.403  -17.206 1.438   1.00 0.00 ? 1134 SER A CB   1  
ATOM 13    O OG   . SER A 1 2   ? 33.530  -17.189 2.554   1.00 0.00 ? 1134 SER A OG   1  
ATOM 14    H H    . SER A 1 2   ? 35.956  -18.030 3.737   1.00 0.00 ? 1134 SER A H    1  
ATOM 15    H HA   . SER A 1 2   ? 36.497  -17.099 1.006   1.00 0.00 ? 1134 SER A HA   1  
ATOM 16    H HB2  . SER A 1 2   ? 34.129  -16.403 0.770   1.00 0.00 ? 1134 SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2   ? 34.297  -18.152 0.927   1.00 0.00 ? 1134 SER A HB3  1  
ATOM 18    H HG   . SER A 1 2   ? 32.621  -17.144 2.250   1.00 0.00 ? 1134 SER A HG   1  
ATOM 19    N N    . SER A 1 3   ? 35.938  -14.610 1.695   1.00 0.00 ? 1135 SER A N    1  
ATOM 20    C CA   . SER A 1 3   ? 36.099  -13.244 2.176   1.00 0.00 ? 1135 SER A CA   1  
ATOM 21    C C    . SER A 1 3   ? 35.049  -12.323 1.560   1.00 0.00 ? 1135 SER A C    1  
ATOM 22    O O    . SER A 1 3   ? 35.093  -12.024 0.368   1.00 0.00 ? 1135 SER A O    1  
ATOM 23    C CB   . SER A 1 3   ? 37.502  -12.727 1.849   1.00 0.00 ? 1135 SER A CB   1  
ATOM 24    O OG   . SER A 1 3   ? 38.426  -13.084 2.861   1.00 0.00 ? 1135 SER A OG   1  
ATOM 25    H H    . SER A 1 3   ? 35.748  -14.764 0.745   1.00 0.00 ? 1135 SER A H    1  
ATOM 26    H HA   . SER A 1 3   ? 35.969  -13.252 3.248   1.00 0.00 ? 1135 SER A HA   1  
ATOM 27    H HB2  . SER A 1 3   ? 37.830  -13.152 0.912   1.00 0.00 ? 1135 SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3   ? 37.475  -11.650 1.765   1.00 0.00 ? 1135 SER A HB3  1  
ATOM 29    H HG   . SER A 1 3   ? 38.583  -14.031 2.833   1.00 0.00 ? 1135 SER A HG   1  
ATOM 30    N N    . GLY A 1 4   ? 34.106  -11.878 2.384   1.00 0.00 ? 1136 GLY A N    1  
ATOM 31    C CA   . GLY A 1 4   ? 33.057  -10.997 1.904   1.00 0.00 ? 1136 GLY A CA   1  
ATOM 32    C C    . GLY A 1 4   ? 33.564  -9.598  1.613   1.00 0.00 ? 1136 GLY A C    1  
ATOM 33    O O    . GLY A 1 4   ? 34.758  -9.325  1.735   1.00 0.00 ? 1136 GLY A O    1  
ATOM 34    H H    . GLY A 1 4   ? 34.121  -12.150 3.326   1.00 0.00 ? 1136 GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4   ? 32.639  -11.413 1.000   1.00 0.00 ? 1136 GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4   ? 32.281  -10.937 2.653   1.00 0.00 ? 1136 GLY A HA3  1  
ATOM 37    N N    . SER A 1 5   ? 32.654  -8.710  1.224   1.00 0.00 ? 1137 SER A N    1  
ATOM 38    C CA   . SER A 1 5   ? 33.016  -7.333  0.909   1.00 0.00 ? 1137 SER A CA   1  
ATOM 39    C C    . SER A 1 5   ? 31.843  -6.391  1.164   1.00 0.00 ? 1137 SER A C    1  
ATOM 40    O O    . SER A 1 5   ? 30.745  -6.828  1.505   1.00 0.00 ? 1137 SER A O    1  
ATOM 41    C CB   . SER A 1 5   ? 33.467  -7.223  -0.549  1.00 0.00 ? 1137 SER A CB   1  
ATOM 42    O OG   . SER A 1 5   ? 32.488  -7.753  -1.426  1.00 0.00 ? 1137 SER A OG   1  
ATOM 43    H H    . SER A 1 5   ? 31.718  -8.988  1.146   1.00 0.00 ? 1137 SER A H    1  
ATOM 44    H HA   . SER A 1 5   ? 33.836  -7.050  1.553   1.00 0.00 ? 1137 SER A HA   1  
ATOM 45    H HB2  . SER A 1 5   ? 33.629  -6.185  -0.795  1.00 0.00 ? 1137 SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5   ? 34.388  -7.772  -0.681  1.00 0.00 ? 1137 SER A HB3  1  
ATOM 47    H HG   . SER A 1 5   ? 32.922  -8.173  -2.173  1.00 0.00 ? 1137 SER A HG   1  
ATOM 48    N N    . SER A 1 6   ? 32.086  -5.095  0.995   1.00 0.00 ? 1138 SER A N    1  
ATOM 49    C CA   . SER A 1 6   ? 31.052  -4.089  1.210   1.00 0.00 ? 1138 SER A CA   1  
ATOM 50    C C    . SER A 1 6   ? 30.636  -3.447  -0.110  1.00 0.00 ? 1138 SER A C    1  
ATOM 51    O O    . SER A 1 6   ? 31.365  -3.508  -1.100  1.00 0.00 ? 1138 SER A O    1  
ATOM 52    C CB   . SER A 1 6   ? 31.550  -3.015  2.179   1.00 0.00 ? 1138 SER A CB   1  
ATOM 53    O OG   . SER A 1 6   ? 30.627  -1.943  2.269   1.00 0.00 ? 1138 SER A OG   1  
ATOM 54    H H    . SER A 1 6   ? 32.983  -4.809  0.722   1.00 0.00 ? 1138 SER A H    1  
ATOM 55    H HA   . SER A 1 6   ? 30.195  -4.583  1.643   1.00 0.00 ? 1138 SER A HA   1  
ATOM 56    H HB2  . SER A 1 6   ? 31.677  -3.448  3.159   1.00 0.00 ? 1138 SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6   ? 32.497  -2.630  1.829   1.00 0.00 ? 1138 SER A HB3  1  
ATOM 58    H HG   . SER A 1 6   ? 30.471  -1.732  3.192   1.00 0.00 ? 1138 SER A HG   1  
ATOM 59    N N    . GLY A 1 7   ? 29.458  -2.831  -0.116  1.00 0.00 ? 1139 GLY A N    1  
ATOM 60    C CA   . GLY A 1 7   ? 28.964  -2.187  -1.319  1.00 0.00 ? 1139 GLY A CA   1  
ATOM 61    C C    . GLY A 1 7   ? 29.007  -0.674  -1.225  1.00 0.00 ? 1139 GLY A C    1  
ATOM 62    O O    . GLY A 1 7   ? 29.469  -0.120  -0.228  1.00 0.00 ? 1139 GLY A O    1  
ATOM 63    H H    . GLY A 1 7   ? 28.920  -2.815  0.703   1.00 0.00 ? 1139 GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7   ? 29.567  -2.503  -2.157  1.00 0.00 ? 1139 GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7   ? 27.942  -2.496  -1.485  1.00 0.00 ? 1139 GLY A HA3  1  
ATOM 66    N N    . SER A 1 8   ? 28.526  -0.005  -2.268  1.00 0.00 ? 1140 SER A N    1  
ATOM 67    C CA   . SER A 1 8   ? 28.517  1.453   -2.302  1.00 0.00 ? 1140 SER A CA   1  
ATOM 68    C C    . SER A 1 8   ? 27.403  2.010   -1.422  1.00 0.00 ? 1140 SER A C    1  
ATOM 69    O O    . SER A 1 8   ? 26.648  1.257   -0.806  1.00 0.00 ? 1140 SER A O    1  
ATOM 70    C CB   . SER A 1 8   ? 28.344  1.950   -3.739  1.00 0.00 ? 1140 SER A CB   1  
ATOM 71    O OG   . SER A 1 8   ? 27.158  1.434   -4.317  1.00 0.00 ? 1140 SER A OG   1  
ATOM 72    H H    . SER A 1 8   ? 28.171  -0.503  -3.034  1.00 0.00 ? 1140 SER A H    1  
ATOM 73    H HA   . SER A 1 8   ? 29.467  1.799   -1.922  1.00 0.00 ? 1140 SER A HA   1  
ATOM 74    H HB2  . SER A 1 8   ? 28.292  3.028   -3.740  1.00 0.00 ? 1140 SER A HB2  1  
ATOM 75    H HB3  . SER A 1 8   ? 29.189  1.629   -4.331  1.00 0.00 ? 1140 SER A HB3  1  
ATOM 76    H HG   . SER A 1 8   ? 26.579  2.159   -4.563  1.00 0.00 ? 1140 SER A HG   1  
ATOM 77    N N    . SER A 1 9   ? 27.306  3.335   -1.367  1.00 0.00 ? 1141 SER A N    1  
ATOM 78    C CA   . SER A 1 9   ? 26.287  3.994   -0.560  1.00 0.00 ? 1141 SER A CA   1  
ATOM 79    C C    . SER A 1 9   ? 25.779  5.256   -1.251  1.00 0.00 ? 1141 SER A C    1  
ATOM 80    O O    . SER A 1 9   ? 26.562  6.122   -1.639  1.00 0.00 ? 1141 SER A O    1  
ATOM 81    C CB   . SER A 1 9   ? 26.847  4.345   0.820   1.00 0.00 ? 1141 SER A CB   1  
ATOM 82    O OG   . SER A 1 9   ? 27.921  5.263   0.716   1.00 0.00 ? 1141 SER A OG   1  
ATOM 83    H H    . SER A 1 9   ? 27.938  3.881   -1.881  1.00 0.00 ? 1141 SER A H    1  
ATOM 84    H HA   . SER A 1 9   ? 25.463  3.307   -0.440  1.00 0.00 ? 1141 SER A HA   1  
ATOM 85    H HB2  . SER A 1 9   ? 26.067  4.788   1.420   1.00 0.00 ? 1141 SER A HB2  1  
ATOM 86    H HB3  . SER A 1 9   ? 27.203  3.445   1.300   1.00 0.00 ? 1141 SER A HB3  1  
ATOM 87    H HG   . SER A 1 9   ? 27.798  5.974   1.350   1.00 0.00 ? 1141 SER A HG   1  
ATOM 88    N N    . GLN A 1 10  ? 24.461  5.351   -1.400  1.00 0.00 ? 1142 GLN A N    1  
ATOM 89    C CA   . GLN A 1 10  ? 23.848  6.507   -2.045  1.00 0.00 ? 1142 GLN A CA   1  
ATOM 90    C C    . GLN A 1 10  ? 23.639  7.640   -1.046  1.00 0.00 ? 1142 GLN A C    1  
ATOM 91    O O    . GLN A 1 10  ? 23.435  7.419   0.147   1.00 0.00 ? 1142 GLN A O    1  
ATOM 92    C CB   . GLN A 1 10  ? 22.511  6.115   -2.677  1.00 0.00 ? 1142 GLN A CB   1  
ATOM 93    C CG   . GLN A 1 10  ? 21.370  6.021   -1.677  1.00 0.00 ? 1142 GLN A CG   1  
ATOM 94    C CD   . GLN A 1 10  ? 21.426  4.756   -0.843  1.00 0.00 ? 1142 GLN A CD   1  
ATOM 95    O OE1  . GLN A 1 10  ? 22.092  4.710   0.191   1.00 0.00 ? 1142 GLN A OE1  1  
ATOM 96    N NE2  . GLN A 1 10  ? 20.726  3.721   -1.291  1.00 0.00 ? 1142 GLN A NE2  1  
ATOM 97    H H    . GLN A 1 10  ? 23.889  4.629   -1.070  1.00 0.00 ? 1142 GLN A H    1  
ATOM 98    H HA   . GLN A 1 10  ? 24.517  6.846   -2.821  1.00 0.00 ? 1142 GLN A HA   1  
ATOM 99    H HB2  . GLN A 1 10  ? 22.249  6.850   -3.422  1.00 0.00 ? 1142 GLN A HB2  1  
ATOM 100   H HB3  . GLN A 1 10  ? 22.621  5.152   -3.155  1.00 0.00 ? 1142 GLN A HB3  1  
ATOM 101   H HG2  . GLN A 1 10  ? 21.418  6.872   -1.014  1.00 0.00 ? 1142 GLN A HG2  1  
ATOM 102   H HG3  . GLN A 1 10  ? 20.434  6.039   -2.216  1.00 0.00 ? 1142 GLN A HG3  1  
ATOM 103   H HE21 . GLN A 1 10  ? 20.220  3.830   -2.123  1.00 0.00 ? 1142 GLN A HE21 1  
ATOM 104   H HE22 . GLN A 1 10  ? 20.745  2.890   -0.772  1.00 0.00 ? 1142 GLN A HE22 1  
ATOM 105   N N    . PRO A 1 11  ? 23.691  8.885   -1.544  1.00 0.00 ? 1143 PRO A N    1  
ATOM 106   C CA   . PRO A 1 11  ? 23.510  10.078  -0.712  1.00 0.00 ? 1143 PRO A CA   1  
ATOM 107   C C    . PRO A 1 11  ? 22.074  10.229  -0.221  1.00 0.00 ? 1143 PRO A C    1  
ATOM 108   O O    . PRO A 1 11  ? 21.138  9.732   -0.846  1.00 0.00 ? 1143 PRO A O    1  
ATOM 109   C CB   . PRO A 1 11  ? 23.876  11.227  -1.655  1.00 0.00 ? 1143 PRO A CB   1  
ATOM 110   C CG   . PRO A 1 11  ? 23.619  10.692  -3.021  1.00 0.00 ? 1143 PRO A CG   1  
ATOM 111   C CD   . PRO A 1 11  ? 23.931  9.223   -2.957  1.00 0.00 ? 1143 PRO A CD   1  
ATOM 112   H HA   . PRO A 1 11  ? 24.181  10.077  0.135   1.00 0.00 ? 1143 PRO A HA   1  
ATOM 113   H HB2  . PRO A 1 11  ? 23.254  12.084  -1.441  1.00 0.00 ? 1143 PRO A HB2  1  
ATOM 114   H HB3  . PRO A 1 11  ? 24.916  11.488  -1.523  1.00 0.00 ? 1143 PRO A HB3  1  
ATOM 115   H HG2  . PRO A 1 11  ? 22.583  10.845  -3.286  1.00 0.00 ? 1143 PRO A HG2  1  
ATOM 116   H HG3  . PRO A 1 11  ? 24.266  11.182  -3.734  1.00 0.00 ? 1143 PRO A HG3  1  
ATOM 117   H HD2  . PRO A 1 11  ? 23.269  8.668   -3.604  1.00 0.00 ? 1143 PRO A HD2  1  
ATOM 118   H HD3  . PRO A 1 11  ? 24.962  9.044   -3.226  1.00 0.00 ? 1143 PRO A HD3  1  
ATOM 119   N N    . VAL A 1 12  ? 21.908  10.920  0.903   1.00 0.00 ? 1144 VAL A N    1  
ATOM 120   C CA   . VAL A 1 12  ? 20.585  11.138  1.477   1.00 0.00 ? 1144 VAL A CA   1  
ATOM 121   C C    . VAL A 1 12  ? 19.619  11.692  0.436   1.00 0.00 ? 1144 VAL A C    1  
ATOM 122   O O    . VAL A 1 12  ? 20.036  12.281  -0.561  1.00 0.00 ? 1144 VAL A O    1  
ATOM 123   C CB   . VAL A 1 12  ? 20.646  12.108  2.673   1.00 0.00 ? 1144 VAL A CB   1  
ATOM 124   C CG1  . VAL A 1 12  ? 21.590  11.579  3.742   1.00 0.00 ? 1144 VAL A CG1  1  
ATOM 125   C CG2  . VAL A 1 12  ? 21.070  13.494  2.213   1.00 0.00 ? 1144 VAL A CG2  1  
ATOM 126   H H    . VAL A 1 12  ? 22.693  11.292  1.356   1.00 0.00 ? 1144 VAL A H    1  
ATOM 127   H HA   . VAL A 1 12  ? 20.213  10.187  1.830   1.00 0.00 ? 1144 VAL A HA   1  
ATOM 128   H HB   . VAL A 1 12  ? 19.657  12.180  3.101   1.00 0.00 ? 1144 VAL A HB   1  
ATOM 129   H HG11 . VAL A 1 12  ? 22.444  11.116  3.270   1.00 0.00 ? 1144 VAL A HG11 1  
ATOM 130   H HG12 . VAL A 1 12  ? 21.921  12.396  4.366   1.00 0.00 ? 1144 VAL A HG12 1  
ATOM 131   H HG13 . VAL A 1 12  ? 21.075  10.848  4.347   1.00 0.00 ? 1144 VAL A HG13 1  
ATOM 132   H HG21 . VAL A 1 12  ? 21.171  14.142  3.071   1.00 0.00 ? 1144 VAL A HG21 1  
ATOM 133   H HG22 . VAL A 1 12  ? 22.018  13.429  1.698   1.00 0.00 ? 1144 VAL A HG22 1  
ATOM 134   H HG23 . VAL A 1 12  ? 20.324  13.896  1.544   1.00 0.00 ? 1144 VAL A HG23 1  
ATOM 135   N N    . ILE A 1 13  ? 18.326  11.499  0.676   1.00 0.00 ? 1145 ILE A N    1  
ATOM 136   C CA   . ILE A 1 13  ? 17.300  11.981  -0.241  1.00 0.00 ? 1145 ILE A CA   1  
ATOM 137   C C    . ILE A 1 13  ? 16.926  13.427  0.065   1.00 0.00 ? 1145 ILE A C    1  
ATOM 138   O O    . ILE A 1 13  ? 16.737  13.799  1.223   1.00 0.00 ? 1145 ILE A O    1  
ATOM 139   C CB   . ILE A 1 13  ? 16.032  11.109  -0.174  1.00 0.00 ? 1145 ILE A CB   1  
ATOM 140   C CG1  . ILE A 1 13  ? 16.389  9.635   -0.374  1.00 0.00 ? 1145 ILE A CG1  1  
ATOM 141   C CG2  . ILE A 1 13  ? 15.023  11.562  -1.219  1.00 0.00 ? 1145 ILE A CG2  1  
ATOM 142   C CD1  . ILE A 1 13  ? 15.237  8.692   -0.104  1.00 0.00 ? 1145 ILE A CD1  1  
ATOM 143   H H    . ILE A 1 13  ? 18.056  11.022  1.488   1.00 0.00 ? 1145 ILE A H    1  
ATOM 144   H HA   . ILE A 1 13  ? 17.698  11.927  -1.244  1.00 0.00 ? 1145 ILE A HA   1  
ATOM 145   H HB   . ILE A 1 13  ? 15.586  11.235  0.800   1.00 0.00 ? 1145 ILE A HB   1  
ATOM 146   H HG12 . ILE A 1 13  ? 16.709  9.483   -1.393  1.00 0.00 ? 1145 ILE A HG12 1  
ATOM 147   H HG13 . ILE A 1 13  ? 17.196  9.374   0.295   1.00 0.00 ? 1145 ILE A HG13 1  
ATOM 148   H HG21 . ILE A 1 13  ? 15.508  12.217  -1.927  1.00 0.00 ? 1145 ILE A HG21 1  
ATOM 149   H HG22 . ILE A 1 13  ? 14.631  10.700  -1.738  1.00 0.00 ? 1145 ILE A HG22 1  
ATOM 150   H HG23 . ILE A 1 13  ? 14.215  12.089  -0.735  1.00 0.00 ? 1145 ILE A HG23 1  
ATOM 151   H HD11 . ILE A 1 13  ? 15.100  8.587   0.962   1.00 0.00 ? 1145 ILE A HD11 1  
ATOM 152   H HD12 . ILE A 1 13  ? 14.336  9.088   -0.547  1.00 0.00 ? 1145 ILE A HD12 1  
ATOM 153   H HD13 . ILE A 1 13  ? 15.455  7.725   -0.534  1.00 0.00 ? 1145 ILE A HD13 1  
ATOM 154   N N    . SER A 1 14  ? 16.818  14.238  -0.983  1.00 0.00 ? 1146 SER A N    1  
ATOM 155   C CA   . SER A 1 14  ? 16.468  15.645  -0.827  1.00 0.00 ? 1146 SER A CA   1  
ATOM 156   C C    . SER A 1 14  ? 15.113  15.795  -0.142  1.00 0.00 ? 1146 SER A C    1  
ATOM 157   O O    . SER A 1 14  ? 14.122  15.202  -0.565  1.00 0.00 ? 1146 SER A O    1  
ATOM 158   C CB   . SER A 1 14  ? 16.443  16.340  -2.190  1.00 0.00 ? 1146 SER A CB   1  
ATOM 159   O OG   . SER A 1 14  ? 15.255  16.032  -2.898  1.00 0.00 ? 1146 SER A OG   1  
ATOM 160   H H    . SER A 1 14  ? 16.981  13.883  -1.881  1.00 0.00 ? 1146 SER A H    1  
ATOM 161   H HA   . SER A 1 14  ? 17.224  16.109  -0.210  1.00 0.00 ? 1146 SER A HA   1  
ATOM 162   H HB2  . SER A 1 14  ? 16.495  17.409  -2.047  1.00 0.00 ? 1146 SER A HB2  1  
ATOM 163   H HB3  . SER A 1 14  ? 17.291  16.013  -2.773  1.00 0.00 ? 1146 SER A HB3  1  
ATOM 164   H HG   . SER A 1 14  ? 15.038  15.105  -2.772  1.00 0.00 ? 1146 SER A HG   1  
ATOM 165   N N    . ALA A 1 15  ? 15.080  16.594  0.920   1.00 0.00 ? 1147 ALA A N    1  
ATOM 166   C CA   . ALA A 1 15  ? 13.847  16.824  1.664   1.00 0.00 ? 1147 ALA A CA   1  
ATOM 167   C C    . ALA A 1 15  ? 12.649  16.919  0.725   1.00 0.00 ? 1147 ALA A C    1  
ATOM 168   O O    . ALA A 1 15  ? 11.548  16.486  1.065   1.00 0.00 ? 1147 ALA A O    1  
ATOM 169   C CB   . ALA A 1 15  ? 13.965  18.089  2.502   1.00 0.00 ? 1147 ALA A CB   1  
ATOM 170   H H    . ALA A 1 15  ? 15.903  17.039  1.210   1.00 0.00 ? 1147 ALA A H    1  
ATOM 171   H HA   . ALA A 1 15  ? 13.701  15.990  2.335   1.00 0.00 ? 1147 ALA A HA   1  
ATOM 172   H HB1  . ALA A 1 15  ? 13.156  18.123  3.216   1.00 0.00 ? 1147 ALA A HB1  1  
ATOM 173   H HB2  . ALA A 1 15  ? 14.909  18.086  3.026   1.00 0.00 ? 1147 ALA A HB2  1  
ATOM 174   H HB3  . ALA A 1 15  ? 13.913  18.953  1.857   1.00 0.00 ? 1147 ALA A HB3  1  
ATOM 175   N N    . GLN A 1 16  ? 12.872  17.488  -0.455  1.00 0.00 ? 1148 GLN A N    1  
ATOM 176   C CA   . GLN A 1 16  ? 11.809  17.640  -1.441  1.00 0.00 ? 1148 GLN A CA   1  
ATOM 177   C C    . GLN A 1 16  ? 10.948  16.383  -1.512  1.00 0.00 ? 1148 GLN A C    1  
ATOM 178   O O    . GLN A 1 16  ? 9.740   16.434  -1.284  1.00 0.00 ? 1148 GLN A O    1  
ATOM 179   C CB   . GLN A 1 16  ? 12.401  17.945  -2.818  1.00 0.00 ? 1148 GLN A CB   1  
ATOM 180   C CG   . GLN A 1 16  ? 12.577  19.431  -3.090  1.00 0.00 ? 1148 GLN A CG   1  
ATOM 181   C CD   . GLN A 1 16  ? 13.920  19.955  -2.622  1.00 0.00 ? 1148 GLN A CD   1  
ATOM 182   O OE1  . GLN A 1 16  ? 14.935  19.264  -2.713  1.00 0.00 ? 1148 GLN A OE1  1  
ATOM 183   N NE2  . GLN A 1 16  ? 13.934  21.183  -2.119  1.00 0.00 ? 1148 GLN A NE2  1  
ATOM 184   H H    . GLN A 1 16  ? 13.771  17.813  -0.667  1.00 0.00 ? 1148 GLN A H    1  
ATOM 185   H HA   . GLN A 1 16  ? 11.189  18.469  -1.135  1.00 0.00 ? 1148 GLN A HA   1  
ATOM 186   H HB2  . GLN A 1 16  ? 13.368  17.471  -2.894  1.00 0.00 ? 1148 GLN A HB2  1  
ATOM 187   H HB3  . GLN A 1 16  ? 11.749  17.537  -3.576  1.00 0.00 ? 1148 GLN A HB3  1  
ATOM 188   H HG2  . GLN A 1 16  ? 12.491  19.602  -4.152  1.00 0.00 ? 1148 GLN A HG2  1  
ATOM 189   H HG3  . GLN A 1 16  ? 11.796  19.972  -2.575  1.00 0.00 ? 1148 GLN A HG3  1  
ATOM 190   H HE21 . GLN A 1 16  ? 13.086  21.675  -2.076  1.00 0.00 ? 1148 GLN A HE21 1  
ATOM 191   H HE22 . GLN A 1 16  ? 14.788  21.547  -1.808  1.00 0.00 ? 1148 GLN A HE22 1  
ATOM 192   N N    . GLU A 1 17  ? 11.578  15.257  -1.831  1.00 0.00 ? 1149 GLU A N    1  
ATOM 193   C CA   . GLU A 1 17  ? 10.869  13.988  -1.933  1.00 0.00 ? 1149 GLU A CA   1  
ATOM 194   C C    . GLU A 1 17  ? 11.062  13.153  -0.670  1.00 0.00 ? 1149 GLU A C    1  
ATOM 195   O O    . GLU A 1 17  ? 10.142  12.471  -0.218  1.00 0.00 ? 1149 GLU A O    1  
ATOM 196   C CB   . GLU A 1 17  ? 11.353  13.203  -3.154  1.00 0.00 ? 1149 GLU A CB   1  
ATOM 197   C CG   . GLU A 1 17  ? 12.866  13.166  -3.292  1.00 0.00 ? 1149 GLU A CG   1  
ATOM 198   C CD   . GLU A 1 17  ? 13.322  12.370  -4.500  1.00 0.00 ? 1149 GLU A CD   1  
ATOM 199   O OE1  . GLU A 1 17  ? 13.076  12.826  -5.637  1.00 0.00 ? 1149 GLU A OE1  1  
ATOM 200   O OE2  . GLU A 1 17  ? 13.924  11.293  -4.309  1.00 0.00 ? 1149 GLU A OE2  1  
ATOM 201   H H    . GLU A 1 17  ? 12.543  15.281  -2.002  1.00 0.00 ? 1149 GLU A H    1  
ATOM 202   H HA   . GLU A 1 17  ? 9.817   14.204  -2.050  1.00 0.00 ? 1149 GLU A HA   1  
ATOM 203   H HB2  . GLU A 1 17  ? 10.993  12.188  -3.081  1.00 0.00 ? 1149 GLU A HB2  1  
ATOM 204   H HB3  . GLU A 1 17  ? 10.943  13.658  -4.044  1.00 0.00 ? 1149 GLU A HB3  1  
ATOM 205   H HG2  . GLU A 1 17  ? 13.232  14.177  -3.388  1.00 0.00 ? 1149 GLU A HG2  1  
ATOM 206   H HG3  . GLU A 1 17  ? 13.285  12.716  -2.404  1.00 0.00 ? 1149 GLU A HG3  1  
ATOM 207   N N    . GLN A 1 18  ? 12.264  13.213  -0.106  1.00 0.00 ? 1150 GLN A N    1  
ATOM 208   C CA   . GLN A 1 18  ? 12.578  12.462  1.104   1.00 0.00 ? 1150 GLN A CA   1  
ATOM 209   C C    . GLN A 1 18  ? 11.430  12.538  2.105   1.00 0.00 ? 1150 GLN A C    1  
ATOM 210   O O    . GLN A 1 18  ? 10.888  11.514  2.519   1.00 0.00 ? 1150 GLN A O    1  
ATOM 211   C CB   . GLN A 1 18  ? 13.862  12.995  1.741   1.00 0.00 ? 1150 GLN A CB   1  
ATOM 212   C CG   . GLN A 1 18  ? 14.332  12.181  2.935   1.00 0.00 ? 1150 GLN A CG   1  
ATOM 213   C CD   . GLN A 1 18  ? 15.454  12.857  3.698   1.00 0.00 ? 1150 GLN A CD   1  
ATOM 214   O OE1  . GLN A 1 18  ? 15.614  14.077  3.638   1.00 0.00 ? 1150 GLN A OE1  1  
ATOM 215   N NE2  . GLN A 1 18  ? 16.238  12.068  4.423   1.00 0.00 ? 1150 GLN A NE2  1  
ATOM 216   H H    . GLN A 1 18  ? 12.955  13.775  -0.513  1.00 0.00 ? 1150 GLN A H    1  
ATOM 217   H HA   . GLN A 1 18  ? 12.727  11.430  0.824   1.00 0.00 ? 1150 GLN A HA   1  
ATOM 218   H HB2  . GLN A 1 18  ? 14.647  12.992  0.999   1.00 0.00 ? 1150 GLN A HB2  1  
ATOM 219   H HB3  . GLN A 1 18  ? 13.692  14.010  2.070   1.00 0.00 ? 1150 GLN A HB3  1  
ATOM 220   H HG2  . GLN A 1 18  ? 13.499  12.035  3.606   1.00 0.00 ? 1150 GLN A HG2  1  
ATOM 221   H HG3  . GLN A 1 18  ? 14.683  11.221  2.584   1.00 0.00 ? 1150 GLN A HG3  1  
ATOM 222   H HE21 . GLN A 1 18  ? 16.052  11.105  4.422   1.00 0.00 ? 1150 GLN A HE21 1  
ATOM 223   H HE22 . GLN A 1 18  ? 16.971  12.478  4.925   1.00 0.00 ? 1150 GLN A HE22 1  
ATOM 224   N N    . GLU A 1 19  ? 11.066  13.757  2.489   1.00 0.00 ? 1151 GLU A N    1  
ATOM 225   C CA   . GLU A 1 19  ? 9.983   13.965  3.443   1.00 0.00 ? 1151 GLU A CA   1  
ATOM 226   C C    . GLU A 1 19  ? 8.748   13.161  3.047   1.00 0.00 ? 1151 GLU A C    1  
ATOM 227   O O    . GLU A 1 19  ? 8.250   12.343  3.822   1.00 0.00 ? 1151 GLU A O    1  
ATOM 228   C CB   . GLU A 1 19  ? 9.630   15.451  3.532   1.00 0.00 ? 1151 GLU A CB   1  
ATOM 229   C CG   . GLU A 1 19  ? 9.075   15.865  4.885   1.00 0.00 ? 1151 GLU A CG   1  
ATOM 230   C CD   . GLU A 1 19  ? 8.616   17.310  4.910   1.00 0.00 ? 1151 GLU A CD   1  
ATOM 231   O OE1  . GLU A 1 19  ? 9.449   18.203  4.649   1.00 0.00 ? 1151 GLU A OE1  1  
ATOM 232   O OE2  . GLU A 1 19  ? 7.422   17.548  5.190   1.00 0.00 ? 1151 GLU A OE2  1  
ATOM 233   H H    . GLU A 1 19  ? 11.537  14.535  2.123   1.00 0.00 ? 1151 GLU A H    1  
ATOM 234   H HA   . GLU A 1 19  ? 10.323  13.627  4.410   1.00 0.00 ? 1151 GLU A HA   1  
ATOM 235   H HB2  . GLU A 1 19  ? 10.520  16.033  3.338   1.00 0.00 ? 1151 GLU A HB2  1  
ATOM 236   H HB3  . GLU A 1 19  ? 8.891   15.679  2.778   1.00 0.00 ? 1151 GLU A HB3  1  
ATOM 237   H HG2  . GLU A 1 19  ? 8.233   15.232  5.123   1.00 0.00 ? 1151 GLU A HG2  1  
ATOM 238   H HG3  . GLU A 1 19  ? 9.845   15.735  5.631   1.00 0.00 ? 1151 GLU A HG3  1  
ATOM 239   N N    . THR A 1 20  ? 8.256   13.400  1.835   1.00 0.00 ? 1152 THR A N    1  
ATOM 240   C CA   . THR A 1 20  ? 7.079   12.700  1.336   1.00 0.00 ? 1152 THR A CA   1  
ATOM 241   C C    . THR A 1 20  ? 7.183   11.200  1.587   1.00 0.00 ? 1152 THR A C    1  
ATOM 242   O O    . THR A 1 20  ? 6.217   10.564  2.006   1.00 0.00 ? 1152 THR A O    1  
ATOM 243   C CB   . THR A 1 20  ? 6.878   12.944  -0.171  1.00 0.00 ? 1152 THR A CB   1  
ATOM 244   O OG1  . THR A 1 20  ? 6.585   14.326  -0.409  1.00 0.00 ? 1152 THR A OG1  1  
ATOM 245   C CG2  . THR A 1 20  ? 5.748   12.081  -0.713  1.00 0.00 ? 1152 THR A CG2  1  
ATOM 246   H H    . THR A 1 20  ? 8.697   14.063  1.264   1.00 0.00 ? 1152 THR A H    1  
ATOM 247   H HA   . THR A 1 20  ? 6.216   13.084  1.861   1.00 0.00 ? 1152 THR A HA   1  
ATOM 248   H HB   . THR A 1 20  ? 7.790   12.683  -0.688  1.00 0.00 ? 1152 THR A HB   1  
ATOM 249   H HG1  . THR A 1 20  ? 7.122   14.646  -1.138  1.00 0.00 ? 1152 THR A HG1  1  
ATOM 250   H HG21 . THR A 1 20  ? 4.806   12.430  -0.316  1.00 0.00 ? 1152 THR A HG21 1  
ATOM 251   H HG22 . THR A 1 20  ? 5.906   11.055  -0.417  1.00 0.00 ? 1152 THR A HG22 1  
ATOM 252   H HG23 . THR A 1 20  ? 5.731   12.146  -1.790  1.00 0.00 ? 1152 THR A HG23 1  
ATOM 253   N N    . GLN A 1 21  ? 8.362   10.642  1.330   1.00 0.00 ? 1153 GLN A N    1  
ATOM 254   C CA   . GLN A 1 21  ? 8.591   9.216   1.528   1.00 0.00 ? 1153 GLN A CA   1  
ATOM 255   C C    . GLN A 1 21  ? 8.527   8.855   3.009   1.00 0.00 ? 1153 GLN A C    1  
ATOM 256   O O    . GLN A 1 21  ? 8.004   7.804   3.379   1.00 0.00 ? 1153 GLN A O    1  
ATOM 257   C CB   . GLN A 1 21  ? 9.948   8.811   0.950   1.00 0.00 ? 1153 GLN A CB   1  
ATOM 258   C CG   . GLN A 1 21  ? 10.034  8.956   -0.560  1.00 0.00 ? 1153 GLN A CG   1  
ATOM 259   C CD   . GLN A 1 21  ? 11.463  8.969   -1.065  1.00 0.00 ? 1153 GLN A CD   1  
ATOM 260   O OE1  . GLN A 1 21  ? 12.302  8.191   -0.609  1.00 0.00 ? 1153 GLN A OE1  1  
ATOM 261   N NE2  . GLN A 1 21  ? 11.749  9.855   -2.012  1.00 0.00 ? 1153 GLN A NE2  1  
ATOM 262   H H    . GLN A 1 21  ? 9.094   11.202  0.998   1.00 0.00 ? 1153 GLN A H    1  
ATOM 263   H HA   . GLN A 1 21  ? 7.813   8.680   1.006   1.00 0.00 ? 1153 GLN A HA   1  
ATOM 264   H HB2  . GLN A 1 21  ? 10.714  9.429   1.394   1.00 0.00 ? 1153 GLN A HB2  1  
ATOM 265   H HB3  . GLN A 1 21  ? 10.139  7.778   1.202   1.00 0.00 ? 1153 GLN A HB3  1  
ATOM 266   H HG2  . GLN A 1 21  ? 9.515   8.127   -1.019  1.00 0.00 ? 1153 GLN A HG2  1  
ATOM 267   H HG3  . GLN A 1 21  ? 9.557   9.881   -0.848  1.00 0.00 ? 1153 GLN A HG3  1  
ATOM 268   H HE21 . GLN A 1 21  ? 11.031  10.444  -2.326  1.00 0.00 ? 1153 GLN A HE21 1  
ATOM 269   H HE22 . GLN A 1 21  ? 12.665  9.886   -2.355  1.00 0.00 ? 1153 GLN A HE22 1  
ATOM 270   N N    . ILE A 1 22  ? 9.062   9.733   3.850   1.00 0.00 ? 1154 ILE A N    1  
ATOM 271   C CA   . ILE A 1 22  ? 9.065   9.507   5.290   1.00 0.00 ? 1154 ILE A CA   1  
ATOM 272   C C    . ILE A 1 22  ? 7.644   9.442   5.839   1.00 0.00 ? 1154 ILE A C    1  
ATOM 273   O O    . ILE A 1 22  ? 7.271   8.484   6.516   1.00 0.00 ? 1154 ILE A O    1  
ATOM 274   C CB   . ILE A 1 22  ? 9.840   10.612  6.032   1.00 0.00 ? 1154 ILE A CB   1  
ATOM 275   C CG1  . ILE A 1 22  ? 11.296  10.646  5.564   1.00 0.00 ? 1154 ILE A CG1  1  
ATOM 276   C CG2  . ILE A 1 22  ? 9.765   10.392  7.536   1.00 0.00 ? 1154 ILE A CG2  1  
ATOM 277   C CD1  . ILE A 1 22  ? 12.050  11.874  6.023   1.00 0.00 ? 1154 ILE A CD1  1  
ATOM 278   H H    . ILE A 1 22  ? 9.464   10.553  3.494   1.00 0.00 ? 1154 ILE A H    1  
ATOM 279   H HA   . ILE A 1 22  ? 9.556   8.563   5.478   1.00 0.00 ? 1154 ILE A HA   1  
ATOM 280   H HB   . ILE A 1 22  ? 9.375   11.560  5.807   1.00 0.00 ? 1154 ILE A HB   1  
ATOM 281   H HG12 . ILE A 1 22  ? 11.811  9.779   5.948   1.00 0.00 ? 1154 ILE A HG12 1  
ATOM 282   H HG13 . ILE A 1 22  ? 11.320  10.625  4.484   1.00 0.00 ? 1154 ILE A HG13 1  
ATOM 283   H HG21 . ILE A 1 22  ? 9.272   9.453   7.738   1.00 0.00 ? 1154 ILE A HG21 1  
ATOM 284   H HG22 . ILE A 1 22  ? 10.764  10.369  7.945   1.00 0.00 ? 1154 ILE A HG22 1  
ATOM 285   H HG23 . ILE A 1 22  ? 9.208   11.197  7.990   1.00 0.00 ? 1154 ILE A HG23 1  
ATOM 286   H HD11 . ILE A 1 22  ? 11.918  12.668  5.303   1.00 0.00 ? 1154 ILE A HD11 1  
ATOM 287   H HD12 . ILE A 1 22  ? 11.672  12.192  6.983   1.00 0.00 ? 1154 ILE A HD12 1  
ATOM 288   H HD13 . ILE A 1 22  ? 13.101  11.640  6.110   1.00 0.00 ? 1154 ILE A HD13 1  
ATOM 289   N N    . VAL A 1 23  ? 6.852   10.468  5.541   1.00 0.00 ? 1155 VAL A N    1  
ATOM 290   C CA   . VAL A 1 23  ? 5.470   10.526  6.001   1.00 0.00 ? 1155 VAL A CA   1  
ATOM 291   C C    . VAL A 1 23  ? 4.650   9.376   5.427   1.00 0.00 ? 1155 VAL A C    1  
ATOM 292   O O    . VAL A 1 23  ? 3.821   8.785   6.119   1.00 0.00 ? 1155 VAL A O    1  
ATOM 293   C CB   . VAL A 1 23  ? 4.805   11.860  5.613   1.00 0.00 ? 1155 VAL A CB   1  
ATOM 294   C CG1  . VAL A 1 23  ? 3.372   11.910  6.120   1.00 0.00 ? 1155 VAL A CG1  1  
ATOM 295   C CG2  . VAL A 1 23  ? 5.611   13.033  6.151   1.00 0.00 ? 1155 VAL A CG2  1  
ATOM 296   H H    . VAL A 1 23  ? 7.206   11.202  4.997   1.00 0.00 ? 1155 VAL A H    1  
ATOM 297   H HA   . VAL A 1 23  ? 5.474   10.450  7.079   1.00 0.00 ? 1155 VAL A HA   1  
ATOM 298   H HB   . VAL A 1 23  ? 4.785   11.929  4.535   1.00 0.00 ? 1155 VAL A HB   1  
ATOM 299   H HG11 . VAL A 1 23  ? 3.204   11.091  6.804   1.00 0.00 ? 1155 VAL A HG11 1  
ATOM 300   H HG12 . VAL A 1 23  ? 3.202   12.847  6.630   1.00 0.00 ? 1155 VAL A HG12 1  
ATOM 301   H HG13 . VAL A 1 23  ? 2.692   11.826  5.285   1.00 0.00 ? 1155 VAL A HG13 1  
ATOM 302   H HG21 . VAL A 1 23  ? 6.639   12.732  6.283   1.00 0.00 ? 1155 VAL A HG21 1  
ATOM 303   H HG22 . VAL A 1 23  ? 5.563   13.855  5.451   1.00 0.00 ? 1155 VAL A HG22 1  
ATOM 304   H HG23 . VAL A 1 23  ? 5.202   13.345  7.101   1.00 0.00 ? 1155 VAL A HG23 1  
ATOM 305   N N    . LEU A 1 24  ? 4.888   9.063   4.158   1.00 0.00 ? 1156 LEU A N    1  
ATOM 306   C CA   . LEU A 1 24  ? 4.172   7.982   3.490   1.00 0.00 ? 1156 LEU A CA   1  
ATOM 307   C C    . LEU A 1 24  ? 4.521   6.633   4.109   1.00 0.00 ? 1156 LEU A C    1  
ATOM 308   O O    . LEU A 1 24  ? 3.648   5.922   4.606   1.00 0.00 ? 1156 LEU A O    1  
ATOM 309   C CB   . LEU A 1 24  ? 4.503   7.972   1.996   1.00 0.00 ? 1156 LEU A CB   1  
ATOM 310   C CG   . LEU A 1 24  ? 3.836   6.873   1.168   1.00 0.00 ? 1156 LEU A CG   1  
ATOM 311   C CD1  . LEU A 1 24  ? 2.342   6.825   1.450   1.00 0.00 ? 1156 LEU A CD1  1  
ATOM 312   C CD2  . LEU A 1 24  ? 4.094   7.092   -0.315  1.00 0.00 ? 1156 LEU A CD2  1  
ATOM 313   H H    . LEU A 1 24  ? 5.561   9.570   3.658   1.00 0.00 ? 1156 LEU A H    1  
ATOM 314   H HA   . LEU A 1 24  ? 3.114   8.159   3.615   1.00 0.00 ? 1156 LEU A HA   1  
ATOM 315   H HB2  . LEU A 1 24  ? 4.203   8.924   1.585   1.00 0.00 ? 1156 LEU A HB2  1  
ATOM 316   H HB3  . LEU A 1 24  ? 5.573   7.860   1.896   1.00 0.00 ? 1156 LEU A HB3  1  
ATOM 317   H HG   . LEU A 1 24  ? 4.257   5.917   1.445   1.00 0.00 ? 1156 LEU A HG   1  
ATOM 318   H HD11 . LEU A 1 24  ? 2.178   6.747   2.514   1.00 0.00 ? 1156 LEU A HD11 1  
ATOM 319   H HD12 . LEU A 1 24  ? 1.910   5.968   0.955   1.00 0.00 ? 1156 LEU A HD12 1  
ATOM 320   H HD13 . LEU A 1 24  ? 1.877   7.727   1.079   1.00 0.00 ? 1156 LEU A HD13 1  
ATOM 321   H HD21 . LEU A 1 24  ? 3.158   7.051   -0.853  1.00 0.00 ? 1156 LEU A HD21 1  
ATOM 322   H HD22 . LEU A 1 24  ? 4.754   6.319   -0.683  1.00 0.00 ? 1156 LEU A HD22 1  
ATOM 323   H HD23 . LEU A 1 24  ? 4.552   8.058   -0.462  1.00 0.00 ? 1156 LEU A HD23 1  
ATOM 324   N N    . TYR A 1 25  ? 5.804   6.288   4.076   1.00 0.00 ? 1157 TYR A N    1  
ATOM 325   C CA   . TYR A 1 25  ? 6.269   5.023   4.634   1.00 0.00 ? 1157 TYR A CA   1  
ATOM 326   C C    . TYR A 1 25  ? 5.507   4.677   5.910   1.00 0.00 ? 1157 TYR A C    1  
ATOM 327   O O    . TYR A 1 25  ? 4.978   3.576   6.051   1.00 0.00 ? 1157 TYR A O    1  
ATOM 328   C CB   . TYR A 1 25  ? 7.769   5.091   4.925   1.00 0.00 ? 1157 TYR A CB   1  
ATOM 329   C CG   . TYR A 1 25  ? 8.322   3.831   5.551   1.00 0.00 ? 1157 TYR A CG   1  
ATOM 330   C CD1  . TYR A 1 25  ? 8.398   2.648   4.827   1.00 0.00 ? 1157 TYR A CD1  1  
ATOM 331   C CD2  . TYR A 1 25  ? 8.771   3.824   6.866   1.00 0.00 ? 1157 TYR A CD2  1  
ATOM 332   C CE1  . TYR A 1 25  ? 8.902   1.494   5.395   1.00 0.00 ? 1157 TYR A CE1  1  
ATOM 333   C CE2  . TYR A 1 25  ? 9.278   2.676   7.442   1.00 0.00 ? 1157 TYR A CE2  1  
ATOM 334   C CZ   . TYR A 1 25  ? 9.341   1.513   6.703   1.00 0.00 ? 1157 TYR A CZ   1  
ATOM 335   O OH   . TYR A 1 25  ? 9.845   0.366   7.272   1.00 0.00 ? 1157 TYR A OH   1  
ATOM 336   H H    . TYR A 1 25  ? 6.453   6.896   3.666   1.00 0.00 ? 1157 TYR A H    1  
ATOM 337   H HA   . TYR A 1 25  ? 6.089   4.251   3.900   1.00 0.00 ? 1157 TYR A HA   1  
ATOM 338   H HB2  . TYR A 1 25  ? 8.300   5.263   4.002   1.00 0.00 ? 1157 TYR A HB2  1  
ATOM 339   H HB3  . TYR A 1 25  ? 7.960   5.910   5.603   1.00 0.00 ? 1157 TYR A HB3  1  
ATOM 340   H HD1  . TYR A 1 25  ? 8.054   2.636   3.803   1.00 0.00 ? 1157 TYR A HD1  1  
ATOM 341   H HD2  . TYR A 1 25  ? 8.720   4.737   7.443   1.00 0.00 ? 1157 TYR A HD2  1  
ATOM 342   H HE1  . TYR A 1 25  ? 8.952   0.583   4.817   1.00 0.00 ? 1157 TYR A HE1  1  
ATOM 343   H HE2  . TYR A 1 25  ? 9.621   2.690   8.466   1.00 0.00 ? 1157 TYR A HE2  1  
ATOM 344   H HH   . TYR A 1 25  ? 10.800  0.354   7.175   1.00 0.00 ? 1157 TYR A HH   1  
ATOM 345   N N    . GLY A 1 26  ? 5.456   5.629   6.837   1.00 0.00 ? 1158 GLY A N    1  
ATOM 346   C CA   . GLY A 1 26  ? 4.757   5.407   8.090   1.00 0.00 ? 1158 GLY A CA   1  
ATOM 347   C C    . GLY A 1 26  ? 3.332   4.933   7.882   1.00 0.00 ? 1158 GLY A C    1  
ATOM 348   O O    . GLY A 1 26  ? 2.864   4.028   8.574   1.00 0.00 ? 1158 GLY A O    1  
ATOM 349   H H    . GLY A 1 26  ? 5.896   6.488   6.670   1.00 0.00 ? 1158 GLY A H    1  
ATOM 350   H HA2  . GLY A 1 26  ? 5.293   4.666   8.662   1.00 0.00 ? 1158 GLY A HA2  1  
ATOM 351   H HA3  . GLY A 1 26  ? 4.738   6.333   8.647   1.00 0.00 ? 1158 GLY A HA3  1  
ATOM 352   N N    . LYS A 1 27  ? 2.639   5.545   6.928   1.00 0.00 ? 1159 LYS A N    1  
ATOM 353   C CA   . LYS A 1 27  ? 1.259   5.180   6.631   1.00 0.00 ? 1159 LYS A CA   1  
ATOM 354   C C    . LYS A 1 27  ? 1.167   3.731   6.164   1.00 0.00 ? 1159 LYS A C    1  
ATOM 355   O O    . LYS A 1 27  ? 0.298   2.979   6.608   1.00 0.00 ? 1159 LYS A O    1  
ATOM 356   C CB   . LYS A 1 27  ? 0.684   6.109   5.559   1.00 0.00 ? 1159 LYS A CB   1  
ATOM 357   C CG   . LYS A 1 27  ? 0.674   7.573   5.965   1.00 0.00 ? 1159 LYS A CG   1  
ATOM 358   C CD   . LYS A 1 27  ? -0.049  8.431   4.940   1.00 0.00 ? 1159 LYS A CD   1  
ATOM 359   C CE   . LYS A 1 27  ? -0.618  9.692   5.571   1.00 0.00 ? 1159 LYS A CE   1  
ATOM 360   N NZ   . LYS A 1 27  ? -1.873  9.417   6.325   1.00 0.00 ? 1159 LYS A NZ   1  
ATOM 361   H H    . LYS A 1 27  ? 3.067   6.259   6.410   1.00 0.00 ? 1159 LYS A H    1  
ATOM 362   H HA   . LYS A 1 27  ? 0.684   5.291   7.538   1.00 0.00 ? 1159 LYS A HA   1  
ATOM 363   H HB2  . LYS A 1 27  ? 1.274   6.011   4.660   1.00 0.00 ? 1159 LYS A HB2  1  
ATOM 364   H HB3  . LYS A 1 27  ? -0.332  5.809   5.347   1.00 0.00 ? 1159 LYS A HB3  1  
ATOM 365   H HG2  . LYS A 1 27  ? 0.174   7.670   6.917   1.00 0.00 ? 1159 LYS A HG2  1  
ATOM 366   H HG3  . LYS A 1 27  ? 1.694   7.919   6.056   1.00 0.00 ? 1159 LYS A HG3  1  
ATOM 367   H HD2  . LYS A 1 27  ? 0.647   8.713   4.164   1.00 0.00 ? 1159 LYS A HD2  1  
ATOM 368   H HD3  . LYS A 1 27  ? -0.857  7.857   4.510   1.00 0.00 ? 1159 LYS A HD3  1  
ATOM 369   H HE2  . LYS A 1 27  ? 0.115   10.103  6.248   1.00 0.00 ? 1159 LYS A HE2  1  
ATOM 370   H HE3  . LYS A 1 27  ? -0.828  10.407  4.789   1.00 0.00 ? 1159 LYS A HE3  1  
ATOM 371   H HZ1  . LYS A 1 27  ? -2.587  10.140  6.105   1.00 0.00 ? 1159 LYS A HZ1  1  
ATOM 372   H HZ2  . LYS A 1 27  ? -1.685  9.432   7.348   1.00 0.00 ? 1159 LYS A HZ2  1  
ATOM 373   H HZ3  . LYS A 1 27  ? -2.248  8.483   6.066   1.00 0.00 ? 1159 LYS A HZ3  1  
ATOM 374   N N    . LEU A 1 28  ? 2.069   3.344   5.269   1.00 0.00 ? 1160 LEU A N    1  
ATOM 375   C CA   . LEU A 1 28  ? 2.091   1.983   4.744   1.00 0.00 ? 1160 LEU A CA   1  
ATOM 376   C C    . LEU A 1 28  ? 2.285   0.969   5.866   1.00 0.00 ? 1160 LEU A C    1  
ATOM 377   O O    . LEU A 1 28  ? 1.506   0.026   6.006   1.00 0.00 ? 1160 LEU A O    1  
ATOM 378   C CB   . LEU A 1 28  ? 3.206   1.834   3.708   1.00 0.00 ? 1160 LEU A CB   1  
ATOM 379   C CG   . LEU A 1 28  ? 2.983   2.545   2.373   1.00 0.00 ? 1160 LEU A CG   1  
ATOM 380   C CD1  . LEU A 1 28  ? 4.298   2.708   1.628   1.00 0.00 ? 1160 LEU A CD1  1  
ATOM 381   C CD2  . LEU A 1 28  ? 1.978   1.781   1.523   1.00 0.00 ? 1160 LEU A CD2  1  
ATOM 382   H H    . LEU A 1 28  ? 2.737   3.988   4.953   1.00 0.00 ? 1160 LEU A H    1  
ATOM 383   H HA   . LEU A 1 28  ? 1.140   1.797   4.267   1.00 0.00 ? 1160 LEU A HA   1  
ATOM 384   H HB2  . LEU A 1 28  ? 4.115   2.223   4.141   1.00 0.00 ? 1160 LEU A HB2  1  
ATOM 385   H HB3  . LEU A 1 28  ? 3.329   0.779   3.505   1.00 0.00 ? 1160 LEU A HB3  1  
ATOM 386   H HG   . LEU A 1 28  ? 2.581   3.531   2.560   1.00 0.00 ? 1160 LEU A HG   1  
ATOM 387   H HD11 . LEU A 1 28  ? 4.588   1.762   1.198   1.00 0.00 ? 1160 LEU A HD11 1  
ATOM 388   H HD12 . LEU A 1 28  ? 5.062   3.041   2.315   1.00 0.00 ? 1160 LEU A HD12 1  
ATOM 389   H HD13 . LEU A 1 28  ? 4.179   3.440   0.842   1.00 0.00 ? 1160 LEU A HD13 1  
ATOM 390   H HD21 . LEU A 1 28  ? 1.270   1.280   2.167   1.00 0.00 ? 1160 LEU A HD21 1  
ATOM 391   H HD22 . LEU A 1 28  ? 2.498   1.048   0.922   1.00 0.00 ? 1160 LEU A HD22 1  
ATOM 392   H HD23 . LEU A 1 28  ? 1.454   2.470   0.878   1.00 0.00 ? 1160 LEU A HD23 1  
ATOM 393   N N    . VAL A 1 29  ? 3.327   1.171   6.666   1.00 0.00 ? 1161 VAL A N    1  
ATOM 394   C CA   . VAL A 1 29  ? 3.622   0.276   7.779   1.00 0.00 ? 1161 VAL A CA   1  
ATOM 395   C C    . VAL A 1 29  ? 2.372   0.002   8.608   1.00 0.00 ? 1161 VAL A C    1  
ATOM 396   O O    . VAL A 1 29  ? 2.077   -1.145  8.943   1.00 0.00 ? 1161 VAL A O    1  
ATOM 397   C CB   . VAL A 1 29  ? 4.714   0.859   8.694   1.00 0.00 ? 1161 VAL A CB   1  
ATOM 398   C CG1  . VAL A 1 29  ? 4.993   -0.079  9.858   1.00 0.00 ? 1161 VAL A CG1  1  
ATOM 399   C CG2  . VAL A 1 29  ? 5.984   1.130   7.901   1.00 0.00 ? 1161 VAL A CG2  1  
ATOM 400   H H    . VAL A 1 29  ? 3.912   1.940   6.504   1.00 0.00 ? 1161 VAL A H    1  
ATOM 401   H HA   . VAL A 1 29  ? 3.983   -0.657  7.371   1.00 0.00 ? 1161 VAL A HA   1  
ATOM 402   H HB   . VAL A 1 29  ? 4.358   1.797   9.094   1.00 0.00 ? 1161 VAL A HB   1  
ATOM 403   H HG11 . VAL A 1 29  ? 5.306   -1.041  9.478   1.00 0.00 ? 1161 VAL A HG11 1  
ATOM 404   H HG12 . VAL A 1 29  ? 5.775   0.337   10.477  1.00 0.00 ? 1161 VAL A HG12 1  
ATOM 405   H HG13 . VAL A 1 29  ? 4.094   -0.200  10.446  1.00 0.00 ? 1161 VAL A HG13 1  
ATOM 406   H HG21 . VAL A 1 29  ? 6.845   0.931   8.522   1.00 0.00 ? 1161 VAL A HG21 1  
ATOM 407   H HG22 . VAL A 1 29  ? 6.011   0.487   7.033   1.00 0.00 ? 1161 VAL A HG22 1  
ATOM 408   H HG23 . VAL A 1 29  ? 5.998   2.162   7.584   1.00 0.00 ? 1161 VAL A HG23 1  
ATOM 409   N N    . GLU A 1 30  ? 1.642   1.063   8.937   1.00 0.00 ? 1162 GLU A N    1  
ATOM 410   C CA   . GLU A 1 30  ? 0.424   0.936   9.728   1.00 0.00 ? 1162 GLU A CA   1  
ATOM 411   C C    . GLU A 1 30  ? -0.573  0.002   9.047   1.00 0.00 ? 1162 GLU A C    1  
ATOM 412   O O    . GLU A 1 30  ? -1.149  -0.879  9.684   1.00 0.00 ? 1162 GLU A O    1  
ATOM 413   C CB   . GLU A 1 30  ? -0.215  2.309   9.947   1.00 0.00 ? 1162 GLU A CB   1  
ATOM 414   C CG   . GLU A 1 30  ? 0.577   3.207   10.882  1.00 0.00 ? 1162 GLU A CG   1  
ATOM 415   C CD   . GLU A 1 30  ? 0.333   2.887   12.344  1.00 0.00 ? 1162 GLU A CD   1  
ATOM 416   O OE1  . GLU A 1 30  ? 0.865   1.863   12.823  1.00 0.00 ? 1162 GLU A OE1  1  
ATOM 417   O OE2  . GLU A 1 30  ? -0.389  3.658   13.008  1.00 0.00 ? 1162 GLU A OE2  1  
ATOM 418   H H    . GLU A 1 30  ? 1.929   1.952   8.640   1.00 0.00 ? 1162 GLU A H    1  
ATOM 419   H HA   . GLU A 1 30  ? 0.693   0.518   10.686  1.00 0.00 ? 1162 GLU A HA   1  
ATOM 420   H HB2  . GLU A 1 30  ? -0.305  2.807   8.992   1.00 0.00 ? 1162 GLU A HB2  1  
ATOM 421   H HB3  . GLU A 1 30  ? -1.201  2.171   10.364  1.00 0.00 ? 1162 GLU A HB3  1  
ATOM 422   H HG2  . GLU A 1 30  ? 1.629   3.084   10.673  1.00 0.00 ? 1162 GLU A HG2  1  
ATOM 423   H HG3  . GLU A 1 30  ? 0.293   4.233   10.701  1.00 0.00 ? 1162 GLU A HG3  1  
ATOM 424   N N    . ALA A 1 31  ? -0.770  0.202   7.748   1.00 0.00 ? 1163 ALA A N    1  
ATOM 425   C CA   . ALA A 1 31  ? -1.694  -0.622  6.980   1.00 0.00 ? 1163 ALA A CA   1  
ATOM 426   C C    . ALA A 1 31  ? -1.271  -2.087  6.999   1.00 0.00 ? 1163 ALA A C    1  
ATOM 427   O O    . ALA A 1 31  ? -2.062  -2.967  7.338   1.00 0.00 ? 1163 ALA A O    1  
ATOM 428   C CB   . ALA A 1 31  ? -1.787  -0.116  5.548   1.00 0.00 ? 1163 ALA A CB   1  
ATOM 429   H H    . ALA A 1 31  ? -0.281  0.920   7.296   1.00 0.00 ? 1163 ALA A H    1  
ATOM 430   H HA   . ALA A 1 31  ? -2.673  -0.535  7.430   1.00 0.00 ? 1163 ALA A HA   1  
ATOM 431   H HB1  . ALA A 1 31  ? -1.811  -0.958  4.871   1.00 0.00 ? 1163 ALA A HB1  1  
ATOM 432   H HB2  . ALA A 1 31  ? -2.688  0.467   5.430   1.00 0.00 ? 1163 ALA A HB2  1  
ATOM 433   H HB3  . ALA A 1 31  ? -0.928  0.499   5.327   1.00 0.00 ? 1163 ALA A HB3  1  
ATOM 434   N N    . ARG A 1 32  ? -0.019  -2.341  6.633   1.00 0.00 ? 1164 ARG A N    1  
ATOM 435   C CA   . ARG A 1 32  ? 0.509   -3.699  6.607   1.00 0.00 ? 1164 ARG A CA   1  
ATOM 436   C C    . ARG A 1 32  ? 0.170   -4.439  7.897   1.00 0.00 ? 1164 ARG A C    1  
ATOM 437   O O    . ARG A 1 32  ? -0.255  -5.594  7.868   1.00 0.00 ? 1164 ARG A O    1  
ATOM 438   C CB   . ARG A 1 32  ? 2.025   -3.676  6.402   1.00 0.00 ? 1164 ARG A CB   1  
ATOM 439   C CG   . ARG A 1 32  ? 2.680   -5.040  6.547   1.00 0.00 ? 1164 ARG A CG   1  
ATOM 440   C CD   . ARG A 1 32  ? 4.112   -4.921  7.046   1.00 0.00 ? 1164 ARG A CD   1  
ATOM 441   N NE   . ARG A 1 32  ? 4.174   -4.735  8.493   1.00 0.00 ? 1164 ARG A NE   1  
ATOM 442   C CZ   . ARG A 1 32  ? 5.297   -4.820  9.197   1.00 0.00 ? 1164 ARG A CZ   1  
ATOM 443   N NH1  . ARG A 1 32  ? 6.445   -5.087  8.591   1.00 0.00 ? 1164 ARG A NH1  1  
ATOM 444   N NH2  . ARG A 1 32  ? 5.272   -4.638  10.511  1.00 0.00 ? 1164 ARG A NH2  1  
ATOM 445   H H    . ARG A 1 32  ? 0.564   -1.596  6.373   1.00 0.00 ? 1164 ARG A H    1  
ATOM 446   H HA   . ARG A 1 32  ? 0.051   -4.217  5.778   1.00 0.00 ? 1164 ARG A HA   1  
ATOM 447   H HB2  . ARG A 1 32  ? 2.238   -3.304  5.411   1.00 0.00 ? 1164 ARG A HB2  1  
ATOM 448   H HB3  . ARG A 1 32  ? 2.464   -3.011  7.130   1.00 0.00 ? 1164 ARG A HB3  1  
ATOM 449   H HG2  . ARG A 1 32  ? 2.113   -5.629  7.254   1.00 0.00 ? 1164 ARG A HG2  1  
ATOM 450   H HG3  . ARG A 1 32  ? 2.682   -5.532  5.586   1.00 0.00 ? 1164 ARG A HG3  1  
ATOM 451   H HD2  . ARG A 1 32  ? 4.646   -5.822  6.785   1.00 0.00 ? 1164 ARG A HD2  1  
ATOM 452   H HD3  . ARG A 1 32  ? 4.577   -4.075  6.563   1.00 0.00 ? 1164 ARG A HD3  1  
ATOM 453   H HE   . ARG A 1 32  ? 3.337   -4.537  8.961   1.00 0.00 ? 1164 ARG A HE   1  
ATOM 454   H HH11 . ARG A 1 32  ? 6.467   -5.223  7.601   1.00 0.00 ? 1164 ARG A HH11 1  
ATOM 455   H HH12 . ARG A 1 32  ? 7.289   -5.149  9.123   1.00 0.00 ? 1164 ARG A HH12 1  
ATOM 456   H HH21 . ARG A 1 32  ? 4.409   -4.437  10.972  1.00 0.00 ? 1164 ARG A HH21 1  
ATOM 457   H HH22 . ARG A 1 32  ? 6.118   -4.703  11.041  1.00 0.00 ? 1164 ARG A HH22 1  
ATOM 458   N N    . GLN A 1 33  ? 0.362   -3.766  9.027   1.00 0.00 ? 1165 GLN A N    1  
ATOM 459   C CA   . GLN A 1 33  ? 0.078   -4.361  10.328  1.00 0.00 ? 1165 GLN A CA   1  
ATOM 460   C C    . GLN A 1 33  ? -1.385  -4.779  10.427  1.00 0.00 ? 1165 GLN A C    1  
ATOM 461   O O    . GLN A 1 33  ? -1.702  -5.969  10.441  1.00 0.00 ? 1165 GLN A O    1  
ATOM 462   C CB   . GLN A 1 33  ? 0.416   -3.375  11.448  1.00 0.00 ? 1165 GLN A CB   1  
ATOM 463   C CG   . GLN A 1 33  ? 0.189   -3.937  12.842  1.00 0.00 ? 1165 GLN A CG   1  
ATOM 464   C CD   . GLN A 1 33  ? 0.102   -2.855  13.900  1.00 0.00 ? 1165 GLN A CD   1  
ATOM 465   O OE1  . GLN A 1 33  ? 1.101   -2.218  14.237  1.00 0.00 ? 1165 GLN A OE1  1  
ATOM 466   N NE2  . GLN A 1 33  ? -1.096  -2.640  14.431  1.00 0.00 ? 1165 GLN A NE2  1  
ATOM 467   H H    . GLN A 1 33  ? 0.703   -2.849  8.985   1.00 0.00 ? 1165 GLN A H    1  
ATOM 468   H HA   . GLN A 1 33  ? 0.698   -5.238  10.434  1.00 0.00 ? 1165 GLN A HA   1  
ATOM 469   H HB2  . GLN A 1 33  ? 1.454   -3.093  11.361  1.00 0.00 ? 1165 GLN A HB2  1  
ATOM 470   H HB3  . GLN A 1 33  ? -0.199  -2.495  11.334  1.00 0.00 ? 1165 GLN A HB3  1  
ATOM 471   H HG2  . GLN A 1 33  ? -0.735  -4.496  12.845  1.00 0.00 ? 1165 GLN A HG2  1  
ATOM 472   H HG3  . GLN A 1 33  ? 1.008   -4.596  13.088  1.00 0.00 ? 1165 GLN A HG3  1  
ATOM 473   H HE21 . GLN A 1 33  ? -1.847  -3.187  14.114  1.00 0.00 ? 1165 GLN A HE21 1  
ATOM 474   H HE22 . GLN A 1 33  ? -1.181  -1.948  15.118  1.00 0.00 ? 1165 GLN A HE22 1  
ATOM 475   N N    . LYS A 1 34  ? -2.274  -3.794  10.496  1.00 0.00 ? 1166 LYS A N    1  
ATOM 476   C CA   . LYS A 1 34  ? -3.704  -4.059  10.593  1.00 0.00 ? 1166 LYS A CA   1  
ATOM 477   C C    . LYS A 1 34  ? -4.130  -5.124  9.588   1.00 0.00 ? 1166 LYS A C    1  
ATOM 478   O O    . LYS A 1 34  ? -5.110  -5.839  9.803   1.00 0.00 ? 1166 LYS A O    1  
ATOM 479   C CB   . LYS A 1 34  ? -4.499  -2.772  10.357  1.00 0.00 ? 1166 LYS A CB   1  
ATOM 480   C CG   . LYS A 1 34  ? -4.488  -2.308  8.910   1.00 0.00 ? 1166 LYS A CG   1  
ATOM 481   C CD   . LYS A 1 34  ? -5.700  -1.449  8.592   1.00 0.00 ? 1166 LYS A CD   1  
ATOM 482   C CE   . LYS A 1 34  ? -6.908  -2.301  8.232   1.00 0.00 ? 1166 LYS A CE   1  
ATOM 483   N NZ   . LYS A 1 34  ? -8.121  -1.470  7.993   1.00 0.00 ? 1166 LYS A NZ   1  
ATOM 484   H H    . LYS A 1 34  ? -1.959  -2.865  10.481  1.00 0.00 ? 1166 LYS A H    1  
ATOM 485   H HA   . LYS A 1 34  ? -3.908  -4.419  11.590  1.00 0.00 ? 1166 LYS A HA   1  
ATOM 486   H HB2  . LYS A 1 34  ? -5.525  -2.938  10.652  1.00 0.00 ? 1166 LYS A HB2  1  
ATOM 487   H HB3  . LYS A 1 34  ? -4.079  -1.987  10.968  1.00 0.00 ? 1166 LYS A HB3  1  
ATOM 488   H HG2  . LYS A 1 34  ? -3.594  -1.729  8.734   1.00 0.00 ? 1166 LYS A HG2  1  
ATOM 489   H HG3  . LYS A 1 34  ? -4.492  -3.175  8.264   1.00 0.00 ? 1166 LYS A HG3  1  
ATOM 490   H HD2  . LYS A 1 34  ? -5.942  -0.848  9.455   1.00 0.00 ? 1166 LYS A HD2  1  
ATOM 491   H HD3  . LYS A 1 34  ? -5.464  -0.804  7.757   1.00 0.00 ? 1166 LYS A HD3  1  
ATOM 492   H HE2  . LYS A 1 34  ? -6.684  -2.861  7.338   1.00 0.00 ? 1166 LYS A HE2  1  
ATOM 493   H HE3  . LYS A 1 34  ? -7.105  -2.984  9.045   1.00 0.00 ? 1166 LYS A HE3  1  
ATOM 494   H HZ1  . LYS A 1 34  ? -7.924  -0.476  8.225   1.00 0.00 ? 1166 LYS A HZ1  1  
ATOM 495   H HZ2  . LYS A 1 34  ? -8.906  -1.804  8.588   1.00 0.00 ? 1166 LYS A HZ2  1  
ATOM 496   H HZ3  . LYS A 1 34  ? -8.406  -1.533  6.995   1.00 0.00 ? 1166 LYS A HZ3  1  
ATOM 497   N N    . HIS A 1 35  ? -3.387  -5.226  8.491   1.00 0.00 ? 1167 HIS A N    1  
ATOM 498   C CA   . HIS A 1 35  ? -3.687  -6.207  7.453   1.00 0.00 ? 1167 HIS A CA   1  
ATOM 499   C C    . HIS A 1 35  ? -3.043  -7.552  7.774   1.00 0.00 ? 1167 HIS A C    1  
ATOM 500   O O    . HIS A 1 35  ? -3.582  -8.605  7.437   1.00 0.00 ? 1167 HIS A O    1  
ATOM 501   C CB   . HIS A 1 35  ? -3.199  -5.706  6.093   1.00 0.00 ? 1167 HIS A CB   1  
ATOM 502   C CG   . HIS A 1 35  ? -3.738  -6.492  4.937   1.00 0.00 ? 1167 HIS A CG   1  
ATOM 503   N ND1  . HIS A 1 35  ? -4.814  -7.348  5.046   1.00 0.00 ? 1167 HIS A ND1  1  
ATOM 504   C CD2  . HIS A 1 35  ? -3.345  -6.546  3.643   1.00 0.00 ? 1167 HIS A CD2  1  
ATOM 505   C CE1  . HIS A 1 35  ? -5.058  -7.896  3.869   1.00 0.00 ? 1167 HIS A CE1  1  
ATOM 506   N NE2  . HIS A 1 35  ? -4.181  -7.426  3.000   1.00 0.00 ? 1167 HIS A NE2  1  
ATOM 507   H H    . HIS A 1 35  ? -2.619  -4.629  8.376   1.00 0.00 ? 1167 HIS A H    1  
ATOM 508   H HA   . HIS A 1 35  ? -4.758  -6.334  7.417   1.00 0.00 ? 1167 HIS A HA   1  
ATOM 509   H HB2  . HIS A 1 35  ? -3.503  -4.678  5.965   1.00 0.00 ? 1167 HIS A HB2  1  
ATOM 510   H HB3  . HIS A 1 35  ? -2.121  -5.765  6.061   1.00 0.00 ? 1167 HIS A HB3  1  
ATOM 511   H HD1  . HIS A 1 35  ? -5.322  -7.528  5.864   1.00 0.00 ? 1167 HIS A HD1  1  
ATOM 512   H HD2  . HIS A 1 35  ? -2.525  -6.000  3.198   1.00 0.00 ? 1167 HIS A HD2  1  
ATOM 513   H HE1  . HIS A 1 35  ? -5.841  -8.607  3.652   1.00 0.00 ? 1167 HIS A HE1  1  
ATOM 514   H HE2  . HIS A 1 35  ? -4.083  -7.732  2.075   1.00 0.00 ? 1167 HIS A HE2  1  
ATOM 515   N N    . ALA A 1 36  ? -1.886  -7.508  8.427   1.00 0.00 ? 1168 ALA A N    1  
ATOM 516   C CA   . ALA A 1 36  ? -1.170  -8.723  8.795   1.00 0.00 ? 1168 ALA A CA   1  
ATOM 517   C C    . ALA A 1 36  ? -2.034  -9.628  9.666   1.00 0.00 ? 1168 ALA A C    1  
ATOM 518   O O    . ALA A 1 36  ? -2.171  -10.820 9.395   1.00 0.00 ? 1168 ALA A O    1  
ATOM 519   C CB   . ALA A 1 36  ? 0.125   -8.375  9.514   1.00 0.00 ? 1168 ALA A CB   1  
ATOM 520   H H    . ALA A 1 36  ? -1.506  -6.638  8.669   1.00 0.00 ? 1168 ALA A H    1  
ATOM 521   H HA   . ALA A 1 36  ? -0.917  -9.250  7.886   1.00 0.00 ? 1168 ALA A HA   1  
ATOM 522   H HB1  . ALA A 1 36  ? 0.883   -9.103  9.262   1.00 0.00 ? 1168 ALA A HB1  1  
ATOM 523   H HB2  . ALA A 1 36  ? 0.453   -7.393  9.209   1.00 0.00 ? 1168 ALA A HB2  1  
ATOM 524   H HB3  . ALA A 1 36  ? -0.042  -8.384  10.581  1.00 0.00 ? 1168 ALA A HB3  1  
ATOM 525   N N    . ASN A 1 37  ? -2.615  -9.053  10.714  1.00 0.00 ? 1169 ASN A N    1  
ATOM 526   C CA   . ASN A 1 37  ? -3.466  -9.809  11.626  1.00 0.00 ? 1169 ASN A CA   1  
ATOM 527   C C    . ASN A 1 37  ? -4.678  -10.378 10.895  1.00 0.00 ? 1169 ASN A C    1  
ATOM 528   O O    . ASN A 1 37  ? -5.034  -11.543 11.073  1.00 0.00 ? 1169 ASN A O    1  
ATOM 529   C CB   . ASN A 1 37  ? -3.926  -8.919  12.783  1.00 0.00 ? 1169 ASN A CB   1  
ATOM 530   C CG   . ASN A 1 37  ? -2.952  -8.932  13.945  1.00 0.00 ? 1169 ASN A CG   1  
ATOM 531   O OD1  . ASN A 1 37  ? -3.237  -9.495  15.002  1.00 0.00 ? 1169 ASN A OD1  1  
ATOM 532   N ND2  . ASN A 1 37  ? -1.795  -8.310  13.754  1.00 0.00 ? 1169 ASN A ND2  1  
ATOM 533   H H    . ASN A 1 37  ? -2.468  -8.098  10.879  1.00 0.00 ? 1169 ASN A H    1  
ATOM 534   H HA   . ASN A 1 37  ? -2.883  -10.626 12.023  1.00 0.00 ? 1169 ASN A HA   1  
ATOM 535   H HB2  . ASN A 1 37  ? -4.022  -7.902  12.431  1.00 0.00 ? 1169 ASN A HB2  1  
ATOM 536   H HB3  . ASN A 1 37  ? -4.885  -9.266  13.137  1.00 0.00 ? 1169 ASN A HB3  1  
ATOM 537   H HD21 . ASN A 1 37  ? -1.636  -7.883  12.886  1.00 0.00 ? 1169 ASN A HD21 1  
ATOM 538   H HD22 . ASN A 1 37  ? -1.146  -8.304  14.489  1.00 0.00 ? 1169 ASN A HD22 1  
ATOM 539   N N    . LYS A 1 38  ? -5.307  -9.548  10.069  1.00 0.00 ? 1170 LYS A N    1  
ATOM 540   C CA   . LYS A 1 38  ? -6.478  -9.967  9.308   1.00 0.00 ? 1170 LYS A CA   1  
ATOM 541   C C    . LYS A 1 38  ? -6.228  -11.304 8.618   1.00 0.00 ? 1170 LYS A C    1  
ATOM 542   O O    . LYS A 1 38  ? -7.015  -12.240 8.755   1.00 0.00 ? 1170 LYS A O    1  
ATOM 543   C CB   . LYS A 1 38  ? -6.843  -8.905  8.269   1.00 0.00 ? 1170 LYS A CB   1  
ATOM 544   C CG   . LYS A 1 38  ? -8.032  -9.284  7.403   1.00 0.00 ? 1170 LYS A CG   1  
ATOM 545   C CD   . LYS A 1 38  ? -7.597  -10.038 6.157   1.00 0.00 ? 1170 LYS A CD   1  
ATOM 546   C CE   . LYS A 1 38  ? -8.610  -9.888  5.033   1.00 0.00 ? 1170 LYS A CE   1  
ATOM 547   N NZ   . LYS A 1 38  ? -9.873  -10.622 5.323   1.00 0.00 ? 1170 LYS A NZ   1  
ATOM 548   H H    . LYS A 1 38  ? -4.975  -8.631  9.969   1.00 0.00 ? 1170 LYS A H    1  
ATOM 549   H HA   . LYS A 1 38  ? -7.299  -10.080 9.999   1.00 0.00 ? 1170 LYS A HA   1  
ATOM 550   H HB2  . LYS A 1 38  ? -7.076  -7.983  8.781   1.00 0.00 ? 1170 LYS A HB2  1  
ATOM 551   H HB3  . LYS A 1 38  ? -5.991  -8.743  7.623   1.00 0.00 ? 1170 LYS A HB3  1  
ATOM 552   H HG2  . LYS A 1 38  ? -8.697  -9.912  7.976   1.00 0.00 ? 1170 LYS A HG2  1  
ATOM 553   H HG3  . LYS A 1 38  ? -8.550  -8.384  7.105   1.00 0.00 ? 1170 LYS A HG3  1  
ATOM 554   H HD2  . LYS A 1 38  ? -6.646  -9.648  5.825   1.00 0.00 ? 1170 LYS A HD2  1  
ATOM 555   H HD3  . LYS A 1 38  ? -7.493  -11.086 6.399   1.00 0.00 ? 1170 LYS A HD3  1  
ATOM 556   H HE2  . LYS A 1 38  ? -8.834  -8.840  4.905   1.00 0.00 ? 1170 LYS A HE2  1  
ATOM 557   H HE3  . LYS A 1 38  ? -8.178  -10.277 4.123   1.00 0.00 ? 1170 LYS A HE3  1  
ATOM 558   H HZ1  . LYS A 1 38  ? -10.279 -10.995 4.441   1.00 0.00 ? 1170 LYS A HZ1  1  
ATOM 559   H HZ2  . LYS A 1 38  ? -10.563 -9.983  5.766   1.00 0.00 ? 1170 LYS A HZ2  1  
ATOM 560   H HZ3  . LYS A 1 38  ? -9.685  -11.415 5.968   1.00 0.00 ? 1170 LYS A HZ3  1  
ATOM 561   N N    . MET A 1 39  ? -5.127  -11.386 7.877   1.00 0.00 ? 1171 MET A N    1  
ATOM 562   C CA   . MET A 1 39  ? -4.773  -12.610 7.168   1.00 0.00 ? 1171 MET A CA   1  
ATOM 563   C C    . MET A 1 39  ? -4.174  -13.638 8.123   1.00 0.00 ? 1171 MET A C    1  
ATOM 564   O O    . MET A 1 39  ? -3.911  -14.777 7.738   1.00 0.00 ? 1171 MET A O    1  
ATOM 565   C CB   . MET A 1 39  ? -3.783  -12.304 6.042   1.00 0.00 ? 1171 MET A CB   1  
ATOM 566   C CG   . MET A 1 39  ? -4.452  -11.955 4.723   1.00 0.00 ? 1171 MET A CG   1  
ATOM 567   S SD   . MET A 1 39  ? -3.366  -12.204 3.306   1.00 0.00 ? 1171 MET A SD   1  
ATOM 568   C CE   . MET A 1 39  ? -2.842  -10.523 2.980   1.00 0.00 ? 1171 MET A CE   1  
ATOM 569   H H    . MET A 1 39  ? -4.539  -10.606 7.806   1.00 0.00 ? 1171 MET A H    1  
ATOM 570   H HA   . MET A 1 39  ? -5.676  -13.018 6.740   1.00 0.00 ? 1171 MET A HA   1  
ATOM 571   H HB2  . MET A 1 39  ? -3.165  -11.471 6.339   1.00 0.00 ? 1171 MET A HB2  1  
ATOM 572   H HB3  . MET A 1 39  ? -3.156  -13.170 5.885   1.00 0.00 ? 1171 MET A HB3  1  
ATOM 573   H HG2  . MET A 1 39  ? -5.326  -12.577 4.602   1.00 0.00 ? 1171 MET A HG2  1  
ATOM 574   H HG3  . MET A 1 39  ? -4.752  -10.918 4.751   1.00 0.00 ? 1171 MET A HG3  1  
ATOM 575   H HE1  . MET A 1 39  ? -3.618  -10.002 2.439   1.00 0.00 ? 1171 MET A HE1  1  
ATOM 576   H HE2  . MET A 1 39  ? -2.654  -10.017 3.916   1.00 0.00 ? 1171 MET A HE2  1  
ATOM 577   H HE3  . MET A 1 39  ? -1.938  -10.536 2.389   1.00 0.00 ? 1171 MET A HE3  1  
ATOM 578   N N    . ASP A 1 40  ? -3.960  -13.227 9.368   1.00 0.00 ? 1172 ASP A N    1  
ATOM 579   C CA   . ASP A 1 40  ? -3.392  -14.113 10.378  1.00 0.00 ? 1172 ASP A CA   1  
ATOM 580   C C    . ASP A 1 40  ? -1.939  -14.444 10.055  1.00 0.00 ? 1172 ASP A C    1  
ATOM 581   O O    . ASP A 1 40  ? -1.494  -15.578 10.237  1.00 0.00 ? 1172 ASP A O    1  
ATOM 582   C CB   . ASP A 1 40  ? -4.212  -15.400 10.477  1.00 0.00 ? 1172 ASP A CB   1  
ATOM 583   C CG   . ASP A 1 40  ? -5.700  -15.152 10.329  1.00 0.00 ? 1172 ASP A CG   1  
ATOM 584   O OD1  . ASP A 1 40  ? -6.167  -15.013 9.179   1.00 0.00 ? 1172 ASP A OD1  1  
ATOM 585   O OD2  . ASP A 1 40  ? -6.399  -15.095 11.363  1.00 0.00 ? 1172 ASP A OD2  1  
ATOM 586   H H    . ASP A 1 40  ? -4.191  -12.307 9.614   1.00 0.00 ? 1172 ASP A H    1  
ATOM 587   H HA   . ASP A 1 40  ? -3.429  -13.600 11.327  1.00 0.00 ? 1172 ASP A HA   1  
ATOM 588   H HB2  . ASP A 1 40  ? -3.900  -16.079 9.697   1.00 0.00 ? 1172 ASP A HB2  1  
ATOM 589   H HB3  . ASP A 1 40  ? -4.036  -15.858 11.439  1.00 0.00 ? 1172 ASP A HB3  1  
ATOM 590   N N    . VAL A 1 41  ? -1.203  -13.447 9.574   1.00 0.00 ? 1173 VAL A N    1  
ATOM 591   C CA   . VAL A 1 41  ? 0.201   -13.633 9.225   1.00 0.00 ? 1173 VAL A CA   1  
ATOM 592   C C    . VAL A 1 41  ? 1.077   -12.582 9.897   1.00 0.00 ? 1173 VAL A C    1  
ATOM 593   O O    . VAL A 1 41  ? 0.699   -11.418 10.034  1.00 0.00 ? 1173 VAL A O    1  
ATOM 594   C CB   . VAL A 1 41  ? 0.414   -13.566 7.701   1.00 0.00 ? 1173 VAL A CB   1  
ATOM 595   C CG1  . VAL A 1 41  ? -0.332  -14.695 7.007   1.00 0.00 ? 1173 VAL A CG1  1  
ATOM 596   C CG2  . VAL A 1 41  ? -0.026  -12.214 7.161   1.00 0.00 ? 1173 VAL A CG2  1  
ATOM 597   H H    . VAL A 1 41  ? -1.613  -12.566 9.451   1.00 0.00 ? 1173 VAL A H    1  
ATOM 598   H HA   . VAL A 1 41  ? 0.503   -14.612 9.567   1.00 0.00 ? 1173 VAL A HA   1  
ATOM 599   H HB   . VAL A 1 41  ? 1.469   -13.684 7.500   1.00 0.00 ? 1173 VAL A HB   1  
ATOM 600   H HG11 . VAL A 1 41  ? -1.255  -14.315 6.593   1.00 0.00 ? 1173 VAL A HG11 1  
ATOM 601   H HG12 . VAL A 1 41  ? 0.280   -15.098 6.214   1.00 0.00 ? 1173 VAL A HG12 1  
ATOM 602   H HG13 . VAL A 1 41  ? -0.553  -15.473 7.723   1.00 0.00 ? 1173 VAL A HG13 1  
ATOM 603   H HG21 . VAL A 1 41  ? 0.828   -11.555 7.101   1.00 0.00 ? 1173 VAL A HG21 1  
ATOM 604   H HG22 . VAL A 1 41  ? -0.453  -12.340 6.176   1.00 0.00 ? 1173 VAL A HG22 1  
ATOM 605   H HG23 . VAL A 1 41  ? -0.766  -11.785 7.821   1.00 0.00 ? 1173 VAL A HG23 1  
ATOM 606   N N    . PRO A 1 42  ? 2.278   -12.999 10.326  1.00 0.00 ? 1174 PRO A N    1  
ATOM 607   C CA   . PRO A 1 42  ? 3.234   -12.108 10.990  1.00 0.00 ? 1174 PRO A CA   1  
ATOM 608   C C    . PRO A 1 42  ? 3.421   -10.795 10.238  1.00 0.00 ? 1174 PRO A C    1  
ATOM 609   O O    . PRO A 1 42  ? 3.502   -10.760 9.010   1.00 0.00 ? 1174 PRO A O    1  
ATOM 610   C CB   . PRO A 1 42  ? 4.534   -12.917 10.985  1.00 0.00 ? 1174 PRO A CB   1  
ATOM 611   C CG   . PRO A 1 42  ? 4.095   -14.339 10.937  1.00 0.00 ? 1174 PRO A CG   1  
ATOM 612   C CD   . PRO A 1 42  ? 2.794   -14.372 10.196  1.00 0.00 ? 1174 PRO A CD   1  
ATOM 613   H HA   . PRO A 1 42  ? 2.941   -11.900 12.009  1.00 0.00 ? 1174 PRO A HA   1  
ATOM 614   H HB2  . PRO A 1 42  ? 5.121   -12.654 10.116  1.00 0.00 ? 1174 PRO A HB2  1  
ATOM 615   H HB3  . PRO A 1 42  ? 5.096   -12.707 11.883  1.00 0.00 ? 1174 PRO A HB3  1  
ATOM 616   H HG2  . PRO A 1 42  ? 4.829   -14.933 10.414  1.00 0.00 ? 1174 PRO A HG2  1  
ATOM 617   H HG3  . PRO A 1 42  ? 3.953   -14.713 11.940  1.00 0.00 ? 1174 PRO A HG3  1  
ATOM 618   H HD2  . PRO A 1 42  ? 2.961   -14.624 9.159   1.00 0.00 ? 1174 PRO A HD2  1  
ATOM 619   H HD3  . PRO A 1 42  ? 2.120   -15.081 10.655  1.00 0.00 ? 1174 PRO A HD3  1  
ATOM 620   N N    . PRO A 1 43  ? 3.492   -9.686  10.990  1.00 0.00 ? 1175 PRO A N    1  
ATOM 621   C CA   . PRO A 1 43  ? 3.672   -8.350  10.416  1.00 0.00 ? 1175 PRO A CA   1  
ATOM 622   C C    . PRO A 1 43  ? 4.797   -8.307  9.388   1.00 0.00 ? 1175 PRO A C    1  
ATOM 623   O O    . PRO A 1 43  ? 4.824   -7.436  8.519   1.00 0.00 ? 1175 PRO A O    1  
ATOM 624   C CB   . PRO A 1 43  ? 4.023   -7.486  11.630  1.00 0.00 ? 1175 PRO A CB   1  
ATOM 625   C CG   . PRO A 1 43  ? 3.406   -8.191  12.788  1.00 0.00 ? 1175 PRO A CG   1  
ATOM 626   C CD   . PRO A 1 43  ? 3.403   -9.653  12.460  1.00 0.00 ? 1175 PRO A CD   1  
ATOM 627   H HA   . PRO A 1 43  ? 2.760   -7.986  9.965   1.00 0.00 ? 1175 PRO A HA   1  
ATOM 628   H HB2  . PRO A 1 43  ? 5.097   -7.423  11.731  1.00 0.00 ? 1175 PRO A HB2  1  
ATOM 629   H HB3  . PRO A 1 43  ? 3.609   -6.497  11.504  1.00 0.00 ? 1175 PRO A HB3  1  
ATOM 630   H HG2  . PRO A 1 43  ? 3.991   -8.017  13.678  1.00 0.00 ? 1175 PRO A HG2  1  
ATOM 631   H HG3  . PRO A 1 43  ? 2.392   -7.847  12.930  1.00 0.00 ? 1175 PRO A HG3  1  
ATOM 632   H HD2  . PRO A 1 43  ? 4.258   -10.138 12.909  1.00 0.00 ? 1175 PRO A HD2  1  
ATOM 633   H HD3  . PRO A 1 43  ? 2.486   -10.110 12.800  1.00 0.00 ? 1175 PRO A HD3  1  
ATOM 634   N N    . ALA A 1 44  ? 5.725   -9.253  9.493   1.00 0.00 ? 1176 ALA A N    1  
ATOM 635   C CA   . ALA A 1 44  ? 6.851   -9.324  8.571   1.00 0.00 ? 1176 ALA A CA   1  
ATOM 636   C C    . ALA A 1 44  ? 6.527   -10.215 7.377   1.00 0.00 ? 1176 ALA A C    1  
ATOM 637   O O    . ALA A 1 44  ? 6.959   -9.947  6.255   1.00 0.00 ? 1176 ALA A O    1  
ATOM 638   C CB   . ALA A 1 44  ? 8.091   -9.833  9.291   1.00 0.00 ? 1176 ALA A CB   1  
ATOM 639   H H    . ALA A 1 44  ? 5.649   -9.919  10.207  1.00 0.00 ? 1176 ALA A H    1  
ATOM 640   H HA   . ALA A 1 44  ? 7.056   -8.324  8.216   1.00 0.00 ? 1176 ALA A HA   1  
ATOM 641   H HB1  . ALA A 1 44  ? 8.822   -9.039  9.351   1.00 0.00 ? 1176 ALA A HB1  1  
ATOM 642   H HB2  . ALA A 1 44  ? 7.823   -10.153 10.287  1.00 0.00 ? 1176 ALA A HB2  1  
ATOM 643   H HB3  . ALA A 1 44  ? 8.508   -10.665 8.745   1.00 0.00 ? 1176 ALA A HB3  1  
ATOM 644   N N    . ILE A 1 45  ? 5.767   -11.276 7.625   1.00 0.00 ? 1177 ILE A N    1  
ATOM 645   C CA   . ILE A 1 45  ? 5.386   -12.207 6.570   1.00 0.00 ? 1177 ILE A CA   1  
ATOM 646   C C    . ILE A 1 45  ? 4.618   -11.495 5.461   1.00 0.00 ? 1177 ILE A C    1  
ATOM 647   O O    . ILE A 1 45  ? 4.926   -11.651 4.278   1.00 0.00 ? 1177 ILE A O    1  
ATOM 648   C CB   . ILE A 1 45  ? 4.524   -13.358 7.119   1.00 0.00 ? 1177 ILE A CB   1  
ATOM 649   C CG1  . ILE A 1 45  ? 5.390   -14.341 7.909   1.00 0.00 ? 1177 ILE A CG1  1  
ATOM 650   C CG2  . ILE A 1 45  ? 3.807   -14.072 5.982   1.00 0.00 ? 1177 ILE A CG2  1  
ATOM 651   C CD1  . ILE A 1 45  ? 6.388   -15.090 7.054   1.00 0.00 ? 1177 ILE A CD1  1  
ATOM 652   H H    . ILE A 1 45  ? 5.455   -11.437 8.540   1.00 0.00 ? 1177 ILE A H    1  
ATOM 653   H HA   . ILE A 1 45  ? 6.290   -12.627 6.154   1.00 0.00 ? 1177 ILE A HA   1  
ATOM 654   H HB   . ILE A 1 45  ? 3.777   -12.938 7.775   1.00 0.00 ? 1177 ILE A HB   1  
ATOM 655   H HG12 . ILE A 1 45  ? 5.939   -13.801 8.664   1.00 0.00 ? 1177 ILE A HG12 1  
ATOM 656   H HG13 . ILE A 1 45  ? 4.750   -15.069 8.388   1.00 0.00 ? 1177 ILE A HG13 1  
ATOM 657   H HG21 . ILE A 1 45  ? 2.764   -13.792 5.983   1.00 0.00 ? 1177 ILE A HG21 1  
ATOM 658   H HG22 . ILE A 1 45  ? 4.254   -13.788 5.041   1.00 0.00 ? 1177 ILE A HG22 1  
ATOM 659   H HG23 . ILE A 1 45  ? 3.893   -15.139 6.115   1.00 0.00 ? 1177 ILE A HG23 1  
ATOM 660   H HD11 . ILE A 1 45  ? 6.851   -15.870 7.640   1.00 0.00 ? 1177 ILE A HD11 1  
ATOM 661   H HD12 . ILE A 1 45  ? 5.881   -15.527 6.207   1.00 0.00 ? 1177 ILE A HD12 1  
ATOM 662   H HD13 . ILE A 1 45  ? 7.147   -14.405 6.705   1.00 0.00 ? 1177 ILE A HD13 1  
ATOM 663   N N    . LEU A 1 46  ? 3.618   -10.712 5.850   1.00 0.00 ? 1178 LEU A N    1  
ATOM 664   C CA   . LEU A 1 46  ? 2.806   -9.973  4.889   1.00 0.00 ? 1178 LEU A CA   1  
ATOM 665   C C    . LEU A 1 46  ? 3.687   -9.214  3.902   1.00 0.00 ? 1178 LEU A C    1  
ATOM 666   O O    . LEU A 1 46  ? 3.650   -9.470  2.698   1.00 0.00 ? 1178 LEU A O    1  
ATOM 667   C CB   . LEU A 1 46  ? 1.880   -8.998  5.618   1.00 0.00 ? 1178 LEU A CB   1  
ATOM 668   C CG   . LEU A 1 46  ? 0.698   -8.463  4.808   1.00 0.00 ? 1178 LEU A CG   1  
ATOM 669   C CD1  . LEU A 1 46  ? -0.364  -9.538  4.638   1.00 0.00 ? 1178 LEU A CD1  1  
ATOM 670   C CD2  . LEU A 1 46  ? 0.109   -7.229  5.476   1.00 0.00 ? 1178 LEU A CD2  1  
ATOM 671   H H    . LEU A 1 46  ? 3.421   -10.627 6.806   1.00 0.00 ? 1178 LEU A H    1  
ATOM 672   H HA   . LEU A 1 46  ? 2.207   -10.687 4.344   1.00 0.00 ? 1178 LEU A HA   1  
ATOM 673   H HB2  . LEU A 1 46  ? 1.483   -9.504  6.485   1.00 0.00 ? 1178 LEU A HB2  1  
ATOM 674   H HB3  . LEU A 1 46  ? 2.474   -8.154  5.936   1.00 0.00 ? 1178 LEU A HB3  1  
ATOM 675   H HG   . LEU A 1 46  ? 1.045   -8.178  3.823   1.00 0.00 ? 1178 LEU A HG   1  
ATOM 676   H HD11 . LEU A 1 46  ? 0.069   -10.506 4.837   1.00 0.00 ? 1178 LEU A HD11 1  
ATOM 677   H HD12 . LEU A 1 46  ? -0.742  -9.513  3.627   1.00 0.00 ? 1178 LEU A HD12 1  
ATOM 678   H HD13 . LEU A 1 46  ? -1.173  -9.356  5.330   1.00 0.00 ? 1178 LEU A HD13 1  
ATOM 679   H HD21 . LEU A 1 46  ? -0.968  -7.260  5.403   1.00 0.00 ? 1178 LEU A HD21 1  
ATOM 680   H HD22 . LEU A 1 46  ? 0.478   -6.341  4.981   1.00 0.00 ? 1178 LEU A HD22 1  
ATOM 681   H HD23 . LEU A 1 46  ? 0.400   -7.209  6.515   1.00 0.00 ? 1178 LEU A HD23 1  
ATOM 682   N N    . ALA A 1 47  ? 4.479   -8.281  4.419   1.00 0.00 ? 1179 ALA A N    1  
ATOM 683   C CA   . ALA A 1 47  ? 5.372   -7.488  3.584   1.00 0.00 ? 1179 ALA A CA   1  
ATOM 684   C C    . ALA A 1 47  ? 6.599   -7.035  4.368   1.00 0.00 ? 1179 ALA A C    1  
ATOM 685   O O    . ALA A 1 47  ? 6.480   -6.398  5.415   1.00 0.00 ? 1179 ALA A O    1  
ATOM 686   C CB   . ALA A 1 47  ? 4.633   -6.286  3.014   1.00 0.00 ? 1179 ALA A CB   1  
ATOM 687   H H    . ALA A 1 47  ? 4.464   -8.124  5.386   1.00 0.00 ? 1179 ALA A H    1  
ATOM 688   H HA   . ALA A 1 47  ? 5.694   -8.107  2.758   1.00 0.00 ? 1179 ALA A HA   1  
ATOM 689   H HB1  . ALA A 1 47  ? 3.749   -6.623  2.492   1.00 0.00 ? 1179 ALA A HB1  1  
ATOM 690   H HB2  . ALA A 1 47  ? 4.348   -5.625  3.818   1.00 0.00 ? 1179 ALA A HB2  1  
ATOM 691   H HB3  . ALA A 1 47  ? 5.279   -5.760  2.327   1.00 0.00 ? 1179 ALA A HB3  1  
ATOM 692   N N    . THR A 1 48  ? 7.780   -7.367  3.855   1.00 0.00 ? 1180 THR A N    1  
ATOM 693   C CA   . THR A 1 48  ? 9.029   -6.996  4.508   1.00 0.00 ? 1180 THR A CA   1  
ATOM 694   C C    . THR A 1 48  ? 9.377   -5.537  4.239   1.00 0.00 ? 1180 THR A C    1  
ATOM 695   O O    . THR A 1 48  ? 8.966   -4.967  3.229   1.00 0.00 ? 1180 THR A O    1  
ATOM 696   C CB   . THR A 1 48  ? 10.195  -7.886  4.038   1.00 0.00 ? 1180 THR A CB   1  
ATOM 697   O OG1  . THR A 1 48  ? 11.341  -7.671  4.869   1.00 0.00 ? 1180 THR A OG1  1  
ATOM 698   C CG2  . THR A 1 48  ? 10.550  -7.590  2.588   1.00 0.00 ? 1180 THR A CG2  1  
ATOM 699   H H    . THR A 1 48  ? 7.810   -7.875  3.018   1.00 0.00 ? 1180 THR A H    1  
ATOM 700   H HA   . THR A 1 48  ? 8.903   -7.136  5.572   1.00 0.00 ? 1180 THR A HA   1  
ATOM 701   H HB   . THR A 1 48  ? 9.892   -8.920  4.115   1.00 0.00 ? 1180 THR A HB   1  
ATOM 702   H HG1  . THR A 1 48  ? 12.140  -7.799  4.352   1.00 0.00 ? 1180 THR A HG1  1  
ATOM 703   H HG21 . THR A 1 48  ? 10.897  -6.571  2.503   1.00 0.00 ? 1180 THR A HG21 1  
ATOM 704   H HG22 . THR A 1 48  ? 9.677   -7.727  1.968   1.00 0.00 ? 1180 THR A HG22 1  
ATOM 705   H HG23 . THR A 1 48  ? 11.330  -8.263  2.265   1.00 0.00 ? 1180 THR A HG23 1  
ATOM 706   N N    . ASN A 1 49  ? 10.138  -4.937  5.149   1.00 0.00 ? 1181 ASN A N    1  
ATOM 707   C CA   . ASN A 1 49  ? 10.542  -3.543  5.009   1.00 0.00 ? 1181 ASN A CA   1  
ATOM 708   C C    . ASN A 1 49  ? 11.033  -3.258  3.593   1.00 0.00 ? 1181 ASN A C    1  
ATOM 709   O O    . ASN A 1 49  ? 10.763  -2.196  3.031   1.00 0.00 ? 1181 ASN A O    1  
ATOM 710   C CB   . ASN A 1 49  ? 11.640  -3.204  6.019   1.00 0.00 ? 1181 ASN A CB   1  
ATOM 711   C CG   . ASN A 1 49  ? 11.083  -2.875  7.390   1.00 0.00 ? 1181 ASN A CG   1  
ATOM 712   O OD1  . ASN A 1 49  ? 11.052  -1.713  7.797   1.00 0.00 ? 1181 ASN A OD1  1  
ATOM 713   N ND2  . ASN A 1 49  ? 10.638  -3.898  8.110   1.00 0.00 ? 1181 ASN A ND2  1  
ATOM 714   H H    . ASN A 1 49  ? 10.435  -5.444  5.933   1.00 0.00 ? 1181 ASN A H    1  
ATOM 715   H HA   . ASN A 1 49  ? 9.679   -2.926  5.209   1.00 0.00 ? 1181 ASN A HA   1  
ATOM 716   H HB2  . ASN A 1 49  ? 12.305  -4.051  6.116   1.00 0.00 ? 1181 ASN A HB2  1  
ATOM 717   H HB3  . ASN A 1 49  ? 12.199  -2.352  5.663   1.00 0.00 ? 1181 ASN A HB3  1  
ATOM 718   H HD21 . ASN A 1 49  ? 10.694  -4.797  7.722   1.00 0.00 ? 1181 ASN A HD21 1  
ATOM 719   H HD22 . ASN A 1 49  ? 10.272  -3.714  9.000   1.00 0.00 ? 1181 ASN A HD22 1  
ATOM 720   N N    . LYS A 1 50  ? 11.756  -4.215  3.020   1.00 0.00 ? 1182 LYS A N    1  
ATOM 721   C CA   . LYS A 1 50  ? 12.284  -4.070  1.669   1.00 0.00 ? 1182 LYS A CA   1  
ATOM 722   C C    . LYS A 1 50  ? 11.182  -3.669  0.694   1.00 0.00 ? 1182 LYS A C    1  
ATOM 723   O O    . LYS A 1 50  ? 11.366  -2.775  -0.133  1.00 0.00 ? 1182 LYS A O    1  
ATOM 724   C CB   . LYS A 1 50  ? 12.935  -5.377  1.210   1.00 0.00 ? 1182 LYS A CB   1  
ATOM 725   C CG   . LYS A 1 50  ? 14.023  -5.182  0.169   1.00 0.00 ? 1182 LYS A CG   1  
ATOM 726   C CD   . LYS A 1 50  ? 13.444  -5.090  -1.233  1.00 0.00 ? 1182 LYS A CD   1  
ATOM 727   C CE   . LYS A 1 50  ? 14.485  -4.616  -2.236  1.00 0.00 ? 1182 LYS A CE   1  
ATOM 728   N NZ   . LYS A 1 50  ? 14.816  -3.175  -2.052  1.00 0.00 ? 1182 LYS A NZ   1  
ATOM 729   H H    . LYS A 1 50  ? 11.938  -5.039  3.519   1.00 0.00 ? 1182 LYS A H    1  
ATOM 730   H HA   . LYS A 1 50  ? 13.033  -3.292  1.687   1.00 0.00 ? 1182 LYS A HA   1  
ATOM 731   H HB2  . LYS A 1 50  ? 13.370  -5.869  2.068   1.00 0.00 ? 1182 LYS A HB2  1  
ATOM 732   H HB3  . LYS A 1 50  ? 12.172  -6.016  0.788   1.00 0.00 ? 1182 LYS A HB3  1  
ATOM 733   H HG2  . LYS A 1 50  ? 14.558  -4.270  0.387   1.00 0.00 ? 1182 LYS A HG2  1  
ATOM 734   H HG3  . LYS A 1 50  ? 14.704  -6.020  0.213   1.00 0.00 ? 1182 LYS A HG3  1  
ATOM 735   H HD2  . LYS A 1 50  ? 13.091  -6.065  -1.532  1.00 0.00 ? 1182 LYS A HD2  1  
ATOM 736   H HD3  . LYS A 1 50  ? 12.618  -4.392  -1.226  1.00 0.00 ? 1182 LYS A HD3  1  
ATOM 737   H HE2  . LYS A 1 50  ? 15.382  -5.202  -2.108  1.00 0.00 ? 1182 LYS A HE2  1  
ATOM 738   H HE3  . LYS A 1 50  ? 14.097  -4.763  -3.233  1.00 0.00 ? 1182 LYS A HE3  1  
ATOM 739   H HZ1  . LYS A 1 50  ? 15.455  -2.857  -2.809  1.00 0.00 ? 1182 LYS A HZ1  1  
ATOM 740   H HZ2  . LYS A 1 50  ? 15.284  -3.031  -1.135  1.00 0.00 ? 1182 LYS A HZ2  1  
ATOM 741   H HZ3  . LYS A 1 50  ? 13.949  -2.603  -2.081  1.00 0.00 ? 1182 LYS A HZ3  1  
ATOM 742   N N    . ILE A 1 51  ? 10.036  -4.334  0.797   1.00 0.00 ? 1183 ILE A N    1  
ATOM 743   C CA   . ILE A 1 51  ? 8.904   -4.045  -0.074  1.00 0.00 ? 1183 ILE A CA   1  
ATOM 744   C C    . ILE A 1 51  ? 8.308   -2.676  0.235   1.00 0.00 ? 1183 ILE A C    1  
ATOM 745   O O    . ILE A 1 51  ? 8.125   -1.849  -0.660  1.00 0.00 ? 1183 ILE A O    1  
ATOM 746   C CB   . ILE A 1 51  ? 7.803   -5.113  0.060   1.00 0.00 ? 1183 ILE A CB   1  
ATOM 747   C CG1  . ILE A 1 51  ? 8.318   -6.470  -0.425  1.00 0.00 ? 1183 ILE A CG1  1  
ATOM 748   C CG2  . ILE A 1 51  ? 6.566   -4.700  -0.723  1.00 0.00 ? 1183 ILE A CG2  1  
ATOM 749   C CD1  . ILE A 1 51  ? 7.368   -7.613  -0.140  1.00 0.00 ? 1183 ILE A CD1  1  
ATOM 750   H H    . ILE A 1 51  ? 9.950   -5.036  1.476   1.00 0.00 ? 1183 ILE A H    1  
ATOM 751   H HA   . ILE A 1 51  ? 9.260   -4.049  -1.095  1.00 0.00 ? 1183 ILE A HA   1  
ATOM 752   H HB   . ILE A 1 51  ? 7.532   -5.190  1.101   1.00 0.00 ? 1183 ILE A HB   1  
ATOM 753   H HG12 . ILE A 1 51  ? 8.476   -6.429  -1.491  1.00 0.00 ? 1183 ILE A HG12 1  
ATOM 754   H HG13 . ILE A 1 51  ? 9.256   -6.687  0.066   1.00 0.00 ? 1183 ILE A HG13 1  
ATOM 755   H HG21 . ILE A 1 51  ? 6.303   -3.683  -0.470  1.00 0.00 ? 1183 ILE A HG21 1  
ATOM 756   H HG22 . ILE A 1 51  ? 6.771   -4.765  -1.781  1.00 0.00 ? 1183 ILE A HG22 1  
ATOM 757   H HG23 . ILE A 1 51  ? 5.746   -5.356  -0.473  1.00 0.00 ? 1183 ILE A HG23 1  
ATOM 758   H HD11 . ILE A 1 51  ? 7.931   -8.481  0.170   1.00 0.00 ? 1183 ILE A HD11 1  
ATOM 759   H HD12 . ILE A 1 51  ? 6.684   -7.327  0.644   1.00 0.00 ? 1183 ILE A HD12 1  
ATOM 760   H HD13 . ILE A 1 51  ? 6.810   -7.849  -1.035  1.00 0.00 ? 1183 ILE A HD13 1  
ATOM 761   N N    . LEU A 1 52  ? 8.010   -2.440  1.508   1.00 0.00 ? 1184 LEU A N    1  
ATOM 762   C CA   . LEU A 1 52  ? 7.436   -1.170  1.938   1.00 0.00 ? 1184 LEU A CA   1  
ATOM 763   C C    . LEU A 1 52  ? 8.280   0.002   1.446   1.00 0.00 ? 1184 LEU A C    1  
ATOM 764   O O    . LEU A 1 52  ? 7.758   0.962   0.880   1.00 0.00 ? 1184 LEU A O    1  
ATOM 765   C CB   . LEU A 1 52  ? 7.323   -1.128  3.462   1.00 0.00 ? 1184 LEU A CB   1  
ATOM 766   C CG   . LEU A 1 52  ? 6.383   -2.155  4.094   1.00 0.00 ? 1184 LEU A CG   1  
ATOM 767   C CD1  . LEU A 1 52  ? 6.575   -2.198  5.602   1.00 0.00 ? 1184 LEU A CD1  1  
ATOM 768   C CD2  . LEU A 1 52  ? 4.936   -1.837  3.748   1.00 0.00 ? 1184 LEU A CD2  1  
ATOM 769   H H    . LEU A 1 52  ? 8.179   -3.137  2.176   1.00 0.00 ? 1184 LEU A H    1  
ATOM 770   H HA   . LEU A 1 52  ? 6.448   -1.091  1.509   1.00 0.00 ? 1184 LEU A HA   1  
ATOM 771   H HB2  . LEU A 1 52  ? 8.309   -1.287  3.871   1.00 0.00 ? 1184 LEU A HB2  1  
ATOM 772   H HB3  . LEU A 1 52  ? 6.975   -0.143  3.740   1.00 0.00 ? 1184 LEU A HB3  1  
ATOM 773   H HG   . LEU A 1 52  ? 6.614   -3.135  3.701   1.00 0.00 ? 1184 LEU A HG   1  
ATOM 774   H HD11 . LEU A 1 52  ? 5.980   -1.424  6.063   1.00 0.00 ? 1184 LEU A HD11 1  
ATOM 775   H HD12 . LEU A 1 52  ? 7.617   -2.039  5.837   1.00 0.00 ? 1184 LEU A HD12 1  
ATOM 776   H HD13 . LEU A 1 52  ? 6.265   -3.163  5.977   1.00 0.00 ? 1184 LEU A HD13 1  
ATOM 777   H HD21 . LEU A 1 52  ? 4.564   -1.078  4.421   1.00 0.00 ? 1184 LEU A HD21 1  
ATOM 778   H HD22 . LEU A 1 52  ? 4.337   -2.730  3.848   1.00 0.00 ? 1184 LEU A HD22 1  
ATOM 779   H HD23 . LEU A 1 52  ? 4.879   -1.476  2.732   1.00 0.00 ? 1184 LEU A HD23 1  
ATOM 780   N N    . VAL A 1 53  ? 9.588   -0.084  1.666   1.00 0.00 ? 1185 VAL A N    1  
ATOM 781   C CA   . VAL A 1 53  ? 10.506  0.967   1.243   1.00 0.00 ? 1185 VAL A CA   1  
ATOM 782   C C    . VAL A 1 53  ? 10.324  1.293   -0.235  1.00 0.00 ? 1185 VAL A C    1  
ATOM 783   O O    . VAL A 1 53  ? 10.126  2.450   -0.606  1.00 0.00 ? 1185 VAL A O    1  
ATOM 784   C CB   . VAL A 1 53  ? 11.972  0.567   1.492   1.00 0.00 ? 1185 VAL A CB   1  
ATOM 785   C CG1  . VAL A 1 53  ? 12.915  1.644   0.979   1.00 0.00 ? 1185 VAL A CG1  1  
ATOM 786   C CG2  . VAL A 1 53  ? 12.207  0.302   2.972   1.00 0.00 ? 1185 VAL A CG2  1  
ATOM 787   H H    . VAL A 1 53  ? 9.945   -0.874  2.123   1.00 0.00 ? 1185 VAL A H    1  
ATOM 788   H HA   . VAL A 1 53  ? 10.292  1.851   1.826   1.00 0.00 ? 1185 VAL A HA   1  
ATOM 789   H HB   . VAL A 1 53  ? 12.172  -0.345  0.949   1.00 0.00 ? 1185 VAL A HB   1  
ATOM 790   H HG11 . VAL A 1 53  ? 12.643  2.596   1.412   1.00 0.00 ? 1185 VAL A HG11 1  
ATOM 791   H HG12 . VAL A 1 53  ? 13.929  1.397   1.256   1.00 0.00 ? 1185 VAL A HG12 1  
ATOM 792   H HG13 . VAL A 1 53  ? 12.839  1.705   -0.097  1.00 0.00 ? 1185 VAL A HG13 1  
ATOM 793   H HG21 . VAL A 1 53  ? 13.021  0.919   3.322   1.00 0.00 ? 1185 VAL A HG21 1  
ATOM 794   H HG22 . VAL A 1 53  ? 11.311  0.538   3.527   1.00 0.00 ? 1185 VAL A HG22 1  
ATOM 795   H HG23 . VAL A 1 53  ? 12.455  -0.739  3.117   1.00 0.00 ? 1185 VAL A HG23 1  
ATOM 796   N N    . ASP A 1 54  ? 10.392  0.266   -1.075  1.00 0.00 ? 1186 ASP A N    1  
ATOM 797   C CA   . ASP A 1 54  ? 10.233  0.442   -2.513  1.00 0.00 ? 1186 ASP A CA   1  
ATOM 798   C C    . ASP A 1 54  ? 8.912   1.136   -2.833  1.00 0.00 ? 1186 ASP A C    1  
ATOM 799   O O    . ASP A 1 54  ? 8.879   2.116   -3.577  1.00 0.00 ? 1186 ASP A O    1  
ATOM 800   C CB   . ASP A 1 54  ? 10.299  -0.910  -3.225  1.00 0.00 ? 1186 ASP A CB   1  
ATOM 801   C CG   . ASP A 1 54  ? 11.701  -1.487  -3.244  1.00 0.00 ? 1186 ASP A CG   1  
ATOM 802   O OD1  . ASP A 1 54  ? 12.231  -1.792  -2.155  1.00 0.00 ? 1186 ASP A OD1  1  
ATOM 803   O OD2  . ASP A 1 54  ? 12.268  -1.632  -4.347  1.00 0.00 ? 1186 ASP A OD2  1  
ATOM 804   H H    . ASP A 1 54  ? 10.552  -0.633  -0.718  1.00 0.00 ? 1186 ASP A H    1  
ATOM 805   H HA   . ASP A 1 54  ? 11.044  1.062   -2.863  1.00 0.00 ? 1186 ASP A HA   1  
ATOM 806   H HB2  . ASP A 1 54  ? 9.649   -1.609  -2.718  1.00 0.00 ? 1186 ASP A HB2  1  
ATOM 807   H HB3  . ASP A 1 54  ? 9.964   -0.789  -4.245  1.00 0.00 ? 1186 ASP A HB3  1  
ATOM 808   N N    . MET A 1 55  ? 7.826   0.619   -2.268  1.00 0.00 ? 1187 MET A N    1  
ATOM 809   C CA   . MET A 1 55  ? 6.503   1.189   -2.493  1.00 0.00 ? 1187 MET A CA   1  
ATOM 810   C C    . MET A 1 55  ? 6.473   2.664   -2.105  1.00 0.00 ? 1187 MET A C    1  
ATOM 811   O O    . MET A 1 55  ? 5.807   3.472   -2.751  1.00 0.00 ? 1187 MET A O    1  
ATOM 812   C CB   . MET A 1 55  ? 5.450   0.418   -1.695  1.00 0.00 ? 1187 MET A CB   1  
ATOM 813   C CG   . MET A 1 55  ? 5.126   -0.948  -2.278  1.00 0.00 ? 1187 MET A CG   1  
ATOM 814   S SD   . MET A 1 55  ? 3.720   -1.734  -1.467  1.00 0.00 ? 1187 MET A SD   1  
ATOM 815   C CE   . MET A 1 55  ? 2.358   -0.836  -2.206  1.00 0.00 ? 1187 MET A CE   1  
ATOM 816   H H    . MET A 1 55  ? 7.916   -0.164  -1.685  1.00 0.00 ? 1187 MET A H    1  
ATOM 817   H HA   . MET A 1 55  ? 6.280   1.101   -3.546  1.00 0.00 ? 1187 MET A HA   1  
ATOM 818   H HB2  . MET A 1 55  ? 5.809   0.279   -0.687  1.00 0.00 ? 1187 MET A HB2  1  
ATOM 819   H HB3  . MET A 1 55  ? 4.539   0.998   -1.668  1.00 0.00 ? 1187 MET A HB3  1  
ATOM 820   H HG2  . MET A 1 55  ? 4.899   -0.833  -3.327  1.00 0.00 ? 1187 MET A HG2  1  
ATOM 821   H HG3  . MET A 1 55  ? 5.991   -1.585  -2.167  1.00 0.00 ? 1187 MET A HG3  1  
ATOM 822   H HE1  . MET A 1 55  ? 1.801   -1.496  -2.855  1.00 0.00 ? 1187 MET A HE1  1  
ATOM 823   H HE2  . MET A 1 55  ? 1.708   -0.464  -1.428  1.00 0.00 ? 1187 MET A HE2  1  
ATOM 824   H HE3  . MET A 1 55  ? 2.743   -0.006  -2.781  1.00 0.00 ? 1187 MET A HE3  1  
ATOM 825   N N    . ALA A 1 56  ? 7.199   3.007   -1.046  1.00 0.00 ? 1188 ALA A N    1  
ATOM 826   C CA   . ALA A 1 56  ? 7.256   4.385   -0.573  1.00 0.00 ? 1188 ALA A CA   1  
ATOM 827   C C    . ALA A 1 56  ? 8.104   5.249   -1.501  1.00 0.00 ? 1188 ALA A C    1  
ATOM 828   O O    . ALA A 1 56  ? 8.006   6.476   -1.485  1.00 0.00 ? 1188 ALA A O    1  
ATOM 829   C CB   . ALA A 1 56  ? 7.805   4.434   0.845   1.00 0.00 ? 1188 ALA A CB   1  
ATOM 830   H H    . ALA A 1 56  ? 7.708   2.318   -0.572  1.00 0.00 ? 1188 ALA A H    1  
ATOM 831   H HA   . ALA A 1 56  ? 6.248   4.774   -0.556  1.00 0.00 ? 1188 ALA A HA   1  
ATOM 832   H HB1  . ALA A 1 56  ? 7.079   4.014   1.526   1.00 0.00 ? 1188 ALA A HB1  1  
ATOM 833   H HB2  . ALA A 1 56  ? 8.720   3.862   0.897   1.00 0.00 ? 1188 ALA A HB2  1  
ATOM 834   H HB3  . ALA A 1 56  ? 8.005   5.459   1.118   1.00 0.00 ? 1188 ALA A HB3  1  
ATOM 835   N N    . LYS A 1 57  ? 8.936   4.600   -2.308  1.00 0.00 ? 1189 LYS A N    1  
ATOM 836   C CA   . LYS A 1 57  ? 9.802   5.308   -3.244  1.00 0.00 ? 1189 LYS A CA   1  
ATOM 837   C C    . LYS A 1 57  ? 9.106   5.503   -4.588  1.00 0.00 ? 1189 LYS A C    1  
ATOM 838   O O    . LYS A 1 57  ? 8.993   6.624   -5.082  1.00 0.00 ? 1189 LYS A O    1  
ATOM 839   C CB   . LYS A 1 57  ? 11.110  4.540   -3.442  1.00 0.00 ? 1189 LYS A CB   1  
ATOM 840   C CG   . LYS A 1 57  ? 12.130  4.783   -2.342  1.00 0.00 ? 1189 LYS A CG   1  
ATOM 841   C CD   . LYS A 1 57  ? 13.024  3.572   -2.135  1.00 0.00 ? 1189 LYS A CD   1  
ATOM 842   C CE   . LYS A 1 57  ? 14.239  3.614   -3.049  1.00 0.00 ? 1189 LYS A CE   1  
ATOM 843   N NZ   . LYS A 1 57  ? 15.338  4.439   -2.474  1.00 0.00 ? 1189 LYS A NZ   1  
ATOM 844   H H    . LYS A 1 57  ? 8.969   3.621   -2.275  1.00 0.00 ? 1189 LYS A H    1  
ATOM 845   H HA   . LYS A 1 57  ? 10.023  6.277   -2.823  1.00 0.00 ? 1189 LYS A HA   1  
ATOM 846   H HB2  . LYS A 1 57  ? 10.892  3.483   -3.475  1.00 0.00 ? 1189 LYS A HB2  1  
ATOM 847   H HB3  . LYS A 1 57  ? 11.550  4.838   -4.383  1.00 0.00 ? 1189 LYS A HB3  1  
ATOM 848   H HG2  . LYS A 1 57  ? 12.744  5.628   -2.614  1.00 0.00 ? 1189 LYS A HG2  1  
ATOM 849   H HG3  . LYS A 1 57  ? 11.608  4.996   -1.420  1.00 0.00 ? 1189 LYS A HG3  1  
ATOM 850   H HD2  . LYS A 1 57  ? 13.361  3.556   -1.109  1.00 0.00 ? 1189 LYS A HD2  1  
ATOM 851   H HD3  . LYS A 1 57  ? 12.457  2.676   -2.344  1.00 0.00 ? 1189 LYS A HD3  1  
ATOM 852   H HE2  . LYS A 1 57  ? 14.597  2.606   -3.196  1.00 0.00 ? 1189 LYS A HE2  1  
ATOM 853   H HE3  . LYS A 1 57  ? 13.944  4.033   -3.999  1.00 0.00 ? 1189 LYS A HE3  1  
ATOM 854   H HZ1  . LYS A 1 57  ? 16.150  4.453   -3.123  1.00 0.00 ? 1189 LYS A HZ1  1  
ATOM 855   H HZ2  . LYS A 1 57  ? 15.644  4.042   -1.563  1.00 0.00 ? 1189 LYS A HZ2  1  
ATOM 856   H HZ3  . LYS A 1 57  ? 15.011  5.414   -2.323  1.00 0.00 ? 1189 LYS A HZ3  1  
ATOM 857   N N    . MET A 1 58  ? 8.641   4.404   -5.173  1.00 0.00 ? 1190 MET A N    1  
ATOM 858   C CA   . MET A 1 58  ? 7.954   4.455   -6.458  1.00 0.00 ? 1190 MET A CA   1  
ATOM 859   C C    . MET A 1 58  ? 6.539   5.002   -6.297  1.00 0.00 ? 1190 MET A C    1  
ATOM 860   O O    . MET A 1 58  ? 5.982   5.590   -7.224  1.00 0.00 ? 1190 MET A O    1  
ATOM 861   C CB   . MET A 1 58  ? 7.906   3.063   -7.091  1.00 0.00 ? 1190 MET A CB   1  
ATOM 862   C CG   . MET A 1 58  ? 9.279   2.488   -7.398  1.00 0.00 ? 1190 MET A CG   1  
ATOM 863   S SD   . MET A 1 58  ? 9.195   0.849   -8.145  1.00 0.00 ? 1190 MET A SD   1  
ATOM 864   C CE   . MET A 1 58  ? 10.410  -0.032  -7.167  1.00 0.00 ? 1190 MET A CE   1  
ATOM 865   H H    . MET A 1 58  ? 8.761   3.538   -4.730  1.00 0.00 ? 1190 MET A H    1  
ATOM 866   H HA   . MET A 1 58  ? 8.511   5.116   -7.105  1.00 0.00 ? 1190 MET A HA   1  
ATOM 867   H HB2  . MET A 1 58  ? 7.401   2.390   -6.415  1.00 0.00 ? 1190 MET A HB2  1  
ATOM 868   H HB3  . MET A 1 58  ? 7.349   3.119   -8.014  1.00 0.00 ? 1190 MET A HB3  1  
ATOM 869   H HG2  . MET A 1 58  ? 9.789   3.152   -8.080  1.00 0.00 ? 1190 MET A HG2  1  
ATOM 870   H HG3  . MET A 1 58  ? 9.840   2.421   -6.478  1.00 0.00 ? 1190 MET A HG3  1  
ATOM 871   H HE1  . MET A 1 58  ? 9.907   -0.621  -6.414  1.00 0.00 ? 1190 MET A HE1  1  
ATOM 872   H HE2  . MET A 1 58  ? 10.985  -0.682  -7.809  1.00 0.00 ? 1190 MET A HE2  1  
ATOM 873   H HE3  . MET A 1 58  ? 11.069  0.678   -6.689  1.00 0.00 ? 1190 MET A HE3  1  
ATOM 874   N N    . ARG A 1 59  ? 5.964   4.803   -5.115  1.00 0.00 ? 1191 ARG A N    1  
ATOM 875   C CA   . ARG A 1 59  ? 4.613   5.275   -4.834  1.00 0.00 ? 1191 ARG A CA   1  
ATOM 876   C C    . ARG A 1 59  ? 3.625   4.745   -5.869  1.00 0.00 ? 1191 ARG A C    1  
ATOM 877   O O    . ARG A 1 59  ? 2.899   5.501   -6.515  1.00 0.00 ? 1191 ARG A O    1  
ATOM 878   C CB   . ARG A 1 59  ? 4.578   6.804   -4.816  1.00 0.00 ? 1191 ARG A CB   1  
ATOM 879   C CG   . ARG A 1 59  ? 4.844   7.404   -3.445  1.00 0.00 ? 1191 ARG A CG   1  
ATOM 880   C CD   . ARG A 1 59  ? 5.484   8.779   -3.553  1.00 0.00 ? 1191 ARG A CD   1  
ATOM 881   N NE   . ARG A 1 59  ? 6.747   8.740   -4.286  1.00 0.00 ? 1191 ARG A NE   1  
ATOM 882   C CZ   . ARG A 1 59  ? 7.598   9.758   -4.339  1.00 0.00 ? 1191 ARG A CZ   1  
ATOM 883   N NH1  . ARG A 1 59  ? 7.324   10.889  -3.704  1.00 0.00 ? 1191 ARG A NH1  1  
ATOM 884   N NH2  . ARG A 1 59  ? 8.727   9.646   -5.027  1.00 0.00 ? 1191 ARG A NH2  1  
ATOM 885   H H    . ARG A 1 59  ? 6.459   4.327   -4.416  1.00 0.00 ? 1191 ARG A H    1  
ATOM 886   H HA   . ARG A 1 59  ? 4.329   4.906   -3.860  1.00 0.00 ? 1191 ARG A HA   1  
ATOM 887   H HB2  . ARG A 1 59  ? 5.326   7.178   -5.500  1.00 0.00 ? 1191 ARG A HB2  1  
ATOM 888   H HB3  . ARG A 1 59  ? 3.604   7.134   -5.146  1.00 0.00 ? 1191 ARG A HB3  1  
ATOM 889   H HG2  . ARG A 1 59  ? 3.909   7.495   -2.914  1.00 0.00 ? 1191 ARG A HG2  1  
ATOM 890   H HG3  . ARG A 1 59  ? 5.508   6.749   -2.900  1.00 0.00 ? 1191 ARG A HG3  1  
ATOM 891   H HD2  . ARG A 1 59  ? 4.801   9.440   -4.067  1.00 0.00 ? 1191 ARG A HD2  1  
ATOM 892   H HD3  . ARG A 1 59  ? 5.668   9.155   -2.558  1.00 0.00 ? 1191 ARG A HD3  1  
ATOM 893   H HE   . ARG A 1 59  ? 6.969   7.913   -4.763  1.00 0.00 ? 1191 ARG A HE   1  
ATOM 894   H HH11 . ARG A 1 59  ? 6.474   10.976  -3.184  1.00 0.00 ? 1191 ARG A HH11 1  
ATOM 895   H HH12 . ARG A 1 59  ? 7.967   11.654  -3.744  1.00 0.00 ? 1191 ARG A HH12 1  
ATOM 896   H HH21 . ARG A 1 59  ? 8.937   8.794   -5.506  1.00 0.00 ? 1191 ARG A HH21 1  
ATOM 897   H HH22 . ARG A 1 59  ? 9.367   10.412  -5.065  1.00 0.00 ? 1191 ARG A HH22 1  
ATOM 898   N N    . PRO A 1 60  ? 3.597   3.414   -6.033  1.00 0.00 ? 1192 PRO A N    1  
ATOM 899   C CA   . PRO A 1 60  ? 2.703   2.753   -6.989  1.00 0.00 ? 1192 PRO A CA   1  
ATOM 900   C C    . PRO A 1 60  ? 1.241   2.830   -6.563  1.00 0.00 ? 1192 PRO A C    1  
ATOM 901   O O    . PRO A 1 60  ? 0.883   2.428   -5.456  1.00 0.00 ? 1192 PRO A O    1  
ATOM 902   C CB   . PRO A 1 60  ? 3.186   1.300   -6.980  1.00 0.00 ? 1192 PRO A CB   1  
ATOM 903   C CG   . PRO A 1 60  ? 3.826   1.122   -5.647  1.00 0.00 ? 1192 PRO A CG   1  
ATOM 904   C CD   . PRO A 1 60  ? 4.435   2.452   -5.298  1.00 0.00 ? 1192 PRO A CD   1  
ATOM 905   H HA   . PRO A 1 60  ? 2.810   3.164   -7.982  1.00 0.00 ? 1192 PRO A HA   1  
ATOM 906   H HB2  . PRO A 1 60  ? 2.342   0.637   -7.107  1.00 0.00 ? 1192 PRO A HB2  1  
ATOM 907   H HB3  . PRO A 1 60  ? 3.894   1.148   -7.781  1.00 0.00 ? 1192 PRO A HB3  1  
ATOM 908   H HG2  . PRO A 1 60  ? 3.081   0.847   -4.916  1.00 0.00 ? 1192 PRO A HG2  1  
ATOM 909   H HG3  . PRO A 1 60  ? 4.592   0.363   -5.706  1.00 0.00 ? 1192 PRO A HG3  1  
ATOM 910   H HD2  . PRO A 1 60  ? 4.378   2.626   -4.234  1.00 0.00 ? 1192 PRO A HD2  1  
ATOM 911   H HD3  . PRO A 1 60  ? 5.460   2.498   -5.636  1.00 0.00 ? 1192 PRO A HD3  1  
ATOM 912   N N    . THR A 1 61  ? 0.398   3.349   -7.451  1.00 0.00 ? 1193 THR A N    1  
ATOM 913   C CA   . THR A 1 61  ? -1.026  3.479   -7.167  1.00 0.00 ? 1193 THR A CA   1  
ATOM 914   C C    . THR A 1 61  ? -1.814  2.317   -7.760  1.00 0.00 ? 1193 THR A C    1  
ATOM 915   O O    . THR A 1 61  ? -2.901  1.984   -7.288  1.00 0.00 ? 1193 THR A O    1  
ATOM 916   C CB   . THR A 1 61  ? -1.590  4.802   -7.719  1.00 0.00 ? 1193 THR A CB   1  
ATOM 917   O OG1  . THR A 1 61  ? -1.552  4.791   -9.151  1.00 0.00 ? 1193 THR A OG1  1  
ATOM 918   C CG2  . THR A 1 61  ? -0.797  5.989   -7.195  1.00 0.00 ? 1193 THR A CG2  1  
ATOM 919   H H    . THR A 1 61  ? 0.743   3.651   -8.316  1.00 0.00 ? 1193 THR A H    1  
ATOM 920   H HA   . THR A 1 61  ? -1.154  3.478   -6.094  1.00 0.00 ? 1193 THR A HA   1  
ATOM 921   H HB   . THR A 1 61  ? -2.616  4.902   -7.395  1.00 0.00 ? 1193 THR A HB   1  
ATOM 922   H HG1  . THR A 1 61  ? -2.075  5.521   -9.490  1.00 0.00 ? 1193 THR A HG1  1  
ATOM 923   H HG21 . THR A 1 61  ? -1.478  6.751   -6.845  1.00 0.00 ? 1193 THR A HG21 1  
ATOM 924   H HG22 . THR A 1 61  ? -0.184  6.391   -7.988  1.00 0.00 ? 1193 THR A HG22 1  
ATOM 925   H HG23 . THR A 1 61  ? -0.167  5.669   -6.379  1.00 0.00 ? 1193 THR A HG23 1  
ATOM 926   N N    . THR A 1 62  ? -1.258  1.700   -8.799  1.00 0.00 ? 1194 THR A N    1  
ATOM 927   C CA   . THR A 1 62  ? -1.909  0.575   -9.457  1.00 0.00 ? 1194 THR A CA   1  
ATOM 928   C C    . THR A 1 62  ? -1.199  -0.735  -9.137  1.00 0.00 ? 1194 THR A C    1  
ATOM 929   O O    . THR A 1 62  ? 0.031   -0.797  -9.116  1.00 0.00 ? 1194 THR A O    1  
ATOM 930   C CB   . THR A 1 62  ? -1.949  0.764   -10.986 1.00 0.00 ? 1194 THR A CB   1  
ATOM 931   O OG1  . THR A 1 62  ? -0.619  0.910   -11.496 1.00 0.00 ? 1194 THR A OG1  1  
ATOM 932   C CG2  . THR A 1 62  ? -2.777  1.985   -11.358 1.00 0.00 ? 1194 THR A CG2  1  
ATOM 933   H H    . THR A 1 62  ? -0.390  2.012   -9.130  1.00 0.00 ? 1194 THR A H    1  
ATOM 934   H HA   . THR A 1 62  ? -2.926  0.520   -9.096  1.00 0.00 ? 1194 THR A HA   1  
ATOM 935   H HB   . THR A 1 62  ? -2.403  -0.110  -11.430 1.00 0.00 ? 1194 THR A HB   1  
ATOM 936   H HG1  . THR A 1 62  ? -0.168  1.610   -11.018 1.00 0.00 ? 1194 THR A HG1  1  
ATOM 937   H HG21 . THR A 1 62  ? -3.550  2.135   -10.619 1.00 0.00 ? 1194 THR A HG21 1  
ATOM 938   H HG22 . THR A 1 62  ? -3.230  1.830   -12.326 1.00 0.00 ? 1194 THR A HG22 1  
ATOM 939   H HG23 . THR A 1 62  ? -2.139  2.855   -11.394 1.00 0.00 ? 1194 THR A HG23 1  
ATOM 940   N N    . VAL A 1 63  ? -1.980  -1.781  -8.889  1.00 0.00 ? 1195 VAL A N    1  
ATOM 941   C CA   . VAL A 1 63  ? -1.425  -3.092  -8.572  1.00 0.00 ? 1195 VAL A CA   1  
ATOM 942   C C    . VAL A 1 63  ? -0.419  -3.533  -9.629  1.00 0.00 ? 1195 VAL A C    1  
ATOM 943   O O    . VAL A 1 63  ? 0.514   -4.281  -9.337  1.00 0.00 ? 1195 VAL A O    1  
ATOM 944   C CB   . VAL A 1 63  ? -2.531  -4.157  -8.456  1.00 0.00 ? 1195 VAL A CB   1  
ATOM 945   C CG1  . VAL A 1 63  ? -3.213  -4.367  -9.799  1.00 0.00 ? 1195 VAL A CG1  1  
ATOM 946   C CG2  . VAL A 1 63  ? -1.959  -5.464  -7.929  1.00 0.00 ? 1195 VAL A CG2  1  
ATOM 947   H H    . VAL A 1 63  ? -2.953  -1.670  -8.921  1.00 0.00 ? 1195 VAL A H    1  
ATOM 948   H HA   . VAL A 1 63  ? -0.922  -3.020  -7.618  1.00 0.00 ? 1195 VAL A HA   1  
ATOM 949   H HB   . VAL A 1 63  ? -3.271  -3.803  -7.753  1.00 0.00 ? 1195 VAL A HB   1  
ATOM 950   H HG11 . VAL A 1 63  ? -3.956  -3.598  -9.950  1.00 0.00 ? 1195 VAL A HG11 1  
ATOM 951   H HG12 . VAL A 1 63  ? -2.477  -4.318  -10.588 1.00 0.00 ? 1195 VAL A HG12 1  
ATOM 952   H HG13 . VAL A 1 63  ? -3.692  -5.335  -9.812  1.00 0.00 ? 1195 VAL A HG13 1  
ATOM 953   H HG21 . VAL A 1 63  ? -2.099  -6.241  -8.666  1.00 0.00 ? 1195 VAL A HG21 1  
ATOM 954   H HG22 . VAL A 1 63  ? -0.904  -5.342  -7.731  1.00 0.00 ? 1195 VAL A HG22 1  
ATOM 955   H HG23 . VAL A 1 63  ? -2.466  -5.738  -7.016  1.00 0.00 ? 1195 VAL A HG23 1  
ATOM 956   N N    . GLU A 1 64  ? -0.615  -3.064  -10.857 1.00 0.00 ? 1196 GLU A N    1  
ATOM 957   C CA   . GLU A 1 64  ? 0.276   -3.411  -11.958 1.00 0.00 ? 1196 GLU A CA   1  
ATOM 958   C C    . GLU A 1 64  ? 1.711   -2.995  -11.648 1.00 0.00 ? 1196 GLU A C    1  
ATOM 959   O O    . GLU A 1 64  ? 2.642   -3.788  -11.782 1.00 0.00 ? 1196 GLU A O    1  
ATOM 960   C CB   . GLU A 1 64  ? -0.192  -2.744  -13.252 1.00 0.00 ? 1196 GLU A CB   1  
ATOM 961   C CG   . GLU A 1 64  ? -1.560  -3.213  -13.719 1.00 0.00 ? 1196 GLU A CG   1  
ATOM 962   C CD   . GLU A 1 64  ? -1.631  -4.717  -13.898 1.00 0.00 ? 1196 GLU A CD   1  
ATOM 963   O OE1  . GLU A 1 64  ? -0.786  -5.267  -14.635 1.00 0.00 ? 1196 GLU A OE1  1  
ATOM 964   O OE2  . GLU A 1 64  ? -2.531  -5.344  -13.301 1.00 0.00 ? 1196 GLU A OE2  1  
ATOM 965   H H    . GLU A 1 64  ? -1.377  -2.472  -11.027 1.00 0.00 ? 1196 GLU A H    1  
ATOM 966   H HA   . GLU A 1 64  ? 0.245   -4.483  -12.085 1.00 0.00 ? 1196 GLU A HA   1  
ATOM 967   H HB2  . GLU A 1 64  ? -0.234  -1.675  -13.098 1.00 0.00 ? 1196 GLU A HB2  1  
ATOM 968   H HB3  . GLU A 1 64  ? 0.524   -2.958  -14.032 1.00 0.00 ? 1196 GLU A HB3  1  
ATOM 969   H HG2  . GLU A 1 64  ? -2.297  -2.918  -12.987 1.00 0.00 ? 1196 GLU A HG2  1  
ATOM 970   H HG3  . GLU A 1 64  ? -1.785  -2.742  -14.664 1.00 0.00 ? 1196 GLU A HG3  1  
ATOM 971   N N    . ASN A 1 65  ? 1.882   -1.743  -11.233 1.00 0.00 ? 1197 ASN A N    1  
ATOM 972   C CA   . ASN A 1 65  ? 3.203   -1.220  -10.905 1.00 0.00 ? 1197 ASN A CA   1  
ATOM 973   C C    . ASN A 1 65  ? 3.766   -1.905  -9.664  1.00 0.00 ? 1197 ASN A C    1  
ATOM 974   O O    . ASN A 1 65  ? 4.968   -2.157  -9.572  1.00 0.00 ? 1197 ASN A O    1  
ATOM 975   C CB   . ASN A 1 65  ? 3.134   0.292   -10.681 1.00 0.00 ? 1197 ASN A CB   1  
ATOM 976   C CG   . ASN A 1 65  ? 3.069   1.067   -11.982 1.00 0.00 ? 1197 ASN A CG   1  
ATOM 977   O OD1  . ASN A 1 65  ? 3.784   0.762   -12.936 1.00 0.00 ? 1197 ASN A OD1  1  
ATOM 978   N ND2  . ASN A 1 65  ? 2.208   2.078   -12.026 1.00 0.00 ? 1197 ASN A ND2  1  
ATOM 979   H H    . ASN A 1 65  ? 1.101   -1.158  -11.146 1.00 0.00 ? 1197 ASN A H    1  
ATOM 980   H HA   . ASN A 1 65  ? 3.856   -1.421  -11.741 1.00 0.00 ? 1197 ASN A HA   1  
ATOM 981   H HB2  . ASN A 1 65  ? 2.252   0.524   -10.101 1.00 0.00 ? 1197 ASN A HB2  1  
ATOM 982   H HB3  . ASN A 1 65  ? 4.011   0.610   -10.137 1.00 0.00 ? 1197 ASN A HB3  1  
ATOM 983   H HD21 . ASN A 1 65  ? 1.671   2.264   -11.228 1.00 0.00 ? 1197 ASN A HD21 1  
ATOM 984   H HD22 . ASN A 1 65  ? 2.145   2.596   -12.856 1.00 0.00 ? 1197 ASN A HD22 1  
ATOM 985   N N    . VAL A 1 66  ? 2.890   -2.204  -8.710  1.00 0.00 ? 1198 VAL A N    1  
ATOM 986   C CA   . VAL A 1 66  ? 3.299   -2.861  -7.475  1.00 0.00 ? 1198 VAL A CA   1  
ATOM 987   C C    . VAL A 1 66  ? 3.988   -4.191  -7.762  1.00 0.00 ? 1198 VAL A C    1  
ATOM 988   O O    . VAL A 1 66  ? 5.049   -4.485  -7.210  1.00 0.00 ? 1198 VAL A O    1  
ATOM 989   C CB   . VAL A 1 66  ? 2.096   -3.109  -6.546  1.00 0.00 ? 1198 VAL A CB   1  
ATOM 990   C CG1  . VAL A 1 66  ? 2.537   -3.831  -5.282  1.00 0.00 ? 1198 VAL A CG1  1  
ATOM 991   C CG2  . VAL A 1 66  ? 1.406   -1.796  -6.207  1.00 0.00 ? 1198 VAL A CG2  1  
ATOM 992   H H    . VAL A 1 66  ? 1.946   -1.978  -8.841  1.00 0.00 ? 1198 VAL A H    1  
ATOM 993   H HA   . VAL A 1 66  ? 3.994   -2.210  -6.964  1.00 0.00 ? 1198 VAL A HA   1  
ATOM 994   H HB   . VAL A 1 66  ? 1.389   -3.739  -7.066  1.00 0.00 ? 1198 VAL A HB   1  
ATOM 995   H HG11 . VAL A 1 66  ? 1.779   -4.543  -4.991  1.00 0.00 ? 1198 VAL A HG11 1  
ATOM 996   H HG12 . VAL A 1 66  ? 3.466   -4.348  -5.468  1.00 0.00 ? 1198 VAL A HG12 1  
ATOM 997   H HG13 . VAL A 1 66  ? 2.678   -3.112  -4.488  1.00 0.00 ? 1198 VAL A HG13 1  
ATOM 998   H HG21 . VAL A 1 66  ? 2.120   -1.119  -5.763  1.00 0.00 ? 1198 VAL A HG21 1  
ATOM 999   H HG22 . VAL A 1 66  ? 1.006   -1.356  -7.109  1.00 0.00 ? 1198 VAL A HG22 1  
ATOM 1000  H HG23 . VAL A 1 66  ? 0.602   -1.981  -5.510  1.00 0.00 ? 1198 VAL A HG23 1  
ATOM 1001  N N    . LYS A 1 67  ? 3.378   -4.991  -8.629  1.00 0.00 ? 1199 LYS A N    1  
ATOM 1002  C CA   . LYS A 1 67  ? 3.933   -6.290  -8.992  1.00 0.00 ? 1199 LYS A CA   1  
ATOM 1003  C C    . LYS A 1 67  ? 5.395   -6.161  -9.406  1.00 0.00 ? 1199 LYS A C    1  
ATOM 1004  O O    . LYS A 1 67  ? 6.212   -7.035  -9.114  1.00 0.00 ? 1199 LYS A O    1  
ATOM 1005  C CB   . LYS A 1 67  ? 3.122   -6.913  -10.131 1.00 0.00 ? 1199 LYS A CB   1  
ATOM 1006  C CG   . LYS A 1 67  ? 1.785   -7.481  -9.687  1.00 0.00 ? 1199 LYS A CG   1  
ATOM 1007  C CD   . LYS A 1 67  ? 0.751   -7.409  -10.798 1.00 0.00 ? 1199 LYS A CD   1  
ATOM 1008  C CE   . LYS A 1 67  ? -0.261  -8.539  -10.691 1.00 0.00 ? 1199 LYS A CE   1  
ATOM 1009  N NZ   . LYS A 1 67  ? -1.031  -8.476  -9.419  1.00 0.00 ? 1199 LYS A NZ   1  
ATOM 1010  H H    . LYS A 1 67  ? 2.535   -4.701  -9.036  1.00 0.00 ? 1199 LYS A H    1  
ATOM 1011  H HA   . LYS A 1 67  ? 3.871   -6.931  -8.126  1.00 0.00 ? 1199 LYS A HA   1  
ATOM 1012  H HB2  . LYS A 1 67  ? 2.937   -6.158  -10.881 1.00 0.00 ? 1199 LYS A HB2  1  
ATOM 1013  H HB3  . LYS A 1 67  ? 3.700   -7.712  -10.573 1.00 0.00 ? 1199 LYS A HB3  1  
ATOM 1014  H HG2  . LYS A 1 67  ? 1.920   -8.514  -9.402  1.00 0.00 ? 1199 LYS A HG2  1  
ATOM 1015  H HG3  . LYS A 1 67  ? 1.429   -6.916  -8.838  1.00 0.00 ? 1199 LYS A HG3  1  
ATOM 1016  H HD2  . LYS A 1 67  ? 0.229   -6.466  -10.731 1.00 0.00 ? 1199 LYS A HD2  1  
ATOM 1017  H HD3  . LYS A 1 67  ? 1.255   -7.477  -11.752 1.00 0.00 ? 1199 LYS A HD3  1  
ATOM 1018  H HE2  . LYS A 1 67  ? -0.947  -8.470  -11.521 1.00 0.00 ? 1199 LYS A HE2  1  
ATOM 1019  H HE3  . LYS A 1 67  ? 0.265   -9.481  -10.737 1.00 0.00 ? 1199 LYS A HE3  1  
ATOM 1020  H HZ1  . LYS A 1 67  ? -0.466  -8.008  -8.682  1.00 0.00 ? 1199 LYS A HZ1  1  
ATOM 1021  H HZ2  . LYS A 1 67  ? -1.272  -9.436  -9.098  1.00 0.00 ? 1199 LYS A HZ2  1  
ATOM 1022  H HZ3  . LYS A 1 67  ? -1.911  -7.939  -9.559  1.00 0.00 ? 1199 LYS A HZ3  1  
ATOM 1023  N N    . ARG A 1 68  ? 5.718   -5.067  -10.087 1.00 0.00 ? 1200 ARG A N    1  
ATOM 1024  C CA   . ARG A 1 68  ? 7.082   -4.824  -10.541 1.00 0.00 ? 1200 ARG A CA   1  
ATOM 1025  C C    . ARG A 1 68  ? 8.023   -4.628  -9.355  1.00 0.00 ? 1200 ARG A C    1  
ATOM 1026  O O    . ARG A 1 68  ? 9.230   -4.843  -9.466  1.00 0.00 ? 1200 ARG A O    1  
ATOM 1027  C CB   . ARG A 1 68  ? 7.129   -3.595  -11.451 1.00 0.00 ? 1200 ARG A CB   1  
ATOM 1028  C CG   . ARG A 1 68  ? 6.197   -3.689  -12.649 1.00 0.00 ? 1200 ARG A CG   1  
ATOM 1029  C CD   . ARG A 1 68  ? 6.441   -2.556  -13.633 1.00 0.00 ? 1200 ARG A CD   1  
ATOM 1030  N NE   . ARG A 1 68  ? 7.580   -2.824  -14.506 1.00 0.00 ? 1200 ARG A NE   1  
ATOM 1031  C CZ   . ARG A 1 68  ? 8.177   -1.893  -15.243 1.00 0.00 ? 1200 ARG A CZ   1  
ATOM 1032  N NH1  . ARG A 1 68  ? 7.744   -0.641  -15.212 1.00 0.00 ? 1200 ARG A NH1  1  
ATOM 1033  N NH2  . ARG A 1 68  ? 9.209   -2.215  -16.012 1.00 0.00 ? 1200 ARG A NH2  1  
ATOM 1034  H H    . ARG A 1 68  ? 5.022   -4.407  -10.291 1.00 0.00 ? 1200 ARG A H    1  
ATOM 1035  H HA   . ARG A 1 68  ? 7.404   -5.689  -11.102 1.00 0.00 ? 1200 ARG A HA   1  
ATOM 1036  H HB2  . ARG A 1 68  ? 6.852   -2.724  -10.875 1.00 0.00 ? 1200 ARG A HB2  1  
ATOM 1037  H HB3  . ARG A 1 68  ? 8.137   -3.471  -11.816 1.00 0.00 ? 1200 ARG A HB3  1  
ATOM 1038  H HG2  . ARG A 1 68  ? 6.366   -4.630  -13.151 1.00 0.00 ? 1200 ARG A HG2  1  
ATOM 1039  H HG3  . ARG A 1 68  ? 5.176   -3.641  -12.303 1.00 0.00 ? 1200 ARG A HG3  1  
ATOM 1040  H HD2  . ARG A 1 68  ? 5.557   -2.428  -14.240 1.00 0.00 ? 1200 ARG A HD2  1  
ATOM 1041  H HD3  . ARG A 1 68  ? 6.629   -1.649  -13.078 1.00 0.00 ? 1200 ARG A HD3  1  
ATOM 1042  H HE   . ARG A 1 68  ? 7.917   -3.743  -14.544 1.00 0.00 ? 1200 ARG A HE   1  
ATOM 1043  H HH11 . ARG A 1 68  ? 6.967   -0.395  -14.632 1.00 0.00 ? 1200 ARG A HH11 1  
ATOM 1044  H HH12 . ARG A 1 68  ? 8.196   0.058   -15.767 1.00 0.00 ? 1200 ARG A HH12 1  
ATOM 1045  H HH21 . ARG A 1 68  ? 9.538   -3.159  -16.038 1.00 0.00 ? 1200 ARG A HH21 1  
ATOM 1046  H HH22 . ARG A 1 68  ? 9.657   -1.515  -16.566 1.00 0.00 ? 1200 ARG A HH22 1  
ATOM 1047  N N    . ILE A 1 69  ? 7.461   -4.219  -8.223  1.00 0.00 ? 1201 ILE A N    1  
ATOM 1048  C CA   . ILE A 1 69  ? 8.249   -3.995  -7.017  1.00 0.00 ? 1201 ILE A CA   1  
ATOM 1049  C C    . ILE A 1 69  ? 9.100   -5.215  -6.682  1.00 0.00 ? 1201 ILE A C    1  
ATOM 1050  O O    . ILE A 1 69  ? 8.733   -6.347  -6.999  1.00 0.00 ? 1201 ILE A O    1  
ATOM 1051  C CB   . ILE A 1 69  ? 7.351   -3.663  -5.811  1.00 0.00 ? 1201 ILE A CB   1  
ATOM 1052  C CG1  . ILE A 1 69  ? 6.537   -2.397  -6.087  1.00 0.00 ? 1201 ILE A CG1  1  
ATOM 1053  C CG2  . ILE A 1 69  ? 8.192   -3.495  -4.555  1.00 0.00 ? 1201 ILE A CG2  1  
ATOM 1054  C CD1  . ILE A 1 69  ? 7.379   -1.143  -6.168  1.00 0.00 ? 1201 ILE A CD1  1  
ATOM 1055  H H    . ILE A 1 69  ? 6.494   -4.065  -8.197  1.00 0.00 ? 1201 ILE A H    1  
ATOM 1056  H HA   . ILE A 1 69  ? 8.902   -3.153  -7.198  1.00 0.00 ? 1201 ILE A HA   1  
ATOM 1057  H HB   . ILE A 1 69  ? 6.675   -4.490  -5.655  1.00 0.00 ? 1201 ILE A HB   1  
ATOM 1058  H HG12 . ILE A 1 69  ? 6.017   -2.508  -7.025  1.00 0.00 ? 1201 ILE A HG12 1  
ATOM 1059  H HG13 . ILE A 1 69  ? 5.816   -2.262  -5.294  1.00 0.00 ? 1201 ILE A HG13 1  
ATOM 1060  H HG21 . ILE A 1 69  ? 8.886   -2.679  -4.692  1.00 0.00 ? 1201 ILE A HG21 1  
ATOM 1061  H HG22 . ILE A 1 69  ? 7.547   -3.280  -3.716  1.00 0.00 ? 1201 ILE A HG22 1  
ATOM 1062  H HG23 . ILE A 1 69  ? 8.741   -4.405  -4.364  1.00 0.00 ? 1201 ILE A HG23 1  
ATOM 1063  H HD11 . ILE A 1 69  ? 7.923   -1.013  -5.244  1.00 0.00 ? 1201 ILE A HD11 1  
ATOM 1064  H HD12 . ILE A 1 69  ? 8.076   -1.229  -6.988  1.00 0.00 ? 1201 ILE A HD12 1  
ATOM 1065  H HD13 . ILE A 1 69  ? 6.738   -0.289  -6.330  1.00 0.00 ? 1201 ILE A HD13 1  
ATOM 1066  N N    . ASP A 1 70  ? 10.238  -4.977  -6.038  1.00 0.00 ? 1202 ASP A N    1  
ATOM 1067  C CA   . ASP A 1 70  ? 11.141  -6.057  -5.657  1.00 0.00 ? 1202 ASP A CA   1  
ATOM 1068  C C    . ASP A 1 70  ? 10.650  -6.755  -4.392  1.00 0.00 ? 1202 ASP A C    1  
ATOM 1069  O O    . ASP A 1 70  ? 10.206  -6.106  -3.445  1.00 0.00 ? 1202 ASP A O    1  
ATOM 1070  C CB   . ASP A 1 70  ? 12.554  -5.516  -5.440  1.00 0.00 ? 1202 ASP A CB   1  
ATOM 1071  C CG   . ASP A 1 70  ? 13.590  -6.620  -5.349  1.00 0.00 ? 1202 ASP A CG   1  
ATOM 1072  O OD1  . ASP A 1 70  ? 13.432  -7.511  -4.488  1.00 0.00 ? 1202 ASP A OD1  1  
ATOM 1073  O OD2  . ASP A 1 70  ? 14.556  -6.592  -6.139  1.00 0.00 ? 1202 ASP A OD2  1  
ATOM 1074  H H    . ASP A 1 70  ? 10.475  -4.053  -5.813  1.00 0.00 ? 1202 ASP A H    1  
ATOM 1075  H HA   . ASP A 1 70  ? 11.160  -6.774  -6.464  1.00 0.00 ? 1202 ASP A HA   1  
ATOM 1076  H HB2  . ASP A 1 70  ? 12.816  -4.870  -6.265  1.00 0.00 ? 1202 ASP A HB2  1  
ATOM 1077  H HB3  . ASP A 1 70  ? 12.578  -4.947  -4.522  1.00 0.00 ? 1202 ASP A HB3  1  
ATOM 1078  N N    . GLY A 1 71  ? 10.732  -8.082  -4.384  1.00 0.00 ? 1203 GLY A N    1  
ATOM 1079  C CA   . GLY A 1 71  ? 10.292  -8.845  -3.231  1.00 0.00 ? 1203 GLY A CA   1  
ATOM 1080  C C    . GLY A 1 71  ? 8.897   -9.411  -3.409  1.00 0.00 ? 1203 GLY A C    1  
ATOM 1081  O O    . GLY A 1 71  ? 8.615   -10.532 -2.985  1.00 0.00 ? 1203 GLY A O    1  
ATOM 1082  H H    . GLY A 1 71  ? 11.095  -8.546  -5.167  1.00 0.00 ? 1203 GLY A H    1  
ATOM 1083  H HA2  . GLY A 1 71  ? 10.982  -9.660  -3.067  1.00 0.00 ? 1203 GLY A HA2  1  
ATOM 1084  H HA3  . GLY A 1 71  ? 10.298  -8.202  -2.364  1.00 0.00 ? 1203 GLY A HA3  1  
ATOM 1085  N N    . VAL A 1 72  ? 8.020   -8.634  -4.037  1.00 0.00 ? 1204 VAL A N    1  
ATOM 1086  C CA   . VAL A 1 72  ? 6.647   -9.065  -4.270  1.00 0.00 ? 1204 VAL A CA   1  
ATOM 1087  C C    . VAL A 1 72  ? 6.579   -10.112 -5.376  1.00 0.00 ? 1204 VAL A C    1  
ATOM 1088  O O    . VAL A 1 72  ? 7.170   -9.942  -6.442  1.00 0.00 ? 1204 VAL A O    1  
ATOM 1089  C CB   . VAL A 1 72  ? 5.742   -7.876  -4.646  1.00 0.00 ? 1204 VAL A CB   1  
ATOM 1090  C CG1  . VAL A 1 72  ? 6.342   -7.095  -5.806  1.00 0.00 ? 1204 VAL A CG1  1  
ATOM 1091  C CG2  . VAL A 1 72  ? 4.341   -8.360  -4.986  1.00 0.00 ? 1204 VAL A CG2  1  
ATOM 1092  H H    . VAL A 1 72  ? 8.304   -7.751  -4.352  1.00 0.00 ? 1204 VAL A H    1  
ATOM 1093  H HA   . VAL A 1 72  ? 6.273   -9.498  -3.353  1.00 0.00 ? 1204 VAL A HA   1  
ATOM 1094  H HB   . VAL A 1 72  ? 5.676   -7.216  -3.794  1.00 0.00 ? 1204 VAL A HB   1  
ATOM 1095  H HG11 . VAL A 1 72  ? 6.692   -7.785  -6.560  1.00 0.00 ? 1204 VAL A HG11 1  
ATOM 1096  H HG12 . VAL A 1 72  ? 5.590   -6.447  -6.231  1.00 0.00 ? 1204 VAL A HG12 1  
ATOM 1097  H HG13 . VAL A 1 72  ? 7.171   -6.502  -5.450  1.00 0.00 ? 1204 VAL A HG13 1  
ATOM 1098  H HG21 . VAL A 1 72  ? 3.719   -7.513  -5.237  1.00 0.00 ? 1204 VAL A HG21 1  
ATOM 1099  H HG22 . VAL A 1 72  ? 4.387   -9.034  -5.829  1.00 0.00 ? 1204 VAL A HG22 1  
ATOM 1100  H HG23 . VAL A 1 72  ? 3.922   -8.876  -4.136  1.00 0.00 ? 1204 VAL A HG23 1  
ATOM 1101  N N    . SER A 1 73  ? 5.853   -11.194 -5.115  1.00 0.00 ? 1205 SER A N    1  
ATOM 1102  C CA   . SER A 1 73  ? 5.710   -12.271 -6.087  1.00 0.00 ? 1205 SER A CA   1  
ATOM 1103  C C    . SER A 1 73  ? 4.425   -12.107 -6.894  1.00 0.00 ? 1205 SER A C    1  
ATOM 1104  O O    . SER A 1 73  ? 3.409   -11.648 -6.375  1.00 0.00 ? 1205 SER A O    1  
ATOM 1105  C CB   . SER A 1 73  ? 5.712   -13.628 -5.381  1.00 0.00 ? 1205 SER A CB   1  
ATOM 1106  O OG   . SER A 1 73  ? 5.571   -14.688 -6.311  1.00 0.00 ? 1205 SER A OG   1  
ATOM 1107  H H    . SER A 1 73  ? 5.405   -11.271 -4.246  1.00 0.00 ? 1205 SER A H    1  
ATOM 1108  H HA   . SER A 1 73  ? 6.552   -12.224 -6.761  1.00 0.00 ? 1205 SER A HA   1  
ATOM 1109  H HB2  . SER A 1 73  ? 6.644   -13.753 -4.850  1.00 0.00 ? 1205 SER A HB2  1  
ATOM 1110  H HB3  . SER A 1 73  ? 4.891   -13.668 -4.680  1.00 0.00 ? 1205 SER A HB3  1  
ATOM 1111  H HG   . SER A 1 73  ? 5.847   -14.389 -7.181  1.00 0.00 ? 1205 SER A HG   1  
ATOM 1112  N N    . GLU A 1 74  ? 4.480   -12.488 -8.166  1.00 0.00 ? 1206 GLU A N    1  
ATOM 1113  C CA   . GLU A 1 74  ? 3.321   -12.382 -9.045  1.00 0.00 ? 1206 GLU A CA   1  
ATOM 1114  C C    . GLU A 1 74  ? 2.045   -12.791 -8.315  1.00 0.00 ? 1206 GLU A C    1  
ATOM 1115  O O    . GLU A 1 74  ? 1.995   -13.835 -7.667  1.00 0.00 ? 1206 GLU A O    1  
ATOM 1116  C CB   . GLU A 1 74  ? 3.514   -13.256 -10.286 1.00 0.00 ? 1206 GLU A CB   1  
ATOM 1117  C CG   . GLU A 1 74  ? 2.522   -12.961 -11.399 1.00 0.00 ? 1206 GLU A CG   1  
ATOM 1118  C CD   . GLU A 1 74  ? 2.837   -13.714 -12.677 1.00 0.00 ? 1206 GLU A CD   1  
ATOM 1119  O OE1  . GLU A 1 74  ? 3.976   -13.592 -13.172 1.00 0.00 ? 1206 GLU A OE1  1  
ATOM 1120  O OE2  . GLU A 1 74  ? 1.943   -14.425 -13.181 1.00 0.00 ? 1206 GLU A OE2  1  
ATOM 1121  H H    . GLU A 1 74  ? 5.319   -12.847 -8.522  1.00 0.00 ? 1206 GLU A H    1  
ATOM 1122  H HA   . GLU A 1 74  ? 3.231   -11.352 -9.353  1.00 0.00 ? 1206 GLU A HA   1  
ATOM 1123  H HB2  . GLU A 1 74  ? 4.511   -13.101 -10.670 1.00 0.00 ? 1206 GLU A HB2  1  
ATOM 1124  H HB3  . GLU A 1 74  ? 3.404   -14.293 -10.002 1.00 0.00 ? 1206 GLU A HB3  1  
ATOM 1125  H HG2  . GLU A 1 74  ? 1.534   -13.243 -11.067 1.00 0.00 ? 1206 GLU A HG2  1  
ATOM 1126  H HG3  . GLU A 1 74  ? 2.541   -11.901 -11.609 1.00 0.00 ? 1206 GLU A HG3  1  
ATOM 1127  N N    . GLY A 1 75  ? 1.015   -11.958 -8.425  1.00 0.00 ? 1207 GLY A N    1  
ATOM 1128  C CA   . GLY A 1 75  ? -0.247  -12.248 -7.769  1.00 0.00 ? 1207 GLY A CA   1  
ATOM 1129  C C    . GLY A 1 75  ? -0.307  -11.700 -6.357  1.00 0.00 ? 1207 GLY A C    1  
ATOM 1130  O O    . GLY A 1 75  ? -1.186  -10.903 -6.029  1.00 0.00 ? 1207 GLY A O    1  
ATOM 1131  H H    . GLY A 1 75  ? 1.112   -11.139 -8.955  1.00 0.00 ? 1207 GLY A H    1  
ATOM 1132  H HA2  . GLY A 1 75  ? -1.049  -11.813 -8.348  1.00 0.00 ? 1207 GLY A HA2  1  
ATOM 1133  H HA3  . GLY A 1 75  ? -0.382  -13.319 -7.733  1.00 0.00 ? 1207 GLY A HA3  1  
ATOM 1134  N N    . LYS A 1 76  ? 0.630   -12.129 -5.518  1.00 0.00 ? 1208 LYS A N    1  
ATOM 1135  C CA   . LYS A 1 76  ? 0.681   -11.677 -4.132  1.00 0.00 ? 1208 LYS A CA   1  
ATOM 1136  C C    . LYS A 1 76  ? 0.303   -10.203 -4.027  1.00 0.00 ? 1208 LYS A C    1  
ATOM 1137  O O    . LYS A 1 76  ? -0.554  -9.828  -3.227  1.00 0.00 ? 1208 LYS A O    1  
ATOM 1138  C CB   . LYS A 1 76  ? 2.080   -11.898 -3.554  1.00 0.00 ? 1208 LYS A CB   1  
ATOM 1139  C CG   . LYS A 1 76  ? 2.255   -11.335 -2.154  1.00 0.00 ? 1208 LYS A CG   1  
ATOM 1140  C CD   . LYS A 1 76  ? 3.702   -10.955 -1.883  1.00 0.00 ? 1208 LYS A CD   1  
ATOM 1141  C CE   . LYS A 1 76  ? 4.487   -12.124 -1.311  1.00 0.00 ? 1208 LYS A CE   1  
ATOM 1142  N NZ   . LYS A 1 76  ? 3.970   -12.542 0.021   1.00 0.00 ? 1208 LYS A NZ   1  
ATOM 1143  H H    . LYS A 1 76  ? 1.304   -12.765 -5.838  1.00 0.00 ? 1208 LYS A H    1  
ATOM 1144  H HA   . LYS A 1 76  ? -0.030  -12.260 -3.567  1.00 0.00 ? 1208 LYS A HA   1  
ATOM 1145  H HB2  . LYS A 1 76  ? 2.279   -12.959 -3.520  1.00 0.00 ? 1208 LYS A HB2  1  
ATOM 1146  H HB3  . LYS A 1 76  ? 2.804   -11.426 -4.202  1.00 0.00 ? 1208 LYS A HB3  1  
ATOM 1147  H HG2  . LYS A 1 76  ? 1.638   -10.455 -2.050  1.00 0.00 ? 1208 LYS A HG2  1  
ATOM 1148  H HG3  . LYS A 1 76  ? 1.948   -12.080 -1.435  1.00 0.00 ? 1208 LYS A HG3  1  
ATOM 1149  H HD2  . LYS A 1 76  ? 4.163   -10.644 -2.809  1.00 0.00 ? 1208 LYS A HD2  1  
ATOM 1150  H HD3  . LYS A 1 76  ? 3.723   -10.137 -1.176  1.00 0.00 ? 1208 LYS A HD3  1  
ATOM 1151  H HE2  . LYS A 1 76  ? 4.415   -12.958 -1.993  1.00 0.00 ? 1208 LYS A HE2  1  
ATOM 1152  H HE3  . LYS A 1 76  ? 5.522   -11.831 -1.211  1.00 0.00 ? 1208 LYS A HE3  1  
ATOM 1153  H HZ1  . LYS A 1 76  ? 4.731   -12.498 0.729   1.00 0.00 ? 1208 LYS A HZ1  1  
ATOM 1154  H HZ2  . LYS A 1 76  ? 3.610   -13.516 -0.024  1.00 0.00 ? 1208 LYS A HZ2  1  
ATOM 1155  H HZ3  . LYS A 1 76  ? 3.198   -11.912 0.318   1.00 0.00 ? 1208 LYS A HZ3  1  
ATOM 1156  N N    . ALA A 1 77  ? 0.947   -9.372  -4.839  1.00 0.00 ? 1209 ALA A N    1  
ATOM 1157  C CA   . ALA A 1 77  ? 0.675   -7.940  -4.839  1.00 0.00 ? 1209 ALA A CA   1  
ATOM 1158  C C    . ALA A 1 77  ? -0.795  -7.660  -4.546  1.00 0.00 ? 1209 ALA A C    1  
ATOM 1159  O O    . ALA A 1 77  ? -1.122  -6.828  -3.700  1.00 0.00 ? 1209 ALA A O    1  
ATOM 1160  C CB   . ALA A 1 77  ? 1.076   -7.326  -6.173  1.00 0.00 ? 1209 ALA A CB   1  
ATOM 1161  H H    . ALA A 1 77  ? 1.619   -9.730  -5.455  1.00 0.00 ? 1209 ALA A H    1  
ATOM 1162  H HA   . ALA A 1 77  ? 1.279   -7.486  -4.066  1.00 0.00 ? 1209 ALA A HA   1  
ATOM 1163  H HB1  . ALA A 1 77  ? 0.305   -6.643  -6.500  1.00 0.00 ? 1209 ALA A HB1  1  
ATOM 1164  H HB2  . ALA A 1 77  ? 2.007   -6.791  -6.058  1.00 0.00 ? 1209 ALA A HB2  1  
ATOM 1165  H HB3  . ALA A 1 77  ? 1.198   -8.109  -6.906  1.00 0.00 ? 1209 ALA A HB3  1  
ATOM 1166  N N    . ALA A 1 78  ? -1.678  -8.359  -5.252  1.00 0.00 ? 1210 ALA A N    1  
ATOM 1167  C CA   . ALA A 1 78  ? -3.113  -8.186  -5.067  1.00 0.00 ? 1210 ALA A CA   1  
ATOM 1168  C C    . ALA A 1 78  ? -3.461  -8.028  -3.590  1.00 0.00 ? 1210 ALA A C    1  
ATOM 1169  O O    . ALA A 1 78  ? -3.896  -6.963  -3.156  1.00 0.00 ? 1210 ALA A O    1  
ATOM 1170  C CB   . ALA A 1 78  ? -3.868  -9.363  -5.666  1.00 0.00 ? 1210 ALA A CB   1  
ATOM 1171  H H    . ALA A 1 78  ? -1.356  -9.007  -5.913  1.00 0.00 ? 1210 ALA A H    1  
ATOM 1172  H HA   . ALA A 1 78  ? -3.413  -7.292  -5.594  1.00 0.00 ? 1210 ALA A HA   1  
ATOM 1173  H HB1  . ALA A 1 78  ? -3.280  -9.801  -6.459  1.00 0.00 ? 1210 ALA A HB1  1  
ATOM 1174  H HB2  . ALA A 1 78  ? -4.047  -10.103 -4.900  1.00 0.00 ? 1210 ALA A HB2  1  
ATOM 1175  H HB3  . ALA A 1 78  ? -4.811  -9.021  -6.064  1.00 0.00 ? 1210 ALA A HB3  1  
ATOM 1176  N N    . MET A 1 79  ? -3.266  -9.096  -2.824  1.00 0.00 ? 1211 MET A N    1  
ATOM 1177  C CA   . MET A 1 79  ? -3.559  -9.075  -1.395  1.00 0.00 ? 1211 MET A CA   1  
ATOM 1178  C C    . MET A 1 79  ? -2.984  -7.823  -0.741  1.00 0.00 ? 1211 MET A C    1  
ATOM 1179  O O    . MET A 1 79  ? -3.506  -7.340  0.265   1.00 0.00 ? 1211 MET A O    1  
ATOM 1180  C CB   . MET A 1 79  ? -2.992  -10.325 -0.718  1.00 0.00 ? 1211 MET A CB   1  
ATOM 1181  C CG   . MET A 1 79  ? -1.514  -10.216 -0.382  1.00 0.00 ? 1211 MET A CG   1  
ATOM 1182  S SD   . MET A 1 79  ? -0.674  -11.811 -0.417  1.00 0.00 ? 1211 MET A SD   1  
ATOM 1183  C CE   . MET A 1 79  ? 0.465   -11.625 0.953   1.00 0.00 ? 1211 MET A CE   1  
ATOM 1184  H H    . MET A 1 79  ? -2.916  -9.918  -3.228  1.00 0.00 ? 1211 MET A H    1  
ATOM 1185  H HA   . MET A 1 79  ? -4.632  -9.068  -1.278  1.00 0.00 ? 1211 MET A HA   1  
ATOM 1186  H HB2  . MET A 1 79  ? -3.536  -10.501 0.198   1.00 0.00 ? 1211 MET A HB2  1  
ATOM 1187  H HB3  . MET A 1 79  ? -3.127  -11.170 -1.377  1.00 0.00 ? 1211 MET A HB3  1  
ATOM 1188  H HG2  . MET A 1 79  ? -1.041  -9.561  -1.099  1.00 0.00 ? 1211 MET A HG2  1  
ATOM 1189  H HG3  . MET A 1 79  ? -1.414  -9.794  0.607   1.00 0.00 ? 1211 MET A HG3  1  
ATOM 1190  H HE1  . MET A 1 79  ? 1.048   -12.528 1.062   1.00 0.00 ? 1211 MET A HE1  1  
ATOM 1191  H HE2  . MET A 1 79  ? 1.124   -10.791 0.762   1.00 0.00 ? 1211 MET A HE2  1  
ATOM 1192  H HE3  . MET A 1 79  ? -0.092  -11.444 1.861   1.00 0.00 ? 1211 MET A HE3  1  
ATOM 1193  N N    . LEU A 1 80  ? -1.906  -7.302  -1.317  1.00 0.00 ? 1212 LEU A N    1  
ATOM 1194  C CA   . LEU A 1 80  ? -1.260  -6.105  -0.789  1.00 0.00 ? 1212 LEU A CA   1  
ATOM 1195  C C    . LEU A 1 80  ? -1.908  -4.844  -1.350  1.00 0.00 ? 1212 LEU A C    1  
ATOM 1196  O O    . LEU A 1 80  ? -1.254  -3.812  -1.500  1.00 0.00 ? 1212 LEU A O    1  
ATOM 1197  C CB   . LEU A 1 80  ? 0.233   -6.118  -1.125  1.00 0.00 ? 1212 LEU A CB   1  
ATOM 1198  C CG   . LEU A 1 80  ? 1.036   -7.294  -0.568  1.00 0.00 ? 1212 LEU A CG   1  
ATOM 1199  C CD1  . LEU A 1 80  ? 2.433   -7.317  -1.168  1.00 0.00 ? 1212 LEU A CD1  1  
ATOM 1200  C CD2  . LEU A 1 80  ? 1.107   -7.220  0.950   1.00 0.00 ? 1212 LEU A CD2  1  
ATOM 1201  H H    . LEU A 1 80  ? -1.535  -7.731  -2.116  1.00 0.00 ? 1212 LEU A H    1  
ATOM 1202  H HA   . LEU A 1 80  ? -1.379  -6.110  0.284   1.00 0.00 ? 1212 LEU A HA   1  
ATOM 1203  H HB2  . LEU A 1 80  ? 0.330   -6.130  -2.199  1.00 0.00 ? 1212 LEU A HB2  1  
ATOM 1204  H HB3  . LEU A 1 80  ? 0.666   -5.207  -0.736  1.00 0.00 ? 1212 LEU A HB3  1  
ATOM 1205  H HG   . LEU A 1 80  ? 0.542   -8.218  -0.837  1.00 0.00 ? 1212 LEU A HG   1  
ATOM 1206  H HD11 . LEU A 1 80  ? 3.152   -7.020  -0.419  1.00 0.00 ? 1212 LEU A HD11 1  
ATOM 1207  H HD12 . LEU A 1 80  ? 2.478   -6.633  -2.002  1.00 0.00 ? 1212 LEU A HD12 1  
ATOM 1208  H HD13 . LEU A 1 80  ? 2.661   -8.317  -1.510  1.00 0.00 ? 1212 LEU A HD13 1  
ATOM 1209  H HD21 . LEU A 1 80  ? 2.041   -6.765  1.245   1.00 0.00 ? 1212 LEU A HD21 1  
ATOM 1210  H HD22 . LEU A 1 80  ? 1.047   -8.218  1.362   1.00 0.00 ? 1212 LEU A HD22 1  
ATOM 1211  H HD23 . LEU A 1 80  ? 0.284   -6.627  1.321   1.00 0.00 ? 1212 LEU A HD23 1  
ATOM 1212  N N    . ALA A 1 81  ? -3.198  -4.934  -1.657  1.00 0.00 ? 1213 ALA A N    1  
ATOM 1213  C CA   . ALA A 1 81  ? -3.936  -3.799  -2.198  1.00 0.00 ? 1213 ALA A CA   1  
ATOM 1214  C C    . ALA A 1 81  ? -4.055  -2.681  -1.168  1.00 0.00 ? 1213 ALA A C    1  
ATOM 1215  O O    . ALA A 1 81  ? -3.735  -1.522  -1.434  1.00 0.00 ? 1213 ALA A O    1  
ATOM 1216  C CB   . ALA A 1 81  ? -5.316  -4.240  -2.663  1.00 0.00 ? 1213 ALA A CB   1  
ATOM 1217  H H    . ALA A 1 81  ? -3.665  -5.784  -1.516  1.00 0.00 ? 1213 ALA A H    1  
ATOM 1218  H HA   . ALA A 1 81  ? -3.395  -3.428  -3.056  1.00 0.00 ? 1213 ALA A HA   1  
ATOM 1219  H HB1  . ALA A 1 81  ? -5.412  -4.059  -3.724  1.00 0.00 ? 1213 ALA A HB1  1  
ATOM 1220  H HB2  . ALA A 1 81  ? -5.443  -5.293  -2.464  1.00 0.00 ? 1213 ALA A HB2  1  
ATOM 1221  H HB3  . ALA A 1 81  ? -6.070  -3.679  -2.132  1.00 0.00 ? 1213 ALA A HB3  1  
ATOM 1222  N N    . PRO A 1 82  ? -4.526  -3.033  0.038   1.00 0.00 ? 1214 PRO A N    1  
ATOM 1223  C CA   . PRO A 1 82  ? -4.698  -2.073  1.132   1.00 0.00 ? 1214 PRO A CA   1  
ATOM 1224  C C    . PRO A 1 82  ? -3.466  -1.197  1.334   1.00 0.00 ? 1214 PRO A C    1  
ATOM 1225  O O    . PRO A 1 82  ? -3.555  -0.102  1.891   1.00 0.00 ? 1214 PRO A O    1  
ATOM 1226  C CB   . PRO A 1 82  ? -4.926  -2.966  2.355   1.00 0.00 ? 1214 PRO A CB   1  
ATOM 1227  C CG   . PRO A 1 82  ? -5.493  -4.228  1.802   1.00 0.00 ? 1214 PRO A CG   1  
ATOM 1228  C CD   . PRO A 1 82  ? -4.927  -4.396  0.425   1.00 0.00 ? 1214 PRO A CD   1  
ATOM 1229  H HA   . PRO A 1 82  ? -5.563  -1.445  0.977   1.00 0.00 ? 1214 PRO A HA   1  
ATOM 1230  H HB2  . PRO A 1 82  ? -3.984  -3.141  2.856   1.00 0.00 ? 1214 PRO A HB2  1  
ATOM 1231  H HB3  . PRO A 1 82  ? -5.617  -2.486  3.031   1.00 0.00 ? 1214 PRO A HB3  1  
ATOM 1232  H HG2  . PRO A 1 82  ? -5.203  -5.063  2.421   1.00 0.00 ? 1214 PRO A HG2  1  
ATOM 1233  H HG3  . PRO A 1 82  ? -6.569  -4.154  1.748   1.00 0.00 ? 1214 PRO A HG3  1  
ATOM 1234  H HD2  . PRO A 1 82  ? -4.073  -5.057  0.451   1.00 0.00 ? 1214 PRO A HD2  1  
ATOM 1235  H HD3  . PRO A 1 82  ? -5.683  -4.780  -0.244  1.00 0.00 ? 1214 PRO A HD3  1  
ATOM 1236  N N    . LEU A 1 83  ? -2.318  -1.685  0.878   1.00 0.00 ? 1215 LEU A N    1  
ATOM 1237  C CA   . LEU A 1 83  ? -1.067  -0.946  1.008   1.00 0.00 ? 1215 LEU A CA   1  
ATOM 1238  C C    . LEU A 1 83  ? -1.002  0.195   -0.002  1.00 0.00 ? 1215 LEU A C    1  
ATOM 1239  O O    . LEU A 1 83  ? -1.028  1.368   0.370   1.00 0.00 ? 1215 LEU A O    1  
ATOM 1240  C CB   . LEU A 1 83  ? 0.125   -1.884  0.812   1.00 0.00 ? 1215 LEU A CB   1  
ATOM 1241  C CG   . LEU A 1 83  ? 0.467   -2.790  1.996   1.00 0.00 ? 1215 LEU A CG   1  
ATOM 1242  C CD1  . LEU A 1 83  ? -0.502  -3.960  2.070   1.00 0.00 ? 1215 LEU A CD1  1  
ATOM 1243  C CD2  . LEU A 1 83  ? 1.901   -3.289  1.888   1.00 0.00 ? 1215 LEU A CD2  1  
ATOM 1244  H H    . LEU A 1 83  ? -2.310  -2.563  0.443   1.00 0.00 ? 1215 LEU A H    1  
ATOM 1245  H HA   . LEU A 1 83  ? -1.029  -0.532  2.004   1.00 0.00 ? 1215 LEU A HA   1  
ATOM 1246  H HB2  . LEU A 1 83  ? -0.087  -2.516  -0.037  1.00 0.00 ? 1215 LEU A HB2  1  
ATOM 1247  H HB3  . LEU A 1 83  ? 0.992   -1.276  0.599   1.00 0.00 ? 1215 LEU A HB3  1  
ATOM 1248  H HG   . LEU A 1 83  ? 0.377   -2.224  2.912   1.00 0.00 ? 1215 LEU A HG   1  
ATOM 1249  H HD11 . LEU A 1 83  ? -1.393  -3.656  2.597   1.00 0.00 ? 1215 LEU A HD11 1  
ATOM 1250  H HD12 . LEU A 1 83  ? -0.035  -4.781  2.595   1.00 0.00 ? 1215 LEU A HD12 1  
ATOM 1251  H HD13 . LEU A 1 83  ? -0.763  -4.275  1.071   1.00 0.00 ? 1215 LEU A HD13 1  
ATOM 1252  H HD21 . LEU A 1 83  ? 2.538   -2.691  2.523   1.00 0.00 ? 1215 LEU A HD21 1  
ATOM 1253  H HD22 . LEU A 1 83  ? 2.235   -3.207  0.864   1.00 0.00 ? 1215 LEU A HD22 1  
ATOM 1254  H HD23 . LEU A 1 83  ? 1.947   -4.321  2.202   1.00 0.00 ? 1215 LEU A HD23 1  
ATOM 1255  N N    . TRP A 1 84  ? -0.919  -0.157  -1.280  1.00 0.00 ? 1216 TRP A N    1  
ATOM 1256  C CA   . TRP A 1 84  ? -0.852  0.839   -2.344  1.00 0.00 ? 1216 TRP A CA   1  
ATOM 1257  C C    . TRP A 1 84  ? -2.097  1.718   -2.345  1.00 0.00 ? 1216 TRP A C    1  
ATOM 1258  O O    . TRP A 1 84  ? -2.042  2.886   -2.729  1.00 0.00 ? 1216 TRP A O    1  
ATOM 1259  C CB   . TRP A 1 84  ? -0.694  0.154   -3.702  1.00 0.00 ? 1216 TRP A CB   1  
ATOM 1260  C CG   . TRP A 1 84  ? -1.982  -0.381  -4.251  1.00 0.00 ? 1216 TRP A CG   1  
ATOM 1261  C CD1  . TRP A 1 84  ? -3.111  0.334   -4.534  1.00 0.00 ? 1216 TRP A CD1  1  
ATOM 1262  C CD2  . TRP A 1 84  ? -2.274  -1.743  -4.580  1.00 0.00 ? 1216 TRP A CD2  1  
ATOM 1263  N NE1  . TRP A 1 84  ? -4.087  -0.503  -5.020  1.00 0.00 ? 1216 TRP A NE1  1  
ATOM 1264  C CE2  . TRP A 1 84  ? -3.598  -1.782  -5.059  1.00 0.00 ? 1216 TRP A CE2  1  
ATOM 1265  C CE3  . TRP A 1 84  ? -1.544  -2.933  -4.520  1.00 0.00 ? 1216 TRP A CE3  1  
ATOM 1266  C CZ2  . TRP A 1 84  ? -4.205  -2.965  -5.472  1.00 0.00 ? 1216 TRP A CZ2  1  
ATOM 1267  C CZ3  . TRP A 1 84  ? -2.148  -4.106  -4.930  1.00 0.00 ? 1216 TRP A CZ3  1  
ATOM 1268  C CH2  . TRP A 1 84  ? -3.468  -4.115  -5.402  1.00 0.00 ? 1216 TRP A CH2  1  
ATOM 1269  H H    . TRP A 1 84  ? -0.902  -1.108  -1.514  1.00 0.00 ? 1216 TRP A H    1  
ATOM 1270  H HA   . TRP A 1 84  ? 0.013   1.460   -2.161  1.00 0.00 ? 1216 TRP A HA   1  
ATOM 1271  H HB2  . TRP A 1 84  ? -0.298  0.864   -4.413  1.00 0.00 ? 1216 TRP A HB2  1  
ATOM 1272  H HB3  . TRP A 1 84  ? -0.005  -0.672  -3.602  1.00 0.00 ? 1216 TRP A HB3  1  
ATOM 1273  H HD1  . TRP A 1 84  ? -3.209  1.399   -4.390  1.00 0.00 ? 1216 TRP A HD1  1  
ATOM 1274  H HE1  . TRP A 1 84  ? -4.987  -0.228  -5.295  1.00 0.00 ? 1216 TRP A HE1  1  
ATOM 1275  H HE3  . TRP A 1 84  ? -0.526  -2.947  -4.159  1.00 0.00 ? 1216 TRP A HE3  1  
ATOM 1276  H HZ2  . TRP A 1 84  ? -5.221  -2.988  -5.839  1.00 0.00 ? 1216 TRP A HZ2  1  
ATOM 1277  H HZ3  . TRP A 1 84  ? -1.601  -5.037  -4.890  1.00 0.00 ? 1216 TRP A HZ3  1  
ATOM 1278  H HH2  . TRP A 1 84  ? -3.900  -5.054  -5.712  1.00 0.00 ? 1216 TRP A HH2  1  
ATOM 1279  N N    . GLU A 1 85  ? -3.219  1.149   -1.914  1.00 0.00 ? 1217 GLU A N    1  
ATOM 1280  C CA   . GLU A 1 85  ? -4.478  1.883   -1.867  1.00 0.00 ? 1217 GLU A CA   1  
ATOM 1281  C C    . GLU A 1 85  ? -4.324  3.177   -1.073  1.00 0.00 ? 1217 GLU A C    1  
ATOM 1282  O O    . GLU A 1 85  ? -4.947  4.191   -1.389  1.00 0.00 ? 1217 GLU A O    1  
ATOM 1283  C CB   . GLU A 1 85  ? -5.576  1.018   -1.246  1.00 0.00 ? 1217 GLU A CB   1  
ATOM 1284  C CG   . GLU A 1 85  ? -6.270  0.106   -2.244  1.00 0.00 ? 1217 GLU A CG   1  
ATOM 1285  C CD   . GLU A 1 85  ? -7.471  0.763   -2.896  1.00 0.00 ? 1217 GLU A CD   1  
ATOM 1286  O OE1  . GLU A 1 85  ? -8.257  1.412   -2.174  1.00 0.00 ? 1217 GLU A OE1  1  
ATOM 1287  O OE2  . GLU A 1 85  ? -7.626  0.627   -4.128  1.00 0.00 ? 1217 GLU A OE2  1  
ATOM 1288  H H    . GLU A 1 85  ? -3.199  0.214   -1.621  1.00 0.00 ? 1217 GLU A H    1  
ATOM 1289  H HA   . GLU A 1 85  ? -4.757  2.129   -2.881  1.00 0.00 ? 1217 GLU A HA   1  
ATOM 1290  H HB2  . GLU A 1 85  ? -5.139  0.404   -0.472  1.00 0.00 ? 1217 GLU A HB2  1  
ATOM 1291  H HB3  . GLU A 1 85  ? -6.319  1.664   -0.803  1.00 0.00 ? 1217 GLU A HB3  1  
ATOM 1292  H HG2  . GLU A 1 85  ? -5.565  -0.166  -3.015  1.00 0.00 ? 1217 GLU A HG2  1  
ATOM 1293  H HG3  . GLU A 1 85  ? -6.600  -0.784  -1.729  1.00 0.00 ? 1217 GLU A HG3  1  
ATOM 1294  N N    . VAL A 1 86  ? -3.490  3.134   -0.039  1.00 0.00 ? 1218 VAL A N    1  
ATOM 1295  C CA   . VAL A 1 86  ? -3.253  4.302   0.802   1.00 0.00 ? 1218 VAL A CA   1  
ATOM 1296  C C    . VAL A 1 86  ? -2.383  5.328   0.084   1.00 0.00 ? 1218 VAL A C    1  
ATOM 1297  O O    . VAL A 1 86  ? -2.536  6.533   0.283   1.00 0.00 ? 1218 VAL A O    1  
ATOM 1298  C CB   . VAL A 1 86  ? -2.577  3.910   2.129   1.00 0.00 ? 1218 VAL A CB   1  
ATOM 1299  C CG1  . VAL A 1 86  ? -2.245  5.150   2.945   1.00 0.00 ? 1218 VAL A CG1  1  
ATOM 1300  C CG2  . VAL A 1 86  ? -3.467  2.964   2.920   1.00 0.00 ? 1218 VAL A CG2  1  
ATOM 1301  H H    . VAL A 1 86  ? -3.022  2.297   0.163   1.00 0.00 ? 1218 VAL A H    1  
ATOM 1302  H HA   . VAL A 1 86  ? -4.210  4.750   1.027   1.00 0.00 ? 1218 VAL A HA   1  
ATOM 1303  H HB   . VAL A 1 86  ? -1.654  3.398   1.902   1.00 0.00 ? 1218 VAL A HB   1  
ATOM 1304  H HG11 . VAL A 1 86  ? -2.575  5.009   3.964   1.00 0.00 ? 1218 VAL A HG11 1  
ATOM 1305  H HG12 . VAL A 1 86  ? -1.178  5.316   2.930   1.00 0.00 ? 1218 VAL A HG12 1  
ATOM 1306  H HG13 . VAL A 1 86  ? -2.749  6.006   2.520   1.00 0.00 ? 1218 VAL A HG13 1  
ATOM 1307  H HG21 . VAL A 1 86  ? -2.884  2.120   3.257   1.00 0.00 ? 1218 VAL A HG21 1  
ATOM 1308  H HG22 . VAL A 1 86  ? -3.875  3.483   3.775   1.00 0.00 ? 1218 VAL A HG22 1  
ATOM 1309  H HG23 . VAL A 1 86  ? -4.273  2.617   2.292   1.00 0.00 ? 1218 VAL A HG23 1  
ATOM 1310  N N    . ILE A 1 87  ? -1.471  4.841   -0.750  1.00 0.00 ? 1219 ILE A N    1  
ATOM 1311  C CA   . ILE A 1 87  ? -0.577  5.716   -1.499  1.00 0.00 ? 1219 ILE A CA   1  
ATOM 1312  C C    . ILE A 1 87  ? -1.351  6.563   -2.504  1.00 0.00 ? 1219 ILE A C    1  
ATOM 1313  O O    . ILE A 1 87  ? -1.074  7.750   -2.677  1.00 0.00 ? 1219 ILE A O    1  
ATOM 1314  C CB   . ILE A 1 87  ? 0.503   4.912   -2.246  1.00 0.00 ? 1219 ILE A CB   1  
ATOM 1315  C CG1  . ILE A 1 87  ? 1.311   4.064   -1.261  1.00 0.00 ? 1219 ILE A CG1  1  
ATOM 1316  C CG2  . ILE A 1 87  ? 1.418   5.847   -3.023  1.00 0.00 ? 1219 ILE A CG2  1  
ATOM 1317  C CD1  . ILE A 1 87  ? 2.165   3.011   -1.931  1.00 0.00 ? 1219 ILE A CD1  1  
ATOM 1318  H H    . ILE A 1 87  ? -1.398  3.871   -0.866  1.00 0.00 ? 1219 ILE A H    1  
ATOM 1319  H HA   . ILE A 1 87  ? -0.086  6.372   -0.794  1.00 0.00 ? 1219 ILE A HA   1  
ATOM 1320  H HB   . ILE A 1 87  ? 0.011   4.261   -2.952  1.00 0.00 ? 1219 ILE A HB   1  
ATOM 1321  H HG12 . ILE A 1 87  ? 1.963   4.708   -0.693  1.00 0.00 ? 1219 ILE A HG12 1  
ATOM 1322  H HG13 . ILE A 1 87  ? 0.631   3.562   -0.588  1.00 0.00 ? 1219 ILE A HG13 1  
ATOM 1323  H HG21 . ILE A 1 87  ? 2.235   6.159   -2.389  1.00 0.00 ? 1219 ILE A HG21 1  
ATOM 1324  H HG22 . ILE A 1 87  ? 1.809   5.332   -3.887  1.00 0.00 ? 1219 ILE A HG22 1  
ATOM 1325  H HG23 . ILE A 1 87  ? 0.859   6.714   -3.342  1.00 0.00 ? 1219 ILE A HG23 1  
ATOM 1326  H HD11 . ILE A 1 87  ? 3.140   3.421   -2.147  1.00 0.00 ? 1219 ILE A HD11 1  
ATOM 1327  H HD12 . ILE A 1 87  ? 2.269   2.160   -1.274  1.00 0.00 ? 1219 ILE A HD12 1  
ATOM 1328  H HD13 . ILE A 1 87  ? 1.695   2.698   -2.852  1.00 0.00 ? 1219 ILE A HD13 1  
ATOM 1329  N N    . LYS A 1 88  ? -2.325  5.945   -3.164  1.00 0.00 ? 1220 LYS A N    1  
ATOM 1330  C CA   . LYS A 1 88  ? -3.143  6.641   -4.150  1.00 0.00 ? 1220 LYS A CA   1  
ATOM 1331  C C    . LYS A 1 88  ? -3.878  7.817   -3.515  1.00 0.00 ? 1220 LYS A C    1  
ATOM 1332  O O    . LYS A 1 88  ? -4.018  8.877   -4.125  1.00 0.00 ? 1220 LYS A O    1  
ATOM 1333  C CB   . LYS A 1 88  ? -4.150  5.676   -4.780  1.00 0.00 ? 1220 LYS A CB   1  
ATOM 1334  C CG   . LYS A 1 88  ? -4.674  6.138   -6.129  1.00 0.00 ? 1220 LYS A CG   1  
ATOM 1335  C CD   . LYS A 1 88  ? -5.212  4.975   -6.946  1.00 0.00 ? 1220 LYS A CD   1  
ATOM 1336  C CE   . LYS A 1 88  ? -6.597  4.558   -6.477  1.00 0.00 ? 1220 LYS A CE   1  
ATOM 1337  N NZ   . LYS A 1 88  ? -7.214  3.558   -7.391  1.00 0.00 ? 1220 LYS A NZ   1  
ATOM 1338  H H    . LYS A 1 88  ? -2.499  4.997   -2.982  1.00 0.00 ? 1220 LYS A H    1  
ATOM 1339  H HA   . LYS A 1 88  ? -2.486  7.016   -4.920  1.00 0.00 ? 1220 LYS A HA   1  
ATOM 1340  H HB2  . LYS A 1 88  ? -3.676  4.714   -4.911  1.00 0.00 ? 1220 LYS A HB2  1  
ATOM 1341  H HB3  . LYS A 1 88  ? -4.991  5.565   -4.110  1.00 0.00 ? 1220 LYS A HB3  1  
ATOM 1342  H HG2  . LYS A 1 88  ? -5.469  6.851   -5.971  1.00 0.00 ? 1220 LYS A HG2  1  
ATOM 1343  H HG3  . LYS A 1 88  ? -3.868  6.608   -6.675  1.00 0.00 ? 1220 LYS A HG3  1  
ATOM 1344  H HD2  . LYS A 1 88  ? -5.269  5.271   -7.983  1.00 0.00 ? 1220 LYS A HD2  1  
ATOM 1345  H HD3  . LYS A 1 88  ? -4.539  4.135   -6.846  1.00 0.00 ? 1220 LYS A HD3  1  
ATOM 1346  H HE2  . LYS A 1 88  ? -6.515  4.129   -5.490  1.00 0.00 ? 1220 LYS A HE2  1  
ATOM 1347  H HE3  . LYS A 1 88  ? -7.228  5.434   -6.437  1.00 0.00 ? 1220 LYS A HE3  1  
ATOM 1348  H HZ1  . LYS A 1 88  ? -8.236  3.490   -7.208  1.00 0.00 ? 1220 LYS A HZ1  1  
ATOM 1349  H HZ2  . LYS A 1 88  ? -6.784  2.623   -7.241  1.00 0.00 ? 1220 LYS A HZ2  1  
ATOM 1350  H HZ3  . LYS A 1 88  ? -7.068  3.840   -8.381  1.00 0.00 ? 1220 LYS A HZ3  1  
ATOM 1351  N N    . HIS A 1 89  ? -4.345  7.623   -2.286  1.00 0.00 ? 1221 HIS A N    1  
ATOM 1352  C CA   . HIS A 1 89  ? -5.064  8.669   -1.567  1.00 0.00 ? 1221 HIS A CA   1  
ATOM 1353  C C    . HIS A 1 89  ? -4.096  9.703   -1.001  1.00 0.00 ? 1221 HIS A C    1  
ATOM 1354  O O    . HIS A 1 89  ? -4.306  10.908  -1.142  1.00 0.00 ? 1221 HIS A O    1  
ATOM 1355  C CB   . HIS A 1 89  ? -5.897  8.062   -0.438  1.00 0.00 ? 1221 HIS A CB   1  
ATOM 1356  C CG   . HIS A 1 89  ? -7.070  8.903   -0.040  1.00 0.00 ? 1221 HIS A CG   1  
ATOM 1357  N ND1  . HIS A 1 89  ? -8.282  8.864   -0.696  1.00 0.00 ? 1221 HIS A ND1  1  
ATOM 1358  C CD2  . HIS A 1 89  ? -7.212  9.809   0.957   1.00 0.00 ? 1221 HIS A CD2  1  
ATOM 1359  C CE1  . HIS A 1 89  ? -9.118  9.711   -0.123  1.00 0.00 ? 1221 HIS A CE1  1  
ATOM 1360  N NE2  . HIS A 1 89  ? -8.494  10.296  0.883   1.00 0.00 ? 1221 HIS A NE2  1  
ATOM 1361  H H    . HIS A 1 89  ? -4.202  6.756   -1.851  1.00 0.00 ? 1221 HIS A H    1  
ATOM 1362  H HA   . HIS A 1 89  ? -5.724  9.158   -2.267  1.00 0.00 ? 1221 HIS A HA   1  
ATOM 1363  H HB2  . HIS A 1 89  ? -6.272  7.099   -0.754  1.00 0.00 ? 1221 HIS A HB2  1  
ATOM 1364  H HB3  . HIS A 1 89  ? -5.271  7.930   0.432   1.00 0.00 ? 1221 HIS A HB3  1  
ATOM 1365  H HD1  . HIS A 1 89  ? -8.496  8.302   -1.469  1.00 0.00 ? 1221 HIS A HD1  1  
ATOM 1366  H HD2  . HIS A 1 89  ? -6.458  10.095  1.676   1.00 0.00 ? 1221 HIS A HD2  1  
ATOM 1367  H HE1  . HIS A 1 89  ? -10.139 9.893   -0.424  1.00 0.00 ? 1221 HIS A HE1  1  
ATOM 1368  H HE2  . HIS A 1 89  ? -8.857  11.029  1.423   1.00 0.00 ? 1221 HIS A HE2  1  
ATOM 1369  N N    . PHE A 1 90  ? -3.035  9.225   -0.359  1.00 0.00 ? 1222 PHE A N    1  
ATOM 1370  C CA   . PHE A 1 90  ? -2.035  10.108  0.230   1.00 0.00 ? 1222 PHE A CA   1  
ATOM 1371  C C    . PHE A 1 90  ? -1.545  11.131  -0.790  1.00 0.00 ? 1222 PHE A C    1  
ATOM 1372  O O    . PHE A 1 90  ? -1.364  12.306  -0.468  1.00 0.00 ? 1222 PHE A O    1  
ATOM 1373  C CB   . PHE A 1 90  ? -0.853  9.293   0.760   1.00 0.00 ? 1222 PHE A CB   1  
ATOM 1374  C CG   . PHE A 1 90  ? 0.370   10.120  1.036   1.00 0.00 ? 1222 PHE A CG   1  
ATOM 1375  C CD1  . PHE A 1 90  ? 0.444   10.914  2.169   1.00 0.00 ? 1222 PHE A CD1  1  
ATOM 1376  C CD2  . PHE A 1 90  ? 1.445   10.104  0.162   1.00 0.00 ? 1222 PHE A CD2  1  
ATOM 1377  C CE1  . PHE A 1 90  ? 1.568   11.677  2.425   1.00 0.00 ? 1222 PHE A CE1  1  
ATOM 1378  C CE2  . PHE A 1 90  ? 2.572   10.865  0.413   1.00 0.00 ? 1222 PHE A CE2  1  
ATOM 1379  C CZ   . PHE A 1 90  ? 2.633   11.651  1.546   1.00 0.00 ? 1222 PHE A CZ   1  
ATOM 1380  H H    . PHE A 1 90  ? -2.922  8.254   -0.280  1.00 0.00 ? 1222 PHE A H    1  
ATOM 1381  H HA   . PHE A 1 90  ? -2.499  10.630  1.052   1.00 0.00 ? 1222 PHE A HA   1  
ATOM 1382  H HB2  . PHE A 1 90  ? -1.142  8.811   1.682   1.00 0.00 ? 1222 PHE A HB2  1  
ATOM 1383  H HB3  . PHE A 1 90  ? -0.589  8.540   0.032   1.00 0.00 ? 1222 PHE A HB3  1  
ATOM 1384  H HD1  . PHE A 1 90  ? -0.388  10.934  2.858   1.00 0.00 ? 1222 PHE A HD1  1  
ATOM 1385  H HD2  . PHE A 1 90  ? 1.398   9.489   -0.725  1.00 0.00 ? 1222 PHE A HD2  1  
ATOM 1386  H HE1  . PHE A 1 90  ? 1.614   12.291  3.312   1.00 0.00 ? 1222 PHE A HE1  1  
ATOM 1387  H HE2  . PHE A 1 90  ? 3.403   10.842  -0.276  1.00 0.00 ? 1222 PHE A HE2  1  
ATOM 1388  H HZ   . PHE A 1 90  ? 3.512   12.247  1.744   1.00 0.00 ? 1222 PHE A HZ   1  
ATOM 1389  N N    . CYS A 1 91  ? -1.332  10.677  -2.020  1.00 0.00 ? 1223 CYS A N    1  
ATOM 1390  C CA   . CYS A 1 91  ? -0.861  11.552  -3.087  1.00 0.00 ? 1223 CYS A CA   1  
ATOM 1391  C C    . CYS A 1 91  ? -2.026  12.294  -3.736  1.00 0.00 ? 1223 CYS A C    1  
ATOM 1392  O O    . CYS A 1 91  ? -1.891  13.449  -4.137  1.00 0.00 ? 1223 CYS A O    1  
ATOM 1393  C CB   . CYS A 1 91  ? -0.106  10.743  -4.143  1.00 0.00 ? 1223 CYS A CB   1  
ATOM 1394  S SG   . CYS A 1 91  ? -1.152  9.629   -5.108  1.00 0.00 ? 1223 CYS A SG   1  
ATOM 1395  H H    . CYS A 1 91  ? -1.494  9.730   -2.215  1.00 0.00 ? 1223 CYS A H    1  
ATOM 1396  H HA   . CYS A 1 91  ? -0.189  12.275  -2.650  1.00 0.00 ? 1223 CYS A HA   1  
ATOM 1397  H HB2  . CYS A 1 91  ? 0.373   11.423  -4.832  1.00 0.00 ? 1223 CYS A HB2  1  
ATOM 1398  H HB3  . CYS A 1 91  ? 0.650   10.146  -3.654  1.00 0.00 ? 1223 CYS A HB3  1  
ATOM 1399  H HG   . CYS A 1 91  ? -1.953  8.991   -4.268  1.00 0.00 ? 1223 CYS A HG   1  
ATOM 1400  N N    . GLN A 1 92  ? -3.167  11.620  -3.835  1.00 0.00 ? 1224 GLN A N    1  
ATOM 1401  C CA   . GLN A 1 92  ? -4.355  12.215  -4.437  1.00 0.00 ? 1224 GLN A CA   1  
ATOM 1402  C C    . GLN A 1 92  ? -4.845  13.403  -3.616  1.00 0.00 ? 1224 GLN A C    1  
ATOM 1403  O O    . GLN A 1 92  ? -5.398  14.361  -4.157  1.00 0.00 ? 1224 GLN A O    1  
ATOM 1404  C CB   . GLN A 1 92  ? -5.467  11.172  -4.561  1.00 0.00 ? 1224 GLN A CB   1  
ATOM 1405  C CG   . GLN A 1 92  ? -5.367  10.322  -5.817  1.00 0.00 ? 1224 GLN A CG   1  
ATOM 1406  C CD   . GLN A 1 92  ? -5.859  11.048  -7.054  1.00 0.00 ? 1224 GLN A CD   1  
ATOM 1407  O OE1  . GLN A 1 92  ? -5.174  11.917  -7.592  1.00 0.00 ? 1224 GLN A OE1  1  
ATOM 1408  N NE2  . GLN A 1 92  ? -7.055  10.694  -7.511  1.00 0.00 ? 1224 GLN A NE2  1  
ATOM 1409  H H    . GLN A 1 92  ? -3.212  10.702  -3.497  1.00 0.00 ? 1224 GLN A H    1  
ATOM 1410  H HA   . GLN A 1 92  ? -4.088  12.562  -5.424  1.00 0.00 ? 1224 GLN A HA   1  
ATOM 1411  H HB2  . GLN A 1 92  ? -5.426  10.517  -3.704  1.00 0.00 ? 1224 GLN A HB2  1  
ATOM 1412  H HB3  . GLN A 1 92  ? -6.420  11.680  -4.571  1.00 0.00 ? 1224 GLN A HB3  1  
ATOM 1413  H HG2  . GLN A 1 92  ? -4.333  10.047  -5.969  1.00 0.00 ? 1224 GLN A HG2  1  
ATOM 1414  H HG3  . GLN A 1 92  ? -5.960  9.430   -5.681  1.00 0.00 ? 1224 GLN A HG3  1  
ATOM 1415  H HE21 . GLN A 1 92  ? -7.545  9.994   -7.031  1.00 0.00 ? 1224 GLN A HE21 1  
ATOM 1416  H HE22 . GLN A 1 92  ? -7.398  11.147  -8.308  1.00 0.00 ? 1224 GLN A HE22 1  
ATOM 1417  N N    . THR A 1 93  ? -4.638  13.335  -2.304  1.00 0.00 ? 1225 THR A N    1  
ATOM 1418  C CA   . THR A 1 93  ? -5.060  14.403  -1.407  1.00 0.00 ? 1225 THR A CA   1  
ATOM 1419  C C    . THR A 1 93  ? -3.968  15.456  -1.254  1.00 0.00 ? 1225 THR A C    1  
ATOM 1420  O O    . THR A 1 93  ? -4.222  16.562  -0.781  1.00 0.00 ? 1225 THR A O    1  
ATOM 1421  C CB   . THR A 1 93  ? -5.428  13.856  -0.015  1.00 0.00 ? 1225 THR A CB   1  
ATOM 1422  O OG1  . THR A 1 93  ? -5.688  14.939  0.885   1.00 0.00 ? 1225 THR A OG1  1  
ATOM 1423  C CG2  . THR A 1 93  ? -4.309  12.987  0.538   1.00 0.00 ? 1225 THR A CG2  1  
ATOM 1424  H H    . THR A 1 93  ? -4.192  12.545  -1.932  1.00 0.00 ? 1225 THR A H    1  
ATOM 1425  H HA   . THR A 1 93  ? -5.938  14.868  -1.832  1.00 0.00 ? 1225 THR A HA   1  
ATOM 1426  H HB   . THR A 1 93  ? -6.320  13.252  -0.107  1.00 0.00 ? 1225 THR A HB   1  
ATOM 1427  H HG1  . THR A 1 93  ? -4.926  15.523  0.910   1.00 0.00 ? 1225 THR A HG1  1  
ATOM 1428  H HG21 . THR A 1 93  ? -3.518  12.909  -0.193  1.00 0.00 ? 1225 THR A HG21 1  
ATOM 1429  H HG22 . THR A 1 93  ? -4.693  12.002  0.759   1.00 0.00 ? 1225 THR A HG22 1  
ATOM 1430  H HG23 . THR A 1 93  ? -3.920  13.433  1.441   1.00 0.00 ? 1225 THR A HG23 1  
ATOM 1431  N N    . ASN A 1 94  ? -2.752  15.103  -1.658  1.00 0.00 ? 1226 ASN A N    1  
ATOM 1432  C CA   . ASN A 1 94  ? -1.621  16.019  -1.566  1.00 0.00 ? 1226 ASN A CA   1  
ATOM 1433  C C    . ASN A 1 94  ? -1.029  16.293  -2.945  1.00 0.00 ? 1226 ASN A C    1  
ATOM 1434  O O    . ASN A 1 94  ? 0.082   16.809  -3.063  1.00 0.00 ? 1226 ASN A O    1  
ATOM 1435  C CB   . ASN A 1 94  ? -0.546  15.442  -0.642  1.00 0.00 ? 1226 ASN A CB   1  
ATOM 1436  C CG   . ASN A 1 94  ? -0.869  15.654  0.824   1.00 0.00 ? 1226 ASN A CG   1  
ATOM 1437  O OD1  . ASN A 1 94  ? -0.258  16.489  1.492   1.00 0.00 ? 1226 ASN A OD1  1  
ATOM 1438  N ND2  . ASN A 1 94  ? -1.834  14.896  1.332   1.00 0.00 ? 1226 ASN A ND2  1  
ATOM 1439  H H    . ASN A 1 94  ? -2.612  14.206  -2.027  1.00 0.00 ? 1226 ASN A H    1  
ATOM 1440  H HA   . ASN A 1 94  ? -1.980  16.948  -1.150  1.00 0.00 ? 1226 ASN A HA   1  
ATOM 1441  H HB2  . ASN A 1 94  ? -0.457  14.381  -0.822  1.00 0.00 ? 1226 ASN A HB2  1  
ATOM 1442  H HB3  . ASN A 1 94  ? 0.399   15.919  -0.857  1.00 0.00 ? 1226 ASN A HB3  1  
ATOM 1443  H HD21 . ASN A 1 94  ? -2.277  14.252  0.741   1.00 0.00 ? 1226 ASN A HD21 1  
ATOM 1444  H HD22 . ASN A 1 94  ? -2.064  15.013  2.278   1.00 0.00 ? 1226 ASN A HD22 1  
ATOM 1445  N N    . SER A 1 95  ? -1.779  15.943  -3.985  1.00 0.00 ? 1227 SER A N    1  
ATOM 1446  C CA   . SER A 1 95  ? -1.327  16.148  -5.356  1.00 0.00 ? 1227 SER A CA   1  
ATOM 1447  C C    . SER A 1 95  ? 0.148   15.787  -5.502  1.00 0.00 ? 1227 SER A C    1  
ATOM 1448  O O    . SER A 1 95  ? 0.904   16.481  -6.183  1.00 0.00 ? 1227 SER A O    1  
ATOM 1449  C CB   . SER A 1 95  ? -1.553  17.602  -5.778  1.00 0.00 ? 1227 SER A CB   1  
ATOM 1450  O OG   . SER A 1 95  ? -1.584  17.724  -7.189  1.00 0.00 ? 1227 SER A OG   1  
ATOM 1451  H H    . SER A 1 95  ? -2.656  15.535  -3.826  1.00 0.00 ? 1227 SER A H    1  
ATOM 1452  H HA   . SER A 1 95  ? -1.909  15.502  -5.997  1.00 0.00 ? 1227 SER A HA   1  
ATOM 1453  H HB2  . SER A 1 95  ? -2.493  17.948  -5.378  1.00 0.00 ? 1227 SER A HB2  1  
ATOM 1454  H HB3  . SER A 1 95  ? -0.750  18.214  -5.393  1.00 0.00 ? 1227 SER A HB3  1  
ATOM 1455  H HG   . SER A 1 95  ? -0.964  17.103  -7.579  1.00 0.00 ? 1227 SER A HG   1  
ATOM 1456  N N    . VAL A 1 96  ? 0.550   14.696  -4.858  1.00 0.00 ? 1228 VAL A N    1  
ATOM 1457  C CA   . VAL A 1 96  ? 1.934   14.241  -4.916  1.00 0.00 ? 1228 VAL A CA   1  
ATOM 1458  C C    . VAL A 1 96  ? 2.163   13.330  -6.117  1.00 0.00 ? 1228 VAL A C    1  
ATOM 1459  O O    . VAL A 1 96  ? 1.288   12.549  -6.492  1.00 0.00 ? 1228 VAL A O    1  
ATOM 1460  C CB   . VAL A 1 96  ? 2.332   13.488  -3.632  1.00 0.00 ? 1228 VAL A CB   1  
ATOM 1461  C CG1  . VAL A 1 96  ? 3.760   12.977  -3.734  1.00 0.00 ? 1228 VAL A CG1  1  
ATOM 1462  C CG2  . VAL A 1 96  ? 2.162   14.386  -2.416  1.00 0.00 ? 1228 VAL A CG2  1  
ATOM 1463  H H    . VAL A 1 96  ? -0.100  14.185  -4.332  1.00 0.00 ? 1228 VAL A H    1  
ATOM 1464  H HA   . VAL A 1 96  ? 2.568   15.110  -5.010  1.00 0.00 ? 1228 VAL A HA   1  
ATOM 1465  H HB   . VAL A 1 96  ? 1.676   12.638  -3.520  1.00 0.00 ? 1228 VAL A HB   1  
ATOM 1466  H HG11 . VAL A 1 96  ? 4.445   13.813  -3.698  1.00 0.00 ? 1228 VAL A HG11 1  
ATOM 1467  H HG12 . VAL A 1 96  ? 3.963   12.309  -2.910  1.00 0.00 ? 1228 VAL A HG12 1  
ATOM 1468  H HG13 . VAL A 1 96  ? 3.888   12.448  -4.667  1.00 0.00 ? 1228 VAL A HG13 1  
ATOM 1469  H HG21 . VAL A 1 96  ? 2.250   15.419  -2.717  1.00 0.00 ? 1228 VAL A HG21 1  
ATOM 1470  H HG22 . VAL A 1 96  ? 1.188   14.220  -1.978  1.00 0.00 ? 1228 VAL A HG22 1  
ATOM 1471  H HG23 . VAL A 1 96  ? 2.927   14.155  -1.689  1.00 0.00 ? 1228 VAL A HG23 1  
ATOM 1472  N N    . GLN A 1 97  ? 3.344   13.436  -6.717  1.00 0.00 ? 1229 GLN A N    1  
ATOM 1473  C CA   . GLN A 1 97  ? 3.688   12.622  -7.876  1.00 0.00 ? 1229 GLN A CA   1  
ATOM 1474  C C    . GLN A 1 97  ? 3.749   11.144  -7.505  1.00 0.00 ? 1229 GLN A C    1  
ATOM 1475  O O    . GLN A 1 97  ? 4.096   10.790  -6.377  1.00 0.00 ? 1229 GLN A O    1  
ATOM 1476  C CB   . GLN A 1 97  ? 5.029   13.069  -8.460  1.00 0.00 ? 1229 GLN A CB   1  
ATOM 1477  C CG   . GLN A 1 97  ? 5.143   12.848  -9.960  1.00 0.00 ? 1229 GLN A CG   1  
ATOM 1478  C CD   . GLN A 1 97  ? 6.279   13.637  -10.582 1.00 0.00 ? 1229 GLN A CD   1  
ATOM 1479  O OE1  . GLN A 1 97  ? 7.076   14.258  -9.878  1.00 0.00 ? 1229 GLN A OE1  1  
ATOM 1480  N NE2  . GLN A 1 97  ? 6.359   13.617  -11.907 1.00 0.00 ? 1229 GLN A NE2  1  
ATOM 1481  H H    . GLN A 1 97  ? 4.000   14.077  -6.372  1.00 0.00 ? 1229 GLN A H    1  
ATOM 1482  H HA   . GLN A 1 97  ? 2.918   12.761  -8.619  1.00 0.00 ? 1229 GLN A HA   1  
ATOM 1483  H HB2  . GLN A 1 97  ? 5.162   14.122  -8.262  1.00 0.00 ? 1229 GLN A HB2  1  
ATOM 1484  H HB3  . GLN A 1 97  ? 5.821   12.517  -7.977  1.00 0.00 ? 1229 GLN A HB3  1  
ATOM 1485  H HG2  . GLN A 1 97  ? 5.312   11.798  -10.145 1.00 0.00 ? 1229 GLN A HG2  1  
ATOM 1486  H HG3  . GLN A 1 97  ? 4.217   13.150  -10.427 1.00 0.00 ? 1229 GLN A HG3  1  
ATOM 1487  H HE21 . GLN A 1 97  ? 5.687   13.102  -12.403 1.00 0.00 ? 1229 GLN A HE21 1  
ATOM 1488  H HE22 . GLN A 1 97  ? 7.082   14.119  -12.335 1.00 0.00 ? 1229 GLN A HE22 1  
ATOM 1489  N N    . THR A 1 98  ? 3.410   10.284  -8.460  1.00 0.00 ? 1230 THR A N    1  
ATOM 1490  C CA   . THR A 1 98  ? 3.425   8.844   -8.233  1.00 0.00 ? 1230 THR A CA   1  
ATOM 1491  C C    . THR A 1 98  ? 3.808   8.091   -9.502  1.00 0.00 ? 1230 THR A C    1  
ATOM 1492  O O    . THR A 1 98  ? 4.135   8.699   -10.521 1.00 0.00 ? 1230 THR A O    1  
ATOM 1493  C CB   . THR A 1 98  ? 2.055   8.339   -7.742  1.00 0.00 ? 1230 THR A CB   1  
ATOM 1494  O OG1  . THR A 1 98  ? 1.024   8.775   -8.635  1.00 0.00 ? 1230 THR A OG1  1  
ATOM 1495  C CG2  . THR A 1 98  ? 1.764   8.843   -6.337  1.00 0.00 ? 1230 THR A CG2  1  
ATOM 1496  H H    . THR A 1 98  ? 3.144   10.627  -9.338  1.00 0.00 ? 1230 THR A H    1  
ATOM 1497  H HA   . THR A 1 98  ? 4.158   8.635   -7.467  1.00 0.00 ? 1230 THR A HA   1  
ATOM 1498  H HB   . THR A 1 98  ? 2.072   7.258   -7.725  1.00 0.00 ? 1230 THR A HB   1  
ATOM 1499  H HG1  . THR A 1 98  ? 0.193   8.838   -8.157  1.00 0.00 ? 1230 THR A HG1  1  
ATOM 1500  H HG21 . THR A 1 98  ? 1.383   9.852   -6.388  1.00 0.00 ? 1230 THR A HG21 1  
ATOM 1501  H HG22 . THR A 1 98  ? 2.673   8.830   -5.755  1.00 0.00 ? 1230 THR A HG22 1  
ATOM 1502  H HG23 . THR A 1 98  ? 1.029   8.204   -5.871  1.00 0.00 ? 1230 THR A HG23 1  
ATOM 1503  N N    . ASP A 1 99  ? 3.763   6.765   -9.434  1.00 0.00 ? 1231 ASP A N    1  
ATOM 1504  C CA   . ASP A 1 99  ? 4.103   5.929   -10.579 1.00 0.00 ? 1231 ASP A CA   1  
ATOM 1505  C C    . ASP A 1 99  ? 5.342   6.461   -11.291 1.00 0.00 ? 1231 ASP A C    1  
ATOM 1506  O O    . ASP A 1 99  ? 5.345   6.631   -12.511 1.00 0.00 ? 1231 ASP A O    1  
ATOM 1507  C CB   . ASP A 1 99  ? 2.927   5.862   -11.555 1.00 0.00 ? 1231 ASP A CB   1  
ATOM 1508  C CG   . ASP A 1 99  ? 2.601   7.212   -12.162 1.00 0.00 ? 1231 ASP A CG   1  
ATOM 1509  O OD1  . ASP A 1 99  ? 1.812   7.962   -11.549 1.00 0.00 ? 1231 ASP A OD1  1  
ATOM 1510  O OD2  . ASP A 1 99  ? 3.133   7.519   -13.249 1.00 0.00 ? 1231 ASP A OD2  1  
ATOM 1511  H H    . ASP A 1 99  ? 3.493   6.339   -8.593  1.00 0.00 ? 1231 ASP A H    1  
ATOM 1512  H HA   . ASP A 1 99  ? 4.312   4.935   -10.213 1.00 0.00 ? 1231 ASP A HA   1  
ATOM 1513  H HB2  . ASP A 1 99  ? 3.171   5.178   -12.356 1.00 0.00 ? 1231 ASP A HB2  1  
ATOM 1514  H HB3  . ASP A 1 99  ? 2.054   5.501   -11.033 1.00 0.00 ? 1231 ASP A HB3  1  
ATOM 1515  N N    . LEU A 1 100 ? 6.394   6.722   -10.522 1.00 0.00 ? 1232 LEU A N    1  
ATOM 1516  C CA   . LEU A 1 100 ? 7.640   7.236   -11.079 1.00 0.00 ? 1232 LEU A CA   1  
ATOM 1517  C C    . LEU A 1 100 ? 8.481   6.106   -11.667 1.00 0.00 ? 1232 LEU A C    1  
ATOM 1518  O O    . LEU A 1 100 ? 9.698   6.067   -11.489 1.00 0.00 ? 1232 LEU A O    1  
ATOM 1519  C CB   . LEU A 1 100 ? 8.438   7.973   -10.002 1.00 0.00 ? 1232 LEU A CB   1  
ATOM 1520  C CG   . LEU A 1 100 ? 7.695   9.084   -9.260  1.00 0.00 ? 1232 LEU A CG   1  
ATOM 1521  C CD1  . LEU A 1 100 ? 8.387   9.401   -7.943  1.00 0.00 ? 1232 LEU A CD1  1  
ATOM 1522  C CD2  . LEU A 1 100 ? 7.596   10.331  -10.127 1.00 0.00 ? 1232 LEU A CD2  1  
ATOM 1523  H H    . LEU A 1 100 ? 6.331   6.566   -9.557  1.00 0.00 ? 1232 LEU A H    1  
ATOM 1524  H HA   . LEU A 1 100 ? 7.389   7.929   -11.868 1.00 0.00 ? 1232 LEU A HA   1  
ATOM 1525  H HB2  . LEU A 1 100 ? 8.759   7.245   -9.273  1.00 0.00 ? 1232 LEU A HB2  1  
ATOM 1526  H HB3  . LEU A 1 100 ? 9.304   8.412   -10.476 1.00 0.00 ? 1232 LEU A HB3  1  
ATOM 1527  H HG   . LEU A 1 100 ? 6.691   8.751   -9.037  1.00 0.00 ? 1232 LEU A HG   1  
ATOM 1528  H HD11 . LEU A 1 100 ? 7.706   9.937   -7.299  1.00 0.00 ? 1232 LEU A HD11 1  
ATOM 1529  H HD12 . LEU A 1 100 ? 9.258   10.011  -8.132  1.00 0.00 ? 1232 LEU A HD12 1  
ATOM 1530  H HD13 . LEU A 1 100 ? 8.688   8.481   -7.464  1.00 0.00 ? 1232 LEU A HD13 1  
ATOM 1531  H HD21 . LEU A 1 100 ? 8.375   10.311  -10.875 1.00 0.00 ? 1232 LEU A HD21 1  
ATOM 1532  H HD22 . LEU A 1 100 ? 7.713   11.209  -9.508  1.00 0.00 ? 1232 LEU A HD22 1  
ATOM 1533  H HD23 . LEU A 1 100 ? 6.632   10.357  -10.611 1.00 0.00 ? 1232 LEU A HD23 1  
ATOM 1534  N N    . PHE A 1 101 ? 7.823   5.190   -12.369 1.00 0.00 ? 1233 PHE A N    1  
ATOM 1535  C CA   . PHE A 1 101 ? 8.509   4.060   -12.985 1.00 0.00 ? 1233 PHE A CA   1  
ATOM 1536  C C    . PHE A 1 101 ? 9.121   4.459   -14.324 1.00 0.00 ? 1233 PHE A C    1  
ATOM 1537  O O    . PHE A 1 101 ? 8.941   5.584   -14.791 1.00 0.00 ? 1233 PHE A O    1  
ATOM 1538  C CB   . PHE A 1 101 ? 7.540   2.893   -13.181 1.00 0.00 ? 1233 PHE A CB   1  
ATOM 1539  C CG   . PHE A 1 101 ? 7.156   2.210   -11.900 1.00 0.00 ? 1233 PHE A CG   1  
ATOM 1540  C CD1  . PHE A 1 101 ? 6.379   2.863   -10.957 1.00 0.00 ? 1233 PHE A CD1  1  
ATOM 1541  C CD2  . PHE A 1 101 ? 7.572   0.914   -11.639 1.00 0.00 ? 1233 PHE A CD2  1  
ATOM 1542  C CE1  . PHE A 1 101 ? 6.025   2.237   -9.777  1.00 0.00 ? 1233 PHE A CE1  1  
ATOM 1543  C CE2  . PHE A 1 101 ? 7.221   0.283   -10.460 1.00 0.00 ? 1233 PHE A CE2  1  
ATOM 1544  C CZ   . PHE A 1 101 ? 6.445   0.945   -9.529  1.00 0.00 ? 1233 PHE A CZ   1  
ATOM 1545  H H    . PHE A 1 101 ? 6.852   5.276   -12.476 1.00 0.00 ? 1233 PHE A H    1  
ATOM 1546  H HA   . PHE A 1 101 ? 9.300   3.751   -12.319 1.00 0.00 ? 1233 PHE A HA   1  
ATOM 1547  H HB2  . PHE A 1 101 ? 6.636   3.259   -13.645 1.00 0.00 ? 1233 PHE A HB2  1  
ATOM 1548  H HB3  . PHE A 1 101 ? 7.998   2.158   -13.826 1.00 0.00 ? 1233 PHE A HB3  1  
ATOM 1549  H HD1  . PHE A 1 101 ? 6.048   3.873   -11.150 1.00 0.00 ? 1233 PHE A HD1  1  
ATOM 1550  H HD2  . PHE A 1 101 ? 8.179   0.395   -12.367 1.00 0.00 ? 1233 PHE A HD2  1  
ATOM 1551  H HE1  . PHE A 1 101 ? 5.418   2.756   -9.050  1.00 0.00 ? 1233 PHE A HE1  1  
ATOM 1552  H HE2  . PHE A 1 101 ? 7.552   -0.727  -10.269 1.00 0.00 ? 1233 PHE A HE2  1  
ATOM 1553  H HZ   . PHE A 1 101 ? 6.171   0.454   -8.607  1.00 0.00 ? 1233 PHE A HZ   1  
ATOM 1554  N N    . SER A 1 102 ? 9.845   3.529   -14.938 1.00 0.00 ? 1234 SER A N    1  
ATOM 1555  C CA   . SER A 1 102 ? 10.488  3.784   -16.222 1.00 0.00 ? 1234 SER A CA   1  
ATOM 1556  C C    . SER A 1 102 ? 9.599   3.326   -17.374 1.00 0.00 ? 1234 SER A C    1  
ATOM 1557  O O    . SER A 1 102 ? 9.336   4.084   -18.308 1.00 0.00 ? 1234 SER A O    1  
ATOM 1558  C CB   . SER A 1 102 ? 11.839  3.070   -16.290 1.00 0.00 ? 1234 SER A CB   1  
ATOM 1559  O OG   . SER A 1 102 ? 11.702  1.690   -16.003 1.00 0.00 ? 1234 SER A OG   1  
ATOM 1560  H H    . SER A 1 102 ? 9.952   2.651   -14.515 1.00 0.00 ? 1234 SER A H    1  
ATOM 1561  H HA   . SER A 1 102 ? 10.648  4.849   -16.307 1.00 0.00 ? 1234 SER A HA   1  
ATOM 1562  H HB2  . SER A 1 102 ? 12.252  3.180   -17.282 1.00 0.00 ? 1234 SER A HB2  1  
ATOM 1563  H HB3  . SER A 1 102 ? 12.513  3.511   -15.570 1.00 0.00 ? 1234 SER A HB3  1  
ATOM 1564  H HG   . SER A 1 102 ? 11.531  1.573   -15.065 1.00 0.00 ? 1234 SER A HG   1  
ATOM 1565  N N    . SER A 1 103 ? 9.141   2.081   -17.301 1.00 0.00 ? 1235 SER A N    1  
ATOM 1566  C CA   . SER A 1 103 ? 8.285   1.520   -18.340 1.00 0.00 ? 1235 SER A CA   1  
ATOM 1567  C C    . SER A 1 103 ? 6.813   1.637   -17.953 1.00 0.00 ? 1235 SER A C    1  
ATOM 1568  O O    . SER A 1 103 ? 6.256   0.750   -17.306 1.00 0.00 ? 1235 SER A O    1  
ATOM 1569  C CB   . SER A 1 103 ? 8.643   0.053   -18.588 1.00 0.00 ? 1235 SER A CB   1  
ATOM 1570  O OG   . SER A 1 103 ? 7.846   -0.499  -19.621 1.00 0.00 ? 1235 SER A OG   1  
ATOM 1571  H H    . SER A 1 103 ? 9.386   1.526   -16.532 1.00 0.00 ? 1235 SER A H    1  
ATOM 1572  H HA   . SER A 1 103 ? 8.452   2.081   -19.247 1.00 0.00 ? 1235 SER A HA   1  
ATOM 1573  H HB2  . SER A 1 103 ? 9.681   -0.018  -18.875 1.00 0.00 ? 1235 SER A HB2  1  
ATOM 1574  H HB3  . SER A 1 103 ? 8.480   -0.513  -17.682 1.00 0.00 ? 1235 SER A HB3  1  
ATOM 1575  H HG   . SER A 1 103 ? 6.945   -0.178  -19.537 1.00 0.00 ? 1235 SER A HG   1  
ATOM 1576  N N    . THR A 1 104 ? 6.188   2.739   -18.356 1.00 0.00 ? 1236 THR A N    1  
ATOM 1577  C CA   . THR A 1 104 ? 4.783   2.975   -18.051 1.00 0.00 ? 1236 THR A CA   1  
ATOM 1578  C C    . THR A 1 104 ? 3.893   2.584   -19.226 1.00 0.00 ? 1236 THR A C    1  
ATOM 1579  O O    . THR A 1 104 ? 4.382   2.196   -20.287 1.00 0.00 ? 1236 THR A O    1  
ATOM 1580  C CB   . THR A 1 104 ? 4.525   4.451   -17.696 1.00 0.00 ? 1236 THR A CB   1  
ATOM 1581  O OG1  . THR A 1 104 ? 3.177   4.618   -17.242 1.00 0.00 ? 1236 THR A OG1  1  
ATOM 1582  C CG2  . THR A 1 104 ? 4.774   5.349   -18.898 1.00 0.00 ? 1236 THR A CG2  1  
ATOM 1583  H H    . THR A 1 104 ? 6.686   3.409   -18.868 1.00 0.00 ? 1236 THR A H    1  
ATOM 1584  H HA   . THR A 1 104 ? 4.521   2.369   -17.196 1.00 0.00 ? 1236 THR A HA   1  
ATOM 1585  H HB   . THR A 1 104 ? 5.202   4.739   -16.904 1.00 0.00 ? 1236 THR A HB   1  
ATOM 1586  H HG1  . THR A 1 104 ? 2.895   5.522   -17.400 1.00 0.00 ? 1236 THR A HG1  1  
ATOM 1587  H HG21 . THR A 1 104 ? 4.370   6.331   -18.705 1.00 0.00 ? 1236 THR A HG21 1  
ATOM 1588  H HG22 . THR A 1 104 ? 4.294   4.927   -19.768 1.00 0.00 ? 1236 THR A HG22 1  
ATOM 1589  H HG23 . THR A 1 104 ? 5.837   5.426   -19.075 1.00 0.00 ? 1236 THR A HG23 1  
ATOM 1590  N N    . LYS A 1 105 ? 2.583   2.689   -19.030 1.00 0.00 ? 1237 LYS A N    1  
ATOM 1591  C CA   . LYS A 1 105 ? 1.623   2.348   -20.073 1.00 0.00 ? 1237 LYS A CA   1  
ATOM 1592  C C    . LYS A 1 105 ? 0.784   3.562   -20.458 1.00 0.00 ? 1237 LYS A C    1  
ATOM 1593  O O    . LYS A 1 105 ? 0.432   4.394   -19.622 1.00 0.00 ? 1237 LYS A O    1  
ATOM 1594  C CB   . LYS A 1 105 ? 0.711   1.212   -19.605 1.00 0.00 ? 1237 LYS A CB   1  
ATOM 1595  C CG   . LYS A 1 105 ? 0.040   1.483   -18.269 1.00 0.00 ? 1237 LYS A CG   1  
ATOM 1596  C CD   . LYS A 1 105 ? 0.882   0.978   -17.110 1.00 0.00 ? 1237 LYS A CD   1  
ATOM 1597  C CE   . LYS A 1 105 ? 0.236   1.300   -15.770 1.00 0.00 ? 1237 LYS A CE   1  
ATOM 1598  N NZ   . LYS A 1 105 ? 0.506   2.702   -15.348 1.00 0.00 ? 1237 LYS A NZ   1  
ATOM 1599  H H    . LYS A 1 105 ? 2.253   3.004   -18.162 1.00 0.00 ? 1237 LYS A H    1  
ATOM 1600  H HA   . LYS A 1 105 ? 2.177   2.019   -20.939 1.00 0.00 ? 1237 LYS A HA   1  
ATOM 1601  H HB2  . LYS A 1 105 ? -0.059  1.056   -20.346 1.00 0.00 ? 1237 LYS A HB2  1  
ATOM 1602  H HB3  . LYS A 1 105 ? 1.298   0.310   -19.512 1.00 0.00 ? 1237 LYS A HB3  1  
ATOM 1603  H HG2  . LYS A 1 105 ? -0.105  2.547   -18.158 1.00 0.00 ? 1237 LYS A HG2  1  
ATOM 1604  H HG3  . LYS A 1 105 ? -0.919  0.983   -18.251 1.00 0.00 ? 1237 LYS A HG3  1  
ATOM 1605  H HD2  . LYS A 1 105 ? 0.991   -0.093  -17.195 1.00 0.00 ? 1237 LYS A HD2  1  
ATOM 1606  H HD3  . LYS A 1 105 ? 1.855   1.446   -17.152 1.00 0.00 ? 1237 LYS A HD3  1  
ATOM 1607  H HE2  . LYS A 1 105 ? -0.830  1.158   -15.856 1.00 0.00 ? 1237 LYS A HE2  1  
ATOM 1608  H HE3  . LYS A 1 105 ? 0.631   0.626   -15.024 1.00 0.00 ? 1237 LYS A HE3  1  
ATOM 1609  H HZ1  . LYS A 1 105 ? 1.526   2.899   -15.395 1.00 0.00 ? 1237 LYS A HZ1  1  
ATOM 1610  H HZ2  . LYS A 1 105 ? 0.181   2.850   -14.372 1.00 0.00 ? 1237 LYS A HZ2  1  
ATOM 1611  H HZ3  . LYS A 1 105 ? 0.006   3.366   -15.973 1.00 0.00 ? 1237 LYS A HZ3  1  
ATOM 1612  N N    . PRO A 1 106 ? 0.454   3.668   -21.754 1.00 0.00 ? 1238 PRO A N    1  
ATOM 1613  C CA   . PRO A 1 106 ? -0.350  4.776   -22.278 1.00 0.00 ? 1238 PRO A CA   1  
ATOM 1614  C C    . PRO A 1 106 ? -1.800  4.711   -21.813 1.00 0.00 ? 1238 PRO A C    1  
ATOM 1615  O O    . PRO A 1 106 ? -2.166  3.851   -21.013 1.00 0.00 ? 1238 PRO A O    1  
ATOM 1616  C CB   . PRO A 1 106 ? -0.265  4.589   -23.795 1.00 0.00 ? 1238 PRO A CB   1  
ATOM 1617  C CG   . PRO A 1 106 ? 0.003   3.135   -23.983 1.00 0.00 ? 1238 PRO A CG   1  
ATOM 1618  C CD   . PRO A 1 106 ? 0.840   2.713   -22.807 1.00 0.00 ? 1238 PRO A CD   1  
ATOM 1619  H HA   . PRO A 1 106 ? 0.071   5.734   -22.009 1.00 0.00 ? 1238 PRO A HA   1  
ATOM 1620  H HB2  . PRO A 1 106 ? -1.202  4.880   -24.249 1.00 0.00 ? 1238 PRO A HB2  1  
ATOM 1621  H HB3  . PRO A 1 106 ? 0.537   5.192   -24.192 1.00 0.00 ? 1238 PRO A HB3  1  
ATOM 1622  H HG2  . PRO A 1 106 ? -0.927  2.589   -23.997 1.00 0.00 ? 1238 PRO A HG2  1  
ATOM 1623  H HG3  . PRO A 1 106 ? 0.545   2.979   -24.904 1.00 0.00 ? 1238 PRO A HG3  1  
ATOM 1624  H HD2  . PRO A 1 106 ? 0.600   1.701   -22.517 1.00 0.00 ? 1238 PRO A HD2  1  
ATOM 1625  H HD3  . PRO A 1 106 ? 1.891   2.802   -23.040 1.00 0.00 ? 1238 PRO A HD3  1  
ATOM 1626  N N    . GLN A 1 107 ? -2.621  5.625   -22.320 1.00 0.00 ? 1239 GLN A N    1  
ATOM 1627  C CA   . GLN A 1 107 ? -4.032  5.670   -21.956 1.00 0.00 ? 1239 GLN A CA   1  
ATOM 1628  C C    . GLN A 1 107 ? -4.915  5.692   -23.199 1.00 0.00 ? 1239 GLN A C    1  
ATOM 1629  O O    . GLN A 1 107 ? -5.327  6.756   -23.661 1.00 0.00 ? 1239 GLN A O    1  
ATOM 1630  C CB   . GLN A 1 107 ? -4.318  6.899   -21.091 1.00 0.00 ? 1239 GLN A CB   1  
ATOM 1631  C CG   . GLN A 1 107 ? -3.600  6.881   -19.751 1.00 0.00 ? 1239 GLN A CG   1  
ATOM 1632  C CD   . GLN A 1 107 ? -3.598  8.236   -19.072 1.00 0.00 ? 1239 GLN A CD   1  
ATOM 1633  O OE1  . GLN A 1 107 ? -2.831  9.127   -19.441 1.00 0.00 ? 1239 GLN A OE1  1  
ATOM 1634  N NE2  . GLN A 1 107 ? -4.457  8.400   -18.073 1.00 0.00 ? 1239 GLN A NE2  1  
ATOM 1635  H H    . GLN A 1 107 ? -2.270  6.284   -22.954 1.00 0.00 ? 1239 GLN A H    1  
ATOM 1636  H HA   . GLN A 1 107 ? -4.256  4.781   -21.386 1.00 0.00 ? 1239 GLN A HA   1  
ATOM 1637  H HB2  . GLN A 1 107 ? -4.008  7.783   -21.629 1.00 0.00 ? 1239 GLN A HB2  1  
ATOM 1638  H HB3  . GLN A 1 107 ? -5.380  6.954   -20.905 1.00 0.00 ? 1239 GLN A HB3  1  
ATOM 1639  H HG2  . GLN A 1 107 ? -4.093  6.172   -19.103 1.00 0.00 ? 1239 GLN A HG2  1  
ATOM 1640  H HG3  . GLN A 1 107 ? -2.578  6.571   -19.910 1.00 0.00 ? 1239 GLN A HG3  1  
ATOM 1641  H HE21 . GLN A 1 107 ? -5.036  7.645   -17.833 1.00 0.00 ? 1239 GLN A HE21 1  
ATOM 1642  H HE22 . GLN A 1 107 ? -4.476  9.265   -17.616 1.00 0.00 ? 1239 GLN A HE22 1  
ATOM 1643  N N    . SER A 1 108 ? -5.201  4.510   -23.736 1.00 0.00 ? 1240 SER A N    1  
ATOM 1644  C CA   . SER A 1 108 ? -6.032  4.394   -24.929 1.00 0.00 ? 1240 SER A CA   1  
ATOM 1645  C C    . SER A 1 108 ? -7.507  4.282   -24.555 1.00 0.00 ? 1240 SER A C    1  
ATOM 1646  O O    . SER A 1 108 ? -8.374  4.184   -25.422 1.00 0.00 ? 1240 SER A O    1  
ATOM 1647  C CB   . SER A 1 108 ? -5.610  3.177   -25.754 1.00 0.00 ? 1240 SER A CB   1  
ATOM 1648  O OG   . SER A 1 108 ? -5.699  1.987   -24.989 1.00 0.00 ? 1240 SER A OG   1  
ATOM 1649  H H    . SER A 1 108 ? -4.843  3.698   -23.322 1.00 0.00 ? 1240 SER A H    1  
ATOM 1650  H HA   . SER A 1 108 ? -5.890  5.286   -25.520 1.00 0.00 ? 1240 SER A HA   1  
ATOM 1651  H HB2  . SER A 1 108 ? -6.256  3.086   -26.613 1.00 0.00 ? 1240 SER A HB2  1  
ATOM 1652  H HB3  . SER A 1 108 ? -4.589  3.305   -26.082 1.00 0.00 ? 1240 SER A HB3  1  
ATOM 1653  H HG   . SER A 1 108 ? -5.765  2.209   -24.057 1.00 0.00 ? 1240 SER A HG   1  
ATOM 1654  N N    . GLY A 1 109 ? -7.784  4.299   -23.254 1.00 0.00 ? 1241 GLY A N    1  
ATOM 1655  C CA   . GLY A 1 109 ? -9.155  4.199   -22.786 1.00 0.00 ? 1241 GLY A CA   1  
ATOM 1656  C C    . GLY A 1 109 ? -9.780  2.856   -23.107 1.00 0.00 ? 1241 GLY A C    1  
ATOM 1657  O O    . GLY A 1 109 ? -10.512 2.706   -24.086 1.00 0.00 ? 1241 GLY A O    1  
ATOM 1658  H H    . GLY A 1 109 ? -7.052  4.380   -22.607 1.00 0.00 ? 1241 GLY A H    1  
ATOM 1659  H HA2  . GLY A 1 109 ? -9.170  4.345   -21.717 1.00 0.00 ? 1241 GLY A HA2  1  
ATOM 1660  H HA3  . GLY A 1 109 ? -9.740  4.976   -23.254 1.00 0.00 ? 1241 GLY A HA3  1  
ATOM 1661  N N    . PRO A 1 110 ? -9.490  1.848   -22.271 1.00 0.00 ? 1242 PRO A N    1  
ATOM 1662  C CA   . PRO A 1 110 ? -10.018 0.493   -22.450 1.00 0.00 ? 1242 PRO A CA   1  
ATOM 1663  C C    . PRO A 1 110 ? -11.517 0.414   -22.181 1.00 0.00 ? 1242 PRO A C    1  
ATOM 1664  O O    . PRO A 1 110 ? -12.142 1.405   -21.803 1.00 0.00 ? 1242 PRO A O    1  
ATOM 1665  C CB   . PRO A 1 110 ? -9.245  -0.329  -21.416 1.00 0.00 ? 1242 PRO A CB   1  
ATOM 1666  C CG   . PRO A 1 110 ? -8.854  0.654   -20.367 1.00 0.00 ? 1242 PRO A CG   1  
ATOM 1667  C CD   . PRO A 1 110 ? -8.624  1.955   -21.084 1.00 0.00 ? 1242 PRO A CD   1  
ATOM 1668  H HA   . PRO A 1 110 ? -9.811  0.114   -23.441 1.00 0.00 ? 1242 PRO A HA   1  
ATOM 1669  H HB2  . PRO A 1 110 ? -9.886  -1.102  -21.015 1.00 0.00 ? 1242 PRO A HB2  1  
ATOM 1670  H HB3  . PRO A 1 110 ? -8.379  -0.777  -21.880 1.00 0.00 ? 1242 PRO A HB3  1  
ATOM 1671  H HG2  . PRO A 1 110 ? -9.650  0.758   -19.646 1.00 0.00 ? 1242 PRO A HG2  1  
ATOM 1672  H HG3  . PRO A 1 110 ? -7.946  0.329   -19.881 1.00 0.00 ? 1242 PRO A HG3  1  
ATOM 1673  H HD2  . PRO A 1 110 ? -8.922  2.786   -20.463 1.00 0.00 ? 1242 PRO A HD2  1  
ATOM 1674  H HD3  . PRO A 1 110 ? -7.587  2.050   -21.372 1.00 0.00 ? 1242 PRO A HD3  1  
ATOM 1675  N N    . SER A 1 111 ? -12.088 -0.770  -22.379 1.00 0.00 ? 1243 SER A N    1  
ATOM 1676  C CA   . SER A 1 111 ? -13.514 -0.976  -22.160 1.00 0.00 ? 1243 SER A CA   1  
ATOM 1677  C C    . SER A 1 111 ? -13.848 -2.465  -22.121 1.00 0.00 ? 1243 SER A C    1  
ATOM 1678  O O    . SER A 1 111 ? -13.754 -3.160  -23.133 1.00 0.00 ? 1243 SER A O    1  
ATOM 1679  C CB   . SER A 1 111 ? -14.325 -0.289  -23.261 1.00 0.00 ? 1243 SER A CB   1  
ATOM 1680  O OG   . SER A 1 111 ? -15.702 -0.246  -22.928 1.00 0.00 ? 1243 SER A OG   1  
ATOM 1681  H H    . SER A 1 111 ? -11.536 -1.522  -22.680 1.00 0.00 ? 1243 SER A H    1  
ATOM 1682  H HA   . SER A 1 111 ? -13.771 -0.537  -21.208 1.00 0.00 ? 1243 SER A HA   1  
ATOM 1683  H HB2  . SER A 1 111 ? -13.967 0.721   -23.391 1.00 0.00 ? 1243 SER A HB2  1  
ATOM 1684  H HB3  . SER A 1 111 ? -14.207 -0.835  -24.185 1.00 0.00 ? 1243 SER A HB3  1  
ATOM 1685  H HG   . SER A 1 111 ? -16.141 0.414   -23.470 1.00 0.00 ? 1243 SER A HG   1  
ATOM 1686  N N    . SER A 1 112 ? -14.239 -2.947  -20.946 1.00 0.00 ? 1244 SER A N    1  
ATOM 1687  C CA   . SER A 1 112 ? -14.583 -4.353  -20.772 1.00 0.00 ? 1244 SER A CA   1  
ATOM 1688  C C    . SER A 1 112 ? -15.761 -4.510  -19.816 1.00 0.00 ? 1244 SER A C    1  
ATOM 1689  O O    . SER A 1 112 ? -16.195 -3.547  -19.185 1.00 0.00 ? 1244 SER A O    1  
ATOM 1690  C CB   . SER A 1 112 ? -13.377 -5.134  -20.247 1.00 0.00 ? 1244 SER A CB   1  
ATOM 1691  O OG   . SER A 1 112 ? -12.549 -5.570  -21.311 1.00 0.00 ? 1244 SER A OG   1  
ATOM 1692  H H    . SER A 1 112 ? -14.294 -2.342  -20.176 1.00 0.00 ? 1244 SER A H    1  
ATOM 1693  H HA   . SER A 1 112 ? -14.864 -4.747  -21.738 1.00 0.00 ? 1244 SER A HA   1  
ATOM 1694  H HB2  . SER A 1 112 ? -12.798 -4.500  -19.593 1.00 0.00 ? 1244 SER A HB2  1  
ATOM 1695  H HB3  . SER A 1 112 ? -13.723 -5.998  -19.698 1.00 0.00 ? 1244 SER A HB3  1  
ATOM 1696  H HG   . SER A 1 112 ? -13.073 -6.071  -21.940 1.00 0.00 ? 1244 SER A HG   1  
ATOM 1697  N N    . GLY A 1 113 ? -16.274 -5.732  -19.714 1.00 0.00 ? 1245 GLY A N    1  
ATOM 1698  C CA   . GLY A 1 113 ? -17.397 -5.995  -18.833 1.00 0.00 ? 1245 GLY A CA   1  
ATOM 1699  C C    . GLY A 1 113 ? -18.608 -5.148  -19.170 1.00 0.00 ? 1245 GLY A C    1  
ATOM 1700  O O    . GLY A 1 113 ? -18.892 -4.897  -20.341 1.00 0.00 ? 1245 GLY A O    1  
ATOM 1701  H H    . GLY A 1 113 ? -15.887 -6.462  -20.241 1.00 0.00 ? 1245 GLY A H    1  
ATOM 1702  H HA2  . GLY A 1 113 ? -17.666 -7.037  -18.911 1.00 0.00 ? 1245 GLY A HA2  1  
ATOM 1703  H HA3  . GLY A 1 113 ? -17.098 -5.786  -17.816 1.00 0.00 ? 1245 GLY A HA3  1  
ATOM 1704  N N    . GLY A 1 1   ? 16.211  -10.057 -8.643  1.00 0.00 ? 1133 GLY A N    2  
ATOM 1705  C CA   . GLY A 1 1   ? 17.143  -10.708 -9.546  1.00 0.00 ? 1133 GLY A CA   2  
ATOM 1706  C C    . GLY A 1 1   ? 18.589  -10.428 -9.188  1.00 0.00 ? 1133 GLY A C    2  
ATOM 1707  O O    . GLY A 1 1   ? 18.875  -9.847  -8.141  1.00 0.00 ? 1133 GLY A O    2  
ATOM 1708  H H1   . GLY A 1 1   ? 16.550  -9.536  -7.885  1.00 0.00 ? 1133 GLY A H1   2  
ATOM 1709  H HA2  . GLY A 1 1   ? 16.974  -11.774 -9.513  1.00 0.00 ? 1133 GLY A HA2  2  
ATOM 1710  H HA3  . GLY A 1 1   ? 16.958  -10.355 -10.550 1.00 0.00 ? 1133 GLY A HA3  2  
ATOM 1711  N N    . SER A 1 2   ? 19.503  -10.842 -10.059 1.00 0.00 ? 1134 SER A N    2  
ATOM 1712  C CA   . SER A 1 2   ? 20.928  -10.638 -9.827  1.00 0.00 ? 1134 SER A CA   2  
ATOM 1713  C C    . SER A 1 2   ? 21.312  -9.179  -10.057 1.00 0.00 ? 1134 SER A C    2  
ATOM 1714  O O    . SER A 1 2   ? 21.408  -8.724  -11.197 1.00 0.00 ? 1134 SER A O    2  
ATOM 1715  C CB   . SER A 1 2   ? 21.751  -11.545 -10.744 1.00 0.00 ? 1134 SER A CB   2  
ATOM 1716  O OG   . SER A 1 2   ? 21.367  -11.384 -12.099 1.00 0.00 ? 1134 SER A OG   2  
ATOM 1717  H H    . SER A 1 2   ? 19.212  -11.299 -10.876 1.00 0.00 ? 1134 SER A H    2  
ATOM 1718  H HA   . SER A 1 2   ? 21.137  -10.895 -8.799  1.00 0.00 ? 1134 SER A HA   2  
ATOM 1719  H HB2  . SER A 1 2   ? 22.797  -11.296 -10.647 1.00 0.00 ? 1134 SER A HB2  2  
ATOM 1720  H HB3  . SER A 1 2   ? 21.598  -12.575 -10.459 1.00 0.00 ? 1134 SER A HB3  2  
ATOM 1721  H HG   . SER A 1 2   ? 21.258  -12.246 -12.505 1.00 0.00 ? 1134 SER A HG   2  
ATOM 1722  N N    . SER A 1 3   ? 21.531  -8.452  -8.966  1.00 0.00 ? 1135 SER A N    2  
ATOM 1723  C CA   . SER A 1 3   ? 21.901  -7.044  -9.048  1.00 0.00 ? 1135 SER A CA   2  
ATOM 1724  C C    . SER A 1 3   ? 23.074  -6.736  -8.122  1.00 0.00 ? 1135 SER A C    2  
ATOM 1725  O O    . SER A 1 3   ? 23.398  -7.519  -7.230  1.00 0.00 ? 1135 SER A O    2  
ATOM 1726  C CB   . SER A 1 3   ? 20.706  -6.159  -8.687  1.00 0.00 ? 1135 SER A CB   2  
ATOM 1727  O OG   . SER A 1 3   ? 21.017  -4.787  -8.858  1.00 0.00 ? 1135 SER A OG   2  
ATOM 1728  H H    . SER A 1 3   ? 21.438  -8.873  -8.086  1.00 0.00 ? 1135 SER A H    2  
ATOM 1729  H HA   . SER A 1 3   ? 22.196  -6.837  -10.065 1.00 0.00 ? 1135 SER A HA   2  
ATOM 1730  H HB2  . SER A 1 3   ? 19.871  -6.409  -9.323  1.00 0.00 ? 1135 SER A HB2  2  
ATOM 1731  H HB3  . SER A 1 3   ? 20.435  -6.329  -7.654  1.00 0.00 ? 1135 SER A HB3  2  
ATOM 1732  H HG   . SER A 1 3   ? 20.273  -4.339  -9.267  1.00 0.00 ? 1135 SER A HG   2  
ATOM 1733  N N    . GLY A 1 4   ? 23.708  -5.588  -8.342  1.00 0.00 ? 1136 GLY A N    2  
ATOM 1734  C CA   . GLY A 1 4   ? 24.838  -5.196  -7.521  1.00 0.00 ? 1136 GLY A CA   2  
ATOM 1735  C C    . GLY A 1 4   ? 25.467  -3.897  -7.983  1.00 0.00 ? 1136 GLY A C    2  
ATOM 1736  O O    . GLY A 1 4   ? 26.691  -3.776  -8.035  1.00 0.00 ? 1136 GLY A O    2  
ATOM 1737  H H    . GLY A 1 4   ? 23.405  -5.003  -9.068  1.00 0.00 ? 1136 GLY A H    2  
ATOM 1738  H HA2  . GLY A 1 4   ? 24.505  -5.079  -6.501  1.00 0.00 ? 1136 GLY A HA2  2  
ATOM 1739  H HA3  . GLY A 1 4   ? 25.584  -5.977  -7.559  1.00 0.00 ? 1136 GLY A HA3  2  
ATOM 1740  N N    . SER A 1 5   ? 24.629  -2.922  -8.322  1.00 0.00 ? 1137 SER A N    2  
ATOM 1741  C CA   . SER A 1 5   ? 25.110  -1.627  -8.788  1.00 0.00 ? 1137 SER A CA   2  
ATOM 1742  C C    . SER A 1 5   ? 25.376  -0.692  -7.612  1.00 0.00 ? 1137 SER A C    2  
ATOM 1743  O O    . SER A 1 5   ? 24.447  -0.220  -6.957  1.00 0.00 ? 1137 SER A O    2  
ATOM 1744  C CB   . SER A 1 5   ? 24.093  -0.993  -9.739  1.00 0.00 ? 1137 SER A CB   2  
ATOM 1745  O OG   . SER A 1 5   ? 22.851  -0.782  -9.090  1.00 0.00 ? 1137 SER A OG   2  
ATOM 1746  H H    . SER A 1 5   ? 23.663  -3.080  -8.259  1.00 0.00 ? 1137 SER A H    2  
ATOM 1747  H HA   . SER A 1 5   ? 26.035  -1.789  -9.320  1.00 0.00 ? 1137 SER A HA   2  
ATOM 1748  H HB2  . SER A 1 5   ? 24.471  -0.043  -10.084 1.00 0.00 ? 1137 SER A HB2  2  
ATOM 1749  H HB3  . SER A 1 5   ? 23.938  -1.648  -10.584 1.00 0.00 ? 1137 SER A HB3  2  
ATOM 1750  H HG   . SER A 1 5   ? 22.987  -0.252  -8.301  1.00 0.00 ? 1137 SER A HG   2  
ATOM 1751  N N    . SER A 1 6   ? 26.652  -0.428  -7.351  1.00 0.00 ? 1138 SER A N    2  
ATOM 1752  C CA   . SER A 1 6   ? 27.043  0.448   -6.253  1.00 0.00 ? 1138 SER A CA   2  
ATOM 1753  C C    . SER A 1 6   ? 27.048  1.908   -6.697  1.00 0.00 ? 1138 SER A C    2  
ATOM 1754  O O    . SER A 1 6   ? 26.881  2.209   -7.878  1.00 0.00 ? 1138 SER A O    2  
ATOM 1755  C CB   . SER A 1 6   ? 28.425  0.058   -5.728  1.00 0.00 ? 1138 SER A CB   2  
ATOM 1756  O OG   . SER A 1 6   ? 29.418  0.235   -6.723  1.00 0.00 ? 1138 SER A OG   2  
ATOM 1757  H H    . SER A 1 6   ? 27.348  -0.834  -7.910  1.00 0.00 ? 1138 SER A H    2  
ATOM 1758  H HA   . SER A 1 6   ? 26.319  0.328   -5.460  1.00 0.00 ? 1138 SER A HA   2  
ATOM 1759  H HB2  . SER A 1 6   ? 28.672  0.675   -4.877  1.00 0.00 ? 1138 SER A HB2  2  
ATOM 1760  H HB3  . SER A 1 6   ? 28.414  -0.980  -5.428  1.00 0.00 ? 1138 SER A HB3  2  
ATOM 1761  H HG   . SER A 1 6   ? 29.004  0.243   -7.590  1.00 0.00 ? 1138 SER A HG   2  
ATOM 1762  N N    . GLY A 1 7   ? 27.242  2.811   -5.741  1.00 0.00 ? 1139 GLY A N    2  
ATOM 1763  C CA   . GLY A 1 7   ? 27.266  4.228   -6.052  1.00 0.00 ? 1139 GLY A CA   2  
ATOM 1764  C C    . GLY A 1 7   ? 28.325  4.976   -5.266  1.00 0.00 ? 1139 GLY A C    2  
ATOM 1765  O O    . GLY A 1 7   ? 29.237  4.369   -4.706  1.00 0.00 ? 1139 GLY A O    2  
ATOM 1766  H H    . GLY A 1 7   ? 27.370  2.512   -4.816  1.00 0.00 ? 1139 GLY A H    2  
ATOM 1767  H HA2  . GLY A 1 7   ? 27.462  4.350   -7.107  1.00 0.00 ? 1139 GLY A HA2  2  
ATOM 1768  H HA3  . GLY A 1 7   ? 26.299  4.651   -5.824  1.00 0.00 ? 1139 GLY A HA3  2  
ATOM 1769  N N    . SER A 1 8   ? 28.204  6.299   -5.226  1.00 0.00 ? 1140 SER A N    2  
ATOM 1770  C CA   . SER A 1 8   ? 29.162  7.132   -4.507  1.00 0.00 ? 1140 SER A CA   2  
ATOM 1771  C C    . SER A 1 8   ? 28.488  7.855   -3.345  1.00 0.00 ? 1140 SER A C    2  
ATOM 1772  O O    . SER A 1 8   ? 27.272  8.046   -3.339  1.00 0.00 ? 1140 SER A O    2  
ATOM 1773  C CB   . SER A 1 8   ? 29.797  8.151   -5.456  1.00 0.00 ? 1140 SER A CB   2  
ATOM 1774  O OG   . SER A 1 8   ? 28.857  9.136   -5.850  1.00 0.00 ? 1140 SER A OG   2  
ATOM 1775  H H    . SER A 1 8   ? 27.455  6.725   -5.692  1.00 0.00 ? 1140 SER A H    2  
ATOM 1776  H HA   . SER A 1 8   ? 29.934  6.487   -4.116  1.00 0.00 ? 1140 SER A HA   2  
ATOM 1777  H HB2  . SER A 1 8   ? 30.622  8.636   -4.959  1.00 0.00 ? 1140 SER A HB2  2  
ATOM 1778  H HB3  . SER A 1 8   ? 30.157  7.641   -6.338  1.00 0.00 ? 1140 SER A HB3  2  
ATOM 1779  H HG   . SER A 1 8   ? 29.259  10.005  -5.787  1.00 0.00 ? 1140 SER A HG   2  
ATOM 1780  N N    . SER A 1 9   ? 29.288  8.254   -2.361  1.00 0.00 ? 1141 SER A N    2  
ATOM 1781  C CA   . SER A 1 9   ? 28.770  8.952   -1.190  1.00 0.00 ? 1141 SER A CA   2  
ATOM 1782  C C    . SER A 1 9   ? 27.957  10.175  -1.602  1.00 0.00 ? 1141 SER A C    2  
ATOM 1783  O O    . SER A 1 9   ? 28.425  11.013  -2.373  1.00 0.00 ? 1141 SER A O    2  
ATOM 1784  C CB   . SER A 1 9   ? 29.919  9.375   -0.273  1.00 0.00 ? 1141 SER A CB   2  
ATOM 1785  O OG   . SER A 1 9   ? 30.704  10.391  -0.873  1.00 0.00 ? 1141 SER A OG   2  
ATOM 1786  H H    . SER A 1 9   ? 30.249  8.072   -2.423  1.00 0.00 ? 1141 SER A H    2  
ATOM 1787  H HA   . SER A 1 9   ? 28.126  8.270   -0.655  1.00 0.00 ? 1141 SER A HA   2  
ATOM 1788  H HB2  . SER A 1 9   ? 29.516  9.749   0.656   1.00 0.00 ? 1141 SER A HB2  2  
ATOM 1789  H HB3  . SER A 1 9   ? 30.550  8.520   -0.073  1.00 0.00 ? 1141 SER A HB3  2  
ATOM 1790  H HG   . SER A 1 9   ? 30.128  11.063  -1.244  1.00 0.00 ? 1141 SER A HG   2  
ATOM 1791  N N    . GLN A 1 10  ? 26.737  10.269  -1.084  1.00 0.00 ? 1142 GLN A N    2  
ATOM 1792  C CA   . GLN A 1 10  ? 25.858  11.389  -1.398  1.00 0.00 ? 1142 GLN A CA   2  
ATOM 1793  C C    . GLN A 1 10  ? 25.116  11.865  -0.154  1.00 0.00 ? 1142 GLN A C    2  
ATOM 1794  O O    . GLN A 1 10  ? 24.840  11.095  0.767   1.00 0.00 ? 1142 GLN A O    2  
ATOM 1795  C CB   . GLN A 1 10  ? 24.857  10.990  -2.483  1.00 0.00 ? 1142 GLN A CB   2  
ATOM 1796  C CG   . GLN A 1 10  ? 23.805  10.001  -2.006  1.00 0.00 ? 1142 GLN A CG   2  
ATOM 1797  C CD   . GLN A 1 10  ? 22.852  9.586   -3.109  1.00 0.00 ? 1142 GLN A CD   2  
ATOM 1798  O OE1  . GLN A 1 10  ? 22.415  10.411  -3.911  1.00 0.00 ? 1142 GLN A OE1  2  
ATOM 1799  N NE2  . GLN A 1 10  ? 22.523  8.300   -3.155  1.00 0.00 ? 1142 GLN A NE2  2  
ATOM 1800  H H    . GLN A 1 10  ? 26.421  9.570   -0.476  1.00 0.00 ? 1142 GLN A H    2  
ATOM 1801  H HA   . GLN A 1 10  ? 26.471  12.198  -1.767  1.00 0.00 ? 1142 GLN A HA   2  
ATOM 1802  H HB2  . GLN A 1 10  ? 24.352  11.877  -2.835  1.00 0.00 ? 1142 GLN A HB2  2  
ATOM 1803  H HB3  . GLN A 1 10  ? 25.395  10.541  -3.305  1.00 0.00 ? 1142 GLN A HB3  2  
ATOM 1804  H HG2  . GLN A 1 10  ? 24.303  9.119   -1.631  1.00 0.00 ? 1142 GLN A HG2  2  
ATOM 1805  H HG3  . GLN A 1 10  ? 23.236  10.457  -1.210  1.00 0.00 ? 1142 GLN A HG3  2  
ATOM 1806  H HE21 . GLN A 1 10  ? 22.909  7.700   -2.482  1.00 0.00 ? 1142 GLN A HE21 2  
ATOM 1807  H HE22 . GLN A 1 10  ? 21.908  8.004   -3.857  1.00 0.00 ? 1142 GLN A HE22 2  
ATOM 1808  N N    . PRO A 1 11  ? 24.783  13.164  -0.123  1.00 0.00 ? 1143 PRO A N    2  
ATOM 1809  C CA   . PRO A 1 11  ? 24.067  13.771  1.003   1.00 0.00 ? 1143 PRO A CA   2  
ATOM 1810  C C    . PRO A 1 11  ? 22.620  13.297  1.094   1.00 0.00 ? 1143 PRO A C    2  
ATOM 1811  O O    . PRO A 1 11  ? 22.202  12.404  0.358   1.00 0.00 ? 1143 PRO A O    2  
ATOM 1812  C CB   . PRO A 1 11  ? 24.121  15.268  0.692   1.00 0.00 ? 1143 PRO A CB   2  
ATOM 1813  C CG   . PRO A 1 11  ? 24.268  15.342  -0.789  1.00 0.00 ? 1143 PRO A CG   2  
ATOM 1814  C CD   . PRO A 1 11  ? 25.079  14.140  -1.185  1.00 0.00 ? 1143 PRO A CD   2  
ATOM 1815  H HA   . PRO A 1 11  ? 24.567  13.578  1.941   1.00 0.00 ? 1143 PRO A HA   2  
ATOM 1816  H HB2  . PRO A 1 11  ? 23.207  15.741  1.023   1.00 0.00 ? 1143 PRO A HB2  2  
ATOM 1817  H HB3  . PRO A 1 11  ? 24.966  15.714  1.195   1.00 0.00 ? 1143 PRO A HB3  2  
ATOM 1818  H HG2  . PRO A 1 11  ? 23.296  15.310  -1.256  1.00 0.00 ? 1143 PRO A HG2  2  
ATOM 1819  H HG3  . PRO A 1 11  ? 24.787  16.250  -1.061  1.00 0.00 ? 1143 PRO A HG3  2  
ATOM 1820  H HD2  . PRO A 1 11  ? 24.760  13.770  -2.148  1.00 0.00 ? 1143 PRO A HD2  2  
ATOM 1821  H HD3  . PRO A 1 11  ? 26.131  14.383  -1.202  1.00 0.00 ? 1143 PRO A HD3  2  
ATOM 1822  N N    . VAL A 1 12  ? 21.860  13.902  2.002   1.00 0.00 ? 1144 VAL A N    2  
ATOM 1823  C CA   . VAL A 1 12  ? 20.459  13.543  2.187   1.00 0.00 ? 1144 VAL A CA   2  
ATOM 1824  C C    . VAL A 1 12  ? 19.609  14.026  1.018   1.00 0.00 ? 1144 VAL A C    2  
ATOM 1825  O O    . VAL A 1 12  ? 20.049  14.849  0.215   1.00 0.00 ? 1144 VAL A O    2  
ATOM 1826  C CB   . VAL A 1 12  ? 19.898  14.132  3.495   1.00 0.00 ? 1144 VAL A CB   2  
ATOM 1827  C CG1  . VAL A 1 12  ? 20.634  13.561  4.697   1.00 0.00 ? 1144 VAL A CG1  2  
ATOM 1828  C CG2  . VAL A 1 12  ? 19.987  15.650  3.476   1.00 0.00 ? 1144 VAL A CG2  2  
ATOM 1829  H H    . VAL A 1 12  ? 22.251  14.607  2.559   1.00 0.00 ? 1144 VAL A H    2  
ATOM 1830  H HA   . VAL A 1 12  ? 20.395  12.466  2.245   1.00 0.00 ? 1144 VAL A HA   2  
ATOM 1831  H HB   . VAL A 1 12  ? 18.857  13.854  3.573   1.00 0.00 ? 1144 VAL A HB   2  
ATOM 1832  H HG11 . VAL A 1 12  ? 21.671  13.402  4.442   1.00 0.00 ? 1144 VAL A HG11 2  
ATOM 1833  H HG12 . VAL A 1 12  ? 20.567  14.254  5.523   1.00 0.00 ? 1144 VAL A HG12 2  
ATOM 1834  H HG13 . VAL A 1 12  ? 20.186  12.620  4.980   1.00 0.00 ? 1144 VAL A HG13 2  
ATOM 1835  H HG21 . VAL A 1 12  ? 19.025  16.069  3.732   1.00 0.00 ? 1144 VAL A HG21 2  
ATOM 1836  H HG22 . VAL A 1 12  ? 20.724  15.977  4.195   1.00 0.00 ? 1144 VAL A HG22 2  
ATOM 1837  H HG23 . VAL A 1 12  ? 20.274  15.982  2.490   1.00 0.00 ? 1144 VAL A HG23 2  
ATOM 1838  N N    . ILE A 1 13  ? 18.388  13.510  0.929   1.00 0.00 ? 1145 ILE A N    2  
ATOM 1839  C CA   . ILE A 1 13  ? 17.474  13.890  -0.141  1.00 0.00 ? 1145 ILE A CA   2  
ATOM 1840  C C    . ILE A 1 13  ? 16.685  15.142  0.228   1.00 0.00 ? 1145 ILE A C    2  
ATOM 1841  O O    . ILE A 1 13  ? 16.240  15.294  1.366   1.00 0.00 ? 1145 ILE A O    2  
ATOM 1842  C CB   . ILE A 1 13  ? 16.488  12.754  -0.470  1.00 0.00 ? 1145 ILE A CB   2  
ATOM 1843  C CG1  . ILE A 1 13  ? 17.249  11.470  -0.807  1.00 0.00 ? 1145 ILE A CG1  2  
ATOM 1844  C CG2  . ILE A 1 13  ? 15.582  13.157  -1.624  1.00 0.00 ? 1145 ILE A CG2  2  
ATOM 1845  C CD1  . ILE A 1 13  ? 16.356  10.258  -0.949  1.00 0.00 ? 1145 ILE A CD1  2  
ATOM 1846  H H    . ILE A 1 13  ? 18.094  12.858  1.599   1.00 0.00 ? 1145 ILE A H    2  
ATOM 1847  H HA   . ILE A 1 13  ? 18.063  14.096  -1.024  1.00 0.00 ? 1145 ILE A HA   2  
ATOM 1848  H HB   . ILE A 1 13  ? 15.870  12.581  0.397   1.00 0.00 ? 1145 ILE A HB   2  
ATOM 1849  H HG12 . ILE A 1 13  ? 17.775  11.605  -1.739  1.00 0.00 ? 1145 ILE A HG12 2  
ATOM 1850  H HG13 . ILE A 1 13  ? 17.963  11.268  -0.021  1.00 0.00 ? 1145 ILE A HG13 2  
ATOM 1851  H HG21 . ILE A 1 13  ? 14.578  12.808  -1.432  1.00 0.00 ? 1145 ILE A HG21 2  
ATOM 1852  H HG22 . ILE A 1 13  ? 15.576  14.232  -1.718  1.00 0.00 ? 1145 ILE A HG22 2  
ATOM 1853  H HG23 . ILE A 1 13  ? 15.947  12.716  -2.540  1.00 0.00 ? 1145 ILE A HG23 2  
ATOM 1854  H HD11 . ILE A 1 13  ? 15.572  10.299  -0.207  1.00 0.00 ? 1145 ILE A HD11 2  
ATOM 1855  H HD12 . ILE A 1 13  ? 15.920  10.245  -1.936  1.00 0.00 ? 1145 ILE A HD12 2  
ATOM 1856  H HD13 . ILE A 1 13  ? 16.941  9.361   -0.803  1.00 0.00 ? 1145 ILE A HD13 2  
ATOM 1857  N N    . SER A 1 14  ? 16.514  16.035  -0.741  1.00 0.00 ? 1146 SER A N    2  
ATOM 1858  C CA   . SER A 1 14  ? 15.780  17.275  -0.518  1.00 0.00 ? 1146 SER A CA   2  
ATOM 1859  C C    . SER A 1 14  ? 14.479  17.008  0.233   1.00 0.00 ? 1146 SER A C    2  
ATOM 1860  O O    . SER A 1 14  ? 13.613  16.275  -0.245  1.00 0.00 ? 1146 SER A O    2  
ATOM 1861  C CB   . SER A 1 14  ? 15.481  17.963  -1.851  1.00 0.00 ? 1146 SER A CB   2  
ATOM 1862  O OG   . SER A 1 14  ? 14.900  19.239  -1.648  1.00 0.00 ? 1146 SER A OG   2  
ATOM 1863  H H    . SER A 1 14  ? 16.893  15.856  -1.628  1.00 0.00 ? 1146 SER A H    2  
ATOM 1864  H HA   . SER A 1 14  ? 16.401  17.924  0.081   1.00 0.00 ? 1146 SER A HA   2  
ATOM 1865  H HB2  . SER A 1 14  ? 16.399  18.082  -2.405  1.00 0.00 ? 1146 SER A HB2  2  
ATOM 1866  H HB3  . SER A 1 14  ? 14.793  17.354  -2.421  1.00 0.00 ? 1146 SER A HB3  2  
ATOM 1867  H HG   . SER A 1 14  ? 13.946  19.175  -1.734  1.00 0.00 ? 1146 SER A HG   2  
ATOM 1868  N N    . ALA A 1 15  ? 14.349  17.608  1.412   1.00 0.00 ? 1147 ALA A N    2  
ATOM 1869  C CA   . ALA A 1 15  ? 13.154  17.438  2.228   1.00 0.00 ? 1147 ALA A CA   2  
ATOM 1870  C C    . ALA A 1 15  ? 11.905  17.335  1.359   1.00 0.00 ? 1147 ALA A C    2  
ATOM 1871  O O    . ALA A 1 15  ? 11.081  16.440  1.546   1.00 0.00 ? 1147 ALA A O    2  
ATOM 1872  C CB   . ALA A 1 15  ? 13.020  18.589  3.214   1.00 0.00 ? 1147 ALA A CB   2  
ATOM 1873  H H    . ALA A 1 15  ? 15.074  18.180  1.739   1.00 0.00 ? 1147 ALA A H    2  
ATOM 1874  H HA   . ALA A 1 15  ? 13.264  16.523  2.794   1.00 0.00 ? 1147 ALA A HA   2  
ATOM 1875  H HB1  . ALA A 1 15  ? 12.596  19.446  2.710   1.00 0.00 ? 1147 ALA A HB1  2  
ATOM 1876  H HB2  . ALA A 1 15  ? 12.374  18.293  4.027   1.00 0.00 ? 1147 ALA A HB2  2  
ATOM 1877  H HB3  . ALA A 1 15  ? 13.994  18.846  3.602   1.00 0.00 ? 1147 ALA A HB3  2  
ATOM 1878  N N    . GLN A 1 16  ? 11.772  18.256  0.411   1.00 0.00 ? 1148 GLN A N    2  
ATOM 1879  C CA   . GLN A 1 16  ? 10.623  18.268  -0.486  1.00 0.00 ? 1148 GLN A CA   2  
ATOM 1880  C C    . GLN A 1 16  ? 10.161  16.849  -0.799  1.00 0.00 ? 1148 GLN A C    2  
ATOM 1881  O O    . GLN A 1 16  ? 8.970   16.546  -0.736  1.00 0.00 ? 1148 GLN A O    2  
ATOM 1882  C CB   . GLN A 1 16  ? 10.968  19.002  -1.783  1.00 0.00 ? 1148 GLN A CB   2  
ATOM 1883  C CG   . GLN A 1 16  ? 10.934  20.516  -1.652  1.00 0.00 ? 1148 GLN A CG   2  
ATOM 1884  C CD   . GLN A 1 16  ? 11.580  21.218  -2.831  1.00 0.00 ? 1148 GLN A CD   2  
ATOM 1885  O OE1  . GLN A 1 16  ? 12.736  20.959  -3.165  1.00 0.00 ? 1148 GLN A OE1  2  
ATOM 1886  N NE2  . GLN A 1 16  ? 10.834  22.113  -3.468  1.00 0.00 ? 1148 GLN A NE2  2  
ATOM 1887  H H    . GLN A 1 16  ? 12.463  18.943  0.312   1.00 0.00 ? 1148 GLN A H    2  
ATOM 1888  H HA   . GLN A 1 16  ? 9.821   18.793  0.011   1.00 0.00 ? 1148 GLN A HA   2  
ATOM 1889  H HB2  . GLN A 1 16  ? 11.960  18.711  -2.094  1.00 0.00 ? 1148 GLN A HB2  2  
ATOM 1890  H HB3  . GLN A 1 16  ? 10.261  18.713  -2.546  1.00 0.00 ? 1148 GLN A HB3  2  
ATOM 1891  H HG2  . GLN A 1 16  ? 9.905   20.836  -1.583  1.00 0.00 ? 1148 GLN A HG2  2  
ATOM 1892  H HG3  . GLN A 1 16  ? 11.459  20.799  -0.752  1.00 0.00 ? 1148 GLN A HG3  2  
ATOM 1893  H HE21 . GLN A 1 16  ? 9.922   22.269  -3.145  1.00 0.00 ? 1148 GLN A HE21 2  
ATOM 1894  H HE22 . GLN A 1 16  ? 11.227  22.582  -4.233  1.00 0.00 ? 1148 GLN A HE22 2  
ATOM 1895  N N    . GLU A 1 17  ? 11.112  15.983  -1.136  1.00 0.00 ? 1149 GLU A N    2  
ATOM 1896  C CA   . GLU A 1 17  ? 10.801  14.596  -1.460  1.00 0.00 ? 1149 GLU A CA   2  
ATOM 1897  C C    . GLU A 1 17  ? 11.030  13.691  -0.252  1.00 0.00 ? 1149 GLU A C    2  
ATOM 1898  O O    . GLU A 1 17  ? 10.158  12.909  0.124   1.00 0.00 ? 1149 GLU A O    2  
ATOM 1899  C CB   . GLU A 1 17  ? 11.655  14.120  -2.637  1.00 0.00 ? 1149 GLU A CB   2  
ATOM 1900  C CG   . GLU A 1 17  ? 11.084  12.908  -3.353  1.00 0.00 ? 1149 GLU A CG   2  
ATOM 1901  C CD   . GLU A 1 17  ? 9.868   13.246  -4.193  1.00 0.00 ? 1149 GLU A CD   2  
ATOM 1902  O OE1  . GLU A 1 17  ? 9.874   14.314  -4.841  1.00 0.00 ? 1149 GLU A OE1  2  
ATOM 1903  O OE2  . GLU A 1 17  ? 8.910   12.444  -4.202  1.00 0.00 ? 1149 GLU A OE2  2  
ATOM 1904  H H    . GLU A 1 17  ? 12.044  16.285  -1.168  1.00 0.00 ? 1149 GLU A H    2  
ATOM 1905  H HA   . GLU A 1 17  ? 9.760   14.546  -1.739  1.00 0.00 ? 1149 GLU A HA   2  
ATOM 1906  H HB2  . GLU A 1 17  ? 11.744  14.926  -3.350  1.00 0.00 ? 1149 GLU A HB2  2  
ATOM 1907  H HB3  . GLU A 1 17  ? 12.639  13.865  -2.272  1.00 0.00 ? 1149 GLU A HB3  2  
ATOM 1908  H HG2  . GLU A 1 17  ? 11.844  12.495  -3.998  1.00 0.00 ? 1149 GLU A HG2  2  
ATOM 1909  H HG3  . GLU A 1 17  ? 10.800  12.171  -2.615  1.00 0.00 ? 1149 GLU A HG3  2  
ATOM 1910  N N    . GLN A 1 18  ? 12.210  13.804  0.349   1.00 0.00 ? 1150 GLN A N    2  
ATOM 1911  C CA   . GLN A 1 18  ? 12.555  12.995  1.512   1.00 0.00 ? 1150 GLN A CA   2  
ATOM 1912  C C    . GLN A 1 18  ? 11.394  12.941  2.500   1.00 0.00 ? 1150 GLN A C    2  
ATOM 1913  O O    . GLN A 1 18  ? 10.889  11.866  2.820   1.00 0.00 ? 1150 GLN A O    2  
ATOM 1914  C CB   . GLN A 1 18  ? 13.800  13.557  2.200   1.00 0.00 ? 1150 GLN A CB   2  
ATOM 1915  C CG   . GLN A 1 18  ? 14.401  12.618  3.233   1.00 0.00 ? 1150 GLN A CG   2  
ATOM 1916  C CD   . GLN A 1 18  ? 14.255  11.159  2.850   1.00 0.00 ? 1150 GLN A CD   2  
ATOM 1917  O OE1  . GLN A 1 18  ? 14.759  10.723  1.814   1.00 0.00 ? 1150 GLN A OE1  2  
ATOM 1918  N NE2  . GLN A 1 18  ? 13.562  10.394  3.685   1.00 0.00 ? 1150 GLN A NE2  2  
ATOM 1919  H H    . GLN A 1 18  ? 12.864  14.445  0.002   1.00 0.00 ? 1150 GLN A H    2  
ATOM 1920  H HA   . GLN A 1 18  ? 12.766  11.994  1.169   1.00 0.00 ? 1150 GLN A HA   2  
ATOM 1921  H HB2  . GLN A 1 18  ? 14.550  13.761  1.450   1.00 0.00 ? 1150 GLN A HB2  2  
ATOM 1922  H HB3  . GLN A 1 18  ? 13.537  14.481  2.695   1.00 0.00 ? 1150 GLN A HB3  2  
ATOM 1923  H HG2  . GLN A 1 18  ? 15.452  12.843  3.337   1.00 0.00 ? 1150 GLN A HG2  2  
ATOM 1924  H HG3  . GLN A 1 18  ? 13.904  12.779  4.179   1.00 0.00 ? 1150 GLN A HG3  2  
ATOM 1925  H HE21 . GLN A 1 18  ? 13.188  10.809  4.491   1.00 0.00 ? 1150 GLN A HE21 2  
ATOM 1926  H HE22 . GLN A 1 18  ? 13.451  9.447   3.462   1.00 0.00 ? 1150 GLN A HE22 2  
ATOM 1927  N N    . GLU A 1 19  ? 10.978  14.109  2.981   1.00 0.00 ? 1151 GLU A N    2  
ATOM 1928  C CA   . GLU A 1 19  ? 9.877   14.193  3.934   1.00 0.00 ? 1151 GLU A CA   2  
ATOM 1929  C C    . GLU A 1 19  ? 8.690   13.353  3.470   1.00 0.00 ? 1151 GLU A C    2  
ATOM 1930  O O    . GLU A 1 19  ? 8.249   12.441  4.169   1.00 0.00 ? 1151 GLU A O    2  
ATOM 1931  C CB   . GLU A 1 19  ? 9.445   15.649  4.120   1.00 0.00 ? 1151 GLU A CB   2  
ATOM 1932  C CG   . GLU A 1 19  ? 8.746   15.911  5.443   1.00 0.00 ? 1151 GLU A CG   2  
ATOM 1933  C CD   . GLU A 1 19  ? 8.164   17.309  5.528   1.00 0.00 ? 1151 GLU A CD   2  
ATOM 1934  O OE1  . GLU A 1 19  ? 8.912   18.243  5.884   1.00 0.00 ? 1151 GLU A OE1  2  
ATOM 1935  O OE2  . GLU A 1 19  ? 6.960   17.468  5.238   1.00 0.00 ? 1151 GLU A OE2  2  
ATOM 1936  H H    . GLU A 1 19  ? 11.421  14.932  2.688   1.00 0.00 ? 1151 GLU A H    2  
ATOM 1937  H HA   . GLU A 1 19  ? 10.227  13.807  4.879   1.00 0.00 ? 1151 GLU A HA   2  
ATOM 1938  H HB2  . GLU A 1 19  ? 10.318  16.281  4.065   1.00 0.00 ? 1151 GLU A HB2  2  
ATOM 1939  H HB3  . GLU A 1 19  ? 8.768   15.915  3.321   1.00 0.00 ? 1151 GLU A HB3  2  
ATOM 1940  H HG2  . GLU A 1 19  ? 7.945   15.197  5.561   1.00 0.00 ? 1151 GLU A HG2  2  
ATOM 1941  H HG3  . GLU A 1 19  ? 9.460   15.785  6.244   1.00 0.00 ? 1151 GLU A HG3  2  
ATOM 1942  N N    . THR A 1 20  ? 8.177   13.669  2.285   1.00 0.00 ? 1152 THR A N    2  
ATOM 1943  C CA   . THR A 1 20  ? 7.040   12.947  1.727   1.00 0.00 ? 1152 THR A CA   2  
ATOM 1944  C C    . THR A 1 20  ? 7.199   11.442  1.915   1.00 0.00 ? 1152 THR A C    2  
ATOM 1945  O O    . THR A 1 20  ? 6.260   10.755  2.314   1.00 0.00 ? 1152 THR A O    2  
ATOM 1946  C CB   . THR A 1 20  ? 6.863   13.250  0.227   1.00 0.00 ? 1152 THR A CB   2  
ATOM 1947  O OG1  . THR A 1 20  ? 6.591   14.643  0.038   1.00 0.00 ? 1152 THR A OG1  2  
ATOM 1948  C CG2  . THR A 1 20  ? 5.731   12.422  -0.362  1.00 0.00 ? 1152 THR A CG2  2  
ATOM 1949  H H    . THR A 1 20  ? 8.572   14.407  1.775   1.00 0.00 ? 1152 THR A H    2  
ATOM 1950  H HA   . THR A 1 20  ? 6.151   13.272  2.247   1.00 0.00 ? 1152 THR A HA   2  
ATOM 1951  H HB   . THR A 1 20  ? 7.779   12.996  -0.286  1.00 0.00 ? 1152 THR A HB   2  
ATOM 1952  H HG1  . THR A 1 20  ? 6.385   14.806  -0.886  1.00 0.00 ? 1152 THR A HG1  2  
ATOM 1953  H HG21 . THR A 1 20  ? 4.793   12.733  0.074   1.00 0.00 ? 1152 THR A HG21 2  
ATOM 1954  H HG22 . THR A 1 20  ? 5.899   11.377  -0.147  1.00 0.00 ? 1152 THR A HG22 2  
ATOM 1955  H HG23 . THR A 1 20  ? 5.697   12.569  -1.431  1.00 0.00 ? 1152 THR A HG23 2  
ATOM 1956  N N    . GLN A 1 21  ? 8.394   10.938  1.625   1.00 0.00 ? 1153 GLN A N    2  
ATOM 1957  C CA   . GLN A 1 21  ? 8.675   9.513   1.762   1.00 0.00 ? 1153 GLN A CA   2  
ATOM 1958  C C    . GLN A 1 21  ? 8.601   9.082   3.223   1.00 0.00 ? 1153 GLN A C    2  
ATOM 1959  O O    . GLN A 1 21  ? 8.114   7.995   3.535   1.00 0.00 ? 1153 GLN A O    2  
ATOM 1960  C CB   . GLN A 1 21  ? 10.057  9.187   1.192   1.00 0.00 ? 1153 GLN A CB   2  
ATOM 1961  C CG   . GLN A 1 21  ? 10.087  9.116   -0.326  1.00 0.00 ? 1153 GLN A CG   2  
ATOM 1962  C CD   . GLN A 1 21  ? 11.484  9.282   -0.891  1.00 0.00 ? 1153 GLN A CD   2  
ATOM 1963  O OE1  . GLN A 1 21  ? 12.464  9.339   -0.147  1.00 0.00 ? 1153 GLN A OE1  2  
ATOM 1964  N NE2  . GLN A 1 21  ? 11.583  9.359   -2.212  1.00 0.00 ? 1153 GLN A NE2  2  
ATOM 1965  H H    . GLN A 1 21  ? 9.103   11.537  1.311   1.00 0.00 ? 1153 GLN A H    2  
ATOM 1966  H HA   . GLN A 1 21  ? 7.928   8.973   1.202   1.00 0.00 ? 1153 GLN A HA   2  
ATOM 1967  H HB2  . GLN A 1 21  ? 10.753  9.949   1.509   1.00 0.00 ? 1153 GLN A HB2  2  
ATOM 1968  H HB3  . GLN A 1 21  ? 10.377  8.232   1.582   1.00 0.00 ? 1153 GLN A HB3  2  
ATOM 1969  H HG2  . GLN A 1 21  ? 9.702   8.156   -0.637  1.00 0.00 ? 1153 GLN A HG2  2  
ATOM 1970  H HG3  . GLN A 1 21  ? 9.459   9.900   -0.723  1.00 0.00 ? 1153 GLN A HG3  2  
ATOM 1971  H HE21 . GLN A 1 21  ? 10.760  9.308   -2.742  1.00 0.00 ? 1153 GLN A HE21 2  
ATOM 1972  H HE22 . GLN A 1 21  ? 12.474  9.468   -2.604  1.00 0.00 ? 1153 GLN A HE22 2  
ATOM 1973  N N    . ILE A 1 22  ? 9.086   9.941   4.114   1.00 0.00 ? 1154 ILE A N    2  
ATOM 1974  C CA   . ILE A 1 22  ? 9.073   9.648   5.542   1.00 0.00 ? 1154 ILE A CA   2  
ATOM 1975  C C    . ILE A 1 22  ? 7.646   9.523   6.065   1.00 0.00 ? 1154 ILE A C    2  
ATOM 1976  O O    . ILE A 1 22  ? 7.319   8.583   6.790   1.00 0.00 ? 1154 ILE A O    2  
ATOM 1977  C CB   . ILE A 1 22  ? 9.809   10.736  6.346   1.00 0.00 ? 1154 ILE A CB   2  
ATOM 1978  C CG1  . ILE A 1 22  ? 11.272  10.824  5.907   1.00 0.00 ? 1154 ILE A CG1  2  
ATOM 1979  C CG2  . ILE A 1 22  ? 9.714   10.448  7.837   1.00 0.00 ? 1154 ILE A CG2  2  
ATOM 1980  C CD1  . ILE A 1 22  ? 12.000  12.026  6.466   1.00 0.00 ? 1154 ILE A CD1  2  
ATOM 1981  H H    . ILE A 1 22  ? 9.461   10.791  3.803   1.00 0.00 ? 1154 ILE A H    2  
ATOM 1982  H HA   . ILE A 1 22  ? 9.585   8.709   5.694   1.00 0.00 ? 1154 ILE A HA   2  
ATOM 1983  H HB   . ILE A 1 22  ? 9.326   11.682  6.155   1.00 0.00 ? 1154 ILE A HB   2  
ATOM 1984  H HG12 . ILE A 1 22  ? 11.794  9.939   6.235   1.00 0.00 ? 1154 ILE A HG12 2  
ATOM 1985  H HG13 . ILE A 1 22  ? 11.313  10.883  4.829   1.00 0.00 ? 1154 ILE A HG13 2  
ATOM 1986  H HG21 . ILE A 1 22  ? 9.461   11.357  8.363   1.00 0.00 ? 1154 ILE A HG21 2  
ATOM 1987  H HG22 . ILE A 1 22  ? 8.949   9.707   8.012   1.00 0.00 ? 1154 ILE A HG22 2  
ATOM 1988  H HG23 . ILE A 1 22  ? 10.663  10.078  8.193   1.00 0.00 ? 1154 ILE A HG23 2  
ATOM 1989  H HD11 . ILE A 1 22  ? 13.018  12.031  6.107   1.00 0.00 ? 1154 ILE A HD11 2  
ATOM 1990  H HD12 . ILE A 1 22  ? 11.501  12.930  6.149   1.00 0.00 ? 1154 ILE A HD12 2  
ATOM 1991  H HD13 . ILE A 1 22  ? 12.000  11.976  7.546   1.00 0.00 ? 1154 ILE A HD13 2  
ATOM 1992  N N    . VAL A 1 23  ? 6.799   10.476  5.690   1.00 0.00 ? 1155 VAL A N    2  
ATOM 1993  C CA   . VAL A 1 23  ? 5.405   10.472  6.118   1.00 0.00 ? 1155 VAL A CA   2  
ATOM 1994  C C    . VAL A 1 23  ? 4.645   9.302   5.503   1.00 0.00 ? 1155 VAL A C    2  
ATOM 1995  O O    . VAL A 1 23  ? 3.853   8.640   6.176   1.00 0.00 ? 1155 VAL A O    2  
ATOM 1996  C CB   . VAL A 1 23  ? 4.697   11.786  5.739   1.00 0.00 ? 1155 VAL A CB   2  
ATOM 1997  C CG1  . VAL A 1 23  ? 3.236   11.746  6.159   1.00 0.00 ? 1155 VAL A CG1  2  
ATOM 1998  C CG2  . VAL A 1 23  ? 5.409   12.975  6.367   1.00 0.00 ? 1155 VAL A CG2  2  
ATOM 1999  H H    . VAL A 1 23  ? 7.118   11.200  5.111   1.00 0.00 ? 1155 VAL A H    2  
ATOM 2000  H HA   . VAL A 1 23  ? 5.387   10.375  7.194   1.00 0.00 ? 1155 VAL A HA   2  
ATOM 2001  H HB   . VAL A 1 23  ? 4.737   11.896  4.665   1.00 0.00 ? 1155 VAL A HB   2  
ATOM 2002  H HG11 . VAL A 1 23  ? 3.152   12.035  7.196   1.00 0.00 ? 1155 VAL A HG11 2  
ATOM 2003  H HG12 . VAL A 1 23  ? 2.666   12.429  5.546   1.00 0.00 ? 1155 VAL A HG12 2  
ATOM 2004  H HG13 . VAL A 1 23  ? 2.852   10.744  6.033   1.00 0.00 ? 1155 VAL A HG13 2  
ATOM 2005  H HG21 . VAL A 1 23  ? 5.196   13.865  5.794   1.00 0.00 ? 1155 VAL A HG21 2  
ATOM 2006  H HG22 . VAL A 1 23  ? 5.061   13.108  7.381   1.00 0.00 ? 1155 VAL A HG22 2  
ATOM 2007  H HG23 . VAL A 1 23  ? 6.473   12.796  6.373   1.00 0.00 ? 1155 VAL A HG23 2  
ATOM 2008  N N    . LEU A 1 24  ? 4.891   9.052   4.222   1.00 0.00 ? 1156 LEU A N    2  
ATOM 2009  C CA   . LEU A 1 24  ? 4.230   7.960   3.515   1.00 0.00 ? 1156 LEU A CA   2  
ATOM 2010  C C    . LEU A 1 24  ? 4.685   6.608   4.055   1.00 0.00 ? 1156 LEU A C    2  
ATOM 2011  O O    . LEU A 1 24  ? 3.870   5.804   4.509   1.00 0.00 ? 1156 LEU A O    2  
ATOM 2012  C CB   . LEU A 1 24  ? 4.520   8.048   2.016   1.00 0.00 ? 1156 LEU A CB   2  
ATOM 2013  C CG   . LEU A 1 24  ? 3.759   7.065   1.126   1.00 0.00 ? 1156 LEU A CG   2  
ATOM 2014  C CD1  . LEU A 1 24  ? 2.267   7.132   1.412   1.00 0.00 ? 1156 LEU A CD1  2  
ATOM 2015  C CD2  . LEU A 1 24  ? 4.035   7.351   -0.343  1.00 0.00 ? 1156 LEU A CD2  2  
ATOM 2016  H H    . LEU A 1 24  ? 5.532   9.614   3.739   1.00 0.00 ? 1156 LEU A H    2  
ATOM 2017  H HA   . LEU A 1 24  ? 3.166   8.059   3.674   1.00 0.00 ? 1156 LEU A HA   2  
ATOM 2018  H HB2  . LEU A 1 24  ? 4.276   9.047   1.690   1.00 0.00 ? 1156 LEU A HB2  2  
ATOM 2019  H HB3  . LEU A 1 24  ? 5.578   7.874   1.874   1.00 0.00 ? 1156 LEU A HB3  2  
ATOM 2020  H HG   . LEU A 1 24  ? 4.094   6.060   1.341   1.00 0.00 ? 1156 LEU A HG   2  
ATOM 2021  H HD11 . LEU A 1 24  ? 1.918   8.143   1.269   1.00 0.00 ? 1156 LEU A HD11 2  
ATOM 2022  H HD12 . LEU A 1 24  ? 2.082   6.829   2.432   1.00 0.00 ? 1156 LEU A HD12 2  
ATOM 2023  H HD13 . LEU A 1 24  ? 1.741   6.470   0.739   1.00 0.00 ? 1156 LEU A HD13 2  
ATOM 2024  H HD21 . LEU A 1 24  ? 4.595   8.270   -0.431  1.00 0.00 ? 1156 LEU A HD21 2  
ATOM 2025  H HD22 . LEU A 1 24  ? 3.099   7.448   -0.873  1.00 0.00 ? 1156 LEU A HD22 2  
ATOM 2026  H HD23 . LEU A 1 24  ? 4.607   6.538   -0.766  1.00 0.00 ? 1156 LEU A HD23 2  
ATOM 2027  N N    . TYR A 1 25  ? 5.989   6.365   4.003   1.00 0.00 ? 1157 TYR A N    2  
ATOM 2028  C CA   . TYR A 1 25  ? 6.553   5.110   4.487   1.00 0.00 ? 1157 TYR A CA   2  
ATOM 2029  C C    . TYR A 1 25  ? 5.835   4.641   5.748   1.00 0.00 ? 1157 TYR A C    2  
ATOM 2030  O O    . TYR A 1 25  ? 5.399   3.494   5.839   1.00 0.00 ? 1157 TYR A O    2  
ATOM 2031  C CB   . TYR A 1 25  ? 8.048   5.272   4.767   1.00 0.00 ? 1157 TYR A CB   2  
ATOM 2032  C CG   . TYR A 1 25  ? 8.687   4.042   5.371   1.00 0.00 ? 1157 TYR A CG   2  
ATOM 2033  C CD1  . TYR A 1 25  ? 8.740   2.845   4.667   1.00 0.00 ? 1157 TYR A CD1  2  
ATOM 2034  C CD2  . TYR A 1 25  ? 9.240   4.077   6.645   1.00 0.00 ? 1157 TYR A CD2  2  
ATOM 2035  C CE1  . TYR A 1 25  ? 9.323   1.719   5.215   1.00 0.00 ? 1157 TYR A CE1  2  
ATOM 2036  C CE2  . TYR A 1 25  ? 9.826   2.956   7.201   1.00 0.00 ? 1157 TYR A CE2  2  
ATOM 2037  C CZ   . TYR A 1 25  ? 9.864   1.780   6.482   1.00 0.00 ? 1157 TYR A CZ   2  
ATOM 2038  O OH   . TYR A 1 25  ? 10.447  0.660   7.031   1.00 0.00 ? 1157 TYR A OH   2  
ATOM 2039  H H    . TYR A 1 25  ? 6.588   7.045   3.630   1.00 0.00 ? 1157 TYR A H    2  
ATOM 2040  H HA   . TYR A 1 25  ? 6.420   4.367   3.713   1.00 0.00 ? 1157 TYR A HA   2  
ATOM 2041  H HB2  . TYR A 1 25  ? 8.559   5.491   3.842   1.00 0.00 ? 1157 TYR A HB2  2  
ATOM 2042  H HB3  . TYR A 1 25  ? 8.191   6.092   5.455   1.00 0.00 ? 1157 TYR A HB3  2  
ATOM 2043  H HD1  . TYR A 1 25  ? 8.315   2.802   3.674   1.00 0.00 ? 1157 TYR A HD1  2  
ATOM 2044  H HD2  . TYR A 1 25  ? 9.208   5.000   7.206   1.00 0.00 ? 1157 TYR A HD2  2  
ATOM 2045  H HE1  . TYR A 1 25  ? 9.353   0.798   4.652   1.00 0.00 ? 1157 TYR A HE1  2  
ATOM 2046  H HE2  . TYR A 1 25  ? 10.250  3.003   8.193   1.00 0.00 ? 1157 TYR A HE2  2  
ATOM 2047  H HH   . TYR A 1 25  ? 11.402  0.739   6.980   1.00 0.00 ? 1157 TYR A HH   2  
ATOM 2048  N N    . GLY A 1 26  ? 5.715   5.538   6.722   1.00 0.00 ? 1158 GLY A N    2  
ATOM 2049  C CA   . GLY A 1 26  ? 5.050   5.199   7.966   1.00 0.00 ? 1158 GLY A CA   2  
ATOM 2050  C C    . GLY A 1 26  ? 3.629   4.716   7.751   1.00 0.00 ? 1158 GLY A C    2  
ATOM 2051  O O    . GLY A 1 26  ? 3.208   3.721   8.339   1.00 0.00 ? 1158 GLY A O    2  
ATOM 2052  H H    . GLY A 1 26  ? 6.083   6.438   6.594   1.00 0.00 ? 1158 GLY A H    2  
ATOM 2053  H HA2  . GLY A 1 26  ? 5.612   4.422   8.462   1.00 0.00 ? 1158 GLY A HA2  2  
ATOM 2054  H HA3  . GLY A 1 26  ? 5.028   6.074   8.599   1.00 0.00 ? 1158 GLY A HA3  2  
ATOM 2055  N N    . LYS A 1 27  ? 2.887   5.424   6.906   1.00 0.00 ? 1159 LYS A N    2  
ATOM 2056  C CA   . LYS A 1 27  ? 1.505   5.063   6.613   1.00 0.00 ? 1159 LYS A CA   2  
ATOM 2057  C C    . LYS A 1 27  ? 1.417   3.639   6.075   1.00 0.00 ? 1159 LYS A C    2  
ATOM 2058  O O    . LYS A 1 27  ? 0.561   2.858   6.493   1.00 0.00 ? 1159 LYS A O    2  
ATOM 2059  C CB   . LYS A 1 27  ? 0.904   6.041   5.601   1.00 0.00 ? 1159 LYS A CB   2  
ATOM 2060  C CG   . LYS A 1 27  ? 0.873   7.479   6.088   1.00 0.00 ? 1159 LYS A CG   2  
ATOM 2061  C CD   . LYS A 1 27  ? 0.489   8.437   4.973   1.00 0.00 ? 1159 LYS A CD   2  
ATOM 2062  C CE   . LYS A 1 27  ? 0.030   9.778   5.525   1.00 0.00 ? 1159 LYS A CE   2  
ATOM 2063  N NZ   . LYS A 1 27  ? -1.403  9.750   5.929   1.00 0.00 ? 1159 LYS A NZ   2  
ATOM 2064  H H    . LYS A 1 27  ? 3.280   6.208   6.467   1.00 0.00 ? 1159 LYS A H    2  
ATOM 2065  H HA   . LYS A 1 27  ? 0.945   5.122   7.534   1.00 0.00 ? 1159 LYS A HA   2  
ATOM 2066  H HB2  . LYS A 1 27  ? 1.488   6.003   4.692   1.00 0.00 ? 1159 LYS A HB2  2  
ATOM 2067  H HB3  . LYS A 1 27  ? -0.109  5.735   5.381   1.00 0.00 ? 1159 LYS A HB3  2  
ATOM 2068  H HG2  . LYS A 1 27  ? 0.150   7.564   6.886   1.00 0.00 ? 1159 LYS A HG2  2  
ATOM 2069  H HG3  . LYS A 1 27  ? 1.853   7.745   6.458   1.00 0.00 ? 1159 LYS A HG3  2  
ATOM 2070  H HD2  . LYS A 1 27  ? 1.347   8.598   4.337   1.00 0.00 ? 1159 LYS A HD2  2  
ATOM 2071  H HD3  . LYS A 1 27  ? -0.313  8.001   4.396   1.00 0.00 ? 1159 LYS A HD3  2  
ATOM 2072  H HE2  . LYS A 1 27  ? 0.632   10.024  6.386   1.00 0.00 ? 1159 LYS A HE2  2  
ATOM 2073  H HE3  . LYS A 1 27  ? 0.165   10.531  4.763   1.00 0.00 ? 1159 LYS A HE3  2  
ATOM 2074  H HZ1  . LYS A 1 27  ? -1.986  10.225  5.210   1.00 0.00 ? 1159 LYS A HZ1  2  
ATOM 2075  H HZ2  . LYS A 1 27  ? -1.528  10.238  6.838   1.00 0.00 ? 1159 LYS A HZ2  2  
ATOM 2076  H HZ3  . LYS A 1 27  ? -1.728  8.767   6.028   1.00 0.00 ? 1159 LYS A HZ3  2  
ATOM 2077  N N    . LEU A 1 28  ? 2.307   3.306   5.147   1.00 0.00 ? 1160 LEU A N    2  
ATOM 2078  C CA   . LEU A 1 28  ? 2.331   1.974   4.552   1.00 0.00 ? 1160 LEU A CA   2  
ATOM 2079  C C    . LEU A 1 28  ? 2.570   0.907   5.616   1.00 0.00 ? 1160 LEU A C    2  
ATOM 2080  O O    . LEU A 1 28  ? 1.820   -0.065  5.715   1.00 0.00 ? 1160 LEU A O    2  
ATOM 2081  C CB   . LEU A 1 28  ? 3.418   1.893   3.479   1.00 0.00 ? 1160 LEU A CB   2  
ATOM 2082  C CG   . LEU A 1 28  ? 3.118   2.614   2.164   1.00 0.00 ? 1160 LEU A CG   2  
ATOM 2083  C CD1  . LEU A 1 28  ? 4.403   2.876   1.394   1.00 0.00 ? 1160 LEU A CD1  2  
ATOM 2084  C CD2  . LEU A 1 28  ? 2.145   1.803   1.321   1.00 0.00 ? 1160 LEU A CD2  2  
ATOM 2085  H H    . LEU A 1 28  ? 2.964   3.971   4.854   1.00 0.00 ? 1160 LEU A H    2  
ATOM 2086  H HA   . LEU A 1 28  ? 1.369   1.799   4.093   1.00 0.00 ? 1160 LEU A HA   2  
ATOM 2087  H HB2  . LEU A 1 28  ? 4.321   2.317   3.890   1.00 0.00 ? 1160 LEU A HB2  2  
ATOM 2088  H HB3  . LEU A 1 28  ? 3.582   0.848   3.254   1.00 0.00 ? 1160 LEU A HB3  2  
ATOM 2089  H HG   . LEU A 1 28  ? 2.659   3.568   2.381   1.00 0.00 ? 1160 LEU A HG   2  
ATOM 2090  H HD11 . LEU A 1 28  ? 4.164   3.278   0.421   1.00 0.00 ? 1160 LEU A HD11 2  
ATOM 2091  H HD12 . LEU A 1 28  ? 4.948   1.951   1.277   1.00 0.00 ? 1160 LEU A HD12 2  
ATOM 2092  H HD13 . LEU A 1 28  ? 5.010   3.584   1.938   1.00 0.00 ? 1160 LEU A HD13 2  
ATOM 2093  H HD21 . LEU A 1 28  ? 1.999   2.293   0.369   1.00 0.00 ? 1160 LEU A HD21 2  
ATOM 2094  H HD22 . LEU A 1 28  ? 1.198   1.728   1.836   1.00 0.00 ? 1160 LEU A HD22 2  
ATOM 2095  H HD23 . LEU A 1 28  ? 2.547   0.814   1.159   1.00 0.00 ? 1160 LEU A HD23 2  
ATOM 2096  N N    . VAL A 1 29  ? 3.618   1.096   6.411   1.00 0.00 ? 1161 VAL A N    2  
ATOM 2097  C CA   . VAL A 1 29  ? 3.954   0.151   7.470   1.00 0.00 ? 1161 VAL A CA   2  
ATOM 2098  C C    . VAL A 1 29  ? 2.750   -0.120  8.366   1.00 0.00 ? 1161 VAL A C    2  
ATOM 2099  O O    . VAL A 1 29  ? 2.504   -1.259  8.762   1.00 0.00 ? 1161 VAL A O    2  
ATOM 2100  C CB   . VAL A 1 29  ? 5.118   0.669   8.335   1.00 0.00 ? 1161 VAL A CB   2  
ATOM 2101  C CG1  . VAL A 1 29  ? 5.429   -0.312  9.455   1.00 0.00 ? 1161 VAL A CG1  2  
ATOM 2102  C CG2  . VAL A 1 29  ? 6.349   0.919   7.477   1.00 0.00 ? 1161 VAL A CG2  2  
ATOM 2103  H H    . VAL A 1 29  ? 4.178   1.889   6.283   1.00 0.00 ? 1161 VAL A H    2  
ATOM 2104  H HA   . VAL A 1 29  ? 4.261   -0.775  7.006   1.00 0.00 ? 1161 VAL A HA   2  
ATOM 2105  H HB   . VAL A 1 29  ? 4.819   1.606   8.781   1.00 0.00 ? 1161 VAL A HB   2  
ATOM 2106  H HG11 . VAL A 1 29  ? 6.259   -0.939  9.164   1.00 0.00 ? 1161 VAL A HG11 2  
ATOM 2107  H HG12 . VAL A 1 29  ? 5.684   0.233   10.352  1.00 0.00 ? 1161 VAL A HG12 2  
ATOM 2108  H HG13 . VAL A 1 29  ? 4.563   -0.930  9.643   1.00 0.00 ? 1161 VAL A HG13 2  
ATOM 2109  H HG21 . VAL A 1 29  ? 7.184   0.362   7.876   1.00 0.00 ? 1161 VAL A HG21 2  
ATOM 2110  H HG22 . VAL A 1 29  ? 6.153   0.598   6.464   1.00 0.00 ? 1161 VAL A HG22 2  
ATOM 2111  H HG23 . VAL A 1 29  ? 6.583   1.973   7.482   1.00 0.00 ? 1161 VAL A HG23 2  
ATOM 2112  N N    . GLU A 1 30  ? 2.004   0.934   8.681   1.00 0.00 ? 1162 GLU A N    2  
ATOM 2113  C CA   . GLU A 1 30  ? 0.826   0.808   9.531   1.00 0.00 ? 1162 GLU A CA   2  
ATOM 2114  C C    . GLU A 1 30  ? -0.190  -0.149  8.915   1.00 0.00 ? 1162 GLU A C    2  
ATOM 2115  O O    . GLU A 1 30  ? -0.696  -1.050  9.584   1.00 0.00 ? 1162 GLU A O    2  
ATOM 2116  C CB   . GLU A 1 30  ? 0.183   2.178   9.755   1.00 0.00 ? 1162 GLU A CB   2  
ATOM 2117  C CG   . GLU A 1 30  ? 0.949   3.058   10.728  1.00 0.00 ? 1162 GLU A CG   2  
ATOM 2118  C CD   . GLU A 1 30  ? 0.221   4.351   11.042  1.00 0.00 ? 1162 GLU A CD   2  
ATOM 2119  O OE1  . GLU A 1 30  ? -0.489  4.864   10.152  1.00 0.00 ? 1162 GLU A OE1  2  
ATOM 2120  O OE2  . GLU A 1 30  ? 0.363   4.850   12.178  1.00 0.00 ? 1162 GLU A OE2  2  
ATOM 2121  H H    . GLU A 1 30  ? 2.252   1.816   8.335   1.00 0.00 ? 1162 GLU A H    2  
ATOM 2122  H HA   . GLU A 1 30  ? 1.145   0.411   10.483  1.00 0.00 ? 1162 GLU A HA   2  
ATOM 2123  H HB2  . GLU A 1 30  ? 0.121   2.692   8.808   1.00 0.00 ? 1162 GLU A HB2  2  
ATOM 2124  H HB3  . GLU A 1 30  ? -0.815  2.034   10.142  1.00 0.00 ? 1162 GLU A HB3  2  
ATOM 2125  H HG2  . GLU A 1 30  ? 1.095   2.513   11.649  1.00 0.00 ? 1162 GLU A HG2  2  
ATOM 2126  H HG3  . GLU A 1 30  ? 1.910   3.299   10.297  1.00 0.00 ? 1162 GLU A HG3  2  
ATOM 2127  N N    . ALA A 1 31  ? -0.484  0.055   7.635   1.00 0.00 ? 1163 ALA A N    2  
ATOM 2128  C CA   . ALA A 1 31  ? -1.439  -0.790  6.927   1.00 0.00 ? 1163 ALA A CA   2  
ATOM 2129  C C    . ALA A 1 31  ? -1.023  -2.256  6.985   1.00 0.00 ? 1163 ALA A C    2  
ATOM 2130  O O    . ALA A 1 31  ? -1.794  -3.112  7.419   1.00 0.00 ? 1163 ALA A O    2  
ATOM 2131  C CB   . ALA A 1 31  ? -1.575  -0.335  5.481   1.00 0.00 ? 1163 ALA A CB   2  
ATOM 2132  H H    . ALA A 1 31  ? -0.048  0.789   7.155   1.00 0.00 ? 1163 ALA A H    2  
ATOM 2133  H HA   . ALA A 1 31  ? -2.401  -0.679  7.405   1.00 0.00 ? 1163 ALA A HA   2  
ATOM 2134  H HB1  . ALA A 1 31  ? -2.046  0.636   5.453   1.00 0.00 ? 1163 ALA A HB1  2  
ATOM 2135  H HB2  . ALA A 1 31  ? -0.596  -0.274  5.030   1.00 0.00 ? 1163 ALA A HB2  2  
ATOM 2136  H HB3  . ALA A 1 31  ? -2.179  -1.045  4.936   1.00 0.00 ? 1163 ALA A HB3  2  
ATOM 2137  N N    . ARG A 1 32  ? 0.199   -2.538  6.546   1.00 0.00 ? 1164 ARG A N    2  
ATOM 2138  C CA   . ARG A 1 32  ? 0.715   -3.901  6.547   1.00 0.00 ? 1164 ARG A CA   2  
ATOM 2139  C C    . ARG A 1 32  ? 0.445   -4.584  7.884   1.00 0.00 ? 1164 ARG A C    2  
ATOM 2140  O O    . ARG A 1 32  ? 0.206   -5.790  7.939   1.00 0.00 ? 1164 ARG A O    2  
ATOM 2141  C CB   . ARG A 1 32  ? 2.217   -3.901  6.256   1.00 0.00 ? 1164 ARG A CB   2  
ATOM 2142  C CG   . ARG A 1 32  ? 2.885   -5.244  6.498   1.00 0.00 ? 1164 ARG A CG   2  
ATOM 2143  C CD   . ARG A 1 32  ? 4.389   -5.097  6.665   1.00 0.00 ? 1164 ARG A CD   2  
ATOM 2144  N NE   . ARG A 1 32  ? 4.734   -4.275  7.822   1.00 0.00 ? 1164 ARG A NE   2  
ATOM 2145  C CZ   . ARG A 1 32  ? 5.901   -4.346  8.451   1.00 0.00 ? 1164 ARG A CZ   2  
ATOM 2146  N NH1  . ARG A 1 32  ? 6.832   -5.195  8.037   1.00 0.00 ? 1164 ARG A NH1  2  
ATOM 2147  N NH2  . ARG A 1 32  ? 6.140   -3.565  9.497   1.00 0.00 ? 1164 ARG A NH2  2  
ATOM 2148  H H    . ARG A 1 32  ? 0.766   -1.812  6.212   1.00 0.00 ? 1164 ARG A H    2  
ATOM 2149  H HA   . ARG A 1 32  ? 0.207   -4.449  5.767   1.00 0.00 ? 1164 ARG A HA   2  
ATOM 2150  H HB2  . ARG A 1 32  ? 2.372   -3.628  5.222   1.00 0.00 ? 1164 ARG A HB2  2  
ATOM 2151  H HB3  . ARG A 1 32  ? 2.693   -3.167  6.889   1.00 0.00 ? 1164 ARG A HB3  2  
ATOM 2152  H HG2  . ARG A 1 32  ? 2.476   -5.683  7.396   1.00 0.00 ? 1164 ARG A HG2  2  
ATOM 2153  H HG3  . ARG A 1 32  ? 2.686   -5.891  5.656   1.00 0.00 ? 1164 ARG A HG3  2  
ATOM 2154  H HD2  . ARG A 1 32  ? 4.822   -6.078  6.790   1.00 0.00 ? 1164 ARG A HD2  2  
ATOM 2155  H HD3  . ARG A 1 32  ? 4.793   -4.637  5.775   1.00 0.00 ? 1164 ARG A HD3  2  
ATOM 2156  H HE   . ARG A 1 32  ? 4.061   -3.641  8.145   1.00 0.00 ? 1164 ARG A HE   2  
ATOM 2157  H HH11 . ARG A 1 32  ? 6.655   -5.784  7.249   1.00 0.00 ? 1164 ARG A HH11 2  
ATOM 2158  H HH12 . ARG A 1 32  ? 7.710   -5.245  8.512   1.00 0.00 ? 1164 ARG A HH12 2  
ATOM 2159  H HH21 . ARG A 1 32  ? 5.442   -2.923  9.812   1.00 0.00 ? 1164 ARG A HH21 2  
ATOM 2160  H HH22 . ARG A 1 32  ? 7.019   -3.619  9.970   1.00 0.00 ? 1164 ARG A HH22 2  
ATOM 2161  N N    . GLN A 1 33  ? 0.486   -3.804  8.960   1.00 0.00 ? 1165 GLN A N    2  
ATOM 2162  C CA   . GLN A 1 33  ? 0.247   -4.335  10.297  1.00 0.00 ? 1165 GLN A CA   2  
ATOM 2163  C C    . GLN A 1 33  ? -1.216  -4.727  10.474  1.00 0.00 ? 1165 GLN A C    2  
ATOM 2164  O O    . GLN A 1 33  ? -1.540  -5.905  10.624  1.00 0.00 ? 1165 GLN A O    2  
ATOM 2165  C CB   . GLN A 1 33  ? 0.643   -3.303  11.355  1.00 0.00 ? 1165 GLN A CB   2  
ATOM 2166  C CG   . GLN A 1 33  ? 0.367   -3.757  12.780  1.00 0.00 ? 1165 GLN A CG   2  
ATOM 2167  C CD   . GLN A 1 33  ? -1.075  -3.537  13.194  1.00 0.00 ? 1165 GLN A CD   2  
ATOM 2168  O OE1  . GLN A 1 33  ? -1.900  -4.448  13.122  1.00 0.00 ? 1165 GLN A OE1  2  
ATOM 2169  N NE2  . GLN A 1 33  ? -1.386  -2.322  13.631  1.00 0.00 ? 1165 GLN A NE2  2  
ATOM 2170  H H    . GLN A 1 33  ? 0.682   -2.851  8.852   1.00 0.00 ? 1165 GLN A H    2  
ATOM 2171  H HA   . GLN A 1 33  ? 0.860   -5.215  10.418  1.00 0.00 ? 1165 GLN A HA   2  
ATOM 2172  H HB2  . GLN A 1 33  ? 1.699   -3.098  11.264  1.00 0.00 ? 1165 GLN A HB2  2  
ATOM 2173  H HB3  . GLN A 1 33  ? 0.090   -2.393  11.178  1.00 0.00 ? 1165 GLN A HB3  2  
ATOM 2174  H HG2  . GLN A 1 33  ? 0.590   -4.811  12.858  1.00 0.00 ? 1165 GLN A HG2  2  
ATOM 2175  H HG3  . GLN A 1 33  ? 1.008   -3.204  13.450  1.00 0.00 ? 1165 GLN A HG3  2  
ATOM 2176  H HE21 . GLN A 1 33  ? -0.677  -1.645  13.660  1.00 0.00 ? 1165 GLN A HE21 2  
ATOM 2177  H HE22 . GLN A 1 33  ? -2.310  -2.151  13.904  1.00 0.00 ? 1165 GLN A HE22 2  
ATOM 2178  N N    . LYS A 1 34  ? -2.096  -3.732  10.455  1.00 0.00 ? 1166 LYS A N    2  
ATOM 2179  C CA   . LYS A 1 34  ? -3.526  -3.971  10.612  1.00 0.00 ? 1166 LYS A CA   2  
ATOM 2180  C C    . LYS A 1 34  ? -4.018  -5.007  9.607   1.00 0.00 ? 1166 LYS A C    2  
ATOM 2181  O O    . LYS A 1 34  ? -4.999  -5.709  9.853   1.00 0.00 ? 1166 LYS A O    2  
ATOM 2182  C CB   . LYS A 1 34  ? -4.305  -2.666  10.438  1.00 0.00 ? 1166 LYS A CB   2  
ATOM 2183  C CG   . LYS A 1 34  ? -4.397  -2.200  8.995   1.00 0.00 ? 1166 LYS A CG   2  
ATOM 2184  C CD   . LYS A 1 34  ? -5.672  -1.413  8.743   1.00 0.00 ? 1166 LYS A CD   2  
ATOM 2185  C CE   . LYS A 1 34  ? -5.615  -0.670  7.417   1.00 0.00 ? 1166 LYS A CE   2  
ATOM 2186  N NZ   . LYS A 1 34  ? -5.792  -1.588  6.258   1.00 0.00 ? 1166 LYS A NZ   2  
ATOM 2187  H H    . LYS A 1 34  ? -1.776  -2.813  10.332  1.00 0.00 ? 1166 LYS A H    2  
ATOM 2188  H HA   . LYS A 1 34  ? -3.691  -4.349  11.610  1.00 0.00 ? 1166 LYS A HA   2  
ATOM 2189  H HB2  . LYS A 1 34  ? -5.308  -2.806  10.814  1.00 0.00 ? 1166 LYS A HB2  2  
ATOM 2190  H HB3  . LYS A 1 34  ? -3.819  -1.891  11.014  1.00 0.00 ? 1166 LYS A HB3  2  
ATOM 2191  H HG2  . LYS A 1 34  ? -3.548  -1.570  8.775   1.00 0.00 ? 1166 LYS A HG2  2  
ATOM 2192  H HG3  . LYS A 1 34  ? -4.383  -3.064  8.346   1.00 0.00 ? 1166 LYS A HG3  2  
ATOM 2193  H HD2  . LYS A 1 34  ? -6.508  -2.096  8.724   1.00 0.00 ? 1166 LYS A HD2  2  
ATOM 2194  H HD3  . LYS A 1 34  ? -5.807  -0.698  9.542   1.00 0.00 ? 1166 LYS A HD3  2  
ATOM 2195  H HE2  . LYS A 1 34  ? -6.399  0.072   7.401   1.00 0.00 ? 1166 LYS A HE2  2  
ATOM 2196  H HE3  . LYS A 1 34  ? -4.656  -0.180  7.335   1.00 0.00 ? 1166 LYS A HE3  2  
ATOM 2197  H HZ1  . LYS A 1 34  ? -4.898  -2.079  6.053   1.00 0.00 ? 1166 LYS A HZ1  2  
ATOM 2198  H HZ2  . LYS A 1 34  ? -6.079  -1.049  5.417   1.00 0.00 ? 1166 LYS A HZ2  2  
ATOM 2199  H HZ3  . LYS A 1 34  ? -6.523  -2.295  6.471   1.00 0.00 ? 1166 LYS A HZ3  2  
ATOM 2200  N N    . HIS A 1 35  ? -3.329  -5.099  8.473   1.00 0.00 ? 1167 HIS A N    2  
ATOM 2201  C CA   . HIS A 1 35  ? -3.695  -6.051  7.431   1.00 0.00 ? 1167 HIS A CA   2  
ATOM 2202  C C    . HIS A 1 35  ? -3.112  -7.430  7.726   1.00 0.00 ? 1167 HIS A C    2  
ATOM 2203  O O    . HIS A 1 35  ? -3.732  -8.452  7.434   1.00 0.00 ? 1167 HIS A O    2  
ATOM 2204  C CB   . HIS A 1 35  ? -3.208  -5.560  6.068   1.00 0.00 ? 1167 HIS A CB   2  
ATOM 2205  C CG   . HIS A 1 35  ? -3.940  -6.172  4.914   1.00 0.00 ? 1167 HIS A CG   2  
ATOM 2206  N ND1  . HIS A 1 35  ? -5.240  -6.624  5.001   1.00 0.00 ? 1167 HIS A ND1  2  
ATOM 2207  C CD2  . HIS A 1 35  ? -3.548  -6.405  3.639   1.00 0.00 ? 1167 HIS A CD2  2  
ATOM 2208  C CE1  . HIS A 1 35  ? -5.615  -7.110  3.832   1.00 0.00 ? 1167 HIS A CE1  2  
ATOM 2209  N NE2  . HIS A 1 35  ? -4.606  -6.988  2.987   1.00 0.00 ? 1167 HIS A NE2  2  
ATOM 2210  H H    . HIS A 1 35  ? -2.556  -4.512  8.335   1.00 0.00 ? 1167 HIS A H    2  
ATOM 2211  H HA   . HIS A 1 35  ? -4.772  -6.126  7.413   1.00 0.00 ? 1167 HIS A HA   2  
ATOM 2212  H HB2  . HIS A 1 35  ? -3.337  -4.489  6.011   1.00 0.00 ? 1167 HIS A HB2  2  
ATOM 2213  H HB3  . HIS A 1 35  ? -2.159  -5.798  5.960   1.00 0.00 ? 1167 HIS A HB3  2  
ATOM 2214  H HD1  . HIS A 1 35  ? -5.803  -6.595  5.803   1.00 0.00 ? 1167 HIS A HD1  2  
ATOM 2215  H HD2  . HIS A 1 35  ? -2.581  -6.175  3.213   1.00 0.00 ? 1167 HIS A HD2  2  
ATOM 2216  H HE1  . HIS A 1 35  ? -6.581  -7.534  3.603   1.00 0.00 ? 1167 HIS A HE1  2  
ATOM 2217  H HE2  . HIS A 1 35  ? -4.587  -7.347  2.076   1.00 0.00 ? 1167 HIS A HE2  2  
ATOM 2218  N N    . ALA A 1 36  ? -1.917  -7.450  8.306   1.00 0.00 ? 1168 ALA A N    2  
ATOM 2219  C CA   . ALA A 1 36  ? -1.251  -8.703  8.641   1.00 0.00 ? 1168 ALA A CA   2  
ATOM 2220  C C    . ALA A 1 36  ? -2.153  -9.594  9.489   1.00 0.00 ? 1168 ALA A C    2  
ATOM 2221  O O    . ALA A 1 36  ? -2.319  -10.778 9.201   1.00 0.00 ? 1168 ALA A O    2  
ATOM 2222  C CB   . ALA A 1 36  ? 0.057   -8.427  9.369   1.00 0.00 ? 1168 ALA A CB   2  
ATOM 2223  H H    . ALA A 1 36  ? -1.472  -6.602  8.514   1.00 0.00 ? 1168 ALA A H    2  
ATOM 2224  H HA   . ALA A 1 36  ? -1.020  -9.216  7.719   1.00 0.00 ? 1168 ALA A HA   2  
ATOM 2225  H HB1  . ALA A 1 36  ? 0.552   -9.363  9.583   1.00 0.00 ? 1168 ALA A HB1  2  
ATOM 2226  H HB2  . ALA A 1 36  ? 0.693   -7.817  8.746   1.00 0.00 ? 1168 ALA A HB2  2  
ATOM 2227  H HB3  . ALA A 1 36  ? -0.148  -7.908  10.293  1.00 0.00 ? 1168 ALA A HB3  2  
ATOM 2228  N N    . ASN A 1 37  ? -2.732  -9.016  10.537  1.00 0.00 ? 1169 ASN A N    2  
ATOM 2229  C CA   . ASN A 1 37  ? -3.616  -9.759  11.428  1.00 0.00 ? 1169 ASN A CA   2  
ATOM 2230  C C    . ASN A 1 37  ? -4.899  -10.163 10.708  1.00 0.00 ? 1169 ASN A C    2  
ATOM 2231  O O    . ASN A 1 37  ? -5.431  -11.251 10.928  1.00 0.00 ? 1169 ASN A O    2  
ATOM 2232  C CB   . ASN A 1 37  ? -3.952  -8.919  12.662  1.00 0.00 ? 1169 ASN A CB   2  
ATOM 2233  C CG   . ASN A 1 37  ? -2.843  -8.940  13.695  1.00 0.00 ? 1169 ASN A CG   2  
ATOM 2234  O OD1  . ASN A 1 37  ? -2.925  -9.651  14.696  1.00 0.00 ? 1169 ASN A OD1  2  
ATOM 2235  N ND2  . ASN A 1 37  ? -1.798  -8.156  13.456  1.00 0.00 ? 1169 ASN A ND2  2  
ATOM 2236  H H    . ASN A 1 37  ? -2.560  -8.068  10.715  1.00 0.00 ? 1169 ASN A H    2  
ATOM 2237  H HA   . ASN A 1 37  ? -3.096  -10.651 11.741  1.00 0.00 ? 1169 ASN A HA   2  
ATOM 2238  H HB2  . ASN A 1 37  ? -4.118  -7.896  12.359  1.00 0.00 ? 1169 ASN A HB2  2  
ATOM 2239  H HB3  . ASN A 1 37  ? -4.852  -9.305  13.118  1.00 0.00 ? 1169 ASN A HB3  2  
ATOM 2240  H HD21 . ASN A 1 37  ? -1.801  -7.616  12.638  1.00 0.00 ? 1169 ASN A HD21 2  
ATOM 2241  H HD22 . ASN A 1 37  ? -1.065  -8.150  14.107  1.00 0.00 ? 1169 ASN A HD22 2  
ATOM 2242  N N    . LYS A 1 38  ? -5.391  -9.279  9.846   1.00 0.00 ? 1170 LYS A N    2  
ATOM 2243  C CA   . LYS A 1 38  ? -6.610  -9.543  9.091   1.00 0.00 ? 1170 LYS A CA   2  
ATOM 2244  C C    . LYS A 1 38  ? -6.533  -10.893 8.387   1.00 0.00 ? 1170 LYS A C    2  
ATOM 2245  O O    . LYS A 1 38  ? -7.506  -11.645 8.358   1.00 0.00 ? 1170 LYS A O    2  
ATOM 2246  C CB   . LYS A 1 38  ? -6.849  -8.433  8.065   1.00 0.00 ? 1170 LYS A CB   2  
ATOM 2247  C CG   . LYS A 1 38  ? -7.975  -8.736  7.092   1.00 0.00 ? 1170 LYS A CG   2  
ATOM 2248  C CD   . LYS A 1 38  ? -8.645  -7.464  6.600   1.00 0.00 ? 1170 LYS A CD   2  
ATOM 2249  C CE   . LYS A 1 38  ? -9.265  -7.657  5.225   1.00 0.00 ? 1170 LYS A CE   2  
ATOM 2250  N NZ   . LYS A 1 38  ? -10.204 -6.554  4.880   1.00 0.00 ? 1170 LYS A NZ   2  
ATOM 2251  H H    . LYS A 1 38  ? -4.921  -8.428  9.714   1.00 0.00 ? 1170 LYS A H    2  
ATOM 2252  H HA   . LYS A 1 38  ? -7.434  -9.560  9.788   1.00 0.00 ? 1170 LYS A HA   2  
ATOM 2253  H HB2  . LYS A 1 38  ? -7.090  -7.520  8.589   1.00 0.00 ? 1170 LYS A HB2  2  
ATOM 2254  H HB3  . LYS A 1 38  ? -5.942  -8.283  7.497   1.00 0.00 ? 1170 LYS A HB3  2  
ATOM 2255  H HG2  . LYS A 1 38  ? -7.572  -9.270  6.244   1.00 0.00 ? 1170 LYS A HG2  2  
ATOM 2256  H HG3  . LYS A 1 38  ? -8.712  -9.351  7.589   1.00 0.00 ? 1170 LYS A HG3  2  
ATOM 2257  H HD2  . LYS A 1 38  ? -9.421  -7.183  7.296   1.00 0.00 ? 1170 LYS A HD2  2  
ATOM 2258  H HD3  . LYS A 1 38  ? -7.906  -6.677  6.545   1.00 0.00 ? 1170 LYS A HD3  2  
ATOM 2259  H HE2  . LYS A 1 38  ? -8.476  -7.690  4.490   1.00 0.00 ? 1170 LYS A HE2  2  
ATOM 2260  H HE3  . LYS A 1 38  ? -9.805  -8.593  5.216   1.00 0.00 ? 1170 LYS A HE3  2  
ATOM 2261  H HZ1  . LYS A 1 38  ? -10.870 -6.394  5.663   1.00 0.00 ? 1170 LYS A HZ1  2  
ATOM 2262  H HZ2  . LYS A 1 38  ? -10.744 -6.797  4.025   1.00 0.00 ? 1170 LYS A HZ2  2  
ATOM 2263  H HZ3  . LYS A 1 38  ? -9.675  -5.676  4.705   1.00 0.00 ? 1170 LYS A HZ3  2  
ATOM 2264  N N    . MET A 1 39  ? -5.368  -11.195 7.821   1.00 0.00 ? 1171 MET A N    2  
ATOM 2265  C CA   . MET A 1 39  ? -5.164  -12.457 7.120   1.00 0.00 ? 1171 MET A CA   2  
ATOM 2266  C C    . MET A 1 39  ? -4.501  -13.484 8.031   1.00 0.00 ? 1171 MET A C    2  
ATOM 2267  O O    . MET A 1 39  ? -4.197  -14.599 7.607   1.00 0.00 ? 1171 MET A O    2  
ATOM 2268  C CB   . MET A 1 39  ? -4.309  -12.238 5.870   1.00 0.00 ? 1171 MET A CB   2  
ATOM 2269  C CG   . MET A 1 39  ? -4.980  -11.369 4.819   1.00 0.00 ? 1171 MET A CG   2  
ATOM 2270  S SD   . MET A 1 39  ? -4.640  -9.613  5.047   1.00 0.00 ? 1171 MET A SD   2  
ATOM 2271  C CE   . MET A 1 39  ? -3.257  -9.389  3.931   1.00 0.00 ? 1171 MET A CE   2  
ATOM 2272  H H    . MET A 1 39  ? -4.629  -10.554 7.878   1.00 0.00 ? 1171 MET A H    2  
ATOM 2273  H HA   . MET A 1 39  ? -6.133  -12.830 6.821   1.00 0.00 ? 1171 MET A HA   2  
ATOM 2274  H HB2  . MET A 1 39  ? -3.383  -11.763 6.161   1.00 0.00 ? 1171 MET A HB2  2  
ATOM 2275  H HB3  . MET A 1 39  ? -4.088  -13.197 5.426   1.00 0.00 ? 1171 MET A HB3  2  
ATOM 2276  H HG2  . MET A 1 39  ? -4.623  -11.666 3.844   1.00 0.00 ? 1171 MET A HG2  2  
ATOM 2277  H HG3  . MET A 1 39  ? -6.047  -11.525 4.871   1.00 0.00 ? 1171 MET A HG3  2  
ATOM 2278  H HE1  . MET A 1 39  ? -3.625  -9.144  2.946   1.00 0.00 ? 1171 MET A HE1  2  
ATOM 2279  H HE2  . MET A 1 39  ? -2.631  -8.585  4.291   1.00 0.00 ? 1171 MET A HE2  2  
ATOM 2280  H HE3  . MET A 1 39  ? -2.681  -10.301 3.884   1.00 0.00 ? 1171 MET A HE3  2  
ATOM 2281  N N    . ASP A 1 40  ? -4.278  -13.102 9.283   1.00 0.00 ? 1172 ASP A N    2  
ATOM 2282  C CA   . ASP A 1 40  ? -3.651  -13.990 10.254  1.00 0.00 ? 1172 ASP A CA   2  
ATOM 2283  C C    . ASP A 1 40  ? -2.241  -14.370 9.812   1.00 0.00 ? 1172 ASP A C    2  
ATOM 2284  O O    . ASP A 1 40  ? -1.762  -15.466 10.104  1.00 0.00 ? 1172 ASP A O    2  
ATOM 2285  C CB   . ASP A 1 40  ? -4.496  -15.251 10.444  1.00 0.00 ? 1172 ASP A CB   2  
ATOM 2286  C CG   . ASP A 1 40  ? -5.970  -14.939 10.615  1.00 0.00 ? 1172 ASP A CG   2  
ATOM 2287  O OD1  . ASP A 1 40  ? -6.389  -14.661 11.758  1.00 0.00 ? 1172 ASP A OD1  2  
ATOM 2288  O OD2  . ASP A 1 40  ? -6.704  -14.973 9.606   1.00 0.00 ? 1172 ASP A OD2  2  
ATOM 2289  H H    . ASP A 1 40  ? -4.543  -12.200 9.562   1.00 0.00 ? 1172 ASP A H    2  
ATOM 2290  H HA   . ASP A 1 40  ? -3.590  -13.464 11.195  1.00 0.00 ? 1172 ASP A HA   2  
ATOM 2291  H HB2  . ASP A 1 40  ? -4.380  -15.888 9.580   1.00 0.00 ? 1172 ASP A HB2  2  
ATOM 2292  H HB3  . ASP A 1 40  ? -4.154  -15.777 11.323  1.00 0.00 ? 1172 ASP A HB3  2  
ATOM 2293  N N    . VAL A 1 41  ? -1.582  -13.458 9.106   1.00 0.00 ? 1173 VAL A N    2  
ATOM 2294  C CA   . VAL A 1 41  ? -0.227  -13.696 8.623   1.00 0.00 ? 1173 VAL A CA   2  
ATOM 2295  C C    . VAL A 1 41  ? 0.776   -12.792 9.330   1.00 0.00 ? 1173 VAL A C    2  
ATOM 2296  O O    . VAL A 1 41  ? 0.529   -11.607 9.554   1.00 0.00 ? 1173 VAL A O    2  
ATOM 2297  C CB   . VAL A 1 41  ? -0.125  -13.469 7.103   1.00 0.00 ? 1173 VAL A CB   2  
ATOM 2298  C CG1  . VAL A 1 41  ? -1.031  -14.435 6.356   1.00 0.00 ? 1173 VAL A CG1  2  
ATOM 2299  C CG2  . VAL A 1 41  ? -0.467  -12.028 6.756   1.00 0.00 ? 1173 VAL A CG2  2  
ATOM 2300  H H    . VAL A 1 41  ? -2.017  -12.603 8.905   1.00 0.00 ? 1173 VAL A H    2  
ATOM 2301  H HA   . VAL A 1 41  ? 0.024   -14.727 8.829   1.00 0.00 ? 1173 VAL A HA   2  
ATOM 2302  H HB   . VAL A 1 41  ? 0.894   -13.658 6.799   1.00 0.00 ? 1173 VAL A HB   2  
ATOM 2303  H HG11 . VAL A 1 41  ? -2.034  -14.035 6.322   1.00 0.00 ? 1173 VAL A HG11 2  
ATOM 2304  H HG12 . VAL A 1 41  ? -0.662  -14.571 5.350   1.00 0.00 ? 1173 VAL A HG12 2  
ATOM 2305  H HG13 . VAL A 1 41  ? -1.042  -15.387 6.867   1.00 0.00 ? 1173 VAL A HG13 2  
ATOM 2306  H HG21 . VAL A 1 41  ? -0.589  -11.459 7.666   1.00 0.00 ? 1173 VAL A HG21 2  
ATOM 2307  H HG22 . VAL A 1 41  ? 0.332   -11.599 6.169   1.00 0.00 ? 1173 VAL A HG22 2  
ATOM 2308  H HG23 . VAL A 1 41  ? -1.384  -12.002 6.188   1.00 0.00 ? 1173 VAL A HG23 2  
ATOM 2309  N N    . PRO A 1 42  ? 1.935   -13.361 9.690   1.00 0.00 ? 1174 PRO A N    2  
ATOM 2310  C CA   . PRO A 1 42  ? 3.000   -12.624 10.376  1.00 0.00 ? 1174 PRO A CA   2  
ATOM 2311  C C    . PRO A 1 42  ? 3.307   -11.290 9.704   1.00 0.00 ? 1174 PRO A C    2  
ATOM 2312  O O    . PRO A 1 42  ? 3.403   -11.191 8.481   1.00 0.00 ? 1174 PRO A O    2  
ATOM 2313  C CB   . PRO A 1 42  ? 4.205   -13.563 10.274  1.00 0.00 ? 1174 PRO A CB   2  
ATOM 2314  C CG   . PRO A 1 42  ? 3.614   -14.925 10.150  1.00 0.00 ? 1174 PRO A CG   2  
ATOM 2315  C CD   . PRO A 1 42  ? 2.297   -14.769 9.454   1.00 0.00 ? 1174 PRO A CD   2  
ATOM 2316  H HA   . PRO A 1 42  ? 2.760   -12.455 11.416  1.00 0.00 ? 1174 PRO A HA   2  
ATOM 2317  H HB2  . PRO A 1 42  ? 4.792   -13.306 9.404   1.00 0.00 ? 1174 PRO A HB2  2  
ATOM 2318  H HB3  . PRO A 1 42  ? 4.810   -13.475 11.164  1.00 0.00 ? 1174 PRO A HB3  2  
ATOM 2319  H HG2  . PRO A 1 42  ? 4.265   -15.556 9.565   1.00 0.00 ? 1174 PRO A HG2  2  
ATOM 2320  H HG3  . PRO A 1 42  ? 3.460   -15.349 11.132  1.00 0.00 ? 1174 PRO A HG3  2  
ATOM 2321  H HD2  . PRO A 1 42  ? 2.408   -14.967 8.398   1.00 0.00 ? 1174 PRO A HD2  2  
ATOM 2322  H HD3  . PRO A 1 42  ? 1.564   -15.433 9.889   1.00 0.00 ? 1174 PRO A HD3  2  
ATOM 2323  N N    . PRO A 1 43  ? 3.465   -10.237 10.521  1.00 0.00 ? 1175 PRO A N    2  
ATOM 2324  C CA   . PRO A 1 43  ? 3.764   -8.890  10.028  1.00 0.00 ? 1175 PRO A CA   2  
ATOM 2325  C C    . PRO A 1 43  ? 4.900   -8.884  9.010   1.00 0.00 ? 1175 PRO A C    2  
ATOM 2326  O O    . PRO A 1 43  ? 5.081   -7.915  8.273   1.00 0.00 ? 1175 PRO A O    2  
ATOM 2327  C CB   . PRO A 1 43  ? 4.175   -8.132  11.293  1.00 0.00 ? 1175 PRO A CB   2  
ATOM 2328  C CG   . PRO A 1 43  ? 3.488   -8.848  12.403  1.00 0.00 ? 1175 PRO A CG   2  
ATOM 2329  C CD   . PRO A 1 43  ? 3.364   -10.283 11.990  1.00 0.00 ? 1175 PRO A CD   2  
ATOM 2330  H HA   . PRO A 1 43  ? 2.892   -8.423  9.594   1.00 0.00 ? 1175 PRO A HA   2  
ATOM 2331  H HB2  . PRO A 1 43  ? 5.250   -8.168  11.403  1.00 0.00 ? 1175 PRO A HB2  2  
ATOM 2332  H HB3  . PRO A 1 43  ? 3.849   -7.105  11.224  1.00 0.00 ? 1175 PRO A HB3  2  
ATOM 2333  H HG2  . PRO A 1 43  ? 4.076   -8.777  13.306  1.00 0.00 ? 1175 PRO A HG2  2  
ATOM 2334  H HG3  . PRO A 1 43  ? 2.506   -8.426  12.560  1.00 0.00 ? 1175 PRO A HG3  2  
ATOM 2335  H HD2  . PRO A 1 43  ? 4.169   -10.864 12.414  1.00 0.00 ? 1175 PRO A HD2  2  
ATOM 2336  H HD3  . PRO A 1 43  ? 2.407   -10.678 12.298  1.00 0.00 ? 1175 PRO A HD3  2  
ATOM 2337  N N    . ALA A 1 44  ? 5.662   -9.972  8.975   1.00 0.00 ? 1176 ALA A N    2  
ATOM 2338  C CA   . ALA A 1 44  ? 6.779   -10.093 8.046   1.00 0.00 ? 1176 ALA A CA   2  
ATOM 2339  C C    . ALA A 1 44  ? 6.358   -10.821 6.774   1.00 0.00 ? 1176 ALA A C    2  
ATOM 2340  O O    . ALA A 1 44  ? 6.703   -10.405 5.667   1.00 0.00 ? 1176 ALA A O    2  
ATOM 2341  C CB   . ALA A 1 44  ? 7.942   -10.816 8.709   1.00 0.00 ? 1176 ALA A CB   2  
ATOM 2342  H H    . ALA A 1 44  ? 5.468   -10.712 9.588   1.00 0.00 ? 1176 ALA A H    2  
ATOM 2343  H HA   . ALA A 1 44  ? 7.107   -9.096  7.787   1.00 0.00 ? 1176 ALA A HA   2  
ATOM 2344  H HB1  . ALA A 1 44  ? 8.860   -10.563 8.199   1.00 0.00 ? 1176 ALA A HB1  2  
ATOM 2345  H HB2  . ALA A 1 44  ? 8.010   -10.514 9.744   1.00 0.00 ? 1176 ALA A HB2  2  
ATOM 2346  H HB3  . ALA A 1 44  ? 7.781   -11.882 8.655   1.00 0.00 ? 1176 ALA A HB3  2  
ATOM 2347  N N    . ILE A 1 45  ? 5.612   -11.908 6.939   1.00 0.00 ? 1177 ILE A N    2  
ATOM 2348  C CA   . ILE A 1 45  ? 5.145   -12.693 5.803   1.00 0.00 ? 1177 ILE A CA   2  
ATOM 2349  C C    . ILE A 1 45  ? 4.322   -11.837 4.845   1.00 0.00 ? 1177 ILE A C    2  
ATOM 2350  O O    . ILE A 1 45  ? 4.435   -11.967 3.625   1.00 0.00 ? 1177 ILE A O    2  
ATOM 2351  C CB   . ILE A 1 45  ? 4.295   -13.893 6.259   1.00 0.00 ? 1177 ILE A CB   2  
ATOM 2352  C CG1  . ILE A 1 45  ? 5.135   -14.843 7.116   1.00 0.00 ? 1177 ILE A CG1  2  
ATOM 2353  C CG2  . ILE A 1 45  ? 3.722   -14.625 5.055   1.00 0.00 ? 1177 ILE A CG2  2  
ATOM 2354  C CD1  . ILE A 1 45  ? 6.183   -15.599 6.330   1.00 0.00 ? 1177 ILE A CD1  2  
ATOM 2355  H H    . ILE A 1 45  ? 5.370   -12.189 7.845   1.00 0.00 ? 1177 ILE A H    2  
ATOM 2356  H HA   . ILE A 1 45  ? 6.012   -13.069 5.278   1.00 0.00 ? 1177 ILE A HA   2  
ATOM 2357  H HB   . ILE A 1 45  ? 3.472   -13.520 6.849   1.00 0.00 ? 1177 ILE A HB   2  
ATOM 2358  H HG12 . ILE A 1 45  ? 5.640   -14.276 7.882   1.00 0.00 ? 1177 ILE A HG12 2  
ATOM 2359  H HG13 . ILE A 1 45  ? 4.482   -15.567 7.583   1.00 0.00 ? 1177 ILE A HG13 2  
ATOM 2360  H HG21 . ILE A 1 45  ? 3.383   -13.905 4.324   1.00 0.00 ? 1177 ILE A HG21 2  
ATOM 2361  H HG22 . ILE A 1 45  ? 4.486   -15.249 4.616   1.00 0.00 ? 1177 ILE A HG22 2  
ATOM 2362  H HG23 . ILE A 1 45  ? 2.891   -15.238 5.368   1.00 0.00 ? 1177 ILE A HG23 2  
ATOM 2363  H HD11 . ILE A 1 45  ? 6.333   -15.119 5.375   1.00 0.00 ? 1177 ILE A HD11 2  
ATOM 2364  H HD12 . ILE A 1 45  ? 7.111   -15.607 6.881   1.00 0.00 ? 1177 ILE A HD12 2  
ATOM 2365  H HD13 . ILE A 1 45  ? 5.850   -16.616 6.173   1.00 0.00 ? 1177 ILE A HD13 2  
ATOM 2366  N N    . LEU A 1 46  ? 3.495   -10.961 5.405   1.00 0.00 ? 1178 LEU A N    2  
ATOM 2367  C CA   . LEU A 1 46  ? 2.654   -10.081 4.601   1.00 0.00 ? 1178 LEU A CA   2  
ATOM 2368  C C    . LEU A 1 46  ? 3.502   -9.202  3.687   1.00 0.00 ? 1178 LEU A C    2  
ATOM 2369  O O    . LEU A 1 46  ? 3.413   -9.295  2.463   1.00 0.00 ? 1178 LEU A O    2  
ATOM 2370  C CB   . LEU A 1 46  ? 1.785   -9.206  5.506   1.00 0.00 ? 1178 LEU A CB   2  
ATOM 2371  C CG   . LEU A 1 46  ? 0.581   -8.540  4.840   1.00 0.00 ? 1178 LEU A CG   2  
ATOM 2372  C CD1  . LEU A 1 46  ? -0.446  -9.583  4.428   1.00 0.00 ? 1178 LEU A CD1  2  
ATOM 2373  C CD2  . LEU A 1 46  ? -0.044  -7.514  5.774   1.00 0.00 ? 1178 LEU A CD2  2  
ATOM 2374  H H    . LEU A 1 46  ? 3.449   -10.903 6.381   1.00 0.00 ? 1178 LEU A H    2  
ATOM 2375  H HA   . LEU A 1 46  ? 2.014   -10.701 3.991   1.00 0.00 ? 1178 LEU A HA   2  
ATOM 2376  H HB2  . LEU A 1 46  ? 1.418   -9.825  6.310   1.00 0.00 ? 1178 LEU A HB2  2  
ATOM 2377  H HB3  . LEU A 1 46  ? 2.414   -8.426  5.912   1.00 0.00 ? 1178 LEU A HB3  2  
ATOM 2378  H HG   . LEU A 1 46  ? 0.910   -8.025  3.948   1.00 0.00 ? 1178 LEU A HG   2  
ATOM 2379  H HD11 . LEU A 1 46  ? -0.900  -9.291  3.493   1.00 0.00 ? 1178 LEU A HD11 2  
ATOM 2380  H HD12 . LEU A 1 46  ? -1.207  -9.660  5.189   1.00 0.00 ? 1178 LEU A HD12 2  
ATOM 2381  H HD13 . LEU A 1 46  ? 0.041   -10.540 4.308   1.00 0.00 ? 1178 LEU A HD13 2  
ATOM 2382  H HD21 . LEU A 1 46  ? 0.246   -6.521  5.464   1.00 0.00 ? 1178 LEU A HD21 2  
ATOM 2383  H HD22 . LEU A 1 46  ? 0.298   -7.690  6.783   1.00 0.00 ? 1178 LEU A HD22 2  
ATOM 2384  H HD23 . LEU A 1 46  ? -1.120  -7.602  5.737   1.00 0.00 ? 1178 LEU A HD23 2  
ATOM 2385  N N    . ALA A 1 47  ? 4.326   -8.352  4.290   1.00 0.00 ? 1179 ALA A N    2  
ATOM 2386  C CA   . ALA A 1 47  ? 5.193   -7.460  3.531   1.00 0.00 ? 1179 ALA A CA   2  
ATOM 2387  C C    . ALA A 1 47  ? 6.473   -7.151  4.301   1.00 0.00 ? 1179 ALA A C    2  
ATOM 2388  O O    . ALA A 1 47  ? 6.446   -6.951  5.516   1.00 0.00 ? 1179 ALA A O    2  
ATOM 2389  C CB   . ALA A 1 47  ? 4.457   -6.173  3.189   1.00 0.00 ? 1179 ALA A CB   2  
ATOM 2390  H H    . ALA A 1 47  ? 4.352   -8.325  5.269   1.00 0.00 ? 1179 ALA A H    2  
ATOM 2391  H HA   . ALA A 1 47  ? 5.452   -7.954  2.606   1.00 0.00 ? 1179 ALA A HA   2  
ATOM 2392  H HB1  . ALA A 1 47  ? 3.593   -6.403  2.583   1.00 0.00 ? 1179 ALA A HB1  2  
ATOM 2393  H HB2  . ALA A 1 47  ? 4.139   -5.687  4.100   1.00 0.00 ? 1179 ALA A HB2  2  
ATOM 2394  H HB3  . ALA A 1 47  ? 5.117   -5.516  2.642   1.00 0.00 ? 1179 ALA A HB3  2  
ATOM 2395  N N    . THR A 1 48  ? 7.594   -7.114  3.587   1.00 0.00 ? 1180 THR A N    2  
ATOM 2396  C CA   . THR A 1 48  ? 8.884   -6.832  4.204   1.00 0.00 ? 1180 THR A CA   2  
ATOM 2397  C C    . THR A 1 48  ? 9.213   -5.345  4.133   1.00 0.00 ? 1180 THR A C    2  
ATOM 2398  O O    . THR A 1 48  ? 8.625   -4.607  3.345   1.00 0.00 ? 1180 THR A O    2  
ATOM 2399  C CB   . THR A 1 48  ? 10.015  -7.630  3.529   1.00 0.00 ? 1180 THR A CB   2  
ATOM 2400  O OG1  . THR A 1 48  ? 10.223  -7.153  2.195   1.00 0.00 ? 1180 THR A OG1  2  
ATOM 2401  C CG2  . THR A 1 48  ? 9.686   -9.115  3.496   1.00 0.00 ? 1180 THR A CG2  2  
ATOM 2402  H H    . THR A 1 48  ? 7.550   -7.282  2.623   1.00 0.00 ? 1180 THR A H    2  
ATOM 2403  H HA   . THR A 1 48  ? 8.830   -7.130  5.241   1.00 0.00 ? 1180 THR A HA   2  
ATOM 2404  H HB   . THR A 1 48  ? 10.923  -7.490  4.099   1.00 0.00 ? 1180 THR A HB   2  
ATOM 2405  H HG1  . THR A 1 48  ? 9.375   -6.970  1.784   1.00 0.00 ? 1180 THR A HG1  2  
ATOM 2406  H HG21 . THR A 1 48  ? 8.614   -9.245  3.451   1.00 0.00 ? 1180 THR A HG21 2  
ATOM 2407  H HG22 . THR A 1 48  ? 10.069  -9.588  4.387   1.00 0.00 ? 1180 THR A HG22 2  
ATOM 2408  H HG23 . THR A 1 48  ? 10.139  -9.564  2.626   1.00 0.00 ? 1180 THR A HG23 2  
ATOM 2409  N N    . ASN A 1 49  ? 10.158  -4.914  4.962   1.00 0.00 ? 1181 ASN A N    2  
ATOM 2410  C CA   . ASN A 1 49  ? 10.566  -3.514  4.993   1.00 0.00 ? 1181 ASN A CA   2  
ATOM 2411  C C    . ASN A 1 49  ? 11.029  -3.052  3.615   1.00 0.00 ? 1181 ASN A C    2  
ATOM 2412  O O    . ASN A 1 49  ? 10.795  -1.909  3.219   1.00 0.00 ? 1181 ASN A O    2  
ATOM 2413  C CB   . ASN A 1 49  ? 11.687  -3.310  6.014   1.00 0.00 ? 1181 ASN A CB   2  
ATOM 2414  C CG   . ASN A 1 49  ? 11.330  -3.861  7.382   1.00 0.00 ? 1181 ASN A CG   2  
ATOM 2415  O OD1  . ASN A 1 49  ? 10.289  -4.495  7.555   1.00 0.00 ? 1181 ASN A OD1  2  
ATOM 2416  N ND2  . ASN A 1 49  ? 12.195  -3.621  8.360   1.00 0.00 ? 1181 ASN A ND2  2  
ATOM 2417  H H    . ASN A 1 49  ? 10.591  -5.551  5.567   1.00 0.00 ? 1181 ASN A H    2  
ATOM 2418  H HA   . ASN A 1 49  ? 9.711   -2.926  5.288   1.00 0.00 ? 1181 ASN A HA   2  
ATOM 2419  H HB2  . ASN A 1 49  ? 12.578  -3.813  5.667   1.00 0.00 ? 1181 ASN A HB2  2  
ATOM 2420  H HB3  . ASN A 1 49  ? 11.889  -2.254  6.113   1.00 0.00 ? 1181 ASN A HB3  2  
ATOM 2421  H HD21 . ASN A 1 49  ? 13.004  -3.109  8.149   1.00 0.00 ? 1181 ASN A HD21 2  
ATOM 2422  H HD22 . ASN A 1 49  ? 11.989  -3.966  9.254   1.00 0.00 ? 1181 ASN A HD22 2  
ATOM 2423  N N    . LYS A 1 50  ? 11.688  -3.947  2.887   1.00 0.00 ? 1182 LYS A N    2  
ATOM 2424  C CA   . LYS A 1 50  ? 12.183  -3.634  1.552   1.00 0.00 ? 1182 LYS A CA   2  
ATOM 2425  C C    . LYS A 1 50  ? 11.044  -3.191  0.639   1.00 0.00 ? 1182 LYS A C    2  
ATOM 2426  O O    . LYS A 1 50  ? 11.118  -2.139  0.003   1.00 0.00 ? 1182 LYS A O    2  
ATOM 2427  C CB   . LYS A 1 50  ? 12.890  -4.850  0.949   1.00 0.00 ? 1182 LYS A CB   2  
ATOM 2428  C CG   . LYS A 1 50  ? 14.345  -4.975  1.366   1.00 0.00 ? 1182 LYS A CG   2  
ATOM 2429  C CD   . LYS A 1 50  ? 15.231  -4.009  0.599   1.00 0.00 ? 1182 LYS A CD   2  
ATOM 2430  C CE   . LYS A 1 50  ? 15.524  -4.515  -0.805  1.00 0.00 ? 1182 LYS A CE   2  
ATOM 2431  N NZ   . LYS A 1 50  ? 16.750  -5.359  -0.846  1.00 0.00 ? 1182 LYS A NZ   2  
ATOM 2432  H H    . LYS A 1 50  ? 11.844  -4.842  3.257   1.00 0.00 ? 1182 LYS A H    2  
ATOM 2433  H HA   . LYS A 1 50  ? 12.891  -2.824  1.642   1.00 0.00 ? 1182 LYS A HA   2  
ATOM 2434  H HB2  . LYS A 1 50  ? 12.370  -5.744  1.259   1.00 0.00 ? 1182 LYS A HB2  2  
ATOM 2435  H HB3  . LYS A 1 50  ? 12.852  -4.776  -0.128  1.00 0.00 ? 1182 LYS A HB3  2  
ATOM 2436  H HG2  . LYS A 1 50  ? 14.428  -4.762  2.421   1.00 0.00 ? 1182 LYS A HG2  2  
ATOM 2437  H HG3  . LYS A 1 50  ? 14.679  -5.985  1.174   1.00 0.00 ? 1182 LYS A HG3  2  
ATOM 2438  H HD2  . LYS A 1 50  ? 14.731  -3.054  0.528   1.00 0.00 ? 1182 LYS A HD2  2  
ATOM 2439  H HD3  . LYS A 1 50  ? 16.165  -3.889  1.131   1.00 0.00 ? 1182 LYS A HD3  2  
ATOM 2440  H HE2  . LYS A 1 50  ? 14.683  -5.100  -1.145  1.00 0.00 ? 1182 LYS A HE2  2  
ATOM 2441  H HE3  . LYS A 1 50  ? 15.659  -3.666  -1.459  1.00 0.00 ? 1182 LYS A HE3  2  
ATOM 2442  H HZ1  . LYS A 1 50  ? 17.169  -5.334  -1.798  1.00 0.00 ? 1182 LYS A HZ1  2  
ATOM 2443  H HZ2  . LYS A 1 50  ? 16.514  -6.344  -0.610  1.00 0.00 ? 1182 LYS A HZ2  2  
ATOM 2444  H HZ3  . LYS A 1 50  ? 17.449  -5.007  -0.162  1.00 0.00 ? 1182 LYS A HZ3  2  
ATOM 2445  N N    . ILE A 1 51  ? 9.991   -3.999  0.580   1.00 0.00 ? 1183 ILE A N    2  
ATOM 2446  C CA   . ILE A 1 51  ? 8.836   -3.689  -0.253  1.00 0.00 ? 1183 ILE A CA   2  
ATOM 2447  C C    . ILE A 1 51  ? 8.233   -2.340  0.124   1.00 0.00 ? 1183 ILE A C    2  
ATOM 2448  O O    . ILE A 1 51  ? 7.967   -1.503  -0.739  1.00 0.00 ? 1183 ILE A O    2  
ATOM 2449  C CB   . ILE A 1 51  ? 7.749   -4.774  -0.136  1.00 0.00 ? 1183 ILE A CB   2  
ATOM 2450  C CG1  . ILE A 1 51  ? 8.305   -6.132  -0.573  1.00 0.00 ? 1183 ILE A CG1  2  
ATOM 2451  C CG2  . ILE A 1 51  ? 6.535   -4.400  -0.972  1.00 0.00 ? 1183 ILE A CG2  2  
ATOM 2452  C CD1  . ILE A 1 51  ? 7.418   -7.297  -0.196  1.00 0.00 ? 1183 ILE A CD1  2  
ATOM 2453  H H    . ILE A 1 51  ? 9.991   -4.823  1.110   1.00 0.00 ? 1183 ILE A H    2  
ATOM 2454  H HA   . ILE A 1 51  ? 9.167   -3.648  -1.280  1.00 0.00 ? 1183 ILE A HA   2  
ATOM 2455  H HB   . ILE A 1 51  ? 7.441   -4.835  0.896   1.00 0.00 ? 1183 ILE A HB   2  
ATOM 2456  H HG12 . ILE A 1 51  ? 8.422   -6.138  -1.645  1.00 0.00 ? 1183 ILE A HG12 2  
ATOM 2457  H HG13 . ILE A 1 51  ? 9.269   -6.283  -0.108  1.00 0.00 ? 1183 ILE A HG13 2  
ATOM 2458  H HG21 . ILE A 1 51  ? 5.665   -4.917  -0.594  1.00 0.00 ? 1183 ILE A HG21 2  
ATOM 2459  H HG22 . ILE A 1 51  ? 6.372   -3.334  -0.913  1.00 0.00 ? 1183 ILE A HG22 2  
ATOM 2460  H HG23 . ILE A 1 51  ? 6.703   -4.683  -2.000  1.00 0.00 ? 1183 ILE A HG23 2  
ATOM 2461  H HD11 . ILE A 1 51  ? 7.764   -7.729  0.732   1.00 0.00 ? 1183 ILE A HD11 2  
ATOM 2462  H HD12 . ILE A 1 51  ? 6.402   -6.953  -0.077  1.00 0.00 ? 1183 ILE A HD12 2  
ATOM 2463  H HD13 . ILE A 1 51  ? 7.456   -8.045  -0.975  1.00 0.00 ? 1183 ILE A HD13 2  
ATOM 2464  N N    . LEU A 1 52  ? 8.020   -2.134  1.420   1.00 0.00 ? 1184 LEU A N    2  
ATOM 2465  C CA   . LEU A 1 52  ? 7.450   -0.885  1.913   1.00 0.00 ? 1184 LEU A CA   2  
ATOM 2466  C C    . LEU A 1 52  ? 8.253   0.313   1.417   1.00 0.00 ? 1184 LEU A C    2  
ATOM 2467  O O    . LEU A 1 52  ? 7.695   1.263   0.867   1.00 0.00 ? 1184 LEU A O    2  
ATOM 2468  C CB   . LEU A 1 52  ? 7.410   -0.889  3.442   1.00 0.00 ? 1184 LEU A CB   2  
ATOM 2469  C CG   . LEU A 1 52  ? 6.629   -2.033  4.090   1.00 0.00 ? 1184 LEU A CG   2  
ATOM 2470  C CD1  . LEU A 1 52  ? 6.791   -2.000  5.602   1.00 0.00 ? 1184 LEU A CD1  2  
ATOM 2471  C CD2  . LEU A 1 52  ? 5.158   -1.959  3.707   1.00 0.00 ? 1184 LEU A CD2  2  
ATOM 2472  H H    . LEU A 1 52  ? 8.252   -2.838  2.060   1.00 0.00 ? 1184 LEU A H    2  
ATOM 2473  H HA   . LEU A 1 52  ? 6.442   -0.809  1.534   1.00 0.00 ? 1184 LEU A HA   2  
ATOM 2474  H HB2  . LEU A 1 52  ? 8.427   -0.939  3.799   1.00 0.00 ? 1184 LEU A HB2  2  
ATOM 2475  H HB3  . LEU A 1 52  ? 6.963   0.041   3.762   1.00 0.00 ? 1184 LEU A HB3  2  
ATOM 2476  H HG   . LEU A 1 52  ? 7.022   -2.975  3.734   1.00 0.00 ? 1184 LEU A HG   2  
ATOM 2477  H HD11 . LEU A 1 52  ? 7.186   -1.041  5.901   1.00 0.00 ? 1184 LEU A HD11 2  
ATOM 2478  H HD12 . LEU A 1 52  ? 7.470   -2.781  5.909   1.00 0.00 ? 1184 LEU A HD12 2  
ATOM 2479  H HD13 . LEU A 1 52  ? 5.829   -2.156  6.070   1.00 0.00 ? 1184 LEU A HD13 2  
ATOM 2480  H HD21 . LEU A 1 52  ? 5.072   -1.744  2.652   1.00 0.00 ? 1184 LEU A HD21 2  
ATOM 2481  H HD22 . LEU A 1 52  ? 4.678   -1.175  4.274   1.00 0.00 ? 1184 LEU A HD22 2  
ATOM 2482  H HD23 . LEU A 1 52  ? 4.682   -2.904  3.923   1.00 0.00 ? 1184 LEU A HD23 2  
ATOM 2483  N N    . VAL A 1 53  ? 9.567   0.261   1.612   1.00 0.00 ? 1185 VAL A N    2  
ATOM 2484  C CA   . VAL A 1 53  ? 10.448  1.340   1.182   1.00 0.00 ? 1185 VAL A CA   2  
ATOM 2485  C C    . VAL A 1 53  ? 10.300  1.607   -0.312  1.00 0.00 ? 1185 VAL A C    2  
ATOM 2486  O O    . VAL A 1 53  ? 10.083  2.744   -0.731  1.00 0.00 ? 1185 VAL A O    2  
ATOM 2487  C CB   . VAL A 1 53  ? 11.922  1.019   1.492   1.00 0.00 ? 1185 VAL A CB   2  
ATOM 2488  C CG1  . VAL A 1 53  ? 12.835  2.091   0.916   1.00 0.00 ? 1185 VAL A CG1  2  
ATOM 2489  C CG2  . VAL A 1 53  ? 12.132  0.878   2.992   1.00 0.00 ? 1185 VAL A CG2  2  
ATOM 2490  H H    . VAL A 1 53  ? 9.953   -0.523  2.056   1.00 0.00 ? 1185 VAL A H    2  
ATOM 2491  H HA   . VAL A 1 53  ? 10.173  2.232   1.726   1.00 0.00 ? 1185 VAL A HA   2  
ATOM 2492  H HB   . VAL A 1 53  ? 12.170  0.077   1.025   1.00 0.00 ? 1185 VAL A HB   2  
ATOM 2493  H HG11 . VAL A 1 53  ? 13.652  2.271   1.598   1.00 0.00 ? 1185 VAL A HG11 2  
ATOM 2494  H HG12 . VAL A 1 53  ? 13.224  1.759   -0.035  1.00 0.00 ? 1185 VAL A HG12 2  
ATOM 2495  H HG13 . VAL A 1 53  ? 12.274  3.003   0.777   1.00 0.00 ? 1185 VAL A HG13 2  
ATOM 2496  H HG21 . VAL A 1 53  ? 13.068  1.340   3.268   1.00 0.00 ? 1185 VAL A HG21 2  
ATOM 2497  H HG22 . VAL A 1 53  ? 11.322  1.363   3.517   1.00 0.00 ? 1185 VAL A HG22 2  
ATOM 2498  H HG23 . VAL A 1 53  ? 12.155  -0.169  3.256   1.00 0.00 ? 1185 VAL A HG23 2  
ATOM 2499  N N    . ASP A 1 54  ? 10.419  0.552   -1.110  1.00 0.00 ? 1186 ASP A N    2  
ATOM 2500  C CA   . ASP A 1 54  ? 10.297  0.672   -2.558  1.00 0.00 ? 1186 ASP A CA   2  
ATOM 2501  C C    . ASP A 1 54  ? 8.974   1.327   -2.940  1.00 0.00 ? 1186 ASP A C    2  
ATOM 2502  O O    . ASP A 1 54  ? 8.936   2.234   -3.771  1.00 0.00 ? 1186 ASP A O    2  
ATOM 2503  C CB   . ASP A 1 54  ? 10.408  -0.705  -3.216  1.00 0.00 ? 1186 ASP A CB   2  
ATOM 2504  C CG   . ASP A 1 54  ? 11.742  -1.371  -2.944  1.00 0.00 ? 1186 ASP A CG   2  
ATOM 2505  O OD1  . ASP A 1 54  ? 12.778  -0.824  -3.376  1.00 0.00 ? 1186 ASP A OD1  2  
ATOM 2506  O OD2  . ASP A 1 54  ? 11.750  -2.440  -2.298  1.00 0.00 ? 1186 ASP A OD2  2  
ATOM 2507  H H    . ASP A 1 54  ? 10.592  -0.329  -0.716  1.00 0.00 ? 1186 ASP A H    2  
ATOM 2508  H HA   . ASP A 1 54  ? 11.107  1.294   -2.909  1.00 0.00 ? 1186 ASP A HA   2  
ATOM 2509  H HB2  . ASP A 1 54  ? 9.623   -1.343  -2.836  1.00 0.00 ? 1186 ASP A HB2  2  
ATOM 2510  H HB3  . ASP A 1 54  ? 10.291  -0.596  -4.285  1.00 0.00 ? 1186 ASP A HB3  2  
ATOM 2511  N N    . MET A 1 55  ? 7.890   0.861   -2.329  1.00 0.00 ? 1187 MET A N    2  
ATOM 2512  C CA   . MET A 1 55  ? 6.565   1.402   -2.605  1.00 0.00 ? 1187 MET A CA   2  
ATOM 2513  C C    . MET A 1 55  ? 6.519   2.900   -2.322  1.00 0.00 ? 1187 MET A C    2  
ATOM 2514  O O    . MET A 1 55  ? 5.919   3.666   -3.075  1.00 0.00 ? 1187 MET A O    2  
ATOM 2515  C CB   . MET A 1 55  ? 5.510   0.680   -1.764  1.00 0.00 ? 1187 MET A CB   2  
ATOM 2516  C CG   . MET A 1 55  ? 5.244   -0.746  -2.216  1.00 0.00 ? 1187 MET A CG   2  
ATOM 2517  S SD   . MET A 1 55  ? 3.786   -1.463  -1.433  1.00 0.00 ? 1187 MET A SD   2  
ATOM 2518  C CE   . MET A 1 55  ? 2.478   -0.650  -2.346  1.00 0.00 ? 1187 MET A CE   2  
ATOM 2519  H H    . MET A 1 55  ? 7.984   0.136   -1.675  1.00 0.00 ? 1187 MET A H    2  
ATOM 2520  H HA   . MET A 1 55  ? 6.352   1.239   -3.650  1.00 0.00 ? 1187 MET A HA   2  
ATOM 2521  H HB2  . MET A 1 55  ? 5.842   0.653   -0.737  1.00 0.00 ? 1187 MET A HB2  2  
ATOM 2522  H HB3  . MET A 1 55  ? 4.583   1.231   -1.819  1.00 0.00 ? 1187 MET A HB3  2  
ATOM 2523  H HG2  . MET A 1 55  ? 5.098   -0.750  -3.286  1.00 0.00 ? 1187 MET A HG2  2  
ATOM 2524  H HG3  . MET A 1 55  ? 6.103   -1.353  -1.970  1.00 0.00 ? 1187 MET A HG3  2  
ATOM 2525  H HE1  . MET A 1 55  ? 2.847   0.280   -2.754  1.00 0.00 ? 1187 MET A HE1  2  
ATOM 2526  H HE2  . MET A 1 55  ? 2.148   -1.291  -3.150  1.00 0.00 ? 1187 MET A HE2  2  
ATOM 2527  H HE3  . MET A 1 55  ? 1.649   -0.448  -1.683  1.00 0.00 ? 1187 MET A HE3  2  
ATOM 2528  N N    . ALA A 1 56  ? 7.158   3.311   -1.231  1.00 0.00 ? 1188 ALA A N    2  
ATOM 2529  C CA   . ALA A 1 56  ? 7.192   4.718   -0.850  1.00 0.00 ? 1188 ALA A CA   2  
ATOM 2530  C C    . ALA A 1 56  ? 7.945   5.549   -1.883  1.00 0.00 ? 1188 ALA A C    2  
ATOM 2531  O O    . ALA A 1 56  ? 7.635   6.721   -2.098  1.00 0.00 ? 1188 ALA A O    2  
ATOM 2532  C CB   . ALA A 1 56  ? 7.827   4.878   0.523   1.00 0.00 ? 1188 ALA A CB   2  
ATOM 2533  H H    . ALA A 1 56  ? 7.619   2.653   -0.670  1.00 0.00 ? 1188 ALA A H    2  
ATOM 2534  H HA   . ALA A 1 56  ? 6.172   5.072   -0.791  1.00 0.00 ? 1188 ALA A HA   2  
ATOM 2535  H HB1  . ALA A 1 56  ? 8.503   5.721   0.510   1.00 0.00 ? 1188 ALA A HB1  2  
ATOM 2536  H HB2  . ALA A 1 56  ? 7.055   5.045   1.260   1.00 0.00 ? 1188 ALA A HB2  2  
ATOM 2537  H HB3  . ALA A 1 56  ? 8.375   3.981   0.773   1.00 0.00 ? 1188 ALA A HB3  2  
ATOM 2538  N N    . LYS A 1 57  ? 8.936   4.935   -2.521  1.00 0.00 ? 1189 LYS A N    2  
ATOM 2539  C CA   . LYS A 1 57  ? 9.734   5.617   -3.533  1.00 0.00 ? 1189 LYS A CA   2  
ATOM 2540  C C    . LYS A 1 57  ? 9.000   5.656   -4.869  1.00 0.00 ? 1189 LYS A C    2  
ATOM 2541  O O    . LYS A 1 57  ? 8.682   6.728   -5.382  1.00 0.00 ? 1189 LYS A O    2  
ATOM 2542  C CB   . LYS A 1 57  ? 11.085  4.919   -3.701  1.00 0.00 ? 1189 LYS A CB   2  
ATOM 2543  C CG   . LYS A 1 57  ? 11.934  4.924   -2.441  1.00 0.00 ? 1189 LYS A CG   2  
ATOM 2544  C CD   . LYS A 1 57  ? 12.840  3.706   -2.375  1.00 0.00 ? 1189 LYS A CD   2  
ATOM 2545  C CE   . LYS A 1 57  ? 14.156  3.951   -3.096  1.00 0.00 ? 1189 LYS A CE   2  
ATOM 2546  N NZ   . LYS A 1 57  ? 15.090  4.777   -2.281  1.00 0.00 ? 1189 LYS A NZ   2  
ATOM 2547  H H    . LYS A 1 57  ? 9.135   3.999   -2.306  1.00 0.00 ? 1189 LYS A H    2  
ATOM 2548  H HA   . LYS A 1 57  ? 9.900   6.629   -3.197  1.00 0.00 ? 1189 LYS A HA   2  
ATOM 2549  H HB2  . LYS A 1 57  ? 10.914  3.893   -3.991  1.00 0.00 ? 1189 LYS A HB2  2  
ATOM 2550  H HB3  . LYS A 1 57  ? 11.639  5.418   -4.484  1.00 0.00 ? 1189 LYS A HB3  2  
ATOM 2551  H HG2  . LYS A 1 57  ? 12.544  5.815   -2.433  1.00 0.00 ? 1189 LYS A HG2  2  
ATOM 2552  H HG3  . LYS A 1 57  ? 11.281  4.924   -1.579  1.00 0.00 ? 1189 LYS A HG3  2  
ATOM 2553  H HD2  . LYS A 1 57  ? 13.046  3.478   -1.340  1.00 0.00 ? 1189 LYS A HD2  2  
ATOM 2554  H HD3  . LYS A 1 57  ? 12.337  2.868   -2.836  1.00 0.00 ? 1189 LYS A HD3  2  
ATOM 2555  H HE2  . LYS A 1 57  ? 14.620  2.999   -3.304  1.00 0.00 ? 1189 LYS A HE2  2  
ATOM 2556  H HE3  . LYS A 1 57  ? 13.953  4.463   -4.025  1.00 0.00 ? 1189 LYS A HE3  2  
ATOM 2557  H HZ1  . LYS A 1 57  ? 14.571  5.553   -1.822  1.00 0.00 ? 1189 LYS A HZ1  2  
ATOM 2558  H HZ2  . LYS A 1 57  ? 15.831  5.183   -2.888  1.00 0.00 ? 1189 LYS A HZ2  2  
ATOM 2559  H HZ3  . LYS A 1 57  ? 15.538  4.192   -1.548  1.00 0.00 ? 1189 LYS A HZ3  2  
ATOM 2560  N N    . MET A 1 58  ? 8.732   4.479   -5.427  1.00 0.00 ? 1190 MET A N    2  
ATOM 2561  C CA   . MET A 1 58  ? 8.033   4.380   -6.703  1.00 0.00 ? 1190 MET A CA   2  
ATOM 2562  C C    . MET A 1 58  ? 6.630   4.970   -6.601  1.00 0.00 ? 1190 MET A C    2  
ATOM 2563  O O    . MET A 1 58  ? 6.151   5.619   -7.531  1.00 0.00 ? 1190 MET A O    2  
ATOM 2564  C CB   . MET A 1 58  ? 7.953   2.920   -7.153  1.00 0.00 ? 1190 MET A CB   2  
ATOM 2565  C CG   . MET A 1 58  ? 9.313   2.281   -7.385  1.00 0.00 ? 1190 MET A CG   2  
ATOM 2566  S SD   . MET A 1 58  ? 9.198   0.691   -8.227  1.00 0.00 ? 1190 MET A SD   2  
ATOM 2567  C CE   . MET A 1 58  ? 10.409  -0.263  -7.315  1.00 0.00 ? 1190 MET A CE   2  
ATOM 2568  H H    . MET A 1 58  ? 9.011   3.658   -4.970  1.00 0.00 ? 1190 MET A H    2  
ATOM 2569  H HA   . MET A 1 58  ? 8.595   4.942   -7.433  1.00 0.00 ? 1190 MET A HA   2  
ATOM 2570  H HB2  . MET A 1 58  ? 7.436   2.350   -6.396  1.00 0.00 ? 1190 MET A HB2  2  
ATOM 2571  H HB3  . MET A 1 58  ? 7.394   2.870   -8.075  1.00 0.00 ? 1190 MET A HB3  2  
ATOM 2572  H HG2  . MET A 1 58  ? 9.912   2.948   -7.988  1.00 0.00 ? 1190 MET A HG2  2  
ATOM 2573  H HG3  . MET A 1 58  ? 9.794   2.133   -6.429  1.00 0.00 ? 1190 MET A HG3  2  
ATOM 2574  H HE1  . MET A 1 58  ? 11.342  -0.274  -7.859  1.00 0.00 ? 1190 MET A HE1  2  
ATOM 2575  H HE2  . MET A 1 58  ? 10.564  0.185   -6.345  1.00 0.00 ? 1190 MET A HE2  2  
ATOM 2576  H HE3  . MET A 1 58  ? 10.052  -1.276  -7.193  1.00 0.00 ? 1190 MET A HE3  2  
ATOM 2577  N N    . ARG A 1 59  ? 5.977   4.740   -5.467  1.00 0.00 ? 1191 ARG A N    2  
ATOM 2578  C CA   . ARG A 1 59  ? 4.628   5.247   -5.245  1.00 0.00 ? 1191 ARG A CA   2  
ATOM 2579  C C    . ARG A 1 59  ? 3.638   4.598   -6.207  1.00 0.00 ? 1191 ARG A C    2  
ATOM 2580  O O    . ARG A 1 59  ? 2.887   5.272   -6.913  1.00 0.00 ? 1191 ARG A O    2  
ATOM 2581  C CB   . ARG A 1 59  ? 4.598   6.767   -5.414  1.00 0.00 ? 1191 ARG A CB   2  
ATOM 2582  C CG   . ARG A 1 59  ? 5.576   7.500   -4.511  1.00 0.00 ? 1191 ARG A CG   2  
ATOM 2583  C CD   . ARG A 1 59  ? 4.941   7.858   -3.176  1.00 0.00 ? 1191 ARG A CD   2  
ATOM 2584  N NE   . ARG A 1 59  ? 5.905   8.452   -2.253  1.00 0.00 ? 1191 ARG A NE   2  
ATOM 2585  C CZ   . ARG A 1 59  ? 6.437   9.657   -2.423  1.00 0.00 ? 1191 ARG A CZ   2  
ATOM 2586  N NH1  . ARG A 1 59  ? 6.102   10.392  -3.474  1.00 0.00 ? 1191 ARG A NH1  2  
ATOM 2587  N NH2  . ARG A 1 59  ? 7.308   10.129  -1.539  1.00 0.00 ? 1191 ARG A NH2  2  
ATOM 2588  H H    . ARG A 1 59  ? 6.412   4.215   -4.762  1.00 0.00 ? 1191 ARG A H    2  
ATOM 2589  H HA   . ARG A 1 59  ? 4.343   5.001   -4.233  1.00 0.00 ? 1191 ARG A HA   2  
ATOM 2590  H HB2  . ARG A 1 59  ? 4.839   7.009   -6.439  1.00 0.00 ? 1191 ARG A HB2  2  
ATOM 2591  H HB3  . ARG A 1 59  ? 3.603   7.122   -5.194  1.00 0.00 ? 1191 ARG A HB3  2  
ATOM 2592  H HG2  . ARG A 1 59  ? 6.432   6.865   -4.331  1.00 0.00 ? 1191 ARG A HG2  2  
ATOM 2593  H HG3  . ARG A 1 59  ? 5.896   8.407   -5.002  1.00 0.00 ? 1191 ARG A HG3  2  
ATOM 2594  H HD2  . ARG A 1 59  ? 4.142   8.563   -3.350  1.00 0.00 ? 1191 ARG A HD2  2  
ATOM 2595  H HD3  . ARG A 1 59  ? 4.539   6.959   -2.733  1.00 0.00 ? 1191 ARG A HD3  2  
ATOM 2596  H HE   . ARG A 1 59  ? 6.167   7.926   -1.470  1.00 0.00 ? 1191 ARG A HE   2  
ATOM 2597  H HH11 . ARG A 1 59  ? 5.446   10.040  -4.141  1.00 0.00 ? 1191 ARG A HH11 2  
ATOM 2598  H HH12 . ARG A 1 59  ? 6.504   11.300  -3.598  1.00 0.00 ? 1191 ARG A HH12 2  
ATOM 2599  H HH21 . ARG A 1 59  ? 7.563   9.578   -0.745  1.00 0.00 ? 1191 ARG A HH21 2  
ATOM 2600  H HH22 . ARG A 1 59  ? 7.708   11.036  -1.667  1.00 0.00 ? 1191 ARG A HH22 2  
ATOM 2601  N N    . PRO A 1 60  ? 3.635   3.257   -6.238  1.00 0.00 ? 1192 PRO A N    2  
ATOM 2602  C CA   . PRO A 1 60  ? 2.742   2.487   -7.109  1.00 0.00 ? 1192 PRO A CA   2  
ATOM 2603  C C    . PRO A 1 60  ? 1.284   2.578   -6.671  1.00 0.00 ? 1192 PRO A C    2  
ATOM 2604  O O    . PRO A 1 60  ? 0.966   2.403   -5.494  1.00 0.00 ? 1192 PRO A O    2  
ATOM 2605  C CB   . PRO A 1 60  ? 3.255   1.052   -6.964  1.00 0.00 ? 1192 PRO A CB   2  
ATOM 2606  C CG   . PRO A 1 60  ? 3.916   1.020   -5.629  1.00 0.00 ? 1192 PRO A CG   2  
ATOM 2607  C CD   . PRO A 1 60  ? 4.502   2.389   -5.424  1.00 0.00 ? 1192 PRO A CD   2  
ATOM 2608  H HA   . PRO A 1 60  ? 2.827   2.799   -8.139  1.00 0.00 ? 1192 PRO A HA   2  
ATOM 2609  H HB2  . PRO A 1 60  ? 2.424   0.363   -7.011  1.00 0.00 ? 1192 PRO A HB2  2  
ATOM 2610  H HB3  . PRO A 1 60  ? 3.955   0.835   -7.756  1.00 0.00 ? 1192 PRO A HB3  2  
ATOM 2611  H HG2  . PRO A 1 60  ? 3.187   0.805   -4.863  1.00 0.00 ? 1192 PRO A HG2  2  
ATOM 2612  H HG3  . PRO A 1 60  ? 4.698   0.274   -5.625  1.00 0.00 ? 1192 PRO A HG3  2  
ATOM 2613  H HD2  . PRO A 1 60  ? 4.456   2.667   -4.381  1.00 0.00 ? 1192 PRO A HD2  2  
ATOM 2614  H HD3  . PRO A 1 60  ? 5.521   2.421   -5.780  1.00 0.00 ? 1192 PRO A HD3  2  
ATOM 2615  N N    . THR A 1 61  ? 0.400   2.853   -7.625  1.00 0.00 ? 1193 THR A N    2  
ATOM 2616  C CA   . THR A 1 61  ? -1.024  2.968   -7.337  1.00 0.00 ? 1193 THR A CA   2  
ATOM 2617  C C    . THR A 1 61  ? -1.831  1.955   -8.140  1.00 0.00 ? 1193 THR A C    2  
ATOM 2618  O O    . THR A 1 61  ? -3.018  2.154   -8.399  1.00 0.00 ? 1193 THR A O    2  
ATOM 2619  C CB   . THR A 1 61  ? -1.547  4.384   -7.646  1.00 0.00 ? 1193 THR A CB   2  
ATOM 2620  O OG1  . THR A 1 61  ? -1.416  4.660   -9.045  1.00 0.00 ? 1193 THR A OG1  2  
ATOM 2621  C CG2  . THR A 1 61  ? -0.786  5.429   -6.844  1.00 0.00 ? 1193 THR A CG2  2  
ATOM 2622  H H    . THR A 1 61  ? 0.715   2.983   -8.544  1.00 0.00 ? 1193 THR A H    2  
ATOM 2623  H HA   . THR A 1 61  ? -1.168  2.776   -6.284  1.00 0.00 ? 1193 THR A HA   2  
ATOM 2624  H HB   . THR A 1 61  ? -2.592  4.433   -7.373  1.00 0.00 ? 1193 THR A HB   2  
ATOM 2625  H HG1  . THR A 1 61  ? -0.492  4.818   -9.255  1.00 0.00 ? 1193 THR A HG1  2  
ATOM 2626  H HG21 . THR A 1 61  ? 0.034   5.810   -7.435  1.00 0.00 ? 1193 THR A HG21 2  
ATOM 2627  H HG22 . THR A 1 61  ? -0.400  4.979   -5.941  1.00 0.00 ? 1193 THR A HG22 2  
ATOM 2628  H HG23 . THR A 1 61  ? -1.451  6.239   -6.587  1.00 0.00 ? 1193 THR A HG23 2  
ATOM 2629  N N    . THR A 1 62  ? -1.179  0.864   -8.533  1.00 0.00 ? 1194 THR A N    2  
ATOM 2630  C CA   . THR A 1 62  ? -1.836  -0.181  -9.308  1.00 0.00 ? 1194 THR A CA   2  
ATOM 2631  C C    . THR A 1 62  ? -1.426  -1.566  -8.821  1.00 0.00 ? 1194 THR A C    2  
ATOM 2632  O O    . THR A 1 62  ? -0.246  -1.830  -8.589  1.00 0.00 ? 1194 THR A O    2  
ATOM 2633  C CB   . THR A 1 62  ? -1.508  -0.059  -10.808 1.00 0.00 ? 1194 THR A CB   2  
ATOM 2634  O OG1  . THR A 1 62  ? -0.097  0.110   -10.989 1.00 0.00 ? 1194 THR A OG1  2  
ATOM 2635  C CG2  . THR A 1 62  ? -2.248  1.115   -11.430 1.00 0.00 ? 1194 THR A CG2  2  
ATOM 2636  H H    . THR A 1 62  ? -0.234  0.763   -8.297  1.00 0.00 ? 1194 THR A H    2  
ATOM 2637  H HA   . THR A 1 62  ? -2.903  -0.068  -9.184  1.00 0.00 ? 1194 THR A HA   2  
ATOM 2638  H HB   . THR A 1 62  ? -1.821  -0.967  -11.304 1.00 0.00 ? 1194 THR A HB   2  
ATOM 2639  H HG1  . THR A 1 62  ? 0.071   0.488   -11.855 1.00 0.00 ? 1194 THR A HG1  2  
ATOM 2640  H HG21 . THR A 1 62  ? -1.556  1.926   -11.604 1.00 0.00 ? 1194 THR A HG21 2  
ATOM 2641  H HG22 . THR A 1 62  ? -3.028  1.445   -10.760 1.00 0.00 ? 1194 THR A HG22 2  
ATOM 2642  H HG23 . THR A 1 62  ? -2.686  0.808   -12.368 1.00 0.00 ? 1194 THR A HG23 2  
ATOM 2643  N N    . VAL A 1 63  ? -2.408  -2.449  -8.668  1.00 0.00 ? 1195 VAL A N    2  
ATOM 2644  C CA   . VAL A 1 63  ? -2.148  -3.809  -8.210  1.00 0.00 ? 1195 VAL A CA   2  
ATOM 2645  C C    . VAL A 1 63  ? -1.079  -4.482  -9.063  1.00 0.00 ? 1195 VAL A C    2  
ATOM 2646  O O    . VAL A 1 63  ? -0.372  -5.376  -8.599  1.00 0.00 ? 1195 VAL A O    2  
ATOM 2647  C CB   . VAL A 1 63  ? -3.428  -4.665  -8.241  1.00 0.00 ? 1195 VAL A CB   2  
ATOM 2648  C CG1  . VAL A 1 63  ? -4.038  -4.664  -9.635  1.00 0.00 ? 1195 VAL A CG1  2  
ATOM 2649  C CG2  . VAL A 1 63  ? -3.130  -6.085  -7.782  1.00 0.00 ? 1195 VAL A CG2  2  
ATOM 2650  H H    . VAL A 1 63  ? -3.328  -2.180  -8.869  1.00 0.00 ? 1195 VAL A H    2  
ATOM 2651  H HA   . VAL A 1 63  ? -1.800  -3.757  -7.189  1.00 0.00 ? 1195 VAL A HA   2  
ATOM 2652  H HB   . VAL A 1 63  ? -4.144  -4.231  -7.559  1.00 0.00 ? 1195 VAL A HB   2  
ATOM 2653  H HG11 . VAL A 1 63  ? -3.298  -4.337  -10.350 1.00 0.00 ? 1195 VAL A HG11 2  
ATOM 2654  H HG12 . VAL A 1 63  ? -4.367  -5.662  -9.885  1.00 0.00 ? 1195 VAL A HG12 2  
ATOM 2655  H HG13 . VAL A 1 63  ? -4.882  -3.990  -9.657  1.00 0.00 ? 1195 VAL A HG13 2  
ATOM 2656  H HG21 . VAL A 1 63  ? -2.114  -6.139  -7.419  1.00 0.00 ? 1195 VAL A HG21 2  
ATOM 2657  H HG22 . VAL A 1 63  ? -3.811  -6.357  -6.988  1.00 0.00 ? 1195 VAL A HG22 2  
ATOM 2658  H HG23 . VAL A 1 63  ? -3.254  -6.765  -8.611  1.00 0.00 ? 1195 VAL A HG23 2  
ATOM 2659  N N    . GLU A 1 64  ? -0.965  -4.045  -10.314 1.00 0.00 ? 1196 GLU A N    2  
ATOM 2660  C CA   . GLU A 1 64  ? 0.019   -4.606  -11.232 1.00 0.00 ? 1196 GLU A CA   2  
ATOM 2661  C C    . GLU A 1 64  ? 1.420   -4.099  -10.903 1.00 0.00 ? 1196 GLU A C    2  
ATOM 2662  O O    . GLU A 1 64  ? 2.279   -4.862  -10.464 1.00 0.00 ? 1196 GLU A O    2  
ATOM 2663  C CB   . GLU A 1 64  ? -0.338  -4.250  -12.677 1.00 0.00 ? 1196 GLU A CB   2  
ATOM 2664  C CG   . GLU A 1 64  ? -1.649  -4.857  -13.147 1.00 0.00 ? 1196 GLU A CG   2  
ATOM 2665  C CD   . GLU A 1 64  ? -1.728  -4.977  -14.657 1.00 0.00 ? 1196 GLU A CD   2  
ATOM 2666  O OE1  . GLU A 1 64  ? -1.182  -5.958  -15.204 1.00 0.00 ? 1196 GLU A OE1  2  
ATOM 2667  O OE2  . GLU A 1 64  ? -2.337  -4.090  -15.290 1.00 0.00 ? 1196 GLU A OE2  2  
ATOM 2668  H H    . GLU A 1 64  ? -1.558  -3.329  -10.626 1.00 0.00 ? 1196 GLU A H    2  
ATOM 2669  H HA   . GLU A 1 64  ? 0.002   -5.679  -11.121 1.00 0.00 ? 1196 GLU A HA   2  
ATOM 2670  H HB2  . GLU A 1 64  ? -0.411  -3.176  -12.763 1.00 0.00 ? 1196 GLU A HB2  2  
ATOM 2671  H HB3  . GLU A 1 64  ? 0.450   -4.601  -13.326 1.00 0.00 ? 1196 GLU A HB3  2  
ATOM 2672  H HG2  . GLU A 1 64  ? -1.749  -5.843  -12.717 1.00 0.00 ? 1196 GLU A HG2  2  
ATOM 2673  H HG3  . GLU A 1 64  ? -2.463  -4.233  -12.807 1.00 0.00 ? 1196 GLU A HG3  2  
ATOM 2674  N N    . ASN A 1 65  ? 1.642   -2.807  -11.121 1.00 0.00 ? 1197 ASN A N    2  
ATOM 2675  C CA   . ASN A 1 65  ? 2.939   -2.198  -10.849 1.00 0.00 ? 1197 ASN A CA   2  
ATOM 2676  C C    . ASN A 1 65  ? 3.491   -2.670  -9.507  1.00 0.00 ? 1197 ASN A C    2  
ATOM 2677  O O    . ASN A 1 65  ? 4.689   -2.920  -9.370  1.00 0.00 ? 1197 ASN A O    2  
ATOM 2678  C CB   . ASN A 1 65  ? 2.822   -0.673  -10.858 1.00 0.00 ? 1197 ASN A CB   2  
ATOM 2679  C CG   . ASN A 1 65  ? 2.636   -0.115  -12.256 1.00 0.00 ? 1197 ASN A CG   2  
ATOM 2680  O OD1  . ASN A 1 65  ? 2.619   -0.860  -13.236 1.00 0.00 ? 1197 ASN A OD1  2  
ATOM 2681  N ND2  . ASN A 1 65  ? 2.497   1.202   -12.353 1.00 0.00 ? 1197 ASN A ND2  2  
ATOM 2682  H H    . ASN A 1 65  ? 0.917   -2.250  -11.473 1.00 0.00 ? 1197 ASN A H    2  
ATOM 2683  H HA   . ASN A 1 65  ? 3.618   -2.503  -11.632 1.00 0.00 ? 1197 ASN A HA   2  
ATOM 2684  H HB2  . ASN A 1 65  ? 1.972   -0.380  -10.259 1.00 0.00 ? 1197 ASN A HB2  2  
ATOM 2685  H HB3  . ASN A 1 65  ? 3.719   -0.246  -10.435 1.00 0.00 ? 1197 ASN A HB3  2  
ATOM 2686  H HD21 . ASN A 1 65  ? 2.522   1.733   -11.529 1.00 0.00 ? 1197 ASN A HD21 2  
ATOM 2687  H HD22 . ASN A 1 65  ? 2.375   1.589   -13.245 1.00 0.00 ? 1197 ASN A HD22 2  
ATOM 2688  N N    . VAL A 1 66  ? 2.609   -2.789  -8.520  1.00 0.00 ? 1198 VAL A N    2  
ATOM 2689  C CA   . VAL A 1 66  ? 3.007   -3.232  -7.189  1.00 0.00 ? 1198 VAL A CA   2  
ATOM 2690  C C    . VAL A 1 66  ? 3.868   -4.488  -7.262  1.00 0.00 ? 1198 VAL A C    2  
ATOM 2691  O O    . VAL A 1 66  ? 4.880   -4.602  -6.571  1.00 0.00 ? 1198 VAL A O    2  
ATOM 2692  C CB   . VAL A 1 66  ? 1.780   -3.514  -6.301  1.00 0.00 ? 1198 VAL A CB   2  
ATOM 2693  C CG1  . VAL A 1 66  ? 2.216   -3.991  -4.924  1.00 0.00 ? 1198 VAL A CG1  2  
ATOM 2694  C CG2  . VAL A 1 66  ? 0.905   -2.275  -6.194  1.00 0.00 ? 1198 VAL A CG2  2  
ATOM 2695  H H    . VAL A 1 66  ? 1.669   -2.574  -8.691  1.00 0.00 ? 1198 VAL A H    2  
ATOM 2696  H HA   . VAL A 1 66  ? 3.582   -2.440  -6.731  1.00 0.00 ? 1198 VAL A HA   2  
ATOM 2697  H HB   . VAL A 1 66  ? 1.201   -4.300  -6.763  1.00 0.00 ? 1198 VAL A HB   2  
ATOM 2698  H HG11 . VAL A 1 66  ? 1.367   -4.409  -4.404  1.00 0.00 ? 1198 VAL A HG11 2  
ATOM 2699  H HG12 . VAL A 1 66  ? 2.983   -4.744  -5.029  1.00 0.00 ? 1198 VAL A HG12 2  
ATOM 2700  H HG13 . VAL A 1 66  ? 2.606   -3.155  -4.361  1.00 0.00 ? 1198 VAL A HG13 2  
ATOM 2701  H HG21 . VAL A 1 66  ? 1.231   -1.541  -6.916  1.00 0.00 ? 1198 VAL A HG21 2  
ATOM 2702  H HG22 . VAL A 1 66  ? -0.123  -2.542  -6.391  1.00 0.00 ? 1198 VAL A HG22 2  
ATOM 2703  H HG23 . VAL A 1 66  ? 0.985   -1.862  -5.199  1.00 0.00 ? 1198 VAL A HG23 2  
ATOM 2704  N N    . LYS A 1 67  ? 3.459   -5.431  -8.105  1.00 0.00 ? 1199 LYS A N    2  
ATOM 2705  C CA   . LYS A 1 67  ? 4.192   -6.680  -8.272  1.00 0.00 ? 1199 LYS A CA   2  
ATOM 2706  C C    . LYS A 1 67  ? 5.638   -6.412  -8.674  1.00 0.00 ? 1199 LYS A C    2  
ATOM 2707  O O    . LYS A 1 67  ? 6.538   -7.184  -8.343  1.00 0.00 ? 1199 LYS A O    2  
ATOM 2708  C CB   . LYS A 1 67  ? 3.512   -7.558  -9.325  1.00 0.00 ? 1199 LYS A CB   2  
ATOM 2709  C CG   . LYS A 1 67  ? 2.047   -7.831  -9.034  1.00 0.00 ? 1199 LYS A CG   2  
ATOM 2710  C CD   . LYS A 1 67  ? 1.374   -8.552  -10.191 1.00 0.00 ? 1199 LYS A CD   2  
ATOM 2711  C CE   . LYS A 1 67  ? 1.677   -7.876  -11.520 1.00 0.00 ? 1199 LYS A CE   2  
ATOM 2712  N NZ   . LYS A 1 67  ? 2.911   -8.421  -12.151 1.00 0.00 ? 1199 LYS A NZ   2  
ATOM 2713  H H    . LYS A 1 67  ? 2.643   -5.282  -8.629  1.00 0.00 ? 1199 LYS A H    2  
ATOM 2714  H HA   . LYS A 1 67  ? 4.185   -7.197  -7.324  1.00 0.00 ? 1199 LYS A HA   2  
ATOM 2715  H HB2  . LYS A 1 67  ? 3.582   -7.067  -10.284 1.00 0.00 ? 1199 LYS A HB2  2  
ATOM 2716  H HB3  . LYS A 1 67  ? 4.031   -8.504  -9.376  1.00 0.00 ? 1199 LYS A HB3  2  
ATOM 2717  H HG2  . LYS A 1 67  ? 1.973   -8.447  -8.150  1.00 0.00 ? 1199 LYS A HG2  2  
ATOM 2718  H HG3  . LYS A 1 67  ? 1.541   -6.891  -8.865  1.00 0.00 ? 1199 LYS A HG3  2  
ATOM 2719  H HD2  . LYS A 1 67  ? 1.733   -9.570  -10.228 1.00 0.00 ? 1199 LYS A HD2  2  
ATOM 2720  H HD3  . LYS A 1 67  ? 0.305   -8.551  -10.032 1.00 0.00 ? 1199 LYS A HD3  2  
ATOM 2721  H HE2  . LYS A 1 67  ? 0.843   -8.033  -12.187 1.00 0.00 ? 1199 LYS A HE2  2  
ATOM 2722  H HE3  . LYS A 1 67  ? 1.807   -6.818  -11.349 1.00 0.00 ? 1199 LYS A HE3  2  
ATOM 2723  H HZ1  . LYS A 1 67  ? 3.530   -8.835  -11.424 1.00 0.00 ? 1199 LYS A HZ1  2  
ATOM 2724  H HZ2  . LYS A 1 67  ? 3.428   -7.662  -12.638 1.00 0.00 ? 1199 LYS A HZ2  2  
ATOM 2725  H HZ3  . LYS A 1 67  ? 2.665   -9.157  -12.842 1.00 0.00 ? 1199 LYS A HZ3  2  
ATOM 2726  N N    . ARG A 1 68  ? 5.855   -5.312  -9.389  1.00 0.00 ? 1200 ARG A N    2  
ATOM 2727  C CA   . ARG A 1 68  ? 7.192   -4.943  -9.837  1.00 0.00 ? 1200 ARG A CA   2  
ATOM 2728  C C    . ARG A 1 68  ? 8.079   -4.573  -8.651  1.00 0.00 ? 1200 ARG A C    2  
ATOM 2729  O O    . ARG A 1 68  ? 9.298   -4.746  -8.697  1.00 0.00 ? 1200 ARG A O    2  
ATOM 2730  C CB   . ARG A 1 68  ? 7.120   -3.772  -10.818 1.00 0.00 ? 1200 ARG A CB   2  
ATOM 2731  C CG   . ARG A 1 68  ? 6.315   -4.076  -12.071 1.00 0.00 ? 1200 ARG A CG   2  
ATOM 2732  C CD   . ARG A 1 68  ? 5.885   -2.802  -12.780 1.00 0.00 ? 1200 ARG A CD   2  
ATOM 2733  N NE   . ARG A 1 68  ? 4.815   -3.046  -13.744 1.00 0.00 ? 1200 ARG A NE   2  
ATOM 2734  C CZ   . ARG A 1 68  ? 5.015   -3.584  -14.942 1.00 0.00 ? 1200 ARG A CZ   2  
ATOM 2735  N NH1  . ARG A 1 68  ? 6.237   -3.931  -15.321 1.00 0.00 ? 1200 ARG A NH1  2  
ATOM 2736  N NH2  . ARG A 1 68  ? 3.991   -3.775  -15.764 1.00 0.00 ? 1200 ARG A NH2  2  
ATOM 2737  H H    . ARG A 1 68  ? 5.097   -4.736  -9.622  1.00 0.00 ? 1200 ARG A H    2  
ATOM 2738  H HA   . ARG A 1 68  ? 7.622   -5.796  -10.340 1.00 0.00 ? 1200 ARG A HA   2  
ATOM 2739  H HB2  . ARG A 1 68  ? 6.664   -2.928  -10.321 1.00 0.00 ? 1200 ARG A HB2  2  
ATOM 2740  H HB3  . ARG A 1 68  ? 8.122   -3.505  -11.116 1.00 0.00 ? 1200 ARG A HB3  2  
ATOM 2741  H HG2  . ARG A 1 68  ? 6.924   -4.661  -12.745 1.00 0.00 ? 1200 ARG A HG2  2  
ATOM 2742  H HG3  . ARG A 1 68  ? 5.437   -4.639  -11.795 1.00 0.00 ? 1200 ARG A HG3  2  
ATOM 2743  H HD2  . ARG A 1 68  ? 5.536   -2.095  -12.042 1.00 0.00 ? 1200 ARG A HD2  2  
ATOM 2744  H HD3  . ARG A 1 68  ? 6.737   -2.389  -13.298 1.00 0.00 ? 1200 ARG A HD3  2  
ATOM 2745  H HE   . ARG A 1 68  ? 3.904   -2.797  -13.485 1.00 0.00 ? 1200 ARG A HE   2  
ATOM 2746  H HH11 . ARG A 1 68  ? 7.010   -3.789  -14.704 1.00 0.00 ? 1200 ARG A HH11 2  
ATOM 2747  H HH12 . ARG A 1 68  ? 6.384   -4.337  -16.224 1.00 0.00 ? 1200 ARG A HH12 2  
ATOM 2748  H HH21 . ARG A 1 68  ? 3.068   -3.514  -15.482 1.00 0.00 ? 1200 ARG A HH21 2  
ATOM 2749  H HH22 . ARG A 1 68  ? 4.142   -4.179  -16.665 1.00 0.00 ? 1200 ARG A HH22 2  
ATOM 2750  N N    . ILE A 1 69  ? 7.460   -4.063  -7.592  1.00 0.00 ? 1201 ILE A N    2  
ATOM 2751  C CA   . ILE A 1 69  ? 8.193   -3.670  -6.395  1.00 0.00 ? 1201 ILE A CA   2  
ATOM 2752  C C    . ILE A 1 69  ? 8.947   -4.853  -5.798  1.00 0.00 ? 1201 ILE A C    2  
ATOM 2753  O O    . ILE A 1 69  ? 8.359   -5.705  -5.132  1.00 0.00 ? 1201 ILE A O    2  
ATOM 2754  C CB   . ILE A 1 69  ? 7.252   -3.083  -5.326  1.00 0.00 ? 1201 ILE A CB   2  
ATOM 2755  C CG1  . ILE A 1 69  ? 6.440   -1.925  -5.910  1.00 0.00 ? 1201 ILE A CG1  2  
ATOM 2756  C CG2  . ILE A 1 69  ? 8.049   -2.620  -4.116  1.00 0.00 ? 1201 ILE A CG2  2  
ATOM 2757  C CD1  . ILE A 1 69  ? 7.241   -0.655  -6.089  1.00 0.00 ? 1201 ILE A CD1  2  
ATOM 2758  H H    . ILE A 1 69  ? 6.487   -3.950  -7.616  1.00 0.00 ? 1201 ILE A H    2  
ATOM 2759  H HA   . ILE A 1 69  ? 8.905   -2.907  -6.677  1.00 0.00 ? 1201 ILE A HA   2  
ATOM 2760  H HB   . ILE A 1 69  ? 6.577   -3.862  -5.006  1.00 0.00 ? 1201 ILE A HB   2  
ATOM 2761  H HG12 . ILE A 1 69  ? 6.057   -2.214  -6.876  1.00 0.00 ? 1201 ILE A HG12 2  
ATOM 2762  H HG13 . ILE A 1 69  ? 5.613   -1.707  -5.250  1.00 0.00 ? 1201 ILE A HG13 2  
ATOM 2763  H HG21 . ILE A 1 69  ? 9.079   -2.464  -4.401  1.00 0.00 ? 1201 ILE A HG21 2  
ATOM 2764  H HG22 . ILE A 1 69  ? 7.635   -1.695  -3.745  1.00 0.00 ? 1201 ILE A HG22 2  
ATOM 2765  H HG23 . ILE A 1 69  ? 8.000   -3.372  -3.343  1.00 0.00 ? 1201 ILE A HG23 2  
ATOM 2766  H HD11 . ILE A 1 69  ? 8.242   -0.902  -6.410  1.00 0.00 ? 1201 ILE A HD11 2  
ATOM 2767  H HD12 . ILE A 1 69  ? 6.767   -0.032  -6.833  1.00 0.00 ? 1201 ILE A HD12 2  
ATOM 2768  H HD13 . ILE A 1 69  ? 7.287   -0.123  -5.150  1.00 0.00 ? 1201 ILE A HD13 2  
ATOM 2769  N N    . ASP A 1 70  ? 10.252  -4.899  -6.041  1.00 0.00 ? 1202 ASP A N    2  
ATOM 2770  C CA   . ASP A 1 70  ? 11.089  -5.977  -5.526  1.00 0.00 ? 1202 ASP A CA   2  
ATOM 2771  C C    . ASP A 1 70  ? 10.555  -6.487  -4.191  1.00 0.00 ? 1202 ASP A C    2  
ATOM 2772  O O    . ASP A 1 70  ? 10.017  -5.721  -3.392  1.00 0.00 ? 1202 ASP A O    2  
ATOM 2773  C CB   . ASP A 1 70  ? 12.532  -5.497  -5.363  1.00 0.00 ? 1202 ASP A CB   2  
ATOM 2774  C CG   . ASP A 1 70  ? 13.515  -6.647  -5.252  1.00 0.00 ? 1202 ASP A CG   2  
ATOM 2775  O OD1  . ASP A 1 70  ? 13.707  -7.157  -4.128  1.00 0.00 ? 1202 ASP A OD1  2  
ATOM 2776  O OD2  . ASP A 1 70  ? 14.091  -7.036  -6.289  1.00 0.00 ? 1202 ASP A OD2  2  
ATOM 2777  H H    . ASP A 1 70  ? 10.664  -4.190  -6.580  1.00 0.00 ? 1202 ASP A H    2  
ATOM 2778  H HA   . ASP A 1 70  ? 11.066  -6.785  -6.240  1.00 0.00 ? 1202 ASP A HA   2  
ATOM 2779  H HB2  . ASP A 1 70  ? 12.804  -4.897  -6.219  1.00 0.00 ? 1202 ASP A HB2  2  
ATOM 2780  H HB3  . ASP A 1 70  ? 12.606  -4.896  -4.469  1.00 0.00 ? 1202 ASP A HB3  2  
ATOM 2781  N N    . GLY A 1 71  ? 10.708  -7.787  -3.956  1.00 0.00 ? 1203 GLY A N    2  
ATOM 2782  C CA   . GLY A 1 71  ? 10.236  -8.377  -2.717  1.00 0.00 ? 1203 GLY A CA   2  
ATOM 2783  C C    . GLY A 1 71  ? 8.908   -9.089  -2.884  1.00 0.00 ? 1203 GLY A C    2  
ATOM 2784  O O    . GLY A 1 71  ? 8.706   -10.176 -2.342  1.00 0.00 ? 1203 GLY A O    2  
ATOM 2785  H H    . GLY A 1 71  ? 11.146  -8.349  -4.629  1.00 0.00 ? 1203 GLY A H    2  
ATOM 2786  H HA2  . GLY A 1 71  ? 10.971  -9.086  -2.365  1.00 0.00 ? 1203 GLY A HA2  2  
ATOM 2787  H HA3  . GLY A 1 71  ? 10.122  -7.596  -1.980  1.00 0.00 ? 1203 GLY A HA3  2  
ATOM 2788  N N    . VAL A 1 72  ? 7.999   -8.475  -3.634  1.00 0.00 ? 1204 VAL A N    2  
ATOM 2789  C CA   . VAL A 1 72  ? 6.683   -9.056  -3.870  1.00 0.00 ? 1204 VAL A CA   2  
ATOM 2790  C C    . VAL A 1 72  ? 6.665   -9.871  -5.158  1.00 0.00 ? 1204 VAL A C    2  
ATOM 2791  O O    . VAL A 1 72  ? 7.257   -9.476  -6.163  1.00 0.00 ? 1204 VAL A O    2  
ATOM 2792  C CB   . VAL A 1 72  ? 5.595   -7.969  -3.948  1.00 0.00 ? 1204 VAL A CB   2  
ATOM 2793  C CG1  . VAL A 1 72  ? 5.579   -7.327  -5.326  1.00 0.00 ? 1204 VAL A CG1  2  
ATOM 2794  C CG2  . VAL A 1 72  ? 4.232   -8.555  -3.608  1.00 0.00 ? 1204 VAL A CG2  2  
ATOM 2795  H H    . VAL A 1 72  ? 8.219   -7.610  -4.039  1.00 0.00 ? 1204 VAL A H    2  
ATOM 2796  H HA   . VAL A 1 72  ? 6.452   -9.708  -3.040  1.00 0.00 ? 1204 VAL A HA   2  
ATOM 2797  H HB   . VAL A 1 72  ? 5.826   -7.204  -3.221  1.00 0.00 ? 1204 VAL A HB   2  
ATOM 2798  H HG11 . VAL A 1 72  ? 4.762   -6.624  -5.386  1.00 0.00 ? 1204 VAL A HG11 2  
ATOM 2799  H HG12 . VAL A 1 72  ? 6.513   -6.810  -5.494  1.00 0.00 ? 1204 VAL A HG12 2  
ATOM 2800  H HG13 . VAL A 1 72  ? 5.451   -8.092  -6.078  1.00 0.00 ? 1204 VAL A HG13 2  
ATOM 2801  H HG21 . VAL A 1 72  ? 4.112   -8.586  -2.536  1.00 0.00 ? 1204 VAL A HG21 2  
ATOM 2802  H HG22 . VAL A 1 72  ? 3.457   -7.938  -4.039  1.00 0.00 ? 1204 VAL A HG22 2  
ATOM 2803  H HG23 . VAL A 1 72  ? 4.160   -9.555  -4.008  1.00 0.00 ? 1204 VAL A HG23 2  
ATOM 2804  N N    . SER A 1 73  ? 5.982   -11.011 -5.122  1.00 0.00 ? 1205 SER A N    2  
ATOM 2805  C CA   . SER A 1 73  ? 5.889   -11.884 -6.286  1.00 0.00 ? 1205 SER A CA   2  
ATOM 2806  C C    . SER A 1 73  ? 4.557   -11.692 -7.005  1.00 0.00 ? 1205 SER A C    2  
ATOM 2807  O O    . SER A 1 73  ? 3.512   -11.558 -6.370  1.00 0.00 ? 1205 SER A O    2  
ATOM 2808  C CB   . SER A 1 73  ? 6.049   -13.347 -5.867  1.00 0.00 ? 1205 SER A CB   2  
ATOM 2809  O OG   . SER A 1 73  ? 5.662   -14.222 -6.912  1.00 0.00 ? 1205 SER A OG   2  
ATOM 2810  H H    . SER A 1 73  ? 5.531   -11.271 -4.291  1.00 0.00 ? 1205 SER A H    2  
ATOM 2811  H HA   . SER A 1 73  ? 6.690   -11.622 -6.961  1.00 0.00 ? 1205 SER A HA   2  
ATOM 2812  H HB2  . SER A 1 73  ? 7.082   -13.537 -5.619  1.00 0.00 ? 1205 SER A HB2  2  
ATOM 2813  H HB3  . SER A 1 73  ? 5.430   -13.540 -5.002  1.00 0.00 ? 1205 SER A HB3  2  
ATOM 2814  H HG   . SER A 1 73  ? 4.787   -14.574 -6.727  1.00 0.00 ? 1205 SER A HG   2  
ATOM 2815  N N    . GLU A 1 74  ? 4.605   -11.679 -8.333  1.00 0.00 ? 1206 GLU A N    2  
ATOM 2816  C CA   . GLU A 1 74  ? 3.403   -11.502 -9.139  1.00 0.00 ? 1206 GLU A CA   2  
ATOM 2817  C C    . GLU A 1 74  ? 2.198   -12.157 -8.469  1.00 0.00 ? 1206 GLU A C    2  
ATOM 2818  O O    . GLU A 1 74  ? 2.251   -13.320 -8.071  1.00 0.00 ? 1206 GLU A O    2  
ATOM 2819  C CB   . GLU A 1 74  ? 3.607   -12.093 -10.536 1.00 0.00 ? 1206 GLU A CB   2  
ATOM 2820  C CG   . GLU A 1 74  ? 2.507   -11.725 -11.518 1.00 0.00 ? 1206 GLU A CG   2  
ATOM 2821  C CD   . GLU A 1 74  ? 2.649   -12.441 -12.847 1.00 0.00 ? 1206 GLU A CD   2  
ATOM 2822  O OE1  . GLU A 1 74  ? 2.929   -13.658 -12.838 1.00 0.00 ? 1206 GLU A OE1  2  
ATOM 2823  O OE2  . GLU A 1 74  ? 2.482   -11.784 -13.896 1.00 0.00 ? 1206 GLU A OE2  2  
ATOM 2824  H H    . GLU A 1 74  ? 5.470   -11.791 -8.782  1.00 0.00 ? 1206 GLU A H    2  
ATOM 2825  H HA   . GLU A 1 74  ? 3.217   -10.443 -9.230  1.00 0.00 ? 1206 GLU A HA   2  
ATOM 2826  H HB2  . GLU A 1 74  ? 4.547   -11.738 -10.930 1.00 0.00 ? 1206 GLU A HB2  2  
ATOM 2827  H HB3  . GLU A 1 74  ? 3.644   -13.169 -10.456 1.00 0.00 ? 1206 GLU A HB3  2  
ATOM 2828  H HG2  . GLU A 1 74  ? 1.553   -11.988 -11.086 1.00 0.00 ? 1206 GLU A HG2  2  
ATOM 2829  H HG3  . GLU A 1 74  ? 2.540   -10.660 -11.694 1.00 0.00 ? 1206 GLU A HG3  2  
ATOM 2830  N N    . GLY A 1 75  ? 1.112   -11.399 -8.347  1.00 0.00 ? 1207 GLY A N    2  
ATOM 2831  C CA   . GLY A 1 75  ? -0.090  -11.921 -7.724  1.00 0.00 ? 1207 GLY A CA   2  
ATOM 2832  C C    . GLY A 1 75  ? -0.239  -11.473 -6.284  1.00 0.00 ? 1207 GLY A C    2  
ATOM 2833  O O    . GLY A 1 75  ? -1.171  -10.743 -5.946  1.00 0.00 ? 1207 GLY A O    2  
ATOM 2834  H H    . GLY A 1 75  ? 1.128   -10.479 -8.682  1.00 0.00 ? 1207 GLY A H    2  
ATOM 2835  H HA2  . GLY A 1 75  ? -0.949  -11.585 -8.286  1.00 0.00 ? 1207 GLY A HA2  2  
ATOM 2836  H HA3  . GLY A 1 75  ? -0.056  -13.001 -7.751  1.00 0.00 ? 1207 GLY A HA3  2  
ATOM 2837  N N    . LYS A 1 76  ? 0.682   -11.910 -5.431  1.00 0.00 ? 1208 LYS A N    2  
ATOM 2838  C CA   . LYS A 1 76  ? 0.650   -11.550 -4.019  1.00 0.00 ? 1208 LYS A CA   2  
ATOM 2839  C C    . LYS A 1 76  ? 0.217   -10.099 -3.837  1.00 0.00 ? 1208 LYS A C    2  
ATOM 2840  O O    . LYS A 1 76  ? -0.654  -9.799  -3.021  1.00 0.00 ? 1208 LYS A O    2  
ATOM 2841  C CB   . LYS A 1 76  ? 2.026   -11.767 -3.385  1.00 0.00 ? 1208 LYS A CB   2  
ATOM 2842  C CG   . LYS A 1 76  ? 2.100   -11.336 -1.930  1.00 0.00 ? 1208 LYS A CG   2  
ATOM 2843  C CD   . LYS A 1 76  ? 3.535   -11.097 -1.492  1.00 0.00 ? 1208 LYS A CD   2  
ATOM 2844  C CE   . LYS A 1 76  ? 4.258   -12.405 -1.212  1.00 0.00 ? 1208 LYS A CE   2  
ATOM 2845  N NZ   . LYS A 1 76  ? 3.654   -13.138 -0.065  1.00 0.00 ? 1208 LYS A NZ   2  
ATOM 2846  H H    . LYS A 1 76  ? 1.401   -12.490 -5.761  1.00 0.00 ? 1208 LYS A H    2  
ATOM 2847  H HA   . LYS A 1 76  ? -0.068  -12.191 -3.529  1.00 0.00 ? 1208 LYS A HA   2  
ATOM 2848  H HB2  . LYS A 1 76  ? 2.274   -12.817 -3.441  1.00 0.00 ? 1208 LYS A HB2  2  
ATOM 2849  H HB3  . LYS A 1 76  ? 2.759   -11.202 -3.944  1.00 0.00 ? 1208 LYS A HB3  2  
ATOM 2850  H HG2  . LYS A 1 76  ? 1.540   -10.421 -1.806  1.00 0.00 ? 1208 LYS A HG2  2  
ATOM 2851  H HG3  . LYS A 1 76  ? 1.669   -12.111 -1.313  1.00 0.00 ? 1208 LYS A HG3  2  
ATOM 2852  H HD2  . LYS A 1 76  ? 4.059   -10.570 -2.276  1.00 0.00 ? 1208 LYS A HD2  2  
ATOM 2853  H HD3  . LYS A 1 76  ? 3.533   -10.497 -0.593  1.00 0.00 ? 1208 LYS A HD3  2  
ATOM 2854  H HE2  . LYS A 1 76  ? 4.205   -13.027 -2.093  1.00 0.00 ? 1208 LYS A HE2  2  
ATOM 2855  H HE3  . LYS A 1 76  ? 5.292   -12.189 -0.986  1.00 0.00 ? 1208 LYS A HE3  2  
ATOM 2856  H HZ1  . LYS A 1 76  ? 3.634   -12.528 0.778   1.00 0.00 ? 1208 LYS A HZ1  2  
ATOM 2857  H HZ2  . LYS A 1 76  ? 4.212   -13.989 0.150   1.00 0.00 ? 1208 LYS A HZ2  2  
ATOM 2858  H HZ3  . LYS A 1 76  ? 2.681   -13.424 -0.296  1.00 0.00 ? 1208 LYS A HZ3  2  
ATOM 2859  N N    . ALA A 1 77  ? 0.831   -9.203  -4.603  1.00 0.00 ? 1209 ALA A N    2  
ATOM 2860  C CA   . ALA A 1 77  ? 0.506   -7.784  -4.529  1.00 0.00 ? 1209 ALA A CA   2  
ATOM 2861  C C    . ALA A 1 77  ? -0.978  -7.574  -4.246  1.00 0.00 ? 1209 ALA A C    2  
ATOM 2862  O O    . ALA A 1 77  ? -1.351  -6.725  -3.438  1.00 0.00 ? 1209 ALA A O    2  
ATOM 2863  C CB   . ALA A 1 77  ? 0.904   -7.083  -5.819  1.00 0.00 ? 1209 ALA A CB   2  
ATOM 2864  H H    . ALA A 1 77  ? 1.517   -9.504  -5.235  1.00 0.00 ? 1209 ALA A H    2  
ATOM 2865  H HA   . ALA A 1 77  ? 1.081   -7.352  -3.722  1.00 0.00 ? 1209 ALA A HA   2  
ATOM 2866  H HB1  . ALA A 1 77  ? 0.032   -6.966  -6.447  1.00 0.00 ? 1209 ALA A HB1  2  
ATOM 2867  H HB2  . ALA A 1 77  ? 1.315   -6.112  -5.589  1.00 0.00 ? 1209 ALA A HB2  2  
ATOM 2868  H HB3  . ALA A 1 77  ? 1.643   -7.675  -6.337  1.00 0.00 ? 1209 ALA A HB3  2  
ATOM 2869  N N    . ALA A 1 78  ? -1.819  -8.354  -4.917  1.00 0.00 ? 1210 ALA A N    2  
ATOM 2870  C CA   . ALA A 1 78  ? -3.262  -8.254  -4.737  1.00 0.00 ? 1210 ALA A CA   2  
ATOM 2871  C C    . ALA A 1 78  ? -3.621  -8.083  -3.265  1.00 0.00 ? 1210 ALA A C    2  
ATOM 2872  O O    . ALA A 1 78  ? -4.134  -7.041  -2.858  1.00 0.00 ? 1210 ALA A O    2  
ATOM 2873  C CB   . ALA A 1 78  ? -3.952  -9.482  -5.311  1.00 0.00 ? 1210 ALA A CB   2  
ATOM 2874  H H    . ALA A 1 78  ? -1.461  -9.012  -5.548  1.00 0.00 ? 1210 ALA A H    2  
ATOM 2875  H HA   . ALA A 1 78  ? -3.608  -7.388  -5.284  1.00 0.00 ? 1210 ALA A HA   2  
ATOM 2876  H HB1  . ALA A 1 78  ? -3.679  -9.594  -6.351  1.00 0.00 ? 1210 ALA A HB1  2  
ATOM 2877  H HB2  . ALA A 1 78  ? -3.643  -10.358 -4.761  1.00 0.00 ? 1210 ALA A HB2  2  
ATOM 2878  H HB3  . ALA A 1 78  ? -5.022  -9.364  -5.230  1.00 0.00 ? 1210 ALA A HB3  2  
ATOM 2879  N N    . MET A 1 79  ? -3.348  -9.113  -2.471  1.00 0.00 ? 1211 MET A N    2  
ATOM 2880  C CA   . MET A 1 79  ? -3.642  -9.076  -1.043  1.00 0.00 ? 1211 MET A CA   2  
ATOM 2881  C C    . MET A 1 79  ? -3.024  -7.842  -0.392  1.00 0.00 ? 1211 MET A C    2  
ATOM 2882  O O    . MET A 1 79  ? -3.492  -7.376  0.647   1.00 0.00 ? 1211 MET A O    2  
ATOM 2883  C CB   . MET A 1 79  ? -3.121  -10.342 -0.360  1.00 0.00 ? 1211 MET A CB   2  
ATOM 2884  C CG   . MET A 1 79  ? -1.650  -10.269 0.016   1.00 0.00 ? 1211 MET A CG   2  
ATOM 2885  S SD   . MET A 1 79  ? -0.856  -11.887 0.035   1.00 0.00 ? 1211 MET A SD   2  
ATOM 2886  C CE   . MET A 1 79  ? 0.529   -11.572 1.126   1.00 0.00 ? 1211 MET A CE   2  
ATOM 2887  H H    . MET A 1 79  ? -2.939  -9.918  -2.853  1.00 0.00 ? 1211 MET A H    2  
ATOM 2888  H HA   . MET A 1 79  ? -4.714  -9.031  -0.927  1.00 0.00 ? 1211 MET A HA   2  
ATOM 2889  H HB2  . MET A 1 79  ? -3.692  -10.512 0.541   1.00 0.00 ? 1211 MET A HB2  2  
ATOM 2890  H HB3  . MET A 1 79  ? -3.258  -11.180 -1.027  1.00 0.00 ? 1211 MET A HB3  2  
ATOM 2891  H HG2  . MET A 1 79  ? -1.140  -9.643  -0.701  1.00 0.00 ? 1211 MET A HG2  2  
ATOM 2892  H HG3  . MET A 1 79  ? -1.565  -9.829  0.999   1.00 0.00 ? 1211 MET A HG3  2  
ATOM 2893  H HE1  . MET A 1 79  ? 0.247   -10.836 1.863   1.00 0.00 ? 1211 MET A HE1  2  
ATOM 2894  H HE2  . MET A 1 79  ? 0.812   -12.489 1.622   1.00 0.00 ? 1211 MET A HE2  2  
ATOM 2895  H HE3  . MET A 1 79  ? 1.364   -11.202 0.548   1.00 0.00 ? 1211 MET A HE3  2  
ATOM 2896  N N    . LEU A 1 80  ? -1.970  -7.319  -1.010  1.00 0.00 ? 1212 LEU A N    2  
ATOM 2897  C CA   . LEU A 1 80  ? -1.288  -6.139  -0.490  1.00 0.00 ? 1212 LEU A CA   2  
ATOM 2898  C C    . LEU A 1 80  ? -1.863  -4.865  -1.100  1.00 0.00 ? 1212 LEU A C    2  
ATOM 2899  O O    . LEU A 1 80  ? -1.143  -3.892  -1.323  1.00 0.00 ? 1212 LEU A O    2  
ATOM 2900  C CB   . LEU A 1 80  ? 0.212   -6.225  -0.779  1.00 0.00 ? 1212 LEU A CB   2  
ATOM 2901  C CG   . LEU A 1 80  ? 0.961   -7.376  -0.106  1.00 0.00 ? 1212 LEU A CG   2  
ATOM 2902  C CD1  . LEU A 1 80  ? 2.395   -7.444  -0.606  1.00 0.00 ? 1212 LEU A CD1  2  
ATOM 2903  C CD2  . LEU A 1 80  ? 0.927   -7.221  1.407   1.00 0.00 ? 1212 LEU A CD2  2  
ATOM 2904  H H    . LEU A 1 80  ? -1.643  -7.735  -1.834  1.00 0.00 ? 1212 LEU A H    2  
ATOM 2905  H HA   . LEU A 1 80  ? -1.439  -6.112  0.578   1.00 0.00 ? 1212 LEU A HA   2  
ATOM 2906  H HB2  . LEU A 1 80  ? 0.338   -6.328  -1.846  1.00 0.00 ? 1212 LEU A HB2  2  
ATOM 2907  H HB3  . LEU A 1 80  ? 0.664   -5.299  -0.453  1.00 0.00 ? 1212 LEU A HB3  2  
ATOM 2908  H HG   . LEU A 1 80  ? 0.475   -8.309  -0.359  1.00 0.00 ? 1212 LEU A HG   2  
ATOM 2909  H HD11 . LEU A 1 80  ? 2.658   -6.507  -1.074  1.00 0.00 ? 1212 LEU A HD11 2  
ATOM 2910  H HD12 . LEU A 1 80  ? 2.489   -8.244  -1.325  1.00 0.00 ? 1212 LEU A HD12 2  
ATOM 2911  H HD13 . LEU A 1 80  ? 3.058   -7.630  0.227   1.00 0.00 ? 1212 LEU A HD13 2  
ATOM 2912  H HD21 . LEU A 1 80  ? -0.090  -7.057  1.729   1.00 0.00 ? 1212 LEU A HD21 2  
ATOM 2913  H HD22 . LEU A 1 80  ? 1.537   -6.377  1.696   1.00 0.00 ? 1212 LEU A HD22 2  
ATOM 2914  H HD23 . LEU A 1 80  ? 1.312   -8.118  1.869   1.00 0.00 ? 1212 LEU A HD23 2  
ATOM 2915  N N    . ALA A 1 81  ? -3.165  -4.877  -1.366  1.00 0.00 ? 1213 ALA A N    2  
ATOM 2916  C CA   . ALA A 1 81  ? -3.837  -3.721  -1.946  1.00 0.00 ? 1213 ALA A CA   2  
ATOM 2917  C C    . ALA A 1 81  ? -3.869  -2.555  -0.964  1.00 0.00 ? 1213 ALA A C    2  
ATOM 2918  O O    . ALA A 1 81  ? -3.512  -1.424  -1.295  1.00 0.00 ? 1213 ALA A O    2  
ATOM 2919  C CB   . ALA A 1 81  ? -5.250  -4.092  -2.373  1.00 0.00 ? 1213 ALA A CB   2  
ATOM 2920  H H    . ALA A 1 81  ? -3.686  -5.683  -1.166  1.00 0.00 ? 1213 ALA A H    2  
ATOM 2921  H HA   . ALA A 1 81  ? -3.288  -3.423  -2.827  1.00 0.00 ? 1213 ALA A HA   2  
ATOM 2922  H HB1  . ALA A 1 81  ? -5.394  -5.156  -2.253  1.00 0.00 ? 1213 ALA A HB1  2  
ATOM 2923  H HB2  . ALA A 1 81  ? -5.962  -3.560  -1.761  1.00 0.00 ? 1213 ALA A HB2  2  
ATOM 2924  H HB3  . ALA A 1 81  ? -5.394  -3.825  -3.409  1.00 0.00 ? 1213 ALA A HB3  2  
ATOM 2925  N N    . PRO A 1 82  ? -4.307  -2.833  0.273   1.00 0.00 ? 1214 PRO A N    2  
ATOM 2926  C CA   . PRO A 1 82  ? -4.396  -1.819  1.328   1.00 0.00 ? 1214 PRO A CA   2  
ATOM 2927  C C    . PRO A 1 82  ? -3.121  -0.990  1.443   1.00 0.00 ? 1214 PRO A C    2  
ATOM 2928  O O    . PRO A 1 82  ? -3.134  0.113   1.992   1.00 0.00 ? 1214 PRO A O    2  
ATOM 2929  C CB   . PRO A 1 82  ? -4.613  -2.646  2.597   1.00 0.00 ? 1214 PRO A CB   2  
ATOM 2930  C CG   . PRO A 1 82  ? -5.253  -3.905  2.124   1.00 0.00 ? 1214 PRO A CG   2  
ATOM 2931  C CD   . PRO A 1 82  ? -4.749  -4.159  0.737   1.00 0.00 ? 1214 PRO A CD   2  
ATOM 2932  H HA   . PRO A 1 82  ? -5.239  -1.161  1.176   1.00 0.00 ? 1214 PRO A HA   2  
ATOM 2933  H HB2  . PRO A 1 82  ? -3.660  -2.840  3.071   1.00 0.00 ? 1214 PRO A HB2  2  
ATOM 2934  H HB3  . PRO A 1 82  ? -5.256  -2.108  3.277   1.00 0.00 ? 1214 PRO A HB3  2  
ATOM 2935  H HG2  . PRO A 1 82  ? -4.975  -4.724  2.770   1.00 0.00 ? 1214 PRO A HG2  2  
ATOM 2936  H HG3  . PRO A 1 82  ? -6.326  -3.787  2.108   1.00 0.00 ? 1214 PRO A HG3  2  
ATOM 2937  H HD2  . PRO A 1 82  ? -3.923  -4.854  0.761   1.00 0.00 ? 1214 PRO A HD2  2  
ATOM 2938  H HD3  . PRO A 1 82  ? -5.546  -4.538  0.114   1.00 0.00 ? 1214 PRO A HD3  2  
ATOM 2939  N N    . LEU A 1 83  ? -2.023  -1.526  0.923   1.00 0.00 ? 1215 LEU A N    2  
ATOM 2940  C CA   . LEU A 1 83  ? -0.739  -0.835  0.968   1.00 0.00 ? 1215 LEU A CA   2  
ATOM 2941  C C    . LEU A 1 83  ? -0.683  0.277   -0.075  1.00 0.00 ? 1215 LEU A C    2  
ATOM 2942  O O    . LEU A 1 83  ? -0.578  1.456   0.266   1.00 0.00 ? 1215 LEU A O    2  
ATOM 2943  C CB   . LEU A 1 83  ? 0.404   -1.825  0.736   1.00 0.00 ? 1215 LEU A CB   2  
ATOM 2944  C CG   . LEU A 1 83  ? 0.718   -2.770  1.896   1.00 0.00 ? 1215 LEU A CG   2  
ATOM 2945  C CD1  . LEU A 1 83  ? -0.297  -3.901  1.953   1.00 0.00 ? 1215 LEU A CD1  2  
ATOM 2946  C CD2  . LEU A 1 83  ? 2.130   -3.324  1.764   1.00 0.00 ? 1215 LEU A CD2  2  
ATOM 2947  H H    . LEU A 1 83  ? -2.075  -2.407  0.499   1.00 0.00 ? 1215 LEU A H    2  
ATOM 2948  H HA   . LEU A 1 83  ? -0.632  -0.397  1.949   1.00 0.00 ? 1215 LEU A HA   2  
ATOM 2949  H HB2  . LEU A 1 83  ? 0.150   -2.428  -0.122  1.00 0.00 ? 1215 LEU A HB2  2  
ATOM 2950  H HB3  . LEU A 1 83  ? 1.296   -1.254  0.521   1.00 0.00 ? 1215 LEU A HB3  2  
ATOM 2951  H HG   . LEU A 1 83  ? 0.659   -2.221  2.826   1.00 0.00 ? 1215 LEU A HG   2  
ATOM 2952  H HD11 . LEU A 1 83  ? -1.005  -3.709  2.745   1.00 0.00 ? 1215 LEU A HD11 2  
ATOM 2953  H HD12 . LEU A 1 83  ? 0.213   -4.833  2.145   1.00 0.00 ? 1215 LEU A HD12 2  
ATOM 2954  H HD13 . LEU A 1 83  ? -0.819  -3.964  1.010   1.00 0.00 ? 1215 LEU A HD13 2  
ATOM 2955  H HD21 . LEU A 1 83  ? 2.500   -3.600  2.741   1.00 0.00 ? 1215 LEU A HD21 2  
ATOM 2956  H HD22 . LEU A 1 83  ? 2.774   -2.571  1.335   1.00 0.00 ? 1215 LEU A HD22 2  
ATOM 2957  H HD23 . LEU A 1 83  ? 2.116   -4.194  1.125   1.00 0.00 ? 1215 LEU A HD23 2  
ATOM 2958  N N    . TRP A 1 84  ? -0.756  -0.105  -1.344  1.00 0.00 ? 1216 TRP A N    2  
ATOM 2959  C CA   . TRP A 1 84  ? -0.716  0.860   -2.437  1.00 0.00 ? 1216 TRP A CA   2  
ATOM 2960  C C    . TRP A 1 84  ? -1.942  1.765   -2.409  1.00 0.00 ? 1216 TRP A C    2  
ATOM 2961  O O    . TRP A 1 84  ? -1.917  2.875   -2.940  1.00 0.00 ? 1216 TRP A O    2  
ATOM 2962  C CB   . TRP A 1 84  ? -0.631  0.136   -3.782  1.00 0.00 ? 1216 TRP A CB   2  
ATOM 2963  C CG   . TRP A 1 84  ? -1.957  -0.363  -4.272  1.00 0.00 ? 1216 TRP A CG   2  
ATOM 2964  C CD1  . TRP A 1 84  ? -3.068  0.387   -4.536  1.00 0.00 ? 1216 TRP A CD1  2  
ATOM 2965  C CD2  . TRP A 1 84  ? -2.310  -1.721  -4.555  1.00 0.00 ? 1216 TRP A CD2  2  
ATOM 2966  N NE1  . TRP A 1 84  ? -4.091  -0.424  -4.965  1.00 0.00 ? 1216 TRP A NE1  2  
ATOM 2967  C CE2  . TRP A 1 84  ? -3.651  -1.722  -4.987  1.00 0.00 ? 1216 TRP A CE2  2  
ATOM 2968  C CE3  . TRP A 1 84  ? -1.624  -2.936  -4.488  1.00 0.00 ? 1216 TRP A CE3  2  
ATOM 2969  C CZ2  . TRP A 1 84  ? -4.316  -2.890  -5.348  1.00 0.00 ? 1216 TRP A CZ2  2  
ATOM 2970  C CZ3  . TRP A 1 84  ? -2.285  -4.095  -4.846  1.00 0.00 ? 1216 TRP A CZ3  2  
ATOM 2971  C CH2  . TRP A 1 84  ? -3.619  -4.066  -5.272  1.00 0.00 ? 1216 TRP A CH2  2  
ATOM 2972  H H    . TRP A 1 84  ? -0.839  -1.060  -1.553  1.00 0.00 ? 1216 TRP A H    2  
ATOM 2973  H HA   . TRP A 1 84  ? 0.168   1.467   -2.309  1.00 0.00 ? 1216 TRP A HA   2  
ATOM 2974  H HB2  . TRP A 1 84  ? -0.235  0.813   -4.524  1.00 0.00 ? 1216 TRP A HB2  2  
ATOM 2975  H HB3  . TRP A 1 84  ? 0.030   -0.713  -3.684  1.00 0.00 ? 1216 TRP A HB3  2  
ATOM 2976  H HD1  . TRP A 1 84  ? -3.121  1.458   -4.417  1.00 0.00 ? 1216 TRP A HD1  2  
ATOM 2977  H HE1  . TRP A 1 84  ? -4.989  -0.122  -5.217  1.00 0.00 ? 1216 TRP A HE1  2  
ATOM 2978  H HE3  . TRP A 1 84  ? -0.595  -2.979  -4.162  1.00 0.00 ? 1216 TRP A HE3  2  
ATOM 2979  H HZ2  . TRP A 1 84  ? -5.344  -2.884  -5.679  1.00 0.00 ? 1216 TRP A HZ2  2  
ATOM 2980  H HZ3  . TRP A 1 84  ? -1.771  -5.044  -4.800  1.00 0.00 ? 1216 TRP A HZ3  2  
ATOM 2981  H HH2  . TRP A 1 84  ? -4.096  -4.996  -5.542  1.00 0.00 ? 1216 TRP A HH2  2  
ATOM 2982  N N    . GLU A 1 85  ? -3.014  1.284   -1.786  1.00 0.00 ? 1217 GLU A N    2  
ATOM 2983  C CA   . GLU A 1 85  ? -4.250  2.052   -1.690  1.00 0.00 ? 1217 GLU A CA   2  
ATOM 2984  C C    . GLU A 1 85  ? -4.025  3.352   -0.924  1.00 0.00 ? 1217 GLU A C    2  
ATOM 2985  O O    . GLU A 1 85  ? -4.615  4.384   -1.243  1.00 0.00 ? 1217 GLU A O    2  
ATOM 2986  C CB   . GLU A 1 85  ? -5.339  1.224   -1.005  1.00 0.00 ? 1217 GLU A CB   2  
ATOM 2987  C CG   . GLU A 1 85  ? -6.147  0.367   -1.964  1.00 0.00 ? 1217 GLU A CG   2  
ATOM 2988  C CD   . GLU A 1 85  ? -7.313  -0.326  -1.287  1.00 0.00 ? 1217 GLU A CD   2  
ATOM 2989  O OE1  . GLU A 1 85  ? -7.747  0.150   -0.218  1.00 0.00 ? 1217 GLU A OE1  2  
ATOM 2990  O OE2  . GLU A 1 85  ? -7.791  -1.346  -1.826  1.00 0.00 ? 1217 GLU A OE2  2  
ATOM 2991  H H    . GLU A 1 85  ? -2.972  0.392   -1.382  1.00 0.00 ? 1217 GLU A H    2  
ATOM 2992  H HA   . GLU A 1 85  ? -4.571  2.290   -2.693  1.00 0.00 ? 1217 GLU A HA   2  
ATOM 2993  H HB2  . GLU A 1 85  ? -4.875  0.574   -0.277  1.00 0.00 ? 1217 GLU A HB2  2  
ATOM 2994  H HB3  . GLU A 1 85  ? -6.016  1.894   -0.496  1.00 0.00 ? 1217 GLU A HB3  2  
ATOM 2995  H HG2  . GLU A 1 85  ? -6.531  0.996   -2.753  1.00 0.00 ? 1217 GLU A HG2  2  
ATOM 2996  H HG3  . GLU A 1 85  ? -5.498  -0.385  -2.389  1.00 0.00 ? 1217 GLU A HG3  2  
ATOM 2997  N N    . VAL A 1 86  ? -3.168  3.293   0.091   1.00 0.00 ? 1218 VAL A N    2  
ATOM 2998  C CA   . VAL A 1 86  ? -2.865  4.464   0.904   1.00 0.00 ? 1218 VAL A CA   2  
ATOM 2999  C C    . VAL A 1 86  ? -2.113  5.515   0.094   1.00 0.00 ? 1218 VAL A C    2  
ATOM 3000  O O    . VAL A 1 86  ? -2.403  6.708   0.186   1.00 0.00 ? 1218 VAL A O    2  
ATOM 3001  C CB   . VAL A 1 86  ? -2.026  4.088   2.140   1.00 0.00 ? 1218 VAL A CB   2  
ATOM 3002  C CG1  . VAL A 1 86  ? -1.574  5.338   2.879   1.00 0.00 ? 1218 VAL A CG1  2  
ATOM 3003  C CG2  . VAL A 1 86  ? -2.817  3.170   3.060   1.00 0.00 ? 1218 VAL A CG2  2  
ATOM 3004  H H    . VAL A 1 86  ? -2.729  2.441   0.297   1.00 0.00 ? 1218 VAL A H    2  
ATOM 3005  H HA   . VAL A 1 86  ? -3.799  4.886   1.244   1.00 0.00 ? 1218 VAL A HA   2  
ATOM 3006  H HB   . VAL A 1 86  ? -1.147  3.557   1.805   1.00 0.00 ? 1218 VAL A HB   2  
ATOM 3007  H HG11 . VAL A 1 86  ? -1.153  6.040   2.175   1.00 0.00 ? 1218 VAL A HG11 2  
ATOM 3008  H HG12 . VAL A 1 86  ? -2.420  5.788   3.377   1.00 0.00 ? 1218 VAL A HG12 2  
ATOM 3009  H HG13 . VAL A 1 86  ? -0.825  5.072   3.611   1.00 0.00 ? 1218 VAL A HG13 2  
ATOM 3010  H HG21 . VAL A 1 86  ? -2.692  2.147   2.741   1.00 0.00 ? 1218 VAL A HG21 2  
ATOM 3011  H HG22 . VAL A 1 86  ? -2.455  3.278   4.073   1.00 0.00 ? 1218 VAL A HG22 2  
ATOM 3012  H HG23 . VAL A 1 86  ? -3.862  3.435   3.022   1.00 0.00 ? 1218 VAL A HG23 2  
ATOM 3013  N N    . ILE A 1 87  ? -1.147  5.064   -0.698  1.00 0.00 ? 1219 ILE A N    2  
ATOM 3014  C CA   . ILE A 1 87  ? -0.355  5.965   -1.526  1.00 0.00 ? 1219 ILE A CA   2  
ATOM 3015  C C    . ILE A 1 87  ? -1.236  6.721   -2.515  1.00 0.00 ? 1219 ILE A C    2  
ATOM 3016  O O    . ILE A 1 87  ? -1.040  7.913   -2.753  1.00 0.00 ? 1219 ILE A O    2  
ATOM 3017  C CB   . ILE A 1 87  ? 0.734   5.204   -2.304  1.00 0.00 ? 1219 ILE A CB   2  
ATOM 3018  C CG1  . ILE A 1 87  ? 1.632   4.427   -1.340  1.00 0.00 ? 1219 ILE A CG1  2  
ATOM 3019  C CG2  . ILE A 1 87  ? 1.559   6.169   -3.142  1.00 0.00 ? 1219 ILE A CG2  2  
ATOM 3020  C CD1  . ILE A 1 87  ? 2.492   3.386   -2.021  1.00 0.00 ? 1219 ILE A CD1  2  
ATOM 3021  H H    . ILE A 1 87  ? -0.963  4.102   -0.728  1.00 0.00 ? 1219 ILE A H    2  
ATOM 3022  H HA   . ILE A 1 87  ? 0.128   6.678   -0.873  1.00 0.00 ? 1219 ILE A HA   2  
ATOM 3023  H HB   . ILE A 1 87  ? 0.249   4.509   -2.972  1.00 0.00 ? 1219 ILE A HB   2  
ATOM 3024  H HG12 . ILE A 1 87  ? 2.287   5.117   -0.832  1.00 0.00 ? 1219 ILE A HG12 2  
ATOM 3025  H HG13 . ILE A 1 87  ? 1.013   3.922   -0.612  1.00 0.00 ? 1219 ILE A HG13 2  
ATOM 3026  H HG21 . ILE A 1 87  ? 2.330   5.623   -3.666  1.00 0.00 ? 1219 ILE A HG21 2  
ATOM 3027  H HG22 . ILE A 1 87  ? 0.918   6.662   -3.858  1.00 0.00 ? 1219 ILE A HG22 2  
ATOM 3028  H HG23 . ILE A 1 87  ? 2.014   6.907   -2.499  1.00 0.00 ? 1219 ILE A HG23 2  
ATOM 3029  H HD11 . ILE A 1 87  ? 3.228   3.013   -1.323  1.00 0.00 ? 1219 ILE A HD11 2  
ATOM 3030  H HD12 . ILE A 1 87  ? 1.872   2.570   -2.360  1.00 0.00 ? 1219 ILE A HD12 2  
ATOM 3031  H HD13 . ILE A 1 87  ? 2.994   3.832   -2.868  1.00 0.00 ? 1219 ILE A HD13 2  
ATOM 3032  N N    . LYS A 1 88  ? -2.209  6.020   -3.087  1.00 0.00 ? 1220 LYS A N    2  
ATOM 3033  C CA   . LYS A 1 88  ? -3.124  6.625   -4.048  1.00 0.00 ? 1220 LYS A CA   2  
ATOM 3034  C C    . LYS A 1 88  ? -3.902  7.772   -3.412  1.00 0.00 ? 1220 LYS A C    2  
ATOM 3035  O O    . LYS A 1 88  ? -4.073  8.830   -4.017  1.00 0.00 ? 1220 LYS A O    2  
ATOM 3036  C CB   . LYS A 1 88  ? -4.096  5.573   -4.588  1.00 0.00 ? 1220 LYS A CB   2  
ATOM 3037  C CG   . LYS A 1 88  ? -4.739  5.960   -5.909  1.00 0.00 ? 1220 LYS A CG   2  
ATOM 3038  C CD   . LYS A 1 88  ? -5.374  4.761   -6.593  1.00 0.00 ? 1220 LYS A CD   2  
ATOM 3039  C CE   . LYS A 1 88  ? -6.606  4.279   -5.842  1.00 0.00 ? 1220 LYS A CE   2  
ATOM 3040  N NZ   . LYS A 1 88  ? -7.689  5.300   -5.840  1.00 0.00 ? 1220 LYS A NZ   2  
ATOM 3041  H H    . LYS A 1 88  ? -2.315  5.073   -2.856  1.00 0.00 ? 1220 LYS A H    2  
ATOM 3042  H HA   . LYS A 1 88  ? -2.537  7.014   -4.866  1.00 0.00 ? 1220 LYS A HA   2  
ATOM 3043  H HB2  . LYS A 1 88  ? -3.562  4.645   -4.730  1.00 0.00 ? 1220 LYS A HB2  2  
ATOM 3044  H HB3  . LYS A 1 88  ? -4.881  5.419   -3.862  1.00 0.00 ? 1220 LYS A HB3  2  
ATOM 3045  H HG2  . LYS A 1 88  ? -5.502  6.702   -5.724  1.00 0.00 ? 1220 LYS A HG2  2  
ATOM 3046  H HG3  . LYS A 1 88  ? -3.982  6.375   -6.559  1.00 0.00 ? 1220 LYS A HG3  2  
ATOM 3047  H HD2  . LYS A 1 88  ? -5.664  5.041   -7.595  1.00 0.00 ? 1220 LYS A HD2  2  
ATOM 3048  H HD3  . LYS A 1 88  ? -4.652  3.958   -6.636  1.00 0.00 ? 1220 LYS A HD3  2  
ATOM 3049  H HE2  . LYS A 1 88  ? -6.971  3.381   -6.316  1.00 0.00 ? 1220 LYS A HE2  2  
ATOM 3050  H HE3  . LYS A 1 88  ? -6.326  4.060   -4.822  1.00 0.00 ? 1220 LYS A HE3  2  
ATOM 3051  H HZ1  . LYS A 1 88  ? -7.424  6.101   -5.231  1.00 0.00 ? 1220 LYS A HZ1  2  
ATOM 3052  H HZ2  . LYS A 1 88  ? -8.572  4.884   -5.480  1.00 0.00 ? 1220 LYS A HZ2  2  
ATOM 3053  H HZ3  . LYS A 1 88  ? -7.852  5.652   -6.805  1.00 0.00 ? 1220 LYS A HZ3  2  
ATOM 3054  N N    . HIS A 1 89  ? -4.371  7.556   -2.186  1.00 0.00 ? 1221 HIS A N    2  
ATOM 3055  C CA   . HIS A 1 89  ? -5.129  8.573   -1.467  1.00 0.00 ? 1221 HIS A CA   2  
ATOM 3056  C C    . HIS A 1 89  ? -4.213  9.695   -0.987  1.00 0.00 ? 1221 HIS A C    2  
ATOM 3057  O O    . HIS A 1 89  ? -4.540  10.875  -1.116  1.00 0.00 ? 1221 HIS A O    2  
ATOM 3058  C CB   . HIS A 1 89  ? -5.858  7.950   -0.277  1.00 0.00 ? 1221 HIS A CB   2  
ATOM 3059  C CG   . HIS A 1 89  ? -6.806  8.889   0.404   1.00 0.00 ? 1221 HIS A CG   2  
ATOM 3060  N ND1  . HIS A 1 89  ? -8.102  8.547   0.726   1.00 0.00 ? 1221 HIS A ND1  2  
ATOM 3061  C CD2  . HIS A 1 89  ? -6.638  10.164  0.826   1.00 0.00 ? 1221 HIS A CD2  2  
ATOM 3062  C CE1  . HIS A 1 89  ? -8.692  9.572   1.314   1.00 0.00 ? 1221 HIS A CE1  2  
ATOM 3063  N NE2  . HIS A 1 89  ? -7.825  10.566  1.388   1.00 0.00 ? 1221 HIS A NE2  2  
ATOM 3064  H H    . HIS A 1 89  ? -4.202  6.692   -1.756  1.00 0.00 ? 1221 HIS A H    2  
ATOM 3065  H HA   . HIS A 1 89  ? -5.857  8.987   -2.148  1.00 0.00 ? 1221 HIS A HA   2  
ATOM 3066  H HB2  . HIS A 1 89  ? -6.425  7.096   -0.617  1.00 0.00 ? 1221 HIS A HB2  2  
ATOM 3067  H HB3  . HIS A 1 89  ? -5.130  7.625   0.453   1.00 0.00 ? 1221 HIS A HB3  2  
ATOM 3068  H HD1  . HIS A 1 89  ? -8.527  7.683   0.547   1.00 0.00 ? 1221 HIS A HD1  2  
ATOM 3069  H HD2  . HIS A 1 89  ? -5.739  10.757  0.737   1.00 0.00 ? 1221 HIS A HD2  2  
ATOM 3070  H HE1  . HIS A 1 89  ? -9.710  9.595   1.675   1.00 0.00 ? 1221 HIS A HE1  2  
ATOM 3071  H HE2  . HIS A 1 89  ? -8.030  11.471  1.702   1.00 0.00 ? 1221 HIS A HE2  2  
ATOM 3072  N N    . PHE A 1 90  ? -3.065  9.319   -0.432  1.00 0.00 ? 1222 PHE A N    2  
ATOM 3073  C CA   . PHE A 1 90  ? -2.103  10.294  0.068   1.00 0.00 ? 1222 PHE A CA   2  
ATOM 3074  C C    . PHE A 1 90  ? -1.691  11.267  -1.032  1.00 0.00 ? 1222 PHE A C    2  
ATOM 3075  O O    . PHE A 1 90  ? -1.651  12.480  -0.820  1.00 0.00 ? 1222 PHE A O    2  
ATOM 3076  C CB   . PHE A 1 90  ? -0.867  9.583   0.624   1.00 0.00 ? 1222 PHE A CB   2  
ATOM 3077  C CG   . PHE A 1 90  ? 0.296   10.502  0.864   1.00 0.00 ? 1222 PHE A CG   2  
ATOM 3078  C CD1  . PHE A 1 90  ? 0.374   11.252  2.026   1.00 0.00 ? 1222 PHE A CD1  2  
ATOM 3079  C CD2  . PHE A 1 90  ? 1.311   10.615  -0.071  1.00 0.00 ? 1222 PHE A CD2  2  
ATOM 3080  C CE1  . PHE A 1 90  ? 1.443   12.099  2.250   1.00 0.00 ? 1222 PHE A CE1  2  
ATOM 3081  C CE2  . PHE A 1 90  ? 2.383   11.460  0.146   1.00 0.00 ? 1222 PHE A CE2  2  
ATOM 3082  C CZ   . PHE A 1 90  ? 2.450   12.203  1.309   1.00 0.00 ? 1222 PHE A CZ   2  
ATOM 3083  H H    . PHE A 1 90  ? -2.861  8.363   -0.358  1.00 0.00 ? 1222 PHE A H    2  
ATOM 3084  H HA   . PHE A 1 90  ? -2.577  10.848  0.864   1.00 0.00 ? 1222 PHE A HA   2  
ATOM 3085  H HB2  . PHE A 1 90  ? -1.121  9.117   1.565   1.00 0.00 ? 1222 PHE A HB2  2  
ATOM 3086  H HB3  . PHE A 1 90  ? -0.553  8.823   -0.076  1.00 0.00 ? 1222 PHE A HB3  2  
ATOM 3087  H HD1  . PHE A 1 90  ? -0.411  11.172  2.764   1.00 0.00 ? 1222 PHE A HD1  2  
ATOM 3088  H HD2  . PHE A 1 90  ? 1.260   10.034  -0.982  1.00 0.00 ? 1222 PHE A HD2  2  
ATOM 3089  H HE1  . PHE A 1 90  ? 1.493   12.679  3.159   1.00 0.00 ? 1222 PHE A HE1  2  
ATOM 3090  H HE2  . PHE A 1 90  ? 3.168   11.538  -0.591  1.00 0.00 ? 1222 PHE A HE2  2  
ATOM 3091  H HZ   . PHE A 1 90  ? 3.286   12.864  1.481   1.00 0.00 ? 1222 PHE A HZ   2  
ATOM 3092  N N    . CYS A 1 91  ? -1.386  10.727  -2.207  1.00 0.00 ? 1223 CYS A N    2  
ATOM 3093  C CA   . CYS A 1 91  ? -0.976  11.547  -3.342  1.00 0.00 ? 1223 CYS A CA   2  
ATOM 3094  C C    . CYS A 1 91  ? -2.149  12.362  -3.876  1.00 0.00 ? 1223 CYS A C    2  
ATOM 3095  O O    . CYS A 1 91  ? -1.980  13.503  -4.304  1.00 0.00 ? 1223 CYS A O    2  
ATOM 3096  C CB   . CYS A 1 91  ? -0.403  10.666  -4.453  1.00 0.00 ? 1223 CYS A CB   2  
ATOM 3097  S SG   . CYS A 1 91  ? -1.576  9.462   -5.119  1.00 0.00 ? 1223 CYS A SG   2  
ATOM 3098  H H    . CYS A 1 91  ? -1.437  9.754   -2.315  1.00 0.00 ? 1223 CYS A H    2  
ATOM 3099  H HA   . CYS A 1 91  ? -0.209  12.225  -3.000  1.00 0.00 ? 1223 CYS A HA   2  
ATOM 3100  H HB2  . CYS A 1 91  ? -0.080  11.295  -5.270  1.00 0.00 ? 1223 CYS A HB2  2  
ATOM 3101  H HB3  . CYS A 1 91  ? 0.447   10.122  -4.069  1.00 0.00 ? 1223 CYS A HB3  2  
ATOM 3102  H HG   . CYS A 1 91  ? -2.737  10.075  -5.292  1.00 0.00 ? 1223 CYS A HG   2  
ATOM 3103  N N    . GLN A 1 92  ? -3.338  11.767  -3.848  1.00 0.00 ? 1224 GLN A N    2  
ATOM 3104  C CA   . GLN A 1 92  ? -4.538  12.438  -4.332  1.00 0.00 ? 1224 GLN A CA   2  
ATOM 3105  C C    . GLN A 1 92  ? -4.770  13.747  -3.584  1.00 0.00 ? 1224 GLN A C    2  
ATOM 3106  O O    . GLN A 1 92  ? -5.254  14.724  -4.155  1.00 0.00 ? 1224 GLN A O    2  
ATOM 3107  C CB   . GLN A 1 92  ? -5.756  11.525  -4.176  1.00 0.00 ? 1224 GLN A CB   2  
ATOM 3108  C CG   . GLN A 1 92  ? -6.016  10.645  -5.388  1.00 0.00 ? 1224 GLN A CG   2  
ATOM 3109  C CD   . GLN A 1 92  ? -6.253  11.448  -6.652  1.00 0.00 ? 1224 GLN A CD   2  
ATOM 3110  O OE1  . GLN A 1 92  ? -5.360  11.592  -7.487  1.00 0.00 ? 1224 GLN A OE1  2  
ATOM 3111  N NE2  . GLN A 1 92  ? -7.462  11.976  -6.800  1.00 0.00 ? 1224 GLN A NE2  2  
ATOM 3112  H H    . GLN A 1 92  ? -3.408  10.857  -3.495  1.00 0.00 ? 1224 GLN A H    2  
ATOM 3113  H HA   . GLN A 1 92  ? -4.396  12.657  -5.380  1.00 0.00 ? 1224 GLN A HA   2  
ATOM 3114  H HB2  . GLN A 1 92  ? -5.604  10.886  -3.320  1.00 0.00 ? 1224 GLN A HB2  2  
ATOM 3115  H HB3  . GLN A 1 92  ? -6.630  12.137  -4.009  1.00 0.00 ? 1224 GLN A HB3  2  
ATOM 3116  H HG2  . GLN A 1 92  ? -5.160  10.005  -5.543  1.00 0.00 ? 1224 GLN A HG2  2  
ATOM 3117  H HG3  . GLN A 1 92  ? -6.888  10.038  -5.196  1.00 0.00 ? 1224 GLN A HG3  2  
ATOM 3118  H HE21 . GLN A 1 92  ? -8.124  11.821  -6.093  1.00 0.00 ? 1224 GLN A HE21 2  
ATOM 3119  H HE22 . GLN A 1 92  ? -7.643  12.500  -7.607  1.00 0.00 ? 1224 GLN A HE22 2  
ATOM 3120  N N    . THR A 1 93  ? -4.422  13.759  -2.301  1.00 0.00 ? 1225 THR A N    2  
ATOM 3121  C CA   . THR A 1 93  ? -4.593  14.946  -1.474  1.00 0.00 ? 1225 THR A CA   2  
ATOM 3122  C C    . THR A 1 93  ? -3.326  15.793  -1.458  1.00 0.00 ? 1225 THR A C    2  
ATOM 3123  O O    . THR A 1 93  ? -3.389  17.021  -1.454  1.00 0.00 ? 1225 THR A O    2  
ATOM 3124  C CB   . THR A 1 93  ? -4.966  14.574  -0.026  1.00 0.00 ? 1225 THR A CB   2  
ATOM 3125  O OG1  . THR A 1 93  ? -5.511  15.713  0.648   1.00 0.00 ? 1225 THR A OG1  2  
ATOM 3126  C CG2  . THR A 1 93  ? -3.750  14.063  0.732   1.00 0.00 ? 1225 THR A CG2  2  
ATOM 3127  H H    . THR A 1 93  ? -4.041  12.948  -1.902  1.00 0.00 ? 1225 THR A H    2  
ATOM 3128  H HA   . THR A 1 93  ? -5.400  15.531  -1.892  1.00 0.00 ? 1225 THR A HA   2  
ATOM 3129  H HB   . THR A 1 93  ? -5.710  13.790  -0.053  1.00 0.00 ? 1225 THR A HB   2  
ATOM 3130  H HG1  . THR A 1 93  ? -6.155  16.144  0.080   1.00 0.00 ? 1225 THR A HG1  2  
ATOM 3131  H HG21 . THR A 1 93  ? -2.946  14.780  0.647   1.00 0.00 ? 1225 THR A HG21 2  
ATOM 3132  H HG22 . THR A 1 93  ? -3.436  13.118  0.314   1.00 0.00 ? 1225 THR A HG22 2  
ATOM 3133  H HG23 . THR A 1 93  ? -4.005  13.931  1.772   1.00 0.00 ? 1225 THR A HG23 2  
ATOM 3134  N N    . ASN A 1 94  ? -2.175  15.127  -1.450  1.00 0.00 ? 1226 ASN A N    2  
ATOM 3135  C CA   . ASN A 1 94  ? -0.892  15.820  -1.434  1.00 0.00 ? 1226 ASN A CA   2  
ATOM 3136  C C    . ASN A 1 94  ? -0.360  16.011  -2.852  1.00 0.00 ? 1226 ASN A C    2  
ATOM 3137  O O    . ASN A 1 94  ? 0.818   16.307  -3.049  1.00 0.00 ? 1226 ASN A O    2  
ATOM 3138  C CB   . ASN A 1 94  ? 0.123   15.038  -0.598  1.00 0.00 ? 1226 ASN A CB   2  
ATOM 3139  C CG   . ASN A 1 94  ? -0.088  15.226  0.892   1.00 0.00 ? 1226 ASN A CG   2  
ATOM 3140  O OD1  . ASN A 1 94  ? 0.473   16.137  1.500   1.00 0.00 ? 1226 ASN A OD1  2  
ATOM 3141  N ND2  . ASN A 1 94  ? -0.901  14.361  1.487   1.00 0.00 ? 1226 ASN A ND2  2  
ATOM 3142  H H    . ASN A 1 94  ? -2.189  14.147  -1.453  1.00 0.00 ? 1226 ASN A H    2  
ATOM 3143  H HA   . ASN A 1 94  ? -1.044  16.790  -0.985  1.00 0.00 ? 1226 ASN A HA   2  
ATOM 3144  H HB2  . ASN A 1 94  ? 0.033   13.986  -0.825  1.00 0.00 ? 1226 ASN A HB2  2  
ATOM 3145  H HB3  . ASN A 1 94  ? 1.119   15.372  -0.847  1.00 0.00 ? 1226 ASN A HB3  2  
ATOM 3146  H HD21 . ASN A 1 94  ? -1.314  13.660  0.940   1.00 0.00 ? 1226 ASN A HD21 2  
ATOM 3147  H HD22 . ASN A 1 94  ? -1.057  14.459  2.450   1.00 0.00 ? 1226 ASN A HD22 2  
ATOM 3148  N N    . SER A 1 95  ? -1.238  15.841  -3.835  1.00 0.00 ? 1227 SER A N    2  
ATOM 3149  C CA   . SER A 1 95  ? -0.856  15.991  -5.234  1.00 0.00 ? 1227 SER A CA   2  
ATOM 3150  C C    . SER A 1 95  ? 0.566   15.491  -5.467  1.00 0.00 ? 1227 SER A C    2  
ATOM 3151  O O    . SER A 1 95  ? 1.372   16.155  -6.118  1.00 0.00 ? 1227 SER A O    2  
ATOM 3152  C CB   . SER A 1 95  ? -0.970  17.456  -5.661  1.00 0.00 ? 1227 SER A CB   2  
ATOM 3153  O OG   . SER A 1 95  ? -2.253  17.977  -5.360  1.00 0.00 ? 1227 SER A OG   2  
ATOM 3154  H H    . SER A 1 95  ? -2.163  15.606  -3.614  1.00 0.00 ? 1227 SER A H    2  
ATOM 3155  H HA   . SER A 1 95  ? -1.536  15.399  -5.829  1.00 0.00 ? 1227 SER A HA   2  
ATOM 3156  H HB2  . SER A 1 95  ? -0.227  18.039  -5.139  1.00 0.00 ? 1227 SER A HB2  2  
ATOM 3157  H HB3  . SER A 1 95  ? -0.804  17.532  -6.726  1.00 0.00 ? 1227 SER A HB3  2  
ATOM 3158  H HG   . SER A 1 95  ? -2.194  18.551  -4.593  1.00 0.00 ? 1227 SER A HG   2  
ATOM 3159  N N    . VAL A 1 96  ? 0.867   14.313  -4.929  1.00 0.00 ? 1228 VAL A N    2  
ATOM 3160  C CA   . VAL A 1 96  ? 2.191   13.721  -5.078  1.00 0.00 ? 1228 VAL A CA   2  
ATOM 3161  C C    . VAL A 1 96  ? 2.283   12.894  -6.355  1.00 0.00 ? 1228 VAL A C    2  
ATOM 3162  O O    . VAL A 1 96  ? 1.349   12.175  -6.708  1.00 0.00 ? 1228 VAL A O    2  
ATOM 3163  C CB   . VAL A 1 96  ? 2.545   12.828  -3.874  1.00 0.00 ? 1228 VAL A CB   2  
ATOM 3164  C CG1  . VAL A 1 96  ? 3.937   12.237  -4.038  1.00 0.00 ? 1228 VAL A CG1  2  
ATOM 3165  C CG2  . VAL A 1 96  ? 2.441   13.616  -2.577  1.00 0.00 ? 1228 VAL A CG2  2  
ATOM 3166  H H    . VAL A 1 96  ? 0.182   13.831  -4.421  1.00 0.00 ? 1228 VAL A H    2  
ATOM 3167  H HA   . VAL A 1 96  ? 2.912   14.524  -5.127  1.00 0.00 ? 1228 VAL A HA   2  
ATOM 3168  H HB   . VAL A 1 96  ? 1.836   12.014  -3.835  1.00 0.00 ? 1228 VAL A HB   2  
ATOM 3169  H HG11 . VAL A 1 96  ? 4.652   12.847  -3.506  1.00 0.00 ? 1228 VAL A HG11 2  
ATOM 3170  H HG12 . VAL A 1 96  ? 3.952   11.233  -3.640  1.00 0.00 ? 1228 VAL A HG12 2  
ATOM 3171  H HG13 . VAL A 1 96  ? 4.196   12.213  -5.086  1.00 0.00 ? 1228 VAL A HG13 2  
ATOM 3172  H HG21 . VAL A 1 96  ? 1.563   13.299  -2.034  1.00 0.00 ? 1228 VAL A HG21 2  
ATOM 3173  H HG22 . VAL A 1 96  ? 3.320   13.437  -1.975  1.00 0.00 ? 1228 VAL A HG22 2  
ATOM 3174  H HG23 . VAL A 1 96  ? 2.366   14.669  -2.801  1.00 0.00 ? 1228 VAL A HG23 2  
ATOM 3175  N N    . GLN A 1 97  ? 3.415   13.002  -7.043  1.00 0.00 ? 1229 GLN A N    2  
ATOM 3176  C CA   . GLN A 1 97  ? 3.629   12.264  -8.282  1.00 0.00 ? 1229 GLN A CA   2  
ATOM 3177  C C    . GLN A 1 97  ? 3.628   10.760  -8.027  1.00 0.00 ? 1229 GLN A C    2  
ATOM 3178  O O    . GLN A 1 97  ? 4.039   10.300  -6.961  1.00 0.00 ? 1229 GLN A O    2  
ATOM 3179  C CB   . GLN A 1 97  ? 4.950   12.682  -8.929  1.00 0.00 ? 1229 GLN A CB   2  
ATOM 3180  C CG   . GLN A 1 97  ? 4.977   12.492  -10.437 1.00 0.00 ? 1229 GLN A CG   2  
ATOM 3181  C CD   . GLN A 1 97  ? 4.432   13.693  -11.186 1.00 0.00 ? 1229 GLN A CD   2  
ATOM 3182  O OE1  . GLN A 1 97  ? 3.220   13.905  -11.244 1.00 0.00 ? 1229 GLN A OE1  2  
ATOM 3183  N NE2  . GLN A 1 97  ? 5.326   14.486  -11.765 1.00 0.00 ? 1229 GLN A NE2  2  
ATOM 3184  H H    . GLN A 1 97  ? 4.123   13.592  -6.710  1.00 0.00 ? 1229 GLN A H    2  
ATOM 3185  H HA   . GLN A 1 97  ? 2.818   12.502  -8.954  1.00 0.00 ? 1229 GLN A HA   2  
ATOM 3186  H HB2  . GLN A 1 97  ? 5.127   13.726  -8.716  1.00 0.00 ? 1229 GLN A HB2  2  
ATOM 3187  H HB3  . GLN A 1 97  ? 5.749   12.095  -8.500  1.00 0.00 ? 1229 GLN A HB3  2  
ATOM 3188  H HG2  . GLN A 1 97  ? 5.997   12.327  -10.749 1.00 0.00 ? 1229 GLN A HG2  2  
ATOM 3189  H HG3  . GLN A 1 97  ? 4.380   11.628  -10.688 1.00 0.00 ? 1229 GLN A HG3  2  
ATOM 3190  H HE21 . GLN A 1 97  ? 6.275   14.253  -11.678 1.00 0.00 ? 1229 GLN A HE21 2  
ATOM 3191  H HE22 . GLN A 1 97  ? 5.002   15.268  -12.256 1.00 0.00 ? 1229 GLN A HE22 2  
ATOM 3192  N N    . THR A 1 98  ? 3.163   9.998   -9.012  1.00 0.00 ? 1230 THR A N    2  
ATOM 3193  C CA   . THR A 1 98  ? 3.107   8.546   -8.894  1.00 0.00 ? 1230 THR A CA   2  
ATOM 3194  C C    . THR A 1 98  ? 3.545   7.872   -10.189 1.00 0.00 ? 1230 THR A C    2  
ATOM 3195  O O    . THR A 1 98  ? 3.968   8.537   -11.134 1.00 0.00 ? 1230 THR A O    2  
ATOM 3196  C CB   . THR A 1 98  ? 1.688   8.066   -8.533  1.00 0.00 ? 1230 THR A CB   2  
ATOM 3197  O OG1  . THR A 1 98  ? 0.738   8.606   -9.459  1.00 0.00 ? 1230 THR A OG1  2  
ATOM 3198  C CG2  . THR A 1 98  ? 1.319   8.485   -7.118  1.00 0.00 ? 1230 THR A CG2  2  
ATOM 3199  H H    . THR A 1 98  ? 2.850   10.423  -9.837  1.00 0.00 ? 1230 THR A H    2  
ATOM 3200  H HA   . THR A 1 98  ? 3.777   8.250   -8.100  1.00 0.00 ? 1230 THR A HA   2  
ATOM 3201  H HB   . THR A 1 98  ? 1.664   6.988   -8.592  1.00 0.00 ? 1230 THR A HB   2  
ATOM 3202  H HG1  . THR A 1 98  ? 0.905   9.544   -9.578  1.00 0.00 ? 1230 THR A HG1  2  
ATOM 3203  H HG21 . THR A 1 98  ? 0.251   8.399   -6.985  1.00 0.00 ? 1230 THR A HG21 2  
ATOM 3204  H HG22 . THR A 1 98  ? 1.621   9.508   -6.955  1.00 0.00 ? 1230 THR A HG22 2  
ATOM 3205  H HG23 . THR A 1 98  ? 1.822   7.843   -6.411  1.00 0.00 ? 1230 THR A HG23 2  
ATOM 3206  N N    . ASP A 1 99  ? 3.442   6.548   -10.225 1.00 0.00 ? 1231 ASP A N    2  
ATOM 3207  C CA   . ASP A 1 99  ? 3.827   5.783   -11.406 1.00 0.00 ? 1231 ASP A CA   2  
ATOM 3208  C C    . ASP A 1 99  ? 5.199   6.217   -11.911 1.00 0.00 ? 1231 ASP A C    2  
ATOM 3209  O O    . ASP A 1 99  ? 5.378   6.486   -13.100 1.00 0.00 ? 1231 ASP A O    2  
ATOM 3210  C CB   . ASP A 1 99  ? 2.784   5.953   -12.512 1.00 0.00 ? 1231 ASP A CB   2  
ATOM 3211  C CG   . ASP A 1 99  ? 2.716   7.377   -13.029 1.00 0.00 ? 1231 ASP A CG   2  
ATOM 3212  O OD1  . ASP A 1 99  ? 1.958   8.183   -12.450 1.00 0.00 ? 1231 ASP A OD1  2  
ATOM 3213  O OD2  . ASP A 1 99  ? 3.421   7.685   -14.013 1.00 0.00 ? 1231 ASP A OD2  2  
ATOM 3214  H H    . ASP A 1 99  ? 3.098   6.074   -9.439  1.00 0.00 ? 1231 ASP A H    2  
ATOM 3215  H HA   . ASP A 1 99  ? 3.873   4.742   -11.125 1.00 0.00 ? 1231 ASP A HA   2  
ATOM 3216  H HB2  . ASP A 1 99  ? 3.034   5.302   -13.337 1.00 0.00 ? 1231 ASP A HB2  2  
ATOM 3217  H HB3  . ASP A 1 99  ? 1.812   5.682   -12.126 1.00 0.00 ? 1231 ASP A HB3  2  
ATOM 3218  N N    . LEU A 1 100 ? 6.164   6.286   -11.002 1.00 0.00 ? 1232 LEU A N    2  
ATOM 3219  C CA   . LEU A 1 100 ? 7.521   6.689   -11.355 1.00 0.00 ? 1232 LEU A CA   2  
ATOM 3220  C C    . LEU A 1 100 ? 8.298   5.520   -11.953 1.00 0.00 ? 1232 LEU A C    2  
ATOM 3221  O O    . LEU A 1 100 ? 9.437   5.257   -11.568 1.00 0.00 ? 1232 LEU A O    2  
ATOM 3222  C CB   . LEU A 1 100 ? 8.252   7.225   -10.123 1.00 0.00 ? 1232 LEU A CB   2  
ATOM 3223  C CG   . LEU A 1 100 ? 7.505   8.280   -9.305  1.00 0.00 ? 1232 LEU A CG   2  
ATOM 3224  C CD1  . LEU A 1 100 ? 8.085   8.377   -7.902  1.00 0.00 ? 1232 LEU A CD1  2  
ATOM 3225  C CD2  . LEU A 1 100 ? 7.560   9.631   -10.002 1.00 0.00 ? 1232 LEU A CD2  2  
ATOM 3226  H H    . LEU A 1 100 ? 5.961   6.060   -10.070 1.00 0.00 ? 1232 LEU A H    2  
ATOM 3227  H HA   . LEU A 1 100 ? 7.452   7.475   -12.092 1.00 0.00 ? 1232 LEU A HA   2  
ATOM 3228  H HB2  . LEU A 1 100 ? 8.460   6.389   -9.473  1.00 0.00 ? 1232 LEU A HB2  2  
ATOM 3229  H HB3  . LEU A 1 100 ? 9.183   7.661   -10.456 1.00 0.00 ? 1232 LEU A HB3  2  
ATOM 3230  H HG   . LEU A 1 100 ? 6.467   7.989   -9.217  1.00 0.00 ? 1232 LEU A HG   2  
ATOM 3231  H HD11 . LEU A 1 100 ? 8.849   7.625   -7.776  1.00 0.00 ? 1232 LEU A HD11 2  
ATOM 3232  H HD12 . LEU A 1 100 ? 7.300   8.219   -7.177  1.00 0.00 ? 1232 LEU A HD12 2  
ATOM 3233  H HD13 . LEU A 1 100 ? 8.516   9.357   -7.758  1.00 0.00 ? 1232 LEU A HD13 2  
ATOM 3234  H HD21 . LEU A 1 100 ? 6.659   9.775   -10.579 1.00 0.00 ? 1232 LEU A HD21 2  
ATOM 3235  H HD22 . LEU A 1 100 ? 8.417   9.663   -10.659 1.00 0.00 ? 1232 LEU A HD22 2  
ATOM 3236  H HD23 . LEU A 1 100 ? 7.643   10.414  -9.262  1.00 0.00 ? 1232 LEU A HD23 2  
ATOM 3237  N N    . PHE A 1 101 ? 7.675   4.824   -12.898 1.00 0.00 ? 1233 PHE A N    2  
ATOM 3238  C CA   . PHE A 1 101 ? 8.308   3.684   -13.551 1.00 0.00 ? 1233 PHE A CA   2  
ATOM 3239  C C    . PHE A 1 101 ? 8.828   4.069   -14.933 1.00 0.00 ? 1233 PHE A C    2  
ATOM 3240  O O    . PHE A 1 101 ? 8.643   5.199   -15.385 1.00 0.00 ? 1233 PHE A O    2  
ATOM 3241  C CB   . PHE A 1 101 ? 7.319   2.523   -13.670 1.00 0.00 ? 1233 PHE A CB   2  
ATOM 3242  C CG   . PHE A 1 101 ? 6.898   1.957   -12.344 1.00 0.00 ? 1233 PHE A CG   2  
ATOM 3243  C CD1  . PHE A 1 101 ? 5.914   2.578   -11.592 1.00 0.00 ? 1233 PHE A CD1  2  
ATOM 3244  C CD2  . PHE A 1 101 ? 7.485   0.803   -11.851 1.00 0.00 ? 1233 PHE A CD2  2  
ATOM 3245  C CE1  . PHE A 1 101 ? 5.525   2.059   -10.371 1.00 0.00 ? 1233 PHE A CE1  2  
ATOM 3246  C CE2  . PHE A 1 101 ? 7.100   0.279   -10.631 1.00 0.00 ? 1233 PHE A CE2  2  
ATOM 3247  C CZ   . PHE A 1 101 ? 6.117   0.907   -9.891  1.00 0.00 ? 1233 PHE A CZ   2  
ATOM 3248  H H    . PHE A 1 101 ? 6.767   5.083   -13.162 1.00 0.00 ? 1233 PHE A H    2  
ATOM 3249  H HA   . PHE A 1 101 ? 9.142   3.375   -12.940 1.00 0.00 ? 1233 PHE A HA   2  
ATOM 3250  H HB2  . PHE A 1 101 ? 6.432   2.866   -14.180 1.00 0.00 ? 1233 PHE A HB2  2  
ATOM 3251  H HB3  . PHE A 1 101 ? 7.774   1.729   -14.242 1.00 0.00 ? 1233 PHE A HB3  2  
ATOM 3252  H HD1  . PHE A 1 101 ? 5.448   3.477   -11.966 1.00 0.00 ? 1233 PHE A HD1  2  
ATOM 3253  H HD2  . PHE A 1 101 ? 8.254   0.310   -12.429 1.00 0.00 ? 1233 PHE A HD2  2  
ATOM 3254  H HE1  . PHE A 1 101 ? 4.756   2.552   -9.794  1.00 0.00 ? 1233 PHE A HE1  2  
ATOM 3255  H HE2  . PHE A 1 101 ? 7.565   -0.622  -10.259 1.00 0.00 ? 1233 PHE A HE2  2  
ATOM 3256  H HZ   . PHE A 1 101 ? 5.815   0.500   -8.937  1.00 0.00 ? 1233 PHE A HZ   2  
ATOM 3257  N N    . SER A 1 102 ? 9.478   3.120   -15.599 1.00 0.00 ? 1234 SER A N    2  
ATOM 3258  C CA   . SER A 1 102 ? 10.028  3.359   -16.928 1.00 0.00 ? 1234 SER A CA   2  
ATOM 3259  C C    . SER A 1 102 ? 9.022   4.094   -17.809 1.00 0.00 ? 1234 SER A C    2  
ATOM 3260  O O    . SER A 1 102 ? 9.375   5.030   -18.526 1.00 0.00 ? 1234 SER A O    2  
ATOM 3261  C CB   . SER A 1 102 ? 10.426  2.036   -17.584 1.00 0.00 ? 1234 SER A CB   2  
ATOM 3262  O OG   . SER A 1 102 ? 11.740  1.656   -17.211 1.00 0.00 ? 1234 SER A OG   2  
ATOM 3263  H H    . SER A 1 102 ? 9.593   2.239   -15.185 1.00 0.00 ? 1234 SER A H    2  
ATOM 3264  H HA   . SER A 1 102 ? 10.908  3.975   -16.817 1.00 0.00 ? 1234 SER A HA   2  
ATOM 3265  H HB2  . SER A 1 102 ? 9.740   1.263   -17.275 1.00 0.00 ? 1234 SER A HB2  2  
ATOM 3266  H HB3  . SER A 1 102 ? 10.387  2.144   -18.659 1.00 0.00 ? 1234 SER A HB3  2  
ATOM 3267  H HG   . SER A 1 102 ? 11.746  0.730   -16.959 1.00 0.00 ? 1234 SER A HG   2  
ATOM 3268  N N    . SER A 1 103 ? 7.766   3.662   -17.748 1.00 0.00 ? 1235 SER A N    2  
ATOM 3269  C CA   . SER A 1 103 ? 6.708   4.275   -18.542 1.00 0.00 ? 1235 SER A CA   2  
ATOM 3270  C C    . SER A 1 103 ? 6.898   3.974   -20.026 1.00 0.00 ? 1235 SER A C    2  
ATOM 3271  O O    . SER A 1 103 ? 6.679   4.833   -20.880 1.00 0.00 ? 1235 SER A O    2  
ATOM 3272  C CB   . SER A 1 103 ? 6.684   5.788   -18.317 1.00 0.00 ? 1235 SER A CB   2  
ATOM 3273  O OG   . SER A 1 103 ? 5.516   6.368   -18.872 1.00 0.00 ? 1235 SER A OG   2  
ATOM 3274  H H    . SER A 1 103 ? 7.547   2.911   -17.157 1.00 0.00 ? 1235 SER A H    2  
ATOM 3275  H HA   . SER A 1 103 ? 5.767   3.857   -18.220 1.00 0.00 ? 1235 SER A HA   2  
ATOM 3276  H HB2  . SER A 1 103 ? 6.703   5.992   -17.257 1.00 0.00 ? 1235 SER A HB2  2  
ATOM 3277  H HB3  . SER A 1 103 ? 7.550   6.233   -18.785 1.00 0.00 ? 1235 SER A HB3  2  
ATOM 3278  H HG   . SER A 1 103 ? 4.925   5.673   -19.172 1.00 0.00 ? 1235 SER A HG   2  
ATOM 3279  N N    . THR A 1 104 ? 7.307   2.745   -20.326 1.00 0.00 ? 1236 THR A N    2  
ATOM 3280  C CA   . THR A 1 104 ? 7.528   2.328   -21.705 1.00 0.00 ? 1236 THR A CA   2  
ATOM 3281  C C    . THR A 1 104 ? 6.211   2.006   -22.400 1.00 0.00 ? 1236 THR A C    2  
ATOM 3282  O O    . THR A 1 104 ? 5.252   1.566   -21.764 1.00 0.00 ? 1236 THR A O    2  
ATOM 3283  C CB   . THR A 1 104 ? 8.449   1.096   -21.779 1.00 0.00 ? 1236 THR A CB   2  
ATOM 3284  O OG1  . THR A 1 104 ? 8.739   0.782   -23.145 1.00 0.00 ? 1236 THR A OG1  2  
ATOM 3285  C CG2  . THR A 1 104 ? 7.802   -0.104  -21.104 1.00 0.00 ? 1236 THR A CG2  2  
ATOM 3286  H H    . THR A 1 104 ? 7.465   2.104   -19.601 1.00 0.00 ? 1236 THR A H    2  
ATOM 3287  H HA   . THR A 1 104 ? 8.010   3.143   -22.226 1.00 0.00 ? 1236 THR A HA   2  
ATOM 3288  H HB   . THR A 1 104 ? 9.373   1.324   -21.266 1.00 0.00 ? 1236 THR A HB   2  
ATOM 3289  H HG1  . THR A 1 104 ? 7.918   0.642   -23.623 1.00 0.00 ? 1236 THR A HG1  2  
ATOM 3290  H HG21 . THR A 1 104 ? 8.482   -0.943  -21.131 1.00 0.00 ? 1236 THR A HG21 2  
ATOM 3291  H HG22 . THR A 1 104 ? 6.891   -0.362  -21.623 1.00 0.00 ? 1236 THR A HG22 2  
ATOM 3292  H HG23 . THR A 1 104 ? 7.574   0.140   -20.077 1.00 0.00 ? 1236 THR A HG23 2  
ATOM 3293  N N    . LYS A 1 105 ? 6.168   2.227   -23.710 1.00 0.00 ? 1237 LYS A N    2  
ATOM 3294  C CA   . LYS A 1 105 ? 4.968   1.959   -24.493 1.00 0.00 ? 1237 LYS A CA   2  
ATOM 3295  C C    . LYS A 1 105 ? 4.481   0.531   -24.270 1.00 0.00 ? 1237 LYS A C    2  
ATOM 3296  O O    . LYS A 1 105 ? 5.261   -0.380  -23.992 1.00 0.00 ? 1237 LYS A O    2  
ATOM 3297  C CB   . LYS A 1 105 ? 5.243   2.189   -25.981 1.00 0.00 ? 1237 LYS A CB   2  
ATOM 3298  C CG   . LYS A 1 105 ? 6.086   1.099   -26.619 1.00 0.00 ? 1237 LYS A CG   2  
ATOM 3299  C CD   . LYS A 1 105 ? 7.570   1.411   -26.521 1.00 0.00 ? 1237 LYS A CD   2  
ATOM 3300  C CE   . LYS A 1 105 ? 8.404   0.404   -27.297 1.00 0.00 ? 1237 LYS A CE   2  
ATOM 3301  N NZ   . LYS A 1 105 ? 8.248   0.570   -28.768 1.00 0.00 ? 1237 LYS A NZ   2  
ATOM 3302  H H    . LYS A 1 105 ? 6.965   2.579   -24.161 1.00 0.00 ? 1237 LYS A H    2  
ATOM 3303  H HA   . LYS A 1 105 ? 4.200   2.644   -24.168 1.00 0.00 ? 1237 LYS A HA   2  
ATOM 3304  H HB2  . LYS A 1 105 ? 4.301   2.240   -26.505 1.00 0.00 ? 1237 LYS A HB2  2  
ATOM 3305  H HB3  . LYS A 1 105 ? 5.762   3.130   -26.097 1.00 0.00 ? 1237 LYS A HB3  2  
ATOM 3306  H HG2  . LYS A 1 105 ? 5.892   0.164   -26.114 1.00 0.00 ? 1237 LYS A HG2  2  
ATOM 3307  H HG3  . LYS A 1 105 ? 5.814   1.010   -27.661 1.00 0.00 ? 1237 LYS A HG3  2  
ATOM 3308  H HD2  . LYS A 1 105 ? 7.749   2.397   -26.926 1.00 0.00 ? 1237 LYS A HD2  2  
ATOM 3309  H HD3  . LYS A 1 105 ? 7.866   1.388   -25.482 1.00 0.00 ? 1237 LYS A HD3  2  
ATOM 3310  H HE2  . LYS A 1 105 ? 9.443   0.539   -27.036 1.00 0.00 ? 1237 LYS A HE2  2  
ATOM 3311  H HE3  . LYS A 1 105 ? 8.091   -0.592  -27.020 1.00 0.00 ? 1237 LYS A HE3  2  
ATOM 3312  H HZ1  . LYS A 1 105 ? 7.798   -0.274  -29.177 1.00 0.00 ? 1237 LYS A HZ1  2  
ATOM 3313  H HZ2  . LYS A 1 105 ? 9.178   0.702   -29.214 1.00 0.00 ? 1237 LYS A HZ2  2  
ATOM 3314  H HZ3  . LYS A 1 105 ? 7.656   1.399   -28.974 1.00 0.00 ? 1237 LYS A HZ3  2  
ATOM 3315  N N    . PRO A 1 106 ? 3.161   0.328   -24.396 1.00 0.00 ? 1238 PRO A N    2  
ATOM 3316  C CA   . PRO A 1 106 ? 2.541   -0.988  -24.215 1.00 0.00 ? 1238 PRO A CA   2  
ATOM 3317  C C    . PRO A 1 106 ? 2.897   -1.956  -25.338 1.00 0.00 ? 1238 PRO A C    2  
ATOM 3318  O O    . PRO A 1 106 ? 2.690   -1.658  -26.514 1.00 0.00 ? 1238 PRO A O    2  
ATOM 3319  C CB   . PRO A 1 106 ? 1.042   -0.679  -24.229 1.00 0.00 ? 1238 PRO A CB   2  
ATOM 3320  C CG   . PRO A 1 106 ? 0.923   0.582   -25.013 1.00 0.00 ? 1238 PRO A CG   2  
ATOM 3321  C CD   . PRO A 1 106 ? 2.172   1.368   -24.727 1.00 0.00 ? 1238 PRO A CD   2  
ATOM 3322  H HA   . PRO A 1 106 ? 2.811   -1.426  -23.265 1.00 0.00 ? 1238 PRO A HA   2  
ATOM 3323  H HB2  . PRO A 1 106 ? 0.509   -1.491  -24.703 1.00 0.00 ? 1238 PRO A HB2  2  
ATOM 3324  H HB3  . PRO A 1 106 ? 0.688   -0.549  -23.218 1.00 0.00 ? 1238 PRO A HB3  2  
ATOM 3325  H HG2  . PRO A 1 106 ? 0.856   0.355   -26.066 1.00 0.00 ? 1238 PRO A HG2  2  
ATOM 3326  H HG3  . PRO A 1 106 ? 0.052   1.133   -24.691 1.00 0.00 ? 1238 PRO A HG3  2  
ATOM 3327  H HD2  . PRO A 1 106 ? 2.476   1.926   -25.600 1.00 0.00 ? 1238 PRO A HD2  2  
ATOM 3328  H HD3  . PRO A 1 106 ? 2.017   2.031   -23.888 1.00 0.00 ? 1238 PRO A HD3  2  
ATOM 3329  N N    . GLN A 1 107 ? 3.431   -3.115  -24.968 1.00 0.00 ? 1239 GLN A N    2  
ATOM 3330  C CA   . GLN A 1 107 ? 3.814   -4.126  -25.946 1.00 0.00 ? 1239 GLN A CA   2  
ATOM 3331  C C    . GLN A 1 107 ? 2.613   -4.560  -26.779 1.00 0.00 ? 1239 GLN A C    2  
ATOM 3332  O O    . GLN A 1 107 ? 1.834   -5.418  -26.364 1.00 0.00 ? 1239 GLN A O    2  
ATOM 3333  C CB   . GLN A 1 107 ? 4.428   -5.339  -25.243 1.00 0.00 ? 1239 GLN A CB   2  
ATOM 3334  C CG   . GLN A 1 107 ? 5.738   -5.033  -24.535 1.00 0.00 ? 1239 GLN A CG   2  
ATOM 3335  C CD   . GLN A 1 107 ? 6.279   -6.224  -23.769 1.00 0.00 ? 1239 GLN A CD   2  
ATOM 3336  O OE1  . GLN A 1 107 ? 6.297   -6.229  -22.538 1.00 0.00 ? 1239 GLN A OE1  2  
ATOM 3337  N NE2  . GLN A 1 107 ? 6.723   -7.243  -24.495 1.00 0.00 ? 1239 GLN A NE2  2  
ATOM 3338  H H    . GLN A 1 107 ? 3.571   -3.294  -24.015 1.00 0.00 ? 1239 GLN A H    2  
ATOM 3339  H HA   . GLN A 1 107 ? 4.553   -3.690  -26.601 1.00 0.00 ? 1239 GLN A HA   2  
ATOM 3340  H HB2  . GLN A 1 107 ? 3.726   -5.709  -24.512 1.00 0.00 ? 1239 GLN A HB2  2  
ATOM 3341  H HB3  . GLN A 1 107 ? 4.612   -6.110  -25.977 1.00 0.00 ? 1239 GLN A HB3  2  
ATOM 3342  H HG2  . GLN A 1 107 ? 6.470   -4.736  -25.272 1.00 0.00 ? 1239 GLN A HG2  2  
ATOM 3343  H HG3  . GLN A 1 107 ? 5.576   -4.221  -23.842 1.00 0.00 ? 1239 GLN A HG3  2  
ATOM 3344  H HE21 . GLN A 1 107 ? 6.679   -7.169  -25.472 1.00 0.00 ? 1239 GLN A HE21 2  
ATOM 3345  H HE22 . GLN A 1 107 ? 7.079   -8.025  -24.026 1.00 0.00 ? 1239 GLN A HE22 2  
ATOM 3346  N N    . SER A 1 108 ? 2.470   -3.963  -27.958 1.00 0.00 ? 1240 SER A N    2  
ATOM 3347  C CA   . SER A 1 108 ? 1.361   -4.285  -28.849 1.00 0.00 ? 1240 SER A CA   2  
ATOM 3348  C C    . SER A 1 108 ? 1.229   -5.794  -29.028 1.00 0.00 ? 1240 SER A C    2  
ATOM 3349  O O    . SER A 1 108 ? 2.212   -6.489  -29.283 1.00 0.00 ? 1240 SER A O    2  
ATOM 3350  C CB   . SER A 1 108 ? 1.561   -3.614  -30.209 1.00 0.00 ? 1240 SER A CB   2  
ATOM 3351  O OG   . SER A 1 108 ? 2.782   -4.018  -30.803 1.00 0.00 ? 1240 SER A OG   2  
ATOM 3352  H H    . SER A 1 108 ? 3.125   -3.287  -28.234 1.00 0.00 ? 1240 SER A H    2  
ATOM 3353  H HA   . SER A 1 108 ? 0.455   -3.907  -28.400 1.00 0.00 ? 1240 SER A HA   2  
ATOM 3354  H HB2  . SER A 1 108 ? 0.748   -3.887  -30.865 1.00 0.00 ? 1240 SER A HB2  2  
ATOM 3355  H HB3  . SER A 1 108 ? 1.574   -2.541  -30.080 1.00 0.00 ? 1240 SER A HB3  2  
ATOM 3356  H HG   . SER A 1 108 ? 2.829   -4.977  -30.819 1.00 0.00 ? 1240 SER A HG   2  
ATOM 3357  N N    . GLY A 1 109 ? 0.005   -6.295  -28.891 1.00 0.00 ? 1241 GLY A N    2  
ATOM 3358  C CA   . GLY A 1 109 ? -0.235  -7.719  -29.041 1.00 0.00 ? 1241 GLY A CA   2  
ATOM 3359  C C    . GLY A 1 109 ? -1.685  -8.033  -29.351 1.00 0.00 ? 1241 GLY A C    2  
ATOM 3360  O O    . GLY A 1 109 ? -2.475  -8.360  -28.466 1.00 0.00 ? 1241 GLY A O    2  
ATOM 3361  H H    . GLY A 1 109 ? -0.741  -5.693  -28.687 1.00 0.00 ? 1241 GLY A H    2  
ATOM 3362  H HA2  . GLY A 1 109 ? 0.384   -8.095  -29.842 1.00 0.00 ? 1241 GLY A HA2  2  
ATOM 3363  H HA3  . GLY A 1 109 ? 0.040   -8.217  -28.122 1.00 0.00 ? 1241 GLY A HA3  2  
ATOM 3364  N N    . PRO A 1 110 ? -2.053  -7.932  -30.637 1.00 0.00 ? 1242 PRO A N    2  
ATOM 3365  C CA   . PRO A 1 110 ? -3.420  -8.203  -31.092 1.00 0.00 ? 1242 PRO A CA   2  
ATOM 3366  C C    . PRO A 1 110 ? -3.779  -9.682  -31.003 1.00 0.00 ? 1242 PRO A C    2  
ATOM 3367  O O    . PRO A 1 110 ? -2.941  -10.513 -30.652 1.00 0.00 ? 1242 PRO A O    2  
ATOM 3368  C CB   . PRO A 1 110 ? -3.406  -7.743  -32.552 1.00 0.00 ? 1242 PRO A CB   2  
ATOM 3369  C CG   . PRO A 1 110 ? -1.981  -7.855  -32.970 1.00 0.00 ? 1242 PRO A CG   2  
ATOM 3370  C CD   . PRO A 1 110 ? -1.164  -7.547  -31.746 1.00 0.00 ? 1242 PRO A CD   2  
ATOM 3371  H HA   . PRO A 1 110 ? -4.145  -7.624  -30.537 1.00 0.00 ? 1242 PRO A HA   2  
ATOM 3372  H HB2  . PRO A 1 110 ? -4.044  -8.387  -33.141 1.00 0.00 ? 1242 PRO A HB2  2  
ATOM 3373  H HB3  . PRO A 1 110 ? -3.757  -6.724  -32.615 1.00 0.00 ? 1242 PRO A HB3  2  
ATOM 3374  H HG2  . PRO A 1 110 ? -1.777  -8.857  -33.315 1.00 0.00 ? 1242 PRO A HG2  2  
ATOM 3375  H HG3  . PRO A 1 110 ? -1.770  -7.138  -33.751 1.00 0.00 ? 1242 PRO A HG3  2  
ATOM 3376  H HD2  . PRO A 1 110 ? -0.260  -8.136  -31.737 1.00 0.00 ? 1242 PRO A HD2  2  
ATOM 3377  H HD3  . PRO A 1 110 ? -0.931  -6.493  -31.703 1.00 0.00 ? 1242 PRO A HD3  2  
ATOM 3378  N N    . SER A 1 111 ? -5.028  -10.005 -31.324 1.00 0.00 ? 1243 SER A N    2  
ATOM 3379  C CA   . SER A 1 111 ? -5.497  -11.384 -31.278 1.00 0.00 ? 1243 SER A CA   2  
ATOM 3380  C C    . SER A 1 111 ? -5.414  -12.033 -32.656 1.00 0.00 ? 1243 SER A C    2  
ATOM 3381  O O    . SER A 1 111 ? -5.945  -11.509 -33.634 1.00 0.00 ? 1243 SER A O    2  
ATOM 3382  C CB   . SER A 1 111 ? -6.937  -11.438 -30.762 1.00 0.00 ? 1243 SER A CB   2  
ATOM 3383  O OG   . SER A 1 111 ? -7.198  -12.668 -30.108 1.00 0.00 ? 1243 SER A OG   2  
ATOM 3384  H H    . SER A 1 111 ? -5.648  -9.297  -31.597 1.00 0.00 ? 1243 SER A H    2  
ATOM 3385  H HA   . SER A 1 111 ? -4.859  -11.929 -30.597 1.00 0.00 ? 1243 SER A HA   2  
ATOM 3386  H HB2  . SER A 1 111 ? -7.096  -10.631 -30.063 1.00 0.00 ? 1243 SER A HB2  2  
ATOM 3387  H HB3  . SER A 1 111 ? -7.618  -11.334 -31.594 1.00 0.00 ? 1243 SER A HB3  2  
ATOM 3388  H HG   . SER A 1 111 ? -8.010  -13.047 -30.452 1.00 0.00 ? 1243 SER A HG   2  
ATOM 3389  N N    . SER A 1 112 ? -4.743  -13.179 -32.724 1.00 0.00 ? 1244 SER A N    2  
ATOM 3390  C CA   . SER A 1 112 ? -4.586  -13.899 -33.982 1.00 0.00 ? 1244 SER A CA   2  
ATOM 3391  C C    . SER A 1 112 ? -5.557  -15.074 -34.060 1.00 0.00 ? 1244 SER A C    2  
ATOM 3392  O O    . SER A 1 112 ? -6.350  -15.177 -34.995 1.00 0.00 ? 1244 SER A O    2  
ATOM 3393  C CB   . SER A 1 112 ? -3.149  -14.400 -34.131 1.00 0.00 ? 1244 SER A CB   2  
ATOM 3394  O OG   . SER A 1 112 ? -2.264  -13.332 -34.424 1.00 0.00 ? 1244 SER A OG   2  
ATOM 3395  H H    . SER A 1 112 ? -4.342  -13.547 -31.908 1.00 0.00 ? 1244 SER A H    2  
ATOM 3396  H HA   . SER A 1 112 ? -4.805  -13.213 -34.786 1.00 0.00 ? 1244 SER A HA   2  
ATOM 3397  H HB2  . SER A 1 112 ? -2.836  -14.869 -33.211 1.00 0.00 ? 1244 SER A HB2  2  
ATOM 3398  H HB3  . SER A 1 112 ? -3.103  -15.120 -34.935 1.00 0.00 ? 1244 SER A HB3  2  
ATOM 3399  H HG   . SER A 1 112 ? -1.940  -12.951 -33.604 1.00 0.00 ? 1244 SER A HG   2  
ATOM 3400  N N    . GLY A 1 113 ? -5.487  -15.959 -33.070 1.00 0.00 ? 1245 GLY A N    2  
ATOM 3401  C CA   . GLY A 1 113 ? -6.363  -17.115 -33.045 1.00 0.00 ? 1245 GLY A CA   2  
ATOM 3402  C C    . GLY A 1 113 ? -6.009  -18.135 -34.109 1.00 0.00 ? 1245 GLY A C    2  
ATOM 3403  O O    . GLY A 1 113 ? -5.722  -19.291 -33.798 1.00 0.00 ? 1245 GLY A O    2  
ATOM 3404  H H    . GLY A 1 113 ? -4.834  -15.825 -32.351 1.00 0.00 ? 1245 GLY A H    2  
ATOM 3405  H HA2  . GLY A 1 113 ? -6.295  -17.583 -32.074 1.00 0.00 ? 1245 GLY A HA2  2  
ATOM 3406  H HA3  . GLY A 1 113 ? -7.380  -16.785 -33.203 1.00 0.00 ? 1245 GLY A HA3  2  
ATOM 3407  N N    . GLY A 1 1   ? 11.995  15.733  -9.456  1.00 0.00 ? 1133 GLY A N    3  
ATOM 3408  C CA   . GLY A 1 1   ? 13.064  14.958  -8.855  1.00 0.00 ? 1133 GLY A CA   3  
ATOM 3409  C C    . GLY A 1 1   ? 12.954  13.479  -9.167  1.00 0.00 ? 1133 GLY A C    3  
ATOM 3410  O O    . GLY A 1 1   ? 11.873  12.897  -9.077  1.00 0.00 ? 1133 GLY A O    3  
ATOM 3411  H H1   . GLY A 1 1   ? 11.360  15.300  -10.065 1.00 0.00 ? 1133 GLY A H1   3  
ATOM 3412  H HA2  . GLY A 1 1   ? 14.011  15.324  -9.224  1.00 0.00 ? 1133 GLY A HA2  3  
ATOM 3413  H HA3  . GLY A 1 1   ? 13.031  15.091  -7.784  1.00 0.00 ? 1133 GLY A HA3  3  
ATOM 3414  N N    . SER A 1 2   ? 14.076  12.868  -9.537  1.00 0.00 ? 1134 SER A N    3  
ATOM 3415  C CA   . SER A 1 2   ? 14.099  11.449  -9.869  1.00 0.00 ? 1134 SER A CA   3  
ATOM 3416  C C    . SER A 1 2   ? 15.515  10.890  -9.764  1.00 0.00 ? 1134 SER A C    3  
ATOM 3417  O O    . SER A 1 2   ? 16.465  11.473  -10.286 1.00 0.00 ? 1134 SER A O    3  
ATOM 3418  C CB   . SER A 1 2   ? 13.553  11.224  -11.280 1.00 0.00 ? 1134 SER A CB   3  
ATOM 3419  O OG   . SER A 1 2   ? 12.283  11.831  -11.438 1.00 0.00 ? 1134 SER A OG   3  
ATOM 3420  H H    . SER A 1 2   ? 14.906  13.386  -9.590  1.00 0.00 ? 1134 SER A H    3  
ATOM 3421  H HA   . SER A 1 2   ? 13.468  10.932  -9.161  1.00 0.00 ? 1134 SER A HA   3  
ATOM 3422  H HB2  . SER A 1 2   ? 14.235  11.652  -11.999 1.00 0.00 ? 1134 SER A HB2  3  
ATOM 3423  H HB3  . SER A 1 2   ? 13.458  10.163  -11.462 1.00 0.00 ? 1134 SER A HB3  3  
ATOM 3424  H HG   . SER A 1 2   ? 11.986  11.722  -12.344 1.00 0.00 ? 1134 SER A HG   3  
ATOM 3425  N N    . SER A 1 3   ? 15.648  9.755   -9.085  1.00 0.00 ? 1135 SER A N    3  
ATOM 3426  C CA   . SER A 1 3   ? 16.948  9.118   -8.908  1.00 0.00 ? 1135 SER A CA   3  
ATOM 3427  C C    . SER A 1 3   ? 17.139  7.985   -9.912  1.00 0.00 ? 1135 SER A C    3  
ATOM 3428  O O    . SER A 1 3   ? 16.181  7.509   -10.518 1.00 0.00 ? 1135 SER A O    3  
ATOM 3429  C CB   . SER A 1 3   ? 17.085  8.580   -7.482  1.00 0.00 ? 1135 SER A CB   3  
ATOM 3430  O OG   . SER A 1 3   ? 17.368  9.624   -6.567  1.00 0.00 ? 1135 SER A OG   3  
ATOM 3431  H H    . SER A 1 3   ? 14.853  9.338   -8.692  1.00 0.00 ? 1135 SER A H    3  
ATOM 3432  H HA   . SER A 1 3   ? 17.709  9.865   -9.076  1.00 0.00 ? 1135 SER A HA   3  
ATOM 3433  H HB2  . SER A 1 3   ? 16.162  8.102   -7.190  1.00 0.00 ? 1135 SER A HB2  3  
ATOM 3434  H HB3  . SER A 1 3   ? 17.890  7.859   -7.448  1.00 0.00 ? 1135 SER A HB3  3  
ATOM 3435  H HG   . SER A 1 3   ? 17.776  9.258   -5.779  1.00 0.00 ? 1135 SER A HG   3  
ATOM 3436  N N    . GLY A 1 4   ? 18.387  7.559   -10.082 1.00 0.00 ? 1136 GLY A N    3  
ATOM 3437  C CA   . GLY A 1 4   ? 18.683  6.486   -11.013 1.00 0.00 ? 1136 GLY A CA   3  
ATOM 3438  C C    . GLY A 1 4   ? 19.377  5.314   -10.347 1.00 0.00 ? 1136 GLY A C    3  
ATOM 3439  O O    . GLY A 1 4   ? 19.054  4.955   -9.214  1.00 0.00 ? 1136 GLY A O    3  
ATOM 3440  H H    . GLY A 1 4   ? 19.112  7.976   -9.571  1.00 0.00 ? 1136 GLY A H    3  
ATOM 3441  H HA2  . GLY A 1 4   ? 17.760  6.141   -11.454 1.00 0.00 ? 1136 GLY A HA2  3  
ATOM 3442  H HA3  . GLY A 1 4   ? 19.322  6.869   -11.795 1.00 0.00 ? 1136 GLY A HA3  3  
ATOM 3443  N N    . SER A 1 5   ? 20.332  4.715   -11.051 1.00 0.00 ? 1137 SER A N    3  
ATOM 3444  C CA   . SER A 1 5   ? 21.069  3.573   -10.522 1.00 0.00 ? 1137 SER A CA   3  
ATOM 3445  C C    . SER A 1 5   ? 22.572  3.772   -10.691 1.00 0.00 ? 1137 SER A C    3  
ATOM 3446  O O    . SER A 1 5   ? 23.026  4.350   -11.678 1.00 0.00 ? 1137 SER A O    3  
ATOM 3447  C CB   . SER A 1 5   ? 20.631  2.287   -11.225 1.00 0.00 ? 1137 SER A CB   3  
ATOM 3448  O OG   . SER A 1 5   ? 19.308  1.933   -10.862 1.00 0.00 ? 1137 SER A OG   3  
ATOM 3449  H H    . SER A 1 5   ? 20.544  5.048   -11.948 1.00 0.00 ? 1137 SER A H    3  
ATOM 3450  H HA   . SER A 1 5   ? 20.845  3.493   -9.469  1.00 0.00 ? 1137 SER A HA   3  
ATOM 3451  H HB2  . SER A 1 5   ? 20.671  2.432   -12.294 1.00 0.00 ? 1137 SER A HB2  3  
ATOM 3452  H HB3  . SER A 1 5   ? 21.296  1.483   -10.945 1.00 0.00 ? 1137 SER A HB3  3  
ATOM 3453  H HG   . SER A 1 5   ? 18.803  1.729   -11.652 1.00 0.00 ? 1137 SER A HG   3  
ATOM 3454  N N    . SER A 1 6   ? 23.340  3.288   -9.719  1.00 0.00 ? 1138 SER A N    3  
ATOM 3455  C CA   . SER A 1 6   ? 24.792  3.415   -9.757  1.00 0.00 ? 1138 SER A CA   3  
ATOM 3456  C C    . SER A 1 6   ? 25.442  2.525   -8.702  1.00 0.00 ? 1138 SER A C    3  
ATOM 3457  O O    . SER A 1 6   ? 24.761  1.942   -7.860  1.00 0.00 ? 1138 SER A O    3  
ATOM 3458  C CB   . SER A 1 6   ? 25.203  4.872   -9.536  1.00 0.00 ? 1138 SER A CB   3  
ATOM 3459  O OG   . SER A 1 6   ? 26.557  5.081   -9.900  1.00 0.00 ? 1138 SER A OG   3  
ATOM 3460  H H    . SER A 1 6   ? 22.918  2.837   -8.958  1.00 0.00 ? 1138 SER A H    3  
ATOM 3461  H HA   . SER A 1 6   ? 25.127  3.100   -10.734 1.00 0.00 ? 1138 SER A HA   3  
ATOM 3462  H HB2  . SER A 1 6   ? 24.579  5.515   -10.137 1.00 0.00 ? 1138 SER A HB2  3  
ATOM 3463  H HB3  . SER A 1 6   ? 25.081  5.123   -8.492  1.00 0.00 ? 1138 SER A HB3  3  
ATOM 3464  H HG   . SER A 1 6   ? 27.127  4.844   -9.164  1.00 0.00 ? 1138 SER A HG   3  
ATOM 3465  N N    . GLY A 1 7   ? 26.767  2.427   -8.756  1.00 0.00 ? 1139 GLY A N    3  
ATOM 3466  C CA   . GLY A 1 7   ? 27.489  1.607   -7.801  1.00 0.00 ? 1139 GLY A CA   3  
ATOM 3467  C C    . GLY A 1 7   ? 28.246  2.434   -6.781  1.00 0.00 ? 1139 GLY A C    3  
ATOM 3468  O O    . GLY A 1 7   ? 29.438  2.219   -6.558  1.00 0.00 ? 1139 GLY A O    3  
ATOM 3469  H H    . GLY A 1 7   ? 27.259  2.915   -9.450  1.00 0.00 ? 1139 GLY A H    3  
ATOM 3470  H HA2  . GLY A 1 7   ? 26.786  0.972   -7.283  1.00 0.00 ? 1139 GLY A HA2  3  
ATOM 3471  H HA3  . GLY A 1 7   ? 28.193  0.985   -8.336  1.00 0.00 ? 1139 GLY A HA3  3  
ATOM 3472  N N    . SER A 1 8   ? 27.554  3.385   -6.162  1.00 0.00 ? 1140 SER A N    3  
ATOM 3473  C CA   . SER A 1 8   ? 28.170  4.252   -5.164  1.00 0.00 ? 1140 SER A CA   3  
ATOM 3474  C C    . SER A 1 8   ? 27.111  4.888   -4.269  1.00 0.00 ? 1140 SER A C    3  
ATOM 3475  O O    . SER A 1 8   ? 26.380  5.784   -4.693  1.00 0.00 ? 1140 SER A O    3  
ATOM 3476  C CB   . SER A 1 8   ? 28.999  5.342   -5.846  1.00 0.00 ? 1140 SER A CB   3  
ATOM 3477  O OG   . SER A 1 8   ? 30.164  4.798   -6.442  1.00 0.00 ? 1140 SER A OG   3  
ATOM 3478  H H    . SER A 1 8   ? 26.607  3.508   -6.383  1.00 0.00 ? 1140 SER A H    3  
ATOM 3479  H HA   . SER A 1 8   ? 28.822  3.644   -4.554  1.00 0.00 ? 1140 SER A HA   3  
ATOM 3480  H HB2  . SER A 1 8   ? 28.405  5.815   -6.613  1.00 0.00 ? 1140 SER A HB2  3  
ATOM 3481  H HB3  . SER A 1 8   ? 29.294  6.078   -5.113  1.00 0.00 ? 1140 SER A HB3  3  
ATOM 3482  H HG   . SER A 1 8   ? 29.962  4.508   -7.335  1.00 0.00 ? 1140 SER A HG   3  
ATOM 3483  N N    . SER A 1 9   ? 27.034  4.419   -3.028  1.00 0.00 ? 1141 SER A N    3  
ATOM 3484  C CA   . SER A 1 9   ? 26.062  4.938   -2.073  1.00 0.00 ? 1141 SER A CA   3  
ATOM 3485  C C    . SER A 1 9   ? 25.896  6.446   -2.233  1.00 0.00 ? 1141 SER A C    3  
ATOM 3486  O O    . SER A 1 9   ? 26.867  7.199   -2.156  1.00 0.00 ? 1141 SER A O    3  
ATOM 3487  C CB   . SER A 1 9   ? 26.495  4.610   -0.643  1.00 0.00 ? 1141 SER A CB   3  
ATOM 3488  O OG   . SER A 1 9   ? 27.589  5.417   -0.244  1.00 0.00 ? 1141 SER A OG   3  
ATOM 3489  H H    . SER A 1 9   ? 27.644  3.704   -2.749  1.00 0.00 ? 1141 SER A H    3  
ATOM 3490  H HA   . SER A 1 9   ? 25.114  4.461   -2.272  1.00 0.00 ? 1141 SER A HA   3  
ATOM 3491  H HB2  . SER A 1 9   ? 25.669  4.786   0.030   1.00 0.00 ? 1141 SER A HB2  3  
ATOM 3492  H HB3  . SER A 1 9   ? 26.789  3.572   -0.588  1.00 0.00 ? 1141 SER A HB3  3  
ATOM 3493  H HG   . SER A 1 9   ? 28.116  4.943   0.404   1.00 0.00 ? 1141 SER A HG   3  
ATOM 3494  N N    . GLN A 1 10  ? 24.659  6.879   -2.455  1.00 0.00 ? 1142 GLN A N    3  
ATOM 3495  C CA   . GLN A 1 10  ? 24.366  8.297   -2.627  1.00 0.00 ? 1142 GLN A CA   3  
ATOM 3496  C C    . GLN A 1 10  ? 24.104  8.965   -1.281  1.00 0.00 ? 1142 GLN A C    3  
ATOM 3497  O O    . GLN A 1 10  ? 23.694  8.326   -0.312  1.00 0.00 ? 1142 GLN A O    3  
ATOM 3498  C CB   . GLN A 1 10  ? 23.156  8.482   -3.545  1.00 0.00 ? 1142 GLN A CB   3  
ATOM 3499  C CG   . GLN A 1 10  ? 23.415  8.062   -4.983  1.00 0.00 ? 1142 GLN A CG   3  
ATOM 3500  C CD   . GLN A 1 10  ? 22.258  8.394   -5.905  1.00 0.00 ? 1142 GLN A CD   3  
ATOM 3501  O OE1  . GLN A 1 10  ? 21.317  7.612   -6.046  1.00 0.00 ? 1142 GLN A OE1  3  
ATOM 3502  N NE2  . GLN A 1 10  ? 22.322  9.559   -6.539  1.00 0.00 ? 1142 GLN A NE2  3  
ATOM 3503  H H    . GLN A 1 10  ? 23.927  6.230   -2.506  1.00 0.00 ? 1142 GLN A H    3  
ATOM 3504  H HA   . GLN A 1 10  ? 25.227  8.761   -3.083  1.00 0.00 ? 1142 GLN A HA   3  
ATOM 3505  H HB2  . GLN A 1 10  ? 22.336  7.894   -3.162  1.00 0.00 ? 1142 GLN A HB2  3  
ATOM 3506  H HB3  . GLN A 1 10  ? 22.874  9.524   -3.543  1.00 0.00 ? 1142 GLN A HB3  3  
ATOM 3507  H HG2  . GLN A 1 10  ? 24.297  8.571   -5.341  1.00 0.00 ? 1142 GLN A HG2  3  
ATOM 3508  H HG3  . GLN A 1 10  ? 23.581  6.995   -5.008  1.00 0.00 ? 1142 GLN A HG3  3  
ATOM 3509  H HE21 . GLN A 1 10  ? 23.102  10.131  -6.379  1.00 0.00 ? 1142 GLN A HE21 3  
ATOM 3510  H HE22 . GLN A 1 10  ? 21.588  9.799   -7.141  1.00 0.00 ? 1142 GLN A HE22 3  
ATOM 3511  N N    . PRO A 1 11  ? 24.346  10.283  -1.217  1.00 0.00 ? 1143 PRO A N    3  
ATOM 3512  C CA   . PRO A 1 11  ? 24.143  11.067  0.005   1.00 0.00 ? 1143 PRO A CA   3  
ATOM 3513  C C    . PRO A 1 11  ? 22.667  11.222  0.356   1.00 0.00 ? 1143 PRO A C    3  
ATOM 3514  O O    . PRO A 1 11  ? 21.791  10.937  -0.461  1.00 0.00 ? 1143 PRO A O    3  
ATOM 3515  C CB   . PRO A 1 11  ? 24.756  12.426  -0.340  1.00 0.00 ? 1143 PRO A CB   3  
ATOM 3516  C CG   . PRO A 1 11  ? 24.671  12.515  -1.825  1.00 0.00 ? 1143 PRO A CG   3  
ATOM 3517  C CD   . PRO A 1 11  ? 24.836  11.109  -2.333  1.00 0.00 ? 1143 PRO A CD   3  
ATOM 3518  H HA   . PRO A 1 11  ? 24.668  10.636  0.845   1.00 0.00 ? 1143 PRO A HA   3  
ATOM 3519  H HB2  . PRO A 1 11  ? 24.187  13.212  0.137   1.00 0.00 ? 1143 PRO A HB2  3  
ATOM 3520  H HB3  . PRO A 1 11  ? 25.781  12.460  -0.001  1.00 0.00 ? 1143 PRO A HB3  3  
ATOM 3521  H HG2  . PRO A 1 11  ? 23.709  12.908  -2.114  1.00 0.00 ? 1143 PRO A HG2  3  
ATOM 3522  H HG3  . PRO A 1 11  ? 25.464  13.144  -2.200  1.00 0.00 ? 1143 PRO A HG3  3  
ATOM 3523  H HD2  . PRO A 1 11  ? 24.237  10.956  -3.219  1.00 0.00 ? 1143 PRO A HD2  3  
ATOM 3524  H HD3  . PRO A 1 11  ? 25.876  10.902  -2.538  1.00 0.00 ? 1143 PRO A HD3  3  
ATOM 3525  N N    . VAL A 1 12  ? 22.399  11.675  1.576   1.00 0.00 ? 1144 VAL A N    3  
ATOM 3526  C CA   . VAL A 1 12  ? 21.028  11.869  2.035   1.00 0.00 ? 1144 VAL A CA   3  
ATOM 3527  C C    . VAL A 1 12  ? 20.160  12.468  0.934   1.00 0.00 ? 1144 VAL A C    3  
ATOM 3528  O O    . VAL A 1 12  ? 20.628  13.274  0.130   1.00 0.00 ? 1144 VAL A O    3  
ATOM 3529  C CB   . VAL A 1 12  ? 20.975  12.786  3.272   1.00 0.00 ? 1144 VAL A CB   3  
ATOM 3530  C CG1  . VAL A 1 12  ? 19.537  12.986  3.726   1.00 0.00 ? 1144 VAL A CG1  3  
ATOM 3531  C CG2  . VAL A 1 12  ? 21.823  12.213  4.396   1.00 0.00 ? 1144 VAL A CG2  3  
ATOM 3532  H H    . VAL A 1 12  ? 23.139  11.884  2.182   1.00 0.00 ? 1144 VAL A H    3  
ATOM 3533  H HA   . VAL A 1 12  ? 20.628  10.904  2.311   1.00 0.00 ? 1144 VAL A HA   3  
ATOM 3534  H HB   . VAL A 1 12  ? 21.380  13.749  2.998   1.00 0.00 ? 1144 VAL A HB   3  
ATOM 3535  H HG11 . VAL A 1 12  ? 19.512  13.097  4.800   1.00 0.00 ? 1144 VAL A HG11 3  
ATOM 3536  H HG12 . VAL A 1 12  ? 19.133  13.874  3.262   1.00 0.00 ? 1144 VAL A HG12 3  
ATOM 3537  H HG13 . VAL A 1 12  ? 18.946  12.129  3.440   1.00 0.00 ? 1144 VAL A HG13 3  
ATOM 3538  H HG21 . VAL A 1 12  ? 22.728  12.793  4.495   1.00 0.00 ? 1144 VAL A HG21 3  
ATOM 3539  H HG22 . VAL A 1 12  ? 21.268  12.251  5.323   1.00 0.00 ? 1144 VAL A HG22 3  
ATOM 3540  H HG23 . VAL A 1 12  ? 22.075  11.187  4.171   1.00 0.00 ? 1144 VAL A HG23 3  
ATOM 3541  N N    . ILE A 1 13  ? 18.893  12.068  0.905   1.00 0.00 ? 1145 ILE A N    3  
ATOM 3542  C CA   . ILE A 1 13  ? 17.958  12.567  -0.096  1.00 0.00 ? 1145 ILE A CA   3  
ATOM 3543  C C    . ILE A 1 13  ? 17.354  13.900  0.331   1.00 0.00 ? 1145 ILE A C    3  
ATOM 3544  O O    . ILE A 1 13  ? 16.991  14.085  1.493   1.00 0.00 ? 1145 ILE A O    3  
ATOM 3545  C CB   . ILE A 1 13  ? 16.822  11.561  -0.356  1.00 0.00 ? 1145 ILE A CB   3  
ATOM 3546  C CG1  . ILE A 1 13  ? 17.397  10.190  -0.717  1.00 0.00 ? 1145 ILE A CG1  3  
ATOM 3547  C CG2  . ILE A 1 13  ? 15.909  12.067  -1.463  1.00 0.00 ? 1145 ILE A CG2  3  
ATOM 3548  C CD1  . ILE A 1 13  ? 16.353  9.098   -0.799  1.00 0.00 ? 1145 ILE A CD1  3  
ATOM 3549  H H    . ILE A 1 13  ? 18.579  11.424  1.573   1.00 0.00 ? 1145 ILE A H    3  
ATOM 3550  H HA   . ILE A 1 13  ? 18.503  12.710  -1.018  1.00 0.00 ? 1145 ILE A HA   3  
ATOM 3551  H HB   . ILE A 1 13  ? 16.237  11.471  0.547   1.00 0.00 ? 1145 ILE A HB   3  
ATOM 3552  H HG12 . ILE A 1 13  ? 17.886  10.253  -1.677  1.00 0.00 ? 1145 ILE A HG12 3  
ATOM 3553  H HG13 . ILE A 1 13  ? 18.121  9.903   0.032   1.00 0.00 ? 1145 ILE A HG13 3  
ATOM 3554  H HG21 . ILE A 1 13  ? 14.950  11.576  -1.391  1.00 0.00 ? 1145 ILE A HG21 3  
ATOM 3555  H HG22 . ILE A 1 13  ? 15.775  13.133  -1.360  1.00 0.00 ? 1145 ILE A HG22 3  
ATOM 3556  H HG23 . ILE A 1 13  ? 16.353  11.850  -2.423  1.00 0.00 ? 1145 ILE A HG23 3  
ATOM 3557  H HD11 . ILE A 1 13  ? 16.032  8.982   -1.823  1.00 0.00 ? 1145 ILE A HD11 3  
ATOM 3558  H HD12 . ILE A 1 13  ? 16.774  8.170   -0.445  1.00 0.00 ? 1145 ILE A HD12 3  
ATOM 3559  H HD13 . ILE A 1 13  ? 15.505  9.366   -0.185  1.00 0.00 ? 1145 ILE A HD13 3  
ATOM 3560  N N    . SER A 1 14  ? 17.248  14.826  -0.616  1.00 0.00 ? 1146 SER A N    3  
ATOM 3561  C CA   . SER A 1 14  ? 16.689  16.144  -0.338  1.00 0.00 ? 1146 SER A CA   3  
ATOM 3562  C C    . SER A 1 14  ? 15.350  16.025  0.384   1.00 0.00 ? 1146 SER A C    3  
ATOM 3563  O O    . SER A 1 14  ? 14.474  15.267  -0.031  1.00 0.00 ? 1146 SER A O    3  
ATOM 3564  C CB   . SER A 1 14  ? 16.512  16.931  -1.638  1.00 0.00 ? 1146 SER A CB   3  
ATOM 3565  O OG   . SER A 1 14  ? 16.550  18.328  -1.397  1.00 0.00 ? 1146 SER A OG   3  
ATOM 3566  H H    . SER A 1 14  ? 17.555  14.619  -1.524  1.00 0.00 ? 1146 SER A H    3  
ATOM 3567  H HA   . SER A 1 14  ? 17.383  16.670  0.300   1.00 0.00 ? 1146 SER A HA   3  
ATOM 3568  H HB2  . SER A 1 14  ? 17.307  16.675  -2.322  1.00 0.00 ? 1146 SER A HB2  3  
ATOM 3569  H HB3  . SER A 1 14  ? 15.560  16.680  -2.081  1.00 0.00 ? 1146 SER A HB3  3  
ATOM 3570  H HG   . SER A 1 14  ? 15.721  18.607  -1.002  1.00 0.00 ? 1146 SER A HG   3  
ATOM 3571  N N    . ALA A 1 15  ? 15.200  16.780  1.468   1.00 0.00 ? 1147 ALA A N    3  
ATOM 3572  C CA   . ALA A 1 15  ? 13.969  16.761  2.247   1.00 0.00 ? 1147 ALA A CA   3  
ATOM 3573  C C    . ALA A 1 15  ? 12.744  16.765  1.338   1.00 0.00 ? 1147 ALA A C    3  
ATOM 3574  O O    . ALA A 1 15  ? 11.805  15.997  1.545   1.00 0.00 ? 1147 ALA A O    3  
ATOM 3575  C CB   . ALA A 1 15  ? 13.928  17.949  3.197   1.00 0.00 ? 1147 ALA A CB   3  
ATOM 3576  H H    . ALA A 1 15  ? 15.935  17.364  1.749   1.00 0.00 ? 1147 ALA A H    3  
ATOM 3577  H HA   . ALA A 1 15  ? 13.962  15.857  2.839   1.00 0.00 ? 1147 ALA A HA   3  
ATOM 3578  H HB1  . ALA A 1 15  ? 14.776  17.904  3.865   1.00 0.00 ? 1147 ALA A HB1  3  
ATOM 3579  H HB2  . ALA A 1 15  ? 13.964  18.866  2.629   1.00 0.00 ? 1147 ALA A HB2  3  
ATOM 3580  H HB3  . ALA A 1 15  ? 13.015  17.917  3.773   1.00 0.00 ? 1147 ALA A HB3  3  
ATOM 3581  N N    . GLN A 1 16  ? 12.761  17.636  0.334   1.00 0.00 ? 1148 GLN A N    3  
ATOM 3582  C CA   . GLN A 1 16  ? 11.650  17.740  -0.605  1.00 0.00 ? 1148 GLN A CA   3  
ATOM 3583  C C    . GLN A 1 16  ? 11.079  16.363  -0.927  1.00 0.00 ? 1148 GLN A C    3  
ATOM 3584  O O    . GLN A 1 16  ? 9.869   16.152  -0.859  1.00 0.00 ? 1148 GLN A O    3  
ATOM 3585  C CB   . GLN A 1 16  ? 12.105  18.431  -1.891  1.00 0.00 ? 1148 GLN A CB   3  
ATOM 3586  C CG   . GLN A 1 16  ? 12.069  19.948  -1.813  1.00 0.00 ? 1148 GLN A CG   3  
ATOM 3587  C CD   . GLN A 1 16  ? 12.971  20.608  -2.838  1.00 0.00 ? 1148 GLN A CD   3  
ATOM 3588  O OE1  . GLN A 1 16  ? 12.798  20.426  -4.043  1.00 0.00 ? 1148 GLN A OE1  3  
ATOM 3589  N NE2  . GLN A 1 16  ? 13.942  21.379  -2.363  1.00 0.00 ? 1148 GLN A NE2  3  
ATOM 3590  H H    . GLN A 1 16  ? 13.538  18.221  0.222   1.00 0.00 ? 1148 GLN A H    3  
ATOM 3591  H HA   . GLN A 1 16  ? 10.879  18.336  -0.141  1.00 0.00 ? 1148 GLN A HA   3  
ATOM 3592  H HB2  . GLN A 1 16  ? 13.118  18.127  -2.110  1.00 0.00 ? 1148 GLN A HB2  3  
ATOM 3593  H HB3  . GLN A 1 16  ? 11.462  18.118  -2.701  1.00 0.00 ? 1148 GLN A HB3  3  
ATOM 3594  H HG2  . GLN A 1 16  ? 11.055  20.281  -1.982  1.00 0.00 ? 1148 GLN A HG2  3  
ATOM 3595  H HG3  . GLN A 1 16  ? 12.386  20.252  -0.826  1.00 0.00 ? 1148 GLN A HG3  3  
ATOM 3596  H HE21 . GLN A 1 16  ? 14.021  21.477  -1.390  1.00 0.00 ? 1148 GLN A HE21 3  
ATOM 3597  H HE22 . GLN A 1 16  ? 14.540  21.817  -3.002  1.00 0.00 ? 1148 GLN A HE22 3  
ATOM 3598  N N    . GLU A 1 17  ? 11.959  15.430  -1.279  1.00 0.00 ? 1149 GLU A N    3  
ATOM 3599  C CA   . GLU A 1 17  ? 11.540  14.074  -1.613  1.00 0.00 ? 1149 GLU A CA   3  
ATOM 3600  C C    . GLU A 1 17  ? 11.605  13.167  -0.387  1.00 0.00 ? 1149 GLU A C    3  
ATOM 3601  O O    . GLU A 1 17  ? 10.644  12.465  -0.072  1.00 0.00 ? 1149 GLU A O    3  
ATOM 3602  C CB   . GLU A 1 17  ? 12.420  13.505  -2.728  1.00 0.00 ? 1149 GLU A CB   3  
ATOM 3603  C CG   . GLU A 1 17  ? 11.847  12.258  -3.380  1.00 0.00 ? 1149 GLU A CG   3  
ATOM 3604  C CD   . GLU A 1 17  ? 12.864  11.526  -4.234  1.00 0.00 ? 1149 GLU A CD   3  
ATOM 3605  O OE1  . GLU A 1 17  ? 13.739  10.845  -3.660  1.00 0.00 ? 1149 GLU A OE1  3  
ATOM 3606  O OE2  . GLU A 1 17  ? 12.785  11.635  -5.476  1.00 0.00 ? 1149 GLU A OE2  3  
ATOM 3607  H H    . GLU A 1 17  ? 12.911  15.660  -1.315  1.00 0.00 ? 1149 GLU A H    3  
ATOM 3608  H HA   . GLU A 1 17  ? 10.519  14.118  -1.960  1.00 0.00 ? 1149 GLU A HA   3  
ATOM 3609  H HB2  . GLU A 1 17  ? 12.546  14.260  -3.491  1.00 0.00 ? 1149 GLU A HB2  3  
ATOM 3610  H HB3  . GLU A 1 17  ? 13.387  13.258  -2.316  1.00 0.00 ? 1149 GLU A HB3  3  
ATOM 3611  H HG2  . GLU A 1 17  ? 11.502  11.589  -2.606  1.00 0.00 ? 1149 GLU A HG2  3  
ATOM 3612  H HG3  . GLU A 1 17  ? 11.013  12.545  -4.004  1.00 0.00 ? 1149 GLU A HG3  3  
ATOM 3613  N N    . GLN A 1 18  ? 12.743  13.189  0.298   1.00 0.00 ? 1150 GLN A N    3  
ATOM 3614  C CA   . GLN A 1 18  ? 12.933  12.368  1.488   1.00 0.00 ? 1150 GLN A CA   3  
ATOM 3615  C C    . GLN A 1 18  ? 11.735  12.481  2.425   1.00 0.00 ? 1150 GLN A C    3  
ATOM 3616  O O    . GLN A 1 18  ? 11.073  11.488  2.724   1.00 0.00 ? 1150 GLN A O    3  
ATOM 3617  C CB   . GLN A 1 18  ? 14.210  12.782  2.221   1.00 0.00 ? 1150 GLN A CB   3  
ATOM 3618  C CG   . GLN A 1 18  ? 14.751  11.712  3.155   1.00 0.00 ? 1150 GLN A CG   3  
ATOM 3619  C CD   . GLN A 1 18  ? 14.721  10.328  2.536   1.00 0.00 ? 1150 GLN A CD   3  
ATOM 3620  O OE1  . GLN A 1 18  ? 15.721  9.857   1.994   1.00 0.00 ? 1150 GLN A OE1  3  
ATOM 3621  N NE2  . GLN A 1 18  ? 13.571  9.669   2.613   1.00 0.00 ? 1150 GLN A NE2  3  
ATOM 3622  H H    . GLN A 1 18  ? 13.472  13.769  -0.004  1.00 0.00 ? 1150 GLN A H    3  
ATOM 3623  H HA   . GLN A 1 18  ? 13.029  11.341  1.170   1.00 0.00 ? 1150 GLN A HA   3  
ATOM 3624  H HB2  . GLN A 1 18  ? 14.972  13.012  1.491   1.00 0.00 ? 1150 GLN A HB2  3  
ATOM 3625  H HB3  . GLN A 1 18  ? 14.004  13.668  2.805   1.00 0.00 ? 1150 GLN A HB3  3  
ATOM 3626  H HG2  . GLN A 1 18  ? 15.772  11.954  3.407   1.00 0.00 ? 1150 GLN A HG2  3  
ATOM 3627  H HG3  . GLN A 1 18  ? 14.152  11.701  4.054   1.00 0.00 ? 1150 GLN A HG3  3  
ATOM 3628  H HE21 . GLN A 1 18  ? 12.815  10.108  3.058   1.00 0.00 ? 1150 GLN A HE21 3  
ATOM 3629  H HE22 . GLN A 1 18  ? 13.523  8.774   2.220   1.00 0.00 ? 1150 GLN A HE22 3  
ATOM 3630  N N    . GLU A 1 19  ? 11.462  13.699  2.884   1.00 0.00 ? 1151 GLU A N    3  
ATOM 3631  C CA   . GLU A 1 19  ? 10.344  13.941  3.788   1.00 0.00 ? 1151 GLU A CA   3  
ATOM 3632  C C    . GLU A 1 19  ? 9.106   13.168  3.342   1.00 0.00 ? 1151 GLU A C    3  
ATOM 3633  O O    . GLU A 1 19  ? 8.591   12.321  4.072   1.00 0.00 ? 1151 GLU A O    3  
ATOM 3634  C CB   . GLU A 1 19  ? 10.028  15.436  3.856   1.00 0.00 ? 1151 GLU A CB   3  
ATOM 3635  C CG   . GLU A 1 19  ? 9.355   15.859  5.150   1.00 0.00 ? 1151 GLU A CG   3  
ATOM 3636  C CD   . GLU A 1 19  ? 8.851   17.288  5.107   1.00 0.00 ? 1151 GLU A CD   3  
ATOM 3637  O OE1  . GLU A 1 19  ? 7.796   17.526  4.482   1.00 0.00 ? 1151 GLU A OE1  3  
ATOM 3638  O OE2  . GLU A 1 19  ? 9.511   18.169  5.696   1.00 0.00 ? 1151 GLU A OE2  3  
ATOM 3639  H H    . GLU A 1 19  ? 12.027  14.451  2.609   1.00 0.00 ? 1151 GLU A H    3  
ATOM 3640  H HA   . GLU A 1 19  ? 10.632  13.599  4.771   1.00 0.00 ? 1151 GLU A HA   3  
ATOM 3641  H HB2  . GLU A 1 19  ? 10.949  15.992  3.755   1.00 0.00 ? 1151 GLU A HB2  3  
ATOM 3642  H HB3  . GLU A 1 19  ? 9.374   15.691  3.035   1.00 0.00 ? 1151 GLU A HB3  3  
ATOM 3643  H HG2  . GLU A 1 19  ? 8.517   15.204  5.336   1.00 0.00 ? 1151 GLU A HG2  3  
ATOM 3644  H HG3  . GLU A 1 19  ? 10.067  15.768  5.958   1.00 0.00 ? 1151 GLU A HG3  3  
ATOM 3645  N N    . THR A 1 20  ? 8.633   13.467  2.136   1.00 0.00 ? 1152 THR A N    3  
ATOM 3646  C CA   . THR A 1 20  ? 7.455   12.802  1.592   1.00 0.00 ? 1152 THR A CA   3  
ATOM 3647  C C    . THR A 1 20  ? 7.506   11.300  1.843   1.00 0.00 ? 1152 THR A C    3  
ATOM 3648  O O    . THR A 1 20  ? 6.520   10.700  2.269   1.00 0.00 ? 1152 THR A O    3  
ATOM 3649  C CB   . THR A 1 20  ? 7.317   13.054  0.078   1.00 0.00 ? 1152 THR A CB   3  
ATOM 3650  O OG1  . THR A 1 20  ? 7.225   14.460  -0.178  1.00 0.00 ? 1152 THR A OG1  3  
ATOM 3651  C CG2  . THR A 1 20  ? 6.089   12.350  -0.478  1.00 0.00 ? 1152 THR A CG2  3  
ATOM 3652  H H    . THR A 1 20  ? 9.087   14.151  1.601   1.00 0.00 ? 1152 THR A H    3  
ATOM 3653  H HA   . THR A 1 20  ? 6.584   13.211  2.084   1.00 0.00 ? 1152 THR A HA   3  
ATOM 3654  H HB   . THR A 1 20  ? 8.194   12.662  -0.418  1.00 0.00 ? 1152 THR A HB   3  
ATOM 3655  H HG1  . THR A 1 20  ? 6.419   14.644  -0.666  1.00 0.00 ? 1152 THR A HG1  3  
ATOM 3656  H HG21 . THR A 1 20  ? 5.204   12.731  0.011   1.00 0.00 ? 1152 THR A HG21 3  
ATOM 3657  H HG22 . THR A 1 20  ? 6.171   11.289  -0.300  1.00 0.00 ? 1152 THR A HG22 3  
ATOM 3658  H HG23 . THR A 1 20  ? 6.020   12.533  -1.540  1.00 0.00 ? 1152 THR A HG23 3  
ATOM 3659  N N    . GLN A 1 21  ? 8.661   10.699  1.577   1.00 0.00 ? 1153 GLN A N    3  
ATOM 3660  C CA   . GLN A 1 21  ? 8.839   9.265   1.775   1.00 0.00 ? 1153 GLN A CA   3  
ATOM 3661  C C    . GLN A 1 21  ? 8.661   8.892   3.242   1.00 0.00 ? 1153 GLN A C    3  
ATOM 3662  O O    . GLN A 1 21  ? 8.084   7.852   3.563   1.00 0.00 ? 1153 GLN A O    3  
ATOM 3663  C CB   . GLN A 1 21  ? 10.223  8.830   1.290   1.00 0.00 ? 1153 GLN A CB   3  
ATOM 3664  C CG   . GLN A 1 21  ? 10.296  8.596   -0.211  1.00 0.00 ? 1153 GLN A CG   3  
ATOM 3665  C CD   . GLN A 1 21  ? 11.721  8.476   -0.714  1.00 0.00 ? 1153 GLN A CD   3  
ATOM 3666  O OE1  . GLN A 1 21  ? 12.302  7.390   -0.715  1.00 0.00 ? 1153 GLN A OE1  3  
ATOM 3667  N NE2  . GLN A 1 21  ? 12.293  9.594   -1.145  1.00 0.00 ? 1153 GLN A NE2  3  
ATOM 3668  H H    . GLN A 1 21  ? 9.410   11.231  1.239   1.00 0.00 ? 1153 GLN A H    3  
ATOM 3669  H HA   . GLN A 1 21  ? 8.087   8.755   1.192   1.00 0.00 ? 1153 GLN A HA   3  
ATOM 3670  H HB2  . GLN A 1 21  ? 10.939  9.595   1.549   1.00 0.00 ? 1153 GLN A HB2  3  
ATOM 3671  H HB3  . GLN A 1 21  ? 10.493  7.911   1.789   1.00 0.00 ? 1153 GLN A HB3  3  
ATOM 3672  H HG2  . GLN A 1 21  ? 9.770   7.683   -0.446  1.00 0.00 ? 1153 GLN A HG2  3  
ATOM 3673  H HG3  . GLN A 1 21  ? 9.820   9.424   -0.715  1.00 0.00 ? 1153 GLN A HG3  3  
ATOM 3674  H HE21 . GLN A 1 21  ? 11.770  10.423  -1.114  1.00 0.00 ? 1153 GLN A HE21 3  
ATOM 3675  H HE22 . GLN A 1 21  ? 13.214  9.546   -1.475  1.00 0.00 ? 1153 GLN A HE22 3  
ATOM 3676  N N    . ILE A 1 22  ? 9.159   9.746   4.130   1.00 0.00 ? 1154 ILE A N    3  
ATOM 3677  C CA   . ILE A 1 22  ? 9.054   9.506   5.563   1.00 0.00 ? 1154 ILE A CA   3  
ATOM 3678  C C    . ILE A 1 22  ? 7.596   9.463   6.008   1.00 0.00 ? 1154 ILE A C    3  
ATOM 3679  O O    . ILE A 1 22  ? 7.190   8.575   6.758   1.00 0.00 ? 1154 ILE A O    3  
ATOM 3680  C CB   . ILE A 1 22  ? 9.793   10.589  6.371   1.00 0.00 ? 1154 ILE A CB   3  
ATOM 3681  C CG1  . ILE A 1 22  ? 11.289  10.563  6.051   1.00 0.00 ? 1154 ILE A CG1  3  
ATOM 3682  C CG2  . ILE A 1 22  ? 9.562   10.388  7.862   1.00 0.00 ? 1154 ILE A CG2  3  
ATOM 3683  C CD1  . ILE A 1 22  ? 12.048  11.746  6.610   1.00 0.00 ? 1154 ILE A CD1  3  
ATOM 3684  H H    . ILE A 1 22  ? 9.607   10.558  3.813   1.00 0.00 ? 1154 ILE A H    3  
ATOM 3685  H HA   . ILE A 1 22  ? 9.512   8.551   5.775   1.00 0.00 ? 1154 ILE A HA   3  
ATOM 3686  H HB   . ILE A 1 22  ? 9.390   11.551  6.096   1.00 0.00 ? 1154 ILE A HB   3  
ATOM 3687  H HG12 . ILE A 1 22  ? 11.724  9.666   6.463   1.00 0.00 ? 1154 ILE A HG12 3  
ATOM 3688  H HG13 . ILE A 1 22  ? 11.420  10.561  4.978   1.00 0.00 ? 1154 ILE A HG13 3  
ATOM 3689  H HG21 . ILE A 1 22  ? 8.965   9.502   8.017   1.00 0.00 ? 1154 ILE A HG21 3  
ATOM 3690  H HG22 . ILE A 1 22  ? 10.513  10.272  8.360   1.00 0.00 ? 1154 ILE A HG22 3  
ATOM 3691  H HG23 . ILE A 1 22  ? 9.046   11.245  8.265   1.00 0.00 ? 1154 ILE A HG23 3  
ATOM 3692  H HD11 . ILE A 1 22  ? 13.022  11.801  6.147   1.00 0.00 ? 1154 ILE A HD11 3  
ATOM 3693  H HD12 . ILE A 1 22  ? 11.500  12.654  6.407   1.00 0.00 ? 1154 ILE A HD12 3  
ATOM 3694  H HD13 . ILE A 1 22  ? 12.164  11.627  7.678   1.00 0.00 ? 1154 ILE A HD13 3  
ATOM 3695  N N    . VAL A 1 23  ? 6.811   10.428  5.539   1.00 0.00 ? 1155 VAL A N    3  
ATOM 3696  C CA   . VAL A 1 23  ? 5.397   10.499  5.886   1.00 0.00 ? 1155 VAL A CA   3  
ATOM 3697  C C    . VAL A 1 23  ? 4.617   9.353   5.251   1.00 0.00 ? 1155 VAL A C    3  
ATOM 3698  O O    . VAL A 1 23  ? 3.774   8.728   5.896   1.00 0.00 ? 1155 VAL A O    3  
ATOM 3699  C CB   . VAL A 1 23  ? 4.776   11.836  5.441   1.00 0.00 ? 1155 VAL A CB   3  
ATOM 3700  C CG1  . VAL A 1 23  ? 3.292   11.874  5.774   1.00 0.00 ? 1155 VAL A CG1  3  
ATOM 3701  C CG2  . VAL A 1 23  ? 5.506   13.003  6.088   1.00 0.00 ? 1155 VAL A CG2  3  
ATOM 3702  H H    . VAL A 1 23  ? 7.192   11.108  4.945   1.00 0.00 ? 1155 VAL A H    3  
ATOM 3703  H HA   . VAL A 1 23  ? 5.312   10.427  6.961   1.00 0.00 ? 1155 VAL A HA   3  
ATOM 3704  H HB   . VAL A 1 23  ? 4.884   11.921  4.369   1.00 0.00 ? 1155 VAL A HB   3  
ATOM 3705  H HG11 . VAL A 1 23  ? 3.166   11.959  6.843   1.00 0.00 ? 1155 VAL A HG11 3  
ATOM 3706  H HG12 . VAL A 1 23  ? 2.835   12.723  5.287   1.00 0.00 ? 1155 VAL A HG12 3  
ATOM 3707  H HG13 . VAL A 1 23  ? 2.823   10.965  5.428   1.00 0.00 ? 1155 VAL A HG13 3  
ATOM 3708  H HG21 . VAL A 1 23  ? 6.571   12.869  5.973   1.00 0.00 ? 1155 VAL A HG21 3  
ATOM 3709  H HG22 . VAL A 1 23  ? 5.207   13.925  5.610   1.00 0.00 ? 1155 VAL A HG22 3  
ATOM 3710  H HG23 . VAL A 1 23  ? 5.259   13.046  7.138   1.00 0.00 ? 1155 VAL A HG23 3  
ATOM 3711  N N    . LEU A 1 24  ? 4.903   9.082   3.982   1.00 0.00 ? 1156 LEU A N    3  
ATOM 3712  C CA   . LEU A 1 24  ? 4.229   8.009   3.258   1.00 0.00 ? 1156 LEU A CA   3  
ATOM 3713  C C    . LEU A 1 24  ? 4.540   6.652   3.881   1.00 0.00 ? 1156 LEU A C    3  
ATOM 3714  O O    . LEU A 1 24  ? 3.634   5.904   4.249   1.00 0.00 ? 1156 LEU A O    3  
ATOM 3715  C CB   . LEU A 1 24  ? 4.651   8.017   1.788   1.00 0.00 ? 1156 LEU A CB   3  
ATOM 3716  C CG   . LEU A 1 24  ? 3.819   7.144   0.847   1.00 0.00 ? 1156 LEU A CG   3  
ATOM 3717  C CD1  . LEU A 1 24  ? 2.340   7.469   0.985   1.00 0.00 ? 1156 LEU A CD1  3  
ATOM 3718  C CD2  . LEU A 1 24  ? 4.275   7.328   -0.593  1.00 0.00 ? 1156 LEU A CD2  3  
ATOM 3719  H H    . LEU A 1 24  ? 5.584   9.614   3.521   1.00 0.00 ? 1156 LEU A H    3  
ATOM 3720  H HA   . LEU A 1 24  ? 3.166   8.185   3.321   1.00 0.00 ? 1156 LEU A HA   3  
ATOM 3721  H HB2  . LEU A 1 24  ? 4.592   9.034   1.432   1.00 0.00 ? 1156 LEU A HB2  3  
ATOM 3722  H HB3  . LEU A 1 24  ? 5.675   7.677   1.737   1.00 0.00 ? 1156 LEU A HB3  3  
ATOM 3723  H HG   . LEU A 1 24  ? 3.958   6.105   1.113   1.00 0.00 ? 1156 LEU A HG   3  
ATOM 3724  H HD11 . LEU A 1 24  ? 1.804   7.073   0.136   1.00 0.00 ? 1156 LEU A HD11 3  
ATOM 3725  H HD12 . LEU A 1 24  ? 2.209   8.540   1.026   1.00 0.00 ? 1156 LEU A HD12 3  
ATOM 3726  H HD13 . LEU A 1 24  ? 1.957   7.025   1.893   1.00 0.00 ? 1156 LEU A HD13 3  
ATOM 3727  H HD21 . LEU A 1 24  ? 4.527   8.365   -0.761  1.00 0.00 ? 1156 LEU A HD21 3  
ATOM 3728  H HD22 . LEU A 1 24  ? 3.478   7.038   -1.263  1.00 0.00 ? 1156 LEU A HD22 3  
ATOM 3729  H HD23 . LEU A 1 24  ? 5.143   6.712   -0.777  1.00 0.00 ? 1156 LEU A HD23 3  
ATOM 3730  N N    . TYR A 1 25  ? 5.827   6.342   3.998   1.00 0.00 ? 1157 TYR A N    3  
ATOM 3731  C CA   . TYR A 1 25  ? 6.257   5.075   4.577   1.00 0.00 ? 1157 TYR A CA   3  
ATOM 3732  C C    . TYR A 1 25  ? 5.403   4.709   5.787   1.00 0.00 ? 1157 TYR A C    3  
ATOM 3733  O O    . TYR A 1 25  ? 4.900   3.592   5.891   1.00 0.00 ? 1157 TYR A O    3  
ATOM 3734  C CB   . TYR A 1 25  ? 7.730   5.150   4.983   1.00 0.00 ? 1157 TYR A CB   3  
ATOM 3735  C CG   . TYR A 1 25  ? 8.237   3.895   5.657   1.00 0.00 ? 1157 TYR A CG   3  
ATOM 3736  C CD1  . TYR A 1 25  ? 8.307   2.692   4.967   1.00 0.00 ? 1157 TYR A CD1  3  
ATOM 3737  C CD2  . TYR A 1 25  ? 8.648   3.914   6.984   1.00 0.00 ? 1157 TYR A CD2  3  
ATOM 3738  C CE1  . TYR A 1 25  ? 8.769   1.543   5.579   1.00 0.00 ? 1157 TYR A CE1  3  
ATOM 3739  C CE2  . TYR A 1 25  ? 9.113   2.770   7.604   1.00 0.00 ? 1157 TYR A CE2  3  
ATOM 3740  C CZ   . TYR A 1 25  ? 9.171   1.587   6.897   1.00 0.00 ? 1157 TYR A CZ   3  
ATOM 3741  O OH   . TYR A 1 25  ? 9.633   0.445   7.510   1.00 0.00 ? 1157 TYR A OH   3  
ATOM 3742  H H    . TYR A 1 25  ? 6.503   6.979   3.687   1.00 0.00 ? 1157 TYR A H    3  
ATOM 3743  H HA   . TYR A 1 25  ? 6.141   4.309   3.824   1.00 0.00 ? 1157 TYR A HA   3  
ATOM 3744  H HB2  . TYR A 1 25  ? 8.331   5.319   4.103   1.00 0.00 ? 1157 TYR A HB2  3  
ATOM 3745  H HB3  . TYR A 1 25  ? 7.866   5.973   5.669   1.00 0.00 ? 1157 TYR A HB3  3  
ATOM 3746  H HD1  . TYR A 1 25  ? 7.992   2.661   3.934   1.00 0.00 ? 1157 TYR A HD1  3  
ATOM 3747  H HD2  . TYR A 1 25  ? 8.602   4.842   7.535   1.00 0.00 ? 1157 TYR A HD2  3  
ATOM 3748  H HE1  . TYR A 1 25  ? 8.815   0.616   5.025   1.00 0.00 ? 1157 TYR A HE1  3  
ATOM 3749  H HE2  . TYR A 1 25  ? 9.428   2.804   8.637   1.00 0.00 ? 1157 TYR A HE2  3  
ATOM 3750  H HH   . TYR A 1 25  ? 10.299  0.679   8.162   1.00 0.00 ? 1157 TYR A HH   3  
ATOM 3751  N N    . GLY A 1 26  ? 5.242   5.663   6.699   1.00 0.00 ? 1158 GLY A N    3  
ATOM 3752  C CA   . GLY A 1 26  ? 4.447   5.424   7.890   1.00 0.00 ? 1158 GLY A CA   3  
ATOM 3753  C C    . GLY A 1 26  ? 3.024   5.016   7.565   1.00 0.00 ? 1158 GLY A C    3  
ATOM 3754  O O    . GLY A 1 26  ? 2.496   4.065   8.141   1.00 0.00 ? 1158 GLY A O    3  
ATOM 3755  H H    . GLY A 1 26  ? 5.667   6.536   6.563   1.00 0.00 ? 1158 GLY A H    3  
ATOM 3756  H HA2  . GLY A 1 26  ? 4.913   4.640   8.468   1.00 0.00 ? 1158 GLY A HA2  3  
ATOM 3757  H HA3  . GLY A 1 26  ? 4.424   6.328   8.481   1.00 0.00 ? 1158 GLY A HA3  3  
ATOM 3758  N N    . LYS A 1 27  ? 2.400   5.737   6.640   1.00 0.00 ? 1159 LYS A N    3  
ATOM 3759  C CA   . LYS A 1 27  ? 1.029   5.446   6.238   1.00 0.00 ? 1159 LYS A CA   3  
ATOM 3760  C C    . LYS A 1 27  ? 0.892   3.997   5.782   1.00 0.00 ? 1159 LYS A C    3  
ATOM 3761  O O    . LYS A 1 27  ? -0.149  3.369   5.980   1.00 0.00 ? 1159 LYS A O    3  
ATOM 3762  C CB   . LYS A 1 27  ? 0.594   6.390   5.115   1.00 0.00 ? 1159 LYS A CB   3  
ATOM 3763  C CG   . LYS A 1 27  ? 0.646   7.858   5.499   1.00 0.00 ? 1159 LYS A CG   3  
ATOM 3764  C CD   . LYS A 1 27  ? -0.220  8.706   4.583   1.00 0.00 ? 1159 LYS A CD   3  
ATOM 3765  C CE   . LYS A 1 27  ? -0.496  10.075  5.185   1.00 0.00 ? 1159 LYS A CE   3  
ATOM 3766  N NZ   . LYS A 1 27  ? -1.419  9.992   6.351   1.00 0.00 ? 1159 LYS A NZ   3  
ATOM 3767  H H    . LYS A 1 27  ? 2.874   6.484   6.216   1.00 0.00 ? 1159 LYS A H    3  
ATOM 3768  H HA   . LYS A 1 27  ? 0.392   5.603   7.096   1.00 0.00 ? 1159 LYS A HA   3  
ATOM 3769  H HB2  . LYS A 1 27  ? 1.241   6.239   4.263   1.00 0.00 ? 1159 LYS A HB2  3  
ATOM 3770  H HB3  . LYS A 1 27  ? -0.421  6.149   4.832   1.00 0.00 ? 1159 LYS A HB3  3  
ATOM 3771  H HG2  . LYS A 1 27  ? 0.292   7.968   6.514   1.00 0.00 ? 1159 LYS A HG2  3  
ATOM 3772  H HG3  . LYS A 1 27  ? 1.668   8.202   5.433   1.00 0.00 ? 1159 LYS A HG3  3  
ATOM 3773  H HD2  . LYS A 1 27  ? 0.289   8.836   3.639   1.00 0.00 ? 1159 LYS A HD2  3  
ATOM 3774  H HD3  . LYS A 1 27  ? -1.160  8.198   4.419   1.00 0.00 ? 1159 LYS A HD3  3  
ATOM 3775  H HE2  . LYS A 1 27  ? 0.439   10.507  5.507   1.00 0.00 ? 1159 LYS A HE2  3  
ATOM 3776  H HE3  . LYS A 1 27  ? -0.941  10.704  4.428   1.00 0.00 ? 1159 LYS A HE3  3  
ATOM 3777  H HZ1  . LYS A 1 27  ? -1.963  9.107   6.313   1.00 0.00 ? 1159 LYS A HZ1  3  
ATOM 3778  H HZ2  . LYS A 1 27  ? -2.082  10.794  6.339   1.00 0.00 ? 1159 LYS A HZ2  3  
ATOM 3779  H HZ3  . LYS A 1 27  ? -0.878  10.017  7.238   1.00 0.00 ? 1159 LYS A HZ3  3  
ATOM 3780  N N    . LEU A 1 28  ? 1.948   3.472   5.171   1.00 0.00 ? 1160 LEU A N    3  
ATOM 3781  C CA   . LEU A 1 28  ? 1.945   2.095   4.687   1.00 0.00 ? 1160 LEU A CA   3  
ATOM 3782  C C    . LEU A 1 28  ? 2.067   1.111   5.846   1.00 0.00 ? 1160 LEU A C    3  
ATOM 3783  O O    . LEU A 1 28  ? 1.187   0.277   6.061   1.00 0.00 ? 1160 LEU A O    3  
ATOM 3784  C CB   . LEU A 1 28  ? 3.092   1.880   3.698   1.00 0.00 ? 1160 LEU A CB   3  
ATOM 3785  C CG   . LEU A 1 28  ? 2.874   2.431   2.288   1.00 0.00 ? 1160 LEU A CG   3  
ATOM 3786  C CD1  . LEU A 1 28  ? 4.204   2.602   1.571   1.00 0.00 ? 1160 LEU A CD1  3  
ATOM 3787  C CD2  . LEU A 1 28  ? 1.951   1.518   1.495   1.00 0.00 ? 1160 LEU A CD2  3  
ATOM 3788  H H    . LEU A 1 28  ? 2.748   4.021   5.042   1.00 0.00 ? 1160 LEU A H    3  
ATOM 3789  H HA   . LEU A 1 28  ? 1.007   1.924   4.182   1.00 0.00 ? 1160 LEU A HA   3  
ATOM 3790  H HB2  . LEU A 1 28  ? 3.973   2.352   4.105   1.00 0.00 ? 1160 LEU A HB2  3  
ATOM 3791  H HB3  . LEU A 1 28  ? 3.261   0.816   3.615   1.00 0.00 ? 1160 LEU A HB3  3  
ATOM 3792  H HG   . LEU A 1 28  ? 2.405   3.403   2.357   1.00 0.00 ? 1160 LEU A HG   3  
ATOM 3793  H HD11 . LEU A 1 28  ? 4.841   3.258   2.144   1.00 0.00 ? 1160 LEU A HD11 3  
ATOM 3794  H HD12 . LEU A 1 28  ? 4.034   3.030   0.594   1.00 0.00 ? 1160 LEU A HD12 3  
ATOM 3795  H HD13 . LEU A 1 28  ? 4.681   1.639   1.463   1.00 0.00 ? 1160 LEU A HD13 3  
ATOM 3796  H HD21 . LEU A 1 28  ? 1.182   1.130   2.146   1.00 0.00 ? 1160 LEU A HD21 3  
ATOM 3797  H HD22 . LEU A 1 28  ? 2.523   0.697   1.085   1.00 0.00 ? 1160 LEU A HD22 3  
ATOM 3798  H HD23 . LEU A 1 28  ? 1.495   2.077   0.691   1.00 0.00 ? 1160 LEU A HD23 3  
ATOM 3799  N N    . VAL A 1 29  ? 3.162   1.215   6.592   1.00 0.00 ? 1161 VAL A N    3  
ATOM 3800  C CA   . VAL A 1 29  ? 3.398   0.336   7.732   1.00 0.00 ? 1161 VAL A CA   3  
ATOM 3801  C C    . VAL A 1 29  ? 2.099   0.039   8.473   1.00 0.00 ? 1161 VAL A C    3  
ATOM 3802  O O    . VAL A 1 29  ? 1.670   -1.111  8.556   1.00 0.00 ? 1161 VAL A O    3  
ATOM 3803  C CB   . VAL A 1 29  ? 4.409   0.953   8.716   1.00 0.00 ? 1161 VAL A CB   3  
ATOM 3804  C CG1  . VAL A 1 29  ? 4.570   0.066   9.941   1.00 0.00 ? 1161 VAL A CG1  3  
ATOM 3805  C CG2  . VAL A 1 29  ? 5.749   1.178   8.031   1.00 0.00 ? 1161 VAL A CG2  3  
ATOM 3806  H H    . VAL A 1 29  ? 3.827   1.900   6.371   1.00 0.00 ? 1161 VAL A H    3  
ATOM 3807  H HA   . VAL A 1 29  ? 3.809   -0.591  7.359   1.00 0.00 ? 1161 VAL A HA   3  
ATOM 3808  H HB   . VAL A 1 29  ? 4.028   1.910   9.039   1.00 0.00 ? 1161 VAL A HB   3  
ATOM 3809  H HG11 . VAL A 1 29  ? 3.644   0.050   10.497  1.00 0.00 ? 1161 VAL A HG11 3  
ATOM 3810  H HG12 . VAL A 1 29  ? 4.822   -0.937  9.630   1.00 0.00 ? 1161 VAL A HG12 3  
ATOM 3811  H HG13 . VAL A 1 29  ? 5.358   0.458   10.568  1.00 0.00 ? 1161 VAL A HG13 3  
ATOM 3812  H HG21 . VAL A 1 29  ? 5.998   2.228   8.066   1.00 0.00 ? 1161 VAL A HG21 3  
ATOM 3813  H HG22 . VAL A 1 29  ? 6.514   0.610   8.541   1.00 0.00 ? 1161 VAL A HG22 3  
ATOM 3814  H HG23 . VAL A 1 29  ? 5.687   0.855   7.003   1.00 0.00 ? 1161 VAL A HG23 3  
ATOM 3815  N N    . GLU A 1 30  ? 1.479   1.084   9.011   1.00 0.00 ? 1162 GLU A N    3  
ATOM 3816  C CA   . GLU A 1 30  ? 0.229   0.934   9.747   1.00 0.00 ? 1162 GLU A CA   3  
ATOM 3817  C C    . GLU A 1 30  ? -0.675  -0.099  9.080   1.00 0.00 ? 1162 GLU A C    3  
ATOM 3818  O O    . GLU A 1 30  ? -1.114  -1.057  9.714   1.00 0.00 ? 1162 GLU A O    3  
ATOM 3819  C CB   . GLU A 1 30  ? -0.497  2.278   9.843   1.00 0.00 ? 1162 GLU A CB   3  
ATOM 3820  C CG   . GLU A 1 30  ? -0.488  3.068   8.545   1.00 0.00 ? 1162 GLU A CG   3  
ATOM 3821  C CD   . GLU A 1 30  ? -0.887  4.518   8.742   1.00 0.00 ? 1162 GLU A CD   3  
ATOM 3822  O OE1  . GLU A 1 30  ? -0.323  5.170   9.646   1.00 0.00 ? 1162 GLU A OE1  3  
ATOM 3823  O OE2  . GLU A 1 30  ? -1.762  5.000   7.994   1.00 0.00 ? 1162 GLU A OE2  3  
ATOM 3824  H H    . GLU A 1 30  ? 1.871   1.977   8.911   1.00 0.00 ? 1162 GLU A H    3  
ATOM 3825  H HA   . GLU A 1 30  ? 0.469   0.594   10.743  1.00 0.00 ? 1162 GLU A HA   3  
ATOM 3826  H HB2  . GLU A 1 30  ? -1.525  2.099   10.124  1.00 0.00 ? 1162 GLU A HB2  3  
ATOM 3827  H HB3  . GLU A 1 30  ? -0.023  2.875   10.607  1.00 0.00 ? 1162 GLU A HB3  3  
ATOM 3828  H HG2  . GLU A 1 30  ? 0.508   3.039   8.128   1.00 0.00 ? 1162 GLU A HG2  3  
ATOM 3829  H HG3  . GLU A 1 30  ? -1.180  2.610   7.854   1.00 0.00 ? 1162 GLU A HG3  3  
ATOM 3830  N N    . ALA A 1 31  ? -0.948  0.105   7.795   1.00 0.00 ? 1163 ALA A N    3  
ATOM 3831  C CA   . ALA A 1 31  ? -1.798  -0.808  7.041   1.00 0.00 ? 1163 ALA A CA   3  
ATOM 3832  C C    . ALA A 1 31  ? -1.211  -2.215  7.024   1.00 0.00 ? 1163 ALA A C    3  
ATOM 3833  O O    . ALA A 1 31  ? -1.923  -3.197  7.237   1.00 0.00 ? 1163 ALA A O    3  
ATOM 3834  C CB   . ALA A 1 31  ? -1.991  -0.297  5.620   1.00 0.00 ? 1163 ALA A CB   3  
ATOM 3835  H H    . ALA A 1 31  ? -0.568  0.888   7.344   1.00 0.00 ? 1163 ALA A H    3  
ATOM 3836  H HA   . ALA A 1 31  ? -2.765  -0.837  7.521   1.00 0.00 ? 1163 ALA A HA   3  
ATOM 3837  H HB1  . ALA A 1 31  ? -2.977  -0.567  5.273   1.00 0.00 ? 1163 ALA A HB1  3  
ATOM 3838  H HB2  . ALA A 1 31  ? -1.885  0.777   5.607   1.00 0.00 ? 1163 ALA A HB2  3  
ATOM 3839  H HB3  . ALA A 1 31  ? -1.248  -0.740  4.975   1.00 0.00 ? 1163 ALA A HB3  3  
ATOM 3840  N N    . ARG A 1 32  ? 0.089   -2.307  6.767   1.00 0.00 ? 1164 ARG A N    3  
ATOM 3841  C CA   . ARG A 1 32  ? 0.770   -3.595  6.720   1.00 0.00 ? 1164 ARG A CA   3  
ATOM 3842  C C    . ARG A 1 32  ? 0.540   -4.379  8.009   1.00 0.00 ? 1164 ARG A C    3  
ATOM 3843  O O    . ARG A 1 32  ? 0.187   -5.557  7.975   1.00 0.00 ? 1164 ARG A O    3  
ATOM 3844  C CB   . ARG A 1 32  ? 2.270   -3.395  6.493   1.00 0.00 ? 1164 ARG A CB   3  
ATOM 3845  C CG   . ARG A 1 32  ? 3.056   -4.695  6.438   1.00 0.00 ? 1164 ARG A CG   3  
ATOM 3846  C CD   . ARG A 1 32  ? 4.491   -4.498  6.901   1.00 0.00 ? 1164 ARG A CD   3  
ATOM 3847  N NE   . ARG A 1 32  ? 4.562   -4.067  8.295   1.00 0.00 ? 1164 ARG A NE   3  
ATOM 3848  C CZ   . ARG A 1 32  ? 5.647   -4.198  9.050   1.00 0.00 ? 1164 ARG A CZ   3  
ATOM 3849  N NH1  . ARG A 1 32  ? 6.746   -4.744  8.548   1.00 0.00 ? 1164 ARG A NH1  3  
ATOM 3850  N NH2  . ARG A 1 32  ? 5.634   -3.781  10.310  1.00 0.00 ? 1164 ARG A NH2  3  
ATOM 3851  H H    . ARG A 1 32  ? 0.604   -1.488  6.605   1.00 0.00 ? 1164 ARG A H    3  
ATOM 3852  H HA   . ARG A 1 32  ? 0.362   -4.156  5.894   1.00 0.00 ? 1164 ARG A HA   3  
ATOM 3853  H HB2  . ARG A 1 32  ? 2.415   -2.873  5.559   1.00 0.00 ? 1164 ARG A HB2  3  
ATOM 3854  H HB3  . ARG A 1 32  ? 2.666   -2.794  7.298   1.00 0.00 ? 1164 ARG A HB3  3  
ATOM 3855  H HG2  . ARG A 1 32  ? 2.579   -5.421  7.079   1.00 0.00 ? 1164 ARG A HG2  3  
ATOM 3856  H HG3  . ARG A 1 32  ? 3.061   -5.058  5.421   1.00 0.00 ? 1164 ARG A HG3  3  
ATOM 3857  H HD2  . ARG A 1 32  ? 5.020   -5.433  6.796   1.00 0.00 ? 1164 ARG A HD2  3  
ATOM 3858  H HD3  . ARG A 1 32  ? 4.957   -3.749  6.278   1.00 0.00 ? 1164 ARG A HD3  3  
ATOM 3859  H HE   . ARG A 1 32  ? 3.761   -3.661  8.685   1.00 0.00 ? 1164 ARG A HE   3  
ATOM 3860  H HH11 . ARG A 1 32  ? 6.759   -5.058  7.599   1.00 0.00 ? 1164 ARG A HH11 3  
ATOM 3861  H HH12 . ARG A 1 32  ? 7.562   -4.840  9.119   1.00 0.00 ? 1164 ARG A HH12 3  
ATOM 3862  H HH21 . ARG A 1 32  ? 4.807   -3.369  10.691  1.00 0.00 ? 1164 ARG A HH21 3  
ATOM 3863  H HH22 . ARG A 1 32  ? 6.451   -3.880  10.877  1.00 0.00 ? 1164 ARG A HH22 3  
ATOM 3864  N N    . GLN A 1 33  ? 0.743   -3.716  9.143   1.00 0.00 ? 1165 GLN A N    3  
ATOM 3865  C CA   . GLN A 1 33  ? 0.558   -4.351  10.442  1.00 0.00 ? 1165 GLN A CA   3  
ATOM 3866  C C    . GLN A 1 33  ? -0.866  -4.874  10.596  1.00 0.00 ? 1165 GLN A C    3  
ATOM 3867  O O    . GLN A 1 33  ? -1.091  -6.081  10.680  1.00 0.00 ? 1165 GLN A O    3  
ATOM 3868  C CB   . GLN A 1 33  ? 0.876   -3.364  11.566  1.00 0.00 ? 1165 GLN A CB   3  
ATOM 3869  C CG   . GLN A 1 33  ? 0.650   -3.932  12.958  1.00 0.00 ? 1165 GLN A CG   3  
ATOM 3870  C CD   . GLN A 1 33  ? 1.567   -3.317  13.996  1.00 0.00 ? 1165 GLN A CD   3  
ATOM 3871  O OE1  . GLN A 1 33  ? 2.596   -3.893  14.351  1.00 0.00 ? 1165 GLN A OE1  3  
ATOM 3872  N NE2  . GLN A 1 33  ? 1.199   -2.140  14.489  1.00 0.00 ? 1165 GLN A NE2  3  
ATOM 3873  H H    . GLN A 1 33  ? 1.023   -2.778  9.105   1.00 0.00 ? 1165 GLN A H    3  
ATOM 3874  H HA   . GLN A 1 33  ? 1.242   -5.184  10.504  1.00 0.00 ? 1165 GLN A HA   3  
ATOM 3875  H HB2  . GLN A 1 33  ? 1.911   -3.066  11.486  1.00 0.00 ? 1165 GLN A HB2  3  
ATOM 3876  H HB3  . GLN A 1 33  ? 0.248   -2.492  11.451  1.00 0.00 ? 1165 GLN A HB3  3  
ATOM 3877  H HG2  . GLN A 1 33  ? -0.374  -3.744  13.248  1.00 0.00 ? 1165 GLN A HG2  3  
ATOM 3878  H HG3  . GLN A 1 33  ? 0.824   -4.998  12.930  1.00 0.00 ? 1165 GLN A HG3  3  
ATOM 3879  H HE21 . GLN A 1 33  ? 0.366   -1.741  14.160  1.00 0.00 ? 1165 GLN A HE21 3  
ATOM 3880  H HE22 . GLN A 1 33  ? 1.773   -1.720  15.162  1.00 0.00 ? 1165 GLN A HE22 3  
ATOM 3881  N N    . LYS A 1 34  ? -1.827  -3.956  10.632  1.00 0.00 ? 1166 LYS A N    3  
ATOM 3882  C CA   . LYS A 1 34  ? -3.231  -4.323  10.774  1.00 0.00 ? 1166 LYS A CA   3  
ATOM 3883  C C    . LYS A 1 34  ? -3.601  -5.444  9.808   1.00 0.00 ? 1166 LYS A C    3  
ATOM 3884  O O    . LYS A 1 34  ? -4.272  -6.405  10.184  1.00 0.00 ? 1166 LYS A O    3  
ATOM 3885  C CB   . LYS A 1 34  ? -4.125  -3.106  10.526  1.00 0.00 ? 1166 LYS A CB   3  
ATOM 3886  C CG   . LYS A 1 34  ? -4.039  -2.567  9.109   1.00 0.00 ? 1166 LYS A CG   3  
ATOM 3887  C CD   . LYS A 1 34  ? -4.976  -1.388  8.903   1.00 0.00 ? 1166 LYS A CD   3  
ATOM 3888  C CE   . LYS A 1 34  ? -4.455  -0.136  9.592   1.00 0.00 ? 1166 LYS A CE   3  
ATOM 3889  N NZ   . LYS A 1 34  ? -4.938  -0.033  10.996  1.00 0.00 ? 1166 LYS A NZ   3  
ATOM 3890  H H    . LYS A 1 34  ? -1.585  -3.008  10.560  1.00 0.00 ? 1166 LYS A H    3  
ATOM 3891  H HA   . LYS A 1 34  ? -3.382  -4.670  11.784  1.00 0.00 ? 1166 LYS A HA   3  
ATOM 3892  H HB2  . LYS A 1 34  ? -5.150  -3.381  10.723  1.00 0.00 ? 1166 LYS A HB2  3  
ATOM 3893  H HB3  . LYS A 1 34  ? -3.836  -2.318  11.207  1.00 0.00 ? 1166 LYS A HB3  3  
ATOM 3894  H HG2  . LYS A 1 34  ? -3.027  -2.246  8.916   1.00 0.00 ? 1166 LYS A HG2  3  
ATOM 3895  H HG3  . LYS A 1 34  ? -4.308  -3.353  8.418   1.00 0.00 ? 1166 LYS A HG3  3  
ATOM 3896  H HD2  . LYS A 1 34  ? -5.067  -1.192  7.845   1.00 0.00 ? 1166 LYS A HD2  3  
ATOM 3897  H HD3  . LYS A 1 34  ? -5.946  -1.635  9.310   1.00 0.00 ? 1166 LYS A HD3  3  
ATOM 3898  H HE2  . LYS A 1 34  ? -3.376  -0.163  9.592   1.00 0.00 ? 1166 LYS A HE2  3  
ATOM 3899  H HE3  . LYS A 1 34  ? -4.793  0.729   9.040   1.00 0.00 ? 1166 LYS A HE3  3  
ATOM 3900  H HZ1  . LYS A 1 34  ? -4.171  0.303   11.614  1.00 0.00 ? 1166 LYS A HZ1  3  
ATOM 3901  H HZ2  . LYS A 1 34  ? -5.256  -0.964  11.334  1.00 0.00 ? 1166 LYS A HZ2  3  
ATOM 3902  H HZ3  . LYS A 1 34  ? -5.733  0.634   11.054  1.00 0.00 ? 1166 LYS A HZ3  3  
ATOM 3903  N N    . HIS A 1 35  ? -3.159  -5.314  8.561   1.00 0.00 ? 1167 HIS A N    3  
ATOM 3904  C CA   . HIS A 1 35  ? -3.442  -6.318  7.541   1.00 0.00 ? 1167 HIS A CA   3  
ATOM 3905  C C    . HIS A 1 35  ? -2.914  -7.686  7.963   1.00 0.00 ? 1167 HIS A C    3  
ATOM 3906  O O    . HIS A 1 35  ? -3.588  -8.701  7.793   1.00 0.00 ? 1167 HIS A O    3  
ATOM 3907  C CB   . HIS A 1 35  ? -2.820  -5.908  6.205   1.00 0.00 ? 1167 HIS A CB   3  
ATOM 3908  C CG   . HIS A 1 35  ? -3.500  -6.516  5.017   1.00 0.00 ? 1167 HIS A CG   3  
ATOM 3909  N ND1  . HIS A 1 35  ? -4.540  -7.415  5.123   1.00 0.00 ? 1167 HIS A ND1  3  
ATOM 3910  C CD2  . HIS A 1 35  ? -3.283  -6.348  3.692   1.00 0.00 ? 1167 HIS A CD2  3  
ATOM 3911  C CE1  . HIS A 1 35  ? -4.933  -7.775  3.914   1.00 0.00 ? 1167 HIS A CE1  3  
ATOM 3912  N NE2  . HIS A 1 35  ? -4.186  -7.142  3.028   1.00 0.00 ? 1167 HIS A NE2  3  
ATOM 3913  H H    . HIS A 1 35  ? -2.629  -4.526  8.321   1.00 0.00 ? 1167 HIS A H    3  
ATOM 3914  H HA   . HIS A 1 35  ? -4.514  -6.380  7.425   1.00 0.00 ? 1167 HIS A HA   3  
ATOM 3915  H HB2  . HIS A 1 35  ? -2.875  -4.834  6.105   1.00 0.00 ? 1167 HIS A HB2  3  
ATOM 3916  H HB3  . HIS A 1 35  ? -1.784  -6.214  6.189   1.00 0.00 ? 1167 HIS A HB3  3  
ATOM 3917  H HD1  . HIS A 1 35  ? -4.931  -7.741  5.960   1.00 0.00 ? 1167 HIS A HD1  3  
ATOM 3918  H HD2  . HIS A 1 35  ? -2.537  -5.710  3.239   1.00 0.00 ? 1167 HIS A HD2  3  
ATOM 3919  H HE1  . HIS A 1 35  ? -5.729  -8.468  3.688   1.00 0.00 ? 1167 HIS A HE1  3  
ATOM 3920  H HE2  . HIS A 1 35  ? -4.209  -7.292  2.060   1.00 0.00 ? 1167 HIS A HE2  3  
ATOM 3921  N N    . ALA A 1 36  ? -1.705  -7.703  8.514   1.00 0.00 ? 1168 ALA A N    3  
ATOM 3922  C CA   . ALA A 1 36  ? -1.087  -8.946  8.961   1.00 0.00 ? 1168 ALA A CA   3  
ATOM 3923  C C    . ALA A 1 36  ? -2.085  -9.812  9.722   1.00 0.00 ? 1168 ALA A C    3  
ATOM 3924  O O    . ALA A 1 36  ? -2.304  -10.972 9.377   1.00 0.00 ? 1168 ALA A O    3  
ATOM 3925  C CB   . ALA A 1 36  ? 0.127   -8.649  9.829   1.00 0.00 ? 1168 ALA A CB   3  
ATOM 3926  H H    . ALA A 1 36  ? -1.217  -6.861  8.623   1.00 0.00 ? 1168 ALA A H    3  
ATOM 3927  H HA   . ALA A 1 36  ? -0.751  -9.485  8.087   1.00 0.00 ? 1168 ALA A HA   3  
ATOM 3928  H HB1  . ALA A 1 36  ? -0.095  -8.905  10.855  1.00 0.00 ? 1168 ALA A HB1  3  
ATOM 3929  H HB2  . ALA A 1 36  ? 0.967   -9.234  9.485   1.00 0.00 ? 1168 ALA A HB2  3  
ATOM 3930  H HB3  . ALA A 1 36  ? 0.367   -7.599  9.764   1.00 0.00 ? 1168 ALA A HB3  3  
ATOM 3931  N N    . ASN A 1 37  ? -2.687  -9.240  10.760  1.00 0.00 ? 1169 ASN A N    3  
ATOM 3932  C CA   . ASN A 1 37  ? -3.662  -9.961  11.571  1.00 0.00 ? 1169 ASN A CA   3  
ATOM 3933  C C    . ASN A 1 37  ? -4.851  -10.406 10.725  1.00 0.00 ? 1169 ASN A C    3  
ATOM 3934  O O    . ASN A 1 37  ? -5.280  -11.558 10.794  1.00 0.00 ? 1169 ASN A O    3  
ATOM 3935  C CB   . ASN A 1 37  ? -4.144  -9.082  12.727  1.00 0.00 ? 1169 ASN A CB   3  
ATOM 3936  C CG   . ASN A 1 37  ? -3.210  -9.133  13.920  1.00 0.00 ? 1169 ASN A CG   3  
ATOM 3937  O OD1  . ASN A 1 37  ? -3.296  -10.036 14.752  1.00 0.00 ? 1169 ASN A OD1  3  
ATOM 3938  N ND2  . ASN A 1 37  ? -2.311  -8.159  14.009  1.00 0.00 ? 1169 ASN A ND2  3  
ATOM 3939  H H    . ASN A 1 37  ? -2.471  -8.311  10.986  1.00 0.00 ? 1169 ASN A H    3  
ATOM 3940  H HA   . ASN A 1 37  ? -3.174  -10.836 11.975  1.00 0.00 ? 1169 ASN A HA   3  
ATOM 3941  H HB2  . ASN A 1 37  ? -4.210  -8.058  12.389  1.00 0.00 ? 1169 ASN A HB2  3  
ATOM 3942  H HB3  . ASN A 1 37  ? -5.121  -9.417  13.042  1.00 0.00 ? 1169 ASN A HB3  3  
ATOM 3943  H HD21 . ASN A 1 37  ? -2.301  -7.473  13.310  1.00 0.00 ? 1169 ASN A HD21 3  
ATOM 3944  H HD22 . ASN A 1 37  ? -1.694  -8.168  14.771  1.00 0.00 ? 1169 ASN A HD22 3  
ATOM 3945  N N    . LYS A 1 38  ? -5.379  -9.485  9.926   1.00 0.00 ? 1170 LYS A N    3  
ATOM 3946  C CA   . LYS A 1 38  ? -6.517  -9.781  9.064   1.00 0.00 ? 1170 LYS A CA   3  
ATOM 3947  C C    . LYS A 1 38  ? -6.353  -11.142 8.395   1.00 0.00 ? 1170 LYS A C    3  
ATOM 3948  O O    . LYS A 1 38  ? -7.253  -11.980 8.442   1.00 0.00 ? 1170 LYS A O    3  
ATOM 3949  C CB   . LYS A 1 38  ? -6.673  -8.693  7.999   1.00 0.00 ? 1170 LYS A CB   3  
ATOM 3950  C CG   . LYS A 1 38  ? -7.830  -8.937  7.046   1.00 0.00 ? 1170 LYS A CG   3  
ATOM 3951  C CD   . LYS A 1 38  ? -7.929  -7.842  5.998   1.00 0.00 ? 1170 LYS A CD   3  
ATOM 3952  C CE   . LYS A 1 38  ? -9.174  -8.003  5.139   1.00 0.00 ? 1170 LYS A CE   3  
ATOM 3953  N NZ   . LYS A 1 38  ? -10.422 -7.806  5.928   1.00 0.00 ? 1170 LYS A NZ   3  
ATOM 3954  H H    . LYS A 1 38  ? -4.992  -8.584  9.914   1.00 0.00 ? 1170 LYS A H    3  
ATOM 3955  H HA   . LYS A 1 38  ? -7.403  -9.801  9.680   1.00 0.00 ? 1170 LYS A HA   3  
ATOM 3956  H HB2  . LYS A 1 38  ? -6.834  -7.745  8.492   1.00 0.00 ? 1170 LYS A HB2  3  
ATOM 3957  H HB3  . LYS A 1 38  ? -5.762  -8.639  7.421   1.00 0.00 ? 1170 LYS A HB3  3  
ATOM 3958  H HG2  . LYS A 1 38  ? -7.681  -9.884  6.548   1.00 0.00 ? 1170 LYS A HG2  3  
ATOM 3959  H HG3  . LYS A 1 38  ? -8.751  -8.967  7.611   1.00 0.00 ? 1170 LYS A HG3  3  
ATOM 3960  H HD2  . LYS A 1 38  ? -7.970  -6.883  6.494   1.00 0.00 ? 1170 LYS A HD2  3  
ATOM 3961  H HD3  . LYS A 1 38  ? -7.056  -7.883  5.362   1.00 0.00 ? 1170 LYS A HD3  3  
ATOM 3962  H HE2  . LYS A 1 38  ? -9.144  -7.274  4.343   1.00 0.00 ? 1170 LYS A HE2  3  
ATOM 3963  H HE3  . LYS A 1 38  ? -9.178  -8.997  4.717   1.00 0.00 ? 1170 LYS A HE3  3  
ATOM 3964  H HZ1  . LYS A 1 38  ? -10.427 -8.443  6.751   1.00 0.00 ? 1170 LYS A HZ1  3  
ATOM 3965  H HZ2  . LYS A 1 38  ? -11.254 -8.013  5.339   1.00 0.00 ? 1170 LYS A HZ2  3  
ATOM 3966  H HZ3  . LYS A 1 38  ? -10.482 -6.824  6.263   1.00 0.00 ? 1170 LYS A HZ3  3  
ATOM 3967  N N    . MET A 1 39  ? -5.198  -11.356 7.773   1.00 0.00 ? 1171 MET A N    3  
ATOM 3968  C CA   . MET A 1 39  ? -4.916  -12.617 7.097   1.00 0.00 ? 1171 MET A CA   3  
ATOM 3969  C C    . MET A 1 39  ? -4.311  -13.629 8.064   1.00 0.00 ? 1171 MET A C    3  
ATOM 3970  O O    . MET A 1 39  ? -4.097  -14.789 7.710   1.00 0.00 ? 1171 MET A O    3  
ATOM 3971  C CB   . MET A 1 39  ? -3.966  -12.388 5.920   1.00 0.00 ? 1171 MET A CB   3  
ATOM 3972  C CG   . MET A 1 39  ? -4.586  -11.589 4.785   1.00 0.00 ? 1171 MET A CG   3  
ATOM 3973  S SD   . MET A 1 39  ? -3.701  -11.793 3.227   1.00 0.00 ? 1171 MET A SD   3  
ATOM 3974  C CE   . MET A 1 39  ? -2.080  -11.176 3.675   1.00 0.00 ? 1171 MET A CE   3  
ATOM 3975  H H    . MET A 1 39  ? -4.518  -10.650 7.769   1.00 0.00 ? 1171 MET A H    3  
ATOM 3976  H HA   . MET A 1 39  ? -5.850  -13.008 6.723   1.00 0.00 ? 1171 MET A HA   3  
ATOM 3977  H HB2  . MET A 1 39  ? -3.096  -11.854 6.273   1.00 0.00 ? 1171 MET A HB2  3  
ATOM 3978  H HB3  . MET A 1 39  ? -3.657  -13.346 5.529   1.00 0.00 ? 1171 MET A HB3  3  
ATOM 3979  H HG2  . MET A 1 39  ? -5.606  -11.915 4.648   1.00 0.00 ? 1171 MET A HG2  3  
ATOM 3980  H HG3  . MET A 1 39  ? -4.578  -10.543 5.054   1.00 0.00 ? 1171 MET A HG3  3  
ATOM 3981  H HE1  . MET A 1 39  ? -1.360  -11.978 3.613   1.00 0.00 ? 1171 MET A HE1  3  
ATOM 3982  H HE2  . MET A 1 39  ? -1.797  -10.384 2.998   1.00 0.00 ? 1171 MET A HE2  3  
ATOM 3983  H HE3  . MET A 1 39  ? -2.108  -10.794 4.686   1.00 0.00 ? 1171 MET A HE3  3  
ATOM 3984  N N    . ASP A 1 40  ? -4.037  -13.183 9.285   1.00 0.00 ? 1172 ASP A N    3  
ATOM 3985  C CA   . ASP A 1 40  ? -3.458  -14.051 10.304  1.00 0.00 ? 1172 ASP A CA   3  
ATOM 3986  C C    . ASP A 1 40  ? -2.031  -14.446 9.934   1.00 0.00 ? 1172 ASP A C    3  
ATOM 3987  O O    . ASP A 1 40  ? -1.578  -15.546 10.251  1.00 0.00 ? 1172 ASP A O    3  
ATOM 3988  C CB   . ASP A 1 40  ? -4.316  -15.304 10.486  1.00 0.00 ? 1172 ASP A CB   3  
ATOM 3989  C CG   . ASP A 1 40  ? -5.800  -14.999 10.453  1.00 0.00 ? 1172 ASP A CG   3  
ATOM 3990  O OD1  . ASP A 1 40  ? -6.387  -15.023 9.351   1.00 0.00 ? 1172 ASP A OD1  3  
ATOM 3991  O OD2  . ASP A 1 40  ? -6.376  -14.735 11.530  1.00 0.00 ? 1172 ASP A OD2  3  
ATOM 3992  H H    . ASP A 1 40  ? -4.231  -12.248 9.507   1.00 0.00 ? 1172 ASP A H    3  
ATOM 3993  H HA   . ASP A 1 40  ? -3.436  -13.503 11.233  1.00 0.00 ? 1172 ASP A HA   3  
ATOM 3994  H HB2  . ASP A 1 40  ? -4.094  -16.003 9.692   1.00 0.00 ? 1172 ASP A HB2  3  
ATOM 3995  H HB3  . ASP A 1 40  ? -4.080  -15.759 11.436  1.00 0.00 ? 1172 ASP A HB3  3  
ATOM 3996  N N    . VAL A 1 41  ? -1.328  -13.541 9.260   1.00 0.00 ? 1173 VAL A N    3  
ATOM 3997  C CA   . VAL A 1 41  ? 0.047   -13.794 8.846   1.00 0.00 ? 1173 VAL A CA   3  
ATOM 3998  C C    . VAL A 1 41  ? 1.016   -12.854 9.555   1.00 0.00 ? 1173 VAL A C    3  
ATOM 3999  O O    . VAL A 1 41  ? 0.734   -11.674 9.763   1.00 0.00 ? 1173 VAL A O    3  
ATOM 4000  C CB   . VAL A 1 41  ? 0.213   -13.633 7.324   1.00 0.00 ? 1173 VAL A CB   3  
ATOM 4001  C CG1  . VAL A 1 41  ? -0.635  -14.655 6.583   1.00 0.00 ? 1173 VAL A CG1  3  
ATOM 4002  C CG2  . VAL A 1 41  ? -0.145  -12.219 6.895   1.00 0.00 ? 1173 VAL A CG2  3  
ATOM 4003  H H    . VAL A 1 41  ? -1.744  -12.682 9.036   1.00 0.00 ? 1173 VAL A H    3  
ATOM 4004  H HA   . VAL A 1 41  ? 0.292   -14.813 9.109   1.00 0.00 ? 1173 VAL A HA   3  
ATOM 4005  H HB   . VAL A 1 41  ? 1.249   -13.811 7.074   1.00 0.00 ? 1173 VAL A HB   3  
ATOM 4006  H HG11 . VAL A 1 41  ? -1.616  -14.242 6.398   1.00 0.00 ? 1173 VAL A HG11 3  
ATOM 4007  H HG12 . VAL A 1 41  ? -0.164  -14.901 5.642   1.00 0.00 ? 1173 VAL A HG12 3  
ATOM 4008  H HG13 . VAL A 1 41  ? -0.729  -15.548 7.183   1.00 0.00 ? 1173 VAL A HG13 3  
ATOM 4009  H HG21 . VAL A 1 41  ? -0.791  -11.772 7.636   1.00 0.00 ? 1173 VAL A HG21 3  
ATOM 4010  H HG22 . VAL A 1 41  ? 0.756   -11.630 6.802   1.00 0.00 ? 1173 VAL A HG22 3  
ATOM 4011  H HG23 . VAL A 1 41  ? -0.655  -12.248 5.943   1.00 0.00 ? 1173 VAL A HG23 3  
ATOM 4012  N N    . PRO A 1 42  ? 2.187   -13.387 9.933   1.00 0.00 ? 1174 PRO A N    3  
ATOM 4013  C CA   . PRO A 1 42  ? 3.223   -12.612 10.623  1.00 0.00 ? 1174 PRO A CA   3  
ATOM 4014  C C    . PRO A 1 42  ? 3.500   -11.277 9.941   1.00 0.00 ? 1174 PRO A C    3  
ATOM 4015  O O    . PRO A 1 42  ? 3.596   -11.187 8.717   1.00 0.00 ? 1174 PRO A O    3  
ATOM 4016  C CB   . PRO A 1 42  ? 4.454   -13.518 10.545  1.00 0.00 ? 1174 PRO A CB   3  
ATOM 4017  C CG   . PRO A 1 42  ? 3.903   -14.898 10.430  1.00 0.00 ? 1174 PRO A CG   3  
ATOM 4018  C CD   . PRO A 1 42  ? 2.590   -14.786 9.717   1.00 0.00 ? 1174 PRO A CD   3  
ATOM 4019  H HA   . PRO A 1 42  ? 2.966   -12.440 11.658  1.00 0.00 ? 1174 PRO A HA   3  
ATOM 4020  H HB2  . PRO A 1 42  ? 5.044   -13.254 9.679   1.00 0.00 ? 1174 PRO A HB2  3  
ATOM 4021  H HB3  . PRO A 1 42  ? 5.047   -13.404 11.440  1.00 0.00 ? 1174 PRO A HB3  3  
ATOM 4022  H HG2  . PRO A 1 42  ? 4.578   -15.516 9.859   1.00 0.00 ? 1174 PRO A HG2  3  
ATOM 4023  H HG3  . PRO A 1 42  ? 3.750   -15.315 11.414  1.00 0.00 ? 1174 PRO A HG3  3  
ATOM 4024  H HD2  . PRO A 1 42  ? 2.719   -14.992 8.665   1.00 0.00 ? 1174 PRO A HD2  3  
ATOM 4025  H HD3  . PRO A 1 42  ? 1.871   -15.466 10.151  1.00 0.00 ? 1174 PRO A HD3  3  
ATOM 4026  N N    . PRO A 1 43  ? 3.632   -10.215 10.749  1.00 0.00 ? 1175 PRO A N    3  
ATOM 4027  C CA   . PRO A 1 43  ? 3.901   -8.865  10.244  1.00 0.00 ? 1175 PRO A CA   3  
ATOM 4028  C C    . PRO A 1 43  ? 5.038   -8.842  9.228   1.00 0.00 ? 1175 PRO A C    3  
ATOM 4029  O O    . PRO A 1 43  ? 5.192   -7.879  8.477   1.00 0.00 ? 1175 PRO A O    3  
ATOM 4030  C CB   . PRO A 1 43  ? 4.293   -8.087  11.503  1.00 0.00 ? 1175 PRO A CB   3  
ATOM 4031  C CG   . PRO A 1 43  ? 3.621   -8.809  12.619  1.00 0.00 ? 1175 PRO A CG   3  
ATOM 4032  C CD   . PRO A 1 43  ? 3.530   -10.250 12.217  1.00 0.00 ? 1175 PRO A CD   3  
ATOM 4033  H HA   . PRO A 1 43  ? 3.018   -8.422  9.806   1.00 0.00 ? 1175 PRO A HA   3  
ATOM 4034  H HB2  . PRO A 1 43  ? 5.368   -8.097  11.615  1.00 0.00 ? 1175 PRO A HB2  3  
ATOM 4035  H HB3  . PRO A 1 43  ? 3.943   -7.069  11.425  1.00 0.00 ? 1175 PRO A HB3  3  
ATOM 4036  H HG2  . PRO A 1 43  ? 4.206   -8.717  13.521  1.00 0.00 ? 1175 PRO A HG2  3  
ATOM 4037  H HG3  . PRO A 1 43  ? 2.629   -8.409  12.770  1.00 0.00 ? 1175 PRO A HG3  3  
ATOM 4038  H HD2  . PRO A 1 43  ? 4.347   -10.809 12.648  1.00 0.00 ? 1175 PRO A HD2  3  
ATOM 4039  H HD3  . PRO A 1 43  ? 2.582   -10.664 12.528  1.00 0.00 ? 1175 PRO A HD3  3  
ATOM 4040  N N    . ALA A 1 44  ? 5.831   -9.908  9.210   1.00 0.00 ? 1176 ALA A N    3  
ATOM 4041  C CA   . ALA A 1 44  ? 6.952   -10.011 8.284   1.00 0.00 ? 1176 ALA A CA   3  
ATOM 4042  C C    . ALA A 1 44  ? 6.552   -10.762 7.019   1.00 0.00 ? 1176 ALA A C    3  
ATOM 4043  O O    . ALA A 1 44  ? 6.941   -10.385 5.913   1.00 0.00 ? 1176 ALA A O    3  
ATOM 4044  C CB   . ALA A 1 44  ? 8.131   -10.697 8.957   1.00 0.00 ? 1176 ALA A CB   3  
ATOM 4045  H H    . ALA A 1 44  ? 5.657   -10.644 9.833   1.00 0.00 ? 1176 ALA A H    3  
ATOM 4046  H HA   . ALA A 1 44  ? 7.255   -9.009  8.015   1.00 0.00 ? 1176 ALA A HA   3  
ATOM 4047  H HB1  . ALA A 1 44  ? 8.140   -10.446 10.008  1.00 0.00 ? 1176 ALA A HB1  3  
ATOM 4048  H HB2  . ALA A 1 44  ? 8.039   -11.766 8.842   1.00 0.00 ? 1176 ALA A HB2  3  
ATOM 4049  H HB3  . ALA A 1 44  ? 9.051   -10.363 8.500   1.00 0.00 ? 1176 ALA A HB3  3  
ATOM 4050  N N    . ILE A 1 45  ? 5.775   -11.826 7.189   1.00 0.00 ? 1177 ILE A N    3  
ATOM 4051  C CA   . ILE A 1 45  ? 5.323   -12.630 6.060   1.00 0.00 ? 1177 ILE A CA   3  
ATOM 4052  C C    . ILE A 1 45  ? 4.555   -11.780 5.053   1.00 0.00 ? 1177 ILE A C    3  
ATOM 4053  O O    . ILE A 1 45  ? 4.751   -11.904 3.843   1.00 0.00 ? 1177 ILE A O    3  
ATOM 4054  C CB   . ILE A 1 45  ? 4.427   -13.794 6.521   1.00 0.00 ? 1177 ILE A CB   3  
ATOM 4055  C CG1  . ILE A 1 45  ? 5.247   -14.818 7.309   1.00 0.00 ? 1177 ILE A CG1  3  
ATOM 4056  C CG2  . ILE A 1 45  ? 3.756   -14.453 5.325   1.00 0.00 ? 1177 ILE A CG2  3  
ATOM 4057  C CD1  . ILE A 1 45  ? 6.317   -15.498 6.484   1.00 0.00 ? 1177 ILE A CD1  3  
ATOM 4058  H H    . ILE A 1 45  ? 5.499   -12.076 8.095   1.00 0.00 ? 1177 ILE A H    3  
ATOM 4059  H HA   . ILE A 1 45  ? 6.196   -13.044 5.575   1.00 0.00 ? 1177 ILE A HA   3  
ATOM 4060  H HB   . ILE A 1 45  ? 3.655   -13.394 7.160   1.00 0.00 ? 1177 ILE A HB   3  
ATOM 4061  H HG12 . ILE A 1 45  ? 5.732   -14.322 8.135   1.00 0.00 ? 1177 ILE A HG12 3  
ATOM 4062  H HG13 . ILE A 1 45  ? 4.586   -15.582 7.690   1.00 0.00 ? 1177 ILE A HG13 3  
ATOM 4063  H HG21 . ILE A 1 45  ? 4.512   -14.853 4.664   1.00 0.00 ? 1177 ILE A HG21 3  
ATOM 4064  H HG22 . ILE A 1 45  ? 3.117   -15.253 5.666   1.00 0.00 ? 1177 ILE A HG22 3  
ATOM 4065  H HG23 . ILE A 1 45  ? 3.166   -13.721 4.794   1.00 0.00 ? 1177 ILE A HG23 3  
ATOM 4066  H HD11 . ILE A 1 45  ? 6.818   -16.242 7.085   1.00 0.00 ? 1177 ILE A HD11 3  
ATOM 4067  H HD12 . ILE A 1 45  ? 5.865   -15.971 5.626   1.00 0.00 ? 1177 ILE A HD12 3  
ATOM 4068  H HD13 . ILE A 1 45  ? 7.037   -14.763 6.151   1.00 0.00 ? 1177 ILE A HD13 3  
ATOM 4069  N N    . LEU A 1 46  ? 3.683   -10.917 5.560   1.00 0.00 ? 1178 LEU A N    3  
ATOM 4070  C CA   . LEU A 1 46  ? 2.886   -10.044 4.704   1.00 0.00 ? 1178 LEU A CA   3  
ATOM 4071  C C    . LEU A 1 46  ? 3.777   -9.250  3.755   1.00 0.00 ? 1178 LEU A C    3  
ATOM 4072  O O    . LEU A 1 46  ? 3.758   -9.467  2.543   1.00 0.00 ? 1178 LEU A O    3  
ATOM 4073  C CB   . LEU A 1 46  ? 2.050   -9.087  5.556   1.00 0.00 ? 1178 LEU A CB   3  
ATOM 4074  C CG   . LEU A 1 46  ? 0.932   -8.341  4.827   1.00 0.00 ? 1178 LEU A CG   3  
ATOM 4075  C CD1  . LEU A 1 46  ? -0.256  -9.261  4.590   1.00 0.00 ? 1178 LEU A CD1  3  
ATOM 4076  C CD2  . LEU A 1 46  ? 0.507   -7.112  5.617   1.00 0.00 ? 1178 LEU A CD2  3  
ATOM 4077  H H    . LEU A 1 46  ? 3.570   -10.864 6.531   1.00 0.00 ? 1178 LEU A H    3  
ATOM 4078  H HA   . LEU A 1 46  ? 2.223   -10.666 4.122   1.00 0.00 ? 1178 LEU A HA   3  
ATOM 4079  H HB2  . LEU A 1 46  ? 1.601   -9.660  6.353   1.00 0.00 ? 1178 LEU A HB2  3  
ATOM 4080  H HB3  . LEU A 1 46  ? 2.720   -8.350  5.978   1.00 0.00 ? 1178 LEU A HB3  3  
ATOM 4081  H HG   . LEU A 1 46  ? 1.296   -8.012  3.864   1.00 0.00 ? 1178 LEU A HG   3  
ATOM 4082  H HD11 . LEU A 1 46  ? 0.002   -9.997  3.843   1.00 0.00 ? 1178 LEU A HD11 3  
ATOM 4083  H HD12 . LEU A 1 46  ? -1.098  -8.679  4.246   1.00 0.00 ? 1178 LEU A HD12 3  
ATOM 4084  H HD13 . LEU A 1 46  ? -0.516  -9.759  5.513   1.00 0.00 ? 1178 LEU A HD13 3  
ATOM 4085  H HD21 . LEU A 1 46  ? 0.033   -6.404  4.953   1.00 0.00 ? 1178 LEU A HD21 3  
ATOM 4086  H HD22 . LEU A 1 46  ? 1.376   -6.656  6.069   1.00 0.00 ? 1178 LEU A HD22 3  
ATOM 4087  H HD23 . LEU A 1 46  ? -0.190  -7.403  6.389   1.00 0.00 ? 1178 LEU A HD23 3  
ATOM 4088  N N    . ALA A 1 47  ? 4.559   -8.332  4.313   1.00 0.00 ? 1179 ALA A N    3  
ATOM 4089  C CA   . ALA A 1 47  ? 5.461   -7.510  3.517   1.00 0.00 ? 1179 ALA A CA   3  
ATOM 4090  C C    . ALA A 1 47  ? 6.629   -7.004  4.357   1.00 0.00 ? 1179 ALA A C    3  
ATOM 4091  O O    . ALA A 1 47  ? 6.435   -6.306  5.353   1.00 0.00 ? 1179 ALA A O    3  
ATOM 4092  C CB   . ALA A 1 47  ? 4.705   -6.341  2.902   1.00 0.00 ? 1179 ALA A CB   3  
ATOM 4093  H H    . ALA A 1 47  ? 4.529   -8.206  5.284   1.00 0.00 ? 1179 ALA A H    3  
ATOM 4094  H HA   . ALA A 1 47  ? 5.847   -8.120  2.713   1.00 0.00 ? 1179 ALA A HA   3  
ATOM 4095  H HB1  . ALA A 1 47  ? 3.659   -6.597  2.812   1.00 0.00 ? 1179 ALA A HB1  3  
ATOM 4096  H HB2  . ALA A 1 47  ? 4.810   -5.472  3.534   1.00 0.00 ? 1179 ALA A HB2  3  
ATOM 4097  H HB3  . ALA A 1 47  ? 5.109   -6.126  1.924   1.00 0.00 ? 1179 ALA A HB3  3  
ATOM 4098  N N    . THR A 1 48  ? 7.843   -7.359  3.949   1.00 0.00 ? 1180 THR A N    3  
ATOM 4099  C CA   . THR A 1 48  ? 9.042   -6.943  4.665   1.00 0.00 ? 1180 THR A CA   3  
ATOM 4100  C C    . THR A 1 48  ? 9.323   -5.460  4.451   1.00 0.00 ? 1180 THR A C    3  
ATOM 4101  O O    . THR A 1 48  ? 8.891   -4.874  3.460   1.00 0.00 ? 1180 THR A O    3  
ATOM 4102  C CB   . THR A 1 48  ? 10.273  -7.756  4.221   1.00 0.00 ? 1180 THR A CB   3  
ATOM 4103  O OG1  . THR A 1 48  ? 11.415  -7.380  4.998   1.00 0.00 ? 1180 THR A OG1  3  
ATOM 4104  C CG2  . THR A 1 48  ? 10.562  -7.537  2.744   1.00 0.00 ? 1180 THR A CG2  3  
ATOM 4105  H H    . THR A 1 48  ? 7.933   -7.916  3.148   1.00 0.00 ? 1180 THR A H    3  
ATOM 4106  H HA   . THR A 1 48  ? 8.880   -7.121  5.718   1.00 0.00 ? 1180 THR A HA   3  
ATOM 4107  H HB   . THR A 1 48  ? 10.068  -8.806  4.381   1.00 0.00 ? 1180 THR A HB   3  
ATOM 4108  H HG1  . THR A 1 48  ? 11.137  -7.155  5.889   1.00 0.00 ? 1180 THR A HG1  3  
ATOM 4109  H HG21 . THR A 1 48  ? 11.384  -6.844  2.637   1.00 0.00 ? 1180 THR A HG21 3  
ATOM 4110  H HG22 . THR A 1 48  ? 9.685   -7.133  2.262   1.00 0.00 ? 1180 THR A HG22 3  
ATOM 4111  H HG23 . THR A 1 48  ? 10.824  -8.478  2.285   1.00 0.00 ? 1180 THR A HG23 3  
ATOM 4112  N N    . ASN A 1 49  ? 10.052  -4.860  5.387   1.00 0.00 ? 1181 ASN A N    3  
ATOM 4113  C CA   . ASN A 1 49  ? 10.391  -3.444  5.300   1.00 0.00 ? 1181 ASN A CA   3  
ATOM 4114  C C    . ASN A 1 49  ? 10.900  -3.091  3.906   1.00 0.00 ? 1181 ASN A C    3  
ATOM 4115  O O    . ASN A 1 49  ? 10.521  -2.069  3.334   1.00 0.00 ? 1181 ASN A O    3  
ATOM 4116  C CB   . ASN A 1 49  ? 11.447  -3.086  6.347   1.00 0.00 ? 1181 ASN A CB   3  
ATOM 4117  C CG   . ASN A 1 49  ? 12.545  -4.128  6.440   1.00 0.00 ? 1181 ASN A CG   3  
ATOM 4118  O OD1  . ASN A 1 49  ? 12.430  -5.102  7.183   1.00 0.00 ? 1181 ASN A OD1  3  
ATOM 4119  N ND2  . ASN A 1 49  ? 13.618  -3.925  5.684   1.00 0.00 ? 1181 ASN A ND2  3  
ATOM 4120  H H    . ASN A 1 49  ? 10.368  -5.380  6.154   1.00 0.00 ? 1181 ASN A H    3  
ATOM 4121  H HA   . ASN A 1 49  ? 9.494   -2.876  5.497   1.00 0.00 ? 1181 ASN A HA   3  
ATOM 4122  H HB2  . ASN A 1 49  ? 11.897  -2.139  6.086   1.00 0.00 ? 1181 ASN A HB2  3  
ATOM 4123  H HB3  . ASN A 1 49  ? 10.974  -3.001  7.314   1.00 0.00 ? 1181 ASN A HB3  3  
ATOM 4124  H HD21 . ASN A 1 49  ? 13.641  -3.127  5.116   1.00 0.00 ? 1181 ASN A HD21 3  
ATOM 4125  H HD22 . ASN A 1 49  ? 14.343  -4.584  5.724   1.00 0.00 ? 1181 ASN A HD22 3  
ATOM 4126  N N    . LYS A 1 50  ? 11.762  -3.945  3.364   1.00 0.00 ? 1182 LYS A N    3  
ATOM 4127  C CA   . LYS A 1 50  ? 12.324  -3.726  2.036   1.00 0.00 ? 1182 LYS A CA   3  
ATOM 4128  C C    . LYS A 1 50  ? 11.227  -3.390  1.030   1.00 0.00 ? 1182 LYS A C    3  
ATOM 4129  O O    . LYS A 1 50  ? 11.306  -2.384  0.325   1.00 0.00 ? 1182 LYS A O    3  
ATOM 4130  C CB   . LYS A 1 50  ? 13.092  -4.966  1.574   1.00 0.00 ? 1182 LYS A CB   3  
ATOM 4131  C CG   . LYS A 1 50  ? 14.055  -4.695  0.431   1.00 0.00 ? 1182 LYS A CG   3  
ATOM 4132  C CD   . LYS A 1 50  ? 15.264  -3.902  0.896   1.00 0.00 ? 1182 LYS A CD   3  
ATOM 4133  C CE   . LYS A 1 50  ? 16.235  -4.774  1.678   1.00 0.00 ? 1182 LYS A CE   3  
ATOM 4134  N NZ   . LYS A 1 50  ? 17.142  -3.963  2.537   1.00 0.00 ? 1182 LYS A NZ   3  
ATOM 4135  H H    . LYS A 1 50  ? 12.027  -4.742  3.869   1.00 0.00 ? 1182 LYS A H    3  
ATOM 4136  H HA   . LYS A 1 50  ? 13.007  -2.892  2.098   1.00 0.00 ? 1182 LYS A HA   3  
ATOM 4137  H HB2  . LYS A 1 50  ? 13.657  -5.356  2.408   1.00 0.00 ? 1182 LYS A HB2  3  
ATOM 4138  H HB3  . LYS A 1 50  ? 12.383  -5.714  1.250   1.00 0.00 ? 1182 LYS A HB3  3  
ATOM 4139  H HG2  . LYS A 1 50  ? 14.390  -5.637  0.023   1.00 0.00 ? 1182 LYS A HG2  3  
ATOM 4140  H HG3  . LYS A 1 50  ? 13.540  -4.132  -0.335  1.00 0.00 ? 1182 LYS A HG3  3  
ATOM 4141  H HD2  . LYS A 1 50  ? 15.775  -3.500  0.034   1.00 0.00 ? 1182 LYS A HD2  3  
ATOM 4142  H HD3  . LYS A 1 50  ? 14.931  -3.092  1.530   1.00 0.00 ? 1182 LYS A HD3  3  
ATOM 4143  H HE2  . LYS A 1 50  ? 15.669  -5.448  2.303   1.00 0.00 ? 1182 LYS A HE2  3  
ATOM 4144  H HE3  . LYS A 1 50  ? 16.829  -5.344  0.980   1.00 0.00 ? 1182 LYS A HE3  3  
ATOM 4145  H HZ1  . LYS A 1 50  ? 16.980  -2.949  2.368   1.00 0.00 ? 1182 LYS A HZ1  3  
ATOM 4146  H HZ2  . LYS A 1 50  ? 18.134  -4.185  2.318   1.00 0.00 ? 1182 LYS A HZ2  3  
ATOM 4147  H HZ3  . LYS A 1 50  ? 16.964  -4.169  3.540   1.00 0.00 ? 1182 LYS A HZ3  3  
ATOM 4148  N N    . ILE A 1 51  ? 10.206  -4.238  0.970   1.00 0.00 ? 1183 ILE A N    3  
ATOM 4149  C CA   . ILE A 1 51  ? 9.093   -4.029  0.053   1.00 0.00 ? 1183 ILE A CA   3  
ATOM 4150  C C    . ILE A 1 51  ? 8.416   -2.686  0.307   1.00 0.00 ? 1183 ILE A C    3  
ATOM 4151  O O    . ILE A 1 51  ? 8.048   -1.977  -0.631  1.00 0.00 ? 1183 ILE A O    3  
ATOM 4152  C CB   . ILE A 1 51  ? 8.045   -5.151  0.174   1.00 0.00 ? 1183 ILE A CB   3  
ATOM 4153  C CG1  . ILE A 1 51  ? 8.645   -6.489  -0.263  1.00 0.00 ? 1183 ILE A CG1  3  
ATOM 4154  C CG2  . ILE A 1 51  ? 6.815   -4.819  -0.657  1.00 0.00 ? 1183 ILE A CG2  3  
ATOM 4155  C CD1  . ILE A 1 51  ? 7.816   -7.686  0.147   1.00 0.00 ? 1183 ILE A CD1  3  
ATOM 4156  H H    . ILE A 1 51  ? 10.200  -5.022  1.558   1.00 0.00 ? 1183 ILE A H    3  
ATOM 4157  H HA   . ILE A 1 51  ? 9.485   -4.038  -0.954  1.00 0.00 ? 1183 ILE A HA   3  
ATOM 4158  H HB   . ILE A 1 51  ? 7.743   -5.221  1.208   1.00 0.00 ? 1183 ILE A HB   3  
ATOM 4159  H HG12 . ILE A 1 51  ? 8.735   -6.501  -1.338  1.00 0.00 ? 1183 ILE A HG12 3  
ATOM 4160  H HG13 . ILE A 1 51  ? 9.625   -6.596  0.178   1.00 0.00 ? 1183 ILE A HG13 3  
ATOM 4161  H HG21 . ILE A 1 51  ? 6.311   -5.732  -0.935  1.00 0.00 ? 1183 ILE A HG21 3  
ATOM 4162  H HG22 . ILE A 1 51  ? 6.145   -4.201  -0.077  1.00 0.00 ? 1183 ILE A HG22 3  
ATOM 4163  H HG23 . ILE A 1 51  ? 7.114   -4.287  -1.548  1.00 0.00 ? 1183 ILE A HG23 3  
ATOM 4164  H HD11 . ILE A 1 51  ? 7.748   -8.377  -0.680  1.00 0.00 ? 1183 ILE A HD11 3  
ATOM 4165  H HD12 . ILE A 1 51  ? 8.280   -8.174  0.990   1.00 0.00 ? 1183 ILE A HD12 3  
ATOM 4166  H HD13 . ILE A 1 51  ? 6.823   -7.358  0.423   1.00 0.00 ? 1183 ILE A HD13 3  
ATOM 4167  N N    . LEU A 1 52  ? 8.256   -2.342  1.580   1.00 0.00 ? 1184 LEU A N    3  
ATOM 4168  C CA   . LEU A 1 52  ? 7.625   -1.082  1.958   1.00 0.00 ? 1184 LEU A CA   3  
ATOM 4169  C C    . LEU A 1 52  ? 8.385   0.104   1.374   1.00 0.00 ? 1184 LEU A C    3  
ATOM 4170  O O    . LEU A 1 52  ? 7.840   0.875   0.582   1.00 0.00 ? 1184 LEU A O    3  
ATOM 4171  C CB   . LEU A 1 52  ? 7.559   -0.960  3.481   1.00 0.00 ? 1184 LEU A CB   3  
ATOM 4172  C CG   . LEU A 1 52  ? 6.674   -1.980  4.199   1.00 0.00 ? 1184 LEU A CG   3  
ATOM 4173  C CD1  . LEU A 1 52  ? 6.773   -1.806  5.706   1.00 0.00 ? 1184 LEU A CD1  3  
ATOM 4174  C CD2  . LEU A 1 52  ? 5.230   -1.851  3.739   1.00 0.00 ? 1184 LEU A CD2  3  
ATOM 4175  H H    . LEU A 1 52  ? 8.570   -2.948  2.282   1.00 0.00 ? 1184 LEU A H    3  
ATOM 4176  H HA   . LEU A 1 52  ? 6.621   -1.083  1.561   1.00 0.00 ? 1184 LEU A HA   3  
ATOM 4177  H HB2  . LEU A 1 52  ? 8.562   -1.064  3.865   1.00 0.00 ? 1184 LEU A HB2  3  
ATOM 4178  H HB3  . LEU A 1 52  ? 7.186   0.027   3.717   1.00 0.00 ? 1184 LEU A HB3  3  
ATOM 4179  H HG   . LEU A 1 52  ? 7.016   -2.977  3.955   1.00 0.00 ? 1184 LEU A HG   3  
ATOM 4180  H HD11 . LEU A 1 52  ? 7.454   -2.540  6.109   1.00 0.00 ? 1184 LEU A HD11 3  
ATOM 4181  H HD12 . LEU A 1 52  ? 5.797   -1.939  6.149   1.00 0.00 ? 1184 LEU A HD12 3  
ATOM 4182  H HD13 . LEU A 1 52  ? 7.138   -0.814  5.931   1.00 0.00 ? 1184 LEU A HD13 3  
ATOM 4183  H HD21 . LEU A 1 52  ? 5.047   -0.839  3.408   1.00 0.00 ? 1184 LEU A HD21 3  
ATOM 4184  H HD22 . LEU A 1 52  ? 4.568   -2.086  4.560   1.00 0.00 ? 1184 LEU A HD22 3  
ATOM 4185  H HD23 . LEU A 1 52  ? 5.049   -2.535  2.923   1.00 0.00 ? 1184 LEU A HD23 3  
ATOM 4186  N N    . VAL A 1 53  ? 9.646   0.245   1.768   1.00 0.00 ? 1185 VAL A N    3  
ATOM 4187  C CA   . VAL A 1 53  ? 10.482  1.336   1.281   1.00 0.00 ? 1185 VAL A CA   3  
ATOM 4188  C C    . VAL A 1 53  ? 10.270  1.567   -0.211  1.00 0.00 ? 1185 VAL A C    3  
ATOM 4189  O O    . VAL A 1 53  ? 10.040  2.694   -0.649  1.00 0.00 ? 1185 VAL A O    3  
ATOM 4190  C CB   . VAL A 1 53  ? 11.975  1.057   1.539   1.00 0.00 ? 1185 VAL A CB   3  
ATOM 4191  C CG1  . VAL A 1 53  ? 12.833  2.180   0.976   1.00 0.00 ? 1185 VAL A CG1  3  
ATOM 4192  C CG2  . VAL A 1 53  ? 12.233  0.873   3.027   1.00 0.00 ? 1185 VAL A CG2  3  
ATOM 4193  H H    . VAL A 1 53  ? 10.024  -0.401  2.400   1.00 0.00 ? 1185 VAL A H    3  
ATOM 4194  H HA   . VAL A 1 53  ? 10.207  2.232   1.817   1.00 0.00 ? 1185 VAL A HA   3  
ATOM 4195  H HB   . VAL A 1 53  ? 12.243  0.142   1.032   1.00 0.00 ? 1185 VAL A HB   3  
ATOM 4196  H HG11 . VAL A 1 53  ? 13.257  1.870   0.032   1.00 0.00 ? 1185 VAL A HG11 3  
ATOM 4197  H HG12 . VAL A 1 53  ? 12.223  3.059   0.827   1.00 0.00 ? 1185 VAL A HG12 3  
ATOM 4198  H HG13 . VAL A 1 53  ? 13.629  2.407   1.670   1.00 0.00 ? 1185 VAL A HG13 3  
ATOM 4199  H HG21 . VAL A 1 53  ? 12.088  1.814   3.536   1.00 0.00 ? 1185 VAL A HG21 3  
ATOM 4200  H HG22 . VAL A 1 53  ? 11.545  0.140   3.423   1.00 0.00 ? 1185 VAL A HG22 3  
ATOM 4201  H HG23 . VAL A 1 53  ? 13.246  0.534   3.178   1.00 0.00 ? 1185 VAL A HG23 3  
ATOM 4202  N N    . ASP A 1 54  ? 10.349  0.492   -0.988  1.00 0.00 ? 1186 ASP A N    3  
ATOM 4203  C CA   . ASP A 1 54  ? 10.164  0.576   -2.432  1.00 0.00 ? 1186 ASP A CA   3  
ATOM 4204  C C    . ASP A 1 54  ? 8.856   1.283   -2.772  1.00 0.00 ? 1186 ASP A C    3  
ATOM 4205  O O    . ASP A 1 54  ? 8.836   2.226   -3.562  1.00 0.00 ? 1186 ASP A O    3  
ATOM 4206  C CB   . ASP A 1 54  ? 10.179  -0.822  -3.052  1.00 0.00 ? 1186 ASP A CB   3  
ATOM 4207  C CG   . ASP A 1 54  ? 11.569  -1.424  -3.089  1.00 0.00 ? 1186 ASP A CG   3  
ATOM 4208  O OD1  . ASP A 1 54  ? 12.326  -1.230  -2.114  1.00 0.00 ? 1186 ASP A OD1  3  
ATOM 4209  O OD2  . ASP A 1 54  ? 11.902  -2.089  -4.092  1.00 0.00 ? 1186 ASP A OD2  3  
ATOM 4210  H H    . ASP A 1 54  ? 10.535  -0.380  -0.580  1.00 0.00 ? 1186 ASP A H    3  
ATOM 4211  H HA   . ASP A 1 54  ? 10.984  1.149   -2.838  1.00 0.00 ? 1186 ASP A HA   3  
ATOM 4212  H HB2  . ASP A 1 54  ? 9.540   -1.473  -2.472  1.00 0.00 ? 1186 ASP A HB2  3  
ATOM 4213  H HB3  . ASP A 1 54  ? 9.804   -0.764  -4.063  1.00 0.00 ? 1186 ASP A HB3  3  
ATOM 4214  N N    . MET A 1 55  ? 7.765   0.820   -2.170  1.00 0.00 ? 1187 MET A N    3  
ATOM 4215  C CA   . MET A 1 55  ? 6.452   1.409   -2.409  1.00 0.00 ? 1187 MET A CA   3  
ATOM 4216  C C    . MET A 1 55  ? 6.464   2.904   -2.109  1.00 0.00 ? 1187 MET A C    3  
ATOM 4217  O O    . MET A 1 55  ? 5.816   3.690   -2.800  1.00 0.00 ? 1187 MET A O    3  
ATOM 4218  C CB   . MET A 1 55  ? 5.394   0.713   -1.550  1.00 0.00 ? 1187 MET A CB   3  
ATOM 4219  C CG   . MET A 1 55  ? 5.239   -0.767  -1.858  1.00 0.00 ? 1187 MET A CG   3  
ATOM 4220  S SD   . MET A 1 55  ? 3.975   -1.558  -0.844  1.00 0.00 ? 1187 MET A SD   3  
ATOM 4221  C CE   . MET A 1 55  ? 2.483   -0.945  -1.623  1.00 0.00 ? 1187 MET A CE   3  
ATOM 4222  H H    . MET A 1 55  ? 7.844   0.066   -1.549  1.00 0.00 ? 1187 MET A H    3  
ATOM 4223  H HA   . MET A 1 55  ? 6.210   1.264   -3.451  1.00 0.00 ? 1187 MET A HA   3  
ATOM 4224  H HB2  . MET A 1 55  ? 5.666   0.816   -0.511  1.00 0.00 ? 1187 MET A HB2  3  
ATOM 4225  H HB3  . MET A 1 55  ? 4.441   1.194   -1.714  1.00 0.00 ? 1187 MET A HB3  3  
ATOM 4226  H HG2  . MET A 1 55  ? 4.967   -0.879  -2.897  1.00 0.00 ? 1187 MET A HG2  3  
ATOM 4227  H HG3  . MET A 1 55  ? 6.184   -1.258  -1.680  1.00 0.00 ? 1187 MET A HG3  3  
ATOM 4228  H HE1  . MET A 1 55  ? 2.670   -0.769  -2.672  1.00 0.00 ? 1187 MET A HE1  3  
ATOM 4229  H HE2  . MET A 1 55  ? 1.695   -1.675  -1.516  1.00 0.00 ? 1187 MET A HE2  3  
ATOM 4230  H HE3  . MET A 1 55  ? 2.185   -0.020  -1.151  1.00 0.00 ? 1187 MET A HE3  3  
ATOM 4231  N N    . ALA A 1 56  ? 7.205   3.290   -1.076  1.00 0.00 ? 1188 ALA A N    3  
ATOM 4232  C CA   . ALA A 1 56  ? 7.303   4.692   -0.687  1.00 0.00 ? 1188 ALA A CA   3  
ATOM 4233  C C    . ALA A 1 56  ? 8.054   5.502   -1.737  1.00 0.00 ? 1188 ALA A C    3  
ATOM 4234  O O    . ALA A 1 56  ? 7.773   6.684   -1.943  1.00 0.00 ? 1188 ALA A O    3  
ATOM 4235  C CB   . ALA A 1 56  ? 7.985   4.817   0.667   1.00 0.00 ? 1188 ALA A CB   3  
ATOM 4236  H H    . ALA A 1 56  ? 7.699   2.617   -0.564  1.00 0.00 ? 1188 ALA A H    3  
ATOM 4237  H HA   . ALA A 1 56  ? 6.299   5.083   -0.594  1.00 0.00 ? 1188 ALA A HA   3  
ATOM 4238  H HB1  . ALA A 1 56  ? 9.004   4.466   0.589   1.00 0.00 ? 1188 ALA A HB1  3  
ATOM 4239  H HB2  . ALA A 1 56  ? 7.983   5.852   0.977   1.00 0.00 ? 1188 ALA A HB2  3  
ATOM 4240  H HB3  . ALA A 1 56  ? 7.454   4.222   1.395   1.00 0.00 ? 1188 ALA A HB3  3  
ATOM 4241  N N    . LYS A 1 57  ? 9.010   4.861   -2.400  1.00 0.00 ? 1189 LYS A N    3  
ATOM 4242  C CA   . LYS A 1 57  ? 9.802   5.522   -3.431  1.00 0.00 ? 1189 LYS A CA   3  
ATOM 4243  C C    . LYS A 1 57  ? 9.021   5.621   -4.738  1.00 0.00 ? 1189 LYS A C    3  
ATOM 4244  O O    . LYS A 1 57  ? 8.719   6.717   -5.209  1.00 0.00 ? 1189 LYS A O    3  
ATOM 4245  C CB   . LYS A 1 57  ? 11.110  4.762   -3.663  1.00 0.00 ? 1189 LYS A CB   3  
ATOM 4246  C CG   . LYS A 1 57  ? 11.970  4.636   -2.417  1.00 0.00 ? 1189 LYS A CG   3  
ATOM 4247  C CD   . LYS A 1 57  ? 13.301  3.971   -2.723  1.00 0.00 ? 1189 LYS A CD   3  
ATOM 4248  C CE   . LYS A 1 57  ? 13.130  2.486   -3.004  1.00 0.00 ? 1189 LYS A CE   3  
ATOM 4249  N NZ   . LYS A 1 57  ? 14.388  1.869   -3.509  1.00 0.00 ? 1189 LYS A NZ   3  
ATOM 4250  H H    . LYS A 1 57  ? 9.187   3.919   -2.192  1.00 0.00 ? 1189 LYS A H    3  
ATOM 4251  H HA   . LYS A 1 57  ? 10.031  6.518   -3.086  1.00 0.00 ? 1189 LYS A HA   3  
ATOM 4252  H HB2  . LYS A 1 57  ? 10.878  3.768   -4.016  1.00 0.00 ? 1189 LYS A HB2  3  
ATOM 4253  H HB3  . LYS A 1 57  ? 11.683  5.279   -4.420  1.00 0.00 ? 1189 LYS A HB3  3  
ATOM 4254  H HG2  . LYS A 1 57  ? 12.156  5.623   -2.018  1.00 0.00 ? 1189 LYS A HG2  3  
ATOM 4255  H HG3  . LYS A 1 57  ? 11.441  4.044   -1.684  1.00 0.00 ? 1189 LYS A HG3  3  
ATOM 4256  H HD2  . LYS A 1 57  ? 13.739  4.442   -3.590  1.00 0.00 ? 1189 LYS A HD2  3  
ATOM 4257  H HD3  . LYS A 1 57  ? 13.958  4.094   -1.874  1.00 0.00 ? 1189 LYS A HD3  3  
ATOM 4258  H HE2  . LYS A 1 57  ? 12.837  1.991   -2.091  1.00 0.00 ? 1189 LYS A HE2  3  
ATOM 4259  H HE3  . LYS A 1 57  ? 12.355  2.361   -3.746  1.00 0.00 ? 1189 LYS A HE3  3  
ATOM 4260  H HZ1  . LYS A 1 57  ? 15.042  1.694   -2.719  1.00 0.00 ? 1189 LYS A HZ1  3  
ATOM 4261  H HZ2  . LYS A 1 57  ? 14.849  2.504   -4.191  1.00 0.00 ? 1189 LYS A HZ2  3  
ATOM 4262  H HZ3  . LYS A 1 57  ? 14.179  0.965   -3.978  1.00 0.00 ? 1189 LYS A HZ3  3  
ATOM 4263  N N    . MET A 1 58  ? 8.696   4.469   -5.316  1.00 0.00 ? 1190 MET A N    3  
ATOM 4264  C CA   . MET A 1 58  ? 7.948   4.428   -6.567  1.00 0.00 ? 1190 MET A CA   3  
ATOM 4265  C C    . MET A 1 58  ? 6.554   5.020   -6.387  1.00 0.00 ? 1190 MET A C    3  
ATOM 4266  O O    . MET A 1 58  ? 6.051   5.726   -7.261  1.00 0.00 ? 1190 MET A O    3  
ATOM 4267  C CB   . MET A 1 58  ? 7.841   2.988   -7.075  1.00 0.00 ? 1190 MET A CB   3  
ATOM 4268  C CG   . MET A 1 58  ? 9.185   2.357   -7.399  1.00 0.00 ? 1190 MET A CG   3  
ATOM 4269  S SD   . MET A 1 58  ? 9.026   0.694   -8.077  1.00 0.00 ? 1190 MET A SD   3  
ATOM 4270  C CE   . MET A 1 58  ? 10.411  -0.126  -7.291  1.00 0.00 ? 1190 MET A CE   3  
ATOM 4271  H H    . MET A 1 58  ? 8.965   3.628   -4.893  1.00 0.00 ? 1190 MET A H    3  
ATOM 4272  H HA   . MET A 1 58  ? 8.485   5.017   -7.295  1.00 0.00 ? 1190 MET A HA   3  
ATOM 4273  H HB2  . MET A 1 58  ? 7.358   2.388   -6.319  1.00 0.00 ? 1190 MET A HB2  3  
ATOM 4274  H HB3  . MET A 1 58  ? 7.238   2.979   -7.971  1.00 0.00 ? 1190 MET A HB3  3  
ATOM 4275  H HG2  . MET A 1 58  ? 9.695   2.977   -8.121  1.00 0.00 ? 1190 MET A HG2  3  
ATOM 4276  H HG3  . MET A 1 58  ? 9.771   2.307   -6.493  1.00 0.00 ? 1190 MET A HG3  3  
ATOM 4277  H HE1  . MET A 1 58  ? 11.292  0.492   -7.378  1.00 0.00 ? 1190 MET A HE1  3  
ATOM 4278  H HE2  . MET A 1 58  ? 10.187  -0.290  -6.248  1.00 0.00 ? 1190 MET A HE2  3  
ATOM 4279  H HE3  . MET A 1 58  ? 10.588  -1.076  -7.775  1.00 0.00 ? 1190 MET A HE3  3  
ATOM 4280  N N    . ARG A 1 59  ? 5.935   4.729   -5.247  1.00 0.00 ? 1191 ARG A N    3  
ATOM 4281  C CA   . ARG A 1 59  ? 4.598   5.232   -4.954  1.00 0.00 ? 1191 ARG A CA   3  
ATOM 4282  C C    . ARG A 1 59  ? 3.569   4.627   -5.904  1.00 0.00 ? 1191 ARG A C    3  
ATOM 4283  O O    . ARG A 1 59  ? 2.820   5.334   -6.579  1.00 0.00 ? 1191 ARG A O    3  
ATOM 4284  C CB   . ARG A 1 59  ? 4.570   6.758   -5.058  1.00 0.00 ? 1191 ARG A CB   3  
ATOM 4285  C CG   . ARG A 1 59  ? 5.719   7.439   -4.332  1.00 0.00 ? 1191 ARG A CG   3  
ATOM 4286  C CD   . ARG A 1 59  ? 5.364   8.866   -3.944  1.00 0.00 ? 1191 ARG A CD   3  
ATOM 4287  N NE   . ARG A 1 59  ? 6.540   9.730   -3.901  1.00 0.00 ? 1191 ARG A NE   3  
ATOM 4288  C CZ   . ARG A 1 59  ? 7.338   9.834   -2.843  1.00 0.00 ? 1191 ARG A CZ   3  
ATOM 4289  N NH1  . ARG A 1 59  ? 7.086   9.131   -1.748  1.00 0.00 ? 1191 ARG A NH1  3  
ATOM 4290  N NH2  . ARG A 1 59  ? 8.390   10.642  -2.881  1.00 0.00 ? 1191 ARG A NH2  3  
ATOM 4291  H H    . ARG A 1 59  ? 6.387   4.161   -4.589  1.00 0.00 ? 1191 ARG A H    3  
ATOM 4292  H HA   . ARG A 1 59  ? 4.350   4.945   -3.943  1.00 0.00 ? 1191 ARG A HA   3  
ATOM 4293  H HB2  . ARG A 1 59  ? 4.617   7.037   -6.101  1.00 0.00 ? 1191 ARG A HB2  3  
ATOM 4294  H HB3  . ARG A 1 59  ? 3.643   7.118   -4.638  1.00 0.00 ? 1191 ARG A HB3  3  
ATOM 4295  H HG2  . ARG A 1 59  ? 5.948   6.881   -3.436  1.00 0.00 ? 1191 ARG A HG2  3  
ATOM 4296  H HG3  . ARG A 1 59  ? 6.582   7.456   -4.980  1.00 0.00 ? 1191 ARG A HG3  3  
ATOM 4297  H HD2  . ARG A 1 59  ? 4.667   9.259   -4.668  1.00 0.00 ? 1191 ARG A HD2  3  
ATOM 4298  H HD3  . ARG A 1 59  ? 4.901   8.855   -2.968  1.00 0.00 ? 1191 ARG A HD3  3  
ATOM 4299  H HE   . ARG A 1 59  ? 6.745   10.259  -4.700  1.00 0.00 ? 1191 ARG A HE   3  
ATOM 4300  H HH11 . ARG A 1 59  ? 6.295   8.521   -1.717  1.00 0.00 ? 1191 ARG A HH11 3  
ATOM 4301  H HH12 . ARG A 1 59  ? 7.689   9.211   -0.953  1.00 0.00 ? 1191 ARG A HH12 3  
ATOM 4302  H HH21 . ARG A 1 59  ? 8.582   11.173  -3.705  1.00 0.00 ? 1191 ARG A HH21 3  
ATOM 4303  H HH22 . ARG A 1 59  ? 8.989   10.720  -2.085  1.00 0.00 ? 1191 ARG A HH22 3  
ATOM 4304  N N    . PRO A 1 60  ? 3.529   3.288   -5.959  1.00 0.00 ? 1192 PRO A N    3  
ATOM 4305  C CA   . PRO A 1 60  ? 2.596   2.559   -6.823  1.00 0.00 ? 1192 PRO A CA   3  
ATOM 4306  C C    . PRO A 1 60  ? 1.151   2.680   -6.349  1.00 0.00 ? 1192 PRO A C    3  
ATOM 4307  O O    . PRO A 1 60  ? 0.849   2.443   -5.179  1.00 0.00 ? 1192 PRO A O    3  
ATOM 4308  C CB   . PRO A 1 60  ? 3.074   1.108   -6.717  1.00 0.00 ? 1192 PRO A CB   3  
ATOM 4309  C CG   . PRO A 1 60  ? 3.764   1.032   -5.399  1.00 0.00 ? 1192 PRO A CG   3  
ATOM 4310  C CD   . PRO A 1 60  ? 4.391   2.382   -5.182  1.00 0.00 ? 1192 PRO A CD   3  
ATOM 4311  H HA   . PRO A 1 60  ? 2.665   2.888   -7.849  1.00 0.00 ? 1192 PRO A HA   3  
ATOM 4312  H HB2  . PRO A 1 60  ? 2.223   0.442   -6.757  1.00 0.00 ? 1192 PRO A HB2  3  
ATOM 4313  H HB3  . PRO A 1 60  ? 3.749   0.888   -7.530  1.00 0.00 ? 1192 PRO A HB3  3  
ATOM 4314  H HG2  . PRO A 1 60  ? 3.048   0.822   -4.620  1.00 0.00 ? 1192 PRO A HG2  3  
ATOM 4315  H HG3  . PRO A 1 60  ? 4.525   0.266   -5.427  1.00 0.00 ? 1192 PRO A HG3  3  
ATOM 4316  H HD2  . PRO A 1 60  ? 4.377   2.641   -4.134  1.00 0.00 ? 1192 PRO A HD2  3  
ATOM 4317  H HD3  . PRO A 1 60  ? 5.403   2.394   -5.562  1.00 0.00 ? 1192 PRO A HD3  3  
ATOM 4318  N N    . THR A 1 61  ? 0.262   3.049   -7.265  1.00 0.00 ? 1193 THR A N    3  
ATOM 4319  C CA   . THR A 1 61  ? -1.151  3.202   -6.940  1.00 0.00 ? 1193 THR A CA   3  
ATOM 4320  C C    . THR A 1 61  ? -1.970  2.037   -7.484  1.00 0.00 ? 1193 THR A C    3  
ATOM 4321  O O    . THR A 1 61  ? -3.032  1.710   -6.954  1.00 0.00 ? 1193 THR A O    3  
ATOM 4322  C CB   . THR A 1 61  ? -1.717  4.520   -7.502  1.00 0.00 ? 1193 THR A CB   3  
ATOM 4323  O OG1  . THR A 1 61  ? -1.504  4.581   -8.917  1.00 0.00 ? 1193 THR A OG1  3  
ATOM 4324  C CG2  . THR A 1 61  ? -1.063  5.719   -6.833  1.00 0.00 ? 1193 THR A CG2  3  
ATOM 4325  H H    . THR A 1 61  ? 0.564   3.223   -8.180  1.00 0.00 ? 1193 THR A H    3  
ATOM 4326  H HA   . THR A 1 61  ? -1.245  3.224   -5.864  1.00 0.00 ? 1193 THR A HA   3  
ATOM 4327  H HB   . THR A 1 61  ? -2.779  4.551   -7.304  1.00 0.00 ? 1193 THR A HB   3  
ATOM 4328  H HG1  . THR A 1 61  ? -2.294  4.283   -9.373  1.00 0.00 ? 1193 THR A HG1  3  
ATOM 4329  H HG21 . THR A 1 61  ? 0.007   5.674   -6.979  1.00 0.00 ? 1193 THR A HG21 3  
ATOM 4330  H HG22 . THR A 1 61  ? -1.283  5.707   -5.776  1.00 0.00 ? 1193 THR A HG22 3  
ATOM 4331  H HG23 . THR A 1 61  ? -1.446  6.628   -7.270  1.00 0.00 ? 1193 THR A HG23 3  
ATOM 4332  N N    . THR A 1 62  ? -1.469  1.413   -8.546  1.00 0.00 ? 1194 THR A N    3  
ATOM 4333  C CA   . THR A 1 62  ? -2.154  0.284   -9.162  1.00 0.00 ? 1194 THR A CA   3  
ATOM 4334  C C    . THR A 1 62  ? -1.421  -1.023  -8.884  1.00 0.00 ? 1194 THR A C    3  
ATOM 4335  O O    . THR A 1 62  ? -0.199  -1.042  -8.736  1.00 0.00 ? 1194 THR A O    3  
ATOM 4336  C CB   . THR A 1 62  ? -2.286  0.471   -10.686 1.00 0.00 ? 1194 THR A CB   3  
ATOM 4337  O OG1  . THR A 1 62  ? -0.988  0.506   -11.289 1.00 0.00 ? 1194 THR A OG1  3  
ATOM 4338  C CG2  . THR A 1 62  ? -3.037  1.754   -11.011 1.00 0.00 ? 1194 THR A CG2  3  
ATOM 4339  H H    . THR A 1 62  ? -0.618  1.721   -8.923  1.00 0.00 ? 1194 THR A H    3  
ATOM 4340  H HA   . THR A 1 62  ? -3.147  0.226   -8.741  1.00 0.00 ? 1194 THR A HA   3  
ATOM 4341  H HB   . THR A 1 62  ? -2.840  -0.365  -11.089 1.00 0.00 ? 1194 THR A HB   3  
ATOM 4342  H HG1  . THR A 1 62  ? -1.063  0.291   -12.222 1.00 0.00 ? 1194 THR A HG1  3  
ATOM 4343  H HG21 . THR A 1 62  ? -3.521  2.123   -10.119 1.00 0.00 ? 1194 THR A HG21 3  
ATOM 4344  H HG22 . THR A 1 62  ? -3.780  1.554   -11.768 1.00 0.00 ? 1194 THR A HG22 3  
ATOM 4345  H HG23 . THR A 1 62  ? -2.341  2.495   -11.375 1.00 0.00 ? 1194 THR A HG23 3  
ATOM 4346  N N    . VAL A 1 63  ? -2.175  -2.116  -8.814  1.00 0.00 ? 1195 VAL A N    3  
ATOM 4347  C CA   . VAL A 1 63  ? -1.597  -3.428  -8.555  1.00 0.00 ? 1195 VAL A CA   3  
ATOM 4348  C C    . VAL A 1 63  ? -0.561  -3.791  -9.613  1.00 0.00 ? 1195 VAL A C    3  
ATOM 4349  O O    . VAL A 1 63  ? 0.363   -4.561  -9.353  1.00 0.00 ? 1195 VAL A O    3  
ATOM 4350  C CB   . VAL A 1 63  ? -2.681  -4.522  -8.517  1.00 0.00 ? 1195 VAL A CB   3  
ATOM 4351  C CG1  . VAL A 1 63  ? -3.298  -4.710  -9.894  1.00 0.00 ? 1195 VAL A CG1  3  
ATOM 4352  C CG2  . VAL A 1 63  ? -2.100  -5.830  -8.000  1.00 0.00 ? 1195 VAL A CG2  3  
ATOM 4353  H H    . VAL A 1 63  ? -3.144  -2.037  -8.940  1.00 0.00 ? 1195 VAL A H    3  
ATOM 4354  H HA   . VAL A 1 63  ? -1.114  -3.396  -7.589  1.00 0.00 ? 1195 VAL A HA   3  
ATOM 4355  H HB   . VAL A 1 63  ? -3.459  -4.205  -7.838  1.00 0.00 ? 1195 VAL A HB   3  
ATOM 4356  H HG11 . VAL A 1 63  ? -3.071  -5.702  -10.257 1.00 0.00 ? 1195 VAL A HG11 3  
ATOM 4357  H HG12 . VAL A 1 63  ? -4.369  -4.585  -9.829  1.00 0.00 ? 1195 VAL A HG12 3  
ATOM 4358  H HG13 . VAL A 1 63  ? -2.890  -3.977  -10.574 1.00 0.00 ? 1195 VAL A HG13 3  
ATOM 4359  H HG21 . VAL A 1 63  ? -2.554  -6.657  -8.525  1.00 0.00 ? 1195 VAL A HG21 3  
ATOM 4360  H HG22 . VAL A 1 63  ? -1.032  -5.841  -8.167  1.00 0.00 ? 1195 VAL A HG22 3  
ATOM 4361  H HG23 . VAL A 1 63  ? -2.299  -5.920  -6.943  1.00 0.00 ? 1195 VAL A HG23 3  
ATOM 4362  N N    . GLU A 1 64  ? -0.722  -3.230  -10.808 1.00 0.00 ? 1196 GLU A N    3  
ATOM 4363  C CA   . GLU A 1 64  ? 0.199   -3.496  -11.906 1.00 0.00 ? 1196 GLU A CA   3  
ATOM 4364  C C    . GLU A 1 64  ? 1.628   -3.122  -11.520 1.00 0.00 ? 1196 GLU A C    3  
ATOM 4365  O O    . GLU A 1 64  ? 2.565   -3.882  -11.760 1.00 0.00 ? 1196 GLU A O    3  
ATOM 4366  C CB   . GLU A 1 64  ? -0.223  -2.718  -13.154 1.00 0.00 ? 1196 GLU A CB   3  
ATOM 4367  C CG   . GLU A 1 64  ? -1.235  -3.454  -14.016 1.00 0.00 ? 1196 GLU A CG   3  
ATOM 4368  C CD   . GLU A 1 64  ? -1.693  -2.634  -15.207 1.00 0.00 ? 1196 GLU A CD   3  
ATOM 4369  O OE1  . GLU A 1 64  ? -1.968  -1.429  -15.026 1.00 0.00 ? 1196 GLU A OE1  3  
ATOM 4370  O OE2  . GLU A 1 64  ? -1.777  -3.197  -16.318 1.00 0.00 ? 1196 GLU A OE2  3  
ATOM 4371  H H    . GLU A 1 64  ? -1.479  -2.625  -10.954 1.00 0.00 ? 1196 GLU A H    3  
ATOM 4372  H HA   . GLU A 1 64  ? 0.162   -4.553  -12.122 1.00 0.00 ? 1196 GLU A HA   3  
ATOM 4373  H HB2  . GLU A 1 64  ? -0.656  -1.778  -12.849 1.00 0.00 ? 1196 GLU A HB2  3  
ATOM 4374  H HB3  . GLU A 1 64  ? 0.654   -2.522  -13.754 1.00 0.00 ? 1196 GLU A HB3  3  
ATOM 4375  H HG2  . GLU A 1 64  ? -0.785  -4.366  -14.379 1.00 0.00 ? 1196 GLU A HG2  3  
ATOM 4376  H HG3  . GLU A 1 64  ? -2.097  -3.695  -13.411 1.00 0.00 ? 1196 GLU A HG3  3  
ATOM 4377  N N    . ASN A 1 65  ? 1.784   -1.946  -10.920 1.00 0.00 ? 1197 ASN A N    3  
ATOM 4378  C CA   . ASN A 1 65  ? 3.098   -1.471  -10.502 1.00 0.00 ? 1197 ASN A CA   3  
ATOM 4379  C C    . ASN A 1 65  ? 3.584   -2.229  -9.271  1.00 0.00 ? 1197 ASN A C    3  
ATOM 4380  O O    . ASN A 1 65  ? 4.744   -2.636  -9.196  1.00 0.00 ? 1197 ASN A O    3  
ATOM 4381  C CB   . ASN A 1 65  ? 3.049   0.029   -10.204 1.00 0.00 ? 1197 ASN A CB   3  
ATOM 4382  C CG   . ASN A 1 65  ? 3.166   0.872   -11.460 1.00 0.00 ? 1197 ASN A CG   3  
ATOM 4383  O OD1  . ASN A 1 65  ? 4.196   0.862   -12.134 1.00 0.00 ? 1197 ASN A OD1  3  
ATOM 4384  N ND2  . ASN A 1 65  ? 2.107   1.606   -11.780 1.00 0.00 ? 1197 ASN A ND2  3  
ATOM 4385  H H    . ASN A 1 65  ? 0.998   -1.385  -10.756 1.00 0.00 ? 1197 ASN A H    3  
ATOM 4386  H HA   . ASN A 1 65  ? 3.788   -1.646  -11.314 1.00 0.00 ? 1197 ASN A HA   3  
ATOM 4387  H HB2  . ASN A 1 65  ? 2.112   0.264   -9.722  1.00 0.00 ? 1197 ASN A HB2  3  
ATOM 4388  H HB3  . ASN A 1 65  ? 3.863   0.286   -9.543  1.00 0.00 ? 1197 ASN A HB3  3  
ATOM 4389  H HD21 . ASN A 1 65  ? 1.320   1.564   -11.196 1.00 0.00 ? 1197 ASN A HD21 3  
ATOM 4390  H HD22 . ASN A 1 65  ? 2.155   2.160   -12.587 1.00 0.00 ? 1197 ASN A HD22 3  
ATOM 4391  N N    . VAL A 1 66  ? 2.689   -2.417  -8.306  1.00 0.00 ? 1198 VAL A N    3  
ATOM 4392  C CA   . VAL A 1 66  ? 3.025   -3.128  -7.078  1.00 0.00 ? 1198 VAL A CA   3  
ATOM 4393  C C    . VAL A 1 66  ? 3.828   -4.389  -7.376  1.00 0.00 ? 1198 VAL A C    3  
ATOM 4394  O O    . VAL A 1 66  ? 4.830   -4.671  -6.719  1.00 0.00 ? 1198 VAL A O    3  
ATOM 4395  C CB   . VAL A 1 66  ? 1.760   -3.512  -6.288  1.00 0.00 ? 1198 VAL A CB   3  
ATOM 4396  C CG1  . VAL A 1 66  ? 2.120   -4.387  -5.096  1.00 0.00 ? 1198 VAL A CG1  3  
ATOM 4397  C CG2  . VAL A 1 66  ? 1.015   -2.264  -5.838  1.00 0.00 ? 1198 VAL A CG2  3  
ATOM 4398  H H    . VAL A 1 66  ? 1.780   -2.069  -8.423  1.00 0.00 ? 1198 VAL A H    3  
ATOM 4399  H HA   . VAL A 1 66  ? 3.622   -2.470  -6.464  1.00 0.00 ? 1198 VAL A HA   3  
ATOM 4400  H HB   . VAL A 1 66  ? 1.111   -4.078  -6.939  1.00 0.00 ? 1198 VAL A HB   3  
ATOM 4401  H HG11 . VAL A 1 66  ? 1.222   -4.829  -4.691  1.00 0.00 ? 1198 VAL A HG11 3  
ATOM 4402  H HG12 . VAL A 1 66  ? 2.797   -5.167  -5.413  1.00 0.00 ? 1198 VAL A HG12 3  
ATOM 4403  H HG13 . VAL A 1 66  ? 2.597   -3.783  -4.338  1.00 0.00 ? 1198 VAL A HG13 3  
ATOM 4404  H HG21 . VAL A 1 66  ? 0.007   -2.289  -6.225  1.00 0.00 ? 1198 VAL A HG21 3  
ATOM 4405  H HG22 . VAL A 1 66  ? 0.985   -2.232  -4.758  1.00 0.00 ? 1198 VAL A HG22 3  
ATOM 4406  H HG23 . VAL A 1 66  ? 1.522   -1.387  -6.210  1.00 0.00 ? 1198 VAL A HG23 3  
ATOM 4407  N N    . LYS A 1 67  ? 3.381   -5.146  -8.373  1.00 0.00 ? 1199 LYS A N    3  
ATOM 4408  C CA   . LYS A 1 67  ? 4.057   -6.378  -8.761  1.00 0.00 ? 1199 LYS A CA   3  
ATOM 4409  C C    . LYS A 1 67  ? 5.513   -6.107  -9.128  1.00 0.00 ? 1199 LYS A C    3  
ATOM 4410  O O    . LYS A 1 67  ? 6.393   -6.924  -8.857  1.00 0.00 ? 1199 LYS A O    3  
ATOM 4411  C CB   . LYS A 1 67  ? 3.335   -7.031  -9.942  1.00 0.00 ? 1199 LYS A CB   3  
ATOM 4412  C CG   . LYS A 1 67  ? 2.005   -7.661  -9.568  1.00 0.00 ? 1199 LYS A CG   3  
ATOM 4413  C CD   . LYS A 1 67  ? 1.032   -7.643  -10.735 1.00 0.00 ? 1199 LYS A CD   3  
ATOM 4414  C CE   . LYS A 1 67  ? 0.061   -8.811  -10.670 1.00 0.00 ? 1199 LYS A CE   3  
ATOM 4415  N NZ   . LYS A 1 67  ? 0.620   -10.033 -11.312 1.00 0.00 ? 1199 LYS A NZ   3  
ATOM 4416  H H    . LYS A 1 67  ? 2.576   -4.869  -8.860  1.00 0.00 ? 1199 LYS A H    3  
ATOM 4417  H HA   . LYS A 1 67  ? 4.031   -7.051  -7.917  1.00 0.00 ? 1199 LYS A HA   3  
ATOM 4418  H HB2  . LYS A 1 67  ? 3.155   -6.280  -10.697 1.00 0.00 ? 1199 LYS A HB2  3  
ATOM 4419  H HB3  . LYS A 1 67  ? 3.971   -7.800  -10.356 1.00 0.00 ? 1199 LYS A HB3  3  
ATOM 4420  H HG2  . LYS A 1 67  ? 2.173   -8.685  -9.270  1.00 0.00 ? 1199 LYS A HG2  3  
ATOM 4421  H HG3  . LYS A 1 67  ? 1.575   -7.110  -8.744  1.00 0.00 ? 1199 LYS A HG3  3  
ATOM 4422  H HD2  . LYS A 1 67  ? 0.470   -6.721  -10.710 1.00 0.00 ? 1199 LYS A HD2  3  
ATOM 4423  H HD3  . LYS A 1 67  ? 1.590   -7.701  -11.659 1.00 0.00 ? 1199 LYS A HD3  3  
ATOM 4424  H HE2  . LYS A 1 67  ? -0.155  -9.026  -9.635  1.00 0.00 ? 1199 LYS A HE2  3  
ATOM 4425  H HE3  . LYS A 1 67  ? -0.851  -8.533  -11.177 1.00 0.00 ? 1199 LYS A HE3  3  
ATOM 4426  H HZ1  . LYS A 1 67  ? -0.152  -10.664 -11.611 1.00 0.00 ? 1199 LYS A HZ1  3  
ATOM 4427  H HZ2  . LYS A 1 67  ? 1.228   -10.543 -10.641 1.00 0.00 ? 1199 LYS A HZ2  3  
ATOM 4428  H HZ3  . LYS A 1 67  ? 1.183   -9.773  -12.146 1.00 0.00 ? 1199 LYS A HZ3  3  
ATOM 4429  N N    . ARG A 1 68  ? 5.758   -4.956  -9.744  1.00 0.00 ? 1200 ARG A N    3  
ATOM 4430  C CA   . ARG A 1 68  ? 7.107   -4.578  -10.148 1.00 0.00 ? 1200 ARG A CA   3  
ATOM 4431  C C    . ARG A 1 68  ? 7.978   -4.286  -8.929  1.00 0.00 ? 1200 ARG A C    3  
ATOM 4432  O O    . ARG A 1 68  ? 9.201   -4.418  -8.982  1.00 0.00 ? 1200 ARG A O    3  
ATOM 4433  C CB   . ARG A 1 68  ? 7.064   -3.352  -11.062 1.00 0.00 ? 1200 ARG A CB   3  
ATOM 4434  C CG   . ARG A 1 68  ? 6.341   -3.598  -12.377 1.00 0.00 ? 1200 ARG A CG   3  
ATOM 4435  C CD   . ARG A 1 68  ? 6.039   -2.294  -13.099 1.00 0.00 ? 1200 ARG A CD   3  
ATOM 4436  N NE   . ARG A 1 68  ? 5.364   -2.518  -14.374 1.00 0.00 ? 1200 ARG A NE   3  
ATOM 4437  C CZ   . ARG A 1 68  ? 5.998   -2.854  -15.492 1.00 0.00 ? 1200 ARG A CZ   3  
ATOM 4438  N NH1  . ARG A 1 68  ? 7.315   -3.004  -15.492 1.00 0.00 ? 1200 ARG A NH1  3  
ATOM 4439  N NH2  . ARG A 1 68  ? 5.314   -3.041  -16.614 1.00 0.00 ? 1200 ARG A NH2  3  
ATOM 4440  H H    . ARG A 1 68  ? 5.015   -4.346  -9.933  1.00 0.00 ? 1200 ARG A H    3  
ATOM 4441  H HA   . ARG A 1 68  ? 7.536   -5.407  -10.692 1.00 0.00 ? 1200 ARG A HA   3  
ATOM 4442  H HB2  . ARG A 1 68  ? 6.561   -2.549  -10.545 1.00 0.00 ? 1200 ARG A HB2  3  
ATOM 4443  H HB3  . ARG A 1 68  ? 8.076   -3.048  -11.285 1.00 0.00 ? 1200 ARG A HB3  3  
ATOM 4444  H HG2  . ARG A 1 68  ? 6.964   -4.211  -13.011 1.00 0.00 ? 1200 ARG A HG2  3  
ATOM 4445  H HG3  . ARG A 1 68  ? 5.413   -4.111  -12.175 1.00 0.00 ? 1200 ARG A HG3  3  
ATOM 4446  H HD2  . ARG A 1 68  ? 5.406   -1.687  -12.469 1.00 0.00 ? 1200 ARG A HD2  3  
ATOM 4447  H HD3  . ARG A 1 68  ? 6.969   -1.775  -13.280 1.00 0.00 ? 1200 ARG A HD3  3  
ATOM 4448  H HE   . ARG A 1 68  ? 4.391   -2.412  -14.397 1.00 0.00 ? 1200 ARG A HE   3  
ATOM 4449  H HH11 . ARG A 1 68  ? 7.833   -2.865  -14.648 1.00 0.00 ? 1200 ARG A HH11 3  
ATOM 4450  H HH12 . ARG A 1 68  ? 7.790   -3.259  -16.335 1.00 0.00 ? 1200 ARG A HH12 3  
ATOM 4451  H HH21 . ARG A 1 68  ? 4.321   -2.929  -16.618 1.00 0.00 ? 1200 ARG A HH21 3  
ATOM 4452  H HH22 . ARG A 1 68  ? 5.792   -3.294  -17.454 1.00 0.00 ? 1200 ARG A HH22 3  
ATOM 4453  N N    . ILE A 1 69  ? 7.339   -3.889  -7.834  1.00 0.00 ? 1201 ILE A N    3  
ATOM 4454  C CA   . ILE A 1 69  ? 8.055   -3.580  -6.603  1.00 0.00 ? 1201 ILE A CA   3  
ATOM 4455  C C    . ILE A 1 69  ? 8.918   -4.756  -6.158  1.00 0.00 ? 1201 ILE A C    3  
ATOM 4456  O O    . ILE A 1 69  ? 8.429   -5.696  -5.532  1.00 0.00 ? 1201 ILE A O    3  
ATOM 4457  C CB   . ILE A 1 69  ? 7.085   -3.211  -5.465  1.00 0.00 ? 1201 ILE A CB   3  
ATOM 4458  C CG1  . ILE A 1 69  ? 6.253   -1.987  -5.852  1.00 0.00 ? 1201 ILE A CG1  3  
ATOM 4459  C CG2  . ILE A 1 69  ? 7.853   -2.950  -4.178  1.00 0.00 ? 1201 ILE A CG2  3  
ATOM 4460  C CD1  . ILE A 1 69  ? 7.053   -0.704  -5.906  1.00 0.00 ? 1201 ILE A CD1  3  
ATOM 4461  H H    . ILE A 1 69  ? 6.364   -3.804  -7.854  1.00 0.00 ? 1201 ILE A H    3  
ATOM 4462  H HA   . ILE A 1 69  ? 8.695   -2.730  -6.794  1.00 0.00 ? 1201 ILE A HA   3  
ATOM 4463  H HB   . ILE A 1 69  ? 6.425   -4.048  -5.298  1.00 0.00 ? 1201 ILE A HB   3  
ATOM 4464  H HG12 . ILE A 1 69  ? 5.819   -2.147  -6.826  1.00 0.00 ? 1201 ILE A HG12 3  
ATOM 4465  H HG13 . ILE A 1 69  ? 5.462   -1.855  -5.128  1.00 0.00 ? 1201 ILE A HG13 3  
ATOM 4466  H HG21 . ILE A 1 69  ? 7.850   -1.891  -3.965  1.00 0.00 ? 1201 ILE A HG21 3  
ATOM 4467  H HG22 . ILE A 1 69  ? 7.382   -3.480  -3.364  1.00 0.00 ? 1201 ILE A HG22 3  
ATOM 4468  H HG23 . ILE A 1 69  ? 8.871   -3.292  -4.290  1.00 0.00 ? 1201 ILE A HG23 3  
ATOM 4469  H HD11 . ILE A 1 69  ? 8.069   -0.925  -6.197  1.00 0.00 ? 1201 ILE A HD11 3  
ATOM 4470  H HD12 . ILE A 1 69  ? 6.610   -0.032  -6.626  1.00 0.00 ? 1201 ILE A HD12 3  
ATOM 4471  H HD13 . ILE A 1 69  ? 7.052   -0.238  -4.931  1.00 0.00 ? 1201 ILE A HD13 3  
ATOM 4472  N N    . ASP A 1 70  ? 10.205  -4.695  -6.485  1.00 0.00 ? 1202 ASP A N    3  
ATOM 4473  C CA   . ASP A 1 70  ? 11.137  -5.754  -6.117  1.00 0.00 ? 1202 ASP A CA   3  
ATOM 4474  C C    . ASP A 1 70  ? 10.771  -6.355  -4.763  1.00 0.00 ? 1202 ASP A C    3  
ATOM 4475  O O    . ASP A 1 70  ? 10.324  -5.650  -3.860  1.00 0.00 ? 1202 ASP A O    3  
ATOM 4476  C CB   . ASP A 1 70  ? 12.567  -5.212  -6.078  1.00 0.00 ? 1202 ASP A CB   3  
ATOM 4477  C CG   . ASP A 1 70  ? 13.603  -6.297  -6.299  1.00 0.00 ? 1202 ASP A CG   3  
ATOM 4478  O OD1  . ASP A 1 70  ? 13.372  -7.439  -5.850  1.00 0.00 ? 1202 ASP A OD1  3  
ATOM 4479  O OD2  . ASP A 1 70  ? 14.645  -6.003  -6.921  1.00 0.00 ? 1202 ASP A OD2  3  
ATOM 4480  H H    . ASP A 1 70  ? 10.535  -3.920  -6.985  1.00 0.00 ? 1202 ASP A H    3  
ATOM 4481  H HA   . ASP A 1 70  ? 11.076  -6.527  -6.868  1.00 0.00 ? 1202 ASP A HA   3  
ATOM 4482  H HB2  . ASP A 1 70  ? 12.684  -4.466  -6.850  1.00 0.00 ? 1202 ASP A HB2  3  
ATOM 4483  H HB3  . ASP A 1 70  ? 12.747  -4.758  -5.114  1.00 0.00 ? 1202 ASP A HB3  3  
ATOM 4484  N N    . GLY A 1 71  ? 10.963  -7.664  -4.631  1.00 0.00 ? 1203 GLY A N    3  
ATOM 4485  C CA   . GLY A 1 71  ? 10.646  -8.338  -3.386  1.00 0.00 ? 1203 GLY A CA   3  
ATOM 4486  C C    . GLY A 1 71  ? 9.303   -9.039  -3.431  1.00 0.00 ? 1203 GLY A C    3  
ATOM 4487  O O    . GLY A 1 71  ? 9.182   -10.193 -3.021  1.00 0.00 ? 1203 GLY A O    3  
ATOM 4488  H H    . GLY A 1 71  ? 11.322  -8.176  -5.386  1.00 0.00 ? 1203 GLY A H    3  
ATOM 4489  H HA2  . GLY A 1 71  ? 11.414  -9.068  -3.178  1.00 0.00 ? 1203 GLY A HA2  3  
ATOM 4490  H HA3  . GLY A 1 71  ? 10.632  -7.609  -2.589  1.00 0.00 ? 1203 GLY A HA3  3  
ATOM 4491  N N    . VAL A 1 72  ? 8.288   -8.339  -3.929  1.00 0.00 ? 1204 VAL A N    3  
ATOM 4492  C CA   . VAL A 1 72  ? 6.946   -8.901  -4.026  1.00 0.00 ? 1204 VAL A CA   3  
ATOM 4493  C C    . VAL A 1 72  ? 6.843   -9.881  -5.189  1.00 0.00 ? 1204 VAL A C    3  
ATOM 4494  O O    . VAL A 1 72  ? 7.431   -9.667  -6.249  1.00 0.00 ? 1204 VAL A O    3  
ATOM 4495  C CB   . VAL A 1 72  ? 5.887   -7.797  -4.205  1.00 0.00 ? 1204 VAL A CB   3  
ATOM 4496  C CG1  . VAL A 1 72  ? 6.033   -7.132  -5.565  1.00 0.00 ? 1204 VAL A CG1  3  
ATOM 4497  C CG2  . VAL A 1 72  ? 4.488   -8.367  -4.028  1.00 0.00 ? 1204 VAL A CG2  3  
ATOM 4498  H H    . VAL A 1 72  ? 8.446   -7.423  -4.240  1.00 0.00 ? 1204 VAL A H    3  
ATOM 4499  H HA   . VAL A 1 72  ? 6.737   -9.426  -3.105  1.00 0.00 ? 1204 VAL A HA   3  
ATOM 4500  H HB   . VAL A 1 72  ? 6.046   -7.047  -3.443  1.00 0.00 ? 1204 VAL A HB   3  
ATOM 4501  H HG11 . VAL A 1 72  ? 5.234   -7.461  -6.213  1.00 0.00 ? 1204 VAL A HG11 3  
ATOM 4502  H HG12 . VAL A 1 72  ? 5.985   -6.059  -5.449  1.00 0.00 ? 1204 VAL A HG12 3  
ATOM 4503  H HG13 . VAL A 1 72  ? 6.984   -7.405  -5.999  1.00 0.00 ? 1204 VAL A HG13 3  
ATOM 4504  H HG21 . VAL A 1 72  ? 4.395   -8.790  -3.038  1.00 0.00 ? 1204 VAL A HG21 3  
ATOM 4505  H HG22 . VAL A 1 72  ? 3.759   -7.580  -4.153  1.00 0.00 ? 1204 VAL A HG22 3  
ATOM 4506  H HG23 . VAL A 1 72  ? 4.317   -9.137  -4.766  1.00 0.00 ? 1204 VAL A HG23 3  
ATOM 4507  N N    . SER A 1 73  ? 6.093   -10.959 -4.983  1.00 0.00 ? 1205 SER A N    3  
ATOM 4508  C CA   . SER A 1 73  ? 5.915   -11.975 -6.013  1.00 0.00 ? 1205 SER A CA   3  
ATOM 4509  C C    . SER A 1 73  ? 4.582   -11.792 -6.732  1.00 0.00 ? 1205 SER A C    3  
ATOM 4510  O O    . SER A 1 73  ? 3.634   -11.243 -6.173  1.00 0.00 ? 1205 SER A O    3  
ATOM 4511  C CB   . SER A 1 73  ? 5.988   -13.374 -5.397  1.00 0.00 ? 1205 SER A CB   3  
ATOM 4512  O OG   . SER A 1 73  ? 5.767   -14.374 -6.376  1.00 0.00 ? 1205 SER A OG   3  
ATOM 4513  H H    . SER A 1 73  ? 5.650   -11.073 -4.116  1.00 0.00 ? 1205 SER A H    3  
ATOM 4514  H HA   . SER A 1 73  ? 6.715   -11.864 -6.729  1.00 0.00 ? 1205 SER A HA   3  
ATOM 4515  H HB2  . SER A 1 73  ? 6.964   -13.522 -4.962  1.00 0.00 ? 1205 SER A HB2  3  
ATOM 4516  H HB3  . SER A 1 73  ? 5.233   -13.465 -4.629  1.00 0.00 ? 1205 SER A HB3  3  
ATOM 4517  H HG   . SER A 1 73  ? 6.372   -14.244 -7.110  1.00 0.00 ? 1205 SER A HG   3  
ATOM 4518  N N    . GLU A 1 74  ? 4.519   -12.258 -7.976  1.00 0.00 ? 1206 GLU A N    3  
ATOM 4519  C CA   . GLU A 1 74  ? 3.303   -12.145 -8.772  1.00 0.00 ? 1206 GLU A CA   3  
ATOM 4520  C C    . GLU A 1 74  ? 2.100   -12.693 -8.009  1.00 0.00 ? 1206 GLU A C    3  
ATOM 4521  O O    . GLU A 1 74  ? 2.216   -13.659 -7.257  1.00 0.00 ? 1206 GLU A O    3  
ATOM 4522  C CB   . GLU A 1 74  ? 3.463   -12.892 -10.098 1.00 0.00 ? 1206 GLU A CB   3  
ATOM 4523  C CG   . GLU A 1 74  ? 4.023   -12.032 -11.218 1.00 0.00 ? 1206 GLU A CG   3  
ATOM 4524  C CD   . GLU A 1 74  ? 5.472   -11.647 -10.990 1.00 0.00 ? 1206 GLU A CD   3  
ATOM 4525  O OE1  . GLU A 1 74  ? 5.716   -10.635 -10.300 1.00 0.00 ? 1206 GLU A OE1  3  
ATOM 4526  O OE2  . GLU A 1 74  ? 6.362   -12.359 -11.502 1.00 0.00 ? 1206 GLU A OE2  3  
ATOM 4527  H H    . GLU A 1 74  ? 5.309   -12.686 -8.367  1.00 0.00 ? 1206 GLU A H    3  
ATOM 4528  H HA   . GLU A 1 74  ? 3.137   -11.098 -8.978  1.00 0.00 ? 1206 GLU A HA   3  
ATOM 4529  H HB2  . GLU A 1 74  ? 4.129   -13.729 -9.947  1.00 0.00 ? 1206 GLU A HB2  3  
ATOM 4530  H HB3  . GLU A 1 74  ? 2.497   -13.264 -10.406 1.00 0.00 ? 1206 GLU A HB3  3  
ATOM 4531  H HG2  . GLU A 1 74  ? 3.954   -12.580 -12.145 1.00 0.00 ? 1206 GLU A HG2  3  
ATOM 4532  H HG3  . GLU A 1 74  ? 3.433   -11.129 -11.290 1.00 0.00 ? 1206 GLU A HG3  3  
ATOM 4533  N N    . GLY A 1 75  ? 0.944   -12.067 -8.210  1.00 0.00 ? 1207 GLY A N    3  
ATOM 4534  C CA   . GLY A 1 75  ? -0.263  -12.504 -7.534  1.00 0.00 ? 1207 GLY A CA   3  
ATOM 4535  C C    . GLY A 1 75  ? -0.377  -11.944 -6.130  1.00 0.00 ? 1207 GLY A C    3  
ATOM 4536  O O    . GLY A 1 75  ? -1.371  -11.303 -5.788  1.00 0.00 ? 1207 GLY A O    3  
ATOM 4537  H H    . GLY A 1 75  ? 0.911   -11.302 -8.821  1.00 0.00 ? 1207 GLY A H    3  
ATOM 4538  H HA2  . GLY A 1 75  ? -1.120  -12.185 -8.108  1.00 0.00 ? 1207 GLY A HA2  3  
ATOM 4539  H HA3  . GLY A 1 75  ? -0.261  -13.583 -7.479  1.00 0.00 ? 1207 GLY A HA3  3  
ATOM 4540  N N    . LYS A 1 76  ? 0.642   -12.188 -5.313  1.00 0.00 ? 1208 LYS A N    3  
ATOM 4541  C CA   . LYS A 1 76  ? 0.653   -11.704 -3.938  1.00 0.00 ? 1208 LYS A CA   3  
ATOM 4542  C C    . LYS A 1 76  ? 0.192   -10.252 -3.868  1.00 0.00 ? 1208 LYS A C    3  
ATOM 4543  O O    . LYS A 1 76  ? -0.674  -9.903  -3.066  1.00 0.00 ? 1208 LYS A O    3  
ATOM 4544  C CB   . LYS A 1 76  ? 2.056   -11.834 -3.341  1.00 0.00 ? 1208 LYS A CB   3  
ATOM 4545  C CG   . LYS A 1 76  ? 2.206   -11.162 -1.987  1.00 0.00 ? 1208 LYS A CG   3  
ATOM 4546  C CD   . LYS A 1 76  ? 3.665   -11.053 -1.577  1.00 0.00 ? 1208 LYS A CD   3  
ATOM 4547  C CE   . LYS A 1 76  ? 4.183   -12.365 -1.008  1.00 0.00 ? 1208 LYS A CE   3  
ATOM 4548  N NZ   . LYS A 1 76  ? 4.672   -13.279 -2.077  1.00 0.00 ? 1208 LYS A NZ   3  
ATOM 4549  H H    . LYS A 1 76  ? 1.406   -12.705 -5.644  1.00 0.00 ? 1208 LYS A H    3  
ATOM 4550  H HA   . LYS A 1 76  ? -0.030  -12.314 -3.366  1.00 0.00 ? 1208 LYS A HA   3  
ATOM 4551  H HB2  . LYS A 1 76  ? 2.290   -12.882 -3.227  1.00 0.00 ? 1208 LYS A HB2  3  
ATOM 4552  H HB3  . LYS A 1 76  ? 2.767   -11.388 -4.022  1.00 0.00 ? 1208 LYS A HB3  3  
ATOM 4553  H HG2  . LYS A 1 76  ? 1.783   -10.169 -2.039  1.00 0.00 ? 1208 LYS A HG2  3  
ATOM 4554  H HG3  . LYS A 1 76  ? 1.675   -11.743 -1.246  1.00 0.00 ? 1208 LYS A HG3  3  
ATOM 4555  H HD2  . LYS A 1 76  ? 4.255   -10.792 -2.443  1.00 0.00 ? 1208 LYS A HD2  3  
ATOM 4556  H HD3  . LYS A 1 76  ? 3.763   -10.282 -0.826  1.00 0.00 ? 1208 LYS A HD3  3  
ATOM 4557  H HE2  . LYS A 1 76  ? 4.995   -12.152 -0.329  1.00 0.00 ? 1208 LYS A HE2  3  
ATOM 4558  H HE3  . LYS A 1 76  ? 3.382   -12.850 -0.470  1.00 0.00 ? 1208 LYS A HE3  3  
ATOM 4559  H HZ1  . LYS A 1 76  ? 4.258   -14.225 -1.955  1.00 0.00 ? 1208 LYS A HZ1  3  
ATOM 4560  H HZ2  . LYS A 1 76  ? 5.708   -13.359 -2.033  1.00 0.00 ? 1208 LYS A HZ2  3  
ATOM 4561  H HZ3  . LYS A 1 76  ? 4.403   -12.912 -3.012  1.00 0.00 ? 1208 LYS A HZ3  3  
ATOM 4562  N N    . ALA A 1 77  ? 0.775   -9.409  -4.714  1.00 0.00 ? 1209 ALA A N    3  
ATOM 4563  C CA   . ALA A 1 77  ? 0.422   -7.996  -4.750  1.00 0.00 ? 1209 ALA A CA   3  
ATOM 4564  C C    . ALA A 1 77  ? -1.061  -7.793  -4.456  1.00 0.00 ? 1209 ALA A C    3  
ATOM 4565  O O    . ALA A 1 77  ? -1.431  -6.966  -3.624  1.00 0.00 ? 1209 ALA A O    3  
ATOM 4566  C CB   . ALA A 1 77  ? 0.780   -7.396  -6.102  1.00 0.00 ? 1209 ALA A CB   3  
ATOM 4567  H H    . ALA A 1 77  ? 1.459   -9.747  -5.329  1.00 0.00 ? 1209 ALA A H    3  
ATOM 4568  H HA   . ALA A 1 77  ? 1.001   -7.487  -3.993  1.00 0.00 ? 1209 ALA A HA   3  
ATOM 4569  H HB1  . ALA A 1 77  ? 1.761   -6.947  -6.047  1.00 0.00 ? 1209 ALA A HB1  3  
ATOM 4570  H HB2  . ALA A 1 77  ? 0.781   -8.174  -6.851  1.00 0.00 ? 1209 ALA A HB2  3  
ATOM 4571  H HB3  . ALA A 1 77  ? 0.053   -6.643  -6.366  1.00 0.00 ? 1209 ALA A HB3  3  
ATOM 4572  N N    . ALA A 1 78  ? -1.905  -8.553  -5.145  1.00 0.00 ? 1210 ALA A N    3  
ATOM 4573  C CA   . ALA A 1 78  ? -3.348  -8.458  -4.957  1.00 0.00 ? 1210 ALA A CA   3  
ATOM 4574  C C    . ALA A 1 78  ? -3.696  -8.240  -3.488  1.00 0.00 ? 1210 ALA A C    3  
ATOM 4575  O O    . ALA A 1 78  ? -4.216  -7.189  -3.113  1.00 0.00 ? 1210 ALA A O    3  
ATOM 4576  C CB   . ALA A 1 78  ? -4.033  -9.710  -5.484  1.00 0.00 ? 1210 ALA A CB   3  
ATOM 4577  H H    . ALA A 1 78  ? -1.550  -9.195  -5.795  1.00 0.00 ? 1210 ALA A H    3  
ATOM 4578  H HA   . ALA A 1 78  ? -3.704  -7.614  -5.530  1.00 0.00 ? 1210 ALA A HA   3  
ATOM 4579  H HB1  . ALA A 1 78  ? -5.057  -9.479  -5.737  1.00 0.00 ? 1210 ALA A HB1  3  
ATOM 4580  H HB2  . ALA A 1 78  ? -3.514  -10.061 -6.363  1.00 0.00 ? 1210 ALA A HB2  3  
ATOM 4581  H HB3  . ALA A 1 78  ? -4.014  -10.477 -4.724  1.00 0.00 ? 1210 ALA A HB3  3  
ATOM 4582  N N    . MET A 1 79  ? -3.407  -9.240  -2.662  1.00 0.00 ? 1211 MET A N    3  
ATOM 4583  C CA   . MET A 1 79  ? -3.690  -9.156  -1.233  1.00 0.00 ? 1211 MET A CA   3  
ATOM 4584  C C    . MET A 1 79  ? -3.091  -7.887  -0.634  1.00 0.00 ? 1211 MET A C    3  
ATOM 4585  O O    . MET A 1 79  ? -3.574  -7.379  0.379   1.00 0.00 ? 1211 MET A O    3  
ATOM 4586  C CB   . MET A 1 79  ? -3.138  -10.385 -0.510  1.00 0.00 ? 1211 MET A CB   3  
ATOM 4587  C CG   . MET A 1 79  ? -1.657  -10.283 -0.181  1.00 0.00 ? 1211 MET A CG   3  
ATOM 4588  S SD   . MET A 1 79  ? -0.845  -11.893 -0.126  1.00 0.00 ? 1211 MET A SD   3  
ATOM 4589  C CE   . MET A 1 79  ? 0.456   -11.575 1.063   1.00 0.00 ? 1211 MET A CE   3  
ATOM 4590  H H    . MET A 1 79  ? -2.993  -10.053 -3.020  1.00 0.00 ? 1211 MET A H    3  
ATOM 4591  H HA   . MET A 1 79  ? -4.762  -9.127  -1.109  1.00 0.00 ? 1211 MET A HA   3  
ATOM 4592  H HB2  . MET A 1 79  ? -3.681  -10.519 0.414   1.00 0.00 ? 1211 MET A HB2  3  
ATOM 4593  H HB3  . MET A 1 79  ? -3.286  -11.254 -1.134  1.00 0.00 ? 1211 MET A HB3  3  
ATOM 4594  H HG2  . MET A 1 79  ? -1.175  -9.679  -0.935  1.00 0.00 ? 1211 MET A HG2  3  
ATOM 4595  H HG3  . MET A 1 79  ? -1.549  -9.807  0.782   1.00 0.00 ? 1211 MET A HG3  3  
ATOM 4596  H HE1  . MET A 1 79  ? 1.290   -12.233 0.869   1.00 0.00 ? 1211 MET A HE1  3  
ATOM 4597  H HE2  . MET A 1 79  ? 0.780   -10.548 0.975   1.00 0.00 ? 1211 MET A HE2  3  
ATOM 4598  H HE3  . MET A 1 79  ? 0.083   -11.751 2.061   1.00 0.00 ? 1211 MET A HE3  3  
ATOM 4599  N N    . LEU A 1 80  ? -2.037  -7.381  -1.265  1.00 0.00 ? 1212 LEU A N    3  
ATOM 4600  C CA   . LEU A 1 80  ? -1.372  -6.171  -0.793  1.00 0.00 ? 1212 LEU A CA   3  
ATOM 4601  C C    . LEU A 1 80  ? -2.032  -4.925  -1.375  1.00 0.00 ? 1212 LEU A C    3  
ATOM 4602  O O    . LEU A 1 80  ? -1.370  -3.917  -1.621  1.00 0.00 ? 1212 LEU A O    3  
ATOM 4603  C CB   . LEU A 1 80  ? 0.110   -6.200  -1.171  1.00 0.00 ? 1212 LEU A CB   3  
ATOM 4604  C CG   . LEU A 1 80  ? 0.925   -7.362  -0.602  1.00 0.00 ? 1212 LEU A CG   3  
ATOM 4605  C CD1  . LEU A 1 80  ? 2.272   -7.461  -1.300  1.00 0.00 ? 1212 LEU A CD1  3  
ATOM 4606  C CD2  . LEU A 1 80  ? 1.110   -7.199  0.899   1.00 0.00 ? 1212 LEU A CD2  3  
ATOM 4607  H H    . LEU A 1 80  ? -1.698  -7.830  -2.067  1.00 0.00 ? 1212 LEU A H    3  
ATOM 4608  H HA   . LEU A 1 80  ? -1.461  -6.142  0.282   1.00 0.00 ? 1212 LEU A HA   3  
ATOM 4609  H HB2  . LEU A 1 80  ? 0.176   -6.245  -2.247  1.00 0.00 ? 1212 LEU A HB2  3  
ATOM 4610  H HB3  . LEU A 1 80  ? 0.557   -5.280  -0.823  1.00 0.00 ? 1212 LEU A HB3  3  
ATOM 4611  H HG   . LEU A 1 80  ? 0.391   -8.287  -0.776  1.00 0.00 ? 1212 LEU A HG   3  
ATOM 4612  H HD11 . LEU A 1 80  ? 2.965   -6.770  -0.844  1.00 0.00 ? 1212 LEU A HD11 3  
ATOM 4613  H HD12 . LEU A 1 80  ? 2.155   -7.217  -2.345  1.00 0.00 ? 1212 LEU A HD12 3  
ATOM 4614  H HD13 . LEU A 1 80  ? 2.653   -8.468  -1.206  1.00 0.00 ? 1212 LEU A HD13 3  
ATOM 4615  H HD21 . LEU A 1 80  ? 2.163   -7.118  1.125   1.00 0.00 ? 1212 LEU A HD21 3  
ATOM 4616  H HD22 . LEU A 1 80  ? 0.699   -8.059  1.408   1.00 0.00 ? 1212 LEU A HD22 3  
ATOM 4617  H HD23 . LEU A 1 80  ? 0.601   -6.307  1.230   1.00 0.00 ? 1212 LEU A HD23 3  
ATOM 4618  N N    . ALA A 1 81  ? -3.341  -5.001  -1.590  1.00 0.00 ? 1213 ALA A N    3  
ATOM 4619  C CA   . ALA A 1 81  ? -4.092  -3.878  -2.139  1.00 0.00 ? 1213 ALA A CA   3  
ATOM 4620  C C    . ALA A 1 81  ? -4.206  -2.746  -1.124  1.00 0.00 ? 1213 ALA A C    3  
ATOM 4621  O O    . ALA A 1 81  ? -3.867  -1.595  -1.401  1.00 0.00 ? 1213 ALA A O    3  
ATOM 4622  C CB   . ALA A 1 81  ? -5.475  -4.333  -2.582  1.00 0.00 ? 1213 ALA A CB   3  
ATOM 4623  H H    . ALA A 1 81  ? -3.814  -5.831  -1.374  1.00 0.00 ? 1213 ALA A H    3  
ATOM 4624  H HA   . ALA A 1 81  ? -3.563  -3.516  -3.009  1.00 0.00 ? 1213 ALA A HA   3  
ATOM 4625  H HB1  . ALA A 1 81  ? -6.225  -3.730  -2.091  1.00 0.00 ? 1213 ALA A HB1  3  
ATOM 4626  H HB2  . ALA A 1 81  ? -5.565  -4.221  -3.652  1.00 0.00 ? 1213 ALA A HB2  3  
ATOM 4627  H HB3  . ALA A 1 81  ? -5.614  -5.370  -2.315  1.00 0.00 ? 1213 ALA A HB3  3  
ATOM 4628  N N    . PRO A 1 82  ? -4.694  -3.076  0.081   1.00 0.00 ? 1214 PRO A N    3  
ATOM 4629  C CA   . PRO A 1 82  ? -4.864  -2.101  1.162   1.00 0.00 ? 1214 PRO A CA   3  
ATOM 4630  C C    . PRO A 1 82  ? -3.622  -1.240  1.365   1.00 0.00 ? 1214 PRO A C    3  
ATOM 4631  O O    . PRO A 1 82  ? -3.685  -0.178  1.987   1.00 0.00 ? 1214 PRO A O    3  
ATOM 4632  C CB   . PRO A 1 82  ? -5.116  -2.975  2.393   1.00 0.00 ? 1214 PRO A CB   3  
ATOM 4633  C CG   . PRO A 1 82  ? -5.695  -4.236  1.849   1.00 0.00 ? 1214 PRO A CG   3  
ATOM 4634  C CD   . PRO A 1 82  ? -5.118  -4.429  0.481   1.00 0.00 ? 1214 PRO A CD   3  
ATOM 4635  H HA   . PRO A 1 82  ? -5.719  -1.463  0.990   1.00 0.00 ? 1214 PRO A HA   3  
ATOM 4636  H HB2  . PRO A 1 82  ? -4.182  -3.157  2.906   1.00 0.00 ? 1214 PRO A HB2  3  
ATOM 4637  H HB3  . PRO A 1 82  ? -5.807  -2.477  3.056   1.00 0.00 ? 1214 PRO A HB3  3  
ATOM 4638  H HG2  . PRO A 1 82  ? -5.423  -5.067  2.482   1.00 0.00 ? 1214 PRO A HG2  3  
ATOM 4639  H HG3  . PRO A 1 82  ? -6.769  -4.148  1.784   1.00 0.00 ? 1214 PRO A HG3  3  
ATOM 4640  H HD2  . PRO A 1 82  ? -4.273  -5.101  0.524   1.00 0.00 ? 1214 PRO A HD2  3  
ATOM 4641  H HD3  . PRO A 1 82  ? -5.872  -4.811  -0.191  1.00 0.00 ? 1214 PRO A HD3  3  
ATOM 4642  N N    . LEU A 1 83  ? -2.494  -1.703  0.839   1.00 0.00 ? 1215 LEU A N    3  
ATOM 4643  C CA   . LEU A 1 83  ? -1.236  -0.974  0.963   1.00 0.00 ? 1215 LEU A CA   3  
ATOM 4644  C C    . LEU A 1 83  ? -1.152  0.146   -0.069  1.00 0.00 ? 1215 LEU A C    3  
ATOM 4645  O O    . LEU A 1 83  ? -1.122  1.326   0.282   1.00 0.00 ? 1215 LEU A O    3  
ATOM 4646  C CB   . LEU A 1 83  ? -0.052  -1.928  0.794   1.00 0.00 ? 1215 LEU A CB   3  
ATOM 4647  C CG   . LEU A 1 83  ? 0.309   -2.771  2.018   1.00 0.00 ? 1215 LEU A CG   3  
ATOM 4648  C CD1  . LEU A 1 83  ? -0.666  -3.928  2.176   1.00 0.00 ? 1215 LEU A CD1  3  
ATOM 4649  C CD2  . LEU A 1 83  ? 1.737   -3.287  1.907   1.00 0.00 ? 1215 LEU A CD2  3  
ATOM 4650  H H    . LEU A 1 83  ? -2.506  -2.554  0.355   1.00 0.00 ? 1215 LEU A H    3  
ATOM 4651  H HA   . LEU A 1 83  ? -1.201  -0.540  1.951   1.00 0.00 ? 1215 LEU A HA   3  
ATOM 4652  H HB2  . LEU A 1 83  ? -0.284  -2.603  -0.015  1.00 0.00 ? 1215 LEU A HB2  3  
ATOM 4653  H HB3  . LEU A 1 83  ? 0.813   -1.337  0.531   1.00 0.00 ? 1215 LEU A HB3  3  
ATOM 4654  H HG   . LEU A 1 83  ? 0.243   -2.155  2.904   1.00 0.00 ? 1215 LEU A HG   3  
ATOM 4655  H HD11 . LEU A 1 83  ? -1.459  -3.639  2.849   1.00 0.00 ? 1215 LEU A HD11 3  
ATOM 4656  H HD12 . LEU A 1 83  ? -0.146  -4.784  2.578   1.00 0.00 ? 1215 LEU A HD12 3  
ATOM 4657  H HD13 . LEU A 1 83  ? -1.084  -4.180  1.213   1.00 0.00 ? 1215 LEU A HD13 3  
ATOM 4658  H HD21 . LEU A 1 83  ? 2.234   -3.176  2.859   1.00 0.00 ? 1215 LEU A HD21 3  
ATOM 4659  H HD22 . LEU A 1 83  ? 2.267   -2.719  1.156   1.00 0.00 ? 1215 LEU A HD22 3  
ATOM 4660  H HD23 . LEU A 1 83  ? 1.722   -4.329  1.627   1.00 0.00 ? 1215 LEU A HD23 3  
ATOM 4661  N N    . TRP A 1 84  ? -1.116  -0.231  -1.342  1.00 0.00 ? 1216 TRP A N    3  
ATOM 4662  C CA   . TRP A 1 84  ? -1.037  0.742   -2.425  1.00 0.00 ? 1216 TRP A CA   3  
ATOM 4663  C C    . TRP A 1 84  ? -2.269  1.641   -2.440  1.00 0.00 ? 1216 TRP A C    3  
ATOM 4664  O O    . TRP A 1 84  ? -2.223  2.762   -2.945  1.00 0.00 ? 1216 TRP A O    3  
ATOM 4665  C CB   . TRP A 1 84  ? -0.896  0.028   -3.771  1.00 0.00 ? 1216 TRP A CB   3  
ATOM 4666  C CG   . TRP A 1 84  ? -2.191  -0.513  -4.295  1.00 0.00 ? 1216 TRP A CG   3  
ATOM 4667  C CD1  . TRP A 1 84  ? -3.321  0.200   -4.581  1.00 0.00 ? 1216 TRP A CD1  3  
ATOM 4668  C CD2  . TRP A 1 84  ? -2.490  -1.880  -4.595  1.00 0.00 ? 1216 TRP A CD2  3  
ATOM 4669  N NE1  . TRP A 1 84  ? -4.305  -0.643  -5.040  1.00 0.00 ? 1216 TRP A NE1  3  
ATOM 4670  C CE2  . TRP A 1 84  ? -3.820  -1.924  -5.059  1.00 0.00 ? 1216 TRP A CE2  3  
ATOM 4671  C CE3  . TRP A 1 84  ? -1.764  -3.072  -4.519  1.00 0.00 ? 1216 TRP A CE3  3  
ATOM 4672  C CZ2  . TRP A 1 84  ? -4.435  -3.113  -5.442  1.00 0.00 ? 1216 TRP A CZ2  3  
ATOM 4673  C CZ3  . TRP A 1 84  ? -2.376  -4.250  -4.900  1.00 0.00 ? 1216 TRP A CZ3  3  
ATOM 4674  C CH2  . TRP A 1 84  ? -3.701  -4.264  -5.357  1.00 0.00 ? 1216 TRP A CH2  3  
ATOM 4675  H H    . TRP A 1 84  ? -1.142  -1.187  -1.559  1.00 0.00 ? 1216 TRP A H    3  
ATOM 4676  H HA   . TRP A 1 84  ? -0.162  1.353   -2.258  1.00 0.00 ? 1216 TRP A HA   3  
ATOM 4677  H HB2  . TRP A 1 84  ? -0.504  0.722   -4.500  1.00 0.00 ? 1216 TRP A HB2  3  
ATOM 4678  H HB3  . TRP A 1 84  ? -0.209  -0.798  -3.660  1.00 0.00 ? 1216 TRP A HB3  3  
ATOM 4679  H HD1  . TRP A 1 84  ? -3.414  1.268   -4.457  1.00 0.00 ? 1216 TRP A HD1  3  
ATOM 4680  H HE1  . TRP A 1 84  ? -5.206  -0.370  -5.311  1.00 0.00 ? 1216 TRP A HE1  3  
ATOM 4681  H HE3  . TRP A 1 84  ? -0.742  -3.082  -4.169  1.00 0.00 ? 1216 TRP A HE3  3  
ATOM 4682  H HZ2  . TRP A 1 84  ? -5.455  -3.140  -5.798  1.00 0.00 ? 1216 TRP A HZ2  3  
ATOM 4683  H HZ3  . TRP A 1 84  ? -1.831  -5.181  -4.847  1.00 0.00 ? 1216 TRP A HZ3  3  
ATOM 4684  H HH2  . TRP A 1 84  ? -4.139  -5.208  -5.644  1.00 0.00 ? 1216 TRP A HH2  3  
ATOM 4685  N N    . GLU A 1 85  ? -3.368  1.141   -1.883  1.00 0.00 ? 1217 GLU A N    3  
ATOM 4686  C CA   . GLU A 1 85  ? -4.611  1.901   -1.834  1.00 0.00 ? 1217 GLU A CA   3  
ATOM 4687  C C    . GLU A 1 85  ? -4.415  3.218   -1.089  1.00 0.00 ? 1217 GLU A C    3  
ATOM 4688  O O    . GLU A 1 85  ? -4.957  4.252   -1.480  1.00 0.00 ? 1217 GLU A O    3  
ATOM 4689  C CB   . GLU A 1 85  ? -5.710  1.079   -1.157  1.00 0.00 ? 1217 GLU A CB   3  
ATOM 4690  C CG   . GLU A 1 85  ? -6.371  0.069   -2.080  1.00 0.00 ? 1217 GLU A CG   3  
ATOM 4691  C CD   . GLU A 1 85  ? -7.572  -0.604  -1.445  1.00 0.00 ? 1217 GLU A CD   3  
ATOM 4692  O OE1  . GLU A 1 85  ? -8.147  -0.024  -0.500  1.00 0.00 ? 1217 GLU A OE1  3  
ATOM 4693  O OE2  . GLU A 1 85  ? -7.937  -1.711  -1.893  1.00 0.00 ? 1217 GLU A OE2  3  
ATOM 4694  H H    . GLU A 1 85  ? -3.341  0.241   -1.497  1.00 0.00 ? 1217 GLU A H    3  
ATOM 4695  H HA   . GLU A 1 85  ? -4.909  2.116   -2.849  1.00 0.00 ? 1217 GLU A HA   3  
ATOM 4696  H HB2  . GLU A 1 85  ? -5.282  0.545   -0.321  1.00 0.00 ? 1217 GLU A HB2  3  
ATOM 4697  H HB3  . GLU A 1 85  ? -6.472  1.752   -0.790  1.00 0.00 ? 1217 GLU A HB3  3  
ATOM 4698  H HG2  . GLU A 1 85  ? -6.695  0.578   -2.976  1.00 0.00 ? 1217 GLU A HG2  3  
ATOM 4699  H HG3  . GLU A 1 85  ? -5.647  -0.689  -2.340  1.00 0.00 ? 1217 GLU A HG3  3  
ATOM 4700  N N    . VAL A 1 86  ? -3.636  3.173   -0.013  1.00 0.00 ? 1218 VAL A N    3  
ATOM 4701  C CA   . VAL A 1 86  ? -3.367  4.361   0.787   1.00 0.00 ? 1218 VAL A CA   3  
ATOM 4702  C C    . VAL A 1 86  ? -2.496  5.352   0.024   1.00 0.00 ? 1218 VAL A C    3  
ATOM 4703  O O    . VAL A 1 86  ? -2.732  6.560   0.061   1.00 0.00 ? 1218 VAL A O    3  
ATOM 4704  C CB   . VAL A 1 86  ? -2.673  4.000   2.114   1.00 0.00 ? 1218 VAL A CB   3  
ATOM 4705  C CG1  . VAL A 1 86  ? -2.359  5.256   2.912   1.00 0.00 ? 1218 VAL A CG1  3  
ATOM 4706  C CG2  . VAL A 1 86  ? -3.536  3.045   2.924   1.00 0.00 ? 1218 VAL A CG2  3  
ATOM 4707  H H    . VAL A 1 86  ? -3.232  2.319   0.249   1.00 0.00 ? 1218 VAL A H    3  
ATOM 4708  H HA   . VAL A 1 86  ? -4.313  4.831   1.017   1.00 0.00 ? 1218 VAL A HA   3  
ATOM 4709  H HB   . VAL A 1 86  ? -1.741  3.504   1.885   1.00 0.00 ? 1218 VAL A HB   3  
ATOM 4710  H HG11 . VAL A 1 86  ? -3.141  5.426   3.638   1.00 0.00 ? 1218 VAL A HG11 3  
ATOM 4711  H HG12 . VAL A 1 86  ? -1.415  5.133   3.421   1.00 0.00 ? 1218 VAL A HG12 3  
ATOM 4712  H HG13 . VAL A 1 86  ? -2.301  6.102   2.243   1.00 0.00 ? 1218 VAL A HG13 3  
ATOM 4713  H HG21 . VAL A 1 86  ? -4.257  3.610   3.496   1.00 0.00 ? 1218 VAL A HG21 3  
ATOM 4714  H HG22 . VAL A 1 86  ? -4.055  2.373   2.256   1.00 0.00 ? 1218 VAL A HG22 3  
ATOM 4715  H HG23 . VAL A 1 86  ? -2.912  2.474   3.594   1.00 0.00 ? 1218 VAL A HG23 3  
ATOM 4716  N N    . ILE A 1 87  ? -1.488  4.833   -0.669  1.00 0.00 ? 1219 ILE A N    3  
ATOM 4717  C CA   . ILE A 1 87  ? -0.582  5.672   -1.443  1.00 0.00 ? 1219 ILE A CA   3  
ATOM 4718  C C    . ILE A 1 87  ? -1.352  6.583   -2.394  1.00 0.00 ? 1219 ILE A C    3  
ATOM 4719  O O    . ILE A 1 87  ? -1.105  7.787   -2.455  1.00 0.00 ? 1219 ILE A O    3  
ATOM 4720  C CB   . ILE A 1 87  ? 0.414   4.824   -2.257  1.00 0.00 ? 1219 ILE A CB   3  
ATOM 4721  C CG1  . ILE A 1 87  ? 1.237   3.932   -1.327  1.00 0.00 ? 1219 ILE A CG1  3  
ATOM 4722  C CG2  . ILE A 1 87  ? 1.324   5.722   -3.081  1.00 0.00 ? 1219 ILE A CG2  3  
ATOM 4723  C CD1  . ILE A 1 87  ? 2.027   2.867   -2.054  1.00 0.00 ? 1219 ILE A CD1  3  
ATOM 4724  H H    . ILE A 1 87  ? -1.351  3.863   -0.660  1.00 0.00 ? 1219 ILE A H    3  
ATOM 4725  H HA   . ILE A 1 87  ? -0.021  6.284   -0.751  1.00 0.00 ? 1219 ILE A HA   3  
ATOM 4726  H HB   . ILE A 1 87  ? -0.149  4.202   -2.937  1.00 0.00 ? 1219 ILE A HB   3  
ATOM 4727  H HG12 . ILE A 1 87  ? 1.934   4.543   -0.776  1.00 0.00 ? 1219 ILE A HG12 3  
ATOM 4728  H HG13 . ILE A 1 87  ? 0.572   3.437   -0.634  1.00 0.00 ? 1219 ILE A HG13 3  
ATOM 4729  H HG21 . ILE A 1 87  ? 2.352   5.552   -2.796  1.00 0.00 ? 1219 ILE A HG21 3  
ATOM 4730  H HG22 . ILE A 1 87  ? 1.201   5.495   -4.130  1.00 0.00 ? 1219 ILE A HG22 3  
ATOM 4731  H HG23 . ILE A 1 87  ? 1.068   6.756   -2.904  1.00 0.00 ? 1219 ILE A HG23 3  
ATOM 4732  H HD11 . ILE A 1 87  ? 1.611   2.719   -3.040  1.00 0.00 ? 1219 ILE A HD11 3  
ATOM 4733  H HD12 . ILE A 1 87  ? 3.057   3.178   -2.141  1.00 0.00 ? 1219 ILE A HD12 3  
ATOM 4734  H HD13 . ILE A 1 87  ? 1.977   1.940   -1.500  1.00 0.00 ? 1219 ILE A HD13 3  
ATOM 4735  N N    . LYS A 1 88  ? -2.290  5.999   -3.133  1.00 0.00 ? 1220 LYS A N    3  
ATOM 4736  C CA   . LYS A 1 88  ? -3.101  6.757   -4.078  1.00 0.00 ? 1220 LYS A CA   3  
ATOM 4737  C C    . LYS A 1 88  ? -3.787  7.932   -3.388  1.00 0.00 ? 1220 LYS A C    3  
ATOM 4738  O O    . LYS A 1 88  ? -3.806  9.047   -3.910  1.00 0.00 ? 1220 LYS A O    3  
ATOM 4739  C CB   . LYS A 1 88  ? -4.149  5.849   -4.725  1.00 0.00 ? 1220 LYS A CB   3  
ATOM 4740  C CG   . LYS A 1 88  ? -4.571  6.300   -6.113  1.00 0.00 ? 1220 LYS A CG   3  
ATOM 4741  C CD   . LYS A 1 88  ? -5.289  5.192   -6.865  1.00 0.00 ? 1220 LYS A CD   3  
ATOM 4742  C CE   . LYS A 1 88  ? -6.726  5.037   -6.390  1.00 0.00 ? 1220 LYS A CE   3  
ATOM 4743  N NZ   . LYS A 1 88  ? -7.608  4.493   -7.459  1.00 0.00 ? 1220 LYS A NZ   3  
ATOM 4744  H H    . LYS A 1 88  ? -2.441  5.035   -3.039  1.00 0.00 ? 1220 LYS A H    3  
ATOM 4745  H HA   . LYS A 1 88  ? -2.445  7.139   -4.846  1.00 0.00 ? 1220 LYS A HA   3  
ATOM 4746  H HB2  . LYS A 1 88  ? -3.745  4.850   -4.801  1.00 0.00 ? 1220 LYS A HB2  3  
ATOM 4747  H HB3  . LYS A 1 88  ? -5.026  5.826   -4.095  1.00 0.00 ? 1220 LYS A HB3  3  
ATOM 4748  H HG2  . LYS A 1 88  ? -5.235  7.146   -6.020  1.00 0.00 ? 1220 LYS A HG2  3  
ATOM 4749  H HG3  . LYS A 1 88  ? -3.691  6.589   -6.671  1.00 0.00 ? 1220 LYS A HG3  3  
ATOM 4750  H HD2  . LYS A 1 88  ? -5.294  5.428   -7.919  1.00 0.00 ? 1220 LYS A HD2  3  
ATOM 4751  H HD3  . LYS A 1 88  ? -4.764  4.261   -6.705  1.00 0.00 ? 1220 LYS A HD3  3  
ATOM 4752  H HE2  . LYS A 1 88  ? -6.742  4.365   -5.546  1.00 0.00 ? 1220 LYS A HE2  3  
ATOM 4753  H HE3  . LYS A 1 88  ? -7.097  6.005   -6.087  1.00 0.00 ? 1220 LYS A HE3  3  
ATOM 4754  H HZ1  . LYS A 1 88  ? -7.067  4.367   -8.339  1.00 0.00 ? 1220 LYS A HZ1  3  
ATOM 4755  H HZ2  . LYS A 1 88  ? -8.395  5.147   -7.641  1.00 0.00 ? 1220 LYS A HZ2  3  
ATOM 4756  H HZ3  . LYS A 1 88  ? -7.996  3.573   -7.169  1.00 0.00 ? 1220 LYS A HZ3  3  
ATOM 4757  N N    . HIS A 1 89  ? -4.349  7.674   -2.211  1.00 0.00 ? 1221 HIS A N    3  
ATOM 4758  C CA   . HIS A 1 89  ? -5.034  8.711   -1.448  1.00 0.00 ? 1221 HIS A CA   3  
ATOM 4759  C C    . HIS A 1 89  ? -4.066  9.821   -1.047  1.00 0.00 ? 1221 HIS A C    3  
ATOM 4760  O O    . HIS A 1 89  ? -4.284  10.991  -1.359  1.00 0.00 ? 1221 HIS A O    3  
ATOM 4761  C CB   . HIS A 1 89  ? -5.684  8.111   -0.201  1.00 0.00 ? 1221 HIS A CB   3  
ATOM 4762  C CG   . HIS A 1 89  ? -6.486  9.098   0.590   1.00 0.00 ? 1221 HIS A CG   3  
ATOM 4763  N ND1  . HIS A 1 89  ? -7.865  9.091   0.626   1.00 0.00 ? 1221 HIS A ND1  3  
ATOM 4764  C CD2  . HIS A 1 89  ? -6.096  10.125  1.380   1.00 0.00 ? 1221 HIS A CD2  3  
ATOM 4765  C CE1  . HIS A 1 89  ? -8.288  10.073  1.402   1.00 0.00 ? 1221 HIS A CE1  3  
ATOM 4766  N NE2  . HIS A 1 89  ? -7.234  10.716  1.872   1.00 0.00 ? 1221 HIS A NE2  3  
ATOM 4767  H H    . HIS A 1 89  ? -4.300  6.766   -1.847  1.00 0.00 ? 1221 HIS A H    3  
ATOM 4768  H HA   . HIS A 1 89  ? -5.803  9.132   -2.077  1.00 0.00 ? 1221 HIS A HA   3  
ATOM 4769  H HB2  . HIS A 1 89  ? -6.345  7.310   -0.498  1.00 0.00 ? 1221 HIS A HB2  3  
ATOM 4770  H HB3  . HIS A 1 89  ? -4.913  7.715   0.444   1.00 0.00 ? 1221 HIS A HB3  3  
ATOM 4771  H HD1  . HIS A 1 89  ? -8.446  8.461   0.152   1.00 0.00 ? 1221 HIS A HD1  3  
ATOM 4772  H HD2  . HIS A 1 89  ? -5.078  10.427  1.585   1.00 0.00 ? 1221 HIS A HD2  3  
ATOM 4773  H HE1  . HIS A 1 89  ? -9.319  10.310  1.617   1.00 0.00 ? 1221 HIS A HE1  3  
ATOM 4774  H HE2  . HIS A 1 89  ? -7.266  11.538  2.404   1.00 0.00 ? 1221 HIS A HE2  3  
ATOM 4775  N N    . PHE A 1 90  ? -2.997  9.444   -0.354  1.00 0.00 ? 1222 PHE A N    3  
ATOM 4776  C CA   . PHE A 1 90  ? -1.996  10.407  0.091   1.00 0.00 ? 1222 PHE A CA   3  
ATOM 4777  C C    . PHE A 1 90  ? -1.656  11.393  -1.024  1.00 0.00 ? 1222 PHE A C    3  
ATOM 4778  O O    . PHE A 1 90  ? -1.969  12.580  -0.933  1.00 0.00 ? 1222 PHE A O    3  
ATOM 4779  C CB   . PHE A 1 90  ? -0.729  9.683   0.551   1.00 0.00 ? 1222 PHE A CB   3  
ATOM 4780  C CG   . PHE A 1 90  ? 0.429   10.604  0.804   1.00 0.00 ? 1222 PHE A CG   3  
ATOM 4781  C CD1  . PHE A 1 90  ? 0.457   11.410  1.931   1.00 0.00 ? 1222 PHE A CD1  3  
ATOM 4782  C CD2  . PHE A 1 90  ? 1.491   10.664  -0.084  1.00 0.00 ? 1222 PHE A CD2  3  
ATOM 4783  C CE1  . PHE A 1 90  ? 1.522   12.260  2.166   1.00 0.00 ? 1222 PHE A CE1  3  
ATOM 4784  C CE2  . PHE A 1 90  ? 2.559   11.511  0.145   1.00 0.00 ? 1222 PHE A CE2  3  
ATOM 4785  C CZ   . PHE A 1 90  ? 2.575   12.309  1.272   1.00 0.00 ? 1222 PHE A CZ   3  
ATOM 4786  H H    . PHE A 1 90  ? -2.878  8.496   -0.136  1.00 0.00 ? 1222 PHE A H    3  
ATOM 4787  H HA   . PHE A 1 90  ? -2.411  10.954  0.924   1.00 0.00 ? 1222 PHE A HA   3  
ATOM 4788  H HB2  . PHE A 1 90  ? -0.939  9.154   1.468   1.00 0.00 ? 1222 PHE A HB2  3  
ATOM 4789  H HB3  . PHE A 1 90  ? -0.433  8.975   -0.208  1.00 0.00 ? 1222 PHE A HB3  3  
ATOM 4790  H HD1  . PHE A 1 90  ? -0.364  11.372  2.631   1.00 0.00 ? 1222 PHE A HD1  3  
ATOM 4791  H HD2  . PHE A 1 90  ? 1.479   10.040  -0.967  1.00 0.00 ? 1222 PHE A HD2  3  
ATOM 4792  H HE1  . PHE A 1 90  ? 1.532   12.882  3.048   1.00 0.00 ? 1222 PHE A HE1  3  
ATOM 4793  H HE2  . PHE A 1 90  ? 3.380   11.547  -0.555  1.00 0.00 ? 1222 PHE A HE2  3  
ATOM 4794  H HZ   . PHE A 1 90  ? 3.407   12.972  1.454   1.00 0.00 ? 1222 PHE A HZ   3  
ATOM 4795  N N    . CYS A 1 91  ? -1.014  10.891  -2.072  1.00 0.00 ? 1223 CYS A N    3  
ATOM 4796  C CA   . CYS A 1 91  ? -0.630  11.726  -3.205  1.00 0.00 ? 1223 CYS A CA   3  
ATOM 4797  C C    . CYS A 1 91  ? -1.819  12.536  -3.711  1.00 0.00 ? 1223 CYS A C    3  
ATOM 4798  O O    . CYS A 1 91  ? -1.753  13.762  -3.801  1.00 0.00 ? 1223 CYS A O    3  
ATOM 4799  C CB   . CYS A 1 91  ? -0.067  10.863  -4.334  1.00 0.00 ? 1223 CYS A CB   3  
ATOM 4800  S SG   . CYS A 1 91  ? 1.336   9.832   -3.847  1.00 0.00 ? 1223 CYS A SG   3  
ATOM 4801  H H    . CYS A 1 91  ? -0.792  9.936   -2.086  1.00 0.00 ? 1223 CYS A H    3  
ATOM 4802  H HA   . CYS A 1 91  ? 0.137   12.408  -2.868  1.00 0.00 ? 1223 CYS A HA   3  
ATOM 4803  H HB2  . CYS A 1 91  ? -0.844  10.207  -4.698  1.00 0.00 ? 1223 CYS A HB2  3  
ATOM 4804  H HB3  . CYS A 1 91  ? 0.259   11.504  -5.139  1.00 0.00 ? 1223 CYS A HB3  3  
ATOM 4805  H HG   . CYS A 1 91  ? 0.868   8.807   -3.151  1.00 0.00 ? 1223 CYS A HG   3  
ATOM 4806  N N    . GLN A 1 92  ? -2.903  11.842  -4.042  1.00 0.00 ? 1224 GLN A N    3  
ATOM 4807  C CA   . GLN A 1 92  ? -4.105  12.497  -4.542  1.00 0.00 ? 1224 GLN A CA   3  
ATOM 4808  C C    . GLN A 1 92  ? -4.312  13.848  -3.863  1.00 0.00 ? 1224 GLN A C    3  
ATOM 4809  O O    . GLN A 1 92  ? -4.164  14.898  -4.489  1.00 0.00 ? 1224 GLN A O    3  
ATOM 4810  C CB   . GLN A 1 92  ? -5.328  11.607  -4.315  1.00 0.00 ? 1224 GLN A CB   3  
ATOM 4811  C CG   . GLN A 1 92  ? -5.619  10.667  -5.474  1.00 0.00 ? 1224 GLN A CG   3  
ATOM 4812  C CD   . GLN A 1 92  ? -6.701  9.655   -5.147  1.00 0.00 ? 1224 GLN A CD   3  
ATOM 4813  O OE1  . GLN A 1 92  ? -6.422  8.585   -4.606  1.00 0.00 ? 1224 GLN A OE1  3  
ATOM 4814  N NE2  . GLN A 1 92  ? -7.943  9.990   -5.475  1.00 0.00 ? 1224 GLN A NE2  3  
ATOM 4815  H H    . GLN A 1 92  ? -2.893  10.867  -3.948  1.00 0.00 ? 1224 GLN A H    3  
ATOM 4816  H HA   . GLN A 1 92  ? -3.979  12.657  -5.602  1.00 0.00 ? 1224 GLN A HA   3  
ATOM 4817  H HB2  . GLN A 1 92  ? -5.167  11.012  -3.429  1.00 0.00 ? 1224 GLN A HB2  3  
ATOM 4818  H HB3  . GLN A 1 92  ? -6.194  12.236  -4.165  1.00 0.00 ? 1224 GLN A HB3  3  
ATOM 4819  H HG2  . GLN A 1 92  ? -5.940  11.251  -6.324  1.00 0.00 ? 1224 GLN A HG2  3  
ATOM 4820  H HG3  . GLN A 1 92  ? -4.713  10.135  -5.725  1.00 0.00 ? 1224 GLN A HG3  3  
ATOM 4821  H HE21 . GLN A 1 92  ? -8.090  10.858  -5.906  1.00 0.00 ? 1224 GLN A HE21 3  
ATOM 4822  H HE22 . GLN A 1 92  ? -8.661  9.354   -5.277  1.00 0.00 ? 1224 GLN A HE22 3  
ATOM 4823  N N    . THR A 1 93  ? -4.655  13.813  -2.580  1.00 0.00 ? 1225 THR A N    3  
ATOM 4824  C CA   . THR A 1 93  ? -4.884  15.033  -1.816  1.00 0.00 ? 1225 THR A CA   3  
ATOM 4825  C C    . THR A 1 93  ? -3.632  15.902  -1.780  1.00 0.00 ? 1225 THR A C    3  
ATOM 4826  O O    . THR A 1 93  ? -3.714  17.128  -1.835  1.00 0.00 ? 1225 THR A O    3  
ATOM 4827  C CB   . THR A 1 93  ? -5.318  14.719  -0.372  1.00 0.00 ? 1225 THR A CB   3  
ATOM 4828  O OG1  . THR A 1 93  ? -6.729  14.477  -0.327  1.00 0.00 ? 1225 THR A OG1  3  
ATOM 4829  C CG2  . THR A 1 93  ? -4.966  15.868  0.561   1.00 0.00 ? 1225 THR A CG2  3  
ATOM 4830  H H    . THR A 1 93  ? -4.758  12.945  -2.137  1.00 0.00 ? 1225 THR A H    3  
ATOM 4831  H HA   . THR A 1 93  ? -5.679  15.584  -2.298  1.00 0.00 ? 1225 THR A HA   3  
ATOM 4832  H HB   . THR A 1 93  ? -4.797  13.833  -0.040  1.00 0.00 ? 1225 THR A HB   3  
ATOM 4833  H HG1  . THR A 1 93  ? -6.898  13.542  -0.471  1.00 0.00 ? 1225 THR A HG1  3  
ATOM 4834  H HG21 . THR A 1 93  ? -5.452  16.771  0.220   1.00 0.00 ? 1225 THR A HG21 3  
ATOM 4835  H HG22 . THR A 1 93  ? -3.897  16.014  0.564   1.00 0.00 ? 1225 THR A HG22 3  
ATOM 4836  H HG23 . THR A 1 93  ? -5.302  15.636  1.560   1.00 0.00 ? 1225 THR A HG23 3  
ATOM 4837  N N    . ASN A 1 94  ? -2.473  15.258  -1.690  1.00 0.00 ? 1226 ASN A N    3  
ATOM 4838  C CA   . ASN A 1 94  ? -1.202  15.973  -1.647  1.00 0.00 ? 1226 ASN A CA   3  
ATOM 4839  C C    . ASN A 1 94  ? -0.707  16.286  -3.056  1.00 0.00 ? 1226 ASN A C    3  
ATOM 4840  O O    . ASN A 1 94  ? 0.465   16.605  -3.256  1.00 0.00 ? 1226 ASN A O    3  
ATOM 4841  C CB   . ASN A 1 94  ? -0.154  15.148  -0.897  1.00 0.00 ? 1226 ASN A CB   3  
ATOM 4842  C CG   . ASN A 1 94  ? -0.490  14.985  0.573   1.00 0.00 ? 1226 ASN A CG   3  
ATOM 4843  O OD1  . ASN A 1 94  ? 0.264   15.416  1.445   1.00 0.00 ? 1226 ASN A OD1  3  
ATOM 4844  N ND2  . ASN A 1 94  ? -1.627  14.358  0.853   1.00 0.00 ? 1226 ASN A ND2  3  
ATOM 4845  H H    . ASN A 1 94  ? -2.471  14.279  -1.650  1.00 0.00 ? 1226 ASN A H    3  
ATOM 4846  H HA   . ASN A 1 94  ? -1.362  16.901  -1.119  1.00 0.00 ? 1226 ASN A HA   3  
ATOM 4847  H HB2  . ASN A 1 94  ? -0.091  14.166  -1.343  1.00 0.00 ? 1226 ASN A HB2  3  
ATOM 4848  H HB3  . ASN A 1 94  ? 0.805   15.638  -0.976  1.00 0.00 ? 1226 ASN A HB3  3  
ATOM 4849  H HD21 . ASN A 1 94  ? -2.178  14.041  0.107   1.00 0.00 ? 1226 ASN A HD21 3  
ATOM 4850  H HD22 . ASN A 1 94  ? -1.869  14.239  1.795   1.00 0.00 ? 1226 ASN A HD22 3  
ATOM 4851  N N    . SER A 1 95  ? -1.608  16.193  -4.028  1.00 0.00 ? 1227 SER A N    3  
ATOM 4852  C CA   . SER A 1 95  ? -1.262  16.464  -5.419  1.00 0.00 ? 1227 SER A CA   3  
ATOM 4853  C C    . SER A 1 95  ? 0.170   16.030  -5.717  1.00 0.00 ? 1227 SER A C    3  
ATOM 4854  O O    . SER A 1 95  ? 0.964   16.800  -6.258  1.00 0.00 ? 1227 SER A O    3  
ATOM 4855  C CB   . SER A 1 95  ? -1.431  17.952  -5.729  1.00 0.00 ? 1227 SER A CB   3  
ATOM 4856  O OG   . SER A 1 95  ? -1.773  18.155  -7.089  1.00 0.00 ? 1227 SER A OG   3  
ATOM 4857  H H    . SER A 1 95  ? -2.526  15.934  -3.805  1.00 0.00 ? 1227 SER A H    3  
ATOM 4858  H HA   . SER A 1 95  ? -1.935  15.896  -6.044  1.00 0.00 ? 1227 SER A HA   3  
ATOM 4859  H HB2  . SER A 1 95  ? -2.215  18.359  -5.109  1.00 0.00 ? 1227 SER A HB2  3  
ATOM 4860  H HB3  . SER A 1 95  ? -0.504  18.468  -5.522  1.00 0.00 ? 1227 SER A HB3  3  
ATOM 4861  H HG   . SER A 1 95  ? -1.088  18.674  -7.517  1.00 0.00 ? 1227 SER A HG   3  
ATOM 4862  N N    . VAL A 1 96  ? 0.494   14.792  -5.358  1.00 0.00 ? 1228 VAL A N    3  
ATOM 4863  C CA   . VAL A 1 96  ? 1.829   14.254  -5.587  1.00 0.00 ? 1228 VAL A CA   3  
ATOM 4864  C C    . VAL A 1 96  ? 1.842   13.304  -6.779  1.00 0.00 ? 1228 VAL A C    3  
ATOM 4865  O O    . VAL A 1 96  ? 0.900   12.539  -6.985  1.00 0.00 ? 1228 VAL A O    3  
ATOM 4866  C CB   . VAL A 1 96  ? 2.355   13.509  -4.346  1.00 0.00 ? 1228 VAL A CB   3  
ATOM 4867  C CG1  . VAL A 1 96  ? 3.721   12.901  -4.626  1.00 0.00 ? 1228 VAL A CG1  3  
ATOM 4868  C CG2  . VAL A 1 96  ? 2.415   14.446  -3.149  1.00 0.00 ? 1228 VAL A CG2  3  
ATOM 4869  H H    . VAL A 1 96  ? -0.182  14.226  -4.930  1.00 0.00 ? 1228 VAL A H    3  
ATOM 4870  H HA   . VAL A 1 96  ? 2.492   15.082  -5.792  1.00 0.00 ? 1228 VAL A HA   3  
ATOM 4871  H HB   . VAL A 1 96  ? 1.669   12.708  -4.114  1.00 0.00 ? 1228 VAL A HB   3  
ATOM 4872  H HG11 . VAL A 1 96  ? 3.956   12.177  -3.859  1.00 0.00 ? 1228 VAL A HG11 3  
ATOM 4873  H HG12 . VAL A 1 96  ? 3.708   12.415  -5.590  1.00 0.00 ? 1228 VAL A HG12 3  
ATOM 4874  H HG13 . VAL A 1 96  ? 4.469   13.680  -4.626  1.00 0.00 ? 1228 VAL A HG13 3  
ATOM 4875  H HG21 . VAL A 1 96  ? 1.497   14.370  -2.587  1.00 0.00 ? 1228 VAL A HG21 3  
ATOM 4876  H HG22 . VAL A 1 96  ? 3.248   14.171  -2.517  1.00 0.00 ? 1228 VAL A HG22 3  
ATOM 4877  H HG23 . VAL A 1 96  ? 2.545   15.462  -3.492  1.00 0.00 ? 1228 VAL A HG23 3  
ATOM 4878  N N    . GLN A 1 97  ? 2.916   13.358  -7.561  1.00 0.00 ? 1229 GLN A N    3  
ATOM 4879  C CA   . GLN A 1 97  ? 3.051   12.501  -8.733  1.00 0.00 ? 1229 GLN A CA   3  
ATOM 4880  C C    . GLN A 1 97  ? 3.252   11.046  -8.324  1.00 0.00 ? 1229 GLN A C    3  
ATOM 4881  O O    . GLN A 1 97  ? 3.721   10.758  -7.222  1.00 0.00 ? 1229 GLN A O    3  
ATOM 4882  C CB   . GLN A 1 97  ? 4.224   12.966  -9.598  1.00 0.00 ? 1229 GLN A CB   3  
ATOM 4883  C CG   . GLN A 1 97  ? 5.579   12.783  -8.935  1.00 0.00 ? 1229 GLN A CG   3  
ATOM 4884  C CD   . GLN A 1 97  ? 6.663   13.624  -9.580  1.00 0.00 ? 1229 GLN A CD   3  
ATOM 4885  O OE1  . GLN A 1 97  ? 6.380   14.507  -10.390 1.00 0.00 ? 1229 GLN A OE1  3  
ATOM 4886  N NE2  . GLN A 1 97  ? 7.913   13.355  -9.223  1.00 0.00 ? 1229 GLN A NE2  3  
ATOM 4887  H H    . GLN A 1 97  ? 3.634   13.988  -7.344  1.00 0.00 ? 1229 GLN A H    3  
ATOM 4888  H HA   . GLN A 1 97  ? 2.140   12.578  -9.306  1.00 0.00 ? 1229 GLN A HA   3  
ATOM 4889  H HB2  . GLN A 1 97  ? 4.219   12.406  -10.521 1.00 0.00 ? 1229 GLN A HB2  3  
ATOM 4890  H HB3  . GLN A 1 97  ? 4.096   14.015  -9.822  1.00 0.00 ? 1229 GLN A HB3  3  
ATOM 4891  H HG2  . GLN A 1 97  ? 5.499   13.063  -7.896  1.00 0.00 ? 1229 GLN A HG2  3  
ATOM 4892  H HG3  . GLN A 1 97  ? 5.862   11.743  -9.005  1.00 0.00 ? 1229 GLN A HG3  3  
ATOM 4893  H HE21 . GLN A 1 97  ? 8.064   12.637  -8.572  1.00 0.00 ? 1229 GLN A HE21 3  
ATOM 4894  H HE22 . GLN A 1 97  ? 8.633   13.883  -9.624  1.00 0.00 ? 1229 GLN A HE22 3  
ATOM 4895  N N    . THR A 1 98  ? 2.893   10.130  -9.218  1.00 0.00 ? 1230 THR A N    3  
ATOM 4896  C CA   . THR A 1 98  ? 3.032   8.704   -8.949  1.00 0.00 ? 1230 THR A CA   3  
ATOM 4897  C C    . THR A 1 98  ? 3.446   7.946   -10.205 1.00 0.00 ? 1230 THR A C    3  
ATOM 4898  O O    . THR A 1 98  ? 3.671   8.544   -11.258 1.00 0.00 ? 1230 THR A O    3  
ATOM 4899  C CB   . THR A 1 98  ? 1.720   8.103   -8.410  1.00 0.00 ? 1230 THR A CB   3  
ATOM 4900  O OG1  . THR A 1 98  ? 0.636   8.426   -9.288  1.00 0.00 ? 1230 THR A OG1  3  
ATOM 4901  C CG2  . THR A 1 98  ? 1.420   8.625   -7.013  1.00 0.00 ? 1230 THR A CG2  3  
ATOM 4902  H H    . THR A 1 98  ? 2.526   10.421  -10.078 1.00 0.00 ? 1230 THR A H    3  
ATOM 4903  H HA   . THR A 1 98  ? 3.797   8.579   -8.197  1.00 0.00 ? 1230 THR A HA   3  
ATOM 4904  H HB   . THR A 1 98  ? 1.827   7.029   -8.362  1.00 0.00 ? 1230 THR A HB   3  
ATOM 4905  H HG1  . THR A 1 98  ? 0.820   9.257   -9.732  1.00 0.00 ? 1230 THR A HG1  3  
ATOM 4906  H HG21 . THR A 1 98  ? 0.533   9.240   -7.041  1.00 0.00 ? 1230 THR A HG21 3  
ATOM 4907  H HG22 . THR A 1 98  ? 2.255   9.214   -6.662  1.00 0.00 ? 1230 THR A HG22 3  
ATOM 4908  H HG23 . THR A 1 98  ? 1.260   7.793   -6.345  1.00 0.00 ? 1230 THR A HG23 3  
ATOM 4909  N N    . ASP A 1 99  ? 3.544   6.626   -10.089 1.00 0.00 ? 1231 ASP A N    3  
ATOM 4910  C CA   . ASP A 1 99  ? 3.930   5.785   -11.216 1.00 0.00 ? 1231 ASP A CA   3  
ATOM 4911  C C    . ASP A 1 99  ? 5.258   6.246   -11.809 1.00 0.00 ? 1231 ASP A C    3  
ATOM 4912  O O    . ASP A 1 99  ? 5.371   6.456   -13.017 1.00 0.00 ? 1231 ASP A O    3  
ATOM 4913  C CB   . ASP A 1 99  ? 2.842   5.807   -12.292 1.00 0.00 ? 1231 ASP A CB   3  
ATOM 4914  C CG   . ASP A 1 99  ? 2.902   4.596   -13.201 1.00 0.00 ? 1231 ASP A CG   3  
ATOM 4915  O OD1  . ASP A 1 99  ? 4.023   4.180   -13.561 1.00 0.00 ? 1231 ASP A OD1  3  
ATOM 4916  O OD2  . ASP A 1 99  ? 1.828   4.064   -13.553 1.00 0.00 ? 1231 ASP A OD2  3  
ATOM 4917  H H    . ASP A 1 99  ? 3.352   6.207   -9.224  1.00 0.00 ? 1231 ASP A H    3  
ATOM 4918  H HA   . ASP A 1 99  ? 4.043   4.775   -10.853 1.00 0.00 ? 1231 ASP A HA   3  
ATOM 4919  H HB2  . ASP A 1 99  ? 1.873   5.828   -11.814 1.00 0.00 ? 1231 ASP A HB2  3  
ATOM 4920  H HB3  . ASP A 1 99  ? 2.960   6.695   -12.896 1.00 0.00 ? 1231 ASP A HB3  3  
ATOM 4921  N N    . LEU A 1 100 ? 6.260   6.403   -10.951 1.00 0.00 ? 1232 LEU A N    3  
ATOM 4922  C CA   . LEU A 1 100 ? 7.581   6.841   -11.389 1.00 0.00 ? 1232 LEU A CA   3  
ATOM 4923  C C    . LEU A 1 100 ? 8.419   5.656   -11.857 1.00 0.00 ? 1232 LEU A C    3  
ATOM 4924  O O    . LEU A 1 100 ? 9.602   5.551   -11.531 1.00 0.00 ? 1232 LEU A O    3  
ATOM 4925  C CB   . LEU A 1 100 ? 8.300   7.572   -10.254 1.00 0.00 ? 1232 LEU A CB   3  
ATOM 4926  C CG   . LEU A 1 100 ? 7.579   8.792   -9.679  1.00 0.00 ? 1232 LEU A CG   3  
ATOM 4927  C CD1  . LEU A 1 100 ? 8.151   9.158   -8.318  1.00 0.00 ? 1232 LEU A CD1  3  
ATOM 4928  C CD2  . LEU A 1 100 ? 7.679   9.971   -10.637 1.00 0.00 ? 1232 LEU A CD2  3  
ATOM 4929  H H    . LEU A 1 100 ? 6.109   6.221   -10.000 1.00 0.00 ? 1232 LEU A H    3  
ATOM 4930  H HA   . LEU A 1 100 ? 7.447   7.521   -12.217 1.00 0.00 ? 1232 LEU A HA   3  
ATOM 4931  H HB2  . LEU A 1 100 ? 8.450   6.869   -9.450  1.00 0.00 ? 1232 LEU A HB2  3  
ATOM 4932  H HB3  . LEU A 1 100 ? 9.259   7.900   -10.628 1.00 0.00 ? 1232 LEU A HB3  3  
ATOM 4933  H HG   . LEU A 1 100 ? 6.532   8.555   -9.548  1.00 0.00 ? 1232 LEU A HG   3  
ATOM 4934  H HD11 . LEU A 1 100 ? 8.613   10.132  -8.372  1.00 0.00 ? 1232 LEU A HD11 3  
ATOM 4935  H HD12 . LEU A 1 100 ? 8.888   8.424   -8.029  1.00 0.00 ? 1232 LEU A HD12 3  
ATOM 4936  H HD13 . LEU A 1 100 ? 7.356   9.176   -7.587  1.00 0.00 ? 1232 LEU A HD13 3  
ATOM 4937  H HD21 . LEU A 1 100 ? 7.502   9.631   -11.646 1.00 0.00 ? 1232 LEU A HD21 3  
ATOM 4938  H HD22 . LEU A 1 100 ? 8.667   10.404  -10.571 1.00 0.00 ? 1232 LEU A HD22 3  
ATOM 4939  H HD23 . LEU A 1 100 ? 6.942   10.714  -10.372 1.00 0.00 ? 1232 LEU A HD23 3  
ATOM 4940  N N    . PHE A 1 101 ? 7.800   4.765   -12.624 1.00 0.00 ? 1233 PHE A N    3  
ATOM 4941  C CA   . PHE A 1 101 ? 8.489   3.588   -13.139 1.00 0.00 ? 1233 PHE A CA   3  
ATOM 4942  C C    . PHE A 1 101 ? 9.076   3.861   -14.520 1.00 0.00 ? 1233 PHE A C    3  
ATOM 4943  O O    . PHE A 1 101 ? 10.244  3.569   -14.779 1.00 0.00 ? 1233 PHE A O    3  
ATOM 4944  C CB   . PHE A 1 101 ? 7.530   2.398   -13.207 1.00 0.00 ? 1233 PHE A CB   3  
ATOM 4945  C CG   . PHE A 1 101 ? 7.001   1.976   -11.865 1.00 0.00 ? 1233 PHE A CG   3  
ATOM 4946  C CD1  . PHE A 1 101 ? 6.261   2.855   -11.090 1.00 0.00 ? 1233 PHE A CD1  3  
ATOM 4947  C CD2  . PHE A 1 101 ? 7.244   0.702   -11.380 1.00 0.00 ? 1233 PHE A CD2  3  
ATOM 4948  C CE1  . PHE A 1 101 ? 5.775   2.470   -9.855  1.00 0.00 ? 1233 PHE A CE1  3  
ATOM 4949  C CE2  . PHE A 1 101 ? 6.759   0.311   -10.145 1.00 0.00 ? 1233 PHE A CE2  3  
ATOM 4950  C CZ   . PHE A 1 101 ? 6.023   1.196   -9.383  1.00 0.00 ? 1233 PHE A CZ   3  
ATOM 4951  H H    . PHE A 1 101 ? 6.855   4.903   -12.850 1.00 0.00 ? 1233 PHE A H    3  
ATOM 4952  H HA   . PHE A 1 101 ? 9.293   3.352   -12.459 1.00 0.00 ? 1233 PHE A HA   3  
ATOM 4953  H HB2  . PHE A 1 101 ? 6.686   2.660   -13.827 1.00 0.00 ? 1233 PHE A HB2  3  
ATOM 4954  H HB3  . PHE A 1 101 ? 8.044   1.555   -13.642 1.00 0.00 ? 1233 PHE A HB3  3  
ATOM 4955  H HD1  . PHE A 1 101 ? 6.065   3.851   -11.459 1.00 0.00 ? 1233 PHE A HD1  3  
ATOM 4956  H HD2  . PHE A 1 101 ? 7.820   0.008   -11.976 1.00 0.00 ? 1233 PHE A HD2  3  
ATOM 4957  H HE1  . PHE A 1 101 ? 5.199   3.163   -9.261  1.00 0.00 ? 1233 PHE A HE1  3  
ATOM 4958  H HE2  . PHE A 1 101 ? 6.956   -0.686  -9.779  1.00 0.00 ? 1233 PHE A HE2  3  
ATOM 4959  H HZ   . PHE A 1 101 ? 5.644   0.893   -8.418  1.00 0.00 ? 1233 PHE A HZ   3  
ATOM 4960  N N    . SER A 1 102 ? 8.258   4.425   -15.403 1.00 0.00 ? 1234 SER A N    3  
ATOM 4961  C CA   . SER A 1 102 ? 8.694   4.734   -16.760 1.00 0.00 ? 1234 SER A CA   3  
ATOM 4962  C C    . SER A 1 102 ? 9.215   6.166   -16.850 1.00 0.00 ? 1234 SER A C    3  
ATOM 4963  O O    . SER A 1 102 ? 8.461   7.095   -17.136 1.00 0.00 ? 1234 SER A O    3  
ATOM 4964  C CB   . SER A 1 102 ? 7.542   4.536   -17.746 1.00 0.00 ? 1234 SER A CB   3  
ATOM 4965  O OG   . SER A 1 102 ? 7.477   3.193   -18.192 1.00 0.00 ? 1234 SER A OG   3  
ATOM 4966  H H    . SER A 1 102 ? 7.339   4.634   -15.137 1.00 0.00 ? 1234 SER A H    3  
ATOM 4967  H HA   . SER A 1 102 ? 9.495   4.056   -17.014 1.00 0.00 ? 1234 SER A HA   3  
ATOM 4968  H HB2  . SER A 1 102 ? 6.610   4.788   -17.263 1.00 0.00 ? 1234 SER A HB2  3  
ATOM 4969  H HB3  . SER A 1 102 ? 7.689   5.180   -18.601 1.00 0.00 ? 1234 SER A HB3  3  
ATOM 4970  H HG   . SER A 1 102 ? 8.346   2.791   -18.124 1.00 0.00 ? 1234 SER A HG   3  
ATOM 4971  N N    . SER A 1 103 ? 10.510  6.334   -16.602 1.00 0.00 ? 1235 SER A N    3  
ATOM 4972  C CA   . SER A 1 103 ? 11.133  7.651   -16.651 1.00 0.00 ? 1235 SER A CA   3  
ATOM 4973  C C    . SER A 1 103 ? 10.788  8.367   -17.953 1.00 0.00 ? 1235 SER A C    3  
ATOM 4974  O O    . SER A 1 103 ? 10.396  9.535   -17.950 1.00 0.00 ? 1235 SER A O    3  
ATOM 4975  C CB   . SER A 1 103 ? 12.651  7.527   -16.511 1.00 0.00 ? 1235 SER A CB   3  
ATOM 4976  O OG   . SER A 1 103 ? 13.190  6.692   -17.522 1.00 0.00 ? 1235 SER A OG   3  
ATOM 4977  H H    . SER A 1 103 ? 11.059  5.553   -16.379 1.00 0.00 ? 1235 SER A H    3  
ATOM 4978  H HA   . SER A 1 103 ? 10.750  8.230   -15.824 1.00 0.00 ? 1235 SER A HA   3  
ATOM 4979  H HB2  . SER A 1 103 ? 13.099  8.505   -16.593 1.00 0.00 ? 1235 SER A HB2  3  
ATOM 4980  H HB3  . SER A 1 103 ? 12.887  7.102   -15.546 1.00 0.00 ? 1235 SER A HB3  3  
ATOM 4981  H HG   . SER A 1 103 ? 14.093  6.459   -17.297 1.00 0.00 ? 1235 SER A HG   3  
ATOM 4982  N N    . THR A 1 104 ? 10.937  7.659   -19.068 1.00 0.00 ? 1236 THR A N    3  
ATOM 4983  C CA   . THR A 1 104 ? 10.643  8.225   -20.379 1.00 0.00 ? 1236 THR A CA   3  
ATOM 4984  C C    . THR A 1 104 ? 9.350   7.652   -20.948 1.00 0.00 ? 1236 THR A C    3  
ATOM 4985  O O    . THR A 1 104 ? 9.053   6.470   -20.774 1.00 0.00 ? 1236 THR A O    3  
ATOM 4986  C CB   . THR A 1 104 ? 11.789  7.963   -21.374 1.00 0.00 ? 1236 THR A CB   3  
ATOM 4987  O OG1  . THR A 1 104 ? 12.027  6.556   -21.487 1.00 0.00 ? 1236 THR A OG1  3  
ATOM 4988  C CG2  . THR A 1 104 ? 13.064  8.664   -20.929 1.00 0.00 ? 1236 THR A CG2  3  
ATOM 4989  H H    . THR A 1 104 ? 11.253  6.733   -19.007 1.00 0.00 ? 1236 THR A H    3  
ATOM 4990  H HA   . THR A 1 104 ? 10.532  9.294   -20.263 1.00 0.00 ? 1236 THR A HA   3  
ATOM 4991  H HB   . THR A 1 104 ? 11.502  8.351   -22.341 1.00 0.00 ? 1236 THR A HB   3  
ATOM 4992  H HG1  . THR A 1 104 ? 12.128  6.321   -22.413 1.00 0.00 ? 1236 THR A HG1  3  
ATOM 4993  H HG21 . THR A 1 104 ? 12.868  9.718   -20.796 1.00 0.00 ? 1236 THR A HG21 3  
ATOM 4994  H HG22 . THR A 1 104 ? 13.828  8.531   -21.679 1.00 0.00 ? 1236 THR A HG22 3  
ATOM 4995  H HG23 . THR A 1 104 ? 13.399  8.241   -19.994 1.00 0.00 ? 1236 THR A HG23 3  
ATOM 4996  N N    . LYS A 1 105 ? 8.584   8.497   -21.629 1.00 0.00 ? 1237 LYS A N    3  
ATOM 4997  C CA   . LYS A 1 105 ? 7.322   8.075   -22.227 1.00 0.00 ? 1237 LYS A CA   3  
ATOM 4998  C C    . LYS A 1 105 ? 6.992   8.918   -23.454 1.00 0.00 ? 1237 LYS A C    3  
ATOM 4999  O O    . LYS A 1 105 ? 7.355   10.091  -23.547 1.00 0.00 ? 1237 LYS A O    3  
ATOM 5000  C CB   . LYS A 1 105 ? 6.189   8.180   -21.203 1.00 0.00 ? 1237 LYS A CB   3  
ATOM 5001  C CG   . LYS A 1 105 ? 5.901   9.603   -20.758 1.00 0.00 ? 1237 LYS A CG   3  
ATOM 5002  C CD   . LYS A 1 105 ? 5.132   9.633   -19.448 1.00 0.00 ? 1237 LYS A CD   3  
ATOM 5003  C CE   . LYS A 1 105 ? 3.666   9.287   -19.654 1.00 0.00 ? 1237 LYS A CE   3  
ATOM 5004  N NZ   . LYS A 1 105 ? 2.956   9.087   -18.361 1.00 0.00 ? 1237 LYS A NZ   3  
ATOM 5005  H H    . LYS A 1 105 ? 8.874   9.428   -21.734 1.00 0.00 ? 1237 LYS A H    3  
ATOM 5006  H HA   . LYS A 1 105 ? 7.427   7.045   -22.530 1.00 0.00 ? 1237 LYS A HA   3  
ATOM 5007  H HB2  . LYS A 1 105 ? 5.289   7.772   -21.638 1.00 0.00 ? 1237 LYS A HB2  3  
ATOM 5008  H HB3  . LYS A 1 105 ? 6.453   7.599   -20.331 1.00 0.00 ? 1237 LYS A HB3  3  
ATOM 5009  H HG2  . LYS A 1 105 ? 6.837   10.126  -20.626 1.00 0.00 ? 1237 LYS A HG2  3  
ATOM 5010  H HG3  . LYS A 1 105 ? 5.316   10.098  -21.520 1.00 0.00 ? 1237 LYS A HG3  3  
ATOM 5011  H HD2  . LYS A 1 105 ? 5.568   8.916   -18.768 1.00 0.00 ? 1237 LYS A HD2  3  
ATOM 5012  H HD3  . LYS A 1 105 ? 5.203   10.624  -19.022 1.00 0.00 ? 1237 LYS A HD3  3  
ATOM 5013  H HE2  . LYS A 1 105 ? 3.192   10.092  -20.195 1.00 0.00 ? 1237 LYS A HE2  3  
ATOM 5014  H HE3  . LYS A 1 105 ? 3.603   8.378   -20.234 1.00 0.00 ? 1237 LYS A HE3  3  
ATOM 5015  H HZ1  . LYS A 1 105 ? 2.015   9.530   -18.398 1.00 0.00 ? 1237 LYS A HZ1  3  
ATOM 5016  H HZ2  . LYS A 1 105 ? 3.498   9.518   -17.585 1.00 0.00 ? 1237 LYS A HZ2  3  
ATOM 5017  H HZ3  . LYS A 1 105 ? 2.842   8.072   -18.169 1.00 0.00 ? 1237 LYS A HZ3  3  
ATOM 5018  N N    . PRO A 1 106 ? 6.287   8.310   -24.419 1.00 0.00 ? 1238 PRO A N    3  
ATOM 5019  C CA   . PRO A 1 106 ? 5.892   8.987   -25.658 1.00 0.00 ? 1238 PRO A CA   3  
ATOM 5020  C C    . PRO A 1 106 ? 4.830   10.056  -25.420 1.00 0.00 ? 1238 PRO A C    3  
ATOM 5021  O O    . PRO A 1 106 ? 4.779   11.061  -26.128 1.00 0.00 ? 1238 PRO A O    3  
ATOM 5022  C CB   . PRO A 1 106 ? 5.327   7.854   -26.517 1.00 0.00 ? 1238 PRO A CB   3  
ATOM 5023  C CG   . PRO A 1 106 ? 4.872   6.827   -25.539 1.00 0.00 ? 1238 PRO A CG   3  
ATOM 5024  C CD   . PRO A 1 106 ? 5.822   6.913   -24.376 1.00 0.00 ? 1238 PRO A CD   3  
ATOM 5025  H HA   . PRO A 1 106 ? 6.741   9.431   -26.156 1.00 0.00 ? 1238 PRO A HA   3  
ATOM 5026  H HB2  . PRO A 1 106 ? 4.504   8.225   -27.112 1.00 0.00 ? 1238 PRO A HB2  3  
ATOM 5027  H HB3  . PRO A 1 106 ? 6.100   7.468   -27.164 1.00 0.00 ? 1238 PRO A HB3  3  
ATOM 5028  H HG2  . PRO A 1 106 ? 3.865   7.045   -25.218 1.00 0.00 ? 1238 PRO A HG2  3  
ATOM 5029  H HG3  . PRO A 1 106 ? 4.920   5.846   -25.988 1.00 0.00 ? 1238 PRO A HG3  3  
ATOM 5030  H HD2  . PRO A 1 106 ? 5.305   6.708   -23.450 1.00 0.00 ? 1238 PRO A HD2  3  
ATOM 5031  H HD3  . PRO A 1 106 ? 6.646   6.229   -24.510 1.00 0.00 ? 1238 PRO A HD3  3  
ATOM 5032  N N    . GLN A 1 107 ? 3.985   9.831   -24.419 1.00 0.00 ? 1239 GLN A N    3  
ATOM 5033  C CA   . GLN A 1 107 ? 2.924   10.775  -24.089 1.00 0.00 ? 1239 GLN A CA   3  
ATOM 5034  C C    . GLN A 1 107 ? 2.182   10.342  -22.829 1.00 0.00 ? 1239 GLN A C    3  
ATOM 5035  O O    . GLN A 1 107 ? 2.210   9.171   -22.452 1.00 0.00 ? 1239 GLN A O    3  
ATOM 5036  C CB   . GLN A 1 107 ? 1.942   10.899  -25.255 1.00 0.00 ? 1239 GLN A CB   3  
ATOM 5037  C CG   . GLN A 1 107 ? 1.333   9.573   -25.682 1.00 0.00 ? 1239 GLN A CG   3  
ATOM 5038  C CD   . GLN A 1 107 ? 0.572   8.893   -24.562 1.00 0.00 ? 1239 GLN A CD   3  
ATOM 5039  O OE1  . GLN A 1 107 ? -0.144  9.542   -23.799 1.00 0.00 ? 1239 GLN A OE1  3  
ATOM 5040  N NE2  . GLN A 1 107 ? 0.722   7.578   -24.457 1.00 0.00 ? 1239 GLN A NE2  3  
ATOM 5041  H H    . GLN A 1 107 ? 4.076   9.011   -23.891 1.00 0.00 ? 1239 GLN A H    3  
ATOM 5042  H HA   . GLN A 1 107 ? 3.380   11.737  -23.911 1.00 0.00 ? 1239 GLN A HA   3  
ATOM 5043  H HB2  . GLN A 1 107 ? 1.140   11.563  -24.967 1.00 0.00 ? 1239 GLN A HB2  3  
ATOM 5044  H HB3  . GLN A 1 107 ? 2.460   11.322  -26.103 1.00 0.00 ? 1239 GLN A HB3  3  
ATOM 5045  H HG2  . GLN A 1 107 ? 0.653   9.751   -26.502 1.00 0.00 ? 1239 GLN A HG2  3  
ATOM 5046  H HG3  . GLN A 1 107 ? 2.126   8.917   -26.009 1.00 0.00 ? 1239 GLN A HG3  3  
ATOM 5047  H HE21 . GLN A 1 107 ? 1.309   7.127   -25.100 1.00 0.00 ? 1239 GLN A HE21 3  
ATOM 5048  H HE22 . GLN A 1 107 ? 0.242   7.113   -23.742 1.00 0.00 ? 1239 GLN A HE22 3  
ATOM 5049  N N    . SER A 1 108 ? 1.520   11.296  -22.181 1.00 0.00 ? 1240 SER A N    3  
ATOM 5050  C CA   . SER A 1 108 ? 0.774   11.014  -20.960 1.00 0.00 ? 1240 SER A CA   3  
ATOM 5051  C C    . SER A 1 108 ? -0.697  10.756  -21.269 1.00 0.00 ? 1240 SER A C    3  
ATOM 5052  O O    . SER A 1 108 ? -1.468  11.688  -21.492 1.00 0.00 ? 1240 SER A O    3  
ATOM 5053  C CB   . SER A 1 108 ? 0.904   12.179  -19.977 1.00 0.00 ? 1240 SER A CB   3  
ATOM 5054  O OG   . SER A 1 108 ? 2.023   12.005  -19.125 1.00 0.00 ? 1240 SER A OG   3  
ATOM 5055  H H    . SER A 1 108 ? 1.536   12.211  -22.531 1.00 0.00 ? 1240 SER A H    3  
ATOM 5056  H HA   . SER A 1 108 ? 1.196   10.126  -20.511 1.00 0.00 ? 1240 SER A HA   3  
ATOM 5057  H HB2  . SER A 1 108 ? 1.026   13.099  -20.527 1.00 0.00 ? 1240 SER A HB2  3  
ATOM 5058  H HB3  . SER A 1 108 ? 0.011   12.237  -19.372 1.00 0.00 ? 1240 SER A HB3  3  
ATOM 5059  H HG   . SER A 1 108 ? 2.057   12.723  -18.489 1.00 0.00 ? 1240 SER A HG   3  
ATOM 5060  N N    . GLY A 1 109 ? -1.079  9.483   -21.281 1.00 0.00 ? 1241 GLY A N    3  
ATOM 5061  C CA   . GLY A 1 109 ? -2.457  9.124   -21.564 1.00 0.00 ? 1241 GLY A CA   3  
ATOM 5062  C C    . GLY A 1 109 ? -2.977  8.043   -20.637 1.00 0.00 ? 1241 GLY A C    3  
ATOM 5063  O O    . GLY A 1 109 ? -3.463  8.317   -19.540 1.00 0.00 ? 1241 GLY A O    3  
ATOM 5064  H H    . GLY A 1 109 ? -0.420  8.781   -21.095 1.00 0.00 ? 1241 GLY A H    3  
ATOM 5065  H HA2  . GLY A 1 109 ? -3.075  10.003  -21.458 1.00 0.00 ? 1241 GLY A HA2  3  
ATOM 5066  H HA3  . GLY A 1 109 ? -2.522  8.771   -22.582 1.00 0.00 ? 1241 GLY A HA3  3  
ATOM 5067  N N    . PRO A 1 110 ? -2.878  6.781   -21.080 1.00 0.00 ? 1242 PRO A N    3  
ATOM 5068  C CA   . PRO A 1 110 ? -3.338  5.629   -20.299 1.00 0.00 ? 1242 PRO A CA   3  
ATOM 5069  C C    . PRO A 1 110 ? -2.464  5.372   -19.076 1.00 0.00 ? 1242 PRO A C    3  
ATOM 5070  O O    . PRO A 1 110 ? -1.408  5.984   -18.916 1.00 0.00 ? 1242 PRO A O    3  
ATOM 5071  C CB   . PRO A 1 110 ? -3.232  4.465   -21.287 1.00 0.00 ? 1242 PRO A CB   3  
ATOM 5072  C CG   . PRO A 1 110 ? -2.186  4.887   -22.259 1.00 0.00 ? 1242 PRO A CG   3  
ATOM 5073  C CD   . PRO A 1 110 ? -2.310  6.381   -22.379 1.00 0.00 ? 1242 PRO A CD   3  
ATOM 5074  H HA   . PRO A 1 110 ? -4.366  5.746   -19.987 1.00 0.00 ? 1242 PRO A HA   3  
ATOM 5075  H HB2  . PRO A 1 110 ? -2.944  3.567   -20.759 1.00 0.00 ? 1242 PRO A HB2  3  
ATOM 5076  H HB3  . PRO A 1 110 ? -4.184  4.313   -21.773 1.00 0.00 ? 1242 PRO A HB3  3  
ATOM 5077  H HG2  . PRO A 1 110 ? -1.209  4.620   -21.886 1.00 0.00 ? 1242 PRO A HG2  3  
ATOM 5078  H HG3  . PRO A 1 110 ? -2.364  4.418   -23.216 1.00 0.00 ? 1242 PRO A HG3  3  
ATOM 5079  H HD2  . PRO A 1 110 ? -1.339  6.829   -22.529 1.00 0.00 ? 1242 PRO A HD2  3  
ATOM 5080  H HD3  . PRO A 1 110 ? -2.977  6.640   -23.187 1.00 0.00 ? 1242 PRO A HD3  3  
ATOM 5081  N N    . SER A 1 111 ? -2.910  4.461   -18.217 1.00 0.00 ? 1243 SER A N    3  
ATOM 5082  C CA   . SER A 1 111 ? -2.169  4.125   -17.006 1.00 0.00 ? 1243 SER A CA   3  
ATOM 5083  C C    . SER A 1 111 ? -2.025  5.345   -16.101 1.00 0.00 ? 1243 SER A C    3  
ATOM 5084  O O    . SER A 1 111 ? -0.949  5.610   -15.566 1.00 0.00 ? 1243 SER A O    3  
ATOM 5085  C CB   . SER A 1 111 ? -0.787  3.576   -17.365 1.00 0.00 ? 1243 SER A CB   3  
ATOM 5086  O OG   . SER A 1 111 ? -0.197  2.917   -16.257 1.00 0.00 ? 1243 SER A OG   3  
ATOM 5087  H H    . SER A 1 111 ? -3.759  4.007   -18.400 1.00 0.00 ? 1243 SER A H    3  
ATOM 5088  H HA   . SER A 1 111 ? -2.724  3.364   -16.479 1.00 0.00 ? 1243 SER A HA   3  
ATOM 5089  H HB2  . SER A 1 111 ? -0.882  2.872   -18.178 1.00 0.00 ? 1243 SER A HB2  3  
ATOM 5090  H HB3  . SER A 1 111 ? -0.146  4.391   -17.668 1.00 0.00 ? 1243 SER A HB3  3  
ATOM 5091  H HG   . SER A 1 111 ? -0.307  3.455   -15.470 1.00 0.00 ? 1243 SER A HG   3  
ATOM 5092  N N    . SER A 1 112 ? -3.117  6.084   -15.936 1.00 0.00 ? 1244 SER A N    3  
ATOM 5093  C CA   . SER A 1 112 ? -3.113  7.278   -15.100 1.00 0.00 ? 1244 SER A CA   3  
ATOM 5094  C C    . SER A 1 112 ? -4.447  7.440   -14.377 1.00 0.00 ? 1244 SER A C    3  
ATOM 5095  O O    . SER A 1 112 ? -5.506  7.161   -14.936 1.00 0.00 ? 1244 SER A O    3  
ATOM 5096  C CB   . SER A 1 112 ? -2.825  8.519   -15.947 1.00 0.00 ? 1244 SER A CB   3  
ATOM 5097  O OG   . SER A 1 112 ? -3.910  8.810   -16.811 1.00 0.00 ? 1244 SER A OG   3  
ATOM 5098  H H    . SER A 1 112 ? -3.945  5.821   -16.390 1.00 0.00 ? 1244 SER A H    3  
ATOM 5099  H HA   . SER A 1 112 ? -2.330  7.165   -14.365 1.00 0.00 ? 1244 SER A HA   3  
ATOM 5100  H HB2  . SER A 1 112 ? -2.661  9.365   -15.298 1.00 0.00 ? 1244 SER A HB2  3  
ATOM 5101  H HB3  . SER A 1 112 ? -1.941  8.347   -16.544 1.00 0.00 ? 1244 SER A HB3  3  
ATOM 5102  H HG   . SER A 1 112 ? -3.612  8.776   -17.723 1.00 0.00 ? 1244 SER A HG   3  
ATOM 5103  N N    . GLY A 1 113 ? -4.385  7.895   -13.129 1.00 0.00 ? 1245 GLY A N    3  
ATOM 5104  C CA   . GLY A 1 113 ? -5.594  8.086   -12.349 1.00 0.00 ? 1245 GLY A CA   3  
ATOM 5105  C C    . GLY A 1 113 ? -5.694  9.483   -11.769 1.00 0.00 ? 1245 GLY A C    3  
ATOM 5106  O O    . GLY A 1 113 ? -6.742  9.875   -11.255 1.00 0.00 ? 1245 GLY A O    3  
ATOM 5107  H H    . GLY A 1 113 ? -3.512  8.101   -12.735 1.00 0.00 ? 1245 GLY A H    3  
ATOM 5108  H HA2  . GLY A 1 113 ? -6.450  7.908   -12.982 1.00 0.00 ? 1245 GLY A HA2  3  
ATOM 5109  H HA3  . GLY A 1 113 ? -5.603  7.372   -11.539 1.00 0.00 ? 1245 GLY A HA3  3  
ATOM 5110  N N    . GLY A 1 1   ? 24.838  12.602  -16.111 1.00 0.00 ? 1133 GLY A N    4  
ATOM 5111  C CA   . GLY A 1 1   ? 24.683  12.289  -14.702 1.00 0.00 ? 1133 GLY A CA   4  
ATOM 5112  C C    . GLY A 1 1   ? 25.919  11.640  -14.113 1.00 0.00 ? 1133 GLY A C    4  
ATOM 5113  O O    . GLY A 1 1   ? 27.034  11.871  -14.583 1.00 0.00 ? 1133 GLY A O    4  
ATOM 5114  H H1   . GLY A 1 1   ? 25.219  11.935  -16.720 1.00 0.00 ? 1133 GLY A H1   4  
ATOM 5115  H HA2  . GLY A 1 1   ? 24.476  13.202  -14.163 1.00 0.00 ? 1133 GLY A HA2  4  
ATOM 5116  H HA3  . GLY A 1 1   ? 23.846  11.616  -14.585 1.00 0.00 ? 1133 GLY A HA3  4  
ATOM 5117  N N    . SER A 1 2   ? 25.724  10.826  -13.081 1.00 0.00 ? 1134 SER A N    4  
ATOM 5118  C CA   . SER A 1 2   ? 26.833  10.146  -12.423 1.00 0.00 ? 1134 SER A CA   4  
ATOM 5119  C C    . SER A 1 2   ? 26.942  8.700   -12.898 1.00 0.00 ? 1134 SER A C    4  
ATOM 5120  O O    . SER A 1 2   ? 26.051  8.189   -13.576 1.00 0.00 ? 1134 SER A O    4  
ATOM 5121  C CB   . SER A 1 2   ? 26.653  10.183  -10.904 1.00 0.00 ? 1134 SER A CB   4  
ATOM 5122  O OG   . SER A 1 2   ? 25.431  9.576   -10.520 1.00 0.00 ? 1134 SER A OG   4  
ATOM 5123  H H    . SER A 1 2   ? 24.811  10.682  -12.752 1.00 0.00 ? 1134 SER A H    4  
ATOM 5124  H HA   . SER A 1 2   ? 27.742  10.667  -12.682 1.00 0.00 ? 1134 SER A HA   4  
ATOM 5125  H HB2  . SER A 1 2   ? 27.467  9.652   -10.434 1.00 0.00 ? 1134 SER A HB2  4  
ATOM 5126  H HB3  . SER A 1 2   ? 26.652  11.210  -10.569 1.00 0.00 ? 1134 SER A HB3  4  
ATOM 5127  H HG   . SER A 1 2   ? 24.870  9.470   -11.292 1.00 0.00 ? 1134 SER A HG   4  
ATOM 5128  N N    . SER A 1 3   ? 28.043  8.047   -12.538 1.00 0.00 ? 1135 SER A N    4  
ATOM 5129  C CA   . SER A 1 3   ? 28.272  6.661   -12.931 1.00 0.00 ? 1135 SER A CA   4  
ATOM 5130  C C    . SER A 1 3   ? 27.904  5.708   -11.798 1.00 0.00 ? 1135 SER A C    4  
ATOM 5131  O O    . SER A 1 3   ? 27.052  4.836   -11.957 1.00 0.00 ? 1135 SER A O    4  
ATOM 5132  C CB   . SER A 1 3   ? 29.735  6.458   -13.330 1.00 0.00 ? 1135 SER A CB   4  
ATOM 5133  O OG   . SER A 1 3   ? 29.963  5.131   -13.771 1.00 0.00 ? 1135 SER A OG   4  
ATOM 5134  H H    . SER A 1 3   ? 28.717  8.509   -11.998 1.00 0.00 ? 1135 SER A H    4  
ATOM 5135  H HA   . SER A 1 3   ? 27.642  6.450   -13.782 1.00 0.00 ? 1135 SER A HA   4  
ATOM 5136  H HB2  . SER A 1 3   ? 29.985  7.138   -14.129 1.00 0.00 ? 1135 SER A HB2  4  
ATOM 5137  H HB3  . SER A 1 3   ? 30.368  6.655   -12.477 1.00 0.00 ? 1135 SER A HB3  4  
ATOM 5138  H HG   . SER A 1 3   ? 29.170  4.793   -14.194 1.00 0.00 ? 1135 SER A HG   4  
ATOM 5139  N N    . GLY A 1 4   ? 28.556  5.882   -10.652 1.00 0.00 ? 1136 GLY A N    4  
ATOM 5140  C CA   . GLY A 1 4   ? 28.285  5.030   -9.508  1.00 0.00 ? 1136 GLY A CA   4  
ATOM 5141  C C    . GLY A 1 4   ? 29.510  4.261   -9.055  1.00 0.00 ? 1136 GLY A C    4  
ATOM 5142  O O    . GLY A 1 4   ? 30.593  4.419   -9.617  1.00 0.00 ? 1136 GLY A O    4  
ATOM 5143  H H    . GLY A 1 4   ? 29.226  6.594   -10.582 1.00 0.00 ? 1136 GLY A H    4  
ATOM 5144  H HA2  . GLY A 1 4   ? 27.935  5.644   -8.691  1.00 0.00 ? 1136 GLY A HA2  4  
ATOM 5145  H HA3  . GLY A 1 4   ? 27.510  4.326   -9.774  1.00 0.00 ? 1136 GLY A HA3  4  
ATOM 5146  N N    . SER A 1 5   ? 29.339  3.428   -8.034  1.00 0.00 ? 1137 SER A N    4  
ATOM 5147  C CA   . SER A 1 5   ? 30.441  2.635   -7.501  1.00 0.00 ? 1137 SER A CA   4  
ATOM 5148  C C    . SER A 1 5   ? 29.920  1.398   -6.776  1.00 0.00 ? 1137 SER A C    4  
ATOM 5149  O O    . SER A 1 5   ? 28.880  1.443   -6.119  1.00 0.00 ? 1137 SER A O    4  
ATOM 5150  C CB   . SER A 1 5   ? 31.290  3.479   -6.549  1.00 0.00 ? 1137 SER A CB   4  
ATOM 5151  O OG   . SER A 1 5   ? 32.298  2.695   -5.934  1.00 0.00 ? 1137 SER A OG   4  
ATOM 5152  H H    . SER A 1 5   ? 28.450  3.346   -7.627  1.00 0.00 ? 1137 SER A H    4  
ATOM 5153  H HA   . SER A 1 5   ? 31.054  2.319   -8.332  1.00 0.00 ? 1137 SER A HA   4  
ATOM 5154  H HB2  . SER A 1 5   ? 31.760  4.278   -7.102  1.00 0.00 ? 1137 SER A HB2  4  
ATOM 5155  H HB3  . SER A 1 5   ? 30.656  3.897   -5.780  1.00 0.00 ? 1137 SER A HB3  4  
ATOM 5156  H HG   . SER A 1 5   ? 32.233  2.781   -4.980  1.00 0.00 ? 1137 SER A HG   4  
ATOM 5157  N N    . SER A 1 6   ? 30.651  0.295   -6.900  1.00 0.00 ? 1138 SER A N    4  
ATOM 5158  C CA   . SER A 1 6   ? 30.262  -0.956  -6.260  1.00 0.00 ? 1138 SER A CA   4  
ATOM 5159  C C    . SER A 1 6   ? 30.330  -0.833  -4.740  1.00 0.00 ? 1138 SER A C    4  
ATOM 5160  O O    . SER A 1 6   ? 31.398  -0.610  -4.172  1.00 0.00 ? 1138 SER A O    4  
ATOM 5161  C CB   . SER A 1 6   ? 31.164  -2.097  -6.732  1.00 0.00 ? 1138 SER A CB   4  
ATOM 5162  O OG   . SER A 1 6   ? 30.628  -3.357  -6.365  1.00 0.00 ? 1138 SER A OG   4  
ATOM 5163  H H    . SER A 1 6   ? 31.470  0.323   -7.437  1.00 0.00 ? 1138 SER A H    4  
ATOM 5164  H HA   . SER A 1 6   ? 29.243  -1.172  -6.546  1.00 0.00 ? 1138 SER A HA   4  
ATOM 5165  H HB2  . SER A 1 6   ? 31.257  -2.058  -7.806  1.00 0.00 ? 1138 SER A HB2  4  
ATOM 5166  H HB3  . SER A 1 6   ? 32.141  -1.990  -6.282  1.00 0.00 ? 1138 SER A HB3  4  
ATOM 5167  H HG   . SER A 1 6   ? 30.297  -3.314  -5.465  1.00 0.00 ? 1138 SER A HG   4  
ATOM 5168  N N    . GLY A 1 7   ? 29.181  -0.980  -4.088  1.00 0.00 ? 1139 GLY A N    4  
ATOM 5169  C CA   . GLY A 1 7   ? 29.131  -0.883  -2.641  1.00 0.00 ? 1139 GLY A CA   4  
ATOM 5170  C C    . GLY A 1 7   ? 29.740  0.407   -2.126  1.00 0.00 ? 1139 GLY A C    4  
ATOM 5171  O O    . GLY A 1 7   ? 30.960  0.524   -2.015  1.00 0.00 ? 1139 GLY A O    4  
ATOM 5172  H H    . GLY A 1 7   ? 28.360  -1.156  -4.594  1.00 0.00 ? 1139 GLY A H    4  
ATOM 5173  H HA2  . GLY A 1 7   ? 28.101  -0.935  -2.323  1.00 0.00 ? 1139 GLY A HA2  4  
ATOM 5174  H HA3  . GLY A 1 7   ? 29.671  -1.716  -2.217  1.00 0.00 ? 1139 GLY A HA3  4  
ATOM 5175  N N    . SER A 1 8   ? 28.888  1.377   -1.812  1.00 0.00 ? 1140 SER A N    4  
ATOM 5176  C CA   . SER A 1 8   ? 29.349  2.667   -1.311  1.00 0.00 ? 1140 SER A CA   4  
ATOM 5177  C C    . SER A 1 8   ? 28.236  3.384   -0.553  1.00 0.00 ? 1140 SER A C    4  
ATOM 5178  O O    . SER A 1 8   ? 27.111  2.892   -0.466  1.00 0.00 ? 1140 SER A O    4  
ATOM 5179  C CB   . SER A 1 8   ? 29.839  3.541   -2.467  1.00 0.00 ? 1140 SER A CB   4  
ATOM 5180  O OG   . SER A 1 8   ? 28.767  3.918   -3.312  1.00 0.00 ? 1140 SER A OG   4  
ATOM 5181  H H    . SER A 1 8   ? 27.926  1.223   -1.923  1.00 0.00 ? 1140 SER A H    4  
ATOM 5182  H HA   . SER A 1 8   ? 30.170  2.485   -0.634  1.00 0.00 ? 1140 SER A HA   4  
ATOM 5183  H HB2  . SER A 1 8   ? 30.300  4.433   -2.070  1.00 0.00 ? 1140 SER A HB2  4  
ATOM 5184  H HB3  . SER A 1 8   ? 30.564  2.990   -3.048  1.00 0.00 ? 1140 SER A HB3  4  
ATOM 5185  H HG   . SER A 1 8   ? 28.230  3.147   -3.513  1.00 0.00 ? 1140 SER A HG   4  
ATOM 5186  N N    . SER A 1 9   ? 28.559  4.551   -0.005  1.00 0.00 ? 1141 SER A N    4  
ATOM 5187  C CA   . SER A 1 9   ? 27.590  5.336   0.750   1.00 0.00 ? 1141 SER A CA   4  
ATOM 5188  C C    . SER A 1 9   ? 26.907  6.365   -0.147  1.00 0.00 ? 1141 SER A C    4  
ATOM 5189  O O    . SER A 1 9   ? 27.289  7.535   -0.168  1.00 0.00 ? 1141 SER A O    4  
ATOM 5190  C CB   . SER A 1 9   ? 28.274  6.040   1.924   1.00 0.00 ? 1141 SER A CB   4  
ATOM 5191  O OG   . SER A 1 9   ? 29.369  6.823   1.480   1.00 0.00 ? 1141 SER A OG   4  
ATOM 5192  H H    . SER A 1 9   ? 29.473  4.891   -0.109  1.00 0.00 ? 1141 SER A H    4  
ATOM 5193  H HA   . SER A 1 9   ? 26.842  4.659   1.134   1.00 0.00 ? 1141 SER A HA   4  
ATOM 5194  H HB2  . SER A 1 9   ? 27.563  6.684   2.418   1.00 0.00 ? 1141 SER A HB2  4  
ATOM 5195  H HB3  . SER A 1 9   ? 28.636  5.299   2.622   1.00 0.00 ? 1141 SER A HB3  4  
ATOM 5196  H HG   . SER A 1 9   ? 30.175  6.305   1.532   1.00 0.00 ? 1141 SER A HG   4  
ATOM 5197  N N    . GLN A 1 10  ? 25.896  5.919   -0.885  1.00 0.00 ? 1142 GLN A N    4  
ATOM 5198  C CA   . GLN A 1 10  ? 25.161  6.800   -1.784  1.00 0.00 ? 1142 GLN A CA   4  
ATOM 5199  C C    . GLN A 1 10  ? 24.618  8.013   -1.035  1.00 0.00 ? 1142 GLN A C    4  
ATOM 5200  O O    . GLN A 1 10  ? 24.318  7.953   0.157   1.00 0.00 ? 1142 GLN A O    4  
ATOM 5201  C CB   . GLN A 1 10  ? 24.012  6.041   -2.450  1.00 0.00 ? 1142 GLN A CB   4  
ATOM 5202  C CG   . GLN A 1 10  ? 22.842  5.770   -1.518  1.00 0.00 ? 1142 GLN A CG   4  
ATOM 5203  C CD   . GLN A 1 10  ? 22.987  4.463   -0.764  1.00 0.00 ? 1142 GLN A CD   4  
ATOM 5204  O OE1  . GLN A 1 10  ? 23.816  4.343   0.139   1.00 0.00 ? 1142 GLN A OE1  4  
ATOM 5205  N NE2  . GLN A 1 10  ? 22.179  3.475   -1.130  1.00 0.00 ? 1142 GLN A NE2  4  
ATOM 5206  H H    . GLN A 1 10  ? 25.639  4.976   -0.824  1.00 0.00 ? 1142 GLN A H    4  
ATOM 5207  H HA   . GLN A 1 10  ? 25.845  7.141   -2.547  1.00 0.00 ? 1142 GLN A HA   4  
ATOM 5208  H HB2  . GLN A 1 10  ? 23.651  6.619   -3.287  1.00 0.00 ? 1142 GLN A HB2  4  
ATOM 5209  H HB3  . GLN A 1 10  ? 24.384  5.093   -2.810  1.00 0.00 ? 1142 GLN A HB3  4  
ATOM 5210  H HG2  . GLN A 1 10  ? 22.774  6.575   -0.802  1.00 0.00 ? 1142 GLN A HG2  4  
ATOM 5211  H HG3  . GLN A 1 10  ? 21.934  5.733   -2.103  1.00 0.00 ? 1142 GLN A HG3  4  
ATOM 5212  H HE21 . GLN A 1 10  ? 21.544  3.643   -1.858  1.00 0.00 ? 1142 GLN A HE21 4  
ATOM 5213  H HE22 . GLN A 1 10  ? 22.252  2.619   -0.660  1.00 0.00 ? 1142 GLN A HE22 4  
ATOM 5214  N N    . PRO A 1 11  ? 24.490  9.141   -1.749  1.00 0.00 ? 1143 PRO A N    4  
ATOM 5215  C CA   . PRO A 1 11  ? 23.983  10.390  -1.172  1.00 0.00 ? 1143 PRO A CA   4  
ATOM 5216  C C    . PRO A 1 11  ? 22.496  10.314  -0.841  1.00 0.00 ? 1143 PRO A C    4  
ATOM 5217  O O    . PRO A 1 11  ? 21.675  9.987   -1.698  1.00 0.00 ? 1143 PRO A O    4  
ATOM 5218  C CB   . PRO A 1 11  ? 24.233  11.419  -2.277  1.00 0.00 ? 1143 PRO A CB   4  
ATOM 5219  C CG   . PRO A 1 11  ? 24.250  10.625  -3.537  1.00 0.00 ? 1143 PRO A CG   4  
ATOM 5220  C CD   . PRO A 1 11  ? 24.829  9.285   -3.175  1.00 0.00 ? 1143 PRO A CD   4  
ATOM 5221  H HA   . PRO A 1 11  ? 24.534  10.670  -0.286  1.00 0.00 ? 1143 PRO A HA   4  
ATOM 5222  H HB2  . PRO A 1 11  ? 23.435  12.149  -2.280  1.00 0.00 ? 1143 PRO A HB2  4  
ATOM 5223  H HB3  . PRO A 1 11  ? 25.178  11.911  -2.108  1.00 0.00 ? 1143 PRO A HB3  4  
ATOM 5224  H HG2  . PRO A 1 11  ? 23.244  10.509  -3.912  1.00 0.00 ? 1143 PRO A HG2  4  
ATOM 5225  H HG3  . PRO A 1 11  ? 24.871  11.115  -4.272  1.00 0.00 ? 1143 PRO A HG3  4  
ATOM 5226  H HD2  . PRO A 1 11  ? 24.369  8.504   -3.761  1.00 0.00 ? 1143 PRO A HD2  4  
ATOM 5227  H HD3  . PRO A 1 11  ? 25.900  9.286   -3.317  1.00 0.00 ? 1143 PRO A HD3  4  
ATOM 5228  N N    . VAL A 1 12  ? 22.157  10.618  0.408   1.00 0.00 ? 1144 VAL A N    4  
ATOM 5229  C CA   . VAL A 1 12  ? 20.768  10.586  0.852   1.00 0.00 ? 1144 VAL A CA   4  
ATOM 5230  C C    . VAL A 1 12  ? 19.865  11.349  -0.111  1.00 0.00 ? 1144 VAL A C    4  
ATOM 5231  O O    . VAL A 1 12  ? 20.344  12.068  -0.989  1.00 0.00 ? 1144 VAL A O    4  
ATOM 5232  C CB   . VAL A 1 12  ? 20.616  11.183  2.263   1.00 0.00 ? 1144 VAL A CB   4  
ATOM 5233  C CG1  . VAL A 1 12  ? 21.435  10.390  3.270   1.00 0.00 ? 1144 VAL A CG1  4  
ATOM 5234  C CG2  . VAL A 1 12  ? 21.024  12.649  2.268   1.00 0.00 ? 1144 VAL A CG2  4  
ATOM 5235  H H    . VAL A 1 12  ? 22.856  10.871  1.045   1.00 0.00 ? 1144 VAL A H    4  
ATOM 5236  H HA   . VAL A 1 12  ? 20.452  9.553   0.885   1.00 0.00 ? 1144 VAL A HA   4  
ATOM 5237  H HB   . VAL A 1 12  ? 19.576  11.120  2.549   1.00 0.00 ? 1144 VAL A HB   4  
ATOM 5238  H HG11 . VAL A 1 12  ? 22.385  10.125  2.831   1.00 0.00 ? 1144 VAL A HG11 4  
ATOM 5239  H HG12 . VAL A 1 12  ? 21.599  10.990  4.153   1.00 0.00 ? 1144 VAL A HG12 4  
ATOM 5240  H HG13 . VAL A 1 12  ? 20.900  9.491   3.540   1.00 0.00 ? 1144 VAL A HG13 4  
ATOM 5241  H HG21 . VAL A 1 12  ? 20.504  13.164  3.061   1.00 0.00 ? 1144 VAL A HG21 4  
ATOM 5242  H HG22 . VAL A 1 12  ? 22.090  12.725  2.428   1.00 0.00 ? 1144 VAL A HG22 4  
ATOM 5243  H HG23 . VAL A 1 12  ? 20.770  13.097  1.319   1.00 0.00 ? 1144 VAL A HG23 4  
ATOM 5244  N N    . ILE A 1 13  ? 18.558  11.187  0.059   1.00 0.00 ? 1145 ILE A N    4  
ATOM 5245  C CA   . ILE A 1 13  ? 17.588  11.863  -0.794  1.00 0.00 ? 1145 ILE A CA   4  
ATOM 5246  C C    . ILE A 1 13  ? 17.255  13.250  -0.257  1.00 0.00 ? 1145 ILE A C    4  
ATOM 5247  O O    . ILE A 1 13  ? 17.106  13.441  0.950   1.00 0.00 ? 1145 ILE A O    4  
ATOM 5248  C CB   . ILE A 1 13  ? 16.287  11.048  -0.921  1.00 0.00 ? 1145 ILE A CB   4  
ATOM 5249  C CG1  . ILE A 1 13  ? 16.592  9.630   -1.407  1.00 0.00 ? 1145 ILE A CG1  4  
ATOM 5250  C CG2  . ILE A 1 13  ? 15.318  11.741  -1.868  1.00 0.00 ? 1145 ILE A CG2  4  
ATOM 5251  C CD1  . ILE A 1 13  ? 15.404  8.697   -1.336  1.00 0.00 ? 1145 ILE A CD1  4  
ATOM 5252  H H    . ILE A 1 13  ? 18.237  10.601  0.776   1.00 0.00 ? 1145 ILE A H    4  
ATOM 5253  H HA   . ILE A 1 13  ? 18.023  11.964  -1.778  1.00 0.00 ? 1145 ILE A HA   4  
ATOM 5254  H HB   . ILE A 1 13  ? 15.825  10.996  0.052   1.00 0.00 ? 1145 ILE A HB   4  
ATOM 5255  H HG12 . ILE A 1 13  ? 16.920  9.671   -2.434  1.00 0.00 ? 1145 ILE A HG12 4  
ATOM 5256  H HG13 . ILE A 1 13  ? 17.381  9.211   -0.799  1.00 0.00 ? 1145 ILE A HG13 4  
ATOM 5257  H HG21 . ILE A 1 13  ? 14.441  12.053  -1.321  1.00 0.00 ? 1145 ILE A HG21 4  
ATOM 5258  H HG22 . ILE A 1 13  ? 15.797  12.606  -2.302  1.00 0.00 ? 1145 ILE A HG22 4  
ATOM 5259  H HG23 . ILE A 1 13  ? 15.029  11.058  -2.652  1.00 0.00 ? 1145 ILE A HG23 4  
ATOM 5260  H HD11 . ILE A 1 13  ? 14.811  8.935   -0.465  1.00 0.00 ? 1145 ILE A HD11 4  
ATOM 5261  H HD12 . ILE A 1 13  ? 14.801  8.812   -2.224  1.00 0.00 ? 1145 ILE A HD12 4  
ATOM 5262  H HD13 . ILE A 1 13  ? 15.751  7.676   -1.266  1.00 0.00 ? 1145 ILE A HD13 4  
ATOM 5263  N N    . SER A 1 14  ? 17.138  14.217  -1.162  1.00 0.00 ? 1146 SER A N    4  
ATOM 5264  C CA   . SER A 1 14  ? 16.825  15.589  -0.779  1.00 0.00 ? 1146 SER A CA   4  
ATOM 5265  C C    . SER A 1 14  ? 15.506  15.651  -0.015  1.00 0.00 ? 1146 SER A C    4  
ATOM 5266  O O    . SER A 1 14  ? 14.483  15.147  -0.477  1.00 0.00 ? 1146 SER A O    4  
ATOM 5267  C CB   . SER A 1 14  ? 16.752  16.482  -2.019  1.00 0.00 ? 1146 SER A CB   4  
ATOM 5268  O OG   . SER A 1 14  ? 16.675  17.850  -1.657  1.00 0.00 ? 1146 SER A OG   4  
ATOM 5269  H H    . SER A 1 14  ? 17.269  14.002  -2.110  1.00 0.00 ? 1146 SER A H    4  
ATOM 5270  H HA   . SER A 1 14  ? 17.617  15.943  -0.137  1.00 0.00 ? 1146 SER A HA   4  
ATOM 5271  H HB2  . SER A 1 14  ? 17.635  16.331  -2.621  1.00 0.00 ? 1146 SER A HB2  4  
ATOM 5272  H HB3  . SER A 1 14  ? 15.875  16.224  -2.594  1.00 0.00 ? 1146 SER A HB3  4  
ATOM 5273  H HG   . SER A 1 14  ? 15.789  18.050  -1.347  1.00 0.00 ? 1146 SER A HG   4  
ATOM 5274  N N    . ALA A 1 15  ? 15.538  16.275  1.158   1.00 0.00 ? 1147 ALA A N    4  
ATOM 5275  C CA   . ALA A 1 15  ? 14.346  16.407  1.987   1.00 0.00 ? 1147 ALA A CA   4  
ATOM 5276  C C    . ALA A 1 15  ? 13.095  16.561  1.128   1.00 0.00 ? 1147 ALA A C    4  
ATOM 5277  O O    . ALA A 1 15  ? 12.063  15.952  1.406   1.00 0.00 ? 1147 ALA A O    4  
ATOM 5278  C CB   . ALA A 1 15  ? 14.489  17.590  2.933   1.00 0.00 ? 1147 ALA A CB   4  
ATOM 5279  H H    . ALA A 1 15  ? 16.384  16.658  1.473   1.00 0.00 ? 1147 ALA A H    4  
ATOM 5280  H HA   . ALA A 1 15  ? 14.254  15.510  2.583   1.00 0.00 ? 1147 ALA A HA   4  
ATOM 5281  H HB1  . ALA A 1 15  ? 13.756  17.509  3.722   1.00 0.00 ? 1147 ALA A HB1  4  
ATOM 5282  H HB2  . ALA A 1 15  ? 15.480  17.592  3.360   1.00 0.00 ? 1147 ALA A HB2  4  
ATOM 5283  H HB3  . ALA A 1 15  ? 14.330  18.508  2.387   1.00 0.00 ? 1147 ALA A HB3  4  
ATOM 5284  N N    . GLN A 1 16  ? 13.196  17.379  0.086   1.00 0.00 ? 1148 GLN A N    4  
ATOM 5285  C CA   . GLN A 1 16  ? 12.071  17.614  -0.812  1.00 0.00 ? 1148 GLN A CA   4  
ATOM 5286  C C    . GLN A 1 16  ? 11.274  16.332  -1.032  1.00 0.00 ? 1148 GLN A C    4  
ATOM 5287  O O    . GLN A 1 16  ? 10.059  16.305  -0.840  1.00 0.00 ? 1148 GLN A O    4  
ATOM 5288  C CB   . GLN A 1 16  ? 12.566  18.158  -2.153  1.00 0.00 ? 1148 GLN A CB   4  
ATOM 5289  C CG   . GLN A 1 16  ? 13.067  19.591  -2.081  1.00 0.00 ? 1148 GLN A CG   4  
ATOM 5290  C CD   . GLN A 1 16  ? 11.984  20.567  -1.662  1.00 0.00 ? 1148 GLN A CD   4  
ATOM 5291  O OE1  . GLN A 1 16  ? 10.848  20.490  -2.131  1.00 0.00 ? 1148 GLN A OE1  4  
ATOM 5292  N NE2  . GLN A 1 16  ? 12.331  21.491  -0.775  1.00 0.00 ? 1148 GLN A NE2  4  
ATOM 5293  H H    . GLN A 1 16  ? 14.046  17.836  -0.083  1.00 0.00 ? 1148 GLN A H    4  
ATOM 5294  H HA   . GLN A 1 16  ? 11.427  18.348  -0.352  1.00 0.00 ? 1148 GLN A HA   4  
ATOM 5295  H HB2  . GLN A 1 16  ? 13.374  17.534  -2.505  1.00 0.00 ? 1148 GLN A HB2  4  
ATOM 5296  H HB3  . GLN A 1 16  ? 11.755  18.118  -2.865  1.00 0.00 ? 1148 GLN A HB3  4  
ATOM 5297  H HG2  . GLN A 1 16  ? 13.872  19.642  -1.363  1.00 0.00 ? 1148 GLN A HG2  4  
ATOM 5298  H HG3  . GLN A 1 16  ? 13.434  19.880  -3.054  1.00 0.00 ? 1148 GLN A HG3  4  
ATOM 5299  H HE21 . GLN A 1 16  ? 13.255  21.493  -0.446  1.00 0.00 ? 1148 GLN A HE21 4  
ATOM 5300  H HE22 . GLN A 1 16  ? 11.652  22.135  -0.487  1.00 0.00 ? 1148 GLN A HE22 4  
ATOM 5301  N N    . GLU A 1 17  ? 11.967  15.272  -1.437  1.00 0.00 ? 1149 GLU A N    4  
ATOM 5302  C CA   . GLU A 1 17  ? 11.323  13.988  -1.685  1.00 0.00 ? 1149 GLU A CA   4  
ATOM 5303  C C    . GLU A 1 17  ? 11.397  13.095  -0.450  1.00 0.00 ? 1149 GLU A C    4  
ATOM 5304  O O    . GLU A 1 17  ? 10.397  12.512  -0.033  1.00 0.00 ? 1149 GLU A O    4  
ATOM 5305  C CB   . GLU A 1 17  ? 11.977  13.285  -2.876  1.00 0.00 ? 1149 GLU A CB   4  
ATOM 5306  C CG   . GLU A 1 17  ? 11.052  12.317  -3.595  1.00 0.00 ? 1149 GLU A CG   4  
ATOM 5307  C CD   . GLU A 1 17  ? 11.374  12.190  -5.071  1.00 0.00 ? 1149 GLU A CD   4  
ATOM 5308  O OE1  . GLU A 1 17  ? 12.471  11.690  -5.398  1.00 0.00 ? 1149 GLU A OE1  4  
ATOM 5309  O OE2  . GLU A 1 17  ? 10.529  12.590  -5.899  1.00 0.00 ? 1149 GLU A OE2  4  
ATOM 5310  H H    . GLU A 1 17  ? 12.934  15.356  -1.573  1.00 0.00 ? 1149 GLU A H    4  
ATOM 5311  H HA   . GLU A 1 17  ? 10.285  14.177  -1.916  1.00 0.00 ? 1149 GLU A HA   4  
ATOM 5312  H HB2  . GLU A 1 17  ? 12.304  14.032  -3.585  1.00 0.00 ? 1149 GLU A HB2  4  
ATOM 5313  H HB3  . GLU A 1 17  ? 12.837  12.735  -2.525  1.00 0.00 ? 1149 GLU A HB3  4  
ATOM 5314  H HG2  . GLU A 1 17  ? 11.145  11.344  -3.137  1.00 0.00 ? 1149 GLU A HG2  4  
ATOM 5315  H HG3  . GLU A 1 17  ? 10.035  12.666  -3.491  1.00 0.00 ? 1149 GLU A HG3  4  
ATOM 5316  N N    . GLN A 1 18  ? 12.589  12.993  0.128   1.00 0.00 ? 1150 GLN A N    4  
ATOM 5317  C CA   . GLN A 1 18  ? 12.795  12.170  1.314   1.00 0.00 ? 1150 GLN A CA   4  
ATOM 5318  C C    . GLN A 1 18  ? 11.618  12.298  2.276   1.00 0.00 ? 1150 GLN A C    4  
ATOM 5319  O O    . GLN A 1 18  ? 10.974  11.307  2.618   1.00 0.00 ? 1150 GLN A O    4  
ATOM 5320  C CB   . GLN A 1 18  ? 14.092  12.570  2.020   1.00 0.00 ? 1150 GLN A CB   4  
ATOM 5321  C CG   . GLN A 1 18  ? 14.651  11.484  2.926   1.00 0.00 ? 1150 GLN A CG   4  
ATOM 5322  C CD   . GLN A 1 18  ? 16.147  11.612  3.134   1.00 0.00 ? 1150 GLN A CD   4  
ATOM 5323  O OE1  . GLN A 1 18  ? 16.925  10.785  2.657   1.00 0.00 ? 1150 GLN A OE1  4  
ATOM 5324  N NE2  . GLN A 1 18  ? 16.559  12.652  3.850   1.00 0.00 ? 1150 GLN A NE2  4  
ATOM 5325  H H    . GLN A 1 18  ? 13.348  13.482  -0.251  1.00 0.00 ? 1150 GLN A H    4  
ATOM 5326  H HA   . GLN A 1 18  ? 12.872  11.142  0.995   1.00 0.00 ? 1150 GLN A HA   4  
ATOM 5327  H HB2  . GLN A 1 18  ? 14.836  12.805  1.274   1.00 0.00 ? 1150 GLN A HB2  4  
ATOM 5328  H HB3  . GLN A 1 18  ? 13.905  13.448  2.621   1.00 0.00 ? 1150 GLN A HB3  4  
ATOM 5329  H HG2  . GLN A 1 18  ? 14.163  11.548  3.887   1.00 0.00 ? 1150 GLN A HG2  4  
ATOM 5330  H HG3  . GLN A 1 18  ? 14.445  10.522  2.482   1.00 0.00 ? 1150 GLN A HG3  4  
ATOM 5331  H HE21 . GLN A 1 18  ? 15.882  13.269  4.200   1.00 0.00 ? 1150 GLN A HE21 4  
ATOM 5332  H HE22 . GLN A 1 18  ? 17.520  12.758  4.001   1.00 0.00 ? 1150 GLN A HE22 4  
ATOM 5333  N N    . GLU A 1 19  ? 11.344  13.525  2.709   1.00 0.00 ? 1151 GLU A N    4  
ATOM 5334  C CA   . GLU A 1 19  ? 10.246  13.781  3.632   1.00 0.00 ? 1151 GLU A CA   4  
ATOM 5335  C C    . GLU A 1 19  ? 8.997   13.006  3.221   1.00 0.00 ? 1151 GLU A C    4  
ATOM 5336  O O    . GLU A 1 19  ? 8.495   12.170  3.974   1.00 0.00 ? 1151 GLU A O    4  
ATOM 5337  C CB   . GLU A 1 19  ? 9.934   15.278  3.687   1.00 0.00 ? 1151 GLU A CB   4  
ATOM 5338  C CG   . GLU A 1 19  ? 9.386   15.737  5.027   1.00 0.00 ? 1151 GLU A CG   4  
ATOM 5339  C CD   . GLU A 1 19  ? 9.170   17.237  5.087   1.00 0.00 ? 1151 GLU A CD   4  
ATOM 5340  O OE1  . GLU A 1 19  ? 8.516   17.779  4.171   1.00 0.00 ? 1151 GLU A OE1  4  
ATOM 5341  O OE2  . GLU A 1 19  ? 9.655   17.869  6.048   1.00 0.00 ? 1151 GLU A OE2  4  
ATOM 5342  H H    . GLU A 1 19  ? 11.894  14.275  2.400   1.00 0.00 ? 1151 GLU A H    4  
ATOM 5343  H HA   . GLU A 1 19  ? 10.553  13.451  4.613   1.00 0.00 ? 1151 GLU A HA   4  
ATOM 5344  H HB2  . GLU A 1 19  ? 10.840  15.830  3.484   1.00 0.00 ? 1151 GLU A HB2  4  
ATOM 5345  H HB3  . GLU A 1 19  ? 9.205   15.510  2.925   1.00 0.00 ? 1151 GLU A HB3  4  
ATOM 5346  H HG2  . GLU A 1 19  ? 8.440   15.246  5.202   1.00 0.00 ? 1151 GLU A HG2  4  
ATOM 5347  H HG3  . GLU A 1 19  ? 10.084  15.458  5.803   1.00 0.00 ? 1151 GLU A HG3  4  
ATOM 5348  N N    . THR A 1 20  ? 8.500   13.289  2.021   1.00 0.00 ? 1152 THR A N    4  
ATOM 5349  C CA   . THR A 1 20  ? 7.310   12.621  1.509   1.00 0.00 ? 1152 THR A CA   4  
ATOM 5350  C C    . THR A 1 20  ? 7.368   11.120  1.770   1.00 0.00 ? 1152 THR A C    4  
ATOM 5351  O O    . THR A 1 20  ? 6.408   10.530  2.267   1.00 0.00 ? 1152 THR A O    4  
ATOM 5352  C CB   . THR A 1 20  ? 7.137   12.861  -0.002  1.00 0.00 ? 1152 THR A CB   4  
ATOM 5353  O OG1  . THR A 1 20  ? 7.047   14.266  -0.267  1.00 0.00 ? 1152 THR A OG1  4  
ATOM 5354  C CG2  . THR A 1 20  ? 5.891   12.161  -0.522  1.00 0.00 ? 1152 THR A CG2  4  
ATOM 5355  H H    . THR A 1 20  ? 8.945   13.964  1.468   1.00 0.00 ? 1152 THR A H    4  
ATOM 5356  H HA   . THR A 1 20  ? 6.451   13.032  2.019   1.00 0.00 ? 1152 THR A HA   4  
ATOM 5357  H HB   . THR A 1 20  ? 7.999   12.460  -0.516  1.00 0.00 ? 1152 THR A HB   4  
ATOM 5358  H HG1  . THR A 1 20  ? 7.528   14.471  -1.073  1.00 0.00 ? 1152 THR A HG1  4  
ATOM 5359  H HG21 . THR A 1 20  ? 5.812   11.183  -0.070  1.00 0.00 ? 1152 THR A HG21 4  
ATOM 5360  H HG22 . THR A 1 20  ? 5.957   12.058  -1.595  1.00 0.00 ? 1152 THR A HG22 4  
ATOM 5361  H HG23 . THR A 1 20  ? 5.018   12.745  -0.270  1.00 0.00 ? 1152 THR A HG23 4  
ATOM 5362  N N    . GLN A 1 21  ? 8.498   10.508  1.433   1.00 0.00 ? 1153 GLN A N    4  
ATOM 5363  C CA   . GLN A 1 21  ? 8.679   9.075   1.631   1.00 0.00 ? 1153 GLN A CA   4  
ATOM 5364  C C    . GLN A 1 21  ? 8.585   8.714   3.110   1.00 0.00 ? 1153 GLN A C    4  
ATOM 5365  O O    . GLN A 1 21  ? 8.114   7.633   3.466   1.00 0.00 ? 1153 GLN A O    4  
ATOM 5366  C CB   . GLN A 1 21  ? 10.030  8.628   1.069   1.00 0.00 ? 1153 GLN A CB   4  
ATOM 5367  C CG   . GLN A 1 21  ? 10.122  8.727   -0.445  1.00 0.00 ? 1153 GLN A CG   4  
ATOM 5368  C CD   . GLN A 1 21  ? 11.544  8.587   -0.953  1.00 0.00 ? 1153 GLN A CD   4  
ATOM 5369  O OE1  . GLN A 1 21  ? 12.408  8.036   -0.270  1.00 0.00 ? 1153 GLN A OE1  4  
ATOM 5370  N NE2  . GLN A 1 21  ? 11.793  9.085   -2.159  1.00 0.00 ? 1153 GLN A NE2  4  
ATOM 5371  H H    . GLN A 1 21  ? 9.227   11.032  1.041   1.00 0.00 ? 1153 GLN A H    4  
ATOM 5372  H HA   . GLN A 1 21  ? 7.891   8.565   1.098   1.00 0.00 ? 1153 GLN A HA   4  
ATOM 5373  H HB2  . GLN A 1 21  ? 10.806  9.244   1.497   1.00 0.00 ? 1153 GLN A HB2  4  
ATOM 5374  H HB3  . GLN A 1 21  ? 10.201  7.599   1.352   1.00 0.00 ? 1153 GLN A HB3  4  
ATOM 5375  H HG2  . GLN A 1 21  ? 9.521   7.943   -0.882  1.00 0.00 ? 1153 GLN A HG2  4  
ATOM 5376  H HG3  . GLN A 1 21  ? 9.738   9.688   -0.753  1.00 0.00 ? 1153 GLN A HG3  4  
ATOM 5377  H HE21 . GLN A 1 21  ? 11.056  9.510   -2.645  1.00 0.00 ? 1153 GLN A HE21 4  
ATOM 5378  H HE22 . GLN A 1 21  ? 12.703  9.009   -2.512  1.00 0.00 ? 1153 GLN A HE22 4  
ATOM 5379  N N    . ILE A 1 22  ? 9.037   9.624   3.966   1.00 0.00 ? 1154 ILE A N    4  
ATOM 5380  C CA   . ILE A 1 22  ? 9.003   9.401   5.406   1.00 0.00 ? 1154 ILE A CA   4  
ATOM 5381  C C    . ILE A 1 22  ? 7.569   9.358   5.922   1.00 0.00 ? 1154 ILE A C    4  
ATOM 5382  O O    . ILE A 1 22  ? 7.119   8.343   6.453   1.00 0.00 ? 1154 ILE A O    4  
ATOM 5383  C CB   . ILE A 1 22  ? 9.777   10.496  6.163   1.00 0.00 ? 1154 ILE A CB   4  
ATOM 5384  C CG1  . ILE A 1 22  ? 11.262  10.446  5.799   1.00 0.00 ? 1154 ILE A CG1  4  
ATOM 5385  C CG2  . ILE A 1 22  ? 9.589   10.335  7.665   1.00 0.00 ? 1154 ILE A CG2  4  
ATOM 5386  C CD1  . ILE A 1 22  ? 12.033  11.673  6.234   1.00 0.00 ? 1154 ILE A CD1  4  
ATOM 5387  H H    . ILE A 1 22  ? 9.401   10.466  3.621   1.00 0.00 ? 1154 ILE A H    4  
ATOM 5388  H HA   . ILE A 1 22  ? 9.475   8.450   5.607   1.00 0.00 ? 1154 ILE A HA   4  
ATOM 5389  H HB   . ILE A 1 22  ? 9.375   11.455  5.875   1.00 0.00 ? 1154 ILE A HB   4  
ATOM 5390  H HG12 . ILE A 1 22  ? 11.714  9.587   6.270   1.00 0.00 ? 1154 ILE A HG12 4  
ATOM 5391  H HG13 . ILE A 1 22  ? 11.359  10.356  4.727   1.00 0.00 ? 1154 ILE A HG13 4  
ATOM 5392  H HG21 . ILE A 1 22  ? 9.988   9.382   7.977   1.00 0.00 ? 1154 ILE A HG21 4  
ATOM 5393  H HG22 . ILE A 1 22  ? 10.110  11.129  8.179   1.00 0.00 ? 1154 ILE A HG22 4  
ATOM 5394  H HG23 . ILE A 1 22  ? 8.537   10.381  7.903   1.00 0.00 ? 1154 ILE A HG23 4  
ATOM 5395  H HD11 . ILE A 1 22  ? 11.340  12.447  6.530   1.00 0.00 ? 1154 ILE A HD11 4  
ATOM 5396  H HD12 . ILE A 1 22  ? 12.671  11.421  7.068   1.00 0.00 ? 1154 ILE A HD12 4  
ATOM 5397  H HD13 . ILE A 1 22  ? 12.638  12.028  5.413   1.00 0.00 ? 1154 ILE A HD13 4  
ATOM 5398  N N    . VAL A 1 23  ? 6.854   10.468  5.760   1.00 0.00 ? 1155 VAL A N    4  
ATOM 5399  C CA   . VAL A 1 23  ? 5.469   10.557  6.207   1.00 0.00 ? 1155 VAL A CA   4  
ATOM 5400  C C    . VAL A 1 23  ? 4.640   9.402   5.658   1.00 0.00 ? 1155 VAL A C    4  
ATOM 5401  O O    . VAL A 1 23  ? 3.844   8.797   6.379   1.00 0.00 ? 1155 VAL A O    4  
ATOM 5402  C CB   . VAL A 1 23  ? 4.825   11.888  5.775   1.00 0.00 ? 1155 VAL A CB   4  
ATOM 5403  C CG1  . VAL A 1 23  ? 3.408   11.996  6.318   1.00 0.00 ? 1155 VAL A CG1  4  
ATOM 5404  C CG2  . VAL A 1 23  ? 5.673   13.064  6.235   1.00 0.00 ? 1155 VAL A CG2  4  
ATOM 5405  H H    . VAL A 1 23  ? 7.269   11.245  5.329   1.00 0.00 ? 1155 VAL A H    4  
ATOM 5406  H HA   . VAL A 1 23  ? 5.463   10.512  7.286   1.00 0.00 ? 1155 VAL A HA   4  
ATOM 5407  H HB   . VAL A 1 23  ? 4.775   11.907  4.696   1.00 0.00 ? 1155 VAL A HB   4  
ATOM 5408  H HG11 . VAL A 1 23  ? 3.396   12.678  7.156   1.00 0.00 ? 1155 VAL A HG11 4  
ATOM 5409  H HG12 . VAL A 1 23  ? 2.752   12.364  5.543   1.00 0.00 ? 1155 VAL A HG12 4  
ATOM 5410  H HG13 . VAL A 1 23  ? 3.072   11.023  6.643   1.00 0.00 ? 1155 VAL A HG13 4  
ATOM 5411  H HG21 . VAL A 1 23  ? 5.181   13.987  5.969   1.00 0.00 ? 1155 VAL A HG21 4  
ATOM 5412  H HG22 . VAL A 1 23  ? 5.800   13.019  7.307   1.00 0.00 ? 1155 VAL A HG22 4  
ATOM 5413  H HG23 . VAL A 1 23  ? 6.640   13.020  5.757   1.00 0.00 ? 1155 VAL A HG23 4  
ATOM 5414  N N    . LEU A 1 24  ? 4.830   9.099   4.379   1.00 0.00 ? 1156 LEU A N    4  
ATOM 5415  C CA   . LEU A 1 24  ? 4.100   8.014   3.732   1.00 0.00 ? 1156 LEU A CA   4  
ATOM 5416  C C    . LEU A 1 24  ? 4.471   6.667   4.344   1.00 0.00 ? 1156 LEU A C    4  
ATOM 5417  O O    . LEU A 1 24  ? 3.608   5.938   4.833   1.00 0.00 ? 1156 LEU A O    4  
ATOM 5418  C CB   . LEU A 1 24  ? 4.389   8.002   2.230   1.00 0.00 ? 1156 LEU A CB   4  
ATOM 5419  C CG   . LEU A 1 24  ? 3.585   7.002   1.399   1.00 0.00 ? 1156 LEU A CG   4  
ATOM 5420  C CD1  . LEU A 1 24  ? 2.102   7.113   1.720   1.00 0.00 ? 1156 LEU A CD1  4  
ATOM 5421  C CD2  . LEU A 1 24  ? 3.829   7.224   -0.086  1.00 0.00 ? 1156 LEU A CD2  4  
ATOM 5422  H H    . LEU A 1 24  ? 5.477   9.616   3.856   1.00 0.00 ? 1156 LEU A H    4  
ATOM 5423  H HA   . LEU A 1 24  ? 3.045   8.188   3.886   1.00 0.00 ? 1156 LEU A HA   4  
ATOM 5424  H HB2  . LEU A 1 24  ? 4.185   8.990   1.846   1.00 0.00 ? 1156 LEU A HB2  4  
ATOM 5425  H HB3  . LEU A 1 24  ? 5.438   7.776   2.098   1.00 0.00 ? 1156 LEU A HB3  4  
ATOM 5426  H HG   . LEU A 1 24  ? 3.905   5.999   1.646   1.00 0.00 ? 1156 LEU A HG   4  
ATOM 5427  H HD11 . LEU A 1 24  ? 1.756   8.108   1.483   1.00 0.00 ? 1156 LEU A HD11 4  
ATOM 5428  H HD12 . LEU A 1 24  ? 1.945   6.917   2.770   1.00 0.00 ? 1156 LEU A HD12 4  
ATOM 5429  H HD13 . LEU A 1 24  ? 1.552   6.391   1.133   1.00 0.00 ? 1156 LEU A HD13 4  
ATOM 5430  H HD21 . LEU A 1 24  ? 4.147   8.243   -0.250  1.00 0.00 ? 1156 LEU A HD21 4  
ATOM 5431  H HD22 . LEU A 1 24  ? 2.915   7.040   -0.633  1.00 0.00 ? 1156 LEU A HD22 4  
ATOM 5432  H HD23 . LEU A 1 24  ? 4.597   6.547   -0.429  1.00 0.00 ? 1156 LEU A HD23 4  
ATOM 5433  N N    . TYR A 1 25  ? 5.759   6.345   4.314   1.00 0.00 ? 1157 TYR A N    4  
ATOM 5434  C CA   . TYR A 1 25  ? 6.244   5.085   4.865   1.00 0.00 ? 1157 TYR A CA   4  
ATOM 5435  C C    . TYR A 1 25  ? 5.504   4.732   6.151   1.00 0.00 ? 1157 TYR A C    4  
ATOM 5436  O O    . TYR A 1 25  ? 5.125   3.581   6.367   1.00 0.00 ? 1157 TYR A O    4  
ATOM 5437  C CB   . TYR A 1 25  ? 7.748   5.168   5.136   1.00 0.00 ? 1157 TYR A CB   4  
ATOM 5438  C CG   . TYR A 1 25  ? 8.316   3.926   5.784   1.00 0.00 ? 1157 TYR A CG   4  
ATOM 5439  C CD1  . TYR A 1 25  ? 8.424   2.736   5.075   1.00 0.00 ? 1157 TYR A CD1  4  
ATOM 5440  C CD2  . TYR A 1 25  ? 8.746   3.943   7.105   1.00 0.00 ? 1157 TYR A CD2  4  
ATOM 5441  C CE1  . TYR A 1 25  ? 8.942   1.599   5.663   1.00 0.00 ? 1157 TYR A CE1  4  
ATOM 5442  C CE2  . TYR A 1 25  ? 9.266   2.811   7.701   1.00 0.00 ? 1157 TYR A CE2  4  
ATOM 5443  C CZ   . TYR A 1 25  ? 9.362   1.641   6.976   1.00 0.00 ? 1157 TYR A CZ   4  
ATOM 5444  O OH   . TYR A 1 25  ? 9.880   0.510   7.565   1.00 0.00 ? 1157 TYR A OH   4  
ATOM 5445  H H    . TYR A 1 25  ? 6.399   6.967   3.910   1.00 0.00 ? 1157 TYR A H    4  
ATOM 5446  H HA   . TYR A 1 25  ? 6.063   4.311   4.134   1.00 0.00 ? 1157 TYR A HA   4  
ATOM 5447  H HB2  . TYR A 1 25  ? 8.266   5.322   4.202   1.00 0.00 ? 1157 TYR A HB2  4  
ATOM 5448  H HB3  . TYR A 1 25  ? 7.943   6.004   5.792   1.00 0.00 ? 1157 TYR A HB3  4  
ATOM 5449  H HD1  . TYR A 1 25  ? 8.095   2.707   4.046   1.00 0.00 ? 1157 TYR A HD1  4  
ATOM 5450  H HD2  . TYR A 1 25  ? 8.670   4.860   7.670   1.00 0.00 ? 1157 TYR A HD2  4  
ATOM 5451  H HE1  . TYR A 1 25  ? 9.018   0.683   5.095   1.00 0.00 ? 1157 TYR A HE1  4  
ATOM 5452  H HE2  . TYR A 1 25  ? 9.595   2.843   8.729   1.00 0.00 ? 1157 TYR A HE2  4  
ATOM 5453  H HH   . TYR A 1 25  ? 10.226  0.732   8.433   1.00 0.00 ? 1157 TYR A HH   4  
ATOM 5454  N N    . GLY A 1 26  ? 5.300   5.732   7.003   1.00 0.00 ? 1158 GLY A N    4  
ATOM 5455  C CA   . GLY A 1 26  ? 4.605   5.509   8.257   1.00 0.00 ? 1158 GLY A CA   4  
ATOM 5456  C C    . GLY A 1 26  ? 3.190   5.005   8.054   1.00 0.00 ? 1158 GLY A C    4  
ATOM 5457  O O    . GLY A 1 26  ? 2.757   4.061   8.717   1.00 0.00 ? 1158 GLY A O    4  
ATOM 5458  H H    . GLY A 1 26  ? 5.624   6.629   6.778   1.00 0.00 ? 1158 GLY A H    4  
ATOM 5459  H HA2  . GLY A 1 26  ? 5.155   4.782   8.837   1.00 0.00 ? 1158 GLY A HA2  4  
ATOM 5460  H HA3  . GLY A 1 26  ? 4.568   6.438   8.806   1.00 0.00 ? 1158 GLY A HA3  4  
ATOM 5461  N N    . LYS A 1 27  ? 2.465   5.636   7.137   1.00 0.00 ? 1159 LYS A N    4  
ATOM 5462  C CA   . LYS A 1 27  ? 1.090   5.247   6.848   1.00 0.00 ? 1159 LYS A CA   4  
ATOM 5463  C C    . LYS A 1 27  ? 1.026   3.814   6.330   1.00 0.00 ? 1159 LYS A C    4  
ATOM 5464  O O    . LYS A 1 27  ? 0.171   3.030   6.745   1.00 0.00 ? 1159 LYS A O    4  
ATOM 5465  C CB   . LYS A 1 27  ? 0.474   6.199   5.820   1.00 0.00 ? 1159 LYS A CB   4  
ATOM 5466  C CG   . LYS A 1 27  ? 0.479   7.654   6.258   1.00 0.00 ? 1159 LYS A CG   4  
ATOM 5467  C CD   . LYS A 1 27  ? -0.613  8.449   5.563   1.00 0.00 ? 1159 LYS A CD   4  
ATOM 5468  C CE   . LYS A 1 27  ? -0.476  9.939   5.835   1.00 0.00 ? 1159 LYS A CE   4  
ATOM 5469  N NZ   . LYS A 1 27  ? -1.227  10.352  7.053   1.00 0.00 ? 1159 LYS A NZ   4  
ATOM 5470  H H    . LYS A 1 27  ? 2.865   6.381   6.641   1.00 0.00 ? 1159 LYS A H    4  
ATOM 5471  H HA   . LYS A 1 27  ? 0.527   5.311   7.767   1.00 0.00 ? 1159 LYS A HA   4  
ATOM 5472  H HB2  . LYS A 1 27  ? 1.030   6.121   4.897   1.00 0.00 ? 1159 LYS A HB2  4  
ATOM 5473  H HB3  . LYS A 1 27  ? -0.549  5.903   5.640   1.00 0.00 ? 1159 LYS A HB3  4  
ATOM 5474  H HG2  . LYS A 1 27  ? 0.319   7.699   7.325   1.00 0.00 ? 1159 LYS A HG2  4  
ATOM 5475  H HG3  . LYS A 1 27  ? 1.438   8.089   6.017   1.00 0.00 ? 1159 LYS A HG3  4  
ATOM 5476  H HD2  . LYS A 1 27  ? -0.547  8.282   4.498   1.00 0.00 ? 1159 LYS A HD2  4  
ATOM 5477  H HD3  . LYS A 1 27  ? -1.575  8.113   5.923   1.00 0.00 ? 1159 LYS A HD3  4  
ATOM 5478  H HE2  . LYS A 1 27  ? 0.569   10.173  5.971   1.00 0.00 ? 1159 LYS A HE2  4  
ATOM 5479  H HE3  . LYS A 1 27  ? -0.859  10.484  4.984   1.00 0.00 ? 1159 LYS A HE3  4  
ATOM 5480  H HZ1  . LYS A 1 27  ? -2.241  10.153  6.932   1.00 0.00 ? 1159 LYS A HZ1  4  
ATOM 5481  H HZ2  . LYS A 1 27  ? -1.104  11.371  7.220   1.00 0.00 ? 1159 LYS A HZ2  4  
ATOM 5482  H HZ3  . LYS A 1 27  ? -0.878  9.831   7.882   1.00 0.00 ? 1159 LYS A HZ3  4  
ATOM 5483  N N    . LEU A 1 28  ? 1.937   3.476   5.424   1.00 0.00 ? 1160 LEU A N    4  
ATOM 5484  C CA   . LEU A 1 28  ? 1.986   2.136   4.851   1.00 0.00 ? 1160 LEU A CA   4  
ATOM 5485  C C    . LEU A 1 28  ? 2.208   1.087   5.936   1.00 0.00 ? 1160 LEU A C    4  
ATOM 5486  O O    . LEU A 1 28  ? 1.457   0.118   6.041   1.00 0.00 ? 1160 LEU A O    4  
ATOM 5487  C CB   . LEU A 1 28  ? 3.098   2.047   3.805   1.00 0.00 ? 1160 LEU A CB   4  
ATOM 5488  C CG   . LEU A 1 28  ? 2.775   2.633   2.430   1.00 0.00 ? 1160 LEU A CG   4  
ATOM 5489  C CD1  . LEU A 1 28  ? 4.053   2.934   1.663   1.00 0.00 ? 1160 LEU A CD1  4  
ATOM 5490  C CD2  . LEU A 1 28  ? 1.889   1.680   1.639   1.00 0.00 ? 1160 LEU A CD2  4  
ATOM 5491  H H    . LEU A 1 28  ? 2.592   4.144   5.132   1.00 0.00 ? 1160 LEU A H    4  
ATOM 5492  H HA   . LEU A 1 28  ? 1.037   1.945   4.372   1.00 0.00 ? 1160 LEU A HA   4  
ATOM 5493  H HB2  . LEU A 1 28  ? 3.959   2.570   4.192   1.00 0.00 ? 1160 LEU A HB2  4  
ATOM 5494  H HB3  . LEU A 1 28  ? 3.343   1.003   3.671   1.00 0.00 ? 1160 LEU A HB3  4  
ATOM 5495  H HG   . LEU A 1 28  ? 2.237   3.562   2.559   1.00 0.00 ? 1160 LEU A HG   4  
ATOM 5496  H HD11 . LEU A 1 28  ? 3.843   3.644   0.878   1.00 0.00 ? 1160 LEU A HD11 4  
ATOM 5497  H HD12 . LEU A 1 28  ? 4.437   2.022   1.231   1.00 0.00 ? 1160 LEU A HD12 4  
ATOM 5498  H HD13 . LEU A 1 28  ? 4.788   3.349   2.338   1.00 0.00 ? 1160 LEU A HD13 4  
ATOM 5499  H HD21 . LEU A 1 28  ? 0.935   1.582   2.136   1.00 0.00 ? 1160 LEU A HD21 4  
ATOM 5500  H HD22 . LEU A 1 28  ? 2.365   0.712   1.579   1.00 0.00 ? 1160 LEU A HD22 4  
ATOM 5501  H HD23 . LEU A 1 28  ? 1.739   2.071   0.644   1.00 0.00 ? 1160 LEU A HD23 4  
ATOM 5502  N N    . VAL A 1 29  ? 3.244   1.290   6.744   1.00 0.00 ? 1161 VAL A N    4  
ATOM 5503  C CA   . VAL A 1 29  ? 3.564   0.364   7.824   1.00 0.00 ? 1161 VAL A CA   4  
ATOM 5504  C C    . VAL A 1 29  ? 2.324   0.028   8.645   1.00 0.00 ? 1161 VAL A C    4  
ATOM 5505  O O    . VAL A 1 29  ? 2.085   -1.132  8.979   1.00 0.00 ? 1161 VAL A O    4  
ATOM 5506  C CB   . VAL A 1 29  ? 4.643   0.943   8.758   1.00 0.00 ? 1161 VAL A CB   4  
ATOM 5507  C CG1  . VAL A 1 29  ? 4.917   -0.009  9.912   1.00 0.00 ? 1161 VAL A CG1  4  
ATOM 5508  C CG2  . VAL A 1 29  ? 5.919   1.234   7.982   1.00 0.00 ? 1161 VAL A CG2  4  
ATOM 5509  H H    . VAL A 1 29  ? 3.807   2.081   6.611   1.00 0.00 ? 1161 VAL A H    4  
ATOM 5510  H HA   . VAL A 1 29  ? 3.949   -0.544  7.383   1.00 0.00 ? 1161 VAL A HA   4  
ATOM 5511  H HB   . VAL A 1 29  ? 4.276   1.873   9.167   1.00 0.00 ? 1161 VAL A HB   4  
ATOM 5512  H HG11 . VAL A 1 29  ? 5.478   -0.859  9.552   1.00 0.00 ? 1161 VAL A HG11 4  
ATOM 5513  H HG12 . VAL A 1 29  ? 5.486   0.503   10.674  1.00 0.00 ? 1161 VAL A HG12 4  
ATOM 5514  H HG13 . VAL A 1 29  ? 3.980   -0.348  10.329  1.00 0.00 ? 1161 VAL A HG13 4  
ATOM 5515  H HG21 . VAL A 1 29  ? 6.736   0.673   8.411   1.00 0.00 ? 1161 VAL A HG21 4  
ATOM 5516  H HG22 . VAL A 1 29  ? 5.787   0.944   6.950   1.00 0.00 ? 1161 VAL A HG22 4  
ATOM 5517  H HG23 . VAL A 1 29  ? 6.139   2.290   8.034   1.00 0.00 ? 1161 VAL A HG23 4  
ATOM 5518  N N    . GLU A 1 30  ? 1.538   1.051   8.965   1.00 0.00 ? 1162 GLU A N    4  
ATOM 5519  C CA   . GLU A 1 30  ? 0.322   0.863   9.748   1.00 0.00 ? 1162 GLU A CA   4  
ATOM 5520  C C    . GLU A 1 30  ? -0.614  -0.132  9.068   1.00 0.00 ? 1162 GLU A C    4  
ATOM 5521  O O    . GLU A 1 30  ? -1.162  -1.026  9.712   1.00 0.00 ? 1162 GLU A O    4  
ATOM 5522  C CB   . GLU A 1 30  ? -0.394  2.200   9.947   1.00 0.00 ? 1162 GLU A CB   4  
ATOM 5523  C CG   . GLU A 1 30  ? 0.267   3.097   10.979  1.00 0.00 ? 1162 GLU A CG   4  
ATOM 5524  C CD   . GLU A 1 30  ? 0.525   2.384   12.293  1.00 0.00 ? 1162 GLU A CD   4  
ATOM 5525  O OE1  . GLU A 1 30  ? -0.394  1.698   12.786  1.00 0.00 ? 1162 GLU A OE1  4  
ATOM 5526  O OE2  . GLU A 1 30  ? 1.647   2.513   12.827  1.00 0.00 ? 1162 GLU A OE2  4  
ATOM 5527  H H    . GLU A 1 30  ? 1.782   1.953   8.670   1.00 0.00 ? 1162 GLU A H    4  
ATOM 5528  H HA   . GLU A 1 30  ? 0.606   0.470   10.712  1.00 0.00 ? 1162 GLU A HA   4  
ATOM 5529  H HB2  . GLU A 1 30  ? -0.418  2.727   9.004   1.00 0.00 ? 1162 GLU A HB2  4  
ATOM 5530  H HB3  . GLU A 1 30  ? -1.408  2.007   10.266  1.00 0.00 ? 1162 GLU A HB3  4  
ATOM 5531  H HG2  . GLU A 1 30  ? 1.211   3.444   10.585  1.00 0.00 ? 1162 GLU A HG2  4  
ATOM 5532  H HG3  . GLU A 1 30  ? -0.376  3.945   11.167  1.00 0.00 ? 1162 GLU A HG3  4  
ATOM 5533  N N    . ALA A 1 31  ? -0.794  0.032   7.761   1.00 0.00 ? 1163 ALA A N    4  
ATOM 5534  C CA   . ALA A 1 31  ? -1.662  -0.851  6.992   1.00 0.00 ? 1163 ALA A CA   4  
ATOM 5535  C C    . ALA A 1 31  ? -1.156  -2.289  7.033   1.00 0.00 ? 1163 ALA A C    4  
ATOM 5536  O O    . ALA A 1 31  ? -1.939  -3.229  7.178   1.00 0.00 ? 1163 ALA A O    4  
ATOM 5537  C CB   . ALA A 1 31  ? -1.767  -0.367  5.554   1.00 0.00 ? 1163 ALA A CB   4  
ATOM 5538  H H    . ALA A 1 31  ? -0.330  0.763   7.303   1.00 0.00 ? 1163 ALA A H    4  
ATOM 5539  H HA   . ALA A 1 31  ? -2.648  -0.815  7.432   1.00 0.00 ? 1163 ALA A HA   4  
ATOM 5540  H HB1  . ALA A 1 31  ? -1.996  0.689   5.546   1.00 0.00 ? 1163 ALA A HB1  4  
ATOM 5541  H HB2  . ALA A 1 31  ? -0.829  -0.537  5.048   1.00 0.00 ? 1163 ALA A HB2  4  
ATOM 5542  H HB3  . ALA A 1 31  ? -2.552  -0.909  5.049   1.00 0.00 ? 1163 ALA A HB3  4  
ATOM 5543  N N    . ARG A 1 32  ? 0.156   -2.454  6.903   1.00 0.00 ? 1164 ARG A N    4  
ATOM 5544  C CA   . ARG A 1 32  ? 0.765   -3.779  6.923   1.00 0.00 ? 1164 ARG A CA   4  
ATOM 5545  C C    . ARG A 1 32  ? 0.443   -4.506  8.225   1.00 0.00 ? 1164 ARG A C    4  
ATOM 5546  O O    . ARG A 1 32  ? 0.147   -5.701  8.222   1.00 0.00 ? 1164 ARG A O    4  
ATOM 5547  C CB   . ARG A 1 32  ? 2.281   -3.669  6.750   1.00 0.00 ? 1164 ARG A CB   4  
ATOM 5548  C CG   . ARG A 1 32  ? 3.019   -4.975  6.995   1.00 0.00 ? 1164 ARG A CG   4  
ATOM 5549  C CD   . ARG A 1 32  ? 4.499   -4.739  7.252   1.00 0.00 ? 1164 ARG A CD   4  
ATOM 5550  N NE   . ARG A 1 32  ? 4.726   -3.965  8.470   1.00 0.00 ? 1164 ARG A NE   4  
ATOM 5551  C CZ   . ARG A 1 32  ? 5.857   -4.006  9.166   1.00 0.00 ? 1164 ARG A CZ   4  
ATOM 5552  N NH1  . ARG A 1 32  ? 6.857   -4.779  8.768   1.00 0.00 ? 1164 ARG A NH1  4  
ATOM 5553  N NH2  . ARG A 1 32  ? 5.988   -3.272  10.264  1.00 0.00 ? 1164 ARG A NH2  4  
ATOM 5554  H H    . ARG A 1 32  ? 0.728   -1.667  6.790   1.00 0.00 ? 1164 ARG A H    4  
ATOM 5555  H HA   . ARG A 1 32  ? 0.358   -4.344  6.098   1.00 0.00 ? 1164 ARG A HA   4  
ATOM 5556  H HB2  . ARG A 1 32  ? 2.495   -3.344  5.742   1.00 0.00 ? 1164 ARG A HB2  4  
ATOM 5557  H HB3  . ARG A 1 32  ? 2.658   -2.932  7.444   1.00 0.00 ? 1164 ARG A HB3  4  
ATOM 5558  H HG2  . ARG A 1 32  ? 2.589   -5.464  7.856   1.00 0.00 ? 1164 ARG A HG2  4  
ATOM 5559  H HG3  . ARG A 1 32  ? 2.909   -5.607  6.127   1.00 0.00 ? 1164 ARG A HG3  4  
ATOM 5560  H HD2  . ARG A 1 32  ? 4.991   -5.696  7.349   1.00 0.00 ? 1164 ARG A HD2  4  
ATOM 5561  H HD3  . ARG A 1 32  ? 4.916   -4.204  6.413   1.00 0.00 ? 1164 ARG A HD3  4  
ATOM 5562  H HE   . ARG A 1 32  ? 4.000   -3.387  8.782   1.00 0.00 ? 1164 ARG A HE   4  
ATOM 5563  H HH11 . ARG A 1 32  ? 6.761   -5.333  7.941   1.00 0.00 ? 1164 ARG A HH11 4  
ATOM 5564  H HH12 . ARG A 1 32  ? 7.708   -4.807  9.294   1.00 0.00 ? 1164 ARG A HH12 4  
ATOM 5565  H HH21 . ARG A 1 32  ? 5.236   -2.687  10.567  1.00 0.00 ? 1164 ARG A HH21 4  
ATOM 5566  H HH22 . ARG A 1 32  ? 6.839   -3.303  10.787  1.00 0.00 ? 1164 ARG A HH22 4  
ATOM 5567  N N    . GLN A 1 33  ? 0.502   -3.777  9.334   1.00 0.00 ? 1165 GLN A N    4  
ATOM 5568  C CA   . GLN A 1 33  ? 0.217   -4.354  10.643  1.00 0.00 ? 1165 GLN A CA   4  
ATOM 5569  C C    . GLN A 1 33  ? -1.236  -4.810  10.732  1.00 0.00 ? 1165 GLN A C    4  
ATOM 5570  O O    . GLN A 1 33  ? -1.516  -5.990  10.944  1.00 0.00 ? 1165 GLN A O    4  
ATOM 5571  C CB   . GLN A 1 33  ? 0.514   -3.338  11.747  1.00 0.00 ? 1165 GLN A CB   4  
ATOM 5572  C CG   . GLN A 1 33  ? 0.130   -3.820  13.137  1.00 0.00 ? 1165 GLN A CG   4  
ATOM 5573  C CD   . GLN A 1 33  ? -1.299  -3.470  13.502  1.00 0.00 ? 1165 GLN A CD   4  
ATOM 5574  O OE1  . GLN A 1 33  ? -1.976  -2.740  12.778  1.00 0.00 ? 1165 GLN A OE1  4  
ATOM 5575  N NE2  . GLN A 1 33  ? -1.766  -3.990  14.631  1.00 0.00 ? 1165 GLN A NE2  4  
ATOM 5576  H H    . GLN A 1 33  ? 0.743   -2.830  9.272   1.00 0.00 ? 1165 GLN A H    4  
ATOM 5577  H HA   . GLN A 1 33  ? 0.858   -5.212  10.773  1.00 0.00 ? 1165 GLN A HA   4  
ATOM 5578  H HB2  . GLN A 1 33  ? 1.571   -3.120  11.744  1.00 0.00 ? 1165 GLN A HB2  4  
ATOM 5579  H HB3  . GLN A 1 33  ? -0.034  -2.430  11.541  1.00 0.00 ? 1165 GLN A HB3  4  
ATOM 5580  H HG2  . GLN A 1 33  ? 0.242   -4.894  13.175  1.00 0.00 ? 1165 GLN A HG2  4  
ATOM 5581  H HG3  . GLN A 1 33  ? 0.793   -3.365  13.857  1.00 0.00 ? 1165 GLN A HG3  4  
ATOM 5582  H HE21 . GLN A 1 33  ? -1.169  -4.562  15.159  1.00 0.00 ? 1165 GLN A HE21 4  
ATOM 5583  H HE22 . GLN A 1 33  ? -2.686  -3.780  14.892  1.00 0.00 ? 1165 GLN A HE22 4  
ATOM 5584  N N    . LYS A 1 34  ? -2.158  -3.867  10.569  1.00 0.00 ? 1166 LYS A N    4  
ATOM 5585  C CA   . LYS A 1 34  ? -3.583  -4.170  10.630  1.00 0.00 ? 1166 LYS A CA   4  
ATOM 5586  C C    . LYS A 1 34  ? -3.946  -5.275  9.644   1.00 0.00 ? 1166 LYS A C    4  
ATOM 5587  O O    . LYS A 1 34  ? -4.804  -6.113  9.924   1.00 0.00 ? 1166 LYS A O    4  
ATOM 5588  C CB   . LYS A 1 34  ? -4.406  -2.915  10.333  1.00 0.00 ? 1166 LYS A CB   4  
ATOM 5589  C CG   . LYS A 1 34  ? -4.057  -2.259  9.007   1.00 0.00 ? 1166 LYS A CG   4  
ATOM 5590  C CD   . LYS A 1 34  ? -5.211  -1.423  8.479   1.00 0.00 ? 1166 LYS A CD   4  
ATOM 5591  C CE   . LYS A 1 34  ? -6.327  -2.298  7.928   1.00 0.00 ? 1166 LYS A CE   4  
ATOM 5592  N NZ   . LYS A 1 34  ? -5.927  -2.977  6.664   1.00 0.00 ? 1166 LYS A NZ   4  
ATOM 5593  H H    . LYS A 1 34  ? -1.873  -2.943  10.403  1.00 0.00 ? 1166 LYS A H    4  
ATOM 5594  H HA   . LYS A 1 34  ? -3.807  -4.509  11.631  1.00 0.00 ? 1166 LYS A HA   4  
ATOM 5595  H HB2  . LYS A 1 34  ? -5.452  -3.181  10.315  1.00 0.00 ? 1166 LYS A HB2  4  
ATOM 5596  H HB3  . LYS A 1 34  ? -4.240  -2.195  11.121  1.00 0.00 ? 1166 LYS A HB3  4  
ATOM 5597  H HG2  . LYS A 1 34  ? -3.198  -1.620  9.147   1.00 0.00 ? 1166 LYS A HG2  4  
ATOM 5598  H HG3  . LYS A 1 34  ? -3.822  -3.029  8.286   1.00 0.00 ? 1166 LYS A HG3  4  
ATOM 5599  H HD2  . LYS A 1 34  ? -5.605  -0.820  9.283   1.00 0.00 ? 1166 LYS A HD2  4  
ATOM 5600  H HD3  . LYS A 1 34  ? -4.846  -0.781  7.690   1.00 0.00 ? 1166 LYS A HD3  4  
ATOM 5601  H HE2  . LYS A 1 34  ? -6.577  -3.046  8.664   1.00 0.00 ? 1166 LYS A HE2  4  
ATOM 5602  H HE3  . LYS A 1 34  ? -7.190  -1.678  7.736   1.00 0.00 ? 1166 LYS A HE3  4  
ATOM 5603  H HZ1  . LYS A 1 34  ? -4.970  -3.373  6.759   1.00 0.00 ? 1166 LYS A HZ1  4  
ATOM 5604  H HZ2  . LYS A 1 34  ? -5.931  -2.298  5.877   1.00 0.00 ? 1166 LYS A HZ2  4  
ATOM 5605  H HZ3  . LYS A 1 34  ? -6.590  -3.748  6.447   1.00 0.00 ? 1166 LYS A HZ3  4  
ATOM 5606  N N    . HIS A 1 35  ? -3.288  -5.272  8.489   1.00 0.00 ? 1167 HIS A N    4  
ATOM 5607  C CA   . HIS A 1 35  ? -3.541  -6.276  7.462   1.00 0.00 ? 1167 HIS A CA   4  
ATOM 5608  C C    . HIS A 1 35  ? -3.001  -7.638  7.889   1.00 0.00 ? 1167 HIS A C    4  
ATOM 5609  O O    . HIS A 1 35  ? -3.688  -8.652  7.773   1.00 0.00 ? 1167 HIS A O    4  
ATOM 5610  C CB   . HIS A 1 35  ? -2.903  -5.854  6.138   1.00 0.00 ? 1167 HIS A CB   4  
ATOM 5611  C CG   . HIS A 1 35  ? -3.536  -6.489  4.939   1.00 0.00 ? 1167 HIS A CG   4  
ATOM 5612  N ND1  . HIS A 1 35  ? -4.556  -7.413  5.027   1.00 0.00 ? 1167 HIS A ND1  4  
ATOM 5613  C CD2  . HIS A 1 35  ? -3.290  -6.327  3.618   1.00 0.00 ? 1167 HIS A CD2  4  
ATOM 5614  C CE1  . HIS A 1 35  ? -4.909  -7.793  3.812   1.00 0.00 ? 1167 HIS A CE1  4  
ATOM 5615  N NE2  . HIS A 1 35  ? -4.156  -7.149  2.939   1.00 0.00 ? 1167 HIS A NE2  4  
ATOM 5616  H H    . HIS A 1 35  ? -2.616  -4.578  8.325   1.00 0.00 ? 1167 HIS A H    4  
ATOM 5617  H HA   . HIS A 1 35  ? -4.609  -6.352  7.329   1.00 0.00 ? 1167 HIS A HA   4  
ATOM 5618  H HB2  . HIS A 1 35  ? -2.990  -4.783  6.030   1.00 0.00 ? 1167 HIS A HB2  4  
ATOM 5619  H HB3  . HIS A 1 35  ? -1.858  -6.127  6.146   1.00 0.00 ? 1167 HIS A HB3  4  
ATOM 5620  H HD1  . HIS A 1 35  ? -4.960  -7.742  5.856   1.00 0.00 ? 1167 HIS A HD1  4  
ATOM 5621  H HD2  . HIS A 1 35  ? -2.550  -5.673  3.178   1.00 0.00 ? 1167 HIS A HD2  4  
ATOM 5622  H HE1  . HIS A 1 35  ? -5.681  -8.509  3.572   1.00 0.00 ? 1167 HIS A HE1  4  
ATOM 5623  H HE2  . HIS A 1 35  ? -4.152  -7.308  1.972   1.00 0.00 ? 1167 HIS A HE2  4  
ATOM 5624  N N    . ALA A 1 36  ? -1.767  -7.652  8.382   1.00 0.00 ? 1168 ALA A N    4  
ATOM 5625  C CA   . ALA A 1 36  ? -1.136  -8.888  8.826   1.00 0.00 ? 1168 ALA A CA   4  
ATOM 5626  C C    . ALA A 1 36  ? -2.101  -9.730  9.655   1.00 0.00 ? 1168 ALA A C    4  
ATOM 5627  O O    . ALA A 1 36  ? -2.291  -10.916 9.388   1.00 0.00 ? 1168 ALA A O    4  
ATOM 5628  C CB   . ALA A 1 36  ? 0.121   -8.581  9.627   1.00 0.00 ? 1168 ALA A CB   4  
ATOM 5629  H H    . ALA A 1 36  ? -1.270  -6.810  8.449   1.00 0.00 ? 1168 ALA A H    4  
ATOM 5630  H HA   . ALA A 1 36  ? -0.846  -9.449  7.950   1.00 0.00 ? 1168 ALA A HA   4  
ATOM 5631  H HB1  . ALA A 1 36  ? 0.292   -9.371  10.344  1.00 0.00 ? 1168 ALA A HB1  4  
ATOM 5632  H HB2  . ALA A 1 36  ? 0.966   -8.512  8.959   1.00 0.00 ? 1168 ALA A HB2  4  
ATOM 5633  H HB3  . ALA A 1 36  ? -0.005  -7.643  10.148  1.00 0.00 ? 1168 ALA A HB3  4  
ATOM 5634  N N    . ASN A 1 37  ? -2.707  -9.108  10.661  1.00 0.00 ? 1169 ASN A N    4  
ATOM 5635  C CA   . ASN A 1 37  ? -3.651  -9.802  11.530  1.00 0.00 ? 1169 ASN A CA   4  
ATOM 5636  C C    . ASN A 1 37  ? -4.846  -10.317 10.733  1.00 0.00 ? 1169 ASN A C    4  
ATOM 5637  O O    . ASN A 1 37  ? -5.265  -11.464 10.892  1.00 0.00 ? 1169 ASN A O    4  
ATOM 5638  C CB   . ASN A 1 37  ? -4.131  -8.869  12.643  1.00 0.00 ? 1169 ASN A CB   4  
ATOM 5639  C CG   . ASN A 1 37  ? -3.158  -8.806  13.805  1.00 0.00 ? 1169 ASN A CG   4  
ATOM 5640  O OD1  . ASN A 1 37  ? -3.256  -9.584  14.754  1.00 0.00 ? 1169 ASN A OD1  4  
ATOM 5641  N ND2  . ASN A 1 37  ? -2.212  -7.877  13.734  1.00 0.00 ? 1169 ASN A ND2  4  
ATOM 5642  H H    . ASN A 1 37  ? -2.514  -8.162  10.824  1.00 0.00 ? 1169 ASN A H    4  
ATOM 5643  H HA   . ASN A 1 37  ? -3.139  -10.642 11.973  1.00 0.00 ? 1169 ASN A HA   4  
ATOM 5644  H HB2  . ASN A 1 37  ? -4.249  -7.872  12.244  1.00 0.00 ? 1169 ASN A HB2  4  
ATOM 5645  H HB3  . ASN A 1 37  ? -5.083  -9.219  13.013  1.00 0.00 ? 1169 ASN A HB3  4  
ATOM 5646  H HD21 . ASN A 1 37  ? -2.196  -7.291  12.948  1.00 0.00 ? 1169 ASN A HD21 4  
ATOM 5647  H HD22 . ASN A 1 37  ? -1.570  -7.814  14.471  1.00 0.00 ? 1169 ASN A HD22 4  
ATOM 5648  N N    . LYS A 1 38  ? -5.390  -9.462  9.874   1.00 0.00 ? 1170 LYS A N    4  
ATOM 5649  C CA   . LYS A 1 38  ? -6.535  -9.829  9.049   1.00 0.00 ? 1170 LYS A CA   4  
ATOM 5650  C C    . LYS A 1 38  ? -6.327  -11.197 8.407   1.00 0.00 ? 1170 LYS A C    4  
ATOM 5651  O O    . LYS A 1 38  ? -7.147  -12.100 8.568   1.00 0.00 ? 1170 LYS A O    4  
ATOM 5652  C CB   . LYS A 1 38  ? -6.768  -8.775  7.964   1.00 0.00 ? 1170 LYS A CB   4  
ATOM 5653  C CG   . LYS A 1 38  ? -7.869  -9.144  6.985   1.00 0.00 ? 1170 LYS A CG   4  
ATOM 5654  C CD   . LYS A 1 38  ? -8.534  -7.908  6.403   1.00 0.00 ? 1170 LYS A CD   4  
ATOM 5655  C CE   . LYS A 1 38  ? -9.230  -8.217  5.086   1.00 0.00 ? 1170 LYS A CE   4  
ATOM 5656  N NZ   . LYS A 1 38  ? -9.495  -6.983  4.296   1.00 0.00 ? 1170 LYS A NZ   4  
ATOM 5657  H H    . LYS A 1 38  ? -5.012  -8.561  9.791   1.00 0.00 ? 1170 LYS A H    4  
ATOM 5658  H HA   . LYS A 1 38  ? -7.404  -9.874  9.689   1.00 0.00 ? 1170 LYS A HA   4  
ATOM 5659  H HB2  . LYS A 1 38  ? -7.034  -7.842  8.438   1.00 0.00 ? 1170 LYS A HB2  4  
ATOM 5660  H HB3  . LYS A 1 38  ? -5.851  -8.639  7.409   1.00 0.00 ? 1170 LYS A HB3  4  
ATOM 5661  H HG2  . LYS A 1 38  ? -7.442  -9.723  6.179   1.00 0.00 ? 1170 LYS A HG2  4  
ATOM 5662  H HG3  . LYS A 1 38  ? -8.613  -9.734  7.499   1.00 0.00 ? 1170 LYS A HG3  4  
ATOM 5663  H HD2  . LYS A 1 38  ? -9.266  -7.539  7.105   1.00 0.00 ? 1170 LYS A HD2  4  
ATOM 5664  H HD3  . LYS A 1 38  ? -7.782  -7.151  6.233   1.00 0.00 ? 1170 LYS A HD3  4  
ATOM 5665  H HE2  . LYS A 1 38  ? -8.600  -8.876  4.507   1.00 0.00 ? 1170 LYS A HE2  4  
ATOM 5666  H HE3  . LYS A 1 38  ? -10.168 -8.709  5.296   1.00 0.00 ? 1170 LYS A HE3  4  
ATOM 5667  H HZ1  . LYS A 1 38  ? -8.985  -7.023  3.390   1.00 0.00 ? 1170 LYS A HZ1  4  
ATOM 5668  H HZ2  . LYS A 1 38  ? -9.177  -6.146  4.823   1.00 0.00 ? 1170 LYS A HZ2  4  
ATOM 5669  H HZ3  . LYS A 1 38  ? -10.513 -6.893  4.105   1.00 0.00 ? 1170 LYS A HZ3  4  
ATOM 5670  N N    . MET A 1 39  ? -5.223  -11.343 7.681   1.00 0.00 ? 1171 MET A N    4  
ATOM 5671  C CA   . MET A 1 39  ? -4.906  -12.602 7.017   1.00 0.00 ? 1171 MET A CA   4  
ATOM 5672  C C    . MET A 1 39  ? -4.310  -13.602 8.004   1.00 0.00 ? 1171 MET A C    4  
ATOM 5673  O O    . MET A 1 39  ? -4.107  -14.770 7.672   1.00 0.00 ? 1171 MET A O    4  
ATOM 5674  C CB   . MET A 1 39  ? -3.932  -12.364 5.862   1.00 0.00 ? 1171 MET A CB   4  
ATOM 5675  C CG   . MET A 1 39  ? -4.538  -11.583 4.708   1.00 0.00 ? 1171 MET A CG   4  
ATOM 5676  S SD   . MET A 1 39  ? -3.772  -11.979 3.124   1.00 0.00 ? 1171 MET A SD   4  
ATOM 5677  C CE   . MET A 1 39  ? -2.399  -10.830 3.114   1.00 0.00 ? 1171 MET A CE   4  
ATOM 5678  H H    . MET A 1 39  ? -4.607  -10.587 7.589   1.00 0.00 ? 1171 MET A H    4  
ATOM 5679  H HA   . MET A 1 39  ? -5.826  -13.009 6.623   1.00 0.00 ? 1171 MET A HA   4  
ATOM 5680  H HB2  . MET A 1 39  ? -3.080  -11.814 6.234   1.00 0.00 ? 1171 MET A HB2  4  
ATOM 5681  H HB3  . MET A 1 39  ? -3.597  -13.319 5.486   1.00 0.00 ? 1171 MET A HB3  4  
ATOM 5682  H HG2  . MET A 1 39  ? -5.591  -11.811 4.649   1.00 0.00 ? 1171 MET A HG2  4  
ATOM 5683  H HG3  . MET A 1 39  ? -4.411  -10.528 4.900   1.00 0.00 ? 1171 MET A HG3  4  
ATOM 5684  H HE1  . MET A 1 39  ? -1.816  -10.957 4.015   1.00 0.00 ? 1171 MET A HE1  4  
ATOM 5685  H HE2  . MET A 1 39  ? -1.777  -11.020 2.252   1.00 0.00 ? 1171 MET A HE2  4  
ATOM 5686  H HE3  . MET A 1 39  ? -2.776  -9.818  3.071   1.00 0.00 ? 1171 MET A HE3  4  
ATOM 5687  N N    . ASP A 1 40  ? -4.031  -13.135 9.216   1.00 0.00 ? 1172 ASP A N    4  
ATOM 5688  C CA   . ASP A 1 40  ? -3.458  -13.988 10.250  1.00 0.00 ? 1172 ASP A CA   4  
ATOM 5689  C C    . ASP A 1 40  ? -2.028  -14.385 9.897   1.00 0.00 ? 1172 ASP A C    4  
ATOM 5690  O O    . ASP A 1 40  ? -1.565  -15.467 10.260  1.00 0.00 ? 1172 ASP A O    4  
ATOM 5691  C CB   . ASP A 1 40  ? -4.316  -15.240 10.441  1.00 0.00 ? 1172 ASP A CB   4  
ATOM 5692  C CG   . ASP A 1 40  ? -4.204  -15.810 11.842  1.00 0.00 ? 1172 ASP A CG   4  
ATOM 5693  O OD1  . ASP A 1 40  ? -3.282  -16.618 12.082  1.00 0.00 ? 1172 ASP A OD1  4  
ATOM 5694  O OD2  . ASP A 1 40  ? -5.038  -15.448 12.698  1.00 0.00 ? 1172 ASP A OD2  4  
ATOM 5695  H H    . ASP A 1 40  ? -4.216  -12.194 9.420   1.00 0.00 ? 1172 ASP A H    4  
ATOM 5696  H HA   . ASP A 1 40  ? -3.445  -13.428 11.173  1.00 0.00 ? 1172 ASP A HA   4  
ATOM 5697  H HB2  . ASP A 1 40  ? -5.351  -14.991 10.256  1.00 0.00 ? 1172 ASP A HB2  4  
ATOM 5698  H HB3  . ASP A 1 40  ? -4.000  -15.996 9.738   1.00 0.00 ? 1172 ASP A HB3  4  
ATOM 5699  N N    . VAL A 1 41  ? -1.333  -13.503 9.186   1.00 0.00 ? 1173 VAL A N    4  
ATOM 5700  C CA   . VAL A 1 41  ? 0.045   -13.761 8.784   1.00 0.00 ? 1173 VAL A CA   4  
ATOM 5701  C C    . VAL A 1 41  ? 1.007   -12.800 9.472   1.00 0.00 ? 1173 VAL A C    4  
ATOM 5702  O O    . VAL A 1 41  ? 0.733   -11.610 9.625   1.00 0.00 ? 1173 VAL A O    4  
ATOM 5703  C CB   . VAL A 1 41  ? 0.216   -13.637 7.258   1.00 0.00 ? 1173 VAL A CB   4  
ATOM 5704  C CG1  . VAL A 1 41  ? -0.648  -14.661 6.538   1.00 0.00 ? 1173 VAL A CG1  4  
ATOM 5705  C CG2  . VAL A 1 41  ? -0.119  -12.226 6.798   1.00 0.00 ? 1173 VAL A CG2  4  
ATOM 5706  H H    . VAL A 1 41  ? -1.756  -12.658 8.927   1.00 0.00 ? 1173 VAL A H    4  
ATOM 5707  H HA   . VAL A 1 41  ? 0.293   -14.772 9.072   1.00 0.00 ? 1173 VAL A HA   4  
ATOM 5708  H HB   . VAL A 1 41  ? 1.249   -13.836 7.015   1.00 0.00 ? 1173 VAL A HB   4  
ATOM 5709  H HG11 . VAL A 1 41  ? -0.112  -15.046 5.683   1.00 0.00 ? 1173 VAL A HG11 4  
ATOM 5710  H HG12 . VAL A 1 41  ? -0.884  -15.471 7.213   1.00 0.00 ? 1173 VAL A HG12 4  
ATOM 5711  H HG13 . VAL A 1 41  ? -1.562  -14.190 6.207   1.00 0.00 ? 1173 VAL A HG13 4  
ATOM 5712  H HG21 . VAL A 1 41  ? 0.786   -11.639 6.750   1.00 0.00 ? 1173 VAL A HG21 4  
ATOM 5713  H HG22 . VAL A 1 41  ? -0.574  -12.265 5.818   1.00 0.00 ? 1173 VAL A HG22 4  
ATOM 5714  H HG23 . VAL A 1 41  ? -0.807  -11.773 7.496   1.00 0.00 ? 1173 VAL A HG23 4  
ATOM 5715  N N    . PRO A 1 42  ? 2.165   -13.327 9.899   1.00 0.00 ? 1174 PRO A N    4  
ATOM 5716  C CA   . PRO A 1 42  ? 3.193   -12.533 10.577  1.00 0.00 ? 1174 PRO A CA   4  
ATOM 5717  C C    . PRO A 1 42  ? 3.498   -11.231 9.845   1.00 0.00 ? 1174 PRO A C    4  
ATOM 5718  O O    . PRO A 1 42  ? 3.621   -11.193 8.620   1.00 0.00 ? 1174 PRO A O    4  
ATOM 5719  C CB   . PRO A 1 42  ? 4.417   -13.452 10.565  1.00 0.00 ? 1174 PRO A CB   4  
ATOM 5720  C CG   . PRO A 1 42  ? 3.855   -14.830 10.496  1.00 0.00 ? 1174 PRO A CG   4  
ATOM 5721  C CD   . PRO A 1 42  ? 2.559   -14.738 9.751   1.00 0.00 ? 1174 PRO A CD   4  
ATOM 5722  H HA   . PRO A 1 42  ? 2.916   -12.314 11.598  1.00 0.00 ? 1174 PRO A HA   4  
ATOM 5723  H HB2  . PRO A 1 42  ? 5.028   -13.231 9.701   1.00 0.00 ? 1174 PRO A HB2  4  
ATOM 5724  H HB3  . PRO A 1 42  ? 4.992   -13.305 11.467  1.00 0.00 ? 1174 PRO A HB3  4  
ATOM 5725  H HG2  . PRO A 1 42  ? 4.536   -15.479 9.967   1.00 0.00 ? 1174 PRO A HG2  4  
ATOM 5726  H HG3  . PRO A 1 42  ? 3.677   -15.204 11.493  1.00 0.00 ? 1174 PRO A HG3  4  
ATOM 5727  H HD2  . PRO A 1 42  ? 2.708   -14.990 8.711   1.00 0.00 ? 1174 PRO A HD2  4  
ATOM 5728  H HD3  . PRO A 1 42  ? 1.824   -15.392 10.198  1.00 0.00 ? 1174 PRO A HD3  4  
ATOM 5729  N N    . PRO A 1 43  ? 3.624   -10.136 10.610  1.00 0.00 ? 1175 PRO A N    4  
ATOM 5730  C CA   . PRO A 1 43  ? 3.917   -8.811  10.054  1.00 0.00 ? 1175 PRO A CA   4  
ATOM 5731  C C    . PRO A 1 43  ? 5.075   -8.842  9.062   1.00 0.00 ? 1175 PRO A C    4  
ATOM 5732  O O    . PRO A 1 43  ? 5.260   -7.909  8.281   1.00 0.00 ? 1175 PRO A O    4  
ATOM 5733  C CB   . PRO A 1 43  ? 4.290   -7.984  11.287  1.00 0.00 ? 1175 PRO A CB   4  
ATOM 5734  C CG   . PRO A 1 43  ? 3.587   -8.652  12.418  1.00 0.00 ? 1175 PRO A CG   4  
ATOM 5735  C CD   . PRO A 1 43  ? 3.490   -10.107 12.076  1.00 0.00 ? 1175 PRO A CD   4  
ATOM 5736  H HA   . PRO A 1 43  ? 3.048   -8.380  9.578   1.00 0.00 ? 1175 PRO A HA   4  
ATOM 5737  H HB2  . PRO A 1 43  ? 5.362   -7.999  11.422  1.00 0.00 ? 1175 PRO A HB2  4  
ATOM 5738  H HB3  . PRO A 1 43  ? 3.952   -6.967  11.158  1.00 0.00 ? 1175 PRO A HB3  4  
ATOM 5739  H HG2  . PRO A 1 43  ? 4.154   -8.526  13.328  1.00 0.00 ? 1175 PRO A HG2  4  
ATOM 5740  H HG3  . PRO A 1 43  ? 2.596   -8.236  12.531  1.00 0.00 ? 1175 PRO A HG3  4  
ATOM 5741  H HD2  . PRO A 1 43  ? 4.293   -10.655 12.547  1.00 0.00 ? 1175 PRO A HD2  4  
ATOM 5742  H HD3  . PRO A 1 43  ? 2.532   -10.499 12.383  1.00 0.00 ? 1175 PRO A HD3  4  
ATOM 5743  N N    . ALA A 1 44  ? 5.851   -9.920  9.100   1.00 0.00 ? 1176 ALA A N    4  
ATOM 5744  C CA   . ALA A 1 44  ? 6.990   -10.072 8.203   1.00 0.00 ? 1176 ALA A CA   4  
ATOM 5745  C C    . ALA A 1 44  ? 6.604   -10.858 6.954   1.00 0.00 ? 1176 ALA A C    4  
ATOM 5746  O O    . ALA A 1 44  ? 7.009   -10.514 5.843   1.00 0.00 ? 1176 ALA A O    4  
ATOM 5747  C CB   . ALA A 1 44  ? 8.142   -10.756 8.924   1.00 0.00 ? 1176 ALA A CB   4  
ATOM 5748  H H    . ALA A 1 44  ? 5.653   -10.630 9.745   1.00 0.00 ? 1176 ALA A H    4  
ATOM 5749  H HA   . ALA A 1 44  ? 7.317   -9.086  7.908   1.00 0.00 ? 1176 ALA A HA   4  
ATOM 5750  H HB1  . ALA A 1 44  ? 9.071   -10.512 8.429   1.00 0.00 ? 1176 ALA A HB1  4  
ATOM 5751  H HB2  . ALA A 1 44  ? 8.178   -10.417 9.948   1.00 0.00 ? 1176 ALA A HB2  4  
ATOM 5752  H HB3  . ALA A 1 44  ? 7.994   -11.826 8.903   1.00 0.00 ? 1176 ALA A HB3  4  
ATOM 5753  N N    . ILE A 1 45  ? 5.820   -11.914 7.144   1.00 0.00 ? 1177 ILE A N    4  
ATOM 5754  C CA   . ILE A 1 45  ? 5.379   -12.747 6.032   1.00 0.00 ? 1177 ILE A CA   4  
ATOM 5755  C C    . ILE A 1 45  ? 4.649   -11.920 4.980   1.00 0.00 ? 1177 ILE A C    4  
ATOM 5756  O O    . ILE A 1 45  ? 4.866   -12.090 3.779   1.00 0.00 ? 1177 ILE A O    4  
ATOM 5757  C CB   . ILE A 1 45  ? 4.453   -13.881 6.511   1.00 0.00 ? 1177 ILE A CB   4  
ATOM 5758  C CG1  . ILE A 1 45  ? 5.212   -14.831 7.439   1.00 0.00 ? 1177 ILE A CG1  4  
ATOM 5759  C CG2  . ILE A 1 45  ? 3.882   -14.637 5.321   1.00 0.00 ? 1177 ILE A CG2  4  
ATOM 5760  C CD1  . ILE A 1 45  ? 6.175   -15.744 6.713   1.00 0.00 ? 1177 ILE A CD1  4  
ATOM 5761  H H    . ILE A 1 45  ? 5.530   -12.137 8.053   1.00 0.00 ? 1177 ILE A H    4  
ATOM 5762  H HA   . ILE A 1 45  ? 6.255   -13.192 5.582   1.00 0.00 ? 1177 ILE A HA   4  
ATOM 5763  H HB   . ILE A 1 45  ? 3.631   -13.439 7.054   1.00 0.00 ? 1177 ILE A HB   4  
ATOM 5764  H HG12 . ILE A 1 45  ? 5.777   -14.253 8.152   1.00 0.00 ? 1177 ILE A HG12 4  
ATOM 5765  H HG13 . ILE A 1 45  ? 4.501   -15.450 7.967   1.00 0.00 ? 1177 ILE A HG13 4  
ATOM 5766  H HG21 . ILE A 1 45  ? 3.544   -13.932 4.575   1.00 0.00 ? 1177 ILE A HG21 4  
ATOM 5767  H HG22 . ILE A 1 45  ? 4.648   -15.269 4.896   1.00 0.00 ? 1177 ILE A HG22 4  
ATOM 5768  H HG23 . ILE A 1 45  ? 3.051   -15.245 5.645   1.00 0.00 ? 1177 ILE A HG23 4  
ATOM 5769  H HD11 . ILE A 1 45  ? 7.004   -15.983 7.362   1.00 0.00 ? 1177 ILE A HD11 4  
ATOM 5770  H HD12 . ILE A 1 45  ? 5.666   -16.652 6.428   1.00 0.00 ? 1177 ILE A HD12 4  
ATOM 5771  H HD13 . ILE A 1 45  ? 6.544   -15.246 5.828   1.00 0.00 ? 1177 ILE A HD13 4  
ATOM 5772  N N    . LEU A 1 46  ? 3.785   -11.021 5.438   1.00 0.00 ? 1178 LEU A N    4  
ATOM 5773  C CA   . LEU A 1 46  ? 3.023   -10.163 4.536   1.00 0.00 ? 1178 LEU A CA   4  
ATOM 5774  C C    . LEU A 1 46  ? 3.954   -9.356  3.637   1.00 0.00 ? 1178 LEU A C    4  
ATOM 5775  O O    . LEU A 1 46  ? 4.034   -9.597  2.433   1.00 0.00 ? 1178 LEU A O    4  
ATOM 5776  C CB   . LEU A 1 46  ? 2.123   -9.220  5.336   1.00 0.00 ? 1178 LEU A CB   4  
ATOM 5777  C CG   . LEU A 1 46  ? 1.098   -8.424  4.528   1.00 0.00 ? 1178 LEU A CG   4  
ATOM 5778  C CD1  . LEU A 1 46  ? -0.087  -9.302  4.156   1.00 0.00 ? 1178 LEU A CD1  4  
ATOM 5779  C CD2  . LEU A 1 46  ? 0.635   -7.203  5.309   1.00 0.00 ? 1178 LEU A CD2  4  
ATOM 5780  H H    . LEU A 1 46  ? 3.655   -10.931 6.404   1.00 0.00 ? 1178 LEU A H    4  
ATOM 5781  H HA   . LEU A 1 46  ? 2.406   -10.798 3.917   1.00 0.00 ? 1178 LEU A HA   4  
ATOM 5782  H HB2  . LEU A 1 46  ? 1.584   -9.813  6.060   1.00 0.00 ? 1178 LEU A HB2  4  
ATOM 5783  H HB3  . LEU A 1 46  ? 2.759   -8.515  5.852   1.00 0.00 ? 1178 LEU A HB3  4  
ATOM 5784  H HG   . LEU A 1 46  ? 1.559   -8.081  3.611   1.00 0.00 ? 1178 LEU A HG   4  
ATOM 5785  H HD11 . LEU A 1 46  ? -0.460  -9.796  5.040   1.00 0.00 ? 1178 LEU A HD11 4  
ATOM 5786  H HD12 . LEU A 1 46  ? 0.225   -10.041 3.434   1.00 0.00 ? 1178 LEU A HD12 4  
ATOM 5787  H HD13 . LEU A 1 46  ? -0.868  -8.689  3.729   1.00 0.00 ? 1178 LEU A HD13 4  
ATOM 5788  H HD21 . LEU A 1 46  ? -0.407  -7.014  5.097   1.00 0.00 ? 1178 LEU A HD21 4  
ATOM 5789  H HD22 . LEU A 1 46  ? 1.223   -6.344  5.016   1.00 0.00 ? 1178 LEU A HD22 4  
ATOM 5790  H HD23 . LEU A 1 46  ? 0.762   -7.382  6.366   1.00 0.00 ? 1178 LEU A HD23 4  
ATOM 5791  N N    . ALA A 1 47  ? 4.657   -8.397  4.231   1.00 0.00 ? 1179 ALA A N    4  
ATOM 5792  C CA   . ALA A 1 47  ? 5.585   -7.556  3.485   1.00 0.00 ? 1179 ALA A CA   4  
ATOM 5793  C C    . ALA A 1 47  ? 6.719   -7.064  4.378   1.00 0.00 ? 1179 ALA A C    4  
ATOM 5794  O O    . ALA A 1 47  ? 6.484   -6.564  5.479   1.00 0.00 ? 1179 ALA A O    4  
ATOM 5795  C CB   . ALA A 1 47  ? 4.849   -6.378  2.865   1.00 0.00 ? 1179 ALA A CB   4  
ATOM 5796  H H    . ALA A 1 47  ? 4.550   -8.253  5.194   1.00 0.00 ? 1179 ALA A H    4  
ATOM 5797  H HA   . ALA A 1 47  ? 6.003   -8.150  2.685   1.00 0.00 ? 1179 ALA A HA   4  
ATOM 5798  H HB1  . ALA A 1 47  ? 5.196   -6.230  1.853   1.00 0.00 ? 1179 ALA A HB1  4  
ATOM 5799  H HB2  . ALA A 1 47  ? 3.788   -6.581  2.857   1.00 0.00 ? 1179 ALA A HB2  4  
ATOM 5800  H HB3  . ALA A 1 47  ? 5.041   -5.488  3.446   1.00 0.00 ? 1179 ALA A HB3  4  
ATOM 5801  N N    . THR A 1 48  ? 7.950   -7.208  3.898   1.00 0.00 ? 1180 THR A N    4  
ATOM 5802  C CA   . THR A 1 48  ? 9.120   -6.780  4.653   1.00 0.00 ? 1180 THR A CA   4  
ATOM 5803  C C    . THR A 1 48  ? 9.346   -5.279  4.513   1.00 0.00 ? 1180 THR A C    4  
ATOM 5804  O O    . THR A 1 48  ? 8.642   -4.603  3.764   1.00 0.00 ? 1180 THR A O    4  
ATOM 5805  C CB   . THR A 1 48  ? 10.389  -7.524  4.194   1.00 0.00 ? 1180 THR A CB   4  
ATOM 5806  O OG1  . THR A 1 48  ? 11.501  -7.146  5.012   1.00 0.00 ? 1180 THR A OG1  4  
ATOM 5807  C CG2  . THR A 1 48  ? 10.697  -7.218  2.736   1.00 0.00 ? 1180 THR A CG2  4  
ATOM 5808  H H    . THR A 1 48  ? 8.072   -7.614  3.014   1.00 0.00 ? 1180 THR A H    4  
ATOM 5809  H HA   . THR A 1 48  ? 8.949   -7.012  5.694   1.00 0.00 ? 1180 THR A HA   4  
ATOM 5810  H HB   . THR A 1 48  ? 10.221  -8.587  4.297   1.00 0.00 ? 1180 THR A HB   4  
ATOM 5811  H HG1  . THR A 1 48  ? 11.434  -7.582  5.865   1.00 0.00 ? 1180 THR A HG1  4  
ATOM 5812  H HG21 . THR A 1 48  ? 9.773   -7.103  2.189   1.00 0.00 ? 1180 THR A HG21 4  
ATOM 5813  H HG22 . THR A 1 48  ? 11.268  -8.031  2.312   1.00 0.00 ? 1180 THR A HG22 4  
ATOM 5814  H HG23 . THR A 1 48  ? 11.269  -6.305  2.674   1.00 0.00 ? 1180 THR A HG23 4  
ATOM 5815  N N    . ASN A 1 49  ? 10.334  -4.764  5.237   1.00 0.00 ? 1181 ASN A N    4  
ATOM 5816  C CA   . ASN A 1 49  ? 10.653  -3.341  5.193   1.00 0.00 ? 1181 ASN A CA   4  
ATOM 5817  C C    . ASN A 1 49  ? 11.086  -2.924  3.790   1.00 0.00 ? 1181 ASN A C    4  
ATOM 5818  O O    . ASN A 1 49  ? 10.623  -1.914  3.260   1.00 0.00 ? 1181 ASN A O    4  
ATOM 5819  C CB   . ASN A 1 49  ? 11.759  -3.013  6.198   1.00 0.00 ? 1181 ASN A CB   4  
ATOM 5820  C CG   . ASN A 1 49  ? 13.031  -3.796  5.934   1.00 0.00 ? 1181 ASN A CG   4  
ATOM 5821  O OD1  . ASN A 1 49  ? 13.013  -5.025  5.863   1.00 0.00 ? 1181 ASN A OD1  4  
ATOM 5822  N ND2  . ASN A 1 49  ? 14.143  -3.086  5.787   1.00 0.00 ? 1181 ASN A ND2  4  
ATOM 5823  H H    . ASN A 1 49  ? 10.861  -5.353  5.816   1.00 0.00 ? 1181 ASN A H    4  
ATOM 5824  H HA   . ASN A 1 49  ? 9.762   -2.793  5.460   1.00 0.00 ? 1181 ASN A HA   4  
ATOM 5825  H HB2  . ASN A 1 49  ? 11.990  -1.960  6.139   1.00 0.00 ? 1181 ASN A HB2  4  
ATOM 5826  H HB3  . ASN A 1 49  ? 11.414  -3.247  7.193   1.00 0.00 ? 1181 ASN A HB3  4  
ATOM 5827  H HD21 . ASN A 1 49  ? 14.082  -2.110  5.856   1.00 0.00 ? 1181 ASN A HD21 4  
ATOM 5828  H HD22 . ASN A 1 49  ? 14.980  -3.567  5.615   1.00 0.00 ? 1181 ASN A HD22 4  
ATOM 5829  N N    . LYS A 1 50  ? 11.975  -3.711  3.193   1.00 0.00 ? 1182 LYS A N    4  
ATOM 5830  C CA   . LYS A 1 50  ? 12.470  -3.426  1.851   1.00 0.00 ? 1182 LYS A CA   4  
ATOM 5831  C C    . LYS A 1 50  ? 11.317  -3.119  0.900   1.00 0.00 ? 1182 LYS A C    4  
ATOM 5832  O O    . LYS A 1 50  ? 11.311  -2.085  0.231   1.00 0.00 ? 1182 LYS A O    4  
ATOM 5833  C CB   . LYS A 1 50  ? 13.280  -4.612  1.322   1.00 0.00 ? 1182 LYS A CB   4  
ATOM 5834  C CG   . LYS A 1 50  ? 14.729  -4.609  1.774   1.00 0.00 ? 1182 LYS A CG   4  
ATOM 5835  C CD   . LYS A 1 50  ? 15.594  -3.747  0.870   1.00 0.00 ? 1182 LYS A CD   4  
ATOM 5836  C CE   . LYS A 1 50  ? 16.093  -4.529  -0.335  1.00 0.00 ? 1182 LYS A CE   4  
ATOM 5837  N NZ   . LYS A 1 50  ? 17.067  -5.586  0.055   1.00 0.00 ? 1182 LYS A NZ   4  
ATOM 5838  H H    . LYS A 1 50  ? 12.307  -4.503  3.667   1.00 0.00 ? 1182 LYS A H    4  
ATOM 5839  H HA   . LYS A 1 50  ? 13.112  -2.561  1.911   1.00 0.00 ? 1182 LYS A HA   4  
ATOM 5840  H HB2  . LYS A 1 50  ? 12.820  -5.528  1.663   1.00 0.00 ? 1182 LYS A HB2  4  
ATOM 5841  H HB3  . LYS A 1 50  ? 13.261  -4.591  0.242   1.00 0.00 ? 1182 LYS A HB3  4  
ATOM 5842  H HG2  . LYS A 1 50  ? 14.782  -4.221  2.781   1.00 0.00 ? 1182 LYS A HG2  4  
ATOM 5843  H HG3  . LYS A 1 50  ? 15.105  -5.622  1.757   1.00 0.00 ? 1182 LYS A HG3  4  
ATOM 5844  H HD2  . LYS A 1 50  ? 15.011  -2.907  0.522   1.00 0.00 ? 1182 LYS A HD2  4  
ATOM 5845  H HD3  . LYS A 1 50  ? 16.444  -3.389  1.433   1.00 0.00 ? 1182 LYS A HD3  4  
ATOM 5846  H HE2  . LYS A 1 50  ? 15.249  -4.992  -0.823  1.00 0.00 ? 1182 LYS A HE2  4  
ATOM 5847  H HE3  . LYS A 1 50  ? 16.573  -3.845  -1.019  1.00 0.00 ? 1182 LYS A HE3  4  
ATOM 5848  H HZ1  . LYS A 1 50  ? 17.328  -5.479  1.056   1.00 0.00 ? 1182 LYS A HZ1  4  
ATOM 5849  H HZ2  . LYS A 1 50  ? 17.927  -5.512  -0.525  1.00 0.00 ? 1182 LYS A HZ2  4  
ATOM 5850  H HZ3  . LYS A 1 50  ? 16.648  -6.528  -0.085  1.00 0.00 ? 1182 LYS A HZ3  4  
ATOM 5851  N N    . ILE A 1 51  ? 10.344  -4.022  0.847   1.00 0.00 ? 1183 ILE A N    4  
ATOM 5852  C CA   . ILE A 1 51  ? 9.186   -3.845  -0.020  1.00 0.00 ? 1183 ILE A CA   4  
ATOM 5853  C C    . ILE A 1 51  ? 8.476   -2.528  0.273   1.00 0.00 ? 1183 ILE A C    4  
ATOM 5854  O O    . ILE A 1 51  ? 8.226   -1.729  -0.631  1.00 0.00 ? 1183 ILE A O    4  
ATOM 5855  C CB   . ILE A 1 51  ? 8.182   -5.002  0.138   1.00 0.00 ? 1183 ILE A CB   4  
ATOM 5856  C CG1  . ILE A 1 51  ? 8.786   -6.306  -0.389  1.00 0.00 ? 1183 ILE A CG1  4  
ATOM 5857  C CG2  . ILE A 1 51  ? 6.885   -4.682  -0.590  1.00 0.00 ? 1183 ILE A CG2  4  
ATOM 5858  C CD1  . ILE A 1 51  ? 7.953   -7.528  -0.075  1.00 0.00 ? 1183 ILE A CD1  4  
ATOM 5859  H H    . ILE A 1 51  ? 10.406  -4.825  1.404   1.00 0.00 ? 1183 ILE A H    4  
ATOM 5860  H HA   . ILE A 1 51  ? 9.534   -3.834  -1.043  1.00 0.00 ? 1183 ILE A HA   4  
ATOM 5861  H HB   . ILE A 1 51  ? 7.959   -5.115  1.188   1.00 0.00 ? 1183 ILE A HB   4  
ATOM 5862  H HG12 . ILE A 1 51  ? 8.888   -6.241  -1.460  1.00 0.00 ? 1183 ILE A HG12 4  
ATOM 5863  H HG13 . ILE A 1 51  ? 9.762   -6.445  0.054   1.00 0.00 ? 1183 ILE A HG13 4  
ATOM 5864  H HG21 . ILE A 1 51  ? 6.432   -3.806  -0.149  1.00 0.00 ? 1183 ILE A HG21 4  
ATOM 5865  H HG22 . ILE A 1 51  ? 7.095   -4.492  -1.632  1.00 0.00 ? 1183 ILE A HG22 4  
ATOM 5866  H HG23 . ILE A 1 51  ? 6.208   -5.518  -0.505  1.00 0.00 ? 1183 ILE A HG23 4  
ATOM 5867  H HD11 . ILE A 1 51  ? 8.593   -8.316  0.295   1.00 0.00 ? 1183 ILE A HD11 4  
ATOM 5868  H HD12 . ILE A 1 51  ? 7.217   -7.280  0.675   1.00 0.00 ? 1183 ILE A HD12 4  
ATOM 5869  H HD13 . ILE A 1 51  ? 7.454   -7.864  -0.972  1.00 0.00 ? 1183 ILE A HD13 4  
ATOM 5870  N N    . LEU A 1 52  ? 8.153   -2.305  1.542   1.00 0.00 ? 1184 LEU A N    4  
ATOM 5871  C CA   . LEU A 1 52  ? 7.473   -1.083  1.956   1.00 0.00 ? 1184 LEU A CA   4  
ATOM 5872  C C    . LEU A 1 52  ? 8.217   0.151   1.454   1.00 0.00 ? 1184 LEU A C    4  
ATOM 5873  O O    . LEU A 1 52  ? 7.621   1.047   0.858   1.00 0.00 ? 1184 LEU A O    4  
ATOM 5874  C CB   . LEU A 1 52  ? 7.352   -1.035  3.481   1.00 0.00 ? 1184 LEU A CB   4  
ATOM 5875  C CG   . LEU A 1 52  ? 6.493   -2.125  4.121   1.00 0.00 ? 1184 LEU A CG   4  
ATOM 5876  C CD1  . LEU A 1 52  ? 6.581   -2.053  5.637   1.00 0.00 ? 1184 LEU A CD1  4  
ATOM 5877  C CD2  . LEU A 1 52  ? 5.047   -2.003  3.662   1.00 0.00 ? 1184 LEU A CD2  4  
ATOM 5878  H H    . LEU A 1 52  ? 8.378   -2.978  2.218   1.00 0.00 ? 1184 LEU A H    4  
ATOM 5879  H HA   . LEU A 1 52  ? 6.483   -1.092  1.525   1.00 0.00 ? 1184 LEU A HA   4  
ATOM 5880  H HB2  . LEU A 1 52  ? 8.346   -1.112  3.894   1.00 0.00 ? 1184 LEU A HB2  4  
ATOM 5881  H HB3  . LEU A 1 52  ? 6.927   -0.078  3.747   1.00 0.00 ? 1184 LEU A HB3  4  
ATOM 5882  H HG   . LEU A 1 52  ? 6.862   -3.094  3.812   1.00 0.00 ? 1184 LEU A HG   4  
ATOM 5883  H HD11 . LEU A 1 52  ? 5.700   -1.565  6.026   1.00 0.00 ? 1184 LEU A HD11 4  
ATOM 5884  H HD12 . LEU A 1 52  ? 7.458   -1.491  5.920   1.00 0.00 ? 1184 LEU A HD12 4  
ATOM 5885  H HD13 . LEU A 1 52  ? 6.648   -3.052  6.042   1.00 0.00 ? 1184 LEU A HD13 4  
ATOM 5886  H HD21 . LEU A 1 52  ? 4.441   -1.640  4.478   1.00 0.00 ? 1184 LEU A HD21 4  
ATOM 5887  H HD22 . LEU A 1 52  ? 4.686   -2.972  3.349   1.00 0.00 ? 1184 LEU A HD22 4  
ATOM 5888  H HD23 . LEU A 1 52  ? 4.989   -1.312  2.835   1.00 0.00 ? 1184 LEU A HD23 4  
ATOM 5889  N N    . VAL A 1 53  ? 9.523   0.188   1.699   1.00 0.00 ? 1185 VAL A N    4  
ATOM 5890  C CA   . VAL A 1 53  ? 10.349  1.310   1.269   1.00 0.00 ? 1185 VAL A CA   4  
ATOM 5891  C C    . VAL A 1 53  ? 10.115  1.633   -0.203  1.00 0.00 ? 1185 VAL A C    4  
ATOM 5892  O O    . VAL A 1 53  ? 9.829   2.775   -0.561  1.00 0.00 ? 1185 VAL A O    4  
ATOM 5893  C CB   . VAL A 1 53  ? 11.846  1.021   1.487   1.00 0.00 ? 1185 VAL A CB   4  
ATOM 5894  C CG1  . VAL A 1 53  ? 12.695  2.159   0.942   1.00 0.00 ? 1185 VAL A CG1  4  
ATOM 5895  C CG2  . VAL A 1 53  ? 12.133  0.791   2.964   1.00 0.00 ? 1185 VAL A CG2  4  
ATOM 5896  H H    . VAL A 1 53  ? 9.941   -0.557  2.179   1.00 0.00 ? 1185 VAL A H    4  
ATOM 5897  H HA   . VAL A 1 53  ? 10.079  2.171   1.863   1.00 0.00 ? 1185 VAL A HA   4  
ATOM 5898  H HB   . VAL A 1 53  ? 12.101  0.121   0.948   1.00 0.00 ? 1185 VAL A HB   4  
ATOM 5899  H HG11 . VAL A 1 53  ? 13.335  1.785   0.156   1.00 0.00 ? 1185 VAL A HG11 4  
ATOM 5900  H HG12 . VAL A 1 53  ? 12.051  2.932   0.547   1.00 0.00 ? 1185 VAL A HG12 4  
ATOM 5901  H HG13 . VAL A 1 53  ? 13.303  2.567   1.736   1.00 0.00 ? 1185 VAL A HG13 4  
ATOM 5902  H HG21 . VAL A 1 53  ? 12.098  -0.267  3.176   1.00 0.00 ? 1185 VAL A HG21 4  
ATOM 5903  H HG22 . VAL A 1 53  ? 13.115  1.173   3.203   1.00 0.00 ? 1185 VAL A HG22 4  
ATOM 5904  H HG23 . VAL A 1 53  ? 11.393  1.304   3.559   1.00 0.00 ? 1185 VAL A HG23 4  
ATOM 5905  N N    . ASP A 1 54  ? 10.238  0.618   -1.052  1.00 0.00 ? 1186 ASP A N    4  
ATOM 5906  C CA   . ASP A 1 54  ? 10.038  0.793   -2.486  1.00 0.00 ? 1186 ASP A CA   4  
ATOM 5907  C C    . ASP A 1 54  ? 8.725   1.518   -2.767  1.00 0.00 ? 1186 ASP A C    4  
ATOM 5908  O O    . ASP A 1 54  ? 8.706   2.549   -3.440  1.00 0.00 ? 1186 ASP A O    4  
ATOM 5909  C CB   . ASP A 1 54  ? 10.047  -0.563  -3.193  1.00 0.00 ? 1186 ASP A CB   4  
ATOM 5910  C CG   . ASP A 1 54  ? 11.446  -1.126  -3.347  1.00 0.00 ? 1186 ASP A CG   4  
ATOM 5911  O OD1  . ASP A 1 54  ? 12.151  -0.714  -4.293  1.00 0.00 ? 1186 ASP A OD1  4  
ATOM 5912  O OD2  . ASP A 1 54  ? 11.837  -1.977  -2.522  1.00 0.00 ? 1186 ASP A OD2  4  
ATOM 5913  H H    . ASP A 1 54  ? 10.468  -0.269  -0.706  1.00 0.00 ? 1186 ASP A H    4  
ATOM 5914  H HA   . ASP A 1 54  ? 10.853  1.391   -2.864  1.00 0.00 ? 1186 ASP A HA   4  
ATOM 5915  H HB2  . ASP A 1 54  ? 9.458   -1.265  -2.619  1.00 0.00 ? 1186 ASP A HB2  4  
ATOM 5916  H HB3  . ASP A 1 54  ? 9.612   -0.453  -4.175  1.00 0.00 ? 1186 ASP A HB3  4  
ATOM 5917  N N    . MET A 1 55  ? 7.630   0.972   -2.248  1.00 0.00 ? 1187 MET A N    4  
ATOM 5918  C CA   . MET A 1 55  ? 6.314   1.568   -2.444  1.00 0.00 ? 1187 MET A CA   4  
ATOM 5919  C C    . MET A 1 55  ? 6.349   3.067   -2.166  1.00 0.00 ? 1187 MET A C    4  
ATOM 5920  O O    . MET A 1 55  ? 5.795   3.862   -2.926  1.00 0.00 ? 1187 MET A O    4  
ATOM 5921  C CB   . MET A 1 55  ? 5.285   0.893   -1.535  1.00 0.00 ? 1187 MET A CB   4  
ATOM 5922  C CG   . MET A 1 55  ? 5.007   -0.556  -1.903  1.00 0.00 ? 1187 MET A CG   4  
ATOM 5923  S SD   . MET A 1 55  ? 3.553   -1.218  -1.067  1.00 0.00 ? 1187 MET A SD   4  
ATOM 5924  C CE   . MET A 1 55  ? 2.244   -0.589  -2.114  1.00 0.00 ? 1187 MET A CE   4  
ATOM 5925  H H    . MET A 1 55  ? 7.709   0.150   -1.721  1.00 0.00 ? 1187 MET A H    4  
ATOM 5926  H HA   . MET A 1 55  ? 6.029   1.411   -3.474  1.00 0.00 ? 1187 MET A HA   4  
ATOM 5927  H HB2  . MET A 1 55  ? 5.647   0.920   -0.519  1.00 0.00 ? 1187 MET A HB2  4  
ATOM 5928  H HB3  . MET A 1 55  ? 4.356   1.440   -1.593  1.00 0.00 ? 1187 MET A HB3  4  
ATOM 5929  H HG2  . MET A 1 55  ? 4.851   -0.619  -2.970  1.00 0.00 ? 1187 MET A HG2  4  
ATOM 5930  H HG3  . MET A 1 55  ? 5.865   -1.152  -1.631  1.00 0.00 ? 1187 MET A HG3  4  
ATOM 5931  H HE1  . MET A 1 55  ? 2.673   -0.145  -3.000  1.00 0.00 ? 1187 MET A HE1  4  
ATOM 5932  H HE2  . MET A 1 55  ? 1.589   -1.399  -2.398  1.00 0.00 ? 1187 MET A HE2  4  
ATOM 5933  H HE3  . MET A 1 55  ? 1.680   0.158   -1.575  1.00 0.00 ? 1187 MET A HE3  4  
ATOM 5934  N N    . ALA A 1 56  ? 7.002   3.447   -1.073  1.00 0.00 ? 1188 ALA A N    4  
ATOM 5935  C CA   . ALA A 1 56  ? 7.110   4.851   -0.696  1.00 0.00 ? 1188 ALA A CA   4  
ATOM 5936  C C    . ALA A 1 56  ? 7.962   5.624   -1.697  1.00 0.00 ? 1188 ALA A C    4  
ATOM 5937  O O    . ALA A 1 56  ? 7.760   6.820   -1.908  1.00 0.00 ? 1188 ALA A O    4  
ATOM 5938  C CB   . ALA A 1 56  ? 7.691   4.979   0.704   1.00 0.00 ? 1188 ALA A CB   4  
ATOM 5939  H H    . ALA A 1 56  ? 7.423   2.767   -0.507  1.00 0.00 ? 1188 ALA A H    4  
ATOM 5940  H HA   . ALA A 1 56  ? 6.115   5.271   -0.686  1.00 0.00 ? 1188 ALA A HA   4  
ATOM 5941  H HB1  . ALA A 1 56  ? 7.869   3.993   1.110   1.00 0.00 ? 1188 ALA A HB1  4  
ATOM 5942  H HB2  . ALA A 1 56  ? 8.622   5.524   0.659   1.00 0.00 ? 1188 ALA A HB2  4  
ATOM 5943  H HB3  . ALA A 1 56  ? 6.994   5.508   1.336   1.00 0.00 ? 1188 ALA A HB3  4  
ATOM 5944  N N    . LYS A 1 57  ? 8.917   4.933   -2.312  1.00 0.00 ? 1189 LYS A N    4  
ATOM 5945  C CA   . LYS A 1 57  ? 9.801   5.554   -3.292  1.00 0.00 ? 1189 LYS A CA   4  
ATOM 5946  C C    . LYS A 1 57  ? 9.098   5.709   -4.637  1.00 0.00 ? 1189 LYS A C    4  
ATOM 5947  O O    . LYS A 1 57  ? 8.907   6.823   -5.123  1.00 0.00 ? 1189 LYS A O    4  
ATOM 5948  C CB   . LYS A 1 57  ? 11.073  4.721   -3.461  1.00 0.00 ? 1189 LYS A CB   4  
ATOM 5949  C CG   . LYS A 1 57  ? 12.043  4.848   -2.299  1.00 0.00 ? 1189 LYS A CG   4  
ATOM 5950  C CD   . LYS A 1 57  ? 12.846  3.573   -2.101  1.00 0.00 ? 1189 LYS A CD   4  
ATOM 5951  C CE   . LYS A 1 57  ? 13.958  3.449   -3.131  1.00 0.00 ? 1189 LYS A CE   4  
ATOM 5952  N NZ   . LYS A 1 57  ? 15.065  2.577   -2.650  1.00 0.00 ? 1189 LYS A NZ   4  
ATOM 5953  H H    . LYS A 1 57  ? 9.029   3.982   -2.102  1.00 0.00 ? 1189 LYS A H    4  
ATOM 5954  H HA   . LYS A 1 57  ? 10.068  6.533   -2.924  1.00 0.00 ? 1189 LYS A HA   4  
ATOM 5955  H HB2  . LYS A 1 57  ? 10.797  3.681   -3.561  1.00 0.00 ? 1189 LYS A HB2  4  
ATOM 5956  H HB3  . LYS A 1 57  ? 11.579  5.038   -4.362  1.00 0.00 ? 1189 LYS A HB3  4  
ATOM 5957  H HG2  . LYS A 1 57  ? 12.724  5.662   -2.498  1.00 0.00 ? 1189 LYS A HG2  4  
ATOM 5958  H HG3  . LYS A 1 57  ? 11.485  5.055   -1.398  1.00 0.00 ? 1189 LYS A HG3  4  
ATOM 5959  H HD2  . LYS A 1 57  ? 13.284  3.584   -1.114  1.00 0.00 ? 1189 LYS A HD2  4  
ATOM 5960  H HD3  . LYS A 1 57  ? 12.184  2.724   -2.194  1.00 0.00 ? 1189 LYS A HD3  4  
ATOM 5961  H HE2  . LYS A 1 57  ? 13.547  3.028   -4.036  1.00 0.00 ? 1189 LYS A HE2  4  
ATOM 5962  H HE3  . LYS A 1 57  ? 14.350  4.434   -3.339  1.00 0.00 ? 1189 LYS A HE3  4  
ATOM 5963  H HZ1  . LYS A 1 57  ? 14.677  1.734   -2.181  1.00 0.00 ? 1189 LYS A HZ1  4  
ATOM 5964  H HZ2  . LYS A 1 57  ? 15.658  3.095   -1.971  1.00 0.00 ? 1189 LYS A HZ2  4  
ATOM 5965  H HZ3  . LYS A 1 57  ? 15.656  2.275   -3.451  1.00 0.00 ? 1189 LYS A HZ3  4  
ATOM 5966  N N    . MET A 1 58  ? 8.715   4.584   -5.232  1.00 0.00 ? 1190 MET A N    4  
ATOM 5967  C CA   . MET A 1 58  ? 8.031   4.596   -6.520  1.00 0.00 ? 1190 MET A CA   4  
ATOM 5968  C C    . MET A 1 58  ? 6.631   5.185   -6.386  1.00 0.00 ? 1190 MET A C    4  
ATOM 5969  O O    . MET A 1 58  ? 6.161   5.900   -7.272  1.00 0.00 ? 1190 MET A O    4  
ATOM 5970  C CB   . MET A 1 58  ? 7.949   3.179   -7.091  1.00 0.00 ? 1190 MET A CB   4  
ATOM 5971  C CG   . MET A 1 58  ? 9.306   2.566   -7.394  1.00 0.00 ? 1190 MET A CG   4  
ATOM 5972  S SD   . MET A 1 58  ? 9.178   0.973   -8.228  1.00 0.00 ? 1190 MET A SD   4  
ATOM 5973  C CE   . MET A 1 58  ? 10.223  -0.041  -7.185  1.00 0.00 ? 1190 MET A CE   4  
ATOM 5974  H H    . MET A 1 58  ? 8.895   3.725   -4.795  1.00 0.00 ? 1190 MET A H    4  
ATOM 5975  H HA   . MET A 1 58  ? 8.606   5.213   -7.194  1.00 0.00 ? 1190 MET A HA   4  
ATOM 5976  H HB2  . MET A 1 58  ? 7.443   2.545   -6.378  1.00 0.00 ? 1190 MET A HB2  4  
ATOM 5977  H HB3  . MET A 1 58  ? 7.377   3.205   -8.007  1.00 0.00 ? 1190 MET A HB3  4  
ATOM 5978  H HG2  . MET A 1 58  ? 9.860   3.243   -8.027  1.00 0.00 ? 1190 MET A HG2  4  
ATOM 5979  H HG3  . MET A 1 58  ? 9.839   2.429   -6.465  1.00 0.00 ? 1190 MET A HG3  4  
ATOM 5980  H HE1  . MET A 1 58  ? 11.131  0.497   -6.953  1.00 0.00 ? 1190 MET A HE1  4  
ATOM 5981  H HE2  . MET A 1 58  ? 9.699   -0.275  -6.270  1.00 0.00 ? 1190 MET A HE2  4  
ATOM 5982  H HE3  . MET A 1 58  ? 10.469  -0.956  -7.703  1.00 0.00 ? 1190 MET A HE3  4  
ATOM 5983  N N    . ARG A 1 59  ? 5.969   4.880   -5.275  1.00 0.00 ? 1191 ARG A N    4  
ATOM 5984  C CA   . ARG A 1 59  ? 4.621   5.379   -5.027  1.00 0.00 ? 1191 ARG A CA   4  
ATOM 5985  C C    . ARG A 1 59  ? 3.641   4.835   -6.062  1.00 0.00 ? 1191 ARG A C    4  
ATOM 5986  O O    . ARG A 1 59  ? 2.898   5.580   -6.701  1.00 0.00 ? 1191 ARG A O    4  
ATOM 5987  C CB   . ARG A 1 59  ? 4.608   6.909   -5.051  1.00 0.00 ? 1191 ARG A CB   4  
ATOM 5988  C CG   . ARG A 1 59  ? 5.500   7.542   -3.996  1.00 0.00 ? 1191 ARG A CG   4  
ATOM 5989  C CD   . ARG A 1 59  ? 4.934   8.867   -3.510  1.00 0.00 ? 1191 ARG A CD   4  
ATOM 5990  N NE   . ARG A 1 59  ? 3.587   8.719   -2.966  1.00 0.00 ? 1191 ARG A NE   4  
ATOM 5991  C CZ   . ARG A 1 59  ? 2.701   9.708   -2.917  1.00 0.00 ? 1191 ARG A CZ   4  
ATOM 5992  N NH1  . ARG A 1 59  ? 3.019   10.910  -3.378  1.00 0.00 ? 1191 ARG A NH1  4  
ATOM 5993  N NH2  . ARG A 1 59  ? 1.495   9.496   -2.406  1.00 0.00 ? 1191 ARG A NH2  4  
ATOM 5994  H H    . ARG A 1 59  ? 6.396   4.306   -4.606  1.00 0.00 ? 1191 ARG A H    4  
ATOM 5995  H HA   . ARG A 1 59  ? 4.317   5.041   -4.048  1.00 0.00 ? 1191 ARG A HA   4  
ATOM 5996  H HB2  . ARG A 1 59  ? 4.942   7.245   -6.022  1.00 0.00 ? 1191 ARG A HB2  4  
ATOM 5997  H HB3  . ARG A 1 59  ? 3.597   7.250   -4.889  1.00 0.00 ? 1191 ARG A HB3  4  
ATOM 5998  H HG2  . ARG A 1 59  ? 5.583   6.869   -3.156  1.00 0.00 ? 1191 ARG A HG2  4  
ATOM 5999  H HG3  . ARG A 1 59  ? 6.478   7.713   -4.421  1.00 0.00 ? 1191 ARG A HG3  4  
ATOM 6000  H HD2  . ARG A 1 59  ? 5.582   9.260   -2.741  1.00 0.00 ? 1191 ARG A HD2  4  
ATOM 6001  H HD3  . ARG A 1 59  ? 4.903   9.556   -4.341  1.00 0.00 ? 1191 ARG A HD3  4  
ATOM 6002  H HE   . ARG A 1 59  ? 3.331   7.839   -2.619  1.00 0.00 ? 1191 ARG A HE   4  
ATOM 6003  H HH11 . ARG A 1 59  ? 3.927   11.073  -3.764  1.00 0.00 ? 1191 ARG A HH11 4  
ATOM 6004  H HH12 . ARG A 1 59  ? 2.350   11.653  -3.341  1.00 0.00 ? 1191 ARG A HH12 4  
ATOM 6005  H HH21 . ARG A 1 59  ? 1.252   8.591   -2.058  1.00 0.00 ? 1191 ARG A HH21 4  
ATOM 6006  H HH22 . ARG A 1 59  ? 0.830   10.241  -2.370  1.00 0.00 ? 1191 ARG A HH22 4  
ATOM 6007  N N    . PRO A 1 60  ? 3.639   3.504   -6.233  1.00 0.00 ? 1192 PRO A N    4  
ATOM 6008  C CA   . PRO A 1 60  ? 2.755   2.831   -7.189  1.00 0.00 ? 1192 PRO A CA   4  
ATOM 6009  C C    . PRO A 1 60  ? 1.293   2.877   -6.759  1.00 0.00 ? 1192 PRO A C    4  
ATOM 6010  O O    . PRO A 1 60  ? 0.976   2.712   -5.581  1.00 0.00 ? 1192 PRO A O    4  
ATOM 6011  C CB   . PRO A 1 60  ? 3.267   1.388   -7.190  1.00 0.00 ? 1192 PRO A CB   4  
ATOM 6012  C CG   . PRO A 1 60  ? 3.915   1.215   -5.859  1.00 0.00 ? 1192 PRO A CG   4  
ATOM 6013  C CD   . PRO A 1 60  ? 4.498   2.555   -5.505  1.00 0.00 ? 1192 PRO A CD   4  
ATOM 6014  H HA   . PRO A 1 60  ? 2.851   3.249   -8.180  1.00 0.00 ? 1192 PRO A HA   4  
ATOM 6015  H HB2  . PRO A 1 60  ? 2.437   0.708   -7.317  1.00 0.00 ? 1192 PRO A HB2  4  
ATOM 6016  H HB3  . PRO A 1 60  ? 3.976   1.254   -7.993  1.00 0.00 ? 1192 PRO A HB3  4  
ATOM 6017  H HG2  . PRO A 1 60  ? 3.177   0.922   -5.127  1.00 0.00 ? 1192 PRO A HG2  4  
ATOM 6018  H HG3  . PRO A 1 60  ? 4.696   0.472   -5.925  1.00 0.00 ? 1192 PRO A HG3  4  
ATOM 6019  H HD2  . PRO A 1 60  ? 4.441   2.722   -4.439  1.00 0.00 ? 1192 PRO A HD2  4  
ATOM 6020  H HD3  . PRO A 1 60  ? 5.521   2.623   -5.845  1.00 0.00 ? 1192 PRO A HD3  4  
ATOM 6021  N N    . THR A 1 61  ? 0.404   3.101   -7.722  1.00 0.00 ? 1193 THR A N    4  
ATOM 6022  C CA   . THR A 1 61  ? -1.024  3.169   -7.443  1.00 0.00 ? 1193 THR A CA   4  
ATOM 6023  C C    . THR A 1 61  ? -1.800  2.173   -8.297  1.00 0.00 ? 1193 THR A C    4  
ATOM 6024  O O    . THR A 1 61  ? -2.984  2.366   -8.576  1.00 0.00 ? 1193 THR A O    4  
ATOM 6025  C CB   . THR A 1 61  ? -1.579  4.584   -7.694  1.00 0.00 ? 1193 THR A CB   4  
ATOM 6026  O OG1  . THR A 1 61  ? -1.668  4.832   -9.102  1.00 0.00 ? 1193 THR A OG1  4  
ATOM 6027  C CG2  . THR A 1 61  ? -0.693  5.636   -7.044  1.00 0.00 ? 1193 THR A CG2  4  
ATOM 6028  H H    . THR A 1 61  ? 0.719   3.224   -8.642  1.00 0.00 ? 1193 THR A H    4  
ATOM 6029  H HA   . THR A 1 61  ? -1.172  2.927   -6.401  1.00 0.00 ? 1193 THR A HA   4  
ATOM 6030  H HB   . THR A 1 61  ? -2.567  4.649   -7.262  1.00 0.00 ? 1193 THR A HB   4  
ATOM 6031  H HG1  . THR A 1 61  ? -1.014  4.302   -9.563  1.00 0.00 ? 1193 THR A HG1  4  
ATOM 6032  H HG21 . THR A 1 61  ? -1.135  5.951   -6.111  1.00 0.00 ? 1193 THR A HG21 4  
ATOM 6033  H HG22 . THR A 1 61  ? -0.600  6.486   -7.704  1.00 0.00 ? 1193 THR A HG22 4  
ATOM 6034  H HG23 . THR A 1 61  ? 0.284   5.217   -6.856  1.00 0.00 ? 1193 THR A HG23 4  
ATOM 6035  N N    . THR A 1 62  ? -1.125  1.104   -8.711  1.00 0.00 ? 1194 THR A N    4  
ATOM 6036  C CA   . THR A 1 62  ? -1.751  0.077   -9.534  1.00 0.00 ? 1194 THR A CA   4  
ATOM 6037  C C    . THR A 1 62  ? -1.297  -1.316  -9.114  1.00 0.00 ? 1194 THR A C    4  
ATOM 6038  O O    . THR A 1 62  ? -0.100  -1.599  -9.056  1.00 0.00 ? 1194 THR A O    4  
ATOM 6039  C CB   . THR A 1 62  ? -1.430  0.281   -11.027 1.00 0.00 ? 1194 THR A CB   4  
ATOM 6040  O OG1  . THR A 1 62  ? -0.018  0.437   -11.208 1.00 0.00 ? 1194 THR A OG1  4  
ATOM 6041  C CG2  . THR A 1 62  ? -2.155  1.501   -11.574 1.00 0.00 ? 1194 THR A CG2  4  
ATOM 6042  H H    . THR A 1 62  ? -0.184  1.006   -8.456  1.00 0.00 ? 1194 THR A H    4  
ATOM 6043  H HA   . THR A 1 62  ? -2.821  0.151   -9.404  1.00 0.00 ? 1194 THR A HA   4  
ATOM 6044  H HB   . THR A 1 62  ? -1.761  -0.591  -11.573 1.00 0.00 ? 1194 THR A HB   4  
ATOM 6045  H HG1  . THR A 1 62  ? 0.207   1.370   -11.174 1.00 0.00 ? 1194 THR A HG1  4  
ATOM 6046  H HG21 . THR A 1 62  ? -2.108  1.494   -12.653 1.00 0.00 ? 1194 THR A HG21 4  
ATOM 6047  H HG22 . THR A 1 62  ? -1.684  2.398   -11.199 1.00 0.00 ? 1194 THR A HG22 4  
ATOM 6048  H HG23 . THR A 1 62  ? -3.187  1.477   -11.259 1.00 0.00 ? 1194 THR A HG23 4  
ATOM 6049  N N    . VAL A 1 63  ? -2.260  -2.184  -8.821  1.00 0.00 ? 1195 VAL A N    4  
ATOM 6050  C CA   . VAL A 1 63  ? -1.959  -3.550  -8.408  1.00 0.00 ? 1195 VAL A CA   4  
ATOM 6051  C C    . VAL A 1 63  ? -0.880  -4.166  -9.292  1.00 0.00 ? 1195 VAL A C    4  
ATOM 6052  O O    . VAL A 1 63  ? -0.064  -4.962  -8.828  1.00 0.00 ? 1195 VAL A O    4  
ATOM 6053  C CB   . VAL A 1 63  ? -3.215  -4.440  -8.454  1.00 0.00 ? 1195 VAL A CB   4  
ATOM 6054  C CG1  . VAL A 1 63  ? -3.743  -4.546  -9.877  1.00 0.00 ? 1195 VAL A CG1  4  
ATOM 6055  C CG2  . VAL A 1 63  ? -2.912  -5.818  -7.885  1.00 0.00 ? 1195 VAL A CG2  4  
ATOM 6056  H H    . VAL A 1 63  ? -3.195  -1.900  -8.886  1.00 0.00 ? 1195 VAL A H    4  
ATOM 6057  H HA   . VAL A 1 63  ? -1.602  -3.519  -7.389  1.00 0.00 ? 1195 VAL A HA   4  
ATOM 6058  H HB   . VAL A 1 63  ? -3.979  -3.982  -7.844  1.00 0.00 ? 1195 VAL A HB   4  
ATOM 6059  H HG11 . VAL A 1 63  ? -3.447  -3.671  -10.436 1.00 0.00 ? 1195 VAL A HG11 4  
ATOM 6060  H HG12 . VAL A 1 63  ? -3.336  -5.430  -10.347 1.00 0.00 ? 1195 VAL A HG12 4  
ATOM 6061  H HG13 . VAL A 1 63  ? -4.820  -4.613  -9.856  1.00 0.00 ? 1195 VAL A HG13 4  
ATOM 6062  H HG21 . VAL A 1 63  ? -2.214  -5.723  -7.066  1.00 0.00 ? 1195 VAL A HG21 4  
ATOM 6063  H HG22 . VAL A 1 63  ? -3.826  -6.270  -7.528  1.00 0.00 ? 1195 VAL A HG22 4  
ATOM 6064  H HG23 . VAL A 1 63  ? -2.480  -6.439  -8.655  1.00 0.00 ? 1195 VAL A HG23 4  
ATOM 6065  N N    . GLU A 1 64  ? -0.882  -3.791  -10.567 1.00 0.00 ? 1196 GLU A N    4  
ATOM 6066  C CA   . GLU A 1 64  ? 0.097   -4.308  -11.516 1.00 0.00 ? 1196 GLU A CA   4  
ATOM 6067  C C    . GLU A 1 64  ? 1.501   -3.819  -11.170 1.00 0.00 ? 1196 GLU A C    4  
ATOM 6068  O O    . GLU A 1 64  ? 2.392   -4.615  -10.876 1.00 0.00 ? 1196 GLU A O    4  
ATOM 6069  C CB   . GLU A 1 64  ? -0.266  -3.884  -12.940 1.00 0.00 ? 1196 GLU A CB   4  
ATOM 6070  C CG   . GLU A 1 64  ? -1.480  -4.606  -13.500 1.00 0.00 ? 1196 GLU A CG   4  
ATOM 6071  C CD   . GLU A 1 64  ? -1.129  -5.948  -14.113 1.00 0.00 ? 1196 GLU A CD   4  
ATOM 6072  O OE1  . GLU A 1 64  ? -0.556  -6.796  -13.397 1.00 0.00 ? 1196 GLU A OE1  4  
ATOM 6073  O OE2  . GLU A 1 64  ? -1.427  -6.150  -15.309 1.00 0.00 ? 1196 GLU A OE2  4  
ATOM 6074  H H    . GLU A 1 64  ? -1.558  -3.153  -10.877 1.00 0.00 ? 1196 GLU A H    4  
ATOM 6075  H HA   . GLU A 1 64  ? 0.080   -5.386  -11.456 1.00 0.00 ? 1196 GLU A HA   4  
ATOM 6076  H HB2  . GLU A 1 64  ? -0.469  -2.823  -12.946 1.00 0.00 ? 1196 GLU A HB2  4  
ATOM 6077  H HB3  . GLU A 1 64  ? 0.575   -4.083  -13.588 1.00 0.00 ? 1196 GLU A HB3  4  
ATOM 6078  H HG2  . GLU A 1 64  ? -2.187  -4.767  -12.701 1.00 0.00 ? 1196 GLU A HG2  4  
ATOM 6079  H HG3  . GLU A 1 64  ? -1.932  -3.987  -14.261 1.00 0.00 ? 1196 GLU A HG3  4  
ATOM 6080  N N    . ASN A 1 65  ? 1.689   -2.504  -11.209 1.00 0.00 ? 1197 ASN A N    4  
ATOM 6081  C CA   . ASN A 1 65  ? 2.984   -1.908  -10.901 1.00 0.00 ? 1197 ASN A CA   4  
ATOM 6082  C C    . ASN A 1 65  ? 3.547   -2.472  -9.600  1.00 0.00 ? 1197 ASN A C    4  
ATOM 6083  O O    . ASN A 1 65  ? 4.734   -2.787  -9.510  1.00 0.00 ? 1197 ASN A O    4  
ATOM 6084  C CB   . ASN A 1 65  ? 2.857   -0.387  -10.797 1.00 0.00 ? 1197 ASN A CB   4  
ATOM 6085  C CG   . ASN A 1 65  ? 2.822   0.285   -12.156 1.00 0.00 ? 1197 ASN A CG   4  
ATOM 6086  O OD1  . ASN A 1 65  ? 2.949   -0.372  -13.189 1.00 0.00 ? 1197 ASN A OD1  4  
ATOM 6087  N ND2  . ASN A 1 65  ? 2.649   1.602   -12.161 1.00 0.00 ? 1197 ASN A ND2  4  
ATOM 6088  H H    . ASN A 1 65  ? 0.940   -1.921  -11.451 1.00 0.00 ? 1197 ASN A H    4  
ATOM 6089  H HA   . ASN A 1 65  ? 3.660   -2.149  -11.707 1.00 0.00 ? 1197 ASN A HA   4  
ATOM 6090  H HB2  . ASN A 1 65  ? 1.944   -0.143  -10.273 1.00 0.00 ? 1197 ASN A HB2  4  
ATOM 6091  H HB3  . ASN A 1 65  ? 3.698   0.003   -10.244 1.00 0.00 ? 1197 ASN A HB3  4  
ATOM 6092  H HD21 . ASN A 1 65  ? 2.555   2.060   -11.299 1.00 0.00 ? 1197 ASN A HD21 4  
ATOM 6093  H HD22 . ASN A 1 65  ? 2.622   2.062   -13.026 1.00 0.00 ? 1197 ASN A HD22 4  
ATOM 6094  N N    . VAL A 1 66  ? 2.687   -2.599  -8.595  1.00 0.00 ? 1198 VAL A N    4  
ATOM 6095  C CA   . VAL A 1 66  ? 3.098   -3.127  -7.299  1.00 0.00 ? 1198 VAL A CA   4  
ATOM 6096  C C    . VAL A 1 66  ? 3.853   -4.442  -7.457  1.00 0.00 ? 1198 VAL A C    4  
ATOM 6097  O O    . VAL A 1 66  ? 4.841   -4.691  -6.765  1.00 0.00 ? 1198 VAL A O    4  
ATOM 6098  C CB   . VAL A 1 66  ? 1.886   -3.351  -6.375  1.00 0.00 ? 1198 VAL A CB   4  
ATOM 6099  C CG1  . VAL A 1 66  ? 2.329   -3.954  -5.051  1.00 0.00 ? 1198 VAL A CG1  4  
ATOM 6100  C CG2  . VAL A 1 66  ? 1.139   -2.045  -6.152  1.00 0.00 ? 1198 VAL A CG2  4  
ATOM 6101  H H    . VAL A 1 66  ? 1.754   -2.331  -8.728  1.00 0.00 ? 1198 VAL A H    4  
ATOM 6102  H HA   . VAL A 1 66  ? 3.750   -2.402  -6.835  1.00 0.00 ? 1198 VAL A HA   4  
ATOM 6103  H HB   . VAL A 1 66  ? 1.216   -4.047  -6.856  1.00 0.00 ? 1198 VAL A HB   4  
ATOM 6104  H HG11 . VAL A 1 66  ? 2.643   -3.165  -4.383  1.00 0.00 ? 1198 VAL A HG11 4  
ATOM 6105  H HG12 . VAL A 1 66  ? 1.506   -4.496  -4.609  1.00 0.00 ? 1198 VAL A HG12 4  
ATOM 6106  H HG13 . VAL A 1 66  ? 3.155   -4.630  -5.222  1.00 0.00 ? 1198 VAL A HG13 4  
ATOM 6107  H HG21 . VAL A 1 66  ? 0.954   -1.913  -5.096  1.00 0.00 ? 1198 VAL A HG21 4  
ATOM 6108  H HG22 . VAL A 1 66  ? 1.734   -1.221  -6.519  1.00 0.00 ? 1198 VAL A HG22 4  
ATOM 6109  H HG23 . VAL A 1 66  ? 0.199   -2.072  -6.681  1.00 0.00 ? 1198 VAL A HG23 4  
ATOM 6110  N N    . LYS A 1 67  ? 3.382   -5.283  -8.372  1.00 0.00 ? 1199 LYS A N    4  
ATOM 6111  C CA   . LYS A 1 67  ? 4.013   -6.573  -8.623  1.00 0.00 ? 1199 LYS A CA   4  
ATOM 6112  C C    . LYS A 1 67  ? 5.445   -6.392  -9.116  1.00 0.00 ? 1199 LYS A C    4  
ATOM 6113  O O    . LYS A 1 67  ? 6.277   -7.289  -8.978  1.00 0.00 ? 1199 LYS A O    4  
ATOM 6114  C CB   . LYS A 1 67  ? 3.205   -7.367  -9.651  1.00 0.00 ? 1199 LYS A CB   4  
ATOM 6115  C CG   . LYS A 1 67  ? 1.740   -7.525  -9.283  1.00 0.00 ? 1199 LYS A CG   4  
ATOM 6116  C CD   . LYS A 1 67  ? 0.862   -7.624  -10.520 1.00 0.00 ? 1199 LYS A CD   4  
ATOM 6117  C CE   . LYS A 1 67  ? 0.740   -9.061  -11.003 1.00 0.00 ? 1199 LYS A CE   4  
ATOM 6118  N NZ   . LYS A 1 67  ? -0.321  -9.804  -10.269 1.00 0.00 ? 1199 LYS A NZ   4  
ATOM 6119  H H    . LYS A 1 67  ? 2.591   -5.028  -8.892  1.00 0.00 ? 1199 LYS A H    4  
ATOM 6120  H HA   . LYS A 1 67  ? 4.032   -7.120  -7.692  1.00 0.00 ? 1199 LYS A HA   4  
ATOM 6121  H HB2  . LYS A 1 67  ? 3.263   -6.863  -10.605 1.00 0.00 ? 1199 LYS A HB2  4  
ATOM 6122  H HB3  . LYS A 1 67  ? 3.638   -8.353  -9.748  1.00 0.00 ? 1199 LYS A HB3  4  
ATOM 6123  H HG2  . LYS A 1 67  ? 1.619   -8.423  -8.697  1.00 0.00 ? 1199 LYS A HG2  4  
ATOM 6124  H HG3  . LYS A 1 67  ? 1.430   -6.668  -8.701  1.00 0.00 ? 1199 LYS A HG3  4  
ATOM 6125  H HD2  . LYS A 1 67  ? -0.123  -7.251  -10.282 1.00 0.00 ? 1199 LYS A HD2  4  
ATOM 6126  H HD3  . LYS A 1 67  ? 1.295   -7.024  -11.308 1.00 0.00 ? 1199 LYS A HD3  4  
ATOM 6127  H HE2  . LYS A 1 67  ? 0.500   -9.054  -12.055 1.00 0.00 ? 1199 LYS A HE2  4  
ATOM 6128  H HE3  . LYS A 1 67  ? 1.686   -9.559  -10.853 1.00 0.00 ? 1199 LYS A HE3  4  
ATOM 6129  H HZ1  . LYS A 1 67  ? -1.231  -9.308  -10.357 1.00 0.00 ? 1199 LYS A HZ1  4  
ATOM 6130  H HZ2  . LYS A 1 67  ? -0.075  -9.877  -9.261  1.00 0.00 ? 1199 LYS A HZ2  4  
ATOM 6131  H HZ3  . LYS A 1 67  ? -0.422  -10.763 -10.660 1.00 0.00 ? 1199 LYS A HZ3  4  
ATOM 6132  N N    . ARG A 1 68  ? 5.725   -5.226  -9.689  1.00 0.00 ? 1200 ARG A N    4  
ATOM 6133  C CA   . ARG A 1 68  ? 7.057   -4.928  -10.202 1.00 0.00 ? 1200 ARG A CA   4  
ATOM 6134  C C    . ARG A 1 68  ? 8.031   -4.654  -9.060  1.00 0.00 ? 1200 ARG A C    4  
ATOM 6135  O O    . ARG A 1 68  ? 9.247   -4.748  -9.232  1.00 0.00 ? 1200 ARG A O    4  
ATOM 6136  C CB   . ARG A 1 68  ? 7.006   -3.723  -11.143 1.00 0.00 ? 1200 ARG A CB   4  
ATOM 6137  C CG   . ARG A 1 68  ? 6.099   -3.927  -12.345 1.00 0.00 ? 1200 ARG A CG   4  
ATOM 6138  C CD   . ARG A 1 68  ? 6.048   -2.686  -13.222 1.00 0.00 ? 1200 ARG A CD   4  
ATOM 6139  N NE   . ARG A 1 68  ? 7.261   -2.529  -14.020 1.00 0.00 ? 1200 ARG A NE   4  
ATOM 6140  C CZ   . ARG A 1 68  ? 7.418   -1.585  -14.942 1.00 0.00 ? 1200 ARG A CZ   4  
ATOM 6141  N NH1  . ARG A 1 68  ? 6.443   -0.718  -15.180 1.00 0.00 ? 1200 ARG A NH1  4  
ATOM 6142  N NH2  . ARG A 1 68  ? 8.551   -1.507  -15.627 1.00 0.00 ? 1200 ARG A NH2  4  
ATOM 6143  H H    . ARG A 1 68  ? 5.020   -4.551  -9.770  1.00 0.00 ? 1200 ARG A H    4  
ATOM 6144  H HA   . ARG A 1 68  ? 7.401   -5.790  -10.754 1.00 0.00 ? 1200 ARG A HA   4  
ATOM 6145  H HB2  . ARG A 1 68  ? 6.650   -2.865  -10.593 1.00 0.00 ? 1200 ARG A HB2  4  
ATOM 6146  H HB3  . ARG A 1 68  ? 8.004   -3.520  -11.503 1.00 0.00 ? 1200 ARG A HB3  4  
ATOM 6147  H HG2  . ARG A 1 68  ? 6.474   -4.753  -12.932 1.00 0.00 ? 1200 ARG A HG2  4  
ATOM 6148  H HG3  . ARG A 1 68  ? 5.102   -4.153  -11.998 1.00 0.00 ? 1200 ARG A HG3  4  
ATOM 6149  H HD2  . ARG A 1 68  ? 5.200   -2.764  -13.886 1.00 0.00 ? 1200 ARG A HD2  4  
ATOM 6150  H HD3  . ARG A 1 68  ? 5.930   -1.819  -12.589 1.00 0.00 ? 1200 ARG A HD3  4  
ATOM 6151  H HE   . ARG A 1 68  ? 7.994   -3.159  -13.861 1.00 0.00 ? 1200 ARG A HE   4  
ATOM 6152  H HH11 . ARG A 1 68  ? 5.588   -0.774  -14.664 1.00 0.00 ? 1200 ARG A HH11 4  
ATOM 6153  H HH12 . ARG A 1 68  ? 6.564   -0.007  -15.873 1.00 0.00 ? 1200 ARG A HH12 4  
ATOM 6154  H HH21 . ARG A 1 68  ? 9.288   -2.159  -15.450 1.00 0.00 ? 1200 ARG A HH21 4  
ATOM 6155  H HH22 . ARG A 1 68  ? 8.668   -0.796  -16.320 1.00 0.00 ? 1200 ARG A HH22 4  
ATOM 6156  N N    . ILE A 1 69  ? 7.488   -4.314  -7.895  1.00 0.00 ? 1201 ILE A N    4  
ATOM 6157  C CA   . ILE A 1 69  ? 8.309   -4.027  -6.726  1.00 0.00 ? 1201 ILE A CA   4  
ATOM 6158  C C    . ILE A 1 69  ? 9.131   -5.245  -6.318  1.00 0.00 ? 1201 ILE A C    4  
ATOM 6159  O O    . ILE A 1 69  ? 8.663   -6.380  -6.406  1.00 0.00 ? 1201 ILE A O    4  
ATOM 6160  C CB   . ILE A 1 69  ? 7.448   -3.580  -5.530  1.00 0.00 ? 1201 ILE A CB   4  
ATOM 6161  C CG1  . ILE A 1 69  ? 6.505   -2.449  -5.947  1.00 0.00 ? 1201 ILE A CG1  4  
ATOM 6162  C CG2  . ILE A 1 69  ? 8.334   -3.138  -4.375  1.00 0.00 ? 1201 ILE A CG2  4  
ATOM 6163  C CD1  . ILE A 1 69  ? 7.222   -1.173  -6.326  1.00 0.00 ? 1201 ILE A CD1  4  
ATOM 6164  H H    . ILE A 1 69  ? 6.513   -4.256  -7.821  1.00 0.00 ? 1201 ILE A H    4  
ATOM 6165  H HA   . ILE A 1 69  ? 8.982   -3.221  -6.981  1.00 0.00 ? 1201 ILE A HA   4  
ATOM 6166  H HB   . ILE A 1 69  ? 6.863   -4.424  -5.200  1.00 0.00 ? 1201 ILE A HB   4  
ATOM 6167  H HG12 . ILE A 1 69  ? 5.925   -2.769  -6.798  1.00 0.00 ? 1201 ILE A HG12 4  
ATOM 6168  H HG13 . ILE A 1 69  ? 5.839   -2.225  -5.126  1.00 0.00 ? 1201 ILE A HG13 4  
ATOM 6169  H HG21 . ILE A 1 69  ? 9.303   -3.608  -4.464  1.00 0.00 ? 1201 ILE A HG21 4  
ATOM 6170  H HG22 . ILE A 1 69  ? 8.452   -2.065  -4.402  1.00 0.00 ? 1201 ILE A HG22 4  
ATOM 6171  H HG23 . ILE A 1 69  ? 7.878   -3.428  -3.440  1.00 0.00 ? 1201 ILE A HG23 4  
ATOM 6172  H HD11 . ILE A 1 69  ? 7.501   -0.637  -5.431  1.00 0.00 ? 1201 ILE A HD11 4  
ATOM 6173  H HD12 . ILE A 1 69  ? 8.108   -1.412  -6.895  1.00 0.00 ? 1201 ILE A HD12 4  
ATOM 6174  H HD13 . ILE A 1 69  ? 6.567   -0.556  -6.925  1.00 0.00 ? 1201 ILE A HD13 4  
ATOM 6175  N N    . ASP A 1 70  ? 10.358  -5.001  -5.871  1.00 0.00 ? 1202 ASP A N    4  
ATOM 6176  C CA   . ASP A 1 70  ? 11.245  -6.078  -5.447  1.00 0.00 ? 1202 ASP A CA   4  
ATOM 6177  C C    . ASP A 1 70  ? 10.721  -6.747  -4.180  1.00 0.00 ? 1202 ASP A C    4  
ATOM 6178  O O    . ASP A 1 70  ? 10.229  -6.080  -3.272  1.00 0.00 ? 1202 ASP A O    4  
ATOM 6179  C CB   . ASP A 1 70  ? 12.657  -5.540  -5.208  1.00 0.00 ? 1202 ASP A CB   4  
ATOM 6180  C CG   . ASP A 1 70  ? 13.696  -6.643  -5.159  1.00 0.00 ? 1202 ASP A CG   4  
ATOM 6181  O OD1  . ASP A 1 70  ? 13.463  -7.705  -5.773  1.00 0.00 ? 1202 ASP A OD1  4  
ATOM 6182  O OD2  . ASP A 1 70  ? 14.743  -6.444  -4.507  1.00 0.00 ? 1202 ASP A OD2  4  
ATOM 6183  H H    . ASP A 1 70  ? 10.675  -4.075  -5.825  1.00 0.00 ? 1202 ASP A H    4  
ATOM 6184  H HA   . ASP A 1 70  ? 11.279  -6.811  -6.239  1.00 0.00 ? 1202 ASP A HA   4  
ATOM 6185  H HB2  . ASP A 1 70  ? 12.917  -4.861  -6.007  1.00 0.00 ? 1202 ASP A HB2  4  
ATOM 6186  H HB3  . ASP A 1 70  ? 12.678  -5.009  -4.268  1.00 0.00 ? 1202 ASP A HB3  4  
ATOM 6187  N N    . GLY A 1 71  ? 10.829  -8.072  -4.128  1.00 0.00 ? 1203 GLY A N    4  
ATOM 6188  C CA   . GLY A 1 71  ? 10.360  -8.809  -2.970  1.00 0.00 ? 1203 GLY A CA   4  
ATOM 6189  C C    . GLY A 1 71  ? 8.999   -9.437  -3.194  1.00 0.00 ? 1203 GLY A C    4  
ATOM 6190  O O    . GLY A 1 71  ? 8.817   -10.636 -2.977  1.00 0.00 ? 1203 GLY A O    4  
ATOM 6191  H H    . GLY A 1 71  ? 11.230  -8.552  -4.883  1.00 0.00 ? 1203 GLY A H    4  
ATOM 6192  H HA2  . GLY A 1 71  ? 11.072  -9.588  -2.740  1.00 0.00 ? 1203 GLY A HA2  4  
ATOM 6193  H HA3  . GLY A 1 71  ? 10.297  -8.134  -2.129  1.00 0.00 ? 1203 GLY A HA3  4  
ATOM 6194  N N    . VAL A 1 72  ? 8.039   -8.627  -3.628  1.00 0.00 ? 1204 VAL A N    4  
ATOM 6195  C CA   . VAL A 1 72  ? 6.687   -9.110  -3.882  1.00 0.00 ? 1204 VAL A CA   4  
ATOM 6196  C C    . VAL A 1 72  ? 6.666   -10.102 -5.039  1.00 0.00 ? 1204 VAL A C    4  
ATOM 6197  O O    . VAL A 1 72  ? 7.314   -9.890  -6.064  1.00 0.00 ? 1204 VAL A O    4  
ATOM 6198  C CB   . VAL A 1 72  ? 5.726   -7.949  -4.197  1.00 0.00 ? 1204 VAL A CB   4  
ATOM 6199  C CG1  . VAL A 1 72  ? 6.255   -7.117  -5.355  1.00 0.00 ? 1204 VAL A CG1  4  
ATOM 6200  C CG2  . VAL A 1 72  ? 4.333   -8.479  -4.503  1.00 0.00 ? 1204 VAL A CG2  4  
ATOM 6201  H H    . VAL A 1 72  ? 8.245   -7.682  -3.783  1.00 0.00 ? 1204 VAL A H    4  
ATOM 6202  H HA   . VAL A 1 72  ? 6.337   -9.607  -2.988  1.00 0.00 ? 1204 VAL A HA   4  
ATOM 6203  H HB   . VAL A 1 72  ? 5.663   -7.314  -3.326  1.00 0.00 ? 1204 VAL A HB   4  
ATOM 6204  H HG11 . VAL A 1 72  ? 6.718   -7.767  -6.083  1.00 0.00 ? 1204 VAL A HG11 4  
ATOM 6205  H HG12 . VAL A 1 72  ? 5.438   -6.582  -5.817  1.00 0.00 ? 1204 VAL A HG12 4  
ATOM 6206  H HG13 . VAL A 1 72  ? 6.985   -6.412  -4.987  1.00 0.00 ? 1204 VAL A HG13 4  
ATOM 6207  H HG21 . VAL A 1 72  ? 3.622   -8.033  -3.824  1.00 0.00 ? 1204 VAL A HG21 4  
ATOM 6208  H HG22 . VAL A 1 72  ? 4.067   -8.227  -5.519  1.00 0.00 ? 1204 VAL A HG22 4  
ATOM 6209  H HG23 . VAL A 1 72  ? 4.321   -9.552  -4.383  1.00 0.00 ? 1204 VAL A HG23 4  
ATOM 6210  N N    . SER A 1 73  ? 5.915   -11.186 -4.870  1.00 0.00 ? 1205 SER A N    4  
ATOM 6211  C CA   . SER A 1 73  ? 5.812   -12.213 -5.899  1.00 0.00 ? 1205 SER A CA   4  
ATOM 6212  C C    . SER A 1 73  ? 4.522   -12.053 -6.698  1.00 0.00 ? 1205 SER A C    4  
ATOM 6213  O O    . SER A 1 73  ? 3.491   -11.655 -6.158  1.00 0.00 ? 1205 SER A O    4  
ATOM 6214  C CB   . SER A 1 73  ? 5.864   -13.606 -5.268  1.00 0.00 ? 1205 SER A CB   4  
ATOM 6215  O OG   . SER A 1 73  ? 5.427   -14.597 -6.182  1.00 0.00 ? 1205 SER A OG   4  
ATOM 6216  H H    . SER A 1 73  ? 5.422   -11.298 -4.030  1.00 0.00 ? 1205 SER A H    4  
ATOM 6217  H HA   . SER A 1 73  ? 6.652   -12.098 -6.568  1.00 0.00 ? 1205 SER A HA   4  
ATOM 6218  H HB2  . SER A 1 73  ? 6.879   -13.827 -4.973  1.00 0.00 ? 1205 SER A HB2  4  
ATOM 6219  H HB3  . SER A 1 73  ? 5.224   -13.627 -4.398  1.00 0.00 ? 1205 SER A HB3  4  
ATOM 6220  H HG   . SER A 1 73  ? 5.712   -14.363 -7.068  1.00 0.00 ? 1205 SER A HG   4  
ATOM 6221  N N    . GLU A 1 74  ? 4.590   -12.366 -7.989  1.00 0.00 ? 1206 GLU A N    4  
ATOM 6222  C CA   . GLU A 1 74  ? 3.428   -12.256 -8.863  1.00 0.00 ? 1206 GLU A CA   4  
ATOM 6223  C C    . GLU A 1 74  ? 2.159   -12.701 -8.141  1.00 0.00 ? 1206 GLU A C    4  
ATOM 6224  O O    . GLU A 1 74  ? 2.146   -13.727 -7.462  1.00 0.00 ? 1206 GLU A O    4  
ATOM 6225  C CB   . GLU A 1 74  ? 3.630   -13.097 -10.125 1.00 0.00 ? 1206 GLU A CB   4  
ATOM 6226  C CG   . GLU A 1 74  ? 4.851   -12.693 -10.936 1.00 0.00 ? 1206 GLU A CG   4  
ATOM 6227  C CD   . GLU A 1 74  ? 4.681   -12.962 -12.419 1.00 0.00 ? 1206 GLU A CD   4  
ATOM 6228  O OE1  . GLU A 1 74  ? 4.166   -12.072 -13.127 1.00 0.00 ? 1206 GLU A OE1  4  
ATOM 6229  O OE2  . GLU A 1 74  ? 5.064   -14.061 -12.870 1.00 0.00 ? 1206 GLU A OE2  4  
ATOM 6230  H H    . GLU A 1 74  ? 5.441   -12.678 -8.361  1.00 0.00 ? 1206 GLU A H    4  
ATOM 6231  H HA   . GLU A 1 74  ? 3.322   -11.220 -9.145  1.00 0.00 ? 1206 GLU A HA   4  
ATOM 6232  H HB2  . GLU A 1 74  ? 3.739   -14.133 -9.840  1.00 0.00 ? 1206 GLU A HB2  4  
ATOM 6233  H HB3  . GLU A 1 74  ? 2.758   -12.996 -10.754 1.00 0.00 ? 1206 GLU A HB3  4  
ATOM 6234  H HG2  . GLU A 1 74  ? 5.028   -11.638 -10.795 1.00 0.00 ? 1206 GLU A HG2  4  
ATOM 6235  H HG3  . GLU A 1 74  ? 5.704   -13.251 -10.579 1.00 0.00 ? 1206 GLU A HG3  4  
ATOM 6236  N N    . GLY A 1 75  ? 1.094   -11.920 -8.292  1.00 0.00 ? 1207 GLY A N    4  
ATOM 6237  C CA   . GLY A 1 75  ? -0.164  -12.249 -7.649  1.00 0.00 ? 1207 GLY A CA   4  
ATOM 6238  C C    . GLY A 1 75  ? -0.249  -11.712 -6.233  1.00 0.00 ? 1207 GLY A C    4  
ATOM 6239  O O    . GLY A 1 75  ? -1.164  -10.957 -5.901  1.00 0.00 ? 1207 GLY A O    4  
ATOM 6240  H H    . GLY A 1 75  ? 1.163   -11.114 -8.846  1.00 0.00 ? 1207 GLY A H    4  
ATOM 6241  H HA2  . GLY A 1 75  ? -0.973  -11.832 -8.230  1.00 0.00 ? 1207 GLY A HA2  4  
ATOM 6242  H HA3  . GLY A 1 75  ? -0.271  -13.323 -7.620  1.00 0.00 ? 1207 GLY A HA3  4  
ATOM 6243  N N    . LYS A 1 76  ? 0.705   -12.103 -5.396  1.00 0.00 ? 1208 LYS A N    4  
ATOM 6244  C CA   . LYS A 1 76  ? 0.735   -11.658 -4.008  1.00 0.00 ? 1208 LYS A CA   4  
ATOM 6245  C C    . LYS A 1 76  ? 0.360   -10.183 -3.902  1.00 0.00 ? 1208 LYS A C    4  
ATOM 6246  O O    . LYS A 1 76  ? -0.547  -9.816  -3.156  1.00 0.00 ? 1208 LYS A O    4  
ATOM 6247  C CB   . LYS A 1 76  ? 2.124   -11.886 -3.407  1.00 0.00 ? 1208 LYS A CB   4  
ATOM 6248  C CG   . LYS A 1 76  ? 2.284   -11.314 -2.009  1.00 0.00 ? 1208 LYS A CG   4  
ATOM 6249  C CD   . LYS A 1 76  ? 3.747   -11.103 -1.657  1.00 0.00 ? 1208 LYS A CD   4  
ATOM 6250  C CE   . LYS A 1 76  ? 4.351   -12.342 -1.015  1.00 0.00 ? 1208 LYS A CE   4  
ATOM 6251  N NZ   . LYS A 1 76  ? 4.848   -13.308 -2.034  1.00 0.00 ? 1208 LYS A NZ   4  
ATOM 6252  H H    . LYS A 1 76  ? 1.407   -12.706 -5.720  1.00 0.00 ? 1208 LYS A H    4  
ATOM 6253  H HA   . LYS A 1 76  ? 0.013   -12.241 -3.456  1.00 0.00 ? 1208 LYS A HA   4  
ATOM 6254  H HB2  . LYS A 1 76  ? 2.313   -12.949 -3.363  1.00 0.00 ? 1208 LYS A HB2  4  
ATOM 6255  H HB3  . LYS A 1 76  ? 2.861   -11.425 -4.049  1.00 0.00 ? 1208 LYS A HB3  4  
ATOM 6256  H HG2  . LYS A 1 76  ? 1.771   -10.365 -1.958  1.00 0.00 ? 1208 LYS A HG2  4  
ATOM 6257  H HG3  . LYS A 1 76  ? 1.847   -12.000 -1.297  1.00 0.00 ? 1208 LYS A HG3  4  
ATOM 6258  H HD2  . LYS A 1 76  ? 4.296   -10.874 -2.559  1.00 0.00 ? 1208 LYS A HD2  4  
ATOM 6259  H HD3  . LYS A 1 76  ? 3.826   -10.275 -0.967  1.00 0.00 ? 1208 LYS A HD3  4  
ATOM 6260  H HE2  . LYS A 1 76  ? 5.174   -12.041 -0.386  1.00 0.00 ? 1208 LYS A HE2  4  
ATOM 6261  H HE3  . LYS A 1 76  ? 3.594   -12.824 -0.413  1.00 0.00 ? 1208 LYS A HE3  4  
ATOM 6262  H HZ1  . LYS A 1 76  ? 5.107   -14.206 -1.578  1.00 0.00 ? 1208 LYS A HZ1  4  
ATOM 6263  H HZ2  . LYS A 1 76  ? 5.686   -12.922 -2.514  1.00 0.00 ? 1208 LYS A HZ2  4  
ATOM 6264  H HZ3  . LYS A 1 76  ? 4.109   -13.492 -2.743  1.00 0.00 ? 1208 LYS A HZ3  4  
ATOM 6265  N N    . ALA A 1 77  ? 1.064   -9.343  -4.653  1.00 0.00 ? 1209 ALA A N    4  
ATOM 6266  C CA   . ALA A 1 77  ? 0.803   -7.909  -4.646  1.00 0.00 ? 1209 ALA A CA   4  
ATOM 6267  C C    . ALA A 1 77  ? -0.685  -7.623  -4.469  1.00 0.00 ? 1209 ALA A C    4  
ATOM 6268  O O    . ALA A 1 77  ? -1.074  -6.802  -3.639  1.00 0.00 ? 1209 ALA A O    4  
ATOM 6269  C CB   . ALA A 1 77  ? 1.315   -7.272  -5.929  1.00 0.00 ? 1209 ALA A CB   4  
ATOM 6270  H H    . ALA A 1 77  ? 1.775   -9.696  -5.227  1.00 0.00 ? 1209 ALA A H    4  
ATOM 6271  H HA   . ALA A 1 77  ? 1.343   -7.475  -3.817  1.00 0.00 ? 1209 ALA A HA   4  
ATOM 6272  H HB1  . ALA A 1 77  ? 1.421   -8.032  -6.690  1.00 0.00 ? 1209 ALA A HB1  4  
ATOM 6273  H HB2  . ALA A 1 77  ? 0.614   -6.522  -6.264  1.00 0.00 ? 1209 ALA A HB2  4  
ATOM 6274  H HB3  . ALA A 1 77  ? 2.274   -6.812  -5.744  1.00 0.00 ? 1209 ALA A HB3  4  
ATOM 6275  N N    . ALA A 1 78  ? -1.512  -8.305  -5.254  1.00 0.00 ? 1210 ALA A N    4  
ATOM 6276  C CA   . ALA A 1 78  ? -2.956  -8.125  -5.183  1.00 0.00 ? 1210 ALA A CA   4  
ATOM 6277  C C    . ALA A 1 78  ? -3.429  -8.046  -3.735  1.00 0.00 ? 1210 ALA A C    4  
ATOM 6278  O O    . ALA A 1 78  ? -3.966  -7.027  -3.303  1.00 0.00 ? 1210 ALA A O    4  
ATOM 6279  C CB   . ALA A 1 78  ? -3.666  -9.258  -5.910  1.00 0.00 ? 1210 ALA A CB   4  
ATOM 6280  H H    . ALA A 1 78  ? -1.141  -8.946  -5.896  1.00 0.00 ? 1210 ALA A H    4  
ATOM 6281  H HA   . ALA A 1 78  ? -3.202  -7.199  -5.683  1.00 0.00 ? 1210 ALA A HA   4  
ATOM 6282  H HB1  . ALA A 1 78  ? -3.800  -10.090 -5.235  1.00 0.00 ? 1210 ALA A HB1  4  
ATOM 6283  H HB2  . ALA A 1 78  ? -4.629  -8.915  -6.257  1.00 0.00 ? 1210 ALA A HB2  4  
ATOM 6284  H HB3  . ALA A 1 78  ? -3.070  -9.572  -6.754  1.00 0.00 ? 1210 ALA A HB3  4  
ATOM 6285  N N    . MET A 1 79  ? -3.225  -9.128  -2.991  1.00 0.00 ? 1211 MET A N    4  
ATOM 6286  C CA   . MET A 1 79  ? -3.630  -9.180  -1.591  1.00 0.00 ? 1211 MET A CA   4  
ATOM 6287  C C    . MET A 1 79  ? -3.125  -7.956  -0.833  1.00 0.00 ? 1211 MET A C    4  
ATOM 6288  O O    . MET A 1 79  ? -3.674  -7.586  0.205   1.00 0.00 ? 1211 MET A O    4  
ATOM 6289  C CB   . MET A 1 79  ? -3.103  -10.456 -0.932  1.00 0.00 ? 1211 MET A CB   4  
ATOM 6290  C CG   . MET A 1 79  ? -1.692  -10.319 -0.386  1.00 0.00 ? 1211 MET A CG   4  
ATOM 6291  S SD   . MET A 1 79  ? -0.829  -11.899 -0.287  1.00 0.00 ? 1211 MET A SD   4  
ATOM 6292  C CE   . MET A 1 79  ? 0.460   -11.508 0.893   1.00 0.00 ? 1211 MET A CE   4  
ATOM 6293  H H    . MET A 1 79  ? -2.792  -9.910  -3.392  1.00 0.00 ? 1211 MET A H    4  
ATOM 6294  H HA   . MET A 1 79  ? -4.710  -9.188  -1.559  1.00 0.00 ? 1211 MET A HA   4  
ATOM 6295  H HB2  . MET A 1 79  ? -3.758  -10.722 -0.116  1.00 0.00 ? 1211 MET A HB2  4  
ATOM 6296  H HB3  . MET A 1 79  ? -3.108  -11.252 -1.662  1.00 0.00 ? 1211 MET A HB3  4  
ATOM 6297  H HG2  . MET A 1 79  ? -1.131  -9.660  -1.032  1.00 0.00 ? 1211 MET A HG2  4  
ATOM 6298  H HG3  . MET A 1 79  ? -1.744  -9.890  0.604   1.00 0.00 ? 1211 MET A HG3  4  
ATOM 6299  H HE1  . MET A 1 79  ? 1.358   -12.053 0.640   1.00 0.00 ? 1211 MET A HE1  4  
ATOM 6300  H HE2  . MET A 1 79  ? 0.663   -10.447 0.866   1.00 0.00 ? 1211 MET A HE2  4  
ATOM 6301  H HE3  . MET A 1 79  ? 0.137   -11.788 1.885   1.00 0.00 ? 1211 MET A HE3  4  
ATOM 6302  N N    . LEU A 1 80  ? -2.076  -7.333  -1.358  1.00 0.00 ? 1212 LEU A N    4  
ATOM 6303  C CA   . LEU A 1 80  ? -1.496  -6.150  -0.731  1.00 0.00 ? 1212 LEU A CA   4  
ATOM 6304  C C    . LEU A 1 80  ? -2.106  -4.875  -1.304  1.00 0.00 ? 1212 LEU A C    4  
ATOM 6305  O O    . LEU A 1 80  ? -1.425  -3.861  -1.451  1.00 0.00 ? 1212 LEU A O    4  
ATOM 6306  C CB   . LEU A 1 80  ? 0.021   -6.136  -0.927  1.00 0.00 ? 1212 LEU A CB   4  
ATOM 6307  C CG   . LEU A 1 80  ? 0.786   -7.318  -0.330  1.00 0.00 ? 1212 LEU A CG   4  
ATOM 6308  C CD1  . LEU A 1 80  ? 2.227   -7.322  -0.816  1.00 0.00 ? 1212 LEU A CD1  4  
ATOM 6309  C CD2  . LEU A 1 80  ? 0.734   -7.273  1.190   1.00 0.00 ? 1212 LEU A CD2  4  
ATOM 6310  H H    . LEU A 1 80  ? -1.681  -7.674  -2.187  1.00 0.00 ? 1212 LEU A H    4  
ATOM 6311  H HA   . LEU A 1 80  ? -1.714  -6.196  0.326   1.00 0.00 ? 1212 LEU A HA   4  
ATOM 6312  H HB2  . LEU A 1 80  ? 0.216   -6.118  -1.988  1.00 0.00 ? 1212 LEU A HB2  4  
ATOM 6313  H HB3  . LEU A 1 80  ? 0.404   -5.231  -0.477  1.00 0.00 ? 1212 LEU A HB3  4  
ATOM 6314  H HG   . LEU A 1 80  ? 0.322   -8.240  -0.655  1.00 0.00 ? 1212 LEU A HG   4  
ATOM 6315  H HD11 . LEU A 1 80  ? 2.576   -8.340  -0.898  1.00 0.00 ? 1212 LEU A HD11 4  
ATOM 6316  H HD12 . LEU A 1 80  ? 2.845   -6.784  -0.113  1.00 0.00 ? 1212 LEU A HD12 4  
ATOM 6317  H HD13 . LEU A 1 80  ? 2.282   -6.842  -1.783  1.00 0.00 ? 1212 LEU A HD13 4  
ATOM 6318  H HD21 . LEU A 1 80  ? 0.920   -8.261  1.585   1.00 0.00 ? 1212 LEU A HD21 4  
ATOM 6319  H HD22 . LEU A 1 80  ? -0.243  -6.937  1.507   1.00 0.00 ? 1212 LEU A HD22 4  
ATOM 6320  H HD23 . LEU A 1 80  ? 1.487   -6.592  1.556   1.00 0.00 ? 1212 LEU A HD23 4  
ATOM 6321  N N    . ALA A 1 81  ? -3.395  -4.934  -1.623  1.00 0.00 ? 1213 ALA A N    4  
ATOM 6322  C CA   . ALA A 1 81  ? -4.098  -3.783  -2.176  1.00 0.00 ? 1213 ALA A CA   4  
ATOM 6323  C C    . ALA A 1 81  ? -4.202  -2.659  -1.151  1.00 0.00 ? 1213 ALA A C    4  
ATOM 6324  O O    . ALA A 1 81  ? -3.829  -1.514  -1.409  1.00 0.00 ? 1213 ALA A O    4  
ATOM 6325  C CB   . ALA A 1 81  ? -5.483  -4.191  -2.657  1.00 0.00 ? 1213 ALA A CB   4  
ATOM 6326  H H    . ALA A 1 81  ? -3.885  -5.771  -1.483  1.00 0.00 ? 1213 ALA A H    4  
ATOM 6327  H HA   . ALA A 1 81  ? -3.538  -3.427  -3.029  1.00 0.00 ? 1213 ALA A HA   4  
ATOM 6328  H HB1  . ALA A 1 81  ? -5.580  -3.960  -3.708  1.00 0.00 ? 1213 ALA A HB1  4  
ATOM 6329  H HB2  . ALA A 1 81  ? -5.617  -5.252  -2.507  1.00 0.00 ? 1213 ALA A HB2  4  
ATOM 6330  H HB3  . ALA A 1 81  ? -6.231  -3.650  -2.098  1.00 0.00 ? 1213 ALA A HB3  4  
ATOM 6331  N N    . PRO A 1 82  ? -4.722  -2.990  0.041   1.00 0.00 ? 1214 PRO A N    4  
ATOM 6332  C CA   . PRO A 1 82  ? -4.887  -2.022  1.129   1.00 0.00 ? 1214 PRO A CA   4  
ATOM 6333  C C    . PRO A 1 82  ? -3.628  -1.195  1.366   1.00 0.00 ? 1214 PRO A C    4  
ATOM 6334  O O    . PRO A 1 82  ? -3.674  -0.144  2.006   1.00 0.00 ? 1214 PRO A O    4  
ATOM 6335  C CB   . PRO A 1 82  ? -5.185  -2.902  2.345   1.00 0.00 ? 1214 PRO A CB   4  
ATOM 6336  C CG   . PRO A 1 82  ? -5.786  -4.142  1.777   1.00 0.00 ? 1214 PRO A CG   4  
ATOM 6337  C CD   . PRO A 1 82  ? -5.187  -4.335  0.417   1.00 0.00 ? 1214 PRO A CD   4  
ATOM 6338  H HA   . PRO A 1 82  ? -5.722  -1.360  0.948   1.00 0.00 ? 1214 PRO A HA   4  
ATOM 6339  H HB2  . PRO A 1 82  ? -4.266  -3.113  2.873   1.00 0.00 ? 1214 PRO A HB2  4  
ATOM 6340  H HB3  . PRO A 1 82  ? -5.876  -2.394  3.001   1.00 0.00 ? 1214 PRO A HB3  4  
ATOM 6341  H HG2  . PRO A 1 82  ? -5.548  -4.986  2.405   1.00 0.00 ? 1214 PRO A HG2  4  
ATOM 6342  H HG3  . PRO A 1 82  ? -6.856  -4.025  1.692   1.00 0.00 ? 1214 PRO A HG3  4  
ATOM 6343  H HD2  . PRO A 1 82  ? -4.361  -5.029  0.469   1.00 0.00 ? 1214 PRO A HD2  4  
ATOM 6344  H HD3  . PRO A 1 82  ? -5.938  -4.690  -0.273  1.00 0.00 ? 1214 PRO A HD3  4  
ATOM 6345  N N    . LEU A 1 83  ? -2.504  -1.675  0.845   1.00 0.00 ? 1215 LEU A N    4  
ATOM 6346  C CA   . LEU A 1 83  ? -1.231  -0.980  1.000   1.00 0.00 ? 1215 LEU A CA   4  
ATOM 6347  C C    . LEU A 1 83  ? -1.093  0.137   -0.029  1.00 0.00 ? 1215 LEU A C    4  
ATOM 6348  O O    . LEU A 1 83  ? -1.088  1.318   0.319   1.00 0.00 ? 1215 LEU A O    4  
ATOM 6349  C CB   . LEU A 1 83  ? -0.069  -1.965  0.859   1.00 0.00 ? 1215 LEU A CB   4  
ATOM 6350  C CG   . LEU A 1 83  ? 0.235   -2.824  2.087   1.00 0.00 ? 1215 LEU A CG   4  
ATOM 6351  C CD1  . LEU A 1 83  ? -0.760  -3.969  2.197   1.00 0.00 ? 1215 LEU A CD1  4  
ATOM 6352  C CD2  . LEU A 1 83  ? 1.659   -3.357  2.026   1.00 0.00 ? 1215 LEU A CD2  4  
ATOM 6353  H H    . LEU A 1 83  ? -2.530  -2.517  0.345   1.00 0.00 ? 1215 LEU A H    4  
ATOM 6354  H HA   . LEU A 1 83  ? -1.208  -0.547  1.989   1.00 0.00 ? 1215 LEU A HA   4  
ATOM 6355  H HB2  . LEU A 1 83  ? -0.296  -2.629  0.039   1.00 0.00 ? 1215 LEU A HB2  4  
ATOM 6356  H HB3  . LEU A 1 83  ? 0.819   -1.396  0.624   1.00 0.00 ? 1215 LEU A HB3  4  
ATOM 6357  H HG   . LEU A 1 83  ? 0.142   -2.216  2.976   1.00 0.00 ? 1215 LEU A HG   4  
ATOM 6358  H HD11 . LEU A 1 83  ? -0.793  -4.508  1.262   1.00 0.00 ? 1215 LEU A HD11 4  
ATOM 6359  H HD12 . LEU A 1 83  ? -1.740  -3.575  2.420   1.00 0.00 ? 1215 LEU A HD12 4  
ATOM 6360  H HD13 . LEU A 1 83  ? -0.453  -4.638  2.987   1.00 0.00 ? 1215 LEU A HD13 4  
ATOM 6361  H HD21 . LEU A 1 83  ? 2.056   -3.436  3.028   1.00 0.00 ? 1215 LEU A HD21 4  
ATOM 6362  H HD22 . LEU A 1 83  ? 2.272   -2.680  1.449   1.00 0.00 ? 1215 LEU A HD22 4  
ATOM 6363  H HD23 . LEU A 1 83  ? 1.660   -4.331  1.560   1.00 0.00 ? 1215 LEU A HD23 4  
ATOM 6364  N N    . TRP A 1 84  ? -0.982  -0.243  -1.297  1.00 0.00 ? 1216 TRP A N    4  
ATOM 6365  C CA   . TRP A 1 84  ? -0.845  0.727   -2.377  1.00 0.00 ? 1216 TRP A CA   4  
ATOM 6366  C C    . TRP A 1 84  ? -2.041  1.673   -2.413  1.00 0.00 ? 1216 TRP A C    4  
ATOM 6367  O O    . TRP A 1 84  ? -1.944  2.790   -2.920  1.00 0.00 ? 1216 TRP A O    4  
ATOM 6368  C CB   . TRP A 1 84  ? -0.707  0.010   -3.720  1.00 0.00 ? 1216 TRP A CB   4  
ATOM 6369  C CG   . TRP A 1 84  ? -2.015  -0.467  -4.277  1.00 0.00 ? 1216 TRP A CG   4  
ATOM 6370  C CD1  . TRP A 1 84  ? -3.103  0.299   -4.582  1.00 0.00 ? 1216 TRP A CD1  4  
ATOM 6371  C CD2  . TRP A 1 84  ? -2.370  -1.817  -4.592  1.00 0.00 ? 1216 TRP A CD2  4  
ATOM 6372  N NE1  . TRP A 1 84  ? -4.115  -0.494  -5.068  1.00 0.00 ? 1216 TRP A NE1  4  
ATOM 6373  C CE2  . TRP A 1 84  ? -3.690  -1.796  -5.085  1.00 0.00 ? 1216 TRP A CE2  4  
ATOM 6374  C CE3  . TRP A 1 84  ? -1.702  -3.042  -4.508  1.00 0.00 ? 1216 TRP A CE3  4  
ATOM 6375  C CZ2  . TRP A 1 84  ? -4.352  -2.952  -5.490  1.00 0.00 ? 1216 TRP A CZ2  4  
ATOM 6376  C CZ3  . TRP A 1 84  ? -2.361  -4.189  -4.910  1.00 0.00 ? 1216 TRP A CZ3  4  
ATOM 6377  C CH2  . TRP A 1 84  ? -3.674  -4.138  -5.397  1.00 0.00 ? 1216 TRP A CH2  4  
ATOM 6378  H H    . TRP A 1 84  ? -0.992  -1.200  -1.512  1.00 0.00 ? 1216 TRP A H    4  
ATOM 6379  H HA   . TRP A 1 84  ? 0.049   1.303   -2.193  1.00 0.00 ? 1216 TRP A HA   4  
ATOM 6380  H HB2  . TRP A 1 84  ? -0.265  0.684   -4.438  1.00 0.00 ? 1216 TRP A HB2  4  
ATOM 6381  H HB3  . TRP A 1 84  ? -0.064  -0.850  -3.596  1.00 0.00 ? 1216 TRP A HB3  4  
ATOM 6382  H HD1  . TRP A 1 84  ? -3.149  1.369   -4.453  1.00 0.00 ? 1216 TRP A HD1  4  
ATOM 6383  H HE1  . TRP A 1 84  ? -4.996  -0.178  -5.357  1.00 0.00 ? 1216 TRP A HE1  4  
ATOM 6384  H HE3  . TRP A 1 84  ? -0.690  -3.102  -4.136  1.00 0.00 ? 1216 TRP A HE3  4  
ATOM 6385  H HZ2  . TRP A 1 84  ? -5.363  -2.929  -5.868  1.00 0.00 ? 1216 TRP A HZ2  4  
ATOM 6386  H HZ3  . TRP A 1 84  ? -1.861  -5.144  -4.852  1.00 0.00 ? 1216 TRP A HZ3  4  
ATOM 6387  H HH2  . TRP A 1 84  ? -4.149  -5.058  -5.699  1.00 0.00 ? 1216 TRP A HH2  4  
ATOM 6388  N N    . GLU A 1 85  ? -3.166  1.219   -1.870  1.00 0.00 ? 1217 GLU A N    4  
ATOM 6389  C CA   . GLU A 1 85  ? -4.380  2.026   -1.842  1.00 0.00 ? 1217 GLU A CA   4  
ATOM 6390  C C    . GLU A 1 85  ? -4.136  3.351   -1.124  1.00 0.00 ? 1217 GLU A C    4  
ATOM 6391  O O    . GLU A 1 85  ? -4.546  4.411   -1.596  1.00 0.00 ? 1217 GLU A O    4  
ATOM 6392  C CB   . GLU A 1 85  ? -5.512  1.262   -1.153  1.00 0.00 ? 1217 GLU A CB   4  
ATOM 6393  C CG   . GLU A 1 85  ? -6.171  0.220   -2.041  1.00 0.00 ? 1217 GLU A CG   4  
ATOM 6394  C CD   . GLU A 1 85  ? -7.323  0.786   -2.848  1.00 0.00 ? 1217 GLU A CD   4  
ATOM 6395  O OE1  . GLU A 1 85  ? -8.280  1.302   -2.234  1.00 0.00 ? 1217 GLU A OE1  4  
ATOM 6396  O OE2  . GLU A 1 85  ? -7.268  0.714   -4.094  1.00 0.00 ? 1217 GLU A OE2  4  
ATOM 6397  H H    . GLU A 1 85  ? -3.181  0.320   -1.481  1.00 0.00 ? 1217 GLU A H    4  
ATOM 6398  H HA   . GLU A 1 85  ? -4.666  2.232   -2.862  1.00 0.00 ? 1217 GLU A HA   4  
ATOM 6399  H HB2  . GLU A 1 85  ? -5.115  0.763   -0.281  1.00 0.00 ? 1217 GLU A HB2  4  
ATOM 6400  H HB3  . GLU A 1 85  ? -6.268  1.967   -0.840  1.00 0.00 ? 1217 GLU A HB3  4  
ATOM 6401  H HG2  . GLU A 1 85  ? -5.433  -0.172  -2.724  1.00 0.00 ? 1217 GLU A HG2  4  
ATOM 6402  H HG3  . GLU A 1 85  ? -6.546  -0.580  -1.419  1.00 0.00 ? 1217 GLU A HG3  4  
ATOM 6403  N N    . VAL A 1 86  ? -3.464  3.281   0.021   1.00 0.00 ? 1218 VAL A N    4  
ATOM 6404  C CA   . VAL A 1 86  ? -3.164  4.473   0.805   1.00 0.00 ? 1218 VAL A CA   4  
ATOM 6405  C C    . VAL A 1 86  ? -2.310  5.454   0.009   1.00 0.00 ? 1218 VAL A C    4  
ATOM 6406  O O    . VAL A 1 86  ? -2.550  6.661   0.031   1.00 0.00 ? 1218 VAL A O    4  
ATOM 6407  C CB   . VAL A 1 86  ? -2.432  4.116   2.112   1.00 0.00 ? 1218 VAL A CB   4  
ATOM 6408  C CG1  . VAL A 1 86  ? -1.958  5.376   2.821   1.00 0.00 ? 1218 VAL A CG1  4  
ATOM 6409  C CG2  . VAL A 1 86  ? -3.333  3.291   3.019   1.00 0.00 ? 1218 VAL A CG2  4  
ATOM 6410  H H    . VAL A 1 86  ? -3.162  2.407   0.346   1.00 0.00 ? 1218 VAL A H    4  
ATOM 6411  H HA   . VAL A 1 86  ? -4.099  4.950   1.060   1.00 0.00 ? 1218 VAL A HA   4  
ATOM 6412  H HB   . VAL A 1 86  ? -1.564  3.522   1.864   1.00 0.00 ? 1218 VAL A HB   4  
ATOM 6413  H HG11 . VAL A 1 86  ? -1.282  5.107   3.619   1.00 0.00 ? 1218 VAL A HG11 4  
ATOM 6414  H HG12 . VAL A 1 86  ? -1.449  6.016   2.116   1.00 0.00 ? 1218 VAL A HG12 4  
ATOM 6415  H HG13 . VAL A 1 86  ? -2.809  5.898   3.232   1.00 0.00 ? 1218 VAL A HG13 4  
ATOM 6416  H HG21 . VAL A 1 86  ? -4.042  3.942   3.509   1.00 0.00 ? 1218 VAL A HG21 4  
ATOM 6417  H HG22 . VAL A 1 86  ? -3.865  2.559   2.429   1.00 0.00 ? 1218 VAL A HG22 4  
ATOM 6418  H HG23 . VAL A 1 86  ? -2.733  2.787   3.761   1.00 0.00 ? 1218 VAL A HG23 4  
ATOM 6419  N N    . ILE A 1 87  ? -1.313  4.927   -0.693  1.00 0.00 ? 1219 ILE A N    4  
ATOM 6420  C CA   . ILE A 1 87  ? -0.424  5.756   -1.498  1.00 0.00 ? 1219 ILE A CA   4  
ATOM 6421  C C    . ILE A 1 87  ? -1.194  6.481   -2.596  1.00 0.00 ? 1219 ILE A C    4  
ATOM 6422  O O    . ILE A 1 87  ? -0.780  7.543   -3.062  1.00 0.00 ? 1219 ILE A O    4  
ATOM 6423  C CB   . ILE A 1 87  ? 0.699   4.919   -2.140  1.00 0.00 ? 1219 ILE A CB   4  
ATOM 6424  C CG1  . ILE A 1 87  ? 1.557   4.262   -1.057  1.00 0.00 ? 1219 ILE A CG1  4  
ATOM 6425  C CG2  . ILE A 1 87  ? 1.555   5.789   -3.047  1.00 0.00 ? 1219 ILE A CG2  4  
ATOM 6426  C CD1  . ILE A 1 87  ? 2.485   3.192   -1.589  1.00 0.00 ? 1219 ILE A CD1  4  
ATOM 6427  H H    . ILE A 1 87  ? -1.172  3.957   -0.670  1.00 0.00 ? 1219 ILE A H    4  
ATOM 6428  H HA   . ILE A 1 87  ? 0.029   6.489   -0.846  1.00 0.00 ? 1219 ILE A HA   4  
ATOM 6429  H HB   . ILE A 1 87  ? 0.243   4.150   -2.744  1.00 0.00 ? 1219 ILE A HB   4  
ATOM 6430  H HG12 . ILE A 1 87  ? 2.162   5.016   -0.579  1.00 0.00 ? 1219 ILE A HG12 4  
ATOM 6431  H HG13 . ILE A 1 87  ? 0.910   3.805   -0.323  1.00 0.00 ? 1219 ILE A HG13 4  
ATOM 6432  H HG21 . ILE A 1 87  ? 1.840   6.688   -2.520  1.00 0.00 ? 1219 ILE A HG21 4  
ATOM 6433  H HG22 . ILE A 1 87  ? 2.442   5.245   -3.335  1.00 0.00 ? 1219 ILE A HG22 4  
ATOM 6434  H HG23 . ILE A 1 87  ? 0.992   6.053   -3.930  1.00 0.00 ? 1219 ILE A HG23 4  
ATOM 6435  H HD11 . ILE A 1 87  ? 2.708   3.391   -2.627  1.00 0.00 ? 1219 ILE A HD11 4  
ATOM 6436  H HD12 . ILE A 1 87  ? 3.401   3.192   -1.017  1.00 0.00 ? 1219 ILE A HD12 4  
ATOM 6437  H HD13 . ILE A 1 87  ? 2.008   2.226   -1.503  1.00 0.00 ? 1219 ILE A HD13 4  
ATOM 6438  N N    . LYS A 1 88  ? -2.317  5.902   -3.006  1.00 0.00 ? 1220 LYS A N    4  
ATOM 6439  C CA   . LYS A 1 88  ? -3.148  6.493   -4.047  1.00 0.00 ? 1220 LYS A CA   4  
ATOM 6440  C C    . LYS A 1 88  ? -3.799  7.782   -3.557  1.00 0.00 ? 1220 LYS A C    4  
ATOM 6441  O O    . LYS A 1 88  ? -3.963  8.736   -4.319  1.00 0.00 ? 1220 LYS A O    4  
ATOM 6442  C CB   . LYS A 1 88  ? -4.226  5.502   -4.493  1.00 0.00 ? 1220 LYS A CB   4  
ATOM 6443  C CG   . LYS A 1 88  ? -3.671  4.161   -4.942  1.00 0.00 ? 1220 LYS A CG   4  
ATOM 6444  C CD   . LYS A 1 88  ? -4.510  3.554   -6.054  1.00 0.00 ? 1220 LYS A CD   4  
ATOM 6445  C CE   . LYS A 1 88  ? -5.671  2.744   -5.497  1.00 0.00 ? 1220 LYS A CE   4  
ATOM 6446  N NZ   . LYS A 1 88  ? -6.711  3.615   -4.883  1.00 0.00 ? 1220 LYS A NZ   4  
ATOM 6447  H H    . LYS A 1 88  ? -2.594  5.055   -2.596  1.00 0.00 ? 1220 LYS A H    4  
ATOM 6448  H HA   . LYS A 1 88  ? -2.512  6.723   -4.889  1.00 0.00 ? 1220 LYS A HA   4  
ATOM 6449  H HB2  . LYS A 1 88  ? -4.903  5.331   -3.669  1.00 0.00 ? 1220 LYS A HB2  4  
ATOM 6450  H HB3  . LYS A 1 88  ? -4.776  5.934   -5.316  1.00 0.00 ? 1220 LYS A HB3  4  
ATOM 6451  H HG2  . LYS A 1 88  ? -2.663  4.301   -5.302  1.00 0.00 ? 1220 LYS A HG2  4  
ATOM 6452  H HG3  . LYS A 1 88  ? -3.663  3.485   -4.099  1.00 0.00 ? 1220 LYS A HG3  4  
ATOM 6453  H HD2  . LYS A 1 88  ? -4.904  4.349   -6.671  1.00 0.00 ? 1220 LYS A HD2  4  
ATOM 6454  H HD3  . LYS A 1 88  ? -3.885  2.907   -6.652  1.00 0.00 ? 1220 LYS A HD3  4  
ATOM 6455  H HE2  . LYS A 1 88  ? -6.116  2.178   -6.301  1.00 0.00 ? 1220 LYS A HE2  4  
ATOM 6456  H HE3  . LYS A 1 88  ? -5.292  2.066   -4.747  1.00 0.00 ? 1220 LYS A HE3  4  
ATOM 6457  H HZ1  . LYS A 1 88  ? -7.510  3.733   -5.539  1.00 0.00 ? 1220 LYS A HZ1  4  
ATOM 6458  H HZ2  . LYS A 1 88  ? -6.312  4.551   -4.668  1.00 0.00 ? 1220 LYS A HZ2  4  
ATOM 6459  H HZ3  . LYS A 1 88  ? -7.061  3.188   -4.002  1.00 0.00 ? 1220 LYS A HZ3  4  
ATOM 6460  N N    . HIS A 1 89  ? -4.168  7.805   -2.280  1.00 0.00 ? 1221 HIS A N    4  
ATOM 6461  C CA   . HIS A 1 89  ? -4.800  8.979   -1.688  1.00 0.00 ? 1221 HIS A CA   4  
ATOM 6462  C C    . HIS A 1 89  ? -3.754  10.013  -1.283  1.00 0.00 ? 1221 HIS A C    4  
ATOM 6463  O O    . HIS A 1 89  ? -3.874  11.194  -1.609  1.00 0.00 ? 1221 HIS A O    4  
ATOM 6464  C CB   . HIS A 1 89  ? -5.634  8.576   -0.472  1.00 0.00 ? 1221 HIS A CB   4  
ATOM 6465  C CG   . HIS A 1 89  ? -6.644  9.606   -0.070  1.00 0.00 ? 1221 HIS A CG   4  
ATOM 6466  N ND1  . HIS A 1 89  ? -7.764  9.311   0.678   1.00 0.00 ? 1221 HIS A ND1  4  
ATOM 6467  C CD2  . HIS A 1 89  ? -6.698  10.936  -0.315  1.00 0.00 ? 1221 HIS A CD2  4  
ATOM 6468  C CE1  . HIS A 1 89  ? -8.464  10.414  0.874   1.00 0.00 ? 1221 HIS A CE1  4  
ATOM 6469  N NE2  . HIS A 1 89  ? -7.838  11.415  0.282   1.00 0.00 ? 1221 HIS A NE2  4  
ATOM 6470  H H    . HIS A 1 89  ? -4.012  7.014   -1.724  1.00 0.00 ? 1221 HIS A H    4  
ATOM 6471  H HA   . HIS A 1 89  ? -5.450  9.416   -2.431  1.00 0.00 ? 1221 HIS A HA   4  
ATOM 6472  H HB2  . HIS A 1 89  ? -6.164  7.661   -0.693  1.00 0.00 ? 1221 HIS A HB2  4  
ATOM 6473  H HB3  . HIS A 1 89  ? -4.976  8.410   0.369   1.00 0.00 ? 1221 HIS A HB3  4  
ATOM 6474  H HD1  . HIS A 1 89  ? -8.011  8.424   1.013   1.00 0.00 ? 1221 HIS A HD1  4  
ATOM 6475  H HD2  . HIS A 1 89  ? -5.978  11.515  -0.877  1.00 0.00 ? 1221 HIS A HD2  4  
ATOM 6476  H HE1  . HIS A 1 89  ? -9.390  10.486  1.424   1.00 0.00 ? 1221 HIS A HE1  4  
ATOM 6477  H HE2  . HIS A 1 89  ? -8.185  12.327  0.199   1.00 0.00 ? 1221 HIS A HE2  4  
ATOM 6478  N N    . PHE A 1 90  ? -2.728  9.561   -0.568  1.00 0.00 ? 1222 PHE A N    4  
ATOM 6479  C CA   . PHE A 1 90  ? -1.662  10.447  -0.117  1.00 0.00 ? 1222 PHE A CA   4  
ATOM 6480  C C    . PHE A 1 90  ? -1.292  11.451  -1.205  1.00 0.00 ? 1222 PHE A C    4  
ATOM 6481  O O    . PHE A 1 90  ? -1.086  12.633  -0.929  1.00 0.00 ? 1222 PHE A O    4  
ATOM 6482  C CB   . PHE A 1 90  ? -0.429  9.633   0.283   1.00 0.00 ? 1222 PHE A CB   4  
ATOM 6483  C CG   . PHE A 1 90  ? 0.556   10.406  1.113   1.00 0.00 ? 1222 PHE A CG   4  
ATOM 6484  C CD1  . PHE A 1 90  ? 0.285   10.697  2.441   1.00 0.00 ? 1222 PHE A CD1  4  
ATOM 6485  C CD2  . PHE A 1 90  ? 1.752   10.841  0.567   1.00 0.00 ? 1222 PHE A CD2  4  
ATOM 6486  C CE1  . PHE A 1 90  ? 1.189   11.408  3.207   1.00 0.00 ? 1222 PHE A CE1  4  
ATOM 6487  C CE2  . PHE A 1 90  ? 2.660   11.553  1.328   1.00 0.00 ? 1222 PHE A CE2  4  
ATOM 6488  C CZ   . PHE A 1 90  ? 2.379   11.836  2.650   1.00 0.00 ? 1222 PHE A CZ   4  
ATOM 6489  H H    . PHE A 1 90  ? -2.688  8.608   -0.339  1.00 0.00 ? 1222 PHE A H    4  
ATOM 6490  H HA   . PHE A 1 90  ? -2.023  10.985  0.746   1.00 0.00 ? 1222 PHE A HA   4  
ATOM 6491  H HB2  . PHE A 1 90  ? -0.744  8.774   0.857   1.00 0.00 ? 1222 PHE A HB2  4  
ATOM 6492  H HB3  . PHE A 1 90  ? 0.077   9.299   -0.610  1.00 0.00 ? 1222 PHE A HB3  4  
ATOM 6493  H HD1  . PHE A 1 90  ? -0.644  10.362  2.878   1.00 0.00 ? 1222 PHE A HD1  4  
ATOM 6494  H HD2  . PHE A 1 90  ? 1.973   10.620  -0.468  1.00 0.00 ? 1222 PHE A HD2  4  
ATOM 6495  H HE1  . PHE A 1 90  ? 0.967   11.628  4.240   1.00 0.00 ? 1222 PHE A HE1  4  
ATOM 6496  H HE2  . PHE A 1 90  ? 3.589   11.885  0.889   1.00 0.00 ? 1222 PHE A HE2  4  
ATOM 6497  H HZ   . PHE A 1 90  ? 3.086   12.392  3.246   1.00 0.00 ? 1222 PHE A HZ   4  
ATOM 6498  N N    . CYS A 1 91  ? -1.208  10.971  -2.440  1.00 0.00 ? 1223 CYS A N    4  
ATOM 6499  C CA   . CYS A 1 91  ? -0.861  11.825  -3.570  1.00 0.00 ? 1223 CYS A CA   4  
ATOM 6500  C C    . CYS A 1 91  ? -2.057  12.666  -4.003  1.00 0.00 ? 1223 CYS A C    4  
ATOM 6501  O O    . CYS A 1 91  ? -1.906  13.826  -4.386  1.00 0.00 ? 1223 CYS A O    4  
ATOM 6502  C CB   . CYS A 1 91  ? -0.367  10.978  -4.744  1.00 0.00 ? 1223 CYS A CB   4  
ATOM 6503  S SG   . CYS A 1 91  ? -1.555  9.739   -5.312  1.00 0.00 ? 1223 CYS A SG   4  
ATOM 6504  H H    . CYS A 1 91  ? -1.383  10.019  -2.597  1.00 0.00 ? 1223 CYS A H    4  
ATOM 6505  H HA   . CYS A 1 91  ? -0.068  12.485  -3.255  1.00 0.00 ? 1223 CYS A HA   4  
ATOM 6506  H HB2  . CYS A 1 91  ? -0.145  11.627  -5.579  1.00 0.00 ? 1223 CYS A HB2  4  
ATOM 6507  H HB3  . CYS A 1 91  ? 0.535   10.461  -4.450  1.00 0.00 ? 1223 CYS A HB3  4  
ATOM 6508  H HG   . CYS A 1 91  ? -1.562  8.747   -4.435  1.00 0.00 ? 1223 CYS A HG   4  
ATOM 6509  N N    . GLN A 1 92  ? -3.245  12.073  -3.941  1.00 0.00 ? 1224 GLN A N    4  
ATOM 6510  C CA   . GLN A 1 92  ? -4.467  12.768  -4.329  1.00 0.00 ? 1224 GLN A CA   4  
ATOM 6511  C C    . GLN A 1 92  ? -4.700  13.992  -3.449  1.00 0.00 ? 1224 GLN A C    4  
ATOM 6512  O O    . GLN A 1 92  ? -5.053  15.065  -3.940  1.00 0.00 ? 1224 GLN A O    4  
ATOM 6513  C CB   . GLN A 1 92  ? -5.666  11.824  -4.238  1.00 0.00 ? 1224 GLN A CB   4  
ATOM 6514  C CG   . GLN A 1 92  ? -5.899  11.012  -5.502  1.00 0.00 ? 1224 GLN A CG   4  
ATOM 6515  C CD   . GLN A 1 92  ? -7.310  10.466  -5.594  1.00 0.00 ? 1224 GLN A CD   4  
ATOM 6516  O OE1  . GLN A 1 92  ? -8.258  11.205  -5.861  1.00 0.00 ? 1224 GLN A OE1  4  
ATOM 6517  N NE2  . GLN A 1 92  ? -7.457  9.165   -5.372  1.00 0.00 ? 1224 GLN A NE2  4  
ATOM 6518  H H    . GLN A 1 92  ? -3.301  11.147  -3.628  1.00 0.00 ? 1224 GLN A H    4  
ATOM 6519  H HA   . GLN A 1 92  ? -4.352  13.092  -5.353  1.00 0.00 ? 1224 GLN A HA   4  
ATOM 6520  H HB2  . GLN A 1 92  ? -5.508  11.138  -3.420  1.00 0.00 ? 1224 GLN A HB2  4  
ATOM 6521  H HB3  . GLN A 1 92  ? -6.554  12.407  -4.043  1.00 0.00 ? 1224 GLN A HB3  4  
ATOM 6522  H HG2  . GLN A 1 92  ? -5.718  11.644  -6.359  1.00 0.00 ? 1224 GLN A HG2  4  
ATOM 6523  H HG3  . GLN A 1 92  ? -5.206  10.183  -5.515  1.00 0.00 ? 1224 GLN A HG3  4  
ATOM 6524  H HE21 . GLN A 1 92  ? -6.657  8.638   -5.164  1.00 0.00 ? 1224 GLN A HE21 4  
ATOM 6525  H HE22 . GLN A 1 92  ? -8.358  8.785   -5.424  1.00 0.00 ? 1224 GLN A HE22 4  
ATOM 6526  N N    . THR A 1 93  ? -4.500  13.824  -2.146  1.00 0.00 ? 1225 THR A N    4  
ATOM 6527  C CA   . THR A 1 93  ? -4.690  14.914  -1.197  1.00 0.00 ? 1225 THR A CA   4  
ATOM 6528  C C    . THR A 1 93  ? -3.536  15.907  -1.263  1.00 0.00 ? 1225 THR A C    4  
ATOM 6529  O O    . THR A 1 93  ? -3.737  17.116  -1.148  1.00 0.00 ? 1225 THR A O    4  
ATOM 6530  C CB   . THR A 1 93  ? -4.818  14.388  0.245   1.00 0.00 ? 1225 THR A CB   4  
ATOM 6531  O OG1  . THR A 1 93  ? -5.323  15.419  1.100   1.00 0.00 ? 1225 THR A OG1  4  
ATOM 6532  C CG2  . THR A 1 93  ? -3.473  13.904  0.766   1.00 0.00 ? 1225 THR A CG2  4  
ATOM 6533  H H    . THR A 1 93  ? -4.219  12.945  -1.816  1.00 0.00 ? 1225 THR A H    4  
ATOM 6534  H HA   . THR A 1 93  ? -5.607  15.424  -1.454  1.00 0.00 ? 1225 THR A HA   4  
ATOM 6535  H HB   . THR A 1 93  ? -5.509  13.557  0.249   1.00 0.00 ? 1225 THR A HB   4  
ATOM 6536  H HG1  . THR A 1 93  ? -6.218  15.200  1.372   1.00 0.00 ? 1225 THR A HG1  4  
ATOM 6537  H HG21 . THR A 1 93  ? -2.899  14.747  1.120   1.00 0.00 ? 1225 THR A HG21 4  
ATOM 6538  H HG22 . THR A 1 93  ? -2.935  13.411  -0.030  1.00 0.00 ? 1225 THR A HG22 4  
ATOM 6539  H HG23 . THR A 1 93  ? -3.630  13.210  1.577   1.00 0.00 ? 1225 THR A HG23 4  
ATOM 6540  N N    . ASN A 1 94  ? -2.326  15.390  -1.448  1.00 0.00 ? 1226 ASN A N    4  
ATOM 6541  C CA   . ASN A 1 94  ? -1.138  16.233  -1.530  1.00 0.00 ? 1226 ASN A CA   4  
ATOM 6542  C C    . ASN A 1 94  ? -0.817  16.582  -2.980  1.00 0.00 ? 1226 ASN A C    4  
ATOM 6543  O O    . ASN A 1 94  ? 0.288   17.026  -3.292  1.00 0.00 ? 1226 ASN A O    4  
ATOM 6544  C CB   . ASN A 1 94  ? 0.058   15.529  -0.886  1.00 0.00 ? 1226 ASN A CB   4  
ATOM 6545  C CG   . ASN A 1 94  ? 0.005   15.569  0.630   1.00 0.00 ? 1226 ASN A CG   4  
ATOM 6546  O OD1  . ASN A 1 94  ? 0.534   16.486  1.257   1.00 0.00 ? 1226 ASN A OD1  4  
ATOM 6547  N ND2  . ASN A 1 94  ? -0.637  14.570  1.225   1.00 0.00 ? 1226 ASN A ND2  4  
ATOM 6548  H H    . ASN A 1 94  ? -2.228  14.419  -1.533  1.00 0.00 ? 1226 ASN A H    4  
ATOM 6549  H HA   . ASN A 1 94  ? -1.342  17.145  -0.989  1.00 0.00 ? 1226 ASN A HA   4  
ATOM 6550  H HB2  . ASN A 1 94  ? 0.070   14.495  -1.199  1.00 0.00 ? 1226 ASN A HB2  4  
ATOM 6551  H HB3  . ASN A 1 94  ? 0.968   16.010  -1.209  1.00 0.00 ? 1226 ASN A HB3  4  
ATOM 6552  H HD21 . ASN A 1 94  ? -1.034  13.873  0.662   1.00 0.00 ? 1226 ASN A HD21 4  
ATOM 6553  H HD22 . ASN A 1 94  ? -0.687  14.571  2.204   1.00 0.00 ? 1226 ASN A HD22 4  
ATOM 6554  N N    . SER A 1 95  ? -1.790  16.377  -3.862  1.00 0.00 ? 1227 SER A N    4  
ATOM 6555  C CA   . SER A 1 95  ? -1.610  16.667  -5.279  1.00 0.00 ? 1227 SER A CA   4  
ATOM 6556  C C    . SER A 1 95  ? -0.179  16.370  -5.717  1.00 0.00 ? 1227 SER A C    4  
ATOM 6557  O O    . SER A 1 95  ? 0.481   17.209  -6.331  1.00 0.00 ? 1227 SER A O    4  
ATOM 6558  C CB   . SER A 1 95  ? -1.952  18.129  -5.570  1.00 0.00 ? 1227 SER A CB   4  
ATOM 6559  O OG   . SER A 1 95  ? -1.955  18.385  -6.964  1.00 0.00 ? 1227 SER A OG   4  
ATOM 6560  H H    . SER A 1 95  ? -2.649  16.020  -3.551  1.00 0.00 ? 1227 SER A H    4  
ATOM 6561  H HA   . SER A 1 95  ? -2.283  16.031  -5.836  1.00 0.00 ? 1227 SER A HA   4  
ATOM 6562  H HB2  . SER A 1 95  ? -2.931  18.353  -5.174  1.00 0.00 ? 1227 SER A HB2  4  
ATOM 6563  H HB3  . SER A 1 95  ? -1.218  18.768  -5.101  1.00 0.00 ? 1227 SER A HB3  4  
ATOM 6564  H HG   . SER A 1 95  ? -2.852  18.322  -7.300  1.00 0.00 ? 1227 SER A HG   4  
ATOM 6565  N N    . VAL A 1 96  ? 0.295   15.171  -5.396  1.00 0.00 ? 1228 VAL A N    4  
ATOM 6566  C CA   . VAL A 1 96  ? 1.648   14.762  -5.756  1.00 0.00 ? 1228 VAL A CA   4  
ATOM 6567  C C    . VAL A 1 96  ? 1.631   13.761  -6.905  1.00 0.00 ? 1228 VAL A C    4  
ATOM 6568  O O    . VAL A 1 96  ? 0.628   13.089  -7.141  1.00 0.00 ? 1228 VAL A O    4  
ATOM 6569  C CB   . VAL A 1 96  ? 2.383   14.137  -4.556  1.00 0.00 ? 1228 VAL A CB   4  
ATOM 6570  C CG1  . VAL A 1 96  ? 3.819   13.798  -4.926  1.00 0.00 ? 1228 VAL A CG1  4  
ATOM 6571  C CG2  . VAL A 1 96  ? 2.340   15.074  -3.358  1.00 0.00 ? 1228 VAL A CG2  4  
ATOM 6572  H H    . VAL A 1 96  ? -0.279  14.546  -4.906  1.00 0.00 ? 1228 VAL A H    4  
ATOM 6573  H HA   . VAL A 1 96  ? 2.191   15.642  -6.066  1.00 0.00 ? 1228 VAL A HA   4  
ATOM 6574  H HB   . VAL A 1 96  ? 1.878   13.220  -4.287  1.00 0.00 ? 1228 VAL A HB   4  
ATOM 6575  H HG11 . VAL A 1 96  ? 3.853   12.815  -5.372  1.00 0.00 ? 1228 VAL A HG11 4  
ATOM 6576  H HG12 . VAL A 1 96  ? 4.191   14.527  -5.631  1.00 0.00 ? 1228 VAL A HG12 4  
ATOM 6577  H HG13 . VAL A 1 96  ? 4.433   13.811  -4.038  1.00 0.00 ? 1228 VAL A HG13 4  
ATOM 6578  H HG21 . VAL A 1 96  ? 2.565   16.080  -3.681  1.00 0.00 ? 1228 VAL A HG21 4  
ATOM 6579  H HG22 . VAL A 1 96  ? 1.354   15.049  -2.916  1.00 0.00 ? 1228 VAL A HG22 4  
ATOM 6580  H HG23 . VAL A 1 96  ? 3.069   14.758  -2.627  1.00 0.00 ? 1228 VAL A HG23 4  
ATOM 6581  N N    . GLN A 1 97  ? 2.750   13.667  -7.617  1.00 0.00 ? 1229 GLN A N    4  
ATOM 6582  C CA   . GLN A 1 97  ? 2.863   12.747  -8.743  1.00 0.00 ? 1229 GLN A CA   4  
ATOM 6583  C C    . GLN A 1 97  ? 3.166   11.332  -8.261  1.00 0.00 ? 1229 GLN A C    4  
ATOM 6584  O O    . GLN A 1 97  ? 3.764   11.139  -7.202  1.00 0.00 ? 1229 GLN A O    4  
ATOM 6585  C CB   . GLN A 1 97  ? 3.957   13.216  -9.704  1.00 0.00 ? 1229 GLN A CB   4  
ATOM 6586  C CG   . GLN A 1 97  ? 5.355   13.160  -9.109  1.00 0.00 ? 1229 GLN A CG   4  
ATOM 6587  C CD   . GLN A 1 97  ? 5.675   14.371  -8.255  1.00 0.00 ? 1229 GLN A CD   4  
ATOM 6588  O OE1  . GLN A 1 97  ? 5.321   15.499  -8.599  1.00 0.00 ? 1229 GLN A OE1  4  
ATOM 6589  N NE2  . GLN A 1 97  ? 6.348   14.143  -7.133  1.00 0.00 ? 1229 GLN A NE2  4  
ATOM 6590  H H    . GLN A 1 97  ? 3.516   14.229  -7.380  1.00 0.00 ? 1229 GLN A H    4  
ATOM 6591  H HA   . GLN A 1 97  ? 1.918   12.742  -9.263  1.00 0.00 ? 1229 GLN A HA   4  
ATOM 6592  H HB2  . GLN A 1 97  ? 3.938   12.592  -10.584 1.00 0.00 ? 1229 GLN A HB2  4  
ATOM 6593  H HB3  . GLN A 1 97  ? 3.753   14.237  -9.991  1.00 0.00 ? 1229 GLN A HB3  4  
ATOM 6594  H HG2  . GLN A 1 97  ? 5.436   12.275  -8.495  1.00 0.00 ? 1229 GLN A HG2  4  
ATOM 6595  H HG3  . GLN A 1 97  ? 6.073   13.105  -9.914  1.00 0.00 ? 1229 GLN A HG3  4  
ATOM 6596  H HE21 . GLN A 1 97  ? 6.598   13.218  -6.923  1.00 0.00 ? 1229 GLN A HE21 4  
ATOM 6597  H HE22 . GLN A 1 97  ? 6.569   14.907  -6.563  1.00 0.00 ? 1229 GLN A HE22 4  
ATOM 6598  N N    . THR A 1 98  ? 2.750   10.343  -9.046  1.00 0.00 ? 1230 THR A N    4  
ATOM 6599  C CA   . THR A 1 98  ? 2.975   8.945   -8.699  1.00 0.00 ? 1230 THR A CA   4  
ATOM 6600  C C    . THR A 1 98  ? 3.214   8.101   -9.946  1.00 0.00 ? 1230 THR A C    4  
ATOM 6601  O O    . THR A 1 98  ? 3.206   8.614   -11.065 1.00 0.00 ? 1230 THR A O    4  
ATOM 6602  C CB   . THR A 1 98  ? 1.783   8.361   -7.918  1.00 0.00 ? 1230 THR A CB   4  
ATOM 6603  O OG1  . THR A 1 98  ? 0.590   8.453   -8.704  1.00 0.00 ? 1230 THR A OG1  4  
ATOM 6604  C CG2  . THR A 1 98  ? 1.586   9.097   -6.601  1.00 0.00 ? 1230 THR A CG2  4  
ATOM 6605  H H    . THR A 1 98  ? 2.279   10.560  -9.878  1.00 0.00 ? 1230 THR A H    4  
ATOM 6606  H HA   . THR A 1 98  ? 3.851   8.895   -8.069  1.00 0.00 ? 1230 THR A HA   4  
ATOM 6607  H HB   . THR A 1 98  ? 1.986   7.321   -7.705  1.00 0.00 ? 1230 THR A HB   4  
ATOM 6608  H HG1  . THR A 1 98  ? 0.066   9.200   -8.405  1.00 0.00 ? 1230 THR A HG1  4  
ATOM 6609  H HG21 . THR A 1 98  ? 0.706   8.717   -6.104  1.00 0.00 ? 1230 THR A HG21 4  
ATOM 6610  H HG22 . THR A 1 98  ? 1.463   10.153  -6.793  1.00 0.00 ? 1230 THR A HG22 4  
ATOM 6611  H HG23 . THR A 1 98  ? 2.450   8.944   -5.971  1.00 0.00 ? 1230 THR A HG23 4  
ATOM 6612  N N    . ASP A 1 99  ? 3.424   6.805   -9.745  1.00 0.00 ? 1231 ASP A N    4  
ATOM 6613  C CA   . ASP A 1 99  ? 3.664   5.889   -10.854 1.00 0.00 ? 1231 ASP A CA   4  
ATOM 6614  C C    . ASP A 1 99  ? 4.912   6.291   -11.632 1.00 0.00 ? 1231 ASP A C    4  
ATOM 6615  O O    . ASP A 1 99  ? 4.905   6.327   -12.863 1.00 0.00 ? 1231 ASP A O    4  
ATOM 6616  C CB   . ASP A 1 99  ? 2.453   5.858   -11.788 1.00 0.00 ? 1231 ASP A CB   4  
ATOM 6617  C CG   . ASP A 1 99  ? 1.147   5.681   -11.039 1.00 0.00 ? 1231 ASP A CG   4  
ATOM 6618  O OD1  . ASP A 1 99  ? 1.173   5.106   -9.931  1.00 0.00 ? 1231 ASP A OD1  4  
ATOM 6619  O OD2  . ASP A 1 99  ? 0.099   6.116   -11.561 1.00 0.00 ? 1231 ASP A OD2  4  
ATOM 6620  H H    . ASP A 1 99  ? 3.418   6.456   -8.829  1.00 0.00 ? 1231 ASP A H    4  
ATOM 6621  H HA   . ASP A 1 99  ? 3.814   4.902   -10.442 1.00 0.00 ? 1231 ASP A HA   4  
ATOM 6622  H HB2  . ASP A 1 99  ? 2.407   6.787   -12.338 1.00 0.00 ? 1231 ASP A HB2  4  
ATOM 6623  H HB3  . ASP A 1 99  ? 2.563   5.038   -12.483 1.00 0.00 ? 1231 ASP A HB3  4  
ATOM 6624  N N    . LEU A 1 100 ? 5.983   6.595   -10.906 1.00 0.00 ? 1232 LEU A N    4  
ATOM 6625  C CA   . LEU A 1 100 ? 7.240   6.996   -11.528 1.00 0.00 ? 1232 LEU A CA   4  
ATOM 6626  C C    . LEU A 1 100 ? 8.041   5.777   -11.974 1.00 0.00 ? 1232 LEU A C    4  
ATOM 6627  O O    . LEU A 1 100 ? 9.228   5.656   -11.671 1.00 0.00 ? 1232 LEU A O    4  
ATOM 6628  C CB   . LEU A 1 100 ? 8.068   7.836   -10.555 1.00 0.00 ? 1232 LEU A CB   4  
ATOM 6629  C CG   . LEU A 1 100 ? 7.341   9.006   -9.891  1.00 0.00 ? 1232 LEU A CG   4  
ATOM 6630  C CD1  . LEU A 1 100 ? 8.069   9.442   -8.629  1.00 0.00 ? 1232 LEU A CD1  4  
ATOM 6631  C CD2  . LEU A 1 100 ? 7.209   10.171  -10.862 1.00 0.00 ? 1232 LEU A CD2  4  
ATOM 6632  H H    . LEU A 1 100 ? 5.928   6.548   -9.930  1.00 0.00 ? 1232 LEU A H    4  
ATOM 6633  H HA   . LEU A 1 100 ? 7.004   7.594   -12.396 1.00 0.00 ? 1232 LEU A HA   4  
ATOM 6634  H HB2  . LEU A 1 100 ? 8.423   7.182   -9.773  1.00 0.00 ? 1232 LEU A HB2  4  
ATOM 6635  H HB3  . LEU A 1 100 ? 8.912   8.236   -11.099 1.00 0.00 ? 1232 LEU A HB3  4  
ATOM 6636  H HG   . LEU A 1 100 ? 6.346   8.691   -9.609  1.00 0.00 ? 1232 LEU A HG   4  
ATOM 6637  H HD11 . LEU A 1 100 ? 9.126   9.250   -8.739  1.00 0.00 ? 1232 LEU A HD11 4  
ATOM 6638  H HD12 . LEU A 1 100 ? 7.689   8.887   -7.785  1.00 0.00 ? 1232 LEU A HD12 4  
ATOM 6639  H HD13 . LEU A 1 100 ? 7.909   10.498  -8.467  1.00 0.00 ? 1232 LEU A HD13 4  
ATOM 6640  H HD21 . LEU A 1 100 ? 7.915   10.944  -10.594 1.00 0.00 ? 1232 LEU A HD21 4  
ATOM 6641  H HD22 . LEU A 1 100 ? 6.205   10.568  -10.813 1.00 0.00 ? 1232 LEU A HD22 4  
ATOM 6642  H HD23 . LEU A 1 100 ? 7.413   9.829   -11.865 1.00 0.00 ? 1232 LEU A HD23 4  
ATOM 6643  N N    . PHE A 1 101 ? 7.384   4.876   -12.698 1.00 0.00 ? 1233 PHE A N    4  
ATOM 6644  C CA   . PHE A 1 101 ? 8.035   3.667   -13.187 1.00 0.00 ? 1233 PHE A CA   4  
ATOM 6645  C C    . PHE A 1 101 ? 8.651   3.899   -14.564 1.00 0.00 ? 1233 PHE A C    4  
ATOM 6646  O O    . PHE A 1 101 ? 9.860   3.756   -14.747 1.00 0.00 ? 1233 PHE A O    4  
ATOM 6647  C CB   . PHE A 1 101 ? 7.032   2.513   -13.253 1.00 0.00 ? 1233 PHE A CB   4  
ATOM 6648  C CG   . PHE A 1 101 ? 6.680   1.947   -11.908 1.00 0.00 ? 1233 PHE A CG   4  
ATOM 6649  C CD1  . PHE A 1 101 ? 5.985   2.707   -10.981 1.00 0.00 ? 1233 PHE A CD1  4  
ATOM 6650  C CD2  . PHE A 1 101 ? 7.044   0.653   -11.569 1.00 0.00 ? 1233 PHE A CD2  4  
ATOM 6651  C CE1  . PHE A 1 101 ? 5.662   2.188   -9.742  1.00 0.00 ? 1233 PHE A CE1  4  
ATOM 6652  C CE2  . PHE A 1 101 ? 6.723   0.129   -10.332 1.00 0.00 ? 1233 PHE A CE2  4  
ATOM 6653  C CZ   . PHE A 1 101 ? 6.029   0.897   -9.417  1.00 0.00 ? 1233 PHE A CZ   4  
ATOM 6654  H H    . PHE A 1 101 ? 6.439   5.029   -12.907 1.00 0.00 ? 1233 PHE A H    4  
ATOM 6655  H HA   . PHE A 1 101 ? 8.820   3.410   -12.493 1.00 0.00 ? 1233 PHE A HA   4  
ATOM 6656  H HB2  . PHE A 1 101 ? 6.120   2.864   -13.713 1.00 0.00 ? 1233 PHE A HB2  4  
ATOM 6657  H HB3  . PHE A 1 101 ? 7.449   1.717   -13.852 1.00 0.00 ? 1233 PHE A HB3  4  
ATOM 6658  H HD1  . PHE A 1 101 ? 5.696   3.717   -11.234 1.00 0.00 ? 1233 PHE A HD1  4  
ATOM 6659  H HD2  . PHE A 1 101 ? 7.587   0.051   -12.285 1.00 0.00 ? 1233 PHE A HD2  4  
ATOM 6660  H HE1  . PHE A 1 101 ? 5.119   2.791   -9.029  1.00 0.00 ? 1233 PHE A HE1  4  
ATOM 6661  H HE2  . PHE A 1 101 ? 7.012   -0.881  -10.081 1.00 0.00 ? 1233 PHE A HE2  4  
ATOM 6662  H HZ   . PHE A 1 101 ? 5.778   0.490   -8.449  1.00 0.00 ? 1233 PHE A HZ   4  
ATOM 6663  N N    . SER A 1 102 ? 7.811   4.259   -15.529 1.00 0.00 ? 1234 SER A N    4  
ATOM 6664  C CA   . SER A 1 102 ? 8.271   4.507   -16.890 1.00 0.00 ? 1234 SER A CA   4  
ATOM 6665  C C    . SER A 1 102 ? 8.984   5.853   -16.985 1.00 0.00 ? 1234 SER A C    4  
ATOM 6666  O O    . SER A 1 102 ? 8.379   6.904   -16.776 1.00 0.00 ? 1234 SER A O    4  
ATOM 6667  C CB   . SER A 1 102 ? 7.092   4.472   -17.864 1.00 0.00 ? 1234 SER A CB   4  
ATOM 6668  O OG   . SER A 1 102 ? 7.507   4.053   -19.152 1.00 0.00 ? 1234 SER A OG   4  
ATOM 6669  H H    . SER A 1 102 ? 6.858   4.357   -15.320 1.00 0.00 ? 1234 SER A H    4  
ATOM 6670  H HA   . SER A 1 102 ? 8.967   3.725   -17.152 1.00 0.00 ? 1234 SER A HA   4  
ATOM 6671  H HB2  . SER A 1 102 ? 6.346   3.783   -17.498 1.00 0.00 ? 1234 SER A HB2  4  
ATOM 6672  H HB3  . SER A 1 102 ? 6.662   5.460   -17.940 1.00 0.00 ? 1234 SER A HB3  4  
ATOM 6673  H HG   . SER A 1 102 ? 7.158   3.177   -19.332 1.00 0.00 ? 1234 SER A HG   4  
ATOM 6674  N N    . SER A 1 103 ? 10.274  5.811   -17.302 1.00 0.00 ? 1235 SER A N    4  
ATOM 6675  C CA   . SER A 1 103 ? 11.072  7.025   -17.422 1.00 0.00 ? 1235 SER A CA   4  
ATOM 6676  C C    . SER A 1 103 ? 10.360  8.059   -18.290 1.00 0.00 ? 1235 SER A C    4  
ATOM 6677  O O    . SER A 1 103 ? 10.509  9.265   -18.089 1.00 0.00 ? 1235 SER A O    4  
ATOM 6678  C CB   . SER A 1 103 ? 12.445  6.703   -18.015 1.00 0.00 ? 1235 SER A CB   4  
ATOM 6679  O OG   . SER A 1 103 ? 12.320  5.975   -19.224 1.00 0.00 ? 1235 SER A OG   4  
ATOM 6680  H H    . SER A 1 103 ? 10.700  4.941   -17.457 1.00 0.00 ? 1235 SER A H    4  
ATOM 6681  H HA   . SER A 1 103 ? 11.204  7.434   -16.431 1.00 0.00 ? 1235 SER A HA   4  
ATOM 6682  H HB2  . SER A 1 103 ? 12.972  7.623   -18.215 1.00 0.00 ? 1235 SER A HB2  4  
ATOM 6683  H HB3  . SER A 1 103 ? 13.008  6.111   -17.309 1.00 0.00 ? 1235 SER A HB3  4  
ATOM 6684  H HG   . SER A 1 103 ? 11.611  5.333   -19.140 1.00 0.00 ? 1235 SER A HG   4  
ATOM 6685  N N    . THR A 1 104 ? 9.586   7.578   -19.258 1.00 0.00 ? 1236 THR A N    4  
ATOM 6686  C CA   . THR A 1 104 ? 8.852   8.458   -20.158 1.00 0.00 ? 1236 THR A CA   4  
ATOM 6687  C C    . THR A 1 104 ? 8.028   9.477   -19.380 1.00 0.00 ? 1236 THR A C    4  
ATOM 6688  O O    . THR A 1 104 ? 7.120   9.116   -18.631 1.00 0.00 ? 1236 THR A O    4  
ATOM 6689  C CB   . THR A 1 104 ? 7.917   7.660   -21.086 1.00 0.00 ? 1236 THR A CB   4  
ATOM 6690  O OG1  . THR A 1 104 ? 7.022   6.858   -20.307 1.00 0.00 ? 1236 THR A OG1  4  
ATOM 6691  C CG2  . THR A 1 104 ? 8.717   6.769   -22.024 1.00 0.00 ? 1236 THR A CG2  4  
ATOM 6692  H H    . THR A 1 104 ? 9.508   6.607   -19.368 1.00 0.00 ? 1236 THR A H    4  
ATOM 6693  H HA   . THR A 1 104 ? 9.571   8.983   -20.771 1.00 0.00 ? 1236 THR A HA   4  
ATOM 6694  H HB   . THR A 1 104 ? 7.341   8.356   -21.678 1.00 0.00 ? 1236 THR A HB   4  
ATOM 6695  H HG1  . THR A 1 104 ? 6.383   7.426   -19.869 1.00 0.00 ? 1236 THR A HG1  4  
ATOM 6696  H HG21 . THR A 1 104 ? 9.195   5.984   -21.456 1.00 0.00 ? 1236 THR A HG21 4  
ATOM 6697  H HG22 . THR A 1 104 ? 9.469   7.359   -22.527 1.00 0.00 ? 1236 THR A HG22 4  
ATOM 6698  H HG23 . THR A 1 104 ? 8.055   6.331   -22.756 1.00 0.00 ? 1236 THR A HG23 4  
ATOM 6699  N N    . LYS A 1 105 ? 8.349   10.754  -19.562 1.00 0.00 ? 1237 LYS A N    4  
ATOM 6700  C CA   . LYS A 1 105 ? 7.637   11.827  -18.879 1.00 0.00 ? 1237 LYS A CA   4  
ATOM 6701  C C    . LYS A 1 105 ? 6.162   11.835  -19.266 1.00 0.00 ? 1237 LYS A C    4  
ATOM 6702  O O    . LYS A 1 105 ? 5.273   11.714  -18.423 1.00 0.00 ? 1237 LYS A O    4  
ATOM 6703  C CB   . LYS A 1 105 ? 8.270   13.180  -19.212 1.00 0.00 ? 1237 LYS A CB   4  
ATOM 6704  C CG   . LYS A 1 105 ? 7.278   14.330  -19.224 1.00 0.00 ? 1237 LYS A CG   4  
ATOM 6705  C CD   . LYS A 1 105 ? 7.982   15.675  -19.155 1.00 0.00 ? 1237 LYS A CD   4  
ATOM 6706  C CE   . LYS A 1 105 ? 8.325   16.196  -20.542 1.00 0.00 ? 1237 LYS A CE   4  
ATOM 6707  N NZ   . LYS A 1 105 ? 9.365   15.362  -21.206 1.00 0.00 ? 1237 LYS A NZ   4  
ATOM 6708  H H    . LYS A 1 105 ? 9.083   10.980  -20.172 1.00 0.00 ? 1237 LYS A H    4  
ATOM 6709  H HA   . LYS A 1 105 ? 7.717   11.654  -17.816 1.00 0.00 ? 1237 LYS A HA   4  
ATOM 6710  H HB2  . LYS A 1 105 ? 9.033   13.398  -18.479 1.00 0.00 ? 1237 LYS A HB2  4  
ATOM 6711  H HB3  . LYS A 1 105 ? 8.729   13.118  -20.188 1.00 0.00 ? 1237 LYS A HB3  4  
ATOM 6712  H HG2  . LYS A 1 105 ? 6.699   14.285  -20.135 1.00 0.00 ? 1237 LYS A HG2  4  
ATOM 6713  H HG3  . LYS A 1 105 ? 6.620   14.234  -18.372 1.00 0.00 ? 1237 LYS A HG3  4  
ATOM 6714  H HD2  . LYS A 1 105 ? 7.333   16.386  -18.666 1.00 0.00 ? 1237 LYS A HD2  4  
ATOM 6715  H HD3  . LYS A 1 105 ? 8.894   15.565  -18.585 1.00 0.00 ? 1237 LYS A HD3  4  
ATOM 6716  H HE2  . LYS A 1 105 ? 7.431   16.189  -21.147 1.00 0.00 ? 1237 LYS A HE2  4  
ATOM 6717  H HE3  . LYS A 1 105 ? 8.691   17.208  -20.452 1.00 0.00 ? 1237 LYS A HE3  4  
ATOM 6718  H HZ1  . LYS A 1 105 ? 9.898   14.823  -20.495 1.00 0.00 ? 1237 LYS A HZ1  4  
ATOM 6719  H HZ2  . LYS A 1 105 ? 10.027  15.968  -21.732 1.00 0.00 ? 1237 LYS A HZ2  4  
ATOM 6720  H HZ3  . LYS A 1 105 ? 8.920   14.696  -21.869 1.00 0.00 ? 1237 LYS A HZ3  4  
ATOM 6721  N N    . PRO A 1 106 ? 5.894   11.979  -20.573 1.00 0.00 ? 1238 PRO A N    4  
ATOM 6722  C CA   . PRO A 1 106 ? 4.527   12.004  -21.102 1.00 0.00 ? 1238 PRO A CA   4  
ATOM 6723  C C    . PRO A 1 106 ? 3.845   10.643  -21.011 1.00 0.00 ? 1238 PRO A C    4  
ATOM 6724  O O    . PRO A 1 106 ? 4.439   9.619   -21.349 1.00 0.00 ? 1238 PRO A O    4  
ATOM 6725  C CB   . PRO A 1 106 ? 4.720   12.409  -22.565 1.00 0.00 ? 1238 PRO A CB   4  
ATOM 6726  C CG   . PRO A 1 106 ? 6.105   11.974  -22.899 1.00 0.00 ? 1238 PRO A CG   4  
ATOM 6727  C CD   . PRO A 1 106 ? 6.904   12.128  -21.634 1.00 0.00 ? 1238 PRO A CD   4  
ATOM 6728  H HA   . PRO A 1 106 ? 3.920   12.743  -20.599 1.00 0.00 ? 1238 PRO A HA   4  
ATOM 6729  H HB2  . PRO A 1 106 ? 3.988   11.905  -23.181 1.00 0.00 ? 1238 PRO A HB2  4  
ATOM 6730  H HB3  . PRO A 1 106 ? 4.607   13.478  -22.664 1.00 0.00 ? 1238 PRO A HB3  4  
ATOM 6731  H HG2  . PRO A 1 106 ? 6.100   10.942  -23.216 1.00 0.00 ? 1238 PRO A HG2  4  
ATOM 6732  H HG3  . PRO A 1 106 ? 6.510   12.605  -23.676 1.00 0.00 ? 1238 PRO A HG3  4  
ATOM 6733  H HD2  . PRO A 1 106 ? 7.653   11.354  -21.564 1.00 0.00 ? 1238 PRO A HD2  4  
ATOM 6734  H HD3  . PRO A 1 106 ? 7.362   13.105  -21.594 1.00 0.00 ? 1238 PRO A HD3  4  
ATOM 6735  N N    . GLN A 1 107 ? 2.597   10.640  -20.555 1.00 0.00 ? 1239 GLN A N    4  
ATOM 6736  C CA   . GLN A 1 107 ? 1.836   9.404   -20.420 1.00 0.00 ? 1239 GLN A CA   4  
ATOM 6737  C C    . GLN A 1 107 ? 1.246   8.979   -21.761 1.00 0.00 ? 1239 GLN A C    4  
ATOM 6738  O O    . GLN A 1 107 ? 0.108   9.319   -22.085 1.00 0.00 ? 1239 GLN A O    4  
ATOM 6739  C CB   . GLN A 1 107 ? 0.719   9.577   -19.390 1.00 0.00 ? 1239 GLN A CB   4  
ATOM 6740  C CG   . GLN A 1 107 ? 0.054   10.943  -19.438 1.00 0.00 ? 1239 GLN A CG   4  
ATOM 6741  C CD   . GLN A 1 107 ? -1.248  10.985  -18.663 1.00 0.00 ? 1239 GLN A CD   4  
ATOM 6742  O OE1  . GLN A 1 107 ? -1.259  10.869  -17.437 1.00 0.00 ? 1239 GLN A OE1  4  
ATOM 6743  N NE2  . GLN A 1 107 ? -2.356  11.153  -19.375 1.00 0.00 ? 1239 GLN A NE2  4  
ATOM 6744  H H    . GLN A 1 107 ? 2.179   11.489  -20.302 1.00 0.00 ? 1239 GLN A H    4  
ATOM 6745  H HA   . GLN A 1 107 ? 2.512   8.634   -20.079 1.00 0.00 ? 1239 GLN A HA   4  
ATOM 6746  H HB2  . GLN A 1 107 ? -0.037  8.826   -19.566 1.00 0.00 ? 1239 GLN A HB2  4  
ATOM 6747  H HB3  . GLN A 1 107 ? 1.132   9.436   -18.402 1.00 0.00 ? 1239 GLN A HB3  4  
ATOM 6748  H HG2  . GLN A 1 107 ? 0.729   11.673  -19.017 1.00 0.00 ? 1239 GLN A HG2  4  
ATOM 6749  H HG3  . GLN A 1 107 ? -0.149  11.194  -20.468 1.00 0.00 ? 1239 GLN A HG3  4  
ATOM 6750  H HE21 . GLN A 1 107 ? -2.272  11.237  -20.349 1.00 0.00 ? 1239 GLN A HE21 4  
ATOM 6751  H HE22 . GLN A 1 107 ? -3.212  11.183  -18.900 1.00 0.00 ? 1239 GLN A HE22 4  
ATOM 6752  N N    . SER A 1 108 ? 2.028   8.235   -22.537 1.00 0.00 ? 1240 SER A N    4  
ATOM 6753  C CA   . SER A 1 108 ? 1.584   7.768   -23.845 1.00 0.00 ? 1240 SER A CA   4  
ATOM 6754  C C    . SER A 1 108 ? 0.994   6.364   -23.749 1.00 0.00 ? 1240 SER A C    4  
ATOM 6755  O O    . SER A 1 108 ? 1.424   5.553   -22.931 1.00 0.00 ? 1240 SER A O    4  
ATOM 6756  C CB   . SER A 1 108 ? 2.750   7.777   -24.836 1.00 0.00 ? 1240 SER A CB   4  
ATOM 6757  O OG   . SER A 1 108 ? 2.356   7.251   -26.092 1.00 0.00 ? 1240 SER A OG   4  
ATOM 6758  H H    . SER A 1 108 ? 2.925   7.997   -22.223 1.00 0.00 ? 1240 SER A H    4  
ATOM 6759  H HA   . SER A 1 108 ? 0.819   8.444   -24.197 1.00 0.00 ? 1240 SER A HA   4  
ATOM 6760  H HB2  . SER A 1 108 ? 3.092   8.791   -24.976 1.00 0.00 ? 1240 SER A HB2  4  
ATOM 6761  H HB3  . SER A 1 108 ? 3.556   7.175   -24.444 1.00 0.00 ? 1240 SER A HB3  4  
ATOM 6762  H HG   . SER A 1 108 ? 2.944   7.579   -26.775 1.00 0.00 ? 1240 SER A HG   4  
ATOM 6763  N N    . GLY A 1 109 ? 0.005   6.086   -24.593 1.00 0.00 ? 1241 GLY A N    4  
ATOM 6764  C CA   . GLY A 1 109 ? -0.629  4.780   -24.588 1.00 0.00 ? 1241 GLY A CA   4  
ATOM 6765  C C    . GLY A 1 109 ? -1.360  4.496   -23.291 1.00 0.00 ? 1241 GLY A C    4  
ATOM 6766  O O    . GLY A 1 109 ? -0.823  3.875   -22.373 1.00 0.00 ? 1241 GLY A O    4  
ATOM 6767  H H    . GLY A 1 109 ? -0.297  6.772   -25.224 1.00 0.00 ? 1241 GLY A H    4  
ATOM 6768  H HA2  . GLY A 1 109 ? -1.334  4.731   -25.404 1.00 0.00 ? 1241 GLY A HA2  4  
ATOM 6769  H HA3  . GLY A 1 109 ? 0.129   4.024   -24.733 1.00 0.00 ? 1241 GLY A HA3  4  
ATOM 6770  N N    . PRO A 1 110 ? -2.617  4.958   -23.202 1.00 0.00 ? 1242 PRO A N    4  
ATOM 6771  C CA   . PRO A 1 110 ? -3.449  4.763   -22.011 1.00 0.00 ? 1242 PRO A CA   4  
ATOM 6772  C C    . PRO A 1 110 ? -3.867  3.308   -21.828 1.00 0.00 ? 1242 PRO A C    4  
ATOM 6773  O O    . PRO A 1 110 ? -4.752  2.814   -22.527 1.00 0.00 ? 1242 PRO A O    4  
ATOM 6774  C CB   . PRO A 1 110 ? -4.673  5.641   -22.286 1.00 0.00 ? 1242 PRO A CB   4  
ATOM 6775  C CG   . PRO A 1 110 ? -4.744  5.737   -23.771 1.00 0.00 ? 1242 PRO A CG   4  
ATOM 6776  C CD   . PRO A 1 110 ? -3.321  5.706   -24.257 1.00 0.00 ? 1242 PRO A CD   4  
ATOM 6777  H HA   . PRO A 1 110 ? -2.950  5.108   -21.117 1.00 0.00 ? 1242 PRO A HA   4  
ATOM 6778  H HB2  . PRO A 1 110 ? -5.556  5.170   -21.877 1.00 0.00 ? 1242 PRO A HB2  4  
ATOM 6779  H HB3  . PRO A 1 110 ? -4.533  6.611   -21.834 1.00 0.00 ? 1242 PRO A HB3  4  
ATOM 6780  H HG2  . PRO A 1 110 ? -5.293  4.897   -24.168 1.00 0.00 ? 1242 PRO A HG2  4  
ATOM 6781  H HG3  . PRO A 1 110 ? -5.216  6.665   -24.056 1.00 0.00 ? 1242 PRO A HG3  4  
ATOM 6782  H HD2  . PRO A 1 110 ? -3.256  5.191   -25.203 1.00 0.00 ? 1242 PRO A HD2  4  
ATOM 6783  H HD3  . PRO A 1 110 ? -2.930  6.709   -24.343 1.00 0.00 ? 1242 PRO A HD3  4  
ATOM 6784  N N    . SER A 1 111 ? -3.226  2.627   -20.884 1.00 0.00 ? 1243 SER A N    4  
ATOM 6785  C CA   . SER A 1 111 ? -3.530  1.227   -20.611 1.00 0.00 ? 1243 SER A CA   4  
ATOM 6786  C C    . SER A 1 111 ? -3.699  0.989   -19.114 1.00 0.00 ? 1243 SER A C    4  
ATOM 6787  O O    . SER A 1 111 ? -2.735  0.693   -18.408 1.00 0.00 ? 1243 SER A O    4  
ATOM 6788  C CB   . SER A 1 111 ? -2.421  0.327   -21.160 1.00 0.00 ? 1243 SER A CB   4  
ATOM 6789  O OG   . SER A 1 111 ? -2.170  0.603   -22.527 1.00 0.00 ? 1243 SER A OG   4  
ATOM 6790  H H    . SER A 1 111 ? -2.531  3.077   -20.359 1.00 0.00 ? 1243 SER A H    4  
ATOM 6791  H HA   . SER A 1 111 ? -4.457  0.986   -21.109 1.00 0.00 ? 1243 SER A HA   4  
ATOM 6792  H HB2  . SER A 1 111 ? -1.515  0.494   -20.599 1.00 0.00 ? 1243 SER A HB2  4  
ATOM 6793  H HB3  . SER A 1 111 ? -2.720  -0.707  -21.063 1.00 0.00 ? 1243 SER A HB3  4  
ATOM 6794  H HG   . SER A 1 111 ? -2.141  -0.220  -23.020 1.00 0.00 ? 1243 SER A HG   4  
ATOM 6795  N N    . SER A 1 112 ? -4.933  1.121   -18.636 1.00 0.00 ? 1244 SER A N    4  
ATOM 6796  C CA   . SER A 1 112 ? -5.229  0.925   -17.222 1.00 0.00 ? 1244 SER A CA   4  
ATOM 6797  C C    . SER A 1 112 ? -6.727  0.729   -17.003 1.00 0.00 ? 1244 SER A C    4  
ATOM 6798  O O    . SER A 1 112 ? -7.547  1.467   -17.546 1.00 0.00 ? 1244 SER A O    4  
ATOM 6799  C CB   . SER A 1 112 ? -4.735  2.120   -16.404 1.00 0.00 ? 1244 SER A CB   4  
ATOM 6800  O OG   . SER A 1 112 ? -3.398  1.928   -15.977 1.00 0.00 ? 1244 SER A OG   4  
ATOM 6801  H H    . SER A 1 112 ? -5.660  1.359   -19.249 1.00 0.00 ? 1244 SER A H    4  
ATOM 6802  H HA   . SER A 1 112 ? -4.710  0.036   -16.894 1.00 0.00 ? 1244 SER A HA   4  
ATOM 6803  H HB2  . SER A 1 112 ? -4.782  3.012   -17.011 1.00 0.00 ? 1244 SER A HB2  4  
ATOM 6804  H HB3  . SER A 1 112 ? -5.365  2.243   -15.535 1.00 0.00 ? 1244 SER A HB3  4  
ATOM 6805  H HG   . SER A 1 112 ? -3.270  2.349   -15.124 1.00 0.00 ? 1244 SER A HG   4  
ATOM 6806  N N    . GLY A 1 113 ? -7.075  -0.274  -16.202 1.00 0.00 ? 1245 GLY A N    4  
ATOM 6807  C CA   . GLY A 1 113 ? -8.472  -0.550  -15.925 1.00 0.00 ? 1245 GLY A CA   4  
ATOM 6808  C C    . GLY A 1 113 ? -9.307  -0.640  -17.187 1.00 0.00 ? 1245 GLY A C    4  
ATOM 6809  O O    . GLY A 1 113 ? -10.537 -0.623  -17.128 1.00 0.00 ? 1245 GLY A O    4  
ATOM 6810  H H    . GLY A 1 113 ? -6.378  -0.830  -15.796 1.00 0.00 ? 1245 GLY A H    4  
ATOM 6811  H HA2  . GLY A 1 113 ? -8.544  -1.486  -15.391 1.00 0.00 ? 1245 GLY A HA2  4  
ATOM 6812  H HA3  . GLY A 1 113 ? -8.867  0.239   -15.302 1.00 0.00 ? 1245 GLY A HA3  4  
ATOM 6813  N N    . GLY A 1 1   ? 36.181  4.062   17.341  1.00 0.00 ? 1133 GLY A N    5  
ATOM 6814  C CA   . GLY A 1 1   ? 36.562  5.235   16.577  1.00 0.00 ? 1133 GLY A CA   5  
ATOM 6815  C C    . GLY A 1 1   ? 35.639  5.487   15.402  1.00 0.00 ? 1133 GLY A C    5  
ATOM 6816  O O    . GLY A 1 1   ? 34.532  4.951   15.346  1.00 0.00 ? 1133 GLY A O    5  
ATOM 6817  H H1   . GLY A 1 1   ? 35.342  3.598   17.137  1.00 0.00 ? 1133 GLY A H1   5  
ATOM 6818  H HA2  . GLY A 1 1   ? 36.543  6.097   17.228  1.00 0.00 ? 1133 GLY A HA2  5  
ATOM 6819  H HA3  . GLY A 1 1   ? 37.568  5.099   16.207  1.00 0.00 ? 1133 GLY A HA3  5  
ATOM 6820  N N    . SER A 1 2   ? 36.093  6.308   14.460  1.00 0.00 ? 1134 SER A N    5  
ATOM 6821  C CA   . SER A 1 2   ? 35.297  6.634   13.282  1.00 0.00 ? 1134 SER A CA   5  
ATOM 6822  C C    . SER A 1 2   ? 36.001  6.179   12.007  1.00 0.00 ? 1134 SER A C    5  
ATOM 6823  O O    . SER A 1 2   ? 35.379  5.605   11.113  1.00 0.00 ? 1134 SER A O    5  
ATOM 6824  C CB   . SER A 1 2   ? 35.032  8.140   13.221  1.00 0.00 ? 1134 SER A CB   5  
ATOM 6825  O OG   . SER A 1 2   ? 36.236  8.863   13.034  1.00 0.00 ? 1134 SER A OG   5  
ATOM 6826  H H    . SER A 1 2   ? 36.984  6.705   14.560  1.00 0.00 ? 1134 SER A H    5  
ATOM 6827  H HA   . SER A 1 2   ? 34.355  6.114   13.364  1.00 0.00 ? 1134 SER A HA   5  
ATOM 6828  H HB2  . SER A 1 2   ? 34.367  8.353   12.398  1.00 0.00 ? 1134 SER A HB2  5  
ATOM 6829  H HB3  . SER A 1 2   ? 34.574  8.459   14.146  1.00 0.00 ? 1134 SER A HB3  5  
ATOM 6830  H HG   . SER A 1 2   ? 36.882  8.585   13.688  1.00 0.00 ? 1134 SER A HG   5  
ATOM 6831  N N    . SER A 1 3   ? 37.303  6.438   11.932  1.00 0.00 ? 1135 SER A N    5  
ATOM 6832  C CA   . SER A 1 3   ? 38.092  6.059   10.766  1.00 0.00 ? 1135 SER A CA   5  
ATOM 6833  C C    . SER A 1 3   ? 37.293  6.257   9.482   1.00 0.00 ? 1135 SER A C    5  
ATOM 6834  O O    . SER A 1 3   ? 37.326  5.419   8.581   1.00 0.00 ? 1135 SER A O    5  
ATOM 6835  C CB   . SER A 1 3   ? 38.541  4.601   10.881  1.00 0.00 ? 1135 SER A CB   5  
ATOM 6836  O OG   . SER A 1 3   ? 39.336  4.402   12.037  1.00 0.00 ? 1135 SER A OG   5  
ATOM 6837  H H    . SER A 1 3   ? 37.742  6.898   12.678  1.00 0.00 ? 1135 SER A H    5  
ATOM 6838  H HA   . SER A 1 3   ? 38.964  6.694   10.735  1.00 0.00 ? 1135 SER A HA   5  
ATOM 6839  H HB2  . SER A 1 3   ? 37.673  3.963   10.942  1.00 0.00 ? 1135 SER A HB2  5  
ATOM 6840  H HB3  . SER A 1 3   ? 39.122  4.337   10.009  1.00 0.00 ? 1135 SER A HB3  5  
ATOM 6841  H HG   . SER A 1 3   ? 39.207  3.509   12.365  1.00 0.00 ? 1135 SER A HG   5  
ATOM 6842  N N    . GLY A 1 4   ? 36.575  7.373   9.405   1.00 0.00 ? 1136 GLY A N    5  
ATOM 6843  C CA   . GLY A 1 4   ? 35.777  7.663   8.228   1.00 0.00 ? 1136 GLY A CA   5  
ATOM 6844  C C    . GLY A 1 4   ? 36.523  7.383   6.938   1.00 0.00 ? 1136 GLY A C    5  
ATOM 6845  O O    . GLY A 1 4   ? 37.754  7.384   6.913   1.00 0.00 ? 1136 GLY A O    5  
ATOM 6846  H H    . GLY A 1 4   ? 36.587  8.005   10.154  1.00 0.00 ? 1136 GLY A H    5  
ATOM 6847  H HA2  . GLY A 1 4   ? 34.884  7.056   8.253   1.00 0.00 ? 1136 GLY A HA2  5  
ATOM 6848  H HA3  . GLY A 1 4   ? 35.493  8.705   8.247   1.00 0.00 ? 1136 GLY A HA3  5  
ATOM 6849  N N    . SER A 1 5   ? 35.778  7.143   5.865   1.00 0.00 ? 1137 SER A N    5  
ATOM 6850  C CA   . SER A 1 5   ? 36.377  6.855   4.567   1.00 0.00 ? 1137 SER A CA   5  
ATOM 6851  C C    . SER A 1 5   ? 35.754  7.722   3.477   1.00 0.00 ? 1137 SER A C    5  
ATOM 6852  O O    . SER A 1 5   ? 34.637  8.217   3.625   1.00 0.00 ? 1137 SER A O    5  
ATOM 6853  C CB   . SER A 1 5   ? 36.203  5.375   4.218   1.00 0.00 ? 1137 SER A CB   5  
ATOM 6854  O OG   . SER A 1 5   ? 37.266  4.599   4.744   1.00 0.00 ? 1137 SER A OG   5  
ATOM 6855  H H    . SER A 1 5   ? 34.801  7.156   5.949   1.00 0.00 ? 1137 SER A H    5  
ATOM 6856  H HA   . SER A 1 5   ? 37.431  7.080   4.631   1.00 0.00 ? 1137 SER A HA   5  
ATOM 6857  H HB2  . SER A 1 5   ? 35.273  5.017   4.632   1.00 0.00 ? 1137 SER A HB2  5  
ATOM 6858  H HB3  . SER A 1 5   ? 36.187  5.261   3.144   1.00 0.00 ? 1137 SER A HB3  5  
ATOM 6859  H HG   . SER A 1 5   ? 37.371  4.791   5.679   1.00 0.00 ? 1137 SER A HG   5  
ATOM 6860  N N    . SER A 1 6   ? 36.487  7.902   2.383   1.00 0.00 ? 1138 SER A N    5  
ATOM 6861  C CA   . SER A 1 6   ? 36.009  8.713   1.268   1.00 0.00 ? 1138 SER A CA   5  
ATOM 6862  C C    . SER A 1 6   ? 35.612  7.833   0.087   1.00 0.00 ? 1138 SER A C    5  
ATOM 6863  O O    . SER A 1 6   ? 36.050  6.689   -0.024  1.00 0.00 ? 1138 SER A O    5  
ATOM 6864  C CB   . SER A 1 6   ? 37.087  9.709   0.837   1.00 0.00 ? 1138 SER A CB   5  
ATOM 6865  O OG   . SER A 1 6   ? 36.637  10.512  -0.241  1.00 0.00 ? 1138 SER A OG   5  
ATOM 6866  H H    . SER A 1 6   ? 37.370  7.482   2.324   1.00 0.00 ? 1138 SER A H    5  
ATOM 6867  H HA   . SER A 1 6   ? 35.140  9.259   1.604   1.00 0.00 ? 1138 SER A HA   5  
ATOM 6868  H HB2  . SER A 1 6   ? 37.334  10.351  1.668   1.00 0.00 ? 1138 SER A HB2  5  
ATOM 6869  H HB3  . SER A 1 6   ? 37.969  9.169   0.524   1.00 0.00 ? 1138 SER A HB3  5  
ATOM 6870  H HG   . SER A 1 6   ? 37.354  10.638  -0.868  1.00 0.00 ? 1138 SER A HG   5  
ATOM 6871  N N    . GLY A 1 7   ? 34.778  8.376   -0.794  1.00 0.00 ? 1139 GLY A N    5  
ATOM 6872  C CA   . GLY A 1 7   ? 34.334  7.628   -1.955  1.00 0.00 ? 1139 GLY A CA   5  
ATOM 6873  C C    . GLY A 1 7   ? 32.846  7.774   -2.206  1.00 0.00 ? 1139 GLY A C    5  
ATOM 6874  O O    . GLY A 1 7   ? 32.344  8.886   -2.368  1.00 0.00 ? 1139 GLY A O    5  
ATOM 6875  H H    . GLY A 1 7   ? 34.461  9.293   -0.654  1.00 0.00 ? 1139 GLY A H    5  
ATOM 6876  H HA2  . GLY A 1 7   ? 34.871  7.980   -2.823  1.00 0.00 ? 1139 GLY A HA2  5  
ATOM 6877  H HA3  . GLY A 1 7   ? 34.560  6.583   -1.803  1.00 0.00 ? 1139 GLY A HA3  5  
ATOM 6878  N N    . SER A 1 8   ? 32.140  6.649   -2.239  1.00 0.00 ? 1140 SER A N    5  
ATOM 6879  C CA   . SER A 1 8   ? 30.701  6.656   -2.478  1.00 0.00 ? 1140 SER A CA   5  
ATOM 6880  C C    . SER A 1 8   ? 29.942  6.209   -1.232  1.00 0.00 ? 1140 SER A C    5  
ATOM 6881  O O    . SER A 1 8   ? 30.438  5.403   -0.445  1.00 0.00 ? 1140 SER A O    5  
ATOM 6882  C CB   . SER A 1 8   ? 30.353  5.744   -3.656  1.00 0.00 ? 1140 SER A CB   5  
ATOM 6883  O OG   . SER A 1 8   ? 30.677  6.360   -4.890  1.00 0.00 ? 1140 SER A OG   5  
ATOM 6884  H H    . SER A 1 8   ? 32.598  5.793   -2.103  1.00 0.00 ? 1140 SER A H    5  
ATOM 6885  H HA   . SER A 1 8   ? 30.410  7.668   -2.719  1.00 0.00 ? 1140 SER A HA   5  
ATOM 6886  H HB2  . SER A 1 8   ? 30.909  4.823   -3.570  1.00 0.00 ? 1140 SER A HB2  5  
ATOM 6887  H HB3  . SER A 1 8   ? 29.295  5.529   -3.640  1.00 0.00 ? 1140 SER A HB3  5  
ATOM 6888  H HG   . SER A 1 8   ? 30.189  5.933   -5.598  1.00 0.00 ? 1140 SER A HG   5  
ATOM 6889  N N    . SER A 1 9   ? 28.735  6.740   -1.060  1.00 0.00 ? 1141 SER A N    5  
ATOM 6890  C CA   . SER A 1 9   ? 27.907  6.399   0.091   1.00 0.00 ? 1141 SER A CA   5  
ATOM 6891  C C    . SER A 1 9   ? 26.482  6.912   -0.094  1.00 0.00 ? 1141 SER A C    5  
ATOM 6892  O O    . SER A 1 9   ? 26.249  8.119   -0.152  1.00 0.00 ? 1141 SER A O    5  
ATOM 6893  C CB   . SER A 1 9   ? 28.510  6.985   1.370   1.00 0.00 ? 1141 SER A CB   5  
ATOM 6894  O OG   . SER A 1 9   ? 28.291  8.383   1.443   1.00 0.00 ? 1141 SER A OG   5  
ATOM 6895  H H    . SER A 1 9   ? 28.395  7.377   -1.723  1.00 0.00 ? 1141 SER A H    5  
ATOM 6896  H HA   . SER A 1 9   ? 27.882  5.323   0.175   1.00 0.00 ? 1141 SER A HA   5  
ATOM 6897  H HB2  . SER A 1 9   ? 28.053  6.515   2.227   1.00 0.00 ? 1141 SER A HB2  5  
ATOM 6898  H HB3  . SER A 1 9   ? 29.574  6.798   1.381   1.00 0.00 ? 1141 SER A HB3  5  
ATOM 6899  H HG   . SER A 1 9   ? 27.415  8.551   1.798   1.00 0.00 ? 1141 SER A HG   5  
ATOM 6900  N N    . GLN A 1 10  ? 25.534  5.985   -0.186  1.00 0.00 ? 1142 GLN A N    5  
ATOM 6901  C CA   . GLN A 1 10  ? 24.132  6.342   -0.365  1.00 0.00 ? 1142 GLN A CA   5  
ATOM 6902  C C    . GLN A 1 10  ? 23.812  7.659   0.335   1.00 0.00 ? 1142 GLN A C    5  
ATOM 6903  O O    . GLN A 1 10  ? 23.537  7.701   1.535   1.00 0.00 ? 1142 GLN A O    5  
ATOM 6904  C CB   . GLN A 1 10  ? 23.228  5.232   0.172   1.00 0.00 ? 1142 GLN A CB   5  
ATOM 6905  C CG   . GLN A 1 10  ? 23.047  4.073   -0.795  1.00 0.00 ? 1142 GLN A CG   5  
ATOM 6906  C CD   . GLN A 1 10  ? 21.923  4.310   -1.785  1.00 0.00 ? 1142 GLN A CD   5  
ATOM 6907  O OE1  . GLN A 1 10  ? 22.162  4.508   -2.977  1.00 0.00 ? 1142 GLN A OE1  5  
ATOM 6908  N NE2  . GLN A 1 10  ? 20.689  4.291   -1.296  1.00 0.00 ? 1142 GLN A NE2  5  
ATOM 6909  H H    . GLN A 1 10  ? 25.783  5.039   -0.133  1.00 0.00 ? 1142 GLN A H    5  
ATOM 6910  H HA   . GLN A 1 10  ? 23.953  6.459   -1.423  1.00 0.00 ? 1142 GLN A HA   5  
ATOM 6911  H HB2  . GLN A 1 10  ? 23.655  4.847   1.086   1.00 0.00 ? 1142 GLN A HB2  5  
ATOM 6912  H HB3  . GLN A 1 10  ? 22.255  5.648   0.387   1.00 0.00 ? 1142 GLN A HB3  5  
ATOM 6913  H HG2  . GLN A 1 10  ? 23.965  3.932   -1.344  1.00 0.00 ? 1142 GLN A HG2  5  
ATOM 6914  H HG3  . GLN A 1 10  ? 22.826  3.180   -0.229  1.00 0.00 ? 1142 GLN A HG3  5  
ATOM 6915  H HE21 . GLN A 1 10  ? 20.574  4.129   -0.335  1.00 0.00 ? 1142 GLN A HE21 5  
ATOM 6916  H HE22 . GLN A 1 10  ? 19.944  4.442   -1.913  1.00 0.00 ? 1142 GLN A HE22 5  
ATOM 6917  N N    . PRO A 1 11  ? 23.848  8.760   -0.429  1.00 0.00 ? 1143 PRO A N    5  
ATOM 6918  C CA   . PRO A 1 11  ? 23.564  10.099  0.098   1.00 0.00 ? 1143 PRO A CA   5  
ATOM 6919  C C    . PRO A 1 11  ? 22.094  10.279  0.460   1.00 0.00 ? 1143 PRO A C    5  
ATOM 6920  O O    . PRO A 1 11  ? 21.240  9.500   0.038   1.00 0.00 ? 1143 PRO A O    5  
ATOM 6921  C CB   . PRO A 1 11  ? 23.947  11.024  -1.060  1.00 0.00 ? 1143 PRO A CB   5  
ATOM 6922  C CG   . PRO A 1 11  ? 23.802  10.183  -2.281  1.00 0.00 ? 1143 PRO A CG   5  
ATOM 6923  C CD   . PRO A 1 11  ? 24.168  8.784   -1.866  1.00 0.00 ? 1143 PRO A CD   5  
ATOM 6924  H HA   . PRO A 1 11  ? 24.176  10.324  0.959   1.00 0.00 ? 1143 PRO A HA   5  
ATOM 6925  H HB2  . PRO A 1 11  ? 23.277  11.873  -1.083  1.00 0.00 ? 1143 PRO A HB2  5  
ATOM 6926  H HB3  . PRO A 1 11  ? 24.964  11.364  -0.933  1.00 0.00 ? 1143 PRO A HB3  5  
ATOM 6927  H HG2  . PRO A 1 11  ? 22.782  10.215  -2.631  1.00 0.00 ? 1143 PRO A HG2  5  
ATOM 6928  H HG3  . PRO A 1 11  ? 24.475  10.533  -3.050  1.00 0.00 ? 1143 PRO A HG3  5  
ATOM 6929  H HD2  . PRO A 1 11  ? 23.572  8.063   -2.406  1.00 0.00 ? 1143 PRO A HD2  5  
ATOM 6930  H HD3  . PRO A 1 11  ? 25.220  8.605   -2.029  1.00 0.00 ? 1143 PRO A HD3  5  
ATOM 6931  N N    . VAL A 1 12  ? 21.805  11.313  1.244   1.00 0.00 ? 1144 VAL A N    5  
ATOM 6932  C CA   . VAL A 1 12  ? 20.437  11.597  1.662   1.00 0.00 ? 1144 VAL A CA   5  
ATOM 6933  C C    . VAL A 1 12  ? 19.640  12.240  0.533   1.00 0.00 ? 1144 VAL A C    5  
ATOM 6934  O O    . VAL A 1 12  ? 20.199  12.927  -0.322  1.00 0.00 ? 1144 VAL A O    5  
ATOM 6935  C CB   . VAL A 1 12  ? 20.407  12.526  2.891   1.00 0.00 ? 1144 VAL A CB   5  
ATOM 6936  C CG1  . VAL A 1 12  ? 18.973  12.847  3.282   1.00 0.00 ? 1144 VAL A CG1  5  
ATOM 6937  C CG2  . VAL A 1 12  ? 21.158  11.895  4.054   1.00 0.00 ? 1144 VAL A CG2  5  
ATOM 6938  H H    . VAL A 1 12  ? 22.529  11.899  1.548   1.00 0.00 ? 1144 VAL A H    5  
ATOM 6939  H HA   . VAL A 1 12  ? 19.970  10.661  1.933   1.00 0.00 ? 1144 VAL A HA   5  
ATOM 6940  H HB   . VAL A 1 12  ? 20.902  13.450  2.630   1.00 0.00 ? 1144 VAL A HB   5  
ATOM 6941  H HG11 . VAL A 1 12  ? 18.367  11.958  3.187   1.00 0.00 ? 1144 VAL A HG11 5  
ATOM 6942  H HG12 . VAL A 1 12  ? 18.948  13.195  4.305   1.00 0.00 ? 1144 VAL A HG12 5  
ATOM 6943  H HG13 . VAL A 1 12  ? 18.586  13.617  2.630   1.00 0.00 ? 1144 VAL A HG13 5  
ATOM 6944  H HG21 . VAL A 1 12  ? 20.673  10.972  4.335   1.00 0.00 ? 1144 VAL A HG21 5  
ATOM 6945  H HG22 . VAL A 1 12  ? 22.176  11.691  3.757   1.00 0.00 ? 1144 VAL A HG22 5  
ATOM 6946  H HG23 . VAL A 1 12  ? 21.156  12.573  4.894   1.00 0.00 ? 1144 VAL A HG23 5  
ATOM 6947  N N    . ILE A 1 13  ? 18.331  12.011  0.536   1.00 0.00 ? 1145 ILE A N    5  
ATOM 6948  C CA   . ILE A 1 13  ? 17.456  12.570  -0.487  1.00 0.00 ? 1145 ILE A CA   5  
ATOM 6949  C C    . ILE A 1 13  ? 16.923  13.936  -0.069  1.00 0.00 ? 1145 ILE A C    5  
ATOM 6950  O O    . ILE A 1 13  ? 16.647  14.173  1.107   1.00 0.00 ? 1145 ILE A O    5  
ATOM 6951  C CB   . ILE A 1 13  ? 16.267  11.636  -0.782  1.00 0.00 ? 1145 ILE A CB   5  
ATOM 6952  C CG1  . ILE A 1 13  ? 16.768  10.237  -1.148  1.00 0.00 ? 1145 ILE A CG1  5  
ATOM 6953  C CG2  . ILE A 1 13  ? 15.410  12.207  -1.902  1.00 0.00 ? 1145 ILE A CG2  5  
ATOM 6954  C CD1  . ILE A 1 13  ? 15.662  9.212   -1.268  1.00 0.00 ? 1145 ILE A CD1  5  
ATOM 6955  H H    . ILE A 1 13  ? 17.944  11.455  1.244   1.00 0.00 ? 1145 ILE A H    5  
ATOM 6956  H HA   . ILE A 1 13  ? 18.033  12.682  -1.393  1.00 0.00 ? 1145 ILE A HA   5  
ATOM 6957  H HB   . ILE A 1 13  ? 15.659  11.572  0.107   1.00 0.00 ? 1145 ILE A HB   5  
ATOM 6958  H HG12 . ILE A 1 13  ? 17.282  10.282  -2.094  1.00 0.00 ? 1145 ILE A HG12 5  
ATOM 6959  H HG13 . ILE A 1 13  ? 17.454  9.898   -0.385  1.00 0.00 ? 1145 ILE A HG13 5  
ATOM 6960  H HG21 . ILE A 1 13  ? 14.485  11.653  -1.965  1.00 0.00 ? 1145 ILE A HG21 5  
ATOM 6961  H HG22 . ILE A 1 13  ? 15.194  13.245  -1.696  1.00 0.00 ? 1145 ILE A HG22 5  
ATOM 6962  H HG23 . ILE A 1 13  ? 15.942  12.129  -2.838  1.00 0.00 ? 1145 ILE A HG23 5  
ATOM 6963  H HD11 . ILE A 1 13  ? 15.198  9.067   -0.303  1.00 0.00 ? 1145 ILE A HD11 5  
ATOM 6964  H HD12 . ILE A 1 13  ? 14.924  9.559   -1.975  1.00 0.00 ? 1145 ILE A HD12 5  
ATOM 6965  H HD13 . ILE A 1 13  ? 16.076  8.275   -1.611  1.00 0.00 ? 1145 ILE A HD13 5  
ATOM 6966  N N    . SER A 1 14  ? 16.780  14.832  -1.041  1.00 0.00 ? 1146 SER A N    5  
ATOM 6967  C CA   . SER A 1 14  ? 16.281  16.176  -0.774  1.00 0.00 ? 1146 SER A CA   5  
ATOM 6968  C C    . SER A 1 14  ? 14.975  16.125  0.013   1.00 0.00 ? 1146 SER A C    5  
ATOM 6969  O O    . SER A 1 14  ? 14.046  15.404  -0.351  1.00 0.00 ? 1146 SER A O    5  
ATOM 6970  C CB   . SER A 1 14  ? 16.070  16.934  -2.086  1.00 0.00 ? 1146 SER A CB   5  
ATOM 6971  O OG   . SER A 1 14  ? 17.293  17.460  -2.573  1.00 0.00 ? 1146 SER A OG   5  
ATOM 6972  H H    . SER A 1 14  ? 17.017  14.583  -1.959  1.00 0.00 ? 1146 SER A H    5  
ATOM 6973  H HA   . SER A 1 14  ? 17.023  16.693  -0.184  1.00 0.00 ? 1146 SER A HA   5  
ATOM 6974  H HB2  . SER A 1 14  ? 15.661  16.263  -2.825  1.00 0.00 ? 1146 SER A HB2  5  
ATOM 6975  H HB3  . SER A 1 14  ? 15.382  17.750  -1.920  1.00 0.00 ? 1146 SER A HB3  5  
ATOM 6976  H HG   . SER A 1 14  ? 17.198  18.403  -2.725  1.00 0.00 ? 1146 SER A HG   5  
ATOM 6977  N N    . ALA A 1 15  ? 14.912  16.896  1.094   1.00 0.00 ? 1147 ALA A N    5  
ATOM 6978  C CA   . ALA A 1 15  ? 13.720  16.941  1.931   1.00 0.00 ? 1147 ALA A CA   5  
ATOM 6979  C C    . ALA A 1 15  ? 12.453  16.968  1.083   1.00 0.00 ? 1147 ALA A C    5  
ATOM 6980  O O    . ALA A 1 15  ? 11.515  16.210  1.328   1.00 0.00 ? 1147 ALA A O    5  
ATOM 6981  C CB   . ALA A 1 15  ? 13.767  18.151  2.852   1.00 0.00 ? 1147 ALA A CB   5  
ATOM 6982  H H    . ALA A 1 15  ? 15.685  17.448  1.332   1.00 0.00 ? 1147 ALA A H    5  
ATOM 6983  H HA   . ALA A 1 15  ? 13.711  16.052  2.546   1.00 0.00 ? 1147 ALA A HA   5  
ATOM 6984  H HB1  . ALA A 1 15  ? 13.256  17.921  3.775   1.00 0.00 ? 1147 ALA A HB1  5  
ATOM 6985  H HB2  . ALA A 1 15  ? 14.796  18.404  3.062   1.00 0.00 ? 1147 ALA A HB2  5  
ATOM 6986  H HB3  . ALA A 1 15  ? 13.282  18.988  2.371   1.00 0.00 ? 1147 ALA A HB3  5  
ATOM 6987  N N    . GLN A 1 16  ? 12.434  17.846  0.085   1.00 0.00 ? 1148 GLN A N    5  
ATOM 6988  C CA   . GLN A 1 16  ? 11.281  17.971  -0.799  1.00 0.00 ? 1148 GLN A CA   5  
ATOM 6989  C C    . GLN A 1 16  ? 10.618  16.616  -1.025  1.00 0.00 ? 1148 GLN A C    5  
ATOM 6990  O O    . GLN A 1 16  ? 9.409   16.470  -0.851  1.00 0.00 ? 1148 GLN A O    5  
ATOM 6991  C CB   . GLN A 1 16  ? 11.702  18.577  -2.138  1.00 0.00 ? 1148 GLN A CB   5  
ATOM 6992  C CG   . GLN A 1 16  ? 12.211  20.005  -2.027  1.00 0.00 ? 1148 GLN A CG   5  
ATOM 6993  C CD   . GLN A 1 16  ? 13.078  20.409  -3.203  1.00 0.00 ? 1148 GLN A CD   5  
ATOM 6994  O OE1  . GLN A 1 16  ? 13.605  19.558  -3.922  1.00 0.00 ? 1148 GLN A OE1  5  
ATOM 6995  N NE2  . GLN A 1 16  ? 13.233  21.712  -3.406  1.00 0.00 ? 1148 GLN A NE2  5  
ATOM 6996  H H    . GLN A 1 16  ? 13.212  18.422  -0.060  1.00 0.00 ? 1148 GLN A H    5  
ATOM 6997  H HA   . GLN A 1 16  ? 10.570  18.630  -0.324  1.00 0.00 ? 1148 GLN A HA   5  
ATOM 6998  H HB2  . GLN A 1 16  ? 12.487  17.970  -2.564  1.00 0.00 ? 1148 GLN A HB2  5  
ATOM 6999  H HB3  . GLN A 1 16  ? 10.852  18.572  -2.805  1.00 0.00 ? 1148 GLN A HB3  5  
ATOM 7000  H HG2  . GLN A 1 16  ? 11.363  20.673  -1.980  1.00 0.00 ? 1148 GLN A HG2  5  
ATOM 7001  H HG3  . GLN A 1 16  ? 12.791  20.097  -1.122  1.00 0.00 ? 1148 GLN A HG3  5  
ATOM 7002  H HE21 . GLN A 1 16  ? 12.784  22.331  -2.792  1.00 0.00 ? 1148 GLN A HE21 5  
ATOM 7003  H HE22 . GLN A 1 16  ? 13.789  22.001  -4.158  1.00 0.00 ? 1148 GLN A HE22 5  
ATOM 7004  N N    . GLU A 1 17  ? 11.419  15.629  -1.415  1.00 0.00 ? 1149 GLU A N    5  
ATOM 7005  C CA   . GLU A 1 17  ? 10.909  14.287  -1.667  1.00 0.00 ? 1149 GLU A CA   5  
ATOM 7006  C C    . GLU A 1 17  ? 11.096  13.395  -0.442  1.00 0.00 ? 1149 GLU A C    5  
ATOM 7007  O O    . GLU A 1 17  ? 10.155  12.748  0.015   1.00 0.00 ? 1149 GLU A O    5  
ATOM 7008  C CB   . GLU A 1 17  ? 11.614  13.667  -2.875  1.00 0.00 ? 1149 GLU A CB   5  
ATOM 7009  C CG   . GLU A 1 17  ? 11.100  12.284  -3.237  1.00 0.00 ? 1149 GLU A CG   5  
ATOM 7010  C CD   . GLU A 1 17  ? 11.303  11.951  -4.702  1.00 0.00 ? 1149 GLU A CD   5  
ATOM 7011  O OE1  . GLU A 1 17  ? 10.859  12.743  -5.559  1.00 0.00 ? 1149 GLU A OE1  5  
ATOM 7012  O OE2  . GLU A 1 17  ? 11.908  10.897  -4.991  1.00 0.00 ? 1149 GLU A OE2  5  
ATOM 7013  H H    . GLU A 1 17  ? 12.375  15.809  -1.537  1.00 0.00 ? 1149 GLU A H    5  
ATOM 7014  H HA   . GLU A 1 17  ? 9.854   14.368  -1.880  1.00 0.00 ? 1149 GLU A HA   5  
ATOM 7015  H HB2  . GLU A 1 17  ? 11.476  14.315  -3.728  1.00 0.00 ? 1149 GLU A HB2  5  
ATOM 7016  H HB3  . GLU A 1 17  ? 12.670  13.591  -2.660  1.00 0.00 ? 1149 GLU A HB3  5  
ATOM 7017  H HG2  . GLU A 1 17  ? 11.624  11.552  -2.641  1.00 0.00 ? 1149 GLU A HG2  5  
ATOM 7018  H HG3  . GLU A 1 17  ? 10.044  12.237  -3.015  1.00 0.00 ? 1149 GLU A HG3  5  
ATOM 7019  N N    . GLN A 1 18  ? 12.317  13.368  0.081   1.00 0.00 ? 1150 GLN A N    5  
ATOM 7020  C CA   . GLN A 1 18  ? 12.628  12.555  1.251   1.00 0.00 ? 1150 GLN A CA   5  
ATOM 7021  C C    . GLN A 1 18  ? 11.476  12.576  2.250   1.00 0.00 ? 1150 GLN A C    5  
ATOM 7022  O O    . GLN A 1 18  ? 10.860  11.547  2.523   1.00 0.00 ? 1150 GLN A O    5  
ATOM 7023  C CB   . GLN A 1 18  ? 13.909  13.056  1.921   1.00 0.00 ? 1150 GLN A CB   5  
ATOM 7024  C CG   . GLN A 1 18  ? 14.331  12.228  3.123   1.00 0.00 ? 1150 GLN A CG   5  
ATOM 7025  C CD   . GLN A 1 18  ? 15.495  12.842  3.876   1.00 0.00 ? 1150 GLN A CD   5  
ATOM 7026  O OE1  . GLN A 1 18  ? 15.696  14.057  3.847   1.00 0.00 ? 1150 GLN A OE1  5  
ATOM 7027  N NE2  . GLN A 1 18  ? 16.270  12.005  4.555   1.00 0.00 ? 1150 GLN A NE2  5  
ATOM 7028  H H    . GLN A 1 18  ? 13.025  13.906  -0.329  1.00 0.00 ? 1150 GLN A H    5  
ATOM 7029  H HA   . GLN A 1 18  ? 12.781  11.540  0.918   1.00 0.00 ? 1150 GLN A HA   5  
ATOM 7030  H HB2  . GLN A 1 18  ? 14.711  13.037  1.197   1.00 0.00 ? 1150 GLN A HB2  5  
ATOM 7031  H HB3  . GLN A 1 18  ? 13.755  14.074  2.248   1.00 0.00 ? 1150 GLN A HB3  5  
ATOM 7032  H HG2  . GLN A 1 18  ? 13.492  12.142  3.798   1.00 0.00 ? 1150 GLN A HG2  5  
ATOM 7033  H HG3  . GLN A 1 18  ? 14.620  11.245  2.783   1.00 0.00 ? 1150 GLN A HG3  5  
ATOM 7034  H HE21 . GLN A 1 18  ? 16.050  11.049  4.531   1.00 0.00 ? 1150 GLN A HE21 5  
ATOM 7035  H HE22 . GLN A 1 18  ? 17.029  12.374  5.049   1.00 0.00 ? 1150 GLN A HE22 5  
ATOM 7036  N N    . GLU A 1 19  ? 11.192  13.756  2.793   1.00 0.00 ? 1151 GLU A N    5  
ATOM 7037  C CA   . GLU A 1 19  ? 10.114  13.910  3.763   1.00 0.00 ? 1151 GLU A CA   5  
ATOM 7038  C C    . GLU A 1 19  ? 8.881   13.119  3.337   1.00 0.00 ? 1151 GLU A C    5  
ATOM 7039  O O    . GLU A 1 19  ? 8.454   12.192  4.026   1.00 0.00 ? 1151 GLU A O    5  
ATOM 7040  C CB   . GLU A 1 19  ? 9.754   15.388  3.929   1.00 0.00 ? 1151 GLU A CB   5  
ATOM 7041  C CG   . GLU A 1 19  ? 9.271   15.744  5.325   1.00 0.00 ? 1151 GLU A CG   5  
ATOM 7042  C CD   . GLU A 1 19  ? 10.401  15.805  6.335   1.00 0.00 ? 1151 GLU A CD   5  
ATOM 7043  O OE1  . GLU A 1 19  ? 11.484  16.317  5.982   1.00 0.00 ? 1151 GLU A OE1  5  
ATOM 7044  O OE2  . GLU A 1 19  ? 10.202  15.341  7.477   1.00 0.00 ? 1151 GLU A OE2  5  
ATOM 7045  H H    . GLU A 1 19  ? 11.719  14.541  2.535   1.00 0.00 ? 1151 GLU A H    5  
ATOM 7046  H HA   . GLU A 1 19  ? 10.463  13.526  4.710   1.00 0.00 ? 1151 GLU A HA   5  
ATOM 7047  H HB2  . GLU A 1 19  ? 10.626  15.986  3.708   1.00 0.00 ? 1151 GLU A HB2  5  
ATOM 7048  H HB3  . GLU A 1 19  ? 8.972   15.635  3.227   1.00 0.00 ? 1151 GLU A HB3  5  
ATOM 7049  H HG2  . GLU A 1 19  ? 8.788   16.709  5.290   1.00 0.00 ? 1151 GLU A HG2  5  
ATOM 7050  H HG3  . GLU A 1 19  ? 8.560   14.998  5.647   1.00 0.00 ? 1151 GLU A HG3  5  
ATOM 7051  N N    . THR A 1 20  ? 8.312   13.492  2.195   1.00 0.00 ? 1152 THR A N    5  
ATOM 7052  C CA   . THR A 1 20  ? 7.127   12.821  1.676   1.00 0.00 ? 1152 THR A CA   5  
ATOM 7053  C C    . THR A 1 20  ? 7.216   11.313  1.881   1.00 0.00 ? 1152 THR A C    5  
ATOM 7054  O O    . THR A 1 20  ? 6.287   10.692  2.397   1.00 0.00 ? 1152 THR A O    5  
ATOM 7055  C CB   . THR A 1 20  ? 6.927   13.113  0.177   1.00 0.00 ? 1152 THR A CB   5  
ATOM 7056  O OG1  . THR A 1 20  ? 6.741   14.518  -0.028  1.00 0.00 ? 1152 THR A OG1  5  
ATOM 7057  C CG2  . THR A 1 20  ? 5.727   12.352  -0.367  1.00 0.00 ? 1152 THR A CG2  5  
ATOM 7058  H H    . THR A 1 20  ? 8.698   14.238  1.691   1.00 0.00 ? 1152 THR A H    5  
ATOM 7059  H HA   . THR A 1 20  ? 6.268   13.197  2.212   1.00 0.00 ? 1152 THR A HA   5  
ATOM 7060  H HB   . THR A 1 20  ? 7.810   12.792  -0.358  1.00 0.00 ? 1152 THR A HB   5  
ATOM 7061  H HG1  . THR A 1 20  ? 6.223   14.881  0.695   1.00 0.00 ? 1152 THR A HG1  5  
ATOM 7062  H HG21 . THR A 1 20  ? 5.790   11.317  -0.067  1.00 0.00 ? 1152 THR A HG21 5  
ATOM 7063  H HG22 . THR A 1 20  ? 5.720   12.415  -1.445  1.00 0.00 ? 1152 THR A HG22 5  
ATOM 7064  H HG23 . THR A 1 20  ? 4.819   12.785  0.025   1.00 0.00 ? 1152 THR A HG23 5  
ATOM 7065  N N    . GLN A 1 21  ? 8.339   10.730  1.474   1.00 0.00 ? 1153 GLN A N    5  
ATOM 7066  C CA   . GLN A 1 21  ? 8.547   9.294   1.614   1.00 0.00 ? 1153 GLN A CA   5  
ATOM 7067  C C    . GLN A 1 21  ? 8.460   8.871   3.076   1.00 0.00 ? 1153 GLN A C    5  
ATOM 7068  O O    . GLN A 1 21  ? 7.907   7.818   3.396   1.00 0.00 ? 1153 GLN A O    5  
ATOM 7069  C CB   . GLN A 1 21  ? 9.907   8.896   1.036   1.00 0.00 ? 1153 GLN A CB   5  
ATOM 7070  C CG   . GLN A 1 21  ? 9.933   8.853   -0.483  1.00 0.00 ? 1153 GLN A CG   5  
ATOM 7071  C CD   . GLN A 1 21  ? 11.237  8.305   -1.029  1.00 0.00 ? 1153 GLN A CD   5  
ATOM 7072  O OE1  . GLN A 1 21  ? 11.936  7.548   -0.355  1.00 0.00 ? 1153 GLN A OE1  5  
ATOM 7073  N NE2  . GLN A 1 21  ? 11.572  8.686   -2.257  1.00 0.00 ? 1153 GLN A NE2  5  
ATOM 7074  H H    . GLN A 1 21  ? 9.042   11.278  1.070   1.00 0.00 ? 1153 GLN A H    5  
ATOM 7075  H HA   . GLN A 1 21  ? 7.770   8.790   1.059   1.00 0.00 ? 1153 GLN A HA   5  
ATOM 7076  H HB2  . GLN A 1 21  ? 10.648  9.608   1.368   1.00 0.00 ? 1153 GLN A HB2  5  
ATOM 7077  H HB3  . GLN A 1 21  ? 10.169  7.916   1.406   1.00 0.00 ? 1153 GLN A HB3  5  
ATOM 7078  H HG2  . GLN A 1 21  ? 9.125   8.225   -0.827  1.00 0.00 ? 1153 GLN A HG2  5  
ATOM 7079  H HG3  . GLN A 1 21  ? 9.794   9.855   -0.861  1.00 0.00 ? 1153 GLN A HG3  5  
ATOM 7080  H HE21 . GLN A 1 21  ? 10.967  9.292   -2.734  1.00 0.00 ? 1153 GLN A HE21 5  
ATOM 7081  H HE22 . GLN A 1 21  ? 12.410  8.348   -2.634  1.00 0.00 ? 1153 GLN A HE22 5  
ATOM 7082  N N    . ILE A 1 22  ? 9.009   9.697   3.960   1.00 0.00 ? 1154 ILE A N    5  
ATOM 7083  C CA   . ILE A 1 22  ? 8.992   9.409   5.388   1.00 0.00 ? 1154 ILE A CA   5  
ATOM 7084  C C    . ILE A 1 22  ? 7.563   9.307   5.912   1.00 0.00 ? 1154 ILE A C    5  
ATOM 7085  O O    . ILE A 1 22  ? 7.166   8.284   6.469   1.00 0.00 ? 1154 ILE A O    5  
ATOM 7086  C CB   . ILE A 1 22  ? 9.745   10.487  6.190   1.00 0.00 ? 1154 ILE A CB   5  
ATOM 7087  C CG1  . ILE A 1 22  ? 11.204  10.564  5.737   1.00 0.00 ? 1154 ILE A CG1  5  
ATOM 7088  C CG2  . ILE A 1 22  ? 9.662   10.194  7.680   1.00 0.00 ? 1154 ILE A CG2  5  
ATOM 7089  C CD1  . ILE A 1 22  ? 11.922  11.805  6.219   1.00 0.00 ? 1154 ILE A CD1  5  
ATOM 7090  H H    . ILE A 1 22  ? 9.435   10.521  3.644   1.00 0.00 ? 1154 ILE A H    5  
ATOM 7091  H HA   . ILE A 1 22  ? 9.488   8.461   5.543   1.00 0.00 ? 1154 ILE A HA   5  
ATOM 7092  H HB   . ILE A 1 22  ? 9.268   11.438  6.007   1.00 0.00 ? 1154 ILE A HB   5  
ATOM 7093  H HG12 . ILE A 1 22  ? 11.738  9.705   6.114   1.00 0.00 ? 1154 ILE A HG12 5  
ATOM 7094  H HG13 . ILE A 1 22  ? 11.239  10.558  4.657   1.00 0.00 ? 1154 ILE A HG13 5  
ATOM 7095  H HG21 . ILE A 1 22  ? 9.152   9.254   7.834   1.00 0.00 ? 1154 ILE A HG21 5  
ATOM 7096  H HG22 . ILE A 1 22  ? 10.659  10.133  8.091   1.00 0.00 ? 1154 ILE A HG22 5  
ATOM 7097  H HG23 . ILE A 1 22  ? 9.117   10.984  8.173   1.00 0.00 ? 1154 ILE A HG23 5  
ATOM 7098  H HD11 . ILE A 1 22  ? 11.343  12.276  7.000   1.00 0.00 ? 1154 ILE A HD11 5  
ATOM 7099  H HD12 . ILE A 1 22  ? 12.893  11.533  6.604   1.00 0.00 ? 1154 ILE A HD12 5  
ATOM 7100  H HD13 . ILE A 1 22  ? 12.042  12.494  5.396   1.00 0.00 ? 1154 ILE A HD13 5  
ATOM 7101  N N    . VAL A 1 23  ? 6.794   10.376  5.727   1.00 0.00 ? 1155 VAL A N    5  
ATOM 7102  C CA   . VAL A 1 23  ? 5.408   10.407  6.178   1.00 0.00 ? 1155 VAL A CA   5  
ATOM 7103  C C    . VAL A 1 23  ? 4.603   9.270   5.557   1.00 0.00 ? 1155 VAL A C    5  
ATOM 7104  O O    . VAL A 1 23  ? 3.813   8.612   6.235   1.00 0.00 ? 1155 VAL A O    5  
ATOM 7105  C CB   . VAL A 1 23  ? 4.734   11.748  5.830   1.00 0.00 ? 1155 VAL A CB   5  
ATOM 7106  C CG1  . VAL A 1 23  ? 3.282   11.749  6.281   1.00 0.00 ? 1155 VAL A CG1  5  
ATOM 7107  C CG2  . VAL A 1 23  ? 5.497   12.905  6.457   1.00 0.00 ? 1155 VAL A CG2  5  
ATOM 7108  H H    . VAL A 1 23  ? 7.168   11.161  5.276   1.00 0.00 ? 1155 VAL A H    5  
ATOM 7109  H HA   . VAL A 1 23  ? 5.403   10.294  7.252   1.00 0.00 ? 1155 VAL A HA   5  
ATOM 7110  H HB   . VAL A 1 23  ? 4.755   11.870  4.757   1.00 0.00 ? 1155 VAL A HB   5  
ATOM 7111  H HG11 . VAL A 1 23  ? 3.187   12.331  7.186   1.00 0.00 ? 1155 VAL A HG11 5  
ATOM 7112  H HG12 . VAL A 1 23  ? 2.664   12.181  5.507   1.00 0.00 ? 1155 VAL A HG12 5  
ATOM 7113  H HG13 . VAL A 1 23  ? 2.963   10.735  6.471   1.00 0.00 ? 1155 VAL A HG13 5  
ATOM 7114  H HG21 . VAL A 1 23  ? 6.435   13.039  5.939   1.00 0.00 ? 1155 VAL A HG21 5  
ATOM 7115  H HG22 . VAL A 1 23  ? 4.910   13.809  6.378   1.00 0.00 ? 1155 VAL A HG22 5  
ATOM 7116  H HG23 . VAL A 1 23  ? 5.687   12.689  7.498   1.00 0.00 ? 1155 VAL A HG23 5  
ATOM 7117  N N    . LEU A 1 24  ? 4.808   9.045   4.264   1.00 0.00 ? 1156 LEU A N    5  
ATOM 7118  C CA   . LEU A 1 24  ? 4.101   7.986   3.551   1.00 0.00 ? 1156 LEU A CA   5  
ATOM 7119  C C    . LEU A 1 24  ? 4.472   6.614   4.105   1.00 0.00 ? 1156 LEU A C    5  
ATOM 7120  O O    . LEU A 1 24  ? 3.621   5.893   4.625   1.00 0.00 ? 1156 LEU A O    5  
ATOM 7121  C CB   . LEU A 1 24  ? 4.423   8.049   2.057   1.00 0.00 ? 1156 LEU A CB   5  
ATOM 7122  C CG   . LEU A 1 24  ? 3.575   7.157   1.150   1.00 0.00 ? 1156 LEU A CG   5  
ATOM 7123  C CD1  . LEU A 1 24  ? 2.095   7.444   1.351   1.00 0.00 ? 1156 LEU A CD1  5  
ATOM 7124  C CD2  . LEU A 1 24  ? 3.964   7.354   -0.308  1.00 0.00 ? 1156 LEU A CD2  5  
ATOM 7125  H H    . LEU A 1 24  ? 5.450   9.602   3.777   1.00 0.00 ? 1156 LEU A H    5  
ATOM 7126  H HA   . LEU A 1 24  ? 3.042   8.143   3.690   1.00 0.00 ? 1156 LEU A HA   5  
ATOM 7127  H HB2  . LEU A 1 24  ? 4.291   9.070   1.733   1.00 0.00 ? 1156 LEU A HB2  5  
ATOM 7128  H HB3  . LEU A 1 24  ? 5.457   7.764   1.930   1.00 0.00 ? 1156 LEU A HB3  5  
ATOM 7129  H HG   . LEU A 1 24  ? 3.751   6.121   1.407   1.00 0.00 ? 1156 LEU A HG   5  
ATOM 7130  H HD11 . LEU A 1 24  ? 1.723   6.853   2.175   1.00 0.00 ? 1156 LEU A HD11 5  
ATOM 7131  H HD12 . LEU A 1 24  ? 1.553   7.189   0.452   1.00 0.00 ? 1156 LEU A HD12 5  
ATOM 7132  H HD13 . LEU A 1 24  ? 1.958   8.493   1.569   1.00 0.00 ? 1156 LEU A HD13 5  
ATOM 7133  H HD21 . LEU A 1 24  ? 3.132   7.087   -0.942  1.00 0.00 ? 1156 LEU A HD21 5  
ATOM 7134  H HD22 . LEU A 1 24  ? 4.811   6.726   -0.542  1.00 0.00 ? 1156 LEU A HD22 5  
ATOM 7135  H HD23 . LEU A 1 24  ? 4.226   8.388   -0.474  1.00 0.00 ? 1156 LEU A HD23 5  
ATOM 7136  N N    . TYR A 1 25  ? 5.748   6.262   3.993   1.00 0.00 ? 1157 TYR A N    5  
ATOM 7137  C CA   . TYR A 1 25  ? 6.232   4.977   4.483   1.00 0.00 ? 1157 TYR A CA   5  
ATOM 7138  C C    . TYR A 1 25  ? 5.506   4.573   5.763   1.00 0.00 ? 1157 TYR A C    5  
ATOM 7139  O O    . TYR A 1 25  ? 5.080   3.430   5.914   1.00 0.00 ? 1157 TYR A O    5  
ATOM 7140  C CB   . TYR A 1 25  ? 7.739   5.038   4.736   1.00 0.00 ? 1157 TYR A CB   5  
ATOM 7141  C CG   . TYR A 1 25  ? 8.306   3.768   5.327   1.00 0.00 ? 1157 TYR A CG   5  
ATOM 7142  C CD1  . TYR A 1 25  ? 8.326   2.586   4.597   1.00 0.00 ? 1157 TYR A CD1  5  
ATOM 7143  C CD2  . TYR A 1 25  ? 8.823   3.749   6.617   1.00 0.00 ? 1157 TYR A CD2  5  
ATOM 7144  C CE1  . TYR A 1 25  ? 8.843   1.423   5.134   1.00 0.00 ? 1157 TYR A CE1  5  
ATOM 7145  C CE2  . TYR A 1 25  ? 9.343   2.591   7.162   1.00 0.00 ? 1157 TYR A CE2  5  
ATOM 7146  C CZ   . TYR A 1 25  ? 9.350   1.430   6.417   1.00 0.00 ? 1157 TYR A CZ   5  
ATOM 7147  O OH   . TYR A 1 25  ? 9.867   0.274   6.955   1.00 0.00 ? 1157 TYR A OH   5  
ATOM 7148  H H    . TYR A 1 25  ? 6.380   6.880   3.570   1.00 0.00 ? 1157 TYR A H    5  
ATOM 7149  H HA   . TYR A 1 25  ? 6.034   4.236   3.722   1.00 0.00 ? 1157 TYR A HA   5  
ATOM 7150  H HB2  . TYR A 1 25  ? 8.247   5.223   3.801   1.00 0.00 ? 1157 TYR A HB2  5  
ATOM 7151  H HB3  . TYR A 1 25  ? 7.950   5.846   5.421   1.00 0.00 ? 1157 TYR A HB3  5  
ATOM 7152  H HD1  . TYR A 1 25  ? 7.929   2.584   3.592   1.00 0.00 ? 1157 TYR A HD1  5  
ATOM 7153  H HD2  . TYR A 1 25  ? 8.816   4.660   7.199   1.00 0.00 ? 1157 TYR A HD2  5  
ATOM 7154  H HE1  . TYR A 1 25  ? 8.849   0.514   4.550   1.00 0.00 ? 1157 TYR A HE1  5  
ATOM 7155  H HE2  . TYR A 1 25  ? 9.740   2.596   8.166   1.00 0.00 ? 1157 TYR A HE2  5  
ATOM 7156  H HH   . TYR A 1 25  ? 9.155   -0.350  7.114   1.00 0.00 ? 1157 TYR A HH   5  
ATOM 7157  N N    . GLY A 1 26  ? 5.370   5.524   6.683   1.00 0.00 ? 1158 GLY A N    5  
ATOM 7158  C CA   . GLY A 1 26  ? 4.696   5.250   7.938   1.00 0.00 ? 1158 GLY A CA   5  
ATOM 7159  C C    . GLY A 1 26  ? 3.253   4.827   7.741   1.00 0.00 ? 1158 GLY A C    5  
ATOM 7160  O O    . GLY A 1 26  ? 2.802   3.841   8.326   1.00 0.00 ? 1158 GLY A O    5  
ATOM 7161  H H    . GLY A 1 26  ? 5.731   6.418   6.508   1.00 0.00 ? 1158 GLY A H    5  
ATOM 7162  H HA2  . GLY A 1 26  ? 5.224   4.462   8.454   1.00 0.00 ? 1158 GLY A HA2  5  
ATOM 7163  H HA3  . GLY A 1 26  ? 4.717   6.142   8.547   1.00 0.00 ? 1158 GLY A HA3  5  
ATOM 7164  N N    . LYS A 1 27  ? 2.527   5.573   6.917   1.00 0.00 ? 1159 LYS A N    5  
ATOM 7165  C CA   . LYS A 1 27  ? 1.127   5.272   6.644   1.00 0.00 ? 1159 LYS A CA   5  
ATOM 7166  C C    . LYS A 1 27  ? 0.971   3.854   6.104   1.00 0.00 ? 1159 LYS A C    5  
ATOM 7167  O O    . LYS A 1 27  ? 0.078   3.114   6.520   1.00 0.00 ? 1159 LYS A O    5  
ATOM 7168  C CB   . LYS A 1 27  ? 0.553   6.276   5.642   1.00 0.00 ? 1159 LYS A CB   5  
ATOM 7169  C CG   . LYS A 1 27  ? 0.663   7.721   6.098   1.00 0.00 ? 1159 LYS A CG   5  
ATOM 7170  C CD   . LYS A 1 27  ? 0.283   8.686   4.989   1.00 0.00 ? 1159 LYS A CD   5  
ATOM 7171  C CE   . LYS A 1 27  ? -0.191  10.019  5.548   1.00 0.00 ? 1159 LYS A CE   5  
ATOM 7172  N NZ   . LYS A 1 27  ? -1.660  10.027  5.793   1.00 0.00 ? 1159 LYS A NZ   5  
ATOM 7173  H H    . LYS A 1 27  ? 2.943   6.347   6.481   1.00 0.00 ? 1159 LYS A H    5  
ATOM 7174  H HA   . LYS A 1 27  ? 0.583   5.352   7.573   1.00 0.00 ? 1159 LYS A HA   5  
ATOM 7175  H HB2  . LYS A 1 27  ? 1.082   6.175   4.706   1.00 0.00 ? 1159 LYS A HB2  5  
ATOM 7176  H HB3  . LYS A 1 27  ? -0.491  6.050   5.482   1.00 0.00 ? 1159 LYS A HB3  5  
ATOM 7177  H HG2  . LYS A 1 27  ? 0.001   7.875   6.938   1.00 0.00 ? 1159 LYS A HG2  5  
ATOM 7178  H HG3  . LYS A 1 27  ? 1.682   7.916   6.401   1.00 0.00 ? 1159 LYS A HG3  5  
ATOM 7179  H HD2  . LYS A 1 27  ? 1.145   8.858   4.362   1.00 0.00 ? 1159 LYS A HD2  5  
ATOM 7180  H HD3  . LYS A 1 27  ? -0.511  8.250   4.400   1.00 0.00 ? 1159 LYS A HD3  5  
ATOM 7181  H HE2  . LYS A 1 27  ? 0.322   10.207  6.479   1.00 0.00 ? 1159 LYS A HE2  5  
ATOM 7182  H HE3  . LYS A 1 27  ? 0.052   10.798  4.840   1.00 0.00 ? 1159 LYS A HE3  5  
ATOM 7183  H HZ1  . LYS A 1 27  ? -1.853  10.217  6.797   1.00 0.00 ? 1159 LYS A HZ1  5  
ATOM 7184  H HZ2  . LYS A 1 27  ? -2.069  9.105   5.541   1.00 0.00 ? 1159 LYS A HZ2  5  
ATOM 7185  H HZ3  . LYS A 1 27  ? -2.114  10.765  5.218   1.00 0.00 ? 1159 LYS A HZ3  5  
ATOM 7186  N N    . LEU A 1 28  ? 1.846   3.479   5.177   1.00 0.00 ? 1160 LEU A N    5  
ATOM 7187  C CA   . LEU A 1 28  ? 1.806   2.148   4.581   1.00 0.00 ? 1160 LEU A CA   5  
ATOM 7188  C C    . LEU A 1 28  ? 2.055   1.073   5.634   1.00 0.00 ? 1160 LEU A C    5  
ATOM 7189  O O    . LEU A 1 28  ? 1.368   0.051   5.667   1.00 0.00 ? 1160 LEU A O    5  
ATOM 7190  C CB   . LEU A 1 28  ? 2.847   2.036   3.466   1.00 0.00 ? 1160 LEU A CB   5  
ATOM 7191  C CG   . LEU A 1 28  ? 2.512   2.758   2.160   1.00 0.00 ? 1160 LEU A CG   5  
ATOM 7192  C CD1  . LEU A 1 28  ? 3.770   2.978   1.334   1.00 0.00 ? 1160 LEU A CD1  5  
ATOM 7193  C CD2  . LEU A 1 28  ? 1.481   1.970   1.365   1.00 0.00 ? 1160 LEU A CD2  5  
ATOM 7194  H H    . LEU A 1 28  ? 2.535   4.112   4.886   1.00 0.00 ? 1160 LEU A H    5  
ATOM 7195  H HA   . LEU A 1 28  ? 0.823   2.003   4.160   1.00 0.00 ? 1160 LEU A HA   5  
ATOM 7196  H HB2  . LEU A 1 28  ? 3.776   2.442   3.838   1.00 0.00 ? 1160 LEU A HB2  5  
ATOM 7197  H HB3  . LEU A 1 28  ? 2.979   0.987   3.241   1.00 0.00 ? 1160 LEU A HB3  5  
ATOM 7198  H HG   . LEU A 1 28  ? 2.090   3.727   2.389   1.00 0.00 ? 1160 LEU A HG   5  
ATOM 7199  H HD11 . LEU A 1 28  ? 4.210   2.025   1.088   1.00 0.00 ? 1160 LEU A HD11 5  
ATOM 7200  H HD12 . LEU A 1 28  ? 4.475   3.565   1.903   1.00 0.00 ? 1160 LEU A HD12 5  
ATOM 7201  H HD13 . LEU A 1 28  ? 3.515   3.504   0.425   1.00 0.00 ? 1160 LEU A HD13 5  
ATOM 7202  H HD21 . LEU A 1 28  ? 1.292   1.027   1.856   1.00 0.00 ? 1160 LEU A HD21 5  
ATOM 7203  H HD22 . LEU A 1 28  ? 1.857   1.788   0.369   1.00 0.00 ? 1160 LEU A HD22 5  
ATOM 7204  H HD23 . LEU A 1 28  ? 0.563   2.536   1.306   1.00 0.00 ? 1160 LEU A HD23 5  
ATOM 7205  N N    . VAL A 1 29  ? 3.040   1.310   6.494   1.00 0.00 ? 1161 VAL A N    5  
ATOM 7206  C CA   . VAL A 1 29  ? 3.377   0.363   7.550   1.00 0.00 ? 1161 VAL A CA   5  
ATOM 7207  C C    . VAL A 1 29  ? 2.167   0.068   8.430   1.00 0.00 ? 1161 VAL A C    5  
ATOM 7208  O O    . VAL A 1 29  ? 1.882   -1.088  8.741   1.00 0.00 ? 1161 VAL A O    5  
ATOM 7209  C CB   . VAL A 1 29  ? 4.523   0.892   8.433   1.00 0.00 ? 1161 VAL A CB   5  
ATOM 7210  C CG1  . VAL A 1 29  ? 4.819   -0.081  9.564   1.00 0.00 ? 1161 VAL A CG1  5  
ATOM 7211  C CG2  . VAL A 1 29  ? 5.768   1.144   7.596   1.00 0.00 ? 1161 VAL A CG2  5  
ATOM 7212  H H    . VAL A 1 29  ? 3.552   2.142   6.417   1.00 0.00 ? 1161 VAL A H    5  
ATOM 7213  H HA   . VAL A 1 29  ? 3.704   -0.555  7.084   1.00 0.00 ? 1161 VAL A HA   5  
ATOM 7214  H HB   . VAL A 1 29  ? 4.211   1.830   8.869   1.00 0.00 ? 1161 VAL A HB   5  
ATOM 7215  H HG11 . VAL A 1 29  ? 5.471   -0.863  9.203   1.00 0.00 ? 1161 VAL A HG11 5  
ATOM 7216  H HG12 . VAL A 1 29  ? 5.301   0.445   10.375  1.00 0.00 ? 1161 VAL A HG12 5  
ATOM 7217  H HG13 . VAL A 1 29  ? 3.896   -0.517  9.914   1.00 0.00 ? 1161 VAL A HG13 5  
ATOM 7218  H HG21 . VAL A 1 29  ? 5.529   1.017   6.550   1.00 0.00 ? 1161 VAL A HG21 5  
ATOM 7219  H HG22 . VAL A 1 29  ? 6.118   2.153   7.765   1.00 0.00 ? 1161 VAL A HG22 5  
ATOM 7220  H HG23 . VAL A 1 29  ? 6.540   0.444   7.877   1.00 0.00 ? 1161 VAL A HG23 5  
ATOM 7221  N N    . GLU A 1 30  ? 1.460   1.121   8.827   1.00 0.00 ? 1162 GLU A N    5  
ATOM 7222  C CA   . GLU A 1 30  ? 0.280   0.973   9.671   1.00 0.00 ? 1162 GLU A CA   5  
ATOM 7223  C C    . GLU A 1 30  ? -0.712  -0.007  9.053   1.00 0.00 ? 1162 GLU A C    5  
ATOM 7224  O O    . GLU A 1 30  ? -1.335  -0.803  9.756   1.00 0.00 ? 1162 GLU A O    5  
ATOM 7225  C CB   . GLU A 1 30  ? -0.394  2.330   9.886   1.00 0.00 ? 1162 GLU A CB   5  
ATOM 7226  C CG   . GLU A 1 30  ? 0.517   3.368   10.520  1.00 0.00 ? 1162 GLU A CG   5  
ATOM 7227  C CD   . GLU A 1 30  ? -0.248  4.409   11.313  1.00 0.00 ? 1162 GLU A CD   5  
ATOM 7228  O OE1  . GLU A 1 30  ? -1.149  4.021   12.086  1.00 0.00 ? 1162 GLU A OE1  5  
ATOM 7229  O OE2  . GLU A 1 30  ? 0.054   5.612   11.161  1.00 0.00 ? 1162 GLU A OE2  5  
ATOM 7230  H H    . GLU A 1 30  ? 1.737   2.017   8.546   1.00 0.00 ? 1162 GLU A H    5  
ATOM 7231  H HA   . GLU A 1 30  ? 0.602   0.586   10.626  1.00 0.00 ? 1162 GLU A HA   5  
ATOM 7232  H HB2  . GLU A 1 30  ? -0.727  2.708   8.931   1.00 0.00 ? 1162 GLU A HB2  5  
ATOM 7233  H HB3  . GLU A 1 30  ? -1.251  2.194   10.529  1.00 0.00 ? 1162 GLU A HB3  5  
ATOM 7234  H HG2  . GLU A 1 30  ? 1.206   2.867   11.183  1.00 0.00 ? 1162 GLU A HG2  5  
ATOM 7235  H HG3  . GLU A 1 30  ? 1.071   3.867   9.738   1.00 0.00 ? 1162 GLU A HG3  5  
ATOM 7236  N N    . ALA A 1 31  ? -0.854  0.057   7.733   1.00 0.00 ? 1163 ALA A N    5  
ATOM 7237  C CA   . ALA A 1 31  ? -1.769  -0.825  7.019   1.00 0.00 ? 1163 ALA A CA   5  
ATOM 7238  C C    . ALA A 1 31  ? -1.288  -2.271  7.068   1.00 0.00 ? 1163 ALA A C    5  
ATOM 7239  O O    . ALA A 1 31  ? -2.053  -3.180  7.392   1.00 0.00 ? 1163 ALA A O    5  
ATOM 7240  C CB   . ALA A 1 31  ? -1.926  -0.368  5.577   1.00 0.00 ? 1163 ALA A CB   5  
ATOM 7241  H H    . ALA A 1 31  ? -0.330  0.712   7.227   1.00 0.00 ? 1163 ALA A H    5  
ATOM 7242  H HA   . ALA A 1 31  ? -2.736  -0.762  7.498   1.00 0.00 ? 1163 ALA A HA   5  
ATOM 7243  H HB1  . ALA A 1 31  ? -2.877  -0.709  5.193   1.00 0.00 ? 1163 ALA A HB1  5  
ATOM 7244  H HB2  . ALA A 1 31  ? -1.886  0.710   5.535   1.00 0.00 ? 1163 ALA A HB2  5  
ATOM 7245  H HB3  . ALA A 1 31  ? -1.127  -0.782  4.980   1.00 0.00 ? 1163 ALA A HB3  5  
ATOM 7246  N N    . ARG A 1 32  ? -0.015  -2.478  6.745   1.00 0.00 ? 1164 ARG A N    5  
ATOM 7247  C CA   . ARG A 1 32  ? 0.567   -3.815  6.750   1.00 0.00 ? 1164 ARG A CA   5  
ATOM 7248  C C    . ARG A 1 32  ? 0.343   -4.500  8.095   1.00 0.00 ? 1164 ARG A C    5  
ATOM 7249  O O    . ARG A 1 32  ? -0.020  -5.674  8.151   1.00 0.00 ? 1164 ARG A O    5  
ATOM 7250  C CB   . ARG A 1 32  ? 2.064   -3.743  6.445   1.00 0.00 ? 1164 ARG A CB   5  
ATOM 7251  C CG   . ARG A 1 32  ? 2.771   -5.084  6.545   1.00 0.00 ? 1164 ARG A CG   5  
ATOM 7252  C CD   . ARG A 1 32  ? 4.226   -4.918  6.955   1.00 0.00 ? 1164 ARG A CD   5  
ATOM 7253  N NE   . ARG A 1 32  ? 4.392   -4.944  8.406   1.00 0.00 ? 1164 ARG A NE   5  
ATOM 7254  C CZ   . ARG A 1 32  ? 5.431   -4.408  9.037   1.00 0.00 ? 1164 ARG A CZ   5  
ATOM 7255  N NH1  . ARG A 1 32  ? 6.392   -3.809  8.347   1.00 0.00 ? 1164 ARG A NH1  5  
ATOM 7256  N NH2  . ARG A 1 32  ? 5.511   -4.472  10.360  1.00 0.00 ? 1164 ARG A NH2  5  
ATOM 7257  H H    . ARG A 1 32  ? 0.545   -1.714  6.495   1.00 0.00 ? 1164 ARG A H    5  
ATOM 7258  H HA   . ARG A 1 32  ? 0.079   -4.392  5.980   1.00 0.00 ? 1164 ARG A HA   5  
ATOM 7259  H HB2  . ARG A 1 32  ? 2.198   -3.364  5.442   1.00 0.00 ? 1164 ARG A HB2  5  
ATOM 7260  H HB3  . ARG A 1 32  ? 2.529   -3.063  7.143   1.00 0.00 ? 1164 ARG A HB3  5  
ATOM 7261  H HG2  . ARG A 1 32  ? 2.268   -5.692  7.282   1.00 0.00 ? 1164 ARG A HG2  5  
ATOM 7262  H HG3  . ARG A 1 32  ? 2.731   -5.574  5.583   1.00 0.00 ? 1164 ARG A HG3  5  
ATOM 7263  H HD2  . ARG A 1 32  ? 4.802   -5.723  6.523   1.00 0.00 ? 1164 ARG A HD2  5  
ATOM 7264  H HD3  . ARG A 1 32  ? 4.587   -3.974  6.577   1.00 0.00 ? 1164 ARG A HD3  5  
ATOM 7265  H HE   . ARG A 1 32  ? 3.693   -5.382  8.935   1.00 0.00 ? 1164 ARG A HE   5  
ATOM 7266  H HH11 . ARG A 1 32  ? 6.334   -3.759  7.350   1.00 0.00 ? 1164 ARG A HH11 5  
ATOM 7267  H HH12 . ARG A 1 32  ? 7.173   -3.406  8.825   1.00 0.00 ? 1164 ARG A HH12 5  
ATOM 7268  H HH21 . ARG A 1 32  ? 4.788   -4.923  10.883  1.00 0.00 ? 1164 ARG A HH21 5  
ATOM 7269  H HH22 . ARG A 1 32  ? 6.293   -4.069  10.833  1.00 0.00 ? 1164 ARG A HH22 5  
ATOM 7270  N N    . GLN A 1 33  ? 0.564   -3.757  9.175   1.00 0.00 ? 1165 GLN A N    5  
ATOM 7271  C CA   . GLN A 1 33  ? 0.388   -4.294  10.520  1.00 0.00 ? 1165 GLN A CA   5  
ATOM 7272  C C    . GLN A 1 33  ? -1.047  -4.765  10.734  1.00 0.00 ? 1165 GLN A C    5  
ATOM 7273  O O    . GLN A 1 33  ? -1.296  -5.949  10.963  1.00 0.00 ? 1165 GLN A O    5  
ATOM 7274  C CB   . GLN A 1 33  ? 0.752   -3.238  11.565  1.00 0.00 ? 1165 GLN A CB   5  
ATOM 7275  C CG   . GLN A 1 33  ? 0.481   -3.679  12.994  1.00 0.00 ? 1165 GLN A CG   5  
ATOM 7276  C CD   . GLN A 1 33  ? 0.863   -2.623  14.013  1.00 0.00 ? 1165 GLN A CD   5  
ATOM 7277  O OE1  . GLN A 1 33  ? 1.458   -1.601  13.671  1.00 0.00 ? 1165 GLN A OE1  5  
ATOM 7278  N NE2  . GLN A 1 33  ? 0.522   -2.865  15.273  1.00 0.00 ? 1165 GLN A NE2  5  
ATOM 7279  H H    . GLN A 1 33  ? 0.852   -2.828  9.066   1.00 0.00 ? 1165 GLN A H    5  
ATOM 7280  H HA   . GLN A 1 33  ? 1.050   -5.139  10.628  1.00 0.00 ? 1165 GLN A HA   5  
ATOM 7281  H HB2  . GLN A 1 33  ? 1.803   -3.008  11.475  1.00 0.00 ? 1165 GLN A HB2  5  
ATOM 7282  H HB3  . GLN A 1 33  ? 0.177   -2.345  11.372  1.00 0.00 ? 1165 GLN A HB3  5  
ATOM 7283  H HG2  . GLN A 1 33  ? -0.573  -3.892  13.098  1.00 0.00 ? 1165 GLN A HG2  5  
ATOM 7284  H HG3  . GLN A 1 33  ? 1.049   -4.575  13.195  1.00 0.00 ? 1165 GLN A HG3  5  
ATOM 7285  H HE21 . GLN A 1 33  ? 0.050   -3.701  15.472  1.00 0.00 ? 1165 GLN A HE21 5  
ATOM 7286  H HE22 . GLN A 1 33  ? 0.757   -2.200  15.952  1.00 0.00 ? 1165 GLN A HE22 5  
ATOM 7287  N N    . LYS A 1 34  ? -1.989  -3.831  10.658  1.00 0.00 ? 1166 LYS A N    5  
ATOM 7288  C CA   . LYS A 1 34  ? -3.400  -4.149  10.843  1.00 0.00 ? 1166 LYS A CA   5  
ATOM 7289  C C    . LYS A 1 34  ? -3.829  -5.278  9.911   1.00 0.00 ? 1166 LYS A C    5  
ATOM 7290  O O    . LYS A 1 34  ? -4.564  -6.181  10.312  1.00 0.00 ? 1166 LYS A O    5  
ATOM 7291  C CB   . LYS A 1 34  ? -4.261  -2.909  10.590  1.00 0.00 ? 1166 LYS A CB   5  
ATOM 7292  C CG   . LYS A 1 34  ? -4.279  -2.467  9.137   1.00 0.00 ? 1166 LYS A CG   5  
ATOM 7293  C CD   . LYS A 1 34  ? -5.283  -1.351  8.906   1.00 0.00 ? 1166 LYS A CD   5  
ATOM 7294  C CE   . LYS A 1 34  ? -4.712  0.003   9.301   1.00 0.00 ? 1166 LYS A CE   5  
ATOM 7295  N NZ   . LYS A 1 34  ? -4.948  0.305   10.740  1.00 0.00 ? 1166 LYS A NZ   5  
ATOM 7296  H H    . LYS A 1 34  ? -1.728  -2.904  10.473  1.00 0.00 ? 1166 LYS A H    5  
ATOM 7297  H HA   . LYS A 1 34  ? -3.537  -4.470  11.864  1.00 0.00 ? 1166 LYS A HA   5  
ATOM 7298  H HB2  . LYS A 1 34  ? -5.275  -3.123  10.892  1.00 0.00 ? 1166 LYS A HB2  5  
ATOM 7299  H HB3  . LYS A 1 34  ? -3.880  -2.093  11.187  1.00 0.00 ? 1166 LYS A HB3  5  
ATOM 7300  H HG2  . LYS A 1 34  ? -3.295  -2.114  8.865   1.00 0.00 ? 1166 LYS A HG2  5  
ATOM 7301  H HG3  . LYS A 1 34  ? -4.544  -3.312  8.516   1.00 0.00 ? 1166 LYS A HG3  5  
ATOM 7302  H HD2  . LYS A 1 34  ? -5.546  -1.325  7.859   1.00 0.00 ? 1166 LYS A HD2  5  
ATOM 7303  H HD3  . LYS A 1 34  ? -6.167  -1.545  9.496   1.00 0.00 ? 1166 LYS A HD3  5  
ATOM 7304  H HE2  . LYS A 1 34  ? -3.649  -0.001  9.112   1.00 0.00 ? 1166 LYS A HE2  5  
ATOM 7305  H HE3  . LYS A 1 34  ? -5.182  0.766   8.699   1.00 0.00 ? 1166 LYS A HE3  5  
ATOM 7306  H HZ1  . LYS A 1 34  ? -4.795  1.318   10.921  1.00 0.00 ? 1166 LYS A HZ1  5  
ATOM 7307  H HZ2  . LYS A 1 34  ? -4.293  -0.244  11.332  1.00 0.00 ? 1166 LYS A HZ2  5  
ATOM 7308  H HZ3  . LYS A 1 34  ? -5.924  0.060   11.001  1.00 0.00 ? 1166 LYS A HZ3  5  
ATOM 7309  N N    . HIS A 1 35  ? -3.365  -5.221  8.667   1.00 0.00 ? 1167 HIS A N    5  
ATOM 7310  C CA   . HIS A 1 35  ? -3.700  -6.241  7.679   1.00 0.00 ? 1167 HIS A CA   5  
ATOM 7311  C C    . HIS A 1 35  ? -3.176  -7.607  8.109   1.00 0.00 ? 1167 HIS A C    5  
ATOM 7312  O O    . HIS A 1 35  ? -3.885  -8.610  8.023   1.00 0.00 ? 1167 HIS A O    5  
ATOM 7313  C CB   . HIS A 1 35  ? -3.122  -5.867  6.313   1.00 0.00 ? 1167 HIS A CB   5  
ATOM 7314  C CG   . HIS A 1 35  ? -3.820  -6.530  5.166   1.00 0.00 ? 1167 HIS A CG   5  
ATOM 7315  N ND1  . HIS A 1 35  ? -4.924  -7.341  5.324   1.00 0.00 ? 1167 HIS A ND1  5  
ATOM 7316  C CD2  . HIS A 1 35  ? -3.567  -6.496  3.837   1.00 0.00 ? 1167 HIS A CD2  5  
ATOM 7317  C CE1  . HIS A 1 35  ? -5.318  -7.779  4.141   1.00 0.00 ? 1167 HIS A CE1  5  
ATOM 7318  N NE2  . HIS A 1 35  ? -4.511  -7.280  3.222   1.00 0.00 ? 1167 HIS A NE2  5  
ATOM 7319  H H    . HIS A 1 35  ? -2.784  -4.477  8.407   1.00 0.00 ? 1167 HIS A H    5  
ATOM 7320  H HA   . HIS A 1 35  ? -4.776  -6.289  7.604   1.00 0.00 ? 1167 HIS A HA   5  
ATOM 7321  H HB2  . HIS A 1 35  ? -3.201  -4.799  6.177   1.00 0.00 ? 1167 HIS A HB2  5  
ATOM 7322  H HB3  . HIS A 1 35  ? -2.081  -6.154  6.280   1.00 0.00 ? 1167 HIS A HB3  5  
ATOM 7323  H HD1  . HIS A 1 35  ? -5.353  -7.564  6.175   1.00 0.00 ? 1167 HIS A HD1  5  
ATOM 7324  H HD2  . HIS A 1 35  ? -2.769  -5.953  3.349   1.00 0.00 ? 1167 HIS A HD2  5  
ATOM 7325  H HE1  . HIS A 1 35  ? -6.157  -8.433  3.957   1.00 0.00 ? 1167 HIS A HE1  5  
ATOM 7326  H HE2  . HIS A 1 35  ? -4.527  -7.514  2.271   1.00 0.00 ? 1167 HIS A HE2  5  
ATOM 7327  N N    . ALA A 1 36  ? -1.931  -7.639  8.573   1.00 0.00 ? 1168 ALA A N    5  
ATOM 7328  C CA   . ALA A 1 36  ? -1.313  -8.882  9.018   1.00 0.00 ? 1168 ALA A CA   5  
ATOM 7329  C C    . ALA A 1 36  ? -2.302  -9.736  9.803   1.00 0.00 ? 1168 ALA A C    5  
ATOM 7330  O O    . ALA A 1 36  ? -2.588  -10.873 9.430   1.00 0.00 ? 1168 ALA A O    5  
ATOM 7331  C CB   . ALA A 1 36  ? -0.081  -8.587  9.861   1.00 0.00 ? 1168 ALA A CB   5  
ATOM 7332  H H    . ALA A 1 36  ? -1.416  -6.807  8.617   1.00 0.00 ? 1168 ALA A H    5  
ATOM 7333  H HA   . ALA A 1 36  ? -0.996  -9.430  8.142   1.00 0.00 ? 1168 ALA A HA   5  
ATOM 7334  H HB1  . ALA A 1 36  ? -0.384  -8.371  10.875  1.00 0.00 ? 1168 ALA A HB1  5  
ATOM 7335  H HB2  . ALA A 1 36  ? 0.573   -9.446  9.855   1.00 0.00 ? 1168 ALA A HB2  5  
ATOM 7336  H HB3  . ALA A 1 36  ? 0.439   -7.734  9.451   1.00 0.00 ? 1168 ALA A HB3  5  
ATOM 7337  N N    . ASN A 1 37  ? -2.820  -9.181  10.894  1.00 0.00 ? 1169 ASN A N    5  
ATOM 7338  C CA   . ASN A 1 37  ? -3.777  -9.893  11.733  1.00 0.00 ? 1169 ASN A CA   5  
ATOM 7339  C C    . ASN A 1 37  ? -4.979  -10.357 10.916  1.00 0.00 ? 1169 ASN A C    5  
ATOM 7340  O O    . ASN A 1 37  ? -5.421  -11.500 11.034  1.00 0.00 ? 1169 ASN A O    5  
ATOM 7341  C CB   . ASN A 1 37  ? -4.243  -8.999  12.884  1.00 0.00 ? 1169 ASN A CB   5  
ATOM 7342  C CG   . ASN A 1 37  ? -3.305  -9.052  14.074  1.00 0.00 ? 1169 ASN A CG   5  
ATOM 7343  O OD1  . ASN A 1 37  ? -2.953  -10.130 14.553  1.00 0.00 ? 1169 ASN A OD1  5  
ATOM 7344  N ND2  . ASN A 1 37  ? -2.897  -7.885  14.558  1.00 0.00 ? 1169 ASN A ND2  5  
ATOM 7345  H H    . ASN A 1 37  ? -2.553  -8.271  11.141  1.00 0.00 ? 1169 ASN A H    5  
ATOM 7346  H HA   . ASN A 1 37  ? -3.279  -10.759 12.142  1.00 0.00 ? 1169 ASN A HA   5  
ATOM 7347  H HB2  . ASN A 1 37  ? -4.296  -7.976  12.538  1.00 0.00 ? 1169 ASN A HB2  5  
ATOM 7348  H HB3  . ASN A 1 37  ? -5.223  -9.317  13.206  1.00 0.00 ? 1169 ASN A HB3  5  
ATOM 7349  H HD21 . ASN A 1 37  ? -3.218  -7.066  14.125  1.00 0.00 ? 1169 ASN A HD21 5  
ATOM 7350  H HD22 . ASN A 1 37  ? -2.289  -7.890  15.327  1.00 0.00 ? 1169 ASN A HD22 5  
ATOM 7351  N N    . LYS A 1 38  ? -5.503  -9.462  10.085  1.00 0.00 ? 1170 LYS A N    5  
ATOM 7352  C CA   . LYS A 1 38  ? -6.652  -9.778  9.245   1.00 0.00 ? 1170 LYS A CA   5  
ATOM 7353  C C    . LYS A 1 38  ? -6.498  -11.155 8.608   1.00 0.00 ? 1170 LYS A C    5  
ATOM 7354  O O    . LYS A 1 38  ? -7.370  -12.013 8.743   1.00 0.00 ? 1170 LYS A O    5  
ATOM 7355  C CB   . LYS A 1 38  ? -6.821  -8.716  8.156   1.00 0.00 ? 1170 LYS A CB   5  
ATOM 7356  C CG   . LYS A 1 38  ? -8.149  -8.803  7.424   1.00 0.00 ? 1170 LYS A CG   5  
ATOM 7357  C CD   . LYS A 1 38  ? -8.606  -7.438  6.935   1.00 0.00 ? 1170 LYS A CD   5  
ATOM 7358  C CE   . LYS A 1 38  ? -9.258  -6.636  8.050   1.00 0.00 ? 1170 LYS A CE   5  
ATOM 7359  N NZ   . LYS A 1 38  ? -9.938  -5.417  7.532   1.00 0.00 ? 1170 LYS A NZ   5  
ATOM 7360  H H    . LYS A 1 38  ? -5.106  -8.567  10.035  1.00 0.00 ? 1170 LYS A H    5  
ATOM 7361  H HA   . LYS A 1 38  ? -7.531  -9.781  9.873   1.00 0.00 ? 1170 LYS A HA   5  
ATOM 7362  H HB2  . LYS A 1 38  ? -6.747  -7.738  8.609   1.00 0.00 ? 1170 LYS A HB2  5  
ATOM 7363  H HB3  . LYS A 1 38  ? -6.027  -8.830  7.433   1.00 0.00 ? 1170 LYS A HB3  5  
ATOM 7364  H HG2  . LYS A 1 38  ? -8.038  -9.459  6.573   1.00 0.00 ? 1170 LYS A HG2  5  
ATOM 7365  H HG3  . LYS A 1 38  ? -8.895  -9.203  8.095   1.00 0.00 ? 1170 LYS A HG3  5  
ATOM 7366  H HD2  . LYS A 1 38  ? -7.750  -6.892  6.567   1.00 0.00 ? 1170 LYS A HD2  5  
ATOM 7367  H HD3  . LYS A 1 38  ? -9.320  -7.573  6.135   1.00 0.00 ? 1170 LYS A HD3  5  
ATOM 7368  H HE2  . LYS A 1 38  ? -9.985  -7.260  8.547   1.00 0.00 ? 1170 LYS A HE2  5  
ATOM 7369  H HE3  . LYS A 1 38  ? -8.496  -6.340  8.756   1.00 0.00 ? 1170 LYS A HE3  5  
ATOM 7370  H HZ1  . LYS A 1 38  ? -9.267  -4.836  6.991   1.00 0.00 ? 1170 LYS A HZ1  5  
ATOM 7371  H HZ2  . LYS A 1 38  ? -10.309 -4.852  8.322   1.00 0.00 ? 1170 LYS A HZ2  5  
ATOM 7372  H HZ3  . LYS A 1 38  ? -10.728 -5.685  6.911   1.00 0.00 ? 1170 LYS A HZ3  5  
ATOM 7373  N N    . MET A 1 39  ? -5.383  -11.359 7.914   1.00 0.00 ? 1171 MET A N    5  
ATOM 7374  C CA   . MET A 1 39  ? -5.114  -12.634 7.258   1.00 0.00 ? 1171 MET A CA   5  
ATOM 7375  C C    . MET A 1 39  ? -4.482  -13.623 8.231   1.00 0.00 ? 1171 MET A C    5  
ATOM 7376  O O    . MET A 1 39  ? -4.211  -14.770 7.876   1.00 0.00 ? 1171 MET A O    5  
ATOM 7377  C CB   . MET A 1 39  ? -4.195  -12.427 6.052   1.00 0.00 ? 1171 MET A CB   5  
ATOM 7378  C CG   . MET A 1 39  ? -4.790  -11.528 4.981   1.00 0.00 ? 1171 MET A CG   5  
ATOM 7379  S SD   . MET A 1 39  ? -4.117  -11.860 3.342   1.00 0.00 ? 1171 MET A SD   5  
ATOM 7380  C CE   . MET A 1 39  ? -2.582  -10.939 3.413   1.00 0.00 ? 1171 MET A CE   5  
ATOM 7381  H H    . MET A 1 39  ? -4.725  -10.637 7.841   1.00 0.00 ? 1171 MET A H    5  
ATOM 7382  H HA   . MET A 1 39  ? -6.057  -13.035 6.916   1.00 0.00 ? 1171 MET A HA   5  
ATOM 7383  H HB2  . MET A 1 39  ? -3.271  -11.984 6.391   1.00 0.00 ? 1171 MET A HB2  5  
ATOM 7384  H HB3  . MET A 1 39  ? -3.983  -13.388 5.607   1.00 0.00 ? 1171 MET A HB3  5  
ATOM 7385  H HG2  . MET A 1 39  ? -5.859  -11.682 4.953   1.00 0.00 ? 1171 MET A HG2  5  
ATOM 7386  H HG3  . MET A 1 39  ? -4.584  -10.500 5.239   1.00 0.00 ? 1171 MET A HG3  5  
ATOM 7387  H HE1  . MET A 1 39  ? -1.895  -11.327 2.677   1.00 0.00 ? 1171 MET A HE1  5  
ATOM 7388  H HE2  . MET A 1 39  ? -2.779  -9.897  3.209   1.00 0.00 ? 1171 MET A HE2  5  
ATOM 7389  H HE3  . MET A 1 39  ? -2.149  -11.038 4.398   1.00 0.00 ? 1171 MET A HE3  5  
ATOM 7390  N N    . ASP A 1 40  ? -4.249  -13.172 9.458   1.00 0.00 ? 1172 ASP A N    5  
ATOM 7391  C CA   . ASP A 1 40  ? -3.648  -14.018 10.483  1.00 0.00 ? 1172 ASP A CA   5  
ATOM 7392  C C    . ASP A 1 40  ? -2.231  -14.425 10.090  1.00 0.00 ? 1172 ASP A C    5  
ATOM 7393  O O    . ASP A 1 40  ? -1.753  -15.493 10.471  1.00 0.00 ? 1172 ASP A O    5  
ATOM 7394  C CB   . ASP A 1 40  ? -4.505  -15.265 10.711  1.00 0.00 ? 1172 ASP A CB   5  
ATOM 7395  C CG   . ASP A 1 40  ? -5.989  -14.955 10.716  1.00 0.00 ? 1172 ASP A CG   5  
ATOM 7396  O OD1  . ASP A 1 40  ? -6.546  -14.707 9.626   1.00 0.00 ? 1172 ASP A OD1  5  
ATOM 7397  O OD2  . ASP A 1 40  ? -6.593  -14.958 11.809  1.00 0.00 ? 1172 ASP A OD2  5  
ATOM 7398  H H    . ASP A 1 40  ? -4.487  -12.247 9.681   1.00 0.00 ? 1172 ASP A H    5  
ATOM 7399  H HA   . ASP A 1 40  ? -3.605  -13.450 11.400  1.00 0.00 ? 1172 ASP A HA   5  
ATOM 7400  H HB2  . ASP A 1 40  ? -4.308  -15.978 9.925   1.00 0.00 ? 1172 ASP A HB2  5  
ATOM 7401  H HB3  . ASP A 1 40  ? -4.244  -15.703 11.663  1.00 0.00 ? 1172 ASP A HB3  5  
ATOM 7402  N N    . VAL A 1 41  ? -1.565  -13.565 9.326   1.00 0.00 ? 1173 VAL A N    5  
ATOM 7403  C CA   . VAL A 1 41  ? -0.203  -13.835 8.882   1.00 0.00 ? 1173 VAL A CA   5  
ATOM 7404  C C    . VAL A 1 41  ? 0.789   -12.883 9.541   1.00 0.00 ? 1173 VAL A C    5  
ATOM 7405  O O    . VAL A 1 41  ? 0.518   -11.697 9.730   1.00 0.00 ? 1173 VAL A O    5  
ATOM 7406  C CB   . VAL A 1 41  ? -0.076  -13.710 7.352   1.00 0.00 ? 1173 VAL A CB   5  
ATOM 7407  C CG1  . VAL A 1 41  ? -0.991  -14.708 6.657   1.00 0.00 ? 1173 VAL A CG1  5  
ATOM 7408  C CG2  . VAL A 1 41  ? -0.387  -12.289 6.906   1.00 0.00 ? 1173 VAL A CG2  5  
ATOM 7409  H H    . VAL A 1 41  ? -2.000  -12.730 9.055   1.00 0.00 ? 1173 VAL A H    5  
ATOM 7410  H HA   . VAL A 1 41  ? 0.046   -14.848 9.161   1.00 0.00 ? 1173 VAL A HA   5  
ATOM 7411  H HB   . VAL A 1 41  ? 0.943   -13.937 7.075   1.00 0.00 ? 1173 VAL A HB   5  
ATOM 7412  H HG11 . VAL A 1 41  ? -0.471  -15.149 5.820   1.00 0.00 ? 1173 VAL A HG11 5  
ATOM 7413  H HG12 . VAL A 1 41  ? -1.276  -15.481 7.355   1.00 0.00 ? 1173 VAL A HG12 5  
ATOM 7414  H HG13 . VAL A 1 41  ? -1.875  -14.199 6.303   1.00 0.00 ? 1173 VAL A HG13 5  
ATOM 7415  H HG21 . VAL A 1 41  ? -0.987  -12.318 6.008   1.00 0.00 ? 1173 VAL A HG21 5  
ATOM 7416  H HG22 . VAL A 1 41  ? -0.932  -11.777 7.686   1.00 0.00 ? 1173 VAL A HG22 5  
ATOM 7417  H HG23 . VAL A 1 41  ? 0.535   -11.764 6.707   1.00 0.00 ? 1173 VAL A HG23 5  
ATOM 7418  N N    . PRO A 1 42  ? 1.967   -13.413 9.902   1.00 0.00 ? 1174 PRO A N    5  
ATOM 7419  C CA   . PRO A 1 42  ? 3.024   -12.627 10.546  1.00 0.00 ? 1174 PRO A CA   5  
ATOM 7420  C C    . PRO A 1 42  ? 3.289   -11.310 9.824   1.00 0.00 ? 1174 PRO A C    5  
ATOM 7421  O O    . PRO A 1 42  ? 3.320   -11.243 8.595   1.00 0.00 ? 1174 PRO A O    5  
ATOM 7422  C CB   . PRO A 1 42  ? 4.249   -13.541 10.457  1.00 0.00 ? 1174 PRO A CB   5  
ATOM 7423  C CG   . PRO A 1 42  ? 3.689   -14.920 10.388  1.00 0.00 ? 1174 PRO A CG   5  
ATOM 7424  C CD   . PRO A 1 42  ? 2.358   -14.819 9.708   1.00 0.00 ? 1174 PRO A CD   5  
ATOM 7425  H HA   . PRO A 1 42  ? 2.796   -12.429 11.583  1.00 0.00 ? 1174 PRO A HA   5  
ATOM 7426  H HB2  . PRO A 1 42  ? 4.817   -13.300 9.569   1.00 0.00 ? 1174 PRO A HB2  5  
ATOM 7427  H HB3  . PRO A 1 42  ? 4.866   -13.409 11.333  1.00 0.00 ? 1174 PRO A HB3  5  
ATOM 7428  H HG2  . PRO A 1 42  ? 4.346   -15.555 9.815   1.00 0.00 ? 1174 PRO A HG2  5  
ATOM 7429  H HG3  . PRO A 1 42  ? 3.561   -15.313 11.386  1.00 0.00 ? 1174 PRO A HG3  5  
ATOM 7430  H HD2  . PRO A 1 42  ? 2.458   -15.050 8.658   1.00 0.00 ? 1174 PRO A HD2  5  
ATOM 7431  H HD3  . PRO A 1 42  ? 1.648   -15.484 10.177  1.00 0.00 ? 1174 PRO A HD3  5  
ATOM 7432  N N    . PRO A 1 43  ? 3.485   -10.237 10.604  1.00 0.00 ? 1175 PRO A N    5  
ATOM 7433  C CA   . PRO A 1 43  ? 3.752   -8.901  10.061  1.00 0.00 ? 1175 PRO A CA   5  
ATOM 7434  C C    . PRO A 1 43  ? 4.832   -8.919  8.985   1.00 0.00 ? 1175 PRO A C    5  
ATOM 7435  O O    . PRO A 1 43  ? 4.965   -7.971  8.211   1.00 0.00 ? 1175 PRO A O    5  
ATOM 7436  C CB   . PRO A 1 43  ? 4.226   -8.110  11.282  1.00 0.00 ? 1175 PRO A CB   5  
ATOM 7437  C CG   . PRO A 1 43  ? 3.602   -8.799  12.446  1.00 0.00 ? 1175 PRO A CG   5  
ATOM 7438  C CD   . PRO A 1 43  ? 3.462   -10.244 12.077  1.00 0.00 ? 1175 PRO A CD   5  
ATOM 7439  H HA   . PRO A 1 43  ? 2.855   -8.449  9.663   1.00 0.00 ? 1175 PRO A HA   5  
ATOM 7440  H HB2  . PRO A 1 43  ? 5.305   -8.139  11.336  1.00 0.00 ? 1175 PRO A HB2  5  
ATOM 7441  H HB3  . PRO A 1 43  ? 3.892   -7.086  11.204  1.00 0.00 ? 1175 PRO A HB3  5  
ATOM 7442  H HG2  . PRO A 1 43  ? 4.237   -8.702  13.314  1.00 0.00 ? 1175 PRO A HG2  5  
ATOM 7443  H HG3  . PRO A 1 43  ? 2.628   -8.376  12.643  1.00 0.00 ? 1175 PRO A HG3  5  
ATOM 7444  H HD2  . PRO A 1 43  ? 4.291   -10.812 12.473  1.00 0.00 ? 1175 PRO A HD2  5  
ATOM 7445  H HD3  . PRO A 1 43  ? 2.525   -10.634 12.445  1.00 0.00 ? 1175 PRO A HD3  5  
ATOM 7446  N N    . ALA A 1 44  ? 5.600   -10.002 8.941   1.00 0.00 ? 1176 ALA A N    5  
ATOM 7447  C CA   . ALA A 1 44  ? 6.667   -10.143 7.958   1.00 0.00 ? 1176 ALA A CA   5  
ATOM 7448  C C    . ALA A 1 44  ? 6.188   -10.919 6.736   1.00 0.00 ? 1176 ALA A C    5  
ATOM 7449  O O    . ALA A 1 44  ? 6.410   -10.503 5.599   1.00 0.00 ? 1176 ALA A O    5  
ATOM 7450  C CB   . ALA A 1 44  ? 7.873   -10.829 8.582   1.00 0.00 ? 1176 ALA A CB   5  
ATOM 7451  H H    . ALA A 1 44  ? 5.445   -10.724 9.585   1.00 0.00 ? 1176 ALA A H    5  
ATOM 7452  H HA   . ALA A 1 44  ? 6.968   -9.153  7.648   1.00 0.00 ? 1176 ALA A HA   5  
ATOM 7453  H HB1  . ALA A 1 44  ? 7.652   -11.876 8.732   1.00 0.00 ? 1176 ALA A HB1  5  
ATOM 7454  H HB2  . ALA A 1 44  ? 8.723   -10.731 7.925   1.00 0.00 ? 1176 ALA A HB2  5  
ATOM 7455  H HB3  . ALA A 1 44  ? 8.097   -10.369 9.533   1.00 0.00 ? 1176 ALA A HB3  5  
ATOM 7456  N N    . ILE A 1 45  ? 5.531   -12.049 6.978   1.00 0.00 ? 1177 ILE A N    5  
ATOM 7457  C CA   . ILE A 1 45  ? 5.021   -12.882 5.897   1.00 0.00 ? 1177 ILE A CA   5  
ATOM 7458  C C    . ILE A 1 45  ? 4.264   -12.048 4.870   1.00 0.00 ? 1177 ILE A C    5  
ATOM 7459  O O    . ILE A 1 45  ? 4.369   -12.280 3.665   1.00 0.00 ? 1177 ILE A O    5  
ATOM 7460  C CB   . ILE A 1 45  ? 4.092   -13.989 6.429   1.00 0.00 ? 1177 ILE A CB   5  
ATOM 7461  C CG1  . ILE A 1 45  ? 4.879   -14.973 7.297   1.00 0.00 ? 1177 ILE A CG1  5  
ATOM 7462  C CG2  . ILE A 1 45  ? 3.417   -14.714 5.275   1.00 0.00 ? 1177 ILE A CG2  5  
ATOM 7463  C CD1  . ILE A 1 45  ? 5.825   -15.850 6.508   1.00 0.00 ? 1177 ILE A CD1  5  
ATOM 7464  H H    . ILE A 1 45  ? 5.386   -12.327 7.906   1.00 0.00 ? 1177 ILE A H    5  
ATOM 7465  H HA   . ILE A 1 45  ? 5.865   -13.351 5.412   1.00 0.00 ? 1177 ILE A HA   5  
ATOM 7466  H HB   . ILE A 1 45  ? 3.324   -13.525 7.029   1.00 0.00 ? 1177 ILE A HB   5  
ATOM 7467  H HG12 . ILE A 1 45  ? 5.461   -14.421 8.018   1.00 0.00 ? 1177 ILE A HG12 5  
ATOM 7468  H HG13 . ILE A 1 45  ? 4.185   -15.616 7.818   1.00 0.00 ? 1177 ILE A HG13 5  
ATOM 7469  H HG21 . ILE A 1 45  ? 4.147   -15.313 4.750   1.00 0.00 ? 1177 ILE A HG21 5  
ATOM 7470  H HG22 . ILE A 1 45  ? 2.637   -15.355 5.660   1.00 0.00 ? 1177 ILE A HG22 5  
ATOM 7471  H HG23 . ILE A 1 45  ? 2.988   -13.992 4.597   1.00 0.00 ? 1177 ILE A HG23 5  
ATOM 7472  H HD11 . ILE A 1 45  ? 6.317   -15.259 5.749   1.00 0.00 ? 1177 ILE A HD11 5  
ATOM 7473  H HD12 . ILE A 1 45  ? 6.565   -16.271 7.173   1.00 0.00 ? 1177 ILE A HD12 5  
ATOM 7474  H HD13 . ILE A 1 45  ? 5.269   -16.648 6.038   1.00 0.00 ? 1177 ILE A HD13 5  
ATOM 7475  N N    . LEU A 1 46  ? 3.501   -11.074 5.354   1.00 0.00 ? 1178 LEU A N    5  
ATOM 7476  C CA   . LEU A 1 46  ? 2.726   -10.202 4.478   1.00 0.00 ? 1178 LEU A CA   5  
ATOM 7477  C C    . LEU A 1 46  ? 3.634   -9.470  3.496   1.00 0.00 ? 1178 LEU A C    5  
ATOM 7478  O O    . LEU A 1 46  ? 3.593   -9.720  2.292   1.00 0.00 ? 1178 LEU A O    5  
ATOM 7479  C CB   . LEU A 1 46  ? 1.931   -9.190  5.307   1.00 0.00 ? 1178 LEU A CB   5  
ATOM 7480  C CG   . LEU A 1 46  ? 0.799   -8.467  4.577   1.00 0.00 ? 1178 LEU A CG   5  
ATOM 7481  C CD1  . LEU A 1 46  ? -0.430  -9.358  4.481   1.00 0.00 ? 1178 LEU A CD1  5  
ATOM 7482  C CD2  . LEU A 1 46  ? 0.459   -7.161  5.280   1.00 0.00 ? 1178 LEU A CD2  5  
ATOM 7483  H H    . LEU A 1 46  ? 3.457   -10.937 6.323   1.00 0.00 ? 1178 LEU A H    5  
ATOM 7484  H HA   . LEU A 1 46  ? 2.037   -10.819 3.922   1.00 0.00 ? 1178 LEU A HA   5  
ATOM 7485  H HB2  . LEU A 1 46  ? 1.501   -9.715  6.146   1.00 0.00 ? 1178 LEU A HB2  5  
ATOM 7486  H HB3  . LEU A 1 46  ? 2.624   -8.443  5.668   1.00 0.00 ? 1178 LEU A HB3  5  
ATOM 7487  H HG   . LEU A 1 46  ? 1.119   -8.233  3.571   1.00 0.00 ? 1178 LEU A HG   5  
ATOM 7488  H HD11 . LEU A 1 46  ? -1.165  -8.891  3.844   1.00 0.00 ? 1178 LEU A HD11 5  
ATOM 7489  H HD12 . LEU A 1 46  ? -0.847  -9.503  5.467   1.00 0.00 ? 1178 LEU A HD12 5  
ATOM 7490  H HD13 . LEU A 1 46  ? -0.149  -10.315 4.066   1.00 0.00 ? 1178 LEU A HD13 5  
ATOM 7491  H HD21 . LEU A 1 46  ? -0.604  -6.984  5.215   1.00 0.00 ? 1178 LEU A HD21 5  
ATOM 7492  H HD22 . LEU A 1 46  ? 0.989   -6.348  4.805   1.00 0.00 ? 1178 LEU A HD22 5  
ATOM 7493  H HD23 . LEU A 1 46  ? 0.751   -7.225  6.318   1.00 0.00 ? 1178 LEU A HD23 5  
ATOM 7494  N N    . ALA A 1 47  ? 4.456   -8.566  4.019   1.00 0.00 ? 1179 ALA A N    5  
ATOM 7495  C CA   . ALA A 1 47  ? 5.378   -7.800  3.189   1.00 0.00 ? 1179 ALA A CA   5  
ATOM 7496  C C    . ALA A 1 47  ? 6.643   -7.442  3.961   1.00 0.00 ? 1179 ALA A C    5  
ATOM 7497  O O    . ALA A 1 47  ? 6.606   -7.234  5.174   1.00 0.00 ? 1179 ALA A O    5  
ATOM 7498  C CB   . ALA A 1 47  ? 4.700   -6.542  2.669   1.00 0.00 ? 1179 ALA A CB   5  
ATOM 7499  H H    . ALA A 1 47  ? 4.443   -8.410  4.987   1.00 0.00 ? 1179 ALA A H    5  
ATOM 7500  H HA   . ALA A 1 47  ? 5.648   -8.411  2.340   1.00 0.00 ? 1179 ALA A HA   5  
ATOM 7501  H HB1  . ALA A 1 47  ? 4.224   -6.025  3.490   1.00 0.00 ? 1179 ALA A HB1  5  
ATOM 7502  H HB2  . ALA A 1 47  ? 5.438   -5.896  2.217   1.00 0.00 ? 1179 ALA A HB2  5  
ATOM 7503  H HB3  . ALA A 1 47  ? 3.957   -6.811  1.934   1.00 0.00 ? 1179 ALA A HB3  5  
ATOM 7504  N N    . THR A 1 48  ? 7.765   -7.371  3.251   1.00 0.00 ? 1180 THR A N    5  
ATOM 7505  C CA   . THR A 1 48  ? 9.042   -7.039  3.869   1.00 0.00 ? 1180 THR A CA   5  
ATOM 7506  C C    . THR A 1 48  ? 9.277   -5.533  3.872   1.00 0.00 ? 1180 THR A C    5  
ATOM 7507  O O    . THR A 1 48  ? 8.544   -4.780  3.233   1.00 0.00 ? 1180 THR A O    5  
ATOM 7508  C CB   . THR A 1 48  ? 10.213  -7.729  3.144   1.00 0.00 ? 1180 THR A CB   5  
ATOM 7509  O OG1  . THR A 1 48  ? 10.292  -7.268  1.791   1.00 0.00 ? 1180 THR A OG1  5  
ATOM 7510  C CG2  . THR A 1 48  ? 10.045  -9.241  3.162   1.00 0.00 ? 1180 THR A CG2  5  
ATOM 7511  H H    . THR A 1 48  ? 7.731   -7.547  2.287   1.00 0.00 ? 1180 THR A H    5  
ATOM 7512  H HA   . THR A 1 48  ? 9.020   -7.392  4.890   1.00 0.00 ? 1180 THR A HA   5  
ATOM 7513  H HB   . THR A 1 48  ? 11.131  -7.478  3.656   1.00 0.00 ? 1180 THR A HB   5  
ATOM 7514  H HG1  . THR A 1 48  ? 11.139  -7.519  1.416   1.00 0.00 ? 1180 THR A HG1  5  
ATOM 7515  H HG21 . THR A 1 48  ? 10.328  -9.623  4.131   1.00 0.00 ? 1180 THR A HG21 5  
ATOM 7516  H HG22 . THR A 1 48  ? 10.675  -9.681  2.403   1.00 0.00 ? 1180 THR A HG22 5  
ATOM 7517  H HG23 . THR A 1 48  ? 9.014   -9.490  2.963   1.00 0.00 ? 1180 THR A HG23 5  
ATOM 7518  N N    . ASN A 1 49  ? 10.305  -5.101  4.595   1.00 0.00 ? 1181 ASN A N    5  
ATOM 7519  C CA   . ASN A 1 49  ? 10.637  -3.683  4.680   1.00 0.00 ? 1181 ASN A CA   5  
ATOM 7520  C C    . ASN A 1 49  ? 11.082  -3.146  3.323   1.00 0.00 ? 1181 ASN A C    5  
ATOM 7521  O O    . ASN A 1 49  ? 10.825  -1.990  2.985   1.00 0.00 ? 1181 ASN A O    5  
ATOM 7522  C CB   . ASN A 1 49  ? 11.739  -3.457  5.717   1.00 0.00 ? 1181 ASN A CB   5  
ATOM 7523  C CG   . ASN A 1 49  ? 11.555  -4.317  6.952   1.00 0.00 ? 1181 ASN A CG   5  
ATOM 7524  O OD1  . ASN A 1 49  ? 10.617  -4.121  7.725   1.00 0.00 ? 1181 ASN A OD1  5  
ATOM 7525  N ND2  . ASN A 1 49  ? 12.454  -5.276  7.144   1.00 0.00 ? 1181 ASN A ND2  5  
ATOM 7526  H H    . ASN A 1 49  ? 10.854  -5.750  5.082   1.00 0.00 ? 1181 ASN A H    5  
ATOM 7527  H HA   . ASN A 1 49  ? 9.749   -3.153  4.990   1.00 0.00 ? 1181 ASN A HA   5  
ATOM 7528  H HB2  . ASN A 1 49  ? 12.695  -3.696  5.274   1.00 0.00 ? 1181 ASN A HB2  5  
ATOM 7529  H HB3  . ASN A 1 49  ? 11.735  -2.420  6.018   1.00 0.00 ? 1181 ASN A HB3  5  
ATOM 7530  H HD21 . ASN A 1 49  ? 13.175  -5.373  6.488   1.00 0.00 ? 1181 ASN A HD21 5  
ATOM 7531  H HD22 . ASN A 1 49  ? 12.359  -5.847  7.935   1.00 0.00 ? 1181 ASN A HD22 5  
ATOM 7532  N N    . LYS A 1 50  ? 11.751  -3.993  2.548   1.00 0.00 ? 1182 LYS A N    5  
ATOM 7533  C CA   . LYS A 1 50  ? 12.231  -3.606  1.227   1.00 0.00 ? 1182 LYS A CA   5  
ATOM 7534  C C    . LYS A 1 50  ? 11.067  -3.252  0.307   1.00 0.00 ? 1182 LYS A C    5  
ATOM 7535  O O    . LYS A 1 50  ? 11.066  -2.198  -0.330  1.00 0.00 ? 1182 LYS A O    5  
ATOM 7536  C CB   . LYS A 1 50  ? 13.056  -4.737  0.610   1.00 0.00 ? 1182 LYS A CB   5  
ATOM 7537  C CG   . LYS A 1 50  ? 13.748  -4.349  -0.685  1.00 0.00 ? 1182 LYS A CG   5  
ATOM 7538  C CD   . LYS A 1 50  ? 14.849  -3.330  -0.445  1.00 0.00 ? 1182 LYS A CD   5  
ATOM 7539  C CE   . LYS A 1 50  ? 15.948  -3.439  -1.492  1.00 0.00 ? 1182 LYS A CE   5  
ATOM 7540  N NZ   . LYS A 1 50  ? 16.938  -4.497  -1.149  1.00 0.00 ? 1182 LYS A NZ   5  
ATOM 7541  H H    . LYS A 1 50  ? 11.926  -4.902  2.873   1.00 0.00 ? 1182 LYS A H    5  
ATOM 7542  H HA   . LYS A 1 50  ? 12.859  -2.736  1.344   1.00 0.00 ? 1182 LYS A HA   5  
ATOM 7543  H HB2  . LYS A 1 50  ? 13.811  -5.044  1.319   1.00 0.00 ? 1182 LYS A HB2  5  
ATOM 7544  H HB3  . LYS A 1 50  ? 12.403  -5.574  0.407   1.00 0.00 ? 1182 LYS A HB3  5  
ATOM 7545  H HG2  . LYS A 1 50  ? 14.181  -5.233  -1.130  1.00 0.00 ? 1182 LYS A HG2  5  
ATOM 7546  H HG3  . LYS A 1 50  ? 13.018  -3.925  -1.360  1.00 0.00 ? 1182 LYS A HG3  5  
ATOM 7547  H HD2  . LYS A 1 50  ? 14.425  -2.338  -0.487  1.00 0.00 ? 1182 LYS A HD2  5  
ATOM 7548  H HD3  . LYS A 1 50  ? 15.278  -3.499  0.533   1.00 0.00 ? 1182 LYS A HD3  5  
ATOM 7549  H HE2  . LYS A 1 50  ? 15.497  -3.674  -2.444  1.00 0.00 ? 1182 LYS A HE2  5  
ATOM 7550  H HE3  . LYS A 1 50  ? 16.457  -2.489  -1.560  1.00 0.00 ? 1182 LYS A HE3  5  
ATOM 7551  H HZ1  . LYS A 1 50  ? 17.409  -4.837  -2.011  1.00 0.00 ? 1182 LYS A HZ1  5  
ATOM 7552  H HZ2  . LYS A 1 50  ? 16.460  -5.298  -0.689  1.00 0.00 ? 1182 LYS A HZ2  5  
ATOM 7553  H HZ3  . LYS A 1 50  ? 17.656  -4.117  -0.500  1.00 0.00 ? 1182 LYS A HZ3  5  
ATOM 7554  N N    . ILE A 1 51  ? 10.078  -4.137  0.244   1.00 0.00 ? 1183 ILE A N    5  
ATOM 7555  C CA   . ILE A 1 51  ? 8.907   -3.916  -0.596  1.00 0.00 ? 1183 ILE A CA   5  
ATOM 7556  C C    . ILE A 1 51  ? 8.230   -2.592  -0.257  1.00 0.00 ? 1183 ILE A C    5  
ATOM 7557  O O    . ILE A 1 51  ? 7.888   -1.811  -1.146  1.00 0.00 ? 1183 ILE A O    5  
ATOM 7558  C CB   . ILE A 1 51  ? 7.883   -5.056  -0.446  1.00 0.00 ? 1183 ILE A CB   5  
ATOM 7559  C CG1  . ILE A 1 51  ? 8.436   -6.350  -1.048  1.00 0.00 ? 1183 ILE A CG1  5  
ATOM 7560  C CG2  . ILE A 1 51  ? 6.567   -4.677  -1.108  1.00 0.00 ? 1183 ILE A CG2  5  
ATOM 7561  C CD1  . ILE A 1 51  ? 7.607   -7.572  -0.720  1.00 0.00 ? 1183 ILE A CD1  5  
ATOM 7562  H H    . ILE A 1 51  ? 10.137  -4.958  0.776   1.00 0.00 ? 1183 ILE A H    5  
ATOM 7563  H HA   . ILE A 1 51  ? 9.236   -3.887  -1.624  1.00 0.00 ? 1183 ILE A HA   5  
ATOM 7564  H HB   . ILE A 1 51  ? 7.698   -5.208  0.607   1.00 0.00 ? 1183 ILE A HB   5  
ATOM 7565  H HG12 . ILE A 1 51  ? 8.472   -6.253  -2.122  1.00 0.00 ? 1183 ILE A HG12 5  
ATOM 7566  H HG13 . ILE A 1 51  ? 9.435   -6.515  -0.672  1.00 0.00 ? 1183 ILE A HG13 5  
ATOM 7567  H HG21 . ILE A 1 51  ? 6.123   -5.554  -1.554  1.00 0.00 ? 1183 ILE A HG21 5  
ATOM 7568  H HG22 . ILE A 1 51  ? 5.895   -4.272  -0.367  1.00 0.00 ? 1183 ILE A HG22 5  
ATOM 7569  H HG23 . ILE A 1 51  ? 6.749   -3.937  -1.873  1.00 0.00 ? 1183 ILE A HG23 5  
ATOM 7570  H HD11 . ILE A 1 51  ? 8.115   -8.457  -1.072  1.00 0.00 ? 1183 ILE A HD11 5  
ATOM 7571  H HD12 . ILE A 1 51  ? 7.468   -7.636  0.349   1.00 0.00 ? 1183 ILE A HD12 5  
ATOM 7572  H HD13 . ILE A 1 51  ? 6.644   -7.494  -1.204  1.00 0.00 ? 1183 ILE A HD13 5  
ATOM 7573  N N    . LEU A 1 52  ? 8.041   -2.344  1.034   1.00 0.00 ? 1184 LEU A N    5  
ATOM 7574  C CA   . LEU A 1 52  ? 7.406   -1.113  1.492   1.00 0.00 ? 1184 LEU A CA   5  
ATOM 7575  C C    . LEU A 1 52  ? 8.201   0.109   1.042   1.00 0.00 ? 1184 LEU A C    5  
ATOM 7576  O O    . LEU A 1 52  ? 7.656   1.024   0.424   1.00 0.00 ? 1184 LEU A O    5  
ATOM 7577  C CB   . LEU A 1 52  ? 7.277   -1.119  3.016   1.00 0.00 ? 1184 LEU A CB   5  
ATOM 7578  C CG   . LEU A 1 52  ? 6.388   -2.212  3.610   1.00 0.00 ? 1184 LEU A CG   5  
ATOM 7579  C CD1  . LEU A 1 52  ? 6.538   -2.258  5.123   1.00 0.00 ? 1184 LEU A CD1  5  
ATOM 7580  C CD2  . LEU A 1 52  ? 4.934   -1.985  3.224   1.00 0.00 ? 1184 LEU A CD2  5  
ATOM 7581  H H    . LEU A 1 52  ? 8.335   -3.004  1.696   1.00 0.00 ? 1184 LEU A H    5  
ATOM 7582  H HA   . LEU A 1 52  ? 6.420   -1.067  1.055   1.00 0.00 ? 1184 LEU A HA   5  
ATOM 7583  H HB2  . LEU A 1 52  ? 8.266   -1.235  3.431   1.00 0.00 ? 1184 LEU A HB2  5  
ATOM 7584  H HB3  . LEU A 1 52  ? 6.873   -0.162  3.317   1.00 0.00 ? 1184 LEU A HB3  5  
ATOM 7585  H HG   . LEU A 1 52  ? 6.695   -3.171  3.215   1.00 0.00 ? 1184 LEU A HG   5  
ATOM 7586  H HD11 . LEU A 1 52  ? 7.292   -2.984  5.388   1.00 0.00 ? 1184 LEU A HD11 5  
ATOM 7587  H HD12 . LEU A 1 52  ? 5.596   -2.539  5.570   1.00 0.00 ? 1184 LEU A HD12 5  
ATOM 7588  H HD13 . LEU A 1 52  ? 6.832   -1.284  5.486   1.00 0.00 ? 1184 LEU A HD13 5  
ATOM 7589  H HD21 . LEU A 1 52  ? 4.295   -2.568  3.871   1.00 0.00 ? 1184 LEU A HD21 5  
ATOM 7590  H HD22 . LEU A 1 52  ? 4.782   -2.291  2.198   1.00 0.00 ? 1184 LEU A HD22 5  
ATOM 7591  H HD23 . LEU A 1 52  ? 4.693   -0.938  3.327   1.00 0.00 ? 1184 LEU A HD23 5  
ATOM 7592  N N    . VAL A 1 53  ? 9.493   0.117   1.356   1.00 0.00 ? 1185 VAL A N    5  
ATOM 7593  C CA   . VAL A 1 53  ? 10.364  1.225   0.981   1.00 0.00 ? 1185 VAL A CA   5  
ATOM 7594  C C    . VAL A 1 53  ? 10.188  1.589   -0.489  1.00 0.00 ? 1185 VAL A C    5  
ATOM 7595  O O    . VAL A 1 53  ? 10.048  2.762   -0.836  1.00 0.00 ? 1185 VAL A O    5  
ATOM 7596  C CB   . VAL A 1 53  ? 11.844  0.888   1.242   1.00 0.00 ? 1185 VAL A CB   5  
ATOM 7597  C CG1  . VAL A 1 53  ? 12.745  1.984   0.695   1.00 0.00 ? 1185 VAL A CG1  5  
ATOM 7598  C CG2  . VAL A 1 53  ? 12.088  0.677   2.728   1.00 0.00 ? 1185 VAL A CG2  5  
ATOM 7599  H H    . VAL A 1 53  ? 9.869   -0.641  1.850   1.00 0.00 ? 1185 VAL A H    5  
ATOM 7600  H HA   . VAL A 1 53  ? 10.098  2.078   1.588   1.00 0.00 ? 1185 VAL A HA   5  
ATOM 7601  H HB   . VAL A 1 53  ? 12.079  -0.032  0.726   1.00 0.00 ? 1185 VAL A HB   5  
ATOM 7602  H HG11 . VAL A 1 53  ? 12.583  2.087   -0.368  1.00 0.00 ? 1185 VAL A HG11 5  
ATOM 7603  H HG12 . VAL A 1 53  ? 12.516  2.918   1.188   1.00 0.00 ? 1185 VAL A HG12 5  
ATOM 7604  H HG13 . VAL A 1 53  ? 13.778  1.725   0.877   1.00 0.00 ? 1185 VAL A HG13 5  
ATOM 7605  H HG21 . VAL A 1 53  ? 12.249  1.633   3.205   1.00 0.00 ? 1185 VAL A HG21 5  
ATOM 7606  H HG22 . VAL A 1 53  ? 11.227  0.196   3.170   1.00 0.00 ? 1185 VAL A HG22 5  
ATOM 7607  H HG23 . VAL A 1 53  ? 12.959  0.054   2.866   1.00 0.00 ? 1185 VAL A HG23 5  
ATOM 7608  N N    . ASP A 1 54  ? 10.196  0.576   -1.349  1.00 0.00 ? 1186 ASP A N    5  
ATOM 7609  C CA   . ASP A 1 54  ? 10.036  0.789   -2.782  1.00 0.00 ? 1186 ASP A CA   5  
ATOM 7610  C C    . ASP A 1 54  ? 8.708   1.476   -3.085  1.00 0.00 ? 1186 ASP A C    5  
ATOM 7611  O O    . ASP A 1 54  ? 8.652   2.422   -3.870  1.00 0.00 ? 1186 ASP A O    5  
ATOM 7612  C CB   . ASP A 1 54  ? 10.117  -0.543  -3.530  1.00 0.00 ? 1186 ASP A CB   5  
ATOM 7613  C CG   . ASP A 1 54  ? 11.508  -1.143  -3.493  1.00 0.00 ? 1186 ASP A CG   5  
ATOM 7614  O OD1  . ASP A 1 54  ? 12.479  -0.409  -3.772  1.00 0.00 ? 1186 ASP A OD1  5  
ATOM 7615  O OD2  . ASP A 1 54  ? 11.627  -2.348  -3.185  1.00 0.00 ? 1186 ASP A OD2  5  
ATOM 7616  H H    . ASP A 1 54  ? 10.311  -0.337  -1.011  1.00 0.00 ? 1186 ASP A H    5  
ATOM 7617  H HA   . ASP A 1 54  ? 10.840  1.427   -3.115  1.00 0.00 ? 1186 ASP A HA   5  
ATOM 7618  H HB2  . ASP A 1 54  ? 9.431   -1.245  -3.077  1.00 0.00 ? 1186 ASP A HB2  5  
ATOM 7619  H HB3  . ASP A 1 54  ? 9.838   -0.387  -4.561  1.00 0.00 ? 1186 ASP A HB3  5  
ATOM 7620  N N    . MET A 1 55  ? 7.641   0.993   -2.457  1.00 0.00 ? 1187 MET A N    5  
ATOM 7621  C CA   . MET A 1 55  ? 6.313   1.561   -2.659  1.00 0.00 ? 1187 MET A CA   5  
ATOM 7622  C C    . MET A 1 55  ? 6.296   3.044   -2.302  1.00 0.00 ? 1187 MET A C    5  
ATOM 7623  O O    . MET A 1 55  ? 5.679   3.851   -2.996  1.00 0.00 ? 1187 MET A O    5  
ATOM 7624  C CB   . MET A 1 55  ? 5.280   0.809   -1.817  1.00 0.00 ? 1187 MET A CB   5  
ATOM 7625  C CG   . MET A 1 55  ? 4.995   -0.597  -2.317  1.00 0.00 ? 1187 MET A CG   5  
ATOM 7626  S SD   . MET A 1 55  ? 3.655   -1.398  -1.414  1.00 0.00 ? 1187 MET A SD   5  
ATOM 7627  C CE   . MET A 1 55  ? 2.237   -0.513  -2.059  1.00 0.00 ? 1187 MET A CE   5  
ATOM 7628  H H    . MET A 1 55  ? 7.748   0.237   -1.842  1.00 0.00 ? 1187 MET A H    5  
ATOM 7629  H HA   . MET A 1 55  ? 6.061   1.451   -3.703  1.00 0.00 ? 1187 MET A HA   5  
ATOM 7630  H HB2  . MET A 1 55  ? 5.641   0.741   -0.802  1.00 0.00 ? 1187 MET A HB2  5  
ATOM 7631  H HB3  . MET A 1 55  ? 4.354   1.365   -1.825  1.00 0.00 ? 1187 MET A HB3  5  
ATOM 7632  H HG2  . MET A 1 55  ? 4.726   -0.547  -3.361  1.00 0.00 ? 1187 MET A HG2  5  
ATOM 7633  H HG3  . MET A 1 55  ? 5.890   -1.191  -2.207  1.00 0.00 ? 1187 MET A HG3  5  
ATOM 7634  H HE1  . MET A 1 55  ? 1.597   -1.199  -2.594  1.00 0.00 ? 1187 MET A HE1  5  
ATOM 7635  H HE2  . MET A 1 55  ? 1.687   -0.071  -1.241  1.00 0.00 ? 1187 MET A HE2  5  
ATOM 7636  H HE3  . MET A 1 55  ? 2.573   0.264   -2.730  1.00 0.00 ? 1187 MET A HE3  5  
ATOM 7637  N N    . ALA A 1 56  ? 6.977   3.394   -1.216  1.00 0.00 ? 1188 ALA A N    5  
ATOM 7638  C CA   . ALA A 1 56  ? 7.041   4.780   -0.769  1.00 0.00 ? 1188 ALA A CA   5  
ATOM 7639  C C    . ALA A 1 56  ? 7.790   5.647   -1.774  1.00 0.00 ? 1188 ALA A C    5  
ATOM 7640  O O    . ALA A 1 56  ? 7.477   6.825   -1.949  1.00 0.00 ? 1188 ALA A O    5  
ATOM 7641  C CB   . ALA A 1 56  ? 7.702   4.863   0.599   1.00 0.00 ? 1188 ALA A CB   5  
ATOM 7642  H H    . ALA A 1 56  ? 7.448   2.704   -0.704  1.00 0.00 ? 1188 ALA A H    5  
ATOM 7643  H HA   . ALA A 1 56  ? 6.029   5.147   -0.675  1.00 0.00 ? 1188 ALA A HA   5  
ATOM 7644  H HB1  . ALA A 1 56  ? 6.949   4.764   1.368   1.00 0.00 ? 1188 ALA A HB1  5  
ATOM 7645  H HB2  . ALA A 1 56  ? 8.425   4.067   0.698   1.00 0.00 ? 1188 ALA A HB2  5  
ATOM 7646  H HB3  . ALA A 1 56  ? 8.198   5.816   0.701   1.00 0.00 ? 1188 ALA A HB3  5  
ATOM 7647  N N    . LYS A 1 57  ? 8.782   5.058   -2.433  1.00 0.00 ? 1189 LYS A N    5  
ATOM 7648  C CA   . LYS A 1 57  ? 9.577   5.776   -3.422  1.00 0.00 ? 1189 LYS A CA   5  
ATOM 7649  C C    . LYS A 1 57  ? 8.814   5.918   -4.735  1.00 0.00 ? 1189 LYS A C    5  
ATOM 7650  O O    . LYS A 1 57  ? 8.520   7.029   -5.176  1.00 0.00 ? 1189 LYS A O    5  
ATOM 7651  C CB   . LYS A 1 57  ? 10.902  5.050   -3.666  1.00 0.00 ? 1189 LYS A CB   5  
ATOM 7652  C CG   . LYS A 1 57  ? 11.865  5.130   -2.494  1.00 0.00 ? 1189 LYS A CG   5  
ATOM 7653  C CD   . LYS A 1 57  ? 12.805  3.937   -2.462  1.00 0.00 ? 1189 LYS A CD   5  
ATOM 7654  C CE   . LYS A 1 57  ? 14.072  4.204   -3.259  1.00 0.00 ? 1189 LYS A CE   5  
ATOM 7655  N NZ   . LYS A 1 57  ? 13.839  4.091   -4.725  1.00 0.00 ? 1189 LYS A NZ   5  
ATOM 7656  H H    . LYS A 1 57  ? 8.985   4.116   -2.250  1.00 0.00 ? 1189 LYS A H    5  
ATOM 7657  H HA   . LYS A 1 57  ? 9.783   6.761   -3.031  1.00 0.00 ? 1189 LYS A HA   5  
ATOM 7658  H HB2  . LYS A 1 57  ? 10.697  4.009   -3.866  1.00 0.00 ? 1189 LYS A HB2  5  
ATOM 7659  H HB3  . LYS A 1 57  ? 11.383  5.485   -4.530  1.00 0.00 ? 1189 LYS A HB3  5  
ATOM 7660  H HG2  . LYS A 1 57  ? 12.450  6.033   -2.582  1.00 0.00 ? 1189 LYS A HG2  5  
ATOM 7661  H HG3  . LYS A 1 57  ? 11.297  5.155   -1.575  1.00 0.00 ? 1189 LYS A HG3  5  
ATOM 7662  H HD2  . LYS A 1 57  ? 13.074  3.729   -1.437  1.00 0.00 ? 1189 LYS A HD2  5  
ATOM 7663  H HD3  . LYS A 1 57  ? 12.299  3.079   -2.883  1.00 0.00 ? 1189 LYS A HD3  5  
ATOM 7664  H HE2  . LYS A 1 57  ? 14.420  5.200   -3.034  1.00 0.00 ? 1189 LYS A HE2  5  
ATOM 7665  H HE3  . LYS A 1 57  ? 14.824  3.485   -2.966  1.00 0.00 ? 1189 LYS A HE3  5  
ATOM 7666  H HZ1  . LYS A 1 57  ? 14.727  4.256   -5.241  1.00 0.00 ? 1189 LYS A HZ1  5  
ATOM 7667  H HZ2  . LYS A 1 57  ? 13.139  4.797   -5.031  1.00 0.00 ? 1189 LYS A HZ2  5  
ATOM 7668  H HZ3  . LYS A 1 57  ? 13.485  3.142   -4.960  1.00 0.00 ? 1189 LYS A HZ3  5  
ATOM 7669  N N    . MET A 1 58  ? 8.494   4.786   -5.353  1.00 0.00 ? 1190 MET A N    5  
ATOM 7670  C CA   . MET A 1 58  ? 7.762   4.785   -6.615  1.00 0.00 ? 1190 MET A CA   5  
ATOM 7671  C C    . MET A 1 58  ? 6.357   5.349   -6.428  1.00 0.00 ? 1190 MET A C    5  
ATOM 7672  O O    . MET A 1 58  ? 5.866   6.108   -7.264  1.00 0.00 ? 1190 MET A O    5  
ATOM 7673  C CB   . MET A 1 58  ? 7.684   3.367   -7.183  1.00 0.00 ? 1190 MET A CB   5  
ATOM 7674  C CG   . MET A 1 58  ? 9.043   2.715   -7.377  1.00 0.00 ? 1190 MET A CG   5  
ATOM 7675  S SD   . MET A 1 58  ? 8.966   1.246   -8.420  1.00 0.00 ? 1190 MET A SD   5  
ATOM 7676  C CE   . MET A 1 58  ? 10.110  0.164   -7.567  1.00 0.00 ? 1190 MET A CE   5  
ATOM 7677  H H    . MET A 1 58  ? 8.756   3.931   -4.953  1.00 0.00 ? 1190 MET A H    5  
ATOM 7678  H HA   . MET A 1 58  ? 8.299   5.413   -7.310  1.00 0.00 ? 1190 MET A HA   5  
ATOM 7679  H HB2  . MET A 1 58  ? 7.106   2.753   -6.508  1.00 0.00 ? 1190 MET A HB2  5  
ATOM 7680  H HB3  . MET A 1 58  ? 7.186   3.402   -8.141  1.00 0.00 ? 1190 MET A HB3  5  
ATOM 7681  H HG2  . MET A 1 58  ? 9.709   3.430   -7.836  1.00 0.00 ? 1190 MET A HG2  5  
ATOM 7682  H HG3  . MET A 1 58  ? 9.432   2.433   -6.410  1.00 0.00 ? 1190 MET A HG3  5  
ATOM 7683  H HE1  . MET A 1 58  ? 11.119  0.385   -7.884  1.00 0.00 ? 1190 MET A HE1  5  
ATOM 7684  H HE2  . MET A 1 58  ? 10.026  0.319   -6.502  1.00 0.00 ? 1190 MET A HE2  5  
ATOM 7685  H HE3  . MET A 1 58  ? 9.876   -0.864  -7.801  1.00 0.00 ? 1190 MET A HE3  5  
ATOM 7686  N N    . ARG A 1 59  ? 5.714   4.972   -5.327  1.00 0.00 ? 1191 ARG A N    5  
ATOM 7687  C CA   . ARG A 1 59  ? 4.365   5.439   -5.032  1.00 0.00 ? 1191 ARG A CA   5  
ATOM 7688  C C    . ARG A 1 59  ? 3.360   4.855   -6.020  1.00 0.00 ? 1191 ARG A C    5  
ATOM 7689  O O    . ARG A 1 59  ? 2.602   5.575   -6.671  1.00 0.00 ? 1191 ARG A O    5  
ATOM 7690  C CB   . ARG A 1 59  ? 4.310   6.967   -5.075  1.00 0.00 ? 1191 ARG A CB   5  
ATOM 7691  C CG   . ARG A 1 59  ? 5.434   7.639   -4.303  1.00 0.00 ? 1191 ARG A CG   5  
ATOM 7692  C CD   . ARG A 1 59  ? 5.119   9.099   -4.018  1.00 0.00 ? 1191 ARG A CD   5  
ATOM 7693  N NE   . ARG A 1 59  ? 6.328   9.916   -3.946  1.00 0.00 ? 1191 ARG A NE   5  
ATOM 7694  C CZ   . ARG A 1 59  ? 7.058   10.051  -2.845  1.00 0.00 ? 1191 ARG A CZ   5  
ATOM 7695  N NH1  . ARG A 1 59  ? 6.704   9.427   -1.729  1.00 0.00 ? 1191 ARG A NH1  5  
ATOM 7696  N NH2  . ARG A 1 59  ? 8.145   10.812  -2.858  1.00 0.00 ? 1191 ARG A NH2  5  
ATOM 7697  H H    . ARG A 1 59  ? 6.158   4.365   -4.698  1.00 0.00 ? 1191 ARG A H    5  
ATOM 7698  H HA   . ARG A 1 59  ? 4.109   5.106   -4.037  1.00 0.00 ? 1191 ARG A HA   5  
ATOM 7699  H HB2  . ARG A 1 59  ? 4.368   7.289   -6.104  1.00 0.00 ? 1191 ARG A HB2  5  
ATOM 7700  H HB3  . ARG A 1 59  ? 3.370   7.293   -4.656  1.00 0.00 ? 1191 ARG A HB3  5  
ATOM 7701  H HG2  . ARG A 1 59  ? 5.573   7.122   -3.365  1.00 0.00 ? 1191 ARG A HG2  5  
ATOM 7702  H HG3  . ARG A 1 59  ? 6.342   7.582   -4.885  1.00 0.00 ? 1191 ARG A HG3  5  
ATOM 7703  H HD2  . ARG A 1 59  ? 4.487   9.478   -4.808  1.00 0.00 ? 1191 ARG A HD2  5  
ATOM 7704  H HD3  . ARG A 1 59  ? 4.595   9.163   -3.076  1.00 0.00 ? 1191 ARG A HD3  5  
ATOM 7705  H HE   . ARG A 1 59  ? 6.607   10.386  -4.759  1.00 0.00 ? 1191 ARG A HE   5  
ATOM 7706  H HH11 . ARG A 1 59  ? 5.887   8.853   -1.717  1.00 0.00 ? 1191 ARG A HH11 5  
ATOM 7707  H HH12 . ARG A 1 59  ? 7.257   9.530   -0.902  1.00 0.00 ? 1191 ARG A HH12 5  
ATOM 7708  H HH21 . ARG A 1 59  ? 8.415   11.284  -3.697  1.00 0.00 ? 1191 ARG A HH21 5  
ATOM 7709  H HH22 . ARG A 1 59  ? 8.694   10.914  -2.029  1.00 0.00 ? 1191 ARG A HH22 5  
ATOM 7710  N N    . PRO A 1 60  ? 3.352   3.519   -6.136  1.00 0.00 ? 1192 PRO A N    5  
ATOM 7711  C CA   . PRO A 1 60  ? 2.445   2.809   -7.043  1.00 0.00 ? 1192 PRO A CA   5  
ATOM 7712  C C    . PRO A 1 60  ? 0.993   2.875   -6.580  1.00 0.00 ? 1192 PRO A C    5  
ATOM 7713  O O    . PRO A 1 60  ? 0.696   2.670   -5.402  1.00 0.00 ? 1192 PRO A O    5  
ATOM 7714  C CB   . PRO A 1 60  ? 2.955   1.366   -6.997  1.00 0.00 ? 1192 PRO A CB   5  
ATOM 7715  C CG   . PRO A 1 60  ? 3.634   1.246   -5.677  1.00 0.00 ? 1192 PRO A CG   5  
ATOM 7716  C CD   . PRO A 1 60  ? 4.227   2.598   -5.392  1.00 0.00 ? 1192 PRO A CD   5  
ATOM 7717  H HA   . PRO A 1 60  ? 2.517   3.186   -8.052  1.00 0.00 ? 1192 PRO A HA   5  
ATOM 7718  H HB2  . PRO A 1 60  ? 2.121   0.684   -7.077  1.00 0.00 ? 1192 PRO A HB2  5  
ATOM 7719  H HB3  . PRO A 1 60  ? 3.644   1.198   -7.812  1.00 0.00 ? 1192 PRO A HB3  5  
ATOM 7720  H HG2  . PRO A 1 60  ? 2.915   0.984   -4.916  1.00 0.00 ? 1192 PRO A HG2  5  
ATOM 7721  H HG3  . PRO A 1 60  ? 4.413   0.500   -5.732  1.00 0.00 ? 1192 PRO A HG3  5  
ATOM 7722  H HD2  . PRO A 1 60  ? 4.196   2.808   -4.333  1.00 0.00 ? 1192 PRO A HD2  5  
ATOM 7723  H HD3  . PRO A 1 60  ? 5.242   2.650   -5.759  1.00 0.00 ? 1192 PRO A HD3  5  
ATOM 7724  N N    . THR A 1 61  ? 0.091   3.162   -7.513  1.00 0.00 ? 1193 THR A N    5  
ATOM 7725  C CA   . THR A 1 61  ? -1.329  3.256   -7.201  1.00 0.00 ? 1193 THR A CA   5  
ATOM 7726  C C    . THR A 1 61  ? -2.073  2.000   -7.641  1.00 0.00 ? 1193 THR A C    5  
ATOM 7727  O O    . THR A 1 61  ? -3.041  1.583   -7.003  1.00 0.00 ? 1193 THR A O    5  
ATOM 7728  C CB   . THR A 1 61  ? -1.973  4.482   -7.875  1.00 0.00 ? 1193 THR A CB   5  
ATOM 7729  O OG1  . THR A 1 61  ? -1.864  4.373   -9.298  1.00 0.00 ? 1193 THR A OG1  5  
ATOM 7730  C CG2  . THR A 1 61  ? -1.307  5.768   -7.408  1.00 0.00 ? 1193 THR A CG2  5  
ATOM 7731  H H    . THR A 1 61  ? 0.390   3.315   -8.434  1.00 0.00 ? 1193 THR A H    5  
ATOM 7732  H HA   . THR A 1 61  ? -1.428  3.365   -6.131  1.00 0.00 ? 1193 THR A HA   5  
ATOM 7733  H HB   . THR A 1 61  ? -3.018  4.517   -7.602  1.00 0.00 ? 1193 THR A HB   5  
ATOM 7734  H HG1  . THR A 1 61  ? -1.851  5.251   -9.687  1.00 0.00 ? 1193 THR A HG1  5  
ATOM 7735  H HG21 . THR A 1 61  ? -0.699  6.169   -8.205  1.00 0.00 ? 1193 THR A HG21 5  
ATOM 7736  H HG22 . THR A 1 61  ? -0.684  5.560   -6.550  1.00 0.00 ? 1193 THR A HG22 5  
ATOM 7737  H HG23 . THR A 1 61  ? -2.064  6.487   -7.136  1.00 0.00 ? 1193 THR A HG23 5  
ATOM 7738  N N    . THR A 1 62  ? -1.615  1.399   -8.735  1.00 0.00 ? 1194 THR A N    5  
ATOM 7739  C CA   . THR A 1 62  ? -2.237  0.191   -9.260  1.00 0.00 ? 1194 THR A CA   5  
ATOM 7740  C C    . THR A 1 62  ? -1.429  -1.048  -8.893  1.00 0.00 ? 1194 THR A C    5  
ATOM 7741  O O    . THR A 1 62  ? -0.208  -0.985  -8.750  1.00 0.00 ? 1194 THR A O    5  
ATOM 7742  C CB   . THR A 1 62  ? -2.388  0.256   -10.792 1.00 0.00 ? 1194 THR A CB   5  
ATOM 7743  O OG1  . THR A 1 62  ? -1.097  0.283   -11.410 1.00 0.00 ? 1194 THR A OG1  5  
ATOM 7744  C CG2  . THR A 1 62  ? -3.179  1.488   -11.205 1.00 0.00 ? 1194 THR A CG2  5  
ATOM 7745  H H    . THR A 1 62  ? -0.840  1.779   -9.199  1.00 0.00 ? 1194 THR A H    5  
ATOM 7746  H HA   . THR A 1 62  ? -3.223  0.107   -8.826  1.00 0.00 ? 1194 THR A HA   5  
ATOM 7747  H HB   . THR A 1 62  ? -2.920  -0.623  -11.124 1.00 0.00 ? 1194 THR A HB   5  
ATOM 7748  H HG1  . THR A 1 62  ? -1.183  0.586   -12.317 1.00 0.00 ? 1194 THR A HG1  5  
ATOM 7749  H HG21 . THR A 1 62  ? -2.512  2.334   -11.284 1.00 0.00 ? 1194 THR A HG21 5  
ATOM 7750  H HG22 . THR A 1 62  ? -3.937  1.695   -10.464 1.00 0.00 ? 1194 THR A HG22 5  
ATOM 7751  H HG23 . THR A 1 62  ? -3.649  1.310   -12.160 1.00 0.00 ? 1194 THR A HG23 5  
ATOM 7752  N N    . VAL A 1 63  ? -2.117  -2.176  -8.742  1.00 0.00 ? 1195 VAL A N    5  
ATOM 7753  C CA   . VAL A 1 63  ? -1.462  -3.431  -8.394  1.00 0.00 ? 1195 VAL A CA   5  
ATOM 7754  C C    . VAL A 1 63  ? -0.387  -3.791  -9.413  1.00 0.00 ? 1195 VAL A C    5  
ATOM 7755  O O    . VAL A 1 63  ? 0.638   -4.377  -9.066  1.00 0.00 ? 1195 VAL A O    5  
ATOM 7756  C CB   . VAL A 1 63  ? -2.476  -4.587  -8.303  1.00 0.00 ? 1195 VAL A CB   5  
ATOM 7757  C CG1  . VAL A 1 63  ? -3.142  -4.820  -9.651  1.00 0.00 ? 1195 VAL A CG1  5  
ATOM 7758  C CG2  . VAL A 1 63  ? -1.795  -5.854  -7.810  1.00 0.00 ? 1195 VAL A CG2  5  
ATOM 7759  H H    . VAL A 1 63  ? -3.089  -2.163  -8.870  1.00 0.00 ? 1195 VAL A H    5  
ATOM 7760  H HA   . VAL A 1 63  ? -1.000  -3.308  -7.425  1.00 0.00 ? 1195 VAL A HA   5  
ATOM 7761  H HB   . VAL A 1 63  ? -3.241  -4.313  -7.591  1.00 0.00 ? 1195 VAL A HB   5  
ATOM 7762  H HG11 . VAL A 1 63  ? -3.727  -5.727  -9.611  1.00 0.00 ? 1195 VAL A HG11 5  
ATOM 7763  H HG12 . VAL A 1 63  ? -3.786  -3.984  -9.884  1.00 0.00 ? 1195 VAL A HG12 5  
ATOM 7764  H HG13 . VAL A 1 63  ? -2.385  -4.914  -10.415 1.00 0.00 ? 1195 VAL A HG13 5  
ATOM 7765  H HG21 . VAL A 1 63  ? -0.895  -5.593  -7.275  1.00 0.00 ? 1195 VAL A HG21 5  
ATOM 7766  H HG22 . VAL A 1 63  ? -2.464  -6.389  -7.150  1.00 0.00 ? 1195 VAL A HG22 5  
ATOM 7767  H HG23 . VAL A 1 63  ? -1.545  -6.481  -8.653  1.00 0.00 ? 1195 VAL A HG23 5  
ATOM 7768  N N    . GLU A 1 64  ? -0.628  -3.435  -10.671 1.00 0.00 ? 1196 GLU A N    5  
ATOM 7769  C CA   . GLU A 1 64  ? 0.320   -3.722  -11.740 1.00 0.00 ? 1196 GLU A CA   5  
ATOM 7770  C C    . GLU A 1 64  ? 1.711   -3.201  -11.388 1.00 0.00 ? 1196 GLU A C    5  
ATOM 7771  O O    . GLU A 1 64  ? 2.705   -3.911  -11.533 1.00 0.00 ? 1196 GLU A O    5  
ATOM 7772  C CB   . GLU A 1 64  ? -0.153  -3.095  -13.054 1.00 0.00 ? 1196 GLU A CB   5  
ATOM 7773  C CG   . GLU A 1 64  ? -1.543  -3.543  -13.475 1.00 0.00 ? 1196 GLU A CG   5  
ATOM 7774  C CD   . GLU A 1 64  ? -2.037  -2.822  -14.714 1.00 0.00 ? 1196 GLU A CD   5  
ATOM 7775  O OE1  . GLU A 1 64  ? -1.218  -2.575  -15.624 1.00 0.00 ? 1196 GLU A OE1  5  
ATOM 7776  O OE2  . GLU A 1 64  ? -3.244  -2.506  -14.774 1.00 0.00 ? 1196 GLU A OE2  5  
ATOM 7777  H H    . GLU A 1 64  ? -1.464  -2.970  -10.884 1.00 0.00 ? 1196 GLU A H    5  
ATOM 7778  H HA   . GLU A 1 64  ? 0.370   -4.793  -11.861 1.00 0.00 ? 1196 GLU A HA   5  
ATOM 7779  H HB2  . GLU A 1 64  ? -0.161  -2.021  -12.944 1.00 0.00 ? 1196 GLU A HB2  5  
ATOM 7780  H HB3  . GLU A 1 64  ? 0.541   -3.363  -13.837 1.00 0.00 ? 1196 GLU A HB3  5  
ATOM 7781  H HG2  . GLU A 1 64  ? -1.519  -4.603  -13.680 1.00 0.00 ? 1196 GLU A HG2  5  
ATOM 7782  H HG3  . GLU A 1 64  ? -2.231  -3.349  -12.666 1.00 0.00 ? 1196 GLU A HG3  5  
ATOM 7783  N N    . ASN A 1 65  ? 1.771   -1.957  -10.926 1.00 0.00 ? 1197 ASN A N    5  
ATOM 7784  C CA   . ASN A 1 65  ? 3.039   -1.340  -10.554 1.00 0.00 ? 1197 ASN A CA   5  
ATOM 7785  C C    . ASN A 1 65  ? 3.645   -2.033  -9.338  1.00 0.00 ? 1197 ASN A C    5  
ATOM 7786  O O    . ASN A 1 65  ? 4.835   -2.349  -9.319  1.00 0.00 ? 1197 ASN A O    5  
ATOM 7787  C CB   . ASN A 1 65  ? 2.839   0.148   -10.260 1.00 0.00 ? 1197 ASN A CB   5  
ATOM 7788  C CG   . ASN A 1 65  ? 2.661   0.969   -11.523 1.00 0.00 ? 1197 ASN A CG   5  
ATOM 7789  O OD1  . ASN A 1 65  ? 3.193   0.626   -12.579 1.00 0.00 ? 1197 ASN A OD1  5  
ATOM 7790  N ND2  . ASN A 1 65  ? 1.910   2.059   -11.419 1.00 0.00 ? 1197 ASN A ND2  5  
ATOM 7791  H H    . ASN A 1 65  ? 0.943   -1.440  -10.833 1.00 0.00 ? 1197 ASN A H    5  
ATOM 7792  H HA   . ASN A 1 65  ? 3.716   -1.445  -11.389 1.00 0.00 ? 1197 ASN A HA   5  
ATOM 7793  H HB2  . ASN A 1 65  ? 1.958   0.272   -9.646  1.00 0.00 ? 1197 ASN A HB2  5  
ATOM 7794  H HB3  . ASN A 1 65  ? 3.700   0.523   -9.727  1.00 0.00 ? 1197 ASN A HB3  5  
ATOM 7795  H HD21 . ASN A 1 65  ? 1.519   2.271   -10.545 1.00 0.00 ? 1197 ASN A HD21 5  
ATOM 7796  H HD22 . ASN A 1 65  ? 1.778   2.608   -12.220 1.00 0.00 ? 1197 ASN A HD22 5  
ATOM 7797  N N    . VAL A 1 66  ? 2.818   -2.268  -8.324  1.00 0.00 ? 1198 VAL A N    5  
ATOM 7798  C CA   . VAL A 1 66  ? 3.272   -2.926  -7.105  1.00 0.00 ? 1198 VAL A CA   5  
ATOM 7799  C C    . VAL A 1 66  ? 4.019   -4.217  -7.421  1.00 0.00 ? 1198 VAL A C    5  
ATOM 7800  O O    . VAL A 1 66  ? 5.157   -4.411  -6.993  1.00 0.00 ? 1198 VAL A O    5  
ATOM 7801  C CB   . VAL A 1 66  ? 2.092   -3.245  -6.167  1.00 0.00 ? 1198 VAL A CB   5  
ATOM 7802  C CG1  . VAL A 1 66  ? 2.581   -3.965  -4.919  1.00 0.00 ? 1198 VAL A CG1  5  
ATOM 7803  C CG2  . VAL A 1 66  ? 1.345   -1.972  -5.800  1.00 0.00 ? 1198 VAL A CG2  5  
ATOM 7804  H H    . VAL A 1 66  ? 1.881   -1.994  -8.399  1.00 0.00 ? 1198 VAL A H    5  
ATOM 7805  H HA   . VAL A 1 66  ? 3.941   -2.252  -6.590  1.00 0.00 ? 1198 VAL A HA   5  
ATOM 7806  H HB   . VAL A 1 66  ? 1.410   -3.900  -6.690  1.00 0.00 ? 1198 VAL A HB   5  
ATOM 7807  H HG11 . VAL A 1 66  ? 3.467   -4.535  -5.157  1.00 0.00 ? 1198 VAL A HG11 5  
ATOM 7808  H HG12 . VAL A 1 66  ? 2.812   -3.240  -4.153  1.00 0.00 ? 1198 VAL A HG12 5  
ATOM 7809  H HG13 . VAL A 1 66  ? 1.810   -4.633  -4.564  1.00 0.00 ? 1198 VAL A HG13 5  
ATOM 7810  H HG21 . VAL A 1 66  ? 1.803   -1.131  -6.296  1.00 0.00 ? 1198 VAL A HG21 5  
ATOM 7811  H HG22 . VAL A 1 66  ? 0.314   -2.057  -6.113  1.00 0.00 ? 1198 VAL A HG22 5  
ATOM 7812  H HG23 . VAL A 1 66  ? 1.385   -1.826  -4.731  1.00 0.00 ? 1198 VAL A HG23 5  
ATOM 7813  N N    . LYS A 1 67  ? 3.371   -5.099  -8.175  1.00 0.00 ? 1199 LYS A N    5  
ATOM 7814  C CA   . LYS A 1 67  ? 3.973   -6.372  -8.553  1.00 0.00 ? 1199 LYS A CA   5  
ATOM 7815  C C    . LYS A 1 67  ? 5.402   -6.173  -9.047  1.00 0.00 ? 1199 LYS A C    5  
ATOM 7816  O O    . LYS A 1 67  ? 6.277   -7.002  -8.796  1.00 0.00 ? 1199 LYS A O    5  
ATOM 7817  C CB   . LYS A 1 67  ? 3.137   -7.053  -9.638  1.00 0.00 ? 1199 LYS A CB   5  
ATOM 7818  C CG   . LYS A 1 67  ? 1.715   -7.365  -9.205  1.00 0.00 ? 1199 LYS A CG   5  
ATOM 7819  C CD   . LYS A 1 67  ? 0.774   -7.446  -10.396 1.00 0.00 ? 1199 LYS A CD   5  
ATOM 7820  C CE   . LYS A 1 67  ? 0.893   -8.784  -11.110 1.00 0.00 ? 1199 LYS A CE   5  
ATOM 7821  N NZ   . LYS A 1 67  ? 0.068   -9.837  -10.455 1.00 0.00 ? 1199 LYS A NZ   5  
ATOM 7822  H H    . LYS A 1 67  ? 2.465   -4.888  -8.487  1.00 0.00 ? 1199 LYS A H    5  
ATOM 7823  H HA   . LYS A 1 67  ? 3.992   -7.003  -7.677  1.00 0.00 ? 1199 LYS A HA   5  
ATOM 7824  H HB2  . LYS A 1 67  ? 3.094   -6.406  -10.502 1.00 0.00 ? 1199 LYS A HB2  5  
ATOM 7825  H HB3  . LYS A 1 67  ? 3.617   -7.980  -9.917  1.00 0.00 ? 1199 LYS A HB3  5  
ATOM 7826  H HG2  . LYS A 1 67  ? 1.705   -8.312  -8.687  1.00 0.00 ? 1199 LYS A HG2  5  
ATOM 7827  H HG3  . LYS A 1 67  ? 1.372   -6.585  -8.540  1.00 0.00 ? 1199 LYS A HG3  5  
ATOM 7828  H HD2  . LYS A 1 67  ? -0.242  -7.324  -10.051 1.00 0.00 ? 1199 LYS A HD2  5  
ATOM 7829  H HD3  . LYS A 1 67  ? 1.018   -6.655  -11.091 1.00 0.00 ? 1199 LYS A HD3  5  
ATOM 7830  H HE2  . LYS A 1 67  ? 0.563   -8.664  -12.130 1.00 0.00 ? 1199 LYS A HE2  5  
ATOM 7831  H HE3  . LYS A 1 67  ? 1.928   -9.092  -11.100 1.00 0.00 ? 1199 LYS A HE3  5  
ATOM 7832  H HZ1  . LYS A 1 67  ? -0.907  -9.802  -10.815 1.00 0.00 ? 1199 LYS A HZ1  5  
ATOM 7833  H HZ2  . LYS A 1 67  ? 0.051   -9.689  -9.426  1.00 0.00 ? 1199 LYS A HZ2  5  
ATOM 7834  H HZ3  . LYS A 1 67  ? 0.466   -10.777 -10.652 1.00 0.00 ? 1199 LYS A HZ3  5  
ATOM 7835  N N    . ARG A 1 68  ? 5.632   -5.068  -9.748  1.00 0.00 ? 1200 ARG A N    5  
ATOM 7836  C CA   . ARG A 1 68  ? 6.956   -4.761  -10.277 1.00 0.00 ? 1200 ARG A CA   5  
ATOM 7837  C C    . ARG A 1 68  ? 7.945   -4.497  -9.146  1.00 0.00 ? 1200 ARG A C    5  
ATOM 7838  O O    . ARG A 1 68  ? 9.125   -4.832  -9.250  1.00 0.00 ? 1200 ARG A O    5  
ATOM 7839  C CB   . ARG A 1 68  ? 6.888   -3.545  -11.204 1.00 0.00 ? 1200 ARG A CB   5  
ATOM 7840  C CG   . ARG A 1 68  ? 5.920   -3.716  -12.363 1.00 0.00 ? 1200 ARG A CG   5  
ATOM 7841  C CD   . ARG A 1 68  ? 5.975   -2.531  -13.314 1.00 0.00 ? 1200 ARG A CD   5  
ATOM 7842  N NE   . ARG A 1 68  ? 7.169   -2.558  -14.154 1.00 0.00 ? 1200 ARG A NE   5  
ATOM 7843  C CZ   . ARG A 1 68  ? 7.265   -3.269  -15.272 1.00 0.00 ? 1200 ARG A CZ   5  
ATOM 7844  N NH1  . ARG A 1 68  ? 6.243   -4.007  -15.682 1.00 0.00 ? 1200 ARG A NH1  5  
ATOM 7845  N NH2  . ARG A 1 68  ? 8.386   -3.242  -15.983 1.00 0.00 ? 1200 ARG A NH2  5  
ATOM 7846  H H    . ARG A 1 68  ? 4.894   -4.445  -9.916  1.00 0.00 ? 1200 ARG A H    5  
ATOM 7847  H HA   . ARG A 1 68  ? 7.294   -5.615  -10.843 1.00 0.00 ? 1200 ARG A HA   5  
ATOM 7848  H HB2  . ARG A 1 68  ? 6.578   -2.685  -10.629 1.00 0.00 ? 1200 ARG A HB2  5  
ATOM 7849  H HB3  . ARG A 1 68  ? 7.872   -3.362  -11.609 1.00 0.00 ? 1200 ARG A HB3  5  
ATOM 7850  H HG2  . ARG A 1 68  ? 6.180   -4.612  -12.908 1.00 0.00 ? 1200 ARG A HG2  5  
ATOM 7851  H HG3  . ARG A 1 68  ? 4.918   -3.808  -11.972 1.00 0.00 ? 1200 ARG A HG3  5  
ATOM 7852  H HD2  . ARG A 1 68  ? 5.101   -2.554  -13.947 1.00 0.00 ? 1200 ARG A HD2  5  
ATOM 7853  H HD3  . ARG A 1 68  ? 5.975   -1.621  -12.733 1.00 0.00 ? 1200 ARG A HD3  5  
ATOM 7854  H HE   . ARG A 1 68  ? 7.936   -2.019  -13.870 1.00 0.00 ? 1200 ARG A HE   5  
ATOM 7855  H HH11 . ARG A 1 68  ? 5.398   -4.029  -15.149 1.00 0.00 ? 1200 ARG A HH11 5  
ATOM 7856  H HH12 . ARG A 1 68  ? 6.318   -4.541  -16.525 1.00 0.00 ? 1200 ARG A HH12 5  
ATOM 7857  H HH21 . ARG A 1 68  ? 9.158   -2.686  -15.677 1.00 0.00 ? 1200 ARG A HH21 5  
ATOM 7858  H HH22 . ARG A 1 68  ? 8.457   -3.777  -16.824 1.00 0.00 ? 1200 ARG A HH22 5  
ATOM 7859  N N    . ILE A 1 69  ? 7.456   -3.894  -8.067  1.00 0.00 ? 1201 ILE A N    5  
ATOM 7860  C CA   . ILE A 1 69  ? 8.297   -3.586  -6.918  1.00 0.00 ? 1201 ILE A CA   5  
ATOM 7861  C C    . ILE A 1 69  ? 9.217   -4.754  -6.581  1.00 0.00 ? 1201 ILE A C    5  
ATOM 7862  O O    . ILE A 1 69  ? 8.863   -5.916  -6.784  1.00 0.00 ? 1201 ILE A O    5  
ATOM 7863  C CB   . ILE A 1 69  ? 7.451   -3.240  -5.678  1.00 0.00 ? 1201 ILE A CB   5  
ATOM 7864  C CG1  . ILE A 1 69  ? 6.525   -2.059  -5.979  1.00 0.00 ? 1201 ILE A CG1  5  
ATOM 7865  C CG2  . ILE A 1 69  ? 8.352   -2.926  -4.493  1.00 0.00 ? 1201 ILE A CG2  5  
ATOM 7866  C CD1  . ILE A 1 69  ? 7.263   -0.764  -6.235  1.00 0.00 ? 1201 ILE A CD1  5  
ATOM 7867  H H    . ILE A 1 69  ? 6.507   -3.651  -8.044  1.00 0.00 ? 1201 ILE A H    5  
ATOM 7868  H HA   . ILE A 1 69  ? 8.901   -2.726  -7.168  1.00 0.00 ? 1201 ILE A HA   5  
ATOM 7869  H HB   . ILE A 1 69  ? 6.853   -4.102  -5.426  1.00 0.00 ? 1201 ILE A HB   5  
ATOM 7870  H HG12 . ILE A 1 69  ? 5.937   -2.285  -6.854  1.00 0.00 ? 1201 ILE A HG12 5  
ATOM 7871  H HG13 . ILE A 1 69  ? 5.866   -1.905  -5.137  1.00 0.00 ? 1201 ILE A HG13 5  
ATOM 7872  H HG21 . ILE A 1 69  ? 8.575   -3.838  -3.959  1.00 0.00 ? 1201 ILE A HG21 5  
ATOM 7873  H HG22 . ILE A 1 69  ? 9.271   -2.483  -4.847  1.00 0.00 ? 1201 ILE A HG22 5  
ATOM 7874  H HG23 . ILE A 1 69  ? 7.850   -2.235  -3.832  1.00 0.00 ? 1201 ILE A HG23 5  
ATOM 7875  H HD11 . ILE A 1 69  ? 6.561   -0.006  -6.552  1.00 0.00 ? 1201 ILE A HD11 5  
ATOM 7876  H HD12 . ILE A 1 69  ? 7.756   -0.444  -5.330  1.00 0.00 ? 1201 ILE A HD12 5  
ATOM 7877  H HD13 . ILE A 1 69  ? 8.000   -0.917  -7.011  1.00 0.00 ? 1201 ILE A HD13 5  
ATOM 7878  N N    . ASP A 1 70  ? 10.400  -4.439  -6.064  1.00 0.00 ? 1202 ASP A N    5  
ATOM 7879  C CA   . ASP A 1 70  ? 11.371  -5.462  -5.696  1.00 0.00 ? 1202 ASP A CA   5  
ATOM 7880  C C    . ASP A 1 70  ? 10.955  -6.169  -4.410  1.00 0.00 ? 1202 ASP A C    5  
ATOM 7881  O O    . ASP A 1 70  ? 10.471  -5.538  -3.471  1.00 0.00 ? 1202 ASP A O    5  
ATOM 7882  C CB   . ASP A 1 70  ? 12.759  -4.841  -5.526  1.00 0.00 ? 1202 ASP A CB   5  
ATOM 7883  C CG   . ASP A 1 70  ? 13.810  -5.867  -5.151  1.00 0.00 ? 1202 ASP A CG   5  
ATOM 7884  O OD1  . ASP A 1 70  ? 13.822  -6.305  -3.982  1.00 0.00 ? 1202 ASP A OD1  5  
ATOM 7885  O OD2  . ASP A 1 70  ? 14.620  -6.233  -6.028  1.00 0.00 ? 1202 ASP A OD2  5  
ATOM 7886  H H    . ASP A 1 70  ? 10.625  -3.494  -5.926  1.00 0.00 ? 1202 ASP A H    5  
ATOM 7887  H HA   . ASP A 1 70  ? 11.407  -6.188  -6.495  1.00 0.00 ? 1202 ASP A HA   5  
ATOM 7888  H HB2  . ASP A 1 70  ? 13.053  -4.374  -6.454  1.00 0.00 ? 1202 ASP A HB2  5  
ATOM 7889  H HB3  . ASP A 1 70  ? 12.718  -4.093  -4.748  1.00 0.00 ? 1202 ASP A HB3  5  
ATOM 7890  N N    . GLY A 1 71  ? 11.146  -7.484  -4.375  1.00 0.00 ? 1203 GLY A N    5  
ATOM 7891  C CA   . GLY A 1 71  ? 10.784  -8.255  -3.200  1.00 0.00 ? 1203 GLY A CA   5  
ATOM 7892  C C    . GLY A 1 71  ? 9.425   -8.914  -3.334  1.00 0.00 ? 1203 GLY A C    5  
ATOM 7893  O O    . GLY A 1 71  ? 9.278   -10.109 -3.076  1.00 0.00 ? 1203 GLY A O    5  
ATOM 7894  H H    . GLY A 1 71  ? 11.536  -7.935  -5.153  1.00 0.00 ? 1203 GLY A H    5  
ATOM 7895  H HA2  . GLY A 1 71  ? 11.529  -9.020  -3.040  1.00 0.00 ? 1203 GLY A HA2  5  
ATOM 7896  H HA3  . GLY A 1 71  ? 10.768  -7.598  -2.343  1.00 0.00 ? 1203 GLY A HA3  5  
ATOM 7897  N N    . VAL A 1 72  ? 8.428   -8.134  -3.739  1.00 0.00 ? 1204 VAL A N    5  
ATOM 7898  C CA   . VAL A 1 72  ? 7.074   -8.648  -3.907  1.00 0.00 ? 1204 VAL A CA   5  
ATOM 7899  C C    . VAL A 1 72  ? 7.009   -9.664  -5.042  1.00 0.00 ? 1204 VAL A C    5  
ATOM 7900  O O    . VAL A 1 72  ? 7.516   -9.419  -6.137  1.00 0.00 ? 1204 VAL A O    5  
ATOM 7901  C CB   . VAL A 1 72  ? 6.073   -7.512  -4.191  1.00 0.00 ? 1204 VAL A CB   5  
ATOM 7902  C CG1  . VAL A 1 72  ? 6.228   -7.009  -5.618  1.00 0.00 ? 1204 VAL A CG1  5  
ATOM 7903  C CG2  . VAL A 1 72  ? 4.649   -7.981  -3.934  1.00 0.00 ? 1204 VAL A CG2  5  
ATOM 7904  H H    . VAL A 1 72  ? 8.608   -7.189  -3.930  1.00 0.00 ? 1204 VAL A H    5  
ATOM 7905  H HA   . VAL A 1 72  ? 6.785   -9.133  -2.986  1.00 0.00 ? 1204 VAL A HA   5  
ATOM 7906  H HB   . VAL A 1 72  ? 6.288   -6.694  -3.519  1.00 0.00 ? 1204 VAL A HB   5  
ATOM 7907  H HG11 . VAL A 1 72  ? 7.238   -7.190  -5.956  1.00 0.00 ? 1204 VAL A HG11 5  
ATOM 7908  H HG12 . VAL A 1 72  ? 5.533   -7.528  -6.261  1.00 0.00 ? 1204 VAL A HG12 5  
ATOM 7909  H HG13 . VAL A 1 72  ? 6.024   -5.948  -5.649  1.00 0.00 ? 1204 VAL A HG13 5  
ATOM 7910  H HG21 . VAL A 1 72  ? 3.955   -7.240  -4.303  1.00 0.00 ? 1204 VAL A HG21 5  
ATOM 7911  H HG22 . VAL A 1 72  ? 4.480   -8.918  -4.445  1.00 0.00 ? 1204 VAL A HG22 5  
ATOM 7912  H HG23 . VAL A 1 72  ? 4.501   -8.118  -2.873  1.00 0.00 ? 1204 VAL A HG23 5  
ATOM 7913  N N    . SER A 1 73  ? 6.382   -10.804 -4.773  1.00 0.00 ? 1205 SER A N    5  
ATOM 7914  C CA   . SER A 1 73  ? 6.253   -11.860 -5.771  1.00 0.00 ? 1205 SER A CA   5  
ATOM 7915  C C    . SER A 1 73  ? 4.911   -11.766 -6.491  1.00 0.00 ? 1205 SER A C    5  
ATOM 7916  O O    . SER A 1 73  ? 4.057   -10.958 -6.129  1.00 0.00 ? 1205 SER A O    5  
ATOM 7917  C CB   . SER A 1 73  ? 6.397   -13.233 -5.113  1.00 0.00 ? 1205 SER A CB   5  
ATOM 7918  O OG   . SER A 1 73  ? 6.637   -14.240 -6.081  1.00 0.00 ? 1205 SER A OG   5  
ATOM 7919  H H    . SER A 1 73  ? 5.999   -10.940 -3.881  1.00 0.00 ? 1205 SER A H    5  
ATOM 7920  H HA   . SER A 1 73  ? 7.046   -11.731 -6.493  1.00 0.00 ? 1205 SER A HA   5  
ATOM 7921  H HB2  . SER A 1 73  ? 7.225   -13.213 -4.420  1.00 0.00 ? 1205 SER A HB2  5  
ATOM 7922  H HB3  . SER A 1 73  ? 5.488   -13.471 -4.581  1.00 0.00 ? 1205 SER A HB3  5  
ATOM 7923  H HG   . SER A 1 73  ? 5.892   -14.845 -6.105  1.00 0.00 ? 1205 SER A HG   5  
ATOM 7924  N N    . GLU A 1 74  ? 4.735   -12.599 -7.512  1.00 0.00 ? 1206 GLU A N    5  
ATOM 7925  C CA   . GLU A 1 74  ? 3.498   -12.609 -8.283  1.00 0.00 ? 1206 GLU A CA   5  
ATOM 7926  C C    . GLU A 1 74  ? 2.315   -13.014 -7.408  1.00 0.00 ? 1206 GLU A C    5  
ATOM 7927  O O    . GLU A 1 74  ? 2.441   -13.865 -6.529  1.00 0.00 ? 1206 GLU A O    5  
ATOM 7928  C CB   . GLU A 1 74  ? 3.619   -13.567 -9.471  1.00 0.00 ? 1206 GLU A CB   5  
ATOM 7929  C CG   . GLU A 1 74  ? 2.377   -13.612 -10.345 1.00 0.00 ? 1206 GLU A CG   5  
ATOM 7930  C CD   . GLU A 1 74  ? 2.366   -12.523 -11.399 1.00 0.00 ? 1206 GLU A CD   5  
ATOM 7931  O OE1  . GLU A 1 74  ? 2.996   -11.469 -11.171 1.00 0.00 ? 1206 GLU A OE1  5  
ATOM 7932  O OE2  . GLU A 1 74  ? 1.726   -12.724 -12.453 1.00 0.00 ? 1206 GLU A OE2  5  
ATOM 7933  H H    . GLU A 1 74  ? 5.454   -13.220 -7.752  1.00 0.00 ? 1206 GLU A H    5  
ATOM 7934  H HA   . GLU A 1 74  ? 3.330   -11.610 -8.655  1.00 0.00 ? 1206 GLU A HA   5  
ATOM 7935  H HB2  . GLU A 1 74  ? 4.454   -13.259 -10.082 1.00 0.00 ? 1206 GLU A HB2  5  
ATOM 7936  H HB3  . GLU A 1 74  ? 3.807   -14.562 -9.097  1.00 0.00 ? 1206 GLU A HB3  5  
ATOM 7937  H HG2  . GLU A 1 74  ? 2.336   -14.571 -10.840 1.00 0.00 ? 1206 GLU A HG2  5  
ATOM 7938  H HG3  . GLU A 1 74  ? 1.506   -13.495 -9.717  1.00 0.00 ? 1206 GLU A HG3  5  
ATOM 7939  N N    . GLY A 1 75  ? 1.164   -12.396 -7.657  1.00 0.00 ? 1207 GLY A N    5  
ATOM 7940  C CA   . GLY A 1 75  ? -0.025  -12.704 -6.884  1.00 0.00 ? 1207 GLY A CA   5  
ATOM 7941  C C    . GLY A 1 75  ? -0.027  -12.026 -5.528  1.00 0.00 ? 1207 GLY A C    5  
ATOM 7942  O O    . GLY A 1 75  ? -0.976  -11.324 -5.177  1.00 0.00 ? 1207 GLY A O    5  
ATOM 7943  H H    . GLY A 1 75  ? 1.122   -11.726 -8.370  1.00 0.00 ? 1207 GLY A H    5  
ATOM 7944  H HA2  . GLY A 1 75  ? -0.894  -12.382 -7.437  1.00 0.00 ? 1207 GLY A HA2  5  
ATOM 7945  H HA3  . GLY A 1 75  ? -0.079  -13.773 -6.738  1.00 0.00 ? 1207 GLY A HA3  5  
ATOM 7946  N N    . LYS A 1 76  ? 1.038   -12.235 -4.762  1.00 0.00 ? 1208 LYS A N    5  
ATOM 7947  C CA   . LYS A 1 76  ? 1.157   -11.640 -3.436  1.00 0.00 ? 1208 LYS A CA   5  
ATOM 7948  C C    . LYS A 1 76  ? 0.673   -10.193 -3.444  1.00 0.00 ? 1208 LYS A C    5  
ATOM 7949  O O    . LYS A 1 76  ? -0.187  -9.812  -2.650  1.00 0.00 ? 1208 LYS A O    5  
ATOM 7950  C CB   . LYS A 1 76  ? 2.609   -11.701 -2.956  1.00 0.00 ? 1208 LYS A CB   5  
ATOM 7951  C CG   . LYS A 1 76  ? 2.868   -10.885 -1.701  1.00 0.00 ? 1208 LYS A CG   5  
ATOM 7952  C CD   . LYS A 1 76  ? 4.335   -10.510 -1.574  1.00 0.00 ? 1208 LYS A CD   5  
ATOM 7953  C CE   . LYS A 1 76  ? 5.183   -11.705 -1.167  1.00 0.00 ? 1208 LYS A CE   5  
ATOM 7954  N NZ   . LYS A 1 76  ? 6.622   -11.346 -1.035  1.00 0.00 ? 1208 LYS A NZ   5  
ATOM 7955  H H    . LYS A 1 76  ? 1.763   -12.804 -5.097  1.00 0.00 ? 1208 LYS A H    5  
ATOM 7956  H HA   . LYS A 1 76  ? 0.538   -12.210 -2.760  1.00 0.00 ? 1208 LYS A HA   5  
ATOM 7957  H HB2  . LYS A 1 76  ? 2.864   -12.730 -2.750  1.00 0.00 ? 1208 LYS A HB2  5  
ATOM 7958  H HB3  . LYS A 1 76  ? 3.251   -11.329 -3.741  1.00 0.00 ? 1208 LYS A HB3  5  
ATOM 7959  H HG2  . LYS A 1 76  ? 2.279   -9.981  -1.742  1.00 0.00 ? 1208 LYS A HG2  5  
ATOM 7960  H HG3  . LYS A 1 76  ? 2.579   -11.467 -0.838  1.00 0.00 ? 1208 LYS A HG3  5  
ATOM 7961  H HD2  . LYS A 1 76  ? 4.688   -10.141 -2.525  1.00 0.00 ? 1208 LYS A HD2  5  
ATOM 7962  H HD3  . LYS A 1 76  ? 4.436   -9.736  -0.826  1.00 0.00 ? 1208 LYS A HD3  5  
ATOM 7963  H HE2  . LYS A 1 76  ? 4.826   -12.077 -0.218  1.00 0.00 ? 1208 LYS A HE2  5  
ATOM 7964  H HE3  . LYS A 1 76  ? 5.080   -12.475 -1.917  1.00 0.00 ? 1208 LYS A HE3  5  
ATOM 7965  H HZ1  . LYS A 1 76  ? 6.915   -10.748 -1.834  1.00 0.00 ? 1208 LYS A HZ1  5  
ATOM 7966  H HZ2  . LYS A 1 76  ? 7.206   -12.206 -1.029  1.00 0.00 ? 1208 LYS A HZ2  5  
ATOM 7967  H HZ3  . LYS A 1 76  ? 6.781   -10.825 -0.149  1.00 0.00 ? 1208 LYS A HZ3  5  
ATOM 7968  N N    . ALA A 1 77  ? 1.230   -9.393  -4.347  1.00 0.00 ? 1209 ALA A N    5  
ATOM 7969  C CA   . ALA A 1 77  ? 0.852   -7.990  -4.461  1.00 0.00 ? 1209 ALA A CA   5  
ATOM 7970  C C    . ALA A 1 77  ? -0.633  -7.796  -4.171  1.00 0.00 ? 1209 ALA A C    5  
ATOM 7971  O O    . ALA A 1 77  ? -1.012  -6.941  -3.370  1.00 0.00 ? 1209 ALA A O    5  
ATOM 7972  C CB   . ALA A 1 77  ? 1.195   -7.461  -5.845  1.00 0.00 ? 1209 ALA A CB   5  
ATOM 7973  H H    . ALA A 1 77  ? 1.909   -9.755  -4.953  1.00 0.00 ? 1209 ALA A H    5  
ATOM 7974  H HA   . ALA A 1 77  ? 1.426   -7.430  -3.736  1.00 0.00 ? 1209 ALA A HA   5  
ATOM 7975  H HB1  . ALA A 1 77  ? 1.188   -8.277  -6.553  1.00 0.00 ? 1209 ALA A HB1  5  
ATOM 7976  H HB2  . ALA A 1 77  ? 0.464   -6.722  -6.140  1.00 0.00 ? 1209 ALA A HB2  5  
ATOM 7977  H HB3  . ALA A 1 77  ? 2.175   -7.010  -5.826  1.00 0.00 ? 1209 ALA A HB3  5  
ATOM 7978  N N    . ALA A 1 78  ? -1.468  -8.594  -4.827  1.00 0.00 ? 1210 ALA A N    5  
ATOM 7979  C CA   . ALA A 1 78  ? -2.911  -8.510  -4.639  1.00 0.00 ? 1210 ALA A CA   5  
ATOM 7980  C C    . ALA A 1 78  ? -3.262  -8.301  -3.169  1.00 0.00 ? 1210 ALA A C    5  
ATOM 7981  O O    . ALA A 1 78  ? -3.785  -7.255  -2.789  1.00 0.00 ? 1210 ALA A O    5  
ATOM 7982  C CB   . ALA A 1 78  ? -3.586  -9.765  -5.171  1.00 0.00 ? 1210 ALA A CB   5  
ATOM 7983  H H    . ALA A 1 78  ? -1.105  -9.255  -5.452  1.00 0.00 ? 1210 ALA A H    5  
ATOM 7984  H HA   . ALA A 1 78  ? -3.274  -7.667  -5.208  1.00 0.00 ? 1210 ALA A HA   5  
ATOM 7985  H HB1  . ALA A 1 78  ? -4.494  -9.492  -5.690  1.00 0.00 ? 1210 ALA A HB1  5  
ATOM 7986  H HB2  . ALA A 1 78  ? -2.920  -10.271 -5.853  1.00 0.00 ? 1210 ALA A HB2  5  
ATOM 7987  H HB3  . ALA A 1 78  ? -3.826  -10.422 -4.348  1.00 0.00 ? 1210 ALA A HB3  5  
ATOM 7988  N N    . MET A 1 79  ? -2.970  -9.305  -2.348  1.00 0.00 ? 1211 MET A N    5  
ATOM 7989  C CA   . MET A 1 79  ? -3.254  -9.230  -0.919  1.00 0.00 ? 1211 MET A CA   5  
ATOM 7990  C C    . MET A 1 79  ? -2.736  -7.922  -0.330  1.00 0.00 ? 1211 MET A C    5  
ATOM 7991  O O    . MET A 1 79  ? -3.239  -7.446  0.689   1.00 0.00 ? 1211 MET A O    5  
ATOM 7992  C CB   . MET A 1 79  ? -2.624  -10.417 -0.189  1.00 0.00 ? 1211 MET A CB   5  
ATOM 7993  C CG   . MET A 1 79  ? -1.176  -10.185 0.211   1.00 0.00 ? 1211 MET A CG   5  
ATOM 7994  S SD   . MET A 1 79  ? -0.233  -11.718 0.326   1.00 0.00 ? 1211 MET A SD   5  
ATOM 7995  C CE   . MET A 1 79  ? 1.064   -11.234 1.463   1.00 0.00 ? 1211 MET A CE   5  
ATOM 7996  H H    . MET A 1 79  ? -2.553  -10.114 -2.710  1.00 0.00 ? 1211 MET A H    5  
ATOM 7997  H HA   . MET A 1 79  ? -4.326  -9.268  -0.793  1.00 0.00 ? 1211 MET A HA   5  
ATOM 7998  H HB2  . MET A 1 79  ? -3.194  -10.618 0.705   1.00 0.00 ? 1211 MET A HB2  5  
ATOM 7999  H HB3  . MET A 1 79  ? -2.662  -11.283 -0.833  1.00 0.00 ? 1211 MET A HB3  5  
ATOM 8000  H HG2  . MET A 1 79  ? -0.710  -9.548  -0.526  1.00 0.00 ? 1211 MET A HG2  5  
ATOM 8001  H HG3  . MET A 1 79  ? -1.157  -9.694  1.172   1.00 0.00 ? 1211 MET A HG3  5  
ATOM 8002  H HE1  . MET A 1 79  ? 1.430   -12.105 1.984   1.00 0.00 ? 1211 MET A HE1  5  
ATOM 8003  H HE2  . MET A 1 79  ? 1.872   -10.777 0.911   1.00 0.00 ? 1211 MET A HE2  5  
ATOM 8004  H HE3  . MET A 1 79  ? 0.669   -10.526 2.177   1.00 0.00 ? 1211 MET A HE3  5  
ATOM 8005  N N    . LEU A 1 80  ? -1.728  -7.346  -0.975  1.00 0.00 ? 1212 LEU A N    5  
ATOM 8006  C CA   . LEU A 1 80  ? -1.140  -6.092  -0.514  1.00 0.00 ? 1212 LEU A CA   5  
ATOM 8007  C C    . LEU A 1 80  ? -1.858  -4.896  -1.131  1.00 0.00 ? 1212 LEU A C    5  
ATOM 8008  O O    . LEU A 1 80  ? -1.250  -3.855  -1.378  1.00 0.00 ? 1212 LEU A O    5  
ATOM 8009  C CB   . LEU A 1 80  ? 0.348   -6.045  -0.864  1.00 0.00 ? 1212 LEU A CB   5  
ATOM 8010  C CG   . LEU A 1 80  ? 1.214   -7.154  -0.266  1.00 0.00 ? 1212 LEU A CG   5  
ATOM 8011  C CD1  . LEU A 1 80  ? 2.607   -7.130  -0.875  1.00 0.00 ? 1212 LEU A CD1  5  
ATOM 8012  C CD2  . LEU A 1 80  ? 1.289   -7.014  1.248   1.00 0.00 ? 1212 LEU A CD2  5  
ATOM 8013  H H    . LEU A 1 80  ? -1.369  -7.773  -1.781  1.00 0.00 ? 1212 LEU A H    5  
ATOM 8014  H HA   . LEU A 1 80  ? -1.251  -6.050  0.559   1.00 0.00 ? 1212 LEU A HA   5  
ATOM 8015  H HB2  . LEU A 1 80  ? 0.437   -6.099  -1.938  1.00 0.00 ? 1212 LEU A HB2  5  
ATOM 8016  H HB3  . LEU A 1 80  ? 0.737   -5.097  -0.519  1.00 0.00 ? 1212 LEU A HB3  5  
ATOM 8017  H HG   . LEU A 1 80  ? 0.767   -8.112  -0.492  1.00 0.00 ? 1212 LEU A HG   5  
ATOM 8018  H HD11 . LEU A 1 80  ? 2.548   -7.393  -1.920  1.00 0.00 ? 1212 LEU A HD11 5  
ATOM 8019  H HD12 . LEU A 1 80  ? 3.237   -7.841  -0.361  1.00 0.00 ? 1212 LEU A HD12 5  
ATOM 8020  H HD13 . LEU A 1 80  ? 3.027   -6.140  -0.775  1.00 0.00 ? 1212 LEU A HD13 5  
ATOM 8021  H HD21 . LEU A 1 80  ? 0.290   -6.939  1.652   1.00 0.00 ? 1212 LEU A HD21 5  
ATOM 8022  H HD22 . LEU A 1 80  ? 1.847   -6.124  1.500   1.00 0.00 ? 1212 LEU A HD22 5  
ATOM 8023  H HD23 . LEU A 1 80  ? 1.783   -7.879  1.665   1.00 0.00 ? 1212 LEU A HD23 5  
ATOM 8024  N N    . ALA A 1 81  ? -3.155  -5.052  -1.374  1.00 0.00 ? 1213 ALA A N    5  
ATOM 8025  C CA   . ALA A 1 81  ? -3.957  -3.983  -1.957  1.00 0.00 ? 1213 ALA A CA   5  
ATOM 8026  C C    . ALA A 1 81  ? -4.132  -2.830  -0.975  1.00 0.00 ? 1213 ALA A C    5  
ATOM 8027  O O    . ALA A 1 81  ? -3.851  -1.671  -1.284  1.00 0.00 ? 1213 ALA A O    5  
ATOM 8028  C CB   . ALA A 1 81  ? -5.313  -4.518  -2.394  1.00 0.00 ? 1213 ALA A CB   5  
ATOM 8029  H H    . ALA A 1 81  ? -3.584  -5.905  -1.155  1.00 0.00 ? 1213 ALA A H    5  
ATOM 8030  H HA   . ALA A 1 81  ? -3.441  -3.620  -2.835  1.00 0.00 ? 1213 ALA A HA   5  
ATOM 8031  H HB1  . ALA A 1 81  ? -6.093  -3.997  -1.859  1.00 0.00 ? 1213 ALA A HB1  5  
ATOM 8032  H HB2  . ALA A 1 81  ? -5.437  -4.361  -3.455  1.00 0.00 ? 1213 ALA A HB2  5  
ATOM 8033  H HB3  . ALA A 1 81  ? -5.370  -5.574  -2.176  1.00 0.00 ? 1213 ALA A HB3  5  
ATOM 8034  N N    . PRO A 1 82  ? -4.609  -3.151  0.237   1.00 0.00 ? 1214 PRO A N    5  
ATOM 8035  C CA   . PRO A 1 82  ? -4.832  -2.155  1.289   1.00 0.00 ? 1214 PRO A CA   5  
ATOM 8036  C C    . PRO A 1 82  ? -3.637  -1.226  1.472   1.00 0.00 ? 1214 PRO A C    5  
ATOM 8037  O O    . PRO A 1 82  ? -3.758  -0.148  2.055   1.00 0.00 ? 1214 PRO A O    5  
ATOM 8038  C CB   . PRO A 1 82  ? -5.046  -3.005  2.543   1.00 0.00 ? 1214 PRO A CB   5  
ATOM 8039  C CG   . PRO A 1 82  ? -5.558  -4.309  2.034   1.00 0.00 ? 1214 PRO A CG   5  
ATOM 8040  C CD   . PRO A 1 82  ? -4.965  -4.511  0.674   1.00 0.00 ? 1214 PRO A CD   5  
ATOM 8041  H HA   . PRO A 1 82  ? -5.717  -1.566  1.096   1.00 0.00 ? 1214 PRO A HA   5  
ATOM 8042  H HB2  . PRO A 1 82  ? -4.106  -3.125  3.064   1.00 0.00 ? 1214 PRO A HB2  5  
ATOM 8043  H HB3  . PRO A 1 82  ? -5.764  -2.525  3.190   1.00 0.00 ? 1214 PRO A HB3  5  
ATOM 8044  H HG2  . PRO A 1 82  ? -5.247  -5.107  2.691   1.00 0.00 ? 1214 PRO A HG2  5  
ATOM 8045  H HG3  . PRO A 1 82  ? -6.635  -4.277  1.963   1.00 0.00 ? 1214 PRO A HG3  5  
ATOM 8046  H HD2  . PRO A 1 82  ? -4.088  -5.138  0.738   1.00 0.00 ? 1214 PRO A HD2  5  
ATOM 8047  H HD3  . PRO A 1 82  ? -5.696  -4.949  0.010   1.00 0.00 ? 1214 PRO A HD3  5  
ATOM 8048  N N    . LEU A 1 83  ? -2.482  -1.651  0.970   1.00 0.00 ? 1215 LEU A N    5  
ATOM 8049  C CA   . LEU A 1 83  ? -1.263  -0.857  1.078   1.00 0.00 ? 1215 LEU A CA   5  
ATOM 8050  C C    . LEU A 1 83  ? -1.244  0.256   0.035   1.00 0.00 ? 1215 LEU A C    5  
ATOM 8051  O O    . LEU A 1 83  ? -1.358  1.435   0.369   1.00 0.00 ? 1215 LEU A O    5  
ATOM 8052  C CB   . LEU A 1 83  ? -0.032  -1.750  0.911   1.00 0.00 ? 1215 LEU A CB   5  
ATOM 8053  C CG   . LEU A 1 83  ? 0.360   -2.587  2.129   1.00 0.00 ? 1215 LEU A CG   5  
ATOM 8054  C CD1  . LEU A 1 83  ? -0.568  -3.783  2.276   1.00 0.00 ? 1215 LEU A CD1  5  
ATOM 8055  C CD2  . LEU A 1 83  ? 1.808   -3.043  2.018   1.00 0.00 ? 1215 LEU A CD2  5  
ATOM 8056  H H    . LEU A 1 83  ? -2.447  -2.518  0.517   1.00 0.00 ? 1215 LEU A H    5  
ATOM 8057  H HA   . LEU A 1 83  ? -1.244  -0.411  2.062   1.00 0.00 ? 1215 LEU A HA   5  
ATOM 8058  H HB2  . LEU A 1 83  ? -0.224  -2.427  0.093   1.00 0.00 ? 1215 LEU A HB2  5  
ATOM 8059  H HB3  . LEU A 1 83  ? 0.805   -1.114  0.661   1.00 0.00 ? 1215 LEU A HB3  5  
ATOM 8060  H HG   . LEU A 1 83  ? 0.266   -1.981  3.020   1.00 0.00 ? 1215 LEU A HG   5  
ATOM 8061  H HD11 . LEU A 1 83  ? -0.459  -4.430  1.419   1.00 0.00 ? 1215 LEU A HD11 5  
ATOM 8062  H HD12 . LEU A 1 83  ? -1.590  -3.440  2.342   1.00 0.00 ? 1215 LEU A HD12 5  
ATOM 8063  H HD13 . LEU A 1 83  ? -0.313  -4.327  3.174   1.00 0.00 ? 1215 LEU A HD13 5  
ATOM 8064  H HD21 . LEU A 1 83  ? 1.921   -4.000  2.506   1.00 0.00 ? 1215 LEU A HD21 5  
ATOM 8065  H HD22 . LEU A 1 83  ? 2.451   -2.318  2.496   1.00 0.00 ? 1215 LEU A HD22 5  
ATOM 8066  H HD23 . LEU A 1 83  ? 2.078   -3.135  0.977   1.00 0.00 ? 1215 LEU A HD23 5  
ATOM 8067  N N    . TRP A 1 84  ? -1.100  -0.128  -1.228  1.00 0.00 ? 1216 TRP A N    5  
ATOM 8068  C CA   . TRP A 1 84  ? -1.068  0.838   -2.321  1.00 0.00 ? 1216 TRP A CA   5  
ATOM 8069  C C    . TRP A 1 84  ? -2.335  1.687   -2.335  1.00 0.00 ? 1216 TRP A C    5  
ATOM 8070  O O    . TRP A 1 84  ? -2.327  2.820   -2.815  1.00 0.00 ? 1216 TRP A O    5  
ATOM 8071  C CB   . TRP A 1 84  ? -0.908  0.117   -3.661  1.00 0.00 ? 1216 TRP A CB   5  
ATOM 8072  C CG   . TRP A 1 84  ? -2.180  -0.498  -4.160  1.00 0.00 ? 1216 TRP A CG   5  
ATOM 8073  C CD1  . TRP A 1 84  ? -3.352  0.148   -4.433  1.00 0.00 ? 1216 TRP A CD1  5  
ATOM 8074  C CD2  . TRP A 1 84  ? -2.408  -1.883  -4.443  1.00 0.00 ? 1216 TRP A CD2  5  
ATOM 8075  N NE1  . TRP A 1 84  ? -4.294  -0.751  -4.869  1.00 0.00 ? 1216 TRP A NE1  5  
ATOM 8076  C CE2  . TRP A 1 84  ? -3.740  -2.004  -4.885  1.00 0.00 ? 1216 TRP A CE2  5  
ATOM 8077  C CE3  . TRP A 1 84  ? -1.617  -3.032  -4.369  1.00 0.00 ? 1216 TRP A CE3  5  
ATOM 8078  C CZ2  . TRP A 1 84  ? -4.295  -3.228  -5.249  1.00 0.00 ? 1216 TRP A CZ2  5  
ATOM 8079  C CZ3  . TRP A 1 84  ? -2.169  -4.246  -4.730  1.00 0.00 ? 1216 TRP A CZ3  5  
ATOM 8080  C CH2  . TRP A 1 84  ? -3.498  -4.337  -5.166  1.00 0.00 ? 1216 TRP A CH2  5  
ATOM 8081  H H    . TRP A 1 84  ? -1.013  -1.083  -1.432  1.00 0.00 ? 1216 TRP A H    5  
ATOM 8082  H HA   . TRP A 1 84  ? -0.217  1.484   -2.166  1.00 0.00 ? 1216 TRP A HA   5  
ATOM 8083  H HB2  . TRP A 1 84  ? -0.565  0.823   -4.403  1.00 0.00 ? 1216 TRP A HB2  5  
ATOM 8084  H HB3  . TRP A 1 84  ? -0.176  -0.670  -3.552  1.00 0.00 ? 1216 TRP A HB3  5  
ATOM 8085  H HD1  . TRP A 1 84  ? -3.501  1.211   -4.317  1.00 0.00 ? 1216 TRP A HD1  5  
ATOM 8086  H HE1  . TRP A 1 84  ? -5.214  -0.531  -5.128  1.00 0.00 ? 1216 TRP A HE1  5  
ATOM 8087  H HE3  . TRP A 1 84  ? -0.590  -2.983  -4.035  1.00 0.00 ? 1216 TRP A HE3  5  
ATOM 8088  H HZ2  . TRP A 1 84  ? -5.318  -3.314  -5.588  1.00 0.00 ? 1216 TRP A HZ2  5  
ATOM 8089  H HZ3  . TRP A 1 84  ? -1.573  -5.145  -4.678  1.00 0.00 ? 1216 TRP A HZ3  5  
ATOM 8090  H HH2  . TRP A 1 84  ? -3.887  -5.305  -5.438  1.00 0.00 ? 1216 TRP A HH2  5  
ATOM 8091  N N    . GLU A 1 85  ? -3.420  1.131   -1.805  1.00 0.00 ? 1217 GLU A N    5  
ATOM 8092  C CA   . GLU A 1 85  ? -4.694  1.839   -1.757  1.00 0.00 ? 1217 GLU A CA   5  
ATOM 8093  C C    . GLU A 1 85  ? -4.549  3.172   -1.029  1.00 0.00 ? 1217 GLU A C    5  
ATOM 8094  O O    . GLU A 1 85  ? -5.167  4.168   -1.405  1.00 0.00 ? 1217 GLU A O    5  
ATOM 8095  C CB   . GLU A 1 85  ? -5.755  0.980   -1.066  1.00 0.00 ? 1217 GLU A CB   5  
ATOM 8096  C CG   . GLU A 1 85  ? -6.408  -0.038  -1.985  1.00 0.00 ? 1217 GLU A CG   5  
ATOM 8097  C CD   . GLU A 1 85  ? -7.708  -0.581  -1.424  1.00 0.00 ? 1217 GLU A CD   5  
ATOM 8098  O OE1  . GLU A 1 85  ? -7.780  -0.794  -0.195  1.00 0.00 ? 1217 GLU A OE1  5  
ATOM 8099  O OE2  . GLU A 1 85  ? -8.652  -0.794  -2.213  1.00 0.00 ? 1217 GLU A OE2  5  
ATOM 8100  H H    . GLU A 1 85  ? -3.363  0.224   -1.438  1.00 0.00 ? 1217 GLU A H    5  
ATOM 8101  H HA   . GLU A 1 85  ? -5.005  2.030   -2.773  1.00 0.00 ? 1217 GLU A HA   5  
ATOM 8102  H HB2  . GLU A 1 85  ? -5.293  0.450   -0.246  1.00 0.00 ? 1217 GLU A HB2  5  
ATOM 8103  H HB3  . GLU A 1 85  ? -6.526  1.628   -0.675  1.00 0.00 ? 1217 GLU A HB3  5  
ATOM 8104  H HG2  . GLU A 1 85  ? -6.613  0.433   -2.935  1.00 0.00 ? 1217 GLU A HG2  5  
ATOM 8105  H HG3  . GLU A 1 85  ? -5.725  -0.861  -2.133  1.00 0.00 ? 1217 GLU A HG3  5  
ATOM 8106  N N    . VAL A 1 86  ? -3.728  3.182   0.016   1.00 0.00 ? 1218 VAL A N    5  
ATOM 8107  C CA   . VAL A 1 86  ? -3.500  4.392   0.798   1.00 0.00 ? 1218 VAL A CA   5  
ATOM 8108  C C    . VAL A 1 86  ? -2.679  5.408   0.012   1.00 0.00 ? 1218 VAL A C    5  
ATOM 8109  O O    . VAL A 1 86  ? -2.965  6.605   0.037   1.00 0.00 ? 1218 VAL A O    5  
ATOM 8110  C CB   . VAL A 1 86  ? -2.777  4.077   2.121   1.00 0.00 ? 1218 VAL A CB   5  
ATOM 8111  C CG1  . VAL A 1 86  ? -2.459  5.360   2.874   1.00 0.00 ? 1218 VAL A CG1  5  
ATOM 8112  C CG2  . VAL A 1 86  ? -3.617  3.141   2.977   1.00 0.00 ? 1218 VAL A CG2  5  
ATOM 8113  H H    . VAL A 1 86  ? -3.263  2.357   0.267   1.00 0.00 ? 1218 VAL A H    5  
ATOM 8114  H HA   . VAL A 1 86  ? -4.462  4.824   1.032   1.00 0.00 ? 1218 VAL A HA   5  
ATOM 8115  H HB   . VAL A 1 86  ? -1.846  3.582   1.890   1.00 0.00 ? 1218 VAL A HB   5  
ATOM 8116  H HG11 . VAL A 1 86  ? -1.433  5.335   3.211   1.00 0.00 ? 1218 VAL A HG11 5  
ATOM 8117  H HG12 . VAL A 1 86  ? -2.604  6.207   2.220   1.00 0.00 ? 1218 VAL A HG12 5  
ATOM 8118  H HG13 . VAL A 1 86  ? -3.115  5.448   3.728   1.00 0.00 ? 1218 VAL A HG13 5  
ATOM 8119  H HG21 . VAL A 1 86  ? -4.281  3.722   3.600   1.00 0.00 ? 1218 VAL A HG21 5  
ATOM 8120  H HG22 . VAL A 1 86  ? -4.199  2.493   2.338   1.00 0.00 ? 1218 VAL A HG22 5  
ATOM 8121  H HG23 . VAL A 1 86  ? -2.968  2.544   3.600   1.00 0.00 ? 1218 VAL A HG23 5  
ATOM 8122  N N    . ILE A 1 87  ? -1.658  4.922   -0.686  1.00 0.00 ? 1219 ILE A N    5  
ATOM 8123  C CA   . ILE A 1 87  ? -0.796  5.788   -1.481  1.00 0.00 ? 1219 ILE A CA   5  
ATOM 8124  C C    . ILE A 1 87  ? -1.613  6.635   -2.451  1.00 0.00 ? 1219 ILE A C    5  
ATOM 8125  O O    . ILE A 1 87  ? -1.491  7.860   -2.479  1.00 0.00 ? 1219 ILE A O    5  
ATOM 8126  C CB   . ILE A 1 87  ? 0.241   4.973   -2.276  1.00 0.00 ? 1219 ILE A CB   5  
ATOM 8127  C CG1  . ILE A 1 87  ? 1.133   4.175   -1.323  1.00 0.00 ? 1219 ILE A CG1  5  
ATOM 8128  C CG2  . ILE A 1 87  ? 1.080   5.893   -3.150  1.00 0.00 ? 1219 ILE A CG2  5  
ATOM 8129  C CD1  . ILE A 1 87  ? 2.046   3.195   -2.028  1.00 0.00 ? 1219 ILE A CD1  5  
ATOM 8130  H H    . ILE A 1 87  ? -1.481  3.959   -0.666  1.00 0.00 ? 1219 ILE A H    5  
ATOM 8131  H HA   . ILE A 1 87  ? -0.268  6.444   -0.804  1.00 0.00 ? 1219 ILE A HA   5  
ATOM 8132  H HB   . ILE A 1 87  ? -0.289  4.289   -2.920  1.00 0.00 ? 1219 ILE A HB   5  
ATOM 8133  H HG12 . ILE A 1 87  ? 1.751   4.857   -0.761  1.00 0.00 ? 1219 ILE A HG12 5  
ATOM 8134  H HG13 . ILE A 1 87  ? 0.509   3.616   -0.641  1.00 0.00 ? 1219 ILE A HG13 5  
ATOM 8135  H HG21 . ILE A 1 87  ? 0.461   6.312   -3.929  1.00 0.00 ? 1219 ILE A HG21 5  
ATOM 8136  H HG22 . ILE A 1 87  ? 1.486   6.691   -2.546  1.00 0.00 ? 1219 ILE A HG22 5  
ATOM 8137  H HG23 . ILE A 1 87  ? 1.888   5.331   -3.594  1.00 0.00 ? 1219 ILE A HG23 5  
ATOM 8138  H HD11 . ILE A 1 87  ? 2.628   2.655   -1.296  1.00 0.00 ? 1219 ILE A HD11 5  
ATOM 8139  H HD12 . ILE A 1 87  ? 1.453   2.500   -2.602  1.00 0.00 ? 1219 ILE A HD12 5  
ATOM 8140  H HD13 . ILE A 1 87  ? 2.710   3.734   -2.689  1.00 0.00 ? 1219 ILE A HD13 5  
ATOM 8141  N N    . LYS A 1 88  ? -2.447  5.974   -3.247  1.00 0.00 ? 1220 LYS A N    5  
ATOM 8142  C CA   . LYS A 1 88  ? -3.288  6.665   -4.218  1.00 0.00 ? 1220 LYS A CA   5  
ATOM 8143  C C    . LYS A 1 88  ? -3.947  7.890   -3.592  1.00 0.00 ? 1220 LYS A C    5  
ATOM 8144  O O    . LYS A 1 88  ? -3.971  8.967   -4.189  1.00 0.00 ? 1220 LYS A O    5  
ATOM 8145  C CB   . LYS A 1 88  ? -4.359  5.717   -4.761  1.00 0.00 ? 1220 LYS A CB   5  
ATOM 8146  C CG   . LYS A 1 88  ? -4.923  6.143   -6.106  1.00 0.00 ? 1220 LYS A CG   5  
ATOM 8147  C CD   . LYS A 1 88  ? -6.172  5.355   -6.462  1.00 0.00 ? 1220 LYS A CD   5  
ATOM 8148  C CE   . LYS A 1 88  ? -5.828  3.955   -6.946  1.00 0.00 ? 1220 LYS A CE   5  
ATOM 8149  N NZ   . LYS A 1 88  ? -7.040  3.099   -7.075  1.00 0.00 ? 1220 LYS A NZ   5  
ATOM 8150  H H    . LYS A 1 88  ? -2.500  4.997   -3.178  1.00 0.00 ? 1220 LYS A H    5  
ATOM 8151  H HA   . LYS A 1 88  ? -2.657  6.987   -5.033  1.00 0.00 ? 1220 LYS A HA   5  
ATOM 8152  H HB2  . LYS A 1 88  ? -3.930  4.732   -4.869  1.00 0.00 ? 1220 LYS A HB2  5  
ATOM 8153  H HB3  . LYS A 1 88  ? -5.174  5.670   -4.052  1.00 0.00 ? 1220 LYS A HB3  5  
ATOM 8154  H HG2  . LYS A 1 88  ? -5.172  7.193   -6.065  1.00 0.00 ? 1220 LYS A HG2  5  
ATOM 8155  H HG3  . LYS A 1 88  ? -4.174  5.978   -6.868  1.00 0.00 ? 1220 LYS A HG3  5  
ATOM 8156  H HD2  . LYS A 1 88  ? -6.800  5.277   -5.587  1.00 0.00 ? 1220 LYS A HD2  5  
ATOM 8157  H HD3  . LYS A 1 88  ? -6.705  5.876   -7.244  1.00 0.00 ? 1220 LYS A HD3  5  
ATOM 8158  H HE2  . LYS A 1 88  ? -5.347  4.029   -7.909  1.00 0.00 ? 1220 LYS A HE2  5  
ATOM 8159  H HE3  . LYS A 1 88  ? -5.150  3.500   -6.239  1.00 0.00 ? 1220 LYS A HE3  5  
ATOM 8160  H HZ1  . LYS A 1 88  ? -7.894  3.692   -7.107  1.00 0.00 ? 1220 LYS A HZ1  5  
ATOM 8161  H HZ2  . LYS A 1 88  ? -7.111  2.455   -6.262  1.00 0.00 ? 1220 LYS A HZ2  5  
ATOM 8162  H HZ3  . LYS A 1 88  ? -6.989  2.535   -7.947  1.00 0.00 ? 1220 LYS A HZ3  5  
ATOM 8163  N N    . HIS A 1 89  ? -4.479  7.719   -2.386  1.00 0.00 ? 1221 HIS A N    5  
ATOM 8164  C CA   . HIS A 1 89  ? -5.137  8.813   -1.679  1.00 0.00 ? 1221 HIS A CA   5  
ATOM 8165  C C    . HIS A 1 89  ? -4.114  9.824   -1.171  1.00 0.00 ? 1221 HIS A C    5  
ATOM 8166  O O    . HIS A 1 89  ? -4.287  11.032  -1.334  1.00 0.00 ? 1221 HIS A O    5  
ATOM 8167  C CB   . HIS A 1 89  ? -5.960  8.270   -0.510  1.00 0.00 ? 1221 HIS A CB   5  
ATOM 8168  C CG   . HIS A 1 89  ? -7.044  9.199   -0.059  1.00 0.00 ? 1221 HIS A CG   5  
ATOM 8169  N ND1  . HIS A 1 89  ? -8.247  8.760   0.451   1.00 0.00 ? 1221 HIS A ND1  5  
ATOM 8170  C CD2  . HIS A 1 89  ? -7.101  10.551  -0.041  1.00 0.00 ? 1221 HIS A CD2  5  
ATOM 8171  C CE1  . HIS A 1 89  ? -8.998  9.802   0.762   1.00 0.00 ? 1221 HIS A CE1  5  
ATOM 8172  N NE2  . HIS A 1 89  ? -8.325  10.901  0.473   1.00 0.00 ? 1221 HIS A NE2  5  
ATOM 8173  H H    . HIS A 1 89  ? -4.428  6.838   -1.962  1.00 0.00 ? 1221 HIS A H    5  
ATOM 8174  H HA   . HIS A 1 89  ? -5.798  9.307   -2.375  1.00 0.00 ? 1221 HIS A HA   5  
ATOM 8175  H HB2  . HIS A 1 89  ? -6.422  7.340   -0.805  1.00 0.00 ? 1221 HIS A HB2  5  
ATOM 8176  H HB3  . HIS A 1 89  ? -5.304  8.090   0.330   1.00 0.00 ? 1221 HIS A HB3  5  
ATOM 8177  H HD1  . HIS A 1 89  ? -8.512  7.824   0.567   1.00 0.00 ? 1221 HIS A HD1  5  
ATOM 8178  H HD2  . HIS A 1 89  ? -6.327  11.231  -0.371  1.00 0.00 ? 1221 HIS A HD2  5  
ATOM 8179  H HE1  . HIS A 1 89  ? -9.993  9.762   1.181   1.00 0.00 ? 1221 HIS A HE1  5  
ATOM 8180  H HE2  . HIS A 1 89  ? -8.683  11.812  0.525   1.00 0.00 ? 1221 HIS A HE2  5  
ATOM 8181  N N    . PHE A 1 90  ? -3.050  9.323   -0.554  1.00 0.00 ? 1222 PHE A N    5  
ATOM 8182  C CA   . PHE A 1 90  ? -2.000  10.183  -0.020  1.00 0.00 ? 1222 PHE A CA   5  
ATOM 8183  C C    . PHE A 1 90  ? -1.533  11.187  -1.070  1.00 0.00 ? 1222 PHE A C    5  
ATOM 8184  O O    . PHE A 1 90  ? -1.620  12.398  -0.867  1.00 0.00 ? 1222 PHE A O    5  
ATOM 8185  C CB   . PHE A 1 90  ? -0.816  9.340   0.459   1.00 0.00 ? 1222 PHE A CB   5  
ATOM 8186  C CG   . PHE A 1 90  ? 0.388   10.157  0.834   1.00 0.00 ? 1222 PHE A CG   5  
ATOM 8187  C CD1  . PHE A 1 90  ? 0.552   10.619  2.129   1.00 0.00 ? 1222 PHE A CD1  5  
ATOM 8188  C CD2  . PHE A 1 90  ? 1.356   10.461  -0.110  1.00 0.00 ? 1222 PHE A CD2  5  
ATOM 8189  C CE1  . PHE A 1 90  ? 1.658   11.372  2.477   1.00 0.00 ? 1222 PHE A CE1  5  
ATOM 8190  C CE2  . PHE A 1 90  ? 2.465   11.213  0.232   1.00 0.00 ? 1222 PHE A CE2  5  
ATOM 8191  C CZ   . PHE A 1 90  ? 2.616   11.668  1.527   1.00 0.00 ? 1222 PHE A CZ   5  
ATOM 8192  H H    . PHE A 1 90  ? -2.968  8.351   -0.454  1.00 0.00 ? 1222 PHE A H    5  
ATOM 8193  H HA   . PHE A 1 90  ? -2.410  10.722  0.820   1.00 0.00 ? 1222 PHE A HA   5  
ATOM 8194  H HB2  . PHE A 1 90  ? -1.114  8.773   1.327   1.00 0.00 ? 1222 PHE A HB2  5  
ATOM 8195  H HB3  . PHE A 1 90  ? -0.525  8.661   -0.328  1.00 0.00 ? 1222 PHE A HB3  5  
ATOM 8196  H HD1  . PHE A 1 90  ? -0.196  10.388  2.873   1.00 0.00 ? 1222 PHE A HD1  5  
ATOM 8197  H HD2  . PHE A 1 90  ? 1.239   10.105  -1.124  1.00 0.00 ? 1222 PHE A HD2  5  
ATOM 8198  H HE1  . PHE A 1 90  ? 1.774   11.726  3.490   1.00 0.00 ? 1222 PHE A HE1  5  
ATOM 8199  H HE2  . PHE A 1 90  ? 3.212   11.442  -0.513  1.00 0.00 ? 1222 PHE A HE2  5  
ATOM 8200  H HZ   . PHE A 1 90  ? 3.481   12.255  1.796   1.00 0.00 ? 1222 PHE A HZ   5  
ATOM 8201  N N    . CYS A 1 91  ? -1.037  10.674  -2.190  1.00 0.00 ? 1223 CYS A N    5  
ATOM 8202  C CA   . CYS A 1 91  ? -0.555  11.525  -3.272  1.00 0.00 ? 1223 CYS A CA   5  
ATOM 8203  C C    . CYS A 1 91  ? -1.633  12.510  -3.711  1.00 0.00 ? 1223 CYS A C    5  
ATOM 8204  O O    . CYS A 1 91  ? -1.374  13.705  -3.853  1.00 0.00 ? 1223 CYS A O    5  
ATOM 8205  C CB   . CYS A 1 91  ? -0.112  10.672  -4.462  1.00 0.00 ? 1223 CYS A CB   5  
ATOM 8206  S SG   . CYS A 1 91  ? -1.408  9.598   -5.122  1.00 0.00 ? 1223 CYS A SG   5  
ATOM 8207  H H    . CYS A 1 91  ? -0.994  9.701   -2.293  1.00 0.00 ? 1223 CYS A H    5  
ATOM 8208  H HA   . CYS A 1 91  ? 0.294   12.080  -2.903  1.00 0.00 ? 1223 CYS A HA   5  
ATOM 8209  H HB2  . CYS A 1 91  ? 0.214   11.322  -5.260  1.00 0.00 ? 1223 CYS A HB2  5  
ATOM 8210  H HB3  . CYS A 1 91  ? 0.713   10.045  -4.158  1.00 0.00 ? 1223 CYS A HB3  5  
ATOM 8211  H HG   . CYS A 1 91  ? -0.822  8.578   -5.731  1.00 0.00 ? 1223 CYS A HG   5  
ATOM 8212  N N    . GLN A 1 92  ? -2.841  12.000  -3.926  1.00 0.00 ? 1224 GLN A N    5  
ATOM 8213  C CA   . GLN A 1 92  ? -3.958  12.836  -4.351  1.00 0.00 ? 1224 GLN A CA   5  
ATOM 8214  C C    . GLN A 1 92  ? -3.973  14.155  -3.587  1.00 0.00 ? 1224 GLN A C    5  
ATOM 8215  O O    . GLN A 1 92  ? -3.706  15.216  -4.152  1.00 0.00 ? 1224 GLN A O    5  
ATOM 8216  C CB   . GLN A 1 92  ? -5.282  12.098  -4.145  1.00 0.00 ? 1224 GLN A CB   5  
ATOM 8217  C CG   . GLN A 1 92  ? -5.723  11.290  -5.355  1.00 0.00 ? 1224 GLN A CG   5  
ATOM 8218  C CD   . GLN A 1 92  ? -7.183  10.886  -5.287  1.00 0.00 ? 1224 GLN A CD   5  
ATOM 8219  O OE1  . GLN A 1 92  ? -7.931  11.362  -4.432  1.00 0.00 ? 1224 GLN A OE1  5  
ATOM 8220  N NE2  . GLN A 1 92  ? -7.597  10.005  -6.190  1.00 0.00 ? 1224 GLN A NE2  5  
ATOM 8221  H H    . GLN A 1 92  ? -2.985  11.040  -3.796  1.00 0.00 ? 1224 GLN A H    5  
ATOM 8222  H HA   . GLN A 1 92  ? -3.834  13.045  -5.403  1.00 0.00 ? 1224 GLN A HA   5  
ATOM 8223  H HB2  . GLN A 1 92  ? -5.179  11.424  -3.308  1.00 0.00 ? 1224 GLN A HB2  5  
ATOM 8224  H HB3  . GLN A 1 92  ? -6.053  12.821  -3.922  1.00 0.00 ? 1224 GLN A HB3  5  
ATOM 8225  H HG2  . GLN A 1 92  ? -5.572  11.885  -6.244  1.00 0.00 ? 1224 GLN A HG2  5  
ATOM 8226  H HG3  . GLN A 1 92  ? -5.120  10.396  -5.414  1.00 0.00 ? 1224 GLN A HG3  5  
ATOM 8227  H HE21 . GLN A 1 92  ? -6.944  9.668   -6.840  1.00 0.00 ? 1224 GLN A HE21 5  
ATOM 8228  H HE22 . GLN A 1 92  ? -8.535  9.726   -6.168  1.00 0.00 ? 1224 GLN A HE22 5  
ATOM 8229  N N    . THR A 1 93  ? -4.288  14.082  -2.297  1.00 0.00 ? 1225 THR A N    5  
ATOM 8230  C CA   . THR A 1 93  ? -4.340  15.271  -1.455  1.00 0.00 ? 1225 THR A CA   5  
ATOM 8231  C C    . THR A 1 93  ? -2.976  15.946  -1.373  1.00 0.00 ? 1225 THR A C    5  
ATOM 8232  O O    . THR A 1 93  ? -2.877  17.172  -1.409  1.00 0.00 ? 1225 THR A O    5  
ATOM 8233  C CB   . THR A 1 93  ? -4.817  14.929  -0.030  1.00 0.00 ? 1225 THR A CB   5  
ATOM 8234  O OG1  . THR A 1 93  ? -6.247  14.891  0.011   1.00 0.00 ? 1225 THR A OG1  5  
ATOM 8235  C CG2  . THR A 1 93  ? -4.302  15.951  0.972   1.00 0.00 ? 1225 THR A CG2  5  
ATOM 8236  H H    . THR A 1 93  ? -4.491  13.208  -1.904  1.00 0.00 ? 1225 THR A H    5  
ATOM 8237  H HA   . THR A 1 93  ? -5.047  15.960  -1.893  1.00 0.00 ? 1225 THR A HA   5  
ATOM 8238  H HB   . THR A 1 93  ? -4.430  13.956  0.239   1.00 0.00 ? 1225 THR A HB   5  
ATOM 8239  H HG1  . THR A 1 93  ? -6.534  14.541  0.858   1.00 0.00 ? 1225 THR A HG1  5  
ATOM 8240  H HG21 . THR A 1 93  ? -4.716  15.739  1.947   1.00 0.00 ? 1225 THR A HG21 5  
ATOM 8241  H HG22 . THR A 1 93  ? -4.599  16.941  0.662   1.00 0.00 ? 1225 THR A HG22 5  
ATOM 8242  H HG23 . THR A 1 93  ? -3.225  15.897  1.020   1.00 0.00 ? 1225 THR A HG23 5  
ATOM 8243  N N    . ASN A 1 94  ? -1.926  15.139  -1.264  1.00 0.00 ? 1226 ASN A N    5  
ATOM 8244  C CA   . ASN A 1 94  ? -0.566  15.660  -1.177  1.00 0.00 ? 1226 ASN A CA   5  
ATOM 8245  C C    . ASN A 1 94  ? -0.036  16.027  -2.560  1.00 0.00 ? 1226 ASN A C    5  
ATOM 8246  O O    . ASN A 1 94  ? 1.162   16.249  -2.737  1.00 0.00 ? 1226 ASN A O    5  
ATOM 8247  C CB   . ASN A 1 94  ? 0.356   14.631  -0.521  1.00 0.00 ? 1226 ASN A CB   5  
ATOM 8248  C CG   . ASN A 1 94  ? 0.026   14.408  0.942   1.00 0.00 ? 1226 ASN A CG   5  
ATOM 8249  O OD1  . ASN A 1 94  ? 0.181   15.306  1.769   1.00 0.00 ? 1226 ASN A OD1  5  
ATOM 8250  N ND2  . ASN A 1 94  ? -0.433  13.205  1.268   1.00 0.00 ? 1226 ASN A ND2  5  
ATOM 8251  H H    . ASN A 1 94  ? -2.068  14.170  -1.240  1.00 0.00 ? 1226 ASN A H    5  
ATOM 8252  H HA   . ASN A 1 94  ? -0.591  16.550  -0.566  1.00 0.00 ? 1226 ASN A HA   5  
ATOM 8253  H HB2  . ASN A 1 94  ? 0.259   13.688  -1.040  1.00 0.00 ? 1226 ASN A HB2  5  
ATOM 8254  H HB3  . ASN A 1 94  ? 1.377   14.973  -0.593  1.00 0.00 ? 1226 ASN A HB3  5  
ATOM 8255  H HD21 . ASN A 1 94  ? -0.531  12.538  0.557   1.00 0.00 ? 1226 ASN A HD21 5  
ATOM 8256  H HD22 . ASN A 1 94  ? -0.655  13.034  2.207   1.00 0.00 ? 1226 ASN A HD22 5  
ATOM 8257  N N    . SER A 1 95  ? -0.936  16.090  -3.536  1.00 0.00 ? 1227 SER A N    5  
ATOM 8258  C CA   . SER A 1 95  ? -0.558  16.427  -4.903  1.00 0.00 ? 1227 SER A CA   5  
ATOM 8259  C C    . SER A 1 95  ? 0.831   15.889  -5.231  1.00 0.00 ? 1227 SER A C    5  
ATOM 8260  O O    . SER A 1 95  ? 1.698   16.623  -5.706  1.00 0.00 ? 1227 SER A O    5  
ATOM 8261  C CB   . SER A 1 95  ? -0.591  17.943  -5.105  1.00 0.00 ? 1227 SER A CB   5  
ATOM 8262  O OG   . SER A 1 95  ? 0.299   18.595  -4.216  1.00 0.00 ? 1227 SER A OG   5  
ATOM 8263  H H    . SER A 1 95  ? -1.876  15.902  -3.331  1.00 0.00 ? 1227 SER A H    5  
ATOM 8264  H HA   . SER A 1 95  ? -1.275  15.968  -5.568  1.00 0.00 ? 1227 SER A HA   5  
ATOM 8265  H HB2  . SER A 1 95  ? -0.302  18.175  -6.119  1.00 0.00 ? 1227 SER A HB2  5  
ATOM 8266  H HB3  . SER A 1 95  ? -1.593  18.306  -4.924  1.00 0.00 ? 1227 SER A HB3  5  
ATOM 8267  H HG   . SER A 1 95  ? 0.988   17.984  -3.946  1.00 0.00 ? 1227 SER A HG   5  
ATOM 8268  N N    . VAL A 1 96  ? 1.036   14.601  -4.975  1.00 0.00 ? 1228 VAL A N    5  
ATOM 8269  C CA   . VAL A 1 96  ? 2.319   13.962  -5.243  1.00 0.00 ? 1228 VAL A CA   5  
ATOM 8270  C C    . VAL A 1 96  ? 2.261   13.126  -6.517  1.00 0.00 ? 1228 VAL A C    5  
ATOM 8271  O O    . VAL A 1 96  ? 1.245   12.497  -6.811  1.00 0.00 ? 1228 VAL A O    5  
ATOM 8272  C CB   . VAL A 1 96  ? 2.755   13.063  -4.071  1.00 0.00 ? 1228 VAL A CB   5  
ATOM 8273  C CG1  . VAL A 1 96  ? 4.064   12.360  -4.395  1.00 0.00 ? 1228 VAL A CG1  5  
ATOM 8274  C CG2  . VAL A 1 96  ? 2.879   13.878  -2.792  1.00 0.00 ? 1228 VAL A CG2  5  
ATOM 8275  H H    . VAL A 1 96  ? 0.307   14.067  -4.596  1.00 0.00 ? 1228 VAL A H    5  
ATOM 8276  H HA   . VAL A 1 96  ? 3.059   14.739  -5.367  1.00 0.00 ? 1228 VAL A HA   5  
ATOM 8277  H HB   . VAL A 1 96  ? 1.995   12.309  -3.920  1.00 0.00 ? 1228 VAL A HB   5  
ATOM 8278  H HG11 . VAL A 1 96  ? 3.856   11.376  -4.790  1.00 0.00 ? 1228 VAL A HG11 5  
ATOM 8279  H HG12 . VAL A 1 96  ? 4.610   12.936  -5.128  1.00 0.00 ? 1228 VAL A HG12 5  
ATOM 8280  H HG13 . VAL A 1 96  ? 4.655   12.268  -3.495  1.00 0.00 ? 1228 VAL A HG13 5  
ATOM 8281  H HG21 . VAL A 1 96  ? 1.933   13.876  -2.272  1.00 0.00 ? 1228 VAL A HG21 5  
ATOM 8282  H HG22 . VAL A 1 96  ? 3.639   13.441  -2.160  1.00 0.00 ? 1228 VAL A HG22 5  
ATOM 8283  H HG23 . VAL A 1 96  ? 3.155   14.892  -3.037  1.00 0.00 ? 1228 VAL A HG23 5  
ATOM 8284  N N    . GLN A 1 97  ? 3.358   13.125  -7.267  1.00 0.00 ? 1229 GLN A N    5  
ATOM 8285  C CA   . GLN A 1 97  ? 3.431   12.366  -8.510  1.00 0.00 ? 1229 GLN A CA   5  
ATOM 8286  C C    . GLN A 1 97  ? 3.605   10.877  -8.229  1.00 0.00 ? 1229 GLN A C    5  
ATOM 8287  O O    . GLN A 1 97  ? 4.019   10.484  -7.138  1.00 0.00 ? 1229 GLN A O    5  
ATOM 8288  C CB   . GLN A 1 97  ? 4.587   12.872  -9.374  1.00 0.00 ? 1229 GLN A CB   5  
ATOM 8289  C CG   . GLN A 1 97  ? 5.959   12.527  -8.818  1.00 0.00 ? 1229 GLN A CG   5  
ATOM 8290  C CD   . GLN A 1 97  ? 6.448   13.539  -7.801  1.00 0.00 ? 1229 GLN A CD   5  
ATOM 8291  O OE1  . GLN A 1 97  ? 6.668   13.209  -6.636  1.00 0.00 ? 1229 GLN A OE1  5  
ATOM 8292  N NE2  . GLN A 1 97  ? 6.622   14.781  -8.238  1.00 0.00 ? 1229 GLN A NE2  5  
ATOM 8293  H H    . GLN A 1 97  ? 4.135   13.646  -6.979  1.00 0.00 ? 1229 GLN A H    5  
ATOM 8294  H HA   . GLN A 1 97  ? 2.504   12.513  -9.043  1.00 0.00 ? 1229 GLN A HA   5  
ATOM 8295  H HB2  . GLN A 1 97  ? 4.502   12.438  -10.359 1.00 0.00 ? 1229 GLN A HB2  5  
ATOM 8296  H HB3  . GLN A 1 97  ? 4.516   13.947  -9.456  1.00 0.00 ? 1229 GLN A HB3  5  
ATOM 8297  H HG2  . GLN A 1 97  ? 5.908   11.559  -8.343  1.00 0.00 ? 1229 GLN A HG2  5  
ATOM 8298  H HG3  . GLN A 1 97  ? 6.665   12.489  -9.635  1.00 0.00 ? 1229 GLN A HG3  5  
ATOM 8299  H HE21 . GLN A 1 97  ? 6.426   14.972  -9.180  1.00 0.00 ? 1229 GLN A HE21 5  
ATOM 8300  H HE22 . GLN A 1 97  ? 6.936   15.456  -7.602  1.00 0.00 ? 1229 GLN A HE22 5  
ATOM 8301  N N    . THR A 1 98  ? 3.286   10.051  -9.221  1.00 0.00 ? 1230 THR A N    5  
ATOM 8302  C CA   . THR A 1 98  ? 3.405   8.605   -9.080  1.00 0.00 ? 1230 THR A CA   5  
ATOM 8303  C C    . THR A 1 98  ? 3.757   7.951   -10.411 1.00 0.00 ? 1230 THR A C    5  
ATOM 8304  O O    . THR A 1 98  ? 3.917   8.630   -11.425 1.00 0.00 ? 1230 THR A O    5  
ATOM 8305  C CB   . THR A 1 98  ? 2.102   7.984   -8.544  1.00 0.00 ? 1230 THR A CB   5  
ATOM 8306  O OG1  . THR A 1 98  ? 1.007   8.328   -9.399  1.00 0.00 ? 1230 THR A OG1  5  
ATOM 8307  C CG2  . THR A 1 98  ? 1.817   8.462   -7.128  1.00 0.00 ? 1230 THR A CG2  5  
ATOM 8308  H H    . THR A 1 98  ? 2.962   10.425  -10.067 1.00 0.00 ? 1230 THR A H    5  
ATOM 8309  H HA   . THR A 1 98  ? 4.195   8.403   -8.371  1.00 0.00 ? 1230 THR A HA   5  
ATOM 8310  H HB   . THR A 1 98  ? 2.214   6.909   -8.529  1.00 0.00 ? 1230 THR A HB   5  
ATOM 8311  H HG1  . THR A 1 98  ? 0.204   8.401   -8.877  1.00 0.00 ? 1230 THR A HG1  5  
ATOM 8312  H HG21 . THR A 1 98  ? 2.045   9.515   -7.051  1.00 0.00 ? 1230 THR A HG21 5  
ATOM 8313  H HG22 . THR A 1 98  ? 2.429   7.909   -6.431  1.00 0.00 ? 1230 THR A HG22 5  
ATOM 8314  H HG23 . THR A 1 98  ? 0.775   8.303   -6.898  1.00 0.00 ? 1230 THR A HG23 5  
ATOM 8315  N N    . ASP A 1 99  ? 3.875   6.627   -10.401 1.00 0.00 ? 1231 ASP A N    5  
ATOM 8316  C CA   . ASP A 1 99  ? 4.206   5.880   -11.609 1.00 0.00 ? 1231 ASP A CA   5  
ATOM 8317  C C    . ASP A 1 99  ? 5.614   6.218   -12.088 1.00 0.00 ? 1231 ASP A C    5  
ATOM 8318  O O    . ASP A 1 99  ? 5.858   6.351   -13.288 1.00 0.00 ? 1231 ASP A O    5  
ATOM 8319  C CB   . ASP A 1 99  ? 3.192   6.181   -12.714 1.00 0.00 ? 1231 ASP A CB   5  
ATOM 8320  C CG   . ASP A 1 99  ? 3.280   5.196   -13.863 1.00 0.00 ? 1231 ASP A CG   5  
ATOM 8321  O OD1  . ASP A 1 99  ? 3.773   4.070   -13.644 1.00 0.00 ? 1231 ASP A OD1  5  
ATOM 8322  O OD2  . ASP A 1 99  ? 2.854   5.551   -14.982 1.00 0.00 ? 1231 ASP A OD2  5  
ATOM 8323  H H    . ASP A 1 99  ? 3.735   6.141   -9.561  1.00 0.00 ? 1231 ASP A H    5  
ATOM 8324  H HA   . ASP A 1 99  ? 4.163   4.828   -11.370 1.00 0.00 ? 1231 ASP A HA   5  
ATOM 8325  H HB2  . ASP A 1 99  ? 2.195   6.136   -12.301 1.00 0.00 ? 1231 ASP A HB2  5  
ATOM 8326  H HB3  . ASP A 1 99  ? 3.373   7.173   -13.100 1.00 0.00 ? 1231 ASP A HB3  5  
ATOM 8327  N N    . LEU A 1 100 ? 6.538   6.356   -11.143 1.00 0.00 ? 1232 LEU A N    5  
ATOM 8328  C CA   . LEU A 1 100 ? 7.923   6.679   -11.468 1.00 0.00 ? 1232 LEU A CA   5  
ATOM 8329  C C    . LEU A 1 100 ? 8.702   5.422   -11.841 1.00 0.00 ? 1232 LEU A C    5  
ATOM 8330  O O    . LEU A 1 100 ? 9.830   5.221   -11.390 1.00 0.00 ? 1232 LEU A O    5  
ATOM 8331  C CB   . LEU A 1 100 ? 8.595   7.377   -10.284 1.00 0.00 ? 1232 LEU A CB   5  
ATOM 8332  C CG   . LEU A 1 100 ? 7.807   8.521   -9.643  1.00 0.00 ? 1232 LEU A CG   5  
ATOM 8333  C CD1  . LEU A 1 100 ? 8.327   8.808   -8.243  1.00 0.00 ? 1232 LEU A CD1  5  
ATOM 8334  C CD2  . LEU A 1 100 ? 7.882   9.770   -10.508 1.00 0.00 ? 1232 LEU A CD2  5  
ATOM 8335  H H    . LEU A 1 100 ? 6.283   6.238   -10.204 1.00 0.00 ? 1232 LEU A H    5  
ATOM 8336  H HA   . LEU A 1 100 ? 7.916   7.349   -12.315 1.00 0.00 ? 1232 LEU A HA   5  
ATOM 8337  H HB2  . LEU A 1 100 ? 8.778   6.635   -9.523  1.00 0.00 ? 1232 LEU A HB2  5  
ATOM 8338  H HB3  . LEU A 1 100 ? 9.538   7.777   -10.630 1.00 0.00 ? 1232 LEU A HB3  5  
ATOM 8339  H HG   . LEU A 1 100 ? 6.769   8.231   -9.561  1.00 0.00 ? 1232 LEU A HG   5  
ATOM 8340  H HD11 . LEU A 1 100 ? 7.699   8.313   -7.518  1.00 0.00 ? 1232 LEU A HD11 5  
ATOM 8341  H HD12 . LEU A 1 100 ? 8.313   9.873   -8.065  1.00 0.00 ? 1232 LEU A HD12 5  
ATOM 8342  H HD13 . LEU A 1 100 ? 9.339   8.442   -8.153  1.00 0.00 ? 1232 LEU A HD13 5  
ATOM 8343  H HD21 . LEU A 1 100 ? 7.907   9.485   -11.550 1.00 0.00 ? 1232 LEU A HD21 5  
ATOM 8344  H HD22 . LEU A 1 100 ? 8.777   10.324  -10.265 1.00 0.00 ? 1232 LEU A HD22 5  
ATOM 8345  H HD23 . LEU A 1 100 ? 7.015   10.387  -10.325 1.00 0.00 ? 1232 LEU A HD23 5  
ATOM 8346  N N    . PHE A 1 101 ? 8.094   4.580   -12.670 1.00 0.00 ? 1233 PHE A N    5  
ATOM 8347  C CA   . PHE A 1 101 ? 8.732   3.343   -13.106 1.00 0.00 ? 1233 PHE A CA   5  
ATOM 8348  C C    . PHE A 1 101 ? 9.414   3.530   -14.458 1.00 0.00 ? 1233 PHE A C    5  
ATOM 8349  O O    . PHE A 1 101 ? 9.362   4.609   -15.048 1.00 0.00 ? 1233 PHE A O    5  
ATOM 8350  C CB   . PHE A 1 101 ? 7.700   2.216   -13.193 1.00 0.00 ? 1233 PHE A CB   5  
ATOM 8351  C CG   . PHE A 1 101 ? 7.122   1.828   -11.863 1.00 0.00 ? 1233 PHE A CG   5  
ATOM 8352  C CD1  . PHE A 1 101 ? 6.379   2.735   -11.124 1.00 0.00 ? 1233 PHE A CD1  5  
ATOM 8353  C CD2  . PHE A 1 101 ? 7.321   0.557   -11.350 1.00 0.00 ? 1233 PHE A CD2  5  
ATOM 8354  C CE1  . PHE A 1 101 ? 5.847   2.381   -9.899  1.00 0.00 ? 1233 PHE A CE1  5  
ATOM 8355  C CE2  . PHE A 1 101 ? 6.791   0.196   -10.126 1.00 0.00 ? 1233 PHE A CE2  5  
ATOM 8356  C CZ   . PHE A 1 101 ? 6.052   1.110   -9.400  1.00 0.00 ? 1233 PHE A CZ   5  
ATOM 8357  H H    . PHE A 1 101 ? 7.195   4.796   -12.996 1.00 0.00 ? 1233 PHE A H    5  
ATOM 8358  H HA   . PHE A 1 101 ? 9.478   3.080   -12.373 1.00 0.00 ? 1233 PHE A HA   5  
ATOM 8359  H HB2  . PHE A 1 101 ? 6.886   2.532   -13.829 1.00 0.00 ? 1233 PHE A HB2  5  
ATOM 8360  H HB3  . PHE A 1 101 ? 8.168   1.343   -13.621 1.00 0.00 ? 1233 PHE A HB3  5  
ATOM 8361  H HD1  . PHE A 1 101 ? 6.217   3.730   -11.514 1.00 0.00 ? 1233 PHE A HD1  5  
ATOM 8362  H HD2  . PHE A 1 101 ? 7.899   -0.159  -11.918 1.00 0.00 ? 1233 PHE A HD2  5  
ATOM 8363  H HE1  . PHE A 1 101 ? 5.269   3.097   -9.333  1.00 0.00 ? 1233 PHE A HE1  5  
ATOM 8364  H HE2  . PHE A 1 101 ? 6.953   -0.799  -9.738  1.00 0.00 ? 1233 PHE A HE2  5  
ATOM 8365  H HZ   . PHE A 1 101 ? 5.637   0.830   -8.442  1.00 0.00 ? 1233 PHE A HZ   5  
ATOM 8366  N N    . SER A 1 102 ? 10.053  2.470   -14.943 1.00 0.00 ? 1234 SER A N    5  
ATOM 8367  C CA   . SER A 1 102 ? 10.750  2.517   -16.223 1.00 0.00 ? 1234 SER A CA   5  
ATOM 8368  C C    . SER A 1 102 ? 9.976   1.749   -17.291 1.00 0.00 ? 1234 SER A C    5  
ATOM 8369  O O    . SER A 1 102 ? 10.295  0.601   -17.599 1.00 0.00 ? 1234 SER A O    5  
ATOM 8370  C CB   . SER A 1 102 ? 12.159  1.938   -16.083 1.00 0.00 ? 1234 SER A CB   5  
ATOM 8371  O OG   . SER A 1 102 ? 12.863  2.562   -15.023 1.00 0.00 ? 1234 SER A OG   5  
ATOM 8372  H H    . SER A 1 102 ? 10.059  1.637   -14.425 1.00 0.00 ? 1234 SER A H    5  
ATOM 8373  H HA   . SER A 1 102 ? 10.823  3.552   -16.523 1.00 0.00 ? 1234 SER A HA   5  
ATOM 8374  H HB2  . SER A 1 102 ? 12.092  0.880   -15.881 1.00 0.00 ? 1234 SER A HB2  5  
ATOM 8375  H HB3  . SER A 1 102 ? 12.703  2.096   -17.003 1.00 0.00 ? 1234 SER A HB3  5  
ATOM 8376  H HG   . SER A 1 102 ? 13.765  2.739   -15.299 1.00 0.00 ? 1234 SER A HG   5  
ATOM 8377  N N    . SER A 1 103 ? 8.958   2.393   -17.852 1.00 0.00 ? 1235 SER A N    5  
ATOM 8378  C CA   . SER A 1 103 ? 8.135   1.770   -18.883 1.00 0.00 ? 1235 SER A CA   5  
ATOM 8379  C C    . SER A 1 103 ? 8.227   2.546   -20.193 1.00 0.00 ? 1235 SER A C    5  
ATOM 8380  O O    . SER A 1 103 ? 8.873   3.592   -20.266 1.00 0.00 ? 1235 SER A O    5  
ATOM 8381  C CB   . SER A 1 103 ? 6.678   1.693   -18.424 1.00 0.00 ? 1235 SER A CB   5  
ATOM 8382  O OG   . SER A 1 103 ? 6.479   0.605   -17.538 1.00 0.00 ? 1235 SER A OG   5  
ATOM 8383  H H    . SER A 1 103 ? 8.753   3.307   -17.564 1.00 0.00 ? 1235 SER A H    5  
ATOM 8384  H HA   . SER A 1 103 ? 8.507   0.769   -19.044 1.00 0.00 ? 1235 SER A HA   5  
ATOM 8385  H HB2  . SER A 1 103 ? 6.414   2.608   -17.917 1.00 0.00 ? 1235 SER A HB2  5  
ATOM 8386  H HB3  . SER A 1 103 ? 6.039   1.561   -19.286 1.00 0.00 ? 1235 SER A HB3  5  
ATOM 8387  H HG   . SER A 1 103 ? 6.329   0.938   -16.650 1.00 0.00 ? 1235 SER A HG   5  
ATOM 8388  N N    . THR A 1 104 ? 7.576   2.026   -21.229 1.00 0.00 ? 1236 THR A N    5  
ATOM 8389  C CA   . THR A 1 104 ? 7.584   2.667   -22.538 1.00 0.00 ? 1236 THR A CA   5  
ATOM 8390  C C    . THR A 1 104 ? 6.165   2.917   -23.036 1.00 0.00 ? 1236 THR A C    5  
ATOM 8391  O O    . THR A 1 104 ? 5.462   1.987   -23.432 1.00 0.00 ? 1236 THR A O    5  
ATOM 8392  C CB   . THR A 1 104 ? 8.339   1.816   -23.576 1.00 0.00 ? 1236 THR A CB   5  
ATOM 8393  O OG1  . THR A 1 104 ? 8.079   2.308   -24.895 1.00 0.00 ? 1236 THR A OG1  5  
ATOM 8394  C CG2  . THR A 1 104 ? 7.923   0.355   -23.483 1.00 0.00 ? 1236 THR A CG2  5  
ATOM 8395  H H    . THR A 1 104 ? 7.079   1.190   -21.109 1.00 0.00 ? 1236 THR A H    5  
ATOM 8396  H HA   . THR A 1 104 ? 8.093   3.615   -22.441 1.00 0.00 ? 1236 THR A HA   5  
ATOM 8397  H HB   . THR A 1 104 ? 9.398   1.887   -23.376 1.00 0.00 ? 1236 THR A HB   5  
ATOM 8398  H HG1  . THR A 1 104 ? 7.148   2.194   -25.102 1.00 0.00 ? 1236 THR A HG1  5  
ATOM 8399  H HG21 . THR A 1 104 ? 8.503   -0.136  -22.716 1.00 0.00 ? 1236 THR A HG21 5  
ATOM 8400  H HG22 . THR A 1 104 ? 8.097   -0.129  -24.432 1.00 0.00 ? 1236 THR A HG22 5  
ATOM 8401  H HG23 . THR A 1 104 ? 6.874   0.295   -23.235 1.00 0.00 ? 1236 THR A HG23 5  
ATOM 8402  N N    . LYS A 1 105 ? 5.750   4.179   -23.017 1.00 0.00 ? 1237 LYS A N    5  
ATOM 8403  C CA   . LYS A 1 105 ? 4.415   4.552   -23.469 1.00 0.00 ? 1237 LYS A CA   5  
ATOM 8404  C C    . LYS A 1 105 ? 3.398   3.472   -23.114 1.00 0.00 ? 1237 LYS A C    5  
ATOM 8405  O O    . LYS A 1 105 ? 2.674   2.962   -23.969 1.00 0.00 ? 1237 LYS A O    5  
ATOM 8406  C CB   . LYS A 1 105 ? 4.414   4.791   -24.980 1.00 0.00 ? 1237 LYS A CB   5  
ATOM 8407  C CG   . LYS A 1 105 ? 4.725   6.226   -25.370 1.00 0.00 ? 1237 LYS A CG   5  
ATOM 8408  C CD   . LYS A 1 105 ? 3.459   7.055   -25.500 1.00 0.00 ? 1237 LYS A CD   5  
ATOM 8409  C CE   . LYS A 1 105 ? 2.861   7.378   -24.139 1.00 0.00 ? 1237 LYS A CE   5  
ATOM 8410  N NZ   . LYS A 1 105 ? 1.850   6.367   -23.724 1.00 0.00 ? 1237 LYS A NZ   5  
ATOM 8411  H H    . LYS A 1 105 ? 6.356   4.877   -22.690 1.00 0.00 ? 1237 LYS A H    5  
ATOM 8412  H HA   . LYS A 1 105 ? 4.139   5.468   -22.968 1.00 0.00 ? 1237 LYS A HA   5  
ATOM 8413  H HB2  . LYS A 1 105 ? 5.154   4.148   -25.435 1.00 0.00 ? 1237 LYS A HB2  5  
ATOM 8414  H HB3  . LYS A 1 105 ? 3.440   4.537   -25.372 1.00 0.00 ? 1237 LYS A HB3  5  
ATOM 8415  H HG2  . LYS A 1 105 ? 5.355   6.667   -24.611 1.00 0.00 ? 1237 LYS A HG2  5  
ATOM 8416  H HG3  . LYS A 1 105 ? 5.245   6.227   -26.317 1.00 0.00 ? 1237 LYS A HG3  5  
ATOM 8417  H HD2  . LYS A 1 105 ? 3.695   7.980   -26.006 1.00 0.00 ? 1237 LYS A HD2  5  
ATOM 8418  H HD3  . LYS A 1 105 ? 2.734   6.501   -26.080 1.00 0.00 ? 1237 LYS A HD3  5  
ATOM 8419  H HE2  . LYS A 1 105 ? 3.655   7.402   -23.409 1.00 0.00 ? 1237 LYS A HE2  5  
ATOM 8420  H HE3  . LYS A 1 105 ? 2.389   8.348   -24.189 1.00 0.00 ? 1237 LYS A HE3  5  
ATOM 8421  H HZ1  . LYS A 1 105 ? 1.356   6.688   -22.867 1.00 0.00 ? 1237 LYS A HZ1  5  
ATOM 8422  H HZ2  . LYS A 1 105 ? 2.314   5.459   -23.523 1.00 0.00 ? 1237 LYS A HZ2  5  
ATOM 8423  H HZ3  . LYS A 1 105 ? 1.152   6.227   -24.482 1.00 0.00 ? 1237 LYS A HZ3  5  
ATOM 8424  N N    . PRO A 1 106 ? 3.339   3.115   -21.822 1.00 0.00 ? 1238 PRO A N    5  
ATOM 8425  C CA   . PRO A 1 106 ? 2.412   2.094   -21.324 1.00 0.00 ? 1238 PRO A CA   5  
ATOM 8426  C C    . PRO A 1 106 ? 0.961   2.560   -21.363 1.00 0.00 ? 1238 PRO A C    5  
ATOM 8427  O O    . PRO A 1 106 ? 0.592   3.524   -20.694 1.00 0.00 ? 1238 PRO A O    5  
ATOM 8428  C CB   . PRO A 1 106 ? 2.866   1.878   -19.878 1.00 0.00 ? 1238 PRO A CB   5  
ATOM 8429  C CG   . PRO A 1 106 ? 3.529   3.156   -19.494 1.00 0.00 ? 1238 PRO A CG   5  
ATOM 8430  C CD   . PRO A 1 106 ? 4.172   3.682   -20.748 1.00 0.00 ? 1238 PRO A CD   5  
ATOM 8431  H HA   . PRO A 1 106 ? 2.508   1.170   -21.875 1.00 0.00 ? 1238 PRO A HA   5  
ATOM 8432  H HB2  . PRO A 1 106 ? 2.006   1.675   -19.255 1.00 0.00 ? 1238 PRO A HB2  5  
ATOM 8433  H HB3  . PRO A 1 106 ? 3.554   1.048   -19.834 1.00 0.00 ? 1238 PRO A HB3  5  
ATOM 8434  H HG2  . PRO A 1 106 ? 2.793   3.856   -19.128 1.00 0.00 ? 1238 PRO A HG2  5  
ATOM 8435  H HG3  . PRO A 1 106 ? 4.278   2.968   -18.740 1.00 0.00 ? 1238 PRO A HG3  5  
ATOM 8436  H HD2  . PRO A 1 106 ? 4.140   4.761   -20.764 1.00 0.00 ? 1238 PRO A HD2  5  
ATOM 8437  H HD3  . PRO A 1 106 ? 5.190   3.331   -20.825 1.00 0.00 ? 1238 PRO A HD3  5  
ATOM 8438  N N    . GLN A 1 107 ? 0.143   1.868   -22.150 1.00 0.00 ? 1239 GLN A N    5  
ATOM 8439  C CA   . GLN A 1 107 ? -1.268  2.212   -22.276 1.00 0.00 ? 1239 GLN A CA   5  
ATOM 8440  C C    . GLN A 1 107 ? -2.122  1.352   -21.350 1.00 0.00 ? 1239 GLN A C    5  
ATOM 8441  O O    . GLN A 1 107 ? -2.630  0.305   -21.752 1.00 0.00 ? 1239 GLN A O    5  
ATOM 8442  C CB   . GLN A 1 107 ? -1.730  2.038   -23.723 1.00 0.00 ? 1239 GLN A CB   5  
ATOM 8443  C CG   . GLN A 1 107 ? -2.988  2.824   -24.059 1.00 0.00 ? 1239 GLN A CG   5  
ATOM 8444  C CD   . GLN A 1 107 ? -3.186  2.999   -25.552 1.00 0.00 ? 1239 GLN A CD   5  
ATOM 8445  O OE1  . GLN A 1 107 ? -2.221  3.065   -26.314 1.00 0.00 ? 1239 GLN A OE1  5  
ATOM 8446  N NE2  . GLN A 1 107 ? -4.441  3.075   -25.978 1.00 0.00 ? 1239 GLN A NE2  5  
ATOM 8447  H H    . GLN A 1 107 ? 0.497   1.109   -22.658 1.00 0.00 ? 1239 GLN A H    5  
ATOM 8448  H HA   . GLN A 1 107 ? -1.383  3.247   -21.992 1.00 0.00 ? 1239 GLN A HA   5  
ATOM 8449  H HB2  . GLN A 1 107 ? -0.941  2.365   -24.383 1.00 0.00 ? 1239 GLN A HB2  5  
ATOM 8450  H HB3  . GLN A 1 107 ? -1.928  0.992   -23.903 1.00 0.00 ? 1239 GLN A HB3  5  
ATOM 8451  H HG2  . GLN A 1 107 ? -3.842  2.300   -23.657 1.00 0.00 ? 1239 GLN A HG2  5  
ATOM 8452  H HG3  . GLN A 1 107 ? -2.919  3.800   -23.602 1.00 0.00 ? 1239 GLN A HG3  5  
ATOM 8453  H HE21 . GLN A 1 107 ? -5.160  3.016   -25.313 1.00 0.00 ? 1239 GLN A HE21 5  
ATOM 8454  H HE22 . GLN A 1 107 ? -4.598  3.189   -26.937 1.00 0.00 ? 1239 GLN A HE22 5  
ATOM 8455  N N    . SER A 1 108 ? -2.277  1.801   -20.108 1.00 0.00 ? 1240 SER A N    5  
ATOM 8456  C CA   . SER A 1 108 ? -3.066  1.070   -19.124 1.00 0.00 ? 1240 SER A CA   5  
ATOM 8457  C C    . SER A 1 108 ? -4.559  1.236   -19.393 1.00 0.00 ? 1240 SER A C    5  
ATOM 8458  O O    . SER A 1 108 ? -5.025  2.327   -19.719 1.00 0.00 ? 1240 SER A O    5  
ATOM 8459  C CB   . SER A 1 108 ? -2.734  1.555   -17.711 1.00 0.00 ? 1240 SER A CB   5  
ATOM 8460  O OG   . SER A 1 108 ? -1.547  0.950   -17.230 1.00 0.00 ? 1240 SER A OG   5  
ATOM 8461  H H    . SER A 1 108 ? -1.847  2.643   -19.848 1.00 0.00 ? 1240 SER A H    5  
ATOM 8462  H HA   . SER A 1 108 ? -2.812  0.024   -19.205 1.00 0.00 ? 1240 SER A HA   5  
ATOM 8463  H HB2  . SER A 1 108 ? -2.599  2.626   -17.724 1.00 0.00 ? 1240 SER A HB2  5  
ATOM 8464  H HB3  . SER A 1 108 ? -3.548  1.302   -17.047 1.00 0.00 ? 1240 SER A HB3  5  
ATOM 8465  H HG   . SER A 1 108 ? -1.014  0.655   -17.972 1.00 0.00 ? 1240 SER A HG   5  
ATOM 8466  N N    . GLY A 1 109 ? -5.304  0.143   -19.255 1.00 0.00 ? 1241 GLY A N    5  
ATOM 8467  C CA   . GLY A 1 109 ? -6.736  0.187   -19.486 1.00 0.00 ? 1241 GLY A CA   5  
ATOM 8468  C C    . GLY A 1 109 ? -7.532  -0.293  -18.290 1.00 0.00 ? 1241 GLY A C    5  
ATOM 8469  O O    . GLY A 1 109 ? -7.109  -1.185  -17.553 1.00 0.00 ? 1241 GLY A O    5  
ATOM 8470  H H    . GLY A 1 109 ? -4.877  -0.700  -18.993 1.00 0.00 ? 1241 GLY A H    5  
ATOM 8471  H HA2  . GLY A 1 109 ? -7.022  1.204   -19.711 1.00 0.00 ? 1241 GLY A HA2  5  
ATOM 8472  H HA3  . GLY A 1 109 ? -6.970  -0.438  -20.335 1.00 0.00 ? 1241 GLY A HA3  5  
ATOM 8473  N N    . PRO A 1 110 ? -8.714  0.305   -18.081 1.00 0.00 ? 1242 PRO A N    5  
ATOM 8474  C CA   . PRO A 1 110 ? -9.595  -0.050  -16.965 1.00 0.00 ? 1242 PRO A CA   5  
ATOM 8475  C C    . PRO A 1 110 ? -10.215 -1.433  -17.134 1.00 0.00 ? 1242 PRO A C    5  
ATOM 8476  O O    . PRO A 1 110 ? -11.018 -1.869  -16.309 1.00 0.00 ? 1242 PRO A O    5  
ATOM 8477  C CB   . PRO A 1 110 ? -10.679 1.030   -17.011 1.00 0.00 ? 1242 PRO A CB   5  
ATOM 8478  C CG   . PRO A 1 110 ? -10.698 1.488   -18.428 1.00 0.00 ? 1242 PRO A CG   5  
ATOM 8479  C CD   . PRO A 1 110 ? -9.281  1.375   -18.919 1.00 0.00 ? 1242 PRO A CD   5  
ATOM 8480  H HA   . PRO A 1 110 ? -9.076  -0.003  -16.019 1.00 0.00 ? 1242 PRO A HA   5  
ATOM 8481  H HB2  . PRO A 1 110 ? -11.628 0.604   -16.719 1.00 0.00 ? 1242 PRO A HB2  5  
ATOM 8482  H HB3  . PRO A 1 110 ? -10.418 1.835   -16.340 1.00 0.00 ? 1242 PRO A HB3  5  
ATOM 8483  H HG2  . PRO A 1 110 ? -11.348 0.853   -19.010 1.00 0.00 ? 1242 PRO A HG2  5  
ATOM 8484  H HG3  . PRO A 1 110 ? -11.031 2.514   -18.478 1.00 0.00 ? 1242 PRO A HG3  5  
ATOM 8485  H HD2  . PRO A 1 110 ? -9.264  1.098   -19.962 1.00 0.00 ? 1242 PRO A HD2  5  
ATOM 8486  H HD3  . PRO A 1 110 ? -8.753  2.305   -18.765 1.00 0.00 ? 1242 PRO A HD3  5  
ATOM 8487  N N    . SER A 1 111 ? -9.836  -2.120  -18.207 1.00 0.00 ? 1243 SER A N    5  
ATOM 8488  C CA   . SER A 1 111 ? -10.358 -3.453  -18.486 1.00 0.00 ? 1243 SER A CA   5  
ATOM 8489  C C    . SER A 1 111 ? -10.582 -4.229  -17.192 1.00 0.00 ? 1243 SER A C    5  
ATOM 8490  O O    . SER A 1 111 ? -9.698  -4.304  -16.339 1.00 0.00 ? 1243 SER A O    5  
ATOM 8491  C CB   . SER A 1 111 ? -9.395  -4.220  -19.394 1.00 0.00 ? 1243 SER A CB   5  
ATOM 8492  O OG   . SER A 1 111 ? -8.176  -4.497  -18.727 1.00 0.00 ? 1243 SER A OG   5  
ATOM 8493  H H    . SER A 1 111 ? -9.192  -1.718  -18.828 1.00 0.00 ? 1243 SER A H    5  
ATOM 8494  H HA   . SER A 1 111 ? -11.304 -3.339  -18.993 1.00 0.00 ? 1243 SER A HA   5  
ATOM 8495  H HB2  . SER A 1 111 ? -9.850  -5.154  -19.689 1.00 0.00 ? 1243 SER A HB2  5  
ATOM 8496  H HB3  . SER A 1 111 ? -9.185  -3.628  -20.273 1.00 0.00 ? 1243 SER A HB3  5  
ATOM 8497  H HG   . SER A 1 111 ? -7.531  -4.821  -19.360 1.00 0.00 ? 1243 SER A HG   5  
ATOM 8498  N N    . SER A 1 112 ? -11.772 -4.805  -17.054 1.00 0.00 ? 1244 SER A N    5  
ATOM 8499  C CA   . SER A 1 112 ? -12.116 -5.574  -15.863 1.00 0.00 ? 1244 SER A CA   5  
ATOM 8500  C C    . SER A 1 112 ? -11.294 -6.857  -15.788 1.00 0.00 ? 1244 SER A C    5  
ATOM 8501  O O    . SER A 1 112 ? -11.110 -7.549  -16.789 1.00 0.00 ? 1244 SER A O    5  
ATOM 8502  C CB   . SER A 1 112 ? -13.608 -5.909  -15.860 1.00 0.00 ? 1244 SER A CB   5  
ATOM 8503  O OG   . SER A 1 112 ? -14.363 -4.872  -15.258 1.00 0.00 ? 1244 SER A OG   5  
ATOM 8504  H H    . SER A 1 112 ? -12.435 -4.709  -17.769 1.00 0.00 ? 1244 SER A H    5  
ATOM 8505  H HA   . SER A 1 112 ? -11.891 -4.965  -15.000 1.00 0.00 ? 1244 SER A HA   5  
ATOM 8506  H HB2  . SER A 1 112 ? -13.947 -6.041  -16.877 1.00 0.00 ? 1244 SER A HB2  5  
ATOM 8507  H HB3  . SER A 1 112 ? -13.768 -6.823  -15.306 1.00 0.00 ? 1244 SER A HB3  5  
ATOM 8508  H HG   . SER A 1 112 ? -14.784 -4.344  -15.940 1.00 0.00 ? 1244 SER A HG   5  
ATOM 8509  N N    . GLY A 1 113 ? -10.802 -7.168  -14.593 1.00 0.00 ? 1245 GLY A N    5  
ATOM 8510  C CA   . GLY A 1 113 ? -10.005 -8.367  -14.408 1.00 0.00 ? 1245 GLY A CA   5  
ATOM 8511  C C    . GLY A 1 113 ? -10.750 -9.446  -13.646 1.00 0.00 ? 1245 GLY A C    5  
ATOM 8512  O O    . GLY A 1 113 ? -11.561 -9.149  -12.770 1.00 0.00 ? 1245 GLY A O    5  
ATOM 8513  H H    . GLY A 1 113 ? -10.981 -6.579  -13.830 1.00 0.00 ? 1245 GLY A H    5  
ATOM 8514  H HA2  . GLY A 1 113 ? -9.725  -8.753  -15.377 1.00 0.00 ? 1245 GLY A HA2  5  
ATOM 8515  H HA3  . GLY A 1 113 ? -9.110  -8.110  -13.862 1.00 0.00 ? 1245 GLY A HA3  5  
ATOM 8516  N N    . GLY A 1 1   ? 41.740  21.731  -7.886  1.00 0.00 ? 1133 GLY A N    6  
ATOM 8517  C CA   . GLY A 1 1   ? 42.264  20.597  -8.625  1.00 0.00 ? 1133 GLY A CA   6  
ATOM 8518  C C    . GLY A 1 1   ? 41.197  19.569  -8.942  1.00 0.00 ? 1133 GLY A C    6  
ATOM 8519  O O    . GLY A 1 1   ? 40.683  18.900  -8.046  1.00 0.00 ? 1133 GLY A O    6  
ATOM 8520  H H1   . GLY A 1 1   ? 41.337  22.483  -8.367  1.00 0.00 ? 1133 GLY A H1   6  
ATOM 8521  H HA2  . GLY A 1 1   ? 42.694  20.952  -9.549  1.00 0.00 ? 1133 GLY A HA2  6  
ATOM 8522  H HA3  . GLY A 1 1   ? 43.038  20.126  -8.037  1.00 0.00 ? 1133 GLY A HA3  6  
ATOM 8523  N N    . SER A 1 2   ? 40.860  19.443  -10.222 1.00 0.00 ? 1134 SER A N    6  
ATOM 8524  C CA   . SER A 1 2   ? 39.843  18.492  -10.655 1.00 0.00 ? 1134 SER A CA   6  
ATOM 8525  C C    . SER A 1 2   ? 40.183  17.081  -10.186 1.00 0.00 ? 1134 SER A C    6  
ATOM 8526  O O    . SER A 1 2   ? 41.280  16.828  -9.689  1.00 0.00 ? 1134 SER A O    6  
ATOM 8527  C CB   . SER A 1 2   ? 39.707  18.517  -12.179 1.00 0.00 ? 1134 SER A CB   6  
ATOM 8528  O OG   . SER A 1 2   ? 39.101  19.721  -12.618 1.00 0.00 ? 1134 SER A OG   6  
ATOM 8529  H H    . SER A 1 2   ? 41.306  20.005  -10.890 1.00 0.00 ? 1134 SER A H    6  
ATOM 8530  H HA   . SER A 1 2   ? 38.903  18.789  -10.214 1.00 0.00 ? 1134 SER A HA   6  
ATOM 8531  H HB2  . SER A 1 2   ? 40.687  18.438  -12.626 1.00 0.00 ? 1134 SER A HB2  6  
ATOM 8532  H HB3  . SER A 1 2   ? 39.098  17.684  -12.497 1.00 0.00 ? 1134 SER A HB3  6  
ATOM 8533  H HG   . SER A 1 2   ? 39.772  20.304  -12.979 1.00 0.00 ? 1134 SER A HG   6  
ATOM 8534  N N    . SER A 1 3   ? 39.234  16.165  -10.349 1.00 0.00 ? 1135 SER A N    6  
ATOM 8535  C CA   . SER A 1 3   ? 39.430  14.780  -9.940  1.00 0.00 ? 1135 SER A CA   6  
ATOM 8536  C C    . SER A 1 3   ? 38.996  13.820  -11.043 1.00 0.00 ? 1135 SER A C    6  
ATOM 8537  O O    . SER A 1 3   ? 38.064  14.103  -11.796 1.00 0.00 ? 1135 SER A O    6  
ATOM 8538  C CB   . SER A 1 3   ? 38.647  14.489  -8.658  1.00 0.00 ? 1135 SER A CB   6  
ATOM 8539  O OG   . SER A 1 3   ? 39.028  13.244  -8.099  1.00 0.00 ? 1135 SER A OG   6  
ATOM 8540  H H    . SER A 1 3   ? 38.380  16.429  -10.752 1.00 0.00 ? 1135 SER A H    6  
ATOM 8541  H HA   . SER A 1 3   ? 40.483  14.637  -9.748  1.00 0.00 ? 1135 SER A HA   6  
ATOM 8542  H HB2  . SER A 1 3   ? 38.840  15.268  -7.936  1.00 0.00 ? 1135 SER A HB2  6  
ATOM 8543  H HB3  . SER A 1 3   ? 37.590  14.460  -8.884  1.00 0.00 ? 1135 SER A HB3  6  
ATOM 8544  H HG   . SER A 1 3   ? 38.889  13.263  -7.149  1.00 0.00 ? 1135 SER A HG   6  
ATOM 8545  N N    . GLY A 1 4   ? 39.679  12.683  -11.133 1.00 0.00 ? 1136 GLY A N    6  
ATOM 8546  C CA   . GLY A 1 4   ? 39.350  11.698  -12.147 1.00 0.00 ? 1136 GLY A CA   6  
ATOM 8547  C C    . GLY A 1 4   ? 37.964  11.114  -11.960 1.00 0.00 ? 1136 GLY A C    6  
ATOM 8548  O O    . GLY A 1 4   ? 37.056  11.793  -11.481 1.00 0.00 ? 1136 GLY A O    6  
ATOM 8549  H H    . GLY A 1 4   ? 40.412  12.511  -10.505 1.00 0.00 ? 1136 GLY A H    6  
ATOM 8550  H HA2  . GLY A 1 4   ? 39.404  12.166  -13.119 1.00 0.00 ? 1136 GLY A HA2  6  
ATOM 8551  H HA3  . GLY A 1 4   ? 40.074  10.898  -12.103 1.00 0.00 ? 1136 GLY A HA3  6  
ATOM 8552  N N    . SER A 1 5   ? 37.799  9.851   -12.341 1.00 0.00 ? 1137 SER A N    6  
ATOM 8553  C CA   . SER A 1 5   ? 36.512  9.177   -12.218 1.00 0.00 ? 1137 SER A CA   6  
ATOM 8554  C C    . SER A 1 5   ? 36.251  8.764   -10.773 1.00 0.00 ? 1137 SER A C    6  
ATOM 8555  O O    . SER A 1 5   ? 37.021  8.005   -10.184 1.00 0.00 ? 1137 SER A O    6  
ATOM 8556  C CB   . SER A 1 5   ? 36.467  7.948   -13.128 1.00 0.00 ? 1137 SER A CB   6  
ATOM 8557  O OG   . SER A 1 5   ? 37.415  6.976   -12.720 1.00 0.00 ? 1137 SER A OG   6  
ATOM 8558  H H    . SER A 1 5   ? 38.562  9.362   -12.716 1.00 0.00 ? 1137 SER A H    6  
ATOM 8559  H HA   . SER A 1 5   ? 35.744  9.871   -12.526 1.00 0.00 ? 1137 SER A HA   6  
ATOM 8560  H HB2  . SER A 1 5   ? 35.481  7.510   -13.089 1.00 0.00 ? 1137 SER A HB2  6  
ATOM 8561  H HB3  . SER A 1 5   ? 36.689  8.246   -14.142 1.00 0.00 ? 1137 SER A HB3  6  
ATOM 8562  H HG   . SER A 1 5   ? 38.300  7.288   -12.921 1.00 0.00 ? 1137 SER A HG   6  
ATOM 8563  N N    . SER A 1 6   ? 35.160  9.269   -10.207 1.00 0.00 ? 1138 SER A N    6  
ATOM 8564  C CA   . SER A 1 6   ? 34.798  8.956   -8.830  1.00 0.00 ? 1138 SER A CA   6  
ATOM 8565  C C    . SER A 1 6   ? 33.674  7.925   -8.784  1.00 0.00 ? 1138 SER A C    6  
ATOM 8566  O O    . SER A 1 6   ? 32.993  7.688   -9.780  1.00 0.00 ? 1138 SER A O    6  
ATOM 8567  C CB   . SER A 1 6   ? 34.370  10.226  -8.092  1.00 0.00 ? 1138 SER A CB   6  
ATOM 8568  O OG   . SER A 1 6   ? 35.482  11.067  -7.837  1.00 0.00 ? 1138 SER A OG   6  
ATOM 8569  H H    . SER A 1 6   ? 34.585  9.868   -10.729 1.00 0.00 ? 1138 SER A H    6  
ATOM 8570  H HA   . SER A 1 6   ? 35.669  8.544   -8.343  1.00 0.00 ? 1138 SER A HA   6  
ATOM 8571  H HB2  . SER A 1 6   ? 33.656  10.767  -8.694  1.00 0.00 ? 1138 SER A HB2  6  
ATOM 8572  H HB3  . SER A 1 6   ? 33.915  9.956   -7.150  1.00 0.00 ? 1138 SER A HB3  6  
ATOM 8573  H HG   . SER A 1 6   ? 36.183  10.555  -7.428  1.00 0.00 ? 1138 SER A HG   6  
ATOM 8574  N N    . GLY A 1 7   ? 33.488  7.314   -7.618  1.00 0.00 ? 1139 GLY A N    6  
ATOM 8575  C CA   . GLY A 1 7   ? 32.447  6.315   -7.462  1.00 0.00 ? 1139 GLY A CA   6  
ATOM 8576  C C    . GLY A 1 7   ? 31.056  6.901   -7.599  1.00 0.00 ? 1139 GLY A C    6  
ATOM 8577  O O    . GLY A 1 7   ? 30.882  7.978   -8.169  1.00 0.00 ? 1139 GLY A O    6  
ATOM 8578  H H    . GLY A 1 7   ? 34.062  7.543   -6.857  1.00 0.00 ? 1139 GLY A H    6  
ATOM 8579  H HA2  . GLY A 1 7   ? 32.580  5.551   -8.214  1.00 0.00 ? 1139 GLY A HA2  6  
ATOM 8580  H HA3  . GLY A 1 7   ? 32.540  5.864   -6.485  1.00 0.00 ? 1139 GLY A HA3  6  
ATOM 8581  N N    . SER A 1 8   ? 30.061  6.189   -7.078  1.00 0.00 ? 1140 SER A N    6  
ATOM 8582  C CA   . SER A 1 8   ? 28.677  6.643   -7.150  1.00 0.00 ? 1140 SER A CA   6  
ATOM 8583  C C    . SER A 1 8   ? 28.531  8.038   -6.550  1.00 0.00 ? 1140 SER A C    6  
ATOM 8584  O O    . SER A 1 8   ? 28.006  8.949   -7.190  1.00 0.00 ? 1140 SER A O    6  
ATOM 8585  C CB   . SER A 1 8   ? 27.758  5.662   -6.420  1.00 0.00 ? 1140 SER A CB   6  
ATOM 8586  O OG   . SER A 1 8   ? 28.232  5.398   -5.110  1.00 0.00 ? 1140 SER A OG   6  
ATOM 8587  H H    . SER A 1 8   ? 30.263  5.338   -6.637  1.00 0.00 ? 1140 SER A H    6  
ATOM 8588  H HA   . SER A 1 8   ? 28.394  6.680   -8.192  1.00 0.00 ? 1140 SER A HA   6  
ATOM 8589  H HB2  . SER A 1 8   ? 26.767  6.083   -6.353  1.00 0.00 ? 1140 SER A HB2  6  
ATOM 8590  H HB3  . SER A 1 8   ? 27.718  4.732   -6.969  1.00 0.00 ? 1140 SER A HB3  6  
ATOM 8591  H HG   . SER A 1 8   ? 28.094  4.471   -4.900  1.00 0.00 ? 1140 SER A HG   6  
ATOM 8592  N N    . SER A 1 9   ? 28.998  8.196   -5.316  1.00 0.00 ? 1141 SER A N    6  
ATOM 8593  C CA   . SER A 1 9   ? 28.917  9.478   -4.626  1.00 0.00 ? 1141 SER A CA   6  
ATOM 8594  C C    . SER A 1 9   ? 27.487  10.011  -4.637  1.00 0.00 ? 1141 SER A C    6  
ATOM 8595  O O    . SER A 1 9   ? 27.258  11.199  -4.859  1.00 0.00 ? 1141 SER A O    6  
ATOM 8596  C CB   . SER A 1 9   ? 29.856  10.494  -5.280  1.00 0.00 ? 1141 SER A CB   6  
ATOM 8597  O OG   . SER A 1 9   ? 31.212  10.179  -5.014  1.00 0.00 ? 1141 SER A OG   6  
ATOM 8598  H H    . SER A 1 9   ? 29.406  7.432   -4.858  1.00 0.00 ? 1141 SER A H    6  
ATOM 8599  H HA   . SER A 1 9   ? 29.223  9.324   -3.602  1.00 0.00 ? 1141 SER A HA   6  
ATOM 8600  H HB2  . SER A 1 9   ? 29.701  10.488  -6.348  1.00 0.00 ? 1141 SER A HB2  6  
ATOM 8601  H HB3  . SER A 1 9   ? 29.644  11.479  -4.890  1.00 0.00 ? 1141 SER A HB3  6  
ATOM 8602  H HG   . SER A 1 9   ? 31.751  10.966  -5.125  1.00 0.00 ? 1141 SER A HG   6  
ATOM 8603  N N    . GLN A 1 10  ? 26.529  9.122   -4.395  1.00 0.00 ? 1142 GLN A N    6  
ATOM 8604  C CA   . GLN A 1 10  ? 25.122  9.501   -4.377  1.00 0.00 ? 1142 GLN A CA   6  
ATOM 8605  C C    . GLN A 1 10  ? 24.793  10.316  -3.131  1.00 0.00 ? 1142 GLN A C    6  
ATOM 8606  O O    . GLN A 1 10  ? 24.935  9.851   -2.000  1.00 0.00 ? 1142 GLN A O    6  
ATOM 8607  C CB   . GLN A 1 10  ? 24.235  8.256   -4.435  1.00 0.00 ? 1142 GLN A CB   6  
ATOM 8608  C CG   . GLN A 1 10  ? 22.756  8.569   -4.593  1.00 0.00 ? 1142 GLN A CG   6  
ATOM 8609  C CD   . GLN A 1 10  ? 22.479  9.511   -5.749  1.00 0.00 ? 1142 GLN A CD   6  
ATOM 8610  O OE1  . GLN A 1 10  ? 23.055  9.373   -6.828  1.00 0.00 ? 1142 GLN A OE1  6  
ATOM 8611  N NE2  . GLN A 1 10  ? 21.592  10.474  -5.529  1.00 0.00 ? 1142 GLN A NE2  6  
ATOM 8612  H H    . GLN A 1 10  ? 26.775  8.189   -4.225  1.00 0.00 ? 1142 GLN A H    6  
ATOM 8613  H HA   . GLN A 1 10  ? 24.931  10.108  -5.249  1.00 0.00 ? 1142 GLN A HA   6  
ATOM 8614  H HB2  . GLN A 1 10  ? 24.544  7.648   -5.272  1.00 0.00 ? 1142 GLN A HB2  6  
ATOM 8615  H HB3  . GLN A 1 10  ? 24.366  7.693   -3.523  1.00 0.00 ? 1142 GLN A HB3  6  
ATOM 8616  H HG2  . GLN A 1 10  ? 22.222  7.647   -4.765  1.00 0.00 ? 1142 GLN A HG2  6  
ATOM 8617  H HG3  . GLN A 1 10  ? 22.399  9.026   -3.682  1.00 0.00 ? 1142 GLN A HG3  6  
ATOM 8618  H HE21 . GLN A 1 10  ? 21.173  10.523  -4.643  1.00 0.00 ? 1142 GLN A HE21 6  
ATOM 8619  H HE22 . GLN A 1 10  ? 21.394  11.097  -6.258  1.00 0.00 ? 1142 GLN A HE22 6  
ATOM 8620  N N    . PRO A 1 11  ? 24.343  11.563  -3.340  1.00 0.00 ? 1143 PRO A N    6  
ATOM 8621  C CA   . PRO A 1 11  ? 23.985  12.469  -2.245  1.00 0.00 ? 1143 PRO A CA   6  
ATOM 8622  C C    . PRO A 1 11  ? 22.719  12.029  -1.518  1.00 0.00 ? 1143 PRO A C    6  
ATOM 8623  O O    . PRO A 1 11  ? 22.152  10.978  -1.819  1.00 0.00 ? 1143 PRO A O    6  
ATOM 8624  C CB   . PRO A 1 11  ? 23.758  13.807  -2.952  1.00 0.00 ? 1143 PRO A CB   6  
ATOM 8625  C CG   . PRO A 1 11  ? 23.387  13.441  -4.347  1.00 0.00 ? 1143 PRO A CG   6  
ATOM 8626  C CD   . PRO A 1 11  ? 24.149  12.183  -4.661  1.00 0.00 ? 1143 PRO A CD   6  
ATOM 8627  H HA   . PRO A 1 11  ? 24.791  12.568  -1.532  1.00 0.00 ? 1143 PRO A HA   6  
ATOM 8628  H HB2  . PRO A 1 11  ? 22.962  14.347  -2.459  1.00 0.00 ? 1143 PRO A HB2  6  
ATOM 8629  H HB3  . PRO A 1 11  ? 24.666  14.391  -2.925  1.00 0.00 ? 1143 PRO A HB3  6  
ATOM 8630  H HG2  . PRO A 1 11  ? 22.325  13.261  -4.409  1.00 0.00 ? 1143 PRO A HG2  6  
ATOM 8631  H HG3  . PRO A 1 11  ? 23.676  14.232  -5.023  1.00 0.00 ? 1143 PRO A HG3  6  
ATOM 8632  H HD2  . PRO A 1 11  ? 23.569  11.541  -5.307  1.00 0.00 ? 1143 PRO A HD2  6  
ATOM 8633  H HD3  . PRO A 1 11  ? 25.099  12.421  -5.118  1.00 0.00 ? 1143 PRO A HD3  6  
ATOM 8634  N N    . VAL A 1 12  ? 22.279  12.839  -0.561  1.00 0.00 ? 1144 VAL A N    6  
ATOM 8635  C CA   . VAL A 1 12  ? 21.078  12.533  0.208   1.00 0.00 ? 1144 VAL A CA   6  
ATOM 8636  C C    . VAL A 1 12  ? 19.821  12.942  -0.552  1.00 0.00 ? 1144 VAL A C    6  
ATOM 8637  O O    . VAL A 1 12  ? 19.894  13.649  -1.557  1.00 0.00 ? 1144 VAL A O    6  
ATOM 8638  C CB   . VAL A 1 12  ? 21.092  13.242  1.575   1.00 0.00 ? 1144 VAL A CB   6  
ATOM 8639  C CG1  . VAL A 1 12  ? 22.270  12.766  2.412   1.00 0.00 ? 1144 VAL A CG1  6  
ATOM 8640  C CG2  . VAL A 1 12  ? 21.132  14.751  1.393   1.00 0.00 ? 1144 VAL A CG2  6  
ATOM 8641  H H    . VAL A 1 12  ? 22.774  13.662  -0.367  1.00 0.00 ? 1144 VAL A H    6  
ATOM 8642  H HA   . VAL A 1 12  ? 21.054  11.467  0.379   1.00 0.00 ? 1144 VAL A HA   6  
ATOM 8643  H HB   . VAL A 1 12  ? 20.182  12.988  2.099   1.00 0.00 ? 1144 VAL A HB   6  
ATOM 8644  H HG11 . VAL A 1 12  ? 22.613  11.812  2.040   1.00 0.00 ? 1144 VAL A HG11 6  
ATOM 8645  H HG12 . VAL A 1 12  ? 23.071  13.488  2.349   1.00 0.00 ? 1144 VAL A HG12 6  
ATOM 8646  H HG13 . VAL A 1 12  ? 21.960  12.659  3.441   1.00 0.00 ? 1144 VAL A HG13 6  
ATOM 8647  H HG21 . VAL A 1 12  ? 22.119  15.116  1.636   1.00 0.00 ? 1144 VAL A HG21 6  
ATOM 8648  H HG22 . VAL A 1 12  ? 20.901  14.996  0.366   1.00 0.00 ? 1144 VAL A HG22 6  
ATOM 8649  H HG23 . VAL A 1 12  ? 20.405  15.213  2.044   1.00 0.00 ? 1144 VAL A HG23 6  
ATOM 8650  N N    . ILE A 1 13  ? 18.670  12.493  -0.064  1.00 0.00 ? 1145 ILE A N    6  
ATOM 8651  C CA   . ILE A 1 13  ? 17.396  12.813  -0.696  1.00 0.00 ? 1145 ILE A CA   6  
ATOM 8652  C C    . ILE A 1 13  ? 16.868  14.161  -0.216  1.00 0.00 ? 1145 ILE A C    6  
ATOM 8653  O O    . ILE A 1 13  ? 16.768  14.408  0.986   1.00 0.00 ? 1145 ILE A O    6  
ATOM 8654  C CB   . ILE A 1 13  ? 16.339  11.730  -0.413  1.00 0.00 ? 1145 ILE A CB   6  
ATOM 8655  C CG1  . ILE A 1 13  ? 16.836  10.364  -0.892  1.00 0.00 ? 1145 ILE A CG1  6  
ATOM 8656  C CG2  . ILE A 1 13  ? 15.022  12.086  -1.087  1.00 0.00 ? 1145 ILE A CG2  6  
ATOM 8657  C CD1  . ILE A 1 13  ? 15.933  9.218   -0.492  1.00 0.00 ? 1145 ILE A CD1  6  
ATOM 8658  H H    . ILE A 1 13  ? 18.677  11.933  0.740   1.00 0.00 ? 1145 ILE A H    6  
ATOM 8659  H HA   . ILE A 1 13  ? 17.557  12.861  -1.764  1.00 0.00 ? 1145 ILE A HA   6  
ATOM 8660  H HB   . ILE A 1 13  ? 16.172  11.691  0.652   1.00 0.00 ? 1145 ILE A HB   6  
ATOM 8661  H HG12 . ILE A 1 13  ? 16.906  10.370  -1.968  1.00 0.00 ? 1145 ILE A HG12 6  
ATOM 8662  H HG13 . ILE A 1 13  ? 17.814  10.178  -0.473  1.00 0.00 ? 1145 ILE A HG13 6  
ATOM 8663  H HG21 . ILE A 1 13  ? 14.201  11.736  -0.479  1.00 0.00 ? 1145 ILE A HG21 6  
ATOM 8664  H HG22 . ILE A 1 13  ? 14.954  13.158  -1.199  1.00 0.00 ? 1145 ILE A HG22 6  
ATOM 8665  H HG23 . ILE A 1 13  ? 14.976  11.618  -2.058  1.00 0.00 ? 1145 ILE A HG23 6  
ATOM 8666  H HD11 . ILE A 1 13  ? 15.042  9.231   -1.104  1.00 0.00 ? 1145 ILE A HD11 6  
ATOM 8667  H HD12 . ILE A 1 13  ? 16.453  8.283   -0.631  1.00 0.00 ? 1145 ILE A HD12 6  
ATOM 8668  H HD13 . ILE A 1 13  ? 15.655  9.325   0.547   1.00 0.00 ? 1145 ILE A HD13 6  
ATOM 8669  N N    . SER A 1 14  ? 16.529  15.029  -1.164  1.00 0.00 ? 1146 SER A N    6  
ATOM 8670  C CA   . SER A 1 14  ? 16.012  16.353  -0.838  1.00 0.00 ? 1146 SER A CA   6  
ATOM 8671  C C    . SER A 1 14  ? 14.694  16.250  -0.077  1.00 0.00 ? 1146 SER A C    6  
ATOM 8672  O O    . SER A 1 14  ? 13.793  15.510  -0.472  1.00 0.00 ? 1146 SER A O    6  
ATOM 8673  C CB   . SER A 1 14  ? 15.815  17.175  -2.114  1.00 0.00 ? 1146 SER A CB   6  
ATOM 8674  O OG   . SER A 1 14  ? 14.927  16.525  -3.007  1.00 0.00 ? 1146 SER A OG   6  
ATOM 8675  H H    . SER A 1 14  ? 16.632  14.773  -2.105  1.00 0.00 ? 1146 SER A H    6  
ATOM 8676  H HA   . SER A 1 14  ? 16.739  16.847  -0.211  1.00 0.00 ? 1146 SER A HA   6  
ATOM 8677  H HB2  . SER A 1 14  ? 15.406  18.140  -1.857  1.00 0.00 ? 1146 SER A HB2  6  
ATOM 8678  H HB3  . SER A 1 14  ? 16.769  17.306  -2.605  1.00 0.00 ? 1146 SER A HB3  6  
ATOM 8679  H HG   . SER A 1 14  ? 14.079  16.975  -2.999  1.00 0.00 ? 1146 SER A HG   6  
ATOM 8680  N N    . ALA A 1 15  ? 14.589  16.997  1.016   1.00 0.00 ? 1147 ALA A N    6  
ATOM 8681  C CA   . ALA A 1 15  ? 13.382  16.992  1.832   1.00 0.00 ? 1147 ALA A CA   6  
ATOM 8682  C C    . ALA A 1 15  ? 12.133  16.873  0.965   1.00 0.00 ? 1147 ALA A C    6  
ATOM 8683  O O    . ALA A 1 15  ? 11.265  16.039  1.222   1.00 0.00 ? 1147 ALA A O    6  
ATOM 8684  C CB   . ALA A 1 15  ? 13.316  18.250  2.686   1.00 0.00 ? 1147 ALA A CB   6  
ATOM 8685  H H    . ALA A 1 15  ? 15.342  17.567  1.280   1.00 0.00 ? 1147 ALA A H    6  
ATOM 8686  H HA   . ALA A 1 15  ? 13.430  16.140  2.495   1.00 0.00 ? 1147 ALA A HA   6  
ATOM 8687  H HB1  . ALA A 1 15  ? 14.143  18.257  3.380   1.00 0.00 ? 1147 ALA A HB1  6  
ATOM 8688  H HB2  . ALA A 1 15  ? 13.373  19.120  2.049   1.00 0.00 ? 1147 ALA A HB2  6  
ATOM 8689  H HB3  . ALA A 1 15  ? 12.385  18.265  3.233   1.00 0.00 ? 1147 ALA A HB3  6  
ATOM 8690  N N    . GLN A 1 16  ? 12.050  17.712  -0.062  1.00 0.00 ? 1148 GLN A N    6  
ATOM 8691  C CA   . GLN A 1 16  ? 10.906  17.701  -0.967  1.00 0.00 ? 1148 GLN A CA   6  
ATOM 8692  C C    . GLN A 1 16  ? 10.409  16.278  -1.198  1.00 0.00 ? 1148 GLN A C    6  
ATOM 8693  O O    . GLN A 1 16  ? 9.219   15.997  -1.063  1.00 0.00 ? 1148 GLN A O    6  
ATOM 8694  C CB   . GLN A 1 16  ? 11.279  18.347  -2.302  1.00 0.00 ? 1148 GLN A CB   6  
ATOM 8695  C CG   . GLN A 1 16  ? 11.487  19.850  -2.214  1.00 0.00 ? 1148 GLN A CG   6  
ATOM 8696  C CD   . GLN A 1 16  ? 11.304  20.544  -3.550  1.00 0.00 ? 1148 GLN A CD   6  
ATOM 8697  O OE1  . GLN A 1 16  ? 10.253  21.125  -3.821  1.00 0.00 ? 1148 GLN A OE1  6  
ATOM 8698  N NE2  . GLN A 1 16  ? 12.328  20.486  -4.392  1.00 0.00 ? 1148 GLN A NE2  6  
ATOM 8699  H H    . GLN A 1 16  ? 12.774  18.354  -0.215  1.00 0.00 ? 1148 GLN A H    6  
ATOM 8700  H HA   . GLN A 1 16  ? 10.116  18.275  -0.508  1.00 0.00 ? 1148 GLN A HA   6  
ATOM 8701  H HB2  . GLN A 1 16  ? 12.193  17.899  -2.663  1.00 0.00 ? 1148 GLN A HB2  6  
ATOM 8702  H HB3  . GLN A 1 16  ? 10.489  18.156  -3.014  1.00 0.00 ? 1148 GLN A HB3  6  
ATOM 8703  H HG2  . GLN A 1 16  ? 10.774  20.259  -1.513  1.00 0.00 ? 1148 GLN A HG2  6  
ATOM 8704  H HG3  . GLN A 1 16  ? 12.489  20.042  -1.860  1.00 0.00 ? 1148 GLN A HG3  6  
ATOM 8705  H HE21 . GLN A 1 16  ? 13.134  20.004  -4.109  1.00 0.00 ? 1148 GLN A HE21 6  
ATOM 8706  H HE22 . GLN A 1 16  ? 12.237  20.926  -5.263  1.00 0.00 ? 1148 GLN A HE22 6  
ATOM 8707  N N    . GLU A 1 17  ? 11.329  15.384  -1.548  1.00 0.00 ? 1149 GLU A N    6  
ATOM 8708  C CA   . GLU A 1 17  ? 10.983  13.990  -1.799  1.00 0.00 ? 1149 GLU A CA   6  
ATOM 8709  C C    . GLU A 1 17  ? 11.185  13.145  -0.544  1.00 0.00 ? 1149 GLU A C    6  
ATOM 8710  O O    . GLU A 1 17  ? 10.285  12.419  -0.122  1.00 0.00 ? 1149 GLU A O    6  
ATOM 8711  C CB   . GLU A 1 17  ? 11.827  13.430  -2.946  1.00 0.00 ? 1149 GLU A CB   6  
ATOM 8712  C CG   . GLU A 1 17  ? 11.126  12.342  -3.741  1.00 0.00 ? 1149 GLU A CG   6  
ATOM 8713  C CD   . GLU A 1 17  ? 10.101  12.896  -4.711  1.00 0.00 ? 1149 GLU A CD   6  
ATOM 8714  O OE1  . GLU A 1 17  ? 10.350  13.979  -5.282  1.00 0.00 ? 1149 GLU A OE1  6  
ATOM 8715  O OE2  . GLU A 1 17  ? 9.051   12.248  -4.900  1.00 0.00 ? 1149 GLU A OE2  6  
ATOM 8716  H H    . GLU A 1 17  ? 12.262  15.669  -1.639  1.00 0.00 ? 1149 GLU A H    6  
ATOM 8717  H HA   . GLU A 1 17  ? 9.941   13.953  -2.079  1.00 0.00 ? 1149 GLU A HA   6  
ATOM 8718  H HB2  . GLU A 1 17  ? 12.077  14.236  -3.619  1.00 0.00 ? 1149 GLU A HB2  6  
ATOM 8719  H HB3  . GLU A 1 17  ? 12.738  13.019  -2.538  1.00 0.00 ? 1149 GLU A HB3  6  
ATOM 8720  H HG2  . GLU A 1 17  ? 11.867  11.790  -4.301  1.00 0.00 ? 1149 GLU A HG2  6  
ATOM 8721  H HG3  . GLU A 1 17  ? 10.626  11.676  -3.053  1.00 0.00 ? 1149 GLU A HG3  6  
ATOM 8722  N N    . GLN A 1 18  ? 12.372  13.245  0.045   1.00 0.00 ? 1150 GLN A N    6  
ATOM 8723  C CA   . GLN A 1 18  ? 12.693  12.489  1.250   1.00 0.00 ? 1150 GLN A CA   6  
ATOM 8724  C C    . GLN A 1 18  ? 11.550  12.560  2.257   1.00 0.00 ? 1150 GLN A C    6  
ATOM 8725  O O    . GLN A 1 18  ? 11.030  11.534  2.692   1.00 0.00 ? 1150 GLN A O    6  
ATOM 8726  C CB   . GLN A 1 18  ? 13.980  13.020  1.883   1.00 0.00 ? 1150 GLN A CB   6  
ATOM 8727  C CG   . GLN A 1 18  ? 14.473  12.183  3.052   1.00 0.00 ? 1150 GLN A CG   6  
ATOM 8728  C CD   . GLN A 1 18  ? 15.573  12.870  3.839   1.00 0.00 ? 1150 GLN A CD   6  
ATOM 8729  O OE1  . GLN A 1 18  ? 16.751  12.774  3.494   1.00 0.00 ? 1150 GLN A OE1  6  
ATOM 8730  N NE2  . GLN A 1 18  ? 15.192  13.568  4.902   1.00 0.00 ? 1150 GLN A NE2  6  
ATOM 8731  H H    . GLN A 1 18  ? 13.048  13.841  -0.340  1.00 0.00 ? 1150 GLN A H    6  
ATOM 8732  H HA   . GLN A 1 18  ? 12.841  11.459  0.965   1.00 0.00 ? 1150 GLN A HA   6  
ATOM 8733  H HB2  . GLN A 1 18  ? 14.755  13.041  1.131   1.00 0.00 ? 1150 GLN A HB2  6  
ATOM 8734  H HB3  . GLN A 1 18  ? 13.805  14.026  2.236   1.00 0.00 ? 1150 GLN A HB3  6  
ATOM 8735  H HG2  . GLN A 1 18  ? 13.644  11.991  3.716   1.00 0.00 ? 1150 GLN A HG2  6  
ATOM 8736  H HG3  . GLN A 1 18  ? 14.853  11.246  2.672   1.00 0.00 ? 1150 GLN A HG3  6  
ATOM 8737  H HE21 . GLN A 1 18  ? 14.236  13.599  5.117   1.00 0.00 ? 1150 GLN A HE21 6  
ATOM 8738  H HE22 . GLN A 1 18  ? 15.882  14.021  5.429   1.00 0.00 ? 1150 GLN A HE22 6  
ATOM 8739  N N    . GLU A 1 19  ? 11.166  13.779  2.624   1.00 0.00 ? 1151 GLU A N    6  
ATOM 8740  C CA   . GLU A 1 19  ? 10.085  13.983  3.582   1.00 0.00 ? 1151 GLU A CA   6  
ATOM 8741  C C    . GLU A 1 19  ? 8.841   13.201  3.172   1.00 0.00 ? 1151 GLU A C    6  
ATOM 8742  O O    . GLU A 1 19  ? 8.345   12.361  3.923   1.00 0.00 ? 1151 GLU A O    6  
ATOM 8743  C CB   . GLU A 1 19  ? 9.751   15.471  3.698   1.00 0.00 ? 1151 GLU A CB   6  
ATOM 8744  C CG   . GLU A 1 19  ? 9.131   15.853  5.032   1.00 0.00 ? 1151 GLU A CG   6  
ATOM 8745  C CD   . GLU A 1 19  ? 8.414   17.188  4.981   1.00 0.00 ? 1151 GLU A CD   6  
ATOM 8746  O OE1  . GLU A 1 19  ? 9.093   18.231  5.077   1.00 0.00 ? 1151 GLU A OE1  6  
ATOM 8747  O OE2  . GLU A 1 19  ? 7.172   17.189  4.845   1.00 0.00 ? 1151 GLU A OE2  6  
ATOM 8748  H H    . GLU A 1 19  ? 11.620  14.559  2.242   1.00 0.00 ? 1151 GLU A H    6  
ATOM 8749  H HA   . GLU A 1 19  ? 10.421  13.622  4.542   1.00 0.00 ? 1151 GLU A HA   6  
ATOM 8750  H HB2  . GLU A 1 19  ? 10.658  16.043  3.569   1.00 0.00 ? 1151 GLU A HB2  6  
ATOM 8751  H HB3  . GLU A 1 19  ? 9.056   15.734  2.914   1.00 0.00 ? 1151 GLU A HB3  6  
ATOM 8752  H HG2  . GLU A 1 19  ? 8.421   15.091  5.316   1.00 0.00 ? 1151 GLU A HG2  6  
ATOM 8753  H HG3  . GLU A 1 19  ? 9.914   15.910  5.775   1.00 0.00 ? 1151 GLU A HG3  6  
ATOM 8754  N N    . THR A 1 20  ? 8.339   13.484  1.973   1.00 0.00 ? 1152 THR A N    6  
ATOM 8755  C CA   . THR A 1 20  ? 7.152   12.810  1.463   1.00 0.00 ? 1152 THR A CA   6  
ATOM 8756  C C    . THR A 1 20  ? 7.223   11.308  1.711   1.00 0.00 ? 1152 THR A C    6  
ATOM 8757  O O    . THR A 1 20  ? 6.231   10.686  2.092   1.00 0.00 ? 1152 THR A O    6  
ATOM 8758  C CB   . THR A 1 20  ? 6.968   13.062  -0.045  1.00 0.00 ? 1152 THR A CB   6  
ATOM 8759  O OG1  . THR A 1 20  ? 6.788   14.461  -0.291  1.00 0.00 ? 1152 THR A OG1  6  
ATOM 8760  C CG2  . THR A 1 20  ? 5.772   12.290  -0.581  1.00 0.00 ? 1152 THR A CG2  6  
ATOM 8761  H H    . THR A 1 20  ? 8.779   14.164  1.421   1.00 0.00 ? 1152 THR A H    6  
ATOM 8762  H HA   . THR A 1 20  ? 6.292   13.211  1.981   1.00 0.00 ? 1152 THR A HA   6  
ATOM 8763  H HB   . THR A 1 20  ? 7.856   12.725  -0.562  1.00 0.00 ? 1152 THR A HB   6  
ATOM 8764  H HG1  . THR A 1 20  ? 6.255   14.582  -1.080  1.00 0.00 ? 1152 THR A HG1  6  
ATOM 8765  H HG21 . THR A 1 20  ? 5.840   12.221  -1.657  1.00 0.00 ? 1152 THR A HG21 6  
ATOM 8766  H HG22 . THR A 1 20  ? 4.861   12.804  -0.310  1.00 0.00 ? 1152 THR A HG22 6  
ATOM 8767  H HG23 . THR A 1 20  ? 5.765   11.298  -0.156  1.00 0.00 ? 1152 THR A HG23 6  
ATOM 8768  N N    . GLN A 1 21  ? 8.401   10.732  1.494   1.00 0.00 ? 1153 GLN A N    6  
ATOM 8769  C CA   . GLN A 1 21  ? 8.599   9.302   1.695   1.00 0.00 ? 1153 GLN A CA   6  
ATOM 8770  C C    . GLN A 1 21  ? 8.485   8.938   3.172   1.00 0.00 ? 1153 GLN A C    6  
ATOM 8771  O O    . GLN A 1 21  ? 7.955   7.883   3.522   1.00 0.00 ? 1153 GLN A O    6  
ATOM 8772  C CB   . GLN A 1 21  ? 9.966   8.875   1.157   1.00 0.00 ? 1153 GLN A CB   6  
ATOM 8773  C CG   . GLN A 1 21  ? 9.952   8.506   -0.318  1.00 0.00 ? 1153 GLN A CG   6  
ATOM 8774  C CD   . GLN A 1 21  ? 11.266  7.911   -0.784  1.00 0.00 ? 1153 GLN A CD   6  
ATOM 8775  O OE1  . GLN A 1 21  ? 11.994  7.297   -0.003  1.00 0.00 ? 1153 GLN A OE1  6  
ATOM 8776  N NE2  . GLN A 1 21  ? 11.576  8.089   -2.062  1.00 0.00 ? 1153 GLN A NE2  6  
ATOM 8777  H H    . GLN A 1 21  ? 9.153   11.281  1.192   1.00 0.00 ? 1153 GLN A H    6  
ATOM 8778  H HA   . GLN A 1 21  ? 7.829   8.780   1.148   1.00 0.00 ? 1153 GLN A HA   6  
ATOM 8779  H HB2  . GLN A 1 21  ? 10.664  9.687   1.296   1.00 0.00 ? 1153 GLN A HB2  6  
ATOM 8780  H HB3  . GLN A 1 21  ? 10.308  8.017   1.717   1.00 0.00 ? 1153 GLN A HB3  6  
ATOM 8781  H HG2  . GLN A 1 21  ? 9.167   7.783   -0.487  1.00 0.00 ? 1153 GLN A HG2  6  
ATOM 8782  H HG3  . GLN A 1 21  ? 9.751   9.396   -0.896  1.00 0.00 ? 1153 GLN A HG3  6  
ATOM 8783  H HE21 . GLN A 1 21  ? 10.949  8.590   -2.625  1.00 0.00 ? 1153 GLN A HE21 6  
ATOM 8784  H HE22 . GLN A 1 21  ? 12.420  7.715   -2.390  1.00 0.00 ? 1153 GLN A HE22 6  
ATOM 8785  N N    . ILE A 1 22  ? 8.984   9.818   4.033   1.00 0.00 ? 1154 ILE A N    6  
ATOM 8786  C CA   . ILE A 1 22  ? 8.937   9.589   5.472   1.00 0.00 ? 1154 ILE A CA   6  
ATOM 8787  C C    . ILE A 1 22  ? 7.498   9.520   5.970   1.00 0.00 ? 1154 ILE A C    6  
ATOM 8788  O O    . ILE A 1 22  ? 7.084   8.528   6.569   1.00 0.00 ? 1154 ILE A O    6  
ATOM 8789  C CB   . ILE A 1 22  ? 9.683   10.695  6.242   1.00 0.00 ? 1154 ILE A CB   6  
ATOM 8790  C CG1  . ILE A 1 22  ? 11.151  10.744  5.813   1.00 0.00 ? 1154 ILE A CG1  6  
ATOM 8791  C CG2  . ILE A 1 22  ? 9.572   10.463  7.742   1.00 0.00 ? 1154 ILE A CG2  6  
ATOM 8792  C CD1  . ILE A 1 22  ? 11.847  12.033  6.189   1.00 0.00 ? 1154 ILE A CD1  6  
ATOM 8793  H H    . ILE A 1 22  ? 9.394   10.640  3.693   1.00 0.00 ? 1154 ILE A H    6  
ATOM 8794  H HA   . ILE A 1 22  ? 9.423   8.646   5.675   1.00 0.00 ? 1154 ILE A HA   6  
ATOM 8795  H HB   . ILE A 1 22  ? 9.216   11.640  6.013   1.00 0.00 ? 1154 ILE A HB   6  
ATOM 8796  H HG12 . ILE A 1 22  ? 11.684  9.931   6.280   1.00 0.00 ? 1154 ILE A HG12 6  
ATOM 8797  H HG13 . ILE A 1 22  ? 11.208  10.636  4.739   1.00 0.00 ? 1154 ILE A HG13 6  
ATOM 8798  H HG21 . ILE A 1 22  ? 8.547   10.606  8.053   1.00 0.00 ? 1154 ILE A HG21 6  
ATOM 8799  H HG22 . ILE A 1 22  ? 9.879   9.454   7.973   1.00 0.00 ? 1154 ILE A HG22 6  
ATOM 8800  H HG23 . ILE A 1 22  ? 10.208  11.162  8.263   1.00 0.00 ? 1154 ILE A HG23 6  
ATOM 8801  H HD11 . ILE A 1 22  ? 12.330  11.915  7.148   1.00 0.00 ? 1154 ILE A HD11 6  
ATOM 8802  H HD12 . ILE A 1 22  ? 12.586  12.275  5.441   1.00 0.00 ? 1154 ILE A HD12 6  
ATOM 8803  H HD13 . ILE A 1 22  ? 11.121  12.831  6.249   1.00 0.00 ? 1154 ILE A HD13 6  
ATOM 8804  N N    . VAL A 1 23  ? 6.738   10.582  5.718   1.00 0.00 ? 1155 VAL A N    6  
ATOM 8805  C CA   . VAL A 1 23  ? 5.343   10.641  6.138   1.00 0.00 ? 1155 VAL A CA   6  
ATOM 8806  C C    . VAL A 1 23  ? 4.546   9.476   5.563   1.00 0.00 ? 1155 VAL A C    6  
ATOM 8807  O O    . VAL A 1 23  ? 3.765   8.835   6.268   1.00 0.00 ? 1155 VAL A O    6  
ATOM 8808  C CB   . VAL A 1 23  ? 4.683   11.964  5.706   1.00 0.00 ? 1155 VAL A CB   6  
ATOM 8809  C CG1  . VAL A 1 23  ? 3.195   11.946  6.023   1.00 0.00 ? 1155 VAL A CG1  6  
ATOM 8810  C CG2  . VAL A 1 23  ? 5.366   13.145  6.380   1.00 0.00 ? 1155 VAL A CG2  6  
ATOM 8811  H H    . VAL A 1 23  ? 7.125   11.343  5.236   1.00 0.00 ? 1155 VAL A H    6  
ATOM 8812  H HA   . VAL A 1 23  ? 5.317   10.585  7.217   1.00 0.00 ? 1155 VAL A HA   6  
ATOM 8813  H HB   . VAL A 1 23  ? 4.800   12.069  4.638   1.00 0.00 ? 1155 VAL A HB   6  
ATOM 8814  H HG11 . VAL A 1 23  ? 2.763   11.022  5.668   1.00 0.00 ? 1155 VAL A HG11 6  
ATOM 8815  H HG12 . VAL A 1 23  ? 3.053   12.026  7.091   1.00 0.00 ? 1155 VAL A HG12 6  
ATOM 8816  H HG13 . VAL A 1 23  ? 2.713   12.780  5.532   1.00 0.00 ? 1155 VAL A HG13 6  
ATOM 8817  H HG21 . VAL A 1 23  ? 6.348   13.283  5.952   1.00 0.00 ? 1155 VAL A HG21 6  
ATOM 8818  H HG22 . VAL A 1 23  ? 4.777   14.037  6.226   1.00 0.00 ? 1155 VAL A HG22 6  
ATOM 8819  H HG23 . VAL A 1 23  ? 5.457   12.952  7.438   1.00 0.00 ? 1155 VAL A HG23 6  
ATOM 8820  N N    . LEU A 1 24  ? 4.747   9.206   4.278   1.00 0.00 ? 1156 LEU A N    6  
ATOM 8821  C CA   . LEU A 1 24  ? 4.047   8.117   3.606   1.00 0.00 ? 1156 LEU A CA   6  
ATOM 8822  C C    . LEU A 1 24  ? 4.401   6.773   4.234   1.00 0.00 ? 1156 LEU A C    6  
ATOM 8823  O O    . LEU A 1 24  ? 3.537   6.082   4.775   1.00 0.00 ? 1156 LEU A O    6  
ATOM 8824  C CB   . LEU A 1 24  ? 4.393   8.104   2.116   1.00 0.00 ? 1156 LEU A CB   6  
ATOM 8825  C CG   . LEU A 1 24  ? 3.668   7.059   1.267   1.00 0.00 ? 1156 LEU A CG   6  
ATOM 8826  C CD1  . LEU A 1 24  ? 2.169   7.116   1.517   1.00 0.00 ? 1156 LEU A CD1  6  
ATOM 8827  C CD2  . LEU A 1 24  ? 3.973   7.265   -0.209  1.00 0.00 ? 1156 LEU A CD2  6  
ATOM 8828  H H    . LEU A 1 24  ? 5.381   9.752   3.767   1.00 0.00 ? 1156 LEU A H    6  
ATOM 8829  H HA   . LEU A 1 24  ? 2.986   8.285   3.719   1.00 0.00 ? 1156 LEU A HA   6  
ATOM 8830  H HB2  . LEU A 1 24  ? 4.159   9.077   1.713   1.00 0.00 ? 1156 LEU A HB2  6  
ATOM 8831  H HB3  . LEU A 1 24  ? 5.455   7.925   2.026   1.00 0.00 ? 1156 LEU A HB3  6  
ATOM 8832  H HG   . LEU A 1 24  ? 4.014   6.073   1.547   1.00 0.00 ? 1156 LEU A HG   6  
ATOM 8833  H HD11 . LEU A 1 24  ? 1.679   6.342   0.946   1.00 0.00 ? 1156 LEU A HD11 6  
ATOM 8834  H HD12 . LEU A 1 24  ? 1.790   8.081   1.213   1.00 0.00 ? 1156 LEU A HD12 6  
ATOM 8835  H HD13 . LEU A 1 24  ? 1.973   6.968   2.569   1.00 0.00 ? 1156 LEU A HD13 6  
ATOM 8836  H HD21 . LEU A 1 24  ? 3.136   6.925   -0.800  1.00 0.00 ? 1156 LEU A HD21 6  
ATOM 8837  H HD22 . LEU A 1 24  ? 4.855   6.701   -0.476  1.00 0.00 ? 1156 LEU A HD22 6  
ATOM 8838  H HD23 . LEU A 1 24  ? 4.145   8.314   -0.398  1.00 0.00 ? 1156 LEU A HD23 6  
ATOM 8839  N N    . TYR A 1 25  ? 5.677   6.409   4.161   1.00 0.00 ? 1157 TYR A N    6  
ATOM 8840  C CA   . TYR A 1 25  ? 6.145   5.148   4.722   1.00 0.00 ? 1157 TYR A CA   6  
ATOM 8841  C C    . TYR A 1 25  ? 5.409   4.821   6.017   1.00 0.00 ? 1157 TYR A C    6  
ATOM 8842  O O    . TYR A 1 25  ? 4.798   3.761   6.147   1.00 0.00 ? 1157 TYR A O    6  
ATOM 8843  C CB   . TYR A 1 25  ? 7.652   5.209   4.980   1.00 0.00 ? 1157 TYR A CB   6  
ATOM 8844  C CG   . TYR A 1 25  ? 8.219   3.933   5.561   1.00 0.00 ? 1157 TYR A CG   6  
ATOM 8845  C CD1  . TYR A 1 25  ? 8.158   2.738   4.855   1.00 0.00 ? 1157 TYR A CD1  6  
ATOM 8846  C CD2  . TYR A 1 25  ? 8.817   3.923   6.815   1.00 0.00 ? 1157 TYR A CD2  6  
ATOM 8847  C CE1  . TYR A 1 25  ? 8.674   1.570   5.382   1.00 0.00 ? 1157 TYR A CE1  6  
ATOM 8848  C CE2  . TYR A 1 25  ? 9.337   2.760   7.349   1.00 0.00 ? 1157 TYR A CE2  6  
ATOM 8849  C CZ   . TYR A 1 25  ? 9.263   1.586   6.629   1.00 0.00 ? 1157 TYR A CZ   6  
ATOM 8850  O OH   . TYR A 1 25  ? 9.779   0.425   7.157   1.00 0.00 ? 1157 TYR A OH   6  
ATOM 8851  H H    . TYR A 1 25  ? 6.318   7.003   3.717   1.00 0.00 ? 1157 TYR A H    6  
ATOM 8852  H HA   . TYR A 1 25  ? 5.945   4.369   4.001   1.00 0.00 ? 1157 TYR A HA   6  
ATOM 8853  H HB2  . TYR A 1 25  ? 8.162   5.405   4.050   1.00 0.00 ? 1157 TYR A HB2  6  
ATOM 8854  H HB3  . TYR A 1 25  ? 7.859   6.010   5.674   1.00 0.00 ? 1157 TYR A HB3  6  
ATOM 8855  H HD1  . TYR A 1 25  ? 7.696   2.729   3.878   1.00 0.00 ? 1157 TYR A HD1  6  
ATOM 8856  H HD2  . TYR A 1 25  ? 8.874   4.845   7.377   1.00 0.00 ? 1157 TYR A HD2  6  
ATOM 8857  H HE1  . TYR A 1 25  ? 8.616   0.651   4.818   1.00 0.00 ? 1157 TYR A HE1  6  
ATOM 8858  H HE2  . TYR A 1 25  ? 9.798   2.772   8.326   1.00 0.00 ? 1157 TYR A HE2  6  
ATOM 8859  H HH   . TYR A 1 25  ? 10.612  0.220   6.725   1.00 0.00 ? 1157 TYR A HH   6  
ATOM 8860  N N    . GLY A 1 26  ? 5.472   5.741   6.975   1.00 0.00 ? 1158 GLY A N    6  
ATOM 8861  C CA   . GLY A 1 26  ? 4.807   5.534   8.248   1.00 0.00 ? 1158 GLY A CA   6  
ATOM 8862  C C    . GLY A 1 26  ? 3.367   5.090   8.084   1.00 0.00 ? 1158 GLY A C    6  
ATOM 8863  O O    . GLY A 1 26  ? 2.906   4.182   8.776   1.00 0.00 ? 1158 GLY A O    6  
ATOM 8864  H H    . GLY A 1 26  ? 5.974   6.568   6.816   1.00 0.00 ? 1158 GLY A H    6  
ATOM 8865  H HA2  . GLY A 1 26  ? 5.344   4.780   8.804   1.00 0.00 ? 1158 GLY A HA2  6  
ATOM 8866  H HA3  . GLY A 1 26  ? 4.825   6.459   8.806   1.00 0.00 ? 1158 GLY A HA3  6  
ATOM 8867  N N    . LYS A 1 27  ? 2.652   5.733   7.167   1.00 0.00 ? 1159 LYS A N    6  
ATOM 8868  C CA   . LYS A 1 27  ? 1.255   5.400   6.914   1.00 0.00 ? 1159 LYS A CA   6  
ATOM 8869  C C    . LYS A 1 27  ? 1.127   3.998   6.329   1.00 0.00 ? 1159 LYS A C    6  
ATOM 8870  O O    . LYS A 1 27  ? 0.219   3.245   6.687   1.00 0.00 ? 1159 LYS A O    6  
ATOM 8871  C CB   . LYS A 1 27  ? 0.631   6.421   5.959   1.00 0.00 ? 1159 LYS A CB   6  
ATOM 8872  C CG   . LYS A 1 27  ? 0.722   7.854   6.457   1.00 0.00 ? 1159 LYS A CG   6  
ATOM 8873  C CD   . LYS A 1 27  ? -0.449  8.689   5.967   1.00 0.00 ? 1159 LYS A CD   6  
ATOM 8874  C CE   . LYS A 1 27  ? -0.223  9.185   4.546   1.00 0.00 ? 1159 LYS A CE   6  
ATOM 8875  N NZ   . LYS A 1 27  ? -0.486  8.120   3.539   1.00 0.00 ? 1159 LYS A NZ   6  
ATOM 8876  H H    . LYS A 1 27  ? 3.075   6.448   6.647   1.00 0.00 ? 1159 LYS A H    6  
ATOM 8877  H HA   . LYS A 1 27  ? 0.730   5.434   7.856   1.00 0.00 ? 1159 LYS A HA   6  
ATOM 8878  H HB2  . LYS A 1 27  ? 1.136   6.361   5.007   1.00 0.00 ? 1159 LYS A HB2  6  
ATOM 8879  H HB3  . LYS A 1 27  ? -0.412  6.176   5.821   1.00 0.00 ? 1159 LYS A HB3  6  
ATOM 8880  H HG2  . LYS A 1 27  ? 0.720   7.851   7.537   1.00 0.00 ? 1159 LYS A HG2  6  
ATOM 8881  H HG3  . LYS A 1 27  ? 1.642   8.292   6.098   1.00 0.00 ? 1159 LYS A HG3  6  
ATOM 8882  H HD2  . LYS A 1 27  ? -1.344  8.086   5.987   1.00 0.00 ? 1159 LYS A HD2  6  
ATOM 8883  H HD3  . LYS A 1 27  ? -0.571  9.541   6.621   1.00 0.00 ? 1159 LYS A HD3  6  
ATOM 8884  H HE2  . LYS A 1 27  ? -0.885  10.017  4.360   1.00 0.00 ? 1159 LYS A HE2  6  
ATOM 8885  H HE3  . LYS A 1 27  ? 0.802   9.512   4.452   1.00 0.00 ? 1159 LYS A HE3  6  
ATOM 8886  H HZ1  . LYS A 1 27  ? 0.164   8.223   2.733   1.00 0.00 ? 1159 LYS A HZ1  6  
ATOM 8887  H HZ2  . LYS A 1 27  ? -1.464  8.191   3.192   1.00 0.00 ? 1159 LYS A HZ2  6  
ATOM 8888  H HZ3  . LYS A 1 27  ? -0.348  7.182   3.966   1.00 0.00 ? 1159 LYS A HZ3  6  
ATOM 8889  N N    . LEU A 1 28  ? 2.040   3.651   5.429   1.00 0.00 ? 1160 LEU A N    6  
ATOM 8890  C CA   . LEU A 1 28  ? 2.030   2.337   4.796   1.00 0.00 ? 1160 LEU A CA   6  
ATOM 8891  C C    . LEU A 1 28  ? 2.246   1.234   5.827   1.00 0.00 ? 1160 LEU A C    6  
ATOM 8892  O O    . LEU A 1 28  ? 1.612   0.180   5.766   1.00 0.00 ? 1160 LEU A O    6  
ATOM 8893  C CB   . LEU A 1 28  ? 3.112   2.261   3.717   1.00 0.00 ? 1160 LEU A CB   6  
ATOM 8894  C CG   . LEU A 1 28  ? 2.764   2.900   2.372   1.00 0.00 ? 1160 LEU A CG   6  
ATOM 8895  C CD1  . LEU A 1 28  ? 4.028   3.200   1.581   1.00 0.00 ? 1160 LEU A CD1  6  
ATOM 8896  C CD2  . LEU A 1 28  ? 1.836   1.995   1.575   1.00 0.00 ? 1160 LEU A CD2  6  
ATOM 8897  H H    . LEU A 1 28  ? 2.739   4.293   5.184   1.00 0.00 ? 1160 LEU A H    6  
ATOM 8898  H HA   . LEU A 1 28  ? 1.064   2.199   4.335   1.00 0.00 ? 1160 LEU A HA   6  
ATOM 8899  H HB2  . LEU A 1 28  ? 3.994   2.752   4.098   1.00 0.00 ? 1160 LEU A HB2  6  
ATOM 8900  H HB3  . LEU A 1 28  ? 3.330   1.217   3.542   1.00 0.00 ? 1160 LEU A HB3  6  
ATOM 8901  H HG   . LEU A 1 28  ? 2.251   3.836   2.547   1.00 0.00 ? 1160 LEU A HG   6  
ATOM 8902  H HD11 . LEU A 1 28  ? 4.653   3.877   2.143   1.00 0.00 ? 1160 LEU A HD11 6  
ATOM 8903  H HD12 . LEU A 1 28  ? 3.763   3.654   0.638   1.00 0.00 ? 1160 LEU A HD12 6  
ATOM 8904  H HD13 . LEU A 1 28  ? 4.565   2.281   1.399   1.00 0.00 ? 1160 LEU A HD13 6  
ATOM 8905  H HD21 . LEU A 1 28  ? 1.447   2.537   0.726   1.00 0.00 ? 1160 LEU A HD21 6  
ATOM 8906  H HD22 . LEU A 1 28  ? 1.018   1.675   2.204   1.00 0.00 ? 1160 LEU A HD22 6  
ATOM 8907  H HD23 . LEU A 1 28  ? 2.385   1.131   1.230   1.00 0.00 ? 1160 LEU A HD23 6  
ATOM 8908  N N    . VAL A 1 29  ? 3.144   1.484   6.775   1.00 0.00 ? 1161 VAL A N    6  
ATOM 8909  C CA   . VAL A 1 29  ? 3.441   0.513   7.821   1.00 0.00 ? 1161 VAL A CA   6  
ATOM 8910  C C    . VAL A 1 29  ? 2.179   0.121   8.581   1.00 0.00 ? 1161 VAL A C    6  
ATOM 8911  O O    . VAL A 1 29  ? 1.968   -1.052  8.888   1.00 0.00 ? 1161 VAL A O    6  
ATOM 8912  C CB   . VAL A 1 29  ? 4.477   1.064   8.819   1.00 0.00 ? 1161 VAL A CB   6  
ATOM 8913  C CG1  . VAL A 1 29  ? 4.680   0.091   9.971   1.00 0.00 ? 1161 VAL A CG1  6  
ATOM 8914  C CG2  . VAL A 1 29  ? 5.795   1.351   8.115   1.00 0.00 ? 1161 VAL A CG2  6  
ATOM 8915  H H    . VAL A 1 29  ? 3.617   2.342   6.770   1.00 0.00 ? 1161 VAL A H    6  
ATOM 8916  H HA   . VAL A 1 29  ? 3.856   -0.367  7.353   1.00 0.00 ? 1161 VAL A HA   6  
ATOM 8917  H HB   . VAL A 1 29  ? 4.100   1.992   9.224   1.00 0.00 ? 1161 VAL A HB   6  
ATOM 8918  H HG11 . VAL A 1 29  ? 5.183   0.595   10.783  1.00 0.00 ? 1161 VAL A HG11 6  
ATOM 8919  H HG12 . VAL A 1 29  ? 3.720   -0.271  10.309  1.00 0.00 ? 1161 VAL A HG12 6  
ATOM 8920  H HG13 . VAL A 1 29  ? 5.282   -0.742  9.637   1.00 0.00 ? 1161 VAL A HG13 6  
ATOM 8921  H HG21 . VAL A 1 29  ? 5.897   2.415   7.963   1.00 0.00 ? 1161 VAL A HG21 6  
ATOM 8922  H HG22 . VAL A 1 29  ? 6.614   0.993   8.723   1.00 0.00 ? 1161 VAL A HG22 6  
ATOM 8923  H HG23 . VAL A 1 29  ? 5.810   0.847   7.160   1.00 0.00 ? 1161 VAL A HG23 6  
ATOM 8924  N N    . GLU A 1 30  ? 1.343   1.110   8.880   1.00 0.00 ? 1162 GLU A N    6  
ATOM 8925  C CA   . GLU A 1 30  ? 0.101   0.867   9.605   1.00 0.00 ? 1162 GLU A CA   6  
ATOM 8926  C C    . GLU A 1 30  ? -0.736  -0.200  8.906   1.00 0.00 ? 1162 GLU A C    6  
ATOM 8927  O O    . GLU A 1 30  ? -1.136  -1.191  9.517   1.00 0.00 ? 1162 GLU A O    6  
ATOM 8928  C CB   . GLU A 1 30  ? -0.704  2.162   9.730   1.00 0.00 ? 1162 GLU A CB   6  
ATOM 8929  C CG   . GLU A 1 30  ? -0.115  3.151   10.722  1.00 0.00 ? 1162 GLU A CG   6  
ATOM 8930  C CD   . GLU A 1 30  ? -1.050  4.307   11.018  1.00 0.00 ? 1162 GLU A CD   6  
ATOM 8931  O OE1  . GLU A 1 30  ? -2.201  4.049   11.427  1.00 0.00 ? 1162 GLU A OE1  6  
ATOM 8932  O OE2  . GLU A 1 30  ? -0.631  5.470   10.839  1.00 0.00 ? 1162 GLU A OE2  6  
ATOM 8933  H H    . GLU A 1 30  ? 1.567   2.024   8.608   1.00 0.00 ? 1162 GLU A H    6  
ATOM 8934  H HA   . GLU A 1 30  ? 0.357   0.516   10.593  1.00 0.00 ? 1162 GLU A HA   6  
ATOM 8935  H HB2  . GLU A 1 30  ? -0.750  2.638   8.762   1.00 0.00 ? 1162 GLU A HB2  6  
ATOM 8936  H HB3  . GLU A 1 30  ? -1.707  1.918   10.050  1.00 0.00 ? 1162 GLU A HB3  6  
ATOM 8937  H HG2  . GLU A 1 30  ? 0.094   2.633   11.646  1.00 0.00 ? 1162 GLU A HG2  6  
ATOM 8938  H HG3  . GLU A 1 30  ? 0.804   3.545   10.316  1.00 0.00 ? 1162 GLU A HG3  6  
ATOM 8939  N N    . ALA A 1 31  ? -0.999  0.011   7.620   1.00 0.00 ? 1163 ALA A N    6  
ATOM 8940  C CA   . ALA A 1 31  ? -1.787  -0.933  6.837   1.00 0.00 ? 1163 ALA A CA   6  
ATOM 8941  C C    . ALA A 1 31  ? -1.099  -2.291  6.758   1.00 0.00 ? 1163 ALA A C    6  
ATOM 8942  O O    . ALA A 1 31  ? -1.739  -3.331  6.917   1.00 0.00 ? 1163 ALA A O    6  
ATOM 8943  C CB   . ALA A 1 31  ? -2.034  -0.382  5.440   1.00 0.00 ? 1163 ALA A CB   6  
ATOM 8944  H H    . ALA A 1 31  ? -0.653  0.819   7.188   1.00 0.00 ? 1163 ALA A H    6  
ATOM 8945  H HA   . ALA A 1 31  ? -2.745  -1.053  7.324   1.00 0.00 ? 1163 ALA A HA   6  
ATOM 8946  H HB1  . ALA A 1 31  ? -2.899  0.265   5.456   1.00 0.00 ? 1163 ALA A HB1  6  
ATOM 8947  H HB2  . ALA A 1 31  ? -1.170  0.179   5.117   1.00 0.00 ? 1163 ALA A HB2  6  
ATOM 8948  H HB3  . ALA A 1 31  ? -2.209  -1.200  4.757   1.00 0.00 ? 1163 ALA A HB3  6  
ATOM 8949  N N    . ARG A 1 32  ? 0.206   -2.275  6.512   1.00 0.00 ? 1164 ARG A N    6  
ATOM 8950  C CA   . ARG A 1 32  ? 0.981   -3.506  6.410   1.00 0.00 ? 1164 ARG A CA   6  
ATOM 8951  C C    . ARG A 1 32  ? 0.864   -4.328  7.691   1.00 0.00 ? 1164 ARG A C    6  
ATOM 8952  O O    . ARG A 1 32  ? 1.009   -5.550  7.669   1.00 0.00 ? 1164 ARG A O    6  
ATOM 8953  C CB   . ARG A 1 32  ? 2.450   -3.188  6.127   1.00 0.00 ? 1164 ARG A CB   6  
ATOM 8954  C CG   . ARG A 1 32  ? 3.236   -4.371  5.588   1.00 0.00 ? 1164 ARG A CG   6  
ATOM 8955  C CD   . ARG A 1 32  ? 3.894   -5.161  6.709   1.00 0.00 ? 1164 ARG A CD   6  
ATOM 8956  N NE   . ARG A 1 32  ? 5.080   -4.487  7.231   1.00 0.00 ? 1164 ARG A NE   6  
ATOM 8957  C CZ   . ARG A 1 32  ? 5.559   -4.684  8.454   1.00 0.00 ? 1164 ARG A CZ   6  
ATOM 8958  N NH1  . ARG A 1 32  ? 4.955   -5.530  9.278   1.00 0.00 ? 1164 ARG A NH1  6  
ATOM 8959  N NH2  . ARG A 1 32  ? 6.643   -4.034  8.856   1.00 0.00 ? 1164 ARG A NH2  6  
ATOM 8960  H H    . ARG A 1 32  ? 0.660   -1.414  6.395   1.00 0.00 ? 1164 ARG A H    6  
ATOM 8961  H HA   . ARG A 1 32  ? 0.581   -4.082  5.589   1.00 0.00 ? 1164 ARG A HA   6  
ATOM 8962  H HB2  . ARG A 1 32  ? 2.500   -2.390  5.401   1.00 0.00 ? 1164 ARG A HB2  6  
ATOM 8963  H HB3  . ARG A 1 32  ? 2.917   -2.860  7.044   1.00 0.00 ? 1164 ARG A HB3  6  
ATOM 8964  H HG2  . ARG A 1 32  ? 2.564   -5.023  5.050   1.00 0.00 ? 1164 ARG A HG2  6  
ATOM 8965  H HG3  . ARG A 1 32  ? 4.002   -4.008  4.919   1.00 0.00 ? 1164 ARG A HG3  6  
ATOM 8966  H HD2  . ARG A 1 32  ? 3.180   -5.284  7.511   1.00 0.00 ? 1164 ARG A HD2  6  
ATOM 8967  H HD3  . ARG A 1 32  ? 4.179   -6.130  6.329   1.00 0.00 ? 1164 ARG A HD3  6  
ATOM 8968  H HE   . ARG A 1 32  ? 5.541   -3.858  6.639   1.00 0.00 ? 1164 ARG A HE   6  
ATOM 8969  H HH11 . ARG A 1 32  ? 4.139   -6.022  8.977   1.00 0.00 ? 1164 ARG A HH11 6  
ATOM 8970  H HH12 . ARG A 1 32  ? 5.319   -5.677  10.198  1.00 0.00 ? 1164 ARG A HH12 6  
ATOM 8971  H HH21 . ARG A 1 32  ? 7.101   -3.395  8.237   1.00 0.00 ? 1164 ARG A HH21 6  
ATOM 8972  H HH22 . ARG A 1 32  ? 7.003   -4.182  9.776   1.00 0.00 ? 1164 ARG A HH22 6  
ATOM 8973  N N    . GLN A 1 33  ? 0.604   -3.648  8.803   1.00 0.00 ? 1165 GLN A N    6  
ATOM 8974  C CA   . GLN A 1 33  ? 0.469   -4.316  10.092  1.00 0.00 ? 1165 GLN A CA   6  
ATOM 8975  C C    . GLN A 1 33  ? -0.974  -4.742  10.337  1.00 0.00 ? 1165 GLN A C    6  
ATOM 8976  O O    . GLN A 1 33  ? -1.301  -5.928  10.287  1.00 0.00 ? 1165 GLN A O    6  
ATOM 8977  C CB   . GLN A 1 33  ? 0.941   -3.395  11.219  1.00 0.00 ? 1165 GLN A CB   6  
ATOM 8978  C CG   . GLN A 1 33  ? 0.997   -4.075  12.577  1.00 0.00 ? 1165 GLN A CG   6  
ATOM 8979  C CD   . GLN A 1 33  ? 1.948   -3.387  13.536  1.00 0.00 ? 1165 GLN A CD   6  
ATOM 8980  O OE1  . GLN A 1 33  ? 2.783   -2.580  13.127  1.00 0.00 ? 1165 GLN A OE1  6  
ATOM 8981  N NE2  . GLN A 1 33  ? 1.825   -3.702  14.820  1.00 0.00 ? 1165 GLN A NE2  6  
ATOM 8982  H H    . GLN A 1 33  ? 0.499   -2.676  8.755   1.00 0.00 ? 1165 GLN A H    6  
ATOM 8983  H HA   . GLN A 1 33  ? 1.093   -5.197  10.075  1.00 0.00 ? 1165 GLN A HA   6  
ATOM 8984  H HB2  . GLN A 1 33  ? 1.929   -3.032  10.981  1.00 0.00 ? 1165 GLN A HB2  6  
ATOM 8985  H HB3  . GLN A 1 33  ? 0.264   -2.556  11.288  1.00 0.00 ? 1165 GLN A HB3  6  
ATOM 8986  H HG2  . GLN A 1 33  ? 0.007   -4.069  13.010  1.00 0.00 ? 1165 GLN A HG2  6  
ATOM 8987  H HG3  . GLN A 1 33  ? 1.322   -5.096  12.441  1.00 0.00 ? 1165 GLN A HG3  6  
ATOM 8988  H HE21 . GLN A 1 33  ? 1.138   -4.354  15.073  1.00 0.00 ? 1165 GLN A HE21 6  
ATOM 8989  H HE22 . GLN A 1 33  ? 2.428   -3.272  15.461  1.00 0.00 ? 1165 GLN A HE22 6  
ATOM 8990  N N    . LYS A 1 34  ? -1.836  -3.766  10.602  1.00 0.00 ? 1166 LYS A N    6  
ATOM 8991  C CA   . LYS A 1 34  ? -3.247  -4.038  10.855  1.00 0.00 ? 1166 LYS A CA   6  
ATOM 8992  C C    . LYS A 1 34  ? -3.773  -5.108  9.904   1.00 0.00 ? 1166 LYS A C    6  
ATOM 8993  O O    . LYS A 1 34  ? -4.689  -5.859  10.243  1.00 0.00 ? 1166 LYS A O    6  
ATOM 8994  C CB   . LYS A 1 34  ? -4.069  -2.757  10.704  1.00 0.00 ? 1166 LYS A CB   6  
ATOM 8995  C CG   . LYS A 1 34  ? -4.097  -2.216  9.285   1.00 0.00 ? 1166 LYS A CG   6  
ATOM 8996  C CD   . LYS A 1 34  ? -5.403  -1.499  8.986   1.00 0.00 ? 1166 LYS A CD   6  
ATOM 8997  C CE   . LYS A 1 34  ? -5.772  -1.603  7.514   1.00 0.00 ? 1166 LYS A CE   6  
ATOM 8998  N NZ   . LYS A 1 34  ? -5.170  -0.502  6.713   1.00 0.00 ? 1166 LYS A NZ   6  
ATOM 8999  H H    . LYS A 1 34  ? -1.516  -2.840  10.628  1.00 0.00 ? 1166 LYS A H    6  
ATOM 9000  H HA   . LYS A 1 34  ? -3.339  -4.398  11.868  1.00 0.00 ? 1166 LYS A HA   6  
ATOM 9001  H HB2  . LYS A 1 34  ? -5.085  -2.957  11.010  1.00 0.00 ? 1166 LYS A HB2  6  
ATOM 9002  H HB3  . LYS A 1 34  ? -3.651  -1.997  11.348  1.00 0.00 ? 1166 LYS A HB3  6  
ATOM 9003  H HG2  . LYS A 1 34  ? -3.281  -1.520  9.158   1.00 0.00 ? 1166 LYS A HG2  6  
ATOM 9004  H HG3  . LYS A 1 34  ? -3.982  -3.038  8.593   1.00 0.00 ? 1166 LYS A HG3  6  
ATOM 9005  H HD2  . LYS A 1 34  ? -6.191  -1.945  9.575   1.00 0.00 ? 1166 LYS A HD2  6  
ATOM 9006  H HD3  . LYS A 1 34  ? -5.300  -0.456  9.250   1.00 0.00 ? 1166 LYS A HD3  6  
ATOM 9007  H HE2  . LYS A 1 34  ? -5.419  -2.549  7.134   1.00 0.00 ? 1166 LYS A HE2  6  
ATOM 9008  H HE3  . LYS A 1 34  ? -6.848  -1.558  7.422   1.00 0.00 ? 1166 LYS A HE3  6  
ATOM 9009  H HZ1  . LYS A 1 34  ? -5.919  0.065   6.265   1.00 0.00 ? 1166 LYS A HZ1  6  
ATOM 9010  H HZ2  . LYS A 1 34  ? -4.558  -0.895  5.970   1.00 0.00 ? 1166 LYS A HZ2  6  
ATOM 9011  H HZ3  . LYS A 1 34  ? -4.601  0.116   7.325   1.00 0.00 ? 1166 LYS A HZ3  6  
ATOM 9012  N N    . HIS A 1 35  ? -3.188  -5.174  8.712   1.00 0.00 ? 1167 HIS A N    6  
ATOM 9013  C CA   . HIS A 1 35  ? -3.597  -6.154  7.712   1.00 0.00 ? 1167 HIS A CA   6  
ATOM 9014  C C    . HIS A 1 35  ? -3.020  -7.530  8.032   1.00 0.00 ? 1167 HIS A C    6  
ATOM 9015  O O    . HIS A 1 35  ? -3.722  -8.538  7.970   1.00 0.00 ? 1167 HIS A O    6  
ATOM 9016  C CB   . HIS A 1 35  ? -3.149  -5.711  6.319   1.00 0.00 ? 1167 HIS A CB   6  
ATOM 9017  C CG   . HIS A 1 35  ? -3.848  -6.432  5.208   1.00 0.00 ? 1167 HIS A CG   6  
ATOM 9018  N ND1  . HIS A 1 35  ? -5.081  -7.031  5.357   1.00 0.00 ? 1167 HIS A ND1  6  
ATOM 9019  C CD2  . HIS A 1 35  ? -3.481  -6.646  3.923   1.00 0.00 ? 1167 HIS A CD2  6  
ATOM 9020  C CE1  . HIS A 1 35  ? -5.441  -7.584  4.213   1.00 0.00 ? 1167 HIS A CE1  6  
ATOM 9021  N NE2  . HIS A 1 35  ? -4.487  -7.365  3.326   1.00 0.00 ? 1167 HIS A NE2  6  
ATOM 9022  H H    . HIS A 1 35  ? -2.464  -4.549  8.500   1.00 0.00 ? 1167 HIS A H    6  
ATOM 9023  H HA   . HIS A 1 35  ? -4.675  -6.217  7.731   1.00 0.00 ? 1167 HIS A HA   6  
ATOM 9024  H HB2  . HIS A 1 35  ? -3.345  -4.655  6.204   1.00 0.00 ? 1167 HIS A HB2  6  
ATOM 9025  H HB3  . HIS A 1 35  ? -2.088  -5.889  6.216   1.00 0.00 ? 1167 HIS A HB3  6  
ATOM 9026  H HD1  . HIS A 1 35  ? -5.612  -7.049  6.180   1.00 0.00 ? 1167 HIS A HD1  6  
ATOM 9027  H HD2  . HIS A 1 35  ? -2.565  -6.315  3.453   1.00 0.00 ? 1167 HIS A HD2  6  
ATOM 9028  H HE1  . HIS A 1 35  ? -6.359  -8.123  4.033   1.00 0.00 ? 1167 HIS A HE1  6  
ATOM 9029  H HE2  . HIS A 1 35  ? -4.461  -7.740  2.421   1.00 0.00 ? 1167 HIS A HE2  6  
ATOM 9030  N N    . ALA A 1 36  ? -1.736  -7.562  8.373   1.00 0.00 ? 1168 ALA A N    6  
ATOM 9031  C CA   . ALA A 1 36  ? -1.064  -8.813  8.703   1.00 0.00 ? 1168 ALA A CA   6  
ATOM 9032  C C    . ALA A 1 36  ? -1.893  -9.639  9.682   1.00 0.00 ? 1168 ALA A C    6  
ATOM 9033  O O    . ALA A 1 36  ? -2.175  -10.811 9.435   1.00 0.00 ? 1168 ALA A O    6  
ATOM 9034  C CB   . ALA A 1 36  ? 0.316   -8.535  9.281   1.00 0.00 ? 1168 ALA A CB   6  
ATOM 9035  H H    . ALA A 1 36  ? -1.228  -6.725  8.404   1.00 0.00 ? 1168 ALA A H    6  
ATOM 9036  H HA   . ALA A 1 36  ? -0.939  -9.376  7.789   1.00 0.00 ? 1168 ALA A HA   6  
ATOM 9037  H HB1  . ALA A 1 36  ? 0.282   -8.636  10.356  1.00 0.00 ? 1168 ALA A HB1  6  
ATOM 9038  H HB2  . ALA A 1 36  ? 1.025   -9.241  8.874   1.00 0.00 ? 1168 ALA A HB2  6  
ATOM 9039  H HB3  . ALA A 1 36  ? 0.618   -7.531  9.022   1.00 0.00 ? 1168 ALA A HB3  6  
ATOM 9040  N N    . ASN A 1 37  ? -2.278  -9.020  10.793  1.00 0.00 ? 1169 ASN A N    6  
ATOM 9041  C CA   . ASN A 1 37  ? -3.073  -9.699  11.809  1.00 0.00 ? 1169 ASN A CA   6  
ATOM 9042  C C    . ASN A 1 37  ? -4.385  -10.211 11.222  1.00 0.00 ? 1169 ASN A C    6  
ATOM 9043  O O    . ASN A 1 37  ? -4.832  -11.313 11.539  1.00 0.00 ? 1169 ASN A O    6  
ATOM 9044  C CB   . ASN A 1 37  ? -3.360  -8.754  12.978  1.00 0.00 ? 1169 ASN A CB   6  
ATOM 9045  C CG   . ASN A 1 37  ? -2.292  -8.824  14.053  1.00 0.00 ? 1169 ASN A CG   6  
ATOM 9046  O OD1  . ASN A 1 37  ? -2.426  -9.562  15.029  1.00 0.00 ? 1169 ASN A OD1  6  
ATOM 9047  N ND2  . ASN A 1 37  ? -1.225  -8.053  13.877  1.00 0.00 ? 1169 ASN A ND2  6  
ATOM 9048  H H    . ASN A 1 37  ? -2.022  -8.084  10.933  1.00 0.00 ? 1169 ASN A H    6  
ATOM 9049  H HA   . ASN A 1 37  ? -2.501  -10.540 12.170  1.00 0.00 ? 1169 ASN A HA   6  
ATOM 9050  H HB2  . ASN A 1 37  ? -3.406  -7.739  12.610  1.00 0.00 ? 1169 ASN A HB2  6  
ATOM 9051  H HB3  . ASN A 1 37  ? -4.309  -9.016  13.421  1.00 0.00 ? 1169 ASN A HB3  6  
ATOM 9052  H HD21 . ASN A 1 37  ? -1.186  -7.491  13.075  1.00 0.00 ? 1169 ASN A HD21 6  
ATOM 9053  H HD22 . ASN A 1 37  ? -0.519  -8.079  14.556  1.00 0.00 ? 1169 ASN A HD22 6  
ATOM 9054  N N    . LYS A 1 38  ? -4.997  -9.403  10.363  1.00 0.00 ? 1170 LYS A N    6  
ATOM 9055  C CA   . LYS A 1 38  ? -6.257  -9.773  9.728   1.00 0.00 ? 1170 LYS A CA   6  
ATOM 9056  C C    . LYS A 1 38  ? -6.180  -11.181 9.147   1.00 0.00 ? 1170 LYS A C    6  
ATOM 9057  O O    . LYS A 1 38  ? -6.982  -12.049 9.490   1.00 0.00 ? 1170 LYS A O    6  
ATOM 9058  C CB   . LYS A 1 38  ? -6.609  -8.773  8.625   1.00 0.00 ? 1170 LYS A CB   6  
ATOM 9059  C CG   . LYS A 1 38  ? -8.084  -8.760  8.263   1.00 0.00 ? 1170 LYS A CG   6  
ATOM 9060  C CD   . LYS A 1 38  ? -8.302  -8.319  6.825   1.00 0.00 ? 1170 LYS A CD   6  
ATOM 9061  C CE   . LYS A 1 38  ? -8.465  -6.810  6.724   1.00 0.00 ? 1170 LYS A CE   6  
ATOM 9062  N NZ   . LYS A 1 38  ? -9.199  -6.413  5.491   1.00 0.00 ? 1170 LYS A NZ   6  
ATOM 9063  H H    . LYS A 1 38  ? -4.591  -8.536  10.150  1.00 0.00 ? 1170 LYS A H    6  
ATOM 9064  H HA   . LYS A 1 38  ? -7.028  -9.750  10.483  1.00 0.00 ? 1170 LYS A HA   6  
ATOM 9065  H HB2  . LYS A 1 38  ? -6.332  -7.781  8.952   1.00 0.00 ? 1170 LYS A HB2  6  
ATOM 9066  H HB3  . LYS A 1 38  ? -6.044  -9.020  7.737   1.00 0.00 ? 1170 LYS A HB3  6  
ATOM 9067  H HG2  . LYS A 1 38  ? -8.484  -9.755  8.387   1.00 0.00 ? 1170 LYS A HG2  6  
ATOM 9068  H HG3  . LYS A 1 38  ? -8.601  -8.077  8.922   1.00 0.00 ? 1170 LYS A HG3  6  
ATOM 9069  H HD2  . LYS A 1 38  ? -7.450  -8.618  6.233   1.00 0.00 ? 1170 LYS A HD2  6  
ATOM 9070  H HD3  . LYS A 1 38  ? -9.194  -8.795  6.443   1.00 0.00 ? 1170 LYS A HD3  6  
ATOM 9071  H HE2  . LYS A 1 38  ? -9.012  -6.462  7.586   1.00 0.00 ? 1170 LYS A HE2  6  
ATOM 9072  H HE3  . LYS A 1 38  ? -7.485  -6.356  6.712   1.00 0.00 ? 1170 LYS A HE3  6  
ATOM 9073  H HZ1  . LYS A 1 38  ? -9.143  -5.383  5.358   1.00 0.00 ? 1170 LYS A HZ1  6  
ATOM 9074  H HZ2  . LYS A 1 38  ? -10.199 -6.688  5.566   1.00 0.00 ? 1170 LYS A HZ2  6  
ATOM 9075  H HZ3  . LYS A 1 38  ? -8.783  -6.882  4.661   1.00 0.00 ? 1170 LYS A HZ3  6  
ATOM 9076  N N    . MET A 1 39  ? -5.209  -11.401 8.266   1.00 0.00 ? 1171 MET A N    6  
ATOM 9077  C CA   . MET A 1 39  ? -5.027  -12.705 7.640   1.00 0.00 ? 1171 MET A CA   6  
ATOM 9078  C C    . MET A 1 39  ? -4.285  -13.657 8.573   1.00 0.00 ? 1171 MET A C    6  
ATOM 9079  O O    . MET A 1 39  ? -3.957  -14.782 8.194   1.00 0.00 ? 1171 MET A O    6  
ATOM 9080  C CB   . MET A 1 39  ? -4.259  -12.560 6.324   1.00 0.00 ? 1171 MET A CB   6  
ATOM 9081  C CG   . MET A 1 39  ? -5.091  -11.968 5.198   1.00 0.00 ? 1171 MET A CG   6  
ATOM 9082  S SD   . MET A 1 39  ? -4.303  -12.145 3.586   1.00 0.00 ? 1171 MET A SD   6  
ATOM 9083  C CE   . MET A 1 39  ? -3.101  -10.818 3.649   1.00 0.00 ? 1171 MET A CE   6  
ATOM 9084  H H    . MET A 1 39  ? -4.600  -10.669 8.032   1.00 0.00 ? 1171 MET A H    6  
ATOM 9085  H HA   . MET A 1 39  ? -6.005  -13.112 7.433   1.00 0.00 ? 1171 MET A HA   6  
ATOM 9086  H HB2  . MET A 1 39  ? -3.406  -11.919 6.488   1.00 0.00 ? 1171 MET A HB2  6  
ATOM 9087  H HB3  . MET A 1 39  ? -3.914  -13.534 6.013   1.00 0.00 ? 1171 MET A HB3  6  
ATOM 9088  H HG2  . MET A 1 39  ? -6.047  -12.470 5.172   1.00 0.00 ? 1171 MET A HG2  6  
ATOM 9089  H HG3  . MET A 1 39  ? -5.244  -10.917 5.396   1.00 0.00 ? 1171 MET A HG3  6  
ATOM 9090  H HE1  . MET A 1 39  ? -3.053  -10.423 4.653   1.00 0.00 ? 1171 MET A HE1  6  
ATOM 9091  H HE2  . MET A 1 39  ? -2.131  -11.198 3.365   1.00 0.00 ? 1171 MET A HE2  6  
ATOM 9092  H HE3  . MET A 1 39  ? -3.395  -10.034 2.967   1.00 0.00 ? 1171 MET A HE3  6  
ATOM 9093  N N    . ASP A 1 40  ? -4.022  -13.199 9.791   1.00 0.00 ? 1172 ASP A N    6  
ATOM 9094  C CA   . ASP A 1 40  ? -3.319  -14.010 10.778  1.00 0.00 ? 1172 ASP A CA   6  
ATOM 9095  C C    . ASP A 1 40  ? -1.947  -14.429 10.259  1.00 0.00 ? 1172 ASP A C    6  
ATOM 9096  O O    . ASP A 1 40  ? -1.483  -15.538 10.526  1.00 0.00 ? 1172 ASP A O    6  
ATOM 9097  C CB   . ASP A 1 40  ? -4.144  -15.248 11.133  1.00 0.00 ? 1172 ASP A CB   6  
ATOM 9098  C CG   . ASP A 1 40  ? -5.534  -14.897 11.624  1.00 0.00 ? 1172 ASP A CG   6  
ATOM 9099  O OD1  . ASP A 1 40  ? -5.724  -13.760 12.106  1.00 0.00 ? 1172 ASP A OD1  6  
ATOM 9100  O OD2  . ASP A 1 40  ? -6.433  -15.758 11.525  1.00 0.00 ? 1172 ASP A OD2  6  
ATOM 9101  H H    . ASP A 1 40  ? -4.308  -12.293 10.034  1.00 0.00 ? 1172 ASP A H    6  
ATOM 9102  H HA   . ASP A 1 40  ? -3.186  -13.411 11.666  1.00 0.00 ? 1172 ASP A HA   6  
ATOM 9103  H HB2  . ASP A 1 40  ? -4.239  -15.872 10.256  1.00 0.00 ? 1172 ASP A HB2  6  
ATOM 9104  H HB3  . ASP A 1 40  ? -3.636  -15.801 11.909  1.00 0.00 ? 1172 ASP A HB3  6  
ATOM 9105  N N    . VAL A 1 41  ? -1.302  -13.535 9.516   1.00 0.00 ? 1173 VAL A N    6  
ATOM 9106  C CA   . VAL A 1 41  ? 0.016   -13.811 8.960   1.00 0.00 ? 1173 VAL A CA   6  
ATOM 9107  C C    . VAL A 1 41  ? 1.070   -12.886 9.558   1.00 0.00 ? 1173 VAL A C    6  
ATOM 9108  O O    . VAL A 1 41  ? 0.830   -11.703 9.799   1.00 0.00 ? 1173 VAL A O    6  
ATOM 9109  C CB   . VAL A 1 41  ? 0.023   -13.655 7.427   1.00 0.00 ? 1173 VAL A CB   6  
ATOM 9110  C CG1  . VAL A 1 41  ? -0.912  -14.666 6.783   1.00 0.00 ? 1173 VAL A CG1  6  
ATOM 9111  C CG2  . VAL A 1 41  ? -0.361  -12.236 7.035   1.00 0.00 ? 1173 VAL A CG2  6  
ATOM 9112  H H    . VAL A 1 41  ? -1.724  -12.668 9.339   1.00 0.00 ? 1173 VAL A H    6  
ATOM 9113  H HA   . VAL A 1 41  ? 0.272   -14.834 9.197   1.00 0.00 ? 1173 VAL A HA   6  
ATOM 9114  H HB   . VAL A 1 41  ? 1.025   -13.845 7.071   1.00 0.00 ? 1173 VAL A HB   6  
ATOM 9115  H HG11 . VAL A 1 41  ? -0.521  -14.954 5.818   1.00 0.00 ? 1173 VAL A HG11 6  
ATOM 9116  H HG12 . VAL A 1 41  ? -0.991  -15.538 7.416   1.00 0.00 ? 1173 VAL A HG12 6  
ATOM 9117  H HG13 . VAL A 1 41  ? -1.889  -14.224 6.657   1.00 0.00 ? 1173 VAL A HG13 6  
ATOM 9118  H HG21 . VAL A 1 41  ? -0.869  -12.252 6.082   1.00 0.00 ? 1173 VAL A HG21 6  
ATOM 9119  H HG22 . VAL A 1 41  ? -1.018  -11.820 7.786   1.00 0.00 ? 1173 VAL A HG22 6  
ATOM 9120  H HG23 . VAL A 1 41  ? 0.529   -11.629 6.960   1.00 0.00 ? 1173 VAL A HG23 6  
ATOM 9121  N N    . PRO A 1 42  ? 2.268   -13.437 9.806   1.00 0.00 ? 1174 PRO A N    6  
ATOM 9122  C CA   . PRO A 1 42  ? 3.384   -12.679 10.379  1.00 0.00 ? 1174 PRO A CA   6  
ATOM 9123  C C    . PRO A 1 42  ? 3.604   -11.345 9.672   1.00 0.00 ? 1174 PRO A C    6  
ATOM 9124  O O    . PRO A 1 42  ? 3.621   -11.262 8.444   1.00 0.00 ? 1174 PRO A O    6  
ATOM 9125  C CB   . PRO A 1 42  ? 4.587   -13.601 10.165  1.00 0.00 ? 1174 PRO A CB   6  
ATOM 9126  C CG   . PRO A 1 42  ? 4.007   -14.972 10.108  1.00 0.00 ? 1174 PRO A CG   6  
ATOM 9127  C CD   . PRO A 1 42  ? 2.626   -14.841 9.544   1.00 0.00 ? 1174 PRO A CD   6  
ATOM 9128  H HA   . PRO A 1 42  ? 3.245   -12.506 11.436  1.00 0.00 ? 1174 PRO A HA   6  
ATOM 9129  H HB2  . PRO A 1 42  ? 5.082   -13.342 9.239   1.00 0.00 ? 1174 PRO A HB2  6  
ATOM 9130  H HB3  . PRO A 1 42  ? 5.276   -13.498 10.989  1.00 0.00 ? 1174 PRO A HB3  6  
ATOM 9131  H HG2  . PRO A 1 42  ? 4.607   -15.599 9.466   1.00 0.00 ? 1174 PRO A HG2  6  
ATOM 9132  H HG3  . PRO A 1 42  ? 3.958   -15.391 11.103  1.00 0.00 ? 1174 PRO A HG3  6  
ATOM 9133  H HD2  . PRO A 1 42  ? 2.635   -15.046 8.484   1.00 0.00 ? 1174 PRO A HD2  6  
ATOM 9134  H HD3  . PRO A 1 42  ? 1.950   -15.512 10.054  1.00 0.00 ? 1174 PRO A HD3  6  
ATOM 9135  N N    . PRO A 1 43  ? 3.775   -10.276 10.463  1.00 0.00 ? 1175 PRO A N    6  
ATOM 9136  C CA   . PRO A 1 43  ? 3.997   -8.927  9.934   1.00 0.00 ? 1175 PRO A CA   6  
ATOM 9137  C C    . PRO A 1 43  ? 5.067   -8.899  8.848   1.00 0.00 ? 1175 PRO A C    6  
ATOM 9138  O O    . PRO A 1 43  ? 5.150   -7.950  8.070   1.00 0.00 ? 1175 PRO A O    6  
ATOM 9139  C CB   . PRO A 1 43  ? 4.459   -8.137  11.161  1.00 0.00 ? 1175 PRO A CB   6  
ATOM 9140  C CG   . PRO A 1 43  ? 3.866   -8.858  12.322  1.00 0.00 ? 1175 PRO A CG   6  
ATOM 9141  C CD   . PRO A 1 43  ? 3.765   -10.302 11.936  1.00 0.00 ? 1175 PRO A CD   6  
ATOM 9142  H HA   . PRO A 1 43  ? 3.084   -8.497  9.549   1.00 0.00 ? 1175 PRO A HA   6  
ATOM 9143  H HB2  . PRO A 1 43  ? 5.539   -8.135  11.206  1.00 0.00 ? 1175 PRO A HB2  6  
ATOM 9144  H HB3  . PRO A 1 43  ? 4.094   -7.122  11.098  1.00 0.00 ? 1175 PRO A HB3  6  
ATOM 9145  H HG2  . PRO A 1 43  ? 4.505   -8.753  13.185  1.00 0.00 ? 1175 PRO A HG2  6  
ATOM 9146  H HG3  . PRO A 1 43  ? 2.881   -8.467  12.533  1.00 0.00 ? 1175 PRO A HG3  6  
ATOM 9147  H HD2  . PRO A 1 43  ? 4.614   -10.850 12.317  1.00 0.00 ? 1175 PRO A HD2  6  
ATOM 9148  H HD3  . PRO A 1 43  ? 2.843   -10.724 12.307  1.00 0.00 ? 1175 PRO A HD3  6  
ATOM 9149  N N    . ALA A 1 44  ? 5.885   -9.946  8.803   1.00 0.00 ? 1176 ALA A N    6  
ATOM 9150  C CA   . ALA A 1 44  ? 6.948   -10.042 7.811   1.00 0.00 ? 1176 ALA A CA   6  
ATOM 9151  C C    . ALA A 1 44  ? 6.482   -10.810 6.578   1.00 0.00 ? 1176 ALA A C    6  
ATOM 9152  O O    . ALA A 1 44  ? 6.801   -10.441 5.448   1.00 0.00 ? 1176 ALA A O    6  
ATOM 9153  C CB   . ALA A 1 44  ? 8.176   -10.707 8.416   1.00 0.00 ? 1176 ALA A CB   6  
ATOM 9154  H H    . ALA A 1 44  ? 5.768   -10.672 9.451   1.00 0.00 ? 1176 ALA A H    6  
ATOM 9155  H HA   . ALA A 1 44  ? 7.221   -9.039  7.515   1.00 0.00 ? 1176 ALA A HA   6  
ATOM 9156  H HB1  . ALA A 1 44  ? 7.934   -11.722 8.693   1.00 0.00 ? 1176 ALA A HB1  6  
ATOM 9157  H HB2  . ALA A 1 44  ? 8.976   -10.711 7.691   1.00 0.00 ? 1176 ALA A HB2  6  
ATOM 9158  H HB3  . ALA A 1 44  ? 8.486   -10.158 9.292   1.00 0.00 ? 1176 ALA A HB3  6  
ATOM 9159  N N    . ILE A 1 45  ? 5.726   -11.879 6.804   1.00 0.00 ? 1177 ILE A N    6  
ATOM 9160  C CA   . ILE A 1 45  ? 5.216   -12.698 5.712   1.00 0.00 ? 1177 ILE A CA   6  
ATOM 9161  C C    . ILE A 1 45  ? 4.371   -11.869 4.751   1.00 0.00 ? 1177 ILE A C    6  
ATOM 9162  O O    . ILE A 1 45  ? 4.546   -11.939 3.534   1.00 0.00 ? 1177 ILE A O    6  
ATOM 9163  C CB   . ILE A 1 45  ? 4.372   -13.875 6.237   1.00 0.00 ? 1177 ILE A CB   6  
ATOM 9164  C CG1  . ILE A 1 45  ? 5.266   -14.900 6.937   1.00 0.00 ? 1177 ILE A CG1  6  
ATOM 9165  C CG2  . ILE A 1 45  ? 3.603   -14.525 5.096   1.00 0.00 ? 1177 ILE A CG2  6  
ATOM 9166  C CD1  . ILE A 1 45  ? 6.253   -15.575 6.009   1.00 0.00 ? 1177 ILE A CD1  6  
ATOM 9167  H H    . ILE A 1 45  ? 5.506   -12.123 7.727   1.00 0.00 ? 1177 ILE A H    6  
ATOM 9168  H HA   . ILE A 1 45  ? 6.063   -13.101 5.174   1.00 0.00 ? 1177 ILE A HA   6  
ATOM 9169  H HB   . ILE A 1 45  ? 3.657   -13.487 6.946   1.00 0.00 ? 1177 ILE A HB   6  
ATOM 9170  H HG12 . ILE A 1 45  ? 5.827   -14.408 7.715   1.00 0.00 ? 1177 ILE A HG12 6  
ATOM 9171  H HG13 . ILE A 1 45  ? 4.645   -15.667 7.376   1.00 0.00 ? 1177 ILE A HG13 6  
ATOM 9172  H HG21 . ILE A 1 45  ? 3.918   -14.094 4.158   1.00 0.00 ? 1177 ILE A HG21 6  
ATOM 9173  H HG22 . ILE A 1 45  ? 3.802   -15.586 5.088   1.00 0.00 ? 1177 ILE A HG22 6  
ATOM 9174  H HG23 . ILE A 1 45  ? 2.546   -14.357 5.233   1.00 0.00 ? 1177 ILE A HG23 6  
ATOM 9175  H HD11 . ILE A 1 45  ? 6.264   -16.637 6.205   1.00 0.00 ? 1177 ILE A HD11 6  
ATOM 9176  H HD12 . ILE A 1 45  ? 5.963   -15.399 4.985   1.00 0.00 ? 1177 ILE A HD12 6  
ATOM 9177  H HD13 . ILE A 1 45  ? 7.240   -15.169 6.178   1.00 0.00 ? 1177 ILE A HD13 6  
ATOM 9178  N N    . LEU A 1 46  ? 3.455   -11.083 5.306   1.00 0.00 ? 1178 LEU A N    6  
ATOM 9179  C CA   . LEU A 1 46  ? 2.582   -10.238 4.499   1.00 0.00 ? 1178 LEU A CA   6  
ATOM 9180  C C    . LEU A 1 46  ? 3.396   -9.366  3.548   1.00 0.00 ? 1178 LEU A C    6  
ATOM 9181  O O    . LEU A 1 46  ? 3.295   -9.499  2.329   1.00 0.00 ? 1178 LEU A O    6  
ATOM 9182  C CB   . LEU A 1 46  ? 1.716   -9.357  5.401   1.00 0.00 ? 1178 LEU A CB   6  
ATOM 9183  C CG   . LEU A 1 46  ? 0.502   -8.705  4.737   1.00 0.00 ? 1178 LEU A CG   6  
ATOM 9184  C CD1  . LEU A 1 46  ? -0.583  -9.738  4.478   1.00 0.00 ? 1178 LEU A CD1  6  
ATOM 9185  C CD2  . LEU A 1 46  ? -0.033  -7.572  5.601   1.00 0.00 ? 1178 LEU A CD2  6  
ATOM 9186  H H    . LEU A 1 46  ? 3.362   -11.070 6.281   1.00 0.00 ? 1178 LEU A H    6  
ATOM 9187  H HA   . LEU A 1 46  ? 1.941   -10.883 3.917   1.00 0.00 ? 1178 LEU A HA   6  
ATOM 9188  H HB2  . LEU A 1 46  ? 1.359   -9.968  6.215   1.00 0.00 ? 1178 LEU A HB2  6  
ATOM 9189  H HB3  . LEU A 1 46  ? 2.343   -8.568  5.793   1.00 0.00 ? 1178 LEU A HB3  6  
ATOM 9190  H HG   . LEU A 1 46  ? 0.801   -8.288  3.785   1.00 0.00 ? 1178 LEU A HG   6  
ATOM 9191  H HD11 . LEU A 1 46  ? -1.292  -9.727  5.291   1.00 0.00 ? 1178 LEU A HD11 6  
ATOM 9192  H HD12 . LEU A 1 46  ? -0.136  -10.718 4.403   1.00 0.00 ? 1178 LEU A HD12 6  
ATOM 9193  H HD13 . LEU A 1 46  ? -1.090  -9.502  3.553   1.00 0.00 ? 1178 LEU A HD13 6  
ATOM 9194  H HD21 . LEU A 1 46  ? -0.761  -7.962  6.296   1.00 0.00 ? 1178 LEU A HD21 6  
ATOM 9195  H HD22 . LEU A 1 46  ? -0.500  -6.829  4.970   1.00 0.00 ? 1178 LEU A HD22 6  
ATOM 9196  H HD23 . LEU A 1 46  ? 0.781   -7.120  6.148   1.00 0.00 ? 1178 LEU A HD23 6  
ATOM 9197  N N    . ALA A 1 47  ? 4.204   -8.476  4.114   1.00 0.00 ? 1179 ALA A N    6  
ATOM 9198  C CA   . ALA A 1 47  ? 5.039   -7.586  3.317   1.00 0.00 ? 1179 ALA A CA   6  
ATOM 9199  C C    . ALA A 1 47  ? 6.285   -7.165  4.088   1.00 0.00 ? 1179 ALA A C    6  
ATOM 9200  O O    . ALA A 1 47  ? 6.192   -6.562  5.158   1.00 0.00 ? 1179 ALA A O    6  
ATOM 9201  C CB   . ALA A 1 47  ? 4.244   -6.362  2.886   1.00 0.00 ? 1179 ALA A CB   6  
ATOM 9202  H H    . ALA A 1 47  ? 4.241   -8.418  5.092   1.00 0.00 ? 1179 ALA A H    6  
ATOM 9203  H HA   . ALA A 1 47  ? 5.342   -8.120  2.427   1.00 0.00 ? 1179 ALA A HA   6  
ATOM 9204  H HB1  . ALA A 1 47  ? 3.447   -6.667  2.224   1.00 0.00 ? 1179 ALA A HB1  6  
ATOM 9205  H HB2  . ALA A 1 47  ? 3.825   -5.881  3.756   1.00 0.00 ? 1179 ALA A HB2  6  
ATOM 9206  H HB3  . ALA A 1 47  ? 4.896   -5.673  2.371   1.00 0.00 ? 1179 ALA A HB3  6  
ATOM 9207  N N    . THR A 1 48  ? 7.452   -7.486  3.539   1.00 0.00 ? 1180 THR A N    6  
ATOM 9208  C CA   . THR A 1 48  ? 8.717   -7.142  4.176   1.00 0.00 ? 1180 THR A CA   6  
ATOM 9209  C C    . THR A 1 48  ? 9.036   -5.662  4.003   1.00 0.00 ? 1180 THR A C    6  
ATOM 9210  O O    . THR A 1 48  ? 8.710   -5.063  2.979   1.00 0.00 ? 1180 THR A O    6  
ATOM 9211  C CB   . THR A 1 48  ? 9.879   -7.977  3.605   1.00 0.00 ? 1180 THR A CB   6  
ATOM 9212  O OG1  . THR A 1 48  ? 11.113  -7.581  4.214   1.00 0.00 ? 1180 THR A OG1  6  
ATOM 9213  C CG2  . THR A 1 48  ? 9.976   -7.807  2.096   1.00 0.00 ? 1180 THR A CG2  6  
ATOM 9214  H H    . THR A 1 48  ? 7.461   -7.966  2.685   1.00 0.00 ? 1180 THR A H    6  
ATOM 9215  H HA   . THR A 1 48  ? 8.630   -7.361  5.231   1.00 0.00 ? 1180 THR A HA   6  
ATOM 9216  H HB   . THR A 1 48  ? 9.696   -9.019  3.824   1.00 0.00 ? 1180 THR A HB   6  
ATOM 9217  H HG1  . THR A 1 48  ? 11.167  -6.622  4.234   1.00 0.00 ? 1180 THR A HG1  6  
ATOM 9218  H HG21 . THR A 1 48  ? 9.382   -8.566  1.609   1.00 0.00 ? 1180 THR A HG21 6  
ATOM 9219  H HG22 . THR A 1 48  ? 11.007  -7.904  1.788   1.00 0.00 ? 1180 THR A HG22 6  
ATOM 9220  H HG23 . THR A 1 48  ? 9.608   -6.830  1.820   1.00 0.00 ? 1180 THR A HG23 6  
ATOM 9221  N N    . ASN A 1 49  ? 9.677   -5.077  5.010   1.00 0.00 ? 1181 ASN A N    6  
ATOM 9222  C CA   . ASN A 1 49  ? 10.040  -3.665  4.968   1.00 0.00 ? 1181 ASN A CA   6  
ATOM 9223  C C    . ASN A 1 49  ? 10.568  -3.280  3.589   1.00 0.00 ? 1181 ASN A C    6  
ATOM 9224  O O    . ASN A 1 49  ? 10.198  -2.243  3.037   1.00 0.00 ? 1181 ASN A O    6  
ATOM 9225  C CB   . ASN A 1 49  ? 11.094  -3.357  6.034   1.00 0.00 ? 1181 ASN A CB   6  
ATOM 9226  C CG   . ASN A 1 49  ? 10.559  -3.528  7.442   1.00 0.00 ? 1181 ASN A CG   6  
ATOM 9227  O OD1  . ASN A 1 49  ? 10.111  -2.568  8.069   1.00 0.00 ? 1181 ASN A OD1  6  
ATOM 9228  N ND2  . ASN A 1 49  ? 10.603  -4.756  7.946   1.00 0.00 ? 1181 ASN A ND2  6  
ATOM 9229  H H    . ASN A 1 49  ? 9.911   -5.607  5.800   1.00 0.00 ? 1181 ASN A H    6  
ATOM 9230  H HA   . ASN A 1 49  ? 9.152   -3.088  5.175   1.00 0.00 ? 1181 ASN A HA   6  
ATOM 9231  H HB2  . ASN A 1 49  ? 11.934  -4.024  5.905   1.00 0.00 ? 1181 ASN A HB2  6  
ATOM 9232  H HB3  . ASN A 1 49  ? 11.428  -2.337  5.916   1.00 0.00 ? 1181 ASN A HB3  6  
ATOM 9233  H HD21 . ASN A 1 49  ? 10.973  -5.472  7.389   1.00 0.00 ? 1181 ASN A HD21 6  
ATOM 9234  H HD22 . ASN A 1 49  ? 10.263  -4.895  8.855   1.00 0.00 ? 1181 ASN A HD22 6  
ATOM 9235  N N    . LYS A 1 50  ? 11.434  -4.123  3.036   1.00 0.00 ? 1182 LYS A N    6  
ATOM 9236  C CA   . LYS A 1 50  ? 12.012  -3.873  1.721   1.00 0.00 ? 1182 LYS A CA   6  
ATOM 9237  C C    . LYS A 1 50  ? 10.937  -3.448  0.726   1.00 0.00 ? 1182 LYS A C    6  
ATOM 9238  O O    . LYS A 1 50  ? 11.060  -2.414  0.070   1.00 0.00 ? 1182 LYS A O    6  
ATOM 9239  C CB   . LYS A 1 50  ? 12.728  -5.126  1.210   1.00 0.00 ? 1182 LYS A CB   6  
ATOM 9240  C CG   . LYS A 1 50  ? 14.124  -5.303  1.781   1.00 0.00 ? 1182 LYS A CG   6  
ATOM 9241  C CD   . LYS A 1 50  ? 15.129  -4.398  1.090   1.00 0.00 ? 1182 LYS A CD   6  
ATOM 9242  C CE   . LYS A 1 50  ? 16.526  -4.572  1.666   1.00 0.00 ? 1182 LYS A CE   6  
ATOM 9243  N NZ   . LYS A 1 50  ? 17.221  -5.756  1.089   1.00 0.00 ? 1182 LYS A NZ   6  
ATOM 9244  H H    . LYS A 1 50  ? 11.691  -4.933  3.525   1.00 0.00 ? 1182 LYS A H    6  
ATOM 9245  H HA   . LYS A 1 50  ? 12.730  -3.074  1.821   1.00 0.00 ? 1182 LYS A HA   6  
ATOM 9246  H HB2  . LYS A 1 50  ? 12.141  -5.994  1.473   1.00 0.00 ? 1182 LYS A HB2  6  
ATOM 9247  H HB3  . LYS A 1 50  ? 12.807  -5.067  0.134   1.00 0.00 ? 1182 LYS A HB3  6  
ATOM 9248  H HG2  . LYS A 1 50  ? 14.106  -5.065  2.834   1.00 0.00 ? 1182 LYS A HG2  6  
ATOM 9249  H HG3  . LYS A 1 50  ? 14.429  -6.332  1.649   1.00 0.00 ? 1182 LYS A HG3  6  
ATOM 9250  H HD2  . LYS A 1 50  ? 15.154  -4.639  0.037   1.00 0.00 ? 1182 LYS A HD2  6  
ATOM 9251  H HD3  . LYS A 1 50  ? 14.822  -3.369  1.218   1.00 0.00 ? 1182 LYS A HD3  6  
ATOM 9252  H HE2  . LYS A 1 50  ? 17.103  -3.686  1.451   1.00 0.00 ? 1182 LYS A HE2  6  
ATOM 9253  H HE3  . LYS A 1 50  ? 16.446  -4.698  2.736   1.00 0.00 ? 1182 LYS A HE3  6  
ATOM 9254  H HZ1  . LYS A 1 50  ? 16.757  -6.631  1.405   1.00 0.00 ? 1182 LYS A HZ1  6  
ATOM 9255  H HZ2  . LYS A 1 50  ? 18.214  -5.773  1.397   1.00 0.00 ? 1182 LYS A HZ2  6  
ATOM 9256  H HZ3  . LYS A 1 50  ? 17.191  -5.716  0.050   1.00 0.00 ? 1182 LYS A HZ3  6  
ATOM 9257  N N    . ILE A 1 51  ? 9.884   -4.251  0.621   1.00 0.00 ? 1183 ILE A N    6  
ATOM 9258  C CA   . ILE A 1 51  ? 8.787   -3.956  -0.292  1.00 0.00 ? 1183 ILE A CA   6  
ATOM 9259  C C    . ILE A 1 51  ? 8.208   -2.570  -0.026  1.00 0.00 ? 1183 ILE A C    6  
ATOM 9260  O O    . ILE A 1 51  ? 8.155   -1.725  -0.920  1.00 0.00 ? 1183 ILE A O    6  
ATOM 9261  C CB   . ILE A 1 51  ? 7.661   -5.001  -0.177  1.00 0.00 ? 1183 ILE A CB   6  
ATOM 9262  C CG1  . ILE A 1 51  ? 8.156   -6.369  -0.650  1.00 0.00 ? 1183 ILE A CG1  6  
ATOM 9263  C CG2  . ILE A 1 51  ? 6.447   -4.563  -0.983  1.00 0.00 ? 1183 ILE A CG2  6  
ATOM 9264  C CD1  . ILE A 1 51  ? 7.222   -7.505  -0.296  1.00 0.00 ? 1183 ILE A CD1  6  
ATOM 9265  H H    . ILE A 1 51  ? 9.843   -5.061  1.171   1.00 0.00 ? 1183 ILE A H    6  
ATOM 9266  H HA   . ILE A 1 51  ? 9.175   -3.984  -1.300  1.00 0.00 ? 1183 ILE A HA   6  
ATOM 9267  H HB   . ILE A 1 51  ? 7.369   -5.070  0.860   1.00 0.00 ? 1183 ILE A HB   6  
ATOM 9268  H HG12 . ILE A 1 51  ? 8.268   -6.354  -1.722  1.00 0.00 ? 1183 ILE A HG12 6  
ATOM 9269  H HG13 . ILE A 1 51  ? 9.115   -6.574  -0.195  1.00 0.00 ? 1183 ILE A HG13 6  
ATOM 9270  H HG21 . ILE A 1 51  ? 6.774   -4.057  -1.879  1.00 0.00 ? 1183 ILE A HG21 6  
ATOM 9271  H HG22 . ILE A 1 51  ? 5.863   -5.430  -1.253  1.00 0.00 ? 1183 ILE A HG22 6  
ATOM 9272  H HG23 . ILE A 1 51  ? 5.844   -3.892  -0.390  1.00 0.00 ? 1183 ILE A HG23 6  
ATOM 9273  H HD11 . ILE A 1 51  ? 7.130   -7.575  0.778   1.00 0.00 ? 1183 ILE A HD11 6  
ATOM 9274  H HD12 . ILE A 1 51  ? 6.251   -7.322  -0.731  1.00 0.00 ? 1183 ILE A HD12 6  
ATOM 9275  H HD13 . ILE A 1 51  ? 7.620   -8.432  -0.684  1.00 0.00 ? 1183 ILE A HD13 6  
ATOM 9276  N N    . LEU A 1 52  ? 7.776   -2.343  1.210   1.00 0.00 ? 1184 LEU A N    6  
ATOM 9277  C CA   . LEU A 1 52  ? 7.203   -1.059  1.596   1.00 0.00 ? 1184 LEU A CA   6  
ATOM 9278  C C    . LEU A 1 52  ? 8.123   0.090   1.198   1.00 0.00 ? 1184 LEU A C    6  
ATOM 9279  O O    . LEU A 1 52  ? 7.699   1.040   0.540   1.00 0.00 ? 1184 LEU A O    6  
ATOM 9280  C CB   . LEU A 1 52  ? 6.948   -1.025  3.104   1.00 0.00 ? 1184 LEU A CB   6  
ATOM 9281  C CG   . LEU A 1 52  ? 6.073   -2.147  3.663   1.00 0.00 ? 1184 LEU A CG   6  
ATOM 9282  C CD1  . LEU A 1 52  ? 6.009   -2.070  5.180   1.00 0.00 ? 1184 LEU A CD1  6  
ATOM 9283  C CD2  . LEU A 1 52  ? 4.675   -2.082  3.064   1.00 0.00 ? 1184 LEU A CD2  6  
ATOM 9284  H H    . LEU A 1 52  ? 7.845   -3.055  1.879   1.00 0.00 ? 1184 LEU A H    6  
ATOM 9285  H HA   . LEU A 1 52  ? 6.262   -0.947  1.078   1.00 0.00 ? 1184 LEU A HA   6  
ATOM 9286  H HB2  . LEU A 1 52  ? 7.904   -1.072  3.602   1.00 0.00 ? 1184 LEU A HB2  6  
ATOM 9287  H HB3  . LEU A 1 52  ? 6.469   -0.084  3.336   1.00 0.00 ? 1184 LEU A HB3  6  
ATOM 9288  H HG   . LEU A 1 52  ? 6.508   -3.101  3.396   1.00 0.00 ? 1184 LEU A HG   6  
ATOM 9289  H HD11 . LEU A 1 52  ? 6.780   -2.694  5.605   1.00 0.00 ? 1184 LEU A HD11 6  
ATOM 9290  H HD12 . LEU A 1 52  ? 5.042   -2.412  5.518   1.00 0.00 ? 1184 LEU A HD12 6  
ATOM 9291  H HD13 . LEU A 1 52  ? 6.159   -1.047  5.495   1.00 0.00 ? 1184 LEU A HD13 6  
ATOM 9292  H HD21 . LEU A 1 52  ? 4.103   -1.317  3.569   1.00 0.00 ? 1184 LEU A HD21 6  
ATOM 9293  H HD22 . LEU A 1 52  ? 4.186   -3.038  3.188   1.00 0.00 ? 1184 LEU A HD22 6  
ATOM 9294  H HD23 . LEU A 1 52  ? 4.744   -1.845  2.013   1.00 0.00 ? 1184 LEU A HD23 6  
ATOM 9295  N N    . VAL A 1 53  ? 9.386   -0.004  1.601   1.00 0.00 ? 1185 VAL A N    6  
ATOM 9296  C CA   . VAL A 1 53  ? 10.368  1.027   1.283   1.00 0.00 ? 1185 VAL A CA   6  
ATOM 9297  C C    . VAL A 1 53  ? 10.262  1.456   -0.176  1.00 0.00 ? 1185 VAL A C    6  
ATOM 9298  O O    . VAL A 1 53  ? 10.205  2.648   -0.480  1.00 0.00 ? 1185 VAL A O    6  
ATOM 9299  C CB   . VAL A 1 53  ? 11.803  0.539   1.560   1.00 0.00 ? 1185 VAL A CB   6  
ATOM 9300  C CG1  . VAL A 1 53  ? 12.817  1.581   1.115   1.00 0.00 ? 1185 VAL A CG1  6  
ATOM 9301  C CG2  . VAL A 1 53  ? 11.978  0.209   3.035   1.00 0.00 ? 1185 VAL A CG2  6  
ATOM 9302  H H    . VAL A 1 53  ? 9.665   -0.785  2.123   1.00 0.00 ? 1185 VAL A H    6  
ATOM 9303  H HA   . VAL A 1 53  ? 10.173  1.880   1.915   1.00 0.00 ? 1185 VAL A HA   6  
ATOM 9304  H HB   . VAL A 1 53  ? 11.972  -0.362  0.989   1.00 0.00 ? 1185 VAL A HB   6  
ATOM 9305  H HG11 . VAL A 1 53  ? 13.139  1.362   0.107   1.00 0.00 ? 1185 VAL A HG11 6  
ATOM 9306  H HG12 . VAL A 1 53  ? 12.363  2.561   1.144   1.00 0.00 ? 1185 VAL A HG12 6  
ATOM 9307  H HG13 . VAL A 1 53  ? 13.670  1.560   1.777   1.00 0.00 ? 1185 VAL A HG13 6  
ATOM 9308  H HG21 . VAL A 1 53  ? 11.027  -0.090  3.451   1.00 0.00 ? 1185 VAL A HG21 6  
ATOM 9309  H HG22 . VAL A 1 53  ? 12.687  -0.600  3.142   1.00 0.00 ? 1185 VAL A HG22 6  
ATOM 9310  H HG23 . VAL A 1 53  ? 12.344  1.079   3.558   1.00 0.00 ? 1185 VAL A HG23 6  
ATOM 9311  N N    . ASP A 1 54  ? 10.235  0.478   -1.074  1.00 0.00 ? 1186 ASP A N    6  
ATOM 9312  C CA   . ASP A 1 54  ? 10.134  0.755   -2.502  1.00 0.00 ? 1186 ASP A CA   6  
ATOM 9313  C C    . ASP A 1 54  ? 8.803   1.424   -2.833  1.00 0.00 ? 1186 ASP A C    6  
ATOM 9314  O O    . ASP A 1 54  ? 8.756   2.392   -3.592  1.00 0.00 ? 1186 ASP A O    6  
ATOM 9315  C CB   . ASP A 1 54  ? 10.283  -0.538  -3.306  1.00 0.00 ? 1186 ASP A CB   6  
ATOM 9316  C CG   . ASP A 1 54  ? 11.725  -0.830  -3.671  1.00 0.00 ? 1186 ASP A CG   6  
ATOM 9317  O OD1  . ASP A 1 54  ? 12.426  -1.464  -2.856  1.00 0.00 ? 1186 ASP A OD1  6  
ATOM 9318  O OD2  . ASP A 1 54  ? 12.153  -0.423  -4.772  1.00 0.00 ? 1186 ASP A OD2  6  
ATOM 9319  H H    . ASP A 1 54  ? 10.284  -0.452  -0.770  1.00 0.00 ? 1186 ASP A H    6  
ATOM 9320  H HA   . ASP A 1 54  ? 10.936  1.427   -2.768  1.00 0.00 ? 1186 ASP A HA   6  
ATOM 9321  H HB2  . ASP A 1 54  ? 9.905   -1.364  -2.720  1.00 0.00 ? 1186 ASP A HB2  6  
ATOM 9322  H HB3  . ASP A 1 54  ? 9.709   -0.456  -4.217  1.00 0.00 ? 1186 ASP A HB3  6  
ATOM 9323  N N    . MET A 1 55  ? 7.725   0.900   -2.260  1.00 0.00 ? 1187 MET A N    6  
ATOM 9324  C CA   . MET A 1 55  ? 6.393   1.447   -2.495  1.00 0.00 ? 1187 MET A CA   6  
ATOM 9325  C C    . MET A 1 55  ? 6.347   2.932   -2.150  1.00 0.00 ? 1187 MET A C    6  
ATOM 9326  O O    . MET A 1 55  ? 5.745   3.727   -2.870  1.00 0.00 ? 1187 MET A O    6  
ATOM 9327  C CB   . MET A 1 55  ? 5.354   0.687   -1.668  1.00 0.00 ? 1187 MET A CB   6  
ATOM 9328  C CG   . MET A 1 55  ? 5.083   -0.720  -2.177  1.00 0.00 ? 1187 MET A CG   6  
ATOM 9329  S SD   . MET A 1 55  ? 3.621   -1.460  -1.427  1.00 0.00 ? 1187 MET A SD   6  
ATOM 9330  C CE   . MET A 1 55  ? 2.320   -0.509  -2.208  1.00 0.00 ? 1187 MET A CE   6  
ATOM 9331  H H    . MET A 1 55  ? 7.826   0.128   -1.665  1.00 0.00 ? 1187 MET A H    6  
ATOM 9332  H HA   . MET A 1 55  ? 6.166   1.325   -3.543  1.00 0.00 ? 1187 MET A HA   6  
ATOM 9333  H HB2  . MET A 1 55  ? 5.703   0.617   -0.649  1.00 0.00 ? 1187 MET A HB2  6  
ATOM 9334  H HB3  . MET A 1 55  ? 4.425   1.237   -1.686  1.00 0.00 ? 1187 MET A HB3  6  
ATOM 9335  H HG2  . MET A 1 55  ? 4.940   -0.680  -3.247  1.00 0.00 ? 1187 MET A HG2  6  
ATOM 9336  H HG3  . MET A 1 55  ? 5.939   -1.339  -1.954  1.00 0.00 ? 1187 MET A HG3  6  
ATOM 9337  H HE1  . MET A 1 55  ? 2.540   -0.394  -3.259  1.00 0.00 ? 1187 MET A HE1  6  
ATOM 9338  H HE2  . MET A 1 55  ? 1.378   -1.023  -2.091  1.00 0.00 ? 1187 MET A HE2  6  
ATOM 9339  H HE3  . MET A 1 55  ? 2.259   0.465   -1.744  1.00 0.00 ? 1187 MET A HE3  6  
ATOM 9340  N N    . ALA A 1 56  ? 6.987   3.298   -1.044  1.00 0.00 ? 1188 ALA A N    6  
ATOM 9341  C CA   . ALA A 1 56  ? 7.020   4.688   -0.606  1.00 0.00 ? 1188 ALA A CA   6  
ATOM 9342  C C    . ALA A 1 56  ? 7.843   5.546   -1.561  1.00 0.00 ? 1188 ALA A C    6  
ATOM 9343  O O    . ALA A 1 56  ? 7.573   6.734   -1.735  1.00 0.00 ? 1188 ALA A O    6  
ATOM 9344  C CB   . ALA A 1 56  ? 7.578   4.783   0.806   1.00 0.00 ? 1188 ALA A CB   6  
ATOM 9345  H H    . ALA A 1 56  ? 7.449   2.618   -0.512  1.00 0.00 ? 1188 ALA A H    6  
ATOM 9346  H HA   . ALA A 1 56  ? 6.005   5.057   -0.591  1.00 0.00 ? 1188 ALA A HA   6  
ATOM 9347  H HB1  . ALA A 1 56  ? 7.791   3.790   1.176   1.00 0.00 ? 1188 ALA A HB1  6  
ATOM 9348  H HB2  . ALA A 1 56  ? 8.487   5.366   0.796   1.00 0.00 ? 1188 ALA A HB2  6  
ATOM 9349  H HB3  . ALA A 1 56  ? 6.852   5.258   1.449   1.00 0.00 ? 1188 ALA A HB3  6  
ATOM 9350  N N    . LYS A 1 57  ? 8.850   4.936   -2.177  1.00 0.00 ? 1189 LYS A N    6  
ATOM 9351  C CA   . LYS A 1 57  ? 9.714   5.643   -3.115  1.00 0.00 ? 1189 LYS A CA   6  
ATOM 9352  C C    . LYS A 1 57  ? 9.022   5.823   -4.463  1.00 0.00 ? 1189 LYS A C    6  
ATOM 9353  O O    . LYS A 1 57  ? 8.843   6.945   -4.934  1.00 0.00 ? 1189 LYS A O    6  
ATOM 9354  C CB   . LYS A 1 57  ? 11.029  4.882   -3.303  1.00 0.00 ? 1189 LYS A CB   6  
ATOM 9355  C CG   . LYS A 1 57  ? 11.946  4.946   -2.094  1.00 0.00 ? 1189 LYS A CG   6  
ATOM 9356  C CD   . LYS A 1 57  ? 12.840  3.721   -2.007  1.00 0.00 ? 1189 LYS A CD   6  
ATOM 9357  C CE   . LYS A 1 57  ? 13.996  3.802   -2.992  1.00 0.00 ? 1189 LYS A CE   6  
ATOM 9358  N NZ   . LYS A 1 57  ? 13.558  3.515   -4.386  1.00 0.00 ? 1189 LYS A NZ   6  
ATOM 9359  H H    . LYS A 1 57  ? 9.017   3.987   -1.997  1.00 0.00 ? 1189 LYS A H    6  
ATOM 9360  H HA   . LYS A 1 57  ? 9.927   6.617   -2.701  1.00 0.00 ? 1189 LYS A HA   6  
ATOM 9361  H HB2  . LYS A 1 57  ? 10.805  3.845   -3.504  1.00 0.00 ? 1189 LYS A HB2  6  
ATOM 9362  H HB3  . LYS A 1 57  ? 11.554  5.300   -4.150  1.00 0.00 ? 1189 LYS A HB3  6  
ATOM 9363  H HG2  . LYS A 1 57  ? 12.567  5.827   -2.171  1.00 0.00 ? 1189 LYS A HG2  6  
ATOM 9364  H HG3  . LYS A 1 57  ? 11.343  5.006   -1.199  1.00 0.00 ? 1189 LYS A HG3  6  
ATOM 9365  H HD2  . LYS A 1 57  ? 13.239  3.647   -1.006  1.00 0.00 ? 1189 LYS A HD2  6  
ATOM 9366  H HD3  . LYS A 1 57  ? 12.252  2.841   -2.227  1.00 0.00 ? 1189 LYS A HD3  6  
ATOM 9367  H HE2  . LYS A 1 57  ? 14.415  4.796   -2.953  1.00 0.00 ? 1189 LYS A HE2  6  
ATOM 9368  H HE3  . LYS A 1 57  ? 14.748  3.083   -2.704  1.00 0.00 ? 1189 LYS A HE3  6  
ATOM 9369  H HZ1  . LYS A 1 57  ? 13.978  2.622   -4.715  1.00 0.00 ? 1189 LYS A HZ1  6  
ATOM 9370  H HZ2  . LYS A 1 57  ? 13.861  4.281   -5.020  1.00 0.00 ? 1189 LYS A HZ2  6  
ATOM 9371  H HZ3  . LYS A 1 57  ? 12.522  3.435   -4.426  1.00 0.00 ? 1189 LYS A HZ3  6  
ATOM 9372  N N    . MET A 1 58  ? 8.634   4.710   -5.076  1.00 0.00 ? 1190 MET A N    6  
ATOM 9373  C CA   . MET A 1 58  ? 7.959   4.746   -6.369  1.00 0.00 ? 1190 MET A CA   6  
ATOM 9374  C C    . MET A 1 58  ? 6.563   5.347   -6.236  1.00 0.00 ? 1190 MET A C    6  
ATOM 9375  O O    . MET A 1 58  ? 6.130   6.127   -7.085  1.00 0.00 ? 1190 MET A O    6  
ATOM 9376  C CB   . MET A 1 58  ? 7.865   3.337   -6.959  1.00 0.00 ? 1190 MET A CB   6  
ATOM 9377  C CG   . MET A 1 58  ? 9.217   2.669   -7.153  1.00 0.00 ? 1190 MET A CG   6  
ATOM 9378  S SD   . MET A 1 58  ? 9.105   1.135   -8.093  1.00 0.00 ? 1190 MET A SD   6  
ATOM 9379  C CE   . MET A 1 58  ? 10.372  0.154   -7.294  1.00 0.00 ? 1190 MET A CE   6  
ATOM 9380  H H    . MET A 1 58  ? 8.805   3.844   -4.651  1.00 0.00 ? 1190 MET A H    6  
ATOM 9381  H HA   . MET A 1 58  ? 8.544   5.366   -7.031  1.00 0.00 ? 1190 MET A HA   6  
ATOM 9382  H HB2  . MET A 1 58  ? 7.275   2.721   -6.297  1.00 0.00 ? 1190 MET A HB2  6  
ATOM 9383  H HB3  . MET A 1 58  ? 7.375   3.394   -7.919  1.00 0.00 ? 1190 MET A HB3  6  
ATOM 9384  H HG2  . MET A 1 58  ? 9.868   3.350   -7.680  1.00 0.00 ? 1190 MET A HG2  6  
ATOM 9385  H HG3  . MET A 1 58  ? 9.637   2.451   -6.182  1.00 0.00 ? 1190 MET A HG3  6  
ATOM 9386  H HE1  . MET A 1 58  ? 11.281  0.197   -7.875  1.00 0.00 ? 1190 MET A HE1  6  
ATOM 9387  H HE2  . MET A 1 58  ? 10.558  0.544   -6.304  1.00 0.00 ? 1190 MET A HE2  6  
ATOM 9388  H HE3  . MET A 1 58  ? 10.039  -0.872  -7.220  1.00 0.00 ? 1190 MET A HE3  6  
ATOM 9389  N N    . ARG A 1 59  ? 5.864   4.980   -5.167  1.00 0.00 ? 1191 ARG A N    6  
ATOM 9390  C CA   . ARG A 1 59  ? 4.517   5.482   -4.925  1.00 0.00 ? 1191 ARG A CA   6  
ATOM 9391  C C    . ARG A 1 59  ? 3.536   4.923   -5.951  1.00 0.00 ? 1191 ARG A C    6  
ATOM 9392  O O    . ARG A 1 59  ? 2.831   5.661   -6.639  1.00 0.00 ? 1191 ARG A O    6  
ATOM 9393  C CB   . ARG A 1 59  ? 4.504   7.012   -4.973  1.00 0.00 ? 1191 ARG A CB   6  
ATOM 9394  C CG   . ARG A 1 59  ? 5.584   7.657   -4.120  1.00 0.00 ? 1191 ARG A CG   6  
ATOM 9395  C CD   . ARG A 1 59  ? 5.269   9.116   -3.832  1.00 0.00 ? 1191 ARG A CD   6  
ATOM 9396  N NE   . ARG A 1 59  ? 6.480   9.916   -3.668  1.00 0.00 ? 1191 ARG A NE   6  
ATOM 9397  C CZ   . ARG A 1 59  ? 7.138   10.025  -2.519  1.00 0.00 ? 1191 ARG A CZ   6  
ATOM 9398  N NH1  . ARG A 1 59  ? 6.704   9.390   -1.440  1.00 0.00 ? 1191 ARG A NH1  6  
ATOM 9399  N NH2  . ARG A 1 59  ? 8.232   10.772  -2.449  1.00 0.00 ? 1191 ARG A NH2  6  
ATOM 9400  H H    . ARG A 1 59  ? 6.263   4.355   -4.526  1.00 0.00 ? 1191 ARG A H    6  
ATOM 9401  H HA   . ARG A 1 59  ? 4.214   5.159   -3.941  1.00 0.00 ? 1191 ARG A HA   6  
ATOM 9402  H HB2  . ARG A 1 59  ? 4.647   7.329   -5.996  1.00 0.00 ? 1191 ARG A HB2  6  
ATOM 9403  H HB3  . ARG A 1 59  ? 3.544   7.362   -4.626  1.00 0.00 ? 1191 ARG A HB3  6  
ATOM 9404  H HG2  . ARG A 1 59  ? 5.656   7.124   -3.183  1.00 0.00 ? 1191 ARG A HG2  6  
ATOM 9405  H HG3  . ARG A 1 59  ? 6.527   7.597   -4.643  1.00 0.00 ? 1191 ARG A HG3  6  
ATOM 9406  H HD2  . ARG A 1 59  ? 4.694   9.515   -4.654  1.00 0.00 ? 1191 ARG A HD2  6  
ATOM 9407  H HD3  . ARG A 1 59  ? 4.686   9.172   -2.925  1.00 0.00 ? 1191 ARG A HD3  6  
ATOM 9408  H HE   . ARG A 1 59  ? 6.817   10.394  -4.453  1.00 0.00 ? 1191 ARG A HE   6  
ATOM 9409  H HH11 . ARG A 1 59  ? 5.881   8.825   -1.490  1.00 0.00 ? 1191 ARG A HH11 6  
ATOM 9410  H HH12 . ARG A 1 59  ? 7.203   9.473   -0.576  1.00 0.00 ? 1191 ARG A HH12 6  
ATOM 9411  H HH21 . ARG A 1 59  ? 8.562   11.253  -3.261  1.00 0.00 ? 1191 ARG A HH21 6  
ATOM 9412  H HH22 . ARG A 1 59  ? 8.727   10.854  -1.585  1.00 0.00 ? 1191 ARG A HH22 6  
ATOM 9413  N N    . PRO A 1 60  ? 3.488   3.586   -6.056  1.00 0.00 ? 1192 PRO A N    6  
ATOM 9414  C CA   . PRO A 1 60  ? 2.597   2.898   -6.995  1.00 0.00 ? 1192 PRO A CA   6  
ATOM 9415  C C    . PRO A 1 60  ? 1.130   3.017   -6.595  1.00 0.00 ? 1192 PRO A C    6  
ATOM 9416  O O    . PRO A 1 60  ? 0.782   2.883   -5.421  1.00 0.00 ? 1192 PRO A O    6  
ATOM 9417  C CB   . PRO A 1 60  ? 3.056   1.440   -6.916  1.00 0.00 ? 1192 PRO A CB   6  
ATOM 9418  C CG   . PRO A 1 60  ? 3.674   1.310   -5.566  1.00 0.00 ? 1192 PRO A CG   6  
ATOM 9419  C CD   . PRO A 1 60  ? 4.299   2.645   -5.267  1.00 0.00 ? 1192 PRO A CD   6  
ATOM 9420  H HA   . PRO A 1 60  ? 2.724   3.263   -8.004  1.00 0.00 ? 1192 PRO A HA   6  
ATOM 9421  H HB2  . PRO A 1 60  ? 2.203   0.785   -7.025  1.00 0.00 ? 1192 PRO A HB2  6  
ATOM 9422  H HB3  . PRO A 1 60  ? 3.773   1.241   -7.698  1.00 0.00 ? 1192 PRO A HB3  6  
ATOM 9423  H HG2  . PRO A 1 60  ? 2.914   1.080   -4.835  1.00 0.00 ? 1192 PRO A HG2  6  
ATOM 9424  H HG3  . PRO A 1 60  ? 4.429   0.538   -5.581  1.00 0.00 ? 1192 PRO A HG3  6  
ATOM 9425  H HD2  . PRO A 1 60  ? 4.231   2.866   -4.213  1.00 0.00 ? 1192 PRO A HD2  6  
ATOM 9426  H HD3  . PRO A 1 60  ? 5.330   2.660   -5.591  1.00 0.00 ? 1192 PRO A HD3  6  
ATOM 9427  N N    . THR A 1 61  ? 0.272   3.268   -7.579  1.00 0.00 ? 1193 THR A N    6  
ATOM 9428  C CA   . THR A 1 61  ? -1.158  3.406   -7.329  1.00 0.00 ? 1193 THR A CA   6  
ATOM 9429  C C    . THR A 1 61  ? -1.920  2.175   -7.807  1.00 0.00 ? 1193 THR A C    6  
ATOM 9430  O O    . THR A 1 61  ? -2.967  1.828   -7.259  1.00 0.00 ? 1193 THR A O    6  
ATOM 9431  C CB   . THR A 1 61  ? -1.732  4.654   -8.026  1.00 0.00 ? 1193 THR A CB   6  
ATOM 9432  O OG1  . THR A 1 61  ? -1.654  4.501   -9.447  1.00 0.00 ? 1193 THR A OG1  6  
ATOM 9433  C CG2  . THR A 1 61  ? -0.977  5.905   -7.603  1.00 0.00 ? 1193 THR A CG2  6  
ATOM 9434  H H    . THR A 1 61  ? 0.609   3.364   -8.494  1.00 0.00 ? 1193 THR A H    6  
ATOM 9435  H HA   . THR A 1 61  ? -1.301  3.515   -6.264  1.00 0.00 ? 1193 THR A HA   6  
ATOM 9436  H HB   . THR A 1 61  ? -2.768  4.762   -7.739  1.00 0.00 ? 1193 THR A HB   6  
ATOM 9437  H HG1  . THR A 1 61  ? -2.134  5.215   -9.873  1.00 0.00 ? 1193 THR A HG1  6  
ATOM 9438  H HG21 . THR A 1 61  ? -0.911  6.585   -8.439  1.00 0.00 ? 1193 THR A HG21 6  
ATOM 9439  H HG22 . THR A 1 61  ? 0.017   5.633   -7.280  1.00 0.00 ? 1193 THR A HG22 6  
ATOM 9440  H HG23 . THR A 1 61  ? -1.502  6.384   -6.790  1.00 0.00 ? 1193 THR A HG23 6  
ATOM 9441  N N    . THR A 1 62  ? -1.389  1.517   -8.833  1.00 0.00 ? 1194 THR A N    6  
ATOM 9442  C CA   . THR A 1 62  ? -2.020  0.325   -9.385  1.00 0.00 ? 1194 THR A CA   6  
ATOM 9443  C C    . THR A 1 62  ? -1.231  -0.930  -9.028  1.00 0.00 ? 1194 THR A C    6  
ATOM 9444  O O    . THR A 1 62  ? -0.009  -0.888  -8.886  1.00 0.00 ? 1194 THR A O    6  
ATOM 9445  C CB   . THR A 1 62  ? -2.150  0.416   -10.917 1.00 0.00 ? 1194 THR A CB   6  
ATOM 9446  O OG1  . THR A 1 62  ? -0.851  0.444   -11.519 1.00 0.00 ? 1194 THR A OG1  6  
ATOM 9447  C CG2  . THR A 1 62  ? -2.928  1.660   -11.320 1.00 0.00 ? 1194 THR A CG2  6  
ATOM 9448  H H    . THR A 1 62  ? -0.553  1.843   -9.227  1.00 0.00 ? 1194 THR A H    6  
ATOM 9449  H HA   . THR A 1 62  ? -3.012  0.247   -8.964  1.00 0.00 ? 1194 THR A HA   6  
ATOM 9450  H HB   . THR A 1 62  ? -2.684  -0.454  -11.270 1.00 0.00 ? 1194 THR A HB   6  
ATOM 9451  H HG1  . THR A 1 62  ? -0.544  1.352   -11.575 1.00 0.00 ? 1194 THR A HG1  6  
ATOM 9452  H HG21 . THR A 1 62  ? -3.771  1.789   -10.657 1.00 0.00 ? 1194 THR A HG21 6  
ATOM 9453  H HG22 . THR A 1 62  ? -3.282  1.550   -12.334 1.00 0.00 ? 1194 THR A HG22 6  
ATOM 9454  H HG23 . THR A 1 62  ? -2.284  2.524   -11.255 1.00 0.00 ? 1194 THR A HG23 6  
ATOM 9455  N N    . VAL A 1 63  ? -1.938  -2.047  -8.883  1.00 0.00 ? 1195 VAL A N    6  
ATOM 9456  C CA   . VAL A 1 63  ? -1.303  -3.315  -8.544  1.00 0.00 ? 1195 VAL A CA   6  
ATOM 9457  C C    . VAL A 1 63  ? -0.266  -3.707  -9.590  1.00 0.00 ? 1195 VAL A C    6  
ATOM 9458  O O    . VAL A 1 63  ? 0.804   -4.215  -9.257  1.00 0.00 ? 1195 VAL A O    6  
ATOM 9459  C CB   . VAL A 1 63  ? -2.341  -4.446  -8.417  1.00 0.00 ? 1195 VAL A CB   6  
ATOM 9460  C CG1  . VAL A 1 63  ? -3.039  -4.682  -9.748  1.00 0.00 ? 1195 VAL A CG1  6  
ATOM 9461  C CG2  . VAL A 1 63  ? -1.680  -5.722  -7.919  1.00 0.00 ? 1195 VAL A CG2  6  
ATOM 9462  H H    . VAL A 1 63  ? -2.909  -2.017  -9.009  1.00 0.00 ? 1195 VAL A H    6  
ATOM 9463  H HA   . VAL A 1 63  ? -0.811  -3.197  -7.590  1.00 0.00 ? 1195 VAL A HA   6  
ATOM 9464  H HB   . VAL A 1 63  ? -3.085  -4.145  -7.695  1.00 0.00 ? 1195 VAL A HB   6  
ATOM 9465  H HG11 . VAL A 1 63  ? -3.603  -3.802  -10.019 1.00 0.00 ? 1195 VAL A HG11 6  
ATOM 9466  H HG12 . VAL A 1 63  ? -2.302  -4.888  -10.510 1.00 0.00 ? 1195 VAL A HG12 6  
ATOM 9467  H HG13 . VAL A 1 63  ? -3.709  -5.525  -9.658  1.00 0.00 ? 1195 VAL A HG13 6  
ATOM 9468  H HG21 . VAL A 1 63  ? -2.438  -6.403  -7.563  1.00 0.00 ? 1195 VAL A HG21 6  
ATOM 9469  H HG22 . VAL A 1 63  ? -1.132  -6.183  -8.728  1.00 0.00 ? 1195 VAL A HG22 6  
ATOM 9470  H HG23 . VAL A 1 63  ? -1.001  -5.485  -7.114  1.00 0.00 ? 1195 VAL A HG23 6  
ATOM 9471  N N    . GLU A 1 64  ? -0.590  -3.467  -10.857 1.00 0.00 ? 1196 GLU A N    6  
ATOM 9472  C CA   . GLU A 1 64  ? 0.315   -3.795  -11.952 1.00 0.00 ? 1196 GLU A CA   6  
ATOM 9473  C C    . GLU A 1 64  ? 1.728   -3.303  -11.656 1.00 0.00 ? 1196 GLU A C    6  
ATOM 9474  O O    . GLU A 1 64  ? 2.709   -3.888  -12.114 1.00 0.00 ? 1196 GLU A O    6  
ATOM 9475  C CB   . GLU A 1 64  ? -0.188  -3.181  -13.260 1.00 0.00 ? 1196 GLU A CB   6  
ATOM 9476  C CG   . GLU A 1 64  ? -1.380  -3.911  -13.857 1.00 0.00 ? 1196 GLU A CG   6  
ATOM 9477  C CD   . GLU A 1 64  ? -0.970  -5.083  -14.727 1.00 0.00 ? 1196 GLU A CD   6  
ATOM 9478  O OE1  . GLU A 1 64  ? 0.008   -5.773  -14.372 1.00 0.00 ? 1196 GLU A OE1  6  
ATOM 9479  O OE2  . GLU A 1 64  ? -1.630  -5.311  -15.763 1.00 0.00 ? 1196 GLU A OE2  6  
ATOM 9480  H H    . GLU A 1 64  ? -1.458  -3.059  -11.059 1.00 0.00 ? 1196 GLU A H    6  
ATOM 9481  H HA   . GLU A 1 64  ? 0.335   -4.870  -12.054 1.00 0.00 ? 1196 GLU A HA   6  
ATOM 9482  H HB2  . GLU A 1 64  ? -0.474  -2.156  -13.076 1.00 0.00 ? 1196 GLU A HB2  6  
ATOM 9483  H HB3  . GLU A 1 64  ? 0.615   -3.197  -13.983 1.00 0.00 ? 1196 GLU A HB3  6  
ATOM 9484  H HG2  . GLU A 1 64  ? -2.000  -4.279  -13.053 1.00 0.00 ? 1196 GLU A HG2  6  
ATOM 9485  H HG3  . GLU A 1 64  ? -1.947  -3.216  -14.458 1.00 0.00 ? 1196 GLU A HG3  6  
ATOM 9486  N N    . ASN A 1 65  ? 1.824   -2.222  -10.888 1.00 0.00 ? 1197 ASN A N    6  
ATOM 9487  C CA   . ASN A 1 65  ? 3.117   -1.650  -10.532 1.00 0.00 ? 1197 ASN A CA   6  
ATOM 9488  C C    . ASN A 1 65  ? 3.636   -2.247  -9.228  1.00 0.00 ? 1197 ASN A C    6  
ATOM 9489  O O    . ASN A 1 65  ? 4.830   -2.510  -9.084  1.00 0.00 ? 1197 ASN A O    6  
ATOM 9490  C CB   . ASN A 1 65  ? 3.006   -0.129  -10.401 1.00 0.00 ? 1197 ASN A CB   6  
ATOM 9491  C CG   . ASN A 1 65  ? 3.013   0.569   -11.747 1.00 0.00 ? 1197 ASN A CG   6  
ATOM 9492  O OD1  . ASN A 1 65  ? 3.910   0.360   -12.563 1.00 0.00 ? 1197 ASN A OD1  6  
ATOM 9493  N ND2  . ASN A 1 65  ? 2.008   1.405   -11.985 1.00 0.00 ? 1197 ASN A ND2  6  
ATOM 9494  H H    . ASN A 1 65  ? 1.005   -1.800  -10.553 1.00 0.00 ? 1197 ASN A H    6  
ATOM 9495  H HA   . ASN A 1 65  ? 3.812   -1.884  -11.324 1.00 0.00 ? 1197 ASN A HA   6  
ATOM 9496  H HB2  . ASN A 1 65  ? 2.083   0.116   -9.895  1.00 0.00 ? 1197 ASN A HB2  6  
ATOM 9497  H HB3  . ASN A 1 65  ? 3.839   0.238   -9.821  1.00 0.00 ? 1197 ASN A HB3  6  
ATOM 9498  H HD21 . ASN A 1 65  ? 1.329   1.522   -11.289 1.00 0.00 ? 1197 ASN A HD21 6  
ATOM 9499  H HD22 . ASN A 1 65  ? 1.987   1.869   -12.848 1.00 0.00 ? 1197 ASN A HD22 6  
ATOM 9500  N N    . VAL A 1 66  ? 2.729   -2.459  -8.278  1.00 0.00 ? 1198 VAL A N    6  
ATOM 9501  C CA   . VAL A 1 66  ? 3.094   -3.027  -6.986  1.00 0.00 ? 1198 VAL A CA   6  
ATOM 9502  C C    . VAL A 1 66  ? 3.806   -4.365  -7.155  1.00 0.00 ? 1198 VAL A C    6  
ATOM 9503  O O    . VAL A 1 66  ? 4.864   -4.596  -6.570  1.00 0.00 ? 1198 VAL A O    6  
ATOM 9504  C CB   . VAL A 1 66  ? 1.857   -3.226  -6.091  1.00 0.00 ? 1198 VAL A CB   6  
ATOM 9505  C CG1  . VAL A 1 66  ? 2.236   -3.953  -4.810  1.00 0.00 ? 1198 VAL A CG1  6  
ATOM 9506  C CG2  . VAL A 1 66  ? 1.203   -1.888  -5.781  1.00 0.00 ? 1198 VAL A CG2  6  
ATOM 9507  H H    . VAL A 1 66  ? 1.793   -2.229  -8.452  1.00 0.00 ? 1198 VAL A H    6  
ATOM 9508  H HA   . VAL A 1 66  ? 3.761   -2.335  -6.493  1.00 0.00 ? 1198 VAL A HA   6  
ATOM 9509  H HB   . VAL A 1 66  ? 1.144   -3.836  -6.627  1.00 0.00 ? 1198 VAL A HB   6  
ATOM 9510  H HG11 . VAL A 1 66  ? 2.776   -3.280  -4.161  1.00 0.00 ? 1198 VAL A HG11 6  
ATOM 9511  H HG12 . VAL A 1 66  ? 1.340   -4.295  -4.311  1.00 0.00 ? 1198 VAL A HG12 6  
ATOM 9512  H HG13 . VAL A 1 66  ? 2.861   -4.801  -5.049  1.00 0.00 ? 1198 VAL A HG13 6  
ATOM 9513  H HG21 . VAL A 1 66  ? 1.299   -1.677  -4.726  1.00 0.00 ? 1198 VAL A HG21 6  
ATOM 9514  H HG22 . VAL A 1 66  ? 1.690   -1.109  -6.349  1.00 0.00 ? 1198 VAL A HG22 6  
ATOM 9515  H HG23 . VAL A 1 66  ? 0.157   -1.927  -6.048  1.00 0.00 ? 1198 VAL A HG23 6  
ATOM 9516  N N    . LYS A 1 67  ? 3.219   -5.244  -7.960  1.00 0.00 ? 1199 LYS A N    6  
ATOM 9517  C CA   . LYS A 1 67  ? 3.797   -6.559  -8.209  1.00 0.00 ? 1199 LYS A CA   6  
ATOM 9518  C C    . LYS A 1 67  ? 5.220   -6.436  -8.743  1.00 0.00 ? 1199 LYS A C    6  
ATOM 9519  O O    . LYS A 1 67  ? 6.060   -7.304  -8.504  1.00 0.00 ? 1199 LYS A O    6  
ATOM 9520  C CB   . LYS A 1 67  ? 2.933   -7.338  -9.204  1.00 0.00 ? 1199 LYS A CB   6  
ATOM 9521  C CG   . LYS A 1 67  ? 3.082   -6.864  -10.640 1.00 0.00 ? 1199 LYS A CG   6  
ATOM 9522  C CD   . LYS A 1 67  ? 1.864   -7.224  -11.474 1.00 0.00 ? 1199 LYS A CD   6  
ATOM 9523  C CE   . LYS A 1 67  ? 1.839   -8.706  -11.814 1.00 0.00 ? 1199 LYS A CE   6  
ATOM 9524  N NZ   . LYS A 1 67  ? 2.751   -9.031  -12.945 1.00 0.00 ? 1199 LYS A NZ   6  
ATOM 9525  H H    . LYS A 1 67  ? 2.376   -5.001  -8.399  1.00 0.00 ? 1199 LYS A H    6  
ATOM 9526  H HA   . LYS A 1 67  ? 3.822   -7.093  -7.272  1.00 0.00 ? 1199 LYS A HA   6  
ATOM 9527  H HB2  . LYS A 1 67  ? 3.209   -8.382  -9.161  1.00 0.00 ? 1199 LYS A HB2  6  
ATOM 9528  H HB3  . LYS A 1 67  ? 1.896   -7.236  -8.919  1.00 0.00 ? 1199 LYS A HB3  6  
ATOM 9529  H HG2  . LYS A 1 67  ? 3.204   -5.791  -10.644 1.00 0.00 ? 1199 LYS A HG2  6  
ATOM 9530  H HG3  . LYS A 1 67  ? 3.955   -7.329  -11.074 1.00 0.00 ? 1199 LYS A HG3  6  
ATOM 9531  H HD2  . LYS A 1 67  ? 0.971   -6.979  -10.918 1.00 0.00 ? 1199 LYS A HD2  6  
ATOM 9532  H HD3  . LYS A 1 67  ? 1.886   -6.653  -12.392 1.00 0.00 ? 1199 LYS A HD3  6  
ATOM 9533  H HE2  . LYS A 1 67  ? 2.145   -9.267  -10.944 1.00 0.00 ? 1199 LYS A HE2  6  
ATOM 9534  H HE3  . LYS A 1 67  ? 0.831   -8.983  -12.084 1.00 0.00 ? 1199 LYS A HE3  6  
ATOM 9535  H HZ1  . LYS A 1 67  ? 2.220   -9.494  -13.711 1.00 0.00 ? 1199 LYS A HZ1  6  
ATOM 9536  H HZ2  . LYS A 1 67  ? 3.504   -9.673  -12.625 1.00 0.00 ? 1199 LYS A HZ2  6  
ATOM 9537  H HZ3  . LYS A 1 67  ? 3.186   -8.162  -13.316 1.00 0.00 ? 1199 LYS A HZ3  6  
ATOM 9538  N N    . ARG A 1 68  ? 5.485   -5.352  -9.465  1.00 0.00 ? 1200 ARG A N    6  
ATOM 9539  C CA   . ARG A 1 68  ? 6.807   -5.116  -10.032 1.00 0.00 ? 1200 ARG A CA   6  
ATOM 9540  C C    . ARG A 1 68  ? 7.817   -4.785  -8.937  1.00 0.00 ? 1200 ARG A C    6  
ATOM 9541  O O    . ARG A 1 68  ? 9.020   -4.984  -9.109  1.00 0.00 ? 1200 ARG A O    6  
ATOM 9542  C CB   . ARG A 1 68  ? 6.752   -3.976  -11.051 1.00 0.00 ? 1200 ARG A CB   6  
ATOM 9543  C CG   . ARG A 1 68  ? 5.766   -4.217  -12.182 1.00 0.00 ? 1200 ARG A CG   6  
ATOM 9544  C CD   . ARG A 1 68  ? 5.621   -2.987  -13.066 1.00 0.00 ? 1200 ARG A CD   6  
ATOM 9545  N NE   . ARG A 1 68  ? 4.454   -3.077  -13.940 1.00 0.00 ? 1200 ARG A NE   6  
ATOM 9546  C CZ   . ARG A 1 68  ? 4.338   -2.406  -15.081 1.00 0.00 ? 1200 ARG A CZ   6  
ATOM 9547  N NH1  . ARG A 1 68  ? 5.312   -1.602  -15.483 1.00 0.00 ? 1200 ARG A NH1  6  
ATOM 9548  N NH2  . ARG A 1 68  ? 3.246   -2.540  -15.822 1.00 0.00 ? 1200 ARG A NH2  6  
ATOM 9549  H H    . ARG A 1 68  ? 4.774   -4.696  -9.621  1.00 0.00 ? 1200 ARG A H    6  
ATOM 9550  H HA   . ARG A 1 68  ? 7.120   -6.019  -10.533 1.00 0.00 ? 1200 ARG A HA   6  
ATOM 9551  H HB2  . ARG A 1 68  ? 6.467   -3.067  -10.542 1.00 0.00 ? 1200 ARG A HB2  6  
ATOM 9552  H HB3  . ARG A 1 68  ? 7.734   -3.845  -11.480 1.00 0.00 ? 1200 ARG A HB3  6  
ATOM 9553  H HG2  . ARG A 1 68  ? 6.119   -5.040  -12.786 1.00 0.00 ? 1200 ARG A HG2  6  
ATOM 9554  H HG3  . ARG A 1 68  ? 4.803   -4.463  -11.761 1.00 0.00 ? 1200 ARG A HG3  6  
ATOM 9555  H HD2  . ARG A 1 68  ? 5.520   -2.117  -12.435 1.00 0.00 ? 1200 ARG A HD2  6  
ATOM 9556  H HD3  . ARG A 1 68  ? 6.508   -2.890  -13.673 1.00 0.00 ? 1200 ARG A HD3  6  
ATOM 9557  H HE   . ARG A 1 68  ? 3.722   -3.665  -13.661 1.00 0.00 ? 1200 ARG A HE   6  
ATOM 9558  H HH11 . ARG A 1 68  ? 6.137   -1.500  -14.927 1.00 0.00 ? 1200 ARG A HH11 6  
ATOM 9559  H HH12 . ARG A 1 68  ? 5.223   -1.099  -16.343 1.00 0.00 ? 1200 ARG A HH12 6  
ATOM 9560  H HH21 . ARG A 1 68  ? 2.509   -3.146  -15.522 1.00 0.00 ? 1200 ARG A HH21 6  
ATOM 9561  H HH22 . ARG A 1 68  ? 3.159   -2.035  -16.680 1.00 0.00 ? 1200 ARG A HH22 6  
ATOM 9562  N N    . ILE A 1 69  ? 7.320   -4.281  -7.813  1.00 0.00 ? 1201 ILE A N    6  
ATOM 9563  C CA   . ILE A 1 69  ? 8.178   -3.924  -6.691  1.00 0.00 ? 1201 ILE A CA   6  
ATOM 9564  C C    . ILE A 1 69  ? 9.085   -5.086  -6.301  1.00 0.00 ? 1201 ILE A C    6  
ATOM 9565  O O    . ILE A 1 69  ? 8.700   -6.251  -6.410  1.00 0.00 ? 1201 ILE A O    6  
ATOM 9566  C CB   . ILE A 1 69  ? 7.352   -3.498  -5.463  1.00 0.00 ? 1201 ILE A CB   6  
ATOM 9567  C CG1  . ILE A 1 69  ? 6.420   -2.339  -5.825  1.00 0.00 ? 1201 ILE A CG1  6  
ATOM 9568  C CG2  . ILE A 1 69  ? 8.271   -3.106  -4.316  1.00 0.00 ? 1201 ILE A CG2  6  
ATOM 9569  C CD1  . ILE A 1 69  ? 7.151   -1.061  -6.171  1.00 0.00 ? 1201 ILE A CD1  6  
ATOM 9570  H H    . ILE A 1 69  ? 6.352   -4.146  -7.737  1.00 0.00 ? 1201 ILE A H    6  
ATOM 9571  H HA   . ILE A 1 69  ? 8.793   -3.088  -6.994  1.00 0.00 ? 1201 ILE A HA   6  
ATOM 9572  H HB   . ILE A 1 69  ? 6.759   -4.342  -5.145  1.00 0.00 ? 1201 ILE A HB   6  
ATOM 9573  H HG12 . ILE A 1 69  ? 5.822   -2.620  -6.678  1.00 0.00 ? 1201 ILE A HG12 6  
ATOM 9574  H HG13 . ILE A 1 69  ? 5.770   -2.135  -4.987  1.00 0.00 ? 1201 ILE A HG13 6  
ATOM 9575  H HG21 . ILE A 1 69  ? 9.264   -2.920  -4.698  1.00 0.00 ? 1201 ILE A HG21 6  
ATOM 9576  H HG22 . ILE A 1 69  ? 7.895   -2.212  -3.843  1.00 0.00 ? 1201 ILE A HG22 6  
ATOM 9577  H HG23 . ILE A 1 69  ? 8.308   -3.908  -3.594  1.00 0.00 ? 1201 ILE A HG23 6  
ATOM 9578  H HD11 . ILE A 1 69  ? 7.919   -0.874  -5.434  1.00 0.00 ? 1201 ILE A HD11 6  
ATOM 9579  H HD12 . ILE A 1 69  ? 7.603   -1.156  -7.147  1.00 0.00 ? 1201 ILE A HD12 6  
ATOM 9580  H HD13 . ILE A 1 69  ? 6.452   -0.237  -6.177  1.00 0.00 ? 1201 ILE A HD13 6  
ATOM 9581  N N    . ASP A 1 70  ? 10.289  -4.763  -5.843  1.00 0.00 ? 1202 ASP A N    6  
ATOM 9582  C CA   . ASP A 1 70  ? 11.250  -5.780  -5.434  1.00 0.00 ? 1202 ASP A CA   6  
ATOM 9583  C C    . ASP A 1 70  ? 10.788  -6.483  -4.161  1.00 0.00 ? 1202 ASP A C    6  
ATOM 9584  O O    . ASP A 1 70  ? 10.290  -5.846  -3.234  1.00 0.00 ? 1202 ASP A O    6  
ATOM 9585  C CB   . ASP A 1 70  ? 12.627  -5.151  -5.212  1.00 0.00 ? 1202 ASP A CB   6  
ATOM 9586  C CG   . ASP A 1 70  ? 13.603  -6.110  -4.559  1.00 0.00 ? 1202 ASP A CG   6  
ATOM 9587  O OD1  . ASP A 1 70  ? 13.550  -7.317  -4.876  1.00 0.00 ? 1202 ASP A OD1  6  
ATOM 9588  O OD2  . ASP A 1 70  ? 14.419  -5.654  -3.731  1.00 0.00 ? 1202 ASP A OD2  6  
ATOM 9589  H H    . ASP A 1 70  ? 10.537  -3.816  -5.779  1.00 0.00 ? 1202 ASP A H    6  
ATOM 9590  H HA   . ASP A 1 70  ? 11.321  -6.508  -6.227  1.00 0.00 ? 1202 ASP A HA   6  
ATOM 9591  H HB2  . ASP A 1 70  ? 13.034  -4.847  -6.166  1.00 0.00 ? 1202 ASP A HB2  6  
ATOM 9592  H HB3  . ASP A 1 70  ? 12.522  -4.284  -4.577  1.00 0.00 ? 1202 ASP A HB3  6  
ATOM 9593  N N    . GLY A 1 71  ? 10.956  -7.802  -4.125  1.00 0.00 ? 1203 GLY A N    6  
ATOM 9594  C CA   . GLY A 1 71  ? 10.550  -8.570  -2.963  1.00 0.00 ? 1203 GLY A CA   6  
ATOM 9595  C C    . GLY A 1 71  ? 9.214   -9.257  -3.161  1.00 0.00 ? 1203 GLY A C    6  
ATOM 9596  O O    . GLY A 1 71  ? 9.090   -10.463 -2.946  1.00 0.00 ? 1203 GLY A O    6  
ATOM 9597  H H    . GLY A 1 71  ? 11.359  -8.256  -4.894  1.00 0.00 ? 1203 GLY A H    6  
ATOM 9598  H HA2  . GLY A 1 71  ? 11.301  -9.318  -2.759  1.00 0.00 ? 1203 GLY A HA2  6  
ATOM 9599  H HA3  . GLY A 1 71  ? 10.478  -7.906  -2.114  1.00 0.00 ? 1203 GLY A HA3  6  
ATOM 9600  N N    . VAL A 1 72  ? 8.209   -8.489  -3.569  1.00 0.00 ? 1204 VAL A N    6  
ATOM 9601  C CA   . VAL A 1 72  ? 6.874   -9.031  -3.795  1.00 0.00 ? 1204 VAL A CA   6  
ATOM 9602  C C    . VAL A 1 72  ? 6.844   -9.917  -5.035  1.00 0.00 ? 1204 VAL A C    6  
ATOM 9603  O O    . VAL A 1 72  ? 7.526   -9.645  -6.022  1.00 0.00 ? 1204 VAL A O    6  
ATOM 9604  C CB   . VAL A 1 72  ? 5.832   -7.908  -3.954  1.00 0.00 ? 1204 VAL A CB   6  
ATOM 9605  C CG1  . VAL A 1 72  ? 6.018   -7.191  -5.283  1.00 0.00 ? 1204 VAL A CG1  6  
ATOM 9606  C CG2  . VAL A 1 72  ? 4.423   -8.469  -3.835  1.00 0.00 ? 1204 VAL A CG2  6  
ATOM 9607  H H    . VAL A 1 72  ? 8.370   -7.534  -3.723  1.00 0.00 ? 1204 VAL A H    6  
ATOM 9608  H HA   . VAL A 1 72  ? 6.605   -9.624  -2.933  1.00 0.00 ? 1204 VAL A HA   6  
ATOM 9609  H HB   . VAL A 1 72  ? 5.981   -7.191  -3.160  1.00 0.00 ? 1204 VAL A HB   6  
ATOM 9610  H HG11 . VAL A 1 72  ? 6.173   -7.919  -6.066  1.00 0.00 ? 1204 VAL A HG11 6  
ATOM 9611  H HG12 . VAL A 1 72  ? 5.138   -6.605  -5.503  1.00 0.00 ? 1204 VAL A HG12 6  
ATOM 9612  H HG13 . VAL A 1 72  ? 6.879   -6.540  -5.223  1.00 0.00 ? 1204 VAL A HG13 6  
ATOM 9613  H HG21 . VAL A 1 72  ? 4.139   -8.507  -2.794  1.00 0.00 ? 1204 VAL A HG21 6  
ATOM 9614  H HG22 . VAL A 1 72  ? 3.735   -7.832  -4.372  1.00 0.00 ? 1204 VAL A HG22 6  
ATOM 9615  H HG23 . VAL A 1 72  ? 4.395   -9.464  -4.253  1.00 0.00 ? 1204 VAL A HG23 6  
ATOM 9616  N N    . SER A 1 73  ? 6.048   -10.980 -4.976  1.00 0.00 ? 1205 SER A N    6  
ATOM 9617  C CA   . SER A 1 73  ? 5.930   -11.910 -6.094  1.00 0.00 ? 1205 SER A CA   6  
ATOM 9618  C C    . SER A 1 73  ? 4.667   -11.630 -6.903  1.00 0.00 ? 1205 SER A C    6  
ATOM 9619  O O    . SER A 1 73  ? 3.717   -11.030 -6.401  1.00 0.00 ? 1205 SER A O    6  
ATOM 9620  C CB   . SER A 1 73  ? 5.915   -13.352 -5.585  1.00 0.00 ? 1205 SER A CB   6  
ATOM 9621  O OG   . SER A 1 73  ? 6.221   -14.264 -6.626  1.00 0.00 ? 1205 SER A OG   6  
ATOM 9622  H H    . SER A 1 73  ? 5.529   -11.144 -4.161  1.00 0.00 ? 1205 SER A H    6  
ATOM 9623  H HA   . SER A 1 73  ? 6.790   -11.771 -6.732  1.00 0.00 ? 1205 SER A HA   6  
ATOM 9624  H HB2  . SER A 1 73  ? 6.647   -13.462 -4.800  1.00 0.00 ? 1205 SER A HB2  6  
ATOM 9625  H HB3  . SER A 1 73  ? 4.933   -13.583 -5.197  1.00 0.00 ? 1205 SER A HB3  6  
ATOM 9626  H HG   . SER A 1 73  ? 5.853   -15.125 -6.416  1.00 0.00 ? 1205 SER A HG   6  
ATOM 9627  N N    . GLU A 1 74  ? 4.666   -12.069 -8.157  1.00 0.00 ? 1206 GLU A N    6  
ATOM 9628  C CA   . GLU A 1 74  ? 3.521   -11.866 -9.036  1.00 0.00 ? 1206 GLU A CA   6  
ATOM 9629  C C    . GLU A 1 74  ? 2.232   -12.338 -8.369  1.00 0.00 ? 1206 GLU A C    6  
ATOM 9630  O O    . GLU A 1 74  ? 2.211   -13.364 -7.691  1.00 0.00 ? 1206 GLU A O    6  
ATOM 9631  C CB   . GLU A 1 74  ? 3.725   -12.609 -10.358 1.00 0.00 ? 1206 GLU A CB   6  
ATOM 9632  C CG   . GLU A 1 74  ? 4.790   -11.988 -11.246 1.00 0.00 ? 1206 GLU A CG   6  
ATOM 9633  C CD   . GLU A 1 74  ? 5.250   -12.924 -12.347 1.00 0.00 ? 1206 GLU A CD   6  
ATOM 9634  O OE1  . GLU A 1 74  ? 4.392   -13.620 -12.930 1.00 0.00 ? 1206 GLU A OE1  6  
ATOM 9635  O OE2  . GLU A 1 74  ? 6.466   -12.962 -12.626 1.00 0.00 ? 1206 GLU A OE2  6  
ATOM 9636  H H    . GLU A 1 74  ? 5.454   -12.541 -8.500  1.00 0.00 ? 1206 GLU A H    6  
ATOM 9637  H HA   . GLU A 1 74  ? 3.441   -10.808 -9.237  1.00 0.00 ? 1206 GLU A HA   6  
ATOM 9638  H HB2  . GLU A 1 74  ? 4.013   -13.627 -10.144 1.00 0.00 ? 1206 GLU A HB2  6  
ATOM 9639  H HB3  . GLU A 1 74  ? 2.792   -12.615 -10.901 1.00 0.00 ? 1206 GLU A HB3  6  
ATOM 9640  H HG2  . GLU A 1 74  ? 4.387   -11.095 -11.700 1.00 0.00 ? 1206 GLU A HG2  6  
ATOM 9641  H HG3  . GLU A 1 74  ? 5.643   -11.728 -10.636 1.00 0.00 ? 1206 GLU A HG3  6  
ATOM 9642  N N    . GLY A 1 75  ? 1.158   -11.579 -8.566  1.00 0.00 ? 1207 GLY A N    6  
ATOM 9643  C CA   . GLY A 1 75  ? -0.120  -11.935 -7.977  1.00 0.00 ? 1207 GLY A CA   6  
ATOM 9644  C C    . GLY A 1 75  ? -0.229  -11.506 -6.527  1.00 0.00 ? 1207 GLY A C    6  
ATOM 9645  O O    . GLY A 1 75  ? -1.159  -10.793 -6.151  1.00 0.00 ? 1207 GLY A O    6  
ATOM 9646  H H    . GLY A 1 75  ? 1.234   -10.771 -9.116  1.00 0.00 ? 1207 GLY A H    6  
ATOM 9647  H HA2  . GLY A 1 75  ? -0.909  -11.461 -8.542  1.00 0.00 ? 1207 GLY A HA2  6  
ATOM 9648  H HA3  . GLY A 1 75  ? -0.243  -13.007 -8.034  1.00 0.00 ? 1207 GLY A HA3  6  
ATOM 9649  N N    . LYS A 1 76  ? 0.722   -11.944 -5.709  1.00 0.00 ? 1208 LYS A N    6  
ATOM 9650  C CA   . LYS A 1 76  ? 0.730   -11.602 -4.292  1.00 0.00 ? 1208 LYS A CA   6  
ATOM 9651  C C    . LYS A 1 76  ? 0.310   -10.152 -4.079  1.00 0.00 ? 1208 LYS A C    6  
ATOM 9652  O O    . LYS A 1 76  ? -0.639  -9.871  -3.348  1.00 0.00 ? 1208 LYS A O    6  
ATOM 9653  C CB   . LYS A 1 76  ? 2.121   -11.834 -3.698  1.00 0.00 ? 1208 LYS A CB   6  
ATOM 9654  C CG   . LYS A 1 76  ? 2.196   -11.570 -2.204  1.00 0.00 ? 1208 LYS A CG   6  
ATOM 9655  C CD   . LYS A 1 76  ? 3.482   -12.115 -1.605  1.00 0.00 ? 1208 LYS A CD   6  
ATOM 9656  C CE   . LYS A 1 76  ? 4.591   -11.074 -1.625  1.00 0.00 ? 1208 LYS A CE   6  
ATOM 9657  N NZ   . LYS A 1 76  ? 5.926   -11.681 -1.365  1.00 0.00 ? 1208 LYS A NZ   6  
ATOM 9658  H H    . LYS A 1 76  ? 1.438   -12.510 -6.068  1.00 0.00 ? 1208 LYS A H    6  
ATOM 9659  H HA   . LYS A 1 76  ? 0.023   -12.246 -3.791  1.00 0.00 ? 1208 LYS A HA   6  
ATOM 9660  H HB2  . LYS A 1 76  ? 2.409   -12.859 -3.876  1.00 0.00 ? 1208 LYS A HB2  6  
ATOM 9661  H HB3  . LYS A 1 76  ? 2.824   -11.180 -4.194  1.00 0.00 ? 1208 LYS A HB3  6  
ATOM 9662  H HG2  . LYS A 1 76  ? 2.156   -10.504 -2.033  1.00 0.00 ? 1208 LYS A HG2  6  
ATOM 9663  H HG3  . LYS A 1 76  ? 1.355   -12.046 -1.721  1.00 0.00 ? 1208 LYS A HG3  6  
ATOM 9664  H HD2  . LYS A 1 76  ? 3.297   -12.408 -0.583  1.00 0.00 ? 1208 LYS A HD2  6  
ATOM 9665  H HD3  . LYS A 1 76  ? 3.798   -12.976 -2.177  1.00 0.00 ? 1208 LYS A HD3  6  
ATOM 9666  H HE2  . LYS A 1 76  ? 4.604   -10.599 -2.594  1.00 0.00 ? 1208 LYS A HE2  6  
ATOM 9667  H HE3  . LYS A 1 76  ? 4.387   -10.335 -0.864  1.00 0.00 ? 1208 LYS A HE3  6  
ATOM 9668  H HZ1  . LYS A 1 76  ? 6.031   -11.892 -0.352  1.00 0.00 ? 1208 LYS A HZ1  6  
ATOM 9669  H HZ2  . LYS A 1 76  ? 6.679   -11.023 -1.650  1.00 0.00 ? 1208 LYS A HZ2  6  
ATOM 9670  H HZ3  . LYS A 1 76  ? 6.029   -12.564 -1.905  1.00 0.00 ? 1208 LYS A HZ3  6  
ATOM 9671  N N    . ALA A 1 77  ? 1.022   -9.234  -4.725  1.00 0.00 ? 1209 ALA A N    6  
ATOM 9672  C CA   . ALA A 1 77  ? 0.720   -7.812  -4.609  1.00 0.00 ? 1209 ALA A CA   6  
ATOM 9673  C C    . ALA A 1 77  ? -0.779  -7.580  -4.450  1.00 0.00 ? 1209 ALA A C    6  
ATOM 9674  O O    . ALA A 1 77  ? -1.207  -6.771  -3.627  1.00 0.00 ? 1209 ALA A O    6  
ATOM 9675  C CB   . ALA A 1 77  ? 1.246   -7.061  -5.823  1.00 0.00 ? 1209 ALA A CB   6  
ATOM 9676  H H    . ALA A 1 77  ? 1.767   -9.519  -5.294  1.00 0.00 ? 1209 ALA A H    6  
ATOM 9677  H HA   . ALA A 1 77  ? 1.228   -7.434  -3.734  1.00 0.00 ? 1209 ALA A HA   6  
ATOM 9678  H HB1  . ALA A 1 77  ? 0.877   -7.529  -6.724  1.00 0.00 ? 1209 ALA A HB1  6  
ATOM 9679  H HB2  . ALA A 1 77  ? 0.909   -6.036  -5.785  1.00 0.00 ? 1209 ALA A HB2  6  
ATOM 9680  H HB3  . ALA A 1 77  ? 2.326   -7.085  -5.821  1.00 0.00 ? 1209 ALA A HB3  6  
ATOM 9681  N N    . ALA A 1 78  ? -1.571  -8.295  -5.242  1.00 0.00 ? 1210 ALA A N    6  
ATOM 9682  C CA   . ALA A 1 78  ? -3.022  -8.167  -5.188  1.00 0.00 ? 1210 ALA A CA   6  
ATOM 9683  C C    . ALA A 1 78  ? -3.508  -8.041  -3.748  1.00 0.00 ? 1210 ALA A C    6  
ATOM 9684  O O    . ALA A 1 78  ? -4.091  -7.027  -3.367  1.00 0.00 ? 1210 ALA A O    6  
ATOM 9685  C CB   . ALA A 1 78  ? -3.682  -9.357  -5.868  1.00 0.00 ? 1210 ALA A CB   6  
ATOM 9686  H H    . ALA A 1 78  ? -1.170  -8.924  -5.878  1.00 0.00 ? 1210 ALA A H    6  
ATOM 9687  H HA   . ALA A 1 78  ? -3.299  -7.275  -5.730  1.00 0.00 ? 1210 ALA A HA   6  
ATOM 9688  H HB1  . ALA A 1 78  ? -3.547  -10.240 -5.259  1.00 0.00 ? 1210 ALA A HB1  6  
ATOM 9689  H HB2  . ALA A 1 78  ? -4.737  -9.162  -5.990  1.00 0.00 ? 1210 ALA A HB2  6  
ATOM 9690  H HB3  . ALA A 1 78  ? -3.230  -9.515  -6.836  1.00 0.00 ? 1210 ALA A HB3  6  
ATOM 9691  N N    . MET A 1 79  ? -3.265  -9.078  -2.953  1.00 0.00 ? 1211 MET A N    6  
ATOM 9692  C CA   . MET A 1 79  ? -3.678  -9.083  -1.555  1.00 0.00 ? 1211 MET A CA   6  
ATOM 9693  C C    . MET A 1 79  ? -3.109  -7.876  -0.816  1.00 0.00 ? 1211 MET A C    6  
ATOM 9694  O O    . MET A 1 79  ? -3.648  -7.449  0.206   1.00 0.00 ? 1211 MET A O    6  
ATOM 9695  C CB   . MET A 1 79  ? -3.225  -10.374 -0.871  1.00 0.00 ? 1211 MET A CB   6  
ATOM 9696  C CG   . MET A 1 79  ? -1.828  -10.290 -0.278  1.00 0.00 ? 1211 MET A CG   6  
ATOM 9697  S SD   . MET A 1 79  ? -1.119  -11.912 0.064   1.00 0.00 ? 1211 MET A SD   6  
ATOM 9698  C CE   . MET A 1 79  ? 0.355   -11.453 0.972   1.00 0.00 ? 1211 MET A CE   6  
ATOM 9699  H H    . MET A 1 79  ? -2.795  -9.859  -3.315  1.00 0.00 ? 1211 MET A H    6  
ATOM 9700  H HA   . MET A 1 79  ? -4.756  -9.031  -1.528  1.00 0.00 ? 1211 MET A HA   6  
ATOM 9701  H HB2  . MET A 1 79  ? -3.917  -10.608 -0.075  1.00 0.00 ? 1211 MET A HB2  6  
ATOM 9702  H HB3  . MET A 1 79  ? -3.237  -11.175 -1.595  1.00 0.00 ? 1211 MET A HB3  6  
ATOM 9703  H HG2  . MET A 1 79  ? -1.185  -9.773  -0.975  1.00 0.00 ? 1211 MET A HG2  6  
ATOM 9704  H HG3  . MET A 1 79  ? -1.877  -9.731  0.645   1.00 0.00 ? 1211 MET A HG3  6  
ATOM 9705  H HE1  . MET A 1 79  ? 1.220   -11.567 0.335   1.00 0.00 ? 1211 MET A HE1  6  
ATOM 9706  H HE2  . MET A 1 79  ? 0.275   -10.425 1.290   1.00 0.00 ? 1211 MET A HE2  6  
ATOM 9707  H HE3  . MET A 1 79  ? 0.458   -12.092 1.837   1.00 0.00 ? 1211 MET A HE3  6  
ATOM 9708  N N    . LEU A 1 80  ? -2.017  -7.328  -1.339  1.00 0.00 ? 1212 LEU A N    6  
ATOM 9709  C CA   . LEU A 1 80  ? -1.374  -6.170  -0.729  1.00 0.00 ? 1212 LEU A CA   6  
ATOM 9710  C C    . LEU A 1 80  ? -1.949  -4.872  -1.287  1.00 0.00 ? 1212 LEU A C    6  
ATOM 9711  O O    . LEU A 1 80  ? -1.237  -3.880  -1.436  1.00 0.00 ? 1212 LEU A O    6  
ATOM 9712  C CB   . LEU A 1 80  ? 0.136   -6.216  -0.966  1.00 0.00 ? 1212 LEU A CB   6  
ATOM 9713  C CG   . LEU A 1 80  ? 0.882   -7.382  -0.318  1.00 0.00 ? 1212 LEU A CG   6  
ATOM 9714  C CD1  . LEU A 1 80  ? 2.347   -7.371  -0.725  1.00 0.00 ? 1212 LEU A CD1  6  
ATOM 9715  C CD2  . LEU A 1 80  ? 0.747   -7.326  1.197   1.00 0.00 ? 1212 LEU A CD2  6  
ATOM 9716  H H    . LEU A 1 80  ? -1.633  -7.712  -2.155  1.00 0.00 ? 1212 LEU A H    6  
ATOM 9717  H HA   . LEU A 1 80  ? -1.565  -6.206  0.333   1.00 0.00 ? 1212 LEU A HA   6  
ATOM 9718  H HB2  . LEU A 1 80  ? 0.302   -6.268  -2.031  1.00 0.00 ? 1212 LEU A HB2  6  
ATOM 9719  H HB3  . LEU A 1 80  ? 0.558   -5.297  -0.583  1.00 0.00 ? 1212 LEU A HB3  6  
ATOM 9720  H HG   . LEU A 1 80  ? 0.449   -8.312  -0.659  1.00 0.00 ? 1212 LEU A HG   6  
ATOM 9721  H HD11 . LEU A 1 80  ? 2.925   -7.930  -0.004  1.00 0.00 ? 1212 LEU A HD11 6  
ATOM 9722  H HD12 . LEU A 1 80  ? 2.703   -6.352  -0.759  1.00 0.00 ? 1212 LEU A HD12 6  
ATOM 9723  H HD13 . LEU A 1 80  ? 2.453   -7.822  -1.700  1.00 0.00 ? 1212 LEU A HD13 6  
ATOM 9724  H HD21 . LEU A 1 80  ? 1.242   -6.442  1.570   1.00 0.00 ? 1212 LEU A HD21 6  
ATOM 9725  H HD22 . LEU A 1 80  ? 1.203   -8.204  1.632   1.00 0.00 ? 1212 LEU A HD22 6  
ATOM 9726  H HD23 . LEU A 1 80  ? -0.299  -7.293  1.464   1.00 0.00 ? 1212 LEU A HD23 6  
ATOM 9727  N N    . ALA A 1 81  ? -3.243  -4.886  -1.591  1.00 0.00 ? 1213 ALA A N    6  
ATOM 9728  C CA   . ALA A 1 81  ? -3.914  -3.709  -2.128  1.00 0.00 ? 1213 ALA A CA   6  
ATOM 9729  C C    . ALA A 1 81  ? -4.018  -2.609  -1.077  1.00 0.00 ? 1213 ALA A C    6  
ATOM 9730  O O    . ALA A 1 81  ? -3.693  -1.447  -1.324  1.00 0.00 ? 1213 ALA A O    6  
ATOM 9731  C CB   . ALA A 1 81  ? -5.296  -4.079  -2.645  1.00 0.00 ? 1213 ALA A CB   6  
ATOM 9732  H H    . ALA A 1 81  ? -3.758  -5.707  -1.449  1.00 0.00 ? 1213 ALA A H    6  
ATOM 9733  H HA   . ALA A 1 81  ? -3.331  -3.343  -2.961  1.00 0.00 ? 1213 ALA A HA   6  
ATOM 9734  H HB1  . ALA A 1 81  ? -5.486  -3.554  -3.570  1.00 0.00 ? 1213 ALA A HB1  6  
ATOM 9735  H HB2  . ALA A 1 81  ? -5.342  -5.144  -2.819  1.00 0.00 ? 1213 ALA A HB2  6  
ATOM 9736  H HB3  . ALA A 1 81  ? -6.040  -3.802  -1.913  1.00 0.00 ? 1213 ALA A HB3  6  
ATOM 9737  N N    . PRO A 1 82  ? -4.483  -2.980  0.125   1.00 0.00 ? 1214 PRO A N    6  
ATOM 9738  C CA   . PRO A 1 82  ? -4.641  -2.038  1.238   1.00 0.00 ? 1214 PRO A CA   6  
ATOM 9739  C C    . PRO A 1 82  ? -3.402  -1.174  1.447   1.00 0.00 ? 1214 PRO A C    6  
ATOM 9740  O O    . PRO A 1 82  ? -3.460  -0.137  2.109   1.00 0.00 ? 1214 PRO A O    6  
ATOM 9741  C CB   . PRO A 1 82  ? -4.866  -2.951  2.446   1.00 0.00 ? 1214 PRO A CB   6  
ATOM 9742  C CG   . PRO A 1 82  ? -5.445  -4.199  1.875   1.00 0.00 ? 1214 PRO A CG   6  
ATOM 9743  C CD   . PRO A 1 82  ? -4.890  -4.347  0.491   1.00 0.00 ? 1214 PRO A CD   6  
ATOM 9744  H HA   . PRO A 1 82  ? -5.503  -1.402  1.100   1.00 0.00 ? 1214 PRO A HA   6  
ATOM 9745  H HB2  . PRO A 1 82  ? -3.922  -3.142  2.937   1.00 0.00 ? 1214 PRO A HB2  6  
ATOM 9746  H HB3  . PRO A 1 82  ? -5.549  -2.479  3.136   1.00 0.00 ? 1214 PRO A HB3  6  
ATOM 9747  H HG2  . PRO A 1 82  ? -5.157  -5.047  2.477   1.00 0.00 ? 1214 PRO A HG2  6  
ATOM 9748  H HG3  . PRO A 1 82  ? -6.521  -4.117  1.830   1.00 0.00 ? 1214 PRO A HG3  6  
ATOM 9749  H HD2  . PRO A 1 82  ? -4.041  -5.013  0.499   1.00 0.00 ? 1214 PRO A HD2  6  
ATOM 9750  H HD3  . PRO A 1 82  ? -5.654  -4.713  -0.179  1.00 0.00 ? 1214 PRO A HD3  6  
ATOM 9751  N N    . LEU A 1 83  ? -2.282  -1.608  0.878   1.00 0.00 ? 1215 LEU A N    6  
ATOM 9752  C CA   . LEU A 1 83  ? -1.028  -0.873  1.001   1.00 0.00 ? 1215 LEU A CA   6  
ATOM 9753  C C    . LEU A 1 83  ? -0.960  0.263   -0.015  1.00 0.00 ? 1215 LEU A C    6  
ATOM 9754  O O    . LEU A 1 83  ? -0.962  1.438   0.352   1.00 0.00 ? 1215 LEU A O    6  
ATOM 9755  C CB   . LEU A 1 83  ? 0.160   -1.817  0.809   1.00 0.00 ? 1215 LEU A CB   6  
ATOM 9756  C CG   . LEU A 1 83  ? 0.361   -2.873  1.896   1.00 0.00 ? 1215 LEU A CG   6  
ATOM 9757  C CD1  . LEU A 1 83  ? -0.677  -3.977  1.767   1.00 0.00 ? 1215 LEU A CD1  6  
ATOM 9758  C CD2  . LEU A 1 83  ? 1.767   -3.451  1.825   1.00 0.00 ? 1215 LEU A CD2  6  
ATOM 9759  H H    . LEU A 1 83  ? -2.298  -2.441  0.363   1.00 0.00 ? 1215 LEU A H    6  
ATOM 9760  H HA   . LEU A 1 83  ? -0.986  -0.453  1.996   1.00 0.00 ? 1215 LEU A HA   6  
ATOM 9761  H HB2  . LEU A 1 83  ? 0.025   -2.331  -0.130  1.00 0.00 ? 1215 LEU A HB2  6  
ATOM 9762  H HB3  . LEU A 1 83  ? 1.056   -1.215  0.762   1.00 0.00 ? 1215 LEU A HB3  6  
ATOM 9763  H HG   . LEU A 1 83  ? 0.237   -2.411  2.866   1.00 0.00 ? 1215 LEU A HG   6  
ATOM 9764  H HD11 . LEU A 1 83  ? -0.227  -4.926  2.016   1.00 0.00 ? 1215 LEU A HD11 6  
ATOM 9765  H HD12 . LEU A 1 83  ? -1.045  -4.008  0.752   1.00 0.00 ? 1215 LEU A HD12 6  
ATOM 9766  H HD13 . LEU A 1 83  ? -1.498  -3.779  2.440   1.00 0.00 ? 1215 LEU A HD13 6  
ATOM 9767  H HD21 . LEU A 1 83  ? 2.251   -3.339  2.784   1.00 0.00 ? 1215 LEU A HD21 6  
ATOM 9768  H HD22 . LEU A 1 83  ? 2.335   -2.924  1.071   1.00 0.00 ? 1215 LEU A HD22 6  
ATOM 9769  H HD23 . LEU A 1 83  ? 1.714   -4.499  1.569   1.00 0.00 ? 1215 LEU A HD23 6  
ATOM 9770  N N    . TRP A 1 84  ? -0.901  -0.097  -1.292  1.00 0.00 ? 1216 TRP A N    6  
ATOM 9771  C CA   . TRP A 1 84  ? -0.835  0.893   -2.362  1.00 0.00 ? 1216 TRP A CA   6  
ATOM 9772  C C    . TRP A 1 84  ? -2.076  1.778   -2.363  1.00 0.00 ? 1216 TRP A C    6  
ATOM 9773  O O    . TRP A 1 84  ? -2.038  2.915   -2.831  1.00 0.00 ? 1216 TRP A O    6  
ATOM 9774  C CB   . TRP A 1 84  ? -0.686  0.199   -3.717  1.00 0.00 ? 1216 TRP A CB   6  
ATOM 9775  C CG   . TRP A 1 84  ? -1.977  -0.346  -4.249  1.00 0.00 ? 1216 TRP A CG   6  
ATOM 9776  C CD1  . TRP A 1 84  ? -3.114  0.359   -4.522  1.00 0.00 ? 1216 TRP A CD1  6  
ATOM 9777  C CD2  . TRP A 1 84  ? -2.262  -1.711  -4.572  1.00 0.00 ? 1216 TRP A CD2  6  
ATOM 9778  N NE1  . TRP A 1 84  ? -4.089  -0.486  -4.995  1.00 0.00 ? 1216 TRP A NE1  6  
ATOM 9779  C CE2  . TRP A 1 84  ? -3.591  -1.761  -5.035  1.00 0.00 ? 1216 TRP A CE2  6  
ATOM 9780  C CE3  . TRP A 1 84  ? -1.524  -2.897  -4.516  1.00 0.00 ? 1216 TRP A CE3  6  
ATOM 9781  C CZ2  . TRP A 1 84  ? -4.195  -2.950  -5.438  1.00 0.00 ? 1216 TRP A CZ2  6  
ATOM 9782  C CZ3  . TRP A 1 84  ? -2.124  -4.075  -4.915  1.00 0.00 ? 1216 TRP A CZ3  6  
ATOM 9783  C CH2  . TRP A 1 84  ? -3.449  -4.095  -5.372  1.00 0.00 ? 1216 TRP A CH2  6  
ATOM 9784  H H    . TRP A 1 84  ? -0.903  -1.050  -1.522  1.00 0.00 ? 1216 TRP A H    6  
ATOM 9785  H HA   . TRP A 1 84  ? 0.034   1.511   -2.187  1.00 0.00 ? 1216 TRP A HA   6  
ATOM 9786  H HB2  . TRP A 1 84  ? -0.302  0.907   -4.436  1.00 0.00 ? 1216 TRP A HB2  6  
ATOM 9787  H HB3  . TRP A 1 84  ? 0.008   -0.622  -3.618  1.00 0.00 ? 1216 TRP A HB3  6  
ATOM 9788  H HD1  . TRP A 1 84  ? -3.218  1.424   -4.381  1.00 0.00 ? 1216 TRP A HD1  6  
ATOM 9789  H HE1  . TRP A 1 84  ? -4.994  -0.218  -5.261  1.00 0.00 ? 1216 TRP A HE1  6  
ATOM 9790  H HE3  . TRP A 1 84  ? -0.502  -2.902  -4.166  1.00 0.00 ? 1216 TRP A HE3  6  
ATOM 9791  H HZ2  . TRP A 1 84  ? -5.215  -2.981  -5.793  1.00 0.00 ? 1216 TRP A HZ2  6  
ATOM 9792  H HZ3  . TRP A 1 84  ? -1.569  -5.001  -4.878  1.00 0.00 ? 1216 TRP A HZ3  6  
ATOM 9793  H HH2  . TRP A 1 84  ? -3.877  -5.038  -5.674  1.00 0.00 ? 1216 TRP A HH2  6  
ATOM 9794  N N    . GLU A 1 85  ? -3.176  1.248   -1.835  1.00 0.00 ? 1217 GLU A N    6  
ATOM 9795  C CA   . GLU A 1 85  ? -4.429  1.992   -1.776  1.00 0.00 ? 1217 GLU A CA   6  
ATOM 9796  C C    . GLU A 1 85  ? -4.250  3.299   -1.010  1.00 0.00 ? 1217 GLU A C    6  
ATOM 9797  O O    . GLU A 1 85  ? -4.846  4.320   -1.355  1.00 0.00 ? 1217 GLU A O    6  
ATOM 9798  C CB   . GLU A 1 85  ? -5.519  1.146   -1.115  1.00 0.00 ? 1217 GLU A CB   6  
ATOM 9799  C CG   . GLU A 1 85  ? -6.215  0.194   -2.073  1.00 0.00 ? 1217 GLU A CG   6  
ATOM 9800  C CD   . GLU A 1 85  ? -7.516  -0.349  -1.514  1.00 0.00 ? 1217 GLU A CD   6  
ATOM 9801  O OE1  . GLU A 1 85  ? -8.488  0.428   -1.409  1.00 0.00 ? 1217 GLU A OE1  6  
ATOM 9802  O OE2  . GLU A 1 85  ? -7.562  -1.552  -1.181  1.00 0.00 ? 1217 GLU A OE2  6  
ATOM 9803  H H    . GLU A 1 85  ? -3.144  0.336   -1.477  1.00 0.00 ? 1217 GLU A H    6  
ATOM 9804  H HA   . GLU A 1 85  ? -4.727  2.219   -2.788  1.00 0.00 ? 1217 GLU A HA   6  
ATOM 9805  H HB2  . GLU A 1 85  ? -5.075  0.564   -0.321  1.00 0.00 ? 1217 GLU A HB2  6  
ATOM 9806  H HB3  . GLU A 1 85  ? -6.263  1.806   -0.693  1.00 0.00 ? 1217 GLU A HB3  6  
ATOM 9807  H HG2  . GLU A 1 85  ? -6.428  0.720   -2.992  1.00 0.00 ? 1217 GLU A HG2  6  
ATOM 9808  H HG3  . GLU A 1 85  ? -5.555  -0.636  -2.279  1.00 0.00 ? 1217 GLU A HG3  6  
ATOM 9809  N N    . VAL A 1 86  ? -3.425  3.261   0.031   1.00 0.00 ? 1218 VAL A N    6  
ATOM 9810  C CA   . VAL A 1 86  ? -3.166  4.442   0.846   1.00 0.00 ? 1218 VAL A CA   6  
ATOM 9811  C C    . VAL A 1 86  ? -2.374  5.485   0.066   1.00 0.00 ? 1218 VAL A C    6  
ATOM 9812  O O    . VAL A 1 86  ? -2.624  6.685   0.185   1.00 0.00 ? 1218 VAL A O    6  
ATOM 9813  C CB   . VAL A 1 86  ? -2.394  4.080   2.129   1.00 0.00 ? 1218 VAL A CB   6  
ATOM 9814  C CG1  . VAL A 1 86  ? -2.057  5.334   2.921   1.00 0.00 ? 1218 VAL A CG1  6  
ATOM 9815  C CG2  . VAL A 1 86  ? -3.197  3.104   2.976   1.00 0.00 ? 1218 VAL A CG2  6  
ATOM 9816  H H    . VAL A 1 86  ? -2.979  2.418   0.256   1.00 0.00 ? 1218 VAL A H    6  
ATOM 9817  H HA   . VAL A 1 86  ? -4.118  4.865   1.131   1.00 0.00 ? 1218 VAL A HA   6  
ATOM 9818  H HB   . VAL A 1 86  ? -1.469  3.601   1.845   1.00 0.00 ? 1218 VAL A HB   6  
ATOM 9819  H HG11 . VAL A 1 86  ? -1.217  5.135   3.570   1.00 0.00 ? 1218 VAL A HG11 6  
ATOM 9820  H HG12 . VAL A 1 86  ? -1.806  6.134   2.240   1.00 0.00 ? 1218 VAL A HG12 6  
ATOM 9821  H HG13 . VAL A 1 86  ? -2.910  5.623   3.517   1.00 0.00 ? 1218 VAL A HG13 6  
ATOM 9822  H HG21 . VAL A 1 86  ? -3.969  2.654   2.371   1.00 0.00 ? 1218 VAL A HG21 6  
ATOM 9823  H HG22 . VAL A 1 86  ? -2.542  2.333   3.356   1.00 0.00 ? 1218 VAL A HG22 6  
ATOM 9824  H HG23 . VAL A 1 86  ? -3.648  3.632   3.803   1.00 0.00 ? 1218 VAL A HG23 6  
ATOM 9825  N N    . ILE A 1 87  ? -1.419  5.020   -0.731  1.00 0.00 ? 1219 ILE A N    6  
ATOM 9826  C CA   . ILE A 1 87  ? -0.591  5.913   -1.532  1.00 0.00 ? 1219 ILE A CA   6  
ATOM 9827  C C    . ILE A 1 87  ? -1.438  6.713   -2.516  1.00 0.00 ? 1219 ILE A C    6  
ATOM 9828  O O    . ILE A 1 87  ? -1.365  7.941   -2.561  1.00 0.00 ? 1219 ILE A O    6  
ATOM 9829  C CB   . ILE A 1 87  ? 0.484   5.135   -2.313  1.00 0.00 ? 1219 ILE A CB   6  
ATOM 9830  C CG1  . ILE A 1 87  ? 1.412   4.395   -1.347  1.00 0.00 ? 1219 ILE A CG1  6  
ATOM 9831  C CG2  . ILE A 1 87  ? 1.280   6.079   -3.202  1.00 0.00 ? 1219 ILE A CG2  6  
ATOM 9832  C CD1  . ILE A 1 87  ? 2.286   3.361   -2.021  1.00 0.00 ? 1219 ILE A CD1  6  
ATOM 9833  H H    . ILE A 1 87  ? -1.268  4.053   -0.783  1.00 0.00 ? 1219 ILE A H    6  
ATOM 9834  H HA   . ILE A 1 87  ? -0.095  6.599   -0.861  1.00 0.00 ? 1219 ILE A HA   6  
ATOM 9835  H HB   . ILE A 1 87  ? -0.012  4.416   -2.946  1.00 0.00 ? 1219 ILE A HB   6  
ATOM 9836  H HG12 . ILE A 1 87  ? 2.058   5.109   -0.860  1.00 0.00 ? 1219 ILE A HG12 6  
ATOM 9837  H HG13 . ILE A 1 87  ? 0.814   3.890   -0.602  1.00 0.00 ? 1219 ILE A HG13 6  
ATOM 9838  H HG21 . ILE A 1 87  ? 0.669   6.389   -4.036  1.00 0.00 ? 1219 ILE A HG21 6  
ATOM 9839  H HG22 . ILE A 1 87  ? 1.576   6.946   -2.631  1.00 0.00 ? 1219 ILE A HG22 6  
ATOM 9840  H HG23 . ILE A 1 87  ? 2.160   5.572   -3.569  1.00 0.00 ? 1219 ILE A HG23 6  
ATOM 9841  H HD11 . ILE A 1 87  ? 3.301   3.727   -2.075  1.00 0.00 ? 1219 ILE A HD11 6  
ATOM 9842  H HD12 . ILE A 1 87  ? 2.263   2.444   -1.453  1.00 0.00 ? 1219 ILE A HD12 6  
ATOM 9843  H HD13 . ILE A 1 87  ? 1.919   3.175   -3.020  1.00 0.00 ? 1219 ILE A HD13 6  
ATOM 9844  N N    . LYS A 1 88  ? -2.245  6.009   -3.303  1.00 0.00 ? 1220 LYS A N    6  
ATOM 9845  C CA   . LYS A 1 88  ? -3.110  6.652   -4.285  1.00 0.00 ? 1220 LYS A CA   6  
ATOM 9846  C C    . LYS A 1 88  ? -3.837  7.844   -3.671  1.00 0.00 ? 1220 LYS A C    6  
ATOM 9847  O O    . LYS A 1 88  ? -3.951  8.901   -4.292  1.00 0.00 ? 1220 LYS A O    6  
ATOM 9848  C CB   . LYS A 1 88  ? -4.126  5.648   -4.835  1.00 0.00 ? 1220 LYS A CB   6  
ATOM 9849  C CG   . LYS A 1 88  ? -4.649  6.007   -6.215  1.00 0.00 ? 1220 LYS A CG   6  
ATOM 9850  C CD   . LYS A 1 88  ? -5.165  4.782   -6.951  1.00 0.00 ? 1220 LYS A CD   6  
ATOM 9851  C CE   . LYS A 1 88  ? -6.534  4.360   -6.440  1.00 0.00 ? 1220 LYS A CE   6  
ATOM 9852  N NZ   . LYS A 1 88  ? -6.975  3.069   -7.038  1.00 0.00 ? 1220 LYS A NZ   6  
ATOM 9853  H H    . LYS A 1 88  ? -2.259  5.032   -3.221  1.00 0.00 ? 1220 LYS A H    6  
ATOM 9854  H HA   . LYS A 1 88  ? -2.488  7.003   -5.095  1.00 0.00 ? 1220 LYS A HA   6  
ATOM 9855  H HB2  . LYS A 1 88  ? -3.659  4.676   -4.891  1.00 0.00 ? 1220 LYS A HB2  6  
ATOM 9856  H HB3  . LYS A 1 88  ? -4.965  5.597   -4.157  1.00 0.00 ? 1220 LYS A HB3  6  
ATOM 9857  H HG2  . LYS A 1 88  ? -5.457  6.717   -6.110  1.00 0.00 ? 1220 LYS A HG2  6  
ATOM 9858  H HG3  . LYS A 1 88  ? -3.849  6.451   -6.789  1.00 0.00 ? 1220 LYS A HG3  6  
ATOM 9859  H HD2  . LYS A 1 88  ? -5.241  5.011   -8.004  1.00 0.00 ? 1220 LYS A HD2  6  
ATOM 9860  H HD3  . LYS A 1 88  ? -4.469  3.968   -6.808  1.00 0.00 ? 1220 LYS A HD3  6  
ATOM 9861  H HE2  . LYS A 1 88  ? -6.486  4.252   -5.368  1.00 0.00 ? 1220 LYS A HE2  6  
ATOM 9862  H HE3  . LYS A 1 88  ? -7.250  5.127   -6.693  1.00 0.00 ? 1220 LYS A HE3  6  
ATOM 9863  H HZ1  . LYS A 1 88  ? -7.041  3.159   -8.073  1.00 0.00 ? 1220 LYS A HZ1  6  
ATOM 9864  H HZ2  . LYS A 1 88  ? -7.908  2.803   -6.665  1.00 0.00 ? 1220 LYS A HZ2  6  
ATOM 9865  H HZ3  . LYS A 1 88  ? -6.294  2.317   -6.809  1.00 0.00 ? 1220 LYS A HZ3  6  
ATOM 9866  N N    . HIS A 1 89  ? -4.327  7.667   -2.448  1.00 0.00 ? 1221 HIS A N    6  
ATOM 9867  C CA   . HIS A 1 89  ? -5.042  8.729   -1.750  1.00 0.00 ? 1221 HIS A CA   6  
ATOM 9868  C C    . HIS A 1 89  ? -4.069  9.770   -1.203  1.00 0.00 ? 1221 HIS A C    6  
ATOM 9869  O O    . HIS A 1 89  ? -4.290  10.974  -1.340  1.00 0.00 ? 1221 HIS A O    6  
ATOM 9870  C CB   . HIS A 1 89  ? -5.878  8.147   -0.610  1.00 0.00 ? 1221 HIS A CB   6  
ATOM 9871  C CG   . HIS A 1 89  ? -7.077  8.974   -0.263  1.00 0.00 ? 1221 HIS A CG   6  
ATOM 9872  N ND1  . HIS A 1 89  ? -8.316  8.780   -0.835  1.00 0.00 ? 1221 HIS A ND1  6  
ATOM 9873  C CD2  . HIS A 1 89  ? -7.221  10.003  0.605   1.00 0.00 ? 1221 HIS A CD2  6  
ATOM 9874  C CE1  . HIS A 1 89  ? -9.171  9.654   -0.335  1.00 0.00 ? 1221 HIS A CE1  6  
ATOM 9875  N NE2  . HIS A 1 89  ? -8.532  10.408  0.541   1.00 0.00 ? 1221 HIS A NE2  6  
ATOM 9876  H H    . HIS A 1 89  ? -4.204  6.802   -2.005  1.00 0.00 ? 1221 HIS A H    6  
ATOM 9877  H HA   . HIS A 1 89  ? -5.700  9.208   -2.459  1.00 0.00 ? 1221 HIS A HA   6  
ATOM 9878  H HB2  . HIS A 1 89  ? -6.224  7.164   -0.893  1.00 0.00 ? 1221 HIS A HB2  6  
ATOM 9879  H HB3  . HIS A 1 89  ? -5.262  8.066   0.274   1.00 0.00 ? 1221 HIS A HB3  6  
ATOM 9880  H HD1  . HIS A 1 89  ? -8.536  8.103   -1.507  1.00 0.00 ? 1221 HIS A HD1  6  
ATOM 9881  H HD2  . HIS A 1 89  ? -6.449  10.428  1.231   1.00 0.00 ? 1221 HIS A HD2  6  
ATOM 9882  H HE1  . HIS A 1 89  ? -10.215 9.739   -0.597  1.00 0.00 ? 1221 HIS A HE1  6  
ATOM 9883  H HE2  . HIS A 1 89  ? -8.910  11.190  0.994   1.00 0.00 ? 1221 HIS A HE2  6  
ATOM 9884  N N    . PHE A 1 90  ? -2.993  9.299   -0.582  1.00 0.00 ? 1222 PHE A N    6  
ATOM 9885  C CA   . PHE A 1 90  ? -1.988  10.188  -0.013  1.00 0.00 ? 1222 PHE A CA   6  
ATOM 9886  C C    . PHE A 1 90  ? -1.498  11.192  -1.053  1.00 0.00 ? 1222 PHE A C    6  
ATOM 9887  O O    . PHE A 1 90  ? -1.282  12.365  -0.746  1.00 0.00 ? 1222 PHE A O    6  
ATOM 9888  C CB   . PHE A 1 90  ? -0.807  9.379   0.527   1.00 0.00 ? 1222 PHE A CB   6  
ATOM 9889  C CG   . PHE A 1 90  ? 0.438   10.195  0.727   1.00 0.00 ? 1222 PHE A CG   6  
ATOM 9890  C CD1  . PHE A 1 90  ? 0.658   10.865  1.920   1.00 0.00 ? 1222 PHE A CD1  6  
ATOM 9891  C CD2  . PHE A 1 90  ? 1.388   10.292  -0.277  1.00 0.00 ? 1222 PHE A CD2  6  
ATOM 9892  C CE1  . PHE A 1 90  ? 1.803   11.618  2.106   1.00 0.00 ? 1222 PHE A CE1  6  
ATOM 9893  C CE2  . PHE A 1 90  ? 2.534   11.042  -0.096  1.00 0.00 ? 1222 PHE A CE2  6  
ATOM 9894  C CZ   . PHE A 1 90  ? 2.742   11.706  1.098   1.00 0.00 ? 1222 PHE A CZ   6  
ATOM 9895  H H    . PHE A 1 90  ? -2.873  8.329   -0.504  1.00 0.00 ? 1222 PHE A H    6  
ATOM 9896  H HA   . PHE A 1 90  ? -2.446  10.727  0.802   1.00 0.00 ? 1222 PHE A HA   6  
ATOM 9897  H HB2  . PHE A 1 90  ? -1.079  8.951   1.480   1.00 0.00 ? 1222 PHE A HB2  6  
ATOM 9898  H HB3  . PHE A 1 90  ? -0.577  8.585   -0.167  1.00 0.00 ? 1222 PHE A HB3  6  
ATOM 9899  H HD1  . PHE A 1 90  ? -0.075  10.797  2.710   1.00 0.00 ? 1222 PHE A HD1  6  
ATOM 9900  H HD2  . PHE A 1 90  ? 1.226   9.773   -1.211  1.00 0.00 ? 1222 PHE A HD2  6  
ATOM 9901  H HE1  . PHE A 1 90  ? 1.963   12.135  3.040   1.00 0.00 ? 1222 PHE A HE1  6  
ATOM 9902  H HE2  . PHE A 1 90  ? 3.267   11.108  -0.887  1.00 0.00 ? 1222 PHE A HE2  6  
ATOM 9903  H HZ   . PHE A 1 90  ? 3.637   12.293  1.241   1.00 0.00 ? 1222 PHE A HZ   6  
ATOM 9904  N N    . CYS A 1 91  ? -1.324  10.722  -2.283  1.00 0.00 ? 1223 CYS A N    6  
ATOM 9905  C CA   . CYS A 1 91  ? -0.858  11.577  -3.369  1.00 0.00 ? 1223 CYS A CA   6  
ATOM 9906  C C    . CYS A 1 91  ? -2.002  12.416  -3.929  1.00 0.00 ? 1223 CYS A C    6  
ATOM 9907  O O    . CYS A 1 91  ? -1.787  13.518  -4.432  1.00 0.00 ? 1223 CYS A O    6  
ATOM 9908  C CB   . CYS A 1 91  ? -0.237  10.731  -4.482  1.00 0.00 ? 1223 CYS A CB   6  
ATOM 9909  S SG   . CYS A 1 91  ? -1.347  9.475   -5.160  1.00 0.00 ? 1223 CYS A SG   6  
ATOM 9910  H H    . CYS A 1 91  ? -1.512  9.778   -2.466  1.00 0.00 ? 1223 CYS A H    6  
ATOM 9911  H HA   . CYS A 1 91  ? -0.105  12.239  -2.969  1.00 0.00 ? 1223 CYS A HA   6  
ATOM 9912  H HB2  . CYS A 1 91  ? 0.060   11.379  -5.293  1.00 0.00 ? 1223 CYS A HB2  6  
ATOM 9913  H HB3  . CYS A 1 91  ? 0.635   10.226  -4.095  1.00 0.00 ? 1223 CYS A HB3  6  
ATOM 9914  H HG   . CYS A 1 91  ? -2.179  10.075  -5.998  1.00 0.00 ? 1223 CYS A HG   6  
ATOM 9915  N N    . GLN A 1 92  ? -3.217  11.885  -3.840  1.00 0.00 ? 1224 GLN A N    6  
ATOM 9916  C CA   . GLN A 1 92  ? -4.394  12.584  -4.341  1.00 0.00 ? 1224 GLN A CA   6  
ATOM 9917  C C    . GLN A 1 92  ? -4.641  13.867  -3.554  1.00 0.00 ? 1224 GLN A C    6  
ATOM 9918  O O    . GLN A 1 92  ? -5.036  14.888  -4.117  1.00 0.00 ? 1224 GLN A O    6  
ATOM 9919  C CB   . GLN A 1 92  ? -5.624  11.678  -4.262  1.00 0.00 ? 1224 GLN A CB   6  
ATOM 9920  C CG   . GLN A 1 92  ? -5.848  10.845  -5.514  1.00 0.00 ? 1224 GLN A CG   6  
ATOM 9921  C CD   . GLN A 1 92  ? -6.129  11.694  -6.737  1.00 0.00 ? 1224 GLN A CD   6  
ATOM 9922  O OE1  . GLN A 1 92  ? -5.210  12.117  -7.439  1.00 0.00 ? 1224 GLN A OE1  6  
ATOM 9923  N NE2  . GLN A 1 92  ? -7.406  11.950  -7.000  1.00 0.00 ? 1224 GLN A NE2  6  
ATOM 9924  H H    . GLN A 1 92  ? -3.324  11.002  -3.429  1.00 0.00 ? 1224 GLN A H    6  
ATOM 9925  H HA   . GLN A 1 92  ? -4.213  12.840  -5.374  1.00 0.00 ? 1224 GLN A HA   6  
ATOM 9926  H HB2  . GLN A 1 92  ? -5.509  11.007  -3.424  1.00 0.00 ? 1224 GLN A HB2  6  
ATOM 9927  H HB3  . GLN A 1 92  ? -6.499  12.292  -4.103  1.00 0.00 ? 1224 GLN A HB3  6  
ATOM 9928  H HG2  . GLN A 1 92  ? -4.963  10.255  -5.701  1.00 0.00 ? 1224 GLN A HG2  6  
ATOM 9929  H HG3  . GLN A 1 92  ? -6.689  10.188  -5.348  1.00 0.00 ? 1224 GLN A HG3  6  
ATOM 9930  H HE21 . GLN A 1 92  ? -8.085  11.581  -6.396  1.00 0.00 ? 1224 GLN A HE21 6  
ATOM 9931  H HE22 . GLN A 1 92  ? -7.616  12.497  -7.784  1.00 0.00 ? 1224 GLN A HE22 6  
ATOM 9932  N N    . THR A 1 93  ? -4.408  13.807  -2.246  1.00 0.00 ? 1225 THR A N    6  
ATOM 9933  C CA   . THR A 1 93  ? -4.606  14.963  -1.381  1.00 0.00 ? 1225 THR A CA   6  
ATOM 9934  C C    . THR A 1 93  ? -3.357  15.835  -1.333  1.00 0.00 ? 1225 THR A C    6  
ATOM 9935  O O    . THR A 1 93  ? -3.412  16.992  -0.918  1.00 0.00 ? 1225 THR A O    6  
ATOM 9936  C CB   . THR A 1 93  ? -4.974  14.534  0.053   1.00 0.00 ? 1225 THR A CB   6  
ATOM 9937  O OG1  . THR A 1 93  ? -5.045  15.683  0.904   1.00 0.00 ? 1225 THR A OG1  6  
ATOM 9938  C CG2  . THR A 1 93  ? -3.951  13.552  0.603   1.00 0.00 ? 1225 THR A CG2  6  
ATOM 9939  H H    . THR A 1 93  ? -4.095  12.964  -1.856  1.00 0.00 ? 1225 THR A H    6  
ATOM 9940  H HA   . THR A 1 93  ? -5.424  15.543  -1.781  1.00 0.00 ? 1225 THR A HA   6  
ATOM 9941  H HB   . THR A 1 93  ? -5.940  14.051  0.031   1.00 0.00 ? 1225 THR A HB   6  
ATOM 9942  H HG1  . THR A 1 93  ? -4.192  16.126  0.917   1.00 0.00 ? 1225 THR A HG1  6  
ATOM 9943  H HG21 . THR A 1 93  ? -3.122  13.472  -0.084  1.00 0.00 ? 1225 THR A HG21 6  
ATOM 9944  H HG22 . THR A 1 93  ? -4.412  12.583  0.724   1.00 0.00 ? 1225 THR A HG22 6  
ATOM 9945  H HG23 . THR A 1 93  ? -3.593  13.903  1.559   1.00 0.00 ? 1225 THR A HG23 6  
ATOM 9946  N N    . ASN A 1 94  ? -2.232  15.274  -1.762  1.00 0.00 ? 1226 ASN A N    6  
ATOM 9947  C CA   . ASN A 1 94  ? -0.968  16.002  -1.769  1.00 0.00 ? 1226 ASN A CA   6  
ATOM 9948  C C    . ASN A 1 94  ? -0.409  16.108  -3.185  1.00 0.00 ? 1226 ASN A C    6  
ATOM 9949  O O    . ASN A 1 94  ? 0.777   16.374  -3.376  1.00 0.00 ? 1226 ASN A O    6  
ATOM 9950  C CB   . ASN A 1 94  ? 0.048   15.310  -0.858  1.00 0.00 ? 1226 ASN A CB   6  
ATOM 9951  C CG   . ASN A 1 94  ? -0.184  15.621  0.608   1.00 0.00 ? 1226 ASN A CG   6  
ATOM 9952  O OD1  . ASN A 1 94  ? 0.441   16.520  1.170   1.00 0.00 ? 1226 ASN A OD1  6  
ATOM 9953  N ND2  . ASN A 1 94  ? -1.087  14.876  1.235   1.00 0.00 ? 1226 ASN A ND2  6  
ATOM 9954  H H    . ASN A 1 94  ? -2.251  14.347  -2.082  1.00 0.00 ? 1226 ASN A H    6  
ATOM 9955  H HA   . ASN A 1 94  ? -1.157  16.996  -1.393  1.00 0.00 ? 1226 ASN A HA   6  
ATOM 9956  H HB2  . ASN A 1 94  ? -0.024  14.241  -0.995  1.00 0.00 ? 1226 ASN A HB2  6  
ATOM 9957  H HB3  . ASN A 1 94  ? 1.042   15.636  -1.124  1.00 0.00 ? 1226 ASN A HB3  6  
ATOM 9958  H HD21 . ASN A 1 94  ? -1.547  14.177  0.724   1.00 0.00 ? 1226 ASN A HD21 6  
ATOM 9959  H HD22 . ASN A 1 94  ? -1.258  15.056  2.183   1.00 0.00 ? 1226 ASN A HD22 6  
ATOM 9960  N N    . SER A 1 95  ? -1.273  15.899  -4.173  1.00 0.00 ? 1227 SER A N    6  
ATOM 9961  C CA   . SER A 1 95  ? -0.865  15.968  -5.572  1.00 0.00 ? 1227 SER A CA   6  
ATOM 9962  C C    . SER A 1 95  ? 0.564   15.463  -5.747  1.00 0.00 ? 1227 SER A C    6  
ATOM 9963  O O    . SER A 1 95  ? 1.379   16.092  -6.421  1.00 0.00 ? 1227 SER A O    6  
ATOM 9964  C CB   . SER A 1 95  ? -0.977  17.404  -6.087  1.00 0.00 ? 1227 SER A CB   6  
ATOM 9965  O OG   . SER A 1 95  ? -2.253  17.951  -5.801  1.00 0.00 ? 1227 SER A OG   6  
ATOM 9966  H H    . SER A 1 95  ? -2.206  15.690  -3.957  1.00 0.00 ? 1227 SER A H    6  
ATOM 9967  H HA   . SER A 1 95  ? -1.530  15.337  -6.142  1.00 0.00 ? 1227 SER A HA   6  
ATOM 9968  H HB2  . SER A 1 95  ? -0.223  18.014  -5.614  1.00 0.00 ? 1227 SER A HB2  6  
ATOM 9969  H HB3  . SER A 1 95  ? -0.827  17.412  -7.157  1.00 0.00 ? 1227 SER A HB3  6  
ATOM 9970  H HG   . SER A 1 95  ? -2.157  18.873  -5.551  1.00 0.00 ? 1227 SER A HG   6  
ATOM 9971  N N    . VAL A 1 96  ? 0.861   14.321  -5.133  1.00 0.00 ? 1228 VAL A N    6  
ATOM 9972  C CA   . VAL A 1 96  ? 2.191   13.730  -5.221  1.00 0.00 ? 1228 VAL A CA   6  
ATOM 9973  C C    . VAL A 1 96  ? 2.333   12.882  -6.480  1.00 0.00 ? 1228 VAL A C    6  
ATOM 9974  O O    . VAL A 1 96  ? 1.353   12.340  -6.989  1.00 0.00 ? 1228 VAL A O    6  
ATOM 9975  C CB   . VAL A 1 96  ? 2.498   12.856  -3.990  1.00 0.00 ? 1228 VAL A CB   6  
ATOM 9976  C CG1  . VAL A 1 96  ? 3.862   12.198  -4.130  1.00 0.00 ? 1228 VAL A CG1  6  
ATOM 9977  C CG2  . VAL A 1 96  ? 2.426   13.686  -2.717  1.00 0.00 ? 1228 VAL A CG2  6  
ATOM 9978  H H    . VAL A 1 96  ? 0.169   13.866  -4.610  1.00 0.00 ? 1228 VAL A H    6  
ATOM 9979  H HA   . VAL A 1 96  ? 2.912   14.533  -5.256  1.00 0.00 ? 1228 VAL A HA   6  
ATOM 9980  H HB   . VAL A 1 96  ? 1.752   12.078  -3.931  1.00 0.00 ? 1228 VAL A HB   6  
ATOM 9981  H HG11 . VAL A 1 96  ? 4.233   11.927  -3.153  1.00 0.00 ? 1228 VAL A HG11 6  
ATOM 9982  H HG12 . VAL A 1 96  ? 3.773   11.311  -4.741  1.00 0.00 ? 1228 VAL A HG12 6  
ATOM 9983  H HG13 . VAL A 1 96  ? 4.549   12.889  -4.597  1.00 0.00 ? 1228 VAL A HG13 6  
ATOM 9984  H HG21 . VAL A 1 96  ? 1.452   14.145  -2.643  1.00 0.00 ? 1228 VAL A HG21 6  
ATOM 9985  H HG22 . VAL A 1 96  ? 2.589   13.047  -1.861  1.00 0.00 ? 1228 VAL A HG22 6  
ATOM 9986  H HG23 . VAL A 1 96  ? 3.186   14.453  -2.743  1.00 0.00 ? 1228 VAL A HG23 6  
ATOM 9987  N N    . GLN A 1 97  ? 3.561   12.773  -6.978  1.00 0.00 ? 1229 GLN A N    6  
ATOM 9988  C CA   . GLN A 1 97  ? 3.831   11.992  -8.178  1.00 0.00 ? 1229 GLN A CA   6  
ATOM 9989  C C    . GLN A 1 97  ? 3.768   10.497  -7.881  1.00 0.00 ? 1229 GLN A C    6  
ATOM 9990  O O    . GLN A 1 97  ? 4.222   10.042  -6.830  1.00 0.00 ? 1229 GLN A O    6  
ATOM 9991  C CB   . GLN A 1 97  ? 5.204   12.352  -8.749  1.00 0.00 ? 1229 GLN A CB   6  
ATOM 9992  C CG   . GLN A 1 97  ? 5.165   13.491  -9.756  1.00 0.00 ? 1229 GLN A CG   6  
ATOM 9993  C CD   . GLN A 1 97  ? 5.332   14.850  -9.106  1.00 0.00 ? 1229 GLN A CD   6  
ATOM 9994  O OE1  . GLN A 1 97  ? 4.374   15.614  -8.981  1.00 0.00 ? 1229 GLN A OE1  6  
ATOM 9995  N NE2  . GLN A 1 97  ? 6.554   15.161  -8.688  1.00 0.00 ? 1229 GLN A NE2  6  
ATOM 9996  H H    . GLN A 1 97  ? 4.301   13.229  -6.527  1.00 0.00 ? 1229 GLN A H    6  
ATOM 9997  H HA   . GLN A 1 97  ? 3.074   12.233  -8.908  1.00 0.00 ? 1229 GLN A HA   6  
ATOM 9998  H HB2  . GLN A 1 97  ? 5.854   12.641  -7.936  1.00 0.00 ? 1229 GLN A HB2  6  
ATOM 9999  H HB3  . GLN A 1 97  ? 5.617   11.483  -9.238  1.00 0.00 ? 1229 GLN A HB3  6  
ATOM 10000 H HG2  . GLN A 1 97  ? 5.962   13.350  -10.470 1.00 0.00 ? 1229 GLN A HG2  6  
ATOM 10001 H HG3  . GLN A 1 97  ? 4.214   13.467  -10.268 1.00 0.00 ? 1229 GLN A HG3  6  
ATOM 10002 H HE21 . GLN A 1 97  ? 7.269   14.503  -8.822  1.00 0.00 ? 1229 GLN A HE21 6  
ATOM 10003 H HE22 . GLN A 1 97  ? 6.691   16.033  -8.266  1.00 0.00 ? 1229 GLN A HE22 6  
ATOM 10004 N N    . THR A 1 98  ? 3.202   9.736   -8.813  1.00 0.00 ? 1230 THR A N    6  
ATOM 10005 C CA   . THR A 1 98  ? 3.078   8.294   -8.650  1.00 0.00 ? 1230 THR A CA   6  
ATOM 10006 C C    . THR A 1 98  ? 3.612   7.554   -9.871  1.00 0.00 ? 1230 THR A C    6  
ATOM 10007 O O    . THR A 1 98  ? 4.014   8.173   -10.857 1.00 0.00 ? 1230 THR A O    6  
ATOM 10008 C CB   . THR A 1 98  ? 1.613   7.879   -8.413  1.00 0.00 ? 1230 THR A CB   6  
ATOM 10009 O OG1  . THR A 1 98  ? 0.766   8.493   -9.391  1.00 0.00 ? 1230 THR A OG1  6  
ATOM 10010 C CG2  . THR A 1 98  ? 1.157   8.277   -7.017  1.00 0.00 ? 1230 THR A CG2  6  
ATOM 10011 H H    . THR A 1 98  ? 2.860   10.157  -9.629  1.00 0.00 ? 1230 THR A H    6  
ATOM 10012 H HA   . THR A 1 98  ? 3.656   8.005   -7.785  1.00 0.00 ? 1230 THR A HA   6  
ATOM 10013 H HB   . THR A 1 98  ? 1.540   6.805   -8.507  1.00 0.00 ? 1230 THR A HB   6  
ATOM 10014 H HG1  . THR A 1 98  ? -0.062  8.752   -8.979  1.00 0.00 ? 1230 THR A HG1  6  
ATOM 10015 H HG21 . THR A 1 98  ? 1.537   7.567   -6.298  1.00 0.00 ? 1230 THR A HG21 6  
ATOM 10016 H HG22 . THR A 1 98  ? 0.078   8.285   -6.980  1.00 0.00 ? 1230 THR A HG22 6  
ATOM 10017 H HG23 . THR A 1 98  ? 1.533   9.261   -6.784  1.00 0.00 ? 1230 THR A HG23 6  
ATOM 10018 N N    . ASP A 1 99  ? 3.613   6.228   -9.801  1.00 0.00 ? 1231 ASP A N    6  
ATOM 10019 C CA   . ASP A 1 99  ? 4.096   5.404   -10.902 1.00 0.00 ? 1231 ASP A CA   6  
ATOM 10020 C C    . ASP A 1 99  ? 5.391   5.970   -11.477 1.00 0.00 ? 1231 ASP A C    6  
ATOM 10021 O O    . ASP A 1 99  ? 5.539   6.098   -12.693 1.00 0.00 ? 1231 ASP A O    6  
ATOM 10022 C CB   . ASP A 1 99  ? 3.035   5.308   -12.000 1.00 0.00 ? 1231 ASP A CB   6  
ATOM 10023 C CG   . ASP A 1 99  ? 2.564   6.671   -12.469 1.00 0.00 ? 1231 ASP A CG   6  
ATOM 10024 O OD1  . ASP A 1 99  ? 1.632   7.222   -11.848 1.00 0.00 ? 1231 ASP A OD1  6  
ATOM 10025 O OD2  . ASP A 1 99  ? 3.127   7.185   -13.459 1.00 0.00 ? 1231 ASP A OD2  6  
ATOM 10026 H H    . ASP A 1 99  ? 3.279   5.792   -8.988  1.00 0.00 ? 1231 ASP A H    6  
ATOM 10027 H HA   . ASP A 1 99  ? 4.291   4.415   -10.516 1.00 0.00 ? 1231 ASP A HA   6  
ATOM 10028 H HB2  . ASP A 1 99  ? 3.449   4.780   -12.847 1.00 0.00 ? 1231 ASP A HB2  6  
ATOM 10029 H HB3  . ASP A 1 99  ? 2.183   4.763   -11.622 1.00 0.00 ? 1231 ASP A HB3  6  
ATOM 10030 N N    . LEU A 1 100 ? 6.325   6.308   -10.595 1.00 0.00 ? 1232 LEU A N    6  
ATOM 10031 C CA   . LEU A 1 100 ? 7.608   6.862   -11.014 1.00 0.00 ? 1232 LEU A CA   6  
ATOM 10032 C C    . LEU A 1 100 ? 8.608   5.751   -11.318 1.00 0.00 ? 1232 LEU A C    6  
ATOM 10033 O O    . LEU A 1 100 ? 9.786   5.851   -10.976 1.00 0.00 ? 1232 LEU A O    6  
ATOM 10034 C CB   . LEU A 1 100 ? 8.167   7.783   -9.929  1.00 0.00 ? 1232 LEU A CB   6  
ATOM 10035 C CG   . LEU A 1 100 ? 7.331   9.021   -9.604  1.00 0.00 ? 1232 LEU A CG   6  
ATOM 10036 C CD1  . LEU A 1 100 ? 7.700   9.570   -8.234  1.00 0.00 ? 1232 LEU A CD1  6  
ATOM 10037 C CD2  . LEU A 1 100 ? 7.516   10.086  -10.675 1.00 0.00 ? 1232 LEU A CD2  6  
ATOM 10038 H H    . LEU A 1 100 ? 6.149   6.182   -9.640  1.00 0.00 ? 1232 LEU A H    6  
ATOM 10039 H HA   . LEU A 1 100 ? 7.443   7.437   -11.914 1.00 0.00 ? 1232 LEU A HA   6  
ATOM 10040 H HB2  . LEU A 1 100 ? 8.267   7.205   -9.024  1.00 0.00 ? 1232 LEU A HB2  6  
ATOM 10041 H HB3  . LEU A 1 100 ? 9.143   8.117   -10.251 1.00 0.00 ? 1232 LEU A HB3  6  
ATOM 10042 H HG   . LEU A 1 100 ? 6.285   8.746   -9.581  1.00 0.00 ? 1232 LEU A HG   6  
ATOM 10043 H HD11 . LEU A 1 100 ? 7.010   9.191   -7.497  1.00 0.00 ? 1232 LEU A HD11 6  
ATOM 10044 H HD12 . LEU A 1 100 ? 7.650   10.649  -8.254  1.00 0.00 ? 1232 LEU A HD12 6  
ATOM 10045 H HD13 . LEU A 1 100 ? 8.704   9.261   -7.982  1.00 0.00 ? 1232 LEU A HD13 6  
ATOM 10046 H HD21 . LEU A 1 100 ? 8.433   9.899   -11.214 1.00 0.00 ? 1232 LEU A HD21 6  
ATOM 10047 H HD22 . LEU A 1 100 ? 7.564   11.060  -10.210 1.00 0.00 ? 1232 LEU A HD22 6  
ATOM 10048 H HD23 . LEU A 1 100 ? 6.682   10.056  -11.361 1.00 0.00 ? 1232 LEU A HD23 6  
ATOM 10049 N N    . PHE A 1 101 ? 8.130   4.692   -11.965 1.00 0.00 ? 1233 PHE A N    6  
ATOM 10050 C CA   . PHE A 1 101 ? 8.982   3.562   -12.316 1.00 0.00 ? 1233 PHE A CA   6  
ATOM 10051 C C    . PHE A 1 101 ? 9.888   3.910   -13.494 1.00 0.00 ? 1233 PHE A C    6  
ATOM 10052 O O    . PHE A 1 101 ? 11.110  3.797   -13.406 1.00 0.00 ? 1233 PHE A O    6  
ATOM 10053 C CB   . PHE A 1 101 ? 8.128   2.340   -12.659 1.00 0.00 ? 1233 PHE A CB   6  
ATOM 10054 C CG   . PHE A 1 101 ? 7.432   1.742   -11.469 1.00 0.00 ? 1233 PHE A CG   6  
ATOM 10055 C CD1  . PHE A 1 101 ? 6.455   2.454   -10.792 1.00 0.00 ? 1233 PHE A CD1  6  
ATOM 10056 C CD2  . PHE A 1 101 ? 7.756   0.469   -11.027 1.00 0.00 ? 1233 PHE A CD2  6  
ATOM 10057 C CE1  . PHE A 1 101 ? 5.814   1.907   -9.697  1.00 0.00 ? 1233 PHE A CE1  6  
ATOM 10058 C CE2  . PHE A 1 101 ? 7.117   -0.083  -9.933  1.00 0.00 ? 1233 PHE A CE2  6  
ATOM 10059 C CZ   . PHE A 1 101 ? 6.144   0.637   -9.267  1.00 0.00 ? 1233 PHE A CZ   6  
ATOM 10060 H H    . PHE A 1 101 ? 7.181   4.671   -12.211 1.00 0.00 ? 1233 PHE A H    6  
ATOM 10061 H HA   . PHE A 1 101 ? 9.597   3.333   -11.460 1.00 0.00 ? 1233 PHE A HA   6  
ATOM 10062 H HB2  . PHE A 1 101 ? 7.373   2.626   -13.375 1.00 0.00 ? 1233 PHE A HB2  6  
ATOM 10063 H HB3  . PHE A 1 101 ? 8.759   1.579   -13.092 1.00 0.00 ? 1233 PHE A HB3  6  
ATOM 10064 H HD1  . PHE A 1 101 ? 6.194   3.447   -11.127 1.00 0.00 ? 1233 PHE A HD1  6  
ATOM 10065 H HD2  . PHE A 1 101 ? 8.517   -0.095  -11.548 1.00 0.00 ? 1233 PHE A HD2  6  
ATOM 10066 H HE1  . PHE A 1 101 ? 5.053   2.472   -9.178  1.00 0.00 ? 1233 PHE A HE1  6  
ATOM 10067 H HE2  . PHE A 1 101 ? 7.379   -1.076  -9.600  1.00 0.00 ? 1233 PHE A HE2  6  
ATOM 10068 H HZ   . PHE A 1 101 ? 5.645   0.207   -8.411  1.00 0.00 ? 1233 PHE A HZ   6  
ATOM 10069 N N    . SER A 1 102 ? 9.278   4.332   -14.597 1.00 0.00 ? 1234 SER A N    6  
ATOM 10070 C CA   . SER A 1 102 ? 10.028  4.692   -15.795 1.00 0.00 ? 1234 SER A CA   6  
ATOM 10071 C C    . SER A 1 102 ? 10.099  6.208   -15.956 1.00 0.00 ? 1234 SER A C    6  
ATOM 10072 O O    . SER A 1 102 ? 9.131   6.846   -16.369 1.00 0.00 ? 1234 SER A O    6  
ATOM 10073 C CB   . SER A 1 102 ? 9.383   4.066   -17.033 1.00 0.00 ? 1234 SER A CB   6  
ATOM 10074 O OG   . SER A 1 102 ? 8.031   4.469   -17.163 1.00 0.00 ? 1234 SER A OG   6  
ATOM 10075 H H    . SER A 1 102 ? 8.300   4.401   -14.606 1.00 0.00 ? 1234 SER A H    6  
ATOM 10076 H HA   . SER A 1 102 ? 11.030  4.306   -15.687 1.00 0.00 ? 1234 SER A HA   6  
ATOM 10077 H HB2  . SER A 1 102 ? 9.925   4.377   -17.914 1.00 0.00 ? 1234 SER A HB2  6  
ATOM 10078 H HB3  . SER A 1 102 ? 9.420   2.990   -16.949 1.00 0.00 ? 1234 SER A HB3  6  
ATOM 10079 H HG   . SER A 1 102 ? 7.812   4.563   -18.093 1.00 0.00 ? 1234 SER A HG   6  
ATOM 10080 N N    . SER A 1 103 ? 11.254  6.778   -15.627 1.00 0.00 ? 1235 SER A N    6  
ATOM 10081 C CA   . SER A 1 103 ? 11.452  8.219   -15.731 1.00 0.00 ? 1235 SER A CA   6  
ATOM 10082 C C    . SER A 1 103 ? 10.851  8.758   -17.025 1.00 0.00 ? 1235 SER A C    6  
ATOM 10083 O O    . SER A 1 103 ? 10.171  9.785   -17.028 1.00 0.00 ? 1235 SER A O    6  
ATOM 10084 C CB   . SER A 1 103 ? 12.944  8.555   -15.669 1.00 0.00 ? 1235 SER A CB   6  
ATOM 10085 O OG   . SER A 1 103 ? 13.513  8.125   -14.445 1.00 0.00 ? 1235 SER A OG   6  
ATOM 10086 H H    . SER A 1 103 ? 11.989  6.216   -15.304 1.00 0.00 ? 1235 SER A H    6  
ATOM 10087 H HA   . SER A 1 103 ? 10.952  8.683   -14.894 1.00 0.00 ? 1235 SER A HA   6  
ATOM 10088 H HB2  . SER A 1 103 ? 13.455  8.064   -16.483 1.00 0.00 ? 1235 SER A HB2  6  
ATOM 10089 H HB3  . SER A 1 103 ? 13.072  9.625   -15.757 1.00 0.00 ? 1235 SER A HB3  6  
ATOM 10090 H HG   . SER A 1 103 ? 12.985  8.453   -13.713 1.00 0.00 ? 1235 SER A HG   6  
ATOM 10091 N N    . THR A 1 104 ? 11.106  8.057   -18.126 1.00 0.00 ? 1236 THR A N    6  
ATOM 10092 C CA   . THR A 1 104 ? 10.592  8.465   -19.427 1.00 0.00 ? 1236 THR A CA   6  
ATOM 10093 C C    . THR A 1 104 ? 9.099   8.178   -19.543 1.00 0.00 ? 1236 THR A C    6  
ATOM 10094 O O    . THR A 1 104 ? 8.589   7.234   -18.939 1.00 0.00 ? 1236 THR A O    6  
ATOM 10095 C CB   . THR A 1 104 ? 11.331  7.748   -20.573 1.00 0.00 ? 1236 THR A CB   6  
ATOM 10096 O OG1  . THR A 1 104 ? 10.935  8.300   -21.833 1.00 0.00 ? 1236 THR A OG1  6  
ATOM 10097 C CG2  . THR A 1 104 ? 11.040  6.255   -20.554 1.00 0.00 ? 1236 THR A CG2  6  
ATOM 10098 H H    . THR A 1 104 ? 11.654  7.248   -18.060 1.00 0.00 ? 1236 THR A H    6  
ATOM 10099 H HA   . THR A 1 104 ? 10.754  9.528   -19.532 1.00 0.00 ? 1236 THR A HA   6  
ATOM 10100 H HB   . THR A 1 104 ? 12.394  7.894   -20.442 1.00 0.00 ? 1236 THR A HB   6  
ATOM 10101 H HG1  . THR A 1 104 ? 10.928  9.259   -21.775 1.00 0.00 ? 1236 THR A HG1  6  
ATOM 10102 H HG21 . THR A 1 104 ? 9.977   6.094   -20.658 1.00 0.00 ? 1236 THR A HG21 6  
ATOM 10103 H HG22 . THR A 1 104 ? 11.378  5.834   -19.619 1.00 0.00 ? 1236 THR A HG22 6  
ATOM 10104 H HG23 . THR A 1 104 ? 11.557  5.777   -21.372 1.00 0.00 ? 1236 THR A HG23 6  
ATOM 10105 N N    . LYS A 1 105 ? 8.403   8.997   -20.323 1.00 0.00 ? 1237 LYS A N    6  
ATOM 10106 C CA   . LYS A 1 105 ? 6.968   8.831   -20.521 1.00 0.00 ? 1237 LYS A CA   6  
ATOM 10107 C C    . LYS A 1 105 ? 6.647   8.571   -21.989 1.00 0.00 ? 1237 LYS A C    6  
ATOM 10108 O O    . LYS A 1 105 ? 7.260   9.139   -22.893 1.00 0.00 ? 1237 LYS A O    6  
ATOM 10109 C CB   . LYS A 1 105 ? 6.218   10.074  -20.036 1.00 0.00 ? 1237 LYS A CB   6  
ATOM 10110 C CG   . LYS A 1 105 ? 6.491   11.313  -20.872 1.00 0.00 ? 1237 LYS A CG   6  
ATOM 10111 C CD   . LYS A 1 105 ? 5.931   12.564  -20.214 1.00 0.00 ? 1237 LYS A CD   6  
ATOM 10112 C CE   . LYS A 1 105 ? 6.943   13.198  -19.273 1.00 0.00 ? 1237 LYS A CE   6  
ATOM 10113 N NZ   . LYS A 1 105 ? 6.850   12.636  -17.897 1.00 0.00 ? 1237 LYS A NZ   6  
ATOM 10114 H H    . LYS A 1 105 ? 8.866   9.732   -20.779 1.00 0.00 ? 1237 LYS A H    6  
ATOM 10115 H HA   . LYS A 1 105 ? 6.649   7.980   -19.939 1.00 0.00 ? 1237 LYS A HA   6  
ATOM 10116 H HB2  . LYS A 1 105 ? 5.157   9.874   -20.063 1.00 0.00 ? 1237 LYS A HB2  6  
ATOM 10117 H HB3  . LYS A 1 105 ? 6.511   10.282  -19.017 1.00 0.00 ? 1237 LYS A HB3  6  
ATOM 10118 H HG2  . LYS A 1 105 ? 7.558   11.429  -20.991 1.00 0.00 ? 1237 LYS A HG2  6  
ATOM 10119 H HG3  . LYS A 1 105 ? 6.030   11.191  -21.842 1.00 0.00 ? 1237 LYS A HG3  6  
ATOM 10120 H HD2  . LYS A 1 105 ? 5.673   13.278  -20.981 1.00 0.00 ? 1237 LYS A HD2  6  
ATOM 10121 H HD3  . LYS A 1 105 ? 5.046   12.299  -19.653 1.00 0.00 ? 1237 LYS A HD3  6  
ATOM 10122 H HE2  . LYS A 1 105 ? 7.935   13.021  -19.658 1.00 0.00 ? 1237 LYS A HE2  6  
ATOM 10123 H HE3  . LYS A 1 105 ? 6.758   14.262  -19.231 1.00 0.00 ? 1237 LYS A HE3  6  
ATOM 10124 H HZ1  . LYS A 1 105 ? 7.202   11.657  -17.887 1.00 0.00 ? 1237 LYS A HZ1  6  
ATOM 10125 H HZ2  . LYS A 1 105 ? 5.861   12.639  -17.576 1.00 0.00 ? 1237 LYS A HZ2  6  
ATOM 10126 H HZ3  . LYS A 1 105 ? 7.419   13.204  -17.238 1.00 0.00 ? 1237 LYS A HZ3  6  
ATOM 10127 N N    . PRO A 1 106 ? 5.662   7.695   -22.234 1.00 0.00 ? 1238 PRO A N    6  
ATOM 10128 C CA   . PRO A 1 106 ? 5.236   7.342   -23.592 1.00 0.00 ? 1238 PRO A CA   6  
ATOM 10129 C C    . PRO A 1 106 ? 4.520   8.491   -24.292 1.00 0.00 ? 1238 PRO A C    6  
ATOM 10130 O O    . PRO A 1 106 ? 3.752   9.226   -23.671 1.00 0.00 ? 1238 PRO A O    6  
ATOM 10131 C CB   . PRO A 1 106 ? 4.276   6.170   -23.369 1.00 0.00 ? 1238 PRO A CB   6  
ATOM 10132 C CG   . PRO A 1 106 ? 3.761   6.360   -21.985 1.00 0.00 ? 1238 PRO A CG   6  
ATOM 10133 C CD   . PRO A 1 106 ? 4.887   6.981   -21.205 1.00 0.00 ? 1238 PRO A CD   6  
ATOM 10134 H HA   . PRO A 1 106 ? 6.070   7.016   -24.197 1.00 0.00 ? 1238 PRO A HA   6  
ATOM 10135 H HB2  . PRO A 1 106 ? 3.479   6.212   -24.098 1.00 0.00 ? 1238 PRO A HB2  6  
ATOM 10136 H HB3  . PRO A 1 106 ? 4.812   5.238   -23.467 1.00 0.00 ? 1238 PRO A HB3  6  
ATOM 10137 H HG2  . PRO A 1 106 ? 2.907   7.020   -21.998 1.00 0.00 ? 1238 PRO A HG2  6  
ATOM 10138 H HG3  . PRO A 1 106 ? 3.493   5.405   -21.559 1.00 0.00 ? 1238 PRO A HG3  6  
ATOM 10139 H HD2  . PRO A 1 106 ? 4.502   7.668   -20.467 1.00 0.00 ? 1238 PRO A HD2  6  
ATOM 10140 H HD3  . PRO A 1 106 ? 5.487   6.215   -20.735 1.00 0.00 ? 1238 PRO A HD3  6  
ATOM 10141 N N    . GLN A 1 107 ? 4.776   8.641   -25.588 1.00 0.00 ? 1239 GLN A N    6  
ATOM 10142 C CA   . GLN A 1 107 ? 4.155   9.702   -26.372 1.00 0.00 ? 1239 GLN A CA   6  
ATOM 10143 C C    . GLN A 1 107 ? 2.686   9.392   -26.640 1.00 0.00 ? 1239 GLN A C    6  
ATOM 10144 O O    . GLN A 1 107 ? 2.363   8.509   -27.435 1.00 0.00 ? 1239 GLN A O    6  
ATOM 10145 C CB   . GLN A 1 107 ? 4.899   9.890   -27.695 1.00 0.00 ? 1239 GLN A CB   6  
ATOM 10146 C CG   . GLN A 1 107 ? 4.492   11.145  -28.449 1.00 0.00 ? 1239 GLN A CG   6  
ATOM 10147 C CD   . GLN A 1 107 ? 5.596   11.672  -29.345 1.00 0.00 ? 1239 GLN A CD   6  
ATOM 10148 O OE1  . GLN A 1 107 ? 5.924   11.066  -30.365 1.00 0.00 ? 1239 GLN A OE1  6  
ATOM 10149 N NE2  . GLN A 1 107 ? 6.175   12.806  -28.967 1.00 0.00 ? 1239 GLN A NE2  6  
ATOM 10150 H H    . GLN A 1 107 ? 5.397   8.023   -26.027 1.00 0.00 ? 1239 GLN A H    6  
ATOM 10151 H HA   . GLN A 1 107 ? 4.218   10.616  -25.801 1.00 0.00 ? 1239 GLN A HA   6  
ATOM 10152 H HB2  . GLN A 1 107 ? 5.959   9.944   -27.494 1.00 0.00 ? 1239 GLN A HB2  6  
ATOM 10153 H HB3  . GLN A 1 107 ? 4.704   9.037   -28.328 1.00 0.00 ? 1239 GLN A HB3  6  
ATOM 10154 H HG2  . GLN A 1 107 ? 3.631   10.920  -29.060 1.00 0.00 ? 1239 GLN A HG2  6  
ATOM 10155 H HG3  . GLN A 1 107 ? 4.233   11.911  -27.733 1.00 0.00 ? 1239 GLN A HG3  6  
ATOM 10156 H HE21 . GLN A 1 107 ? 5.862   13.232  -28.142 1.00 0.00 ? 1239 GLN A HE21 6  
ATOM 10157 H HE22 . GLN A 1 107 ? 6.892   13.168  -29.527 1.00 0.00 ? 1239 GLN A HE22 6  
ATOM 10158 N N    . SER A 1 108 ? 1.800   10.123  -25.972 1.00 0.00 ? 1240 SER A N    6  
ATOM 10159 C CA   . SER A 1 108 ? 0.365   9.923   -26.135 1.00 0.00 ? 1240 SER A CA   6  
ATOM 10160 C C    . SER A 1 108 ? -0.105  10.442  -27.491 1.00 0.00 ? 1240 SER A C    6  
ATOM 10161 O O    . SER A 1 108 ? 0.109   11.605  -27.831 1.00 0.00 ? 1240 SER A O    6  
ATOM 10162 C CB   . SER A 1 108 ? -0.401  10.628  -25.014 1.00 0.00 ? 1240 SER A CB   6  
ATOM 10163 O OG   . SER A 1 108 ? -1.679  10.046  -24.825 1.00 0.00 ? 1240 SER A OG   6  
ATOM 10164 H H    . SER A 1 108 ? 2.120   10.812  -25.352 1.00 0.00 ? 1240 SER A H    6  
ATOM 10165 H HA   . SER A 1 108 ? 0.170   8.863   -26.081 1.00 0.00 ? 1240 SER A HA   6  
ATOM 10166 H HB2  . SER A 1 108 ? 0.158   10.547  -24.094 1.00 0.00 ? 1240 SER A HB2  6  
ATOM 10167 H HB3  . SER A 1 108 ? -0.527  11.671  -25.268 1.00 0.00 ? 1240 SER A HB3  6  
ATOM 10168 H HG   . SER A 1 108 ? -1.607  9.091   -24.882 1.00 0.00 ? 1240 SER A HG   6  
ATOM 10169 N N    . GLY A 1 109 ? -0.747  9.569   -28.262 1.00 0.00 ? 1241 GLY A N    6  
ATOM 10170 C CA   . GLY A 1 109 ? -1.237  9.956   -29.572 1.00 0.00 ? 1241 GLY A CA   6  
ATOM 10171 C C    . GLY A 1 109 ? -2.734  9.766   -29.710 1.00 0.00 ? 1241 GLY A C    6  
ATOM 10172 O O    . GLY A 1 109 ? -3.464  9.672   -28.722 1.00 0.00 ? 1241 GLY A O    6  
ATOM 10173 H H    . GLY A 1 109 ? -0.889  8.655   -27.938 1.00 0.00 ? 1241 GLY A H    6  
ATOM 10174 H HA2  . GLY A 1 109 ? -0.999  10.996  -29.740 1.00 0.00 ? 1241 GLY A HA2  6  
ATOM 10175 H HA3  . GLY A 1 109 ? -0.740  9.358   -30.321 1.00 0.00 ? 1241 GLY A HA3  6  
ATOM 10176 N N    . PRO A 1 110 ? -3.215  9.709   -30.961 1.00 0.00 ? 1242 PRO A N    6  
ATOM 10177 C CA   . PRO A 1 110 ? -4.640  9.530   -31.254 1.00 0.00 ? 1242 PRO A CA   6  
ATOM 10178 C C    . PRO A 1 110 ? -5.134  8.133   -30.896 1.00 0.00 ? 1242 PRO A C    6  
ATOM 10179 O O    . PRO A 1 110 ? -4.831  7.161   -31.588 1.00 0.00 ? 1242 PRO A O    6  
ATOM 10180 C CB   . PRO A 1 110 ? -4.722  9.755   -32.766 1.00 0.00 ? 1242 PRO A CB   6  
ATOM 10181 C CG   . PRO A 1 110 ? -3.362  9.418   -33.273 1.00 0.00 ? 1242 PRO A CG   6  
ATOM 10182 C CD   . PRO A 1 110 ? -2.404  9.815   -32.185 1.00 0.00 ? 1242 PRO A CD   6  
ATOM 10183 H HA   . PRO A 1 110 ? -5.245  10.266  -30.745 1.00 0.00 ? 1242 PRO A HA   6  
ATOM 10184 H HB2  . PRO A 1 110 ? -5.475  9.105   -33.189 1.00 0.00 ? 1242 PRO A HB2  6  
ATOM 10185 H HB3  . PRO A 1 110 ? -4.973  10.786  -32.967 1.00 0.00 ? 1242 PRO A HB3  6  
ATOM 10186 H HG2  . PRO A 1 110 ? -3.295  8.358   -33.464 1.00 0.00 ? 1242 PRO A HG2  6  
ATOM 10187 H HG3  . PRO A 1 110 ? -3.158  9.977   -34.175 1.00 0.00 ? 1242 PRO A HG3  6  
ATOM 10188 H HD2  . PRO A 1 110 ? -1.566  9.134   -32.153 1.00 0.00 ? 1242 PRO A HD2  6  
ATOM 10189 H HD3  . PRO A 1 110 ? -2.062  10.829  -32.334 1.00 0.00 ? 1242 PRO A HD3  6  
ATOM 10190 N N    . SER A 1 111 ? -5.897  8.040   -29.812 1.00 0.00 ? 1243 SER A N    6  
ATOM 10191 C CA   . SER A 1 111 ? -6.431  6.760   -29.360 1.00 0.00 ? 1243 SER A CA   6  
ATOM 10192 C C    . SER A 1 111 ? -7.384  6.954   -28.185 1.00 0.00 ? 1243 SER A C    6  
ATOM 10193 O O    . SER A 1 111 ? -7.504  8.052   -27.643 1.00 0.00 ? 1243 SER A O    6  
ATOM 10194 C CB   . SER A 1 111 ? -5.292  5.822   -28.958 1.00 0.00 ? 1243 SER A CB   6  
ATOM 10195 O OG   . SER A 1 111 ? -4.441  6.432   -28.004 1.00 0.00 ? 1243 SER A OG   6  
ATOM 10196 H H    . SER A 1 111 ? -6.104  8.851   -29.302 1.00 0.00 ? 1243 SER A H    6  
ATOM 10197 H HA   . SER A 1 111 ? -6.976  6.320   -30.182 1.00 0.00 ? 1243 SER A HA   6  
ATOM 10198 H HB2  . SER A 1 111 ? -5.705  4.921   -28.530 1.00 0.00 ? 1243 SER A HB2  6  
ATOM 10199 H HB3  . SER A 1 111 ? -4.710  5.571   -29.834 1.00 0.00 ? 1243 SER A HB3  6  
ATOM 10200 H HG   . SER A 1 111 ? -4.897  7.169   -27.593 1.00 0.00 ? 1243 SER A HG   6  
ATOM 10201 N N    . SER A 1 112 ? -8.060  5.877   -27.796 1.00 0.00 ? 1244 SER A N    6  
ATOM 10202 C CA   . SER A 1 112 ? -9.007  5.928   -26.687 1.00 0.00 ? 1244 SER A CA   6  
ATOM 10203 C C    . SER A 1 112 ? -8.479  5.148   -25.487 1.00 0.00 ? 1244 SER A C    6  
ATOM 10204 O O    . SER A 1 112 ? -8.569  5.604   -24.348 1.00 0.00 ? 1244 SER A O    6  
ATOM 10205 C CB   . SER A 1 112 ? -10.362 5.365   -27.120 1.00 0.00 ? 1244 SER A CB   6  
ATOM 10206 O OG   . SER A 1 112 ? -10.252 4.003   -27.495 1.00 0.00 ? 1244 SER A OG   6  
ATOM 10207 H H    . SER A 1 112 ? -7.921  5.029   -28.268 1.00 0.00 ? 1244 SER A H    6  
ATOM 10208 H HA   . SER A 1 112 ? -9.130  6.963   -26.404 1.00 0.00 ? 1244 SER A HA   6  
ATOM 10209 H HB2  . SER A 1 112 ? -11.060 5.445   -26.300 1.00 0.00 ? 1244 SER A HB2  6  
ATOM 10210 H HB3  . SER A 1 112 ? -10.731 5.931   -27.963 1.00 0.00 ? 1244 SER A HB3  6  
ATOM 10211 H HG   . SER A 1 112 ? -11.106 3.685   -27.797 1.00 0.00 ? 1244 SER A HG   6  
ATOM 10212 N N    . GLY A 1 113 ? -7.927  3.968   -25.752 1.00 0.00 ? 1245 GLY A N    6  
ATOM 10213 C CA   . GLY A 1 113 ? -7.393  3.142   -24.685 1.00 0.00 ? 1245 GLY A CA   6  
ATOM 10214 C C    . GLY A 1 113 ? -7.091  1.728   -25.141 1.00 0.00 ? 1245 GLY A C    6  
ATOM 10215 O O    . GLY A 1 113 ? -7.459  1.335   -26.248 1.00 0.00 ? 1245 GLY A O    6  
ATOM 10216 H H    . GLY A 1 113 ? -7.882  3.655   -26.680 1.00 0.00 ? 1245 GLY A H    6  
ATOM 10217 H HA2  . GLY A 1 113 ? -6.483  3.593   -24.317 1.00 0.00 ? 1245 GLY A HA2  6  
ATOM 10218 H HA3  . GLY A 1 113 ? -8.113  3.102   -23.881 1.00 0.00 ? 1245 GLY A HA3  6  
ATOM 10219 N N    . GLY A 1 1   ? 13.043  2.984   -21.673 1.00 0.00 ? 1133 GLY A N    7  
ATOM 10220 C CA   . GLY A 1 1   ? 14.418  2.801   -21.247 1.00 0.00 ? 1133 GLY A CA   7  
ATOM 10221 C C    . GLY A 1 1   ? 14.800  1.338   -21.133 1.00 0.00 ? 1133 GLY A C    7  
ATOM 10222 O O    . GLY A 1 1   ? 14.014  0.456   -21.478 1.00 0.00 ? 1133 GLY A O    7  
ATOM 10223 H H1   . GLY A 1 1   ? 12.310  2.777   -21.057 1.00 0.00 ? 1133 GLY A H1   7  
ATOM 10224 H HA2  . GLY A 1 1   ? 15.072  3.278   -21.962 1.00 0.00 ? 1133 GLY A HA2  7  
ATOM 10225 H HA3  . GLY A 1 1   ? 14.550  3.272   -20.284 1.00 0.00 ? 1133 GLY A HA3  7  
ATOM 10226 N N    . SER A 1 2   ? 16.010  1.080   -20.647 1.00 0.00 ? 1134 SER A N    7  
ATOM 10227 C CA   . SER A 1 2   ? 16.496  -0.286  -20.494 1.00 0.00 ? 1134 SER A CA   7  
ATOM 10228 C C    . SER A 1 2   ? 17.035  -0.515  -19.085 1.00 0.00 ? 1134 SER A C    7  
ATOM 10229 O O    . SER A 1 2   ? 18.080  -1.141  -18.902 1.00 0.00 ? 1134 SER A O    7  
ATOM 10230 C CB   . SER A 1 2   ? 17.588  -0.580  -21.524 1.00 0.00 ? 1134 SER A CB   7  
ATOM 10231 O OG   . SER A 1 2   ? 18.794  0.088   -21.194 1.00 0.00 ? 1134 SER A OG   7  
ATOM 10232 H H    . SER A 1 2   ? 16.590  1.827   -20.389 1.00 0.00 ? 1134 SER A H    7  
ATOM 10233 H HA   . SER A 1 2   ? 15.665  -0.955  -20.662 1.00 0.00 ? 1134 SER A HA   7  
ATOM 10234 H HB2  . SER A 1 2   ? 17.776  -1.642  -21.553 1.00 0.00 ? 1134 SER A HB2  7  
ATOM 10235 H HB3  . SER A 1 2   ? 17.260  -0.246  -22.498 1.00 0.00 ? 1134 SER A HB3  7  
ATOM 10236 H HG   . SER A 1 2   ? 18.877  0.882   -21.728 1.00 0.00 ? 1134 SER A HG   7  
ATOM 10237 N N    . SER A 1 3   ? 16.314  -0.005  -18.092 1.00 0.00 ? 1135 SER A N    7  
ATOM 10238 C CA   . SER A 1 3   ? 16.721  -0.150  -16.699 1.00 0.00 ? 1135 SER A CA   7  
ATOM 10239 C C    . SER A 1 3   ? 16.063  -1.372  -16.066 1.00 0.00 ? 1135 SER A C    7  
ATOM 10240 O O    . SER A 1 3   ? 15.057  -1.877  -16.562 1.00 0.00 ? 1135 SER A O    7  
ATOM 10241 C CB   . SER A 1 3   ? 16.358  1.107   -15.906 1.00 0.00 ? 1135 SER A CB   7  
ATOM 10242 O OG   . SER A 1 3   ? 17.396  2.069   -15.972 1.00 0.00 ? 1135 SER A OG   7  
ATOM 10243 H H    . SER A 1 3   ? 15.490  0.483   -18.302 1.00 0.00 ? 1135 SER A H    7  
ATOM 10244 H HA   . SER A 1 3   ? 17.793  -0.281  -16.679 1.00 0.00 ? 1135 SER A HA   7  
ATOM 10245 H HB2  . SER A 1 3   ? 15.457  1.539   -16.314 1.00 0.00 ? 1135 SER A HB2  7  
ATOM 10246 H HB3  . SER A 1 3   ? 16.194  0.842   -14.872 1.00 0.00 ? 1135 SER A HB3  7  
ATOM 10247 H HG   . SER A 1 3   ? 17.289  2.602   -16.764 1.00 0.00 ? 1135 SER A HG   7  
ATOM 10248 N N    . GLY A 1 4   ? 16.641  -1.844  -14.965 1.00 0.00 ? 1136 GLY A N    7  
ATOM 10249 C CA   . GLY A 1 4   ? 16.098  -3.003  -14.280 1.00 0.00 ? 1136 GLY A CA   7  
ATOM 10250 C C    . GLY A 1 4   ? 15.812  -2.731  -12.817 1.00 0.00 ? 1136 GLY A C    7  
ATOM 10251 O O    . GLY A 1 4   ? 15.245  -1.695  -12.470 1.00 0.00 ? 1136 GLY A O    7  
ATOM 10252 H H    . GLY A 1 4   ? 17.442  -1.400  -14.614 1.00 0.00 ? 1136 GLY A H    7  
ATOM 10253 H HA2  . GLY A 1 4   ? 15.181  -3.298  -14.767 1.00 0.00 ? 1136 GLY A HA2  7  
ATOM 10254 H HA3  . GLY A 1 4   ? 16.809  -3.814  -14.352 1.00 0.00 ? 1136 GLY A HA3  7  
ATOM 10255 N N    . SER A 1 5   ? 16.204  -3.665  -11.956 1.00 0.00 ? 1137 SER A N    7  
ATOM 10256 C CA   . SER A 1 5   ? 15.982  -3.523  -10.521 1.00 0.00 ? 1137 SER A CA   7  
ATOM 10257 C C    . SER A 1 5   ? 17.306  -3.525  -9.763  1.00 0.00 ? 1137 SER A C    7  
ATOM 10258 O O    . SER A 1 5   ? 17.715  -4.545  -9.209  1.00 0.00 ? 1137 SER A O    7  
ATOM 10259 C CB   . SER A 1 5   ? 15.086  -4.653  -10.009 1.00 0.00 ? 1137 SER A CB   7  
ATOM 10260 O OG   . SER A 1 5   ? 14.530  -4.330  -8.747  1.00 0.00 ? 1137 SER A OG   7  
ATOM 10261 H H    . SER A 1 5   ? 16.652  -4.469  -12.294 1.00 0.00 ? 1137 SER A H    7  
ATOM 10262 H HA   . SER A 1 5   ? 15.486  -2.579  -10.354 1.00 0.00 ? 1137 SER A HA   7  
ATOM 10263 H HB2  . SER A 1 5   ? 14.283  -4.819  -10.711 1.00 0.00 ? 1137 SER A HB2  7  
ATOM 10264 H HB3  . SER A 1 5   ? 15.671  -5.556  -9.911  1.00 0.00 ? 1137 SER A HB3  7  
ATOM 10265 H HG   . SER A 1 5   ? 15.215  -3.977  -8.175  1.00 0.00 ? 1137 SER A HG   7  
ATOM 10266 N N    . SER A 1 6   ? 17.971  -2.375  -9.744  1.00 0.00 ? 1138 SER A N    7  
ATOM 10267 C CA   . SER A 1 6   ? 19.251  -2.243  -9.058  1.00 0.00 ? 1138 SER A CA   7  
ATOM 10268 C C    . SER A 1 6   ? 19.657  -0.777  -8.941  1.00 0.00 ? 1138 SER A C    7  
ATOM 10269 O O    . SER A 1 6   ? 19.239  0.060   -9.740  1.00 0.00 ? 1138 SER A O    7  
ATOM 10270 C CB   . SER A 1 6   ? 20.335  -3.027  -9.801  1.00 0.00 ? 1138 SER A CB   7  
ATOM 10271 O OG   . SER A 1 6   ? 20.694  -2.380  -11.009 1.00 0.00 ? 1138 SER A OG   7  
ATOM 10272 H H    . SER A 1 6   ? 17.593  -1.596  -10.205 1.00 0.00 ? 1138 SER A H    7  
ATOM 10273 H HA   . SER A 1 6   ? 19.139  -2.654  -8.065  1.00 0.00 ? 1138 SER A HA   7  
ATOM 10274 H HB2  . SER A 1 6   ? 21.211  -3.107  -9.175  1.00 0.00 ? 1138 SER A HB2  7  
ATOM 10275 H HB3  . SER A 1 6   ? 19.966  -4.016  -10.032 1.00 0.00 ? 1138 SER A HB3  7  
ATOM 10276 H HG   . SER A 1 6   ? 21.492  -1.865  -10.872 1.00 0.00 ? 1138 SER A HG   7  
ATOM 10277 N N    . GLY A 1 7   ? 20.476  -0.474  -7.939  1.00 0.00 ? 1139 GLY A N    7  
ATOM 10278 C CA   . GLY A 1 7   ? 20.925  0.890   -7.734  1.00 0.00 ? 1139 GLY A CA   7  
ATOM 10279 C C    . GLY A 1 7   ? 21.208  1.196   -6.277  1.00 0.00 ? 1139 GLY A C    7  
ATOM 10280 O O    . GLY A 1 7   ? 22.075  0.574   -5.663  1.00 0.00 ? 1139 GLY A O    7  
ATOM 10281 H H    . GLY A 1 7   ? 20.777  -1.183  -7.332  1.00 0.00 ? 1139 GLY A H    7  
ATOM 10282 H HA2  . GLY A 1 7   ? 21.827  1.050   -8.307  1.00 0.00 ? 1139 GLY A HA2  7  
ATOM 10283 H HA3  . GLY A 1 7   ? 20.161  1.566   -8.090  1.00 0.00 ? 1139 GLY A HA3  7  
ATOM 10284 N N    . SER A 1 8   ? 20.477  2.157   -5.722  1.00 0.00 ? 1140 SER A N    7  
ATOM 10285 C CA   . SER A 1 8   ? 20.657  2.548   -4.329  1.00 0.00 ? 1140 SER A CA   7  
ATOM 10286 C C    . SER A 1 8   ? 22.093  2.997   -4.073  1.00 0.00 ? 1140 SER A C    7  
ATOM 10287 O O    . SER A 1 8   ? 22.692  2.649   -3.055  1.00 0.00 ? 1140 SER A O    7  
ATOM 10288 C CB   . SER A 1 8   ? 20.302  1.384   -3.401  1.00 0.00 ? 1140 SER A CB   7  
ATOM 10289 O OG   . SER A 1 8   ? 18.906  1.141   -3.400  1.00 0.00 ? 1140 SER A OG   7  
ATOM 10290 H H    . SER A 1 8   ? 19.801  2.616   -6.264  1.00 0.00 ? 1140 SER A H    7  
ATOM 10291 H HA   . SER A 1 8   ? 19.992  3.374   -4.128  1.00 0.00 ? 1140 SER A HA   7  
ATOM 10292 H HB2  . SER A 1 8   ? 20.811  0.493   -3.735  1.00 0.00 ? 1140 SER A HB2  7  
ATOM 10293 H HB3  . SER A 1 8   ? 20.615  1.622   -2.394  1.00 0.00 ? 1140 SER A HB3  7  
ATOM 10294 H HG   . SER A 1 8   ? 18.586  1.107   -4.305  1.00 0.00 ? 1140 SER A HG   7  
ATOM 10295 N N    . SER A 1 9   ? 22.638  3.774   -5.004  1.00 0.00 ? 1141 SER A N    7  
ATOM 10296 C CA   . SER A 1 9   ? 24.004  4.269   -4.882  1.00 0.00 ? 1141 SER A CA   7  
ATOM 10297 C C    . SER A 1 9   ? 24.051  5.784   -5.059  1.00 0.00 ? 1141 SER A C    7  
ATOM 10298 O O    . SER A 1 9   ? 24.544  6.286   -6.068  1.00 0.00 ? 1141 SER A O    7  
ATOM 10299 C CB   . SER A 1 9   ? 24.907  3.595   -5.916  1.00 0.00 ? 1141 SER A CB   7  
ATOM 10300 O OG   . SER A 1 9   ? 26.247  3.530   -5.459  1.00 0.00 ? 1141 SER A OG   7  
ATOM 10301 H H    . SER A 1 9   ? 22.109  4.017   -5.792  1.00 0.00 ? 1141 SER A H    7  
ATOM 10302 H HA   . SER A 1 9   ? 24.359  4.023   -3.892  1.00 0.00 ? 1141 SER A HA   7  
ATOM 10303 H HB2  . SER A 1 9   ? 24.554  2.592   -6.101  1.00 0.00 ? 1141 SER A HB2  7  
ATOM 10304 H HB3  . SER A 1 9   ? 24.881  4.161   -6.836  1.00 0.00 ? 1141 SER A HB3  7  
ATOM 10305 H HG   . SER A 1 9   ? 26.687  2.777   -5.860  1.00 0.00 ? 1141 SER A HG   7  
ATOM 10306 N N    . GLN A 1 10  ? 23.533  6.505   -4.070  1.00 0.00 ? 1142 GLN A N    7  
ATOM 10307 C CA   . GLN A 1 10  ? 23.514  7.962   -4.116  1.00 0.00 ? 1142 GLN A CA   7  
ATOM 10308 C C    . GLN A 1 10  ? 23.432  8.551   -2.711  1.00 0.00 ? 1142 GLN A C    7  
ATOM 10309 O O    . GLN A 1 10  ? 23.043  7.881   -1.754  1.00 0.00 ? 1142 GLN A O    7  
ATOM 10310 C CB   . GLN A 1 10  ? 22.334  8.452   -4.957  1.00 0.00 ? 1142 GLN A CB   7  
ATOM 10311 C CG   . GLN A 1 10  ? 22.665  8.620   -6.431  1.00 0.00 ? 1142 GLN A CG   7  
ATOM 10312 C CD   . GLN A 1 10  ? 21.654  9.480   -7.162  1.00 0.00 ? 1142 GLN A CD   7  
ATOM 10313 O OE1  . GLN A 1 10  ? 20.712  9.998   -6.561  1.00 0.00 ? 1142 GLN A OE1  7  
ATOM 10314 N NE2  . GLN A 1 10  ? 21.844  9.639   -8.467  1.00 0.00 ? 1142 GLN A NE2  7  
ATOM 10315 H H    . GLN A 1 10  ? 23.154  6.047   -3.291  1.00 0.00 ? 1142 GLN A H    7  
ATOM 10316 H HA   . GLN A 1 10  ? 24.433  8.291   -4.577  1.00 0.00 ? 1142 GLN A HA   7  
ATOM 10317 H HB2  . GLN A 1 10  ? 21.526  7.741   -4.870  1.00 0.00 ? 1142 GLN A HB2  7  
ATOM 10318 H HB3  . GLN A 1 10  ? 22.005  9.407   -4.573  1.00 0.00 ? 1142 GLN A HB3  7  
ATOM 10319 H HG2  . GLN A 1 10  ? 23.638  9.082   -6.518  1.00 0.00 ? 1142 GLN A HG2  7  
ATOM 10320 H HG3  . GLN A 1 10  ? 22.689  7.645   -6.895  1.00 0.00 ? 1142 GLN A HG3  7  
ATOM 10321 H HE21 . GLN A 1 10  ? 22.616  9.195   -8.879  1.00 0.00 ? 1142 GLN A HE21 7  
ATOM 10322 H HE22 . GLN A 1 10  ? 21.205  10.189  -8.965  1.00 0.00 ? 1142 GLN A HE22 7  
ATOM 10323 N N    . PRO A 1 11  ? 23.806  9.832   -2.583  1.00 0.00 ? 1143 PRO A N    7  
ATOM 10324 C CA   . PRO A 1 11  ? 23.782  10.539  -1.299  1.00 0.00 ? 1143 PRO A CA   7  
ATOM 10325 C C    . PRO A 1 11  ? 22.363  10.802  -0.808  1.00 0.00 ? 1143 PRO A C    7  
ATOM 10326 O O    . PRO A 1 11  ? 21.390  10.509  -1.503  1.00 0.00 ? 1143 PRO A O    7  
ATOM 10327 C CB   . PRO A 1 11  ? 24.494  11.859  -1.608  1.00 0.00 ? 1143 PRO A CB   7  
ATOM 10328 C CG   . PRO A 1 11  ? 24.295  12.064  -3.070  1.00 0.00 ? 1143 PRO A CG   7  
ATOM 10329 C CD   . PRO A 1 11  ? 24.279  10.690  -3.682  1.00 0.00 ? 1143 PRO A CD   7  
ATOM 10330 H HA   . PRO A 1 11  ? 24.331  10.001  -0.540  1.00 0.00 ? 1143 PRO A HA   7  
ATOM 10331 H HB2  . PRO A 1 11  ? 24.046  12.656  -1.031  1.00 0.00 ? 1143 PRO A HB2  7  
ATOM 10332 H HB3  . PRO A 1 11  ? 25.542  11.773  -1.360  1.00 0.00 ? 1143 PRO A HB3  7  
ATOM 10333 H HG2  . PRO A 1 11  ? 23.355  12.564  -3.246  1.00 0.00 ? 1143 PRO A HG2  7  
ATOM 10334 H HG3  . PRO A 1 11  ? 25.112  12.644  -3.473  1.00 0.00 ? 1143 PRO A HG3  7  
ATOM 10335 H HD2  . PRO A 1 11  ? 23.597  10.658  -4.518  1.00 0.00 ? 1143 PRO A HD2  7  
ATOM 10336 H HD3  . PRO A 1 11  ? 25.273  10.404  -3.993  1.00 0.00 ? 1143 PRO A HD3  7  
ATOM 10337 N N    . VAL A 1 12  ? 22.251  11.357  0.395   1.00 0.00 ? 1144 VAL A N    7  
ATOM 10338 C CA   . VAL A 1 12  ? 20.950  11.661  0.979   1.00 0.00 ? 1144 VAL A CA   7  
ATOM 10339 C C    . VAL A 1 12  ? 20.014  12.275  -0.055  1.00 0.00 ? 1144 VAL A C    7  
ATOM 10340 O O    . VAL A 1 12  ? 20.456  12.954  -0.982  1.00 0.00 ? 1144 VAL A O    7  
ATOM 10341 C CB   . VAL A 1 12  ? 21.082  12.625  2.173   1.00 0.00 ? 1144 VAL A CB   7  
ATOM 10342 C CG1  . VAL A 1 12  ? 19.713  12.958  2.744   1.00 0.00 ? 1144 VAL A CG1  7  
ATOM 10343 C CG2  . VAL A 1 12  ? 21.985  12.028  3.242   1.00 0.00 ? 1144 VAL A CG2  7  
ATOM 10344 H H    . VAL A 1 12  ? 23.063  11.568  0.901   1.00 0.00 ? 1144 VAL A H    7  
ATOM 10345 H HA   . VAL A 1 12  ? 20.520  10.736  1.336   1.00 0.00 ? 1144 VAL A HA   7  
ATOM 10346 H HB   . VAL A 1 12  ? 21.534  13.542  1.821   1.00 0.00 ? 1144 VAL A HB   7  
ATOM 10347 H HG11 . VAL A 1 12  ? 19.326  13.842  2.258   1.00 0.00 ? 1144 VAL A HG11 7  
ATOM 10348 H HG12 . VAL A 1 12  ? 19.041  12.129  2.576   1.00 0.00 ? 1144 VAL A HG12 7  
ATOM 10349 H HG13 . VAL A 1 12  ? 19.801  13.141  3.805   1.00 0.00 ? 1144 VAL A HG13 7  
ATOM 10350 H HG21 . VAL A 1 12  ? 22.324  11.054  2.923   1.00 0.00 ? 1144 VAL A HG21 7  
ATOM 10351 H HG22 . VAL A 1 12  ? 22.838  12.674  3.395   1.00 0.00 ? 1144 VAL A HG22 7  
ATOM 10352 H HG23 . VAL A 1 12  ? 21.435  11.934  4.166   1.00 0.00 ? 1144 VAL A HG23 7  
ATOM 10353 N N    . ILE A 1 13  ? 18.718  12.032  0.110   1.00 0.00 ? 1145 ILE A N    7  
ATOM 10354 C CA   . ILE A 1 13  ? 17.718  12.563  -0.808  1.00 0.00 ? 1145 ILE A CA   7  
ATOM 10355 C C    . ILE A 1 13  ? 17.192  13.912  -0.329  1.00 0.00 ? 1145 ILE A C    7  
ATOM 10356 O O    . ILE A 1 13  ? 17.029  14.135  0.871   1.00 0.00 ? 1145 ILE A O    7  
ATOM 10357 C CB   . ILE A 1 13  ? 16.535  11.592  -0.975  1.00 0.00 ? 1145 ILE A CB   7  
ATOM 10358 C CG1  . ILE A 1 13  ? 17.040  10.195  -1.340  1.00 0.00 ? 1145 ILE A CG1  7  
ATOM 10359 C CG2  . ILE A 1 13  ? 15.572  12.108  -2.034  1.00 0.00 ? 1145 ILE A CG2  7  
ATOM 10360 C CD1  . ILE A 1 13  ? 15.951  9.146   -1.365  1.00 0.00 ? 1145 ILE A CD1  7  
ATOM 10361 H H    . ILE A 1 13  ? 18.427  11.484  0.868   1.00 0.00 ? 1145 ILE A H    7  
ATOM 10362 H HA   . ILE A 1 13  ? 18.189  12.695  -1.772  1.00 0.00 ? 1145 ILE A HA   7  
ATOM 10363 H HB   . ILE A 1 13  ? 16.005  11.541  -0.036  1.00 0.00 ? 1145 ILE A HB   7  
ATOM 10364 H HG12 . ILE A 1 13  ? 17.491  10.227  -2.320  1.00 0.00 ? 1145 ILE A HG12 7  
ATOM 10365 H HG13 . ILE A 1 13  ? 17.781  9.888   -0.617  1.00 0.00 ? 1145 ILE A HG13 7  
ATOM 10366 H HG21 . ILE A 1 13  ? 14.635  11.575  -1.958  1.00 0.00 ? 1145 ILE A HG21 7  
ATOM 10367 H HG22 . ILE A 1 13  ? 15.399  13.162  -1.880  1.00 0.00 ? 1145 ILE A HG22 7  
ATOM 10368 H HG23 . ILE A 1 13  ? 15.997  11.951  -3.014  1.00 0.00 ? 1145 ILE A HG23 7  
ATOM 10369 H HD11 . ILE A 1 13  ? 16.291  8.287   -1.925  1.00 0.00 ? 1145 ILE A HD11 7  
ATOM 10370 H HD12 . ILE A 1 13  ? 15.714  8.848   -0.355  1.00 0.00 ? 1145 ILE A HD12 7  
ATOM 10371 H HD13 . ILE A 1 13  ? 15.068  9.555   -1.837  1.00 0.00 ? 1145 ILE A HD13 7  
ATOM 10372 N N    . SER A 1 14  ? 16.926  14.807  -1.274  1.00 0.00 ? 1146 SER A N    7  
ATOM 10373 C CA   . SER A 1 14  ? 16.419  16.135  -0.948  1.00 0.00 ? 1146 SER A CA   7  
ATOM 10374 C C    . SER A 1 14  ? 15.106  16.041  -0.178  1.00 0.00 ? 1146 SER A C    7  
ATOM 10375 O O    . SER A 1 14  ? 14.189  15.325  -0.578  1.00 0.00 ? 1146 SER A O    7  
ATOM 10376 C CB   . SER A 1 14  ? 16.217  16.954  -2.224  1.00 0.00 ? 1146 SER A CB   7  
ATOM 10377 O OG   . SER A 1 14  ? 16.051  18.330  -1.927  1.00 0.00 ? 1146 SER A OG   7  
ATOM 10378 H H    . SER A 1 14  ? 17.077  14.570  -2.213  1.00 0.00 ? 1146 SER A H    7  
ATOM 10379 H HA   . SER A 1 14  ? 17.153  16.627  -0.327  1.00 0.00 ? 1146 SER A HA   7  
ATOM 10380 H HB2  . SER A 1 14  ? 17.080  16.839  -2.864  1.00 0.00 ? 1146 SER A HB2  7  
ATOM 10381 H HB3  . SER A 1 14  ? 15.337  16.601  -2.740  1.00 0.00 ? 1146 SER A HB3  7  
ATOM 10382 H HG   . SER A 1 14  ? 15.218  18.638  -2.292  1.00 0.00 ? 1146 SER A HG   7  
ATOM 10383 N N    . ALA A 1 15  ? 15.024  16.771  0.930   1.00 0.00 ? 1147 ALA A N    7  
ATOM 10384 C CA   . ALA A 1 15  ? 13.823  16.772  1.757   1.00 0.00 ? 1147 ALA A CA   7  
ATOM 10385 C C    . ALA A 1 15  ? 12.565  16.796  0.897   1.00 0.00 ? 1147 ALA A C    7  
ATOM 10386 O O    . ALA A 1 15  ? 11.610  16.065  1.159   1.00 0.00 ? 1147 ALA A O    7  
ATOM 10387 C CB   . ALA A 1 15  ? 13.838  17.961  2.707   1.00 0.00 ? 1147 ALA A CB   7  
ATOM 10388 H H    . ALA A 1 15  ? 15.789  17.322  1.198   1.00 0.00 ? 1147 ALA A H    7  
ATOM 10389 H HA   . ALA A 1 15  ? 13.825  15.869  2.350   1.00 0.00 ? 1147 ALA A HA   7  
ATOM 10390 H HB1  . ALA A 1 15  ? 14.774  18.490  2.605   1.00 0.00 ? 1147 ALA A HB1  7  
ATOM 10391 H HB2  . ALA A 1 15  ? 13.021  18.624  2.466   1.00 0.00 ? 1147 ALA A HB2  7  
ATOM 10392 H HB3  . ALA A 1 15  ? 13.731  17.611  3.722   1.00 0.00 ? 1147 ALA A HB3  7  
ATOM 10393 N N    . GLN A 1 16  ? 12.571  17.640  -0.130  1.00 0.00 ? 1148 GLN A N    7  
ATOM 10394 C CA   . GLN A 1 16  ? 11.428  17.759  -1.027  1.00 0.00 ? 1148 GLN A CA   7  
ATOM 10395 C C    . GLN A 1 16  ? 10.786  16.398  -1.274  1.00 0.00 ? 1148 GLN A C    7  
ATOM 10396 O O    . GLN A 1 16  ? 9.576   16.235  -1.121  1.00 0.00 ? 1148 GLN A O    7  
ATOM 10397 C CB   . GLN A 1 16  ? 11.859  18.382  -2.356  1.00 0.00 ? 1148 GLN A CB   7  
ATOM 10398 C CG   . GLN A 1 16  ? 12.358  19.812  -2.225  1.00 0.00 ? 1148 GLN A CG   7  
ATOM 10399 C CD   . GLN A 1 16  ? 12.789  20.403  -3.552  1.00 0.00 ? 1148 GLN A CD   7  
ATOM 10400 O OE1  . GLN A 1 16  ? 12.682  19.760  -4.596  1.00 0.00 ? 1148 GLN A OE1  7  
ATOM 10401 N NE2  . GLN A 1 16  ? 13.281  21.637  -3.519  1.00 0.00 ? 1148 GLN A NE2  7  
ATOM 10402 H H    . GLN A 1 16  ? 13.361  18.196  -0.287  1.00 0.00 ? 1148 GLN A H    7  
ATOM 10403 H HA   . GLN A 1 16  ? 10.702  18.405  -0.556  1.00 0.00 ? 1148 GLN A HA   7  
ATOM 10404 H HB2  . GLN A 1 16  ? 12.652  17.784  -2.780  1.00 0.00 ? 1148 GLN A HB2  7  
ATOM 10405 H HB3  . GLN A 1 16  ? 11.016  18.379  -3.032  1.00 0.00 ? 1148 GLN A HB3  7  
ATOM 10406 H HG2  . GLN A 1 16  ? 11.564  20.421  -1.818  1.00 0.00 ? 1148 GLN A HG2  7  
ATOM 10407 H HG3  . GLN A 1 16  ? 13.201  19.824  -1.551  1.00 0.00 ? 1148 GLN A HG3  7  
ATOM 10408 H HE21 . GLN A 1 16  ? 13.338  22.088  -2.651  1.00 0.00 ? 1148 GLN A HE21 7  
ATOM 10409 H HE22 . GLN A 1 16  ? 13.568  22.043  -4.362  1.00 0.00 ? 1148 GLN A HE22 7  
ATOM 10410 N N    . GLU A 1 17  ? 11.605  15.424  -1.659  1.00 0.00 ? 1149 GLU A N    7  
ATOM 10411 C CA   . GLU A 1 17  ? 11.115  14.077  -1.928  1.00 0.00 ? 1149 GLU A CA   7  
ATOM 10412 C C    . GLU A 1 17  ? 11.308  13.175  -0.712  1.00 0.00 ? 1149 GLU A C    7  
ATOM 10413 O O    . GLU A 1 17  ? 10.384  12.481  -0.290  1.00 0.00 ? 1149 GLU A O    7  
ATOM 10414 C CB   . GLU A 1 17  ? 11.836  13.481  -3.139  1.00 0.00 ? 1149 GLU A CB   7  
ATOM 10415 C CG   . GLU A 1 17  ? 11.047  12.388  -3.840  1.00 0.00 ? 1149 GLU A CG   7  
ATOM 10416 C CD   . GLU A 1 17  ? 10.047  12.939  -4.838  1.00 0.00 ? 1149 GLU A CD   7  
ATOM 10417 O OE1  . GLU A 1 17  ? 8.944   13.341  -4.413  1.00 0.00 ? 1149 GLU A OE1  7  
ATOM 10418 O OE2  . GLU A 1 17  ? 10.369  12.968  -6.044  1.00 0.00 ? 1149 GLU A OE2  7  
ATOM 10419 H H    . GLU A 1 17  ? 12.560  15.615  -1.764  1.00 0.00 ? 1149 GLU A H    7  
ATOM 10420 H HA   . GLU A 1 17  ? 10.060  14.145  -2.147  1.00 0.00 ? 1149 GLU A HA   7  
ATOM 10421 H HB2  . GLU A 1 17  ? 12.031  14.269  -3.851  1.00 0.00 ? 1149 GLU A HB2  7  
ATOM 10422 H HB3  . GLU A 1 17  ? 12.777  13.063  -2.812  1.00 0.00 ? 1149 GLU A HB3  7  
ATOM 10423 H HG2  . GLU A 1 17  ? 11.737  11.743  -4.364  1.00 0.00 ? 1149 GLU A HG2  7  
ATOM 10424 H HG3  . GLU A 1 17  ? 10.513  11.814  -3.097  1.00 0.00 ? 1149 GLU A HG3  7  
ATOM 10425 N N    . GLN A 1 18  ? 12.515  13.191  -0.156  1.00 0.00 ? 1150 GLN A N    7  
ATOM 10426 C CA   . GLN A 1 18  ? 12.829  12.373  1.009   1.00 0.00 ? 1150 GLN A CA   7  
ATOM 10427 C C    . GLN A 1 18  ? 11.710  12.445  2.043   1.00 0.00 ? 1150 GLN A C    7  
ATOM 10428 O O    . GLN A 1 18  ? 11.211  11.419  2.503   1.00 0.00 ? 1150 GLN A O    7  
ATOM 10429 C CB   . GLN A 1 18  ? 14.148  12.828  1.637   1.00 0.00 ? 1150 GLN A CB   7  
ATOM 10430 C CG   . GLN A 1 18  ? 14.695  11.859  2.673   1.00 0.00 ? 1150 GLN A CG   7  
ATOM 10431 C CD   . GLN A 1 18  ? 14.442  10.410  2.308   1.00 0.00 ? 1150 GLN A CD   7  
ATOM 10432 O OE1  . GLN A 1 18  ? 14.612  10.009  1.156   1.00 0.00 ? 1150 GLN A OE1  7  
ATOM 10433 N NE2  . GLN A 1 18  ? 14.035  9.614   3.290   1.00 0.00 ? 1150 GLN A NE2  7  
ATOM 10434 H H    . GLN A 1 18  ? 13.210  13.765  -0.539  1.00 0.00 ? 1150 GLN A H    7  
ATOM 10435 H HA   . GLN A 1 18  ? 12.932  11.351  0.679   1.00 0.00 ? 1150 GLN A HA   7  
ATOM 10436 H HB2  . GLN A 1 18  ? 14.885  12.939  0.855   1.00 0.00 ? 1150 GLN A HB2  7  
ATOM 10437 H HB3  . GLN A 1 18  ? 13.995  13.784  2.115   1.00 0.00 ? 1150 GLN A HB3  7  
ATOM 10438 H HG2  . GLN A 1 18  ? 15.760  12.011  2.763   1.00 0.00 ? 1150 GLN A HG2  7  
ATOM 10439 H HG3  . GLN A 1 18  ? 14.222  12.064  3.622   1.00 0.00 ? 1150 GLN A HG3  7  
ATOM 10440 H HE21 . GLN A 1 18  ? 13.920  10.003  4.183   1.00 0.00 ? 1150 GLN A HE21 7  
ATOM 10441 H HE22 . GLN A 1 18  ? 13.863  8.673   3.082   1.00 0.00 ? 1150 GLN A HE22 7  
ATOM 10442 N N    . GLU A 1 19  ? 11.321  13.664  2.403   1.00 0.00 ? 1151 GLU A N    7  
ATOM 10443 C CA   . GLU A 1 19  ? 10.261  13.869  3.383   1.00 0.00 ? 1151 GLU A CA   7  
ATOM 10444 C C    . GLU A 1 19  ? 9.010   13.082  3.003   1.00 0.00 ? 1151 GLU A C    7  
ATOM 10445 O O    . GLU A 1 19  ? 8.527   12.250  3.772   1.00 0.00 ? 1151 GLU A O    7  
ATOM 10446 C CB   . GLU A 1 19  ? 9.925   15.357  3.501   1.00 0.00 ? 1151 GLU A CB   7  
ATOM 10447 C CG   . GLU A 1 19  ? 9.369   15.750  4.859   1.00 0.00 ? 1151 GLU A CG   7  
ATOM 10448 C CD   . GLU A 1 19  ? 8.470   16.969  4.791   1.00 0.00 ? 1151 GLU A CD   7  
ATOM 10449 O OE1  . GLU A 1 19  ? 7.697   17.081  3.817   1.00 0.00 ? 1151 GLU A OE1  7  
ATOM 10450 O OE2  . GLU A 1 19  ? 8.540   17.810  5.711   1.00 0.00 ? 1151 GLU A OE2  7  
ATOM 10451 H H    . GLU A 1 19  ? 11.757  14.444  2.000   1.00 0.00 ? 1151 GLU A H    7  
ATOM 10452 H HA   . GLU A 1 19  ? 10.619  13.514  4.337   1.00 0.00 ? 1151 GLU A HA   7  
ATOM 10453 H HB2  . GLU A 1 19  ? 10.822  15.932  3.321   1.00 0.00 ? 1151 GLU A HB2  7  
ATOM 10454 H HB3  . GLU A 1 19  ? 9.191   15.608  2.749   1.00 0.00 ? 1151 GLU A HB3  7  
ATOM 10455 H HG2  . GLU A 1 19  ? 8.798   14.922  5.253   1.00 0.00 ? 1151 GLU A HG2  7  
ATOM 10456 H HG3  . GLU A 1 19  ? 10.194  15.965  5.523   1.00 0.00 ? 1151 GLU A HG3  7  
ATOM 10457 N N    . THR A 1 20  ? 8.487   13.352  1.811   1.00 0.00 ? 1152 THR A N    7  
ATOM 10458 C CA   . THR A 1 20  ? 7.292   12.672  1.328   1.00 0.00 ? 1152 THR A CA   7  
ATOM 10459 C C    . THR A 1 20  ? 7.362   11.175  1.604   1.00 0.00 ? 1152 THR A C    7  
ATOM 10460 O O    . THR A 1 20  ? 6.382   10.569  2.038   1.00 0.00 ? 1152 THR A O    7  
ATOM 10461 C CB   . THR A 1 20  ? 7.089   12.896  -0.182  1.00 0.00 ? 1152 THR A CB   7  
ATOM 10462 O OG1  . THR A 1 20  ? 6.882   14.287  -0.448  1.00 0.00 ? 1152 THR A OG1  7  
ATOM 10463 C CG2  . THR A 1 20  ? 5.901   12.094  -0.693  1.00 0.00 ? 1152 THR A CG2  7  
ATOM 10464 H H    . THR A 1 20  ? 8.917   14.025  1.243   1.00 0.00 ? 1152 THR A H    7  
ATOM 10465 H HA   . THR A 1 20  ? 6.440   13.085  1.849   1.00 0.00 ? 1152 THR A HA   7  
ATOM 10466 H HB   . THR A 1 20  ? 7.978   12.566  -0.702  1.00 0.00 ? 1152 THR A HB   7  
ATOM 10467 H HG1  . THR A 1 20  ? 6.187   14.623  0.124   1.00 0.00 ? 1152 THR A HG1  7  
ATOM 10468 H HG21 . THR A 1 20  ? 5.920   12.072  -1.773  1.00 0.00 ? 1152 THR A HG21 7  
ATOM 10469 H HG22 . THR A 1 20  ? 4.985   12.556  -0.358  1.00 0.00 ? 1152 THR A HG22 7  
ATOM 10470 H HG23 . THR A 1 20  ? 5.957   11.086  -0.312  1.00 0.00 ? 1152 THR A HG23 7  
ATOM 10471 N N    . GLN A 1 21  ? 8.525   10.585  1.351   1.00 0.00 ? 1153 GLN A N    7  
ATOM 10472 C CA   . GLN A 1 21  ? 8.722   9.157   1.572   1.00 0.00 ? 1153 GLN A CA   7  
ATOM 10473 C C    . GLN A 1 21  ? 8.629   8.819   3.056   1.00 0.00 ? 1153 GLN A C    7  
ATOM 10474 O O    . GLN A 1 21  ? 8.103   7.770   3.432   1.00 0.00 ? 1153 GLN A O    7  
ATOM 10475 C CB   . GLN A 1 21  ? 10.078  8.716   1.021   1.00 0.00 ? 1153 GLN A CB   7  
ATOM 10476 C CG   . GLN A 1 21  ? 10.243  8.976   -0.468  1.00 0.00 ? 1153 GLN A CG   7  
ATOM 10477 C CD   . GLN A 1 21  ? 11.662  8.739   -0.948  1.00 0.00 ? 1153 GLN A CD   7  
ATOM 10478 O OE1  . GLN A 1 21  ? 12.535  8.351   -0.172  1.00 0.00 ? 1153 GLN A OE1  7  
ATOM 10479 N NE2  . GLN A 1 21  ? 11.898  8.971   -2.234  1.00 0.00 ? 1153 GLN A NE2  7  
ATOM 10480 H H    . GLN A 1 21  ? 9.268   11.122  1.006   1.00 0.00 ? 1153 GLN A H    7  
ATOM 10481 H HA   . GLN A 1 21  ? 7.941   8.630   1.046   1.00 0.00 ? 1153 GLN A HA   7  
ATOM 10482 H HB2  . GLN A 1 21  ? 10.858  9.247   1.546   1.00 0.00 ? 1153 GLN A HB2  7  
ATOM 10483 H HB3  . GLN A 1 21  ? 10.197  7.656   1.194   1.00 0.00 ? 1153 GLN A HB3  7  
ATOM 10484 H HG2  . GLN A 1 21  ? 9.582   8.317   -1.011  1.00 0.00 ? 1153 GLN A HG2  7  
ATOM 10485 H HG3  . GLN A 1 21  ? 9.976   10.002  -0.673  1.00 0.00 ? 1153 GLN A HG3  7  
ATOM 10486 H HE21 . GLN A 1 21  ? 11.154  9.280   -2.793  1.00 0.00 ? 1153 GLN A HE21 7  
ATOM 10487 H HE22 . GLN A 1 21  ? 12.806  8.827   -2.571  1.00 0.00 ? 1153 GLN A HE22 7  
ATOM 10488 N N    . ILE A 1 22  ? 9.142   9.712   3.895   1.00 0.00 ? 1154 ILE A N    7  
ATOM 10489 C CA   . ILE A 1 22  ? 9.116   9.508   5.338   1.00 0.00 ? 1154 ILE A CA   7  
ATOM 10490 C C    . ILE A 1 22  ? 7.685   9.499   5.866   1.00 0.00 ? 1154 ILE A C    7  
ATOM 10491 O O    . ILE A 1 22  ? 7.324   8.665   6.697   1.00 0.00 ? 1154 ILE A O    7  
ATOM 10492 C CB   . ILE A 1 22  ? 9.916   10.598  6.076   1.00 0.00 ? 1154 ILE A CB   7  
ATOM 10493 C CG1  . ILE A 1 22  ? 11.384  10.561  5.648   1.00 0.00 ? 1154 ILE A CG1  7  
ATOM 10494 C CG2  . ILE A 1 22  ? 9.793   10.419  7.581   1.00 0.00 ? 1154 ILE A CG2  7  
ATOM 10495 C CD1  . ILE A 1 22  ? 12.168  11.783  6.071   1.00 0.00 ? 1154 ILE A CD1  7  
ATOM 10496 H H    . ILE A 1 22  ? 9.547   10.529  3.535   1.00 0.00 ? 1154 ILE A H    7  
ATOM 10497 H HA   . ILE A 1 22  ? 9.572   8.551   5.547   1.00 0.00 ? 1154 ILE A HA   7  
ATOM 10498 H HB   . ILE A 1 22  ? 9.497   11.558  5.816   1.00 0.00 ? 1154 ILE A HB   7  
ATOM 10499 H HG12 . ILE A 1 22  ? 11.858  9.696   6.084   1.00 0.00 ? 1154 ILE A HG12 7  
ATOM 10500 H HG13 . ILE A 1 22  ? 11.436  10.489  4.571   1.00 0.00 ? 1154 ILE A HG13 7  
ATOM 10501 H HG21 . ILE A 1 22  ? 10.735  10.074  7.981   1.00 0.00 ? 1154 ILE A HG21 7  
ATOM 10502 H HG22 . ILE A 1 22  ? 9.534   11.363  8.036   1.00 0.00 ? 1154 ILE A HG22 7  
ATOM 10503 H HG23 . ILE A 1 22  ? 9.023   9.692   7.796   1.00 0.00 ? 1154 ILE A HG23 7  
ATOM 10504 H HD11 . ILE A 1 22  ? 11.519  12.646  6.070   1.00 0.00 ? 1154 ILE A HD11 7  
ATOM 10505 H HD12 . ILE A 1 22  ? 12.565  11.632  7.063   1.00 0.00 ? 1154 ILE A HD12 7  
ATOM 10506 H HD13 . ILE A 1 22  ? 12.983  11.946  5.379   1.00 0.00 ? 1154 ILE A HD13 7  
ATOM 10507 N N    . VAL A 1 23  ? 6.873   10.431  5.377   1.00 0.00 ? 1155 VAL A N    7  
ATOM 10508 C CA   . VAL A 1 23  ? 5.481   10.529  5.797   1.00 0.00 ? 1155 VAL A CA   7  
ATOM 10509 C C    . VAL A 1 23  ? 4.659   9.368   5.248   1.00 0.00 ? 1155 VAL A C    7  
ATOM 10510 O O    . VAL A 1 23  ? 3.812   8.807   5.946   1.00 0.00 ? 1155 VAL A O    7  
ATOM 10511 C CB   . VAL A 1 23  ? 4.847   11.855  5.337   1.00 0.00 ? 1155 VAL A CB   7  
ATOM 10512 C CG1  . VAL A 1 23  ? 3.384   11.919  5.747   1.00 0.00 ? 1155 VAL A CG1  7  
ATOM 10513 C CG2  . VAL A 1 23  ? 5.620   13.038  5.900   1.00 0.00 ? 1155 VAL A CG2  7  
ATOM 10514 H H    . VAL A 1 23  ? 7.219   11.068  4.717   1.00 0.00 ? 1155 VAL A H    7  
ATOM 10515 H HA   . VAL A 1 23  ? 5.454   10.497  6.877   1.00 0.00 ? 1155 VAL A HA   7  
ATOM 10516 H HB   . VAL A 1 23  ? 4.898   11.900  4.259   1.00 0.00 ? 1155 VAL A HB   7  
ATOM 10517 H HG11 . VAL A 1 23  ? 3.316   12.058  6.816   1.00 0.00 ? 1155 VAL A HG11 7  
ATOM 10518 H HG12 . VAL A 1 23  ? 2.904   12.746  5.243   1.00 0.00 ? 1155 VAL A HG12 7  
ATOM 10519 H HG13 . VAL A 1 23  ? 2.893   10.997  5.473   1.00 0.00 ? 1155 VAL A HG13 7  
ATOM 10520 H HG21 . VAL A 1 23  ? 6.092   13.577  5.092   1.00 0.00 ? 1155 VAL A HG21 7  
ATOM 10521 H HG22 . VAL A 1 23  ? 4.941   13.696  6.423   1.00 0.00 ? 1155 VAL A HG22 7  
ATOM 10522 H HG23 . VAL A 1 23  ? 6.374   12.682  6.586   1.00 0.00 ? 1155 VAL A HG23 7  
ATOM 10523 N N    . LEU A 1 24  ? 4.912   9.011   3.994   1.00 0.00 ? 1156 LEU A N    7  
ATOM 10524 C CA   . LEU A 1 24  ? 4.196   7.916   3.350   1.00 0.00 ? 1156 LEU A CA   7  
ATOM 10525 C C    . LEU A 1 24  ? 4.589   6.575   3.962   1.00 0.00 ? 1156 LEU A C    7  
ATOM 10526 O O    . LEU A 1 24  ? 3.735   5.820   4.430   1.00 0.00 ? 1156 LEU A O    7  
ATOM 10527 C CB   . LEU A 1 24  ? 4.482   7.907   1.848   1.00 0.00 ? 1156 LEU A CB   7  
ATOM 10528 C CG   . LEU A 1 24  ? 3.637   6.946   1.010   1.00 0.00 ? 1156 LEU A CG   7  
ATOM 10529 C CD1  . LEU A 1 24  ? 2.156   7.165   1.278   1.00 0.00 ? 1156 LEU A CD1  7  
ATOM 10530 C CD2  . LEU A 1 24  ? 3.944   7.119   -0.471  1.00 0.00 ? 1156 LEU A CD2  7  
ATOM 10531 H H    . LEU A 1 24  ? 5.598   9.495   3.488   1.00 0.00 ? 1156 LEU A H    7  
ATOM 10532 H HA   . LEU A 1 24  ? 3.139   8.073   3.507   1.00 0.00 ? 1156 LEU A HA   7  
ATOM 10533 H HB2  . LEU A 1 24  ? 4.315   8.905   1.474   1.00 0.00 ? 1156 LEU A HB2  7  
ATOM 10534 H HB3  . LEU A 1 24  ? 5.520   7.642   1.711   1.00 0.00 ? 1156 LEU A HB3  7  
ATOM 10535 H HG   . LEU A 1 24  ? 3.879   5.929   1.286   1.00 0.00 ? 1156 LEU A HG   7  
ATOM 10536 H HD11 . LEU A 1 24  ? 1.588   6.890   0.402   1.00 0.00 ? 1156 LEU A HD11 7  
ATOM 10537 H HD12 . LEU A 1 24  ? 1.982   8.205   1.509   1.00 0.00 ? 1156 LEU A HD12 7  
ATOM 10538 H HD13 . LEU A 1 24  ? 1.848   6.554   2.114   1.00 0.00 ? 1156 LEU A HD13 7  
ATOM 10539 H HD21 . LEU A 1 24  ? 4.403   8.083   -0.633  1.00 0.00 ? 1156 LEU A HD21 7  
ATOM 10540 H HD22 . LEU A 1 24  ? 3.027   7.057   -1.038  1.00 0.00 ? 1156 LEU A HD22 7  
ATOM 10541 H HD23 . LEU A 1 24  ? 4.620   6.340   -0.792  1.00 0.00 ? 1156 LEU A HD23 7  
ATOM 10542 N N    . TYR A 1 25  ? 5.885   6.285   3.957   1.00 0.00 ? 1157 TYR A N    7  
ATOM 10543 C CA   . TYR A 1 25  ? 6.391   5.035   4.511   1.00 0.00 ? 1157 TYR A CA   7  
ATOM 10544 C C    . TYR A 1 25  ? 5.613   4.639   5.762   1.00 0.00 ? 1157 TYR A C    7  
ATOM 10545 O O    . TYR A 1 25  ? 5.251   3.476   5.940   1.00 0.00 ? 1157 TYR A O    7  
ATOM 10546 C CB   . TYR A 1 25  ? 7.879   5.164   4.842   1.00 0.00 ? 1157 TYR A CB   7  
ATOM 10547 C CG   . TYR A 1 25  ? 8.435   3.982   5.603   1.00 0.00 ? 1157 TYR A CG   7  
ATOM 10548 C CD1  . TYR A 1 25  ? 8.449   2.712   5.039   1.00 0.00 ? 1157 TYR A CD1  7  
ATOM 10549 C CD2  . TYR A 1 25  ? 8.948   4.135   6.885   1.00 0.00 ? 1157 TYR A CD2  7  
ATOM 10550 C CE1  . TYR A 1 25  ? 8.956   1.629   5.731   1.00 0.00 ? 1157 TYR A CE1  7  
ATOM 10551 C CE2  . TYR A 1 25  ? 9.458   3.058   7.584   1.00 0.00 ? 1157 TYR A CE2  7  
ATOM 10552 C CZ   . TYR A 1 25  ? 9.459   1.807   7.003   1.00 0.00 ? 1157 TYR A CZ   7  
ATOM 10553 O OH   . TYR A 1 25  ? 9.966   0.731   7.695   1.00 0.00 ? 1157 TYR A OH   7  
ATOM 10554 H H    . TYR A 1 25  ? 6.517   6.926   3.570   1.00 0.00 ? 1157 TYR A H    7  
ATOM 10555 H HA   . TYR A 1 25  ? 6.265   4.265   3.763   1.00 0.00 ? 1157 TYR A HA   7  
ATOM 10556 H HB2  . TYR A 1 25  ? 8.438   5.260   3.924   1.00 0.00 ? 1157 TYR A HB2  7  
ATOM 10557 H HB3  . TYR A 1 25  ? 8.031   6.048   5.444   1.00 0.00 ? 1157 TYR A HB3  7  
ATOM 10558 H HD1  . TYR A 1 25  ? 8.055   2.577   4.043   1.00 0.00 ? 1157 TYR A HD1  7  
ATOM 10559 H HD2  . TYR A 1 25  ? 8.945   5.117   7.338   1.00 0.00 ? 1157 TYR A HD2  7  
ATOM 10560 H HE1  . TYR A 1 25  ? 8.958   0.650   5.276   1.00 0.00 ? 1157 TYR A HE1  7  
ATOM 10561 H HE2  . TYR A 1 25  ? 9.852   3.197   8.580   1.00 0.00 ? 1157 TYR A HE2  7  
ATOM 10562 H HH   . TYR A 1 25  ? 10.155  0.993   8.599   1.00 0.00 ? 1157 TYR A HH   7  
ATOM 10563 N N    . GLY A 1 26  ? 5.358   5.616   6.626   1.00 0.00 ? 1158 GLY A N    7  
ATOM 10564 C CA   . GLY A 1 26  ? 4.624   5.351   7.850   1.00 0.00 ? 1158 GLY A CA   7  
ATOM 10565 C C    . GLY A 1 26  ? 3.209   4.874   7.586   1.00 0.00 ? 1158 GLY A C    7  
ATOM 10566 O O    . GLY A 1 26  ? 2.758   3.890   8.171   1.00 0.00 ? 1158 GLY A O    7  
ATOM 10567 H H    . GLY A 1 26  ? 5.671   6.524   6.432   1.00 0.00 ? 1158 GLY A H    7  
ATOM 10568 H HA2  . GLY A 1 26  ? 5.148   4.595   8.415   1.00 0.00 ? 1158 GLY A HA2  7  
ATOM 10569 H HA3  . GLY A 1 26  ? 4.582   6.258   8.435   1.00 0.00 ? 1158 GLY A HA3  7  
ATOM 10570 N N    . LYS A 1 27  ? 2.506   5.575   6.702   1.00 0.00 ? 1159 LYS A N    7  
ATOM 10571 C CA   . LYS A 1 27  ? 1.134   5.219   6.361   1.00 0.00 ? 1159 LYS A CA   7  
ATOM 10572 C C    . LYS A 1 27  ? 1.053   3.780   5.859   1.00 0.00 ? 1159 LYS A C    7  
ATOM 10573 O O    . LYS A 1 27  ? 0.136   3.039   6.214   1.00 0.00 ? 1159 LYS A O    7  
ATOM 10574 C CB   . LYS A 1 27  ? 0.587   6.173   5.296   1.00 0.00 ? 1159 LYS A CB   7  
ATOM 10575 C CG   . LYS A 1 27  ? 0.638   7.634   5.706   1.00 0.00 ? 1159 LYS A CG   7  
ATOM 10576 C CD   . LYS A 1 27  ? -0.257  8.491   4.827   1.00 0.00 ? 1159 LYS A CD   7  
ATOM 10577 C CE   . LYS A 1 27  ? -0.125  9.968   5.168   1.00 0.00 ? 1159 LYS A CE   7  
ATOM 10578 N NZ   . LYS A 1 27  ? -0.915  10.331  6.376   1.00 0.00 ? 1159 LYS A NZ   7  
ATOM 10579 H H    . LYS A 1 27  ? 2.921   6.350   6.268   1.00 0.00 ? 1159 LYS A H    7  
ATOM 10580 H HA   . LYS A 1 27  ? 0.535   5.309   7.255   1.00 0.00 ? 1159 LYS A HA   7  
ATOM 10581 H HB2  . LYS A 1 27  ? 1.166   6.053   4.392   1.00 0.00 ? 1159 LYS A HB2  7  
ATOM 10582 H HB3  . LYS A 1 27  ? -0.442  5.914   5.092   1.00 0.00 ? 1159 LYS A HB3  7  
ATOM 10583 H HG2  . LYS A 1 27  ? 0.310   7.724   6.731   1.00 0.00 ? 1159 LYS A HG2  7  
ATOM 10584 H HG3  . LYS A 1 27  ? 1.656   7.987   5.620   1.00 0.00 ? 1159 LYS A HG3  7  
ATOM 10585 H HD2  . LYS A 1 27  ? 0.022   8.346   3.793   1.00 0.00 ? 1159 LYS A HD2  7  
ATOM 10586 H HD3  . LYS A 1 27  ? -1.285  8.188   4.970   1.00 0.00 ? 1159 LYS A HD3  7  
ATOM 10587 H HE2  . LYS A 1 27  ? 0.915   10.190  5.348   1.00 0.00 ? 1159 LYS A HE2  7  
ATOM 10588 H HE3  . LYS A 1 27  ? -0.477  10.550  4.329   1.00 0.00 ? 1159 LYS A HE3  7  
ATOM 10589 H HZ1  . LYS A 1 27  ? -1.089  9.485   6.956   1.00 0.00 ? 1159 LYS A HZ1  7  
ATOM 10590 H HZ2  . LYS A 1 27  ? -1.830  10.739  6.096   1.00 0.00 ? 1159 LYS A HZ2  7  
ATOM 10591 H HZ3  . LYS A 1 27  ? -0.396  11.028  6.947   1.00 0.00 ? 1159 LYS A HZ3  7  
ATOM 10592 N N    . LEU A 1 28  ? 2.019   3.392   5.034   1.00 0.00 ? 1160 LEU A N    7  
ATOM 10593 C CA   . LEU A 1 28  ? 2.058   2.041   4.485   1.00 0.00 ? 1160 LEU A CA   7  
ATOM 10594 C C    . LEU A 1 28  ? 2.246   1.008   5.591   1.00 0.00 ? 1160 LEU A C    7  
ATOM 10595 O O    . LEU A 1 28  ? 1.595   -0.037  5.597   1.00 0.00 ? 1160 LEU A O    7  
ATOM 10596 C CB   . LEU A 1 28  ? 3.188   1.918   3.461   1.00 0.00 ? 1160 LEU A CB   7  
ATOM 10597 C CG   . LEU A 1 28  ? 2.911   2.515   2.080   1.00 0.00 ? 1160 LEU A CG   7  
ATOM 10598 C CD1  . LEU A 1 28  ? 4.211   2.733   1.322   1.00 0.00 ? 1160 LEU A CD1  7  
ATOM 10599 C CD2  . LEU A 1 28  ? 1.974   1.615   1.289   1.00 0.00 ? 1160 LEU A CD2  7  
ATOM 10600 H H    . LEU A 1 28  ? 2.722   4.027   4.787   1.00 0.00 ? 1160 LEU A H    7  
ATOM 10601 H HA   . LEU A 1 28  ? 1.116   1.856   3.992   1.00 0.00 ? 1160 LEU A HA   7  
ATOM 10602 H HB2  . LEU A 1 28  ? 4.057   2.414   3.866   1.00 0.00 ? 1160 LEU A HB2  7  
ATOM 10603 H HB3  . LEU A 1 28  ? 3.403   0.867   3.331   1.00 0.00 ? 1160 LEU A HB3  7  
ATOM 10604 H HG   . LEU A 1 28  ? 2.430   3.476   2.200   1.00 0.00 ? 1160 LEU A HG   7  
ATOM 10605 H HD11 . LEU A 1 28  ? 4.016   3.314   0.433   1.00 0.00 ? 1160 LEU A HD11 7  
ATOM 10606 H HD12 . LEU A 1 28  ? 4.629   1.777   1.042   1.00 0.00 ? 1160 LEU A HD12 7  
ATOM 10607 H HD13 . LEU A 1 28  ? 4.911   3.261   1.952   1.00 0.00 ? 1160 LEU A HD13 7  
ATOM 10608 H HD21 . LEU A 1 28  ? 1.461   2.200   0.539   1.00 0.00 ? 1160 LEU A HD21 7  
ATOM 10609 H HD22 . LEU A 1 28  ? 1.249   1.172   1.958   1.00 0.00 ? 1160 LEU A HD22 7  
ATOM 10610 H HD23 . LEU A 1 28  ? 2.545   0.834   0.808   1.00 0.00 ? 1160 LEU A HD23 7  
ATOM 10611 N N    . VAL A 1 29  ? 3.139   1.309   6.529   1.00 0.00 ? 1161 VAL A N    7  
ATOM 10612 C CA   . VAL A 1 29  ? 3.409   0.408   7.644   1.00 0.00 ? 1161 VAL A CA   7  
ATOM 10613 C C    . VAL A 1 29  ? 2.150   0.156   8.464   1.00 0.00 ? 1161 VAL A C    7  
ATOM 10614 O O    . VAL A 1 29  ? 1.879   -0.974  8.871   1.00 0.00 ? 1161 VAL A O    7  
ATOM 10615 C CB   . VAL A 1 29  ? 4.506   0.972   8.567   1.00 0.00 ? 1161 VAL A CB   7  
ATOM 10616 C CG1  . VAL A 1 29  ? 4.718   0.057   9.763   1.00 0.00 ? 1161 VAL A CG1  7  
ATOM 10617 C CG2  . VAL A 1 29  ? 5.803   1.165   7.796   1.00 0.00 ? 1161 VAL A CG2  7  
ATOM 10618 H H    . VAL A 1 29  ? 3.626   2.157   6.471   1.00 0.00 ? 1161 VAL A H    7  
ATOM 10619 H HA   . VAL A 1 29  ? 3.757   -0.530  7.237   1.00 0.00 ? 1161 VAL A HA   7  
ATOM 10620 H HB   . VAL A 1 29  ? 4.182   1.935   8.931   1.00 0.00 ? 1161 VAL A HB   7  
ATOM 10621 H HG11 . VAL A 1 29  ? 5.263   0.589   10.530  1.00 0.00 ? 1161 VAL A HG11 7  
ATOM 10622 H HG12 . VAL A 1 29  ? 3.761   -0.256  10.152  1.00 0.00 ? 1161 VAL A HG12 7  
ATOM 10623 H HG13 . VAL A 1 29  ? 5.284   -0.810  9.457   1.00 0.00 ? 1161 VAL A HG13 7  
ATOM 10624 H HG21 . VAL A 1 29  ? 5.711   0.713   6.819   1.00 0.00 ? 1161 VAL A HG21 7  
ATOM 10625 H HG22 . VAL A 1 29  ? 6.004   2.221   7.686   1.00 0.00 ? 1161 VAL A HG22 7  
ATOM 10626 H HG23 . VAL A 1 29  ? 6.615   0.699   8.334   1.00 0.00 ? 1161 VAL A HG23 7  
ATOM 10627 N N    . GLU A 1 30  ? 1.383   1.215   8.704   1.00 0.00 ? 1162 GLU A N    7  
ATOM 10628 C CA   . GLU A 1 30  ? 0.152   1.108   9.477   1.00 0.00 ? 1162 GLU A CA   7  
ATOM 10629 C C    . GLU A 1 30  ? -0.850  0.191   8.780   1.00 0.00 ? 1162 GLU A C    7  
ATOM 10630 O O    . GLU A 1 30  ? -1.548  -0.589  9.427   1.00 0.00 ? 1162 GLU A O    7  
ATOM 10631 C CB   . GLU A 1 30  ? -0.467  2.491   9.688   1.00 0.00 ? 1162 GLU A CB   7  
ATOM 10632 C CG   . GLU A 1 30  ? 0.299   3.356   10.675  1.00 0.00 ? 1162 GLU A CG   7  
ATOM 10633 C CD   . GLU A 1 30  ? -0.233  4.775   10.741  1.00 0.00 ? 1162 GLU A CD   7  
ATOM 10634 O OE1  . GLU A 1 30  ? 0.123   5.585   9.860   1.00 0.00 ? 1162 GLU A OE1  7  
ATOM 10635 O OE2  . GLU A 1 30  ? -1.006  5.075   11.675  1.00 0.00 ? 1162 GLU A OE2  7  
ATOM 10636 H H    . GLU A 1 30  ? 1.653   2.090   8.353   1.00 0.00 ? 1162 GLU A H    7  
ATOM 10637 H HA   . GLU A 1 30  ? 0.400   0.684   10.439  1.00 0.00 ? 1162 GLU A HA   7  
ATOM 10638 H HB2  . GLU A 1 30  ? -0.500  3.006   8.739   1.00 0.00 ? 1162 GLU A HB2  7  
ATOM 10639 H HB3  . GLU A 1 30  ? -1.475  2.368   10.056  1.00 0.00 ? 1162 GLU A HB3  7  
ATOM 10640 H HG2  . GLU A 1 30  ? 0.223   2.914   11.656  1.00 0.00 ? 1162 GLU A HG2  7  
ATOM 10641 H HG3  . GLU A 1 30  ? 1.336   3.390   10.375  1.00 0.00 ? 1162 GLU A HG3  7  
ATOM 10642 N N    . ALA A 1 31  ? -0.914  0.293   7.456   1.00 0.00 ? 1163 ALA A N    7  
ATOM 10643 C CA   . ALA A 1 31  ? -1.828  -0.527  6.671   1.00 0.00 ? 1163 ALA A CA   7  
ATOM 10644 C C    . ALA A 1 31  ? -1.443  -2.001  6.743   1.00 0.00 ? 1163 ALA A C    7  
ATOM 10645 O O    . ALA A 1 31  ? -2.303  -2.880  6.679   1.00 0.00 ? 1163 ALA A O    7  
ATOM 10646 C CB   . ALA A 1 31  ? -1.850  -0.055  5.225   1.00 0.00 ? 1163 ALA A CB   7  
ATOM 10647 H H    . ALA A 1 31  ? -0.332  0.933   6.997   1.00 0.00 ? 1163 ALA A H    7  
ATOM 10648 H HA   . ALA A 1 31  ? -2.821  -0.404  7.079   1.00 0.00 ? 1163 ALA A HA   7  
ATOM 10649 H HB1  . ALA A 1 31  ? -2.686  0.613   5.078   1.00 0.00 ? 1163 ALA A HB1  7  
ATOM 10650 H HB2  . ALA A 1 31  ? -0.930  0.464   5.002   1.00 0.00 ? 1163 ALA A HB2  7  
ATOM 10651 H HB3  . ALA A 1 31  ? -1.951  -0.908  4.570   1.00 0.00 ? 1163 ALA A HB3  7  
ATOM 10652 N N    . ARG A 1 32  ? -0.147  -2.264  6.876   1.00 0.00 ? 1164 ARG A N    7  
ATOM 10653 C CA   . ARG A 1 32  ? 0.351   -3.632  6.954   1.00 0.00 ? 1164 ARG A CA   7  
ATOM 10654 C C    . ARG A 1 32  ? 0.162   -4.199  8.358   1.00 0.00 ? 1164 ARG A C    7  
ATOM 10655 O O    . ARG A 1 32  ? -0.248  -5.347  8.524   1.00 0.00 ? 1164 ARG A O    7  
ATOM 10656 C CB   . ARG A 1 32  ? 1.830   -3.682  6.567   1.00 0.00 ? 1164 ARG A CB   7  
ATOM 10657 C CG   . ARG A 1 32  ? 2.438   -5.071  6.664   1.00 0.00 ? 1164 ARG A CG   7  
ATOM 10658 C CD   . ARG A 1 32  ? 3.822   -5.118  6.035   1.00 0.00 ? 1164 ARG A CD   7  
ATOM 10659 N NE   . ARG A 1 32  ? 3.826   -4.575  4.680   1.00 0.00 ? 1164 ARG A NE   7  
ATOM 10660 C CZ   . ARG A 1 32  ? 3.235   -5.168  3.648   1.00 0.00 ? 1164 ARG A CZ   7  
ATOM 10661 N NH1  . ARG A 1 32  ? 2.595   -6.317  3.818   1.00 0.00 ? 1164 ARG A NH1  7  
ATOM 10662 N NH2  . ARG A 1 32  ? 3.283   -4.612  2.445   1.00 0.00 ? 1164 ARG A NH2  7  
ATOM 10663 H H    . ARG A 1 32  ? 0.489   -1.520  6.921   1.00 0.00 ? 1164 ARG A H    7  
ATOM 10664 H HA   . ARG A 1 32  ? -0.216  -4.232  6.258   1.00 0.00 ? 1164 ARG A HA   7  
ATOM 10665 H HB2  . ARG A 1 32  ? 1.935   -3.337  5.548   1.00 0.00 ? 1164 ARG A HB2  7  
ATOM 10666 H HB3  . ARG A 1 32  ? 2.383   -3.024  7.220   1.00 0.00 ? 1164 ARG A HB3  7  
ATOM 10667 H HG2  . ARG A 1 32  ? 2.518   -5.347  7.705   1.00 0.00 ? 1164 ARG A HG2  7  
ATOM 10668 H HG3  . ARG A 1 32  ? 1.795   -5.772  6.152   1.00 0.00 ? 1164 ARG A HG3  7  
ATOM 10669 H HD2  . ARG A 1 32  ? 4.500   -4.541  6.646   1.00 0.00 ? 1164 ARG A HD2  7  
ATOM 10670 H HD3  . ARG A 1 32  ? 4.153   -6.146  6.003   1.00 0.00 ? 1164 ARG A HD3  7  
ATOM 10671 H HE   . ARG A 1 32  ? 4.293   -3.727  4.532   1.00 0.00 ? 1164 ARG A HE   7  
ATOM 10672 H HH11 . ARG A 1 32  ? 2.557   -6.738  4.724   1.00 0.00 ? 1164 ARG A HH11 7  
ATOM 10673 H HH12 . ARG A 1 32  ? 2.150   -6.761  3.040   1.00 0.00 ? 1164 ARG A HH12 7  
ATOM 10674 H HH21 . ARG A 1 32  ? 3.764   -3.746  2.313   1.00 0.00 ? 1164 ARG A HH21 7  
ATOM 10675 H HH22 . ARG A 1 32  ? 2.837   -5.059  1.670   1.00 0.00 ? 1164 ARG A HH22 7  
ATOM 10676 N N    . GLN A 1 33  ? 0.466   -3.386  9.365   1.00 0.00 ? 1165 GLN A N    7  
ATOM 10677 C CA   . GLN A 1 33  ? 0.331   -3.808  10.754  1.00 0.00 ? 1165 GLN A CA   7  
ATOM 10678 C C    . GLN A 1 33  ? -1.078  -4.318  11.034  1.00 0.00 ? 1165 GLN A C    7  
ATOM 10679 O O    . GLN A 1 33  ? -1.270  -5.247  11.819  1.00 0.00 ? 1165 GLN A O    7  
ATOM 10680 C CB   . GLN A 1 33  ? 0.664   -2.649  11.696  1.00 0.00 ? 1165 GLN A CB   7  
ATOM 10681 C CG   . GLN A 1 33  ? 0.630   -3.032  13.167  1.00 0.00 ? 1165 GLN A CG   7  
ATOM 10682 C CD   . GLN A 1 33  ? 1.232   -1.966  14.061  1.00 0.00 ? 1165 GLN A CD   7  
ATOM 10683 O OE1  . GLN A 1 33  ? 2.395   -2.053  14.454  1.00 0.00 ? 1165 GLN A OE1  7  
ATOM 10684 N NE2  . GLN A 1 33  ? 0.440   -0.951  14.388  1.00 0.00 ? 1165 GLN A NE2  7  
ATOM 10685 H H    . GLN A 1 33  ? 0.789   -2.482  9.169   1.00 0.00 ? 1165 GLN A H    7  
ATOM 10686 H HA   . GLN A 1 33  ? 1.032   -4.611  10.926  1.00 0.00 ? 1165 GLN A HA   7  
ATOM 10687 H HB2  . GLN A 1 33  ? 1.653   -2.284  11.463  1.00 0.00 ? 1165 GLN A HB2  7  
ATOM 10688 H HB3  . GLN A 1 33  ? -0.051  -1.856  11.537  1.00 0.00 ? 1165 GLN A HB3  7  
ATOM 10689 H HG2  . GLN A 1 33  ? -0.397  -3.189  13.462  1.00 0.00 ? 1165 GLN A HG2  7  
ATOM 10690 H HG3  . GLN A 1 33  ? 1.186   -3.948  13.300  1.00 0.00 ? 1165 GLN A HG3  7  
ATOM 10691 H HE21 . GLN A 1 33  ? -0.476  -0.949  14.039  1.00 0.00 ? 1165 GLN A HE21 7  
ATOM 10692 H HE22 . GLN A 1 33  ? 0.803   -0.248  14.965  1.00 0.00 ? 1165 GLN A HE22 7  
ATOM 10693 N N    . LYS A 1 34  ? -2.063  -3.705  10.387  1.00 0.00 ? 1166 LYS A N    7  
ATOM 10694 C CA   . LYS A 1 34  ? -3.457  -4.096  10.564  1.00 0.00 ? 1166 LYS A CA   7  
ATOM 10695 C C    . LYS A 1 34  ? -3.813  -5.268  9.655   1.00 0.00 ? 1166 LYS A C    7  
ATOM 10696 O O    . LYS A 1 34  ? -4.557  -6.167  10.047  1.00 0.00 ? 1166 LYS A O    7  
ATOM 10697 C CB   . LYS A 1 34  ? -4.382  -2.912  10.275  1.00 0.00 ? 1166 LYS A CB   7  
ATOM 10698 C CG   . LYS A 1 34  ? -4.738  -2.764  8.806   1.00 0.00 ? 1166 LYS A CG   7  
ATOM 10699 C CD   . LYS A 1 34  ? -5.652  -1.573  8.571   1.00 0.00 ? 1166 LYS A CD   7  
ATOM 10700 C CE   . LYS A 1 34  ? -5.977  -1.402  7.095   1.00 0.00 ? 1166 LYS A CE   7  
ATOM 10701 N NZ   . LYS A 1 34  ? -7.170  -2.198  6.694   1.00 0.00 ? 1166 LYS A NZ   7  
ATOM 10702 H H    . LYS A 1 34  ? -1.848  -2.970  9.774   1.00 0.00 ? 1166 LYS A H    7  
ATOM 10703 H HA   . LYS A 1 34  ? -3.587  -4.401  11.592  1.00 0.00 ? 1166 LYS A HA   7  
ATOM 10704 H HB2  . LYS A 1 34  ? -5.296  -3.040  10.834  1.00 0.00 ? 1166 LYS A HB2  7  
ATOM 10705 H HB3  . LYS A 1 34  ? -3.895  -2.003  10.599  1.00 0.00 ? 1166 LYS A HB3  7  
ATOM 10706 H HG2  . LYS A 1 34  ? -3.830  -2.624  8.237   1.00 0.00 ? 1166 LYS A HG2  7  
ATOM 10707 H HG3  . LYS A 1 34  ? -5.238  -3.662  8.474   1.00 0.00 ? 1166 LYS A HG3  7  
ATOM 10708 H HD2  . LYS A 1 34  ? -6.573  -1.724  9.115   1.00 0.00 ? 1166 LYS A HD2  7  
ATOM 10709 H HD3  . LYS A 1 34  ? -5.163  -0.678  8.929   1.00 0.00 ? 1166 LYS A HD3  7  
ATOM 10710 H HE2  . LYS A 1 34  ? -6.170  -0.358  6.901   1.00 0.00 ? 1166 LYS A HE2  7  
ATOM 10711 H HE3  . LYS A 1 34  ? -5.127  -1.726  6.513   1.00 0.00 ? 1166 LYS A HE3  7  
ATOM 10712 H HZ1  . LYS A 1 34  ? -7.076  -2.510  5.706   1.00 0.00 ? 1166 LYS A HZ1  7  
ATOM 10713 H HZ2  . LYS A 1 34  ? -8.031  -1.622  6.783   1.00 0.00 ? 1166 LYS A HZ2  7  
ATOM 10714 H HZ3  . LYS A 1 34  ? -7.262  -3.036  7.303   1.00 0.00 ? 1166 LYS A HZ3  7  
ATOM 10715 N N    . HIS A 1 35  ? -3.276  -5.251  8.438   1.00 0.00 ? 1167 HIS A N    7  
ATOM 10716 C CA   . HIS A 1 35  ? -3.536  -6.313  7.473   1.00 0.00 ? 1167 HIS A CA   7  
ATOM 10717 C C    . HIS A 1 35  ? -2.983  -7.646  7.970   1.00 0.00 ? 1167 HIS A C    7  
ATOM 10718 O O    . HIS A 1 35  ? -3.716  -8.627  8.090   1.00 0.00 ? 1167 HIS A O    7  
ATOM 10719 C CB   . HIS A 1 35  ? -2.918  -5.964  6.119   1.00 0.00 ? 1167 HIS A CB   7  
ATOM 10720 C CG   . HIS A 1 35  ? -3.670  -6.529  4.954   1.00 0.00 ? 1167 HIS A CG   7  
ATOM 10721 N ND1  . HIS A 1 35  ? -4.728  -7.402  5.093   1.00 0.00 ? 1167 HIS A ND1  7  
ATOM 10722 C CD2  . HIS A 1 35  ? -3.514  -6.338  3.623   1.00 0.00 ? 1167 HIS A CD2  7  
ATOM 10723 C CE1  . HIS A 1 35  ? -5.189  -7.726  3.898   1.00 0.00 ? 1167 HIS A CE1  7  
ATOM 10724 N NE2  . HIS A 1 35  ? -4.469  -7.094  2.988   1.00 0.00 ? 1167 HIS A NE2  7  
ATOM 10725 H H    . HIS A 1 35  ? -2.692  -4.507  8.184   1.00 0.00 ? 1167 HIS A H    7  
ATOM 10726 H HA   . HIS A 1 35  ? -4.606  -6.402  7.359   1.00 0.00 ? 1167 HIS A HA   7  
ATOM 10727 H HB2  . HIS A 1 35  ? -2.894  -4.890  6.009   1.00 0.00 ? 1167 HIS A HB2  7  
ATOM 10728 H HB3  . HIS A 1 35  ? -1.909  -6.348  6.082   1.00 0.00 ? 1167 HIS A HB3  7  
ATOM 10729 H HD1  . HIS A 1 35  ? -5.087  -7.736  5.941   1.00 0.00 ? 1167 HIS A HD1  7  
ATOM 10730 H HD2  . HIS A 1 35  ? -2.774  -5.709  3.147   1.00 0.00 ? 1167 HIS A HD2  7  
ATOM 10731 H HE1  . HIS A 1 35  ? -6.013  -8.394  3.697   1.00 0.00 ? 1167 HIS A HE1  7  
ATOM 10732 H HE2  . HIS A 1 35  ? -4.544  -7.223  2.020   1.00 0.00 ? 1167 HIS A HE2  7  
ATOM 10733 N N    . ALA A 1 36  ? -1.686  -7.672  8.257   1.00 0.00 ? 1168 ALA A N    7  
ATOM 10734 C CA   . ALA A 1 36  ? -1.035  -8.883  8.741   1.00 0.00 ? 1168 ALA A CA   7  
ATOM 10735 C C    . ALA A 1 36  ? -1.952  -9.661  9.679   1.00 0.00 ? 1168 ALA A C    7  
ATOM 10736 O O    . ALA A 1 36  ? -2.198  -10.849 9.475   1.00 0.00 ? 1168 ALA A O    7  
ATOM 10737 C CB   . ALA A 1 36  ? 0.270   -8.536  9.443   1.00 0.00 ? 1168 ALA A CB   7  
ATOM 10738 H H    . ALA A 1 36  ? -1.154  -6.857  8.141   1.00 0.00 ? 1168 ALA A H    7  
ATOM 10739 H HA   . ALA A 1 36  ? -0.802  -9.501  7.886   1.00 0.00 ? 1168 ALA A HA   7  
ATOM 10740 H HB1  . ALA A 1 36  ? 0.340   -9.093  10.366  1.00 0.00 ? 1168 ALA A HB1  7  
ATOM 10741 H HB2  . ALA A 1 36  ? 1.101   -8.792  8.804   1.00 0.00 ? 1168 ALA A HB2  7  
ATOM 10742 H HB3  . ALA A 1 36  ? 0.292   -7.478  9.659   1.00 0.00 ? 1168 ALA A HB3  7  
ATOM 10743 N N    . ASN A 1 37  ? -2.453  -8.984  10.706  1.00 0.00 ? 1169 ASN A N    7  
ATOM 10744 C CA   . ASN A 1 37  ? -3.342  -9.613  11.676  1.00 0.00 ? 1169 ASN A CA   7  
ATOM 10745 C C    . ASN A 1 37  ? -4.619  -10.107 11.003  1.00 0.00 ? 1169 ASN A C    7  
ATOM 10746 O O    . ASN A 1 37  ? -5.146  -11.166 11.346  1.00 0.00 ? 1169 ASN A O    7  
ATOM 10747 C CB   . ASN A 1 37  ? -3.690  -8.629  12.795  1.00 0.00 ? 1169 ASN A CB   7  
ATOM 10748 C CG   . ASN A 1 37  ? -2.692  -8.675  13.936  1.00 0.00 ? 1169 ASN A CG   7  
ATOM 10749 O OD1  . ASN A 1 37  ? -2.928  -9.323  14.955  1.00 0.00 ? 1169 ASN A OD1  7  
ATOM 10750 N ND2  . ASN A 1 37  ? -1.570  -7.984  13.769  1.00 0.00 ? 1169 ASN A ND2  7  
ATOM 10751 H H    . ASN A 1 37  ? -2.220  -8.038  10.815  1.00 0.00 ? 1169 ASN A H    7  
ATOM 10752 H HA   . ASN A 1 37  ? -2.823  -10.459 12.101  1.00 0.00 ? 1169 ASN A HA   7  
ATOM 10753 H HB2  . ASN A 1 37  ? -3.701  -7.626  12.393  1.00 0.00 ? 1169 ASN A HB2  7  
ATOM 10754 H HB3  . ASN A 1 37  ? -4.667  -8.866  13.185  1.00 0.00 ? 1169 ASN A HB3  7  
ATOM 10755 H HD21 . ASN A 1 37  ? -1.450  -7.491  12.931  1.00 0.00 ? 1169 ASN A HD21 7  
ATOM 10756 H HD22 . ASN A 1 37  ? -0.907  -7.998  14.491  1.00 0.00 ? 1169 ASN A HD22 7  
ATOM 10757 N N    . LYS A 1 38  ? -5.113  -9.332  10.043  1.00 0.00 ? 1170 LYS A N    7  
ATOM 10758 C CA   . LYS A 1 38  ? -6.327  -9.690  9.319   1.00 0.00 ? 1170 LYS A CA   7  
ATOM 10759 C C    . LYS A 1 38  ? -6.194  -11.070 8.681   1.00 0.00 ? 1170 LYS A C    7  
ATOM 10760 O O    . LYS A 1 38  ? -7.051  -11.933 8.865   1.00 0.00 ? 1170 LYS A O    7  
ATOM 10761 C CB   . LYS A 1 38  ? -6.629  -8.646  8.242   1.00 0.00 ? 1170 LYS A CB   7  
ATOM 10762 C CG   . LYS A 1 38  ? -7.946  -8.879  7.522   1.00 0.00 ? 1170 LYS A CG   7  
ATOM 10763 C CD   . LYS A 1 38  ? -8.436  -7.616  6.832   1.00 0.00 ? 1170 LYS A CD   7  
ATOM 10764 C CE   . LYS A 1 38  ? -9.320  -6.787  7.751   1.00 0.00 ? 1170 LYS A CE   7  
ATOM 10765 N NZ   . LYS A 1 38  ? -9.608  -5.443  7.179   1.00 0.00 ? 1170 LYS A NZ   7  
ATOM 10766 H H    . LYS A 1 38  ? -4.648  -8.500  9.814   1.00 0.00 ? 1170 LYS A H    7  
ATOM 10767 H HA   . LYS A 1 38  ? -7.141  -9.711  10.027  1.00 0.00 ? 1170 LYS A HA   7  
ATOM 10768 H HB2  . LYS A 1 38  ? -6.663  -7.670  8.703   1.00 0.00 ? 1170 LYS A HB2  7  
ATOM 10769 H HB3  . LYS A 1 38  ? -5.835  -8.661  7.509   1.00 0.00 ? 1170 LYS A HB3  7  
ATOM 10770 H HG2  . LYS A 1 38  ? -7.808  -9.651  6.779   1.00 0.00 ? 1170 LYS A HG2  7  
ATOM 10771 H HG3  . LYS A 1 38  ? -8.688  -9.197  8.241   1.00 0.00 ? 1170 LYS A HG3  7  
ATOM 10772 H HD2  . LYS A 1 38  ? -7.583  -7.022  6.540   1.00 0.00 ? 1170 LYS A HD2  7  
ATOM 10773 H HD3  . LYS A 1 38  ? -9.003  -7.893  5.954   1.00 0.00 ? 1170 LYS A HD3  7  
ATOM 10774 H HE2  . LYS A 1 38  ? -10.252 -7.311  7.901   1.00 0.00 ? 1170 LYS A HE2  7  
ATOM 10775 H HE3  . LYS A 1 38  ? -8.818  -6.666  8.699   1.00 0.00 ? 1170 LYS A HE3  7  
ATOM 10776 H HZ1  . LYS A 1 38  ? -9.321  -5.411  6.180   1.00 0.00 ? 1170 LYS A HZ1  7  
ATOM 10777 H HZ2  . LYS A 1 38  ? -9.083  -4.713  7.702   1.00 0.00 ? 1170 LYS A HZ2  7  
ATOM 10778 H HZ3  . LYS A 1 38  ? -10.625 -5.236  7.244   1.00 0.00 ? 1170 LYS A HZ3  7  
ATOM 10779 N N    . MET A 1 39  ? -5.113  -11.269 7.934   1.00 0.00 ? 1171 MET A N    7  
ATOM 10780 C CA   . MET A 1 39  ? -4.868  -12.545 7.272   1.00 0.00 ? 1171 MET A CA   7  
ATOM 10781 C C    . MET A 1 39  ? -4.288  -13.562 8.249   1.00 0.00 ? 1171 MET A C    7  
ATOM 10782 O O    . MET A 1 39  ? -4.036  -14.712 7.887   1.00 0.00 ? 1171 MET A O    7  
ATOM 10783 C CB   . MET A 1 39  ? -3.915  -12.356 6.090   1.00 0.00 ? 1171 MET A CB   7  
ATOM 10784 C CG   . MET A 1 39  ? -4.595  -11.822 4.840   1.00 0.00 ? 1171 MET A CG   7  
ATOM 10785 S SD   . MET A 1 39  ? -3.772  -12.345 3.323   1.00 0.00 ? 1171 MET A SD   7  
ATOM 10786 C CE   . MET A 1 39  ? -2.665  -10.964 3.045   1.00 0.00 ? 1171 MET A CE   7  
ATOM 10787 H H    . MET A 1 39  ? -4.465  -10.542 7.824   1.00 0.00 ? 1171 MET A H    7  
ATOM 10788 H HA   . MET A 1 39  ? -5.813  -12.915 6.904   1.00 0.00 ? 1171 MET A HA   7  
ATOM 10789 H HB2  . MET A 1 39  ? -3.139  -11.661 6.376   1.00 0.00 ? 1171 MET A HB2  7  
ATOM 10790 H HB3  . MET A 1 39  ? -3.465  -13.307 5.849   1.00 0.00 ? 1171 MET A HB3  7  
ATOM 10791 H HG2  . MET A 1 39  ? -5.614  -12.178 4.820   1.00 0.00 ? 1171 MET A HG2  7  
ATOM 10792 H HG3  . MET A 1 39  ? -4.594  -10.742 4.880   1.00 0.00 ? 1171 MET A HG3  7  
ATOM 10793 H HE1  . MET A 1 39  ? -2.602  -10.367 3.943   1.00 0.00 ? 1171 MET A HE1  7  
ATOM 10794 H HE2  . MET A 1 39  ? -1.684  -11.336 2.791   1.00 0.00 ? 1171 MET A HE2  7  
ATOM 10795 H HE3  . MET A 1 39  ? -3.043  -10.358 2.235   1.00 0.00 ? 1171 MET A HE3  7  
ATOM 10796 N N    . ASP A 1 40  ? -4.079  -13.132 9.489   1.00 0.00 ? 1172 ASP A N    7  
ATOM 10797 C CA   . ASP A 1 40  ? -3.530  -14.006 10.519  1.00 0.00 ? 1172 ASP A CA   7  
ATOM 10798 C C    . ASP A 1 40  ? -2.076  -14.355 10.217  1.00 0.00 ? 1172 ASP A C    7  
ATOM 10799 O O    . ASP A 1 40  ? -1.597  -15.430 10.576  1.00 0.00 ? 1172 ASP A O    7  
ATOM 10800 C CB   . ASP A 1 40  ? -4.361  -15.284 10.630  1.00 0.00 ? 1172 ASP A CB   7  
ATOM 10801 C CG   . ASP A 1 40  ? -5.848  -15.021 10.496  1.00 0.00 ? 1172 ASP A CG   7  
ATOM 10802 O OD1  . ASP A 1 40  ? -6.411  -14.331 11.372  1.00 0.00 ? 1172 ASP A OD1  7  
ATOM 10803 O OD2  . ASP A 1 40  ? -6.450  -15.504 9.515   1.00 0.00 ? 1172 ASP A OD2  7  
ATOM 10804 H H    . ASP A 1 40  ? -4.300  -12.204 9.716   1.00 0.00 ? 1172 ASP A H    7  
ATOM 10805 H HA   . ASP A 1 40  ? -3.572  -13.477 11.459  1.00 0.00 ? 1172 ASP A HA   7  
ATOM 10806 H HB2  . ASP A 1 40  ? -4.064  -15.969 9.849   1.00 0.00 ? 1172 ASP A HB2  7  
ATOM 10807 H HB3  . ASP A 1 40  ? -4.180  -15.741 11.592  1.00 0.00 ? 1172 ASP A HB3  7  
ATOM 10808 N N    . VAL A 1 41  ? -1.378  -13.438 9.553   1.00 0.00 ? 1173 VAL A N    7  
ATOM 10809 C CA   . VAL A 1 41  ? 0.022   -13.649 9.202   1.00 0.00 ? 1173 VAL A CA   7  
ATOM 10810 C C    . VAL A 1 41  ? 0.912   -12.584 9.832   1.00 0.00 ? 1173 VAL A C    7  
ATOM 10811 O O    . VAL A 1 41  ? 0.612   -11.390 9.801   1.00 0.00 ? 1173 VAL A O    7  
ATOM 10812 C CB   . VAL A 1 41  ? 0.226   -13.635 7.675   1.00 0.00 ? 1173 VAL A CB   7  
ATOM 10813 C CG1  . VAL A 1 41  ? -0.557  -14.764 7.022   1.00 0.00 ? 1173 VAL A CG1  7  
ATOM 10814 C CG2  . VAL A 1 41  ? -0.181  -12.289 7.096   1.00 0.00 ? 1173 VAL A CG2  7  
ATOM 10815 H H    . VAL A 1 41  ? -1.815  -12.600 9.294   1.00 0.00 ? 1173 VAL A H    7  
ATOM 10816 H HA   . VAL A 1 41  ? 0.317   -14.618 9.575   1.00 0.00 ? 1173 VAL A HA   7  
ATOM 10817 H HB   . VAL A 1 41  ? 1.275   -13.790 7.472   1.00 0.00 ? 1173 VAL A HB   7  
ATOM 10818 H HG11 . VAL A 1 41  ? -1.503  -14.385 6.664   1.00 0.00 ? 1173 VAL A HG11 7  
ATOM 10819 H HG12 . VAL A 1 41  ? 0.010   -15.164 6.194   1.00 0.00 ? 1173 VAL A HG12 7  
ATOM 10820 H HG13 . VAL A 1 41  ? -0.735  -15.545 7.747   1.00 0.00 ? 1173 VAL A HG13 7  
ATOM 10821 H HG21 . VAL A 1 41  ? -0.888  -12.442 6.295   1.00 0.00 ? 1173 VAL A HG21 7  
ATOM 10822 H HG22 . VAL A 1 41  ? -0.636  -11.687 7.868   1.00 0.00 ? 1173 VAL A HG22 7  
ATOM 10823 H HG23 . VAL A 1 41  ? 0.693   -11.783 6.714   1.00 0.00 ? 1173 VAL A HG23 7  
ATOM 10824 N N    . PRO A 1 42  ? 2.036   -13.023 10.419  1.00 0.00 ? 1174 PRO A N    7  
ATOM 10825 C CA   . PRO A 1 42  ? 2.994   -12.124 11.067  1.00 0.00 ? 1174 PRO A CA   7  
ATOM 10826 C C    . PRO A 1 42  ? 3.345   -10.923 10.194  1.00 0.00 ? 1174 PRO A C    7  
ATOM 10827 O O    . PRO A 1 42  ? 3.477   -11.030 8.974   1.00 0.00 ? 1174 PRO A O    7  
ATOM 10828 C CB   . PRO A 1 42  ? 4.225   -13.009 11.277  1.00 0.00 ? 1174 PRO A CB   7  
ATOM 10829 C CG   . PRO A 1 42  ? 3.686   -14.396 11.348  1.00 0.00 ? 1174 PRO A CG   7  
ATOM 10830 C CD   . PRO A 1 42  ? 2.457   -14.432 10.494  1.00 0.00 ? 1174 PRO A CD   7  
ATOM 10831 H HA   . PRO A 1 42  ? 2.630   -11.777 12.023  1.00 0.00 ? 1174 PRO A HA   7  
ATOM 10832 H HB2  . PRO A 1 42  ? 4.904   -12.890 10.445  1.00 0.00 ? 1174 PRO A HB2  7  
ATOM 10833 H HB3  . PRO A 1 42  ? 4.720   -12.731 12.196  1.00 0.00 ? 1174 PRO A HB3  7  
ATOM 10834 H HG2  . PRO A 1 42  ? 4.417   -15.094 10.968  1.00 0.00 ? 1174 PRO A HG2  7  
ATOM 10835 H HG3  . PRO A 1 42  ? 3.430   -14.638 12.369  1.00 0.00 ? 1174 PRO A HG3  7  
ATOM 10836 H HD2  . PRO A 1 42  ? 2.695   -14.816 9.513   1.00 0.00 ? 1174 PRO A HD2  7  
ATOM 10837 H HD3  . PRO A 1 42  ? 1.694   -15.037 10.963  1.00 0.00 ? 1174 PRO A HD3  7  
ATOM 10838 N N    . PRO A 1 43  ? 3.499   -9.753  10.830  1.00 0.00 ? 1175 PRO A N    7  
ATOM 10839 C CA   . PRO A 1 43  ? 3.837   -8.510  10.130  1.00 0.00 ? 1175 PRO A CA   7  
ATOM 10840 C C    . PRO A 1 43  ? 5.001   -8.689  9.161   1.00 0.00 ? 1175 PRO A C    7  
ATOM 10841 O O    . PRO A 1 43  ? 5.222   -7.857  8.281   1.00 0.00 ? 1175 PRO A O    7  
ATOM 10842 C CB   . PRO A 1 43  ? 4.227   -7.559  11.264  1.00 0.00 ? 1175 PRO A CB   7  
ATOM 10843 C CG   . PRO A 1 43  ? 3.495   -8.071  12.456  1.00 0.00 ? 1175 PRO A CG   7  
ATOM 10844 C CD   . PRO A 1 43  ? 3.356   -9.552  12.282  1.00 0.00 ? 1175 PRO A CD   7  
ATOM 10845 H HA   . PRO A 1 43  ? 2.986   -8.110  9.599   1.00 0.00 ? 1175 PRO A HA   7  
ATOM 10846 H HB2  . PRO A 1 43  ? 5.297   -7.591  11.412  1.00 0.00 ? 1175 PRO A HB2  7  
ATOM 10847 H HB3  . PRO A 1 43  ? 3.922   -6.553  11.016  1.00 0.00 ? 1175 PRO A HB3  7  
ATOM 10848 H HG2  . PRO A 1 43  ? 4.059   -7.860  13.352  1.00 0.00 ? 1175 PRO A HG2  7  
ATOM 10849 H HG3  . PRO A 1 43  ? 2.518   -7.616  12.511  1.00 0.00 ? 1175 PRO A HG3  7  
ATOM 10850 H HD2  . PRO A 1 43  ? 4.138   -10.067 12.821  1.00 0.00 ? 1175 PRO A HD2  7  
ATOM 10851 H HD3  . PRO A 1 43  ? 2.384   -9.878  12.621  1.00 0.00 ? 1175 PRO A HD3  7  
ATOM 10852 N N    . ALA A 1 44  ? 5.742   -9.779  9.328   1.00 0.00 ? 1176 ALA A N    7  
ATOM 10853 C CA   . ALA A 1 44  ? 6.882   -10.068 8.466   1.00 0.00 ? 1176 ALA A CA   7  
ATOM 10854 C C    . ALA A 1 44  ? 6.472   -10.948 7.291   1.00 0.00 ? 1176 ALA A C    7  
ATOM 10855 O O    . ALA A 1 44  ? 6.827   -10.673 6.144   1.00 0.00 ? 1176 ALA A O    7  
ATOM 10856 C CB   . ALA A 1 44  ? 7.992   -10.734 9.265   1.00 0.00 ? 1176 ALA A CB   7  
ATOM 10857 H H    . ALA A 1 44  ? 5.516   -10.405 10.047  1.00 0.00 ? 1176 ALA A H    7  
ATOM 10858 H HA   . ALA A 1 44  ? 7.259   -9.129  8.086   1.00 0.00 ? 1176 ALA A HA   7  
ATOM 10859 H HB1  . ALA A 1 44  ? 8.815   -10.971 8.607   1.00 0.00 ? 1176 ALA A HB1  7  
ATOM 10860 H HB2  . ALA A 1 44  ? 8.331   -10.062 10.039  1.00 0.00 ? 1176 ALA A HB2  7  
ATOM 10861 H HB3  . ALA A 1 44  ? 7.617   -11.641 9.714   1.00 0.00 ? 1176 ALA A HB3  7  
ATOM 10862 N N    . ILE A 1 45  ? 5.725   -12.007 7.583   1.00 0.00 ? 1177 ILE A N    7  
ATOM 10863 C CA   . ILE A 1 45  ? 5.267   -12.927 6.549   1.00 0.00 ? 1177 ILE A CA   7  
ATOM 10864 C C    . ILE A 1 45  ? 4.589   -12.178 5.407   1.00 0.00 ? 1177 ILE A C    7  
ATOM 10865 O O    . ILE A 1 45  ? 4.813   -12.478 4.234   1.00 0.00 ? 1177 ILE A O    7  
ATOM 10866 C CB   . ILE A 1 45  ? 4.287   -13.970 7.118   1.00 0.00 ? 1177 ILE A CB   7  
ATOM 10867 C CG1  . ILE A 1 45  ? 4.993   -14.861 8.142   1.00 0.00 ? 1177 ILE A CG1  7  
ATOM 10868 C CG2  . ILE A 1 45  ? 3.697   -14.810 5.995   1.00 0.00 ? 1177 ILE A CG2  7  
ATOM 10869 C CD1  . ILE A 1 45  ? 6.366   -15.318 7.700   1.00 0.00 ? 1177 ILE A CD1  7  
ATOM 10870 H H    . ILE A 1 45  ? 5.475   -12.173 8.516   1.00 0.00 ? 1177 ILE A H    7  
ATOM 10871 H HA   . ILE A 1 45  ? 6.131   -13.448 6.161   1.00 0.00 ? 1177 ILE A HA   7  
ATOM 10872 H HB   . ILE A 1 45  ? 3.479   -13.445 7.604   1.00 0.00 ? 1177 ILE A HB   7  
ATOM 10873 H HG12 . ILE A 1 45  ? 5.107   -14.316 9.066   1.00 0.00 ? 1177 ILE A HG12 7  
ATOM 10874 H HG13 . ILE A 1 45  ? 4.391   -15.740 8.319   1.00 0.00 ? 1177 ILE A HG13 7  
ATOM 10875 H HG21 . ILE A 1 45  ? 4.432   -15.525 5.656   1.00 0.00 ? 1177 ILE A HG21 7  
ATOM 10876 H HG22 . ILE A 1 45  ? 2.826   -15.335 6.358   1.00 0.00 ? 1177 ILE A HG22 7  
ATOM 10877 H HG23 . ILE A 1 45  ? 3.414   -14.167 5.174   1.00 0.00 ? 1177 ILE A HG23 7  
ATOM 10878 H HD11 . ILE A 1 45  ? 6.303   -15.742 6.709   1.00 0.00 ? 1177 ILE A HD11 7  
ATOM 10879 H HD12 . ILE A 1 45  ? 7.041   -14.475 7.691   1.00 0.00 ? 1177 ILE A HD12 7  
ATOM 10880 H HD13 . ILE A 1 45  ? 6.734   -16.066 8.388   1.00 0.00 ? 1177 ILE A HD13 7  
ATOM 10881 N N    . LEU A 1 46  ? 3.760   -11.201 5.758   1.00 0.00 ? 1178 LEU A N    7  
ATOM 10882 C CA   . LEU A 1 46  ? 3.049   -10.406 4.763   1.00 0.00 ? 1178 LEU A CA   7  
ATOM 10883 C C    . LEU A 1 46  ? 4.026   -9.744  3.796   1.00 0.00 ? 1178 LEU A C    7  
ATOM 10884 O O    . LEU A 1 46  ? 3.947   -9.945  2.584   1.00 0.00 ? 1178 LEU A O    7  
ATOM 10885 C CB   . LEU A 1 46  ? 2.193   -9.340  5.449   1.00 0.00 ? 1178 LEU A CB   7  
ATOM 10886 C CG   . LEU A 1 46  ? 1.046   -8.764  4.619   1.00 0.00 ? 1178 LEU A CG   7  
ATOM 10887 C CD1  . LEU A 1 46  ? 0.025   -9.843  4.297   1.00 0.00 ? 1178 LEU A CD1  7  
ATOM 10888 C CD2  . LEU A 1 46  ? 0.387   -7.605  5.352   1.00 0.00 ? 1178 LEU A CD2  7  
ATOM 10889 H H    . LEU A 1 46  ? 3.622   -11.009 6.709   1.00 0.00 ? 1178 LEU A H    7  
ATOM 10890 H HA   . LEU A 1 46  ? 2.405   -11.070 4.207   1.00 0.00 ? 1178 LEU A HA   7  
ATOM 10891 H HB2  . LEU A 1 46  ? 1.769   -9.779  6.339   1.00 0.00 ? 1178 LEU A HB2  7  
ATOM 10892 H HB3  . LEU A 1 46  ? 2.844   -8.523  5.728   1.00 0.00 ? 1178 LEU A HB3  7  
ATOM 10893 H HG   . LEU A 1 46  ? 1.440   -8.389  3.684   1.00 0.00 ? 1178 LEU A HG   7  
ATOM 10894 H HD11 . LEU A 1 46  ? 0.440   -10.528 3.573   1.00 0.00 ? 1178 LEU A HD11 7  
ATOM 10895 H HD12 . LEU A 1 46  ? -0.866  -9.387  3.891   1.00 0.00 ? 1178 LEU A HD12 7  
ATOM 10896 H HD13 . LEU A 1 46  ? -0.227  -10.381 5.200   1.00 0.00 ? 1178 LEU A HD13 7  
ATOM 10897 H HD21 . LEU A 1 46  ? 0.812   -7.516  6.341   1.00 0.00 ? 1178 LEU A HD21 7  
ATOM 10898 H HD22 . LEU A 1 46  ? -0.675  -7.787  5.432   1.00 0.00 ? 1178 LEU A HD22 7  
ATOM 10899 H HD23 . LEU A 1 46  ? 0.555   -6.689  4.804   1.00 0.00 ? 1178 LEU A HD23 7  
ATOM 10900 N N    . ALA A 1 47  ? 4.948   -8.957  4.340   1.00 0.00 ? 1179 ALA A N    7  
ATOM 10901 C CA   . ALA A 1 47  ? 5.943   -8.270  3.527   1.00 0.00 ? 1179 ALA A CA   7  
ATOM 10902 C C    . ALA A 1 47  ? 7.140   -7.842  4.368   1.00 0.00 ? 1179 ALA A C    7  
ATOM 10903 O O    . ALA A 1 47  ? 7.030   -7.674  5.584   1.00 0.00 ? 1179 ALA A O    7  
ATOM 10904 C CB   . ALA A 1 47  ? 5.321   -7.064  2.839   1.00 0.00 ? 1179 ALA A CB   7  
ATOM 10905 H H    . ALA A 1 47  ? 4.960   -8.837  5.313   1.00 0.00 ? 1179 ALA A H    7  
ATOM 10906 H HA   . ALA A 1 47  ? 6.280   -8.955  2.762   1.00 0.00 ? 1179 ALA A HA   7  
ATOM 10907 H HB1  . ALA A 1 47  ? 4.285   -7.273  2.614   1.00 0.00 ? 1179 ALA A HB1  7  
ATOM 10908 H HB2  . ALA A 1 47  ? 5.382   -6.206  3.492   1.00 0.00 ? 1179 ALA A HB2  7  
ATOM 10909 H HB3  . ALA A 1 47  ? 5.853   -6.858  1.922   1.00 0.00 ? 1179 ALA A HB3  7  
ATOM 10910 N N    . THR A 1 48  ? 8.285   -7.667  3.715   1.00 0.00 ? 1180 THR A N    7  
ATOM 10911 C CA   . THR A 1 48  ? 9.504   -7.261  4.404   1.00 0.00 ? 1180 THR A CA   7  
ATOM 10912 C C    . THR A 1 48  ? 9.687   -5.748  4.351   1.00 0.00 ? 1180 THR A C    7  
ATOM 10913 O O    . THR A 1 48  ? 9.089   -5.070  3.516   1.00 0.00 ? 1180 THR A O    7  
ATOM 10914 C CB   . THR A 1 48  ? 10.746  -7.939  3.796   1.00 0.00 ? 1180 THR A CB   7  
ATOM 10915 O OG1  . THR A 1 48  ? 11.028  -7.380  2.508   1.00 0.00 ? 1180 THR A OG1  7  
ATOM 10916 C CG2  . THR A 1 48  ? 10.535  -9.440  3.667   1.00 0.00 ? 1180 THR A CG2  7  
ATOM 10917 H H    . THR A 1 48  ? 8.309   -7.817  2.747   1.00 0.00 ? 1180 THR A H    7  
ATOM 10918 H HA   . THR A 1 48  ? 9.421   -7.568  5.437   1.00 0.00 ? 1180 THR A HA   7  
ATOM 10919 H HB   . THR A 1 48  ? 11.589  -7.763  4.449   1.00 0.00 ? 1180 THR A HB   7  
ATOM 10920 H HG1  . THR A 1 48  ? 10.226  -7.375  1.979   1.00 0.00 ? 1180 THR A HG1  7  
ATOM 10921 H HG21 . THR A 1 48  ? 11.411  -9.959  4.027   1.00 0.00 ? 1180 THR A HG21 7  
ATOM 10922 H HG22 . THR A 1 48  ? 10.366  -9.692  2.631   1.00 0.00 ? 1180 THR A HG22 7  
ATOM 10923 H HG23 . THR A 1 48  ? 9.677   -9.734  4.253   1.00 0.00 ? 1180 THR A HG23 7  
ATOM 10924 N N    . ASN A 1 49  ? 10.518  -5.226  5.246   1.00 0.00 ? 1181 ASN A N    7  
ATOM 10925 C CA   . ASN A 1 49  ? 10.780  -3.792  5.301   1.00 0.00 ? 1181 ASN A CA   7  
ATOM 10926 C C    . ASN A 1 49  ? 11.252  -3.273  3.945   1.00 0.00 ? 1181 ASN A C    7  
ATOM 10927 O O    . ASN A 1 49  ? 11.035  -2.111  3.603   1.00 0.00 ? 1181 ASN A O    7  
ATOM 10928 C CB   . ASN A 1 49  ? 11.830  -3.484  6.370   1.00 0.00 ? 1181 ASN A CB   7  
ATOM 10929 C CG   . ASN A 1 49  ? 11.410  -3.962  7.747   1.00 0.00 ? 1181 ASN A CG   7  
ATOM 10930 O OD1  . ASN A 1 49  ? 10.279  -3.733  8.177   1.00 0.00 ? 1181 ASN A OD1  7  
ATOM 10931 N ND2  . ASN A 1 49  ? 12.321  -4.629  8.446   1.00 0.00 ? 1181 ASN A ND2  7  
ATOM 10932 H H    . ASN A 1 49  ? 10.966  -5.818  5.886   1.00 0.00 ? 1181 ASN A H    7  
ATOM 10933 H HA   . ASN A 1 49  ? 9.857   -3.296  5.562   1.00 0.00 ? 1181 ASN A HA   7  
ATOM 10934 H HB2  . ASN A 1 49  ? 12.757  -3.975  6.108   1.00 0.00 ? 1181 ASN A HB2  7  
ATOM 10935 H HB3  . ASN A 1 49  ? 11.992  -2.418  6.412   1.00 0.00 ? 1181 ASN A HB3  7  
ATOM 10936 H HD21 . ASN A 1 49  ? 13.202  -4.774  8.039   1.00 0.00 ? 1181 ASN A HD21 7  
ATOM 10937 H HD22 . ASN A 1 49  ? 12.076  -4.949  9.339   1.00 0.00 ? 1181 ASN A HD22 7  
ATOM 10938 N N    . LYS A 1 50  ? 11.897  -4.144  3.177   1.00 0.00 ? 1182 LYS A N    7  
ATOM 10939 C CA   . LYS A 1 50  ? 12.398  -3.777  1.858   1.00 0.00 ? 1182 LYS A CA   7  
ATOM 10940 C C    . LYS A 1 50  ? 11.252  -3.391  0.928   1.00 0.00 ? 1182 LYS A C    7  
ATOM 10941 O O    . LYS A 1 50  ? 11.274  -2.327  0.310   1.00 0.00 ? 1182 LYS A O    7  
ATOM 10942 C CB   . LYS A 1 50  ? 13.193  -4.935  1.251   1.00 0.00 ? 1182 LYS A CB   7  
ATOM 10943 C CG   . LYS A 1 50  ? 13.899  -4.575  -0.045  1.00 0.00 ? 1182 LYS A CG   7  
ATOM 10944 C CD   . LYS A 1 50  ? 15.217  -3.866  0.217   1.00 0.00 ? 1182 LYS A CD   7  
ATOM 10945 C CE   . LYS A 1 50  ? 15.806  -3.293  -1.063  1.00 0.00 ? 1182 LYS A CE   7  
ATOM 10946 N NZ   . LYS A 1 50  ? 17.279  -3.100  -0.958  1.00 0.00 ? 1182 LYS A NZ   7  
ATOM 10947 H H    . LYS A 1 50  ? 12.039  -5.058  3.505   1.00 0.00 ? 1182 LYS A H    7  
ATOM 10948 H HA   . LYS A 1 50  ? 13.052  -2.926  1.976   1.00 0.00 ? 1182 LYS A HA   7  
ATOM 10949 H HB2  . LYS A 1 50  ? 13.937  -5.259  1.964   1.00 0.00 ? 1182 LYS A HB2  7  
ATOM 10950 H HB3  . LYS A 1 50  ? 12.517  -5.755  1.052   1.00 0.00 ? 1182 LYS A HB3  7  
ATOM 10951 H HG2  . LYS A 1 50  ? 14.094  -5.480  -0.601  1.00 0.00 ? 1182 LYS A HG2  7  
ATOM 10952 H HG3  . LYS A 1 50  ? 13.260  -3.924  -0.624  1.00 0.00 ? 1182 LYS A HG3  7  
ATOM 10953 H HD2  . LYS A 1 50  ? 15.050  -3.059  0.916   1.00 0.00 ? 1182 LYS A HD2  7  
ATOM 10954 H HD3  . LYS A 1 50  ? 15.918  -4.572  0.641   1.00 0.00 ? 1182 LYS A HD3  7  
ATOM 10955 H HE2  . LYS A 1 50  ? 15.597  -3.972  -1.875  1.00 0.00 ? 1182 LYS A HE2  7  
ATOM 10956 H HE3  . LYS A 1 50  ? 15.340  -2.339  -1.262  1.00 0.00 ? 1182 LYS A HE3  7  
ATOM 10957 H HZ1  . LYS A 1 50  ? 17.598  -2.399  -1.657  1.00 0.00 ? 1182 LYS A HZ1  7  
ATOM 10958 H HZ2  . LYS A 1 50  ? 17.770  -3.999  -1.137  1.00 0.00 ? 1182 LYS A HZ2  7  
ATOM 10959 H HZ3  . LYS A 1 50  ? 17.529  -2.764  -0.007  1.00 0.00 ? 1182 LYS A HZ3  7  
ATOM 10960 N N    . ILE A 1 51  ? 10.252  -4.262  0.836   1.00 0.00 ? 1183 ILE A N    7  
ATOM 10961 C CA   . ILE A 1 51  ? 9.097   -4.010  -0.016  1.00 0.00 ? 1183 ILE A CA   7  
ATOM 10962 C C    . ILE A 1 51  ? 8.423   -2.690  0.347   1.00 0.00 ? 1183 ILE A C    7  
ATOM 10963 O O    . ILE A 1 51  ? 7.995   -1.938  -0.529  1.00 0.00 ? 1183 ILE A O    7  
ATOM 10964 C CB   . ILE A 1 51  ? 8.062   -5.146  0.088   1.00 0.00 ? 1183 ILE A CB   7  
ATOM 10965 C CG1  . ILE A 1 51  ? 8.627   -6.435  -0.512  1.00 0.00 ? 1183 ILE A CG1  7  
ATOM 10966 C CG2  . ILE A 1 51  ? 6.770   -4.752  -0.611  1.00 0.00 ? 1183 ILE A CG2  7  
ATOM 10967 C CD1  . ILE A 1 51  ? 7.840   -7.672  -0.138  1.00 0.00 ? 1183 ILE A CD1  7  
ATOM 10968 H H    . ILE A 1 51  ? 10.292  -5.092  1.354   1.00 0.00 ? 1183 ILE A H    7  
ATOM 10969 H HA   . ILE A 1 51  ? 9.442   -3.956  -1.038  1.00 0.00 ? 1183 ILE A HA   7  
ATOM 10970 H HB   . ILE A 1 51  ? 7.843   -5.309  1.132   1.00 0.00 ? 1183 ILE A HB   7  
ATOM 10971 H HG12 . ILE A 1 51  ? 8.626   -6.355  -1.588  1.00 0.00 ? 1183 ILE A HG12 7  
ATOM 10972 H HG13 . ILE A 1 51  ? 9.642   -6.570  -0.167  1.00 0.00 ? 1183 ILE A HG13 7  
ATOM 10973 H HG21 . ILE A 1 51  ? 7.001   -4.296  -1.563  1.00 0.00 ? 1183 ILE A HG21 7  
ATOM 10974 H HG22 . ILE A 1 51  ? 6.165   -5.632  -0.772  1.00 0.00 ? 1183 ILE A HG22 7  
ATOM 10975 H HG23 . ILE A 1 51  ? 6.228   -4.049  0.003   1.00 0.00 ? 1183 ILE A HG23 7  
ATOM 10976 H HD11 . ILE A 1 51  ? 8.204   -8.060  0.802   1.00 0.00 ? 1183 ILE A HD11 7  
ATOM 10977 H HD12 . ILE A 1 51  ? 6.795   -7.419  -0.044  1.00 0.00 ? 1183 ILE A HD12 7  
ATOM 10978 H HD13 . ILE A 1 51  ? 7.961   -8.422  -0.906  1.00 0.00 ? 1183 ILE A HD13 7  
ATOM 10979 N N    . LEU A 1 52  ? 8.334   -2.415  1.644   1.00 0.00 ? 1184 LEU A N    7  
ATOM 10980 C CA   . LEU A 1 52  ? 7.715   -1.185  2.124   1.00 0.00 ? 1184 LEU A CA   7  
ATOM 10981 C C    . LEU A 1 52  ? 8.459   0.040   1.601   1.00 0.00 ? 1184 LEU A C    7  
ATOM 10982 O O    . LEU A 1 52  ? 7.865   0.926   0.988   1.00 0.00 ? 1184 LEU A O    7  
ATOM 10983 C CB   . LEU A 1 52  ? 7.689   -1.166  3.653   1.00 0.00 ? 1184 LEU A CB   7  
ATOM 10984 C CG   . LEU A 1 52  ? 6.682   -2.103  4.319   1.00 0.00 ? 1184 LEU A CG   7  
ATOM 10985 C CD1  . LEU A 1 52  ? 6.807   -2.033  5.833   1.00 0.00 ? 1184 LEU A CD1  7  
ATOM 10986 C CD2  . LEU A 1 52  ? 5.265   -1.760  3.883   1.00 0.00 ? 1184 LEU A CD2  7  
ATOM 10987 H H    . LEU A 1 52  ? 8.694   -3.053  2.294   1.00 0.00 ? 1184 LEU A H    7  
ATOM 10988 H HA   . LEU A 1 52  ? 6.700   -1.159  1.755   1.00 0.00 ? 1184 LEU A HA   7  
ATOM 10989 H HB2  . LEU A 1 52  ? 8.674   -1.437  4.003   1.00 0.00 ? 1184 LEU A HB2  7  
ATOM 10990 H HB3  . LEU A 1 52  ? 7.462   -0.157  3.967   1.00 0.00 ? 1184 LEU A HB3  7  
ATOM 10991 H HG   . LEU A 1 52  ? 6.889   -3.120  4.015   1.00 0.00 ? 1184 LEU A HG   7  
ATOM 10992 H HD11 . LEU A 1 52  ? 7.849   -2.075  6.110   1.00 0.00 ? 1184 LEU A HD11 7  
ATOM 10993 H HD12 . LEU A 1 52  ? 6.282   -2.866  6.277   1.00 0.00 ? 1184 LEU A HD12 7  
ATOM 10994 H HD13 . LEU A 1 52  ? 6.377   -1.107  6.187   1.00 0.00 ? 1184 LEU A HD13 7  
ATOM 10995 H HD21 . LEU A 1 52  ? 4.621   -1.724  4.749   1.00 0.00 ? 1184 LEU A HD21 7  
ATOM 10996 H HD22 . LEU A 1 52  ? 4.906   -2.515  3.198   1.00 0.00 ? 1184 LEU A HD22 7  
ATOM 10997 H HD23 . LEU A 1 52  ? 5.262   -0.798  3.392   1.00 0.00 ? 1184 LEU A HD23 7  
ATOM 10998 N N    . VAL A 1 53  ? 9.765   0.081   1.847   1.00 0.00 ? 1185 VAL A N    7  
ATOM 10999 C CA   . VAL A 1 53  ? 10.592  1.195   1.398   1.00 0.00 ? 1185 VAL A CA   7  
ATOM 11000 C C    . VAL A 1 53  ? 10.349  1.501   -0.075  1.00 0.00 ? 1185 VAL A C    7  
ATOM 11001 O O    . VAL A 1 53  ? 10.358  2.661   -0.489  1.00 0.00 ? 1185 VAL A O    7  
ATOM 11002 C CB   . VAL A 1 53  ? 12.090  0.904   1.611   1.00 0.00 ? 1185 VAL A CB   7  
ATOM 11003 C CG1  . VAL A 1 53  ? 12.940  2.015   1.015   1.00 0.00 ? 1185 VAL A CG1  7  
ATOM 11004 C CG2  . VAL A 1 53  ? 12.392  0.724   3.091   1.00 0.00 ? 1185 VAL A CG2  7  
ATOM 11005 H H    . VAL A 1 53  ? 10.182  -0.655  2.341   1.00 0.00 ? 1185 VAL A H    7  
ATOM 11006 H HA   . VAL A 1 53  ? 10.329  2.064   1.985   1.00 0.00 ? 1185 VAL A HA   7  
ATOM 11007 H HB   . VAL A 1 53  ? 12.332  -0.017  1.101   1.00 0.00 ? 1185 VAL A HB   7  
ATOM 11008 H HG11 . VAL A 1 53  ? 13.982  1.734   1.059   1.00 0.00 ? 1185 VAL A HG11 7  
ATOM 11009 H HG12 . VAL A 1 53  ? 12.652  2.178   -0.013  1.00 0.00 ? 1185 VAL A HG12 7  
ATOM 11010 H HG13 . VAL A 1 53  ? 12.790  2.924   1.579   1.00 0.00 ? 1185 VAL A HG13 7  
ATOM 11011 H HG21 . VAL A 1 53  ? 11.510  0.359   3.596   1.00 0.00 ? 1185 VAL A HG21 7  
ATOM 11012 H HG22 . VAL A 1 53  ? 13.196  0.012   3.211   1.00 0.00 ? 1185 VAL A HG22 7  
ATOM 11013 H HG23 . VAL A 1 53  ? 12.685  1.672   3.516   1.00 0.00 ? 1185 VAL A HG23 7  
ATOM 11014 N N    . ASP A 1 54  ? 10.132  0.454   -0.863  1.00 0.00 ? 1186 ASP A N    7  
ATOM 11015 C CA   . ASP A 1 54  ? 9.885   0.611   -2.292  1.00 0.00 ? 1186 ASP A CA   7  
ATOM 11016 C C    . ASP A 1 54  ? 8.635   1.449   -2.539  1.00 0.00 ? 1186 ASP A C    7  
ATOM 11017 O O    . ASP A 1 54  ? 8.705   2.528   -3.125  1.00 0.00 ? 1186 ASP A O    7  
ATOM 11018 C CB   . ASP A 1 54  ? 9.737   -0.758  -2.959  1.00 0.00 ? 1186 ASP A CB   7  
ATOM 11019 C CG   . ASP A 1 54  ? 11.075  -1.394  -3.278  1.00 0.00 ? 1186 ASP A CG   7  
ATOM 11020 O OD1  . ASP A 1 54  ? 11.979  -1.339  -2.418  1.00 0.00 ? 1186 ASP A OD1  7  
ATOM 11021 O OD2  . ASP A 1 54  ? 11.220  -1.947  -4.389  1.00 0.00 ? 1186 ASP A OD2  7  
ATOM 11022 H H    . ASP A 1 54  ? 10.138  -0.446  -0.475  1.00 0.00 ? 1186 ASP A H    7  
ATOM 11023 H HA   . ASP A 1 54  ? 10.735  1.120   -2.722  1.00 0.00 ? 1186 ASP A HA   7  
ATOM 11024 H HB2  . ASP A 1 54  ? 9.195   -1.417  -2.296  1.00 0.00 ? 1186 ASP A HB2  7  
ATOM 11025 H HB3  . ASP A 1 54  ? 9.183   -0.645  -3.879  1.00 0.00 ? 1186 ASP A HB3  7  
ATOM 11026 N N    . MET A 1 55  ? 7.491   0.943   -2.088  1.00 0.00 ? 1187 MET A N    7  
ATOM 11027 C CA   . MET A 1 55  ? 6.225   1.645   -2.260  1.00 0.00 ? 1187 MET A CA   7  
ATOM 11028 C C    . MET A 1 55  ? 6.300   3.053   -1.677  1.00 0.00 ? 1187 MET A C    7  
ATOM 11029 O O    . MET A 1 55  ? 5.509   3.925   -2.033  1.00 0.00 ? 1187 MET A O    7  
ATOM 11030 C CB   . MET A 1 55  ? 5.090   0.865   -1.594  1.00 0.00 ? 1187 MET A CB   7  
ATOM 11031 C CG   . MET A 1 55  ? 4.844   -0.500  -2.216  1.00 0.00 ? 1187 MET A CG   7  
ATOM 11032 S SD   . MET A 1 55  ? 3.628   -1.470  -1.305  1.00 0.00 ? 1187 MET A SD   7  
ATOM 11033 C CE   . MET A 1 55  ? 2.107   -0.674  -1.816  1.00 0.00 ? 1187 MET A CE   7  
ATOM 11034 H H    . MET A 1 55  ? 7.499   0.077   -1.628  1.00 0.00 ? 1187 MET A H    7  
ATOM 11035 H HA   . MET A 1 55  ? 6.027   1.717   -3.319  1.00 0.00 ? 1187 MET A HA   7  
ATOM 11036 H HB2  . MET A 1 55  ? 5.330   0.723   -0.551  1.00 0.00 ? 1187 MET A HB2  7  
ATOM 11037 H HB3  . MET A 1 55  ? 4.179   1.441   -1.671  1.00 0.00 ? 1187 MET A HB3  7  
ATOM 11038 H HG2  . MET A 1 55  ? 4.488   -0.362  -3.226  1.00 0.00 ? 1187 MET A HG2  7  
ATOM 11039 H HG3  . MET A 1 55  ? 5.777   -1.044  -2.237  1.00 0.00 ? 1187 MET A HG3  7  
ATOM 11040 H HE1  . MET A 1 55  ? 1.785   -1.087  -2.761  1.00 0.00 ? 1187 MET A HE1  7  
ATOM 11041 H HE2  . MET A 1 55  ? 1.344   -0.843  -1.070  1.00 0.00 ? 1187 MET A HE2  7  
ATOM 11042 H HE3  . MET A 1 55  ? 2.276   0.387   -1.926  1.00 0.00 ? 1187 MET A HE3  7  
ATOM 11043 N N    . ALA A 1 56  ? 7.257   3.266   -0.779  1.00 0.00 ? 1188 ALA A N    7  
ATOM 11044 C CA   . ALA A 1 56  ? 7.436   4.568   -0.148  1.00 0.00 ? 1188 ALA A CA   7  
ATOM 11045 C C    . ALA A 1 56  ? 8.084   5.559   -1.109  1.00 0.00 ? 1188 ALA A C    7  
ATOM 11046 O O    . ALA A 1 56  ? 7.967   6.773   -0.938  1.00 0.00 ? 1188 ALA A O    7  
ATOM 11047 C CB   . ALA A 1 56  ? 8.272   4.432   1.115   1.00 0.00 ? 1188 ALA A CB   7  
ATOM 11048 H H    . ALA A 1 56  ? 7.857   2.531   -0.536  1.00 0.00 ? 1188 ALA A H    7  
ATOM 11049 H HA   . ALA A 1 56  ? 6.461   4.940   0.133   1.00 0.00 ? 1188 ALA A HA   7  
ATOM 11050 H HB1  . ALA A 1 56  ? 9.172   3.878   0.892   1.00 0.00 ? 1188 ALA A HB1  7  
ATOM 11051 H HB2  . ALA A 1 56  ? 8.534   5.413   1.481   1.00 0.00 ? 1188 ALA A HB2  7  
ATOM 11052 H HB3  . ALA A 1 56  ? 7.703   3.906   1.868   1.00 0.00 ? 1188 ALA A HB3  7  
ATOM 11053 N N    . LYS A 1 57  ? 8.768   5.034   -2.121  1.00 0.00 ? 1189 LYS A N    7  
ATOM 11054 C CA   . LYS A 1 57  ? 9.434   5.872   -3.110  1.00 0.00 ? 1189 LYS A CA   7  
ATOM 11055 C C    . LYS A 1 57  ? 8.633   5.924   -4.407  1.00 0.00 ? 1189 LYS A C    7  
ATOM 11056 O O    . LYS A 1 57  ? 8.336   7.003   -4.921  1.00 0.00 ? 1189 LYS A O    7  
ATOM 11057 C CB   . LYS A 1 57  ? 10.843  5.344   -3.390  1.00 0.00 ? 1189 LYS A CB   7  
ATOM 11058 C CG   . LYS A 1 57  ? 11.858  5.725   -2.325  1.00 0.00 ? 1189 LYS A CG   7  
ATOM 11059 C CD   . LYS A 1 57  ? 12.974  4.699   -2.226  1.00 0.00 ? 1189 LYS A CD   7  
ATOM 11060 C CE   . LYS A 1 57  ? 14.160  5.240   -1.442  1.00 0.00 ? 1189 LYS A CE   7  
ATOM 11061 N NZ   . LYS A 1 57  ? 15.039  6.096   -2.287  1.00 0.00 ? 1189 LYS A NZ   7  
ATOM 11062 H H    . LYS A 1 57  ? 8.825   4.059   -2.204  1.00 0.00 ? 1189 LYS A H    7  
ATOM 11063 H HA   . LYS A 1 57  ? 9.507   6.870   -2.706  1.00 0.00 ? 1189 LYS A HA   7  
ATOM 11064 H HB2  . LYS A 1 57  ? 10.805  4.266   -3.452  1.00 0.00 ? 1189 LYS A HB2  7  
ATOM 11065 H HB3  . LYS A 1 57  ? 11.181  5.739   -4.337  1.00 0.00 ? 1189 LYS A HB3  7  
ATOM 11066 H HG2  . LYS A 1 57  ? 12.286  6.684   -2.576  1.00 0.00 ? 1189 LYS A HG2  7  
ATOM 11067 H HG3  . LYS A 1 57  ? 11.356  5.792   -1.370  1.00 0.00 ? 1189 LYS A HG3  7  
ATOM 11068 H HD2  . LYS A 1 57  ? 12.598  3.818   -1.726  1.00 0.00 ? 1189 LYS A HD2  7  
ATOM 11069 H HD3  . LYS A 1 57  ? 13.301  4.438   -3.223  1.00 0.00 ? 1189 LYS A HD3  7  
ATOM 11070 H HE2  . LYS A 1 57  ? 13.791  5.824   -0.614  1.00 0.00 ? 1189 LYS A HE2  7  
ATOM 11071 H HE3  . LYS A 1 57  ? 14.736  4.407   -1.067  1.00 0.00 ? 1189 LYS A HE3  7  
ATOM 11072 H HZ1  . LYS A 1 57  ? 14.546  6.978   -2.535  1.00 0.00 ? 1189 LYS A HZ1  7  
ATOM 11073 H HZ2  . LYS A 1 57  ? 15.291  5.595   -3.162  1.00 0.00 ? 1189 LYS A HZ2  7  
ATOM 11074 H HZ3  . LYS A 1 57  ? 15.911  6.331   -1.771  1.00 0.00 ? 1189 LYS A HZ3  7  
ATOM 11075 N N    . MET A 1 58  ? 8.286   4.753   -4.931  1.00 0.00 ? 1190 MET A N    7  
ATOM 11076 C CA   . MET A 1 58  ? 7.517   4.667   -6.167  1.00 0.00 ? 1190 MET A CA   7  
ATOM 11077 C C    . MET A 1 58  ? 6.057   5.038   -5.926  1.00 0.00 ? 1190 MET A C    7  
ATOM 11078 O O    . MET A 1 58  ? 5.337   5.400   -6.857  1.00 0.00 ? 1190 MET A O    7  
ATOM 11079 C CB   . MET A 1 58  ? 7.606   3.256   -6.751  1.00 0.00 ? 1190 MET A CB   7  
ATOM 11080 C CG   . MET A 1 58  ? 9.031   2.800   -7.024  1.00 0.00 ? 1190 MET A CG   7  
ATOM 11081 S SD   . MET A 1 58  ? 9.752   1.905   -5.636  1.00 0.00 ? 1190 MET A SD   7  
ATOM 11082 C CE   . MET A 1 58  ? 10.119  0.329   -6.403  1.00 0.00 ? 1190 MET A CE   7  
ATOM 11083 H H    . MET A 1 58  ? 8.553   3.927   -4.476  1.00 0.00 ? 1190 MET A H    7  
ATOM 11084 H HA   . MET A 1 58  ? 7.943   5.366   -6.871  1.00 0.00 ? 1190 MET A HA   7  
ATOM 11085 H HB2  . MET A 1 58  ? 7.157   2.562   -6.056  1.00 0.00 ? 1190 MET A HB2  7  
ATOM 11086 H HB3  . MET A 1 58  ? 7.058   3.228   -7.681  1.00 0.00 ? 1190 MET A HB3  7  
ATOM 11087 H HG2  . MET A 1 58  ? 9.028   2.153   -7.889  1.00 0.00 ? 1190 MET A HG2  7  
ATOM 11088 H HG3  . MET A 1 58  ? 9.638   3.669   -7.230  1.00 0.00 ? 1190 MET A HG3  7  
ATOM 11089 H HE1  . MET A 1 58  ? 9.398   0.131   -7.183  1.00 0.00 ? 1190 MET A HE1  7  
ATOM 11090 H HE2  . MET A 1 58  ? 11.111  0.358   -6.829  1.00 0.00 ? 1190 MET A HE2  7  
ATOM 11091 H HE3  . MET A 1 58  ? 10.069  -0.454  -5.659  1.00 0.00 ? 1190 MET A HE3  7  
ATOM 11092 N N    . ARG A 1 59  ? 5.628   4.947   -4.672  1.00 0.00 ? 1191 ARG A N    7  
ATOM 11093 C CA   . ARG A 1 59  ? 4.253   5.272   -4.309  1.00 0.00 ? 1191 ARG A CA   7  
ATOM 11094 C C    . ARG A 1 59  ? 3.292   4.900   -5.435  1.00 0.00 ? 1191 ARG A C    7  
ATOM 11095 O O    . ARG A 1 59  ? 2.519   5.726   -5.922  1.00 0.00 ? 1191 ARG A O    7  
ATOM 11096 C CB   . ARG A 1 59  ? 4.127   6.762   -3.988  1.00 0.00 ? 1191 ARG A CB   7  
ATOM 11097 C CG   . ARG A 1 59  ? 4.615   7.670   -5.105  1.00 0.00 ? 1191 ARG A CG   7  
ATOM 11098 C CD   . ARG A 1 59  ? 4.874   9.082   -4.603  1.00 0.00 ? 1191 ARG A CD   7  
ATOM 11099 N NE   . ARG A 1 59  ? 5.754   9.828   -5.499  1.00 0.00 ? 1191 ARG A NE   7  
ATOM 11100 C CZ   . ARG A 1 59  ? 6.508   10.848  -5.105  1.00 0.00 ? 1191 ARG A CZ   7  
ATOM 11101 N NH1  . ARG A 1 59  ? 6.490   11.242  -3.839  1.00 0.00 ? 1191 ARG A NH1  7  
ATOM 11102 N NH2  . ARG A 1 59  ? 7.284   11.477  -5.980  1.00 0.00 ? 1191 ARG A NH2  7  
ATOM 11103 H H    . ARG A 1 59  ? 6.249   4.653   -3.973  1.00 0.00 ? 1191 ARG A H    7  
ATOM 11104 H HA   . ARG A 1 59  ? 3.998   4.700   -3.430  1.00 0.00 ? 1191 ARG A HA   7  
ATOM 11105 H HB2  . ARG A 1 59  ? 3.089   6.991   -3.796  1.00 0.00 ? 1191 ARG A HB2  7  
ATOM 11106 H HB3  . ARG A 1 59  ? 4.705   6.977   -3.101  1.00 0.00 ? 1191 ARG A HB3  7  
ATOM 11107 H HG2  . ARG A 1 59  ? 5.533   7.269   -5.508  1.00 0.00 ? 1191 ARG A HG2  7  
ATOM 11108 H HG3  . ARG A 1 59  ? 3.864   7.705   -5.881  1.00 0.00 ? 1191 ARG A HG3  7  
ATOM 11109 H HD2  . ARG A 1 59  ? 3.931   9.601   -4.526  1.00 0.00 ? 1191 ARG A HD2  7  
ATOM 11110 H HD3  . ARG A 1 59  ? 5.333   9.023   -3.628  1.00 0.00 ? 1191 ARG A HD3  7  
ATOM 11111 H HE   . ARG A 1 59  ? 5.783   9.554   -6.439  1.00 0.00 ? 1191 ARG A HE   7  
ATOM 11112 H HH11 . ARG A 1 59  ? 5.908   10.769  -3.178  1.00 0.00 ? 1191 ARG A HH11 7  
ATOM 11113 H HH12 . ARG A 1 59  ? 7.060   12.009  -3.546  1.00 0.00 ? 1191 ARG A HH12 7  
ATOM 11114 H HH21 . ARG A 1 59  ? 7.300   11.184  -6.935  1.00 0.00 ? 1191 ARG A HH21 7  
ATOM 11115 H HH22 . ARG A 1 59  ? 7.851   12.245  -5.683  1.00 0.00 ? 1191 ARG A HH22 7  
ATOM 11116 N N    . PRO A 1 60  ? 3.340   3.629   -5.858  1.00 0.00 ? 1192 PRO A N    7  
ATOM 11117 C CA   . PRO A 1 60  ? 2.480   3.119   -6.930  1.00 0.00 ? 1192 PRO A CA   7  
ATOM 11118 C C    . PRO A 1 60  ? 1.019   3.025   -6.507  1.00 0.00 ? 1192 PRO A C    7  
ATOM 11119 O O    . PRO A 1 60  ? 0.714   2.805   -5.334  1.00 0.00 ? 1192 PRO A O    7  
ATOM 11120 C CB   . PRO A 1 60  ? 3.047   1.724   -7.206  1.00 0.00 ? 1192 PRO A CB   7  
ATOM 11121 C CG   . PRO A 1 60  ? 3.704   1.323   -5.931  1.00 0.00 ? 1192 PRO A CG   7  
ATOM 11122 C CD   . PRO A 1 60  ? 4.237   2.591   -5.323  1.00 0.00 ? 1192 PRO A CD   7  
ATOM 11123 H HA   . PRO A 1 60  ? 2.557   3.723   -7.822  1.00 0.00 ? 1192 PRO A HA   7  
ATOM 11124 H HB2  . PRO A 1 60  ? 2.242   1.050   -7.466  1.00 0.00 ? 1192 PRO A HB2  7  
ATOM 11125 H HB3  . PRO A 1 60  ? 3.758   1.774   -8.017  1.00 0.00 ? 1192 PRO A HB3  7  
ATOM 11126 H HG2  . PRO A 1 60  ? 2.980   0.866   -5.273  1.00 0.00 ? 1192 PRO A HG2  7  
ATOM 11127 H HG3  . PRO A 1 60  ? 4.513   0.637   -6.135  1.00 0.00 ? 1192 PRO A HG3  7  
ATOM 11128 H HD2  . PRO A 1 60  ? 4.176   2.547   -4.245  1.00 0.00 ? 1192 PRO A HD2  7  
ATOM 11129 H HD3  . PRO A 1 60  ? 5.255   2.762   -5.639  1.00 0.00 ? 1192 PRO A HD3  7  
ATOM 11130 N N    . THR A 1 61  ? 0.116   3.194   -7.468  1.00 0.00 ? 1193 THR A N    7  
ATOM 11131 C CA   . THR A 1 61  ? -1.314  3.129   -7.195  1.00 0.00 ? 1193 THR A CA   7  
ATOM 11132 C C    . THR A 1 61  ? -2.009  2.146   -8.130  1.00 0.00 ? 1193 THR A C    7  
ATOM 11133 O O    . THR A 1 61  ? -3.211  2.252   -8.377  1.00 0.00 ? 1193 THR A O    7  
ATOM 11134 C CB   . THR A 1 61  ? -1.976  4.513   -7.338  1.00 0.00 ? 1193 THR A CB   7  
ATOM 11135 O OG1  . THR A 1 61  ? -1.730  5.040   -8.646  1.00 0.00 ? 1193 THR A OG1  7  
ATOM 11136 C CG2  . THR A 1 61  ? -1.446  5.478   -6.289  1.00 0.00 ? 1193 THR A CG2  7  
ATOM 11137 H H    . THR A 1 61  ? 0.421   3.367   -8.383  1.00 0.00 ? 1193 THR A H    7  
ATOM 11138 H HA   . THR A 1 61  ? -1.444  2.795   -6.175  1.00 0.00 ? 1193 THR A HA   7  
ATOM 11139 H HB   . THR A 1 61  ? -3.042  4.401   -7.198  1.00 0.00 ? 1193 THR A HB   7  
ATOM 11140 H HG1  . THR A 1 61  ? -2.195  4.510   -9.298  1.00 0.00 ? 1193 THR A HG1  7  
ATOM 11141 H HG21 . THR A 1 61  ? -1.858  5.222   -5.323  1.00 0.00 ? 1193 THR A HG21 7  
ATOM 11142 H HG22 . THR A 1 61  ? -1.736  6.486   -6.548  1.00 0.00 ? 1193 THR A HG22 7  
ATOM 11143 H HG23 . THR A 1 61  ? -0.370  5.411   -6.250  1.00 0.00 ? 1193 THR A HG23 7  
ATOM 11144 N N    . THR A 1 62  ? -1.246  1.189   -8.647  1.00 0.00 ? 1194 THR A N    7  
ATOM 11145 C CA   . THR A 1 62  ? -1.788  0.186   -9.556  1.00 0.00 ? 1194 THR A CA   7  
ATOM 11146 C C    . THR A 1 62  ? -1.202  -1.191  -9.269  1.00 0.00 ? 1194 THR A C    7  
ATOM 11147 O O    . THR A 1 62  ? 0.012   -1.385  -9.331  1.00 0.00 ? 1194 THR A O    7  
ATOM 11148 C CB   . THR A 1 62  ? -1.512  0.553   -11.026 1.00 0.00 ? 1194 THR A CB   7  
ATOM 11149 O OG1  . THR A 1 62  ? -0.133  0.900   -11.194 1.00 0.00 ? 1194 THR A OG1  7  
ATOM 11150 C CG2  . THR A 1 62  ? -2.390  1.714   -11.468 1.00 0.00 ? 1194 THR A CG2  7  
ATOM 11151 H H    . THR A 1 62  ? -0.295  1.157   -8.412  1.00 0.00 ? 1194 THR A H    7  
ATOM 11152 H HA   . THR A 1 62  ? -2.858  0.149   -9.411  1.00 0.00 ? 1194 THR A HA   7  
ATOM 11153 H HB   . THR A 1 62  ? -1.738  -0.305  -11.644 1.00 0.00 ? 1194 THR A HB   7  
ATOM 11154 H HG1  . THR A 1 62  ? -0.046  1.521   -11.922 1.00 0.00 ? 1194 THR A HG1  7  
ATOM 11155 H HG21 . THR A 1 62  ? -1.905  2.647   -11.222 1.00 0.00 ? 1194 THR A HG21 7  
ATOM 11156 H HG22 . THR A 1 62  ? -3.343  1.658   -10.962 1.00 0.00 ? 1194 THR A HG22 7  
ATOM 11157 H HG23 . THR A 1 62  ? -2.546  1.661   -12.535 1.00 0.00 ? 1194 THR A HG23 7  
ATOM 11158 N N    . VAL A 1 63  ? -2.071  -2.146  -8.955  1.00 0.00 ? 1195 VAL A N    7  
ATOM 11159 C CA   . VAL A 1 63  ? -1.639  -3.507  -8.659  1.00 0.00 ? 1195 VAL A CA   7  
ATOM 11160 C C    . VAL A 1 63  ? -0.526  -3.946  -9.603  1.00 0.00 ? 1195 VAL A C    7  
ATOM 11161 O O    . VAL A 1 63  ? 0.425   -4.610  -9.190  1.00 0.00 ? 1195 VAL A O    7  
ATOM 11162 C CB   . VAL A 1 63  ? -2.810  -4.502  -8.765  1.00 0.00 ? 1195 VAL A CB   7  
ATOM 11163 C CG1  . VAL A 1 63  ? -3.287  -4.615  -10.205 1.00 0.00 ? 1195 VAL A CG1  7  
ATOM 11164 C CG2  . VAL A 1 63  ? -2.401  -5.863  -8.222  1.00 0.00 ? 1195 VAL A CG2  7  
ATOM 11165 H H    . VAL A 1 63  ? -3.027  -1.930  -8.921  1.00 0.00 ? 1195 VAL A H    7  
ATOM 11166 H HA   . VAL A 1 63  ? -1.267  -3.526  -7.645  1.00 0.00 ? 1195 VAL A HA   7  
ATOM 11167 H HB   . VAL A 1 63  ? -3.628  -4.130  -8.166  1.00 0.00 ? 1195 VAL A HB   7  
ATOM 11168 H HG11 . VAL A 1 63  ? -4.324  -4.918  -10.217 1.00 0.00 ? 1195 VAL A HG11 7  
ATOM 11169 H HG12 . VAL A 1 63  ? -3.184  -3.658  -10.694 1.00 0.00 ? 1195 VAL A HG12 7  
ATOM 11170 H HG13 . VAL A 1 63  ? -2.691  -5.352  -10.724 1.00 0.00 ? 1195 VAL A HG13 7  
ATOM 11171 H HG21 . VAL A 1 63  ? -3.204  -6.568  -8.378  1.00 0.00 ? 1195 VAL A HG21 7  
ATOM 11172 H HG22 . VAL A 1 63  ? -1.516  -6.206  -8.737  1.00 0.00 ? 1195 VAL A HG22 7  
ATOM 11173 H HG23 . VAL A 1 63  ? -2.193  -5.782  -7.165  1.00 0.00 ? 1195 VAL A HG23 7  
ATOM 11174 N N    . GLU A 1 64  ? -0.650  -3.571  -10.873 1.00 0.00 ? 1196 GLU A N    7  
ATOM 11175 C CA   . GLU A 1 64  ? 0.346   -3.928  -11.875 1.00 0.00 ? 1196 GLU A CA   7  
ATOM 11176 C C    . GLU A 1 64  ? 1.731   -3.436  -11.465 1.00 0.00 ? 1196 GLU A C    7  
ATOM 11177 O O    . GLU A 1 64  ? 2.628   -4.233  -11.189 1.00 0.00 ? 1196 GLU A O    7  
ATOM 11178 C CB   . GLU A 1 64  ? -0.033  -3.339  -13.236 1.00 0.00 ? 1196 GLU A CB   7  
ATOM 11179 C CG   . GLU A 1 64  ? -1.261  -3.984  -13.857 1.00 0.00 ? 1196 GLU A CG   7  
ATOM 11180 C CD   . GLU A 1 64  ? -1.262  -3.899  -15.371 1.00 0.00 ? 1196 GLU A CD   7  
ATOM 11181 O OE1  . GLU A 1 64  ? -1.793  -2.905  -15.909 1.00 0.00 ? 1196 GLU A OE1  7  
ATOM 11182 O OE2  . GLU A 1 64  ? -0.731  -4.827  -16.017 1.00 0.00 ? 1196 GLU A OE2  7  
ATOM 11183 H H    . GLU A 1 64  ? -1.431  -3.043  -11.141 1.00 0.00 ? 1196 GLU A H    7  
ATOM 11184 H HA   . GLU A 1 64  ? 0.368   -5.004  -11.953 1.00 0.00 ? 1196 GLU A HA   7  
ATOM 11185 H HB2  . GLU A 1 64  ? -0.227  -2.283  -13.116 1.00 0.00 ? 1196 GLU A HB2  7  
ATOM 11186 H HB3  . GLU A 1 64  ? 0.797   -3.469  -13.914 1.00 0.00 ? 1196 GLU A HB3  7  
ATOM 11187 H HG2  . GLU A 1 64  ? -1.290  -5.024  -13.570 1.00 0.00 ? 1196 GLU A HG2  7  
ATOM 11188 H HG3  . GLU A 1 64  ? -2.142  -3.484  -13.483 1.00 0.00 ? 1196 GLU A HG3  7  
ATOM 11189 N N    . ASN A 1 65  ? 1.898   -2.118  -11.427 1.00 0.00 ? 1197 ASN A N    7  
ATOM 11190 C CA   . ASN A 1 65  ? 3.173   -1.519  -11.051 1.00 0.00 ? 1197 ASN A CA   7  
ATOM 11191 C C    . ASN A 1 65  ? 3.716   -2.151  -9.773  1.00 0.00 ? 1197 ASN A C    7  
ATOM 11192 O O    . ASN A 1 65  ? 4.910   -2.429  -9.663  1.00 0.00 ? 1197 ASN A O    7  
ATOM 11193 C CB   . ASN A 1 65  ? 3.015   -0.010  -10.860 1.00 0.00 ? 1197 ASN A CB   7  
ATOM 11194 C CG   . ASN A 1 65  ? 2.804   0.721   -12.172 1.00 0.00 ? 1197 ASN A CG   7  
ATOM 11195 O OD1  . ASN A 1 65  ? 2.622   0.099   -13.219 1.00 0.00 ? 1197 ASN A OD1  7  
ATOM 11196 N ND2  . ASN A 1 65  ? 2.827   2.048   -12.121 1.00 0.00 ? 1197 ASN A ND2  7  
ATOM 11197 H H    . ASN A 1 65  ? 1.145   -1.534  -11.658 1.00 0.00 ? 1197 ASN A H    7  
ATOM 11198 H HA   . ASN A 1 65  ? 3.873   -1.700  -11.853 1.00 0.00 ? 1197 ASN A HA   7  
ATOM 11199 H HB2  . ASN A 1 65  ? 2.162   0.179   -10.224 1.00 0.00 ? 1197 ASN A HB2  7  
ATOM 11200 H HB3  . ASN A 1 65  ? 3.903   0.383   -10.389 1.00 0.00 ? 1197 ASN A HB3  7  
ATOM 11201 H HD21 . ASN A 1 65  ? 2.977   2.475   -11.252 1.00 0.00 ? 1197 ASN A HD21 7  
ATOM 11202 H HD22 . ASN A 1 65  ? 2.693   2.545   -12.954 1.00 0.00 ? 1197 ASN A HD22 7  
ATOM 11203 N N    . VAL A 1 66  ? 2.829   -2.377  -8.809  1.00 0.00 ? 1198 VAL A N    7  
ATOM 11204 C CA   . VAL A 1 66  ? 3.217   -2.977  -7.538  1.00 0.00 ? 1198 VAL A CA   7  
ATOM 11205 C C    . VAL A 1 66  ? 4.034   -4.246  -7.757  1.00 0.00 ? 1198 VAL A C    7  
ATOM 11206 O O    . VAL A 1 66  ? 5.088   -4.433  -7.149  1.00 0.00 ? 1198 VAL A O    7  
ATOM 11207 C CB   . VAL A 1 66  ? 1.986   -3.315  -6.677  1.00 0.00 ? 1198 VAL A CB   7  
ATOM 11208 C CG1  . VAL A 1 66  ? 2.409   -3.980  -5.376  1.00 0.00 ? 1198 VAL A CG1  7  
ATOM 11209 C CG2  . VAL A 1 66  ? 1.168   -2.061  -6.403  1.00 0.00 ? 1198 VAL A CG2  7  
ATOM 11210 H H    . VAL A 1 66  ? 1.891   -2.134  -8.955  1.00 0.00 ? 1198 VAL A H    7  
ATOM 11211 H HA   . VAL A 1 66  ? 3.821   -2.261  -7.001  1.00 0.00 ? 1198 VAL A HA   7  
ATOM 11212 H HB   . VAL A 1 66  ? 1.367   -4.010  -7.226  1.00 0.00 ? 1198 VAL A HB   7  
ATOM 11213 H HG11 . VAL A 1 66  ? 3.364   -4.465  -5.515  1.00 0.00 ? 1198 VAL A HG11 7  
ATOM 11214 H HG12 . VAL A 1 66  ? 2.492   -3.233  -4.600  1.00 0.00 ? 1198 VAL A HG12 7  
ATOM 11215 H HG13 . VAL A 1 66  ? 1.671   -4.715  -5.091  1.00 0.00 ? 1198 VAL A HG13 7  
ATOM 11216 H HG21 . VAL A 1 66  ? 1.163   -1.861  -5.342  1.00 0.00 ? 1198 VAL A HG21 7  
ATOM 11217 H HG22 . VAL A 1 66  ? 1.607   -1.223  -6.925  1.00 0.00 ? 1198 VAL A HG22 7  
ATOM 11218 H HG23 . VAL A 1 66  ? 0.156   -2.209  -6.747  1.00 0.00 ? 1198 VAL A HG23 7  
ATOM 11219 N N    . LYS A 1 67  ? 3.540   -5.117  -8.631  1.00 0.00 ? 1199 LYS A N    7  
ATOM 11220 C CA   . LYS A 1 67  ? 4.223   -6.369  -8.933  1.00 0.00 ? 1199 LYS A CA   7  
ATOM 11221 C C    . LYS A 1 67  ? 5.693   -6.122  -9.260  1.00 0.00 ? 1199 LYS A C    7  
ATOM 11222 O O    . LYS A 1 67  ? 6.548   -6.967  -8.996  1.00 0.00 ? 1199 LYS A O    7  
ATOM 11223 C CB   . LYS A 1 67  ? 3.541   -7.076  -10.106 1.00 0.00 ? 1199 LYS A CB   7  
ATOM 11224 C CG   . LYS A 1 67  ? 2.159   -7.612  -9.773  1.00 0.00 ? 1199 LYS A CG   7  
ATOM 11225 C CD   . LYS A 1 67  ? 1.338   -7.857  -11.028 1.00 0.00 ? 1199 LYS A CD   7  
ATOM 11226 C CE   . LYS A 1 67  ? 0.350   -8.997  -10.834 1.00 0.00 ? 1199 LYS A CE   7  
ATOM 11227 N NZ   . LYS A 1 67  ? -0.632  -8.702  -9.754  1.00 0.00 ? 1199 LYS A NZ   7  
ATOM 11228 H H    . LYS A 1 67  ? 2.695   -4.912  -9.084  1.00 0.00 ? 1199 LYS A H    7  
ATOM 11229 H HA   . LYS A 1 67  ? 4.163   -7.000  -8.059  1.00 0.00 ? 1199 LYS A HA   7  
ATOM 11230 H HB2  . LYS A 1 67  ? 3.446   -6.379  -10.925 1.00 0.00 ? 1199 LYS A HB2  7  
ATOM 11231 H HB3  . LYS A 1 67  ? 4.159   -7.905  -10.420 1.00 0.00 ? 1199 LYS A HB3  7  
ATOM 11232 H HG2  . LYS A 1 67  ? 2.264   -8.544  -9.237  1.00 0.00 ? 1199 LYS A HG2  7  
ATOM 11233 H HG3  . LYS A 1 67  ? 1.645   -6.893  -9.151  1.00 0.00 ? 1199 LYS A HG3  7  
ATOM 11234 H HD2  . LYS A 1 67  ? 0.790   -6.958  -11.270 1.00 0.00 ? 1199 LYS A HD2  7  
ATOM 11235 H HD3  . LYS A 1 67  ? 2.005   -8.104  -11.842 1.00 0.00 ? 1199 LYS A HD3  7  
ATOM 11236 H HE2  . LYS A 1 67  ? -0.182  -9.155  -11.759 1.00 0.00 ? 1199 LYS A HE2  7  
ATOM 11237 H HE3  . LYS A 1 67  ? 0.899   -9.891  -10.577 1.00 0.00 ? 1199 LYS A HE3  7  
ATOM 11238 H HZ1  . LYS A 1 67  ? -1.527  -9.198  -9.940  1.00 0.00 ? 1199 LYS A HZ1  7  
ATOM 11239 H HZ2  . LYS A 1 67  ? -0.818  -7.680  -9.709  1.00 0.00 ? 1199 LYS A HZ2  7  
ATOM 11240 H HZ3  . LYS A 1 67  ? -0.258  -9.017  -8.836  1.00 0.00 ? 1199 LYS A HZ3  7  
ATOM 11241 N N    . ARG A 1 68  ? 5.978   -4.958  -9.835  1.00 0.00 ? 1200 ARG A N    7  
ATOM 11242 C CA   . ARG A 1 68  ? 7.345   -4.600  -10.197 1.00 0.00 ? 1200 ARG A CA   7  
ATOM 11243 C C    . ARG A 1 68  ? 8.181   -4.317  -8.952  1.00 0.00 ? 1200 ARG A C    7  
ATOM 11244 O O    . ARG A 1 68  ? 9.394   -4.526  -8.947  1.00 0.00 ? 1200 ARG A O    7  
ATOM 11245 C CB   . ARG A 1 68  ? 7.347   -3.377  -11.115 1.00 0.00 ? 1200 ARG A CB   7  
ATOM 11246 C CG   . ARG A 1 68  ? 6.522   -3.562  -12.379 1.00 0.00 ? 1200 ARG A CG   7  
ATOM 11247 C CD   . ARG A 1 68  ? 6.156   -2.226  -13.005 1.00 0.00 ? 1200 ARG A CD   7  
ATOM 11248 N NE   . ARG A 1 68  ? 5.028   -2.344  -13.926 1.00 0.00 ? 1200 ARG A NE   7  
ATOM 11249 C CZ   . ARG A 1 68  ? 4.684   -1.397  -14.791 1.00 0.00 ? 1200 ARG A CZ   7  
ATOM 11250 N NH1  . ARG A 1 68  ? 5.376   -0.268  -14.854 1.00 0.00 ? 1200 ARG A NH1  7  
ATOM 11251 N NH2  . ARG A 1 68  ? 3.645   -1.579  -15.597 1.00 0.00 ? 1200 ARG A NH2  7  
ATOM 11252 H H    . ARG A 1 68  ? 5.253   -4.325  -10.020 1.00 0.00 ? 1200 ARG A H    7  
ATOM 11253 H HA   . ARG A 1 68  ? 7.778   -5.436  -10.725 1.00 0.00 ? 1200 ARG A HA   7  
ATOM 11254 H HB2  . ARG A 1 68  ? 6.949   -2.532  -10.572 1.00 0.00 ? 1200 ARG A HB2  7  
ATOM 11255 H HB3  . ARG A 1 68  ? 8.365   -3.161  -11.404 1.00 0.00 ? 1200 ARG A HB3  7  
ATOM 11256 H HG2  . ARG A 1 68  ? 7.096   -4.136  -13.091 1.00 0.00 ? 1200 ARG A HG2  7  
ATOM 11257 H HG3  . ARG A 1 68  ? 5.616   -4.095  -12.131 1.00 0.00 ? 1200 ARG A HG3  7  
ATOM 11258 H HD2  . ARG A 1 68  ? 5.894   -1.534  -12.219 1.00 0.00 ? 1200 ARG A HD2  7  
ATOM 11259 H HD3  . ARG A 1 68  ? 7.012   -1.850  -13.545 1.00 0.00 ? 1200 ARG A HD3  7  
ATOM 11260 H HE   . ARG A 1 68  ? 4.503   -3.170  -13.897 1.00 0.00 ? 1200 ARG A HE   7  
ATOM 11261 H HH11 . ARG A 1 68  ? 6.159   -0.128  -14.249 1.00 0.00 ? 1200 ARG A HH11 7  
ATOM 11262 H HH12 . ARG A 1 68  ? 5.115   0.444   -15.507 1.00 0.00 ? 1200 ARG A HH12 7  
ATOM 11263 H HH21 . ARG A 1 68  ? 3.121   -2.429  -15.553 1.00 0.00 ? 1200 ARG A HH21 7  
ATOM 11264 H HH22 . ARG A 1 68  ? 3.386   -0.865  -16.247 1.00 0.00 ? 1200 ARG A HH22 7  
ATOM 11265 N N    . ILE A 1 69  ? 7.524   -3.840  -7.901  1.00 0.00 ? 1201 ILE A N    7  
ATOM 11266 C CA   . ILE A 1 69  ? 8.206   -3.529  -6.651  1.00 0.00 ? 1201 ILE A CA   7  
ATOM 11267 C C    . ILE A 1 69  ? 9.011   -4.724  -6.151  1.00 0.00 ? 1201 ILE A C    7  
ATOM 11268 O O    . ILE A 1 69  ? 8.457   -5.660  -5.574  1.00 0.00 ? 1201 ILE A O    7  
ATOM 11269 C CB   . ILE A 1 69  ? 7.210   -3.101  -5.557  1.00 0.00 ? 1201 ILE A CB   7  
ATOM 11270 C CG1  . ILE A 1 69  ? 6.357   -1.927  -6.043  1.00 0.00 ? 1201 ILE A CG1  7  
ATOM 11271 C CG2  . ILE A 1 69  ? 7.952   -2.731  -4.281  1.00 0.00 ? 1201 ILE A CG2  7  
ATOM 11272 C CD1  . ILE A 1 69  ? 7.135   -0.640  -6.200  1.00 0.00 ? 1201 ILE A CD1  7  
ATOM 11273 H H    . ILE A 1 69  ? 6.557   -3.694  -7.966  1.00 0.00 ? 1201 ILE A H    7  
ATOM 11274 H HA   . ILE A 1 69  ? 8.882   -2.706  -6.836  1.00 0.00 ? 1201 ILE A HA   7  
ATOM 11275 H HB   . ILE A 1 69  ? 6.566   -3.939  -5.340  1.00 0.00 ? 1201 ILE A HB   7  
ATOM 11276 H HG12 . ILE A 1 69  ? 5.929   -2.175  -7.002  1.00 0.00 ? 1201 ILE A HG12 7  
ATOM 11277 H HG13 . ILE A 1 69  ? 5.562   -1.752  -5.333  1.00 0.00 ? 1201 ILE A HG13 7  
ATOM 11278 H HG21 . ILE A 1 69  ? 7.896   -3.551  -3.581  1.00 0.00 ? 1201 ILE A HG21 7  
ATOM 11279 H HG22 . ILE A 1 69  ? 8.986   -2.527  -4.513  1.00 0.00 ? 1201 ILE A HG22 7  
ATOM 11280 H HG23 . ILE A 1 69  ? 7.500   -1.853  -3.843  1.00 0.00 ? 1201 ILE A HG23 7  
ATOM 11281 H HD11 . ILE A 1 69  ? 7.949   -0.622  -5.491  1.00 0.00 ? 1201 ILE A HD11 7  
ATOM 11282 H HD12 . ILE A 1 69  ? 7.528   -0.576  -7.204  1.00 0.00 ? 1201 ILE A HD12 7  
ATOM 11283 H HD13 . ILE A 1 69  ? 6.480   0.201   -6.016  1.00 0.00 ? 1201 ILE A HD13 7  
ATOM 11284 N N    . ASP A 1 70  ? 10.319  -4.685  -6.376  1.00 0.00 ? 1202 ASP A N    7  
ATOM 11285 C CA   . ASP A 1 70  ? 11.201  -5.763  -5.946  1.00 0.00 ? 1202 ASP A CA   7  
ATOM 11286 C C    . ASP A 1 70  ? 10.731  -6.355  -4.621  1.00 0.00 ? 1202 ASP A C    7  
ATOM 11287 O O    . ASP A 1 70  ? 10.201  -5.646  -3.767  1.00 0.00 ? 1202 ASP A O    7  
ATOM 11288 C CB   . ASP A 1 70  ? 12.637  -5.253  -5.810  1.00 0.00 ? 1202 ASP A CB   7  
ATOM 11289 C CG   . ASP A 1 70  ? 13.660  -6.367  -5.919  1.00 0.00 ? 1202 ASP A CG   7  
ATOM 11290 O OD1  . ASP A 1 70  ? 13.564  -7.169  -6.871  1.00 0.00 ? 1202 ASP A OD1  7  
ATOM 11291 O OD2  . ASP A 1 70  ? 14.556  -6.437  -5.051  1.00 0.00 ? 1202 ASP A OD2  7  
ATOM 11292 H H    . ASP A 1 70  ? 10.701  -3.911  -6.842  1.00 0.00 ? 1202 ASP A H    7  
ATOM 11293 H HA   . ASP A 1 70  ? 11.174  -6.535  -6.701  1.00 0.00 ? 1202 ASP A HA   7  
ATOM 11294 H HB2  . ASP A 1 70  ? 12.832  -4.534  -6.592  1.00 0.00 ? 1202 ASP A HB2  7  
ATOM 11295 H HB3  . ASP A 1 70  ? 12.752  -4.775  -4.849  1.00 0.00 ? 1202 ASP A HB3  7  
ATOM 11296 N N    . GLY A 1 71  ? 10.928  -7.660  -4.458  1.00 0.00 ? 1203 GLY A N    7  
ATOM 11297 C CA   . GLY A 1 71  ? 10.517  -8.325  -3.236  1.00 0.00 ? 1203 GLY A CA   7  
ATOM 11298 C C    . GLY A 1 71  ? 9.154   -8.977  -3.360  1.00 0.00 ? 1203 GLY A C    7  
ATOM 11299 O O    . GLY A 1 71  ? 8.942   -10.088 -2.874  1.00 0.00 ? 1203 GLY A O    7  
ATOM 11300 H H    . GLY A 1 71  ? 11.356  -8.175  -5.174  1.00 0.00 ? 1203 GLY A H    7  
ATOM 11301 H HA2  . GLY A 1 71  ? 11.245  -9.083  -2.988  1.00 0.00 ? 1203 GLY A HA2  7  
ATOM 11302 H HA3  . GLY A 1 71  ? 10.484  -7.598  -2.437  1.00 0.00 ? 1203 GLY A HA3  7  
ATOM 11303 N N    . VAL A 1 72  ? 8.226   -8.284  -4.012  1.00 0.00 ? 1204 VAL A N    7  
ATOM 11304 C CA   . VAL A 1 72  ? 6.875   -8.801  -4.198  1.00 0.00 ? 1204 VAL A CA   7  
ATOM 11305 C C    . VAL A 1 72  ? 6.833   -9.834  -5.318  1.00 0.00 ? 1204 VAL A C    7  
ATOM 11306 O O    . VAL A 1 72  ? 7.457   -9.658  -6.364  1.00 0.00 ? 1204 VAL A O    7  
ATOM 11307 C CB   . VAL A 1 72  ? 5.880   -7.670  -4.520  1.00 0.00 ? 1204 VAL A CB   7  
ATOM 11308 C CG1  . VAL A 1 72  ? 6.121   -7.129  -5.921  1.00 0.00 ? 1204 VAL A CG1  7  
ATOM 11309 C CG2  . VAL A 1 72  ? 4.449   -8.162  -4.368  1.00 0.00 ? 1204 VAL A CG2  7  
ATOM 11310 H H    . VAL A 1 72  ? 8.455   -7.403  -4.377  1.00 0.00 ? 1204 VAL A H    7  
ATOM 11311 H HA   . VAL A 1 72  ? 6.568   -9.271  -3.276  1.00 0.00 ? 1204 VAL A HA   7  
ATOM 11312 H HB   . VAL A 1 72  ? 6.039   -6.867  -3.815  1.00 0.00 ? 1204 VAL A HB   7  
ATOM 11313 H HG11 . VAL A 1 72  ? 5.450   -7.615  -6.614  1.00 0.00 ? 1204 VAL A HG11 7  
ATOM 11314 H HG12 . VAL A 1 72  ? 5.942   -6.064  -5.931  1.00 0.00 ? 1204 VAL A HG12 7  
ATOM 11315 H HG13 . VAL A 1 72  ? 7.142   -7.326  -6.212  1.00 0.00 ? 1204 VAL A HG13 7  
ATOM 11316 H HG21 . VAL A 1 72  ? 4.017   -8.317  -5.345  1.00 0.00 ? 1204 VAL A HG21 7  
ATOM 11317 H HG22 . VAL A 1 72  ? 4.443   -9.093  -3.820  1.00 0.00 ? 1204 VAL A HG22 7  
ATOM 11318 H HG23 . VAL A 1 72  ? 3.870   -7.426  -3.831  1.00 0.00 ? 1204 VAL A HG23 7  
ATOM 11319 N N    . SER A 1 73  ? 6.091   -10.914 -5.092  1.00 0.00 ? 1205 SER A N    7  
ATOM 11320 C CA   . SER A 1 73  ? 5.969   -11.978 -6.081  1.00 0.00 ? 1205 SER A CA   7  
ATOM 11321 C C    . SER A 1 73  ? 4.661   -11.852 -6.857  1.00 0.00 ? 1205 SER A C    7  
ATOM 11322 O O    . SER A 1 73  ? 3.621   -11.519 -6.290  1.00 0.00 ? 1205 SER A O    7  
ATOM 11323 C CB   . SER A 1 73  ? 6.041   -13.347 -5.401  1.00 0.00 ? 1205 SER A CB   7  
ATOM 11324 O OG   . SER A 1 73  ? 7.385   -13.735 -5.178  1.00 0.00 ? 1205 SER A OG   7  
ATOM 11325 H H    . SER A 1 73  ? 5.616   -10.997 -4.238  1.00 0.00 ? 1205 SER A H    7  
ATOM 11326 H HA   . SER A 1 73  ? 6.794   -11.885 -6.772  1.00 0.00 ? 1205 SER A HA   7  
ATOM 11327 H HB2  . SER A 1 73  ? 5.530   -13.301 -4.451  1.00 0.00 ? 1205 SER A HB2  7  
ATOM 11328 H HB3  . SER A 1 73  ? 5.564   -14.084 -6.030  1.00 0.00 ? 1205 SER A HB3  7  
ATOM 11329 H HG   . SER A 1 73  ? 7.683   -13.390 -4.333  1.00 0.00 ? 1205 SER A HG   7  
ATOM 11330 N N    . GLU A 1 74  ? 4.723   -12.120 -8.158  1.00 0.00 ? 1206 GLU A N    7  
ATOM 11331 C CA   . GLU A 1 74  ? 3.545   -12.036 -9.012  1.00 0.00 ? 1206 GLU A CA   7  
ATOM 11332 C C    . GLU A 1 74  ? 2.315   -12.593 -8.299  1.00 0.00 ? 1206 GLU A C    7  
ATOM 11333 O O    . GLU A 1 74  ? 2.386   -13.623 -7.630  1.00 0.00 ? 1206 GLU A O    7  
ATOM 11334 C CB   . GLU A 1 74  ? 3.779   -12.796 -10.319 1.00 0.00 ? 1206 GLU A CB   7  
ATOM 11335 C CG   . GLU A 1 74  ? 2.718   -12.532 -11.374 1.00 0.00 ? 1206 GLU A CG   7  
ATOM 11336 C CD   . GLU A 1 74  ? 2.888   -13.406 -12.602 1.00 0.00 ? 1206 GLU A CD   7  
ATOM 11337 O OE1  . GLU A 1 74  ? 2.880   -14.646 -12.453 1.00 0.00 ? 1206 GLU A OE1  7  
ATOM 11338 O OE2  . GLU A 1 74  ? 3.028   -12.851 -13.712 1.00 0.00 ? 1206 GLU A OE2  7  
ATOM 11339 H H    . GLU A 1 74  ? 5.582   -12.381 -8.552  1.00 0.00 ? 1206 GLU A H    7  
ATOM 11340 H HA   . GLU A 1 74  ? 3.373   -10.994 -9.238  1.00 0.00 ? 1206 GLU A HA   7  
ATOM 11341 H HB2  . GLU A 1 74  ? 4.738   -12.508 -10.722 1.00 0.00 ? 1206 GLU A HB2  7  
ATOM 11342 H HB3  . GLU A 1 74  ? 3.791   -13.855 -10.107 1.00 0.00 ? 1206 GLU A HB3  7  
ATOM 11343 H HG2  . GLU A 1 74  ? 1.746   -12.725 -10.946 1.00 0.00 ? 1206 GLU A HG2  7  
ATOM 11344 H HG3  . GLU A 1 74  ? 2.778   -11.497 -11.676 1.00 0.00 ? 1206 GLU A HG3  7  
ATOM 11345 N N    . GLY A 1 75  ? 1.189   -11.903 -8.449  1.00 0.00 ? 1207 GLY A N    7  
ATOM 11346 C CA   . GLY A 1 75  ? -0.040  -12.343 -7.814  1.00 0.00 ? 1207 GLY A CA   7  
ATOM 11347 C C    . GLY A 1 75  ? -0.147  -11.881 -6.374  1.00 0.00 ? 1207 GLY A C    7  
ATOM 11348 O O    . GLY A 1 75  ? -1.090  -11.181 -6.007  1.00 0.00 ? 1207 GLY A O    7  
ATOM 11349 H H    . GLY A 1 75  ? 1.192   -11.088 -8.994  1.00 0.00 ? 1207 GLY A H    7  
ATOM 11350 H HA2  . GLY A 1 75  ? -0.879  -11.952 -8.370  1.00 0.00 ? 1207 GLY A HA2  7  
ATOM 11351 H HA3  . GLY A 1 75  ? -0.077  -13.422 -7.837  1.00 0.00 ? 1207 GLY A HA3  7  
ATOM 11352 N N    . LYS A 1 76  ? 0.823   -12.274 -5.555  1.00 0.00 ? 1208 LYS A N    7  
ATOM 11353 C CA   . LYS A 1 76  ? 0.835   -11.897 -4.147  1.00 0.00 ? 1208 LYS A CA   7  
ATOM 11354 C C    . LYS A 1 76  ? 0.397   -10.447 -3.968  1.00 0.00 ? 1208 LYS A C    7  
ATOM 11355 O O    . LYS A 1 76  ? -0.545  -10.160 -3.229  1.00 0.00 ? 1208 LYS A O    7  
ATOM 11356 C CB   . LYS A 1 76  ? 2.233   -12.094 -3.557  1.00 0.00 ? 1208 LYS A CB   7  
ATOM 11357 C CG   . LYS A 1 76  ? 2.338   -11.701 -2.094  1.00 0.00 ? 1208 LYS A CG   7  
ATOM 11358 C CD   . LYS A 1 76  ? 3.769   -11.791 -1.592  1.00 0.00 ? 1208 LYS A CD   7  
ATOM 11359 C CE   . LYS A 1 76  ? 3.969   -10.973 -0.326  1.00 0.00 ? 1208 LYS A CE   7  
ATOM 11360 N NZ   . LYS A 1 76  ? 5.363   -10.461 -0.211  1.00 0.00 ? 1208 LYS A NZ   7  
ATOM 11361 H H    . LYS A 1 76  ? 1.549   -12.832 -5.907  1.00 0.00 ? 1208 LYS A H    7  
ATOM 11362 H HA   . LYS A 1 76  ? 0.140   -12.538 -3.625  1.00 0.00 ? 1208 LYS A HA   7  
ATOM 11363 H HB2  . LYS A 1 76  ? 2.506   -13.135 -3.648  1.00 0.00 ? 1208 LYS A HB2  7  
ATOM 11364 H HB3  . LYS A 1 76  ? 2.936   -11.497 -4.120  1.00 0.00 ? 1208 LYS A HB3  7  
ATOM 11365 H HG2  . LYS A 1 76  ? 1.991   -10.684 -1.978  1.00 0.00 ? 1208 LYS A HG2  7  
ATOM 11366 H HG3  . LYS A 1 76  ? 1.717   -12.364 -1.507  1.00 0.00 ? 1208 LYS A HG3  7  
ATOM 11367 H HD2  . LYS A 1 76  ? 4.002   -12.824 -1.380  1.00 0.00 ? 1208 LYS A HD2  7  
ATOM 11368 H HD3  . LYS A 1 76  ? 4.434   -11.421 -2.359  1.00 0.00 ? 1208 LYS A HD3  7  
ATOM 11369 H HE2  . LYS A 1 76  ? 3.288   -10.136 -0.343  1.00 0.00 ? 1208 LYS A HE2  7  
ATOM 11370 H HE3  . LYS A 1 76  ? 3.752   -11.597 0.528   1.00 0.00 ? 1208 LYS A HE3  7  
ATOM 11371 H HZ1  . LYS A 1 76  ? 5.734   -10.221 -1.153  1.00 0.00 ? 1208 LYS A HZ1  7  
ATOM 11372 H HZ2  . LYS A 1 76  ? 5.975   -11.184 0.216   1.00 0.00 ? 1208 LYS A HZ2  7  
ATOM 11373 H HZ3  . LYS A 1 76  ? 5.383   -9.609  0.385   1.00 0.00 ? 1208 LYS A HZ3  7  
ATOM 11374 N N    . ALA A 1 77  ? 1.085   -9.537  -4.650  1.00 0.00 ? 1209 ALA A N    7  
ATOM 11375 C CA   . ALA A 1 77  ? 0.763   -8.118  -4.568  1.00 0.00 ? 1209 ALA A CA   7  
ATOM 11376 C C    . ALA A 1 77  ? -0.737  -7.903  -4.396  1.00 0.00 ? 1209 ALA A C    7  
ATOM 11377 O O    . ALA A 1 77  ? -1.166  -7.029  -3.644  1.00 0.00 ? 1209 ALA A O    7  
ATOM 11378 C CB   . ALA A 1 77  ? 1.264   -7.391  -5.808  1.00 0.00 ? 1209 ALA A CB   7  
ATOM 11379 H H    . ALA A 1 77  ? 1.825   -9.828  -5.222  1.00 0.00 ? 1209 ALA A H    7  
ATOM 11380 H HA   . ALA A 1 77  ? 1.276   -7.708  -3.710  1.00 0.00 ? 1209 ALA A HA   7  
ATOM 11381 H HB1  . ALA A 1 77  ? 2.274   -7.048  -5.640  1.00 0.00 ? 1209 ALA A HB1  7  
ATOM 11382 H HB2  . ALA A 1 77  ? 1.248   -8.066  -6.651  1.00 0.00 ? 1209 ALA A HB2  7  
ATOM 11383 H HB3  . ALA A 1 77  ? 0.625   -6.545  -6.012  1.00 0.00 ? 1209 ALA A HB3  7  
ATOM 11384 N N    . ALA A 1 78  ? -1.529  -8.706  -5.099  1.00 0.00 ? 1210 ALA A N    7  
ATOM 11385 C CA   . ALA A 1 78  ? -2.981  -8.605  -5.023  1.00 0.00 ? 1210 ALA A CA   7  
ATOM 11386 C C    . ALA A 1 78  ? -3.442  -8.403  -3.584  1.00 0.00 ? 1210 ALA A C    7  
ATOM 11387 O O    . ALA A 1 78  ? -3.985  -7.354  -3.237  1.00 0.00 ? 1210 ALA A O    7  
ATOM 11388 C CB   . ALA A 1 78  ? -3.629  -9.847  -5.617  1.00 0.00 ? 1210 ALA A CB   7  
ATOM 11389 H H    . ALA A 1 78  ? -1.127  -9.384  -5.682  1.00 0.00 ? 1210 ALA A H    7  
ATOM 11390 H HA   . ALA A 1 78  ? -3.287  -7.752  -5.612  1.00 0.00 ? 1210 ALA A HA   7  
ATOM 11391 H HB1  . ALA A 1 78  ? -3.148  -10.089 -6.554  1.00 0.00 ? 1210 ALA A HB1  7  
ATOM 11392 H HB2  . ALA A 1 78  ? -3.519  -10.673 -4.931  1.00 0.00 ? 1210 ALA A HB2  7  
ATOM 11393 H HB3  . ALA A 1 78  ? -4.678  -9.658  -5.790  1.00 0.00 ? 1210 ALA A HB3  7  
ATOM 11394 N N    . MET A 1 79  ? -3.224  -9.414  -2.750  1.00 0.00 ? 1211 MET A N    7  
ATOM 11395 C CA   . MET A 1 79  ? -3.617  -9.346  -1.347  1.00 0.00 ? 1211 MET A CA   7  
ATOM 11396 C C    . MET A 1 79  ? -3.131  -8.049  -0.708  1.00 0.00 ? 1211 MET A C    7  
ATOM 11397 O O    . MET A 1 79  ? -3.711  -7.570  0.267   1.00 0.00 ? 1211 MET A O    7  
ATOM 11398 C CB   . MET A 1 79  ? -3.059  -10.547 -0.580  1.00 0.00 ? 1211 MET A CB   7  
ATOM 11399 C CG   . MET A 1 79  ? -1.580  -10.422 -0.249  1.00 0.00 ? 1211 MET A CG   7  
ATOM 11400 S SD   . MET A 1 79  ? -0.756  -12.022 -0.141  1.00 0.00 ? 1211 MET A SD   7  
ATOM 11401 C CE   . MET A 1 79  ? 0.687   -11.594 0.830   1.00 0.00 ? 1211 MET A CE   7  
ATOM 11402 H H    . MET A 1 79  ? -2.787  -10.225 -3.084  1.00 0.00 ? 1211 MET A H    7  
ATOM 11403 H HA   . MET A 1 79  ? -4.696  -9.373  -1.304  1.00 0.00 ? 1211 MET A HA   7  
ATOM 11404 H HB2  . MET A 1 79  ? -3.605  -10.653 0.345   1.00 0.00 ? 1211 MET A HB2  7  
ATOM 11405 H HB3  . MET A 1 79  ? -3.198  -11.436 -1.175  1.00 0.00 ? 1211 MET A HB3  7  
ATOM 11406 H HG2  . MET A 1 79  ? -1.100  -9.838  -1.020  1.00 0.00 ? 1211 MET A HG2  7  
ATOM 11407 H HG3  . MET A 1 79  ? -1.480  -9.916  0.699   1.00 0.00 ? 1211 MET A HG3  7  
ATOM 11408 H HE1  . MET A 1 79  ? 0.428   -11.591 1.878   1.00 0.00 ? 1211 MET A HE1  7  
ATOM 11409 H HE2  . MET A 1 79  ? 1.467   -12.320 0.654   1.00 0.00 ? 1211 MET A HE2  7  
ATOM 11410 H HE3  . MET A 1 79  ? 1.036   -10.613 0.542   1.00 0.00 ? 1211 MET A HE3  7  
ATOM 11411 N N    . LEU A 1 80  ? -2.065  -7.485  -1.263  1.00 0.00 ? 1212 LEU A N    7  
ATOM 11412 C CA   . LEU A 1 80  ? -1.501  -6.242  -0.748  1.00 0.00 ? 1212 LEU A CA   7  
ATOM 11413 C C    . LEU A 1 80  ? -2.155  -5.032  -1.406  1.00 0.00 ? 1212 LEU A C    7  
ATOM 11414 O O    . LEU A 1 80  ? -1.550  -3.965  -1.507  1.00 0.00 ? 1212 LEU A O    7  
ATOM 11415 C CB   . LEU A 1 80  ? 0.011   -6.210  -0.981  1.00 0.00 ? 1212 LEU A CB   7  
ATOM 11416 C CG   . LEU A 1 80  ? 0.802   -7.392  -0.421  1.00 0.00 ? 1212 LEU A CG   7  
ATOM 11417 C CD1  . LEU A 1 80  ? 2.157   -7.498  -1.104  1.00 0.00 ? 1212 LEU A CD1  7  
ATOM 11418 C CD2  . LEU A 1 80  ? 0.971   -7.255  1.085   1.00 0.00 ? 1212 LEU A CD2  7  
ATOM 11419 H H    . LEU A 1 80  ? -1.646  -7.913  -2.039  1.00 0.00 ? 1212 LEU A H    7  
ATOM 11420 H HA   . LEU A 1 80  ? -1.693  -6.207  0.314   1.00 0.00 ? 1212 LEU A HA   7  
ATOM 11421 H HB2  . LEU A 1 80  ? 0.180   -6.174  -2.047  1.00 0.00 ? 1212 LEU A HB2  7  
ATOM 11422 H HB3  . LEU A 1 80  ? 0.395   -5.307  -0.527  1.00 0.00 ? 1212 LEU A HB3  7  
ATOM 11423 H HG   . LEU A 1 80  ? 0.258   -8.306  -0.616  1.00 0.00 ? 1212 LEU A HG   7  
ATOM 11424 H HD11 . LEU A 1 80  ? 2.084   -8.170  -1.946  1.00 0.00 ? 1212 LEU A HD11 7  
ATOM 11425 H HD12 . LEU A 1 80  ? 2.885   -7.879  -0.402  1.00 0.00 ? 1212 LEU A HD12 7  
ATOM 11426 H HD13 . LEU A 1 80  ? 2.465   -6.521  -1.447  1.00 0.00 ? 1212 LEU A HD13 7  
ATOM 11427 H HD21 . LEU A 1 80  ? 0.929   -6.211  1.358   1.00 0.00 ? 1212 LEU A HD21 7  
ATOM 11428 H HD22 . LEU A 1 80  ? 1.927   -7.665  1.379   1.00 0.00 ? 1212 LEU A HD22 7  
ATOM 11429 H HD23 . LEU A 1 80  ? 0.179   -7.791  1.586   1.00 0.00 ? 1212 LEU A HD23 7  
ATOM 11430 N N    . ALA A 1 81  ? -3.395  -5.206  -1.851  1.00 0.00 ? 1213 ALA A N    7  
ATOM 11431 C CA   . ALA A 1 81  ? -4.133  -4.127  -2.497  1.00 0.00 ? 1213 ALA A CA   7  
ATOM 11432 C C    . ALA A 1 81  ? -4.459  -3.016  -1.505  1.00 0.00 ? 1213 ALA A C    7  
ATOM 11433 O O    . ALA A 1 81  ? -4.176  -1.840  -1.738  1.00 0.00 ? 1213 ALA A O    7  
ATOM 11434 C CB   . ALA A 1 81  ? -5.409  -4.665  -3.128  1.00 0.00 ? 1213 ALA A CB   7  
ATOM 11435 H H    . ALA A 1 81  ? -3.824  -6.080  -1.742  1.00 0.00 ? 1213 ALA A H    7  
ATOM 11436 H HA   . ALA A 1 81  ? -3.514  -3.723  -3.284  1.00 0.00 ? 1213 ALA A HA   7  
ATOM 11437 H HB1  . ALA A 1 81  ? -5.630  -5.640  -2.717  1.00 0.00 ? 1213 ALA A HB1  7  
ATOM 11438 H HB2  . ALA A 1 81  ? -6.226  -3.991  -2.917  1.00 0.00 ? 1213 ALA A