data_2DH3
# 
_entry.id   2DH3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2DH3         
RCSB  RCSB025411   
WWPDB D_1000025411 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2DH2 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2DH3 
_pdbx_database_status.recvd_initial_deposition_date   2006-03-21 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Fort, J.'    1 
'Fita, I.'    2 
'Palacin, M.' 3 
# 
_citation.id                        primary 
_citation.title                     
'The structure of human 4F2hc ectodomain provides a model for homodimerization and electrostatic interaction with plasma membrane.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            282 
_citation.page_first                31444 
_citation.page_last                 31452 
_citation.year                      2007 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17724034 
_citation.pdbx_database_id_DOI      10.1074/jbc.M704524200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Fort, J.'            1  
primary 'de la Ballina, L.R.' 2  
primary 'Burghardt, H.E.'     3  
primary 'Ferrer-Costa, C.'    4  
primary 'Turnay, J.'          5  
primary 'Ferrer-Orta, C.'     6  
primary 'Uson, I.'            7  
primary 'Zorzano, A.'         8  
primary 'Fernandez-Recio, J.' 9  
primary 'Orozco, M.'          10 
primary 'Lizarbe, M.A.'       11 
primary 'Fita, I.'            12 
primary 'Palacin, M.'         13 
# 
_cell.entry_id           2DH3 
_cell.length_a           69.497 
_cell.length_b           101.786 
_cell.length_c           121.966 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2DH3 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man '4F2 cell-surface antigen heavy chain' 46759.496 2  ? ? 'ED4F2hc(Ectodomain)' ? 
2 non-polymer syn 'ZINC ION'                             65.409    1  ? ? ?                     ? 
3 water       nat water                                  18.015    28 ? ? ?                     ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        '4F2hc, Lymphocyte activation antigen 4F2 large subunit, 4F2 heavy chain antigen, CD98 antigen' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DRWGSELPAQKWWHTGALYRIGDLQAFQGHGAGNLAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFGS
KEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDIENLKDASSFLAEWQNI
TKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLLTSSYLSDSGSTGEHTKSLVTQYLNATGNRWCSWSLSQARLLTSFLP
AQLLRLYQLMLFTLPGTPVFSYGDEIGLDAAALPGQPMEAPVMLWDESSFPDIPGAVSANMTVKGQSEDPGSLLSLFRRL
SDQRSKERSLLHGDFHAFSAGPGLFSYIRHWDQNERFLVVLNFGDVGLSAGLQASDLPASASLPAKADLLLSTQPGREEG
SPLELERLKLEPHEGLLLRFPYAA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DRWGSELPAQKWWHTGALYRIGDLQAFQGHGAGNLAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFGS
KEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDIENLKDASSFLAEWQNI
TKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLLTSSYLSDSGSTGEHTKSLVTQYLNATGNRWCSWSLSQARLLTSFLP
AQLLRLYQLMLFTLPGTPVFSYGDEIGLDAAALPGQPMEAPVMLWDESSFPDIPGAVSANMTVKGQSEDPGSLLSLFRRL
SDQRSKERSLLHGDFHAFSAGPGLFSYIRHWDQNERFLVVLNFGDVGLSAGLQASDLPASASLPAKADLLLSTQPGREEG
SPLELERLKLEPHEGLLLRFPYAA
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ARG n 
1 3   TRP n 
1 4   GLY n 
1 5   SER n 
1 6   GLU n 
1 7   LEU n 
1 8   PRO n 
1 9   ALA n 
1 10  GLN n 
1 11  LYS n 
1 12  TRP n 
1 13  TRP n 
1 14  HIS n 
1 15  THR n 
1 16  GLY n 
1 17  ALA n 
1 18  LEU n 
1 19  TYR n 
1 20  ARG n 
1 21  ILE n 
1 22  GLY n 
1 23  ASP n 
1 24  LEU n 
1 25  GLN n 
1 26  ALA n 
1 27  PHE n 
1 28  GLN n 
1 29  GLY n 
1 30  HIS n 
1 31  GLY n 
1 32  ALA n 
1 33  GLY n 
1 34  ASN n 
1 35  LEU n 
1 36  ALA n 
1 37  GLY n 
1 38  LEU n 
1 39  LYS n 
1 40  GLY n 
1 41  ARG n 
1 42  LEU n 
1 43  ASP n 
1 44  TYR n 
1 45  LEU n 
1 46  SER n 
1 47  SER n 
1 48  LEU n 
1 49  LYS n 
1 50  VAL n 
1 51  LYS n 
1 52  GLY n 
1 53  LEU n 
1 54  VAL n 
1 55  LEU n 
1 56  GLY n 
1 57  PRO n 
1 58  ILE n 
1 59  HIS n 
1 60  LYS n 
1 61  ASN n 
1 62  GLN n 
1 63  LYS n 
1 64  ASP n 
1 65  ASP n 
1 66  VAL n 
1 67  ALA n 
1 68  GLN n 
1 69  THR n 
1 70  ASP n 
1 71  LEU n 
1 72  LEU n 
1 73  GLN n 
1 74  ILE n 
1 75  ASP n 
1 76  PRO n 
1 77  ASN n 
1 78  PHE n 
1 79  GLY n 
1 80  SER n 
1 81  LYS n 
1 82  GLU n 
1 83  ASP n 
1 84  PHE n 
1 85  ASP n 
1 86  SER n 
1 87  LEU n 
1 88  LEU n 
1 89  GLN n 
1 90  SER n 
1 91  ALA n 
1 92  LYS n 
1 93  LYS n 
1 94  LYS n 
1 95  SER n 
1 96  ILE n 
1 97  ARG n 
1 98  VAL n 
1 99  ILE n 
1 100 LEU n 
1 101 ASP n 
1 102 LEU n 
1 103 THR n 
1 104 PRO n 
1 105 ASN n 
1 106 TYR n 
1 107 ARG n 
1 108 GLY n 
1 109 GLU n 
1 110 ASN n 
1 111 SER n 
1 112 TRP n 
1 113 PHE n 
1 114 SER n 
1 115 THR n 
1 116 GLN n 
1 117 VAL n 
1 118 ASP n 
1 119 THR n 
1 120 VAL n 
1 121 ALA n 
1 122 THR n 
1 123 LYS n 
1 124 VAL n 
1 125 LYS n 
1 126 ASP n 
1 127 ALA n 
1 128 LEU n 
1 129 GLU n 
1 130 PHE n 
1 131 TRP n 
1 132 LEU n 
1 133 GLN n 
1 134 ALA n 
1 135 GLY n 
1 136 VAL n 
1 137 ASP n 
1 138 GLY n 
1 139 PHE n 
1 140 GLN n 
1 141 VAL n 
1 142 ARG n 
1 143 ASP n 
1 144 ILE n 
1 145 GLU n 
1 146 ASN n 
1 147 LEU n 
1 148 LYS n 
1 149 ASP n 
1 150 ALA n 
1 151 SER n 
1 152 SER n 
1 153 PHE n 
1 154 LEU n 
1 155 ALA n 
1 156 GLU n 
1 157 TRP n 
1 158 GLN n 
1 159 ASN n 
1 160 ILE n 
1 161 THR n 
1 162 LYS n 
1 163 GLY n 
1 164 PHE n 
1 165 SER n 
1 166 GLU n 
1 167 ASP n 
1 168 ARG n 
1 169 LEU n 
1 170 LEU n 
1 171 ILE n 
1 172 ALA n 
1 173 GLY n 
1 174 THR n 
1 175 ASN n 
1 176 SER n 
1 177 SER n 
1 178 ASP n 
1 179 LEU n 
1 180 GLN n 
1 181 GLN n 
1 182 ILE n 
1 183 LEU n 
1 184 SER n 
1 185 LEU n 
1 186 LEU n 
1 187 GLU n 
1 188 SER n 
1 189 ASN n 
1 190 LYS n 
1 191 ASP n 
1 192 LEU n 
1 193 LEU n 
1 194 LEU n 
1 195 THR n 
1 196 SER n 
1 197 SER n 
1 198 TYR n 
1 199 LEU n 
1 200 SER n 
1 201 ASP n 
1 202 SER n 
1 203 GLY n 
1 204 SER n 
1 205 THR n 
1 206 GLY n 
1 207 GLU n 
1 208 HIS n 
1 209 THR n 
1 210 LYS n 
1 211 SER n 
1 212 LEU n 
1 213 VAL n 
1 214 THR n 
1 215 GLN n 
1 216 TYR n 
1 217 LEU n 
1 218 ASN n 
1 219 ALA n 
1 220 THR n 
1 221 GLY n 
1 222 ASN n 
1 223 ARG n 
1 224 TRP n 
1 225 CYS n 
1 226 SER n 
1 227 TRP n 
1 228 SER n 
1 229 LEU n 
1 230 SER n 
1 231 GLN n 
1 232 ALA n 
1 233 ARG n 
1 234 LEU n 
1 235 LEU n 
1 236 THR n 
1 237 SER n 
1 238 PHE n 
1 239 LEU n 
1 240 PRO n 
1 241 ALA n 
1 242 GLN n 
1 243 LEU n 
1 244 LEU n 
1 245 ARG n 
1 246 LEU n 
1 247 TYR n 
1 248 GLN n 
1 249 LEU n 
1 250 MET n 
1 251 LEU n 
1 252 PHE n 
1 253 THR n 
1 254 LEU n 
1 255 PRO n 
1 256 GLY n 
1 257 THR n 
1 258 PRO n 
1 259 VAL n 
1 260 PHE n 
1 261 SER n 
1 262 TYR n 
1 263 GLY n 
1 264 ASP n 
1 265 GLU n 
1 266 ILE n 
1 267 GLY n 
1 268 LEU n 
1 269 ASP n 
1 270 ALA n 
1 271 ALA n 
1 272 ALA n 
1 273 LEU n 
1 274 PRO n 
1 275 GLY n 
1 276 GLN n 
1 277 PRO n 
1 278 MET n 
1 279 GLU n 
1 280 ALA n 
1 281 PRO n 
1 282 VAL n 
1 283 MET n 
1 284 LEU n 
1 285 TRP n 
1 286 ASP n 
1 287 GLU n 
1 288 SER n 
1 289 SER n 
1 290 PHE n 
1 291 PRO n 
1 292 ASP n 
1 293 ILE n 
1 294 PRO n 
1 295 GLY n 
1 296 ALA n 
1 297 VAL n 
1 298 SER n 
1 299 ALA n 
1 300 ASN n 
1 301 MET n 
1 302 THR n 
1 303 VAL n 
1 304 LYS n 
1 305 GLY n 
1 306 GLN n 
1 307 SER n 
1 308 GLU n 
1 309 ASP n 
1 310 PRO n 
1 311 GLY n 
1 312 SER n 
1 313 LEU n 
1 314 LEU n 
1 315 SER n 
1 316 LEU n 
1 317 PHE n 
1 318 ARG n 
1 319 ARG n 
1 320 LEU n 
1 321 SER n 
1 322 ASP n 
1 323 GLN n 
1 324 ARG n 
1 325 SER n 
1 326 LYS n 
1 327 GLU n 
1 328 ARG n 
1 329 SER n 
1 330 LEU n 
1 331 LEU n 
1 332 HIS n 
1 333 GLY n 
1 334 ASP n 
1 335 PHE n 
1 336 HIS n 
1 337 ALA n 
1 338 PHE n 
1 339 SER n 
1 340 ALA n 
1 341 GLY n 
1 342 PRO n 
1 343 GLY n 
1 344 LEU n 
1 345 PHE n 
1 346 SER n 
1 347 TYR n 
1 348 ILE n 
1 349 ARG n 
1 350 HIS n 
1 351 TRP n 
1 352 ASP n 
1 353 GLN n 
1 354 ASN n 
1 355 GLU n 
1 356 ARG n 
1 357 PHE n 
1 358 LEU n 
1 359 VAL n 
1 360 VAL n 
1 361 LEU n 
1 362 ASN n 
1 363 PHE n 
1 364 GLY n 
1 365 ASP n 
1 366 VAL n 
1 367 GLY n 
1 368 LEU n 
1 369 SER n 
1 370 ALA n 
1 371 GLY n 
1 372 LEU n 
1 373 GLN n 
1 374 ALA n 
1 375 SER n 
1 376 ASP n 
1 377 LEU n 
1 378 PRO n 
1 379 ALA n 
1 380 SER n 
1 381 ALA n 
1 382 SER n 
1 383 LEU n 
1 384 PRO n 
1 385 ALA n 
1 386 LYS n 
1 387 ALA n 
1 388 ASP n 
1 389 LEU n 
1 390 LEU n 
1 391 LEU n 
1 392 SER n 
1 393 THR n 
1 394 GLN n 
1 395 PRO n 
1 396 GLY n 
1 397 ARG n 
1 398 GLU n 
1 399 GLU n 
1 400 GLY n 
1 401 SER n 
1 402 PRO n 
1 403 LEU n 
1 404 GLU n 
1 405 LEU n 
1 406 GLU n 
1 407 ARG n 
1 408 LEU n 
1 409 LYS n 
1 410 LEU n 
1 411 GLU n 
1 412 PRO n 
1 413 HIS n 
1 414 GLU n 
1 415 GLY n 
1 416 LEU n 
1 417 LEU n 
1 418 LEU n 
1 419 ARG n 
1 420 PHE n 
1 421 PRO n 
1 422 TYR n 
1 423 ALA n 
1 424 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'SLC3A2, MDU1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pTrcHis (Invitrogen)' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    4F2_HUMAN 
_struct_ref.pdbx_db_accession          P08195 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;ELPAQKWWHTGALYRIGDLQAFQGHGAGNLAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFGSKEDFD
SLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDIENLKDASSFLAEWQNITKGFS
EDRLLIAGTNSSDLQQILSLLESNKDLLLTSSYLSDSGSTGEHTKSLVTQYLNATGNRWCSWSLSQARLLTSFLPAQLLR
LYQLMLFTLPGTPVFSYGDEIGLDAAALPGQPMEAPVMLWDESSFPDIPGAVSANMTVKGQSEDPGSLLSLFRRLSDQRS
KERSLLHGDFHAFSAGPGLFSYIRHWDQNERFLVVLNFGDVGLSAGLQASDLPASASLPAKADLLLSTQPGREEGSPLEL
ERLKLEPHEGLLLRFPYAA
;
_struct_ref.pdbx_align_begin           111 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2DH3 A 6 ? 424 ? P08195 111 ? 529 ? 111 529 
2 1 2DH3 B 6 ? 424 ? P08195 111 ? 529 ? 111 529 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2DH3 ASP A 1 ? UNP P08195 ? ? 'EXPRESSION TAG' 106 1  
1 2DH3 ARG A 2 ? UNP P08195 ? ? 'EXPRESSION TAG' 107 2  
1 2DH3 TRP A 3 ? UNP P08195 ? ? 'EXPRESSION TAG' 108 3  
1 2DH3 GLY A 4 ? UNP P08195 ? ? 'EXPRESSION TAG' 109 4  
1 2DH3 SER A 5 ? UNP P08195 ? ? 'EXPRESSION TAG' 110 5  
2 2DH3 ASP B 1 ? UNP P08195 ? ? 'EXPRESSION TAG' 106 6  
2 2DH3 ARG B 2 ? UNP P08195 ? ? 'EXPRESSION TAG' 107 7  
2 2DH3 TRP B 3 ? UNP P08195 ? ? 'EXPRESSION TAG' 108 8  
2 2DH3 GLY B 4 ? UNP P08195 ? ? 'EXPRESSION TAG' 109 9  
2 2DH3 SER B 5 ? UNP P08195 ? ? 'EXPRESSION TAG' 110 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.entry_id          2DH3 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.31 
_exptl_crystal.density_percent_sol   46.65 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6 
_exptl_crystal_grow.pdbx_details    '25% PEG 3350, 0,2M AMMONIUM SULFATE, pH 6, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2003-11-28 
_diffrn_detector.details                KB-MIRROR 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'liq N2 cooled Si-111 double monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9789 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID13' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID13 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9789 
# 
_reflns.entry_id                     2DH3 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             29.650 
_reflns.d_resolution_high            2.8 
_reflns.number_obs                   19650 
_reflns.number_all                   19650 
_reflns.percent_possible_obs         94 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.0665 
_reflns.pdbx_netI_over_sigmaI        15.7400 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              7.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.8 
_reflns_shell.d_res_low              2.9 
_reflns_shell.percent_possible_all   96.2 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.3885 
_reflns_shell.meanI_over_sigI_obs    3.460 
_reflns_shell.pdbx_redundancy        4.2 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2DH3 
_refine.ls_number_reflns_obs                     19304 
_refine.ls_number_reflns_all                     19304 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             25.00 
_refine.ls_d_res_high                            2.80 
_refine.ls_percent_reflns_obs                    94.56 
_refine.ls_R_factor_obs                          0.21972 
_refine.ls_R_factor_all                          0.21972 
_refine.ls_R_factor_R_work                       0.21677 
_refine.ls_R_factor_R_free                       0.27508 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1066 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.930 
_refine.correlation_coeff_Fo_to_Fc_free          0.893 
_refine.B_iso_mean                               49.063 
_refine.aniso_B[1][1]                            -1.67 
_refine.aniso_B[2][2]                            -1.65 
_refine.aniso_B[3][3]                            3.31 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.461 
_refine.overall_SU_ML                            0.346 
_refine.overall_SU_B                             38.166 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6504 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             28 
_refine_hist.number_atoms_total               6533 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        25.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.006  0.022  ? 6649  'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 5998  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.186  1.972  ? 9020  'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.732  3.000  ? 13988 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.601  5.000  ? 835   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       32.970 24.582 ? 299   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.795 15.000 ? 1119  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       16.890 15.000 ? 36    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.055  0.200  ? 997   'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.002  0.020  ? 7450  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 1324  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.178  0.200  ? 1157  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.159  0.200  ? 5589  'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.166  0.200  ? 3119  'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.077  0.200  ? 3883  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.140  0.200  ? 113   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          0.018  0.200  ? 1     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.091  0.200  ? 9     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.139  0.200  ? 44    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.098  0.200  ? 3     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.306  1.500  ? 5361  'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.027  1.500  ? 1708  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.338  2.000  ? 6634  'X-RAY DIFFRACTION' ? 
r_scbond_it                  0.353  3.000  ? 2923  'X-RAY DIFFRACTION' ? 
r_scangle_it                 0.571  4.500  ? 2386  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.800 
_refine_ls_shell.d_res_low                        2.872 
_refine_ls_shell.number_reflns_R_work             1436 
_refine_ls_shell.R_factor_R_work                  0.265 
_refine_ls_shell.percent_reflns_obs               96.44 
_refine_ls_shell.R_factor_R_free                  0.369 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             83 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2DH3 
_struct.title                     'Crystal Structure of human ED-4F2hc' 
_struct.pdbx_descriptor           '4F2 cell-surface antigen heavy chain' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2DH3 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN, SIGNALING PROTEIN' 
_struct_keywords.text            
;TIM-barrel, glycosidase like, antiparallel beta-sheet, greek key, ZN interaction, coordination, dimerization, C-terminal domain, extracellular domain, TRANSPORT PROTEIN, SIGNALING PROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 11  ? THR A 15  ? LYS A 116 THR A 120 5 ? 5  
HELX_P HELX_P2  2  ASP A 23  ? GLY A 29  ? ASP A 128 GLY A 134 1 ? 7  
HELX_P HELX_P3  3  ASN A 34  ? LYS A 39  ? ASN A 139 LYS A 144 1 ? 6  
HELX_P HELX_P4  4  ARG A 41  ? SER A 47  ? ARG A 146 SER A 152 1 ? 7  
HELX_P HELX_P5  5  SER A 80  ? LYS A 94  ? SER A 185 LYS A 199 1 ? 15 
HELX_P HELX_P6  6  ASP A 118 ? ALA A 134 ? ASP A 223 ALA A 239 1 ? 17 
HELX_P HELX_P7  7  ASP A 143 ? LEU A 147 ? ASP A 248 LEU A 252 5 ? 5  
HELX_P HELX_P8  8  ASP A 149 ? SER A 165 ? ASP A 254 SER A 270 1 ? 17 
HELX_P HELX_P9  9  ASP A 178 ? GLU A 187 ? ASP A 283 GLU A 292 1 ? 10 
HELX_P HELX_P10 10 GLU A 207 ? THR A 220 ? GLU A 312 THR A 325 1 ? 14 
HELX_P HELX_P11 11 LEU A 234 ? PHE A 238 ? LEU A 339 PHE A 343 5 ? 5  
HELX_P HELX_P12 12 PRO A 240 ? GLN A 242 ? PRO A 345 GLN A 347 5 ? 3  
HELX_P HELX_P13 13 LEU A 243 ? LEU A 254 ? LEU A 348 LEU A 359 1 ? 12 
HELX_P HELX_P14 14 ASP A 286 ? PHE A 290 ? ASP A 391 PHE A 395 5 ? 5  
HELX_P HELX_P15 15 ILE A 293 ? VAL A 297 ? ILE A 398 VAL A 402 5 ? 5  
HELX_P HELX_P16 16 SER A 298 ? MET A 301 ? SER A 403 MET A 406 5 ? 4  
HELX_P HELX_P17 17 THR A 302 ? ASP A 309 ? THR A 407 ASP A 414 1 ? 8  
HELX_P HELX_P18 18 SER A 312 ? GLU A 327 ? SER A 417 GLU A 432 1 ? 16 
HELX_P HELX_P19 19 PRO A 378 ? SER A 382 ? PRO A 483 SER A 487 5 ? 5  
HELX_P HELX_P20 20 LYS B 11  ? THR B 15  ? LYS B 116 THR B 120 5 ? 5  
HELX_P HELX_P21 21 ASP B 23  ? GLY B 29  ? ASP B 128 GLY B 134 1 ? 7  
HELX_P HELX_P22 22 ASN B 34  ? LYS B 39  ? ASN B 139 LYS B 144 1 ? 6  
HELX_P HELX_P23 23 ARG B 41  ? LEU B 48  ? ARG B 146 LEU B 153 1 ? 8  
HELX_P HELX_P24 24 SER B 80  ? LYS B 94  ? SER B 185 LYS B 199 1 ? 15 
HELX_P HELX_P25 25 GLN B 116 ? GLY B 135 ? GLN B 221 GLY B 240 1 ? 20 
HELX_P HELX_P26 26 ASP B 143 ? LEU B 147 ? ASP B 248 LEU B 252 5 ? 5  
HELX_P HELX_P27 27 ASP B 149 ? SER B 165 ? ASP B 254 SER B 270 1 ? 17 
HELX_P HELX_P28 28 LEU B 179 ? SER B 184 ? LEU B 284 SER B 289 1 ? 6  
HELX_P HELX_P29 29 LEU B 185 ? GLU B 187 ? LEU B 290 GLU B 292 5 ? 3  
HELX_P HELX_P30 30 THR B 205 ? ALA B 219 ? THR B 310 ALA B 324 1 ? 15 
HELX_P HELX_P31 31 LEU B 234 ? PHE B 238 ? LEU B 339 PHE B 343 5 ? 5  
HELX_P HELX_P32 32 PRO B 240 ? GLN B 242 ? PRO B 345 GLN B 347 5 ? 3  
HELX_P HELX_P33 33 LEU B 243 ? LEU B 254 ? LEU B 348 LEU B 359 1 ? 12 
HELX_P HELX_P34 34 ASP B 286 ? PHE B 290 ? ASP B 391 PHE B 395 5 ? 5  
HELX_P HELX_P35 35 SER B 298 ? MET B 301 ? SER B 403 MET B 406 5 ? 4  
HELX_P HELX_P36 36 THR B 302 ? SER B 307 ? THR B 407 SER B 412 1 ? 6  
HELX_P HELX_P37 37 SER B 312 ? GLU B 327 ? SER B 417 GLU B 432 1 ? 16 
HELX_P HELX_P38 38 GLU B 327 ? HIS B 332 ? GLU B 432 HIS B 437 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? C ZN . ZN ? ? ? 1_555 B HIS 336 NE2 ? ? A ZN 601 B HIS 441 1_555 ? ? ? ? ? ? ? 2.102 ? 
metalc2 metalc ? ? C ZN . ZN ? ? ? 1_555 A ASP 334 OD1 ? ? A ZN 601 A ASP 439 1_555 ? ? ? ? ? ? ? 2.002 ? 
metalc3 metalc ? ? C ZN . ZN ? ? ? 1_555 A HIS 350 NE2 ? ? A ZN 601 A HIS 455 1_555 ? ? ? ? ? ? ? 2.208 ? 
metalc4 metalc ? ? C ZN . ZN ? ? ? 1_555 A HIS 336 NE2 ? ? A ZN 601 A HIS 441 1_555 ? ? ? ? ? ? ? 2.111 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 56 A . ? GLY 161 A PRO 57 A ? PRO 162 A 1 3.35 
2 GLY 56 B . ? GLY 161 B PRO 57 B ? PRO 162 B 1 5.78 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 8 ? 
B ? 2 ? 
C ? 6 ? 
D ? 2 ? 
E ? 8 ? 
F ? 2 ? 
G ? 6 ? 
H ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? parallel      
A 7 8 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
C 5 6 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? parallel      
E 3 4 ? parallel      
E 4 5 ? parallel      
E 5 6 ? parallel      
E 6 7 ? parallel      
E 7 8 ? parallel      
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
G 5 6 ? anti-parallel 
H 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 193 ? THR A 195 ? LEU A 298 THR A 300 
A 2 LEU A 169 ? GLY A 173 ? LEU A 274 GLY A 278 
A 3 GLY A 138 ? VAL A 141 ? GLY A 243 VAL A 246 
A 4 ARG A 97  ? ASP A 101 ? ARG A 202 ASP A 206 
A 5 VAL A 50  ? LEU A 55  ? VAL A 155 LEU A 160 
A 6 ALA A 17  ? ILE A 21  ? ALA A 122 ILE A 126 
A 7 THR A 257 ? SER A 261 ? THR A 362 SER A 366 
A 8 SER A 226 ? TRP A 227 ? SER A 331 TRP A 332 
B 1 HIS A 59  ? ASN A 61  ? HIS A 164 ASN A 166 
B 2 THR A 69  ? ILE A 74  ? THR A 174 ILE A 179 
C 1 PHE A 335 ? ALA A 337 ? PHE A 440 ALA A 442 
C 2 LEU A 344 ? ARG A 349 ? LEU A 449 ARG A 454 
C 3 ARG A 356 ? ASN A 362 ? ARG A 461 ASN A 467 
C 4 GLY A 415 ? PHE A 420 ? GLY A 520 PHE A 525 
C 5 LYS A 386 ? SER A 392 ? LYS A 491 SER A 497 
C 6 PRO A 402 ? GLU A 404 ? PRO A 507 GLU A 509 
D 1 LEU A 368 ? SER A 369 ? LEU A 473 SER A 474 
D 2 LYS A 409 ? LEU A 410 ? LYS A 514 LEU A 515 
E 1 LEU B 192 ? THR B 195 ? LEU B 297 THR B 300 
E 2 LEU B 169 ? GLY B 173 ? LEU B 274 GLY B 278 
E 3 GLY B 138 ? VAL B 141 ? GLY B 243 VAL B 246 
E 4 ARG B 97  ? ASP B 101 ? ARG B 202 ASP B 206 
E 5 VAL B 50  ? LEU B 55  ? VAL B 155 LEU B 160 
E 6 ALA B 17  ? ILE B 21  ? ALA B 122 ILE B 126 
E 7 THR B 257 ? SER B 261 ? THR B 362 SER B 366 
E 8 SER B 226 ? TRP B 227 ? SER B 331 TRP B 332 
F 1 HIS B 59  ? GLN B 62  ? HIS B 164 GLN B 167 
F 2 ASP B 65  ? ILE B 74  ? ASP B 170 ILE B 179 
G 1 ASP B 334 ? PHE B 338 ? ASP B 439 PHE B 443 
G 2 LEU B 344 ? HIS B 350 ? LEU B 449 HIS B 455 
G 3 ARG B 356 ? ASN B 362 ? ARG B 461 ASN B 467 
G 4 GLY B 415 ? PHE B 420 ? GLY B 520 PHE B 525 
G 5 LYS B 386 ? SER B 392 ? LYS B 491 SER B 497 
G 6 SER B 401 ? GLU B 404 ? SER B 506 GLU B 509 
H 1 LEU B 368 ? SER B 369 ? LEU B 473 SER B 474 
H 2 LYS B 409 ? LEU B 410 ? LYS B 514 LEU B 515 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LEU A 193 ? O LEU A 298 N ALA A 172 ? N ALA A 277 
A 2 3 O ILE A 171 ? O ILE A 276 N PHE A 139 ? N PHE A 244 
A 3 4 O GLN A 140 ? O GLN A 245 N LEU A 100 ? N LEU A 205 
A 4 5 O ILE A 99  ? O ILE A 204 N LEU A 55  ? N LEU A 160 
A 5 6 O VAL A 54  ? O VAL A 159 N TYR A 19  ? N TYR A 124 
A 6 7 N ARG A 20  ? N ARG A 125 O PHE A 260 ? O PHE A 365 
A 7 8 O THR A 257 ? O THR A 362 N TRP A 227 ? N TRP A 332 
B 1 2 N LYS A 60  ? N LYS A 165 O GLN A 73  ? O GLN A 178 
C 1 2 N HIS A 336 ? N HIS A 441 O ILE A 348 ? O ILE A 453 
C 2 3 N TYR A 347 ? N TYR A 452 O VAL A 359 ? O VAL A 464 
C 3 4 N LEU A 358 ? N LEU A 463 O LEU A 418 ? O LEU A 523 
C 4 5 O ARG A 419 ? O ARG A 524 N ASP A 388 ? N ASP A 493 
C 5 6 N ALA A 387 ? N ALA A 492 O LEU A 403 ? O LEU A 508 
D 1 2 N LEU A 368 ? N LEU A 473 O LEU A 410 ? O LEU A 515 
E 1 2 O LEU B 193 ? O LEU B 298 N ALA B 172 ? N ALA B 277 
E 2 3 O ILE B 171 ? O ILE B 276 N PHE B 139 ? N PHE B 244 
E 3 4 O GLY B 138 ? O GLY B 243 N LEU B 100 ? N LEU B 205 
E 4 5 O ASP B 101 ? O ASP B 206 N LEU B 55  ? N LEU B 160 
E 5 6 O VAL B 54  ? O VAL B 159 N ILE B 21  ? N ILE B 126 
E 6 7 N ARG B 20  ? N ARG B 125 O PHE B 260 ? O PHE B 365 
E 7 8 O THR B 257 ? O THR B 362 N TRP B 227 ? N TRP B 332 
F 1 2 N GLN B 62  ? N GLN B 167 O ASP B 65  ? O ASP B 170 
G 1 2 N ASP B 334 ? N ASP B 439 O HIS B 350 ? O HIS B 455 
G 2 3 N TYR B 347 ? N TYR B 452 O VAL B 359 ? O VAL B 464 
G 3 4 N LEU B 358 ? N LEU B 463 O LEU B 418 ? O LEU B 523 
G 4 5 O LEU B 417 ? O LEU B 522 N LEU B 391 ? N LEU B 496 
G 5 6 N ALA B 387 ? N ALA B 492 O LEU B 403 ? O LEU B 508 
H 1 2 N LEU B 368 ? N LEU B 473 O LEU B 410 ? O LEU B 515 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE ZN A 601' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 ASP A 334 ? ASP A 439 . ? 1_555 ? 
2 AC1 4 HIS A 336 ? HIS A 441 . ? 1_555 ? 
3 AC1 4 HIS A 350 ? HIS A 455 . ? 1_555 ? 
4 AC1 4 HIS B 336 ? HIS B 441 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2DH3 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2DH3 
_atom_sites.fract_transf_matrix[1][1]   0.014389 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009825 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008199 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ALA A 1 9   ? 13.330  50.820  30.833 1.00 52.98 ? 114 ALA A N   1 
ATOM   2    C  CA  . ALA A 1 9   ? 14.427  51.633  31.433 1.00 53.00 ? 114 ALA A CA  1 
ATOM   3    C  C   . ALA A 1 9   ? 14.249  51.797  32.953 1.00 53.11 ? 114 ALA A C   1 
ATOM   4    O  O   . ALA A 1 9   ? 13.299  51.269  33.545 1.00 53.39 ? 114 ALA A O   1 
ATOM   5    C  CB  . ALA A 1 9   ? 14.502  53.007  30.748 1.00 53.01 ? 114 ALA A CB  1 
ATOM   6    N  N   . GLN A 1 10  ? 15.191  52.502  33.575 1.00 52.82 ? 115 GLN A N   1 
ATOM   7    C  CA  . GLN A 1 10  ? 15.069  52.931  34.961 1.00 52.55 ? 115 GLN A CA  1 
ATOM   8    C  C   . GLN A 1 10  ? 14.746  54.416  34.950 1.00 52.34 ? 115 GLN A C   1 
ATOM   9    O  O   . GLN A 1 10  ? 15.281  55.159  34.125 1.00 52.56 ? 115 GLN A O   1 
ATOM   10   C  CB  . GLN A 1 10  ? 16.381  52.713  35.722 1.00 52.60 ? 115 GLN A CB  1 
ATOM   11   C  CG  . GLN A 1 10  ? 16.511  51.367  36.406 1.00 52.83 ? 115 GLN A CG  1 
ATOM   12   C  CD  . GLN A 1 10  ? 17.704  51.322  37.348 1.00 53.01 ? 115 GLN A CD  1 
ATOM   13   O  OE1 . GLN A 1 10  ? 17.549  51.362  38.573 1.00 53.37 ? 115 GLN A OE1 1 
ATOM   14   N  NE2 . GLN A 1 10  ? 18.904  51.261  36.778 1.00 53.36 ? 115 GLN A NE2 1 
ATOM   15   N  N   . LYS A 1 11  ? 13.877  54.849  35.857 1.00 51.84 ? 116 LYS A N   1 
ATOM   16   C  CA  . LYS A 1 11  ? 13.613  56.279  36.028 1.00 51.40 ? 116 LYS A CA  1 
ATOM   17   C  C   . LYS A 1 11  ? 14.866  56.970  36.574 1.00 51.10 ? 116 LYS A C   1 
ATOM   18   O  O   . LYS A 1 11  ? 15.589  56.398  37.395 1.00 51.09 ? 116 LYS A O   1 
ATOM   19   C  CB  . LYS A 1 11  ? 12.398  56.512  36.927 1.00 51.43 ? 116 LYS A CB  1 
ATOM   20   C  CG  . LYS A 1 11  ? 12.457  55.825  38.280 1.00 51.16 ? 116 LYS A CG  1 
ATOM   21   C  CD  . LYS A 1 11  ? 11.168  56.011  39.044 1.00 51.32 ? 116 LYS A CD  1 
ATOM   22   C  CE  . LYS A 1 11  ? 9.985   55.354  38.352 1.00 51.18 ? 116 LYS A CE  1 
ATOM   23   N  NZ  . LYS A 1 11  ? 8.840   55.186  39.287 1.00 51.18 ? 116 LYS A NZ  1 
ATOM   24   N  N   . TRP A 1 12  ? 15.105  58.200  36.119 1.00 50.68 ? 117 TRP A N   1 
ATOM   25   C  CA  . TRP A 1 12  ? 16.453  58.800  36.135 1.00 50.37 ? 117 TRP A CA  1 
ATOM   26   C  C   . TRP A 1 12  ? 17.066  59.096  37.509 1.00 50.14 ? 117 TRP A C   1 
ATOM   27   O  O   . TRP A 1 12  ? 18.278  58.987  37.671 1.00 50.03 ? 117 TRP A O   1 
ATOM   28   C  CB  . TRP A 1 12  ? 16.490  60.063  35.263 1.00 50.17 ? 117 TRP A CB  1 
ATOM   29   C  CG  . TRP A 1 12  ? 15.684  61.214  35.789 1.00 50.20 ? 117 TRP A CG  1 
ATOM   30   C  CD1 . TRP A 1 12  ? 14.407  61.546  35.448 1.00 49.95 ? 117 TRP A CD1 1 
ATOM   31   C  CD2 . TRP A 1 12  ? 16.106  62.185  36.753 1.00 50.12 ? 117 TRP A CD2 1 
ATOM   32   N  NE1 . TRP A 1 12  ? 14.008  62.666  36.136 1.00 49.86 ? 117 TRP A NE1 1 
ATOM   33   C  CE2 . TRP A 1 12  ? 15.033  63.078  36.944 1.00 49.81 ? 117 TRP A CE2 1 
ATOM   34   C  CE3 . TRP A 1 12  ? 17.290  62.388  37.470 1.00 49.76 ? 117 TRP A CE3 1 
ATOM   35   C  CZ2 . TRP A 1 12  ? 15.109  64.154  37.820 1.00 49.97 ? 117 TRP A CZ2 1 
ATOM   36   C  CZ3 . TRP A 1 12  ? 17.363  63.450  38.333 1.00 49.87 ? 117 TRP A CZ3 1 
ATOM   37   C  CH2 . TRP A 1 12  ? 16.280  64.323  38.504 1.00 50.06 ? 117 TRP A CH2 1 
ATOM   38   N  N   . TRP A 1 13  ? 16.252  59.462  38.493 1.00 49.94 ? 118 TRP A N   1 
ATOM   39   C  CA  . TRP A 1 13  ? 16.786  59.780  39.819 1.00 49.81 ? 118 TRP A CA  1 
ATOM   40   C  C   . TRP A 1 13  ? 17.245  58.552  40.615 1.00 49.63 ? 118 TRP A C   1 
ATOM   41   O  O   . TRP A 1 13  ? 17.866  58.687  41.666 1.00 49.75 ? 118 TRP A O   1 
ATOM   42   C  CB  . TRP A 1 13  ? 15.808  60.651  40.634 1.00 49.82 ? 118 TRP A CB  1 
ATOM   43   C  CG  . TRP A 1 13  ? 14.505  60.018  41.006 1.00 49.59 ? 118 TRP A CG  1 
ATOM   44   C  CD1 . TRP A 1 13  ? 14.218  59.360  42.162 1.00 49.65 ? 118 TRP A CD1 1 
ATOM   45   C  CD2 . TRP A 1 13  ? 13.300  60.020  40.234 1.00 49.59 ? 118 TRP A CD2 1 
ATOM   46   N  NE1 . TRP A 1 13  ? 12.910  58.929  42.152 1.00 49.81 ? 118 TRP A NE1 1 
ATOM   47   C  CE2 . TRP A 1 13  ? 12.326  59.322  40.976 1.00 49.80 ? 118 TRP A CE2 1 
ATOM   48   C  CE3 . TRP A 1 13  ? 12.954  60.530  38.978 1.00 49.67 ? 118 TRP A CE3 1 
ATOM   49   C  CZ2 . TRP A 1 13  ? 11.030  59.124  40.506 1.00 49.66 ? 118 TRP A CZ2 1 
ATOM   50   C  CZ3 . TRP A 1 13  ? 11.668  60.329  38.511 1.00 49.72 ? 118 TRP A CZ3 1 
ATOM   51   C  CH2 . TRP A 1 13  ? 10.722  59.635  39.274 1.00 49.69 ? 118 TRP A CH2 1 
ATOM   52   N  N   . HIS A 1 14  ? 16.965  57.356  40.109 1.00 49.57 ? 119 HIS A N   1 
ATOM   53   C  CA  . HIS A 1 14  ? 17.502  56.129  40.706 1.00 49.63 ? 119 HIS A CA  1 
ATOM   54   C  C   . HIS A 1 14  ? 18.953  55.836  40.293 1.00 49.62 ? 119 HIS A C   1 
ATOM   55   O  O   . HIS A 1 14  ? 19.600  54.992  40.895 1.00 49.77 ? 119 HIS A O   1 
ATOM   56   C  CB  . HIS A 1 14  ? 16.636  54.918  40.333 1.00 49.65 ? 119 HIS A CB  1 
ATOM   57   C  CG  . HIS A 1 14  ? 15.285  54.906  40.981 1.00 49.63 ? 119 HIS A CG  1 
ATOM   58   N  ND1 . HIS A 1 14  ? 14.719  53.759  41.494 1.00 49.36 ? 119 HIS A ND1 1 
ATOM   59   C  CD2 . HIS A 1 14  ? 14.386  55.896  41.196 1.00 49.98 ? 119 HIS A CD2 1 
ATOM   60   C  CE1 . HIS A 1 14  ? 13.529  54.041  41.992 1.00 49.78 ? 119 HIS A CE1 1 
ATOM   61   N  NE2 . HIS A 1 14  ? 13.302  55.332  41.823 1.00 50.10 ? 119 HIS A NE2 1 
ATOM   62   N  N   . THR A 1 15  ? 19.463  56.522  39.273 1.00 49.59 ? 120 THR A N   1 
ATOM   63   C  CA  . THR A 1 15  ? 20.725  56.132  38.647 1.00 49.40 ? 120 THR A CA  1 
ATOM   64   C  C   . THR A 1 15  ? 21.954  56.931  39.096 1.00 49.42 ? 120 THR A C   1 
ATOM   65   O  O   . THR A 1 15  ? 23.059  56.699  38.599 1.00 49.62 ? 120 THR A O   1 
ATOM   66   C  CB  . THR A 1 15  ? 20.613  56.215  37.118 1.00 49.29 ? 120 THR A CB  1 
ATOM   67   O  OG1 . THR A 1 15  ? 20.474  57.581  36.724 1.00 49.09 ? 120 THR A OG1 1 
ATOM   68   C  CG2 . THR A 1 15  ? 19.412  55.427  36.631 1.00 49.18 ? 120 THR A CG2 1 
ATOM   69   N  N   . GLY A 1 16  ? 21.780  57.860  40.029 1.00 49.26 ? 121 GLY A N   1 
ATOM   70   C  CA  . GLY A 1 16  ? 22.912  58.629  40.531 1.00 49.19 ? 121 GLY A CA  1 
ATOM   71   C  C   . GLY A 1 16  ? 22.594  59.621  41.637 1.00 49.18 ? 121 GLY A C   1 
ATOM   72   O  O   . GLY A 1 16  ? 21.461  59.691  42.133 1.00 49.13 ? 121 GLY A O   1 
ATOM   73   N  N   . ALA A 1 17  ? 23.613  60.392  42.009 1.00 49.01 ? 122 ALA A N   1 
ATOM   74   C  CA  . ALA A 1 17  ? 23.524  61.349  43.104 1.00 48.89 ? 122 ALA A CA  1 
ATOM   75   C  C   . ALA A 1 17  ? 22.895  62.658  42.663 1.00 48.68 ? 122 ALA A C   1 
ATOM   76   O  O   . ALA A 1 17  ? 22.955  63.030  41.494 1.00 48.40 ? 122 ALA A O   1 
ATOM   77   C  CB  . ALA A 1 17  ? 24.910  61.615  43.690 1.00 48.93 ? 122 ALA A CB  1 
ATOM   78   N  N   . LEU A 1 18  ? 22.302  63.353  43.627 1.00 48.79 ? 123 LEU A N   1 
ATOM   79   C  CA  . LEU A 1 18  ? 21.754  64.683  43.407 1.00 48.82 ? 123 LEU A CA  1 
ATOM   80   C  C   . LEU A 1 18  ? 22.650  65.748  44.043 1.00 48.74 ? 123 LEU A C   1 
ATOM   81   O  O   . LEU A 1 18  ? 23.137  65.587  45.162 1.00 48.46 ? 123 LEU A O   1 
ATOM   82   C  CB  . LEU A 1 18  ? 20.331  64.763  43.954 1.00 48.86 ? 123 LEU A CB  1 
ATOM   83   C  CG  . LEU A 1 18  ? 19.347  63.868  43.195 1.00 48.80 ? 123 LEU A CG  1 
ATOM   84   C  CD1 . LEU A 1 18  ? 18.038  63.750  43.946 1.00 48.71 ? 123 LEU A CD1 1 
ATOM   85   C  CD2 . LEU A 1 18  ? 19.118  64.396  41.777 1.00 49.17 ? 123 LEU A CD2 1 
ATOM   86   N  N   . TYR A 1 19  ? 22.852  66.832  43.299 1.00 48.79 ? 124 TYR A N   1 
ATOM   87   C  CA  . TYR A 1 19  ? 23.787  67.890  43.644 1.00 48.92 ? 124 TYR A CA  1 
ATOM   88   C  C   . TYR A 1 19  ? 22.973  69.163  43.855 1.00 49.07 ? 124 TYR A C   1 
ATOM   89   O  O   . TYR A 1 19  ? 22.306  69.629  42.937 1.00 49.14 ? 124 TYR A O   1 
ATOM   90   C  CB  . TYR A 1 19  ? 24.766  68.061  42.476 1.00 48.68 ? 124 TYR A CB  1 
ATOM   91   C  CG  . TYR A 1 19  ? 26.029  68.852  42.758 1.00 48.67 ? 124 TYR A CG  1 
ATOM   92   C  CD1 . TYR A 1 19  ? 27.050  68.318  43.541 1.00 48.36 ? 124 TYR A CD1 1 
ATOM   93   C  CD2 . TYR A 1 19  ? 26.223  70.113  42.201 1.00 48.24 ? 124 TYR A CD2 1 
ATOM   94   C  CE1 . TYR A 1 19  ? 28.212  69.028  43.783 1.00 48.15 ? 124 TYR A CE1 1 
ATOM   95   C  CE2 . TYR A 1 19  ? 27.384  70.830  42.436 1.00 48.14 ? 124 TYR A CE2 1 
ATOM   96   C  CZ  . TYR A 1 19  ? 28.375  70.282  43.227 1.00 48.33 ? 124 TYR A CZ  1 
ATOM   97   O  OH  . TYR A 1 19  ? 29.529  70.992  43.469 1.00 48.26 ? 124 TYR A OH  1 
ATOM   98   N  N   . ARG A 1 20  ? 23.007  69.715  45.063 1.00 49.39 ? 125 ARG A N   1 
ATOM   99   C  CA  . ARG A 1 20  ? 22.247  70.925  45.368 1.00 49.55 ? 125 ARG A CA  1 
ATOM   100  C  C   . ARG A 1 20  ? 23.090  72.178  45.190 1.00 49.80 ? 125 ARG A C   1 
ATOM   101  O  O   . ARG A 1 20  ? 24.149  72.314  45.800 1.00 49.75 ? 125 ARG A O   1 
ATOM   102  C  CB  . ARG A 1 20  ? 21.710  70.880  46.794 1.00 49.53 ? 125 ARG A CB  1 
ATOM   103  C  CG  . ARG A 1 20  ? 20.624  69.855  47.029 1.00 49.31 ? 125 ARG A CG  1 
ATOM   104  C  CD  . ARG A 1 20  ? 20.039  70.042  48.412 1.00 49.41 ? 125 ARG A CD  1 
ATOM   105  N  NE  . ARG A 1 20  ? 21.031  69.763  49.454 1.00 49.19 ? 125 ARG A NE  1 
ATOM   106  C  CZ  . ARG A 1 20  ? 20.938  68.799  50.369 1.00 48.52 ? 125 ARG A CZ  1 
ATOM   107  N  NH1 . ARG A 1 20  ? 19.878  68.001  50.430 1.00 48.44 ? 125 ARG A NH1 1 
ATOM   108  N  NH2 . ARG A 1 20  ? 21.913  68.642  51.250 1.00 48.71 ? 125 ARG A NH2 1 
ATOM   109  N  N   . ILE A 1 21  ? 22.600  73.089  44.353 1.00 50.35 ? 126 ILE A N   1 
ATOM   110  C  CA  . ILE A 1 21  ? 23.239  74.380  44.113 1.00 50.66 ? 126 ILE A CA  1 
ATOM   111  C  C   . ILE A 1 21  ? 22.272  75.483  44.550 1.00 51.03 ? 126 ILE A C   1 
ATOM   112  O  O   . ILE A 1 21  ? 21.464  75.971  43.756 1.00 51.17 ? 126 ILE A O   1 
ATOM   113  C  CB  . ILE A 1 21  ? 23.628  74.548  42.623 1.00 50.70 ? 126 ILE A CB  1 
ATOM   114  C  CG1 . ILE A 1 21  ? 24.589  73.433  42.195 1.00 50.76 ? 126 ILE A CG1 1 
ATOM   115  C  CG2 . ILE A 1 21  ? 24.260  75.935  42.372 1.00 50.58 ? 126 ILE A CG2 1 
ATOM   116  C  CD1 . ILE A 1 21  ? 24.672  73.231  40.693 1.00 50.79 ? 126 ILE A CD1 1 
ATOM   117  N  N   . GLY A 1 22  ? 22.359  75.861  45.822 1.00 51.36 ? 127 GLY A N   1 
ATOM   118  C  CA  . GLY A 1 22  ? 21.449  76.841  46.401 1.00 51.70 ? 127 GLY A CA  1 
ATOM   119  C  C   . GLY A 1 22  ? 21.708  78.268  45.945 1.00 52.09 ? 127 GLY A C   1 
ATOM   120  O  O   . GLY A 1 22  ? 20.774  78.979  45.563 1.00 52.32 ? 127 GLY A O   1 
ATOM   121  N  N   . ASP A 1 23  ? 22.972  78.689  45.996 1.00 52.46 ? 128 ASP A N   1 
ATOM   122  C  CA  . ASP A 1 23  ? 23.364  80.054  45.626 1.00 52.50 ? 128 ASP A CA  1 
ATOM   123  C  C   . ASP A 1 23  ? 24.261  80.045  44.381 1.00 52.65 ? 128 ASP A C   1 
ATOM   124  O  O   . ASP A 1 23  ? 25.437  79.685  44.454 1.00 52.37 ? 128 ASP A O   1 
ATOM   125  C  CB  . ASP A 1 23  ? 24.085  80.719  46.802 1.00 52.57 ? 128 ASP A CB  1 
ATOM   126  C  CG  . ASP A 1 23  ? 24.243  82.223  46.628 1.00 52.85 ? 128 ASP A CG  1 
ATOM   127  O  OD1 . ASP A 1 23  ? 24.252  82.933  47.657 1.00 53.74 ? 128 ASP A OD1 1 
ATOM   128  O  OD2 . ASP A 1 23  ? 24.357  82.701  45.477 1.00 53.63 ? 128 ASP A OD2 1 
ATOM   129  N  N   . LEU A 1 24  ? 23.691  80.444  43.244 1.00 52.91 ? 129 LEU A N   1 
ATOM   130  C  CA  . LEU A 1 24  ? 24.423  80.510  41.972 1.00 53.21 ? 129 LEU A CA  1 
ATOM   131  C  C   . LEU A 1 24  ? 25.687  81.373  42.026 1.00 53.40 ? 129 LEU A C   1 
ATOM   132  O  O   . LEU A 1 24  ? 26.675  81.071  41.354 1.00 53.26 ? 129 LEU A O   1 
ATOM   133  C  CB  . LEU A 1 24  ? 23.510  81.023  40.848 1.00 53.25 ? 129 LEU A CB  1 
ATOM   134  C  CG  . LEU A 1 24  ? 22.876  79.961  39.947 1.00 53.57 ? 129 LEU A CG  1 
ATOM   135  C  CD1 . LEU A 1 24  ? 21.726  80.546  39.150 1.00 53.84 ? 129 LEU A CD1 1 
ATOM   136  C  CD2 . LEU A 1 24  ? 23.924  79.360  39.016 1.00 53.86 ? 129 LEU A CD2 1 
ATOM   137  N  N   . GLN A 1 25  ? 25.653  82.445  42.815 1.00 53.81 ? 130 GLN A N   1 
ATOM   138  C  CA  . GLN A 1 25  ? 26.779  83.382  42.883 1.00 54.04 ? 130 GLN A CA  1 
ATOM   139  C  C   . GLN A 1 25  ? 27.926  82.888  43.769 1.00 54.19 ? 130 GLN A C   1 
ATOM   140  O  O   . GLN A 1 25  ? 29.087  83.170  43.481 1.00 54.31 ? 130 GLN A O   1 
ATOM   141  C  CB  . GLN A 1 25  ? 26.317  84.766  43.343 1.00 53.95 ? 130 GLN A CB  1 
ATOM   142  C  CG  . GLN A 1 25  ? 27.381  85.847  43.159 1.00 54.08 ? 130 GLN A CG  1 
ATOM   143  C  CD  . GLN A 1 25  ? 26.839  87.255  43.304 1.00 54.44 ? 130 GLN A CD  1 
ATOM   144  O  OE1 . GLN A 1 25  ? 25.633  87.462  43.470 1.00 55.47 ? 130 GLN A OE1 1 
ATOM   145  N  NE2 . GLN A 1 25  ? 27.734  88.238  43.240 1.00 54.64 ? 130 GLN A NE2 1 
ATOM   146  N  N   . ALA A 1 26  ? 27.613  82.171  44.843 1.00 54.42 ? 131 ALA A N   1 
ATOM   147  C  CA  . ALA A 1 26  ? 28.655  81.556  45.671 1.00 54.70 ? 131 ALA A CA  1 
ATOM   148  C  C   . ALA A 1 26  ? 29.297  80.347  44.976 1.00 54.93 ? 131 ALA A C   1 
ATOM   149  O  O   . ALA A 1 26  ? 30.471  80.055  45.204 1.00 54.87 ? 131 ALA A O   1 
ATOM   150  C  CB  . ALA A 1 26  ? 28.094  81.154  47.031 1.00 54.61 ? 131 ALA A CB  1 
ATOM   151  N  N   . PHE A 1 27  ? 28.529  79.663  44.125 1.00 55.32 ? 132 PHE A N   1 
ATOM   152  C  CA  . PHE A 1 27  ? 28.977  78.414  43.489 1.00 55.67 ? 132 PHE A CA  1 
ATOM   153  C  C   . PHE A 1 27  ? 30.054  78.611  42.426 1.00 56.01 ? 132 PHE A C   1 
ATOM   154  O  O   . PHE A 1 27  ? 30.943  77.772  42.290 1.00 56.01 ? 132 PHE A O   1 
ATOM   155  C  CB  . PHE A 1 27  ? 27.798  77.653  42.869 1.00 55.47 ? 132 PHE A CB  1 
ATOM   156  C  CG  . PHE A 1 27  ? 28.219  76.516  41.979 1.00 55.41 ? 132 PHE A CG  1 
ATOM   157  C  CD1 . PHE A 1 27  ? 28.824  75.389  42.517 1.00 55.23 ? 132 PHE A CD1 1 
ATOM   158  C  CD2 . PHE A 1 27  ? 28.035  76.582  40.602 1.00 55.56 ? 132 PHE A CD2 1 
ATOM   159  C  CE1 . PHE A 1 27  ? 29.226  74.339  41.700 1.00 55.21 ? 132 PHE A CE1 1 
ATOM   160  C  CE2 . PHE A 1 27  ? 28.432  75.535  39.778 1.00 55.30 ? 132 PHE A CE2 1 
ATOM   161  C  CZ  . PHE A 1 27  ? 29.029  74.413  40.328 1.00 55.23 ? 132 PHE A CZ  1 
ATOM   162  N  N   . GLN A 1 28  ? 29.959  79.690  41.656 1.00 56.52 ? 133 GLN A N   1 
ATOM   163  C  CA  . GLN A 1 28  ? 30.975  79.988  40.635 1.00 57.07 ? 133 GLN A CA  1 
ATOM   164  C  C   . GLN A 1 28  ? 31.748  81.275  40.915 1.00 57.39 ? 133 GLN A C   1 
ATOM   165  O  O   . GLN A 1 28  ? 32.816  81.496  40.335 1.00 57.37 ? 133 GLN A O   1 
ATOM   166  C  CB  . GLN A 1 28  ? 30.392  79.985  39.215 1.00 57.14 ? 133 GLN A CB  1 
ATOM   167  C  CG  . GLN A 1 28  ? 28.888  80.192  39.111 1.00 57.47 ? 133 GLN A CG  1 
ATOM   168  C  CD  . GLN A 1 28  ? 28.363  79.904  37.719 1.00 57.67 ? 133 GLN A CD  1 
ATOM   169  O  OE1 . GLN A 1 28  ? 29.081  79.372  36.864 1.00 58.76 ? 133 GLN A OE1 1 
ATOM   170  N  NE2 . GLN A 1 28  ? 27.098  80.244  37.484 1.00 58.21 ? 133 GLN A NE2 1 
ATOM   171  N  N   . GLY A 1 29  ? 31.218  82.108  41.808 1.00 57.77 ? 134 GLY A N   1 
ATOM   172  C  CA  . GLY A 1 29  ? 31.942  83.272  42.296 1.00 58.01 ? 134 GLY A CA  1 
ATOM   173  C  C   . GLY A 1 29  ? 32.109  84.339  41.237 1.00 58.31 ? 134 GLY A C   1 
ATOM   174  O  O   . GLY A 1 29  ? 31.130  84.808  40.649 1.00 58.46 ? 134 GLY A O   1 
ATOM   175  N  N   . HIS A 1 30  ? 33.361  84.700  40.982 1.00 58.62 ? 135 HIS A N   1 
ATOM   176  C  CA  . HIS A 1 30  ? 33.683  85.817  40.100 1.00 58.84 ? 135 HIS A CA  1 
ATOM   177  C  C   . HIS A 1 30  ? 33.552  85.390  38.641 1.00 58.90 ? 135 HIS A C   1 
ATOM   178  O  O   . HIS A 1 30  ? 33.563  84.194  38.331 1.00 58.86 ? 135 HIS A O   1 
ATOM   179  C  CB  . HIS A 1 30  ? 35.102  86.327  40.382 1.00 59.14 ? 135 HIS A CB  1 
ATOM   180  C  CG  . HIS A 1 30  ? 35.461  86.339  41.838 1.00 59.96 ? 135 HIS A CG  1 
ATOM   181  N  ND1 . HIS A 1 30  ? 34.921  87.240  42.732 1.00 60.77 ? 135 HIS A ND1 1 
ATOM   182  C  CD2 . HIS A 1 30  ? 36.296  85.550  42.556 1.00 60.76 ? 135 HIS A CD2 1 
ATOM   183  C  CE1 . HIS A 1 30  ? 35.415  87.011  43.936 1.00 61.08 ? 135 HIS A CE1 1 
ATOM   184  N  NE2 . HIS A 1 30  ? 36.252  85.991  43.857 1.00 61.26 ? 135 HIS A NE2 1 
ATOM   185  N  N   . GLY A 1 31  ? 33.414  86.372  37.753 1.00 58.90 ? 136 GLY A N   1 
ATOM   186  C  CA  . GLY A 1 31  ? 33.327  86.113  36.317 1.00 58.83 ? 136 GLY A CA  1 
ATOM   187  C  C   . GLY A 1 31  ? 31.968  85.595  35.873 1.00 58.84 ? 136 GLY A C   1 
ATOM   188  O  O   . GLY A 1 31  ? 31.219  86.312  35.216 1.00 59.03 ? 136 GLY A O   1 
ATOM   189  N  N   . ALA A 1 32  ? 31.652  84.351  36.226 1.00 58.64 ? 137 ALA A N   1 
ATOM   190  C  CA  . ALA A 1 32  ? 30.428  83.697  35.754 1.00 58.54 ? 137 ALA A CA  1 
ATOM   191  C  C   . ALA A 1 32  ? 29.181  84.192  36.503 1.00 58.46 ? 137 ALA A C   1 
ATOM   192  O  O   . ALA A 1 32  ? 28.584  85.199  36.110 1.00 58.63 ? 137 ALA A O   1 
ATOM   193  C  CB  . ALA A 1 32  ? 30.569  82.166  35.849 1.00 58.71 ? 137 ALA A CB  1 
ATOM   194  N  N   . GLY A 1 33  ? 28.787  83.483  37.562 1.00 58.16 ? 138 GLY A N   1 
ATOM   195  C  CA  . GLY A 1 33  ? 27.677  83.894  38.432 1.00 57.88 ? 138 GLY A CA  1 
ATOM   196  C  C   . GLY A 1 33  ? 26.288  83.941  37.814 1.00 57.60 ? 138 GLY A C   1 
ATOM   197  O  O   . GLY A 1 33  ? 25.383  84.552  38.378 1.00 57.52 ? 138 GLY A O   1 
ATOM   198  N  N   . ASN A 1 34  ? 26.108  83.281  36.672 1.00 57.37 ? 139 ASN A N   1 
ATOM   199  C  CA  . ASN A 1 34  ? 24.870  83.382  35.897 1.00 57.06 ? 139 ASN A CA  1 
ATOM   200  C  C   . ASN A 1 34  ? 24.311  82.000  35.552 1.00 56.71 ? 139 ASN A C   1 
ATOM   201  O  O   . ASN A 1 34  ? 24.908  80.978  35.889 1.00 56.59 ? 139 ASN A O   1 
ATOM   202  C  CB  . ASN A 1 34  ? 25.145  84.178  34.611 1.00 57.12 ? 139 ASN A CB  1 
ATOM   203  C  CG  . ASN A 1 34  ? 23.937  84.961  34.134 1.00 57.69 ? 139 ASN A CG  1 
ATOM   204  O  OD1 . ASN A 1 34  ? 23.358  85.735  34.890 1.00 59.14 ? 139 ASN A OD1 1 
ATOM   205  N  ND2 . ASN A 1 34  ? 23.558  84.773  32.872 1.00 57.85 ? 139 ASN A ND2 1 
ATOM   206  N  N   . LEU A 1 35  ? 23.153  81.975  34.897 1.00 56.32 ? 140 LEU A N   1 
ATOM   207  C  CA  . LEU A 1 35  ? 22.644  80.757  34.272 1.00 55.93 ? 140 LEU A CA  1 
ATOM   208  C  C   . LEU A 1 35  ? 23.492  80.397  33.046 1.00 55.65 ? 140 LEU A C   1 
ATOM   209  O  O   . LEU A 1 35  ? 23.716  79.220  32.758 1.00 55.54 ? 140 LEU A O   1 
ATOM   210  C  CB  . LEU A 1 35  ? 21.177  80.931  33.872 1.00 55.83 ? 140 LEU A CB  1 
ATOM   211  C  CG  . LEU A 1 35  ? 20.192  81.085  35.037 1.00 55.84 ? 140 LEU A CG  1 
ATOM   212  C  CD1 . LEU A 1 35  ? 18.847  81.576  34.535 1.00 55.76 ? 140 LEU A CD1 1 
ATOM   213  C  CD2 . LEU A 1 35  ? 20.030  79.781  35.809 1.00 55.87 ? 140 LEU A CD2 1 
ATOM   214  N  N   . ALA A 1 36  ? 23.961  81.417  32.328 1.00 55.26 ? 141 ALA A N   1 
ATOM   215  C  CA  . ALA A 1 36  ? 24.878  81.219  31.206 1.00 54.88 ? 141 ALA A CA  1 
ATOM   216  C  C   . ALA A 1 36  ? 26.242  80.738  31.696 1.00 54.61 ? 141 ALA A C   1 
ATOM   217  O  O   . ALA A 1 36  ? 26.933  79.992  30.999 1.00 54.75 ? 141 ALA A O   1 
ATOM   218  C  CB  . ALA A 1 36  ? 25.029  82.507  30.412 1.00 54.86 ? 141 ALA A CB  1 
ATOM   219  N  N   . GLY A 1 37  ? 26.624  81.171  32.896 1.00 54.14 ? 142 GLY A N   1 
ATOM   220  C  CA  . GLY A 1 37  ? 27.888  80.773  33.508 1.00 53.69 ? 142 GLY A CA  1 
ATOM   221  C  C   . GLY A 1 37  ? 27.836  79.357  34.031 1.00 53.24 ? 142 GLY A C   1 
ATOM   222  O  O   . GLY A 1 37  ? 28.808  78.614  33.921 1.00 53.24 ? 142 GLY A O   1 
ATOM   223  N  N   . LEU A 1 38  ? 26.695  78.992  34.611 1.00 52.85 ? 143 LEU A N   1 
ATOM   224  C  CA  . LEU A 1 38  ? 26.442  77.627  35.077 1.00 52.61 ? 143 LEU A CA  1 
ATOM   225  C  C   . LEU A 1 38  ? 26.530  76.628  33.931 1.00 52.35 ? 143 LEU A C   1 
ATOM   226  O  O   . LEU A 1 38  ? 26.881  75.468  34.136 1.00 52.50 ? 143 LEU A O   1 
ATOM   227  C  CB  . LEU A 1 38  ? 25.057  77.538  35.718 1.00 52.55 ? 143 LEU A CB  1 
ATOM   228  C  CG  . LEU A 1 38  ? 24.622  76.166  36.236 1.00 52.70 ? 143 LEU A CG  1 
ATOM   229  C  CD1 . LEU A 1 38  ? 25.607  75.658  37.279 1.00 52.78 ? 143 LEU A CD1 1 
ATOM   230  C  CD2 . LEU A 1 38  ? 23.208  76.230  36.809 1.00 52.64 ? 143 LEU A CD2 1 
ATOM   231  N  N   . LYS A 1 39  ? 26.200  77.093  32.728 1.00 52.03 ? 144 LYS A N   1 
ATOM   232  C  CA  . LYS A 1 39  ? 26.306  76.302  31.507 1.00 51.71 ? 144 LYS A CA  1 
ATOM   233  C  C   . LYS A 1 39  ? 27.731  75.812  31.274 1.00 51.48 ? 144 LYS A C   1 
ATOM   234  O  O   . LYS A 1 39  ? 27.936  74.705  30.784 1.00 51.65 ? 144 LYS A O   1 
ATOM   235  C  CB  . LYS A 1 39  ? 25.858  77.142  30.311 1.00 51.65 ? 144 LYS A CB  1 
ATOM   236  C  CG  . LYS A 1 39  ? 25.447  76.346  29.090 1.00 51.78 ? 144 LYS A CG  1 
ATOM   237  C  CD  . LYS A 1 39  ? 25.486  77.198  27.826 1.00 51.71 ? 144 LYS A CD  1 
ATOM   238  C  CE  . LYS A 1 39  ? 24.561  78.403  27.914 1.00 51.77 ? 144 LYS A CE  1 
ATOM   239  N  NZ  . LYS A 1 39  ? 24.599  79.203  26.667 1.00 51.90 ? 144 LYS A NZ  1 
ATOM   240  N  N   . GLY A 1 40  ? 28.713  76.639  31.621 1.00 51.08 ? 145 GLY A N   1 
ATOM   241  C  CA  . GLY A 1 40  ? 30.118  76.289  31.427 1.00 50.72 ? 145 GLY A CA  1 
ATOM   242  C  C   . GLY A 1 40  ? 30.667  75.257  32.400 1.00 50.38 ? 145 GLY A C   1 
ATOM   243  O  O   . GLY A 1 40  ? 31.715  74.670  32.145 1.00 50.46 ? 145 GLY A O   1 
ATOM   244  N  N   . ARG A 1 41  ? 29.971  75.030  33.512 1.00 49.93 ? 146 ARG A N   1 
ATOM   245  C  CA  . ARG A 1 41  ? 30.440  74.097  34.543 1.00 49.63 ? 146 ARG A CA  1 
ATOM   246  C  C   . ARG A 1 41  ? 29.791  72.716  34.453 1.00 49.18 ? 146 ARG A C   1 
ATOM   247  O  O   . ARG A 1 41  ? 29.889  71.925  35.395 1.00 48.81 ? 146 ARG A O   1 
ATOM   248  C  CB  . ARG A 1 41  ? 30.177  74.683  35.933 1.00 49.67 ? 146 ARG A CB  1 
ATOM   249  C  CG  . ARG A 1 41  ? 30.909  75.983  36.209 1.00 49.84 ? 146 ARG A CG  1 
ATOM   250  C  CD  . ARG A 1 41  ? 32.399  75.767  36.395 1.00 49.78 ? 146 ARG A CD  1 
ATOM   251  N  NE  . ARG A 1 41  ? 33.045  76.955  36.948 1.00 49.91 ? 146 ARG A NE  1 
ATOM   252  C  CZ  . ARG A 1 41  ? 34.355  77.080  37.155 1.00 50.30 ? 146 ARG A CZ  1 
ATOM   253  N  NH1 . ARG A 1 41  ? 35.196  76.088  36.855 1.00 50.30 ? 146 ARG A NH1 1 
ATOM   254  N  NH2 . ARG A 1 41  ? 34.831  78.210  37.666 1.00 50.21 ? 146 ARG A NH2 1 
ATOM   255  N  N   . LEU A 1 42  ? 29.140  72.427  33.327 1.00 48.82 ? 147 LEU A N   1 
ATOM   256  C  CA  . LEU A 1 42  ? 28.398  71.176  33.164 1.00 48.64 ? 147 LEU A CA  1 
ATOM   257  C  C   . LEU A 1 42  ? 29.334  69.989  33.015 1.00 48.44 ? 147 LEU A C   1 
ATOM   258  O  O   . LEU A 1 42  ? 29.074  68.922  33.567 1.00 48.65 ? 147 LEU A O   1 
ATOM   259  C  CB  . LEU A 1 42  ? 27.454  71.250  31.964 1.00 48.54 ? 147 LEU A CB  1 
ATOM   260  C  CG  . LEU A 1 42  ? 26.274  72.215  32.117 1.00 48.55 ? 147 LEU A CG  1 
ATOM   261  C  CD1 . LEU A 1 42  ? 25.582  72.449  30.777 1.00 48.37 ? 147 LEU A CD1 1 
ATOM   262  C  CD2 . LEU A 1 42  ? 25.281  71.705  33.158 1.00 48.35 ? 147 LEU A CD2 1 
ATOM   263  N  N   . ASP A 1 43  ? 30.427  70.179  32.284 1.00 48.12 ? 148 ASP A N   1 
ATOM   264  C  CA  . ASP A 1 43  ? 31.418  69.124  32.118 1.00 47.94 ? 148 ASP A CA  1 
ATOM   265  C  C   . ASP A 1 43  ? 32.041  68.730  33.464 1.00 47.80 ? 148 ASP A C   1 
ATOM   266  O  O   . ASP A 1 43  ? 32.389  67.564  33.668 1.00 47.84 ? 148 ASP A O   1 
ATOM   267  C  CB  . ASP A 1 43  ? 32.501  69.544  31.109 1.00 47.90 ? 148 ASP A CB  1 
ATOM   268  C  CG  . ASP A 1 43  ? 31.961  69.704  29.683 1.00 47.91 ? 148 ASP A CG  1 
ATOM   269  O  OD1 . ASP A 1 43  ? 32.719  70.167  28.808 1.00 48.53 ? 148 ASP A OD1 1 
ATOM   270  O  OD2 . ASP A 1 43  ? 30.785  69.379  29.425 1.00 47.98 ? 148 ASP A OD2 1 
ATOM   271  N  N   . TYR A 1 44  ? 32.167  69.692  34.379 1.00 47.53 ? 149 TYR A N   1 
ATOM   272  C  CA  . TYR A 1 44  ? 32.644  69.411  35.742 1.00 47.45 ? 149 TYR A CA  1 
ATOM   273  C  C   . TYR A 1 44  ? 31.665  68.546  36.517 1.00 47.30 ? 149 TYR A C   1 
ATOM   274  O  O   . TYR A 1 44  ? 32.071  67.618  37.211 1.00 47.29 ? 149 TYR A O   1 
ATOM   275  C  CB  . TYR A 1 44  ? 32.901  70.705  36.529 1.00 47.18 ? 149 TYR A CB  1 
ATOM   276  C  CG  . TYR A 1 44  ? 33.137  70.477  38.009 1.00 47.03 ? 149 TYR A CG  1 
ATOM   277  C  CD1 . TYR A 1 44  ? 34.301  69.869  38.461 1.00 46.46 ? 149 TYR A CD1 1 
ATOM   278  C  CD2 . TYR A 1 44  ? 32.185  70.855  38.955 1.00 46.64 ? 149 TYR A CD2 1 
ATOM   279  C  CE1 . TYR A 1 44  ? 34.516  69.645  39.812 1.00 46.72 ? 149 TYR A CE1 1 
ATOM   280  C  CE2 . TYR A 1 44  ? 32.392  70.636  40.310 1.00 46.52 ? 149 TYR A CE2 1 
ATOM   281  C  CZ  . TYR A 1 44  ? 33.559  70.033  40.732 1.00 46.59 ? 149 TYR A CZ  1 
ATOM   282  O  OH  . TYR A 1 44  ? 33.773  69.820  42.072 1.00 46.68 ? 149 TYR A OH  1 
ATOM   283  N  N   . LEU A 1 45  ? 30.379  68.859  36.414 1.00 47.48 ? 150 LEU A N   1 
ATOM   284  C  CA  . LEU A 1 45  ? 29.350  68.086  37.114 1.00 47.68 ? 150 LEU A CA  1 
ATOM   285  C  C   . LEU A 1 45  ? 29.266  66.675  36.535 1.00 47.80 ? 150 LEU A C   1 
ATOM   286  O  O   . LEU A 1 45  ? 28.997  65.716  37.251 1.00 47.84 ? 150 LEU A O   1 
ATOM   287  C  CB  . LEU A 1 45  ? 27.989  68.781  37.024 1.00 47.59 ? 150 LEU A CB  1 
ATOM   288  C  CG  . LEU A 1 45  ? 27.903  70.187  37.626 1.00 47.41 ? 150 LEU A CG  1 
ATOM   289  C  CD1 . LEU A 1 45  ? 26.542  70.803  37.339 1.00 47.42 ? 150 LEU A CD1 1 
ATOM   290  C  CD2 . LEU A 1 45  ? 28.185  70.172  39.120 1.00 47.18 ? 150 LEU A CD2 1 
ATOM   291  N  N   . SER A 1 46  ? 29.513  66.562  35.233 1.00 47.99 ? 151 SER A N   1 
ATOM   292  C  CA  . SER A 1 46  ? 29.638  65.270  34.573 1.00 48.13 ? 151 SER A CA  1 
ATOM   293  C  C   . SER A 1 46  ? 30.797  64.437  35.155 1.00 48.29 ? 151 SER A C   1 
ATOM   294  O  O   . SER A 1 46  ? 30.685  63.217  35.284 1.00 48.49 ? 151 SER A O   1 
ATOM   295  C  CB  . SER A 1 46  ? 29.826  65.468  33.069 1.00 48.07 ? 151 SER A CB  1 
ATOM   296  O  OG  . SER A 1 46  ? 29.630  64.255  32.376 1.00 48.31 ? 151 SER A OG  1 
ATOM   297  N  N   . SER A 1 47  ? 31.892  65.099  35.525 1.00 48.35 ? 152 SER A N   1 
ATOM   298  C  CA  . SER A 1 47  ? 33.027  64.426  36.162 1.00 48.46 ? 152 SER A CA  1 
ATOM   299  C  C   . SER A 1 47  ? 32.714  63.955  37.585 1.00 48.68 ? 152 SER A C   1 
ATOM   300  O  O   . SER A 1 47  ? 33.480  63.184  38.161 1.00 48.84 ? 152 SER A O   1 
ATOM   301  C  CB  . SER A 1 47  ? 34.259  65.339  36.192 1.00 48.42 ? 152 SER A CB  1 
ATOM   302  O  OG  . SER A 1 47  ? 34.263  66.167  37.345 1.00 48.03 ? 152 SER A OG  1 
ATOM   303  N  N   . LEU A 1 48  ? 31.619  64.446  38.160 1.00 48.96 ? 153 LEU A N   1 
ATOM   304  C  CA  . LEU A 1 48  ? 31.122  63.950  39.444 1.00 49.23 ? 153 LEU A CA  1 
ATOM   305  C  C   . LEU A 1 48  ? 30.042  62.892  39.246 1.00 49.56 ? 153 LEU A C   1 
ATOM   306  O  O   . LEU A 1 48  ? 29.561  62.315  40.223 1.00 49.50 ? 153 LEU A O   1 
ATOM   307  C  CB  . LEU A 1 48  ? 30.527  65.090  40.275 1.00 49.17 ? 153 LEU A CB  1 
ATOM   308  C  CG  . LEU A 1 48  ? 31.351  66.351  40.527 1.00 48.73 ? 153 LEU A CG  1 
ATOM   309  C  CD1 . LEU A 1 48  ? 30.720  67.127  41.671 1.00 48.12 ? 153 LEU A CD1 1 
ATOM   310  C  CD2 . LEU A 1 48  ? 32.809  66.028  40.831 1.00 48.73 ? 153 LEU A CD2 1 
ATOM   311  N  N   . LYS A 1 49  ? 29.658  62.669  37.986 1.00 49.99 ? 154 LYS A N   1 
ATOM   312  C  CA  . LYS A 1 49  ? 28.580  61.745  37.601 1.00 50.35 ? 154 LYS A CA  1 
ATOM   313  C  C   . LYS A 1 49  ? 27.255  61.991  38.330 1.00 50.59 ? 154 LYS A C   1 
ATOM   314  O  O   . LYS A 1 49  ? 26.533  61.045  38.674 1.00 50.76 ? 154 LYS A O   1 
ATOM   315  C  CB  . LYS A 1 49  ? 29.042  60.288  37.738 1.00 50.36 ? 154 LYS A CB  1 
ATOM   316  C  CG  . LYS A 1 49  ? 29.868  59.830  36.538 1.00 50.87 ? 154 LYS A CG  1 
ATOM   317  C  CD  . LYS A 1 49  ? 31.052  58.959  36.932 1.00 51.01 ? 154 LYS A CD  1 
ATOM   318  C  CE  . LYS A 1 49  ? 32.245  59.207  36.009 1.00 51.39 ? 154 LYS A CE  1 
ATOM   319  N  NZ  . LYS A 1 49  ? 33.457  58.440  36.402 1.00 51.40 ? 154 LYS A NZ  1 
ATOM   320  N  N   . VAL A 1 50  ? 26.932  63.264  38.550 1.00 50.70 ? 155 VAL A N   1 
ATOM   321  C  CA  . VAL A 1 50  ? 25.629  63.621  39.098 1.00 50.76 ? 155 VAL A CA  1 
ATOM   322  C  C   . VAL A 1 50  ? 24.617  63.612  37.957 1.00 50.81 ? 155 VAL A C   1 
ATOM   323  O  O   . VAL A 1 50  ? 24.862  64.193  36.897 1.00 50.78 ? 155 VAL A O   1 
ATOM   324  C  CB  . VAL A 1 50  ? 25.637  64.976  39.866 1.00 50.91 ? 155 VAL A CB  1 
ATOM   325  C  CG1 . VAL A 1 50  ? 26.479  64.849  41.145 1.00 51.42 ? 155 VAL A CG1 1 
ATOM   326  C  CG2 . VAL A 1 50  ? 26.144  66.133  39.007 1.00 50.89 ? 155 VAL A CG2 1 
ATOM   327  N  N   . LYS A 1 51  ? 23.500  62.916  38.171 1.00 50.81 ? 156 LYS A N   1 
ATOM   328  C  CA  . LYS A 1 51  ? 22.458  62.780  37.155 1.00 50.73 ? 156 LYS A CA  1 
ATOM   329  C  C   . LYS A 1 51  ? 21.414  63.889  37.235 1.00 50.61 ? 156 LYS A C   1 
ATOM   330  O  O   . LYS A 1 51  ? 20.579  64.019  36.334 1.00 50.67 ? 156 LYS A O   1 
ATOM   331  C  CB  . LYS A 1 51  ? 21.760  61.424  37.279 1.00 50.76 ? 156 LYS A CB  1 
ATOM   332  C  CG  . LYS A 1 51  ? 22.699  60.231  37.240 1.00 51.18 ? 156 LYS A CG  1 
ATOM   333  C  CD  . LYS A 1 51  ? 23.326  60.017  35.875 1.00 51.00 ? 156 LYS A CD  1 
ATOM   334  C  CE  . LYS A 1 51  ? 24.203  58.778  35.878 1.00 51.25 ? 156 LYS A CE  1 
ATOM   335  N  NZ  . LYS A 1 51  ? 25.165  58.769  34.743 1.00 51.68 ? 156 LYS A NZ  1 
ATOM   336  N  N   . GLY A 1 52  ? 21.444  64.672  38.310 1.00 50.40 ? 157 GLY A N   1 
ATOM   337  C  CA  . GLY A 1 52  ? 20.502  65.771  38.472 1.00 50.39 ? 157 GLY A CA  1 
ATOM   338  C  C   . GLY A 1 52  ? 21.009  66.820  39.431 1.00 50.34 ? 157 GLY A C   1 
ATOM   339  O  O   . GLY A 1 52  ? 21.409  66.491  40.548 1.00 50.53 ? 157 GLY A O   1 
ATOM   340  N  N   . LEU A 1 53  ? 21.006  68.080  38.999 1.00 50.25 ? 158 LEU A N   1 
ATOM   341  C  CA  . LEU A 1 53  ? 21.390  69.189  39.876 1.00 50.13 ? 158 LEU A CA  1 
ATOM   342  C  C   . LEU A 1 53  ? 20.141  69.909  40.373 1.00 49.97 ? 158 LEU A C   1 
ATOM   343  O  O   . LEU A 1 53  ? 19.206  70.136  39.607 1.00 49.93 ? 158 LEU A O   1 
ATOM   344  C  CB  . LEU A 1 53  ? 22.355  70.151  39.167 1.00 50.11 ? 158 LEU A CB  1 
ATOM   345  C  CG  . LEU A 1 53  ? 21.860  71.044  38.024 1.00 50.17 ? 158 LEU A CG  1 
ATOM   346  C  CD1 . LEU A 1 53  ? 21.337  72.371  38.537 1.00 50.47 ? 158 LEU A CD1 1 
ATOM   347  C  CD2 . LEU A 1 53  ? 22.979  71.314  37.036 1.00 50.19 ? 158 LEU A CD2 1 
ATOM   348  N  N   . VAL A 1 54  ? 20.128  70.251  41.657 1.00 49.89 ? 159 VAL A N   1 
ATOM   349  C  CA  . VAL A 1 54  ? 18.982  70.916  42.276 1.00 49.88 ? 159 VAL A CA  1 
ATOM   350  C  C   . VAL A 1 54  ? 19.249  72.422  42.349 1.00 49.83 ? 159 VAL A C   1 
ATOM   351  O  O   . VAL A 1 54  ? 20.018  72.899  43.181 1.00 49.70 ? 159 VAL A O   1 
ATOM   352  C  CB  . VAL A 1 54  ? 18.669  70.336  43.673 1.00 49.85 ? 159 VAL A CB  1 
ATOM   353  C  CG1 . VAL A 1 54  ? 17.454  71.043  44.290 1.00 50.03 ? 159 VAL A CG1 1 
ATOM   354  C  CG2 . VAL A 1 54  ? 18.442  68.818  43.583 1.00 49.37 ? 159 VAL A CG2 1 
ATOM   355  N  N   . LEU A 1 55  ? 18.574  73.156  41.471 1.00 49.96 ? 160 LEU A N   1 
ATOM   356  C  CA  . LEU A 1 55  ? 18.901  74.546  41.167 1.00 49.80 ? 160 LEU A CA  1 
ATOM   357  C  C   . LEU A 1 55  ? 17.898  75.512  41.773 1.00 49.55 ? 160 LEU A C   1 
ATOM   358  O  O   . LEU A 1 55  ? 16.696  75.265  41.752 1.00 49.68 ? 160 LEU A O   1 
ATOM   359  C  CB  . LEU A 1 55  ? 18.922  74.723  39.646 1.00 49.92 ? 160 LEU A CB  1 
ATOM   360  C  CG  . LEU A 1 55  ? 18.939  76.123  39.030 1.00 50.23 ? 160 LEU A CG  1 
ATOM   361  C  CD1 . LEU A 1 55  ? 20.355  76.672  39.000 1.00 51.06 ? 160 LEU A CD1 1 
ATOM   362  C  CD2 . LEU A 1 55  ? 18.351  76.079  37.623 1.00 50.21 ? 160 LEU A CD2 1 
ATOM   363  N  N   . GLY A 1 56  ? 18.400  76.622  42.298 1.00 49.35 ? 161 GLY A N   1 
ATOM   364  C  CA  . GLY A 1 56  ? 17.552  77.715  42.745 1.00 49.14 ? 161 GLY A CA  1 
ATOM   365  C  C   . GLY A 1 56  ? 17.333  77.711  44.240 1.00 48.75 ? 161 GLY A C   1 
ATOM   366  O  O   . GLY A 1 56  ? 18.071  77.039  44.965 1.00 48.28 ? 161 GLY A O   1 
ATOM   367  N  N   . PRO A 1 57  ? 16.308  78.455  44.710 1.00 48.60 ? 162 PRO A N   1 
ATOM   368  C  CA  . PRO A 1 57  ? 15.335  79.219  43.909 1.00 48.48 ? 162 PRO A CA  1 
ATOM   369  C  C   . PRO A 1 57  ? 15.928  80.385  43.115 1.00 48.34 ? 162 PRO A C   1 
ATOM   370  O  O   . PRO A 1 57  ? 16.894  81.005  43.555 1.00 48.18 ? 162 PRO A O   1 
ATOM   371  C  CB  . PRO A 1 57  ? 14.348  79.749  44.958 1.00 48.51 ? 162 PRO A CB  1 
ATOM   372  C  CG  . PRO A 1 57  ? 14.581  78.929  46.169 1.00 48.63 ? 162 PRO A CG  1 
ATOM   373  C  CD  . PRO A 1 57  ? 16.025  78.584  46.148 1.00 48.62 ? 162 PRO A CD  1 
ATOM   374  N  N   . ILE A 1 58  ? 15.327  80.672  41.963 1.00 48.38 ? 163 ILE A N   1 
ATOM   375  C  CA  . ILE A 1 58  ? 15.791  81.737  41.066 1.00 48.56 ? 163 ILE A CA  1 
ATOM   376  C  C   . ILE A 1 58  ? 14.702  82.764  40.698 1.00 48.64 ? 163 ILE A C   1 
ATOM   377  O  O   . ILE A 1 58  ? 14.906  83.595  39.807 1.00 48.47 ? 163 ILE A O   1 
ATOM   378  C  CB  . ILE A 1 58  ? 16.361  81.146  39.758 1.00 48.55 ? 163 ILE A CB  1 
ATOM   379  C  CG1 . ILE A 1 58  ? 15.344  80.210  39.101 1.00 48.59 ? 163 ILE A CG1 1 
ATOM   380  C  CG2 . ILE A 1 58  ? 17.649  80.408  40.027 1.00 48.65 ? 163 ILE A CG2 1 
ATOM   381  C  CD1 . ILE A 1 58  ? 15.710  79.824  37.695 1.00 48.73 ? 163 ILE A CD1 1 
ATOM   382  N  N   . HIS A 1 59  ? 13.564  82.719  41.392 1.00 48.74 ? 164 HIS A N   1 
ATOM   383  C  CA  . HIS A 1 59  ? 12.405  83.550  41.050 1.00 48.69 ? 164 HIS A CA  1 
ATOM   384  C  C   . HIS A 1 59  ? 12.386  84.847  41.855 1.00 48.78 ? 164 HIS A C   1 
ATOM   385  O  O   . HIS A 1 59  ? 13.073  84.960  42.872 1.00 48.63 ? 164 HIS A O   1 
ATOM   386  C  CB  . HIS A 1 59  ? 11.099  82.770  41.265 1.00 48.57 ? 164 HIS A CB  1 
ATOM   387  C  CG  . HIS A 1 59  ? 10.821  82.429  42.697 1.00 48.19 ? 164 HIS A CG  1 
ATOM   388  N  ND1 . HIS A 1 59  ? 11.319  81.296  43.302 1.00 47.66 ? 164 HIS A ND1 1 
ATOM   389  C  CD2 . HIS A 1 59  ? 10.097  83.074  43.643 1.00 48.32 ? 164 HIS A CD2 1 
ATOM   390  C  CE1 . HIS A 1 59  ? 10.922  81.262  44.562 1.00 47.82 ? 164 HIS A CE1 1 
ATOM   391  N  NE2 . HIS A 1 59  ? 10.174  82.326  44.793 1.00 48.06 ? 164 HIS A NE2 1 
ATOM   392  N  N   . LYS A 1 60  ? 11.595  85.813  41.387 1.00 48.97 ? 165 LYS A N   1 
ATOM   393  C  CA  . LYS A 1 60  ? 11.440  87.110  42.056 1.00 49.21 ? 165 LYS A CA  1 
ATOM   394  C  C   . LYS A 1 60  ? 10.790  86.972  43.432 1.00 49.25 ? 165 LYS A C   1 
ATOM   395  O  O   . LYS A 1 60  ? 9.743   86.341  43.565 1.00 49.22 ? 165 LYS A O   1 
ATOM   396  C  CB  . LYS A 1 60  ? 10.583  88.053  41.211 1.00 49.28 ? 165 LYS A CB  1 
ATOM   397  C  CG  . LYS A 1 60  ? 11.213  88.495  39.898 1.00 49.54 ? 165 LYS A CG  1 
ATOM   398  C  CD  . LYS A 1 60  ? 10.437  89.670  39.306 1.00 49.61 ? 165 LYS A CD  1 
ATOM   399  C  CE  . LYS A 1 60  ? 11.056  90.191  38.016 1.00 49.79 ? 165 LYS A CE  1 
ATOM   400  N  NZ  . LYS A 1 60  ? 10.411  91.468  37.585 1.00 49.73 ? 165 LYS A NZ  1 
ATOM   401  N  N   . ASN A 1 61  ? 11.399  87.587  44.441 1.00 49.37 ? 166 ASN A N   1 
ATOM   402  C  CA  . ASN A 1 61  ? 10.916  87.479  45.813 1.00 49.56 ? 166 ASN A CA  1 
ATOM   403  C  C   . ASN A 1 61  ? 11.344  88.677  46.660 1.00 49.71 ? 166 ASN A C   1 
ATOM   404  O  O   . ASN A 1 61  ? 12.497  88.760  47.075 1.00 49.76 ? 166 ASN A O   1 
ATOM   405  C  CB  . ASN A 1 61  ? 11.430  86.169  46.435 1.00 49.55 ? 166 ASN A CB  1 
ATOM   406  C  CG  . ASN A 1 61  ? 10.967  85.960  47.880 1.00 49.49 ? 166 ASN A CG  1 
ATOM   407  O  OD1 . ASN A 1 61  ? 11.568  85.184  48.622 1.00 49.51 ? 166 ASN A OD1 1 
ATOM   408  N  ND2 . ASN A 1 61  ? 9.895   86.634  48.276 1.00 49.73 ? 166 ASN A ND2 1 
ATOM   409  N  N   . GLN A 1 62  ? 10.413  89.600  46.903 1.00 49.94 ? 167 GLN A N   1 
ATOM   410  C  CA  . GLN A 1 62  ? 10.621  90.666  47.884 1.00 50.16 ? 167 GLN A CA  1 
ATOM   411  C  C   . GLN A 1 62  ? 10.413  90.076  49.278 1.00 50.29 ? 167 GLN A C   1 
ATOM   412  O  O   . GLN A 1 62  ? 9.320   89.610  49.603 1.00 50.30 ? 167 GLN A O   1 
ATOM   413  C  CB  . GLN A 1 62  ? 9.654   91.838  47.664 1.00 50.21 ? 167 GLN A CB  1 
ATOM   414  C  CG  . GLN A 1 62  ? 10.009  93.104  48.470 1.00 50.10 ? 167 GLN A CG  1 
ATOM   415  C  CD  . GLN A 1 62  ? 8.831   94.064  48.668 1.00 50.48 ? 167 GLN A CD  1 
ATOM   416  O  OE1 . GLN A 1 62  ? 9.006   95.286  48.699 1.00 50.95 ? 167 GLN A OE1 1 
ATOM   417  N  NE2 . GLN A 1 62  ? 7.633   93.513  48.822 1.00 50.93 ? 167 GLN A NE2 1 
ATOM   418  N  N   . LYS A 1 63  ? 11.471  90.113  50.085 1.00 50.45 ? 168 LYS A N   1 
ATOM   419  C  CA  . LYS A 1 63  ? 11.498  89.515  51.424 1.00 50.55 ? 168 LYS A CA  1 
ATOM   420  C  C   . LYS A 1 63  ? 10.211  89.730  52.231 1.00 50.65 ? 168 LYS A C   1 
ATOM   421  O  O   . LYS A 1 63  ? 9.881   90.858  52.591 1.00 50.68 ? 168 LYS A O   1 
ATOM   422  C  CB  . LYS A 1 63  ? 12.690  90.088  52.202 1.00 50.62 ? 168 LYS A CB  1 
ATOM   423  C  CG  . LYS A 1 63  ? 13.033  89.354  53.485 1.00 50.65 ? 168 LYS A CG  1 
ATOM   424  C  CD  . LYS A 1 63  ? 14.192  90.025  54.202 1.00 50.60 ? 168 LYS A CD  1 
ATOM   425  C  CE  . LYS A 1 63  ? 14.484  89.356  55.530 1.00 50.57 ? 168 LYS A CE  1 
ATOM   426  N  NZ  . LYS A 1 63  ? 15.442  90.147  56.345 1.00 50.56 ? 168 LYS A NZ  1 
ATOM   427  N  N   . ASP A 1 64  ? 9.498   88.636  52.502 1.00 50.81 ? 169 ASP A N   1 
ATOM   428  C  CA  . ASP A 1 64  ? 8.288   88.631  53.346 1.00 50.94 ? 169 ASP A CA  1 
ATOM   429  C  C   . ASP A 1 64  ? 7.112   89.425  52.776 1.00 51.08 ? 169 ASP A C   1 
ATOM   430  O  O   . ASP A 1 64  ? 6.484   90.195  53.501 1.00 51.18 ? 169 ASP A O   1 
ATOM   431  C  CB  . ASP A 1 64  ? 8.589   89.137  54.769 1.00 50.84 ? 169 ASP A CB  1 
ATOM   432  C  CG  . ASP A 1 64  ? 9.668   88.335  55.466 1.00 50.72 ? 169 ASP A CG  1 
ATOM   433  O  OD1 . ASP A 1 64  ? 9.576   87.089  55.487 1.00 50.92 ? 169 ASP A OD1 1 
ATOM   434  O  OD2 . ASP A 1 64  ? 10.601  88.957  56.014 1.00 50.28 ? 169 ASP A OD2 1 
ATOM   435  N  N   . ASP A 1 65  ? 6.806   89.235  51.495 1.00 51.33 ? 170 ASP A N   1 
ATOM   436  C  CA  . ASP A 1 65  ? 5.627   89.867  50.893 1.00 51.49 ? 170 ASP A CA  1 
ATOM   437  C  C   . ASP A 1 65  ? 5.074   89.037  49.733 1.00 51.67 ? 170 ASP A C   1 
ATOM   438  O  O   . ASP A 1 65  ? 5.743   88.853  48.708 1.00 51.69 ? 170 ASP A O   1 
ATOM   439  C  CB  . ASP A 1 65  ? 5.953   91.291  50.423 1.00 51.55 ? 170 ASP A CB  1 
ATOM   440  C  CG  . ASP A 1 65  ? 4.714   92.177  50.317 1.00 51.76 ? 170 ASP A CG  1 
ATOM   441  O  OD1 . ASP A 1 65  ? 3.715   91.918  51.023 1.00 52.43 ? 170 ASP A OD1 1 
ATOM   442  O  OD2 . ASP A 1 65  ? 4.743   93.151  49.534 1.00 52.96 ? 170 ASP A OD2 1 
ATOM   443  N  N   . VAL A 1 66  ? 3.842   88.557  49.900 1.00 51.78 ? 171 VAL A N   1 
ATOM   444  C  CA  . VAL A 1 66  ? 3.241   87.588  48.975 1.00 51.89 ? 171 VAL A CA  1 
ATOM   445  C  C   . VAL A 1 66  ? 2.956   88.215  47.613 1.00 51.93 ? 171 VAL A C   1 
ATOM   446  O  O   . VAL A 1 66  ? 3.311   87.649  46.575 1.00 51.84 ? 171 VAL A O   1 
ATOM   447  C  CB  . VAL A 1 66  ? 1.921   86.992  49.546 1.00 51.97 ? 171 VAL A CB  1 
ATOM   448  C  CG1 . VAL A 1 66  ? 1.298   85.994  48.558 1.00 52.02 ? 171 VAL A CG1 1 
ATOM   449  C  CG2 . VAL A 1 66  ? 2.168   86.320  50.897 1.00 52.03 ? 171 VAL A CG2 1 
ATOM   450  N  N   . ALA A 1 67  ? 2.311   89.382  47.636 1.00 52.02 ? 172 ALA A N   1 
ATOM   451  C  CA  . ALA A 1 67  ? 1.937   90.110  46.418 1.00 52.01 ? 172 ALA A CA  1 
ATOM   452  C  C   . ALA A 1 67  ? 3.150   90.425  45.546 1.00 52.06 ? 172 ALA A C   1 
ATOM   453  O  O   . ALA A 1 67  ? 3.079   90.331  44.319 1.00 52.10 ? 172 ALA A O   1 
ATOM   454  C  CB  . ALA A 1 67  ? 1.204   91.394  46.778 1.00 51.91 ? 172 ALA A CB  1 
ATOM   455  N  N   . GLN A 1 68  ? 4.259   90.783  46.192 1.00 52.09 ? 173 GLN A N   1 
ATOM   456  C  CA  . GLN A 1 68  ? 5.518   91.080  45.503 1.00 52.06 ? 173 GLN A CA  1 
ATOM   457  C  C   . GLN A 1 68  ? 6.419   89.843  45.374 1.00 51.89 ? 173 GLN A C   1 
ATOM   458  O  O   . GLN A 1 68  ? 7.627   89.912  45.616 1.00 51.77 ? 173 GLN A O   1 
ATOM   459  C  CB  . GLN A 1 68  ? 6.253   92.210  46.234 1.00 52.21 ? 173 GLN A CB  1 
ATOM   460  C  CG  . GLN A 1 68  ? 5.690   93.586  45.939 1.00 52.69 ? 173 GLN A CG  1 
ATOM   461  C  CD  . GLN A 1 68  ? 6.039   94.052  44.541 1.00 53.36 ? 173 GLN A CD  1 
ATOM   462  O  OE1 . GLN A 1 68  ? 7.209   94.053  44.152 1.00 53.95 ? 173 GLN A OE1 1 
ATOM   463  N  NE2 . GLN A 1 68  ? 5.027   94.446  43.774 1.00 53.50 ? 173 GLN A NE2 1 
ATOM   464  N  N   . THR A 1 69  ? 5.821   88.720  44.984 1.00 51.68 ? 174 THR A N   1 
ATOM   465  C  CA  . THR A 1 69  ? 6.552   87.472  44.758 1.00 51.69 ? 174 THR A CA  1 
ATOM   466  C  C   . THR A 1 69  ? 5.895   86.735  43.590 1.00 51.53 ? 174 THR A C   1 
ATOM   467  O  O   . THR A 1 69  ? 4.681   86.503  43.603 1.00 51.37 ? 174 THR A O   1 
ATOM   468  C  CB  . THR A 1 69  ? 6.564   86.578  46.031 1.00 51.72 ? 174 THR A CB  1 
ATOM   469  O  OG1 . THR A 1 69  ? 7.136   87.303  47.128 1.00 51.92 ? 174 THR A OG1 1 
ATOM   470  C  CG2 . THR A 1 69  ? 7.372   85.313  45.815 1.00 51.61 ? 174 THR A CG2 1 
ATOM   471  N  N   . ASP A 1 70  ? 6.695   86.390  42.582 1.00 51.36 ? 175 ASP A N   1 
ATOM   472  C  CA  . ASP A 1 70  ? 6.196   85.727  41.375 1.00 51.34 ? 175 ASP A CA  1 
ATOM   473  C  C   . ASP A 1 70  ? 7.121   84.577  40.958 1.00 51.33 ? 175 ASP A C   1 
ATOM   474  O  O   . ASP A 1 70  ? 8.235   84.798  40.477 1.00 51.28 ? 175 ASP A O   1 
ATOM   475  C  CB  . ASP A 1 70  ? 6.055   86.740  40.237 1.00 51.21 ? 175 ASP A CB  1 
ATOM   476  C  CG  . ASP A 1 70  ? 5.138   86.254  39.132 1.00 51.33 ? 175 ASP A CG  1 
ATOM   477  O  OD1 . ASP A 1 70  ? 5.211   85.063  38.765 1.00 51.46 ? 175 ASP A OD1 1 
ATOM   478  O  OD2 . ASP A 1 70  ? 4.335   87.067  38.628 1.00 51.51 ? 175 ASP A OD2 1 
ATOM   479  N  N   . LEU A 1 71  ? 6.639   83.350  41.141 1.00 51.31 ? 176 LEU A N   1 
ATOM   480  C  CA  . LEU A 1 71  ? 7.409   82.144  40.828 1.00 51.32 ? 176 LEU A CA  1 
ATOM   481  C  C   . LEU A 1 71  ? 7.616   81.932  39.321 1.00 51.27 ? 176 LEU A C   1 
ATOM   482  O  O   . LEU A 1 71  ? 8.495   81.172  38.924 1.00 51.11 ? 176 LEU A O   1 
ATOM   483  C  CB  . LEU A 1 71  ? 6.727   80.913  41.437 1.00 51.31 ? 176 LEU A CB  1 
ATOM   484  C  CG  . LEU A 1 71  ? 6.756   80.839  42.968 1.00 51.63 ? 176 LEU A CG  1 
ATOM   485  C  CD1 . LEU A 1 71  ? 5.517   80.153  43.535 1.00 51.84 ? 176 LEU A CD1 1 
ATOM   486  C  CD2 . LEU A 1 71  ? 8.014   80.124  43.439 1.00 52.19 ? 176 LEU A CD2 1 
ATOM   487  N  N   . LEU A 1 72  ? 6.812   82.598  38.494 1.00 51.31 ? 177 LEU A N   1 
ATOM   488  C  CA  . LEU A 1 72  ? 6.904   82.459  37.041 1.00 51.41 ? 177 LEU A CA  1 
ATOM   489  C  C   . LEU A 1 72  ? 7.945   83.379  36.411 1.00 51.48 ? 177 LEU A C   1 
ATOM   490  O  O   . LEU A 1 72  ? 8.275   83.216  35.238 1.00 51.35 ? 177 LEU A O   1 
ATOM   491  C  CB  . LEU A 1 72  ? 5.543   82.717  36.395 1.00 51.33 ? 177 LEU A CB  1 
ATOM   492  C  CG  . LEU A 1 72  ? 4.391   81.857  36.920 1.00 51.27 ? 177 LEU A CG  1 
ATOM   493  C  CD1 . LEU A 1 72  ? 3.123   82.124  36.129 1.00 51.65 ? 177 LEU A CD1 1 
ATOM   494  C  CD2 . LEU A 1 72  ? 4.738   80.389  36.864 1.00 51.12 ? 177 LEU A CD2 1 
ATOM   495  N  N   . GLN A 1 73  ? 8.456   84.336  37.184 1.00 51.67 ? 178 GLN A N   1 
ATOM   496  C  CA  . GLN A 1 73  ? 9.443   85.295  36.693 1.00 51.90 ? 178 GLN A CA  1 
ATOM   497  C  C   . GLN A 1 73  ? 10.793  85.101  37.371 1.00 52.09 ? 178 GLN A C   1 
ATOM   498  O  O   . GLN A 1 73  ? 10.886  85.115  38.598 1.00 52.29 ? 178 GLN A O   1 
ATOM   499  C  CB  . GLN A 1 73  ? 8.968   86.727  36.947 1.00 51.99 ? 178 GLN A CB  1 
ATOM   500  C  CG  . GLN A 1 73  ? 7.664   87.101  36.255 1.00 52.01 ? 178 GLN A CG  1 
ATOM   501  C  CD  . GLN A 1 73  ? 7.316   88.568  36.417 1.00 52.14 ? 178 GLN A CD  1 
ATOM   502  O  OE1 . GLN A 1 73  ? 8.147   89.376  36.836 1.00 52.55 ? 178 GLN A OE1 1 
ATOM   503  N  NE2 . GLN A 1 73  ? 6.080   88.923  36.078 1.00 53.07 ? 178 GLN A NE2 1 
ATOM   504  N  N   . ILE A 1 74  ? 11.836  84.939  36.562 1.00 52.28 ? 179 ILE A N   1 
ATOM   505  C  CA  . ILE A 1 74  ? 13.208  84.813  37.055 1.00 52.28 ? 179 ILE A CA  1 
ATOM   506  C  C   . ILE A 1 74  ? 13.725  86.184  37.512 1.00 52.42 ? 179 ILE A C   1 
ATOM   507  O  O   . ILE A 1 74  ? 13.360  87.214  36.944 1.00 52.39 ? 179 ILE A O   1 
ATOM   508  C  CB  . ILE A 1 74  ? 14.143  84.239  35.949 1.00 52.28 ? 179 ILE A CB  1 
ATOM   509  C  CG1 . ILE A 1 74  ? 13.721  82.813  35.573 1.00 52.23 ? 179 ILE A CG1 1 
ATOM   510  C  CG2 . ILE A 1 74  ? 15.613  84.257  36.392 1.00 52.35 ? 179 ILE A CG2 1 
ATOM   511  C  CD1 . ILE A 1 74  ? 14.276  82.339  34.236 1.00 52.23 ? 179 ILE A CD1 1 
ATOM   512  N  N   . ASP A 1 75  ? 14.564  86.191  38.545 1.00 52.58 ? 180 ASP A N   1 
ATOM   513  C  CA  . ASP A 1 75  ? 15.240  87.412  38.976 1.00 52.59 ? 180 ASP A CA  1 
ATOM   514  C  C   . ASP A 1 75  ? 16.357  87.740  37.983 1.00 52.72 ? 180 ASP A C   1 
ATOM   515  O  O   . ASP A 1 75  ? 17.229  86.900  37.741 1.00 52.63 ? 180 ASP A O   1 
ATOM   516  C  CB  . ASP A 1 75  ? 15.825  87.236  40.378 1.00 52.58 ? 180 ASP A CB  1 
ATOM   517  C  CG  . ASP A 1 75  ? 16.417  88.523  40.938 1.00 52.61 ? 180 ASP A CG  1 
ATOM   518  O  OD1 . ASP A 1 75  ? 16.189  88.813  42.130 1.00 52.28 ? 180 ASP A OD1 1 
ATOM   519  O  OD2 . ASP A 1 75  ? 17.113  89.248  40.198 1.00 53.07 ? 180 ASP A OD2 1 
ATOM   520  N  N   . PRO A 1 76  ? 16.341  88.965  37.413 1.00 52.89 ? 181 PRO A N   1 
ATOM   521  C  CA  . PRO A 1 76  ? 17.377  89.451  36.491 1.00 52.95 ? 181 PRO A CA  1 
ATOM   522  C  C   . PRO A 1 76  ? 18.827  89.208  36.938 1.00 53.10 ? 181 PRO A C   1 
ATOM   523  O  O   . PRO A 1 76  ? 19.705  89.086  36.086 1.00 53.31 ? 181 PRO A O   1 
ATOM   524  C  CB  . PRO A 1 76  ? 17.098  90.952  36.421 1.00 52.93 ? 181 PRO A CB  1 
ATOM   525  C  CG  . PRO A 1 76  ? 15.648  91.067  36.646 1.00 52.86 ? 181 PRO A CG  1 
ATOM   526  C  CD  . PRO A 1 76  ? 15.288  89.981  37.615 1.00 52.93 ? 181 PRO A CD  1 
ATOM   527  N  N   . ASN A 1 77  ? 19.075  89.157  38.246 1.00 53.15 ? 182 ASN A N   1 
ATOM   528  C  CA  . ASN A 1 77  ? 20.409  88.854  38.770 1.00 53.26 ? 182 ASN A CA  1 
ATOM   529  C  C   . ASN A 1 77  ? 20.961  87.526  38.253 1.00 53.39 ? 182 ASN A C   1 
ATOM   530  O  O   . ASN A 1 77  ? 22.149  87.417  37.946 1.00 53.48 ? 182 ASN A O   1 
ATOM   531  C  CB  . ASN A 1 77  ? 20.396  88.836  40.302 1.00 53.27 ? 182 ASN A CB  1 
ATOM   532  C  CG  . ASN A 1 77  ? 20.404  90.226  40.900 1.00 53.47 ? 182 ASN A CG  1 
ATOM   533  O  OD1 . ASN A 1 77  ? 21.430  90.909  40.900 1.00 54.08 ? 182 ASN A OD1 1 
ATOM   534  N  ND2 . ASN A 1 77  ? 19.260  90.655  41.415 1.00 53.86 ? 182 ASN A ND2 1 
ATOM   535  N  N   . PHE A 1 78  ? 20.092  86.526  38.154 1.00 53.47 ? 183 PHE A N   1 
ATOM   536  C  CA  . PHE A 1 78  ? 20.496  85.196  37.712 1.00 53.49 ? 183 PHE A CA  1 
ATOM   537  C  C   . PHE A 1 78  ? 20.540  85.072  36.188 1.00 53.47 ? 183 PHE A C   1 
ATOM   538  O  O   . PHE A 1 78  ? 21.119  84.120  35.663 1.00 53.51 ? 183 PHE A O   1 
ATOM   539  C  CB  . PHE A 1 78  ? 19.561  84.137  38.305 1.00 53.66 ? 183 PHE A CB  1 
ATOM   540  C  CG  . PHE A 1 78  ? 19.441  84.214  39.803 1.00 53.65 ? 183 PHE A CG  1 
ATOM   541  C  CD1 . PHE A 1 78  ? 18.203  84.365  40.408 1.00 53.73 ? 183 PHE A CD1 1 
ATOM   542  C  CD2 . PHE A 1 78  ? 20.573  84.159  40.603 1.00 53.86 ? 183 PHE A CD2 1 
ATOM   543  C  CE1 . PHE A 1 78  ? 18.091  84.449  41.788 1.00 53.76 ? 183 PHE A CE1 1 
ATOM   544  C  CE2 . PHE A 1 78  ? 20.471  84.238  41.982 1.00 54.00 ? 183 PHE A CE2 1 
ATOM   545  C  CZ  . PHE A 1 78  ? 19.226  84.383  42.577 1.00 53.91 ? 183 PHE A CZ  1 
ATOM   546  N  N   . GLY A 1 79  ? 19.938  86.029  35.484 1.00 53.37 ? 184 GLY A N   1 
ATOM   547  C  CA  . GLY A 1 79  ? 19.936  86.031  34.022 1.00 53.41 ? 184 GLY A CA  1 
ATOM   548  C  C   . GLY A 1 79  ? 18.541  86.224  33.460 1.00 53.41 ? 184 GLY A C   1 
ATOM   549  O  O   . GLY A 1 79  ? 17.755  86.994  34.012 1.00 53.49 ? 184 GLY A O   1 
ATOM   550  N  N   . SER A 1 80  ? 18.236  85.522  32.367 1.00 53.35 ? 185 SER A N   1 
ATOM   551  C  CA  . SER A 1 80  ? 16.938  85.634  31.689 1.00 53.21 ? 185 SER A CA  1 
ATOM   552  C  C   . SER A 1 80  ? 16.307  84.263  31.417 1.00 53.19 ? 185 SER A C   1 
ATOM   553  O  O   . SER A 1 80  ? 16.837  83.226  31.830 1.00 53.36 ? 185 SER A O   1 
ATOM   554  C  CB  . SER A 1 80  ? 17.099  86.386  30.369 1.00 53.14 ? 185 SER A CB  1 
ATOM   555  O  OG  . SER A 1 80  ? 17.426  85.493  29.322 1.00 52.90 ? 185 SER A OG  1 
ATOM   556  N  N   . LYS A 1 81  ? 15.177  84.273  30.713 1.00 53.01 ? 186 LYS A N   1 
ATOM   557  C  CA  . LYS A 1 81  ? 14.437  83.051  30.404 1.00 53.01 ? 186 LYS A CA  1 
ATOM   558  C  C   . LYS A 1 81  ? 15.133  82.266  29.292 1.00 53.10 ? 186 LYS A C   1 
ATOM   559  O  O   . LYS A 1 81  ? 15.100  81.032  29.280 1.00 53.06 ? 186 LYS A O   1 
ATOM   560  C  CB  . LYS A 1 81  ? 12.997  83.390  30.003 1.00 52.85 ? 186 LYS A CB  1 
ATOM   561  C  CG  . LYS A 1 81  ? 11.950  82.358  30.410 1.00 52.93 ? 186 LYS A CG  1 
ATOM   562  C  CD  . LYS A 1 81  ? 11.866  81.187  29.443 1.00 52.96 ? 186 LYS A CD  1 
ATOM   563  C  CE  . LYS A 1 81  ? 10.601  80.368  29.670 1.00 52.91 ? 186 LYS A CE  1 
ATOM   564  N  NZ  . LYS A 1 81  ? 10.431  79.318  28.628 1.00 53.03 ? 186 LYS A NZ  1 
ATOM   565  N  N   . GLU A 1 82  ? 15.769  82.983  28.368 1.00 53.20 ? 187 GLU A N   1 
ATOM   566  C  CA  . GLU A 1 82  ? 16.471  82.355  27.245 1.00 53.25 ? 187 GLU A CA  1 
ATOM   567  C  C   . GLU A 1 82  ? 17.762  81.696  27.719 1.00 53.18 ? 187 GLU A C   1 
ATOM   568  O  O   . GLU A 1 82  ? 18.184  80.684  27.159 1.00 53.34 ? 187 GLU A O   1 
ATOM   569  C  CB  . GLU A 1 82  ? 16.773  83.372  26.138 1.00 53.48 ? 187 GLU A CB  1 
ATOM   570  C  CG  . GLU A 1 82  ? 15.536  83.862  25.361 1.00 54.38 ? 187 GLU A CG  1 
ATOM   571  C  CD  . GLU A 1 82  ? 14.664  84.853  26.141 1.00 55.81 ? 187 GLU A CD  1 
ATOM   572  O  OE1 . GLU A 1 82  ? 15.211  85.695  26.892 1.00 56.61 ? 187 GLU A OE1 1 
ATOM   573  O  OE2 . GLU A 1 82  ? 13.421  84.795  25.996 1.00 56.83 ? 187 GLU A OE2 1 
ATOM   574  N  N   . ASP A 1 83  ? 18.383  82.274  28.747 1.00 53.00 ? 188 ASP A N   1 
ATOM   575  C  CA  . ASP A 1 83  ? 19.549  81.667  29.399 1.00 52.87 ? 188 ASP A CA  1 
ATOM   576  C  C   . ASP A 1 83  ? 19.183  80.330  30.038 1.00 52.58 ? 188 ASP A C   1 
ATOM   577  O  O   . ASP A 1 83  ? 19.956  79.380  29.978 1.00 52.46 ? 188 ASP A O   1 
ATOM   578  C  CB  . ASP A 1 83  ? 20.116  82.585  30.486 1.00 53.04 ? 188 ASP A CB  1 
ATOM   579  C  CG  . ASP A 1 83  ? 20.696  83.869  29.930 1.00 53.79 ? 188 ASP A CG  1 
ATOM   580  O  OD1 . ASP A 1 83  ? 19.967  84.597  29.222 1.00 55.06 ? 188 ASP A OD1 1 
ATOM   581  O  OD2 . ASP A 1 83  ? 21.878  84.160  30.220 1.00 54.91 ? 188 ASP A OD2 1 
ATOM   582  N  N   . PHE A 1 84  ? 18.008  80.284  30.666 1.00 52.30 ? 189 PHE A N   1 
ATOM   583  C  CA  . PHE A 1 84  ? 17.479  79.063  31.271 1.00 52.16 ? 189 PHE A CA  1 
ATOM   584  C  C   . PHE A 1 84  ? 17.189  78.025  30.200 1.00 52.00 ? 189 PHE A C   1 
ATOM   585  O  O   . PHE A 1 84  ? 17.598  76.871  30.321 1.00 52.04 ? 189 PHE A O   1 
ATOM   586  C  CB  . PHE A 1 84  ? 16.199  79.371  32.051 1.00 52.06 ? 189 PHE A CB  1 
ATOM   587  C  CG  . PHE A 1 84  ? 15.687  78.217  32.863 1.00 51.95 ? 189 PHE A CG  1 
ATOM   588  C  CD1 . PHE A 1 84  ? 16.242  77.924  34.099 1.00 51.69 ? 189 PHE A CD1 1 
ATOM   589  C  CD2 . PHE A 1 84  ? 14.640  77.433  32.399 1.00 51.65 ? 189 PHE A CD2 1 
ATOM   590  C  CE1 . PHE A 1 84  ? 15.772  76.864  34.856 1.00 51.95 ? 189 PHE A CE1 1 
ATOM   591  C  CE2 . PHE A 1 84  ? 14.162  76.373  33.148 1.00 51.74 ? 189 PHE A CE2 1 
ATOM   592  C  CZ  . PHE A 1 84  ? 14.730  76.085  34.380 1.00 52.03 ? 189 PHE A CZ  1 
ATOM   593  N  N   . ASP A 1 85  ? 16.487  78.441  29.149 1.00 51.94 ? 190 ASP A N   1 
ATOM   594  C  CA  . ASP A 1 85  ? 16.201  77.558  28.016 1.00 51.87 ? 190 ASP A CA  1 
ATOM   595  C  C   . ASP A 1 85  ? 17.498  77.042  27.398 1.00 51.60 ? 190 ASP A C   1 
ATOM   596  O  O   . ASP A 1 85  ? 17.615  75.855  27.096 1.00 51.60 ? 190 ASP A O   1 
ATOM   597  C  CB  . ASP A 1 85  ? 15.351  78.275  26.959 1.00 51.98 ? 190 ASP A CB  1 
ATOM   598  C  CG  . ASP A 1 85  ? 13.902  78.485  27.405 1.00 52.74 ? 190 ASP A CG  1 
ATOM   599  O  OD1 . ASP A 1 85  ? 13.360  77.630  28.144 1.00 53.32 ? 190 ASP A OD1 1 
ATOM   600  O  OD2 . ASP A 1 85  ? 13.296  79.505  27.002 1.00 53.94 ? 190 ASP A OD2 1 
ATOM   601  N  N   . SER A 1 86  ? 18.470  77.933  27.234 1.00 51.34 ? 191 SER A N   1 
ATOM   602  C  CA  . SER A 1 86  ? 19.789  77.557  26.731 1.00 51.33 ? 191 SER A CA  1 
ATOM   603  C  C   . SER A 1 86  ? 20.486  76.552  27.654 1.00 51.25 ? 191 SER A C   1 
ATOM   604  O  O   . SER A 1 86  ? 21.170  75.642  27.186 1.00 51.14 ? 191 SER A O   1 
ATOM   605  C  CB  . SER A 1 86  ? 20.659  78.803  26.559 1.00 51.27 ? 191 SER A CB  1 
ATOM   606  O  OG  . SER A 1 86  ? 21.912  78.484  25.984 1.00 51.13 ? 191 SER A OG  1 
ATOM   607  N  N   . LEU A 1 87  ? 20.306  76.714  28.962 1.00 51.30 ? 192 LEU A N   1 
ATOM   608  C  CA  . LEU A 1 87  ? 20.892  75.797  29.938 1.00 51.39 ? 192 LEU A CA  1 
ATOM   609  C  C   . LEU A 1 87  ? 20.270  74.404  29.863 1.00 51.46 ? 192 LEU A C   1 
ATOM   610  O  O   . LEU A 1 87  ? 20.982  73.408  29.940 1.00 51.52 ? 192 LEU A O   1 
ATOM   611  C  CB  . LEU A 1 87  ? 20.758  76.345  31.362 1.00 51.25 ? 192 LEU A CB  1 
ATOM   612  C  CG  . LEU A 1 87  ? 21.388  75.502  32.478 1.00 51.18 ? 192 LEU A CG  1 
ATOM   613  C  CD1 . LEU A 1 87  ? 22.901  75.513  32.387 1.00 51.01 ? 192 LEU A CD1 1 
ATOM   614  C  CD2 . LEU A 1 87  ? 20.939  76.006  33.835 1.00 51.32 ? 192 LEU A CD2 1 
ATOM   615  N  N   . LEU A 1 88  ? 18.948  74.333  29.734 1.00 51.62 ? 193 LEU A N   1 
ATOM   616  C  CA  . LEU A 1 88  ? 18.263  73.038  29.660 1.00 51.75 ? 193 LEU A CA  1 
ATOM   617  C  C   . LEU A 1 88  ? 18.710  72.239  28.440 1.00 51.79 ? 193 LEU A C   1 
ATOM   618  O  O   . LEU A 1 88  ? 18.978  71.039  28.542 1.00 51.57 ? 193 LEU A O   1 
ATOM   619  C  CB  . LEU A 1 88  ? 16.743  73.222  29.628 1.00 51.84 ? 193 LEU A CB  1 
ATOM   620  C  CG  . LEU A 1 88  ? 16.082  73.738  30.908 1.00 52.13 ? 193 LEU A CG  1 
ATOM   621  C  CD1 . LEU A 1 88  ? 14.603  73.974  30.663 1.00 52.33 ? 193 LEU A CD1 1 
ATOM   622  C  CD2 . LEU A 1 88  ? 16.288  72.765  32.064 1.00 52.61 ? 193 LEU A CD2 1 
ATOM   623  N  N   . GLN A 1 89  ? 18.800  72.919  27.298 1.00 51.95 ? 194 GLN A N   1 
ATOM   624  C  CA  . GLN A 1 89  ? 19.179  72.285  26.037 1.00 52.07 ? 194 GLN A CA  1 
ATOM   625  C  C   . GLN A 1 89  ? 20.540  71.596  26.124 1.00 52.19 ? 194 GLN A C   1 
ATOM   626  O  O   . GLN A 1 89  ? 20.685  70.443  25.717 1.00 52.27 ? 194 GLN A O   1 
ATOM   627  C  CB  . GLN A 1 89  ? 19.203  73.318  24.915 1.00 52.03 ? 194 GLN A CB  1 
ATOM   628  C  CG  . GLN A 1 89  ? 19.267  72.705  23.526 1.00 52.10 ? 194 GLN A CG  1 
ATOM   629  C  CD  . GLN A 1 89  ? 19.576  73.718  22.447 1.00 52.07 ? 194 GLN A CD  1 
ATOM   630  O  OE1 . GLN A 1 89  ? 20.035  73.357  21.363 1.00 52.45 ? 194 GLN A OE1 1 
ATOM   631  N  NE2 . GLN A 1 89  ? 19.336  74.992  22.737 1.00 51.78 ? 194 GLN A NE2 1 
ATOM   632  N  N   . SER A 1 90  ? 21.528  72.311  26.652 1.00 52.37 ? 195 SER A N   1 
ATOM   633  C  CA  . SER A 1 90  ? 22.880  71.777  26.809 1.00 52.55 ? 195 SER A CA  1 
ATOM   634  C  C   . SER A 1 90  ? 22.923  70.634  27.819 1.00 52.70 ? 195 SER A C   1 
ATOM   635  O  O   . SER A 1 90  ? 23.616  69.633  27.610 1.00 52.87 ? 195 SER A O   1 
ATOM   636  C  CB  . SER A 1 90  ? 23.841  72.885  27.248 1.00 52.60 ? 195 SER A CB  1 
ATOM   637  O  OG  . SER A 1 90  ? 23.815  73.978  26.342 1.00 52.86 ? 195 SER A OG  1 
ATOM   638  N  N   . ALA A 1 91  ? 22.177  70.793  28.909 1.00 52.81 ? 196 ALA A N   1 
ATOM   639  C  CA  . ALA A 1 91  ? 22.133  69.806  29.980 1.00 52.85 ? 196 ALA A CA  1 
ATOM   640  C  C   . ALA A 1 91  ? 21.557  68.466  29.513 1.00 53.03 ? 196 ALA A C   1 
ATOM   641  O  O   . ALA A 1 91  ? 22.051  67.409  29.909 1.00 53.08 ? 196 ALA A O   1 
ATOM   642  C  CB  . ALA A 1 91  ? 21.328  70.348  31.147 1.00 52.82 ? 196 ALA A CB  1 
ATOM   643  N  N   . LYS A 1 92  ? 20.517  68.509  28.679 1.00 53.13 ? 197 LYS A N   1 
ATOM   644  C  CA  . LYS A 1 92  ? 19.924  67.284  28.131 1.00 53.18 ? 197 LYS A CA  1 
ATOM   645  C  C   . LYS A 1 92  ? 20.856  66.592  27.137 1.00 53.08 ? 197 LYS A C   1 
ATOM   646  O  O   . LYS A 1 92  ? 20.841  65.367  27.023 1.00 53.16 ? 197 LYS A O   1 
ATOM   647  C  CB  . LYS A 1 92  ? 18.576  67.564  27.461 1.00 53.28 ? 197 LYS A CB  1 
ATOM   648  C  CG  . LYS A 1 92  ? 17.479  67.998  28.428 1.00 53.60 ? 197 LYS A CG  1 
ATOM   649  C  CD  . LYS A 1 92  ? 16.098  67.544  27.954 1.00 53.78 ? 197 LYS A CD  1 
ATOM   650  C  CE  . LYS A 1 92  ? 14.965  68.308  28.650 1.00 54.04 ? 197 LYS A CE  1 
ATOM   651  N  NZ  . LYS A 1 92  ? 14.658  69.598  27.964 1.00 54.23 ? 197 LYS A NZ  1 
ATOM   652  N  N   . LYS A 1 93  ? 21.663  67.375  26.423 1.00 52.95 ? 198 LYS A N   1 
ATOM   653  C  CA  . LYS A 1 93  ? 22.676  66.815  25.523 1.00 52.87 ? 198 LYS A CA  1 
ATOM   654  C  C   . LYS A 1 93  ? 23.789  66.090  26.294 1.00 52.62 ? 198 LYS A C   1 
ATOM   655  O  O   . LYS A 1 93  ? 24.457  65.213  25.742 1.00 52.55 ? 198 LYS A O   1 
ATOM   656  C  CB  . LYS A 1 93  ? 23.279  67.908  24.629 1.00 52.93 ? 198 LYS A CB  1 
ATOM   657  C  CG  . LYS A 1 93  ? 24.114  67.367  23.458 1.00 53.09 ? 198 LYS A CG  1 
ATOM   658  C  CD  . LYS A 1 93  ? 24.449  68.455  22.433 1.00 53.20 ? 198 LYS A CD  1 
ATOM   659  C  CE  . LYS A 1 93  ? 25.017  67.880  21.123 1.00 53.22 ? 198 LYS A CE  1 
ATOM   660  N  NZ  . LYS A 1 93  ? 26.447  67.458  21.226 1.00 52.74 ? 198 LYS A NZ  1 
ATOM   661  N  N   . LYS A 1 94  ? 23.973  66.449  27.565 1.00 52.32 ? 199 LYS A N   1 
ATOM   662  C  CA  . LYS A 1 94  ? 24.987  65.824  28.419 1.00 52.21 ? 199 LYS A CA  1 
ATOM   663  C  C   . LYS A 1 94  ? 24.404  64.849  29.455 1.00 51.99 ? 199 LYS A C   1 
ATOM   664  O  O   . LYS A 1 94  ? 25.084  64.480  30.410 1.00 51.93 ? 199 LYS A O   1 
ATOM   665  C  CB  . LYS A 1 94  ? 25.795  66.912  29.135 1.00 52.19 ? 199 LYS A CB  1 
ATOM   666  C  CG  . LYS A 1 94  ? 26.531  67.858  28.198 1.00 52.23 ? 199 LYS A CG  1 
ATOM   667  C  CD  . LYS A 1 94  ? 27.216  68.972  28.975 1.00 52.33 ? 199 LYS A CD  1 
ATOM   668  C  CE  . LYS A 1 94  ? 27.997  69.904  28.061 1.00 52.33 ? 199 LYS A CE  1 
ATOM   669  N  NZ  . LYS A 1 94  ? 29.156  69.225  27.422 1.00 52.38 ? 199 LYS A NZ  1 
ATOM   670  N  N   . SER A 1 95  ? 23.158  64.421  29.262 1.00 51.86 ? 200 SER A N   1 
ATOM   671  C  CA  . SER A 1 95  ? 22.474  63.546  30.223 1.00 51.71 ? 200 SER A CA  1 
ATOM   672  C  C   . SER A 1 95  ? 22.503  64.112  31.647 1.00 51.62 ? 200 SER A C   1 
ATOM   673  O  O   . SER A 1 95  ? 22.900  63.427  32.589 1.00 51.83 ? 200 SER A O   1 
ATOM   674  C  CB  . SER A 1 95  ? 23.071  62.130  30.210 1.00 51.60 ? 200 SER A CB  1 
ATOM   675  O  OG  . SER A 1 95  ? 22.833  61.483  28.978 1.00 51.43 ? 200 SER A OG  1 
ATOM   676  N  N   . ILE A 1 96  ? 22.086  65.366  31.796 1.00 51.42 ? 201 ILE A N   1 
ATOM   677  C  CA  . ILE A 1 96  ? 21.989  65.991  33.113 1.00 51.29 ? 201 ILE A CA  1 
ATOM   678  C  C   . ILE A 1 96  ? 20.602  66.605  33.286 1.00 51.00 ? 201 ILE A C   1 
ATOM   679  O  O   . ILE A 1 96  ? 20.233  67.525  32.559 1.00 51.08 ? 201 ILE A O   1 
ATOM   680  C  CB  . ILE A 1 96  ? 23.098  67.058  33.314 1.00 51.38 ? 201 ILE A CB  1 
ATOM   681  C  CG1 . ILE A 1 96  ? 24.469  66.379  33.410 1.00 51.52 ? 201 ILE A CG1 1 
ATOM   682  C  CG2 . ILE A 1 96  ? 22.850  67.882  34.579 1.00 51.35 ? 201 ILE A CG2 1 
ATOM   683  C  CD1 . ILE A 1 96  ? 25.643  67.332  33.257 1.00 51.64 ? 201 ILE A CD1 1 
ATOM   684  N  N   . ARG A 1 97  ? 19.840  66.089  34.249 1.00 50.69 ? 202 ARG A N   1 
ATOM   685  C  CA  . ARG A 1 97  ? 18.499  66.607  34.544 1.00 50.47 ? 202 ARG A CA  1 
ATOM   686  C  C   . ARG A 1 97  ? 18.565  67.809  35.485 1.00 50.13 ? 202 ARG A C   1 
ATOM   687  O  O   . ARG A 1 97  ? 19.496  67.926  36.285 1.00 50.21 ? 202 ARG A O   1 
ATOM   688  C  CB  . ARG A 1 97  ? 17.624  65.517  35.170 1.00 50.51 ? 202 ARG A CB  1 
ATOM   689  C  CG  . ARG A 1 97  ? 17.551  64.207  34.384 1.00 50.85 ? 202 ARG A CG  1 
ATOM   690  C  CD  . ARG A 1 97  ? 17.147  64.416  32.937 1.00 51.74 ? 202 ARG A CD  1 
ATOM   691  N  NE  . ARG A 1 97  ? 16.117  63.473  32.497 1.00 52.05 ? 202 ARG A NE  1 
ATOM   692  C  CZ  . ARG A 1 97  ? 16.332  62.204  32.154 1.00 52.07 ? 202 ARG A CZ  1 
ATOM   693  N  NH1 . ARG A 1 97  ? 17.557  61.675  32.204 1.00 52.31 ? 202 ARG A NH1 1 
ATOM   694  N  NH2 . ARG A 1 97  ? 15.307  61.454  31.762 1.00 51.88 ? 202 ARG A NH2 1 
ATOM   695  N  N   . VAL A 1 98  ? 17.573  68.692  35.392 1.00 49.66 ? 203 VAL A N   1 
ATOM   696  C  CA  . VAL A 1 98  ? 17.542  69.908  36.199 1.00 49.41 ? 203 VAL A CA  1 
ATOM   697  C  C   . VAL A 1 98  ? 16.275  69.979  37.043 1.00 49.15 ? 203 VAL A C   1 
ATOM   698  O  O   . VAL A 1 98  ? 15.169  70.013  36.505 1.00 49.24 ? 203 VAL A O   1 
ATOM   699  C  CB  . VAL A 1 98  ? 17.616  71.180  35.323 1.00 49.37 ? 203 VAL A CB  1 
ATOM   700  C  CG1 . VAL A 1 98  ? 17.685  72.432  36.205 1.00 49.75 ? 203 VAL A CG1 1 
ATOM   701  C  CG2 . VAL A 1 98  ? 18.809  71.125  34.386 1.00 49.26 ? 203 VAL A CG2 1 
ATOM   702  N  N   . ILE A 1 99  ? 16.450  70.015  38.363 1.00 48.82 ? 204 ILE A N   1 
ATOM   703  C  CA  . ILE A 1 99  ? 15.347  70.177  39.307 1.00 48.60 ? 204 ILE A CA  1 
ATOM   704  C  C   . ILE A 1 99  ? 15.315  71.607  39.847 1.00 48.36 ? 204 ILE A C   1 
ATOM   705  O  O   . ILE A 1 99  ? 16.325  72.108  40.341 1.00 48.51 ? 204 ILE A O   1 
ATOM   706  C  CB  . ILE A 1 99  ? 15.490  69.214  40.491 1.00 48.62 ? 204 ILE A CB  1 
ATOM   707  C  CG1 . ILE A 1 99  ? 15.328  67.767  40.017 1.00 48.66 ? 204 ILE A CG1 1 
ATOM   708  C  CG2 . ILE A 1 99  ? 14.461  69.552  41.583 1.00 48.85 ? 204 ILE A CG2 1 
ATOM   709  C  CD1 . ILE A 1 99  ? 15.798  66.741  41.031 1.00 48.83 ? 204 ILE A CD1 1 
ATOM   710  N  N   . LEU A 1 100 ? 14.147  72.244  39.782 1.00 47.93 ? 205 LEU A N   1 
ATOM   711  C  CA  . LEU A 1 100 ? 13.995  73.636  40.198 1.00 47.62 ? 205 LEU A CA  1 
ATOM   712  C  C   . LEU A 1 100 ? 13.436  73.739  41.622 1.00 47.29 ? 205 LEU A C   1 
ATOM   713  O  O   . LEU A 1 100 ? 12.481  73.047  41.971 1.00 47.15 ? 205 LEU A O   1 
ATOM   714  C  CB  . LEU A 1 100 ? 13.078  74.369  39.214 1.00 47.55 ? 205 LEU A CB  1 
ATOM   715  C  CG  . LEU A 1 100 ? 13.044  75.898  39.329 1.00 47.83 ? 205 LEU A CG  1 
ATOM   716  C  CD1 . LEU A 1 100 ? 14.387  76.509  38.936 1.00 47.80 ? 205 LEU A CD1 1 
ATOM   717  C  CD2 . LEU A 1 100 ? 11.924  76.480  38.483 1.00 47.69 ? 205 LEU A CD2 1 
ATOM   718  N  N   . ASP A 1 101 ? 14.032  74.607  42.438 1.00 46.96 ? 206 ASP A N   1 
ATOM   719  C  CA  . ASP A 1 101 ? 13.543  74.855  43.795 1.00 46.92 ? 206 ASP A CA  1 
ATOM   720  C  C   . ASP A 1 101 ? 12.508  75.987  43.778 1.00 46.78 ? 206 ASP A C   1 
ATOM   721  O  O   . ASP A 1 101 ? 12.776  77.070  43.262 1.00 46.93 ? 206 ASP A O   1 
ATOM   722  C  CB  . ASP A 1 101 ? 14.705  75.200  44.734 1.00 46.75 ? 206 ASP A CB  1 
ATOM   723  C  CG  . ASP A 1 101 ? 14.303  75.182  46.202 1.00 46.66 ? 206 ASP A CG  1 
ATOM   724  O  OD1 . ASP A 1 101 ? 13.182  75.624  46.521 1.00 47.04 ? 206 ASP A OD1 1 
ATOM   725  O  OD2 . ASP A 1 101 ? 15.107  74.732  47.047 1.00 45.83 ? 206 ASP A OD2 1 
ATOM   726  N  N   . LEU A 1 102 ? 11.333  75.728  44.350 1.00 46.61 ? 207 LEU A N   1 
ATOM   727  C  CA  . LEU A 1 102 ? 10.233  76.690  44.360 1.00 46.58 ? 207 LEU A CA  1 
ATOM   728  C  C   . LEU A 1 102 ? 9.827   77.111  45.772 1.00 46.59 ? 207 LEU A C   1 
ATOM   729  O  O   . LEU A 1 102 ? 8.684   77.508  45.991 1.00 46.59 ? 207 LEU A O   1 
ATOM   730  C  CB  . LEU A 1 102 ? 9.012   76.099  43.649 1.00 46.55 ? 207 LEU A CB  1 
ATOM   731  C  CG  . LEU A 1 102 ? 9.088   75.839  42.148 1.00 46.22 ? 207 LEU A CG  1 
ATOM   732  C  CD1 . LEU A 1 102 ? 7.802   75.168  41.708 1.00 46.15 ? 207 LEU A CD1 1 
ATOM   733  C  CD2 . LEU A 1 102 ? 9.321   77.124  41.363 1.00 45.96 ? 207 LEU A CD2 1 
ATOM   734  N  N   . THR A 1 103 ? 10.751  77.037  46.726 1.00 46.61 ? 208 THR A N   1 
ATOM   735  C  CA  . THR A 1 103 ? 10.478  77.497  48.083 1.00 46.65 ? 208 THR A CA  1 
ATOM   736  C  C   . THR A 1 103 ? 10.135  78.997  48.027 1.00 46.74 ? 208 THR A C   1 
ATOM   737  O  O   . THR A 1 103 ? 11.018  79.816  47.774 1.00 46.60 ? 208 THR A O   1 
ATOM   738  C  CB  . THR A 1 103 ? 11.687  77.245  49.004 1.00 46.65 ? 208 THR A CB  1 
ATOM   739  O  OG1 . THR A 1 103 ? 12.103  75.880  48.878 1.00 46.17 ? 208 THR A OG1 1 
ATOM   740  C  CG2 . THR A 1 103 ? 11.336  77.531  50.455 1.00 46.60 ? 208 THR A CG2 1 
ATOM   741  N  N   . PRO A 1 104 ? 8.849   79.359  48.247 1.00 46.97 ? 209 PRO A N   1 
ATOM   742  C  CA  . PRO A 1 104 ? 8.346   80.708  47.917 1.00 47.04 ? 209 PRO A CA  1 
ATOM   743  C  C   . PRO A 1 104 ? 9.099   81.882  48.549 1.00 47.18 ? 209 PRO A C   1 
ATOM   744  O  O   . PRO A 1 104 ? 9.627   82.729  47.825 1.00 46.95 ? 209 PRO A O   1 
ATOM   745  C  CB  . PRO A 1 104 ? 6.898   80.675  48.419 1.00 46.85 ? 209 PRO A CB  1 
ATOM   746  C  CG  . PRO A 1 104 ? 6.539   79.263  48.459 1.00 46.91 ? 209 PRO A CG  1 
ATOM   747  C  CD  . PRO A 1 104 ? 7.782   78.526  48.831 1.00 46.96 ? 209 PRO A CD  1 
ATOM   748  N  N   . ASN A 1 105 ? 9.139   81.928  49.880 1.00 47.58 ? 210 ASN A N   1 
ATOM   749  C  CA  . ASN A 1 105 ? 9.763   83.034  50.606 1.00 47.78 ? 210 ASN A CA  1 
ATOM   750  C  C   . ASN A 1 105 ? 11.172  82.645  51.043 1.00 48.02 ? 210 ASN A C   1 
ATOM   751  O  O   . ASN A 1 105 ? 11.460  82.509  52.234 1.00 47.98 ? 210 ASN A O   1 
ATOM   752  C  CB  . ASN A 1 105 ? 8.902   83.441  51.809 1.00 47.84 ? 210 ASN A CB  1 
ATOM   753  C  CG  . ASN A 1 105 ? 9.220   84.840  52.315 1.00 47.74 ? 210 ASN A CG  1 
ATOM   754  O  OD1 . ASN A 1 105 ? 9.694   85.695  51.564 1.00 48.24 ? 210 ASN A OD1 1 
ATOM   755  N  ND2 . ASN A 1 105 ? 8.944   85.084  53.591 1.00 47.13 ? 210 ASN A ND2 1 
ATOM   756  N  N   . TYR A 1 106 ? 12.049  82.479  50.054 1.00 48.33 ? 211 TYR A N   1 
ATOM   757  C  CA  . TYR A 1 106 ? 13.412  81.998  50.287 1.00 48.38 ? 211 TYR A CA  1 
ATOM   758  C  C   . TYR A 1 106 ? 14.389  83.093  50.721 1.00 48.47 ? 211 TYR A C   1 
ATOM   759  O  O   . TYR A 1 106 ? 15.577  82.824  50.891 1.00 48.42 ? 211 TYR A O   1 
ATOM   760  C  CB  . TYR A 1 106 ? 13.942  81.246  49.055 1.00 48.52 ? 211 TYR A CB  1 
ATOM   761  C  CG  . TYR A 1 106 ? 14.291  82.099  47.845 1.00 48.85 ? 211 TYR A CG  1 
ATOM   762  C  CD1 . TYR A 1 106 ? 15.618  82.259  47.440 1.00 48.61 ? 211 TYR A CD1 1 
ATOM   763  C  CD2 . TYR A 1 106 ? 13.296  82.719  47.085 1.00 48.96 ? 211 TYR A CD2 1 
ATOM   764  C  CE1 . TYR A 1 106 ? 15.943  83.029  46.330 1.00 48.40 ? 211 TYR A CE1 1 
ATOM   765  C  CE2 . TYR A 1 106 ? 13.613  83.488  45.977 1.00 48.66 ? 211 TYR A CE2 1 
ATOM   766  C  CZ  . TYR A 1 106 ? 14.935  83.640  45.605 1.00 48.68 ? 211 TYR A CZ  1 
ATOM   767  O  OH  . TYR A 1 106 ? 15.242  84.402  44.499 1.00 49.09 ? 211 TYR A OH  1 
ATOM   768  N  N   . ARG A 1 107 ? 13.892  84.316  50.907 1.00 48.60 ? 212 ARG A N   1 
ATOM   769  C  CA  . ARG A 1 107 ? 14.706  85.413  51.436 1.00 48.70 ? 212 ARG A CA  1 
ATOM   770  C  C   . ARG A 1 107 ? 14.335  85.785  52.880 1.00 48.81 ? 212 ARG A C   1 
ATOM   771  O  O   . ARG A 1 107 ? 15.095  86.480  53.558 1.00 48.92 ? 212 ARG A O   1 
ATOM   772  C  CB  . ARG A 1 107 ? 14.603  86.640  50.524 1.00 48.69 ? 212 ARG A CB  1 
ATOM   773  C  CG  . ARG A 1 107 ? 14.719  86.318  49.027 1.00 48.86 ? 212 ARG A CG  1 
ATOM   774  C  CD  . ARG A 1 107 ? 15.420  87.416  48.234 1.00 48.94 ? 212 ARG A CD  1 
ATOM   775  N  NE  . ARG A 1 107 ? 16.811  87.055  47.950 1.00 49.29 ? 212 ARG A NE  1 
ATOM   776  C  CZ  . ARG A 1 107 ? 17.311  86.768  46.744 1.00 49.39 ? 212 ARG A CZ  1 
ATOM   777  N  NH1 . ARG A 1 107 ? 16.556  86.808  45.645 1.00 49.07 ? 212 ARG A NH1 1 
ATOM   778  N  NH2 . ARG A 1 107 ? 18.597  86.445  46.635 1.00 49.50 ? 212 ARG A NH2 1 
ATOM   779  N  N   . GLY A 1 108 ? 13.174  85.325  53.345 1.00 48.88 ? 213 GLY A N   1 
ATOM   780  C  CA  . GLY A 1 108 ? 12.732  85.552  54.723 1.00 48.78 ? 213 GLY A CA  1 
ATOM   781  C  C   . GLY A 1 108 ? 12.970  84.335  55.598 1.00 48.78 ? 213 GLY A C   1 
ATOM   782  O  O   . GLY A 1 108 ? 13.451  83.306  55.120 1.00 48.78 ? 213 GLY A O   1 
ATOM   783  N  N   . GLU A 1 109 ? 12.615  84.450  56.878 1.00 48.73 ? 214 GLU A N   1 
ATOM   784  C  CA  . GLU A 1 109 ? 12.831  83.370  57.850 1.00 48.67 ? 214 GLU A CA  1 
ATOM   785  C  C   . GLU A 1 109 ? 11.729  82.304  57.849 1.00 48.53 ? 214 GLU A C   1 
ATOM   786  O  O   . GLU A 1 109 ? 12.018  81.133  58.096 1.00 48.70 ? 214 GLU A O   1 
ATOM   787  C  CB  . GLU A 1 109 ? 13.029  83.934  59.259 1.00 48.67 ? 214 GLU A CB  1 
ATOM   788  C  CG  . GLU A 1 109 ? 14.351  84.672  59.430 1.00 48.98 ? 214 GLU A CG  1 
ATOM   789  C  CD  . GLU A 1 109 ? 14.674  84.972  60.880 1.00 49.12 ? 214 GLU A CD  1 
ATOM   790  O  OE1 . GLU A 1 109 ? 14.902  86.158  61.208 1.00 50.05 ? 214 GLU A OE1 1 
ATOM   791  O  OE2 . GLU A 1 109 ? 14.696  84.022  61.692 1.00 49.85 ? 214 GLU A OE2 1 
ATOM   792  N  N   . ASN A 1 110 ? 10.481  82.699  57.586 1.00 48.29 ? 215 ASN A N   1 
ATOM   793  C  CA  . ASN A 1 110 ? 9.408   81.731  57.319 1.00 48.22 ? 215 ASN A CA  1 
ATOM   794  C  C   . ASN A 1 110 ? 9.245   81.524  55.810 1.00 48.18 ? 215 ASN A C   1 
ATOM   795  O  O   . ASN A 1 110 ? 8.743   82.397  55.103 1.00 48.14 ? 215 ASN A O   1 
ATOM   796  C  CB  . ASN A 1 110 ? 8.078   82.171  57.945 1.00 48.15 ? 215 ASN A CB  1 
ATOM   797  C  CG  . ASN A 1 110 ? 6.974   81.120  57.795 1.00 48.11 ? 215 ASN A CG  1 
ATOM   798  O  OD1 . ASN A 1 110 ? 7.206   80.017  57.296 1.00 47.91 ? 215 ASN A OD1 1 
ATOM   799  N  ND2 . ASN A 1 110 ? 5.768   81.463  58.230 1.00 47.85 ? 215 ASN A ND2 1 
ATOM   800  N  N   . SER A 1 111 ? 9.660   80.355  55.332 1.00 48.16 ? 216 SER A N   1 
ATOM   801  C  CA  . SER A 1 111 ? 9.633   80.041  53.903 1.00 48.16 ? 216 SER A CA  1 
ATOM   802  C  C   . SER A 1 111 ? 8.239   80.042  53.270 1.00 48.21 ? 216 SER A C   1 
ATOM   803  O  O   . SER A 1 111 ? 8.124   80.132  52.044 1.00 48.21 ? 216 SER A O   1 
ATOM   804  C  CB  . SER A 1 111 ? 10.302  78.691  53.644 1.00 48.11 ? 216 SER A CB  1 
ATOM   805  O  OG  . SER A 1 111 ? 11.710  78.811  53.696 1.00 48.16 ? 216 SER A OG  1 
ATOM   806  N  N   . TRP A 1 112 ? 7.193   79.921  54.086 1.00 48.16 ? 217 TRP A N   1 
ATOM   807  C  CA  . TRP A 1 112 ? 5.826   79.912  53.570 1.00 48.36 ? 217 TRP A CA  1 
ATOM   808  C  C   . TRP A 1 112 ? 5.025   81.133  54.041 1.00 48.47 ? 217 TRP A C   1 
ATOM   809  O  O   . TRP A 1 112 ? 3.803   81.070  54.163 1.00 48.29 ? 217 TRP A O   1 
ATOM   810  C  CB  . TRP A 1 112 ? 5.138   78.593  53.942 1.00 48.24 ? 217 TRP A CB  1 
ATOM   811  C  CG  . TRP A 1 112 ? 5.878   77.408  53.391 1.00 48.23 ? 217 TRP A CG  1 
ATOM   812  C  CD1 . TRP A 1 112 ? 6.817   76.654  54.036 1.00 48.13 ? 217 TRP A CD1 1 
ATOM   813  C  CD2 . TRP A 1 112 ? 5.775   76.870  52.066 1.00 48.28 ? 217 TRP A CD2 1 
ATOM   814  N  NE1 . TRP A 1 112 ? 7.295   75.675  53.198 1.00 47.94 ? 217 TRP A NE1 1 
ATOM   815  C  CE2 . TRP A 1 112 ? 6.671   75.784  51.985 1.00 47.97 ? 217 TRP A CE2 1 
ATOM   816  C  CE3 . TRP A 1 112 ? 5.006   77.196  50.943 1.00 48.16 ? 217 TRP A CE3 1 
ATOM   817  C  CZ2 . TRP A 1 112 ? 6.819   75.022  50.827 1.00 48.08 ? 217 TRP A CZ2 1 
ATOM   818  C  CZ3 . TRP A 1 112 ? 5.156   76.439  49.793 1.00 47.94 ? 217 TRP A CZ3 1 
ATOM   819  C  CH2 . TRP A 1 112 ? 6.054   75.365  49.744 1.00 48.02 ? 217 TRP A CH2 1 
ATOM   820  N  N   . PHE A 1 113 ? 5.731   82.242  54.275 1.00 48.77 ? 218 PHE A N   1 
ATOM   821  C  CA  . PHE A 1 113 ? 5.139   83.532  54.667 1.00 49.08 ? 218 PHE A CA  1 
ATOM   822  C  C   . PHE A 1 113 ? 4.422   83.502  56.020 1.00 49.24 ? 218 PHE A C   1 
ATOM   823  O  O   . PHE A 1 113 ? 4.844   84.178  56.956 1.00 49.21 ? 218 PHE A O   1 
ATOM   824  C  CB  . PHE A 1 113 ? 4.207   84.071  53.571 1.00 49.28 ? 218 PHE A CB  1 
ATOM   825  C  CG  . PHE A 1 113 ? 4.897   84.316  52.262 1.00 49.54 ? 218 PHE A CG  1 
ATOM   826  C  CD1 . PHE A 1 113 ? 4.784   83.401  51.216 1.00 49.88 ? 218 PHE A CD1 1 
ATOM   827  C  CD2 . PHE A 1 113 ? 5.674   85.455  52.075 1.00 49.63 ? 218 PHE A CD2 1 
ATOM   828  C  CE1 . PHE A 1 113 ? 5.429   83.622  50.002 1.00 49.54 ? 218 PHE A CE1 1 
ATOM   829  C  CE2 . PHE A 1 113 ? 6.323   85.686  50.859 1.00 49.62 ? 218 PHE A CE2 1 
ATOM   830  C  CZ  . PHE A 1 113 ? 6.201   84.768  49.824 1.00 49.55 ? 218 PHE A CZ  1 
ATOM   831  N  N   . SER A 1 114 ? 3.330   82.746  56.105 1.00 49.46 ? 219 SER A N   1 
ATOM   832  C  CA  . SER A 1 114 ? 2.641   82.502  57.370 1.00 49.67 ? 219 SER A CA  1 
ATOM   833  C  C   . SER A 1 114 ? 1.744   81.263  57.267 1.00 49.84 ? 219 SER A C   1 
ATOM   834  O  O   . SER A 1 114 ? 1.798   80.520  56.285 1.00 49.85 ? 219 SER A O   1 
ATOM   835  C  CB  . SER A 1 114 ? 1.818   83.731  57.793 1.00 49.74 ? 219 SER A CB  1 
ATOM   836  O  OG  . SER A 1 114 ? 0.542   83.757  57.175 1.00 49.75 ? 219 SER A OG  1 
ATOM   837  N  N   . THR A 1 115 ? 0.922   81.051  58.290 1.00 50.12 ? 220 THR A N   1 
ATOM   838  C  CA  . THR A 1 115 ? -0.067  79.974  58.297 1.00 50.28 ? 220 THR A CA  1 
ATOM   839  C  C   . THR A 1 115 ? -1.271  80.284  57.381 1.00 50.49 ? 220 THR A C   1 
ATOM   840  O  O   . THR A 1 115 ? -2.102  79.413  57.130 1.00 50.63 ? 220 THR A O   1 
ATOM   841  C  CB  . THR A 1 115 ? -0.560  79.696  59.738 1.00 50.30 ? 220 THR A CB  1 
ATOM   842  O  OG1 . THR A 1 115 ? 0.534   79.832  60.652 1.00 50.41 ? 220 THR A OG1 1 
ATOM   843  C  CG2 . THR A 1 115 ? -1.128  78.295  59.864 1.00 50.29 ? 220 THR A CG2 1 
ATOM   844  N  N   . GLN A 1 116 ? -1.366  81.519  56.887 1.00 50.63 ? 221 GLN A N   1 
ATOM   845  C  CA  . GLN A 1 116 ? -2.368  81.880  55.880 1.00 50.72 ? 221 GLN A CA  1 
ATOM   846  C  C   . GLN A 1 116 ? -1.882  81.443  54.488 1.00 50.81 ? 221 GLN A C   1 
ATOM   847  O  O   . GLN A 1 116 ? -1.144  82.169  53.819 1.00 50.78 ? 221 GLN A O   1 
ATOM   848  C  CB  . GLN A 1 116 ? -2.635  83.391  55.908 1.00 50.68 ? 221 GLN A CB  1 
ATOM   849  C  CG  . GLN A 1 116 ? -3.103  83.928  57.260 1.00 50.82 ? 221 GLN A CG  1 
ATOM   850  C  CD  . GLN A 1 116 ? -4.529  83.528  57.601 1.00 51.06 ? 221 GLN A CD  1 
ATOM   851  O  OE1 . GLN A 1 116 ? -5.469  83.860  56.878 1.00 51.28 ? 221 GLN A OE1 1 
ATOM   852  N  NE2 . GLN A 1 116 ? -4.697  82.825  58.716 1.00 51.02 ? 221 GLN A NE2 1 
ATOM   853  N  N   . VAL A 1 117 ? -2.305  80.254  54.060 1.00 50.98 ? 222 VAL A N   1 
ATOM   854  C  CA  . VAL A 1 117 ? -1.765  79.623  52.852 1.00 51.17 ? 222 VAL A CA  1 
ATOM   855  C  C   . VAL A 1 117 ? -2.493  80.079  51.584 1.00 51.34 ? 222 VAL A C   1 
ATOM   856  O  O   . VAL A 1 117 ? -1.916  80.801  50.779 1.00 51.56 ? 222 VAL A O   1 
ATOM   857  C  CB  . VAL A 1 117 ? -1.788  78.079  52.959 1.00 51.20 ? 222 VAL A CB  1 
ATOM   858  C  CG1 . VAL A 1 117 ? -1.161  77.443  51.714 1.00 51.43 ? 222 VAL A CG1 1 
ATOM   859  C  CG2 . VAL A 1 117 ? -1.063  77.626  54.222 1.00 51.14 ? 222 VAL A CG2 1 
ATOM   860  N  N   . ASP A 1 118 ? -3.744  79.649  51.411 1.00 51.46 ? 223 ASP A N   1 
ATOM   861  C  CA  . ASP A 1 118 ? -4.594  80.043  50.273 1.00 51.51 ? 223 ASP A CA  1 
ATOM   862  C  C   . ASP A 1 118 ? -3.842  80.570  49.041 1.00 51.61 ? 223 ASP A C   1 
ATOM   863  O  O   . ASP A 1 118 ? -3.580  79.817  48.095 1.00 51.63 ? 223 ASP A O   1 
ATOM   864  C  CB  . ASP A 1 118 ? -5.629  81.081  50.727 1.00 51.58 ? 223 ASP A CB  1 
ATOM   865  C  CG  . ASP A 1 118 ? -6.597  80.534  51.758 1.00 51.77 ? 223 ASP A CG  1 
ATOM   866  O  OD1 . ASP A 1 118 ? -7.012  79.361  51.639 1.00 51.95 ? 223 ASP A OD1 1 
ATOM   867  O  OD2 . ASP A 1 118 ? -6.949  81.289  52.689 1.00 52.16 ? 223 ASP A OD2 1 
ATOM   868  N  N   . THR A 1 119 ? -3.493  81.858  49.068 1.00 51.65 ? 224 THR A N   1 
ATOM   869  C  CA  . THR A 1 119 ? -2.867  82.542  47.930 1.00 51.68 ? 224 THR A CA  1 
ATOM   870  C  C   . THR A 1 119 ? -1.515  81.936  47.538 1.00 51.70 ? 224 THR A C   1 
ATOM   871  O  O   . THR A 1 119 ? -1.185  81.855  46.356 1.00 51.77 ? 224 THR A O   1 
ATOM   872  C  CB  . THR A 1 119 ? -2.658  84.050  48.239 1.00 51.66 ? 224 THR A CB  1 
ATOM   873  O  OG1 . THR A 1 119 ? -3.831  84.584  48.865 1.00 51.30 ? 224 THR A OG1 1 
ATOM   874  C  CG2 . THR A 1 119 ? -2.356  84.838  46.962 1.00 51.69 ? 224 THR A CG2 1 
ATOM   875  N  N   . VAL A 1 120 ? -0.751  81.503  48.536 1.00 51.77 ? 225 VAL A N   1 
ATOM   876  C  CA  . VAL A 1 120 ? 0.607   80.994  48.330 1.00 51.83 ? 225 VAL A CA  1 
ATOM   877  C  C   . VAL A 1 120 ? 0.612   79.628  47.632 1.00 51.84 ? 225 VAL A C   1 
ATOM   878  O  O   . VAL A 1 120 ? 1.463   79.368  46.785 1.00 51.87 ? 225 VAL A O   1 
ATOM   879  C  CB  . VAL A 1 120 ? 1.385   80.879  49.674 1.00 51.86 ? 225 VAL A CB  1 
ATOM   880  C  CG1 . VAL A 1 120 ? 2.851   80.519  49.417 1.00 52.06 ? 225 VAL A CG1 1 
ATOM   881  C  CG2 . VAL A 1 120 ? 1.277   82.183  50.487 1.00 51.80 ? 225 VAL A CG2 1 
ATOM   882  N  N   . ALA A 1 121 ? -0.333  78.763  47.997 1.00 51.85 ? 226 ALA A N   1 
ATOM   883  C  CA  . ALA A 1 121 ? -0.443  77.427  47.401 1.00 51.83 ? 226 ALA A CA  1 
ATOM   884  C  C   . ALA A 1 121 ? -0.908  77.475  45.946 1.00 51.83 ? 226 ALA A C   1 
ATOM   885  O  O   . ALA A 1 121 ? -0.531  76.620  45.141 1.00 51.81 ? 226 ALA A O   1 
ATOM   886  C  CB  . ALA A 1 121 ? -1.388  76.557  48.222 1.00 51.84 ? 226 ALA A CB  1 
ATOM   887  N  N   . THR A 1 122 ? -1.737  78.465  45.621 1.00 51.80 ? 227 THR A N   1 
ATOM   888  C  CA  . THR A 1 122 ? -2.230  78.647  44.260 1.00 51.77 ? 227 THR A CA  1 
ATOM   889  C  C   . THR A 1 122 ? -1.090  79.023  43.325 1.00 51.68 ? 227 THR A C   1 
ATOM   890  O  O   . THR A 1 122 ? -1.038  78.569  42.181 1.00 51.62 ? 227 THR A O   1 
ATOM   891  C  CB  . THR A 1 122 ? -3.298  79.760  44.188 1.00 51.90 ? 227 THR A CB  1 
ATOM   892  O  OG1 . THR A 1 122 ? -4.295  79.548  45.198 1.00 52.31 ? 227 THR A OG1 1 
ATOM   893  C  CG2 . THR A 1 122 ? -3.961  79.788  42.809 1.00 51.91 ? 227 THR A CG2 1 
ATOM   894  N  N   . LYS A 1 123 ? -0.184  79.863  43.816 1.00 51.58 ? 228 LYS A N   1 
ATOM   895  C  CA  . LYS A 1 123 ? 0.976   80.271  43.039 1.00 51.47 ? 228 LYS A CA  1 
ATOM   896  C  C   . LYS A 1 123 ? 1.837   79.063  42.669 1.00 51.35 ? 228 LYS A C   1 
ATOM   897  O  O   . LYS A 1 123 ? 2.340   78.980  41.553 1.00 51.56 ? 228 LYS A O   1 
ATOM   898  C  CB  . LYS A 1 123 ? 1.813   81.300  43.805 1.00 51.53 ? 228 LYS A CB  1 
ATOM   899  C  CG  . LYS A 1 123 ? 1.160   82.669  43.980 1.00 51.43 ? 228 LYS A CG  1 
ATOM   900  C  CD  . LYS A 1 123 ? 1.980   83.527  44.950 1.00 51.44 ? 228 LYS A CD  1 
ATOM   901  C  CE  . LYS A 1 123 ? 1.470   84.960  45.046 1.00 51.57 ? 228 LYS A CE  1 
ATOM   902  N  NZ  . LYS A 1 123 ? 1.881   85.808  43.889 1.00 51.71 ? 228 LYS A NZ  1 
ATOM   903  N  N   . VAL A 1 124 ? 1.987   78.121  43.595 1.00 51.23 ? 229 VAL A N   1 
ATOM   904  C  CA  . VAL A 1 124 ? 2.829   76.946  43.363 1.00 51.13 ? 229 VAL A CA  1 
ATOM   905  C  C   . VAL A 1 124 ? 2.214   76.016  42.311 1.00 51.06 ? 229 VAL A C   1 
ATOM   906  O  O   . VAL A 1 124 ? 2.936   75.442  41.493 1.00 51.00 ? 229 VAL A O   1 
ATOM   907  C  CB  . VAL A 1 124 ? 3.101   76.162  44.673 1.00 51.18 ? 229 VAL A CB  1 
ATOM   908  C  CG1 . VAL A 1 124 ? 3.936   74.908  44.393 1.00 50.92 ? 229 VAL A CG1 1 
ATOM   909  C  CG2 . VAL A 1 124 ? 3.807   77.059  45.700 1.00 51.07 ? 229 VAL A CG2 1 
ATOM   910  N  N   . LYS A 1 125 ? 0.889   75.875  42.339 1.00 50.85 ? 230 LYS A N   1 
ATOM   911  C  CA  . LYS A 1 125 ? 0.165   75.077  41.344 1.00 50.80 ? 230 LYS A CA  1 
ATOM   912  C  C   . LYS A 1 125 ? 0.435   75.532  39.915 1.00 50.65 ? 230 LYS A C   1 
ATOM   913  O  O   . LYS A 1 125 ? 0.667   74.709  39.030 1.00 50.71 ? 230 LYS A O   1 
ATOM   914  C  CB  . LYS A 1 125 ? -1.348  75.138  41.589 1.00 50.83 ? 230 LYS A CB  1 
ATOM   915  C  CG  . LYS A 1 125 ? -1.885  74.097  42.559 1.00 50.91 ? 230 LYS A CG  1 
ATOM   916  C  CD  . LYS A 1 125 ? -3.386  73.889  42.375 1.00 51.17 ? 230 LYS A CD  1 
ATOM   917  C  CE  . LYS A 1 125 ? -3.712  72.877  41.265 1.00 51.42 ? 230 LYS A CE  1 
ATOM   918  N  NZ  . LYS A 1 125 ? -3.327  73.337  39.898 1.00 51.32 ? 230 LYS A NZ  1 
ATOM   919  N  N   . ASP A 1 126 ? 0.382   76.842  39.694 1.00 50.51 ? 231 ASP A N   1 
ATOM   920  C  CA  . ASP A 1 126 ? 0.581   77.412  38.361 1.00 50.38 ? 231 ASP A CA  1 
ATOM   921  C  C   . ASP A 1 126 ? 2.027   77.288  37.888 1.00 50.17 ? 231 ASP A C   1 
ATOM   922  O  O   . ASP A 1 126 ? 2.279   77.098  36.695 1.00 50.22 ? 231 ASP A O   1 
ATOM   923  C  CB  . ASP A 1 126 ? 0.163   78.888  38.335 1.00 50.41 ? 231 ASP A CB  1 
ATOM   924  C  CG  . ASP A 1 126 ? -1.340  79.080  38.467 1.00 50.65 ? 231 ASP A CG  1 
ATOM   925  O  OD1 . ASP A 1 126 ? -2.080  78.077  38.568 1.00 50.94 ? 231 ASP A OD1 1 
ATOM   926  O  OD2 . ASP A 1 126 ? -1.783  80.247  38.469 1.00 50.95 ? 231 ASP A OD2 1 
ATOM   927  N  N   . ALA A 1 127 ? 2.968   77.403  38.820 1.00 49.86 ? 232 ALA A N   1 
ATOM   928  C  CA  . ALA A 1 127 ? 4.389   77.335  38.492 1.00 49.81 ? 232 ALA A CA  1 
ATOM   929  C  C   . ALA A 1 127 ? 4.794   75.951  37.997 1.00 49.62 ? 232 ALA A C   1 
ATOM   930  O  O   . ALA A 1 127 ? 5.558   75.833  37.043 1.00 49.52 ? 232 ALA A O   1 
ATOM   931  C  CB  . ALA A 1 127 ? 5.235   77.742  39.695 1.00 49.84 ? 232 ALA A CB  1 
ATOM   932  N  N   . LEU A 1 128 ? 4.275   74.910  38.641 1.00 49.50 ? 233 LEU A N   1 
ATOM   933  C  CA  . LEU A 1 128 ? 4.545   73.537  38.218 1.00 49.45 ? 233 LEU A CA  1 
ATOM   934  C  C   . LEU A 1 128 ? 4.115   73.347  36.768 1.00 49.25 ? 233 LEU A C   1 
ATOM   935  O  O   . LEU A 1 128 ? 4.900   72.923  35.917 1.00 49.21 ? 233 LEU A O   1 
ATOM   936  C  CB  . LEU A 1 128 ? 3.803   72.538  39.116 1.00 49.53 ? 233 LEU A CB  1 
ATOM   937  C  CG  . LEU A 1 128 ? 4.243   72.479  40.584 1.00 49.76 ? 233 LEU A CG  1 
ATOM   938  C  CD1 . LEU A 1 128 ? 3.255   71.678  41.420 1.00 50.00 ? 233 LEU A CD1 1 
ATOM   939  C  CD2 . LEU A 1 128 ? 5.637   71.900  40.707 1.00 49.96 ? 233 LEU A CD2 1 
ATOM   940  N  N   . GLU A 1 129 ? 2.866   73.691  36.495 1.00 49.00 ? 234 GLU A N   1 
ATOM   941  C  CA  . GLU A 1 129 ? 2.317   73.574  35.155 1.00 48.95 ? 234 GLU A CA  1 
ATOM   942  C  C   . GLU A 1 129 ? 3.149   74.374  34.145 1.00 48.66 ? 234 GLU A C   1 
ATOM   943  O  O   . GLU A 1 129 ? 3.407   73.907  33.038 1.00 48.77 ? 234 GLU A O   1 
ATOM   944  C  CB  . GLU A 1 129 ? 0.845   74.017  35.148 1.00 49.04 ? 234 GLU A CB  1 
ATOM   945  C  CG  . GLU A 1 129 ? -0.085  73.087  35.961 1.00 49.07 ? 234 GLU A CG  1 
ATOM   946  C  CD  . GLU A 1 129 ? -1.454  73.695  36.266 1.00 49.36 ? 234 GLU A CD  1 
ATOM   947  O  OE1 . GLU A 1 129 ? -1.596  74.938  36.225 1.00 49.78 ? 234 GLU A OE1 1 
ATOM   948  O  OE2 . GLU A 1 129 ? -2.394  72.922  36.560 1.00 50.07 ? 234 GLU A OE2 1 
ATOM   949  N  N   . PHE A 1 130 ? 3.591   75.560  34.545 1.00 48.33 ? 235 PHE A N   1 
ATOM   950  C  CA  . PHE A 1 130 ? 4.385   76.430  33.676 1.00 48.17 ? 235 PHE A CA  1 
ATOM   951  C  C   . PHE A 1 130 ? 5.779   75.858  33.368 1.00 47.96 ? 235 PHE A C   1 
ATOM   952  O  O   . PHE A 1 130 ? 6.139   75.709  32.199 1.00 47.84 ? 235 PHE A O   1 
ATOM   953  C  CB  . PHE A 1 130 ? 4.500   77.820  34.313 1.00 48.17 ? 235 PHE A CB  1 
ATOM   954  C  CG  . PHE A 1 130 ? 5.370   78.783  33.548 1.00 48.27 ? 235 PHE A CG  1 
ATOM   955  C  CD1 . PHE A 1 130 ? 4.836   79.572  32.540 1.00 48.14 ? 235 PHE A CD1 1 
ATOM   956  C  CD2 . PHE A 1 130 ? 6.721   78.921  33.859 1.00 48.42 ? 235 PHE A CD2 1 
ATOM   957  C  CE1 . PHE A 1 130 ? 5.630   80.472  31.843 1.00 48.20 ? 235 PHE A CE1 1 
ATOM   958  C  CE2 . PHE A 1 130 ? 7.523   79.818  33.168 1.00 48.37 ? 235 PHE A CE2 1 
ATOM   959  C  CZ  . PHE A 1 130 ? 6.976   80.597  32.157 1.00 48.42 ? 235 PHE A CZ  1 
ATOM   960  N  N   . TRP A 1 131 ? 6.545   75.536  34.415 1.00 47.68 ? 236 TRP A N   1 
ATOM   961  C  CA  . TRP A 1 131 ? 7.956   75.133  34.273 1.00 47.51 ? 236 TRP A CA  1 
ATOM   962  C  C   . TRP A 1 131 ? 8.182   73.726  33.711 1.00 47.39 ? 236 TRP A C   1 
ATOM   963  O  O   . TRP A 1 131 ? 9.260   73.442  33.190 1.00 47.20 ? 236 TRP A O   1 
ATOM   964  C  CB  . TRP A 1 131 ? 8.695   75.252  35.611 1.00 47.42 ? 236 TRP A CB  1 
ATOM   965  C  CG  . TRP A 1 131 ? 8.927   76.661  36.060 1.00 47.22 ? 236 TRP A CG  1 
ATOM   966  C  CD1 . TRP A 1 131 ? 8.351   77.284  37.121 1.00 46.97 ? 236 TRP A CD1 1 
ATOM   967  C  CD2 . TRP A 1 131 ? 9.807   77.619  35.460 1.00 47.27 ? 236 TRP A CD2 1 
ATOM   968  N  NE1 . TRP A 1 131 ? 8.806   78.571  37.219 1.00 47.00 ? 236 TRP A NE1 1 
ATOM   969  C  CE2 . TRP A 1 131 ? 9.704   78.806  36.214 1.00 47.00 ? 236 TRP A CE2 1 
ATOM   970  C  CE3 . TRP A 1 131 ? 10.670  77.591  34.355 1.00 47.20 ? 236 TRP A CE3 1 
ATOM   971  C  CZ2 . TRP A 1 131 ? 10.427  79.960  35.901 1.00 47.12 ? 236 TRP A CZ2 1 
ATOM   972  C  CZ3 . TRP A 1 131 ? 11.392  78.741  34.041 1.00 47.20 ? 236 TRP A CZ3 1 
ATOM   973  C  CH2 . TRP A 1 131 ? 11.265  79.909  34.814 1.00 47.22 ? 236 TRP A CH2 1 
ATOM   974  N  N   . LEU A 1 132 ? 7.195   72.842  33.842 1.00 47.36 ? 237 LEU A N   1 
ATOM   975  C  CA  . LEU A 1 132 ? 7.267   71.522  33.205 1.00 47.31 ? 237 LEU A CA  1 
ATOM   976  C  C   . LEU A 1 132 ? 7.228   71.644  31.680 1.00 47.26 ? 237 LEU A C   1 
ATOM   977  O  O   . LEU A 1 132 ? 7.971   70.949  30.983 1.00 47.31 ? 237 LEU A O   1 
ATOM   978  C  CB  . LEU A 1 132 ? 6.129   70.617  33.680 1.00 47.27 ? 237 LEU A CB  1 
ATOM   979  C  CG  . LEU A 1 132 ? 6.260   70.075  35.102 1.00 47.56 ? 237 LEU A CG  1 
ATOM   980  C  CD1 . LEU A 1 132 ? 4.930   69.509  35.600 1.00 47.08 ? 237 LEU A CD1 1 
ATOM   981  C  CD2 . LEU A 1 132 ? 7.356   69.020  35.176 1.00 48.03 ? 237 LEU A CD2 1 
ATOM   982  N  N   . GLN A 1 133 ? 6.369   72.529  31.169 1.00 47.13 ? 238 GLN A N   1 
ATOM   983  C  CA  . GLN A 1 133 ? 6.306   72.816  29.727 1.00 47.11 ? 238 GLN A CA  1 
ATOM   984  C  C   . GLN A 1 133 ? 7.585   73.489  29.217 1.00 46.96 ? 238 GLN A C   1 
ATOM   985  O  O   . GLN A 1 133 ? 7.910   73.389  28.036 1.00 46.86 ? 238 GLN A O   1 
ATOM   986  C  CB  . GLN A 1 133 ? 5.086   73.685  29.382 1.00 47.04 ? 238 GLN A CB  1 
ATOM   987  C  CG  . GLN A 1 133 ? 3.754   72.949  29.469 1.00 47.07 ? 238 GLN A CG  1 
ATOM   988  C  CD  . GLN A 1 133 ? 2.567   73.810  29.063 1.00 47.22 ? 238 GLN A CD  1 
ATOM   989  O  OE1 . GLN A 1 133 ? 2.667   74.646  28.167 1.00 48.00 ? 238 GLN A OE1 1 
ATOM   990  N  NE2 . GLN A 1 133 ? 1.432   73.600  29.718 1.00 47.40 ? 238 GLN A NE2 1 
ATOM   991  N  N   . ALA A 1 134 ? 8.289   74.182  30.110 1.00 46.87 ? 239 ALA A N   1 
ATOM   992  C  CA  . ALA A 1 134 ? 9.597   74.760  29.803 1.00 46.91 ? 239 ALA A CA  1 
ATOM   993  C  C   . ALA A 1 134 ? 10.705  73.696  29.802 1.00 46.90 ? 239 ALA A C   1 
ATOM   994  O  O   . ALA A 1 134 ? 11.816  73.961  29.341 1.00 46.82 ? 239 ALA A O   1 
ATOM   995  C  CB  . ALA A 1 134 ? 9.932   75.879  30.791 1.00 46.80 ? 239 ALA A CB  1 
ATOM   996  N  N   . GLY A 1 135 ? 10.403  72.514  30.346 1.00 46.95 ? 240 GLY A N   1 
ATOM   997  C  CA  . GLY A 1 135 ? 11.249  71.329  30.199 1.00 46.94 ? 240 GLY A CA  1 
ATOM   998  C  C   . GLY A 1 135 ? 12.035  70.886  31.422 1.00 47.01 ? 240 GLY A C   1 
ATOM   999  O  O   . GLY A 1 135 ? 13.016  70.153  31.283 1.00 46.97 ? 240 GLY A O   1 
ATOM   1000 N  N   . VAL A 1 136 ? 11.627  71.309  32.619 1.00 47.04 ? 241 VAL A N   1 
ATOM   1001 C  CA  . VAL A 1 136 ? 12.327  70.871  33.829 1.00 47.12 ? 241 VAL A CA  1 
ATOM   1002 C  C   . VAL A 1 136 ? 11.949  69.431  34.163 1.00 47.16 ? 241 VAL A C   1 
ATOM   1003 O  O   . VAL A 1 136 ? 10.897  68.938  33.757 1.00 47.16 ? 241 VAL A O   1 
ATOM   1004 C  CB  . VAL A 1 136 ? 12.093  71.798  35.057 1.00 47.19 ? 241 VAL A CB  1 
ATOM   1005 C  CG1 . VAL A 1 136 ? 12.487  73.229  34.733 1.00 47.19 ? 241 VAL A CG1 1 
ATOM   1006 C  CG2 . VAL A 1 136 ? 10.651  71.726  35.555 1.00 47.75 ? 241 VAL A CG2 1 
ATOM   1007 N  N   . ASP A 1 137 ? 12.829  68.763  34.901 1.00 47.28 ? 242 ASP A N   1 
ATOM   1008 C  CA  . ASP A 1 137 ? 12.672  67.348  35.206 1.00 47.19 ? 242 ASP A CA  1 
ATOM   1009 C  C   . ASP A 1 137 ? 12.172  67.082  36.628 1.00 47.12 ? 242 ASP A C   1 
ATOM   1010 O  O   . ASP A 1 137 ? 12.077  65.926  37.037 1.00 47.11 ? 242 ASP A O   1 
ATOM   1011 C  CB  . ASP A 1 137 ? 13.999  66.637  34.972 1.00 47.36 ? 242 ASP A CB  1 
ATOM   1012 C  CG  . ASP A 1 137 ? 14.487  66.784  33.536 1.00 48.14 ? 242 ASP A CG  1 
ATOM   1013 O  OD1 . ASP A 1 137 ? 15.551  67.410  33.328 1.00 48.95 ? 242 ASP A OD1 1 
ATOM   1014 O  OD2 . ASP A 1 137 ? 13.797  66.288  32.614 1.00 48.86 ? 242 ASP A OD2 1 
ATOM   1015 N  N   . GLY A 1 138 ? 11.832  68.138  37.371 1.00 46.98 ? 243 GLY A N   1 
ATOM   1016 C  CA  . GLY A 1 138 ? 11.312  67.989  38.735 1.00 46.89 ? 243 GLY A CA  1 
ATOM   1017 C  C   . GLY A 1 138 ? 11.382  69.254  39.577 1.00 46.75 ? 243 GLY A C   1 
ATOM   1018 O  O   . GLY A 1 138 ? 11.759  70.313  39.080 1.00 46.69 ? 243 GLY A O   1 
ATOM   1019 N  N   . PHE A 1 139 ? 11.023  69.133  40.857 1.00 46.53 ? 244 PHE A N   1 
ATOM   1020 C  CA  . PHE A 1 139 ? 10.928  70.278  41.763 1.00 46.51 ? 244 PHE A CA  1 
ATOM   1021 C  C   . PHE A 1 139 ? 11.351  69.958  43.193 1.00 46.45 ? 244 PHE A C   1 
ATOM   1022 O  O   . PHE A 1 139 ? 11.211  68.823  43.644 1.00 46.29 ? 244 PHE A O   1 
ATOM   1023 C  CB  . PHE A 1 139 ? 9.493   70.798  41.800 1.00 46.55 ? 244 PHE A CB  1 
ATOM   1024 C  CG  . PHE A 1 139 ? 9.013   71.328  40.490 1.00 46.58 ? 244 PHE A CG  1 
ATOM   1025 C  CD1 . PHE A 1 139 ? 8.329   70.509  39.607 1.00 46.84 ? 244 PHE A CD1 1 
ATOM   1026 C  CD2 . PHE A 1 139 ? 9.255   72.645  40.131 1.00 46.66 ? 244 PHE A CD2 1 
ATOM   1027 C  CE1 . PHE A 1 139 ? 7.886   70.993  38.391 1.00 46.94 ? 244 PHE A CE1 1 
ATOM   1028 C  CE2 . PHE A 1 139 ? 8.819   73.140  38.916 1.00 46.73 ? 244 PHE A CE2 1 
ATOM   1029 C  CZ  . PHE A 1 139 ? 8.132   72.314  38.044 1.00 47.14 ? 244 PHE A CZ  1 
ATOM   1030 N  N   . GLN A 1 140 ? 11.853  70.974  43.900 1.00 46.38 ? 245 GLN A N   1 
ATOM   1031 C  CA  . GLN A 1 140 ? 12.105  70.883  45.339 1.00 46.26 ? 245 GLN A CA  1 
ATOM   1032 C  C   . GLN A 1 140 ? 11.375  71.973  46.124 1.00 46.15 ? 245 GLN A C   1 
ATOM   1033 O  O   . GLN A 1 140 ? 11.212  73.088  45.645 1.00 46.00 ? 245 GLN A O   1 
ATOM   1034 C  CB  . GLN A 1 140 ? 13.598  70.986  45.638 1.00 46.29 ? 245 GLN A CB  1 
ATOM   1035 C  CG  . GLN A 1 140 ? 13.930  70.696  47.102 1.00 46.25 ? 245 GLN A CG  1 
ATOM   1036 C  CD  . GLN A 1 140 ? 15.383  70.875  47.423 1.00 46.04 ? 245 GLN A CD  1 
ATOM   1037 O  OE1 . GLN A 1 140 ? 16.078  69.911  47.722 1.00 46.31 ? 245 GLN A OE1 1 
ATOM   1038 N  NE2 . GLN A 1 140 ? 15.855  72.114  47.378 1.00 45.96 ? 245 GLN A NE2 1 
ATOM   1039 N  N   . VAL A 1 141 ? 10.961  71.638  47.341 1.00 46.25 ? 246 VAL A N   1 
ATOM   1040 C  CA  . VAL A 1 141 ? 10.402  72.609  48.282 1.00 46.46 ? 246 VAL A CA  1 
ATOM   1041 C  C   . VAL A 1 141 ? 10.892  72.314  49.709 1.00 46.54 ? 246 VAL A C   1 
ATOM   1042 O  O   . VAL A 1 141 ? 10.834  71.172  50.155 1.00 46.41 ? 246 VAL A O   1 
ATOM   1043 C  CB  . VAL A 1 141 ? 8.854   72.613  48.237 1.00 46.51 ? 246 VAL A CB  1 
ATOM   1044 C  CG1 . VAL A 1 141 ? 8.357   73.372  47.007 1.00 46.54 ? 246 VAL A CG1 1 
ATOM   1045 C  CG2 . VAL A 1 141 ? 8.288   71.183  48.258 1.00 46.26 ? 246 VAL A CG2 1 
ATOM   1046 N  N   . ARG A 1 142 ? 11.372  73.342  50.413 1.00 46.68 ? 247 ARG A N   1 
ATOM   1047 C  CA  . ARG A 1 142 ? 11.987  73.175  51.742 1.00 47.00 ? 247 ARG A CA  1 
ATOM   1048 C  C   . ARG A 1 142 ? 11.143  73.730  52.888 1.00 46.92 ? 247 ARG A C   1 
ATOM   1049 O  O   . ARG A 1 142 ? 10.185  74.458  52.663 1.00 47.01 ? 247 ARG A O   1 
ATOM   1050 C  CB  . ARG A 1 142 ? 13.366  73.838  51.772 1.00 47.04 ? 247 ARG A CB  1 
ATOM   1051 C  CG  . ARG A 1 142 ? 14.451  73.013  51.123 1.00 47.48 ? 247 ARG A CG  1 
ATOM   1052 C  CD  . ARG A 1 142 ? 15.820  73.680  51.229 1.00 47.76 ? 247 ARG A CD  1 
ATOM   1053 N  NE  . ARG A 1 142 ? 15.994  74.728  50.219 1.00 48.51 ? 247 ARG A NE  1 
ATOM   1054 C  CZ  . ARG A 1 142 ? 15.989  76.041  50.450 1.00 48.20 ? 247 ARG A CZ  1 
ATOM   1055 N  NH1 . ARG A 1 142 ? 15.836  76.537  51.676 1.00 47.63 ? 247 ARG A NH1 1 
ATOM   1056 N  NH2 . ARG A 1 142 ? 16.150  76.874  49.428 1.00 48.50 ? 247 ARG A NH2 1 
ATOM   1057 N  N   . ASP A 1 143 ? 11.530  73.377  54.114 1.00 47.06 ? 248 ASP A N   1 
ATOM   1058 C  CA  . ASP A 1 143 ? 10.877  73.840  55.349 1.00 47.32 ? 248 ASP A CA  1 
ATOM   1059 C  C   . ASP A 1 143 ? 9.375   73.571  55.373 1.00 47.44 ? 248 ASP A C   1 
ATOM   1060 O  O   . ASP A 1 143 ? 8.583   74.434  55.755 1.00 47.41 ? 248 ASP A O   1 
ATOM   1061 C  CB  . ASP A 1 143 ? 11.149  75.331  55.597 1.00 47.31 ? 248 ASP A CB  1 
ATOM   1062 C  CG  . ASP A 1 143 ? 12.624  75.638  55.767 1.00 47.43 ? 248 ASP A CG  1 
ATOM   1063 O  OD1 . ASP A 1 143 ? 13.017  76.794  55.518 1.00 47.46 ? 248 ASP A OD1 1 
ATOM   1064 O  OD2 . ASP A 1 143 ? 13.392  74.733  56.151 1.00 48.21 ? 248 ASP A OD2 1 
ATOM   1065 N  N   . ILE A 1 144 ? 9.004   72.357  54.979 1.00 47.67 ? 249 ILE A N   1 
ATOM   1066 C  CA  . ILE A 1 144 ? 7.600   71.926  54.967 1.00 47.94 ? 249 ILE A CA  1 
ATOM   1067 C  C   . ILE A 1 144 ? 6.934   71.890  56.344 1.00 48.03 ? 249 ILE A C   1 
ATOM   1068 O  O   . ILE A 1 144 ? 5.711   71.975  56.429 1.00 48.15 ? 249 ILE A O   1 
ATOM   1069 C  CB  . ILE A 1 144 ? 7.438   70.529  54.335 1.00 47.93 ? 249 ILE A CB  1 
ATOM   1070 C  CG1 . ILE A 1 144 ? 8.224   69.488  55.146 1.00 48.11 ? 249 ILE A CG1 1 
ATOM   1071 C  CG2 . ILE A 1 144 ? 7.867   70.560  52.868 1.00 47.93 ? 249 ILE A CG2 1 
ATOM   1072 C  CD1 . ILE A 1 144 ? 8.229   68.112  54.536 1.00 48.44 ? 249 ILE A CD1 1 
ATOM   1073 N  N   . GLU A 1 145 ? 7.721   71.747  57.410 1.00 48.11 ? 250 GLU A N   1 
ATOM   1074 C  CA  . GLU A 1 145 ? 7.174   71.761  58.777 1.00 48.15 ? 250 GLU A CA  1 
ATOM   1075 C  C   . GLU A 1 145 ? 6.495   73.088  59.138 1.00 48.09 ? 250 GLU A C   1 
ATOM   1076 O  O   . GLU A 1 145 ? 5.659   73.122  60.035 1.00 48.06 ? 250 GLU A O   1 
ATOM   1077 C  CB  . GLU A 1 145 ? 8.236   71.385  59.831 1.00 48.19 ? 250 GLU A CB  1 
ATOM   1078 C  CG  . GLU A 1 145 ? 9.364   72.401  60.055 1.00 48.49 ? 250 GLU A CG  1 
ATOM   1079 C  CD  . GLU A 1 145 ? 10.437  72.371  58.977 1.00 49.11 ? 250 GLU A CD  1 
ATOM   1080 O  OE1 . GLU A 1 145 ? 11.458  73.071  59.146 1.00 49.92 ? 250 GLU A OE1 1 
ATOM   1081 O  OE2 . GLU A 1 145 ? 10.267  71.658  57.961 1.00 48.70 ? 250 GLU A OE2 1 
ATOM   1082 N  N   . ASN A 1 146 ? 6.851   74.166  58.436 1.00 48.13 ? 251 ASN A N   1 
ATOM   1083 C  CA  . ASN A 1 146 ? 6.171   75.461  58.582 1.00 48.21 ? 251 ASN A CA  1 
ATOM   1084 C  C   . ASN A 1 146 ? 4.962   75.654  57.655 1.00 48.25 ? 251 ASN A C   1 
ATOM   1085 O  O   . ASN A 1 146 ? 4.372   76.737  57.634 1.00 48.07 ? 251 ASN A O   1 
ATOM   1086 C  CB  . ASN A 1 146 ? 7.158   76.609  58.353 1.00 48.21 ? 251 ASN A CB  1 
ATOM   1087 C  CG  . ASN A 1 146 ? 8.307   76.599  59.331 1.00 48.12 ? 251 ASN A CG  1 
ATOM   1088 O  OD1 . ASN A 1 146 ? 9.341   77.217  59.090 1.00 48.29 ? 251 ASN A OD1 1 
ATOM   1089 N  ND2 . ASN A 1 146 ? 8.137   75.897  60.442 1.00 48.55 ? 251 ASN A ND2 1 
ATOM   1090 N  N   . LEU A 1 147 ? 4.596   74.615  56.900 1.00 48.41 ? 252 LEU A N   1 
ATOM   1091 C  CA  . LEU A 1 147 ? 3.452   74.672  55.980 1.00 48.40 ? 252 LEU A CA  1 
ATOM   1092 C  C   . LEU A 1 147 ? 2.210   74.022  56.592 1.00 48.39 ? 252 LEU A C   1 
ATOM   1093 O  O   . LEU A 1 147 ? 2.216   72.832  56.910 1.00 48.20 ? 252 LEU A O   1 
ATOM   1094 C  CB  . LEU A 1 147 ? 3.789   73.984  54.647 1.00 48.44 ? 252 LEU A CB  1 
ATOM   1095 C  CG  . LEU A 1 147 ? 2.718   74.036  53.545 1.00 48.56 ? 252 LEU A CG  1 
ATOM   1096 C  CD1 . LEU A 1 147 ? 2.400   75.476  53.157 1.00 48.91 ? 252 LEU A CD1 1 
ATOM   1097 C  CD2 . LEU A 1 147 ? 3.146   73.242  52.321 1.00 48.41 ? 252 LEU A CD2 1 
ATOM   1098 N  N   . LYS A 1 148 ? 1.153   74.819  56.747 1.00 48.48 ? 253 LYS A N   1 
ATOM   1099 C  CA  . LYS A 1 148 ? -0.157  74.326  57.181 1.00 48.51 ? 253 LYS A CA  1 
ATOM   1100 C  C   . LYS A 1 148 ? -0.676  73.270  56.206 1.00 48.61 ? 253 LYS A C   1 
ATOM   1101 O  O   . LYS A 1 148 ? -0.578  73.443  54.988 1.00 48.61 ? 253 LYS A O   1 
ATOM   1102 C  CB  . LYS A 1 148 ? -1.152  75.490  57.291 1.00 48.43 ? 253 LYS A CB  1 
ATOM   1103 C  CG  . LYS A 1 148 ? -2.630  75.090  57.320 1.00 48.53 ? 253 LYS A CG  1 
ATOM   1104 C  CD  . LYS A 1 148 ? -3.514  76.249  57.786 1.00 48.42 ? 253 LYS A CD  1 
ATOM   1105 C  CE  . LYS A 1 148 ? -4.970  76.066  57.381 1.00 48.17 ? 253 LYS A CE  1 
ATOM   1106 N  NZ  . LYS A 1 148 ? -5.547  74.790  57.873 1.00 47.84 ? 253 LYS A NZ  1 
ATOM   1107 N  N   . ASP A 1 149 ? -1.215  72.182  56.756 1.00 48.72 ? 254 ASP A N   1 
ATOM   1108 C  CA  . ASP A 1 149 ? -1.736  71.051  55.973 1.00 48.76 ? 254 ASP A CA  1 
ATOM   1109 C  C   . ASP A 1 149 ? -0.719  70.491  54.965 1.00 48.73 ? 254 ASP A C   1 
ATOM   1110 O  O   . ASP A 1 149 ? -1.066  70.153  53.827 1.00 48.72 ? 254 ASP A O   1 
ATOM   1111 C  CB  . ASP A 1 149 ? -3.049  71.446  55.284 1.00 48.79 ? 254 ASP A CB  1 
ATOM   1112 C  CG  . ASP A 1 149 ? -4.174  71.699  56.276 1.00 49.41 ? 254 ASP A CG  1 
ATOM   1113 O  OD1 . ASP A 1 149 ? -4.310  70.910  57.236 1.00 49.80 ? 254 ASP A OD1 1 
ATOM   1114 O  OD2 . ASP A 1 149 ? -4.931  72.680  56.097 1.00 50.32 ? 254 ASP A OD2 1 
ATOM   1115 N  N   . ALA A 1 150 ? 0.530   70.372  55.408 1.00 48.67 ? 255 ALA A N   1 
ATOM   1116 C  CA  . ALA A 1 150 ? 1.640   69.980  54.533 1.00 48.74 ? 255 ALA A CA  1 
ATOM   1117 C  C   . ALA A 1 150 ? 1.315   68.772  53.654 1.00 48.75 ? 255 ALA A C   1 
ATOM   1118 O  O   . ALA A 1 150 ? 1.366   68.864  52.426 1.00 48.84 ? 255 ALA A O   1 
ATOM   1119 C  CB  . ALA A 1 150 ? 2.885   69.703  55.359 1.00 48.75 ? 255 ALA A CB  1 
ATOM   1120 N  N   . SER A 1 151 ? 0.968   67.655  54.291 1.00 48.68 ? 256 SER A N   1 
ATOM   1121 C  CA  . SER A 1 151 ? 0.735   66.381  53.591 1.00 48.63 ? 256 SER A CA  1 
ATOM   1122 C  C   . SER A 1 151 ? -0.317  66.475  52.477 1.00 48.54 ? 256 SER A C   1 
ATOM   1123 O  O   . SER A 1 151 ? -0.192  65.813  51.443 1.00 48.43 ? 256 SER A O   1 
ATOM   1124 C  CB  . SER A 1 151 ? 0.343   65.287  54.592 1.00 48.59 ? 256 SER A CB  1 
ATOM   1125 O  OG  . SER A 1 151 ? -0.730  65.704  55.417 1.00 48.86 ? 256 SER A OG  1 
ATOM   1126 N  N   . SER A 1 152 ? -1.338  67.304  52.686 1.00 48.42 ? 257 SER A N   1 
ATOM   1127 C  CA  . SER A 1 152 ? -2.394  67.494  51.693 1.00 48.37 ? 257 SER A CA  1 
ATOM   1128 C  C   . SER A 1 152 ? -1.873  68.128  50.407 1.00 48.31 ? 257 SER A C   1 
ATOM   1129 O  O   . SER A 1 152 ? -2.212  67.681  49.314 1.00 48.21 ? 257 SER A O   1 
ATOM   1130 C  CB  . SER A 1 152 ? -3.511  68.362  52.266 1.00 48.35 ? 257 SER A CB  1 
ATOM   1131 O  OG  . SER A 1 152 ? -3.997  67.816  53.477 1.00 48.49 ? 257 SER A OG  1 
ATOM   1132 N  N   . PHE A 1 153 ? -1.051  69.167  50.546 1.00 48.33 ? 258 PHE A N   1 
ATOM   1133 C  CA  . PHE A 1 153 ? -0.492  69.873  49.388 1.00 48.27 ? 258 PHE A CA  1 
ATOM   1134 C  C   . PHE A 1 153 ? 0.566   69.063  48.647 1.00 48.23 ? 258 PHE A C   1 
ATOM   1135 O  O   . PHE A 1 153 ? 0.632   69.107  47.419 1.00 48.20 ? 258 PHE A O   1 
ATOM   1136 C  CB  . PHE A 1 153 ? 0.103   71.219  49.806 1.00 48.21 ? 258 PHE A CB  1 
ATOM   1137 C  CG  . PHE A 1 153 ? -0.921  72.221  50.222 1.00 48.01 ? 258 PHE A CG  1 
ATOM   1138 C  CD1 . PHE A 1 153 ? -1.168  72.464  51.564 1.00 48.02 ? 258 PHE A CD1 1 
ATOM   1139 C  CD2 . PHE A 1 153 ? -1.652  72.915  49.270 1.00 47.86 ? 258 PHE A CD2 1 
ATOM   1140 C  CE1 . PHE A 1 153 ? -2.120  73.392  51.952 1.00 48.17 ? 258 PHE A CE1 1 
ATOM   1141 C  CE2 . PHE A 1 153 ? -2.608  73.841  49.645 1.00 48.06 ? 258 PHE A CE2 1 
ATOM   1142 C  CZ  . PHE A 1 153 ? -2.843  74.083  50.988 1.00 48.22 ? 258 PHE A CZ  1 
ATOM   1143 N  N   . LEU A 1 154 ? 1.401   68.339  49.387 1.00 48.18 ? 259 LEU A N   1 
ATOM   1144 C  CA  . LEU A 1 154 ? 2.426   67.498  48.766 1.00 48.24 ? 259 LEU A CA  1 
ATOM   1145 C  C   . LEU A 1 154 ? 1.804   66.364  47.940 1.00 48.21 ? 259 LEU A C   1 
ATOM   1146 O  O   . LEU A 1 154 ? 2.407   65.895  46.974 1.00 48.24 ? 259 LEU A O   1 
ATOM   1147 C  CB  . LEU A 1 154 ? 3.378   66.924  49.821 1.00 48.35 ? 259 LEU A CB  1 
ATOM   1148 C  CG  . LEU A 1 154 ? 4.339   67.917  50.480 1.00 48.64 ? 259 LEU A CG  1 
ATOM   1149 C  CD1 . LEU A 1 154 ? 4.941   67.329  51.752 1.00 48.70 ? 259 LEU A CD1 1 
ATOM   1150 C  CD2 . LEU A 1 154 ? 5.440   68.334  49.518 1.00 48.98 ? 259 LEU A CD2 1 
ATOM   1151 N  N   . ALA A 1 155 ? 0.604   65.932  48.323 1.00 48.09 ? 260 ALA A N   1 
ATOM   1152 C  CA  . ALA A 1 155 ? -0.133  64.923  47.568 1.00 47.99 ? 260 ALA A CA  1 
ATOM   1153 C  C   . ALA A 1 155 ? -0.560  65.472  46.204 1.00 47.91 ? 260 ALA A C   1 
ATOM   1154 O  O   . ALA A 1 155 ? -0.308  64.846  45.170 1.00 47.82 ? 260 ALA A O   1 
ATOM   1155 C  CB  . ALA A 1 155 ? -1.354  64.455  48.358 1.00 47.89 ? 260 ALA A CB  1 
ATOM   1156 N  N   . GLU A 1 156 ? -1.194  66.645  46.214 1.00 47.79 ? 261 GLU A N   1 
ATOM   1157 C  CA  . GLU A 1 156 ? -1.695  67.276  44.992 1.00 47.75 ? 261 GLU A CA  1 
ATOM   1158 C  C   . GLU A 1 156 ? -0.574  67.601  44.002 1.00 47.60 ? 261 GLU A C   1 
ATOM   1159 O  O   . GLU A 1 156 ? -0.657  67.250  42.825 1.00 47.46 ? 261 GLU A O   1 
ATOM   1160 C  CB  . GLU A 1 156 ? -2.461  68.558  45.326 1.00 47.67 ? 261 GLU A CB  1 
ATOM   1161 C  CG  . GLU A 1 156 ? -3.206  69.149  44.135 1.00 47.99 ? 261 GLU A CG  1 
ATOM   1162 C  CD  . GLU A 1 156 ? -3.818  70.506  44.429 1.00 48.14 ? 261 GLU A CD  1 
ATOM   1163 O  OE1 . GLU A 1 156 ? -3.051  71.472  44.648 1.00 49.11 ? 261 GLU A OE1 1 
ATOM   1164 O  OE2 . GLU A 1 156 ? -5.065  70.609  44.426 1.00 48.23 ? 261 GLU A OE2 1 
ATOM   1165 N  N   . TRP A 1 157 ? 0.463   68.277  44.494 1.00 47.52 ? 262 TRP A N   1 
ATOM   1166 C  CA  . TRP A 1 157 ? 1.598   68.691  43.671 1.00 47.47 ? 262 TRP A CA  1 
ATOM   1167 C  C   . TRP A 1 157 ? 2.365   67.494  43.083 1.00 47.36 ? 262 TRP A C   1 
ATOM   1168 O  O   . TRP A 1 157 ? 2.854   67.555  41.952 1.00 47.19 ? 262 TRP A O   1 
ATOM   1169 C  CB  . TRP A 1 157 ? 2.561   69.564  44.484 1.00 47.46 ? 262 TRP A CB  1 
ATOM   1170 C  CG  . TRP A 1 157 ? 1.971   70.833  45.028 1.00 47.39 ? 262 TRP A CG  1 
ATOM   1171 C  CD1 . TRP A 1 157 ? 0.934   71.553  44.506 1.00 47.43 ? 262 TRP A CD1 1 
ATOM   1172 C  CD2 . TRP A 1 157 ? 2.412   71.551  46.192 1.00 47.62 ? 262 TRP A CD2 1 
ATOM   1173 N  NE1 . TRP A 1 157 ? 0.690   72.667  45.283 1.00 47.34 ? 262 TRP A NE1 1 
ATOM   1174 C  CE2 . TRP A 1 157 ? 1.586   72.690  46.320 1.00 47.36 ? 262 TRP A CE2 1 
ATOM   1175 C  CE3 . TRP A 1 157 ? 3.423   71.339  47.139 1.00 47.21 ? 262 TRP A CE3 1 
ATOM   1176 C  CZ2 . TRP A 1 157 ? 1.740   73.611  47.357 1.00 47.24 ? 262 TRP A CZ2 1 
ATOM   1177 C  CZ3 . TRP A 1 157 ? 3.572   72.256  48.169 1.00 47.19 ? 262 TRP A CZ3 1 
ATOM   1178 C  CH2 . TRP A 1 157 ? 2.734   73.377  48.270 1.00 47.23 ? 262 TRP A CH2 1 
ATOM   1179 N  N   . GLN A 1 158 ? 2.478   66.422  43.861 1.00 47.30 ? 263 GLN A N   1 
ATOM   1180 C  CA  . GLN A 1 158 ? 3.051   65.161  43.378 1.00 47.26 ? 263 GLN A CA  1 
ATOM   1181 C  C   . GLN A 1 158 ? 2.251   64.612  42.190 1.00 46.99 ? 263 GLN A C   1 
ATOM   1182 O  O   . GLN A 1 158 ? 2.829   64.142  41.214 1.00 46.72 ? 263 GLN A O   1 
ATOM   1183 C  CB  . GLN A 1 158 ? 3.106   64.146  44.534 1.00 47.44 ? 263 GLN A CB  1 
ATOM   1184 C  CG  . GLN A 1 158 ? 3.291   62.673  44.174 1.00 47.67 ? 263 GLN A CG  1 
ATOM   1185 C  CD  . GLN A 1 158 ? 4.681   62.335  43.688 1.00 48.49 ? 263 GLN A CD  1 
ATOM   1186 O  OE1 . GLN A 1 158 ? 5.238   63.025  42.836 1.00 49.75 ? 263 GLN A OE1 1 
ATOM   1187 N  NE2 . GLN A 1 158 ? 5.242   61.247  44.212 1.00 48.38 ? 263 GLN A NE2 1 
ATOM   1188 N  N   . ASN A 1 159 ? 0.926   64.694  42.281 1.00 46.93 ? 264 ASN A N   1 
ATOM   1189 C  CA  . ASN A 1 159 ? 0.026   64.220  41.219 1.00 46.93 ? 264 ASN A CA  1 
ATOM   1190 C  C   . ASN A 1 159 ? 0.093   65.017  39.912 1.00 46.85 ? 264 ASN A C   1 
ATOM   1191 O  O   . ASN A 1 159 ? -0.062  64.446  38.832 1.00 46.80 ? 264 ASN A O   1 
ATOM   1192 C  CB  . ASN A 1 159 ? -1.417  64.203  41.722 1.00 46.89 ? 264 ASN A CB  1 
ATOM   1193 C  CG  . ASN A 1 159 ? -1.653  63.149  42.783 1.00 46.92 ? 264 ASN A CG  1 
ATOM   1194 O  OD1 . ASN A 1 159 ? -0.887  62.189  42.911 1.00 46.95 ? 264 ASN A OD1 1 
ATOM   1195 N  ND2 . ASN A 1 159 ? -2.722  63.320  43.550 1.00 46.24 ? 264 ASN A ND2 1 
ATOM   1196 N  N   . ILE A 1 160 ? 0.308   66.326  40.014 1.00 46.71 ? 265 ILE A N   1 
ATOM   1197 C  CA  . ILE A 1 160 ? 0.520   67.168  38.836 1.00 46.68 ? 265 ILE A CA  1 
ATOM   1198 C  C   . ILE A 1 160 ? 1.840   66.802  38.169 1.00 46.59 ? 265 ILE A C   1 
ATOM   1199 O  O   . ILE A 1 160 ? 1.912   66.654  36.951 1.00 46.62 ? 265 ILE A O   1 
ATOM   1200 C  CB  . ILE A 1 160 ? 0.549   68.672  39.201 1.00 46.74 ? 265 ILE A CB  1 
ATOM   1201 C  CG1 . ILE A 1 160 ? -0.822  69.126  39.706 1.00 46.59 ? 265 ILE A CG1 1 
ATOM   1202 C  CG2 . ILE A 1 160 ? 0.972   69.521  37.994 1.00 46.65 ? 265 ILE A CG2 1 
ATOM   1203 C  CD1 . ILE A 1 160 ? -0.806  70.484  40.366 1.00 46.64 ? 265 ILE A CD1 1 
ATOM   1204 N  N   . THR A 1 161 ? 2.876   66.655  38.990 1.00 46.61 ? 266 THR A N   1 
ATOM   1205 C  CA  . THR A 1 161 ? 4.225   66.332  38.527 1.00 46.47 ? 266 THR A CA  1 
ATOM   1206 C  C   . THR A 1 161 ? 4.311   64.969  37.840 1.00 46.27 ? 266 THR A C   1 
ATOM   1207 O  O   . THR A 1 161 ? 4.874   64.861  36.755 1.00 46.12 ? 266 THR A O   1 
ATOM   1208 C  CB  . THR A 1 161 ? 5.222   66.370  39.699 1.00 46.47 ? 266 THR A CB  1 
ATOM   1209 O  OG1 . THR A 1 161 ? 5.174   67.660  40.321 1.00 46.64 ? 266 THR A OG1 1 
ATOM   1210 C  CG2 . THR A 1 161 ? 6.641   66.107  39.217 1.00 46.90 ? 266 THR A CG2 1 
ATOM   1211 N  N   . LYS A 1 162 ? 3.757   63.939  38.473 1.00 46.27 ? 267 LYS A N   1 
ATOM   1212 C  CA  . LYS A 1 162 ? 3.736   62.594  37.888 1.00 46.27 ? 267 LYS A CA  1 
ATOM   1213 C  C   . LYS A 1 162 ? 2.809   62.516  36.681 1.00 46.15 ? 267 LYS A C   1 
ATOM   1214 O  O   . LYS A 1 162 ? 3.026   61.698  35.789 1.00 46.05 ? 267 LYS A O   1 
ATOM   1215 C  CB  . LYS A 1 162 ? 3.304   61.548  38.920 1.00 46.32 ? 267 LYS A CB  1 
ATOM   1216 C  CG  . LYS A 1 162 ? 4.270   61.379  40.072 1.00 46.70 ? 267 LYS A CG  1 
ATOM   1217 C  CD  . LYS A 1 162 ? 5.561   60.672  39.662 1.00 46.91 ? 267 LYS A CD  1 
ATOM   1218 C  CE  . LYS A 1 162 ? 6.582   60.710  40.796 1.00 46.75 ? 267 LYS A CE  1 
ATOM   1219 N  NZ  . LYS A 1 162 ? 7.849   60.013  40.457 1.00 46.73 ? 267 LYS A NZ  1 
ATOM   1220 N  N   . GLY A 1 163 ? 1.775   63.359  36.673 1.00 46.06 ? 268 GLY A N   1 
ATOM   1221 C  CA  . GLY A 1 163 ? 0.818   63.416  35.574 1.00 45.93 ? 268 GLY A CA  1 
ATOM   1222 C  C   . GLY A 1 163 ? 1.453   63.820  34.259 1.00 45.78 ? 268 GLY A C   1 
ATOM   1223 O  O   . GLY A 1 163 ? 1.141   63.248  33.218 1.00 45.69 ? 268 GLY A O   1 
ATOM   1224 N  N   . PHE A 1 164 ? 2.348   64.805  34.308 1.00 45.75 ? 269 PHE A N   1 
ATOM   1225 C  CA  . PHE A 1 164 ? 3.091   65.232  33.119 1.00 45.86 ? 269 PHE A CA  1 
ATOM   1226 C  C   . PHE A 1 164 ? 3.856   64.042  32.549 1.00 45.87 ? 269 PHE A C   1 
ATOM   1227 O  O   . PHE A 1 164 ? 3.669   63.673  31.391 1.00 45.62 ? 269 PHE A O   1 
ATOM   1228 C  CB  . PHE A 1 164 ? 4.051   66.382  33.457 1.00 45.56 ? 269 PHE A CB  1 
ATOM   1229 C  CG  . PHE A 1 164 ? 4.506   67.178  32.254 1.00 45.58 ? 269 PHE A CG  1 
ATOM   1230 C  CD1 . PHE A 1 164 ? 3.710   68.186  31.730 1.00 44.88 ? 269 PHE A CD1 1 
ATOM   1231 C  CD2 . PHE A 1 164 ? 5.741   66.931  31.660 1.00 45.38 ? 269 PHE A CD2 1 
ATOM   1232 C  CE1 . PHE A 1 164 ? 4.134   68.923  30.631 1.00 45.11 ? 269 PHE A CE1 1 
ATOM   1233 C  CE2 . PHE A 1 164 ? 6.169   67.667  30.556 1.00 44.84 ? 269 PHE A CE2 1 
ATOM   1234 C  CZ  . PHE A 1 164 ? 5.368   68.661  30.045 1.00 44.81 ? 269 PHE A CZ  1 
ATOM   1235 N  N   . SER A 1 165 ? 4.694   63.437  33.387 1.00 46.14 ? 270 SER A N   1 
ATOM   1236 C  CA  . SER A 1 165 ? 5.432   62.226  33.032 1.00 46.46 ? 270 SER A CA  1 
ATOM   1237 C  C   . SER A 1 165 ? 5.806   61.475  34.299 1.00 46.76 ? 270 SER A C   1 
ATOM   1238 O  O   . SER A 1 165 ? 6.069   62.092  35.327 1.00 46.93 ? 270 SER A O   1 
ATOM   1239 C  CB  . SER A 1 165 ? 6.697   62.581  32.246 1.00 46.40 ? 270 SER A CB  1 
ATOM   1240 O  OG  . SER A 1 165 ? 7.440   61.425  31.902 1.00 46.18 ? 270 SER A OG  1 
ATOM   1241 N  N   . GLU A 1 166 ? 5.847   60.147  34.222 1.00 47.22 ? 271 GLU A N   1 
ATOM   1242 C  CA  . GLU A 1 166 ? 6.253   59.318  35.368 1.00 47.49 ? 271 GLU A CA  1 
ATOM   1243 C  C   . GLU A 1 166 ? 7.753   59.492  35.646 1.00 47.62 ? 271 GLU A C   1 
ATOM   1244 O  O   . GLU A 1 166 ? 8.237   59.149  36.729 1.00 47.74 ? 271 GLU A O   1 
ATOM   1245 C  CB  . GLU A 1 166 ? 5.944   57.829  35.139 1.00 47.72 ? 271 GLU A CB  1 
ATOM   1246 C  CG  . GLU A 1 166 ? 4.539   57.489  34.591 1.00 49.13 ? 271 GLU A CG  1 
ATOM   1247 C  CD  . GLU A 1 166 ? 3.395   57.737  35.582 1.00 50.84 ? 271 GLU A CD  1 
ATOM   1248 O  OE1 . GLU A 1 166 ? 3.607   58.429  36.606 1.00 51.96 ? 271 GLU A OE1 1 
ATOM   1249 O  OE2 . GLU A 1 166 ? 2.272   57.234  35.323 1.00 51.07 ? 271 GLU A OE2 1 
ATOM   1250 N  N   . ASP A 1 167 ? 8.476   60.030  34.667 1.00 47.61 ? 272 ASP A N   1 
ATOM   1251 C  CA  . ASP A 1 167 ? 9.901   60.284  34.788 1.00 47.70 ? 272 ASP A CA  1 
ATOM   1252 C  C   . ASP A 1 167 ? 10.147  61.734  35.253 1.00 47.51 ? 272 ASP A C   1 
ATOM   1253 O  O   . ASP A 1 167 ? 10.985  62.434  34.691 1.00 47.32 ? 272 ASP A O   1 
ATOM   1254 C  CB  . ASP A 1 167 ? 10.575  59.993  33.430 1.00 47.95 ? 272 ASP A CB  1 
ATOM   1255 C  CG  . ASP A 1 167 ? 11.969  59.373  33.567 1.00 49.48 ? 272 ASP A CG  1 
ATOM   1256 O  OD1 . ASP A 1 167 ? 12.430  59.133  34.708 1.00 51.76 ? 272 ASP A OD1 1 
ATOM   1257 O  OD2 . ASP A 1 167 ? 12.610  59.116  32.522 1.00 51.05 ? 272 ASP A OD2 1 
ATOM   1258 N  N   . ARG A 1 168 ? 9.404   62.164  36.281 1.00 47.53 ? 273 ARG A N   1 
ATOM   1259 C  CA  . ARG A 1 168 ? 9.507   63.511  36.896 1.00 47.46 ? 273 ARG A CA  1 
ATOM   1260 C  C   . ARG A 1 168 ? 9.394   63.400  38.428 1.00 47.31 ? 273 ARG A C   1 
ATOM   1261 O  O   . ARG A 1 168 ? 8.533   62.687  38.936 1.00 47.27 ? 273 ARG A O   1 
ATOM   1262 C  CB  . ARG A 1 168 ? 8.381   64.426  36.402 1.00 47.47 ? 273 ARG A CB  1 
ATOM   1263 C  CG  . ARG A 1 168 ? 8.404   64.755  34.920 1.00 47.44 ? 273 ARG A CG  1 
ATOM   1264 C  CD  . ARG A 1 168 ? 9.326   65.914  34.610 1.00 47.63 ? 273 ARG A CD  1 
ATOM   1265 N  NE  . ARG A 1 168 ? 9.304   66.240  33.185 1.00 47.85 ? 273 ARG A NE  1 
ATOM   1266 C  CZ  . ARG A 1 168 ? 9.982   65.586  32.244 1.00 47.74 ? 273 ARG A CZ  1 
ATOM   1267 N  NH1 . ARG A 1 168 ? 10.758  64.557  32.558 1.00 47.54 ? 273 ARG A NH1 1 
ATOM   1268 N  NH2 . ARG A 1 168 ? 9.885   65.966  30.976 1.00 48.26 ? 273 ARG A NH2 1 
ATOM   1269 N  N   . LEU A 1 169 ? 10.234  64.133  39.155 1.00 47.28 ? 274 LEU A N   1 
ATOM   1270 C  CA  . LEU A 1 169 ? 10.388  63.949  40.607 1.00 47.25 ? 274 LEU A CA  1 
ATOM   1271 C  C   . LEU A 1 169 ? 9.875   65.136  41.434 1.00 47.23 ? 274 LEU A C   1 
ATOM   1272 O  O   . LEU A 1 169 ? 9.869   66.273  40.970 1.00 47.22 ? 274 LEU A O   1 
ATOM   1273 C  CB  . LEU A 1 169 ? 11.870  63.701  40.923 1.00 47.20 ? 274 LEU A CB  1 
ATOM   1274 C  CG  . LEU A 1 169 ? 12.354  63.638  42.380 1.00 47.23 ? 274 LEU A CG  1 
ATOM   1275 C  CD1 . LEU A 1 169 ? 11.825  62.404  43.101 1.00 47.04 ? 274 LEU A CD1 1 
ATOM   1276 C  CD2 . LEU A 1 169 ? 13.876  63.677  42.427 1.00 47.16 ? 274 LEU A CD2 1 
ATOM   1277 N  N   . LEU A 1 170 ? 9.436   64.854  42.660 1.00 47.22 ? 275 LEU A N   1 
ATOM   1278 C  CA  . LEU A 1 170 ? 9.187   65.894  43.655 1.00 47.19 ? 275 LEU A CA  1 
ATOM   1279 C  C   . LEU A 1 170 ? 9.952   65.572  44.937 1.00 47.07 ? 275 LEU A C   1 
ATOM   1280 O  O   . LEU A 1 170 ? 9.775   64.515  45.528 1.00 46.96 ? 275 LEU A O   1 
ATOM   1281 C  CB  . LEU A 1 170 ? 7.692   66.029  43.944 1.00 47.12 ? 275 LEU A CB  1 
ATOM   1282 C  CG  . LEU A 1 170 ? 7.298   67.100  44.968 1.00 47.20 ? 275 LEU A CG  1 
ATOM   1283 C  CD1 . LEU A 1 170 ? 7.699   68.487  44.492 1.00 47.14 ? 275 LEU A CD1 1 
ATOM   1284 C  CD2 . LEU A 1 170 ? 5.806   67.050  45.246 1.00 47.40 ? 275 LEU A CD2 1 
ATOM   1285 N  N   . ILE A 1 171 ? 10.820  66.492  45.343 1.00 47.35 ? 276 ILE A N   1 
ATOM   1286 C  CA  . ILE A 1 171 ? 11.568  66.378  46.591 1.00 47.39 ? 276 ILE A CA  1 
ATOM   1287 C  C   . ILE A 1 171 ? 10.985  67.363  47.588 1.00 47.17 ? 276 ILE A C   1 
ATOM   1288 O  O   . ILE A 1 171 ? 10.730  68.512  47.243 1.00 47.17 ? 276 ILE A O   1 
ATOM   1289 C  CB  . ILE A 1 171 ? 13.060  66.750  46.414 1.00 47.52 ? 276 ILE A CB  1 
ATOM   1290 C  CG1 . ILE A 1 171 ? 13.695  65.969  45.259 1.00 48.01 ? 276 ILE A CG1 1 
ATOM   1291 C  CG2 . ILE A 1 171 ? 13.834  66.498  47.719 1.00 47.67 ? 276 ILE A CG2 1 
ATOM   1292 C  CD1 . ILE A 1 171 ? 14.971  66.611  44.719 1.00 47.87 ? 276 ILE A CD1 1 
ATOM   1293 N  N   . ALA A 1 172 ? 10.776  66.909  48.818 1.00 47.06 ? 277 ALA A N   1 
ATOM   1294 C  CA  . ALA A 1 172 ? 10.394  67.791  49.913 1.00 47.07 ? 277 ALA A CA  1 
ATOM   1295 C  C   . ALA A 1 172 ? 11.470  67.718  50.994 1.00 46.99 ? 277 ALA A C   1 
ATOM   1296 O  O   . ALA A 1 172 ? 12.133  66.698  51.147 1.00 46.77 ? 277 ALA A O   1 
ATOM   1297 C  CB  . ALA A 1 172 ? 9.045   67.397  50.462 1.00 47.01 ? 277 ALA A CB  1 
ATOM   1298 N  N   . GLY A 1 173 ? 11.652  68.812  51.724 1.00 47.07 ? 278 GLY A N   1 
ATOM   1299 C  CA  . GLY A 1 173 ? 12.714  68.914  52.714 1.00 47.25 ? 278 GLY A CA  1 
ATOM   1300 C  C   . GLY A 1 173 ? 12.224  69.454  54.042 1.00 47.34 ? 278 GLY A C   1 
ATOM   1301 O  O   . GLY A 1 173 ? 11.446  70.408  54.083 1.00 47.29 ? 278 GLY A O   1 
ATOM   1302 N  N   . THR A 1 174 ? 12.690  68.843  55.129 1.00 47.56 ? 279 THR A N   1 
ATOM   1303 C  CA  . THR A 1 174 ? 12.350  69.286  56.478 1.00 47.81 ? 279 THR A CA  1 
ATOM   1304 C  C   . THR A 1 174 ? 13.602  69.409  57.334 1.00 48.02 ? 279 THR A C   1 
ATOM   1305 O  O   . THR A 1 174 ? 14.627  68.786  57.048 1.00 48.04 ? 279 THR A O   1 
ATOM   1306 C  CB  . THR A 1 174 ? 11.360  68.331  57.176 1.00 47.77 ? 279 THR A CB  1 
ATOM   1307 O  OG1 . THR A 1 174 ? 11.061  68.830  58.487 1.00 47.51 ? 279 THR A OG1 1 
ATOM   1308 C  CG2 . THR A 1 174 ? 11.935  66.911  57.290 1.00 47.88 ? 279 THR A CG2 1 
ATOM   1309 N  N   . ASN A 1 175 ? 13.505  70.223  58.379 1.00 48.23 ? 280 ASN A N   1 
ATOM   1310 C  CA  . ASN A 1 175 ? 14.571  70.349  59.360 1.00 48.56 ? 280 ASN A CA  1 
ATOM   1311 C  C   . ASN A 1 175 ? 14.390  69.342  60.503 1.00 48.81 ? 280 ASN A C   1 
ATOM   1312 O  O   . ASN A 1 175 ? 15.297  69.151  61.312 1.00 48.91 ? 280 ASN A O   1 
ATOM   1313 C  CB  . ASN A 1 175 ? 14.629  71.783  59.908 1.00 48.63 ? 280 ASN A CB  1 
ATOM   1314 C  CG  . ASN A 1 175 ? 15.139  72.786  58.879 1.00 48.74 ? 280 ASN A CG  1 
ATOM   1315 O  OD1 . ASN A 1 175 ? 16.158  72.560  58.231 1.00 48.73 ? 280 ASN A OD1 1 
ATOM   1316 N  ND2 . ASN A 1 175 ? 14.436  73.906  58.737 1.00 49.04 ? 280 ASN A ND2 1 
ATOM   1317 N  N   . SER A 1 176 ? 13.228  68.693  60.563 1.00 49.05 ? 281 SER A N   1 
ATOM   1318 C  CA  . SER A 1 176 ? 12.941  67.749  61.639 1.00 49.38 ? 281 SER A CA  1 
ATOM   1319 C  C   . SER A 1 176 ? 13.759  66.474  61.503 1.00 49.66 ? 281 SER A C   1 
ATOM   1320 O  O   . SER A 1 176 ? 14.209  66.120  60.414 1.00 49.63 ? 281 SER A O   1 
ATOM   1321 C  CB  . SER A 1 176 ? 11.451  67.394  61.678 1.00 49.43 ? 281 SER A CB  1 
ATOM   1322 O  OG  . SER A 1 176 ? 11.164  66.503  62.744 1.00 48.92 ? 281 SER A OG  1 
ATOM   1323 N  N   . SER A 1 177 ? 13.953  65.802  62.633 1.00 50.09 ? 282 SER A N   1 
ATOM   1324 C  CA  . SER A 1 177 ? 14.629  64.509  62.669 1.00 50.38 ? 282 SER A CA  1 
ATOM   1325 C  C   . SER A 1 177 ? 13.808  63.436  63.397 1.00 50.67 ? 282 SER A C   1 
ATOM   1326 O  O   . SER A 1 177 ? 14.262  62.301  63.520 1.00 50.64 ? 282 SER A O   1 
ATOM   1327 C  CB  . SER A 1 177 ? 16.000  64.666  63.329 1.00 50.32 ? 282 SER A CB  1 
ATOM   1328 O  OG  . SER A 1 177 ? 15.880  65.208  64.632 1.00 50.36 ? 282 SER A OG  1 
ATOM   1329 N  N   . ASP A 1 178 ? 12.610  63.787  63.872 1.00 51.17 ? 283 ASP A N   1 
ATOM   1330 C  CA  . ASP A 1 178 ? 11.732  62.825  64.545 1.00 51.45 ? 283 ASP A CA  1 
ATOM   1331 C  C   . ASP A 1 178 ? 11.156  61.863  63.513 1.00 51.83 ? 283 ASP A C   1 
ATOM   1332 O  O   . ASP A 1 178 ? 10.674  62.286  62.460 1.00 51.86 ? 283 ASP A O   1 
ATOM   1333 C  CB  . ASP A 1 178 ? 10.596  63.538  65.288 1.00 51.39 ? 283 ASP A CB  1 
ATOM   1334 C  CG  . ASP A 1 178 ? 9.671   62.568  66.026 1.00 51.43 ? 283 ASP A CG  1 
ATOM   1335 O  OD1 . ASP A 1 178 ? 10.171  61.652  66.710 1.00 51.59 ? 283 ASP A OD1 1 
ATOM   1336 O  OD2 . ASP A 1 178 ? 8.435   62.729  65.931 1.00 51.79 ? 283 ASP A OD2 1 
ATOM   1337 N  N   . LEU A 1 179 ? 11.210  60.573  63.824 1.00 52.29 ? 284 LEU A N   1 
ATOM   1338 C  CA  . LEU A 1 179 ? 10.769  59.537  62.899 1.00 52.65 ? 284 LEU A CA  1 
ATOM   1339 C  C   . LEU A 1 179 ? 9.267   59.612  62.623 1.00 53.08 ? 284 LEU A C   1 
ATOM   1340 O  O   . LEU A 1 179 ? 8.839   59.507  61.471 1.00 53.04 ? 284 LEU A O   1 
ATOM   1341 C  CB  . LEU A 1 179 ? 11.126  58.160  63.459 1.00 52.66 ? 284 LEU A CB  1 
ATOM   1342 C  CG  . LEU A 1 179 ? 10.741  56.940  62.624 1.00 52.55 ? 284 LEU A CG  1 
ATOM   1343 C  CD1 . LEU A 1 179 ? 11.411  56.977  61.253 1.00 52.66 ? 284 LEU A CD1 1 
ATOM   1344 C  CD2 . LEU A 1 179 ? 11.111  55.680  63.380 1.00 52.56 ? 284 LEU A CD2 1 
ATOM   1345 N  N   . GLN A 1 180 ? 8.478   59.799  63.680 1.00 53.57 ? 285 GLN A N   1 
ATOM   1346 C  CA  . GLN A 1 180 ? 7.015   59.817  63.566 1.00 54.04 ? 285 GLN A CA  1 
ATOM   1347 C  C   . GLN A 1 180 ? 6.494   61.059  62.834 1.00 54.37 ? 285 GLN A C   1 
ATOM   1348 O  O   . GLN A 1 180 ? 5.462   60.991  62.164 1.00 54.31 ? 285 GLN A O   1 
ATOM   1349 C  CB  . GLN A 1 180 ? 6.347   59.711  64.945 1.00 54.16 ? 285 GLN A CB  1 
ATOM   1350 C  CG  . GLN A 1 180 ? 6.349   58.303  65.557 1.00 54.67 ? 285 GLN A CG  1 
ATOM   1351 C  CD  . GLN A 1 180 ? 7.684   57.896  66.180 1.00 55.40 ? 285 GLN A CD  1 
ATOM   1352 O  OE1 . GLN A 1 180 ? 8.048   56.719  66.170 1.00 55.86 ? 285 GLN A OE1 1 
ATOM   1353 N  NE2 . GLN A 1 180 ? 8.410   58.864  66.734 1.00 55.84 ? 285 GLN A NE2 1 
ATOM   1354 N  N   . GLN A 1 181 ? 7.194   62.186  62.976 1.00 54.88 ? 286 GLN A N   1 
ATOM   1355 C  CA  . GLN A 1 181 ? 6.874   63.396  62.208 1.00 55.26 ? 286 GLN A CA  1 
ATOM   1356 C  C   . GLN A 1 181 ? 7.192   63.202  60.718 1.00 55.56 ? 286 GLN A C   1 
ATOM   1357 O  O   . GLN A 1 181 ? 6.525   63.771  59.852 1.00 55.50 ? 286 GLN A O   1 
ATOM   1358 C  CB  . GLN A 1 181 ? 7.638   64.613  62.753 1.00 55.26 ? 286 GLN A CB  1 
ATOM   1359 C  CG  . GLN A 1 181 ? 7.190   65.956  62.153 1.00 55.31 ? 286 GLN A CG  1 
ATOM   1360 C  CD  . GLN A 1 181 ? 8.012   67.152  62.635 1.00 55.59 ? 286 GLN A CD  1 
ATOM   1361 O  OE1 . GLN A 1 181 ? 8.513   67.176  63.764 1.00 55.98 ? 286 GLN A OE1 1 
ATOM   1362 N  NE2 . GLN A 1 181 ? 8.143   68.160  61.774 1.00 55.70 ? 286 GLN A NE2 1 
ATOM   1363 N  N   . ILE A 1 182 ? 8.212   62.397  60.433 1.00 56.01 ? 287 ILE A N   1 
ATOM   1364 C  CA  . ILE A 1 182 ? 8.642   62.128  59.060 1.00 56.32 ? 287 ILE A CA  1 
ATOM   1365 C  C   . ILE A 1 182 ? 7.702   61.143  58.355 1.00 56.70 ? 287 ILE A C   1 
ATOM   1366 O  O   . ILE A 1 182 ? 7.356   61.340  57.185 1.00 56.61 ? 287 ILE A O   1 
ATOM   1367 C  CB  . ILE A 1 182 ? 10.110  61.614  59.030 1.00 56.29 ? 287 ILE A CB  1 
ATOM   1368 C  CG1 . ILE A 1 182 ? 11.069  62.777  59.295 1.00 56.22 ? 287 ILE A CG1 1 
ATOM   1369 C  CG2 . ILE A 1 182 ? 10.445  60.957  57.691 1.00 56.22 ? 287 ILE A CG2 1 
ATOM   1370 C  CD1 . ILE A 1 182 ? 12.459  62.356  59.689 1.00 56.23 ? 287 ILE A CD1 1 
ATOM   1371 N  N   . LEU A 1 183 ? 7.301   60.086  59.061 1.00 57.10 ? 288 LEU A N   1 
ATOM   1372 C  CA  . LEU A 1 183 ? 6.393   59.085  58.495 1.00 57.44 ? 288 LEU A CA  1 
ATOM   1373 C  C   . LEU A 1 183 ? 5.015   59.669  58.184 1.00 57.85 ? 288 LEU A C   1 
ATOM   1374 O  O   . LEU A 1 183 ? 4.397   59.298  57.183 1.00 57.86 ? 288 LEU A O   1 
ATOM   1375 C  CB  . LEU A 1 183 ? 6.248   57.886  59.435 1.00 57.36 ? 288 LEU A CB  1 
ATOM   1376 C  CG  . LEU A 1 183 ? 7.439   56.926  59.488 1.00 57.28 ? 288 LEU A CG  1 
ATOM   1377 C  CD1 . LEU A 1 183 ? 7.328   56.011  60.711 1.00 57.07 ? 288 LEU A CD1 1 
ATOM   1378 C  CD2 . LEU A 1 183 ? 7.552   56.107  58.201 1.00 56.81 ? 288 LEU A CD2 1 
ATOM   1379 N  N   . SER A 1 184 ? 4.543   60.580  59.035 1.00 58.39 ? 289 SER A N   1 
ATOM   1380 C  CA  . SER A 1 184 ? 3.238   61.226  58.844 1.00 58.85 ? 289 SER A CA  1 
ATOM   1381 C  C   . SER A 1 184 ? 3.193   62.071  57.565 1.00 59.20 ? 289 SER A C   1 
ATOM   1382 O  O   . SER A 1 184 ? 2.164   62.136  56.890 1.00 59.14 ? 289 SER A O   1 
ATOM   1383 C  CB  . SER A 1 184 ? 2.880   62.091  60.057 1.00 58.89 ? 289 SER A CB  1 
ATOM   1384 O  OG  . SER A 1 184 ? 3.750   63.205  60.163 1.00 59.14 ? 289 SER A OG  1 
ATOM   1385 N  N   . LEU A 1 185 ? 4.309   62.719  57.243 1.00 59.70 ? 290 LEU A N   1 
ATOM   1386 C  CA  . LEU A 1 185 ? 4.457   63.383  55.951 1.00 60.16 ? 290 LEU A CA  1 
ATOM   1387 C  C   . LEU A 1 185 ? 4.393   62.360  54.814 1.00 60.54 ? 290 LEU A C   1 
ATOM   1388 O  O   . LEU A 1 185 ? 3.746   62.603  53.802 1.00 60.61 ? 290 LEU A O   1 
ATOM   1389 C  CB  . LEU A 1 185 ? 5.777   64.155  55.888 1.00 60.18 ? 290 LEU A CB  1 
ATOM   1390 C  CG  . LEU A 1 185 ? 5.883   65.361  56.824 1.00 60.42 ? 290 LEU A CG  1 
ATOM   1391 C  CD1 . LEU A 1 185 ? 7.342   65.715  57.097 1.00 60.61 ? 290 LEU A CD1 1 
ATOM   1392 C  CD2 . LEU A 1 185 ? 5.123   66.557  56.251 1.00 60.44 ? 290 LEU A CD2 1 
ATOM   1393 N  N   . LEU A 1 186 ? 5.054   61.216  55.001 1.00 61.07 ? 291 LEU A N   1 
ATOM   1394 C  CA  . LEU A 1 186 ? 5.097   60.147  53.990 1.00 61.43 ? 291 LEU A CA  1 
ATOM   1395 C  C   . LEU A 1 186 ? 3.782   59.374  53.830 1.00 61.82 ? 291 LEU A C   1 
ATOM   1396 O  O   . LEU A 1 186 ? 3.541   58.772  52.778 1.00 61.84 ? 291 LEU A O   1 
ATOM   1397 C  CB  . LEU A 1 186 ? 6.222   59.150  54.307 1.00 61.50 ? 291 LEU A CB  1 
ATOM   1398 C  CG  . LEU A 1 186 ? 7.665   59.602  54.065 1.00 61.47 ? 291 LEU A CG  1 
ATOM   1399 C  CD1 . LEU A 1 186 ? 8.626   58.533  54.558 1.00 61.47 ? 291 LEU A CD1 1 
ATOM   1400 C  CD2 . LEU A 1 186 ? 7.915   59.908  52.592 1.00 61.37 ? 291 LEU A CD2 1 
ATOM   1401 N  N   . GLU A 1 187 ? 2.941   59.381  54.864 1.00 62.23 ? 292 GLU A N   1 
ATOM   1402 C  CA  . GLU A 1 187 ? 1.630   58.723  54.795 1.00 62.46 ? 292 GLU A CA  1 
ATOM   1403 C  C   . GLU A 1 187 ? 0.761   59.328  53.680 1.00 62.73 ? 292 GLU A C   1 
ATOM   1404 O  O   . GLU A 1 187 ? -0.211  58.714  53.243 1.00 62.72 ? 292 GLU A O   1 
ATOM   1405 C  CB  . GLU A 1 187 ? 0.908   58.821  56.147 1.00 62.52 ? 292 GLU A CB  1 
ATOM   1406 C  CG  . GLU A 1 187 ? -0.295  57.881  56.316 1.00 62.64 ? 292 GLU A CG  1 
ATOM   1407 C  CD  . GLU A 1 187 ? 0.088   56.407  56.433 1.00 63.37 ? 292 GLU A CD  1 
ATOM   1408 O  OE1 . GLU A 1 187 ? 1.282   56.098  56.638 1.00 63.70 ? 292 GLU A OE1 1 
ATOM   1409 O  OE2 . GLU A 1 187 ? -0.817  55.552  56.326 1.00 63.74 ? 292 GLU A OE2 1 
ATOM   1410 N  N   . SER A 1 188 ? 1.119   60.534  53.237 1.00 63.09 ? 293 SER A N   1 
ATOM   1411 C  CA  . SER A 1 188 ? 0.469   61.197  52.100 1.00 63.27 ? 293 SER A CA  1 
ATOM   1412 C  C   . SER A 1 188 ? 0.657   60.422  50.788 1.00 63.43 ? 293 SER A C   1 
ATOM   1413 O  O   . SER A 1 188 ? -0.221  59.656  50.383 1.00 63.50 ? 293 SER A O   1 
ATOM   1414 C  CB  . SER A 1 188 ? 1.004   62.634  51.952 1.00 63.32 ? 293 SER A CB  1 
ATOM   1415 O  OG  . SER A 1 188 ? 0.676   63.196  50.692 1.00 63.77 ? 293 SER A OG  1 
ATOM   1416 N  N   . ASN A 1 189 ? 1.802   60.628  50.140 1.00 63.54 ? 294 ASN A N   1 
ATOM   1417 C  CA  . ASN A 1 189 ? 2.092   60.023  48.849 1.00 63.52 ? 294 ASN A CA  1 
ATOM   1418 C  C   . ASN A 1 189 ? 3.444   59.319  48.929 1.00 63.53 ? 294 ASN A C   1 
ATOM   1419 O  O   . ASN A 1 189 ? 4.488   59.968  49.007 1.00 63.54 ? 294 ASN A O   1 
ATOM   1420 C  CB  . ASN A 1 189 ? 2.094   61.102  47.763 1.00 63.69 ? 294 ASN A CB  1 
ATOM   1421 C  CG  . ASN A 1 189 ? 1.824   60.541  46.378 1.00 63.95 ? 294 ASN A CG  1 
ATOM   1422 O  OD1 . ASN A 1 189 ? 0.902   60.989  45.690 1.00 64.90 ? 294 ASN A OD1 1 
ATOM   1423 N  ND2 . ASN A 1 189 ? 2.631   59.563  45.958 1.00 64.25 ? 294 ASN A ND2 1 
ATOM   1424 N  N   . LYS A 1 190 ? 3.419   57.989  48.901 1.00 63.49 ? 295 LYS A N   1 
ATOM   1425 C  CA  . LYS A 1 190 ? 4.590   57.194  49.268 1.00 63.31 ? 295 LYS A CA  1 
ATOM   1426 C  C   . LYS A 1 190 ? 5.728   57.215  48.239 1.00 63.17 ? 295 LYS A C   1 
ATOM   1427 O  O   . LYS A 1 190 ? 6.840   56.794  48.556 1.00 63.34 ? 295 LYS A O   1 
ATOM   1428 C  CB  . LYS A 1 190 ? 4.176   55.749  49.570 1.00 63.52 ? 295 LYS A CB  1 
ATOM   1429 C  CG  . LYS A 1 190 ? 5.106   55.016  50.530 1.00 63.79 ? 295 LYS A CG  1 
ATOM   1430 C  CD  . LYS A 1 190 ? 4.960   55.486  51.973 1.00 64.44 ? 295 LYS A CD  1 
ATOM   1431 C  CE  . LYS A 1 190 ? 5.796   54.618  52.916 1.00 64.52 ? 295 LYS A CE  1 
ATOM   1432 N  NZ  . LYS A 1 190 ? 5.493   54.872  54.353 1.00 64.43 ? 295 LYS A NZ  1 
ATOM   1433 N  N   . ASP A 1 191 ? 5.470   57.722  47.032 1.00 62.86 ? 296 ASP A N   1 
ATOM   1434 C  CA  . ASP A 1 191 ? 6.506   57.825  45.992 1.00 62.52 ? 296 ASP A CA  1 
ATOM   1435 C  C   . ASP A 1 191 ? 7.282   59.160  46.041 1.00 62.14 ? 296 ASP A C   1 
ATOM   1436 O  O   . ASP A 1 191 ? 7.963   59.525  45.078 1.00 61.89 ? 296 ASP A O   1 
ATOM   1437 C  CB  . ASP A 1 191 ? 5.869   57.635  44.605 1.00 62.66 ? 296 ASP A CB  1 
ATOM   1438 C  CG  . ASP A 1 191 ? 6.873   57.164  43.548 1.00 63.13 ? 296 ASP A CG  1 
ATOM   1439 O  OD1 . ASP A 1 191 ? 7.552   56.135  43.772 1.00 64.16 ? 296 ASP A OD1 1 
ATOM   1440 O  OD2 . ASP A 1 191 ? 6.977   57.817  42.485 1.00 63.51 ? 296 ASP A OD2 1 
ATOM   1441 N  N   . LEU A 1 192 ? 7.197   59.867  47.169 1.00 61.79 ? 297 LEU A N   1 
ATOM   1442 C  CA  . LEU A 1 192 ? 7.735   61.227  47.302 1.00 61.62 ? 297 LEU A CA  1 
ATOM   1443 C  C   . LEU A 1 192 ? 9.023   61.207  48.115 1.00 61.39 ? 297 LEU A C   1 
ATOM   1444 O  O   . LEU A 1 192 ? 9.045   60.654  49.211 1.00 61.63 ? 297 LEU A O   1 
ATOM   1445 C  CB  . LEU A 1 192 ? 6.685   62.117  47.977 1.00 61.57 ? 297 LEU A CB  1 
ATOM   1446 C  CG  . LEU A 1 192 ? 7.056   63.531  48.435 1.00 61.64 ? 297 LEU A CG  1 
ATOM   1447 C  CD1 . LEU A 1 192 ? 5.928   64.502  48.137 1.00 61.69 ? 297 LEU A CD1 1 
ATOM   1448 C  CD2 . LEU A 1 192 ? 7.393   63.566  49.922 1.00 61.50 ? 297 LEU A CD2 1 
ATOM   1449 N  N   . LEU A 1 193 ? 10.090  61.802  47.584 1.00 61.01 ? 298 LEU A N   1 
ATOM   1450 C  CA  . LEU A 1 193 ? 11.386  61.809  48.276 1.00 60.82 ? 298 LEU A CA  1 
ATOM   1451 C  C   . LEU A 1 193 ? 11.424  62.876  49.364 1.00 60.50 ? 298 LEU A C   1 
ATOM   1452 O  O   . LEU A 1 193 ? 10.995  64.007  49.143 1.00 60.44 ? 298 LEU A O   1 
ATOM   1453 C  CB  . LEU A 1 193 ? 12.544  62.053  47.301 1.00 60.94 ? 298 LEU A CB  1 
ATOM   1454 C  CG  . LEU A 1 193 ? 13.014  60.910  46.399 1.00 61.19 ? 298 LEU A CG  1 
ATOM   1455 C  CD1 . LEU A 1 193 ? 14.212  61.379  45.596 1.00 61.63 ? 298 LEU A CD1 1 
ATOM   1456 C  CD2 . LEU A 1 193 ? 13.375  59.672  47.193 1.00 61.34 ? 298 LEU A CD2 1 
ATOM   1457 N  N   . LEU A 1 194 ? 11.967  62.514  50.524 1.00 60.13 ? 299 LEU A N   1 
ATOM   1458 C  CA  . LEU A 1 194 ? 11.987  63.399  51.681 1.00 59.92 ? 299 LEU A CA  1 
ATOM   1459 C  C   . LEU A 1 194 ? 13.369  63.459  52.325 1.00 59.68 ? 299 LEU A C   1 
ATOM   1460 O  O   . LEU A 1 194 ? 13.841  62.468  52.882 1.00 59.92 ? 299 LEU A O   1 
ATOM   1461 C  CB  . LEU A 1 194 ? 10.966  62.923  52.712 1.00 59.94 ? 299 LEU A CB  1 
ATOM   1462 C  CG  . LEU A 1 194 ? 10.680  63.889  53.865 1.00 60.11 ? 299 LEU A CG  1 
ATOM   1463 C  CD1 . LEU A 1 194 ? 9.938   65.129  53.369 1.00 60.37 ? 299 LEU A CD1 1 
ATOM   1464 C  CD2 . LEU A 1 194 ? 9.879   63.193  54.945 1.00 60.04 ? 299 LEU A CD2 1 
ATOM   1465 N  N   . THR A 1 195 ? 14.002  64.629  52.255 1.00 59.29 ? 300 THR A N   1 
ATOM   1466 C  CA  . THR A 1 195 ? 15.294  64.865  52.899 1.00 58.97 ? 300 THR A CA  1 
ATOM   1467 C  C   . THR A 1 195 ? 15.080  65.446  54.294 1.00 58.64 ? 300 THR A C   1 
ATOM   1468 O  O   . THR A 1 195 ? 14.114  66.166  54.522 1.00 58.42 ? 300 THR A O   1 
ATOM   1469 C  CB  . THR A 1 195 ? 16.147  65.838  52.080 1.00 58.85 ? 300 THR A CB  1 
ATOM   1470 O  OG1 . THR A 1 195 ? 15.453  67.081  51.944 1.00 58.83 ? 300 THR A OG1 1 
ATOM   1471 C  CG2 . THR A 1 195 ? 16.429  65.272  50.702 1.00 58.80 ? 300 THR A CG2 1 
ATOM   1472 N  N   . SER A 1 196 ? 15.995  65.143  55.214 1.00 58.50 ? 301 SER A N   1 
ATOM   1473 C  CA  . SER A 1 196 ? 15.826  65.492  56.627 1.00 58.47 ? 301 SER A CA  1 
ATOM   1474 C  C   . SER A 1 196 ? 17.150  65.495  57.403 1.00 58.43 ? 301 SER A C   1 
ATOM   1475 O  O   . SER A 1 196 ? 18.217  65.245  56.834 1.00 58.33 ? 301 SER A O   1 
ATOM   1476 C  CB  . SER A 1 196 ? 14.838  64.515  57.278 1.00 58.45 ? 301 SER A CB  1 
ATOM   1477 O  OG  . SER A 1 196 ? 15.255  63.169  57.103 1.00 58.01 ? 301 SER A OG  1 
ATOM   1478 N  N   . SER A 1 197 ? 17.065  65.794  58.701 1.00 58.46 ? 302 SER A N   1 
ATOM   1479 C  CA  . SER A 1 197 ? 18.214  65.744  59.613 1.00 58.52 ? 302 SER A CA  1 
ATOM   1480 C  C   . SER A 1 197 ? 18.166  64.494  60.500 1.00 58.48 ? 302 SER A C   1 
ATOM   1481 O  O   . SER A 1 197 ? 18.707  64.481  61.610 1.00 58.40 ? 302 SER A O   1 
ATOM   1482 C  CB  . SER A 1 197 ? 18.254  67.007  60.483 1.00 58.58 ? 302 SER A CB  1 
ATOM   1483 O  OG  . SER A 1 197 ? 18.286  68.183  59.688 1.00 58.92 ? 302 SER A OG  1 
ATOM   1484 N  N   . TYR A 1 198 ? 17.530  63.444  59.984 1.00 58.48 ? 303 TYR A N   1 
ATOM   1485 C  CA  . TYR A 1 198 ? 17.322  62.183  60.699 1.00 58.59 ? 303 TYR A CA  1 
ATOM   1486 C  C   . TYR A 1 198 ? 18.629  61.517  61.111 1.00 58.73 ? 303 TYR A C   1 
ATOM   1487 O  O   . TYR A 1 198 ? 18.721  60.952  62.195 1.00 58.73 ? 303 TYR A O   1 
ATOM   1488 C  CB  . TYR A 1 198 ? 16.504  61.238  59.809 1.00 58.28 ? 303 TYR A CB  1 
ATOM   1489 C  CG  . TYR A 1 198 ? 16.227  59.868  60.382 1.00 58.17 ? 303 TYR A CG  1 
ATOM   1490 C  CD1 . TYR A 1 198 ? 16.762  58.726  59.791 1.00 57.71 ? 303 TYR A CD1 1 
ATOM   1491 C  CD2 . TYR A 1 198 ? 15.412  59.709  61.500 1.00 57.99 ? 303 TYR A CD2 1 
ATOM   1492 C  CE1 . TYR A 1 198 ? 16.502  57.465  60.304 1.00 57.95 ? 303 TYR A CE1 1 
ATOM   1493 C  CE2 . TYR A 1 198 ? 15.146  58.449  62.024 1.00 57.86 ? 303 TYR A CE2 1 
ATOM   1494 C  CZ  . TYR A 1 198 ? 15.694  57.332  61.422 1.00 57.99 ? 303 TYR A CZ  1 
ATOM   1495 O  OH  . TYR A 1 198 ? 15.436  56.083  61.936 1.00 57.90 ? 303 TYR A OH  1 
ATOM   1496 N  N   . LEU A 1 199 ? 19.636  61.589  60.245 1.00 59.17 ? 304 LEU A N   1 
ATOM   1497 C  CA  . LEU A 1 199 ? 20.933  60.959  60.506 1.00 59.50 ? 304 LEU A CA  1 
ATOM   1498 C  C   . LEU A 1 199 ? 21.895  61.812  61.341 1.00 59.88 ? 304 LEU A C   1 
ATOM   1499 O  O   . LEU A 1 199 ? 22.900  61.293  61.827 1.00 60.02 ? 304 LEU A O   1 
ATOM   1500 C  CB  . LEU A 1 199 ? 21.616  60.595  59.183 1.00 59.41 ? 304 LEU A CB  1 
ATOM   1501 C  CG  . LEU A 1 199 ? 20.965  59.501  58.338 1.00 59.26 ? 304 LEU A CG  1 
ATOM   1502 C  CD1 . LEU A 1 199 ? 21.794  59.264  57.089 1.00 59.07 ? 304 LEU A CD1 1 
ATOM   1503 C  CD2 . LEU A 1 199 ? 20.812  58.206  59.128 1.00 59.40 ? 304 LEU A CD2 1 
ATOM   1504 N  N   . SER A 1 200 ? 21.591  63.099  61.516 1.00 60.30 ? 305 SER A N   1 
ATOM   1505 C  CA  . SER A 1 200 ? 22.537  64.052  62.122 1.00 60.63 ? 305 SER A CA  1 
ATOM   1506 C  C   . SER A 1 200 ? 22.754  63.873  63.633 1.00 60.94 ? 305 SER A C   1 
ATOM   1507 O  O   . SER A 1 200 ? 22.004  64.409  64.451 1.00 61.01 ? 305 SER A O   1 
ATOM   1508 C  CB  . SER A 1 200 ? 22.092  65.485  61.828 1.00 60.71 ? 305 SER A CB  1 
ATOM   1509 O  OG  . SER A 1 200 ? 21.963  65.684  60.430 1.00 61.05 ? 305 SER A OG  1 
ATOM   1510 N  N   . ASP A 1 201 ? 23.798  63.119  63.980 1.00 61.33 ? 306 ASP A N   1 
ATOM   1511 C  CA  . ASP A 1 201 ? 24.214  62.906  65.369 1.00 61.51 ? 306 ASP A CA  1 
ATOM   1512 C  C   . ASP A 1 201 ? 25.656  62.375  65.405 1.00 61.79 ? 306 ASP A C   1 
ATOM   1513 O  O   . ASP A 1 201 ? 25.887  61.169  65.571 1.00 61.84 ? 306 ASP A O   1 
ATOM   1514 C  CB  . ASP A 1 201 ? 23.261  61.932  66.077 1.00 61.59 ? 306 ASP A CB  1 
ATOM   1515 C  CG  . ASP A 1 201 ? 23.726  61.559  67.485 1.00 61.65 ? 306 ASP A CG  1 
ATOM   1516 O  OD1 . ASP A 1 201 ? 24.389  62.387  68.152 1.00 61.72 ? 306 ASP A OD1 1 
ATOM   1517 O  OD2 . ASP A 1 201 ? 23.427  60.426  67.920 1.00 62.22 ? 306 ASP A OD2 1 
ATOM   1518 N  N   . SER A 1 202 ? 26.616  63.288  65.253 1.00 62.00 ? 307 SER A N   1 
ATOM   1519 C  CA  . SER A 1 202 ? 28.042  62.939  65.179 1.00 62.09 ? 307 SER A CA  1 
ATOM   1520 C  C   . SER A 1 202 ? 28.693  62.818  66.568 1.00 62.27 ? 307 SER A C   1 
ATOM   1521 O  O   . SER A 1 202 ? 27.994  62.768  67.592 1.00 62.35 ? 307 SER A O   1 
ATOM   1522 C  CB  . SER A 1 202 ? 28.789  63.979  64.336 1.00 62.18 ? 307 SER A CB  1 
ATOM   1523 O  OG  . SER A 1 202 ? 29.088  65.145  65.090 1.00 62.37 ? 307 SER A OG  1 
ATOM   1524 N  N   . GLY A 1 203 ? 30.029  62.762  66.589 1.00 62.28 ? 308 GLY A N   1 
ATOM   1525 C  CA  . GLY A 1 203 ? 30.794  62.676  67.833 1.00 62.22 ? 308 GLY A CA  1 
ATOM   1526 C  C   . GLY A 1 203 ? 30.480  61.396  68.580 1.00 62.26 ? 308 GLY A C   1 
ATOM   1527 O  O   . GLY A 1 203 ? 31.024  60.336  68.264 1.00 62.37 ? 308 GLY A O   1 
ATOM   1528 N  N   . SER A 1 204 ? 29.589  61.498  69.565 1.00 62.17 ? 309 SER A N   1 
ATOM   1529 C  CA  . SER A 1 204 ? 29.087  60.328  70.287 1.00 62.05 ? 309 SER A CA  1 
ATOM   1530 C  C   . SER A 1 204 ? 28.118  59.571  69.366 1.00 61.98 ? 309 SER A C   1 
ATOM   1531 O  O   . SER A 1 204 ? 27.046  60.087  69.030 1.00 61.98 ? 309 SER A O   1 
ATOM   1532 C  CB  . SER A 1 204 ? 28.398  60.763  71.589 1.00 62.07 ? 309 SER A CB  1 
ATOM   1533 O  OG  . SER A 1 204 ? 28.335  59.701  72.525 1.00 62.21 ? 309 SER A OG  1 
ATOM   1534 N  N   . THR A 1 205 ? 28.507  58.364  68.942 1.00 61.81 ? 310 THR A N   1 
ATOM   1535 C  CA  . THR A 1 205 ? 27.756  57.619  67.918 1.00 61.66 ? 310 THR A CA  1 
ATOM   1536 C  C   . THR A 1 205 ? 27.640  56.111  68.214 1.00 61.56 ? 310 THR A C   1 
ATOM   1537 O  O   . THR A 1 205 ? 26.579  55.645  68.642 1.00 61.63 ? 310 THR A O   1 
ATOM   1538 C  CB  . THR A 1 205 ? 28.369  57.840  66.504 1.00 61.66 ? 310 THR A CB  1 
ATOM   1539 O  OG1 . THR A 1 205 ? 28.634  59.236  66.306 1.00 61.60 ? 310 THR A OG1 1 
ATOM   1540 C  CG2 . THR A 1 205 ? 27.425  57.347  65.416 1.00 61.61 ? 310 THR A CG2 1 
ATOM   1541 N  N   . GLY A 1 206 ? 28.721  55.357  67.998 1.00 61.31 ? 311 GLY A N   1 
ATOM   1542 C  CA  . GLY A 1 206 ? 28.677  53.891  68.074 1.00 61.04 ? 311 GLY A CA  1 
ATOM   1543 C  C   . GLY A 1 206 ? 27.831  53.309  66.953 1.00 60.85 ? 311 GLY A C   1 
ATOM   1544 O  O   . GLY A 1 206 ? 27.773  53.878  65.859 1.00 60.87 ? 311 GLY A O   1 
ATOM   1545 N  N   . GLU A 1 207 ? 27.161  52.186  67.220 1.00 60.56 ? 312 GLU A N   1 
ATOM   1546 C  CA  . GLU A 1 207 ? 26.223  51.598  66.246 1.00 60.23 ? 312 GLU A CA  1 
ATOM   1547 C  C   . GLU A 1 207 ? 24.781  52.102  66.434 1.00 59.85 ? 312 GLU A C   1 
ATOM   1548 O  O   . GLU A 1 207 ? 23.811  51.370  66.202 1.00 59.77 ? 312 GLU A O   1 
ATOM   1549 C  CB  . GLU A 1 207 ? 26.271  50.066  66.275 1.00 60.26 ? 312 GLU A CB  1 
ATOM   1550 C  CG  . GLU A 1 207 ? 25.741  49.416  67.548 1.00 60.43 ? 312 GLU A CG  1 
ATOM   1551 C  CD  . GLU A 1 207 ? 25.529  47.926  67.385 1.00 60.55 ? 312 GLU A CD  1 
ATOM   1552 O  OE1 . GLU A 1 207 ? 26.150  47.333  66.473 1.00 60.94 ? 312 GLU A OE1 1 
ATOM   1553 O  OE2 . GLU A 1 207 ? 24.742  47.348  68.169 1.00 60.71 ? 312 GLU A OE2 1 
ATOM   1554 N  N   . HIS A 1 208 ? 24.651  53.354  66.857 1.00 59.36 ? 313 HIS A N   1 
ATOM   1555 C  CA  . HIS A 1 208 ? 23.374  54.050  66.833 1.00 59.01 ? 313 HIS A CA  1 
ATOM   1556 C  C   . HIS A 1 208 ? 22.911  54.203  65.379 1.00 58.62 ? 313 HIS A C   1 
ATOM   1557 O  O   . HIS A 1 208 ? 21.728  54.043  65.080 1.00 58.57 ? 313 HIS A O   1 
ATOM   1558 C  CB  . HIS A 1 208 ? 23.524  55.422  67.503 1.00 59.13 ? 313 HIS A CB  1 
ATOM   1559 C  CG  . HIS A 1 208 ? 22.247  56.196  67.605 1.00 59.42 ? 313 HIS A CG  1 
ATOM   1560 N  ND1 . HIS A 1 208 ? 21.355  56.029  68.644 1.00 59.84 ? 313 HIS A ND1 1 
ATOM   1561 C  CD2 . HIS A 1 208 ? 21.719  57.153  66.806 1.00 59.84 ? 313 HIS A CD2 1 
ATOM   1562 C  CE1 . HIS A 1 208 ? 20.329  56.844  68.476 1.00 59.90 ? 313 HIS A CE1 1 
ATOM   1563 N  NE2 . HIS A 1 208 ? 20.525  57.537  67.368 1.00 60.23 ? 313 HIS A NE2 1 
ATOM   1564 N  N   . THR A 1 209 ? 23.862  54.490  64.486 1.00 58.08 ? 314 THR A N   1 
ATOM   1565 C  CA  . THR A 1 209 ? 23.588  54.712  63.062 1.00 57.66 ? 314 THR A CA  1 
ATOM   1566 C  C   . THR A 1 209 ? 23.024  53.482  62.348 1.00 57.24 ? 314 THR A C   1 
ATOM   1567 O  O   . THR A 1 209 ? 22.108  53.605  61.535 1.00 57.13 ? 314 THR A O   1 
ATOM   1568 C  CB  . THR A 1 209 ? 24.863  55.167  62.333 1.00 57.71 ? 314 THR A CB  1 
ATOM   1569 O  OG1 . THR A 1 209 ? 25.362  56.356  62.956 1.00 57.85 ? 314 THR A OG1 1 
ATOM   1570 C  CG2 . THR A 1 209 ? 24.589  55.445  60.853 1.00 57.95 ? 314 THR A CG2 1 
ATOM   1571 N  N   . LYS A 1 210 ? 23.574  52.306  62.645 1.00 56.72 ? 315 LYS A N   1 
ATOM   1572 C  CA  . LYS A 1 210 ? 23.077  51.051  62.074 1.00 56.42 ? 315 LYS A CA  1 
ATOM   1573 C  C   . LYS A 1 210 ? 21.575  50.867  62.319 1.00 56.07 ? 315 LYS A C   1 
ATOM   1574 O  O   . LYS A 1 210 ? 20.832  50.494  61.408 1.00 56.07 ? 315 LYS A O   1 
ATOM   1575 C  CB  . LYS A 1 210 ? 23.851  49.855  62.645 1.00 56.37 ? 315 LYS A CB  1 
ATOM   1576 C  CG  . LYS A 1 210 ? 23.246  48.493  62.306 1.00 56.48 ? 315 LYS A CG  1 
ATOM   1577 C  CD  . LYS A 1 210 ? 23.978  47.361  63.004 1.00 56.40 ? 315 LYS A CD  1 
ATOM   1578 C  CE  . LYS A 1 210 ? 23.124  46.101  63.065 1.00 56.14 ? 315 LYS A CE  1 
ATOM   1579 N  NZ  . LYS A 1 210 ? 23.705  45.093  63.992 1.00 56.27 ? 315 LYS A NZ  1 
ATOM   1580 N  N   . SER A 1 211 ? 21.136  51.124  63.547 1.00 55.65 ? 316 SER A N   1 
ATOM   1581 C  CA  . SER A 1 211 ? 19.729  50.962  63.891 1.00 55.40 ? 316 SER A CA  1 
ATOM   1582 C  C   . SER A 1 211 ? 18.879  52.018  63.196 1.00 55.11 ? 316 SER A C   1 
ATOM   1583 O  O   . SER A 1 211 ? 17.840  51.694  62.624 1.00 55.21 ? 316 SER A O   1 
ATOM   1584 C  CB  . SER A 1 211 ? 19.514  51.033  65.403 1.00 55.47 ? 316 SER A CB  1 
ATOM   1585 O  OG  . SER A 1 211 ? 19.331  52.369  65.830 1.00 55.79 ? 316 SER A OG  1 
ATOM   1586 N  N   . LEU A 1 212 ? 19.324  53.273  63.242 1.00 54.68 ? 317 LEU A N   1 
ATOM   1587 C  CA  . LEU A 1 212 ? 18.587  54.379  62.619 1.00 54.40 ? 317 LEU A CA  1 
ATOM   1588 C  C   . LEU A 1 212 ? 18.140  54.050  61.195 1.00 54.15 ? 317 LEU A C   1 
ATOM   1589 O  O   . LEU A 1 212 ? 16.992  54.305  60.826 1.00 54.06 ? 317 LEU A O   1 
ATOM   1590 C  CB  . LEU A 1 212 ? 19.427  55.664  62.605 1.00 54.32 ? 317 LEU A CB  1 
ATOM   1591 C  CG  . LEU A 1 212 ? 19.564  56.468  63.904 1.00 54.15 ? 317 LEU A CG  1 
ATOM   1592 C  CD1 . LEU A 1 212 ? 20.493  57.659  63.678 1.00 53.88 ? 317 LEU A CD1 1 
ATOM   1593 C  CD2 . LEU A 1 212 ? 18.209  56.937  64.431 1.00 53.85 ? 317 LEU A CD2 1 
ATOM   1594 N  N   . VAL A 1 213 ? 19.044  53.467  60.411 1.00 53.90 ? 318 VAL A N   1 
ATOM   1595 C  CA  . VAL A 1 213 ? 18.778  53.162  59.005 1.00 53.81 ? 318 VAL A CA  1 
ATOM   1596 C  C   . VAL A 1 213 ? 17.846  51.959  58.841 1.00 53.66 ? 318 VAL A C   1 
ATOM   1597 O  O   . VAL A 1 213 ? 16.909  52.007  58.046 1.00 53.53 ? 318 VAL A O   1 
ATOM   1598 C  CB  . VAL A 1 213 ? 20.090  52.921  58.225 1.00 53.76 ? 318 VAL A CB  1 
ATOM   1599 C  CG1 . VAL A 1 213 ? 19.801  52.518  56.778 1.00 53.61 ? 318 VAL A CG1 1 
ATOM   1600 C  CG2 . VAL A 1 213 ? 20.970  54.168  58.275 1.00 53.80 ? 318 VAL A CG2 1 
ATOM   1601 N  N   . THR A 1 214 ? 18.105  50.884  59.581 1.00 53.66 ? 319 THR A N   1 
ATOM   1602 C  CA  . THR A 1 214 ? 17.244  49.697  59.527 1.00 53.69 ? 319 THR A CA  1 
ATOM   1603 C  C   . THR A 1 214 ? 15.858  49.977  60.102 1.00 53.62 ? 319 THR A C   1 
ATOM   1604 O  O   . THR A 1 214 ? 14.875  49.418  59.630 1.00 53.56 ? 319 THR A O   1 
ATOM   1605 C  CB  . THR A 1 214 ? 17.857  48.478  60.257 1.00 53.66 ? 319 THR A CB  1 
ATOM   1606 O  OG1 . THR A 1 214 ? 18.339  48.872  61.545 1.00 53.63 ? 319 THR A OG1 1 
ATOM   1607 C  CG2 . THR A 1 214 ? 19.000  47.894  59.448 1.00 53.74 ? 319 THR A CG2 1 
ATOM   1608 N  N   . GLN A 1 215 ? 15.784  50.841  61.112 1.00 53.65 ? 320 GLN A N   1 
ATOM   1609 C  CA  . GLN A 1 215 ? 14.496  51.268  61.673 1.00 53.75 ? 320 GLN A CA  1 
ATOM   1610 C  C   . GLN A 1 215 ? 13.659  52.036  60.648 1.00 53.61 ? 320 GLN A C   1 
ATOM   1611 O  O   . GLN A 1 215 ? 12.445  51.853  60.571 1.00 53.47 ? 320 GLN A O   1 
ATOM   1612 C  CB  . GLN A 1 215 ? 14.702  52.126  62.929 1.00 53.75 ? 320 GLN A CB  1 
ATOM   1613 C  CG  . GLN A 1 215 ? 15.095  51.322  64.166 1.00 54.16 ? 320 GLN A CG  1 
ATOM   1614 C  CD  . GLN A 1 215 ? 15.360  52.199  65.381 1.00 54.29 ? 320 GLN A CD  1 
ATOM   1615 O  OE1 . GLN A 1 215 ? 14.556  53.067  65.717 1.00 55.39 ? 320 GLN A OE1 1 
ATOM   1616 N  NE2 . GLN A 1 215 ? 16.487  51.967  66.051 1.00 54.56 ? 320 GLN A NE2 1 
ATOM   1617 N  N   . TYR A 1 216 ? 14.315  52.889  59.863 1.00 53.60 ? 321 TYR A N   1 
ATOM   1618 C  CA  . TYR A 1 216 ? 13.634  53.668  58.829 1.00 53.55 ? 321 TYR A CA  1 
ATOM   1619 C  C   . TYR A 1 216 ? 13.167  52.780  57.681 1.00 53.45 ? 321 TYR A C   1 
ATOM   1620 O  O   . TYR A 1 216 ? 12.038  52.913  57.207 1.00 53.44 ? 321 TYR A O   1 
ATOM   1621 C  CB  . TYR A 1 216 ? 14.548  54.768  58.288 1.00 53.67 ? 321 TYR A CB  1 
ATOM   1622 C  CG  . TYR A 1 216 ? 13.885  55.631  57.245 1.00 53.53 ? 321 TYR A CG  1 
ATOM   1623 C  CD1 . TYR A 1 216 ? 13.185  56.775  57.608 1.00 53.73 ? 321 TYR A CD1 1 
ATOM   1624 C  CD2 . TYR A 1 216 ? 13.946  55.295  55.899 1.00 53.54 ? 321 TYR A CD2 1 
ATOM   1625 C  CE1 . TYR A 1 216 ? 12.567  57.573  56.654 1.00 53.98 ? 321 TYR A CE1 1 
ATOM   1626 C  CE2 . TYR A 1 216 ? 13.331  56.079  54.935 1.00 53.88 ? 321 TYR A CE2 1 
ATOM   1627 C  CZ  . TYR A 1 216 ? 12.645  57.220  55.316 1.00 54.02 ? 321 TYR A CZ  1 
ATOM   1628 O  OH  . TYR A 1 216 ? 12.037  58.006  54.361 1.00 53.82 ? 321 TYR A OH  1 
ATOM   1629 N  N   . LEU A 1 217 ? 14.048  51.892  57.228 1.00 53.30 ? 322 LEU A N   1 
ATOM   1630 C  CA  . LEU A 1 217 ? 13.693  50.916  56.201 1.00 53.25 ? 322 LEU A CA  1 
ATOM   1631 C  C   . LEU A 1 217 ? 12.607  49.963  56.709 1.00 53.25 ? 322 LEU A C   1 
ATOM   1632 O  O   . LEU A 1 217 ? 11.737  49.542  55.941 1.00 53.07 ? 322 LEU A O   1 
ATOM   1633 C  CB  . LEU A 1 217 ? 14.930  50.131  55.737 1.00 53.13 ? 322 LEU A CB  1 
ATOM   1634 C  CG  . LEU A 1 217 ? 15.915  50.873  54.819 1.00 52.64 ? 322 LEU A CG  1 
ATOM   1635 C  CD1 . LEU A 1 217 ? 17.161  50.039  54.577 1.00 52.05 ? 322 LEU A CD1 1 
ATOM   1636 C  CD2 . LEU A 1 217 ? 15.265  51.250  53.487 1.00 52.25 ? 322 LEU A CD2 1 
ATOM   1637 N  N   . ASN A 1 218 ? 12.661  49.647  58.003 1.00 53.32 ? 323 ASN A N   1 
ATOM   1638 C  CA  . ASN A 1 218 ? 11.674  48.778  58.649 1.00 53.42 ? 323 ASN A CA  1 
ATOM   1639 C  C   . ASN A 1 218 ? 10.273  49.377  58.593 1.00 53.49 ? 323 ASN A C   1 
ATOM   1640 O  O   . ASN A 1 218 ? 9.314   48.690  58.249 1.00 53.62 ? 323 ASN A O   1 
ATOM   1641 C  CB  . ASN A 1 218 ? 12.051  48.531  60.119 1.00 53.42 ? 323 ASN A CB  1 
ATOM   1642 C  CG  . ASN A 1 218 ? 11.846  47.095  60.545 1.00 53.45 ? 323 ASN A CG  1 
ATOM   1643 O  OD1 . ASN A 1 218 ? 12.801  46.403  60.896 1.00 53.32 ? 323 ASN A OD1 1 
ATOM   1644 N  ND2 . ASN A 1 218 ? 10.601  46.637  60.515 1.00 53.65 ? 323 ASN A ND2 1 
ATOM   1645 N  N   . ALA A 1 219 ? 10.169  50.659  58.930 1.00 53.57 ? 324 ALA A N   1 
ATOM   1646 C  CA  . ALA A 1 219 ? 8.877   51.338  59.032 1.00 53.69 ? 324 ALA A CA  1 
ATOM   1647 C  C   . ALA A 1 219 ? 8.263   51.663  57.672 1.00 53.80 ? 324 ALA A C   1 
ATOM   1648 O  O   . ALA A 1 219 ? 7.048   51.615  57.515 1.00 53.86 ? 324 ALA A O   1 
ATOM   1649 C  CB  . ALA A 1 219 ? 9.018   52.610  59.854 1.00 53.63 ? 324 ALA A CB  1 
ATOM   1650 N  N   . THR A 1 220 ? 9.101   51.992  56.694 1.00 53.99 ? 325 THR A N   1 
ATOM   1651 C  CA  . THR A 1 220 ? 8.624   52.469  55.396 1.00 54.12 ? 325 THR A CA  1 
ATOM   1652 C  C   . THR A 1 220 ? 8.279   51.349  54.398 1.00 54.31 ? 325 THR A C   1 
ATOM   1653 O  O   . THR A 1 220 ? 7.872   51.633  53.268 1.00 54.29 ? 325 THR A O   1 
ATOM   1654 C  CB  . THR A 1 220 ? 9.660   53.410  54.758 1.00 54.07 ? 325 THR A CB  1 
ATOM   1655 O  OG1 . THR A 1 220 ? 10.934  52.760  54.714 1.00 54.10 ? 325 THR A OG1 1 
ATOM   1656 C  CG2 . THR A 1 220 ? 9.784   54.687  55.567 1.00 54.22 ? 325 THR A CG2 1 
ATOM   1657 N  N   . GLY A 1 221 ? 8.425   50.089  54.814 1.00 54.41 ? 326 GLY A N   1 
ATOM   1658 C  CA  . GLY A 1 221 ? 8.192   48.946  53.929 1.00 54.43 ? 326 GLY A CA  1 
ATOM   1659 C  C   . GLY A 1 221 ? 9.274   48.810  52.868 1.00 54.60 ? 326 GLY A C   1 
ATOM   1660 O  O   . GLY A 1 221 ? 9.038   48.249  51.791 1.00 54.76 ? 326 GLY A O   1 
ATOM   1661 N  N   . ASN A 1 222 ? 10.463  49.327  53.175 1.00 54.57 ? 327 ASN A N   1 
ATOM   1662 C  CA  . ASN A 1 222 ? 11.592  49.325  52.249 1.00 54.53 ? 327 ASN A CA  1 
ATOM   1663 C  C   . ASN A 1 222 ? 11.260  49.925  50.879 1.00 54.47 ? 327 ASN A C   1 
ATOM   1664 O  O   . ASN A 1 222 ? 11.640  49.374  49.849 1.00 54.61 ? 327 ASN A O   1 
ATOM   1665 C  CB  . ASN A 1 222 ? 12.160  47.908  52.090 1.00 54.59 ? 327 ASN A CB  1 
ATOM   1666 C  CG  . ASN A 1 222 ? 12.556  47.285  53.416 1.00 55.08 ? 327 ASN A CG  1 
ATOM   1667 O  OD1 . ASN A 1 222 ? 13.737  47.222  53.758 1.00 55.67 ? 327 ASN A OD1 1 
ATOM   1668 N  ND2 . ASN A 1 222 ? 11.566  46.830  54.176 1.00 55.71 ? 327 ASN A ND2 1 
ATOM   1669 N  N   . ARG A 1 223 ? 10.550  51.051  50.867 1.00 54.36 ? 328 ARG A N   1 
ATOM   1670 C  CA  . ARG A 1 223 ? 10.317  51.779  49.620 1.00 54.32 ? 328 ARG A CA  1 
ATOM   1671 C  C   . ARG A 1 223 ? 11.539  52.633  49.286 1.00 54.05 ? 328 ARG A C   1 
ATOM   1672 O  O   . ARG A 1 223 ? 12.352  52.942  50.159 1.00 54.08 ? 328 ARG A O   1 
ATOM   1673 C  CB  . ARG A 1 223 ? 9.063   52.656  49.702 1.00 54.34 ? 328 ARG A CB  1 
ATOM   1674 C  CG  . ARG A 1 223 ? 7.801   51.887  50.072 1.00 55.00 ? 328 ARG A CG  1 
ATOM   1675 C  CD  . ARG A 1 223 ? 6.593   52.245  49.199 1.00 55.15 ? 328 ARG A CD  1 
ATOM   1676 N  NE  . ARG A 1 223 ? 5.345   51.673  49.727 1.00 55.67 ? 328 ARG A NE  1 
ATOM   1677 C  CZ  . ARG A 1 223 ? 4.142   51.782  49.152 1.00 56.00 ? 328 ARG A CZ  1 
ATOM   1678 N  NH1 . ARG A 1 223 ? 3.990   52.452  48.010 1.00 56.29 ? 328 ARG A NH1 1 
ATOM   1679 N  NH2 . ARG A 1 223 ? 3.078   51.219  49.724 1.00 56.03 ? 328 ARG A NH2 1 
ATOM   1680 N  N   . TRP A 1 224 ? 11.664  53.002  48.015 1.00 53.64 ? 329 TRP A N   1 
ATOM   1681 C  CA  . TRP A 1 224 ? 12.729  53.886  47.564 1.00 53.46 ? 329 TRP A CA  1 
ATOM   1682 C  C   . TRP A 1 224 ? 12.652  55.213  48.315 1.00 53.23 ? 329 TRP A C   1 
ATOM   1683 O  O   . TRP A 1 224 ? 11.559  55.720  48.574 1.00 53.31 ? 329 TRP A O   1 
ATOM   1684 C  CB  . TRP A 1 224 ? 12.616  54.131  46.056 1.00 53.43 ? 329 TRP A CB  1 
ATOM   1685 C  CG  . TRP A 1 224 ? 13.805  54.821  45.465 1.00 53.40 ? 329 TRP A CG  1 
ATOM   1686 C  CD1 . TRP A 1 224 ? 13.954  56.158  45.252 1.00 53.33 ? 329 TRP A CD1 1 
ATOM   1687 C  CD2 . TRP A 1 224 ? 15.013  54.203  45.004 1.00 53.31 ? 329 TRP A CD2 1 
ATOM   1688 N  NE1 . TRP A 1 224 ? 15.180  56.416  44.688 1.00 53.44 ? 329 TRP A NE1 1 
ATOM   1689 C  CE2 . TRP A 1 224 ? 15.851  55.232  44.523 1.00 53.46 ? 329 TRP A CE2 1 
ATOM   1690 C  CE3 . TRP A 1 224 ? 15.468  52.880  44.950 1.00 53.09 ? 329 TRP A CE3 1 
ATOM   1691 C  CZ2 . TRP A 1 224 ? 17.122  54.981  44.004 1.00 53.27 ? 329 TRP A CZ2 1 
ATOM   1692 C  CZ3 . TRP A 1 224 ? 16.725  52.631  44.432 1.00 53.24 ? 329 TRP A CZ3 1 
ATOM   1693 C  CH2 . TRP A 1 224 ? 17.538  53.677  43.964 1.00 53.25 ? 329 TRP A CH2 1 
ATOM   1694 N  N   . CYS A 1 225 ? 13.813  55.763  48.663 1.00 52.91 ? 330 CYS A N   1 
ATOM   1695 C  CA  . CYS A 1 225 ? 13.886  56.992  49.458 1.00 52.68 ? 330 CYS A CA  1 
ATOM   1696 C  C   . CYS A 1 225 ? 15.227  57.712  49.255 1.00 52.39 ? 330 CYS A C   1 
ATOM   1697 O  O   . CYS A 1 225 ? 16.027  57.315  48.398 1.00 52.48 ? 330 CYS A O   1 
ATOM   1698 C  CB  . CYS A 1 225 ? 13.684  56.659  50.936 1.00 52.72 ? 330 CYS A CB  1 
ATOM   1699 S  SG  . CYS A 1 225 ? 15.042  55.726  51.637 1.00 52.87 ? 330 CYS A SG  1 
ATOM   1700 N  N   . SER A 1 226 ? 15.458  58.772  50.030 1.00 51.87 ? 331 SER A N   1 
ATOM   1701 C  CA  . SER A 1 226 ? 16.677  59.564  49.914 1.00 51.61 ? 331 SER A CA  1 
ATOM   1702 C  C   . SER A 1 226 ? 17.541  59.466  51.164 1.00 51.35 ? 331 SER A C   1 
ATOM   1703 O  O   . SER A 1 226 ? 17.049  59.152  52.248 1.00 51.25 ? 331 SER A O   1 
ATOM   1704 C  CB  . SER A 1 226 ? 16.341  61.032  49.627 1.00 51.53 ? 331 SER A CB  1 
ATOM   1705 O  OG  . SER A 1 226 ? 15.755  61.666  50.747 1.00 51.32 ? 331 SER A OG  1 
ATOM   1706 N  N   . TRP A 1 227 ? 18.834  59.741  50.994 1.00 51.13 ? 332 TRP A N   1 
ATOM   1707 C  CA  . TRP A 1 227 ? 19.797  59.740  52.092 1.00 50.88 ? 332 TRP A CA  1 
ATOM   1708 C  C   . TRP A 1 227 ? 20.633  61.022  52.109 1.00 50.67 ? 332 TRP A C   1 
ATOM   1709 O  O   . TRP A 1 227 ? 21.331  61.335  51.147 1.00 50.56 ? 332 TRP A O   1 
ATOM   1710 C  CB  . TRP A 1 227 ? 20.718  58.530  51.987 1.00 50.87 ? 332 TRP A CB  1 
ATOM   1711 C  CG  . TRP A 1 227 ? 20.022  57.225  52.182 1.00 50.84 ? 332 TRP A CG  1 
ATOM   1712 C  CD1 . TRP A 1 227 ? 19.880  56.231  51.263 1.00 50.94 ? 332 TRP A CD1 1 
ATOM   1713 C  CD2 . TRP A 1 227 ? 19.367  56.770  53.373 1.00 50.63 ? 332 TRP A CD2 1 
ATOM   1714 N  NE1 . TRP A 1 227 ? 19.181  55.183  51.807 1.00 50.95 ? 332 TRP A NE1 1 
ATOM   1715 C  CE2 . TRP A 1 227 ? 18.855  55.488  53.101 1.00 50.70 ? 332 TRP A CE2 1 
ATOM   1716 C  CE3 . TRP A 1 227 ? 19.167  57.322  54.643 1.00 50.90 ? 332 TRP A CE3 1 
ATOM   1717 C  CZ2 . TRP A 1 227 ? 18.158  54.743  54.053 1.00 50.78 ? 332 TRP A CZ2 1 
ATOM   1718 C  CZ3 . TRP A 1 227 ? 18.472  56.583  55.590 1.00 50.85 ? 332 TRP A CZ3 1 
ATOM   1719 C  CH2 . TRP A 1 227 ? 17.974  55.309  55.287 1.00 51.00 ? 332 TRP A CH2 1 
ATOM   1720 N  N   . SER A 1 228 ? 20.554  61.750  53.216 1.00 50.54 ? 333 SER A N   1 
ATOM   1721 C  CA  . SER A 1 228 ? 21.307  62.980  53.402 1.00 50.41 ? 333 SER A CA  1 
ATOM   1722 C  C   . SER A 1 228 ? 21.479  63.261  54.894 1.00 50.30 ? 333 SER A C   1 
ATOM   1723 O  O   . SER A 1 228 ? 20.986  62.509  55.730 1.00 50.26 ? 333 SER A O   1 
ATOM   1724 C  CB  . SER A 1 228 ? 20.585  64.145  52.719 1.00 50.45 ? 333 SER A CB  1 
ATOM   1725 O  OG  . SER A 1 228 ? 19.298  64.359  53.276 1.00 50.30 ? 333 SER A OG  1 
ATOM   1726 N  N   . LEU A 1 229 ? 22.200  64.330  55.218 1.00 50.28 ? 334 LEU A N   1 
ATOM   1727 C  CA  . LEU A 1 229 ? 22.313  64.804  56.601 1.00 50.27 ? 334 LEU A CA  1 
ATOM   1728 C  C   . LEU A 1 229 ? 21.417  66.022  56.847 1.00 50.26 ? 334 LEU A C   1 
ATOM   1729 O  O   . LEU A 1 229 ? 21.225  66.420  57.995 1.00 50.58 ? 334 LEU A O   1 
ATOM   1730 C  CB  . LEU A 1 229 ? 23.772  65.141  56.948 1.00 50.26 ? 334 LEU A CB  1 
ATOM   1731 C  CG  . LEU A 1 229 ? 24.725  63.986  57.304 1.00 50.38 ? 334 LEU A CG  1 
ATOM   1732 C  CD1 . LEU A 1 229 ? 24.501  63.488  58.732 1.00 50.35 ? 334 LEU A CD1 1 
ATOM   1733 C  CD2 . LEU A 1 229 ? 24.611  62.832  56.313 1.00 50.56 ? 334 LEU A CD2 1 
ATOM   1734 N  N   . SER A 1 230 ? 20.881  66.613  55.777 1.00 50.17 ? 335 SER A N   1 
ATOM   1735 C  CA  . SER A 1 230 ? 20.006  67.787  55.876 1.00 50.02 ? 335 SER A CA  1 
ATOM   1736 C  C   . SER A 1 230 ? 19.347  68.116  54.544 1.00 49.86 ? 335 SER A C   1 
ATOM   1737 O  O   . SER A 1 230 ? 19.783  67.652  53.494 1.00 49.76 ? 335 SER A O   1 
ATOM   1738 C  CB  . SER A 1 230 ? 20.792  69.017  56.322 1.00 50.04 ? 335 SER A CB  1 
ATOM   1739 O  OG  . SER A 1 230 ? 21.758  69.369  55.346 1.00 50.27 ? 335 SER A OG  1 
ATOM   1740 N  N   . GLN A 1 231 ? 18.309  68.944  54.610 1.00 49.72 ? 336 GLN A N   1 
ATOM   1741 C  CA  . GLN A 1 231 ? 17.610  69.449  53.422 1.00 49.66 ? 336 GLN A CA  1 
ATOM   1742 C  C   . GLN A 1 231 ? 18.444  70.410  52.556 1.00 49.57 ? 336 GLN A C   1 
ATOM   1743 O  O   . GLN A 1 231 ? 18.203  70.526  51.354 1.00 49.63 ? 336 GLN A O   1 
ATOM   1744 C  CB  . GLN A 1 231 ? 16.308  70.148  53.836 1.00 49.64 ? 336 GLN A CB  1 
ATOM   1745 C  CG  . GLN A 1 231 ? 16.490  71.322  54.803 1.00 49.58 ? 336 GLN A CG  1 
ATOM   1746 C  CD  . GLN A 1 231 ? 15.219  72.121  55.002 1.00 49.65 ? 336 GLN A CD  1 
ATOM   1747 O  OE1 . GLN A 1 231 ? 14.125  71.567  55.067 1.00 49.12 ? 336 GLN A OE1 1 
ATOM   1748 N  NE2 . GLN A 1 231 ? 15.361  73.438  55.100 1.00 50.40 ? 336 GLN A NE2 1 
ATOM   1749 N  N   . ALA A 1 232 ? 19.414  71.092  53.160 1.00 49.50 ? 337 ALA A N   1 
ATOM   1750 C  CA  . ALA A 1 232 ? 20.155  72.140  52.463 1.00 49.49 ? 337 ALA A CA  1 
ATOM   1751 C  C   . ALA A 1 232 ? 21.615  72.334  52.912 1.00 49.54 ? 337 ALA A C   1 
ATOM   1752 O  O   . ALA A 1 232 ? 22.486  72.542  52.063 1.00 49.73 ? 337 ALA A O   1 
ATOM   1753 C  CB  . ALA A 1 232 ? 19.394  73.451  52.569 1.00 49.59 ? 337 ALA A CB  1 
ATOM   1754 N  N   . ARG A 1 233 ? 21.882  72.290  54.220 1.00 49.29 ? 338 ARG A N   1 
ATOM   1755 C  CA  . ARG A 1 233 ? 23.235  72.549  54.750 1.00 49.17 ? 338 ARG A CA  1 
ATOM   1756 C  C   . ARG A 1 233 ? 24.270  71.492  54.359 1.00 48.88 ? 338 ARG A C   1 
ATOM   1757 O  O   . ARG A 1 233 ? 23.916  70.383  53.980 1.00 48.99 ? 338 ARG A O   1 
ATOM   1758 C  CB  . ARG A 1 233 ? 23.211  72.672  56.281 1.00 49.37 ? 338 ARG A CB  1 
ATOM   1759 C  CG  . ARG A 1 233 ? 22.875  74.063  56.813 1.00 49.46 ? 338 ARG A CG  1 
ATOM   1760 C  CD  . ARG A 1 233 ? 23.622  74.335  58.111 1.00 49.81 ? 338 ARG A CD  1 
ATOM   1761 N  NE  . ARG A 1 233 ? 23.348  75.671  58.644 1.00 50.49 ? 338 ARG A NE  1 
ATOM   1762 C  CZ  . ARG A 1 233 ? 22.719  75.940  59.792 1.00 50.89 ? 338 ARG A CZ  1 
ATOM   1763 N  NH1 . ARG A 1 233 ? 22.277  74.967  60.590 1.00 50.93 ? 338 ARG A NH1 1 
ATOM   1764 N  NH2 . ARG A 1 233 ? 22.537  77.210  60.152 1.00 50.77 ? 338 ARG A NH2 1 
ATOM   1765 N  N   . LEU A 1 234 ? 25.547  71.852  54.482 1.00 48.64 ? 339 LEU A N   1 
ATOM   1766 C  CA  . LEU A 1 234 ? 26.679  70.976  54.136 1.00 48.50 ? 339 LEU A CA  1 
ATOM   1767 C  C   . LEU A 1 234 ? 26.899  69.852  55.157 1.00 48.46 ? 339 LEU A C   1 
ATOM   1768 O  O   . LEU A 1 234 ? 26.385  69.907  56.272 1.00 48.41 ? 339 LEU A O   1 
ATOM   1769 C  CB  . LEU A 1 234 ? 27.976  71.803  54.038 1.00 48.32 ? 339 LEU A CB  1 
ATOM   1770 C  CG  . LEU A 1 234 ? 28.154  72.797  52.881 1.00 47.54 ? 339 LEU A CG  1 
ATOM   1771 C  CD1 . LEU A 1 234 ? 28.984  73.995  53.313 1.00 46.95 ? 339 LEU A CD1 1 
ATOM   1772 C  CD2 . LEU A 1 234 ? 28.783  72.130  51.674 1.00 47.31 ? 339 LEU A CD2 1 
ATOM   1773 N  N   . LEU A 1 235 ? 27.687  68.847  54.770 1.00 48.50 ? 340 LEU A N   1 
ATOM   1774 C  CA  . LEU A 1 235 ? 28.103  67.776  55.686 1.00 48.62 ? 340 LEU A CA  1 
ATOM   1775 C  C   . LEU A 1 235 ? 28.933  68.291  56.865 1.00 48.62 ? 340 LEU A C   1 
ATOM   1776 O  O   . LEU A 1 235 ? 28.752  67.843  57.999 1.00 48.52 ? 340 LEU A O   1 
ATOM   1777 C  CB  . LEU A 1 235 ? 28.914  66.707  54.946 1.00 48.60 ? 340 LEU A CB  1 
ATOM   1778 C  CG  . LEU A 1 235 ? 28.154  65.765  54.010 1.00 48.77 ? 340 LEU A CG  1 
ATOM   1779 C  CD1 . LEU A 1 235 ? 29.138  64.909  53.233 1.00 49.15 ? 340 LEU A CD1 1 
ATOM   1780 C  CD2 . LEU A 1 235 ? 27.172  64.885  54.767 1.00 48.70 ? 340 LEU A CD2 1 
ATOM   1781 N  N   . THR A 1 236 ? 29.836  69.231  56.589 1.00 48.68 ? 341 THR A N   1 
ATOM   1782 C  CA  . THR A 1 236 ? 30.725  69.803  57.611 1.00 48.75 ? 341 THR A CA  1 
ATOM   1783 C  C   . THR A 1 236 ? 29.991  70.501  58.766 1.00 48.71 ? 341 THR A C   1 
ATOM   1784 O  O   . THR A 1 236 ? 30.565  70.680  59.834 1.00 48.55 ? 341 THR A O   1 
ATOM   1785 C  CB  . THR A 1 236 ? 31.716  70.810  56.987 1.00 48.75 ? 341 THR A CB  1 
ATOM   1786 O  OG1 . THR A 1 236 ? 30.997  71.758  56.189 1.00 49.20 ? 341 THR A OG1 1 
ATOM   1787 C  CG2 . THR A 1 236 ? 32.732  70.097  56.114 1.00 48.62 ? 341 THR A CG2 1 
ATOM   1788 N  N   . SER A 1 237 ? 28.739  70.901  58.547 1.00 48.84 ? 342 SER A N   1 
ATOM   1789 C  CA  . SER A 1 237 ? 27.902  71.480  59.608 1.00 48.93 ? 342 SER A CA  1 
ATOM   1790 C  C   . SER A 1 237 ? 27.590  70.484  60.728 1.00 48.97 ? 342 SER A C   1 
ATOM   1791 O  O   . SER A 1 237 ? 27.412  70.883  61.882 1.00 48.94 ? 342 SER A O   1 
ATOM   1792 C  CB  . SER A 1 237 ? 26.581  71.993  59.027 1.00 48.94 ? 342 SER A CB  1 
ATOM   1793 O  OG  . SER A 1 237 ? 26.806  73.013  58.074 1.00 49.20 ? 342 SER A OG  1 
ATOM   1794 N  N   . PHE A 1 238 ? 27.526  69.198  60.378 1.00 49.03 ? 343 PHE A N   1 
ATOM   1795 C  CA  . PHE A 1 238 ? 27.151  68.132  61.315 1.00 48.93 ? 343 PHE A CA  1 
ATOM   1796 C  C   . PHE A 1 238 ? 28.307  67.220  61.731 1.00 48.77 ? 343 PHE A C   1 
ATOM   1797 O  O   . PHE A 1 238 ? 28.348  66.773  62.875 1.00 48.71 ? 343 PHE A O   1 
ATOM   1798 C  CB  . PHE A 1 238 ? 26.031  67.279  60.707 1.00 49.15 ? 343 PHE A CB  1 
ATOM   1799 C  CG  . PHE A 1 238 ? 24.838  68.081  60.267 1.00 49.32 ? 343 PHE A CG  1 
ATOM   1800 C  CD1 . PHE A 1 238 ? 24.624  68.346  58.924 1.00 49.32 ? 343 PHE A CD1 1 
ATOM   1801 C  CD2 . PHE A 1 238 ? 23.942  68.592  61.203 1.00 49.67 ? 343 PHE A CD2 1 
ATOM   1802 C  CE1 . PHE A 1 238 ? 23.532  69.090  58.516 1.00 49.39 ? 343 PHE A CE1 1 
ATOM   1803 C  CE2 . PHE A 1 238 ? 22.846  69.342  60.806 1.00 49.46 ? 343 PHE A CE2 1 
ATOM   1804 C  CZ  . PHE A 1 238 ? 22.638  69.589  59.460 1.00 49.77 ? 343 PHE A CZ  1 
ATOM   1805 N  N   . LEU A 1 239 ? 29.236  66.948  60.811 1.00 48.66 ? 344 LEU A N   1 
ATOM   1806 C  CA  . LEU A 1 239 ? 30.303  65.958  61.038 1.00 48.55 ? 344 LEU A CA  1 
ATOM   1807 C  C   . LEU A 1 239 ? 31.671  66.588  61.322 1.00 48.46 ? 344 LEU A C   1 
ATOM   1808 O  O   . LEU A 1 239 ? 31.982  67.651  60.788 1.00 48.43 ? 344 LEU A O   1 
ATOM   1809 C  CB  . LEU A 1 239 ? 30.435  65.039  59.821 1.00 48.49 ? 344 LEU A CB  1 
ATOM   1810 C  CG  . LEU A 1 239 ? 29.185  64.270  59.383 1.00 48.12 ? 344 LEU A CG  1 
ATOM   1811 C  CD1 . LEU A 1 239 ? 29.499  63.431  58.158 1.00 47.76 ? 344 LEU A CD1 1 
ATOM   1812 C  CD2 . LEU A 1 239 ? 28.649  63.392  60.510 1.00 48.10 ? 344 LEU A CD2 1 
ATOM   1813 N  N   . PRO A 1 240 ? 32.491  65.933  62.170 1.00 48.41 ? 345 PRO A N   1 
ATOM   1814 C  CA  . PRO A 1 240 ? 33.890  66.334  62.294 1.00 48.36 ? 345 PRO A CA  1 
ATOM   1815 C  C   . PRO A 1 240 ? 34.672  65.917  61.058 1.00 48.30 ? 345 PRO A C   1 
ATOM   1816 O  O   . PRO A 1 240 ? 34.316  64.933  60.406 1.00 48.38 ? 345 PRO A O   1 
ATOM   1817 C  CB  . PRO A 1 240 ? 34.392  65.574  63.532 1.00 48.38 ? 345 PRO A CB  1 
ATOM   1818 C  CG  . PRO A 1 240 ? 33.228  64.850  64.095 1.00 48.35 ? 345 PRO A CG  1 
ATOM   1819 C  CD  . PRO A 1 240 ? 32.163  64.805  63.057 1.00 48.53 ? 345 PRO A CD  1 
ATOM   1820 N  N   . ALA A 1 241 ? 35.729  66.665  60.749 1.00 48.23 ? 346 ALA A N   1 
ATOM   1821 C  CA  . ALA A 1 241 ? 36.510  66.461  59.529 1.00 48.14 ? 346 ALA A CA  1 
ATOM   1822 C  C   . ALA A 1 241 ? 36.845  64.992  59.276 1.00 48.02 ? 346 ALA A C   1 
ATOM   1823 O  O   . ALA A 1 241 ? 36.631  64.484  58.178 1.00 47.83 ? 346 ALA A O   1 
ATOM   1824 C  CB  . ALA A 1 241 ? 37.789  67.292  59.579 1.00 48.19 ? 346 ALA A CB  1 
ATOM   1825 N  N   . GLN A 1 242 ? 37.334  64.306  60.305 1.00 47.99 ? 347 GLN A N   1 
ATOM   1826 C  CA  . GLN A 1 242 ? 37.790  62.919  60.152 1.00 47.85 ? 347 GLN A CA  1 
ATOM   1827 C  C   . GLN A 1 242 ? 36.666  61.866  60.188 1.00 47.58 ? 347 GLN A C   1 
ATOM   1828 O  O   . GLN A 1 242 ? 36.919  60.707  60.503 1.00 47.66 ? 347 GLN A O   1 
ATOM   1829 C  CB  . GLN A 1 242 ? 38.917  62.587  61.154 1.00 48.09 ? 347 GLN A CB  1 
ATOM   1830 C  CG  . GLN A 1 242 ? 38.730  63.067  62.598 1.00 49.00 ? 347 GLN A CG  1 
ATOM   1831 C  CD  . GLN A 1 242 ? 37.581  62.390  63.317 1.00 50.27 ? 347 GLN A CD  1 
ATOM   1832 O  OE1 . GLN A 1 242 ? 36.820  63.039  64.039 1.00 51.46 ? 347 GLN A OE1 1 
ATOM   1833 N  NE2 . GLN A 1 242 ? 37.458  61.078  63.141 1.00 50.44 ? 347 GLN A NE2 1 
ATOM   1834 N  N   . LEU A 1 243 ? 35.439  62.266  59.849 1.00 47.21 ? 348 LEU A N   1 
ATOM   1835 C  CA  . LEU A 1 243 ? 34.346  61.321  59.593 1.00 46.89 ? 348 LEU A CA  1 
ATOM   1836 C  C   . LEU A 1 243 ? 33.725  61.468  58.193 1.00 46.53 ? 348 LEU A C   1 
ATOM   1837 O  O   . LEU A 1 243 ? 32.769  60.773  57.873 1.00 46.32 ? 348 LEU A O   1 
ATOM   1838 C  CB  . LEU A 1 243 ? 33.253  61.468  60.662 1.00 46.91 ? 348 LEU A CB  1 
ATOM   1839 C  CG  . LEU A 1 243 ? 33.425  60.666  61.961 1.00 46.91 ? 348 LEU A CG  1 
ATOM   1840 C  CD1 . LEU A 1 243 ? 32.356  61.070  62.975 1.00 46.72 ? 348 LEU A CD1 1 
ATOM   1841 C  CD2 . LEU A 1 243 ? 33.385  59.158  61.702 1.00 46.76 ? 348 LEU A CD2 1 
ATOM   1842 N  N   . LEU A 1 244 ? 34.278  62.342  57.355 1.00 46.31 ? 349 LEU A N   1 
ATOM   1843 C  CA  . LEU A 1 244 ? 33.669  62.664  56.059 1.00 46.19 ? 349 LEU A CA  1 
ATOM   1844 C  C   . LEU A 1 244 ? 33.772  61.540  55.020 1.00 46.10 ? 349 LEU A C   1 
ATOM   1845 O  O   . LEU A 1 244 ? 32.848  61.344  54.230 1.00 46.12 ? 349 LEU A O   1 
ATOM   1846 C  CB  . LEU A 1 244 ? 34.269  63.955  55.488 1.00 45.94 ? 349 LEU A CB  1 
ATOM   1847 C  CG  . LEU A 1 244 ? 33.959  65.254  56.239 1.00 45.77 ? 349 LEU A CG  1 
ATOM   1848 C  CD1 . LEU A 1 244 ? 34.727  66.417  55.616 1.00 45.83 ? 349 LEU A CD1 1 
ATOM   1849 C  CD2 . LEU A 1 244 ? 32.464  65.560  56.266 1.00 45.19 ? 349 LEU A CD2 1 
ATOM   1850 N  N   . ARG A 1 245 ? 34.886  60.815  55.020 1.00 46.09 ? 350 ARG A N   1 
ATOM   1851 C  CA  . ARG A 1 245 ? 35.089  59.699  54.091 1.00 46.14 ? 350 ARG A CA  1 
ATOM   1852 C  C   . ARG A 1 245 ? 34.137  58.550  54.381 1.00 46.21 ? 350 ARG A C   1 
ATOM   1853 O  O   . ARG A 1 245 ? 33.552  57.966  53.467 1.00 46.28 ? 350 ARG A O   1 
ATOM   1854 C  CB  . ARG A 1 245 ? 36.523  59.184  54.172 1.00 46.07 ? 350 ARG A CB  1 
ATOM   1855 C  CG  . ARG A 1 245 ? 37.546  60.214  53.769 1.00 46.14 ? 350 ARG A CG  1 
ATOM   1856 C  CD  . ARG A 1 245 ? 38.963  59.687  53.829 1.00 46.02 ? 350 ARG A CD  1 
ATOM   1857 N  NE  . ARG A 1 245 ? 39.878  60.703  53.322 1.00 45.98 ? 350 ARG A NE  1 
ATOM   1858 C  CZ  . ARG A 1 245 ? 40.305  60.806  52.064 1.00 45.78 ? 350 ARG A CZ  1 
ATOM   1859 N  NH1 . ARG A 1 245 ? 39.947  59.929  51.130 1.00 44.96 ? 350 ARG A NH1 1 
ATOM   1860 N  NH2 . ARG A 1 245 ? 41.124  61.799  51.745 1.00 46.33 ? 350 ARG A NH2 1 
ATOM   1861 N  N   . LEU A 1 246 ? 33.995  58.240  55.666 1.00 46.40 ? 351 LEU A N   1 
ATOM   1862 C  CA  . LEU A 1 246 ? 33.114  57.176  56.137 1.00 46.35 ? 351 LEU A CA  1 
ATOM   1863 C  C   . LEU A 1 246 ? 31.682  57.429  55.691 1.00 46.30 ? 351 LEU A C   1 
ATOM   1864 O  O   . LEU A 1 246 ? 31.072  56.580  55.042 1.00 46.32 ? 351 LEU A O   1 
ATOM   1865 C  CB  . LEU A 1 246 ? 33.177  57.087  57.663 1.00 46.43 ? 351 LEU A CB  1 
ATOM   1866 C  CG  . LEU A 1 246 ? 32.797  55.764  58.320 1.00 46.56 ? 351 LEU A CG  1 
ATOM   1867 C  CD1 . LEU A 1 246 ? 33.737  54.658  57.872 1.00 47.03 ? 351 LEU A CD1 1 
ATOM   1868 C  CD2 . LEU A 1 246 ? 32.839  55.923  59.837 1.00 46.40 ? 351 LEU A CD2 1 
ATOM   1869 N  N   . TYR A 1 247 ? 31.160  58.606  56.022 1.00 46.29 ? 352 TYR A N   1 
ATOM   1870 C  CA  . TYR A 1 247 ? 29.792  58.970  55.647 1.00 46.42 ? 352 TYR A CA  1 
ATOM   1871 C  C   . TYR A 1 247 ? 29.590  59.072  54.135 1.00 46.42 ? 352 TYR A C   1 
ATOM   1872 O  O   . TYR A 1 247 ? 28.506  58.771  53.648 1.00 46.48 ? 352 TYR A O   1 
ATOM   1873 C  CB  . TYR A 1 247 ? 29.360  60.276  56.317 1.00 46.39 ? 352 TYR A CB  1 
ATOM   1874 C  CG  . TYR A 1 247 ? 28.788  60.091  57.704 1.00 46.64 ? 352 TYR A CG  1 
ATOM   1875 C  CD1 . TYR A 1 247 ? 27.410  60.084  57.917 1.00 46.84 ? 352 TYR A CD1 1 
ATOM   1876 C  CD2 . TYR A 1 247 ? 29.621  59.926  58.806 1.00 46.70 ? 352 TYR A CD2 1 
ATOM   1877 C  CE1 . TYR A 1 247 ? 26.880  59.919  59.189 1.00 46.36 ? 352 TYR A CE1 1 
ATOM   1878 C  CE2 . TYR A 1 247 ? 29.102  59.765  60.079 1.00 46.61 ? 352 TYR A CE2 1 
ATOM   1879 C  CZ  . TYR A 1 247 ? 27.732  59.761  60.266 1.00 46.59 ? 352 TYR A CZ  1 
ATOM   1880 O  OH  . TYR A 1 247 ? 27.218  59.596  61.536 1.00 47.02 ? 352 TYR A OH  1 
ATOM   1881 N  N   . GLN A 1 248 ? 30.614  59.490  53.394 1.00 46.46 ? 353 GLN A N   1 
ATOM   1882 C  CA  . GLN A 1 248 ? 30.502  59.561  51.933 1.00 46.67 ? 353 GLN A CA  1 
ATOM   1883 C  C   . GLN A 1 248 ? 30.338  58.177  51.298 1.00 46.52 ? 353 GLN A C   1 
ATOM   1884 O  O   . GLN A 1 248 ? 29.497  57.995  50.421 1.00 46.38 ? 353 GLN A O   1 
ATOM   1885 C  CB  . GLN A 1 248 ? 31.699  60.283  51.308 1.00 46.88 ? 353 GLN A CB  1 
ATOM   1886 C  CG  . GLN A 1 248 ? 31.509  61.795  51.123 1.00 47.16 ? 353 GLN A CG  1 
ATOM   1887 C  CD  . GLN A 1 248 ? 32.491  62.388  50.118 1.00 47.26 ? 353 GLN A CD  1 
ATOM   1888 O  OE1 . GLN A 1 248 ? 32.948  61.703  49.199 1.00 47.63 ? 353 GLN A OE1 1 
ATOM   1889 N  NE2 . GLN A 1 248 ? 32.816  63.669  50.288 1.00 47.87 ? 353 GLN A NE2 1 
ATOM   1890 N  N   . LEU A 1 249 ? 31.144  57.216  51.743 1.00 46.48 ? 354 LEU A N   1 
ATOM   1891 C  CA  . LEU A 1 249 ? 31.011  55.818  51.314 1.00 46.49 ? 354 LEU A CA  1 
ATOM   1892 C  C   . LEU A 1 249 ? 29.623  55.263  51.638 1.00 46.47 ? 354 LEU A C   1 
ATOM   1893 O  O   . LEU A 1 249 ? 28.980  54.651  50.783 1.00 46.40 ? 354 LEU A O   1 
ATOM   1894 C  CB  . LEU A 1 249 ? 32.101  54.960  51.971 1.00 46.49 ? 354 LEU A CB  1 
ATOM   1895 C  CG  . LEU A 1 249 ? 31.996  53.429  51.974 1.00 46.49 ? 354 LEU A CG  1 
ATOM   1896 C  CD1 . LEU A 1 249 ? 31.879  52.843  50.577 1.00 46.44 ? 354 LEU A CD1 1 
ATOM   1897 C  CD2 . LEU A 1 249 ? 33.201  52.849  52.690 1.00 46.41 ? 354 LEU A CD2 1 
ATOM   1898 N  N   . MET A 1 250 ? 29.166  55.490  52.868 1.00 46.56 ? 355 MET A N   1 
ATOM   1899 C  CA  . MET A 1 250 ? 27.850  55.031  53.303 1.00 46.62 ? 355 MET A CA  1 
ATOM   1900 C  C   . MET A 1 250 ? 26.735  55.597  52.427 1.00 46.63 ? 355 MET A C   1 
ATOM   1901 O  O   . MET A 1 250 ? 25.947  54.839  51.864 1.00 46.84 ? 355 MET A O   1 
ATOM   1902 C  CB  . MET A 1 250 ? 27.596  55.410  54.763 1.00 46.64 ? 355 MET A CB  1 
ATOM   1903 C  CG  . MET A 1 250 ? 26.274  54.859  55.313 1.00 46.75 ? 355 MET A CG  1 
ATOM   1904 S  SD  . MET A 1 250 ? 25.913  55.319  57.019 1.00 46.98 ? 355 MET A SD  1 
ATOM   1905 C  CE  . MET A 1 250 ? 25.790  57.104  56.871 1.00 46.77 ? 355 MET A CE  1 
ATOM   1906 N  N   . LEU A 1 251 ? 26.666  56.920  52.309 1.00 46.59 ? 356 LEU A N   1 
ATOM   1907 C  CA  . LEU A 1 251 ? 25.627  57.559  51.494 1.00 46.67 ? 356 LEU A CA  1 
ATOM   1908 C  C   . LEU A 1 251 ? 25.627  57.061  50.045 1.00 46.83 ? 356 LEU A C   1 
ATOM   1909 O  O   . LEU A 1 251 ? 24.571  56.948  49.430 1.00 47.00 ? 356 LEU A O   1 
ATOM   1910 C  CB  . LEU A 1 251 ? 25.769  59.086  51.512 1.00 46.55 ? 356 LEU A CB  1 
ATOM   1911 C  CG  . LEU A 1 251 ? 25.543  59.821  52.839 1.00 46.28 ? 356 LEU A CG  1 
ATOM   1912 C  CD1 . LEU A 1 251 ? 25.331  61.301  52.582 1.00 46.19 ? 356 LEU A CD1 1 
ATOM   1913 C  CD2 . LEU A 1 251 ? 24.361  59.263  53.605 1.00 46.72 ? 356 LEU A CD2 1 
ATOM   1914 N  N   . PHE A 1 252 ? 26.804  56.756  49.504 1.00 46.99 ? 357 PHE A N   1 
ATOM   1915 C  CA  . PHE A 1 252 ? 26.906  56.263  48.125 1.00 47.00 ? 357 PHE A CA  1 
ATOM   1916 C  C   . PHE A 1 252 ? 26.537  54.781  47.944 1.00 47.10 ? 357 PHE A C   1 
ATOM   1917 O  O   . PHE A 1 252 ? 26.380  54.326  46.813 1.00 47.03 ? 357 PHE A O   1 
ATOM   1918 C  CB  . PHE A 1 252 ? 28.309  56.533  47.553 1.00 46.99 ? 357 PHE A CB  1 
ATOM   1919 C  CG  . PHE A 1 252 ? 28.406  57.820  46.784 1.00 46.72 ? 357 PHE A CG  1 
ATOM   1920 C  CD1 . PHE A 1 252 ? 29.141  58.883  47.266 1.00 46.49 ? 357 PHE A CD1 1 
ATOM   1921 C  CD2 . PHE A 1 252 ? 27.745  57.962  45.569 1.00 47.23 ? 357 PHE A CD2 1 
ATOM   1922 C  CE1 . PHE A 1 252 ? 29.223  60.071  46.555 1.00 47.08 ? 357 PHE A CE1 1 
ATOM   1923 C  CE2 . PHE A 1 252 ? 27.816  59.147  44.849 1.00 47.25 ? 357 PHE A CE2 1 
ATOM   1924 C  CZ  . PHE A 1 252 ? 28.557  60.206  45.345 1.00 47.63 ? 357 PHE A CZ  1 
ATOM   1925 N  N   . THR A 1 253 ? 26.392  54.031  49.037 1.00 47.10 ? 358 THR A N   1 
ATOM   1926 C  CA  . THR A 1 253 ? 26.089  52.594  48.948 1.00 47.08 ? 358 THR A CA  1 
ATOM   1927 C  C   . THR A 1 253 ? 24.802  52.147  49.659 1.00 47.00 ? 358 THR A C   1 
ATOM   1928 O  O   . THR A 1 253 ? 24.479  50.961  49.653 1.00 46.77 ? 358 THR A O   1 
ATOM   1929 C  CB  . THR A 1 253 ? 27.257  51.762  49.493 1.00 47.11 ? 358 THR A CB  1 
ATOM   1930 O  OG1 . THR A 1 253 ? 27.498  52.113  50.863 1.00 47.29 ? 358 THR A OG1 1 
ATOM   1931 C  CG2 . THR A 1 253 ? 28.513  52.011  48.668 1.00 47.14 ? 358 THR A CG2 1 
ATOM   1932 N  N   . LEU A 1 254 ? 24.075  53.082  50.268 1.00 46.99 ? 359 LEU A N   1 
ATOM   1933 C  CA  . LEU A 1 254 ? 22.795  52.762  50.895 1.00 47.09 ? 359 LEU A CA  1 
ATOM   1934 C  C   . LEU A 1 254 ? 21.700  52.746  49.831 1.00 47.04 ? 359 LEU A C   1 
ATOM   1935 O  O   . LEU A 1 254 ? 21.798  53.463  48.838 1.00 46.78 ? 359 LEU A O   1 
ATOM   1936 C  CB  . LEU A 1 254 ? 22.451  53.768  52.002 1.00 47.02 ? 359 LEU A CB  1 
ATOM   1937 C  CG  . LEU A 1 254 ? 23.149  53.574  53.353 1.00 47.13 ? 359 LEU A CG  1 
ATOM   1938 C  CD1 . LEU A 1 254 ? 22.809  54.727  54.284 1.00 47.69 ? 359 LEU A CD1 1 
ATOM   1939 C  CD2 . LEU A 1 254 ? 22.771  52.253  53.999 1.00 46.89 ? 359 LEU A CD2 1 
ATOM   1940 N  N   . PRO A 1 255 ? 20.652  51.928  50.037 1.00 47.20 ? 360 PRO A N   1 
ATOM   1941 C  CA  . PRO A 1 255 ? 19.595  51.772  49.030 1.00 47.36 ? 360 PRO A CA  1 
ATOM   1942 C  C   . PRO A 1 255 ? 18.765  53.042  48.826 1.00 47.49 ? 360 PRO A C   1 
ATOM   1943 O  O   . PRO A 1 255 ? 17.980  53.400  49.697 1.00 47.73 ? 360 PRO A O   1 
ATOM   1944 C  CB  . PRO A 1 255 ? 18.730  50.641  49.603 1.00 47.39 ? 360 PRO A CB  1 
ATOM   1945 C  CG  . PRO A 1 255 ? 18.975  50.679  51.070 1.00 47.12 ? 360 PRO A CG  1 
ATOM   1946 C  CD  . PRO A 1 255 ? 20.400  51.100  51.231 1.00 47.14 ? 360 PRO A CD  1 
ATOM   1947 N  N   . GLY A 1 256 ? 18.943  53.709  47.685 1.00 47.50 ? 361 GLY A N   1 
ATOM   1948 C  CA  . GLY A 1 256 ? 18.248  54.964  47.402 1.00 47.45 ? 361 GLY A CA  1 
ATOM   1949 C  C   . GLY A 1 256 ? 19.131  56.036  46.788 1.00 47.51 ? 361 GLY A C   1 
ATOM   1950 O  O   . GLY A 1 256 ? 20.276  55.779  46.412 1.00 47.48 ? 361 GLY A O   1 
ATOM   1951 N  N   . THR A 1 257 ? 18.591  57.248  46.700 1.00 47.48 ? 362 THR A N   1 
ATOM   1952 C  CA  . THR A 1 257 ? 19.282  58.367  46.070 1.00 47.38 ? 362 THR A CA  1 
ATOM   1953 C  C   . THR A 1 257 ? 20.000  59.231  47.122 1.00 47.46 ? 362 THR A C   1 
ATOM   1954 O  O   . THR A 1 257 ? 19.367  59.710  48.068 1.00 47.26 ? 362 THR A O   1 
ATOM   1955 C  CB  . THR A 1 257 ? 18.287  59.234  45.268 1.00 47.33 ? 362 THR A CB  1 
ATOM   1956 O  OG1 . THR A 1 257 ? 17.588  58.414  44.324 1.00 46.92 ? 362 THR A OG1 1 
ATOM   1957 C  CG2 . THR A 1 257 ? 19.008  60.336  44.524 1.00 47.47 ? 362 THR A CG2 1 
ATOM   1958 N  N   . PRO A 1 258 ? 21.327  59.423  46.967 1.00 47.55 ? 363 PRO A N   1 
ATOM   1959 C  CA  . PRO A 1 258 ? 22.085  60.295  47.864 1.00 47.47 ? 363 PRO A CA  1 
ATOM   1960 C  C   . PRO A 1 258 ? 22.051  61.747  47.395 1.00 47.53 ? 363 PRO A C   1 
ATOM   1961 O  O   . PRO A 1 258 ? 22.151  62.005  46.187 1.00 47.40 ? 363 PRO A O   1 
ATOM   1962 C  CB  . PRO A 1 258 ? 23.503  59.746  47.752 1.00 47.57 ? 363 PRO A CB  1 
ATOM   1963 C  CG  . PRO A 1 258 ? 23.595  59.260  46.342 1.00 47.58 ? 363 PRO A CG  1 
ATOM   1964 C  CD  . PRO A 1 258 ? 22.199  58.822  45.938 1.00 47.66 ? 363 PRO A CD  1 
ATOM   1965 N  N   . VAL A 1 259 ? 21.930  62.676  48.345 1.00 47.36 ? 364 VAL A N   1 
ATOM   1966 C  CA  . VAL A 1 259 ? 21.792  64.099  48.034 1.00 47.32 ? 364 VAL A CA  1 
ATOM   1967 C  C   . VAL A 1 259 ? 22.832  64.949  48.772 1.00 47.31 ? 364 VAL A C   1 
ATOM   1968 O  O   . VAL A 1 259 ? 22.886  64.955  50.007 1.00 47.32 ? 364 VAL A O   1 
ATOM   1969 C  CB  . VAL A 1 259 ? 20.375  64.604  48.387 1.00 47.38 ? 364 VAL A CB  1 
ATOM   1970 C  CG1 . VAL A 1 259 ? 20.166  66.032  47.878 1.00 47.12 ? 364 VAL A CG1 1 
ATOM   1971 C  CG2 . VAL A 1 259 ? 19.313  63.657  47.805 1.00 47.40 ? 364 VAL A CG2 1 
ATOM   1972 N  N   . PHE A 1 260 ? 23.637  65.678  48.002 1.00 47.19 ? 365 PHE A N   1 
ATOM   1973 C  CA  . PHE A 1 260 ? 24.673  66.552  48.546 1.00 47.18 ? 365 PHE A CA  1 
ATOM   1974 C  C   . PHE A 1 260 ? 24.439  68.024  48.189 1.00 47.10 ? 365 PHE A C   1 
ATOM   1975 O  O   . PHE A 1 260 ? 23.752  68.348  47.220 1.00 47.10 ? 365 PHE A O   1 
ATOM   1976 C  CB  . PHE A 1 260 ? 26.044  66.135  48.004 1.00 47.37 ? 365 PHE A CB  1 
ATOM   1977 C  CG  . PHE A 1 260 ? 26.358  64.680  48.186 1.00 47.49 ? 365 PHE A CG  1 
ATOM   1978 C  CD1 . PHE A 1 260 ? 26.170  63.783  47.147 1.00 47.43 ? 365 PHE A CD1 1 
ATOM   1979 C  CD2 . PHE A 1 260 ? 26.848  64.206  49.401 1.00 47.60 ? 365 PHE A CD2 1 
ATOM   1980 C  CE1 . PHE A 1 260 ? 26.461  62.431  47.315 1.00 47.66 ? 365 PHE A CE1 1 
ATOM   1981 C  CE2 . PHE A 1 260 ? 27.142  62.861  49.575 1.00 47.50 ? 365 PHE A CE2 1 
ATOM   1982 C  CZ  . PHE A 1 260 ? 26.947  61.971  48.529 1.00 47.41 ? 365 PHE A CZ  1 
ATOM   1983 N  N   . SER A 1 261 ? 25.028  68.908  48.984 1.00 47.06 ? 366 SER A N   1 
ATOM   1984 C  CA  . SER A 1 261 ? 25.117  70.323  48.650 1.00 46.95 ? 366 SER A CA  1 
ATOM   1985 C  C   . SER A 1 261 ? 26.451  70.541  47.966 1.00 46.98 ? 366 SER A C   1 
ATOM   1986 O  O   . SER A 1 261 ? 27.396  69.795  48.217 1.00 47.08 ? 366 SER A O   1 
ATOM   1987 C  CB  . SER A 1 261 ? 25.035  71.180  49.911 1.00 46.85 ? 366 SER A CB  1 
ATOM   1988 O  OG  . SER A 1 261 ? 23.767  71.053  50.524 1.00 46.57 ? 366 SER A OG  1 
ATOM   1989 N  N   . TYR A 1 262 ? 26.535  71.552  47.104 1.00 46.94 ? 367 TYR A N   1 
ATOM   1990 C  CA  . TYR A 1 262 ? 27.800  71.878  46.446 1.00 46.89 ? 367 TYR A CA  1 
ATOM   1991 C  C   . TYR A 1 262 ? 28.877  72.140  47.504 1.00 46.77 ? 367 TYR A C   1 
ATOM   1992 O  O   . TYR A 1 262 ? 28.632  72.830  48.498 1.00 46.69 ? 367 TYR A O   1 
ATOM   1993 C  CB  . TYR A 1 262 ? 27.650  73.076  45.485 1.00 46.96 ? 367 TYR A CB  1 
ATOM   1994 C  CG  . TYR A 1 262 ? 27.564  74.451  46.147 1.00 47.20 ? 367 TYR A CG  1 
ATOM   1995 C  CD1 . TYR A 1 262 ? 28.718  75.181  46.441 1.00 47.09 ? 367 TYR A CD1 1 
ATOM   1996 C  CD2 . TYR A 1 262 ? 26.333  75.025  46.457 1.00 46.79 ? 367 TYR A CD2 1 
ATOM   1997 C  CE1 . TYR A 1 262 ? 28.649  76.431  47.035 1.00 46.91 ? 367 TYR A CE1 1 
ATOM   1998 C  CE2 . TYR A 1 262 ? 26.256  76.278  47.048 1.00 47.01 ? 367 TYR A CE2 1 
ATOM   1999 C  CZ  . TYR A 1 262 ? 27.419  76.975  47.336 1.00 46.94 ? 367 TYR A CZ  1 
ATOM   2000 O  OH  . TYR A 1 262 ? 27.351  78.215  47.924 1.00 46.71 ? 367 TYR A OH  1 
ATOM   2001 N  N   . GLY A 1 263 ? 30.054  71.560  47.294 1.00 46.73 ? 368 GLY A N   1 
ATOM   2002 C  CA  . GLY A 1 263 ? 31.175  71.702  48.222 1.00 46.69 ? 368 GLY A CA  1 
ATOM   2003 C  C   . GLY A 1 263 ? 31.460  70.467  49.057 1.00 46.51 ? 368 GLY A C   1 
ATOM   2004 O  O   . GLY A 1 263 ? 32.550  70.330  49.603 1.00 46.52 ? 368 GLY A O   1 
ATOM   2005 N  N   . ASP A 1 264 ? 30.487  69.568  49.169 1.00 46.50 ? 369 ASP A N   1 
ATOM   2006 C  CA  . ASP A 1 264 ? 30.677  68.326  49.922 1.00 46.50 ? 369 ASP A CA  1 
ATOM   2007 C  C   . ASP A 1 264 ? 31.723  67.425  49.264 1.00 46.39 ? 369 ASP A C   1 
ATOM   2008 O  O   . ASP A 1 264 ? 32.367  66.621  49.944 1.00 46.28 ? 369 ASP A O   1 
ATOM   2009 C  CB  . ASP A 1 264 ? 29.347  67.573  50.093 1.00 46.54 ? 369 ASP A CB  1 
ATOM   2010 C  CG  . ASP A 1 264 ? 28.401  68.249  51.096 1.00 46.91 ? 369 ASP A CG  1 
ATOM   2011 O  OD1 . ASP A 1 264 ? 28.875  68.829  52.102 1.00 46.75 ? 369 ASP A OD1 1 
ATOM   2012 O  OD2 . ASP A 1 264 ? 27.170  68.188  50.882 1.00 47.56 ? 369 ASP A OD2 1 
ATOM   2013 N  N   . GLU A 1 265 ? 31.902  67.578  47.950 1.00 46.33 ? 370 GLU A N   1 
ATOM   2014 C  CA  . GLU A 1 265 ? 32.888  66.797  47.203 1.00 46.22 ? 370 GLU A CA  1 
ATOM   2015 C  C   . GLU A 1 265 ? 34.335  67.145  47.570 1.00 46.28 ? 370 GLU A C   1 
ATOM   2016 O  O   . GLU A 1 265 ? 35.226  66.320  47.379 1.00 46.39 ? 370 GLU A O   1 
ATOM   2017 C  CB  . GLU A 1 265 ? 32.652  66.914  45.684 1.00 46.10 ? 370 GLU A CB  1 
ATOM   2018 C  CG  . GLU A 1 265 ? 33.025  68.262  45.027 1.00 45.89 ? 370 GLU A CG  1 
ATOM   2019 C  CD  . GLU A 1 265 ? 31.850  69.222  44.858 1.00 45.15 ? 370 GLU A CD  1 
ATOM   2020 O  OE1 . GLU A 1 265 ? 31.032  69.369  45.791 1.00 44.39 ? 370 GLU A OE1 1 
ATOM   2021 O  OE2 . GLU A 1 265 ? 31.755  69.845  43.782 1.00 44.40 ? 370 GLU A OE2 1 
ATOM   2022 N  N   . ILE A 1 266 ? 34.562  68.354  48.095 1.00 46.44 ? 371 ILE A N   1 
ATOM   2023 C  CA  . ILE A 1 266 ? 35.894  68.788  48.562 1.00 46.52 ? 371 ILE A CA  1 
ATOM   2024 C  C   . ILE A 1 266 ? 35.972  69.023  50.078 1.00 46.65 ? 371 ILE A C   1 
ATOM   2025 O  O   . ILE A 1 266 ? 36.999  69.473  50.578 1.00 46.58 ? 371 ILE A O   1 
ATOM   2026 C  CB  . ILE A 1 266 ? 36.383  70.076  47.827 1.00 46.55 ? 371 ILE A CB  1 
ATOM   2027 C  CG1 . ILE A 1 266 ? 35.483  71.284  48.139 1.00 46.63 ? 371 ILE A CG1 1 
ATOM   2028 C  CG2 . ILE A 1 266 ? 36.460  69.840  46.323 1.00 46.47 ? 371 ILE A CG2 1 
ATOM   2029 C  CD1 . ILE A 1 266 ? 35.923  72.584  47.458 1.00 46.30 ? 371 ILE A CD1 1 
ATOM   2030 N  N   . GLY A 1 267 ? 34.898  68.714  50.801 1.00 46.98 ? 372 GLY A N   1 
ATOM   2031 C  CA  . GLY A 1 267 ? 34.847  68.911  52.249 1.00 47.24 ? 372 GLY A CA  1 
ATOM   2032 C  C   . GLY A 1 267 ? 34.739  70.369  52.656 1.00 47.45 ? 372 GLY A C   1 
ATOM   2033 O  O   . GLY A 1 267 ? 35.290  70.771  53.678 1.00 47.45 ? 372 GLY A O   1 
ATOM   2034 N  N   . LEU A 1 268 ? 34.014  71.157  51.867 1.00 47.95 ? 373 LEU A N   1 
ATOM   2035 C  CA  . LEU A 1 268 ? 33.924  72.606  52.071 1.00 48.39 ? 373 LEU A CA  1 
ATOM   2036 C  C   . LEU A 1 268 ? 33.335  72.971  53.439 1.00 48.88 ? 373 LEU A C   1 
ATOM   2037 O  O   . LEU A 1 268 ? 32.323  72.406  53.859 1.00 49.09 ? 373 LEU A O   1 
ATOM   2038 C  CB  . LEU A 1 268 ? 33.090  73.244  50.956 1.00 48.28 ? 373 LEU A CB  1 
ATOM   2039 C  CG  . LEU A 1 268 ? 33.040  74.774  50.898 1.00 48.25 ? 373 LEU A CG  1 
ATOM   2040 C  CD1 . LEU A 1 268 ? 34.429  75.379  50.716 1.00 48.05 ? 373 LEU A CD1 1 
ATOM   2041 C  CD2 . LEU A 1 268 ? 32.112  75.226  49.774 1.00 48.49 ? 373 LEU A CD2 1 
ATOM   2042 N  N   . ASP A 1 269 ? 33.976  73.922  54.117 1.00 49.46 ? 374 ASP A N   1 
ATOM   2043 C  CA  . ASP A 1 269 ? 33.607  74.317  55.479 1.00 49.71 ? 374 ASP A CA  1 
ATOM   2044 C  C   . ASP A 1 269 ? 33.289  75.813  55.529 1.00 50.04 ? 374 ASP A C   1 
ATOM   2045 O  O   . ASP A 1 269 ? 34.110  76.639  55.124 1.00 50.04 ? 374 ASP A O   1 
ATOM   2046 C  CB  . ASP A 1 269 ? 34.763  73.995  56.430 1.00 49.80 ? 374 ASP A CB  1 
ATOM   2047 C  CG  . ASP A 1 269 ? 34.336  73.937  57.891 1.00 49.89 ? 374 ASP A CG  1 
ATOM   2048 O  OD1 . ASP A 1 269 ? 33.500  74.761  58.315 1.00 50.07 ? 374 ASP A OD1 1 
ATOM   2049 O  OD2 . ASP A 1 269 ? 34.856  73.066  58.626 1.00 50.81 ? 374 ASP A OD2 1 
ATOM   2050 N  N   . ALA A 1 270 ? 32.100  76.152  56.027 1.00 50.47 ? 375 ALA A N   1 
ATOM   2051 C  CA  . ALA A 1 270 ? 31.674  77.550  56.178 1.00 50.85 ? 375 ALA A CA  1 
ATOM   2052 C  C   . ALA A 1 270 ? 32.584  78.330  57.132 1.00 51.23 ? 375 ALA A C   1 
ATOM   2053 O  O   . ALA A 1 270 ? 33.069  79.409  56.787 1.00 51.43 ? 375 ALA A O   1 
ATOM   2054 C  CB  . ALA A 1 270 ? 30.239  77.614  56.657 1.00 50.93 ? 375 ALA A CB  1 
ATOM   2055 N  N   . ALA A 1 271 ? 32.805  77.791  58.331 1.00 51.59 ? 376 ALA A N   1 
ATOM   2056 C  CA  . ALA A 1 271 ? 33.875  78.284  59.197 1.00 51.90 ? 376 ALA A CA  1 
ATOM   2057 C  C   . ALA A 1 271 ? 35.198  77.919  58.530 1.00 52.29 ? 376 ALA A C   1 
ATOM   2058 O  O   . ALA A 1 271 ? 35.239  77.028  57.688 1.00 52.60 ? 376 ALA A O   1 
ATOM   2059 C  CB  . ALA A 1 271 ? 33.780  77.677  60.583 1.00 51.86 ? 376 ALA A CB  1 
ATOM   2060 N  N   . ALA A 1 272 ? 36.272  78.603  58.905 1.00 52.66 ? 377 ALA A N   1 
ATOM   2061 C  CA  . ALA A 1 272 ? 37.542  78.559  58.163 1.00 52.94 ? 377 ALA A CA  1 
ATOM   2062 C  C   . ALA A 1 272 ? 37.521  79.532  56.979 1.00 53.26 ? 377 ALA A C   1 
ATOM   2063 O  O   . ALA A 1 272 ? 38.523  79.698  56.285 1.00 53.41 ? 377 ALA A O   1 
ATOM   2064 C  CB  . ALA A 1 272 ? 37.889  77.137  57.698 1.00 52.82 ? 377 ALA A CB  1 
ATOM   2065 N  N   . LEU A 1 273 ? 36.377  80.172  56.754 1.00 53.63 ? 378 LEU A N   1 
ATOM   2066 C  CA  . LEU A 1 273 ? 36.270  81.289  55.828 1.00 53.97 ? 378 LEU A CA  1 
ATOM   2067 C  C   . LEU A 1 273 ? 35.584  82.419  56.593 1.00 54.32 ? 378 LEU A C   1 
ATOM   2068 O  O   . LEU A 1 273 ? 34.367  82.586  56.494 1.00 54.23 ? 378 LEU A O   1 
ATOM   2069 C  CB  . LEU A 1 273 ? 35.476  80.881  54.588 1.00 54.01 ? 378 LEU A CB  1 
ATOM   2070 C  CG  . LEU A 1 273 ? 36.134  79.777  53.751 1.00 53.88 ? 378 LEU A CG  1 
ATOM   2071 C  CD1 . LEU A 1 273 ? 35.133  79.116  52.806 1.00 53.72 ? 378 LEU A CD1 1 
ATOM   2072 C  CD2 . LEU A 1 273 ? 37.328  80.330  52.987 1.00 53.74 ? 378 LEU A CD2 1 
ATOM   2073 N  N   . PRO A 1 274 ? 36.368  83.176  57.390 1.00 54.85 ? 379 PRO A N   1 
ATOM   2074 C  CA  . PRO A 1 274 ? 35.855  84.184  58.324 1.00 55.14 ? 379 PRO A CA  1 
ATOM   2075 C  C   . PRO A 1 274 ? 34.784  85.115  57.745 1.00 55.48 ? 379 PRO A C   1 
ATOM   2076 O  O   . PRO A 1 274 ? 34.987  85.723  56.688 1.00 55.35 ? 379 PRO A O   1 
ATOM   2077 C  CB  . PRO A 1 274 ? 37.110  84.979  58.694 1.00 55.17 ? 379 PRO A CB  1 
ATOM   2078 C  CG  . PRO A 1 274 ? 38.209  83.999  58.581 1.00 55.01 ? 379 PRO A CG  1 
ATOM   2079 C  CD  . PRO A 1 274 ? 37.842  83.095  57.443 1.00 54.85 ? 379 PRO A CD  1 
ATOM   2080 N  N   . GLY A 1 275 ? 33.656  85.208  58.448 1.00 55.88 ? 380 GLY A N   1 
ATOM   2081 C  CA  . GLY A 1 275 ? 32.568  86.103  58.071 1.00 56.15 ? 380 GLY A CA  1 
ATOM   2082 C  C   . GLY A 1 275 ? 31.922  85.688  56.769 1.00 56.48 ? 380 GLY A C   1 
ATOM   2083 O  O   . GLY A 1 275 ? 31.976  86.423  55.783 1.00 56.60 ? 380 GLY A O   1 
ATOM   2084 N  N   . GLN A 1 276 ? 31.320  84.501  56.766 1.00 56.81 ? 381 GLN A N   1 
ATOM   2085 C  CA  . GLN A 1 276 ? 30.668  83.969  55.574 1.00 56.98 ? 381 GLN A CA  1 
ATOM   2086 C  C   . GLN A 1 276 ? 29.489  83.079  55.975 1.00 57.15 ? 381 GLN A C   1 
ATOM   2087 O  O   . GLN A 1 276 ? 29.556  82.397  57.002 1.00 57.08 ? 381 GLN A O   1 
ATOM   2088 C  CB  . GLN A 1 276 ? 31.679  83.189  54.728 1.00 57.01 ? 381 GLN A CB  1 
ATOM   2089 C  CG  . GLN A 1 276 ? 31.275  83.031  53.268 1.00 57.15 ? 381 GLN A CG  1 
ATOM   2090 C  CD  . GLN A 1 276 ? 32.461  82.850  52.339 1.00 57.40 ? 381 GLN A CD  1 
ATOM   2091 O  OE1 . GLN A 1 276 ? 33.229  81.895  52.470 1.00 58.28 ? 381 GLN A OE1 1 
ATOM   2092 N  NE2 . GLN A 1 276 ? 32.614  83.768  51.387 1.00 57.44 ? 381 GLN A NE2 1 
ATOM   2093 N  N   . PRO A 1 277 ? 28.405  83.077  55.167 1.00 57.36 ? 382 PRO A N   1 
ATOM   2094 C  CA  . PRO A 1 277 ? 27.216  82.362  55.619 1.00 57.43 ? 382 PRO A CA  1 
ATOM   2095 C  C   . PRO A 1 277 ? 27.384  80.851  55.546 1.00 57.58 ? 382 PRO A C   1 
ATOM   2096 O  O   . PRO A 1 277 ? 28.071  80.340  54.660 1.00 57.71 ? 382 PRO A O   1 
ATOM   2097 C  CB  . PRO A 1 277 ? 26.117  82.819  54.642 1.00 57.50 ? 382 PRO A CB  1 
ATOM   2098 C  CG  . PRO A 1 277 ? 26.734  83.837  53.747 1.00 57.44 ? 382 PRO A CG  1 
ATOM   2099 C  CD  . PRO A 1 277 ? 28.206  83.669  53.832 1.00 57.37 ? 382 PRO A CD  1 
ATOM   2100 N  N   . MET A 1 278 ? 26.739  80.154  56.472 1.00 57.58 ? 383 MET A N   1 
ATOM   2101 C  CA  . MET A 1 278 ? 26.714  78.695  56.485 1.00 57.58 ? 383 MET A CA  1 
ATOM   2102 C  C   . MET A 1 278 ? 25.833  78.177  55.343 1.00 57.40 ? 383 MET A C   1 
ATOM   2103 O  O   . MET A 1 278 ? 25.966  77.035  54.909 1.00 57.55 ? 383 MET A O   1 
ATOM   2104 C  CB  . MET A 1 278 ? 26.179  78.210  57.833 1.00 57.60 ? 383 MET A CB  1 
ATOM   2105 C  CG  . MET A 1 278 ? 26.968  78.744  59.037 1.00 58.06 ? 383 MET A CG  1 
ATOM   2106 S  SD  . MET A 1 278 ? 25.948  79.588  60.284 1.00 58.62 ? 383 MET A SD  1 
ATOM   2107 C  CE  . MET A 1 278 ? 25.824  81.257  59.629 1.00 58.63 ? 383 MET A CE  1 
ATOM   2108 N  N   . GLU A 1 279 ? 24.928  79.029  54.867 1.00 57.19 ? 384 GLU A N   1 
ATOM   2109 C  CA  . GLU A 1 279 ? 24.056  78.704  53.744 1.00 56.99 ? 384 GLU A CA  1 
ATOM   2110 C  C   . GLU A 1 279 ? 24.829  78.708  52.427 1.00 56.60 ? 384 GLU A C   1 
ATOM   2111 O  O   . GLU A 1 279 ? 24.844  77.713  51.706 1.00 56.65 ? 384 GLU A O   1 
ATOM   2112 C  CB  . GLU A 1 279 ? 22.912  79.727  53.673 1.00 57.10 ? 384 GLU A CB  1 
ATOM   2113 C  CG  . GLU A 1 279 ? 21.939  79.547  52.498 1.00 57.36 ? 384 GLU A CG  1 
ATOM   2114 C  CD  . GLU A 1 279 ? 21.076  80.787  52.252 1.00 57.59 ? 384 GLU A CD  1 
ATOM   2115 O  OE1 . GLU A 1 279 ? 21.641  81.901  52.137 1.00 58.53 ? 384 GLU A OE1 1 
ATOM   2116 O  OE2 . GLU A 1 279 ? 19.833  80.646  52.171 1.00 57.77 ? 384 GLU A OE2 1 
ATOM   2117 N  N   . ALA A 1 280 ? 25.468  79.836  52.129 1.00 56.11 ? 385 ALA A N   1 
ATOM   2118 C  CA  . ALA A 1 280 ? 26.086  80.070  50.828 1.00 55.66 ? 385 ALA A CA  1 
ATOM   2119 C  C   . ALA A 1 280 ? 27.556  80.461  50.950 1.00 55.24 ? 385 ALA A C   1 
ATOM   2120 O  O   . ALA A 1 280 ? 27.928  81.588  50.619 1.00 55.14 ? 385 ALA A O   1 
ATOM   2121 C  CB  . ALA A 1 280 ? 25.314  81.150  50.081 1.00 55.63 ? 385 ALA A CB  1 
ATOM   2122 N  N   . PRO A 1 281 ? 28.399  79.528  51.429 1.00 54.83 ? 386 PRO A N   1 
ATOM   2123 C  CA  . PRO A 1 281 ? 29.840  79.756  51.391 1.00 54.52 ? 386 PRO A CA  1 
ATOM   2124 C  C   . PRO A 1 281 ? 30.389  79.650  49.966 1.00 54.18 ? 386 PRO A C   1 
ATOM   2125 O  O   . PRO A 1 281 ? 29.905  78.850  49.162 1.00 54.04 ? 386 PRO A O   1 
ATOM   2126 C  CB  . PRO A 1 281 ? 30.396  78.647  52.287 1.00 54.42 ? 386 PRO A CB  1 
ATOM   2127 C  CG  . PRO A 1 281 ? 29.397  77.564  52.215 1.00 54.61 ? 386 PRO A CG  1 
ATOM   2128 C  CD  . PRO A 1 281 ? 28.064  78.224  52.032 1.00 54.85 ? 386 PRO A CD  1 
ATOM   2129 N  N   . VAL A 1 282 ? 31.390  80.468  49.665 1.00 53.88 ? 387 VAL A N   1 
ATOM   2130 C  CA  . VAL A 1 282 ? 31.974  80.520  48.332 1.00 53.71 ? 387 VAL A CA  1 
ATOM   2131 C  C   . VAL A 1 282 ? 32.636  79.187  47.973 1.00 53.39 ? 387 VAL A C   1 
ATOM   2132 O  O   . VAL A 1 282 ? 33.369  78.612  48.779 1.00 53.23 ? 387 VAL A O   1 
ATOM   2133 C  CB  . VAL A 1 282 ? 33.003  81.682  48.226 1.00 53.75 ? 387 VAL A CB  1 
ATOM   2134 C  CG1 . VAL A 1 282 ? 33.875  81.557  46.969 1.00 53.94 ? 387 VAL A CG1 1 
ATOM   2135 C  CG2 . VAL A 1 282 ? 32.282  83.019  48.245 1.00 53.80 ? 387 VAL A CG2 1 
ATOM   2136 N  N   . MET A 1 283 ? 32.361  78.705  46.764 1.00 53.06 ? 388 MET A N   1 
ATOM   2137 C  CA  . MET A 1 283 ? 32.978  77.485  46.251 1.00 52.98 ? 388 MET A CA  1 
ATOM   2138 C  C   . MET A 1 283 ? 34.446  77.759  45.928 1.00 52.85 ? 388 MET A C   1 
ATOM   2139 O  O   . MET A 1 283 ? 34.784  78.832  45.420 1.00 52.75 ? 388 MET A O   1 
ATOM   2140 C  CB  . MET A 1 283 ? 32.238  77.003  45.002 1.00 52.76 ? 388 MET A CB  1 
ATOM   2141 C  CG  . MET A 1 283 ? 32.764  75.711  44.392 1.00 52.81 ? 388 MET A CG  1 
ATOM   2142 S  SD  . MET A 1 283 ? 32.520  74.255  45.425 1.00 52.10 ? 388 MET A SD  1 
ATOM   2143 C  CE  . MET A 1 283 ? 33.084  72.972  44.318 1.00 51.98 ? 388 MET A CE  1 
ATOM   2144 N  N   . LEU A 1 284 ? 35.301  76.778  46.221 1.00 52.70 ? 389 LEU A N   1 
ATOM   2145 C  CA  . LEU A 1 284 ? 36.752  76.932  46.122 1.00 52.66 ? 389 LEU A CA  1 
ATOM   2146 C  C   . LEU A 1 284 ? 37.333  76.151  44.936 1.00 52.53 ? 389 LEU A C   1 
ATOM   2147 O  O   . LEU A 1 284 ? 37.645  74.963  45.052 1.00 52.33 ? 389 LEU A O   1 
ATOM   2148 C  CB  . LEU A 1 284 ? 37.409  76.483  47.434 1.00 52.65 ? 389 LEU A CB  1 
ATOM   2149 C  CG  . LEU A 1 284 ? 36.951  77.209  48.707 1.00 52.78 ? 389 LEU A CG  1 
ATOM   2150 C  CD1 . LEU A 1 284 ? 37.605  76.612  49.946 1.00 52.96 ? 389 LEU A CD1 1 
ATOM   2151 C  CD2 . LEU A 1 284 ? 37.247  78.698  48.628 1.00 52.87 ? 389 LEU A CD2 1 
ATOM   2152 N  N   . TRP A 1 285 ? 37.478  76.836  43.800 1.00 52.50 ? 390 TRP A N   1 
ATOM   2153 C  CA  . TRP A 1 285 ? 38.007  76.231  42.570 1.00 52.60 ? 390 TRP A CA  1 
ATOM   2154 C  C   . TRP A 1 285 ? 39.532  76.217  42.569 1.00 52.72 ? 390 TRP A C   1 
ATOM   2155 O  O   . TRP A 1 285 ? 40.153  75.224  42.183 1.00 52.48 ? 390 TRP A O   1 
ATOM   2156 C  CB  . TRP A 1 285 ? 37.512  76.993  41.338 1.00 52.35 ? 390 TRP A CB  1 
ATOM   2157 C  CG  . TRP A 1 285 ? 36.020  77.080  41.241 1.00 52.26 ? 390 TRP A CG  1 
ATOM   2158 C  CD1 . TRP A 1 285 ? 35.245  78.147  41.571 1.00 52.08 ? 390 TRP A CD1 1 
ATOM   2159 C  CD2 . TRP A 1 285 ? 35.123  76.053  40.793 1.00 52.26 ? 390 TRP A CD2 1 
ATOM   2160 N  NE1 . TRP A 1 285 ? 33.922  77.856  41.354 1.00 52.12 ? 390 TRP A NE1 1 
ATOM   2161 C  CE2 . TRP A 1 285 ? 33.817  76.576  40.878 1.00 51.98 ? 390 TRP A CE2 1 
ATOM   2162 C  CE3 . TRP A 1 285 ? 35.298  74.740  40.332 1.00 52.23 ? 390 TRP A CE3 1 
ATOM   2163 C  CZ2 . TRP A 1 285 ? 32.689  75.838  40.511 1.00 52.05 ? 390 TRP A CZ2 1 
ATOM   2164 C  CZ3 . TRP A 1 285 ? 34.175  74.006  39.972 1.00 52.21 ? 390 TRP A CZ3 1 
ATOM   2165 C  CH2 . TRP A 1 285 ? 32.888  74.558  40.065 1.00 52.08 ? 390 TRP A CH2 1 
ATOM   2166 N  N   . ASP A 1 286 ? 40.122  77.333  42.995 1.00 53.08 ? 391 ASP A N   1 
ATOM   2167 C  CA  . ASP A 1 286 ? 41.577  77.473  43.097 1.00 53.32 ? 391 ASP A CA  1 
ATOM   2168 C  C   . ASP A 1 286 ? 41.930  78.601  44.086 1.00 53.47 ? 391 ASP A C   1 
ATOM   2169 O  O   . ASP A 1 286 ? 41.070  79.024  44.861 1.00 53.47 ? 391 ASP A O   1 
ATOM   2170 C  CB  . ASP A 1 286 ? 42.182  77.694  41.700 1.00 53.39 ? 391 ASP A CB  1 
ATOM   2171 C  CG  . ASP A 1 286 ? 41.505  78.818  40.936 1.00 53.73 ? 391 ASP A CG  1 
ATOM   2172 O  OD1 . ASP A 1 286 ? 41.493  79.964  41.434 1.00 54.18 ? 391 ASP A OD1 1 
ATOM   2173 O  OD2 . ASP A 1 286 ? 40.993  78.552  39.828 1.00 54.13 ? 391 ASP A OD2 1 
ATOM   2174 N  N   . GLU A 1 287 ? 43.180  79.071  44.073 1.00 53.68 ? 392 GLU A N   1 
ATOM   2175 C  CA  . GLU A 1 287 ? 43.643  80.109  45.015 1.00 53.84 ? 392 GLU A CA  1 
ATOM   2176 C  C   . GLU A 1 287 ? 42.949  81.465  44.885 1.00 53.98 ? 392 GLU A C   1 
ATOM   2177 O  O   . GLU A 1 287 ? 42.831  82.194  45.875 1.00 54.02 ? 392 GLU A O   1 
ATOM   2178 C  CB  . GLU A 1 287 ? 45.161  80.322  44.896 1.00 53.92 ? 392 GLU A CB  1 
ATOM   2179 C  CG  . GLU A 1 287 ? 45.973  79.772  46.062 1.00 54.20 ? 392 GLU A CG  1 
ATOM   2180 C  CD  . GLU A 1 287 ? 45.995  78.260  46.103 1.00 54.58 ? 392 GLU A CD  1 
ATOM   2181 O  OE1 . GLU A 1 287 ? 47.097  77.681  45.979 1.00 54.91 ? 392 GLU A OE1 1 
ATOM   2182 O  OE2 . GLU A 1 287 ? 44.914  77.650  46.251 1.00 54.72 ? 392 GLU A OE2 1 
ATOM   2183 N  N   . SER A 1 288 ? 42.507  81.806  43.674 1.00 54.09 ? 393 SER A N   1 
ATOM   2184 C  CA  . SER A 1 288 ? 41.893  83.111  43.408 1.00 54.12 ? 393 SER A CA  1 
ATOM   2185 C  C   . SER A 1 288 ? 40.396  83.168  43.742 1.00 54.18 ? 393 SER A C   1 
ATOM   2186 O  O   . SER A 1 288 ? 39.787  84.230  43.652 1.00 54.24 ? 393 SER A O   1 
ATOM   2187 C  CB  . SER A 1 288 ? 42.113  83.508  41.946 1.00 54.07 ? 393 SER A CB  1 
ATOM   2188 O  OG  . SER A 1 288 ? 41.462  82.607  41.069 1.00 54.05 ? 393 SER A OG  1 
ATOM   2189 N  N   . SER A 1 289 ? 39.809  82.037  44.126 1.00 54.30 ? 394 SER A N   1 
ATOM   2190 C  CA  . SER A 1 289 ? 38.387  81.987  44.476 1.00 54.46 ? 394 SER A CA  1 
ATOM   2191 C  C   . SER A 1 289 ? 38.045  82.767  45.754 1.00 54.64 ? 394 SER A C   1 
ATOM   2192 O  O   . SER A 1 289 ? 36.929  83.273  45.886 1.00 54.78 ? 394 SER A O   1 
ATOM   2193 C  CB  . SER A 1 289 ? 37.921  80.535  44.618 1.00 54.47 ? 394 SER A CB  1 
ATOM   2194 O  OG  . SER A 1 289 ? 38.041  79.842  43.389 1.00 54.45 ? 394 SER A OG  1 
ATOM   2195 N  N   . PHE A 1 290 ? 38.990  82.852  46.691 1.00 54.78 ? 395 PHE A N   1 
ATOM   2196 C  CA  . PHE A 1 290 ? 38.817  83.666  47.897 1.00 54.76 ? 395 PHE A CA  1 
ATOM   2197 C  C   . PHE A 1 290 ? 39.919  84.731  47.961 1.00 54.78 ? 395 PHE A C   1 
ATOM   2198 O  O   . PHE A 1 290 ? 41.011  84.470  48.465 1.00 54.80 ? 395 PHE A O   1 
ATOM   2199 C  CB  . PHE A 1 290 ? 38.821  82.785  49.153 1.00 54.92 ? 395 PHE A CB  1 
ATOM   2200 C  CG  . PHE A 1 290 ? 38.195  83.438  50.367 1.00 55.03 ? 395 PHE A CG  1 
ATOM   2201 C  CD1 . PHE A 1 290 ? 36.825  83.352  50.591 1.00 55.39 ? 395 PHE A CD1 1 
ATOM   2202 C  CD2 . PHE A 1 290 ? 38.975  84.124  51.295 1.00 55.45 ? 395 PHE A CD2 1 
ATOM   2203 C  CE1 . PHE A 1 290 ? 36.241  83.946  51.713 1.00 55.26 ? 395 PHE A CE1 1 
ATOM   2204 C  CE2 . PHE A 1 290 ? 38.396  84.716  52.421 1.00 55.22 ? 395 PHE A CE2 1 
ATOM   2205 C  CZ  . PHE A 1 290 ? 37.029  84.627  52.626 1.00 55.15 ? 395 PHE A CZ  1 
ATOM   2206 N  N   . PRO A 1 291 ? 39.643  85.931  47.419 1.00 54.83 ? 396 PRO A N   1 
ATOM   2207 C  CA  . PRO A 1 291 ? 40.599  87.034  47.485 1.00 54.80 ? 396 PRO A CA  1 
ATOM   2208 C  C   . PRO A 1 291 ? 40.542  87.824  48.800 1.00 54.79 ? 396 PRO A C   1 
ATOM   2209 O  O   . PRO A 1 291 ? 41.583  88.299  49.266 1.00 54.77 ? 396 PRO A O   1 
ATOM   2210 C  CB  . PRO A 1 291 ? 40.178  87.921  46.310 1.00 54.81 ? 396 PRO A CB  1 
ATOM   2211 C  CG  . PRO A 1 291 ? 38.715  87.708  46.185 1.00 54.78 ? 396 PRO A CG  1 
ATOM   2212 C  CD  . PRO A 1 291 ? 38.421  86.314  46.683 1.00 54.90 ? 396 PRO A CD  1 
ATOM   2213 N  N   . ASP A 1 292 ? 39.344  87.950  49.380 1.00 54.72 ? 397 ASP A N   1 
ATOM   2214 C  CA  . ASP A 1 292 ? 39.104  88.785  50.574 1.00 54.64 ? 397 ASP A CA  1 
ATOM   2215 C  C   . ASP A 1 292 ? 40.214  88.667  51.622 1.00 54.51 ? 397 ASP A C   1 
ATOM   2216 O  O   . ASP A 1 292 ? 40.802  89.667  52.025 1.00 54.43 ? 397 ASP A O   1 
ATOM   2217 C  CB  . ASP A 1 292 ? 37.753  88.435  51.223 1.00 54.70 ? 397 ASP A CB  1 
ATOM   2218 C  CG  . ASP A 1 292 ? 36.553  88.761  50.331 1.00 55.04 ? 397 ASP A CG  1 
ATOM   2219 O  OD1 . ASP A 1 292 ? 36.692  89.553  49.372 1.00 55.25 ? 397 ASP A OD1 1 
ATOM   2220 O  OD2 . ASP A 1 292 ? 35.456  88.220  50.599 1.00 55.72 ? 397 ASP A OD2 1 
ATOM   2221 N  N   . ILE A 1 293 ? 40.489  87.438  52.052 1.00 54.42 ? 398 ILE A N   1 
ATOM   2222 C  CA  . ILE A 1 293 ? 41.580  87.150  52.988 1.00 54.30 ? 398 ILE A CA  1 
ATOM   2223 C  C   . ILE A 1 293 ? 42.520  86.157  52.298 1.00 54.14 ? 398 ILE A C   1 
ATOM   2224 O  O   . ILE A 1 293 ? 42.178  84.978  52.157 1.00 54.24 ? 398 ILE A O   1 
ATOM   2225 C  CB  . ILE A 1 293 ? 41.071  86.544  54.321 1.00 54.35 ? 398 ILE A CB  1 
ATOM   2226 C  CG1 . ILE A 1 293 ? 39.799  87.254  54.802 1.00 54.50 ? 398 ILE A CG1 1 
ATOM   2227 C  CG2 . ILE A 1 293 ? 42.148  86.638  55.385 1.00 54.33 ? 398 ILE A CG2 1 
ATOM   2228 C  CD1 . ILE A 1 293 ? 39.056  86.500  55.892 1.00 54.52 ? 398 ILE A CD1 1 
ATOM   2229 N  N   . PRO A 1 294 ? 43.706  86.626  51.866 1.00 53.77 ? 399 PRO A N   1 
ATOM   2230 C  CA  . PRO A 1 294 ? 44.538  85.853  50.931 1.00 53.52 ? 399 PRO A CA  1 
ATOM   2231 C  C   . PRO A 1 294 ? 44.955  84.450  51.409 1.00 53.26 ? 399 PRO A C   1 
ATOM   2232 O  O   . PRO A 1 294 ? 44.530  83.451  50.822 1.00 53.29 ? 399 PRO A O   1 
ATOM   2233 C  CB  . PRO A 1 294 ? 45.768  86.753  50.718 1.00 53.56 ? 399 PRO A CB  1 
ATOM   2234 C  CG  . PRO A 1 294 ? 45.766  87.713  51.855 1.00 53.70 ? 399 PRO A CG  1 
ATOM   2235 C  CD  . PRO A 1 294 ? 44.338  87.903  52.243 1.00 53.79 ? 399 PRO A CD  1 
ATOM   2236 N  N   . GLY A 1 295 ? 45.762  84.382  52.465 1.00 52.87 ? 400 GLY A N   1 
ATOM   2237 C  CA  . GLY A 1 295 ? 46.392  83.129  52.885 1.00 52.48 ? 400 GLY A CA  1 
ATOM   2238 C  C   . GLY A 1 295 ? 45.484  82.071  53.492 1.00 52.16 ? 400 GLY A C   1 
ATOM   2239 O  O   . GLY A 1 295 ? 45.907  80.928  53.672 1.00 52.25 ? 400 GLY A O   1 
ATOM   2240 N  N   . ALA A 1 296 ? 44.242  82.435  53.809 1.00 51.69 ? 401 ALA A N   1 
ATOM   2241 C  CA  . ALA A 1 296 ? 43.304  81.512  54.462 1.00 51.28 ? 401 ALA A CA  1 
ATOM   2242 C  C   . ALA A 1 296 ? 43.018  80.253  53.637 1.00 50.90 ? 401 ALA A C   1 
ATOM   2243 O  O   . ALA A 1 296 ? 42.808  79.181  54.202 1.00 51.01 ? 401 ALA A O   1 
ATOM   2244 C  CB  . ALA A 1 296 ? 41.998  82.232  54.804 1.00 51.29 ? 401 ALA A CB  1 
ATOM   2245 N  N   . VAL A 1 297 ? 43.009  80.386  52.312 1.00 50.38 ? 402 VAL A N   1 
ATOM   2246 C  CA  . VAL A 1 297 ? 42.799  79.250  51.412 1.00 49.96 ? 402 VAL A CA  1 
ATOM   2247 C  C   . VAL A 1 297 ? 44.140  78.676  50.961 1.00 49.58 ? 402 VAL A C   1 
ATOM   2248 O  O   . VAL A 1 297 ? 45.089  79.421  50.721 1.00 49.69 ? 402 VAL A O   1 
ATOM   2249 C  CB  . VAL A 1 297 ? 41.961  79.664  50.181 1.00 49.92 ? 402 VAL A CB  1 
ATOM   2250 C  CG1 . VAL A 1 297 ? 41.969  78.577  49.109 1.00 49.90 ? 402 VAL A CG1 1 
ATOM   2251 C  CG2 . VAL A 1 297 ? 40.534  79.983  50.604 1.00 49.91 ? 402 VAL A CG2 1 
ATOM   2252 N  N   . SER A 1 298 ? 44.205  77.349  50.862 1.00 49.14 ? 403 SER A N   1 
ATOM   2253 C  CA  . SER A 1 298 ? 45.382  76.640  50.355 1.00 48.78 ? 403 SER A CA  1 
ATOM   2254 C  C   . SER A 1 298 ? 44.981  75.679  49.229 1.00 48.47 ? 403 SER A C   1 
ATOM   2255 O  O   . SER A 1 298 ? 43.793  75.492  48.953 1.00 48.44 ? 403 SER A O   1 
ATOM   2256 C  CB  . SER A 1 298 ? 46.065  75.871  51.485 1.00 48.69 ? 403 SER A CB  1 
ATOM   2257 O  OG  . SER A 1 298 ? 45.255  74.799  51.928 1.00 48.74 ? 403 SER A OG  1 
ATOM   2258 N  N   . ALA A 1 299 ? 45.974  75.069  48.590 1.00 48.09 ? 404 ALA A N   1 
ATOM   2259 C  CA  . ALA A 1 299 ? 45.736  74.243  47.405 1.00 47.83 ? 404 ALA A CA  1 
ATOM   2260 C  C   . ALA A 1 299 ? 44.954  72.972  47.710 1.00 47.60 ? 404 ALA A C   1 
ATOM   2261 O  O   . ALA A 1 299 ? 44.120  72.555  46.911 1.00 47.74 ? 404 ALA A O   1 
ATOM   2262 C  CB  . ALA A 1 299 ? 47.047  73.895  46.725 1.00 47.82 ? 404 ALA A CB  1 
ATOM   2263 N  N   . ASN A 1 300 ? 45.215  72.353  48.856 1.00 47.31 ? 405 ASN A N   1 
ATOM   2264 C  CA  . ASN A 1 300 ? 44.498  71.126  49.223 1.00 47.07 ? 405 ASN A CA  1 
ATOM   2265 C  C   . ASN A 1 300 ? 43.024  71.327  49.620 1.00 46.87 ? 405 ASN A C   1 
ATOM   2266 O  O   . ASN A 1 300 ? 42.282  70.349  49.730 1.00 47.04 ? 405 ASN A O   1 
ATOM   2267 C  CB  . ASN A 1 300 ? 45.261  70.320  50.291 1.00 47.07 ? 405 ASN A CB  1 
ATOM   2268 C  CG  . ASN A 1 300 ? 45.348  71.022  51.641 1.00 46.98 ? 405 ASN A CG  1 
ATOM   2269 O  OD1 . ASN A 1 300 ? 45.941  70.487  52.575 1.00 46.45 ? 405 ASN A OD1 1 
ATOM   2270 N  ND2 . ASN A 1 300 ? 44.769  72.209  51.752 1.00 47.41 ? 405 ASN A ND2 1 
ATOM   2271 N  N   . MET A 1 301 ? 42.607  72.582  49.818 1.00 46.48 ? 406 MET A N   1 
ATOM   2272 C  CA  . MET A 1 301 ? 41.194  72.923  50.046 1.00 46.22 ? 406 MET A CA  1 
ATOM   2273 C  C   . MET A 1 301 ? 40.403  73.161  48.746 1.00 46.08 ? 406 MET A C   1 
ATOM   2274 O  O   . MET A 1 301 ? 39.185  73.334  48.793 1.00 45.99 ? 406 MET A O   1 
ATOM   2275 C  CB  . MET A 1 301 ? 41.077  74.179  50.921 1.00 46.13 ? 406 MET A CB  1 
ATOM   2276 C  CG  . MET A 1 301 ? 41.603  74.022  52.336 1.00 46.04 ? 406 MET A CG  1 
ATOM   2277 S  SD  . MET A 1 301 ? 41.646  75.581  53.261 1.00 45.87 ? 406 MET A SD  1 
ATOM   2278 C  CE  . MET A 1 301 ? 39.895  75.874  53.516 1.00 45.60 ? 406 MET A CE  1 
ATOM   2279 N  N   . THR A 1 302 ? 41.084  73.177  47.597 1.00 45.97 ? 407 THR A N   1 
ATOM   2280 C  CA  . THR A 1 302 ? 40.451  73.533  46.324 1.00 45.87 ? 407 THR A CA  1 
ATOM   2281 C  C   . THR A 1 302 ? 40.176  72.332  45.430 1.00 45.88 ? 407 THR A C   1 
ATOM   2282 O  O   . THR A 1 302 ? 40.736  71.253  45.624 1.00 45.75 ? 407 THR A O   1 
ATOM   2283 C  CB  . THR A 1 302 ? 41.325  74.495  45.503 1.00 45.74 ? 407 THR A CB  1 
ATOM   2284 O  OG1 . THR A 1 302 ? 42.555  73.848  45.159 1.00 45.40 ? 407 THR A OG1 1 
ATOM   2285 C  CG2 . THR A 1 302 ? 41.606  75.770  46.275 1.00 45.90 ? 407 THR A CG2 1 
ATOM   2286 N  N   . VAL A 1 303 ? 39.321  72.553  44.433 1.00 45.90 ? 408 VAL A N   1 
ATOM   2287 C  CA  . VAL A 1 303 ? 39.059  71.570  43.387 1.00 45.99 ? 408 VAL A CA  1 
ATOM   2288 C  C   . VAL A 1 303 ? 40.334  71.304  42.586 1.00 45.97 ? 408 VAL A C   1 
ATOM   2289 O  O   . VAL A 1 303 ? 40.720  70.152  42.382 1.00 45.84 ? 408 VAL A O   1 
ATOM   2290 C  CB  . VAL A 1 303 ? 37.956  72.065  42.422 1.00 46.14 ? 408 VAL A CB  1 
ATOM   2291 C  CG1 . VAL A 1 303 ? 37.829  71.133  41.203 1.00 46.23 ? 408 VAL A CG1 1 
ATOM   2292 C  CG2 . VAL A 1 303 ? 36.617  72.200  43.152 1.00 46.05 ? 408 VAL A CG2 1 
ATOM   2293 N  N   . LYS A 1 304 ? 40.975  72.384  42.143 1.00 46.09 ? 409 LYS A N   1 
ATOM   2294 C  CA  . LYS A 1 304 ? 42.208  72.317  41.353 1.00 46.06 ? 409 LYS A CA  1 
ATOM   2295 C  C   . LYS A 1 304 ? 43.280  71.472  42.036 1.00 46.06 ? 409 LYS A C   1 
ATOM   2296 O  O   . LYS A 1 304 ? 43.836  70.555  41.425 1.00 46.13 ? 409 LYS A O   1 
ATOM   2297 C  CB  . LYS A 1 304 ? 42.732  73.731  41.089 1.00 45.99 ? 409 LYS A CB  1 
ATOM   2298 C  CG  . LYS A 1 304 ? 44.024  73.794  40.286 1.00 46.20 ? 409 LYS A CG  1 
ATOM   2299 C  CD  . LYS A 1 304 ? 44.085  75.055  39.438 1.00 46.23 ? 409 LYS A CD  1 
ATOM   2300 C  CE  . LYS A 1 304 ? 45.405  75.184  38.707 1.00 46.26 ? 409 LYS A CE  1 
ATOM   2301 N  NZ  . LYS A 1 304 ? 46.437  75.836  39.555 1.00 46.78 ? 409 LYS A NZ  1 
ATOM   2302 N  N   . GLY A 1 305 ? 43.552  71.773  43.303 1.00 46.04 ? 410 GLY A N   1 
ATOM   2303 C  CA  . GLY A 1 305 ? 44.543  71.032  44.078 1.00 46.14 ? 410 GLY A CA  1 
ATOM   2304 C  C   . GLY A 1 305 ? 44.157  69.595  44.395 1.00 46.22 ? 410 GLY A C   1 
ATOM   2305 O  O   . GLY A 1 305 ? 45.005  68.708  44.378 1.00 46.09 ? 410 GLY A O   1 
ATOM   2306 N  N   . GLN A 1 306 ? 42.881  69.355  44.689 1.00 46.44 ? 411 GLN A N   1 
ATOM   2307 C  CA  . GLN A 1 306 ? 42.416  67.998  44.989 1.00 46.53 ? 411 GLN A CA  1 
ATOM   2308 C  C   . GLN A 1 306 ? 42.255  67.139  43.735 1.00 46.72 ? 411 GLN A C   1 
ATOM   2309 O  O   . GLN A 1 306 ? 42.185  65.913  43.831 1.00 46.62 ? 411 GLN A O   1 
ATOM   2310 C  CB  . GLN A 1 306 ? 41.116  68.029  45.792 1.00 46.47 ? 411 GLN A CB  1 
ATOM   2311 C  CG  . GLN A 1 306 ? 41.317  68.511  47.223 1.00 46.39 ? 411 GLN A CG  1 
ATOM   2312 C  CD  . GLN A 1 306 ? 40.034  68.554  48.020 1.00 45.99 ? 411 GLN A CD  1 
ATOM   2313 O  OE1 . GLN A 1 306 ? 39.092  67.821  47.739 1.00 44.83 ? 411 GLN A OE1 1 
ATOM   2314 N  NE2 . GLN A 1 306 ? 39.994  69.417  49.024 1.00 44.92 ? 411 GLN A NE2 1 
ATOM   2315 N  N   . SER A 1 307 ? 42.208  67.775  42.567 1.00 46.94 ? 412 SER A N   1 
ATOM   2316 C  CA  . SER A 1 307 ? 42.183  67.039  41.302 1.00 47.32 ? 412 SER A CA  1 
ATOM   2317 C  C   . SER A 1 307 ? 43.531  66.365  41.000 1.00 47.56 ? 412 SER A C   1 
ATOM   2318 O  O   . SER A 1 307 ? 43.584  65.389  40.249 1.00 47.27 ? 412 SER A O   1 
ATOM   2319 C  CB  . SER A 1 307 ? 41.773  67.958  40.146 1.00 47.36 ? 412 SER A CB  1 
ATOM   2320 O  OG  . SER A 1 307 ? 40.421  68.368  40.280 1.00 47.27 ? 412 SER A OG  1 
ATOM   2321 N  N   . GLU A 1 308 ? 44.609  66.881  41.590 1.00 47.94 ? 413 GLU A N   1 
ATOM   2322 C  CA  . GLU A 1 308 ? 45.938  66.288  41.423 1.00 48.23 ? 413 GLU A CA  1 
ATOM   2323 C  C   . GLU A 1 308 ? 46.126  65.083  42.340 1.00 48.36 ? 413 GLU A C   1 
ATOM   2324 O  O   . GLU A 1 308 ? 46.410  63.979  41.871 1.00 48.69 ? 413 GLU A O   1 
ATOM   2325 C  CB  . GLU A 1 308 ? 47.040  67.318  41.696 1.00 48.51 ? 413 GLU A CB  1 
ATOM   2326 C  CG  . GLU A 1 308 ? 46.951  68.597  40.858 1.00 49.60 ? 413 GLU A CG  1 
ATOM   2327 C  CD  . GLU A 1 308 ? 47.153  68.374  39.357 1.00 51.42 ? 413 GLU A CD  1 
ATOM   2328 O  OE1 . GLU A 1 308 ? 47.452  67.233  38.924 1.00 52.54 ? 413 GLU A OE1 1 
ATOM   2329 O  OE2 . GLU A 1 308 ? 47.017  69.363  38.601 1.00 52.48 ? 413 GLU A OE2 1 
ATOM   2330 N  N   . ASP A 1 309 ? 45.955  65.306  43.643 1.00 48.31 ? 414 ASP A N   1 
ATOM   2331 C  CA  . ASP A 1 309 ? 46.155  64.273  44.666 1.00 48.04 ? 414 ASP A CA  1 
ATOM   2332 C  C   . ASP A 1 309 ? 45.134  63.138  44.537 1.00 47.85 ? 414 ASP A C   1 
ATOM   2333 O  O   . ASP A 1 309 ? 43.933  63.370  44.697 1.00 47.94 ? 414 ASP A O   1 
ATOM   2334 C  CB  . ASP A 1 309 ? 46.051  64.911  46.060 1.00 48.23 ? 414 ASP A CB  1 
ATOM   2335 C  CG  . ASP A 1 309 ? 46.279  63.919  47.197 1.00 48.65 ? 414 ASP A CG  1 
ATOM   2336 O  OD1 . ASP A 1 309 ? 46.769  62.792  46.947 1.00 49.69 ? 414 ASP A OD1 1 
ATOM   2337 O  OD2 . ASP A 1 309 ? 45.967  64.278  48.357 1.00 49.30 ? 414 ASP A OD2 1 
ATOM   2338 N  N   . PRO A 1 310 ? 45.602  61.906  44.243 1.00 47.52 ? 415 PRO A N   1 
ATOM   2339 C  CA  . PRO A 1 310 ? 44.688  60.757  44.251 1.00 47.27 ? 415 PRO A CA  1 
ATOM   2340 C  C   . PRO A 1 310 ? 44.140  60.428  45.645 1.00 46.98 ? 415 PRO A C   1 
ATOM   2341 O  O   . PRO A 1 310 ? 43.086  59.812  45.761 1.00 46.93 ? 415 PRO A O   1 
ATOM   2342 C  CB  . PRO A 1 310 ? 45.559  59.602  43.735 1.00 47.24 ? 415 PRO A CB  1 
ATOM   2343 C  CG  . PRO A 1 310 ? 46.746  60.240  43.115 1.00 47.36 ? 415 PRO A CG  1 
ATOM   2344 C  CD  . PRO A 1 310 ? 46.969  61.500  43.874 1.00 47.53 ? 415 PRO A CD  1 
ATOM   2345 N  N   . GLY A 1 311 ? 44.849  60.838  46.691 1.00 46.66 ? 416 GLY A N   1 
ATOM   2346 C  CA  . GLY A 1 311 ? 44.412  60.580  48.061 1.00 46.36 ? 416 GLY A CA  1 
ATOM   2347 C  C   . GLY A 1 311 ? 43.318  61.489  48.594 1.00 45.96 ? 416 GLY A C   1 
ATOM   2348 O  O   . GLY A 1 311 ? 42.830  61.267  49.698 1.00 45.70 ? 416 GLY A O   1 
ATOM   2349 N  N   . SER A 1 312 ? 42.923  62.499  47.816 1.00 45.59 ? 417 SER A N   1 
ATOM   2350 C  CA  . SER A 1 312 ? 42.009  63.545  48.295 1.00 45.24 ? 417 SER A CA  1 
ATOM   2351 C  C   . SER A 1 312 ? 40.567  63.070  48.489 1.00 44.93 ? 417 SER A C   1 
ATOM   2352 O  O   . SER A 1 312 ? 40.211  61.942  48.144 1.00 44.75 ? 417 SER A O   1 
ATOM   2353 C  CB  . SER A 1 312 ? 42.029  64.752  47.345 1.00 45.10 ? 417 SER A CB  1 
ATOM   2354 O  OG  . SER A 1 312 ? 41.396  64.456  46.113 1.00 44.66 ? 417 SER A OG  1 
ATOM   2355 N  N   . LEU A 1 313 ? 39.755  63.956  49.058 1.00 44.71 ? 418 LEU A N   1 
ATOM   2356 C  CA  . LEU A 1 313 ? 38.332  63.715  49.263 1.00 44.54 ? 418 LEU A CA  1 
ATOM   2357 C  C   . LEU A 1 313 ? 37.592  63.764  47.939 1.00 44.21 ? 418 LEU A C   1 
ATOM   2358 O  O   . LEU A 1 313 ? 36.647  63.008  47.728 1.00 44.18 ? 418 LEU A O   1 
ATOM   2359 C  CB  . LEU A 1 313 ? 37.753  64.761  50.225 1.00 44.59 ? 418 LEU A CB  1 
ATOM   2360 C  CG  . LEU A 1 313 ? 36.369  64.507  50.832 1.00 44.88 ? 418 LEU A CG  1 
ATOM   2361 C  CD1 . LEU A 1 313 ? 36.255  63.103  51.419 1.00 45.34 ? 418 LEU A CD1 1 
ATOM   2362 C  CD2 . LEU A 1 313 ? 36.066  65.546  51.898 1.00 44.84 ? 418 LEU A CD2 1 
ATOM   2363 N  N   . LEU A 1 314 ? 38.027  64.655  47.052 1.00 43.99 ? 419 LEU A N   1 
ATOM   2364 C  CA  . LEU A 1 314 ? 37.466  64.756  45.703 1.00 43.93 ? 419 LEU A CA  1 
ATOM   2365 C  C   . LEU A 1 314 ? 37.695  63.485  44.895 1.00 43.63 ? 419 LEU A C   1 
ATOM   2366 O  O   . LEU A 1 314 ? 36.836  63.096  44.110 1.00 43.23 ? 419 LEU A O   1 
ATOM   2367 C  CB  . LEU A 1 314 ? 38.053  65.961  44.959 1.00 43.99 ? 419 LEU A CB  1 
ATOM   2368 C  CG  . LEU A 1 314 ? 37.635  66.172  43.497 1.00 43.96 ? 419 LEU A CG  1 
ATOM   2369 C  CD1 . LEU A 1 314 ? 36.134  66.387  43.380 1.00 44.29 ? 419 LEU A CD1 1 
ATOM   2370 C  CD2 . LEU A 1 314 ? 38.386  67.344  42.899 1.00 43.84 ? 419 LEU A CD2 1 
ATOM   2371 N  N   . SER A 1 315 ? 38.850  62.848  45.082 1.00 43.66 ? 420 SER A N   1 
ATOM   2372 C  CA  . SER A 1 315 ? 39.150  61.573  44.413 1.00 43.86 ? 420 SER A CA  1 
ATOM   2373 C  C   . SER A 1 315 ? 38.252  60.437  44.909 1.00 43.91 ? 420 SER A C   1 
ATOM   2374 O  O   . SER A 1 315 ? 37.767  59.628  44.119 1.00 43.68 ? 420 SER A O   1 
ATOM   2375 C  CB  . SER A 1 315 ? 40.617  61.182  44.605 1.00 43.87 ? 420 SER A CB  1 
ATOM   2376 O  OG  . SER A 1 315 ? 41.460  61.880  43.704 1.00 44.07 ? 420 SER A OG  1 
ATOM   2377 N  N   . LEU A 1 316 ? 38.040  60.382  46.220 1.00 44.01 ? 421 LEU A N   1 
ATOM   2378 C  CA  . LEU A 1 316 ? 37.131  59.405  46.801 1.00 44.05 ? 421 LEU A CA  1 
ATOM   2379 C  C   . LEU A 1 316 ? 35.728  59.575  46.210 1.00 44.09 ? 421 LEU A C   1 
ATOM   2380 O  O   . LEU A 1 316 ? 35.126  58.614  45.737 1.00 44.07 ? 421 LEU A O   1 
ATOM   2381 C  CB  . LEU A 1 316 ? 37.101  59.553  48.326 1.00 44.00 ? 421 LEU A CB  1 
ATOM   2382 C  CG  . LEU A 1 316 ? 36.308  58.524  49.144 1.00 44.19 ? 421 LEU A CG  1 
ATOM   2383 C  CD1 . LEU A 1 316 ? 36.879  57.124  48.968 1.00 44.46 ? 421 LEU A CD1 1 
ATOM   2384 C  CD2 . LEU A 1 316 ? 36.285  58.910  50.623 1.00 44.09 ? 421 LEU A CD2 1 
ATOM   2385 N  N   . PHE A 1 317 ? 35.234  60.810  46.224 1.00 44.19 ? 422 PHE A N   1 
ATOM   2386 C  CA  . PHE A 1 317 ? 33.890  61.141  45.750 1.00 44.26 ? 422 PHE A CA  1 
ATOM   2387 C  C   . PHE A 1 317 ? 33.661  60.688  44.306 1.00 44.39 ? 422 PHE A C   1 
ATOM   2388 O  O   . PHE A 1 317 ? 32.658  60.041  44.003 1.00 44.24 ? 422 PHE A O   1 
ATOM   2389 C  CB  . PHE A 1 317 ? 33.665  62.652  45.873 1.00 44.26 ? 422 PHE A CB  1 
ATOM   2390 C  CG  . PHE A 1 317 ? 32.248  63.086  45.627 1.00 44.27 ? 422 PHE A CG  1 
ATOM   2391 C  CD1 . PHE A 1 317 ? 31.399  63.362  46.694 1.00 44.34 ? 422 PHE A CD1 1 
ATOM   2392 C  CD2 . PHE A 1 317 ? 31.766  63.235  44.330 1.00 44.24 ? 422 PHE A CD2 1 
ATOM   2393 C  CE1 . PHE A 1 317 ? 30.089  63.768  46.477 1.00 44.48 ? 422 PHE A CE1 1 
ATOM   2394 C  CE2 . PHE A 1 317 ? 30.457  63.634  44.101 1.00 44.48 ? 422 PHE A CE2 1 
ATOM   2395 C  CZ  . PHE A 1 317 ? 29.614  63.901  45.178 1.00 44.73 ? 422 PHE A CZ  1 
ATOM   2396 N  N   . ARG A 1 318 ? 34.594  61.032  43.423 1.00 44.62 ? 423 ARG A N   1 
ATOM   2397 C  CA  . ARG A 1 318 ? 34.490  60.696  42.007 1.00 44.96 ? 423 ARG A CA  1 
ATOM   2398 C  C   . ARG A 1 318 ? 34.466  59.191  41.740 1.00 45.10 ? 423 ARG A C   1 
ATOM   2399 O  O   . ARG A 1 318 ? 33.740  58.731  40.864 1.00 45.19 ? 423 ARG A O   1 
ATOM   2400 C  CB  . ARG A 1 318 ? 35.653  61.304  41.234 1.00 45.10 ? 423 ARG A CB  1 
ATOM   2401 C  CG  . ARG A 1 318 ? 35.534  62.789  40.921 1.00 45.40 ? 423 ARG A CG  1 
ATOM   2402 C  CD  . ARG A 1 318 ? 36.634  63.175  39.933 1.00 45.49 ? 423 ARG A CD  1 
ATOM   2403 N  NE  . ARG A 1 318 ? 36.622  64.589  39.554 1.00 45.68 ? 423 ARG A NE  1 
ATOM   2404 C  CZ  . ARG A 1 318 ? 37.619  65.454  39.752 1.00 46.49 ? 423 ARG A CZ  1 
ATOM   2405 N  NH1 . ARG A 1 318 ? 38.756  65.089  40.349 1.00 47.10 ? 423 ARG A NH1 1 
ATOM   2406 N  NH2 . ARG A 1 318 ? 37.479  66.710  39.343 1.00 46.56 ? 423 ARG A NH2 1 
ATOM   2407 N  N   . ARG A 1 319 ? 35.277  58.439  42.477 1.00 45.39 ? 424 ARG A N   1 
ATOM   2408 C  CA  . ARG A 1 319 ? 35.334  56.984  42.348 1.00 45.77 ? 424 ARG A CA  1 
ATOM   2409 C  C   . ARG A 1 319 ? 34.095  56.311  42.913 1.00 46.10 ? 424 ARG A C   1 
ATOM   2410 O  O   . ARG A 1 319 ? 33.559  55.388  42.301 1.00 46.11 ? 424 ARG A O   1 
ATOM   2411 C  CB  . ARG A 1 319 ? 36.552  56.425  43.074 1.00 45.75 ? 424 ARG A CB  1 
ATOM   2412 C  CG  . ARG A 1 319 ? 37.877  56.846  42.487 1.00 45.81 ? 424 ARG A CG  1 
ATOM   2413 C  CD  . ARG A 1 319 ? 39.016  56.378  43.368 1.00 46.03 ? 424 ARG A CD  1 
ATOM   2414 N  NE  . ARG A 1 319 ? 39.174  54.927  43.320 1.00 46.23 ? 424 ARG A NE  1 
ATOM   2415 C  CZ  . ARG A 1 319 ? 40.038  54.235  44.058 1.00 46.64 ? 424 ARG A CZ  1 
ATOM   2416 N  NH1 . ARG A 1 319 ? 40.833  54.850  44.929 1.00 46.63 ? 424 ARG A NH1 1 
ATOM   2417 N  NH2 . ARG A 1 319 ? 40.103  52.912  43.932 1.00 47.03 ? 424 ARG A NH2 1 
ATOM   2418 N  N   . LEU A 1 320 ? 33.654  56.753  44.089 1.00 46.51 ? 425 LEU A N   1 
ATOM   2419 C  CA  . LEU A 1 320 ? 32.428  56.226  44.681 1.00 46.94 ? 425 LEU A CA  1 
ATOM   2420 C  C   . LEU A 1 320 ? 31.219  56.494  43.783 1.00 47.41 ? 425 LEU A C   1 
ATOM   2421 O  O   . LEU A 1 320 ? 30.383  55.616  43.583 1.00 47.58 ? 425 LEU A O   1 
ATOM   2422 C  CB  . LEU A 1 320 ? 32.182  56.819  46.065 1.00 46.75 ? 425 LEU A CB  1 
ATOM   2423 C  CG  . LEU A 1 320 ? 33.046  56.282  47.204 1.00 47.11 ? 425 LEU A CG  1 
ATOM   2424 C  CD1 . LEU A 1 320 ? 32.728  57.048  48.481 1.00 47.17 ? 425 LEU A CD1 1 
ATOM   2425 C  CD2 . LEU A 1 320 ? 32.857  54.777  47.410 1.00 47.01 ? 425 LEU A CD2 1 
ATOM   2426 N  N   . SER A 1 321 ? 31.135  57.704  43.240 1.00 47.96 ? 426 SER A N   1 
ATOM   2427 C  CA  . SER A 1 321 ? 30.020  58.079  42.373 1.00 48.25 ? 426 SER A CA  1 
ATOM   2428 C  C   . SER A 1 321 ? 30.038  57.321  41.046 1.00 48.56 ? 426 SER A C   1 
ATOM   2429 O  O   . SER A 1 321 ? 28.982  57.040  40.485 1.00 48.52 ? 426 SER A O   1 
ATOM   2430 C  CB  . SER A 1 321 ? 30.028  59.586  42.112 1.00 48.29 ? 426 SER A CB  1 
ATOM   2431 O  OG  . SER A 1 321 ? 28.865  59.980  41.410 1.00 48.36 ? 426 SER A OG  1 
ATOM   2432 N  N   . ASP A 1 322 ? 31.229  56.987  40.551 1.00 49.11 ? 427 ASP A N   1 
ATOM   2433 C  CA  . ASP A 1 322 ? 31.350  56.222  39.301 1.00 49.36 ? 427 ASP A CA  1 
ATOM   2434 C  C   . ASP A 1 322 ? 30.791  54.805  39.464 1.00 49.50 ? 427 ASP A C   1 
ATOM   2435 O  O   . ASP A 1 322 ? 30.092  54.302  38.584 1.00 49.48 ? 427 ASP A O   1 
ATOM   2436 C  CB  . ASP A 1 322 ? 32.811  56.170  38.815 1.00 49.51 ? 427 ASP A CB  1 
ATOM   2437 C  CG  . ASP A 1 322 ? 32.938  55.747  37.344 1.00 49.82 ? 427 ASP A CG  1 
ATOM   2438 O  OD1 . ASP A 1 322 ? 32.004  55.997  36.553 1.00 50.47 ? 427 ASP A OD1 1 
ATOM   2439 O  OD2 . ASP A 1 322 ? 33.991  55.182  36.967 1.00 51.73 ? 427 ASP A OD2 1 
ATOM   2440 N  N   . GLN A 1 323 ? 31.097  54.173  40.593 1.00 49.67 ? 428 GLN A N   1 
ATOM   2441 C  CA  . GLN A 1 323 ? 30.529  52.865  40.919 1.00 49.86 ? 428 GLN A CA  1 
ATOM   2442 C  C   . GLN A 1 323 ? 29.007  52.944  41.026 1.00 50.03 ? 428 GLN A C   1 
ATOM   2443 O  O   . GLN A 1 323 ? 28.287  52.187  40.361 1.00 49.98 ? 428 GLN A O   1 
ATOM   2444 C  CB  . GLN A 1 323 ? 31.102  52.346  42.239 1.00 49.93 ? 428 GLN A CB  1 
ATOM   2445 C  CG  . GLN A 1 323 ? 32.572  51.995  42.185 1.00 50.10 ? 428 GLN A CG  1 
ATOM   2446 C  CD  . GLN A 1 323 ? 32.879  50.968  41.125 1.00 50.53 ? 428 GLN A CD  1 
ATOM   2447 O  OE1 . GLN A 1 323 ? 33.871  51.079  40.410 1.00 51.16 ? 428 GLN A OE1 1 
ATOM   2448 N  NE2 . GLN A 1 323 ? 32.022  49.960  41.010 1.00 50.93 ? 428 GLN A NE2 1 
ATOM   2449 N  N   . ARG A 1 324 ? 28.535  53.876  41.857 1.00 50.03 ? 429 ARG A N   1 
ATOM   2450 C  CA  . ARG A 1 324 ? 27.104  54.085  42.096 1.00 50.08 ? 429 ARG A CA  1 
ATOM   2451 C  C   . ARG A 1 324 ? 26.278  54.171  40.808 1.00 50.09 ? 429 ARG A C   1 
ATOM   2452 O  O   . ARG A 1 324 ? 25.155  53.671  40.768 1.00 50.04 ? 429 ARG A O   1 
ATOM   2453 C  CB  . ARG A 1 324 ? 26.891  55.348  42.940 1.00 50.13 ? 429 ARG A CB  1 
ATOM   2454 C  CG  . ARG A 1 324 ? 25.432  55.744  43.185 1.00 50.05 ? 429 ARG A CG  1 
ATOM   2455 C  CD  . ARG A 1 324 ? 24.679  54.736  44.036 1.00 50.39 ? 429 ARG A CD  1 
ATOM   2456 N  NE  . ARG A 1 324 ? 23.297  55.157  44.257 1.00 50.48 ? 429 ARG A NE  1 
ATOM   2457 C  CZ  . ARG A 1 324 ? 22.306  55.003  43.377 1.00 51.55 ? 429 ARG A CZ  1 
ATOM   2458 N  NH1 . ARG A 1 324 ? 22.523  54.428  42.196 1.00 51.96 ? 429 ARG A NH1 1 
ATOM   2459 N  NH2 . ARG A 1 324 ? 21.082  55.426  43.677 1.00 51.50 ? 429 ARG A NH2 1 
ATOM   2460 N  N   . SER A 1 325 ? 26.825  54.796  39.767 1.00 50.00 ? 430 SER A N   1 
ATOM   2461 C  CA  . SER A 1 325 ? 26.106  54.926  38.502 1.00 50.18 ? 430 SER A CA  1 
ATOM   2462 C  C   . SER A 1 325 ? 26.244  53.688  37.597 1.00 50.05 ? 430 SER A C   1 
ATOM   2463 O  O   . SER A 1 325 ? 25.249  53.166  37.128 1.00 50.03 ? 430 SER A O   1 
ATOM   2464 C  CB  . SER A 1 325 ? 26.510  56.212  37.768 1.00 50.17 ? 430 SER A CB  1 
ATOM   2465 O  OG  . SER A 1 325 ? 27.878  56.509  37.960 1.00 50.83 ? 430 SER A OG  1 
ATOM   2466 N  N   . LYS A 1 326 ? 27.460  53.204  37.377 1.00 50.26 ? 431 LYS A N   1 
ATOM   2467 C  CA  . LYS A 1 326 ? 27.688  52.100  36.428 1.00 50.37 ? 431 LYS A CA  1 
ATOM   2468 C  C   . LYS A 1 326 ? 27.131  50.744  36.893 1.00 50.32 ? 431 LYS A C   1 
ATOM   2469 O  O   . LYS A 1 326 ? 26.460  50.057  36.125 1.00 50.26 ? 431 LYS A O   1 
ATOM   2470 C  CB  . LYS A 1 326 ? 29.185  51.958  36.117 1.00 50.38 ? 431 LYS A CB  1 
ATOM   2471 C  CG  . LYS A 1 326 ? 29.773  53.120  35.323 1.00 50.67 ? 431 LYS A CG  1 
ATOM   2472 C  CD  . LYS A 1 326 ? 31.302  53.103  35.357 1.00 50.96 ? 431 LYS A CD  1 
ATOM   2473 C  CE  . LYS A 1 326 ? 31.917  53.991  34.258 1.00 51.47 ? 431 LYS A CE  1 
ATOM   2474 N  NZ  . LYS A 1 326 ? 33.406  54.174  34.403 1.00 51.22 ? 431 LYS A NZ  1 
ATOM   2475 N  N   . GLU A 1 327 ? 27.411  50.371  38.141 1.00 50.32 ? 432 GLU A N   1 
ATOM   2476 C  CA  . GLU A 1 327 ? 27.113  49.021  38.650 1.00 50.25 ? 432 GLU A CA  1 
ATOM   2477 C  C   . GLU A 1 327 ? 25.646  48.817  39.034 1.00 50.14 ? 432 GLU A C   1 
ATOM   2478 O  O   . GLU A 1 327 ? 25.047  49.672  39.682 1.00 50.36 ? 432 GLU A O   1 
ATOM   2479 C  CB  . GLU A 1 327 ? 27.986  48.715  39.862 1.00 50.36 ? 432 GLU A CB  1 
ATOM   2480 C  CG  . GLU A 1 327 ? 29.474  48.666  39.554 1.00 50.94 ? 432 GLU A CG  1 
ATOM   2481 C  CD  . GLU A 1 327 ? 29.938  47.336  38.978 1.00 51.69 ? 432 GLU A CD  1 
ATOM   2482 O  OE1 . GLU A 1 327 ? 29.089  46.462  38.693 1.00 52.11 ? 432 GLU A OE1 1 
ATOM   2483 O  OE2 . GLU A 1 327 ? 31.170  47.166  38.824 1.00 52.43 ? 432 GLU A OE2 1 
ATOM   2484 N  N   . ARG A 1 328 ? 25.092  47.663  38.667 1.00 49.76 ? 433 ARG A N   1 
ATOM   2485 C  CA  . ARG A 1 328 ? 23.659  47.403  38.819 1.00 49.65 ? 433 ARG A CA  1 
ATOM   2486 C  C   . ARG A 1 328 ? 23.201  47.099  40.247 1.00 49.14 ? 433 ARG A C   1 
ATOM   2487 O  O   . ARG A 1 328 ? 22.064  47.417  40.607 1.00 48.98 ? 433 ARG A O   1 
ATOM   2488 C  CB  . ARG A 1 328 ? 23.227  46.262  37.893 1.00 49.86 ? 433 ARG A CB  1 
ATOM   2489 C  CG  . ARG A 1 328 ? 23.158  46.649  36.433 1.00 50.14 ? 433 ARG A CG  1 
ATOM   2490 C  CD  . ARG A 1 328 ? 22.617  45.506  35.600 1.00 50.71 ? 433 ARG A CD  1 
ATOM   2491 N  NE  . ARG A 1 328 ? 22.646  45.792  34.165 1.00 51.58 ? 433 ARG A NE  1 
ATOM   2492 C  CZ  . ARG A 1 328 ? 23.737  45.753  33.397 1.00 52.65 ? 433 ARG A CZ  1 
ATOM   2493 N  NH1 . ARG A 1 328 ? 24.932  45.453  33.908 1.00 52.76 ? 433 ARG A NH1 1 
ATOM   2494 N  NH2 . ARG A 1 328 ? 23.633  46.027  32.098 1.00 53.19 ? 433 ARG A NH2 1 
ATOM   2495 N  N   . SER A 1 329 ? 24.060  46.477  41.051 1.00 48.63 ? 434 SER A N   1 
ATOM   2496 C  CA  . SER A 1 329 ? 23.698  46.130  42.430 1.00 48.45 ? 434 SER A CA  1 
ATOM   2497 C  C   . SER A 1 329 ? 23.442  47.371  43.290 1.00 48.25 ? 434 SER A C   1 
ATOM   2498 O  O   . SER A 1 329 ? 22.609  47.345  44.199 1.00 47.91 ? 434 SER A O   1 
ATOM   2499 C  CB  . SER A 1 329 ? 24.771  45.249  43.076 1.00 48.31 ? 434 SER A CB  1 
ATOM   2500 O  OG  . SER A 1 329 ? 24.669  43.917  42.614 1.00 47.76 ? 434 SER A OG  1 
ATOM   2501 N  N   . LEU A 1 330 ? 24.157  48.453  42.991 1.00 48.16 ? 435 LEU A N   1 
ATOM   2502 C  CA  . LEU A 1 330 ? 23.970  49.726  43.684 1.00 48.05 ? 435 LEU A CA  1 
ATOM   2503 C  C   . LEU A 1 330 ? 22.878  50.595  43.041 1.00 47.91 ? 435 LEU A C   1 
ATOM   2504 O  O   . LEU A 1 330 ? 22.468  51.597  43.621 1.00 47.73 ? 435 LEU A O   1 
ATOM   2505 C  CB  . LEU A 1 330 ? 25.299  50.482  43.742 1.00 47.94 ? 435 LEU A CB  1 
ATOM   2506 C  CG  . LEU A 1 330 ? 26.453  49.711  44.404 1.00 48.22 ? 435 LEU A CG  1 
ATOM   2507 C  CD1 . LEU A 1 330 ? 27.786  50.420  44.220 1.00 48.43 ? 435 LEU A CD1 1 
ATOM   2508 C  CD2 . LEU A 1 330 ? 26.192  49.480  45.886 1.00 48.17 ? 435 LEU A CD2 1 
ATOM   2509 N  N   . LEU A 1 331 ? 22.408  50.206  41.853 1.00 47.96 ? 436 LEU A N   1 
ATOM   2510 C  CA  . LEU A 1 331 ? 21.329  50.921  41.152 1.00 47.96 ? 436 LEU A CA  1 
ATOM   2511 C  C   . LEU A 1 331 ? 19.935  50.510  41.643 1.00 47.94 ? 436 LEU A C   1 
ATOM   2512 O  O   . LEU A 1 331 ? 19.024  51.339  41.659 1.00 48.18 ? 436 LEU A O   1 
ATOM   2513 C  CB  . LEU A 1 331 ? 21.424  50.714  39.634 1.00 48.06 ? 436 LEU A CB  1 
ATOM   2514 C  CG  . LEU A 1 331 ? 22.519  51.475  38.868 1.00 48.30 ? 436 LEU A CG  1 
ATOM   2515 C  CD1 . LEU A 1 331 ? 22.785  50.843  37.510 1.00 48.30 ? 436 LEU A CD1 1 
ATOM   2516 C  CD2 . LEU A 1 331 ? 22.149  52.935  38.692 1.00 48.68 ? 436 LEU A CD2 1 
ATOM   2517 N  N   . HIS A 1 332 ? 19.768  49.241  42.023 1.00 47.78 ? 437 HIS A N   1 
ATOM   2518 C  CA  . HIS A 1 332 ? 18.515  48.750  42.620 1.00 47.66 ? 437 HIS A CA  1 
ATOM   2519 C  C   . HIS A 1 332 ? 18.625  48.650  44.148 1.00 47.63 ? 437 HIS A C   1 
ATOM   2520 O  O   . HIS A 1 332 ? 19.708  48.816  44.705 1.00 47.91 ? 437 HIS A O   1 
ATOM   2521 C  CB  . HIS A 1 332 ? 18.133  47.412  42.003 1.00 47.63 ? 437 HIS A CB  1 
ATOM   2522 C  CG  . HIS A 1 332 ? 17.957  47.476  40.518 1.00 47.94 ? 437 HIS A CG  1 
ATOM   2523 N  ND1 . HIS A 1 332 ? 18.956  47.130  39.634 1.00 48.59 ? 437 HIS A ND1 1 
ATOM   2524 C  CD2 . HIS A 1 332 ? 16.910  47.879  39.761 1.00 47.98 ? 437 HIS A CD2 1 
ATOM   2525 C  CE1 . HIS A 1 332 ? 18.526  47.301  38.397 1.00 48.23 ? 437 HIS A CE1 1 
ATOM   2526 N  NE2 . HIS A 1 332 ? 17.287  47.754  38.446 1.00 48.02 ? 437 HIS A NE2 1 
ATOM   2527 N  N   . GLY A 1 333 ? 17.512  48.377  44.823 1.00 47.45 ? 438 GLY A N   1 
ATOM   2528 C  CA  . GLY A 1 333 ? 17.431  48.551  46.277 1.00 47.27 ? 438 GLY A CA  1 
ATOM   2529 C  C   . GLY A 1 333 ? 17.397  47.293  47.127 1.00 47.12 ? 438 GLY A C   1 
ATOM   2530 O  O   . GLY A 1 333 ? 16.630  47.221  48.085 1.00 47.14 ? 438 GLY A O   1 
ATOM   2531 N  N   . ASP A 1 334 ? 18.241  46.315  46.803 1.00 46.90 ? 439 ASP A N   1 
ATOM   2532 C  CA  . ASP A 1 334 ? 18.291  45.052  47.545 1.00 46.76 ? 439 ASP A CA  1 
ATOM   2533 C  C   . ASP A 1 334 ? 19.420  45.123  48.575 1.00 46.64 ? 439 ASP A C   1 
ATOM   2534 O  O   . ASP A 1 334 ? 20.589  45.167  48.197 1.00 46.67 ? 439 ASP A O   1 
ATOM   2535 C  CB  . ASP A 1 334 ? 18.522  43.899  46.570 1.00 46.75 ? 439 ASP A CB  1 
ATOM   2536 C  CG  . ASP A 1 334 ? 18.102  42.550  47.128 1.00 46.99 ? 439 ASP A CG  1 
ATOM   2537 O  OD1 . ASP A 1 334 ? 18.043  42.384  48.367 1.00 47.57 ? 439 ASP A OD1 1 
ATOM   2538 O  OD2 . ASP A 1 334 ? 17.841  41.636  46.314 1.00 47.20 ? 439 ASP A OD2 1 
ATOM   2539 N  N   . PHE A 1 335 ? 19.070  45.111  49.864 1.00 46.41 ? 440 PHE A N   1 
ATOM   2540 C  CA  . PHE A 1 335 ? 20.014  45.467  50.938 1.00 46.30 ? 440 PHE A CA  1 
ATOM   2541 C  C   . PHE A 1 335 ? 19.808  44.655  52.221 1.00 46.11 ? 440 PHE A C   1 
ATOM   2542 O  O   . PHE A 1 335 ? 18.675  44.495  52.680 1.00 46.15 ? 440 PHE A O   1 
ATOM   2543 C  CB  . PHE A 1 335 ? 19.876  46.970  51.233 1.00 46.35 ? 440 PHE A CB  1 
ATOM   2544 C  CG  . PHE A 1 335 ? 20.376  47.387  52.591 1.00 46.41 ? 440 PHE A CG  1 
ATOM   2545 C  CD1 . PHE A 1 335 ? 21.665  47.886  52.752 1.00 46.10 ? 440 PHE A CD1 1 
ATOM   2546 C  CD2 . PHE A 1 335 ? 19.548  47.303  53.707 1.00 46.38 ? 440 PHE A CD2 1 
ATOM   2547 C  CE1 . PHE A 1 335 ? 22.123  48.283  54.001 1.00 46.17 ? 440 PHE A CE1 1 
ATOM   2548 C  CE2 . PHE A 1 335 ? 20.004  47.693  54.963 1.00 46.63 ? 440 PHE A CE2 1 
ATOM   2549 C  CZ  . PHE A 1 335 ? 21.295  48.189  55.108 1.00 46.53 ? 440 PHE A CZ  1 
ATOM   2550 N  N   . HIS A 1 336 ? 20.908  44.166  52.800 1.00 45.92 ? 441 HIS A N   1 
ATOM   2551 C  CA  . HIS A 1 336 ? 20.874  43.384  54.051 1.00 45.87 ? 441 HIS A CA  1 
ATOM   2552 C  C   . HIS A 1 336 ? 22.047  43.746  54.964 1.00 45.87 ? 441 HIS A C   1 
ATOM   2553 O  O   . HIS A 1 336 ? 23.182  43.823  54.506 1.00 45.70 ? 441 HIS A O   1 
ATOM   2554 C  CB  . HIS A 1 336 ? 20.896  41.881  53.750 1.00 45.48 ? 441 HIS A CB  1 
ATOM   2555 C  CG  . HIS A 1 336 ? 19.869  41.456  52.748 1.00 44.75 ? 441 HIS A CG  1 
ATOM   2556 N  ND1 . HIS A 1 336 ? 18.519  41.468  53.016 1.00 43.88 ? 441 HIS A ND1 1 
ATOM   2557 C  CD2 . HIS A 1 336 ? 19.995  41.032  51.469 1.00 43.93 ? 441 HIS A CD2 1 
ATOM   2558 C  CE1 . HIS A 1 336 ? 17.856  41.064  51.947 1.00 43.76 ? 441 HIS A CE1 1 
ATOM   2559 N  NE2 . HIS A 1 336 ? 18.729  40.792  50.995 1.00 43.72 ? 441 HIS A NE2 1 
ATOM   2560 N  N   . ALA A 1 337 ? 21.764  43.947  56.254 1.00 46.09 ? 442 ALA A N   1 
ATOM   2561 C  CA  . ALA A 1 337 ? 22.772  44.391  57.232 1.00 46.29 ? 442 ALA A CA  1 
ATOM   2562 C  C   . ALA A 1 337 ? 23.214  43.264  58.158 1.00 46.36 ? 442 ALA A C   1 
ATOM   2563 O  O   . ALA A 1 337 ? 22.403  42.437  58.555 1.00 46.36 ? 442 ALA A O   1 
ATOM   2564 C  CB  . ALA A 1 337 ? 22.226  45.551  58.062 1.00 46.33 ? 442 ALA A CB  1 
ATOM   2565 N  N   . PHE A 1 338 ? 24.499  43.253  58.508 1.00 46.55 ? 443 PHE A N   1 
ATOM   2566 C  CA  . PHE A 1 338 ? 25.055  42.262  59.434 1.00 46.74 ? 443 PHE A CA  1 
ATOM   2567 C  C   . PHE A 1 338 ? 24.859  42.665  60.889 1.00 47.01 ? 443 PHE A C   1 
ATOM   2568 O  O   . PHE A 1 338 ? 24.549  43.820  61.186 1.00 47.27 ? 443 PHE A O   1 
ATOM   2569 C  CB  . PHE A 1 338 ? 26.555  42.099  59.206 1.00 46.76 ? 443 PHE A CB  1 
ATOM   2570 C  CG  . PHE A 1 338 ? 26.901  41.360  57.959 1.00 46.72 ? 443 PHE A CG  1 
ATOM   2571 C  CD1 . PHE A 1 338 ? 27.146  42.042  56.779 1.00 46.82 ? 443 PHE A CD1 1 
ATOM   2572 C  CD2 . PHE A 1 338 ? 27.000  39.983  57.969 1.00 46.65 ? 443 PHE A CD2 1 
ATOM   2573 C  CE1 . PHE A 1 338 ? 27.476  41.362  55.629 1.00 46.84 ? 443 PHE A CE1 1 
ATOM   2574 C  CE2 . PHE A 1 338 ? 27.331  39.290  56.825 1.00 46.76 ? 443 PHE A CE2 1 
ATOM   2575 C  CZ  . PHE A 1 338 ? 27.565  39.979  55.647 1.00 47.03 ? 443 PHE A CZ  1 
ATOM   2576 N  N   . SER A 1 339 ? 25.053  41.696  61.785 1.00 47.22 ? 444 SER A N   1 
ATOM   2577 C  CA  . SER A 1 339 ? 25.163  41.936  63.224 1.00 47.26 ? 444 SER A CA  1 
ATOM   2578 C  C   . SER A 1 339 ? 26.608  41.673  63.643 1.00 47.46 ? 444 SER A C   1 
ATOM   2579 O  O   . SER A 1 339 ? 26.920  40.616  64.196 1.00 47.54 ? 444 SER A O   1 
ATOM   2580 C  CB  . SER A 1 339 ? 24.213  41.022  64.008 1.00 47.27 ? 444 SER A CB  1 
ATOM   2581 O  OG  . SER A 1 339 ? 22.858  41.408  63.845 1.00 47.12 ? 444 SER A OG  1 
ATOM   2582 N  N   . ALA A 1 340 ? 27.484  42.638  63.365 1.00 47.57 ? 445 ALA A N   1 
ATOM   2583 C  CA  . ALA A 1 340 ? 28.919  42.518  63.649 1.00 47.60 ? 445 ALA A CA  1 
ATOM   2584 C  C   . ALA A 1 340 ? 29.276  43.054  65.055 1.00 47.68 ? 445 ALA A C   1 
ATOM   2585 O  O   . ALA A 1 340 ? 28.493  42.891  65.998 1.00 47.48 ? 445 ALA A O   1 
ATOM   2586 C  CB  . ALA A 1 340 ? 29.719  43.234  62.556 1.00 47.58 ? 445 ALA A CB  1 
ATOM   2587 N  N   . GLY A 1 341 ? 30.457  43.666  65.195 1.00 47.79 ? 446 GLY A N   1 
ATOM   2588 C  CA  . GLY A 1 341 ? 30.889  44.283  66.457 1.00 47.79 ? 446 GLY A CA  1 
ATOM   2589 C  C   . GLY A 1 341 ? 30.183  45.600  66.758 1.00 47.79 ? 446 GLY A C   1 
ATOM   2590 O  O   . GLY A 1 341 ? 29.573  46.188  65.865 1.00 47.80 ? 446 GLY A O   1 
ATOM   2591 N  N   . PRO A 1 342 ? 30.278  46.084  68.017 1.00 47.80 ? 447 PRO A N   1 
ATOM   2592 C  CA  . PRO A 1 342 ? 29.441  47.208  68.481 1.00 47.68 ? 447 PRO A CA  1 
ATOM   2593 C  C   . PRO A 1 342 ? 29.749  48.576  67.841 1.00 47.62 ? 447 PRO A C   1 
ATOM   2594 O  O   . PRO A 1 342 ? 28.927  49.497  67.932 1.00 47.65 ? 447 PRO A O   1 
ATOM   2595 C  CB  . PRO A 1 342 ? 29.701  47.251  69.999 1.00 47.63 ? 447 PRO A CB  1 
ATOM   2596 C  CG  . PRO A 1 342 ? 30.485  46.018  70.322 1.00 47.63 ? 447 PRO A CG  1 
ATOM   2597 C  CD  . PRO A 1 342 ? 31.189  45.616  69.078 1.00 47.74 ? 447 PRO A CD  1 
ATOM   2598 N  N   . GLY A 1 343 ? 30.913  48.715  67.214 1.00 47.36 ? 448 GLY A N   1 
ATOM   2599 C  CA  . GLY A 1 343 ? 31.227  49.930  66.461 1.00 47.26 ? 448 GLY A CA  1 
ATOM   2600 C  C   . GLY A 1 343 ? 30.816  49.876  64.996 1.00 47.07 ? 448 GLY A C   1 
ATOM   2601 O  O   . GLY A 1 343 ? 30.550  50.912  64.389 1.00 47.07 ? 448 GLY A O   1 
ATOM   2602 N  N   . LEU A 1 344 ? 30.755  48.663  64.442 1.00 46.93 ? 449 LEU A N   1 
ATOM   2603 C  CA  . LEU A 1 344 ? 30.633  48.444  62.997 1.00 46.70 ? 449 LEU A CA  1 
ATOM   2604 C  C   . LEU A 1 344 ? 29.223  48.592  62.425 1.00 46.55 ? 449 LEU A C   1 
ATOM   2605 O  O   . LEU A 1 344 ? 28.224  48.522  63.147 1.00 46.71 ? 449 LEU A O   1 
ATOM   2606 C  CB  . LEU A 1 344 ? 31.154  47.049  62.628 1.00 46.69 ? 449 LEU A CB  1 
ATOM   2607 C  CG  . LEU A 1 344 ? 32.636  46.780  62.885 1.00 46.87 ? 449 LEU A CG  1 
ATOM   2608 C  CD1 . LEU A 1 344 ? 32.983  45.351  62.503 1.00 46.97 ? 449 LEU A CD1 1 
ATOM   2609 C  CD2 . LEU A 1 344 ? 33.523  47.771  62.131 1.00 47.10 ? 449 LEU A CD2 1 
ATOM   2610 N  N   . PHE A 1 345 ? 29.179  48.783  61.108 1.00 46.14 ? 450 PHE A N   1 
ATOM   2611 C  CA  . PHE A 1 345 ? 27.949  48.771  60.328 1.00 45.91 ? 450 PHE A CA  1 
ATOM   2612 C  C   . PHE A 1 345 ? 28.295  48.187  58.956 1.00 45.74 ? 450 PHE A C   1 
ATOM   2613 O  O   . PHE A 1 345 ? 28.895  48.858  58.116 1.00 45.83 ? 450 PHE A O   1 
ATOM   2614 C  CB  . PHE A 1 345 ? 27.387  50.194  60.215 1.00 45.82 ? 450 PHE A CB  1 
ATOM   2615 C  CG  . PHE A 1 345 ? 26.105  50.309  59.411 1.00 46.00 ? 450 PHE A CG  1 
ATOM   2616 C  CD1 . PHE A 1 345 ? 25.858  51.448  58.651 1.00 45.97 ? 450 PHE A CD1 1 
ATOM   2617 C  CD2 . PHE A 1 345 ? 25.139  49.305  59.426 1.00 46.01 ? 450 PHE A CD2 1 
ATOM   2618 C  CE1 . PHE A 1 345 ? 24.681  51.580  57.917 1.00 45.79 ? 450 PHE A CE1 1 
ATOM   2619 C  CE2 . PHE A 1 345 ? 23.962  49.434  58.692 1.00 45.72 ? 450 PHE A CE2 1 
ATOM   2620 C  CZ  . PHE A 1 345 ? 23.736  50.572  57.937 1.00 45.68 ? 450 PHE A CZ  1 
ATOM   2621 N  N   . SER A 1 346 ? 27.949  46.919  58.755 1.00 45.41 ? 451 SER A N   1 
ATOM   2622 C  CA  . SER A 1 346 ? 28.267  46.211  57.521 1.00 45.12 ? 451 SER A CA  1 
ATOM   2623 C  C   . SER A 1 346 ? 26.999  45.783  56.808 1.00 44.82 ? 451 SER A C   1 
ATOM   2624 O  O   . SER A 1 346 ? 25.975  45.539  57.446 1.00 44.67 ? 451 SER A O   1 
ATOM   2625 C  CB  . SER A 1 346 ? 29.105  44.973  57.817 1.00 45.09 ? 451 SER A CB  1 
ATOM   2626 O  OG  . SER A 1 346 ? 30.265  45.310  58.544 1.00 45.52 ? 451 SER A OG  1 
ATOM   2627 N  N   . TYR A 1 347 ? 27.073  45.678  55.484 1.00 44.54 ? 452 TYR A N   1 
ATOM   2628 C  CA  . TYR A 1 347 ? 25.911  45.282  54.697 1.00 44.33 ? 452 TYR A CA  1 
ATOM   2629 C  C   . TYR A 1 347 ? 26.250  44.784  53.296 1.00 44.07 ? 452 TYR A C   1 
ATOM   2630 O  O   . TYR A 1 347 ? 27.315  45.083  52.764 1.00 43.90 ? 452 TYR A O   1 
ATOM   2631 C  CB  . TYR A 1 347 ? 24.881  46.421  54.631 1.00 44.18 ? 452 TYR A CB  1 
ATOM   2632 C  CG  . TYR A 1 347 ? 25.407  47.793  54.244 1.00 44.09 ? 452 TYR A CG  1 
ATOM   2633 C  CD1 . TYR A 1 347 ? 25.760  48.731  55.216 1.00 44.03 ? 452 TYR A CD1 1 
ATOM   2634 C  CD2 . TYR A 1 347 ? 25.488  48.176  52.910 1.00 44.12 ? 452 TYR A CD2 1 
ATOM   2635 C  CE1 . TYR A 1 347 ? 26.213  50.000  54.862 1.00 43.91 ? 452 TYR A CE1 1 
ATOM   2636 C  CE2 . TYR A 1 347 ? 25.935  49.441  52.549 1.00 44.17 ? 452 TYR A CE2 1 
ATOM   2637 C  CZ  . TYR A 1 347 ? 26.295  50.348  53.525 1.00 43.99 ? 452 TYR A CZ  1 
ATOM   2638 O  OH  . TYR A 1 347 ? 26.738  51.598  53.150 1.00 43.49 ? 452 TYR A OH  1 
ATOM   2639 N  N   . ILE A 1 348 ? 25.317  44.025  52.720 1.00 43.94 ? 453 ILE A N   1 
ATOM   2640 C  CA  . ILE A 1 348 ? 25.468  43.422  51.394 1.00 43.80 ? 453 ILE A CA  1 
ATOM   2641 C  C   . ILE A 1 348 ? 24.543  44.104  50.389 1.00 43.50 ? 453 ILE A C   1 
ATOM   2642 O  O   . ILE A 1 348 ? 23.434  44.503  50.743 1.00 43.52 ? 453 ILE A O   1 
ATOM   2643 C  CB  . ILE A 1 348 ? 25.112  41.912  51.421 1.00 43.91 ? 453 ILE A CB  1 
ATOM   2644 C  CG1 . ILE A 1 348 ? 25.954  41.164  52.461 1.00 44.58 ? 453 ILE A CG1 1 
ATOM   2645 C  CG2 . ILE A 1 348 ? 25.296  41.277  50.040 1.00 44.06 ? 453 ILE A CG2 1 
ATOM   2646 C  CD1 . ILE A 1 348 ? 27.451  41.114  52.156 1.00 45.28 ? 453 ILE A CD1 1 
ATOM   2647 N  N   . ARG A 1 349 ? 25.002  44.233  49.143 1.00 43.08 ? 454 ARG A N   1 
ATOM   2648 C  CA  . ARG A 1 349 ? 24.187  44.785  48.057 1.00 42.88 ? 454 ARG A CA  1 
ATOM   2649 C  C   . ARG A 1 349 ? 24.252  43.863  46.845 1.00 42.66 ? 454 ARG A C   1 
ATOM   2650 O  O   . ARG A 1 349 ? 25.341  43.524  46.392 1.00 42.96 ? 454 ARG A O   1 
ATOM   2651 C  CB  . ARG A 1 349 ? 24.675  46.183  47.668 1.00 42.76 ? 454 ARG A CB  1 
ATOM   2652 C  CG  . ARG A 1 349 ? 24.710  47.189  48.818 1.00 42.59 ? 454 ARG A CG  1 
ATOM   2653 C  CD  . ARG A 1 349 ? 23.338  47.764  49.143 1.00 42.08 ? 454 ARG A CD  1 
ATOM   2654 N  NE  . ARG A 1 349 ? 23.002  48.884  48.262 1.00 42.28 ? 454 ARG A NE  1 
ATOM   2655 C  CZ  . ARG A 1 349 ? 21.910  48.984  47.506 1.00 41.87 ? 454 ARG A CZ  1 
ATOM   2656 N  NH1 . ARG A 1 349 ? 20.989  48.035  47.493 1.00 41.72 ? 454 ARG A NH1 1 
ATOM   2657 N  NH2 . ARG A 1 349 ? 21.743  50.063  46.752 1.00 42.03 ? 454 ARG A NH2 1 
ATOM   2658 N  N   . HIS A 1 350 ? 23.093  43.470  46.316 1.00 42.34 ? 455 HIS A N   1 
ATOM   2659 C  CA  . HIS A 1 350 ? 23.038  42.530  45.188 1.00 42.15 ? 455 HIS A CA  1 
ATOM   2660 C  C   . HIS A 1 350 ? 21.796  42.707  44.302 1.00 42.00 ? 455 HIS A C   1 
ATOM   2661 O  O   . HIS A 1 350 ? 20.781  43.233  44.740 1.00 41.96 ? 455 HIS A O   1 
ATOM   2662 C  CB  . HIS A 1 350 ? 23.135  41.087  45.699 1.00 41.87 ? 455 HIS A CB  1 
ATOM   2663 C  CG  . HIS A 1 350 ? 21.965  40.645  46.525 1.00 41.72 ? 455 HIS A CG  1 
ATOM   2664 N  ND1 . HIS A 1 350 ? 21.287  39.470  46.279 1.00 41.13 ? 455 HIS A ND1 1 
ATOM   2665 C  CD2 . HIS A 1 350 ? 21.360  41.208  47.598 1.00 41.46 ? 455 HIS A CD2 1 
ATOM   2666 C  CE1 . HIS A 1 350 ? 20.314  39.331  47.161 1.00 41.14 ? 455 HIS A CE1 1 
ATOM   2667 N  NE2 . HIS A 1 350 ? 20.335  40.373  47.971 1.00 41.10 ? 455 HIS A NE2 1 
ATOM   2668 N  N   . TRP A 1 351 ? 21.897  42.277  43.048 1.00 41.83 ? 456 TRP A N   1 
ATOM   2669 C  CA  . TRP A 1 351 ? 20.763  42.299  42.127 1.00 41.85 ? 456 TRP A CA  1 
ATOM   2670 C  C   . TRP A 1 351 ? 20.911  41.234  41.031 1.00 41.91 ? 456 TRP A C   1 
ATOM   2671 O  O   . TRP A 1 351 ? 21.872  41.252  40.262 1.00 41.96 ? 456 TRP A O   1 
ATOM   2672 C  CB  . TRP A 1 351 ? 20.613  43.678  41.498 1.00 41.49 ? 456 TRP A CB  1 
ATOM   2673 C  CG  . TRP A 1 351 ? 19.385  43.790  40.680 1.00 41.49 ? 456 TRP A CG  1 
ATOM   2674 C  CD1 . TRP A 1 351 ? 19.303  43.804  39.315 1.00 41.34 ? 456 TRP A CD1 1 
ATOM   2675 C  CD2 . TRP A 1 351 ? 18.045  43.876  41.165 1.00 41.49 ? 456 TRP A CD2 1 
ATOM   2676 N  NE1 . TRP A 1 351 ? 17.993  43.902  38.921 1.00 41.35 ? 456 TRP A NE1 1 
ATOM   2677 C  CE2 . TRP A 1 351 ? 17.198  43.951  40.037 1.00 41.62 ? 456 TRP A CE2 1 
ATOM   2678 C  CE3 . TRP A 1 351 ? 17.475  43.903  42.445 1.00 41.39 ? 456 TRP A CE3 1 
ATOM   2679 C  CZ2 . TRP A 1 351 ? 15.806  44.052  40.151 1.00 41.24 ? 456 TRP A CZ2 1 
ATOM   2680 C  CZ3 . TRP A 1 351 ? 16.091  44.001  42.557 1.00 41.34 ? 456 TRP A CZ3 1 
ATOM   2681 C  CH2 . TRP A 1 351 ? 15.274  44.074  41.413 1.00 41.25 ? 456 TRP A CH2 1 
ATOM   2682 N  N   . ASP A 1 352 ? 19.952  40.315  40.967 1.00 42.03 ? 457 ASP A N   1 
ATOM   2683 C  CA  . ASP A 1 352 ? 19.987  39.201  40.016 1.00 42.20 ? 457 ASP A CA  1 
ATOM   2684 C  C   . ASP A 1 352 ? 21.337  38.472  40.096 1.00 42.36 ? 457 ASP A C   1 
ATOM   2685 O  O   . ASP A 1 352 ? 21.790  38.138  41.196 1.00 42.42 ? 457 ASP A O   1 
ATOM   2686 C  CB  . ASP A 1 352 ? 19.668  39.691  38.599 1.00 42.16 ? 457 ASP A CB  1 
ATOM   2687 C  CG  . ASP A 1 352 ? 18.292  40.327  38.495 1.00 42.46 ? 457 ASP A CG  1 
ATOM   2688 O  OD1 . ASP A 1 352 ? 17.342  39.836  39.144 1.00 42.03 ? 457 ASP A OD1 1 
ATOM   2689 O  OD2 . ASP A 1 352 ? 18.155  41.320  37.752 1.00 43.45 ? 457 ASP A OD2 1 
ATOM   2690 N  N   . GLN A 1 353 ? 21.980  38.235  38.953 1.00 42.53 ? 458 GLN A N   1 
ATOM   2691 C  CA  . GLN A 1 353 ? 23.272  37.554  38.919 1.00 42.53 ? 458 GLN A CA  1 
ATOM   2692 C  C   . GLN A 1 353 ? 24.385  38.541  38.575 1.00 42.72 ? 458 GLN A C   1 
ATOM   2693 O  O   . GLN A 1 353 ? 25.361  38.178  37.923 1.00 42.78 ? 458 GLN A O   1 
ATOM   2694 C  CB  . GLN A 1 353 ? 23.227  36.381  37.928 1.00 42.35 ? 458 GLN A CB  1 
ATOM   2695 C  CG  . GLN A 1 353 ? 22.115  35.380  38.247 1.00 42.00 ? 458 GLN A CG  1 
ATOM   2696 C  CD  . GLN A 1 353 ? 22.193  34.088  37.450 1.00 42.07 ? 458 GLN A CD  1 
ATOM   2697 O  OE1 . GLN A 1 353 ? 23.199  33.787  36.811 1.00 42.10 ? 458 GLN A OE1 1 
ATOM   2698 N  NE2 . GLN A 1 353 ? 21.124  33.314  37.496 1.00 41.04 ? 458 GLN A NE2 1 
ATOM   2699 N  N   . ASN A 1 354 ? 24.228  39.785  39.029 1.00 43.03 ? 459 ASN A N   1 
ATOM   2700 C  CA  . ASN A 1 354 ? 25.242  40.825  38.865 1.00 43.33 ? 459 ASN A CA  1 
ATOM   2701 C  C   . ASN A 1 354 ? 26.293  40.739  39.972 1.00 43.62 ? 459 ASN A C   1 
ATOM   2702 O  O   . ASN A 1 354 ? 26.206  39.897  40.866 1.00 43.42 ? 459 ASN A O   1 
ATOM   2703 C  CB  . ASN A 1 354 ? 24.598  42.219  38.887 1.00 43.37 ? 459 ASN A CB  1 
ATOM   2704 C  CG  . ASN A 1 354 ? 23.652  42.454  37.722 1.00 43.62 ? 459 ASN A CG  1 
ATOM   2705 O  OD1 . ASN A 1 354 ? 23.999  42.225  36.560 1.00 44.00 ? 459 ASN A OD1 1 
ATOM   2706 N  ND2 . ASN A 1 354 ? 22.455  42.934  38.028 1.00 43.27 ? 459 ASN A ND2 1 
ATOM   2707 N  N   . GLU A 1 355 ? 27.285  41.621  39.902 1.00 44.19 ? 460 GLU A N   1 
ATOM   2708 C  CA  . GLU A 1 355 ? 28.360  41.673  40.885 1.00 44.38 ? 460 GLU A CA  1 
ATOM   2709 C  C   . GLU A 1 355 ? 27.841  42.179  42.230 1.00 44.62 ? 460 GLU A C   1 
ATOM   2710 O  O   . GLU A 1 355 ? 27.086  43.151  42.285 1.00 44.75 ? 460 GLU A O   1 
ATOM   2711 C  CB  . GLU A 1 355 ? 29.474  42.594  40.382 1.00 44.51 ? 460 GLU A CB  1 
ATOM   2712 C  CG  . GLU A 1 355 ? 30.757  42.564  41.210 1.00 44.72 ? 460 GLU A CG  1 
ATOM   2713 C  CD  . GLU A 1 355 ? 31.799  41.607  40.671 1.00 45.34 ? 460 GLU A CD  1 
ATOM   2714 O  OE1 . GLU A 1 355 ? 31.429  40.623  39.988 1.00 45.68 ? 460 GLU A OE1 1 
ATOM   2715 O  OE2 . GLU A 1 355 ? 32.996  41.844  40.942 1.00 45.33 ? 460 GLU A OE2 1 
ATOM   2716 N  N   . ARG A 1 356 ? 28.265  41.520  43.305 1.00 44.84 ? 461 ARG A N   1 
ATOM   2717 C  CA  . ARG A 1 356 ? 27.833  41.854  44.664 1.00 44.98 ? 461 ARG A CA  1 
ATOM   2718 C  C   . ARG A 1 356 ? 28.841  42.771  45.365 1.00 45.11 ? 461 ARG A C   1 
ATOM   2719 O  O   . ARG A 1 356 ? 30.029  42.749  45.051 1.00 45.12 ? 461 ARG A O   1 
ATOM   2720 C  CB  . ARG A 1 356 ? 27.623  40.563  45.464 1.00 44.92 ? 461 ARG A CB  1 
ATOM   2721 C  CG  . ARG A 1 356 ? 26.292  39.881  45.152 1.00 44.92 ? 461 ARG A CG  1 
ATOM   2722 C  CD  . ARG A 1 356 ? 26.427  38.425  44.746 1.00 44.96 ? 461 ARG A CD  1 
ATOM   2723 N  NE  . ARG A 1 356 ? 26.159  37.486  45.839 1.00 45.08 ? 461 ARG A NE  1 
ATOM   2724 C  CZ  . ARG A 1 356 ? 27.016  36.583  46.325 1.00 44.69 ? 461 ARG A CZ  1 
ATOM   2725 N  NH1 . ARG A 1 356 ? 28.245  36.460  45.837 1.00 44.48 ? 461 ARG A NH1 1 
ATOM   2726 N  NH2 . ARG A 1 356 ? 26.633  35.785  47.316 1.00 44.64 ? 461 ARG A NH2 1 
ATOM   2727 N  N   . PHE A 1 357 ? 28.355  43.579  46.303 1.00 45.27 ? 462 PHE A N   1 
ATOM   2728 C  CA  . PHE A 1 357 ? 29.208  44.493  47.061 1.00 45.59 ? 462 PHE A CA  1 
ATOM   2729 C  C   . PHE A 1 357 ? 29.007  44.360  48.572 1.00 45.78 ? 462 PHE A C   1 
ATOM   2730 O  O   . PHE A 1 357 ? 27.887  44.158  49.048 1.00 45.73 ? 462 PHE A O   1 
ATOM   2731 C  CB  . PHE A 1 357 ? 28.958  45.938  46.634 1.00 45.80 ? 462 PHE A CB  1 
ATOM   2732 C  CG  . PHE A 1 357 ? 29.393  46.233  45.232 1.00 45.92 ? 462 PHE A CG  1 
ATOM   2733 C  CD1 . PHE A 1 357 ? 28.493  46.130  44.173 1.00 46.48 ? 462 PHE A CD1 1 
ATOM   2734 C  CD2 . PHE A 1 357 ? 30.704  46.599  44.964 1.00 45.79 ? 462 PHE A CD2 1 
ATOM   2735 C  CE1 . PHE A 1 357 ? 28.895  46.394  42.868 1.00 46.21 ? 462 PHE A CE1 1 
ATOM   2736 C  CE2 . PHE A 1 357 ? 31.116  46.869  43.665 1.00 46.10 ? 462 PHE A CE2 1 
ATOM   2737 C  CZ  . PHE A 1 357 ? 30.211  46.764  42.614 1.00 46.27 ? 462 PHE A CZ  1 
ATOM   2738 N  N   . LEU A 1 358 ? 30.112  44.479  49.309 1.00 45.98 ? 463 LEU A N   1 
ATOM   2739 C  CA  . LEU A 1 358 ? 30.124  44.385  50.764 1.00 46.03 ? 463 LEU A CA  1 
ATOM   2740 C  C   . LEU A 1 358 ? 30.749  45.653  51.342 1.00 46.18 ? 463 LEU A C   1 
ATOM   2741 O  O   . LEU A 1 358 ? 31.812  46.080  50.898 1.00 46.26 ? 463 LEU A O   1 
ATOM   2742 C  CB  . LEU A 1 358 ? 30.910  43.148  51.196 1.00 46.03 ? 463 LEU A CB  1 
ATOM   2743 C  CG  . LEU A 1 358 ? 31.345  42.987  52.656 1.00 46.11 ? 463 LEU A CG  1 
ATOM   2744 C  CD1 . LEU A 1 358 ? 30.167  43.014  53.610 1.00 46.29 ? 463 LEU A CD1 1 
ATOM   2745 C  CD2 . LEU A 1 358 ? 32.124  41.685  52.817 1.00 46.07 ? 463 LEU A CD2 1 
ATOM   2746 N  N   . VAL A 1 359 ? 30.072  46.249  52.322 1.00 46.38 ? 464 VAL A N   1 
ATOM   2747 C  CA  . VAL A 1 359 ? 30.525  47.467  52.985 1.00 46.47 ? 464 VAL A CA  1 
ATOM   2748 C  C   . VAL A 1 359 ? 30.830  47.179  54.454 1.00 46.59 ? 464 VAL A C   1 
ATOM   2749 O  O   . VAL A 1 359 ? 30.136  46.384  55.085 1.00 46.57 ? 464 VAL A O   1 
ATOM   2750 C  CB  . VAL A 1 359 ? 29.443  48.553  52.911 1.00 46.54 ? 464 VAL A CB  1 
ATOM   2751 C  CG1 . VAL A 1 359 ? 29.907  49.831  53.613 1.00 46.80 ? 464 VAL A CG1 1 
ATOM   2752 C  CG2 . VAL A 1 359 ? 29.073  48.829  51.459 1.00 46.53 ? 464 VAL A CG2 1 
ATOM   2753 N  N   . VAL A 1 360 ? 31.873  47.822  54.983 1.00 46.74 ? 465 VAL A N   1 
ATOM   2754 C  CA  . VAL A 1 360 ? 32.244  47.712  56.403 1.00 46.85 ? 465 VAL A CA  1 
ATOM   2755 C  C   . VAL A 1 360 ? 32.699  49.084  56.928 1.00 46.88 ? 465 VAL A C   1 
ATOM   2756 O  O   . VAL A 1 360 ? 33.687  49.626  56.449 1.00 46.65 ? 465 VAL A O   1 
ATOM   2757 C  CB  . VAL A 1 360 ? 33.376  46.674  56.627 1.00 46.78 ? 465 VAL A CB  1 
ATOM   2758 C  CG1 . VAL A 1 360 ? 33.560  46.380  58.122 1.00 46.74 ? 465 VAL A CG1 1 
ATOM   2759 C  CG2 . VAL A 1 360 ? 33.089  45.384  55.869 1.00 46.71 ? 465 VAL A CG2 1 
ATOM   2760 N  N   . LEU A 1 361 ? 31.980  49.626  57.913 1.00 47.23 ? 466 LEU A N   1 
ATOM   2761 C  CA  . LEU A 1 361 ? 32.233  50.982  58.425 1.00 47.56 ? 466 LEU A CA  1 
ATOM   2762 C  C   . LEU A 1 361 ? 32.557  50.982  59.922 1.00 47.92 ? 466 LEU A C   1 
ATOM   2763 O  O   . LEU A 1 361 ? 31.707  50.628  60.740 1.00 48.16 ? 466 LEU A O   1 
ATOM   2764 C  CB  . LEU A 1 361 ? 31.010  51.877  58.182 1.00 47.43 ? 466 LEU A CB  1 
ATOM   2765 C  CG  . LEU A 1 361 ? 30.443  51.951  56.759 1.00 47.23 ? 466 LEU A CG  1 
ATOM   2766 C  CD1 . LEU A 1 361 ? 29.136  52.718  56.760 1.00 47.08 ? 466 LEU A CD1 1 
ATOM   2767 C  CD2 . LEU A 1 361 ? 31.425  52.578  55.779 1.00 47.15 ? 466 LEU A CD2 1 
ATOM   2768 N  N   . ASN A 1 362 ? 33.776  51.388  60.278 1.00 48.23 ? 467 ASN A N   1 
ATOM   2769 C  CA  . ASN A 1 362 ? 34.174  51.528  61.684 1.00 48.48 ? 467 ASN A CA  1 
ATOM   2770 C  C   . ASN A 1 362 ? 33.970  52.970  62.155 1.00 48.82 ? 467 ASN A C   1 
ATOM   2771 O  O   . ASN A 1 362 ? 34.618  53.885  61.652 1.00 48.89 ? 467 ASN A O   1 
ATOM   2772 C  CB  . ASN A 1 362 ? 35.636  51.113  61.876 1.00 48.34 ? 467 ASN A CB  1 
ATOM   2773 C  CG  . ASN A 1 362 ? 36.065  51.112  63.341 1.00 48.10 ? 467 ASN A CG  1 
ATOM   2774 O  OD1 . ASN A 1 362 ? 35.322  51.539  64.223 1.00 47.45 ? 467 ASN A OD1 1 
ATOM   2775 N  ND2 . ASN A 1 362 ? 37.275  50.626  63.600 1.00 47.55 ? 467 ASN A ND2 1 
ATOM   2776 N  N   . PHE A 1 363 ? 33.081  53.160  63.130 1.00 49.28 ? 468 PHE A N   1 
ATOM   2777 C  CA  . PHE A 1 363 ? 32.716  54.501  63.609 1.00 49.57 ? 468 PHE A CA  1 
ATOM   2778 C  C   . PHE A 1 363 ? 33.503  54.964  64.845 1.00 49.92 ? 468 PHE A C   1 
ATOM   2779 O  O   . PHE A 1 363 ? 33.531  56.161  65.138 1.00 50.21 ? 468 PHE A O   1 
ATOM   2780 C  CB  . PHE A 1 363 ? 31.210  54.574  63.897 1.00 49.68 ? 468 PHE A CB  1 
ATOM   2781 C  CG  . PHE A 1 363 ? 30.369  54.727  62.666 1.00 49.53 ? 468 PHE A CG  1 
ATOM   2782 C  CD1 . PHE A 1 363 ? 29.974  53.614  61.934 1.00 49.91 ? 468 PHE A CD1 1 
ATOM   2783 C  CD2 . PHE A 1 363 ? 29.980  55.985  62.230 1.00 49.72 ? 468 PHE A CD2 1 
ATOM   2784 C  CE1 . PHE A 1 363 ? 29.198  53.749  60.785 1.00 49.72 ? 468 PHE A CE1 1 
ATOM   2785 C  CE2 . PHE A 1 363 ? 29.205  56.133  61.085 1.00 50.05 ? 468 PHE A CE2 1 
ATOM   2786 C  CZ  . PHE A 1 363 ? 28.812  55.009  60.360 1.00 50.01 ? 468 PHE A CZ  1 
ATOM   2787 N  N   . GLY A 1 364 ? 34.133  54.031  65.560 1.00 50.04 ? 469 GLY A N   1 
ATOM   2788 C  CA  . GLY A 1 364 ? 34.885  54.357  66.775 1.00 50.24 ? 469 GLY A CA  1 
ATOM   2789 C  C   . GLY A 1 364 ? 36.339  54.743  66.545 1.00 50.40 ? 469 GLY A C   1 
ATOM   2790 O  O   . GLY A 1 364 ? 36.836  54.702  65.421 1.00 50.31 ? 469 GLY A O   1 
ATOM   2791 N  N   . ASP A 1 365 ? 37.020  55.105  67.632 1.00 50.70 ? 470 ASP A N   1 
ATOM   2792 C  CA  . ASP A 1 365 ? 38.430  55.513  67.592 1.00 50.94 ? 470 ASP A CA  1 
ATOM   2793 C  C   . ASP A 1 365 ? 39.383  54.364  67.944 1.00 51.10 ? 470 ASP A C   1 
ATOM   2794 O  O   . ASP A 1 365 ? 40.508  54.600  68.387 1.00 51.06 ? 470 ASP A O   1 
ATOM   2795 C  CB  . ASP A 1 365 ? 38.666  56.676  68.567 1.00 51.03 ? 470 ASP A CB  1 
ATOM   2796 C  CG  . ASP A 1 365 ? 37.909  57.932  68.180 1.00 51.12 ? 470 ASP A CG  1 
ATOM   2797 O  OD1 . ASP A 1 365 ? 38.408  59.035  68.496 1.00 51.47 ? 470 ASP A OD1 1 
ATOM   2798 O  OD2 . ASP A 1 365 ? 36.827  57.820  67.560 1.00 50.97 ? 470 ASP A OD2 1 
ATOM   2799 N  N   . VAL A 1 366 ? 38.935  53.128  67.737 1.00 51.38 ? 471 VAL A N   1 
ATOM   2800 C  CA  . VAL A 1 366 ? 39.692  51.945  68.137 1.00 51.58 ? 471 VAL A CA  1 
ATOM   2801 C  C   . VAL A 1 366 ? 39.703  50.916  67.013 1.00 51.75 ? 471 VAL A C   1 
ATOM   2802 O  O   . VAL A 1 366 ? 38.740  50.798  66.258 1.00 51.67 ? 471 VAL A O   1 
ATOM   2803 C  CB  . VAL A 1 366 ? 39.087  51.298  69.407 1.00 51.52 ? 471 VAL A CB  1 
ATOM   2804 C  CG1 . VAL A 1 366 ? 39.979  50.167  69.915 1.00 51.65 ? 471 VAL A CG1 1 
ATOM   2805 C  CG2 . VAL A 1 366 ? 38.878  52.349  70.500 1.00 51.56 ? 471 VAL A CG2 1 
ATOM   2806 N  N   . GLY A 1 367 ? 40.801  50.174  66.912 1.00 52.18 ? 472 GLY A N   1 
ATOM   2807 C  CA  . GLY A 1 367 ? 40.924  49.101  65.936 1.00 52.49 ? 472 GLY A CA  1 
ATOM   2808 C  C   . GLY A 1 367 ? 39.994  47.945  66.254 1.00 52.81 ? 472 GLY A C   1 
ATOM   2809 O  O   . GLY A 1 367 ? 39.742  47.638  67.421 1.00 52.84 ? 472 GLY A O   1 
ATOM   2810 N  N   . LEU A 1 368 ? 39.484  47.301  65.210 1.00 53.25 ? 473 LEU A N   1 
ATOM   2811 C  CA  . LEU A 1 368 ? 38.506  46.227  65.360 1.00 53.53 ? 473 LEU A CA  1 
ATOM   2812 C  C   . LEU A 1 368 ? 38.817  45.047  64.455 1.00 53.81 ? 473 LEU A C   1 
ATOM   2813 O  O   . LEU A 1 368 ? 39.508  45.186  63.443 1.00 53.89 ? 473 LEU A O   1 
ATOM   2814 C  CB  . LEU A 1 368 ? 37.101  46.744  65.033 1.00 53.54 ? 473 LEU A CB  1 
ATOM   2815 C  CG  . LEU A 1 368 ? 36.389  47.539  66.127 1.00 53.59 ? 473 LEU A CG  1 
ATOM   2816 C  CD1 . LEU A 1 368 ? 35.105  48.145  65.584 1.00 53.43 ? 473 LEU A CD1 1 
ATOM   2817 C  CD2 . LEU A 1 368 ? 36.105  46.658  67.340 1.00 53.82 ? 473 LEU A CD2 1 
ATOM   2818 N  N   . SER A 1 369 ? 38.302  43.886  64.838 1.00 54.13 ? 474 SER A N   1 
ATOM   2819 C  CA  . SER A 1 369 ? 38.270  42.729  63.965 1.00 54.47 ? 474 SER A CA  1 
ATOM   2820 C  C   . SER A 1 369 ? 36.831  42.562  63.518 1.00 54.74 ? 474 SER A C   1 
ATOM   2821 O  O   . SER A 1 369 ? 35.946  42.333  64.339 1.00 54.64 ? 474 SER A O   1 
ATOM   2822 C  CB  . SER A 1 369 ? 38.759  41.476  64.687 1.00 54.47 ? 474 SER A CB  1 
ATOM   2823 O  OG  . SER A 1 369 ? 40.175  41.463  64.768 1.00 54.70 ? 474 SER A OG  1 
ATOM   2824 N  N   . ALA A 1 370 ? 36.599  42.706  62.217 1.00 55.26 ? 475 ALA A N   1 
ATOM   2825 C  CA  . ALA A 1 370 ? 35.261  42.564  61.652 1.00 55.56 ? 475 ALA A CA  1 
ATOM   2826 C  C   . ALA A 1 370 ? 34.855  41.093  61.613 1.00 55.91 ? 475 ALA A C   1 
ATOM   2827 O  O   . ALA A 1 370 ? 35.251  40.347  60.711 1.00 56.01 ? 475 ALA A O   1 
ATOM   2828 C  CB  . ALA A 1 370 ? 35.203  43.177  60.258 1.00 55.59 ? 475 ALA A CB  1 
ATOM   2829 N  N   . GLY A 1 371 ? 34.078  40.684  62.613 1.00 56.24 ? 476 GLY A N   1 
ATOM   2830 C  CA  . GLY A 1 371 ? 33.533  39.333  62.677 1.00 56.50 ? 476 GLY A CA  1 
ATOM   2831 C  C   . GLY A 1 371 ? 32.142  39.295  62.080 1.00 56.77 ? 476 GLY A C   1 
ATOM   2832 O  O   . GLY A 1 371 ? 31.179  38.937  62.756 1.00 56.85 ? 476 GLY A O   1 
ATOM   2833 N  N   . LEU A 1 372 ? 32.039  39.665  60.806 1.00 57.12 ? 477 LEU A N   1 
ATOM   2834 C  CA  . LEU A 1 372 ? 30.753  39.684  60.115 1.00 57.44 ? 477 LEU A CA  1 
ATOM   2835 C  C   . LEU A 1 372 ? 30.317  38.253  59.807 1.00 57.72 ? 477 LEU A C   1 
ATOM   2836 O  O   . LEU A 1 372 ? 30.910  37.578  58.962 1.00 57.78 ? 477 LEU A O   1 
ATOM   2837 C  CB  . LEU A 1 372 ? 30.797  40.539  58.835 1.00 57.43 ? 477 LEU A CB  1 
ATOM   2838 C  CG  . LEU A 1 372 ? 31.937  40.362  57.820 1.00 57.43 ? 477 LEU A CG  1 
ATOM   2839 C  CD1 . LEU A 1 372 ? 31.409  40.390  56.398 1.00 57.46 ? 477 LEU A CD1 1 
ATOM   2840 C  CD2 . LEU A 1 372 ? 33.007  41.430  57.988 1.00 57.69 ? 477 LEU A CD2 1 
ATOM   2841 N  N   . GLN A 1 373 ? 29.280  37.802  60.508 1.00 58.02 ? 478 GLN A N   1 
ATOM   2842 C  CA  . GLN A 1 373 ? 28.800  36.429  60.403 1.00 58.35 ? 478 GLN A CA  1 
ATOM   2843 C  C   . GLN A 1 373 ? 27.484  36.350  59.629 1.00 58.62 ? 478 GLN A C   1 
ATOM   2844 O  O   . GLN A 1 373 ? 26.709  37.311  59.605 1.00 58.60 ? 478 GLN A O   1 
ATOM   2845 C  CB  . GLN A 1 373 ? 28.606  35.859  61.806 1.00 58.37 ? 478 GLN A CB  1 
ATOM   2846 C  CG  . GLN A 1 373 ? 28.531  34.349  61.868 1.00 58.18 ? 478 GLN A CG  1 
ATOM   2847 C  CD  . GLN A 1 373 ? 28.532  33.843  63.292 1.00 58.47 ? 478 GLN A CD  1 
ATOM   2848 O  OE1 . GLN A 1 373 ? 28.394  34.619  64.237 1.00 58.72 ? 478 GLN A OE1 1 
ATOM   2849 N  NE2 . GLN A 1 373 ? 28.688  32.534  63.457 1.00 58.95 ? 478 GLN A NE2 1 
ATOM   2850 N  N   . ALA A 1 374 ? 27.235  35.192  59.013 1.00 58.93 ? 479 ALA A N   1 
ATOM   2851 C  CA  . ALA A 1 374 ? 25.966  34.909  58.332 1.00 59.22 ? 479 ALA A CA  1 
ATOM   2852 C  C   . ALA A 1 374 ? 24.790  35.601  59.017 1.00 59.54 ? 479 ALA A C   1 
ATOM   2853 O  O   . ALA A 1 374 ? 23.928  36.174  58.351 1.00 59.58 ? 479 ALA A O   1 
ATOM   2854 C  CB  . ALA A 1 374 ? 25.723  33.407  58.280 1.00 59.22 ? 479 ALA A CB  1 
ATOM   2855 N  N   . SER A 1 375 ? 24.770  35.520  60.349 1.00 59.85 ? 480 SER A N   1 
ATOM   2856 C  CA  . SER A 1 375 ? 23.842  36.261  61.211 1.00 59.99 ? 480 SER A CA  1 
ATOM   2857 C  C   . SER A 1 375 ? 22.831  37.146  60.466 1.00 60.16 ? 480 SER A C   1 
ATOM   2858 O  O   . SER A 1 375 ? 23.171  38.225  59.964 1.00 59.93 ? 480 SER A O   1 
ATOM   2859 C  CB  . SER A 1 375 ? 24.633  37.107  62.215 1.00 60.02 ? 480 SER A CB  1 
ATOM   2860 O  OG  . SER A 1 375 ? 23.778  37.652  63.203 1.00 60.18 ? 480 SER A OG  1 
ATOM   2861 N  N   . ASP A 1 376 ? 21.594  36.653  60.406 1.00 60.42 ? 481 ASP A N   1 
ATOM   2862 C  CA  . ASP A 1 376 ? 20.448  37.365  59.826 1.00 60.55 ? 481 ASP A CA  1 
ATOM   2863 C  C   . ASP A 1 376 ? 20.686  37.898  58.407 1.00 60.59 ? 481 ASP A C   1 
ATOM   2864 O  O   . ASP A 1 376 ? 20.954  39.083  58.200 1.00 60.60 ? 481 ASP A O   1 
ATOM   2865 C  CB  . ASP A 1 376 ? 19.968  38.480  60.765 1.00 60.65 ? 481 ASP A CB  1 
ATOM   2866 C  CG  . ASP A 1 376 ? 18.476  38.739  60.640 1.00 60.91 ? 481 ASP A CG  1 
ATOM   2867 O  OD1 . ASP A 1 376 ? 17.972  38.797  59.495 1.00 60.98 ? 481 ASP A OD1 1 
ATOM   2868 O  OD2 . ASP A 1 376 ? 17.810  38.871  61.691 1.00 61.25 ? 481 ASP A OD2 1 
ATOM   2869 N  N   . LEU A 1 377 ? 20.578  36.992  57.442 1.00 60.62 ? 482 LEU A N   1 
ATOM   2870 C  CA  . LEU A 1 377 ? 20.636  37.324  56.023 1.00 60.66 ? 482 LEU A CA  1 
ATOM   2871 C  C   . LEU A 1 377 ? 19.684  36.384  55.280 1.00 60.71 ? 482 LEU A C   1 
ATOM   2872 O  O   . LEU A 1 377 ? 19.180  35.429  55.871 1.00 60.85 ? 482 LEU A O   1 
ATOM   2873 C  CB  . LEU A 1 377 ? 22.064  37.148  55.498 1.00 60.64 ? 482 LEU A CB  1 
ATOM   2874 C  CG  . LEU A 1 377 ? 23.164  38.075  56.021 1.00 60.41 ? 482 LEU A CG  1 
ATOM   2875 C  CD1 . LEU A 1 377 ? 24.512  37.551  55.566 1.00 60.34 ? 482 LEU A CD1 1 
ATOM   2876 C  CD2 . LEU A 1 377 ? 22.970  39.513  55.562 1.00 60.11 ? 482 LEU A CD2 1 
ATOM   2877 N  N   . PRO A 1 378 ? 19.424  36.647  53.986 1.00 60.73 ? 483 PRO A N   1 
ATOM   2878 C  CA  . PRO A 1 378 ? 18.638  35.686  53.221 1.00 60.76 ? 483 PRO A CA  1 
ATOM   2879 C  C   . PRO A 1 378 ? 19.462  34.470  52.812 1.00 60.77 ? 483 PRO A C   1 
ATOM   2880 O  O   . PRO A 1 378 ? 20.638  34.363  53.171 1.00 60.75 ? 483 PRO A O   1 
ATOM   2881 C  CB  . PRO A 1 378 ? 18.197  36.477  51.976 1.00 60.74 ? 483 PRO A CB  1 
ATOM   2882 C  CG  . PRO A 1 378 ? 18.722  37.854  52.145 1.00 60.86 ? 483 PRO A CG  1 
ATOM   2883 C  CD  . PRO A 1 378 ? 19.807  37.804  53.163 1.00 60.82 ? 483 PRO A CD  1 
ATOM   2884 N  N   . ALA A 1 379 ? 18.833  33.569  52.061 1.00 60.80 ? 484 ALA A N   1 
ATOM   2885 C  CA  . ALA A 1 379 ? 19.501  32.381  51.531 1.00 60.80 ? 484 ALA A CA  1 
ATOM   2886 C  C   . ALA A 1 379 ? 20.607  32.732  50.527 1.00 60.83 ? 484 ALA A C   1 
ATOM   2887 O  O   . ALA A 1 379 ? 21.506  31.921  50.281 1.00 60.84 ? 484 ALA A O   1 
ATOM   2888 C  CB  . ALA A 1 379 ? 18.482  31.454  50.886 1.00 60.89 ? 484 ALA A CB  1 
ATOM   2889 N  N   . SER A 1 380 ? 20.530  33.938  49.959 1.00 60.77 ? 485 SER A N   1 
ATOM   2890 C  CA  . SER A 1 380 ? 21.542  34.460  49.034 1.00 60.73 ? 485 SER A CA  1 
ATOM   2891 C  C   . SER A 1 380 ? 22.656  35.208  49.786 1.00 60.61 ? 485 SER A C   1 
ATOM   2892 O  O   . SER A 1 380 ? 23.179  36.221  49.308 1.00 60.43 ? 485 SER A O   1 
ATOM   2893 C  CB  . SER A 1 380 ? 20.869  35.387  48.009 1.00 60.80 ? 485 SER A CB  1 
ATOM   2894 O  OG  . SER A 1 380 ? 21.799  35.886  47.064 1.00 61.35 ? 485 SER A OG  1 
ATOM   2895 N  N   . ALA A 1 381 ? 23.010  34.696  50.963 1.00 60.47 ? 486 ALA A N   1 
ATOM   2896 C  CA  . ALA A 1 381 ? 24.074  35.266  51.783 1.00 60.33 ? 486 ALA A CA  1 
ATOM   2897 C  C   . ALA A 1 381 ? 25.415  34.692  51.355 1.00 60.15 ? 486 ALA A C   1 
ATOM   2898 O  O   . ALA A 1 381 ? 26.389  35.429  51.184 1.00 60.08 ? 486 ALA A O   1 
ATOM   2899 C  CB  . ALA A 1 381 ? 23.823  34.960  53.259 1.00 60.37 ? 486 ALA A CB  1 
ATOM   2900 N  N   . SER A 1 382 ? 25.437  33.369  51.187 1.00 59.86 ? 487 SER A N   1 
ATOM   2901 C  CA  . SER A 1 382 ? 26.652  32.599  50.908 1.00 59.70 ? 487 SER A CA  1 
ATOM   2902 C  C   . SER A 1 382 ? 27.835  33.459  50.460 1.00 59.48 ? 487 SER A C   1 
ATOM   2903 O  O   . SER A 1 382 ? 28.082  33.631  49.263 1.00 59.51 ? 487 SER A O   1 
ATOM   2904 C  CB  . SER A 1 382 ? 26.359  31.504  49.874 1.00 59.78 ? 487 SER A CB  1 
ATOM   2905 O  OG  . SER A 1 382 ? 25.685  32.030  48.741 1.00 59.88 ? 487 SER A OG  1 
ATOM   2906 N  N   . LEU A 1 383 ? 28.556  33.995  51.442 1.00 59.16 ? 488 LEU A N   1 
ATOM   2907 C  CA  . LEU A 1 383 ? 29.718  34.835  51.181 1.00 58.82 ? 488 LEU A CA  1 
ATOM   2908 C  C   . LEU A 1 383 ? 30.905  33.952  50.819 1.00 58.47 ? 488 LEU A C   1 
ATOM   2909 O  O   . LEU A 1 383 ? 31.032  32.846  51.346 1.00 58.51 ? 488 LEU A O   1 
ATOM   2910 C  CB  . LEU A 1 383 ? 30.075  35.664  52.413 1.00 58.84 ? 488 LEU A CB  1 
ATOM   2911 C  CG  . LEU A 1 383 ? 28.964  36.514  53.027 1.00 59.12 ? 488 LEU A CG  1 
ATOM   2912 C  CD1 . LEU A 1 383 ? 29.433  37.089  54.356 1.00 59.39 ? 488 LEU A CD1 1 
ATOM   2913 C  CD2 . LEU A 1 383 ? 28.541  37.625  52.077 1.00 59.53 ? 488 LEU A CD2 1 
ATOM   2914 N  N   . PRO A 1 384 ? 31.775  34.430  49.916 1.00 58.00 ? 489 PRO A N   1 
ATOM   2915 C  CA  . PRO A 1 384 ? 33.011  33.701  49.641 1.00 57.76 ? 489 PRO A CA  1 
ATOM   2916 C  C   . PRO A 1 384 ? 33.970  33.709  50.828 1.00 57.41 ? 489 PRO A C   1 
ATOM   2917 O  O   . PRO A 1 384 ? 33.766  34.455  51.786 1.00 57.33 ? 489 PRO A O   1 
ATOM   2918 C  CB  . PRO A 1 384 ? 33.636  34.483  48.477 1.00 57.84 ? 489 PRO A CB  1 
ATOM   2919 C  CG  . PRO A 1 384 ? 32.562  35.366  47.951 1.00 58.02 ? 489 PRO A CG  1 
ATOM   2920 C  CD  . PRO A 1 384 ? 31.654  35.644  49.091 1.00 58.03 ? 489 PRO A CD  1 
ATOM   2921 N  N   . ALA A 1 385 ? 35.008  32.882  50.753 1.00 57.06 ? 490 ALA A N   1 
ATOM   2922 C  CA  . ALA A 1 385 ? 36.114  32.940  51.704 1.00 56.84 ? 490 ALA A CA  1 
ATOM   2923 C  C   . ALA A 1 385 ? 36.951  34.208  51.478 1.00 56.61 ? 490 ALA A C   1 
ATOM   2924 O  O   . ALA A 1 385 ? 37.542  34.747  52.419 1.00 56.49 ? 490 ALA A O   1 
ATOM   2925 C  CB  . ALA A 1 385 ? 36.984  31.701  51.575 1.00 56.78 ? 490 ALA A CB  1 
ATOM   2926 N  N   . LYS A 1 386 ? 36.989  34.671  50.227 1.00 56.39 ? 491 LYS A N   1 
ATOM   2927 C  CA  . LYS A 1 386 ? 37.775  35.840  49.831 1.00 56.19 ? 491 LYS A CA  1 
ATOM   2928 C  C   . LYS A 1 386 ? 36.982  36.774  48.911 1.00 56.02 ? 491 LYS A C   1 
ATOM   2929 O  O   . LYS A 1 386 ? 36.206  36.314  48.073 1.00 56.03 ? 491 LYS A O   1 
ATOM   2930 C  CB  . LYS A 1 386 ? 39.053  35.393  49.110 1.00 56.15 ? 491 LYS A CB  1 
ATOM   2931 C  CG  . LYS A 1 386 ? 39.899  34.387  49.883 1.00 56.06 ? 491 LYS A CG  1 
ATOM   2932 C  CD  . LYS A 1 386 ? 41.190  34.051  49.144 1.00 56.09 ? 491 LYS A CD  1 
ATOM   2933 C  CE  . LYS A 1 386 ? 42.084  33.133  49.969 1.00 55.94 ? 491 LYS A CE  1 
ATOM   2934 N  NZ  . LYS A 1 386 ? 43.382  32.846  49.296 1.00 55.91 ? 491 LYS A NZ  1 
ATOM   2935 N  N   . ALA A 1 387 ? 37.187  38.082  49.071 1.00 55.80 ? 492 ALA A N   1 
ATOM   2936 C  CA  . ALA A 1 387 ? 36.617  39.090  48.167 1.00 55.62 ? 492 ALA A CA  1 
ATOM   2937 C  C   . ALA A 1 387 ? 37.646  40.184  47.871 1.00 55.51 ? 492 ALA A C   1 
ATOM   2938 O  O   . ALA A 1 387 ? 38.450  40.540  48.736 1.00 55.50 ? 492 ALA A O   1 
ATOM   2939 C  CB  . ALA A 1 387 ? 35.367  39.693  48.769 1.00 55.50 ? 492 ALA A CB  1 
ATOM   2940 N  N   . ASP A 1 388 ? 37.615  40.715  46.650 1.00 55.37 ? 493 ASP A N   1 
ATOM   2941 C  CA  . ASP A 1 388 ? 38.589  41.722  46.220 1.00 55.36 ? 493 ASP A CA  1 
ATOM   2942 C  C   . ASP A 1 388 ? 38.263  43.092  46.799 1.00 55.16 ? 493 ASP A C   1 
ATOM   2943 O  O   . ASP A 1 388 ? 37.121  43.538  46.731 1.00 55.25 ? 493 ASP A O   1 
ATOM   2944 C  CB  . ASP A 1 388 ? 38.636  41.817  44.690 1.00 55.48 ? 493 ASP A CB  1 
ATOM   2945 C  CG  . ASP A 1 388 ? 39.088  40.522  44.031 1.00 56.27 ? 493 ASP A CG  1 
ATOM   2946 O  OD1 . ASP A 1 388 ? 38.648  40.253  42.890 1.00 56.91 ? 493 ASP A OD1 1 
ATOM   2947 O  OD2 . ASP A 1 388 ? 39.881  39.772  44.647 1.00 57.70 ? 493 ASP A OD2 1 
ATOM   2948 N  N   . LEU A 1 389 ? 39.269  43.754  47.367 1.00 54.93 ? 494 LEU A N   1 
ATOM   2949 C  CA  . LEU A 1 389 ? 39.112  45.115  47.865 1.00 54.85 ? 494 LEU A CA  1 
ATOM   2950 C  C   . LEU A 1 389 ? 39.070  46.079  46.688 1.00 54.76 ? 494 LEU A C   1 
ATOM   2951 O  O   . LEU A 1 389 ? 40.029  46.174  45.924 1.00 54.64 ? 494 LEU A O   1 
ATOM   2952 C  CB  . LEU A 1 389 ? 40.269  45.494  48.790 1.00 54.81 ? 494 LEU A CB  1 
ATOM   2953 C  CG  . LEU A 1 389 ? 40.150  46.852  49.494 1.00 54.79 ? 494 LEU A CG  1 
ATOM   2954 C  CD1 . LEU A 1 389 ? 39.300  46.730  50.742 1.00 54.64 ? 494 LEU A CD1 1 
ATOM   2955 C  CD2 . LEU A 1 389 ? 41.518  47.408  49.850 1.00 54.79 ? 494 LEU A CD2 1 
ATOM   2956 N  N   . LEU A 1 390 ? 37.955  46.785  46.546 1.00 54.72 ? 495 LEU A N   1 
ATOM   2957 C  CA  . LEU A 1 390 ? 37.811  47.804  45.512 1.00 54.74 ? 495 LEU A CA  1 
ATOM   2958 C  C   . LEU A 1 390 ? 38.413  49.131  45.965 1.00 54.81 ? 495 LEU A C   1 
ATOM   2959 O  O   . LEU A 1 390 ? 39.040  49.838  45.174 1.00 54.82 ? 495 LEU A O   1 
ATOM   2960 C  CB  . LEU A 1 390 ? 36.333  48.003  45.178 1.00 54.77 ? 495 LEU A CB  1 
ATOM   2961 C  CG  . LEU A 1 390 ? 35.970  48.928  44.016 1.00 54.71 ? 495 LEU A CG  1 
ATOM   2962 C  CD1 . LEU A 1 390 ? 36.501  48.378  42.705 1.00 54.94 ? 495 LEU A CD1 1 
ATOM   2963 C  CD2 . LEU A 1 390 ? 34.461  49.100  43.949 1.00 54.73 ? 495 LEU A CD2 1 
ATOM   2964 N  N   . LEU A 1 391 ? 38.228  49.460  47.243 1.00 54.84 ? 496 LEU A N   1 
ATOM   2965 C  CA  . LEU A 1 391 ? 38.552  50.790  47.743 1.00 54.74 ? 496 LEU A CA  1 
ATOM   2966 C  C   . LEU A 1 391 ? 38.487  50.849  49.271 1.00 54.63 ? 496 LEU A C   1 
ATOM   2967 O  O   . LEU A 1 391 ? 37.616  50.234  49.885 1.00 54.65 ? 496 LEU A O   1 
ATOM   2968 C  CB  . LEU A 1 391 ? 37.576  51.787  47.110 1.00 54.78 ? 496 LEU A CB  1 
ATOM   2969 C  CG  . LEU A 1 391 ? 37.441  53.221  47.619 1.00 55.02 ? 496 LEU A CG  1 
ATOM   2970 C  CD1 . LEU A 1 391 ? 36.913  54.088  46.473 1.00 55.36 ? 496 LEU A CD1 1 
ATOM   2971 C  CD2 . LEU A 1 391 ? 36.531  53.327  48.853 1.00 54.85 ? 496 LEU A CD2 1 
ATOM   2972 N  N   . SER A 1 392 ? 39.420  51.585  49.872 1.00 54.63 ? 497 SER A N   1 
ATOM   2973 C  CA  . SER A 1 392 ? 39.425  51.859  51.315 1.00 54.67 ? 497 SER A CA  1 
ATOM   2974 C  C   . SER A 1 392 ? 39.485  53.365  51.551 1.00 54.66 ? 497 SER A C   1 
ATOM   2975 O  O   . SER A 1 392 ? 40.098  54.089  50.769 1.00 54.73 ? 497 SER A O   1 
ATOM   2976 C  CB  . SER A 1 392 ? 40.627  51.194  51.989 1.00 54.68 ? 497 SER A CB  1 
ATOM   2977 O  OG  . SER A 1 392 ? 40.756  51.603  53.343 1.00 54.36 ? 497 SER A OG  1 
ATOM   2978 N  N   . THR A 1 393 ? 38.862  53.836  52.629 1.00 54.73 ? 498 THR A N   1 
ATOM   2979 C  CA  . THR A 1 393 ? 38.879  55.266  52.943 1.00 54.87 ? 498 THR A CA  1 
ATOM   2980 C  C   . THR A 1 393 ? 40.293  55.754  53.265 1.00 55.12 ? 498 THR A C   1 
ATOM   2981 O  O   . THR A 1 393 ? 40.609  56.921  53.037 1.00 55.22 ? 498 THR A O   1 
ATOM   2982 C  CB  . THR A 1 393 ? 37.915  55.642  54.103 1.00 54.77 ? 498 THR A CB  1 
ATOM   2983 O  OG1 . THR A 1 393 ? 38.268  54.937  55.299 1.00 54.23 ? 498 THR A OG1 1 
ATOM   2984 C  CG2 . THR A 1 393 ? 36.473  55.335  53.729 1.00 54.44 ? 498 THR A CG2 1 
ATOM   2985 N  N   . GLN A 1 394 ? 41.138  54.856  53.776 1.00 55.53 ? 499 GLN A N   1 
ATOM   2986 C  CA  . GLN A 1 394 ? 42.536  55.172  54.096 1.00 55.79 ? 499 GLN A CA  1 
ATOM   2987 C  C   . GLN A 1 394 ? 43.509  54.569  53.075 1.00 56.18 ? 499 GLN A C   1 
ATOM   2988 O  O   . GLN A 1 394 ? 43.488  53.356  52.839 1.00 56.32 ? 499 GLN A O   1 
ATOM   2989 C  CB  . GLN A 1 394 ? 42.889  54.652  55.489 1.00 55.72 ? 499 GLN A CB  1 
ATOM   2990 C  CG  . GLN A 1 394 ? 42.119  55.325  56.604 1.00 55.61 ? 499 GLN A CG  1 
ATOM   2991 C  CD  . GLN A 1 394 ? 42.409  54.728  57.964 1.00 55.86 ? 499 GLN A CD  1 
ATOM   2992 O  OE1 . GLN A 1 394 ? 43.427  54.057  58.165 1.00 56.18 ? 499 GLN A OE1 1 
ATOM   2993 N  NE2 . GLN A 1 394 ? 41.512  54.969  58.913 1.00 55.91 ? 499 GLN A NE2 1 
ATOM   2994 N  N   . PRO A 1 395 ? 44.355  55.415  52.451 1.00 56.57 ? 500 PRO A N   1 
ATOM   2995 C  CA  . PRO A 1 395 ? 45.465  54.910  51.634 1.00 56.51 ? 500 PRO A CA  1 
ATOM   2996 C  C   . PRO A 1 395 ? 46.419  54.019  52.428 1.00 56.62 ? 500 PRO A C   1 
ATOM   2997 O  O   . PRO A 1 395 ? 46.616  54.242  53.626 1.00 56.62 ? 500 PRO A O   1 
ATOM   2998 C  CB  . PRO A 1 395 ? 46.185  56.189  51.189 1.00 56.61 ? 500 PRO A CB  1 
ATOM   2999 C  CG  . PRO A 1 395 ? 45.142  57.255  51.248 1.00 56.74 ? 500 PRO A CG  1 
ATOM   3000 C  CD  . PRO A 1 395 ? 44.292  56.890  52.431 1.00 56.69 ? 500 PRO A CD  1 
ATOM   3001 N  N   . GLY A 1 396 ? 46.997  53.023  51.756 1.00 56.64 ? 501 GLY A N   1 
ATOM   3002 C  CA  . GLY A 1 396 ? 47.908  52.069  52.388 1.00 56.63 ? 501 GLY A CA  1 
ATOM   3003 C  C   . GLY A 1 396 ? 47.702  50.646  51.898 1.00 56.69 ? 501 GLY A C   1 
ATOM   3004 O  O   . GLY A 1 396 ? 48.665  49.930  51.621 1.00 56.91 ? 501 GLY A O   1 
ATOM   3005 N  N   . ARG A 1 397 ? 46.441  50.240  51.783 1.00 56.66 ? 502 ARG A N   1 
ATOM   3006 C  CA  . ARG A 1 397 ? 46.088  48.869  51.408 1.00 56.66 ? 502 ARG A CA  1 
ATOM   3007 C  C   . ARG A 1 397 ? 46.474  48.535  49.970 1.00 56.75 ? 502 ARG A C   1 
ATOM   3008 O  O   . ARG A 1 397 ? 46.729  49.428  49.153 1.00 56.77 ? 502 ARG A O   1 
ATOM   3009 C  CB  . ARG A 1 397 ? 44.579  48.658  51.539 1.00 56.63 ? 502 ARG A CB  1 
ATOM   3010 C  CG  . ARG A 1 397 ? 44.002  48.886  52.928 1.00 56.48 ? 502 ARG A CG  1 
ATOM   3011 C  CD  . ARG A 1 397 ? 43.893  47.602  53.734 1.00 56.16 ? 502 ARG A CD  1 
ATOM   3012 N  NE  . ARG A 1 397 ? 42.788  47.665  54.690 1.00 56.07 ? 502 ARG A NE  1 
ATOM   3013 C  CZ  . ARG A 1 397 ? 42.532  46.743  55.615 1.00 55.87 ? 502 ARG A CZ  1 
ATOM   3014 N  NH1 . ARG A 1 397 ? 43.293  45.660  55.733 1.00 56.13 ? 502 ARG A NH1 1 
ATOM   3015 N  NH2 . ARG A 1 397 ? 41.505  46.906  56.433 1.00 55.84 ? 502 ARG A NH2 1 
ATOM   3016 N  N   . GLU A 1 398 ? 46.498  47.239  49.671 1.00 56.77 ? 503 GLU A N   1 
ATOM   3017 C  CA  . GLU A 1 398 ? 46.619  46.767  48.296 1.00 56.84 ? 503 GLU A CA  1 
ATOM   3018 C  C   . GLU A 1 398 ? 45.235  46.677  47.673 1.00 56.77 ? 503 GLU A C   1 
ATOM   3019 O  O   . GLU A 1 398 ? 44.525  45.685  47.852 1.00 56.77 ? 503 GLU A O   1 
ATOM   3020 C  CB  . GLU A 1 398 ? 47.293  45.395  48.237 1.00 56.91 ? 503 GLU A CB  1 
ATOM   3021 C  CG  . GLU A 1 398 ? 48.804  45.425  48.433 1.00 57.24 ? 503 GLU A CG  1 
ATOM   3022 C  CD  . GLU A 1 398 ? 49.497  44.212  47.826 1.00 57.20 ? 503 GLU A CD  1 
ATOM   3023 O  OE1 . GLU A 1 398 ? 49.153  43.838  46.681 1.00 57.53 ? 503 GLU A OE1 1 
ATOM   3024 O  OE2 . GLU A 1 398 ? 50.390  43.639  48.489 1.00 57.27 ? 503 GLU A OE2 1 
ATOM   3025 N  N   . GLU A 1 399 ? 44.854  47.720  46.942 1.00 56.79 ? 504 GLU A N   1 
ATOM   3026 C  CA  . GLU A 1 399 ? 43.560  47.756  46.263 1.00 56.80 ? 504 GLU A CA  1 
ATOM   3027 C  C   . GLU A 1 399 ? 43.617  46.908  44.990 1.00 56.70 ? 504 GLU A C   1 
ATOM   3028 O  O   . GLU A 1 399 ? 44.571  47.003  44.219 1.00 56.68 ? 504 GLU A O   1 
ATOM   3029 C  CB  . GLU A 1 399 ? 43.158  49.203  45.955 1.00 56.75 ? 504 GLU A CB  1 
ATOM   3030 C  CG  . GLU A 1 399 ? 43.021  50.073  47.213 1.00 56.90 ? 504 GLU A CG  1 
ATOM   3031 C  CD  . GLU A 1 399 ? 42.642  51.525  46.926 1.00 57.22 ? 504 GLU A CD  1 
ATOM   3032 O  OE1 . GLU A 1 399 ? 42.869  52.008  45.791 1.00 58.38 ? 504 GLU A OE1 1 
ATOM   3033 O  OE2 . GLU A 1 399 ? 42.119  52.193  47.849 1.00 57.30 ? 504 GLU A OE2 1 
ATOM   3034 N  N   . GLY A 1 400 ? 42.600  46.067  44.795 1.00 56.71 ? 505 GLY A N   1 
ATOM   3035 C  CA  . GLY A 1 400 ? 42.552  45.124  43.675 1.00 56.64 ? 505 GLY A CA  1 
ATOM   3036 C  C   . GLY A 1 400 ? 42.721  43.670  44.095 1.00 56.64 ? 505 GLY A C   1 
ATOM   3037 O  O   . GLY A 1 400 ? 42.154  42.776  43.468 1.00 56.62 ? 505 GLY A O   1 
ATOM   3038 N  N   . SER A 1 401 ? 43.494  43.428  45.155 1.00 56.65 ? 506 SER A N   1 
ATOM   3039 C  CA  . SER A 1 401 ? 43.820  42.063  45.589 1.00 56.58 ? 506 SER A CA  1 
ATOM   3040 C  C   . SER A 1 401 ? 42.849  41.524  46.655 1.00 56.51 ? 506 SER A C   1 
ATOM   3041 O  O   . SER A 1 401 ? 42.258  42.303  47.408 1.00 56.40 ? 506 SER A O   1 
ATOM   3042 C  CB  . SER A 1 401 ? 45.257  42.004  46.115 1.00 56.59 ? 506 SER A CB  1 
ATOM   3043 O  OG  . SER A 1 401 ? 45.432  42.883  47.211 1.00 56.97 ? 506 SER A OG  1 
ATOM   3044 N  N   . PRO A 1 402 ? 42.700  40.184  46.734 1.00 56.42 ? 507 PRO A N   1 
ATOM   3045 C  CA  . PRO A 1 402 ? 41.722  39.557  47.633 1.00 56.39 ? 507 PRO A CA  1 
ATOM   3046 C  C   . PRO A 1 402 ? 42.074  39.602  49.124 1.00 56.35 ? 507 PRO A C   1 
ATOM   3047 O  O   . PRO A 1 402 ? 43.222  39.360  49.503 1.00 56.33 ? 507 PRO A O   1 
ATOM   3048 C  CB  . PRO A 1 402 ? 41.692  38.093  47.162 1.00 56.41 ? 507 PRO A CB  1 
ATOM   3049 C  CG  . PRO A 1 402 ? 42.498  38.040  45.905 1.00 56.46 ? 507 PRO A CG  1 
ATOM   3050 C  CD  . PRO A 1 402 ? 43.449  39.170  45.972 1.00 56.36 ? 507 PRO A CD  1 
ATOM   3051 N  N   . LEU A 1 403 ? 41.071  39.900  49.950 1.00 56.28 ? 508 LEU A N   1 
ATOM   3052 C  CA  . LEU A 1 403 ? 41.191  39.829  51.405 1.00 56.25 ? 508 LEU A CA  1 
ATOM   3053 C  C   . LEU A 1 403 ? 40.384  38.630  51.915 1.00 56.28 ? 508 LEU A C   1 
ATOM   3054 O  O   . LEU A 1 403 ? 39.825  37.879  51.118 1.00 56.26 ? 508 LEU A O   1 
ATOM   3055 C  CB  . LEU A 1 403 ? 40.698  41.131  52.043 1.00 56.21 ? 508 LEU A CB  1 
ATOM   3056 C  CG  . LEU A 1 403 ? 41.414  42.411  51.603 1.00 56.07 ? 508 LEU A CG  1 
ATOM   3057 C  CD1 . LEU A 1 403 ? 40.779  43.622  52.264 1.00 55.82 ? 508 LEU A CD1 1 
ATOM   3058 C  CD2 . LEU A 1 403 ? 42.903  42.345  51.922 1.00 56.05 ? 508 LEU A CD2 1 
ATOM   3059 N  N   . GLU A 1 404 ? 40.341  38.451  53.236 1.00 56.31 ? 509 GLU A N   1 
ATOM   3060 C  CA  . GLU A 1 404 ? 39.641  37.329  53.864 1.00 56.28 ? 509 GLU A CA  1 
ATOM   3061 C  C   . GLU A 1 404 ? 38.628  37.848  54.887 1.00 56.28 ? 509 GLU A C   1 
ATOM   3062 O  O   . GLU A 1 404 ? 38.996  38.534  55.841 1.00 56.38 ? 509 GLU A O   1 
ATOM   3063 C  CB  . GLU A 1 404 ? 40.655  36.404  54.534 1.00 56.27 ? 509 GLU A CB  1 
ATOM   3064 C  CG  . GLU A 1 404 ? 40.130  35.008  54.836 1.00 56.38 ? 509 GLU A CG  1 
ATOM   3065 C  CD  . GLU A 1 404 ? 41.190  34.092  55.441 1.00 56.43 ? 509 GLU A CD  1 
ATOM   3066 O  OE1 . GLU A 1 404 ? 40.849  32.942  55.794 1.00 56.97 ? 509 GLU A OE1 1 
ATOM   3067 O  OE2 . GLU A 1 404 ? 42.360  34.515  55.569 1.00 56.29 ? 509 GLU A OE2 1 
ATOM   3068 N  N   . LEU A 1 405 ? 37.358  37.498  54.696 1.00 56.22 ? 510 LEU A N   1 
ATOM   3069 C  CA  . LEU A 1 405 ? 36.256  38.115  55.450 1.00 56.19 ? 510 LEU A CA  1 
ATOM   3070 C  C   . LEU A 1 405 ? 36.193  37.739  56.941 1.00 56.21 ? 510 LEU A C   1 
ATOM   3071 O  O   . LEU A 1 405 ? 35.577  38.460  57.732 1.00 56.22 ? 510 LEU A O   1 
ATOM   3072 C  CB  . LEU A 1 405 ? 34.909  37.795  54.785 1.00 56.15 ? 510 LEU A CB  1 
ATOM   3073 C  CG  . LEU A 1 405 ? 34.760  38.112  53.288 1.00 56.12 ? 510 LEU A CG  1 
ATOM   3074 C  CD1 . LEU A 1 405 ? 33.370  37.719  52.811 1.00 56.16 ? 510 LEU A CD1 1 
ATOM   3075 C  CD2 . LEU A 1 405 ? 35.032  39.576  52.975 1.00 55.85 ? 510 LEU A CD2 1 
ATOM   3076 N  N   . GLU A 1 406 ? 36.818  36.623  57.321 1.00 56.18 ? 511 GLU A N   1 
ATOM   3077 C  CA  . GLU A 1 406 ? 36.850  36.183  58.725 1.00 56.13 ? 511 GLU A CA  1 
ATOM   3078 C  C   . GLU A 1 406 ? 37.876  37.012  59.493 1.00 56.02 ? 511 GLU A C   1 
ATOM   3079 O  O   . GLU A 1 406 ? 37.556  37.640  60.503 1.00 55.99 ? 511 GLU A O   1 
ATOM   3080 C  CB  . GLU A 1 406 ? 37.203  34.692  58.844 1.00 56.24 ? 511 GLU A CB  1 
ATOM   3081 C  CG  . GLU A 1 406 ? 36.213  33.734  58.181 1.00 56.72 ? 511 GLU A CG  1 
ATOM   3082 C  CD  . GLU A 1 406 ? 36.470  33.552  56.691 1.00 57.52 ? 511 GLU A CD  1 
ATOM   3083 O  OE1 . GLU A 1 406 ? 37.525  32.987  56.331 1.00 58.16 ? 511 GLU A OE1 1 
ATOM   3084 O  OE2 . GLU A 1 406 ? 35.620  33.980  55.878 1.00 58.01 ? 511 GLU A OE2 1 
ATOM   3085 N  N   . ARG A 1 407 ? 39.110  36.995  58.993 1.00 55.92 ? 512 ARG A N   1 
ATOM   3086 C  CA  . ARG A 1 407 ? 40.225  37.746  59.565 1.00 55.77 ? 512 ARG A CA  1 
ATOM   3087 C  C   . ARG A 1 407 ? 40.331  39.100  58.865 1.00 55.50 ? 512 ARG A C   1 
ATOM   3088 O  O   . ARG A 1 407 ? 40.930  39.200  57.792 1.00 55.45 ? 512 ARG A O   1 
ATOM   3089 C  CB  . ARG A 1 407 ? 41.528  36.960  59.379 1.00 55.85 ? 512 ARG A CB  1 
ATOM   3090 C  CG  . ARG A 1 407 ? 41.567  35.621  60.118 1.00 56.21 ? 512 ARG A CG  1 
ATOM   3091 C  CD  . ARG A 1 407 ? 42.453  34.585  59.414 1.00 56.28 ? 512 ARG A CD  1 
ATOM   3092 N  NE  . ARG A 1 407 ? 43.796  35.085  59.106 1.00 56.71 ? 512 ARG A NE  1 
ATOM   3093 C  CZ  . ARG A 1 407 ? 44.815  34.327  58.693 1.00 56.85 ? 512 ARG A CZ  1 
ATOM   3094 N  NH1 . ARG A 1 407 ? 44.679  33.010  58.543 1.00 57.11 ? 512 ARG A NH1 1 
ATOM   3095 N  NH2 . ARG A 1 407 ? 45.991  34.890  58.442 1.00 56.99 ? 512 ARG A NH2 1 
ATOM   3096 N  N   . LEU A 1 408 ? 39.747  40.133  59.469 1.00 55.18 ? 513 LEU A N   1 
ATOM   3097 C  CA  . LEU A 1 408 ? 39.646  41.445  58.823 1.00 54.97 ? 513 LEU A CA  1 
ATOM   3098 C  C   . LEU A 1 408 ? 39.872  42.583  59.832 1.00 54.74 ? 513 LEU A C   1 
ATOM   3099 O  O   . LEU A 1 408 ? 38.995  42.893  60.639 1.00 54.73 ? 513 LEU A O   1 
ATOM   3100 C  CB  . LEU A 1 408 ? 38.279  41.570  58.131 1.00 54.97 ? 513 LEU A CB  1 
ATOM   3101 C  CG  . LEU A 1 408 ? 38.075  42.588  57.001 1.00 55.02 ? 513 LEU A CG  1 
ATOM   3102 C  CD1 . LEU A 1 408 ? 38.976  42.317  55.806 1.00 55.17 ? 513 LEU A CD1 1 
ATOM   3103 C  CD2 . LEU A 1 408 ? 36.625  42.565  56.557 1.00 54.97 ? 513 LEU A CD2 1 
ATOM   3104 N  N   . LYS A 1 409 ? 41.062  43.185  59.779 1.00 54.41 ? 514 LYS A N   1 
ATOM   3105 C  CA  . LYS A 1 409 ? 41.450  44.278  60.681 1.00 54.16 ? 514 LYS A CA  1 
ATOM   3106 C  C   . LYS A 1 409 ? 40.881  45.603  60.193 1.00 53.80 ? 514 LYS A C   1 
ATOM   3107 O  O   . LYS A 1 409 ? 40.930  45.884  59.003 1.00 53.82 ? 514 LYS A O   1 
ATOM   3108 C  CB  . LYS A 1 409 ? 42.984  44.394  60.781 1.00 54.24 ? 514 LYS A CB  1 
ATOM   3109 C  CG  . LYS A 1 409 ? 43.723  44.582  59.426 1.00 54.44 ? 514 LYS A CG  1 
ATOM   3110 C  CD  . LYS A 1 409 ? 44.931  45.539  59.505 1.00 54.37 ? 514 LYS A CD  1 
ATOM   3111 C  CE  . LYS A 1 409 ? 46.270  44.817  59.676 1.00 54.46 ? 514 LYS A CE  1 
ATOM   3112 N  NZ  . LYS A 1 409 ? 46.500  44.307  61.057 1.00 54.25 ? 514 LYS A NZ  1 
ATOM   3113 N  N   . LEU A 1 410 ? 40.348  46.415  61.103 1.00 53.42 ? 515 LEU A N   1 
ATOM   3114 C  CA  . LEU A 1 410 ? 39.866  47.759  60.752 1.00 53.10 ? 515 LEU A CA  1 
ATOM   3115 C  C   . LEU A 1 410 ? 40.522  48.817  61.640 1.00 52.80 ? 515 LEU A C   1 
ATOM   3116 O  O   . LEU A 1 410 ? 40.385  48.782  62.862 1.00 52.77 ? 515 LEU A O   1 
ATOM   3117 C  CB  . LEU A 1 410 ? 38.337  47.852  60.867 1.00 53.14 ? 515 LEU A CB  1 
ATOM   3118 C  CG  . LEU A 1 410 ? 37.464  47.478  59.657 1.00 53.16 ? 515 LEU A CG  1 
ATOM   3119 C  CD1 . LEU A 1 410 ? 37.713  48.403  58.472 1.00 53.46 ? 515 LEU A CD1 1 
ATOM   3120 C  CD2 . LEU A 1 410 ? 37.654  46.028  59.242 1.00 53.30 ? 515 LEU A CD2 1 
ATOM   3121 N  N   . GLU A 1 411 ? 41.228  49.756  61.014 1.00 52.38 ? 516 GLU A N   1 
ATOM   3122 C  CA  . GLU A 1 411 ? 41.876  50.854  61.728 1.00 51.93 ? 516 GLU A CA  1 
ATOM   3123 C  C   . GLU A 1 411 ? 40.805  51.896  62.070 1.00 51.48 ? 516 GLU A C   1 
ATOM   3124 O  O   . GLU A 1 411 ? 39.766  51.935  61.415 1.00 51.42 ? 516 GLU A O   1 
ATOM   3125 C  CB  . GLU A 1 411 ? 42.977  51.485  60.864 1.00 52.03 ? 516 GLU A CB  1 
ATOM   3126 C  CG  . GLU A 1 411 ? 43.954  50.493  60.200 1.00 52.15 ? 516 GLU A CG  1 
ATOM   3127 C  CD  . GLU A 1 411 ? 44.712  49.623  61.195 1.00 52.42 ? 516 GLU A CD  1 
ATOM   3128 O  OE1 . GLU A 1 411 ? 45.158  50.148  62.238 1.00 52.03 ? 516 GLU A OE1 1 
ATOM   3129 O  OE2 . GLU A 1 411 ? 44.875  48.413  60.922 1.00 52.38 ? 516 GLU A OE2 1 
ATOM   3130 N  N   . PRO A 1 412 ? 41.040  52.733  63.099 1.00 50.95 ? 517 PRO A N   1 
ATOM   3131 C  CA  . PRO A 1 412 ? 40.052  53.750  63.493 1.00 50.73 ? 517 PRO A CA  1 
ATOM   3132 C  C   . PRO A 1 412 ? 39.475  54.585  62.334 1.00 50.38 ? 517 PRO A C   1 
ATOM   3133 O  O   . PRO A 1 412 ? 40.229  55.129  61.530 1.00 50.38 ? 517 PRO A O   1 
ATOM   3134 C  CB  . PRO A 1 412 ? 40.845  54.638  64.459 1.00 50.58 ? 517 PRO A CB  1 
ATOM   3135 C  CG  . PRO A 1 412 ? 41.828  53.726  65.062 1.00 50.47 ? 517 PRO A CG  1 
ATOM   3136 C  CD  . PRO A 1 412 ? 42.226  52.769  63.975 1.00 50.77 ? 517 PRO A CD  1 
ATOM   3137 N  N   . HIS A 1 413 ? 38.146  54.661  62.260 1.00 50.13 ? 518 HIS A N   1 
ATOM   3138 C  CA  . HIS A 1 413 ? 37.419  55.445  61.241 1.00 50.04 ? 518 HIS A CA  1 
ATOM   3139 C  C   . HIS A 1 413 ? 37.509  54.902  59.801 1.00 49.86 ? 518 HIS A C   1 
ATOM   3140 O  O   . HIS A 1 413 ? 37.084  55.578  58.861 1.00 49.89 ? 518 HIS A O   1 
ATOM   3141 C  CB  . HIS A 1 413 ? 37.851  56.919  61.259 1.00 50.05 ? 518 HIS A CB  1 
ATOM   3142 C  CG  . HIS A 1 413 ? 37.819  57.545  62.619 1.00 50.11 ? 518 HIS A CG  1 
ATOM   3143 N  ND1 . HIS A 1 413 ? 38.963  57.876  63.313 1.00 50.06 ? 518 HIS A ND1 1 
ATOM   3144 C  CD2 . HIS A 1 413 ? 36.780  57.904  63.410 1.00 49.73 ? 518 HIS A CD2 1 
ATOM   3145 C  CE1 . HIS A 1 413 ? 38.630  58.411  64.474 1.00 50.01 ? 518 HIS A CE1 1 
ATOM   3146 N  NE2 . HIS A 1 413 ? 37.312  58.438  64.558 1.00 49.69 ? 518 HIS A NE2 1 
ATOM   3147 N  N   . GLU A 1 414 ? 38.023  53.685  59.629 1.00 49.58 ? 519 GLU A N   1 
ATOM   3148 C  CA  . GLU A 1 414 ? 38.240  53.124  58.295 1.00 49.47 ? 519 GLU A CA  1 
ATOM   3149 C  C   . GLU A 1 414 ? 36.942  52.600  57.674 1.00 49.24 ? 519 GLU A C   1 
ATOM   3150 O  O   . GLU A 1 414 ? 36.029  52.167  58.378 1.00 49.12 ? 519 GLU A O   1 
ATOM   3151 C  CB  . GLU A 1 414 ? 39.289  52.008  58.346 1.00 49.43 ? 519 GLU A CB  1 
ATOM   3152 C  CG  . GLU A 1 414 ? 39.742  51.497  56.977 1.00 49.62 ? 519 GLU A CG  1 
ATOM   3153 C  CD  . GLU A 1 414 ? 40.914  50.521  57.056 1.00 49.95 ? 519 GLU A CD  1 
ATOM   3154 O  OE1 . GLU A 1 414 ? 41.266  50.069  58.170 1.00 50.59 ? 519 GLU A OE1 1 
ATOM   3155 O  OE2 . GLU A 1 414 ? 41.487  50.202  55.993 1.00 50.89 ? 519 GLU A OE2 1 
ATOM   3156 N  N   . GLY A 1 415 ? 36.878  52.648  56.346 1.00 49.00 ? 520 GLY A N   1 
ATOM   3157 C  CA  . GLY A 1 415 ? 35.737  52.130  55.595 1.00 48.84 ? 520 GLY A CA  1 
ATOM   3158 C  C   . GLY A 1 415 ? 36.199  51.296  54.417 1.00 48.61 ? 520 GLY A C   1 
ATOM   3159 O  O   . GLY A 1 415 ? 37.019  51.746  53.618 1.00 48.56 ? 520 GLY A O   1 
ATOM   3160 N  N   . LEU A 1 416 ? 35.673  50.079  54.308 1.00 48.40 ? 521 LEU A N   1 
ATOM   3161 C  CA  . LEU A 1 416 ? 36.068  49.159  53.248 1.00 48.36 ? 521 LEU A CA  1 
ATOM   3162 C  C   . LEU A 1 416 ? 34.900  48.872  52.311 1.00 48.29 ? 521 LEU A C   1 
ATOM   3163 O  O   . LEU A 1 416 ? 33.765  48.710  52.763 1.00 48.09 ? 521 LEU A O   1 
ATOM   3164 C  CB  . LEU A 1 416 ? 36.589  47.850  53.848 1.00 48.23 ? 521 LEU A CB  1 
ATOM   3165 C  CG  . LEU A 1 416 ? 37.791  47.947  54.791 1.00 47.73 ? 521 LEU A CG  1 
ATOM   3166 C  CD1 . LEU A 1 416 ? 38.072  46.608  55.426 1.00 47.42 ? 521 LEU A CD1 1 
ATOM   3167 C  CD2 . LEU A 1 416 ? 39.020  48.440  54.061 1.00 47.86 ? 521 LEU A CD2 1 
ATOM   3168 N  N   . LEU A 1 417 ? 35.196  48.815  51.011 1.00 48.28 ? 522 LEU A N   1 
ATOM   3169 C  CA  . LEU A 1 417 ? 34.215  48.491  49.976 1.00 48.35 ? 522 LEU A CA  1 
ATOM   3170 C  C   . LEU A 1 417 ? 34.715  47.311  49.147 1.00 48.32 ? 522 LEU A C   1 
ATOM   3171 O  O   . LEU A 1 417 ? 35.651  47.456  48.361 1.00 48.35 ? 522 LEU A O   1 
ATOM   3172 C  CB  . LEU A 1 417 ? 33.983  49.707  49.073 1.00 48.35 ? 522 LEU A CB  1 
ATOM   3173 C  CG  . LEU A 1 417 ? 33.078  49.534  47.844 1.00 48.38 ? 522 LEU A CG  1 
ATOM   3174 C  CD1 . LEU A 1 417 ? 31.676  49.120  48.249 1.00 48.73 ? 522 LEU A CD1 1 
ATOM   3175 C  CD2 . LEU A 1 417 ? 33.030  50.813  47.036 1.00 48.37 ? 522 LEU A CD2 1 
ATOM   3176 N  N   . LEU A 1 418 ? 34.086  46.151  49.317 1.00 48.39 ? 523 LEU A N   1 
ATOM   3177 C  CA  . LEU A 1 418 ? 34.562  44.910  48.699 1.00 48.54 ? 523 LEU A CA  1 
ATOM   3178 C  C   . LEU A 1 418 ? 33.596  44.372  47.643 1.00 48.64 ? 523 LEU A C   1 
ATOM   3179 O  O   . LEU A 1 418 ? 32.389  44.355  47.857 1.00 48.45 ? 523 LEU A O   1 
ATOM   3180 C  CB  . LEU A 1 418 ? 34.801  43.846  49.772 1.00 48.47 ? 523 LEU A CB  1 
ATOM   3181 C  CG  . LEU A 1 418 ? 36.000  44.084  50.699 1.00 48.16 ? 523 LEU A CG  1 
ATOM   3182 C  CD1 . LEU A 1 418 ? 35.666  45.047  51.825 1.00 47.87 ? 523 LEU A CD1 1 
ATOM   3183 C  CD2 . LEU A 1 418 ? 36.488  42.765  51.269 1.00 48.44 ? 523 LEU A CD2 1 
ATOM   3184 N  N   . ARG A 1 419 ? 34.155  43.921  46.518 1.00 48.95 ? 524 ARG A N   1 
ATOM   3185 C  CA  . ARG A 1 419 ? 33.393  43.383  45.379 1.00 49.20 ? 524 ARG A CA  1 
ATOM   3186 C  C   . ARG A 1 419 ? 33.568  41.870  45.263 1.00 49.16 ? 524 ARG A C   1 
ATOM   3187 O  O   . ARG A 1 419 ? 34.598  41.337  45.671 1.00 49.16 ? 524 ARG A O   1 
ATOM   3188 C  CB  . ARG A 1 419 ? 33.872  44.024  44.072 1.00 49.13 ? 524 ARG A CB  1 
ATOM   3189 C  CG  . ARG A 1 419 ? 35.389  43.890  43.829 1.00 49.63 ? 524 ARG A CG  1 
ATOM   3190 C  CD  . ARG A 1 419 ? 35.773  43.711  42.355 1.00 50.04 ? 524 ARG A CD  1 
ATOM   3191 N  NE  . ARG A 1 419 ? 35.716  44.975  41.619 1.00 50.89 ? 524 ARG A NE  1 
ATOM   3192 C  CZ  . ARG A 1 419 ? 34.657  45.425  40.945 1.00 51.38 ? 524 ARG A CZ  1 
ATOM   3193 N  NH1 . ARG A 1 419 ? 33.533  44.715  40.880 1.00 51.35 ? 524 ARG A NH1 1 
ATOM   3194 N  NH2 . ARG A 1 419 ? 34.723  46.601  40.326 1.00 51.67 ? 524 ARG A NH2 1 
ATOM   3195 N  N   . PHE A 1 420 ? 32.572  41.181  44.708 1.00 49.36 ? 525 PHE A N   1 
ATOM   3196 C  CA  . PHE A 1 420 ? 32.722  39.754  44.356 1.00 49.56 ? 525 PHE A CA  1 
ATOM   3197 C  C   . PHE A 1 420 ? 31.629  39.251  43.399 1.00 49.71 ? 525 PHE A C   1 
ATOM   3198 O  O   . PHE A 1 420 ? 30.531  39.807  43.362 1.00 49.72 ? 525 PHE A O   1 
ATOM   3199 C  CB  . PHE A 1 420 ? 32.808  38.854  45.608 1.00 49.50 ? 525 PHE A CB  1 
ATOM   3200 C  CG  . PHE A 1 420 ? 31.799  39.176  46.673 1.00 49.44 ? 525 PHE A CG  1 
ATOM   3201 C  CD1 . PHE A 1 420 ? 30.599  38.490  46.735 1.00 49.64 ? 525 PHE A CD1 1 
ATOM   3202 C  CD2 . PHE A 1 420 ? 32.058  40.150  47.629 1.00 49.53 ? 525 PHE A CD2 1 
ATOM   3203 C  CE1 . PHE A 1 420 ? 29.660  38.779  47.721 1.00 49.64 ? 525 PHE A CE1 1 
ATOM   3204 C  CE2 . PHE A 1 420 ? 31.129  40.445  48.617 1.00 49.66 ? 525 PHE A CE2 1 
ATOM   3205 C  CZ  . PHE A 1 420 ? 29.927  39.760  48.662 1.00 49.65 ? 525 PHE A CZ  1 
ATOM   3206 N  N   . PRO A 1 421 ? 31.933  38.197  42.612 1.00 49.99 ? 526 PRO A N   1 
ATOM   3207 C  CA  . PRO A 1 421 ? 30.954  37.654  41.664 1.00 50.17 ? 526 PRO A CA  1 
ATOM   3208 C  C   . PRO A 1 421 ? 29.799  36.930  42.347 1.00 50.42 ? 526 PRO A C   1 
ATOM   3209 O  O   . PRO A 1 421 ? 29.927  36.508  43.496 1.00 50.48 ? 526 PRO A O   1 
ATOM   3210 C  CB  . PRO A 1 421 ? 31.766  36.652  40.826 1.00 50.05 ? 526 PRO A CB  1 
ATOM   3211 C  CG  . PRO A 1 421 ? 33.175  36.791  41.241 1.00 49.92 ? 526 PRO A CG  1 
ATOM   3212 C  CD  . PRO A 1 421 ? 33.203  37.451  42.571 1.00 49.98 ? 526 PRO A CD  1 
ATOM   3213 N  N   . TYR A 1 422 ? 28.697  36.774  41.617 1.00 50.74 ? 527 TYR A N   1 
ATOM   3214 C  CA  . TYR A 1 422 ? 27.484  36.117  42.122 1.00 51.02 ? 527 TYR A CA  1 
ATOM   3215 C  C   . TYR A 1 422 ? 27.769  34.693  42.610 1.00 51.40 ? 527 TYR A C   1 
ATOM   3216 O  O   . TYR A 1 422 ? 27.496  34.367  43.768 1.00 51.37 ? 527 TYR A O   1 
ATOM   3217 C  CB  . TYR A 1 422 ? 26.392  36.142  41.040 1.00 50.78 ? 527 TYR A CB  1 
ATOM   3218 C  CG  . TYR A 1 422 ? 25.267  35.144  41.212 1.00 50.61 ? 527 TYR A CG  1 
ATOM   3219 C  CD1 . TYR A 1 422 ? 24.196  35.408  42.057 1.00 50.15 ? 527 TYR A CD1 1 
ATOM   3220 C  CD2 . TYR A 1 422 ? 25.264  33.944  40.501 1.00 50.52 ? 527 TYR A CD2 1 
ATOM   3221 C  CE1 . TYR A 1 422 ? 23.158  34.498  42.204 1.00 50.37 ? 527 TYR A CE1 1 
ATOM   3222 C  CE2 . TYR A 1 422 ? 24.233  33.027  40.640 1.00 50.56 ? 527 TYR A CE2 1 
ATOM   3223 C  CZ  . TYR A 1 422 ? 23.182  33.310  41.491 1.00 50.52 ? 527 TYR A CZ  1 
ATOM   3224 O  OH  . TYR A 1 422 ? 22.163  32.399  41.633 1.00 50.24 ? 527 TYR A OH  1 
ATOM   3225 N  N   . ALA A 1 423 ? 28.318  33.856  41.733 1.00 51.90 ? 528 ALA A N   1 
ATOM   3226 C  CA  . ALA A 1 423 ? 28.770  32.522  42.128 1.00 52.34 ? 528 ALA A CA  1 
ATOM   3227 C  C   . ALA A 1 423 ? 30.002  32.661  43.021 1.00 52.78 ? 528 ALA A C   1 
ATOM   3228 O  O   . ALA A 1 423 ? 31.066  33.071  42.555 1.00 52.91 ? 528 ALA A O   1 
ATOM   3229 C  CB  . ALA A 1 423 ? 29.093  31.679  40.904 1.00 52.30 ? 528 ALA A CB  1 
ATOM   3230 N  N   . ALA A 1 424 ? 29.855  32.323  44.301 1.00 53.23 ? 529 ALA A N   1 
ATOM   3231 C  CA  . ALA A 1 424 ? 30.930  32.526  45.285 1.00 53.41 ? 529 ALA A CA  1 
ATOM   3232 C  C   . ALA A 1 424 ? 32.277  31.896  44.868 1.00 53.79 ? 529 ALA A C   1 
ATOM   3233 O  O   . ALA A 1 424 ? 33.143  31.097  44.500 1.00 54.01 ? 529 ALA A O   1 
ATOM   3234 C  CB  . ALA A 1 424 ? 30.494  32.025  46.683 1.00 53.56 ? 529 ALA A CB  1 
ATOM   3235 O  OXT . ALA A 1 424 ? 31.634  30.827  44.754 1.00 54.15 ? 529 ALA A OXT 1 
ATOM   3236 N  N   . GLY B 1 4   ? 18.384  46.201  32.611 1.00 53.49 ? 109 GLY B N   1 
ATOM   3237 C  CA  . GLY B 1 4   ? 18.768  45.152  31.620 1.00 53.48 ? 109 GLY B CA  1 
ATOM   3238 C  C   . GLY B 1 4   ? 19.848  44.223  32.141 1.00 53.45 ? 109 GLY B C   1 
ATOM   3239 O  O   . GLY B 1 4   ? 21.035  44.457  31.922 1.00 53.43 ? 109 GLY B O   1 
ATOM   3240 N  N   . SER B 1 5   ? 19.432  43.167  32.835 1.00 53.46 ? 110 SER B N   1 
ATOM   3241 C  CA  . SER B 1 5   ? 20.367  42.188  33.396 1.00 53.53 ? 110 SER B CA  1 
ATOM   3242 C  C   . SER B 1 5   ? 20.599  41.036  32.422 1.00 53.52 ? 110 SER B C   1 
ATOM   3243 O  O   . SER B 1 5   ? 19.660  40.546  31.788 1.00 53.51 ? 110 SER B O   1 
ATOM   3244 C  CB  . SER B 1 5   ? 19.850  41.646  34.734 1.00 53.49 ? 110 SER B CB  1 
ATOM   3245 O  OG  . SER B 1 5   ? 19.898  42.646  35.736 1.00 53.56 ? 110 SER B OG  1 
ATOM   3246 N  N   . GLU B 1 6   ? 21.853  40.606  32.314 1.00 53.51 ? 111 GLU B N   1 
ATOM   3247 C  CA  . GLU B 1 6   ? 22.217  39.521  31.410 1.00 53.57 ? 111 GLU B CA  1 
ATOM   3248 C  C   . GLU B 1 6   ? 21.617  38.209  31.904 1.00 53.52 ? 111 GLU B C   1 
ATOM   3249 O  O   . GLU B 1 6   ? 21.724  37.876  33.083 1.00 53.42 ? 111 GLU B O   1 
ATOM   3250 C  CB  . GLU B 1 6   ? 23.740  39.409  31.294 1.00 53.58 ? 111 GLU B CB  1 
ATOM   3251 C  CG  . GLU B 1 6   ? 24.220  38.458  30.208 1.00 53.56 ? 111 GLU B CG  1 
ATOM   3252 C  CD  . GLU B 1 6   ? 25.650  38.735  29.775 1.00 53.78 ? 111 GLU B CD  1 
ATOM   3253 O  OE1 . GLU B 1 6   ? 25.939  39.883  29.370 1.00 54.04 ? 111 GLU B OE1 1 
ATOM   3254 O  OE2 . GLU B 1 6   ? 26.483  37.804  29.826 1.00 54.51 ? 111 GLU B OE2 1 
ATOM   3255 N  N   . LEU B 1 7   ? 20.976  37.478  30.993 1.00 53.59 ? 112 LEU B N   1 
ATOM   3256 C  CA  . LEU B 1 7   ? 20.293  36.232  31.333 1.00 53.58 ? 112 LEU B CA  1 
ATOM   3257 C  C   . LEU B 1 7   ? 21.297  35.099  31.498 1.00 53.59 ? 112 LEU B C   1 
ATOM   3258 O  O   . LEU B 1 7   ? 22.374  35.135  30.907 1.00 53.49 ? 112 LEU B O   1 
ATOM   3259 C  CB  . LEU B 1 7   ? 19.295  35.847  30.237 1.00 53.53 ? 112 LEU B CB  1 
ATOM   3260 C  CG  . LEU B 1 7   ? 18.225  36.866  29.843 1.00 53.45 ? 112 LEU B CG  1 
ATOM   3261 C  CD1 . LEU B 1 7   ? 17.485  36.374  28.610 1.00 53.54 ? 112 LEU B CD1 1 
ATOM   3262 C  CD2 . LEU B 1 7   ? 17.257  37.125  30.988 1.00 53.39 ? 112 LEU B CD2 1 
ATOM   3263 N  N   . PRO B 1 8   ? 20.940  34.072  32.286 1.00 53.78 ? 113 PRO B N   1 
ATOM   3264 C  CA  . PRO B 1 8   ? 21.828  32.920  32.376 1.00 53.80 ? 113 PRO B CA  1 
ATOM   3265 C  C   . PRO B 1 8   ? 21.771  32.087  31.102 1.00 53.82 ? 113 PRO B C   1 
ATOM   3266 O  O   . PRO B 1 8   ? 20.821  32.212  30.325 1.00 53.66 ? 113 PRO B O   1 
ATOM   3267 C  CB  . PRO B 1 8   ? 21.266  32.115  33.563 1.00 53.82 ? 113 PRO B CB  1 
ATOM   3268 C  CG  . PRO B 1 8   ? 20.163  32.928  34.144 1.00 53.84 ? 113 PRO B CG  1 
ATOM   3269 C  CD  . PRO B 1 8   ? 19.729  33.898  33.106 1.00 53.85 ? 113 PRO B CD  1 
ATOM   3270 N  N   . ALA B 1 9   ? 22.788  31.254  30.897 1.00 53.92 ? 114 ALA B N   1 
ATOM   3271 C  CA  . ALA B 1 9   ? 22.779  30.277  29.813 1.00 53.90 ? 114 ALA B CA  1 
ATOM   3272 C  C   . ALA B 1 9   ? 21.831  29.141  30.184 1.00 53.89 ? 114 ALA B C   1 
ATOM   3273 O  O   . ALA B 1 9   ? 22.121  28.362  31.092 1.00 54.02 ? 114 ALA B O   1 
ATOM   3274 C  CB  . ALA B 1 9   ? 24.181  29.740  29.566 1.00 53.90 ? 114 ALA B CB  1 
ATOM   3275 N  N   . GLN B 1 10  ? 20.700  29.063  29.486 1.00 53.91 ? 115 GLN B N   1 
ATOM   3276 C  CA  . GLN B 1 10  ? 19.657  28.068  29.773 1.00 53.92 ? 115 GLN B CA  1 
ATOM   3277 C  C   . GLN B 1 10  ? 20.108  26.640  29.448 1.00 53.92 ? 115 GLN B C   1 
ATOM   3278 O  O   . GLN B 1 10  ? 20.186  26.258  28.276 1.00 54.14 ? 115 GLN B O   1 
ATOM   3279 C  CB  . GLN B 1 10  ? 18.385  28.381  28.969 1.00 54.04 ? 115 GLN B CB  1 
ATOM   3280 C  CG  . GLN B 1 10  ? 17.667  29.662  29.381 1.00 54.35 ? 115 GLN B CG  1 
ATOM   3281 C  CD  . GLN B 1 10  ? 16.676  29.444  30.512 1.00 54.65 ? 115 GLN B CD  1 
ATOM   3282 O  OE1 . GLN B 1 10  ? 17.055  29.099  31.635 1.00 54.52 ? 115 GLN B OE1 1 
ATOM   3283 N  NE2 . GLN B 1 10  ? 15.396  29.647  30.218 1.00 54.67 ? 115 GLN B NE2 1 
ATOM   3284 N  N   . LYS B 1 11  ? 20.403  25.860  30.485 1.00 53.61 ? 116 LYS B N   1 
ATOM   3285 C  CA  . LYS B 1 11  ? 20.660  24.426  30.325 1.00 53.26 ? 116 LYS B CA  1 
ATOM   3286 C  C   . LYS B 1 11  ? 19.296  23.742  30.295 1.00 52.90 ? 116 LYS B C   1 
ATOM   3287 O  O   . LYS B 1 11  ? 18.365  24.205  30.952 1.00 52.81 ? 116 LYS B O   1 
ATOM   3288 C  CB  . LYS B 1 11  ? 21.499  23.879  31.488 1.00 53.36 ? 116 LYS B CB  1 
ATOM   3289 C  CG  . LYS B 1 11  ? 22.748  24.698  31.859 1.00 53.67 ? 116 LYS B CG  1 
ATOM   3290 C  CD  . LYS B 1 11  ? 23.988  24.336  31.028 1.00 53.99 ? 116 LYS B CD  1 
ATOM   3291 C  CE  . LYS B 1 11  ? 23.918  24.888  29.613 1.00 54.10 ? 116 LYS B CE  1 
ATOM   3292 N  NZ  . LYS B 1 11  ? 25.258  24.957  28.985 1.00 53.89 ? 116 LYS B NZ  1 
ATOM   3293 N  N   . TRP B 1 12  ? 19.166  22.646  29.551 1.00 52.47 ? 117 TRP B N   1 
ATOM   3294 C  CA  . TRP B 1 12  ? 17.846  22.020  29.366 1.00 52.22 ? 117 TRP B CA  1 
ATOM   3295 C  C   . TRP B 1 12  ? 17.171  21.616  30.682 1.00 51.94 ? 117 TRP B C   1 
ATOM   3296 O  O   . TRP B 1 12  ? 15.948  21.618  30.777 1.00 51.99 ? 117 TRP B O   1 
ATOM   3297 C  CB  . TRP B 1 12  ? 17.903  20.831  28.394 1.00 51.98 ? 117 TRP B CB  1 
ATOM   3298 C  CG  . TRP B 1 12  ? 18.775  19.691  28.821 1.00 51.95 ? 117 TRP B CG  1 
ATOM   3299 C  CD1 . TRP B 1 12  ? 20.054  19.443  28.417 1.00 51.77 ? 117 TRP B CD1 1 
ATOM   3300 C  CD2 . TRP B 1 12  ? 18.427  18.627  29.720 1.00 52.03 ? 117 TRP B CD2 1 
ATOM   3301 N  NE1 . TRP B 1 12  ? 20.528  18.300  29.014 1.00 51.80 ? 117 TRP B NE1 1 
ATOM   3302 C  CE2 . TRP B 1 12  ? 19.548  17.777  29.815 1.00 51.96 ? 117 TRP B CE2 1 
ATOM   3303 C  CE3 . TRP B 1 12  ? 17.276  18.312  30.453 1.00 51.81 ? 117 TRP B CE3 1 
ATOM   3304 C  CZ2 . TRP B 1 12  ? 19.556  16.635  30.619 1.00 51.89 ? 117 TRP B CZ2 1 
ATOM   3305 C  CZ3 . TRP B 1 12  ? 17.285  17.177  31.251 1.00 51.89 ? 117 TRP B CZ3 1 
ATOM   3306 C  CH2 . TRP B 1 12  ? 18.419  16.352  31.325 1.00 51.92 ? 117 TRP B CH2 1 
ATOM   3307 N  N   . TRP B 1 13  ? 17.967  21.292  31.695 1.00 51.70 ? 118 TRP B N   1 
ATOM   3308 C  CA  . TRP B 1 13  ? 17.429  20.871  32.991 1.00 51.60 ? 118 TRP B CA  1 
ATOM   3309 C  C   . TRP B 1 13  ? 17.080  22.038  33.920 1.00 51.56 ? 118 TRP B C   1 
ATOM   3310 O  O   . TRP B 1 13  ? 16.537  21.826  35.004 1.00 51.59 ? 118 TRP B O   1 
ATOM   3311 C  CB  . TRP B 1 13  ? 18.383  19.887  33.687 1.00 51.33 ? 118 TRP B CB  1 
ATOM   3312 C  CG  . TRP B 1 13  ? 19.711  20.452  34.108 1.00 51.03 ? 118 TRP B CG  1 
ATOM   3313 C  CD1 . TRP B 1 13  ? 20.026  20.987  35.324 1.00 50.96 ? 118 TRP B CD1 1 
ATOM   3314 C  CD2 . TRP B 1 13  ? 20.912  20.497  33.326 1.00 50.96 ? 118 TRP B CD2 1 
ATOM   3315 N  NE1 . TRP B 1 13  ? 21.344  21.377  35.345 1.00 50.96 ? 118 TRP B NE1 1 
ATOM   3316 C  CE2 . TRP B 1 13  ? 21.911  21.089  34.130 1.00 51.09 ? 118 TRP B CE2 1 
ATOM   3317 C  CE3 . TRP B 1 13  ? 21.239  20.105  32.020 1.00 50.76 ? 118 TRP B CE3 1 
ATOM   3318 C  CZ2 . TRP B 1 13  ? 23.215  21.297  33.671 1.00 50.96 ? 118 TRP B CZ2 1 
ATOM   3319 C  CZ3 . TRP B 1 13  ? 22.530  20.314  31.565 1.00 50.90 ? 118 TRP B CZ3 1 
ATOM   3320 C  CH2 . TRP B 1 13  ? 23.504  20.904  32.389 1.00 50.96 ? 118 TRP B CH2 1 
ATOM   3321 N  N   . HIS B 1 14  ? 17.386  23.264  33.494 1.00 51.52 ? 119 HIS B N   1 
ATOM   3322 C  CA  . HIS B 1 14  ? 16.979  24.466  34.226 1.00 51.41 ? 119 HIS B CA  1 
ATOM   3323 C  C   . HIS B 1 14  ? 15.526  24.853  33.961 1.00 51.39 ? 119 HIS B C   1 
ATOM   3324 O  O   . HIS B 1 14  ? 14.965  25.656  34.701 1.00 51.29 ? 119 HIS B O   1 
ATOM   3325 C  CB  . HIS B 1 14  ? 17.872  25.651  33.850 1.00 51.36 ? 119 HIS B CB  1 
ATOM   3326 C  CG  . HIS B 1 14  ? 19.252  25.578  34.420 1.00 51.34 ? 119 HIS B CG  1 
ATOM   3327 N  ND1 . HIS B 1 14  ? 20.087  26.671  34.480 1.00 51.30 ? 119 HIS B ND1 1 
ATOM   3328 C  CD2 . HIS B 1 14  ? 19.936  24.551  34.976 1.00 51.53 ? 119 HIS B CD2 1 
ATOM   3329 C  CE1 . HIS B 1 14  ? 21.231  26.318  35.038 1.00 51.47 ? 119 HIS B CE1 1 
ATOM   3330 N  NE2 . HIS B 1 14  ? 21.166  25.036  35.349 1.00 51.48 ? 119 HIS B NE2 1 
ATOM   3331 N  N   . THR B 1 15  ? 14.926  24.286  32.913 1.00 51.49 ? 120 THR B N   1 
ATOM   3332 C  CA  . THR B 1 15  ? 13.655  24.775  32.373 1.00 51.54 ? 120 THR B CA  1 
ATOM   3333 C  C   . THR B 1 15  ? 12.431  23.912  32.724 1.00 51.68 ? 120 THR B C   1 
ATOM   3334 O  O   . THR B 1 15  ? 11.356  24.088  32.134 1.00 51.78 ? 120 THR B O   1 
ATOM   3335 C  CB  . THR B 1 15  ? 13.732  24.885  30.834 1.00 51.50 ? 120 THR B CB  1 
ATOM   3336 O  OG1 . THR B 1 15  ? 13.671  23.578  30.252 1.00 51.85 ? 120 THR B OG1 1 
ATOM   3337 C  CG2 . THR B 1 15  ? 15.015  25.568  30.400 1.00 51.31 ? 120 THR B CG2 1 
ATOM   3338 N  N   . GLY B 1 16  ? 12.580  22.987  33.670 1.00 51.65 ? 121 GLY B N   1 
ATOM   3339 C  CA  . GLY B 1 16  ? 11.472  22.105  34.034 1.00 51.58 ? 121 GLY B CA  1 
ATOM   3340 C  C   . GLY B 1 16  ? 11.792  21.077  35.105 1.00 51.58 ? 121 GLY B C   1 
ATOM   3341 O  O   . GLY B 1 16  ? 12.762  21.223  35.853 1.00 51.59 ? 121 GLY B O   1 
ATOM   3342 N  N   . ALA B 1 17  ? 10.960  20.039  35.171 1.00 51.50 ? 122 ALA B N   1 
ATOM   3343 C  CA  . ALA B 1 17  ? 11.131  18.953  36.132 1.00 51.30 ? 122 ALA B CA  1 
ATOM   3344 C  C   . ALA B 1 17  ? 11.811  17.744  35.495 1.00 51.26 ? 122 ALA B C   1 
ATOM   3345 O  O   . ALA B 1 17  ? 11.878  17.617  34.264 1.00 50.97 ? 122 ALA B O   1 
ATOM   3346 C  CB  . ALA B 1 17  ? 9.794   18.550  36.701 1.00 51.22 ? 122 ALA B CB  1 
ATOM   3347 N  N   . LEU B 1 18  ? 12.316  16.864  36.359 1.00 51.21 ? 123 LEU B N   1 
ATOM   3348 C  CA  . LEU B 1 18  ? 12.879  15.581  35.947 1.00 51.05 ? 123 LEU B CA  1 
ATOM   3349 C  C   . LEU B 1 18  ? 12.019  14.453  36.496 1.00 50.96 ? 123 LEU B C   1 
ATOM   3350 O  O   . LEU B 1 18  ? 11.471  14.554  37.599 1.00 51.03 ? 123 LEU B O   1 
ATOM   3351 C  CB  . LEU B 1 18  ? 14.320  15.433  36.436 1.00 51.07 ? 123 LEU B CB  1 
ATOM   3352 C  CG  . LEU B 1 18  ? 15.303  16.466  35.886 1.00 50.95 ? 123 LEU B CG  1 
ATOM   3353 C  CD1 . LEU B 1 18  ? 16.681  16.244  36.478 1.00 50.94 ? 123 LEU B CD1 1 
ATOM   3354 C  CD2 . LEU B 1 18  ? 15.362  16.414  34.371 1.00 51.22 ? 123 LEU B CD2 1 
ATOM   3355 N  N   . TYR B 1 19  ? 11.925  13.378  35.719 1.00 50.76 ? 124 TYR B N   1 
ATOM   3356 C  CA  . TYR B 1 19  ? 10.988  12.292  35.972 1.00 50.70 ? 124 TYR B CA  1 
ATOM   3357 C  C   . TYR B 1 19  ? 11.756  10.982  36.106 1.00 50.62 ? 124 TYR B C   1 
ATOM   3358 O  O   . TYR B 1 19  ? 12.255  10.452  35.112 1.00 50.52 ? 124 TYR B O   1 
ATOM   3359 C  CB  . TYR B 1 19  ? 10.013  12.223  34.798 1.00 50.57 ? 124 TYR B CB  1 
ATOM   3360 C  CG  . TYR B 1 19  ? 8.735   11.469  35.052 1.00 50.47 ? 124 TYR B CG  1 
ATOM   3361 C  CD1 . TYR B 1 19  ? 7.658   12.088  35.677 1.00 50.32 ? 124 TYR B CD1 1 
ATOM   3362 C  CD2 . TYR B 1 19  ? 8.583   10.149  34.632 1.00 50.10 ? 124 TYR B CD2 1 
ATOM   3363 C  CE1 . TYR B 1 19  ? 6.466   11.408  35.898 1.00 50.48 ? 124 TYR B CE1 1 
ATOM   3364 C  CE2 . TYR B 1 19  ? 7.396   9.460   34.853 1.00 50.16 ? 124 TYR B CE2 1 
ATOM   3365 C  CZ  . TYR B 1 19  ? 6.341   10.098  35.481 1.00 50.19 ? 124 TYR B CZ  1 
ATOM   3366 O  OH  . TYR B 1 19  ? 5.161   9.433   35.703 1.00 50.35 ? 124 TYR B OH  1 
ATOM   3367 N  N   . ARG B 1 20  ? 11.868  10.475  37.333 1.00 50.69 ? 125 ARG B N   1 
ATOM   3368 C  CA  . ARG B 1 20  ? 12.593  9.228   37.584 1.00 50.82 ? 125 ARG B CA  1 
ATOM   3369 C  C   . ARG B 1 20  ? 11.715  8.020   37.298 1.00 51.00 ? 125 ARG B C   1 
ATOM   3370 O  O   . ARG B 1 20  ? 10.616  7.907   37.845 1.00 51.09 ? 125 ARG B O   1 
ATOM   3371 C  CB  . ARG B 1 20  ? 13.087  9.145   39.029 1.00 50.72 ? 125 ARG B CB  1 
ATOM   3372 C  CG  . ARG B 1 20  ? 14.155  10.154  39.402 1.00 50.82 ? 125 ARG B CG  1 
ATOM   3373 C  CD  . ARG B 1 20  ? 14.760  9.825   40.760 1.00 50.73 ? 125 ARG B CD  1 
ATOM   3374 N  NE  . ARG B 1 20  ? 13.778  9.911   41.846 1.00 50.91 ? 125 ARG B NE  1 
ATOM   3375 C  CZ  . ARG B 1 20  ? 13.704  10.893  42.750 1.00 50.94 ? 125 ARG B CZ  1 
ATOM   3376 N  NH1 . ARG B 1 20  ? 14.561  11.910  42.750 1.00 51.08 ? 125 ARG B NH1 1 
ATOM   3377 N  NH2 . ARG B 1 20  ? 12.764  10.853  43.681 1.00 51.09 ? 125 ARG B NH2 1 
ATOM   3378 N  N   . ILE B 1 21  ? 12.208  7.129   36.437 1.00 51.19 ? 126 ILE B N   1 
ATOM   3379 C  CA  . ILE B 1 21  ? 11.592  5.826   36.206 1.00 51.38 ? 126 ILE B CA  1 
ATOM   3380 C  C   . ILE B 1 21  ? 12.605  4.754   36.583 1.00 51.62 ? 126 ILE B C   1 
ATOM   3381 O  O   . ILE B 1 21  ? 13.561  4.511   35.844 1.00 51.90 ? 126 ILE B O   1 
ATOM   3382 C  CB  . ILE B 1 21  ? 11.166  5.642   34.732 1.00 51.48 ? 126 ILE B CB  1 
ATOM   3383 C  CG1 . ILE B 1 21  ? 10.050  6.626   34.375 1.00 51.37 ? 126 ILE B CG1 1 
ATOM   3384 C  CG2 . ILE B 1 21  ? 10.707  4.188   34.470 1.00 51.38 ? 126 ILE B CG2 1 
ATOM   3385 C  CD1 . ILE B 1 21  ? 9.818   6.769   32.887 1.00 51.49 ? 126 ILE B CD1 1 
ATOM   3386 N  N   . GLY B 1 22  ? 12.397  4.123   37.735 1.00 51.81 ? 127 GLY B N   1 
ATOM   3387 C  CA  . GLY B 1 22  ? 13.310  3.094   38.229 1.00 51.98 ? 127 GLY B CA  1 
ATOM   3388 C  C   . GLY B 1 22  ? 12.956  1.678   37.809 1.00 52.17 ? 127 GLY B C   1 
ATOM   3389 O  O   . GLY B 1 22  ? 13.783  0.773   37.939 1.00 52.18 ? 127 GLY B O   1 
ATOM   3390 N  N   . ASP B 1 23  ? 11.732  1.485   37.307 1.00 52.47 ? 128 ASP B N   1 
ATOM   3391 C  CA  . ASP B 1 23  ? 11.213  0.156   36.965 1.00 52.54 ? 128 ASP B CA  1 
ATOM   3392 C  C   . ASP B 1 23  ? 10.299  0.220   35.733 1.00 52.64 ? 128 ASP B C   1 
ATOM   3393 O  O   . ASP B 1 23  ? 9.107   0.516   35.846 1.00 52.55 ? 128 ASP B O   1 
ATOM   3394 C  CB  . ASP B 1 23  ? 10.462  -0.422  38.171 1.00 52.62 ? 128 ASP B CB  1 
ATOM   3395 C  CG  . ASP B 1 23  ? 10.284  -1.930  38.094 1.00 52.77 ? 128 ASP B CG  1 
ATOM   3396 O  OD1 . ASP B 1 23  ? 10.857  -2.624  38.959 1.00 53.61 ? 128 ASP B OD1 1 
ATOM   3397 O  OD2 . ASP B 1 23  ? 9.576   -2.425  37.186 1.00 52.52 ? 128 ASP B OD2 1 
ATOM   3398 N  N   . LEU B 1 24  ? 10.877  -0.056  34.561 1.00 52.91 ? 129 LEU B N   1 
ATOM   3399 C  CA  . LEU B 1 24  ? 10.154  -0.043  33.278 1.00 53.07 ? 129 LEU B CA  1 
ATOM   3400 C  C   . LEU B 1 24  ? 8.916   -0.929  33.311 1.00 53.22 ? 129 LEU B C   1 
ATOM   3401 O  O   . LEU B 1 24  ? 7.838   -0.533  32.866 1.00 53.00 ? 129 LEU B O   1 
ATOM   3402 C  CB  . LEU B 1 24  ? 11.061  -0.547  32.150 1.00 53.05 ? 129 LEU B CB  1 
ATOM   3403 C  CG  . LEU B 1 24  ? 12.230  0.324   31.686 1.00 53.02 ? 129 LEU B CG  1 
ATOM   3404 C  CD1 . LEU B 1 24  ? 13.214  -0.512  30.877 1.00 53.11 ? 129 LEU B CD1 1 
ATOM   3405 C  CD2 . LEU B 1 24  ? 11.741  1.513   30.874 1.00 53.20 ? 129 LEU B CD2 1 
ATOM   3406 N  N   . GLN B 1 25  ? 9.098   -2.134  33.840 1.00 53.59 ? 130 GLN B N   1 
ATOM   3407 C  CA  . GLN B 1 25  ? 8.059   -3.155  33.868 1.00 53.91 ? 130 GLN B CA  1 
ATOM   3408 C  C   . GLN B 1 25  ? 6.820   -2.688  34.634 1.00 54.11 ? 130 GLN B C   1 
ATOM   3409 O  O   . GLN B 1 25  ? 5.700   -2.887  34.173 1.00 53.99 ? 130 GLN B O   1 
ATOM   3410 C  CB  . GLN B 1 25  ? 8.633   -4.438  34.482 1.00 53.95 ? 130 GLN B CB  1 
ATOM   3411 C  CG  . GLN B 1 25  ? 7.722   -5.660  34.442 1.00 54.03 ? 130 GLN B CG  1 
ATOM   3412 C  CD  . GLN B 1 25  ? 8.299   -6.844  35.217 1.00 54.31 ? 130 GLN B CD  1 
ATOM   3413 O  OE1 . GLN B 1 25  ? 7.553   -7.675  35.751 1.00 55.19 ? 130 GLN B OE1 1 
ATOM   3414 N  NE2 . GLN B 1 25  ? 9.630   -6.922  35.286 1.00 54.21 ? 130 GLN B NE2 1 
ATOM   3415 N  N   . ALA B 1 26  ? 7.028   -2.056  35.788 1.00 54.48 ? 131 ALA B N   1 
ATOM   3416 C  CA  . ALA B 1 26  ? 5.925   -1.589  36.634 1.00 54.78 ? 131 ALA B CA  1 
ATOM   3417 C  C   . ALA B 1 26  ? 5.331   -0.269  36.152 1.00 55.11 ? 131 ALA B C   1 
ATOM   3418 O  O   . ALA B 1 26  ? 4.151   -0.005  36.374 1.00 55.06 ? 131 ALA B O   1 
ATOM   3419 C  CB  . ALA B 1 26  ? 6.384   -1.457  38.077 1.00 54.70 ? 131 ALA B CB  1 
ATOM   3420 N  N   . PHE B 1 27  ? 6.145   0.566   35.509 1.00 55.72 ? 132 PHE B N   1 
ATOM   3421 C  CA  . PHE B 1 27  ? 5.668   1.854   35.004 1.00 56.13 ? 132 PHE B CA  1 
ATOM   3422 C  C   . PHE B 1 27  ? 4.697   1.671   33.837 1.00 56.67 ? 132 PHE B C   1 
ATOM   3423 O  O   . PHE B 1 27  ? 3.635   2.286   33.813 1.00 56.75 ? 132 PHE B O   1 
ATOM   3424 C  CB  . PHE B 1 27  ? 6.833   2.759   34.591 1.00 55.97 ? 132 PHE B CB  1 
ATOM   3425 C  CG  . PHE B 1 27  ? 6.408   3.981   33.814 1.00 55.89 ? 132 PHE B CG  1 
ATOM   3426 C  CD1 . PHE B 1 27  ? 5.778   5.042   34.451 1.00 55.99 ? 132 PHE B CD1 1 
ATOM   3427 C  CD2 . PHE B 1 27  ? 6.635   4.068   32.442 1.00 55.97 ? 132 PHE B CD2 1 
ATOM   3428 C  CE1 . PHE B 1 27  ? 5.383   6.170   33.738 1.00 55.90 ? 132 PHE B CE1 1 
ATOM   3429 C  CE2 . PHE B 1 27  ? 6.243   5.190   31.722 1.00 55.89 ? 132 PHE B CE2 1 
ATOM   3430 C  CZ  . PHE B 1 27  ? 5.615   6.243   32.371 1.00 56.06 ? 132 PHE B CZ  1 
ATOM   3431 N  N   . GLN B 1 28  ? 5.055   0.832   32.868 1.00 57.27 ? 133 GLN B N   1 
ATOM   3432 C  CA  . GLN B 1 28  ? 4.200   0.640   31.694 1.00 57.70 ? 133 GLN B CA  1 
ATOM   3433 C  C   . GLN B 1 28  ? 3.281   -0.583  31.813 1.00 58.01 ? 133 GLN B C   1 
ATOM   3434 O  O   . GLN B 1 28  ? 2.358   -0.729  31.014 1.00 58.09 ? 133 GLN B O   1 
ATOM   3435 C  CB  . GLN B 1 28  ? 5.038   0.601   30.404 1.00 57.72 ? 133 GLN B CB  1 
ATOM   3436 C  CG  . GLN B 1 28  ? 5.797   -0.691  30.159 1.00 58.01 ? 133 GLN B CG  1 
ATOM   3437 C  CD  . GLN B 1 28  ? 6.714   -0.616  28.946 1.00 58.00 ? 133 GLN B CD  1 
ATOM   3438 O  OE1 . GLN B 1 28  ? 6.595   -1.422  28.020 1.00 58.50 ? 133 GLN B OE1 1 
ATOM   3439 N  NE2 . GLN B 1 28  ? 7.635   0.344   28.949 1.00 57.80 ? 133 GLN B NE2 1 
ATOM   3440 N  N   . GLY B 1 29  ? 3.528   -1.447  32.800 1.00 58.47 ? 134 GLY B N   1 
ATOM   3441 C  CA  . GLY B 1 29  ? 2.634   -2.583  33.098 1.00 58.88 ? 134 GLY B CA  1 
ATOM   3442 C  C   . GLY B 1 29  ? 3.279   -3.954  32.946 1.00 59.30 ? 134 GLY B C   1 
ATOM   3443 O  O   . GLY B 1 29  ? 4.057   -4.182  32.013 1.00 59.49 ? 134 GLY B O   1 
ATOM   3444 N  N   . HIS B 1 30  ? 2.956   -4.872  33.860 1.00 59.70 ? 135 HIS B N   1 
ATOM   3445 C  CA  . HIS B 1 30  ? 3.535   -6.226  33.851 1.00 59.88 ? 135 HIS B CA  1 
ATOM   3446 C  C   . HIS B 1 30  ? 3.130   -6.991  32.588 1.00 60.00 ? 135 HIS B C   1 
ATOM   3447 O  O   . HIS B 1 30  ? 2.263   -7.871  32.628 1.00 60.09 ? 135 HIS B O   1 
ATOM   3448 C  CB  . HIS B 1 30  ? 3.116   -7.014  35.104 1.00 60.20 ? 135 HIS B CB  1 
ATOM   3449 C  CG  . HIS B 1 30  ? 3.860   -6.625  36.346 1.00 61.08 ? 135 HIS B CG  1 
ATOM   3450 N  ND1 . HIS B 1 30  ? 4.679   -7.501  37.028 1.00 61.96 ? 135 HIS B ND1 1 
ATOM   3451 C  CD2 . HIS B 1 30  ? 3.908   -5.455  37.030 1.00 61.83 ? 135 HIS B CD2 1 
ATOM   3452 C  CE1 . HIS B 1 30  ? 5.201   -6.888  38.076 1.00 62.19 ? 135 HIS B CE1 1 
ATOM   3453 N  NE2 . HIS B 1 30  ? 4.750   -5.645  38.100 1.00 62.06 ? 135 HIS B NE2 1 
ATOM   3454 N  N   . GLY B 1 31  ? 3.771   -6.647  31.472 1.00 59.99 ? 136 GLY B N   1 
ATOM   3455 C  CA  . GLY B 1 31  ? 3.457   -7.237  30.169 1.00 59.91 ? 136 GLY B CA  1 
ATOM   3456 C  C   . GLY B 1 31  ? 4.558   -6.940  29.169 1.00 59.89 ? 136 GLY B C   1 
ATOM   3457 O  O   . GLY B 1 31  ? 5.525   -7.699  29.060 1.00 60.01 ? 136 GLY B O   1 
ATOM   3458 N  N   . ALA B 1 32  ? 4.414   -5.831  28.444 1.00 59.73 ? 137 ALA B N   1 
ATOM   3459 C  CA  . ALA B 1 32  ? 5.451   -5.373  27.518 1.00 59.53 ? 137 ALA B CA  1 
ATOM   3460 C  C   . ALA B 1 32  ? 6.723   -5.034  28.299 1.00 59.41 ? 137 ALA B C   1 
ATOM   3461 O  O   . ALA B 1 32  ? 7.784   -5.608  28.044 1.00 59.49 ? 137 ALA B O   1 
ATOM   3462 C  CB  . ALA B 1 32  ? 4.967   -4.162  26.715 1.00 59.58 ? 137 ALA B CB  1 
ATOM   3463 N  N   . GLY B 1 33  ? 6.600   -4.108  29.251 1.00 59.07 ? 138 GLY B N   1 
ATOM   3464 C  CA  . GLY B 1 33  ? 7.674   -3.790  30.196 1.00 58.72 ? 138 GLY B CA  1 
ATOM   3465 C  C   . GLY B 1 33  ? 9.070   -3.774  29.605 1.00 58.44 ? 138 GLY B C   1 
ATOM   3466 O  O   . GLY B 1 33  ? 9.993   -4.359  30.170 1.00 58.59 ? 138 GLY B O   1 
ATOM   3467 N  N   . ASN B 1 34  ? 9.218   -3.100  28.469 1.00 58.06 ? 139 ASN B N   1 
ATOM   3468 C  CA  . ASN B 1 34  ? 10.490  -3.043  27.747 1.00 57.64 ? 139 ASN B CA  1 
ATOM   3469 C  C   . ASN B 1 34  ? 10.775  -1.643  27.201 1.00 57.25 ? 139 ASN B C   1 
ATOM   3470 O  O   . ASN B 1 34  ? 9.943   -0.742  27.316 1.00 57.22 ? 139 ASN B O   1 
ATOM   3471 C  CB  . ASN B 1 34  ? 10.503  -4.085  26.618 1.00 57.65 ? 139 ASN B CB  1 
ATOM   3472 C  CG  . ASN B 1 34  ? 9.245   -4.046  25.754 1.00 57.57 ? 139 ASN B CG  1 
ATOM   3473 O  OD1 . ASN B 1 34  ? 8.689   -2.982  25.481 1.00 57.29 ? 139 ASN B OD1 1 
ATOM   3474 N  ND2 . ASN B 1 34  ? 8.796   -5.218  25.317 1.00 57.39 ? 139 ASN B ND2 1 
ATOM   3475 N  N   . LEU B 1 35  ? 11.956  -1.468  26.618 1.00 56.87 ? 140 LEU B N   1 
ATOM   3476 C  CA  . LEU B 1 35  ? 12.363  -0.176  26.059 1.00 56.59 ? 140 LEU B CA  1 
ATOM   3477 C  C   . LEU B 1 35  ? 11.495  0.235   24.870 1.00 56.22 ? 140 LEU B C   1 
ATOM   3478 O  O   . LEU B 1 35  ? 11.179  1.412   24.702 1.00 56.18 ? 140 LEU B O   1 
ATOM   3479 C  CB  . LEU B 1 35  ? 13.837  -0.220  25.635 1.00 56.65 ? 140 LEU B CB  1 
ATOM   3480 C  CG  . LEU B 1 35  ? 14.855  -0.441  26.764 1.00 56.72 ? 140 LEU B CG  1 
ATOM   3481 C  CD1 . LEU B 1 35  ? 16.140  -1.057  26.226 1.00 56.81 ? 140 LEU B CD1 1 
ATOM   3482 C  CD2 . LEU B 1 35  ? 15.150  0.854   27.509 1.00 56.55 ? 140 LEU B CD2 1 
ATOM   3483 N  N   . ALA B 1 36  ? 11.112  -0.737  24.047 1.00 55.84 ? 141 ALA B N   1 
ATOM   3484 C  CA  . ALA B 1 36  ? 10.279  -0.468  22.872 1.00 55.50 ? 141 ALA B CA  1 
ATOM   3485 C  C   . ALA B 1 36  ? 8.866   -0.017  23.255 1.00 55.11 ? 141 ALA B C   1 
ATOM   3486 O  O   . ALA B 1 36  ? 8.227   0.731   22.513 1.00 55.12 ? 141 ALA B O   1 
ATOM   3487 C  CB  . ALA B 1 36  ? 10.216  -1.694  21.972 1.00 55.54 ? 141 ALA B CB  1 
ATOM   3488 N  N   . GLY B 1 37  ? 8.385   -0.477  24.407 1.00 54.55 ? 142 GLY B N   1 
ATOM   3489 C  CA  . GLY B 1 37  ? 7.069   -0.088  24.910 1.00 54.16 ? 142 GLY B CA  1 
ATOM   3490 C  C   . GLY B 1 37  ? 7.042   1.250   25.629 1.00 53.71 ? 142 GLY B C   1 
ATOM   3491 O  O   . GLY B 1 37  ? 5.974   1.822   25.838 1.00 53.67 ? 142 GLY B O   1 
ATOM   3492 N  N   . LEU B 1 38  ? 8.211   1.757   26.009 1.00 53.29 ? 143 LEU B N   1 
ATOM   3493 C  CA  . LEU B 1 38  ? 8.303   3.049   26.690 1.00 53.01 ? 143 LEU B CA  1 
ATOM   3494 C  C   . LEU B 1 38  ? 8.071   4.240   25.749 1.00 52.59 ? 143 LEU B C   1 
ATOM   3495 O  O   . LEU B 1 38  ? 7.729   5.328   26.208 1.00 52.55 ? 143 LEU B O   1 
ATOM   3496 C  CB  . LEU B 1 38  ? 9.662   3.188   27.377 1.00 52.95 ? 143 LEU B CB  1 
ATOM   3497 C  CG  . LEU B 1 38  ? 9.748   4.291   28.429 1.00 53.39 ? 143 LEU B CG  1 
ATOM   3498 C  CD1 . LEU B 1 38  ? 8.872   3.942   29.633 1.00 53.81 ? 143 LEU B CD1 1 
ATOM   3499 C  CD2 . LEU B 1 38  ? 11.205  4.538   28.850 1.00 53.45 ? 143 LEU B CD2 1 
ATOM   3500 N  N   . LYS B 1 39  ? 8.264   4.031   24.444 1.00 52.16 ? 144 LYS B N   1 
ATOM   3501 C  CA  . LYS B 1 39  ? 7.999   5.062   23.426 1.00 51.73 ? 144 LYS B CA  1 
ATOM   3502 C  C   . LYS B 1 39  ? 6.558   5.562   23.444 1.00 51.35 ? 144 LYS B C   1 
ATOM   3503 O  O   . LYS B 1 39  ? 6.309   6.745   23.225 1.00 51.46 ? 144 LYS B O   1 
ATOM   3504 C  CB  . LYS B 1 39  ? 8.297   4.530   22.020 1.00 51.72 ? 144 LYS B CB  1 
ATOM   3505 C  CG  . LYS B 1 39  ? 9.729   4.704   21.554 1.00 51.66 ? 144 LYS B CG  1 
ATOM   3506 C  CD  . LYS B 1 39  ? 9.977   3.877   20.306 1.00 51.85 ? 144 LYS B CD  1 
ATOM   3507 C  CE  . LYS B 1 39  ? 10.206  2.407   20.650 1.00 52.30 ? 144 LYS B CE  1 
ATOM   3508 N  NZ  . LYS B 1 39  ? 9.476   1.478   19.738 1.00 52.24 ? 144 LYS B NZ  1 
ATOM   3509 N  N   . GLY B 1 40  ? 5.614   4.655   23.684 1.00 50.78 ? 145 GLY B N   1 
ATOM   3510 C  CA  . GLY B 1 40  ? 4.197   4.999   23.692 1.00 50.34 ? 145 GLY B CA  1 
ATOM   3511 C  C   . GLY B 1 40  ? 3.796   5.991   24.769 1.00 49.90 ? 145 GLY B C   1 
ATOM   3512 O  O   . GLY B 1 40  ? 2.784   6.673   24.628 1.00 49.99 ? 145 GLY B O   1 
ATOM   3513 N  N   . ARG B 1 41  ? 4.582   6.078   25.840 1.00 49.35 ? 146 ARG B N   1 
ATOM   3514 C  CA  . ARG B 1 41  ? 4.286   6.987   26.949 1.00 49.11 ? 146 ARG B CA  1 
ATOM   3515 C  C   . ARG B 1 41  ? 5.021   8.331   26.876 1.00 48.69 ? 146 ARG B C   1 
ATOM   3516 O  O   . ARG B 1 41  ? 4.900   9.146   27.789 1.00 48.46 ? 146 ARG B O   1 
ATOM   3517 C  CB  . ARG B 1 41  ? 4.602   6.304   28.289 1.00 49.17 ? 146 ARG B CB  1 
ATOM   3518 C  CG  . ARG B 1 41  ? 3.862   4.982   28.522 1.00 49.23 ? 146 ARG B CG  1 
ATOM   3519 C  CD  . ARG B 1 41  ? 2.362   5.150   28.401 1.00 48.99 ? 146 ARG B CD  1 
ATOM   3520 N  NE  . ARG B 1 41  ? 1.628   4.022   28.963 1.00 48.98 ? 146 ARG B NE  1 
ATOM   3521 C  CZ  . ARG B 1 41  ? 0.300   3.940   29.016 1.00 49.37 ? 146 ARG B CZ  1 
ATOM   3522 N  NH1 . ARG B 1 41  ? -0.463  4.921   28.535 1.00 49.64 ? 146 ARG B NH1 1 
ATOM   3523 N  NH2 . ARG B 1 41  ? -0.275  2.870   29.552 1.00 49.29 ? 146 ARG B NH2 1 
ATOM   3524 N  N   . LEU B 1 42  ? 5.765   8.575   25.799 1.00 48.34 ? 147 LEU B N   1 
ATOM   3525 C  CA  . LEU B 1 42  ? 6.516   9.826   25.666 1.00 48.16 ? 147 LEU B CA  1 
ATOM   3526 C  C   . LEU B 1 42  ? 5.596   11.038  25.498 1.00 47.88 ? 147 LEU B C   1 
ATOM   3527 O  O   . LEU B 1 42  ? 5.909   12.124  25.978 1.00 47.87 ? 147 LEU B O   1 
ATOM   3528 C  CB  . LEU B 1 42  ? 7.520   9.748   24.511 1.00 48.18 ? 147 LEU B CB  1 
ATOM   3529 C  CG  . LEU B 1 42  ? 8.741   8.839   24.721 1.00 48.45 ? 147 LEU B CG  1 
ATOM   3530 C  CD1 . LEU B 1 42  ? 9.567   8.747   23.443 1.00 48.82 ? 147 LEU B CD1 1 
ATOM   3531 C  CD2 . LEU B 1 42  ? 9.619   9.309   25.884 1.00 48.44 ? 147 LEU B CD2 1 
ATOM   3532 N  N   . ASP B 1 43  ? 4.463   10.850  24.829 1.00 47.66 ? 148 ASP B N   1 
ATOM   3533 C  CA  . ASP B 1 43  ? 3.465   11.913  24.706 1.00 47.46 ? 148 ASP B CA  1 
ATOM   3534 C  C   . ASP B 1 43  ? 2.828   12.263  26.057 1.00 47.20 ? 148 ASP B C   1 
ATOM   3535 O  O   . ASP B 1 43  ? 2.510   13.421  26.306 1.00 47.28 ? 148 ASP B O   1 
ATOM   3536 C  CB  . ASP B 1 43  ? 2.386   11.531  23.689 1.00 47.58 ? 148 ASP B CB  1 
ATOM   3537 C  CG  . ASP B 1 43  ? 2.933   11.403  22.267 1.00 47.92 ? 148 ASP B CG  1 
ATOM   3538 O  OD1 . ASP B 1 43  ? 2.163   11.048  21.342 1.00 47.68 ? 148 ASP B OD1 1 
ATOM   3539 O  OD2 . ASP B 1 43  ? 4.140   11.649  22.077 1.00 48.59 ? 148 ASP B OD2 1 
ATOM   3540 N  N   . TYR B 1 44  ? 2.645   11.269  26.924 1.00 46.78 ? 149 TYR B N   1 
ATOM   3541 C  CA  . TYR B 1 44  ? 2.154   11.516  28.283 1.00 46.71 ? 149 TYR B CA  1 
ATOM   3542 C  C   . TYR B 1 44  ? 3.133   12.351  29.102 1.00 46.67 ? 149 TYR B C   1 
ATOM   3543 O  O   . TYR B 1 44  ? 2.734   13.302  29.765 1.00 46.85 ? 149 TYR B O   1 
ATOM   3544 C  CB  . TYR B 1 44  ? 1.882   10.199  29.015 1.00 46.47 ? 149 TYR B CB  1 
ATOM   3545 C  CG  . TYR B 1 44  ? 1.615   10.376  30.489 1.00 46.20 ? 149 TYR B CG  1 
ATOM   3546 C  CD1 . TYR B 1 44  ? 0.415   10.913  30.932 1.00 45.87 ? 149 TYR B CD1 1 
ATOM   3547 C  CD2 . TYR B 1 44  ? 2.567   10.015  31.439 1.00 45.66 ? 149 TYR B CD2 1 
ATOM   3548 C  CE1 . TYR B 1 44  ? 0.164   11.084  32.290 1.00 46.35 ? 149 TYR B CE1 1 
ATOM   3549 C  CE2 . TYR B 1 44  ? 2.327   10.181  32.800 1.00 45.82 ? 149 TYR B CE2 1 
ATOM   3550 C  CZ  . TYR B 1 44  ? 1.125   10.716  33.219 1.00 45.90 ? 149 TYR B CZ  1 
ATOM   3551 O  OH  . TYR B 1 44  ? 0.872   10.888  34.558 1.00 45.64 ? 149 TYR B OH  1 
ATOM   3552 N  N   . LEU B 1 45  ? 4.411   11.983  29.062 1.00 46.67 ? 150 LEU B N   1 
ATOM   3553 C  CA  . LEU B 1 45  ? 5.466   12.742  29.741 1.00 46.68 ? 150 LEU B CA  1 
ATOM   3554 C  C   . LEU B 1 45  ? 5.553   14.178  29.223 1.00 46.67 ? 150 LEU B C   1 
ATOM   3555 O  O   . LEU B 1 45  ? 5.815   15.103  29.983 1.00 46.56 ? 150 LEU B O   1 
ATOM   3556 C  CB  . LEU B 1 45  ? 6.819   12.050  29.559 1.00 46.65 ? 150 LEU B CB  1 
ATOM   3557 C  CG  . LEU B 1 45  ? 6.954   10.662  30.190 1.00 46.65 ? 150 LEU B CG  1 
ATOM   3558 C  CD1 . LEU B 1 45  ? 8.135   9.920   29.595 1.00 46.57 ? 150 LEU B CD1 1 
ATOM   3559 C  CD2 . LEU B 1 45  ? 7.078   10.757  31.703 1.00 46.55 ? 150 LEU B CD2 1 
ATOM   3560 N  N   . SER B 1 46  ? 5.328   14.355  27.926 1.00 46.91 ? 151 SER B N   1 
ATOM   3561 C  CA  . SER B 1 46  ? 5.251   15.681  27.325 1.00 47.10 ? 151 SER B CA  1 
ATOM   3562 C  C   . SER B 1 46  ? 4.054   16.490  27.852 1.00 47.21 ? 151 SER B C   1 
ATOM   3563 O  O   . SER B 1 46  ? 4.114   17.716  27.910 1.00 47.16 ? 151 SER B O   1 
ATOM   3564 C  CB  . SER B 1 46  ? 5.173   15.559  25.801 1.00 47.12 ? 151 SER B CB  1 
ATOM   3565 O  OG  . SER B 1 46  ? 5.277   16.829  25.185 1.00 47.43 ? 151 SER B OG  1 
ATOM   3566 N  N   . SER B 1 47  ? 2.979   15.801  28.235 1.00 47.47 ? 152 SER B N   1 
ATOM   3567 C  CA  . SER B 1 47  ? 1.798   16.448  28.824 1.00 47.73 ? 152 SER B CA  1 
ATOM   3568 C  C   . SER B 1 47  ? 2.057   16.973  30.242 1.00 47.98 ? 152 SER B C   1 
ATOM   3569 O  O   . SER B 1 47  ? 1.329   17.842  30.721 1.00 47.97 ? 152 SER B O   1 
ATOM   3570 C  CB  . SER B 1 47  ? 0.594   15.490  28.835 1.00 47.66 ? 152 SER B CB  1 
ATOM   3571 O  OG  . SER B 1 47  ? 0.653   14.578  29.917 1.00 47.50 ? 152 SER B OG  1 
ATOM   3572 N  N   . LEU B 1 48  ? 3.079   16.435  30.905 1.00 48.34 ? 153 LEU B N   1 
ATOM   3573 C  CA  . LEU B 1 48  ? 3.509   16.917  32.219 1.00 48.74 ? 153 LEU B CA  1 
ATOM   3574 C  C   . LEU B 1 48  ? 4.593   17.988  32.090 1.00 49.15 ? 153 LEU B C   1 
ATOM   3575 O  O   . LEU B 1 48  ? 5.063   18.533  33.097 1.00 49.23 ? 153 LEU B O   1 
ATOM   3576 C  CB  . LEU B 1 48  ? 4.061   15.761  33.055 1.00 48.78 ? 153 LEU B CB  1 
ATOM   3577 C  CG  . LEU B 1 48  ? 3.222   14.486  33.130 1.00 48.95 ? 153 LEU B CG  1 
ATOM   3578 C  CD1 . LEU B 1 48  ? 4.010   13.421  33.867 1.00 48.92 ? 153 LEU B CD1 1 
ATOM   3579 C  CD2 . LEU B 1 48  ? 1.874   14.752  33.795 1.00 48.71 ? 153 LEU B CD2 1 
ATOM   3580 N  N   . LYS B 1 49  ? 4.996   18.261  30.848 1.00 49.55 ? 154 LYS B N   1 
ATOM   3581 C  CA  . LYS B 1 49  ? 6.089   19.181  30.527 1.00 49.71 ? 154 LYS B CA  1 
ATOM   3582 C  C   . LYS B 1 49  ? 7.382   18.878  31.282 1.00 49.85 ? 154 LYS B C   1 
ATOM   3583 O  O   . LYS B 1 49  ? 8.034   19.787  31.797 1.00 50.03 ? 154 LYS B O   1 
ATOM   3584 C  CB  . LYS B 1 49  ? 5.656   20.641  30.723 1.00 49.84 ? 154 LYS B CB  1 
ATOM   3585 C  CG  . LYS B 1 49  ? 4.661   21.112  29.665 1.00 49.97 ? 154 LYS B CG  1 
ATOM   3586 C  CD  . LYS B 1 49  ? 4.726   22.617  29.452 1.00 49.96 ? 154 LYS B CD  1 
ATOM   3587 C  CE  . LYS B 1 49  ? 3.675   23.089  28.447 1.00 50.32 ? 154 LYS B CE  1 
ATOM   3588 N  NZ  . LYS B 1 49  ? 2.279   22.871  28.920 1.00 50.11 ? 154 LYS B NZ  1 
ATOM   3589 N  N   . VAL B 1 50  ? 7.750   17.597  31.337 1.00 49.97 ? 155 VAL B N   1 
ATOM   3590 C  CA  . VAL B 1 50  ? 9.064   17.206  31.850 1.00 50.03 ? 155 VAL B CA  1 
ATOM   3591 C  C   . VAL B 1 50  ? 10.077  17.316  30.716 1.00 50.14 ? 155 VAL B C   1 
ATOM   3592 O  O   . VAL B 1 50  ? 9.778   16.975  29.568 1.00 50.11 ? 155 VAL B O   1 
ATOM   3593 C  CB  . VAL B 1 50  ? 9.088   15.785  32.497 1.00 50.06 ? 155 VAL B CB  1 
ATOM   3594 C  CG1 . VAL B 1 50  ? 8.282   15.778  33.795 1.00 50.05 ? 155 VAL B CG1 1 
ATOM   3595 C  CG2 . VAL B 1 50  ? 8.582   14.718  31.552 1.00 49.98 ? 155 VAL B CG2 1 
ATOM   3596 N  N   . LYS B 1 51  ? 11.267  17.811  31.049 1.00 50.32 ? 156 LYS B N   1 
ATOM   3597 C  CA  . LYS B 1 51  ? 12.300  18.117  30.060 1.00 50.21 ? 156 LYS B CA  1 
ATOM   3598 C  C   . LYS B 1 51  ? 13.291  16.971  29.866 1.00 50.20 ? 156 LYS B C   1 
ATOM   3599 O  O   . LYS B 1 51  ? 14.013  16.942  28.872 1.00 50.38 ? 156 LYS B O   1 
ATOM   3600 C  CB  . LYS B 1 51  ? 13.041  19.393  30.466 1.00 50.34 ? 156 LYS B CB  1 
ATOM   3601 C  CG  . LYS B 1 51  ? 12.123  20.593  30.722 1.00 50.68 ? 156 LYS B CG  1 
ATOM   3602 C  CD  . LYS B 1 51  ? 11.517  21.157  29.438 1.00 50.71 ? 156 LYS B CD  1 
ATOM   3603 C  CE  . LYS B 1 51  ? 10.254  21.964  29.730 1.00 50.97 ? 156 LYS B CE  1 
ATOM   3604 N  NZ  . LYS B 1 51  ? 9.924   22.951  28.655 1.00 51.25 ? 156 LYS B NZ  1 
ATOM   3605 N  N   . GLY B 1 52  ? 13.328  16.035  30.813 1.00 50.19 ? 157 GLY B N   1 
ATOM   3606 C  CA  . GLY B 1 52  ? 14.155  14.837  30.681 1.00 50.02 ? 157 GLY B CA  1 
ATOM   3607 C  C   . GLY B 1 52  ? 13.832  13.768  31.711 1.00 49.87 ? 157 GLY B C   1 
ATOM   3608 O  O   . GLY B 1 52  ? 13.557  14.079  32.869 1.00 49.78 ? 157 GLY B O   1 
ATOM   3609 N  N   . LEU B 1 53  ? 13.874  12.507  31.290 1.00 49.80 ? 158 LEU B N   1 
ATOM   3610 C  CA  . LEU B 1 53  ? 13.525  11.386  32.165 1.00 49.96 ? 158 LEU B CA  1 
ATOM   3611 C  C   . LEU B 1 53  ? 14.775  10.626  32.629 1.00 49.90 ? 158 LEU B C   1 
ATOM   3612 O  O   . LEU B 1 53  ? 15.712  10.432  31.857 1.00 49.76 ? 158 LEU B O   1 
ATOM   3613 C  CB  . LEU B 1 53  ? 12.531  10.447  31.460 1.00 49.90 ? 158 LEU B CB  1 
ATOM   3614 C  CG  . LEU B 1 53  ? 13.003  9.641   30.238 1.00 50.19 ? 158 LEU B CG  1 
ATOM   3615 C  CD1 . LEU B 1 53  ? 13.400  8.226   30.626 1.00 50.67 ? 158 LEU B CD1 1 
ATOM   3616 C  CD2 . LEU B 1 53  ? 11.930  9.577   29.165 1.00 50.03 ? 158 LEU B CD2 1 
ATOM   3617 N  N   . VAL B 1 54  ? 14.787  10.225  33.898 1.00 49.92 ? 159 VAL B N   1 
ATOM   3618 C  CA  . VAL B 1 54  ? 15.853  9.385   34.437 1.00 50.09 ? 159 VAL B CA  1 
ATOM   3619 C  C   . VAL B 1 54  ? 15.410  7.937   34.326 1.00 50.15 ? 159 VAL B C   1 
ATOM   3620 O  O   . VAL B 1 54  ? 14.278  7.608   34.664 1.00 50.25 ? 159 VAL B O   1 
ATOM   3621 C  CB  . VAL B 1 54  ? 16.172  9.719   35.908 1.00 50.03 ? 159 VAL B CB  1 
ATOM   3622 C  CG1 . VAL B 1 54  ? 17.365  8.905   36.393 1.00 50.03 ? 159 VAL B CG1 1 
ATOM   3623 C  CG2 . VAL B 1 54  ? 16.436  11.214  36.070 1.00 50.16 ? 159 VAL B CG2 1 
ATOM   3624 N  N   . LEU B 1 55  ? 16.310  7.076   33.865 1.00 50.47 ? 160 LEU B N   1 
ATOM   3625 C  CA  . LEU B 1 55  ? 15.951  5.722   33.440 1.00 50.52 ? 160 LEU B CA  1 
ATOM   3626 C  C   . LEU B 1 55  ? 16.929  4.659   33.938 1.00 50.48 ? 160 LEU B C   1 
ATOM   3627 O  O   . LEU B 1 55  ? 18.138  4.889   33.992 1.00 50.64 ? 160 LEU B O   1 
ATOM   3628 C  CB  . LEU B 1 55  ? 15.923  5.676   31.914 1.00 50.70 ? 160 LEU B CB  1 
ATOM   3629 C  CG  . LEU B 1 55  ? 15.358  4.410   31.270 1.00 50.99 ? 160 LEU B CG  1 
ATOM   3630 C  CD1 . LEU B 1 55  ? 13.838  4.411   31.396 1.00 51.98 ? 160 LEU B CD1 1 
ATOM   3631 C  CD2 . LEU B 1 55  ? 15.795  4.309   29.809 1.00 50.88 ? 160 LEU B CD2 1 
ATOM   3632 N  N   . GLY B 1 56  ? 16.399  3.486   34.273 1.00 50.38 ? 161 GLY B N   1 
ATOM   3633 C  CA  . GLY B 1 56  ? 17.226  2.348   34.660 1.00 50.28 ? 161 GLY B CA  1 
ATOM   3634 C  C   . GLY B 1 56  ? 17.416  2.246   36.162 1.00 50.20 ? 161 GLY B C   1 
ATOM   3635 O  O   . GLY B 1 56  ? 16.641  2.828   36.925 1.00 50.05 ? 161 GLY B O   1 
ATOM   3636 N  N   . PRO B 1 57  ? 18.459  1.517   36.601 1.00 50.18 ? 162 PRO B N   1 
ATOM   3637 C  CA  . PRO B 1 57  ? 19.509  0.901   35.778 1.00 50.18 ? 162 PRO B CA  1 
ATOM   3638 C  C   . PRO B 1 57  ? 19.002  -0.240  34.893 1.00 50.32 ? 162 PRO B C   1 
ATOM   3639 O  O   . PRO B 1 57  ? 18.053  -0.937  35.272 1.00 50.24 ? 162 PRO B O   1 
ATOM   3640 C  CB  . PRO B 1 57  ? 20.503  0.360   36.816 1.00 50.18 ? 162 PRO B CB  1 
ATOM   3641 C  CG  . PRO B 1 57  ? 20.107  0.975   38.122 1.00 50.08 ? 162 PRO B CG  1 
ATOM   3642 C  CD  . PRO B 1 57  ? 18.657  1.236   38.033 1.00 50.10 ? 162 PRO B CD  1 
ATOM   3643 N  N   . ILE B 1 58  ? 19.642  -0.422  33.732 1.00 50.41 ? 163 ILE B N   1 
ATOM   3644 C  CA  . ILE B 1 58  ? 19.273  -1.487  32.781 1.00 50.31 ? 163 ILE B CA  1 
ATOM   3645 C  C   . ILE B 1 58  ? 20.430  -2.398  32.324 1.00 50.30 ? 163 ILE B C   1 
ATOM   3646 O  O   . ILE B 1 58  ? 20.245  -3.226  31.424 1.00 50.30 ? 163 ILE B O   1 
ATOM   3647 C  CB  . ILE B 1 58  ? 18.592  -0.901  31.522 1.00 50.29 ? 163 ILE B CB  1 
ATOM   3648 C  CG1 . ILE B 1 58  ? 19.523  0.078   30.803 1.00 50.34 ? 163 ILE B CG1 1 
ATOM   3649 C  CG2 . ILE B 1 58  ? 17.283  -0.221  31.895 1.00 50.20 ? 163 ILE B CG2 1 
ATOM   3650 C  CD1 . ILE B 1 58  ? 19.076  0.392   29.388 1.00 50.41 ? 163 ILE B CD1 1 
ATOM   3651 N  N   . HIS B 1 59  ? 21.604  -2.263  32.943 1.00 50.17 ? 164 HIS B N   1 
ATOM   3652 C  CA  . HIS B 1 59  ? 22.797  -3.012  32.513 1.00 50.13 ? 164 HIS B CA  1 
ATOM   3653 C  C   . HIS B 1 59  ? 22.849  -4.414  33.135 1.00 49.99 ? 164 HIS B C   1 
ATOM   3654 O  O   . HIS B 1 59  ? 21.998  -4.773  33.948 1.00 49.95 ? 164 HIS B O   1 
ATOM   3655 C  CB  . HIS B 1 59  ? 24.077  -2.228  32.843 1.00 50.04 ? 164 HIS B CB  1 
ATOM   3656 C  CG  . HIS B 1 59  ? 24.237  -1.915  34.298 1.00 50.29 ? 164 HIS B CG  1 
ATOM   3657 N  ND1 . HIS B 1 59  ? 23.789  -0.737  34.858 1.00 50.50 ? 164 HIS B ND1 1 
ATOM   3658 C  CD2 . HIS B 1 59  ? 24.783  -2.629  35.312 1.00 50.27 ? 164 HIS B CD2 1 
ATOM   3659 C  CE1 . HIS B 1 59  ? 24.055  -0.738  36.152 1.00 50.34 ? 164 HIS B CE1 1 
ATOM   3660 N  NE2 . HIS B 1 59  ? 24.658  -1.875  36.453 1.00 50.43 ? 164 HIS B NE2 1 
ATOM   3661 N  N   . LYS B 1 60  ? 23.845  -5.200  32.735 1.00 49.96 ? 165 LYS B N   1 
ATOM   3662 C  CA  . LYS B 1 60  ? 24.078  -6.525  33.316 1.00 50.10 ? 165 LYS B CA  1 
ATOM   3663 C  C   . LYS B 1 60  ? 24.785  -6.417  34.667 1.00 49.99 ? 165 LYS B C   1 
ATOM   3664 O  O   . LYS B 1 60  ? 25.943  -6.009  34.737 1.00 49.91 ? 165 LYS B O   1 
ATOM   3665 C  CB  . LYS B 1 60  ? 24.913  -7.402  32.370 1.00 50.15 ? 165 LYS B CB  1 
ATOM   3666 C  CG  . LYS B 1 60  ? 24.128  -7.981  31.199 1.00 50.45 ? 165 LYS B CG  1 
ATOM   3667 C  CD  . LYS B 1 60  ? 25.051  -8.565  30.126 1.00 50.54 ? 165 LYS B CD  1 
ATOM   3668 C  CE  . LYS B 1 60  ? 24.268  -9.029  28.892 1.00 50.53 ? 165 LYS B CE  1 
ATOM   3669 N  NZ  . LYS B 1 60  ? 25.102  -9.021  27.656 1.00 50.18 ? 165 LYS B NZ  1 
ATOM   3670 N  N   . ASN B 1 61  ? 24.075  -6.781  35.731 1.00 49.94 ? 166 ASN B N   1 
ATOM   3671 C  CA  . ASN B 1 61  ? 24.648  -6.869  37.070 1.00 50.03 ? 166 ASN B CA  1 
ATOM   3672 C  C   . ASN B 1 61  ? 24.330  -8.230  37.676 1.00 50.07 ? 166 ASN B C   1 
ATOM   3673 O  O   . ASN B 1 61  ? 23.169  -8.617  37.738 1.00 50.11 ? 166 ASN B O   1 
ATOM   3674 C  CB  . ASN B 1 61  ? 24.086  -5.759  37.964 1.00 49.87 ? 166 ASN B CB  1 
ATOM   3675 C  CG  . ASN B 1 61  ? 24.508  -5.903  39.422 1.00 49.47 ? 166 ASN B CG  1 
ATOM   3676 O  OD1 . ASN B 1 61  ? 23.712  -5.674  40.330 1.00 47.93 ? 166 ASN B OD1 1 
ATOM   3677 N  ND2 . ASN B 1 61  ? 25.761  -6.284  39.649 1.00 47.91 ? 166 ASN B ND2 1 
ATOM   3678 N  N   . GLN B 1 62  ? 25.358  -8.951  38.114 1.00 50.24 ? 167 GLN B N   1 
ATOM   3679 C  CA  . GLN B 1 62  ? 25.161  -10.183 38.871 1.00 50.41 ? 167 GLN B CA  1 
ATOM   3680 C  C   . GLN B 1 62  ? 25.485  -9.902  40.335 1.00 50.45 ? 167 GLN B C   1 
ATOM   3681 O  O   . GLN B 1 62  ? 26.623  -9.571  40.666 1.00 50.37 ? 167 GLN B O   1 
ATOM   3682 C  CB  . GLN B 1 62  ? 26.048  -11.304 38.328 1.00 50.48 ? 167 GLN B CB  1 
ATOM   3683 C  CG  . GLN B 1 62  ? 25.507  -12.702 38.595 1.00 50.46 ? 167 GLN B CG  1 
ATOM   3684 C  CD  . GLN B 1 62  ? 26.531  -13.787 38.321 1.00 50.69 ? 167 GLN B CD  1 
ATOM   3685 O  OE1 . GLN B 1 62  ? 27.422  -14.040 39.140 1.00 50.98 ? 167 GLN B OE1 1 
ATOM   3686 N  NE2 . GLN B 1 62  ? 26.405  -14.445 37.170 1.00 50.86 ? 167 GLN B NE2 1 
ATOM   3687 N  N   . LYS B 1 63  ? 24.478  -10.037 41.198 1.00 50.64 ? 168 LYS B N   1 
ATOM   3688 C  CA  . LYS B 1 63  ? 24.587  -9.687  42.621 1.00 50.75 ? 168 LYS B CA  1 
ATOM   3689 C  C   . LYS B 1 63  ? 25.974  -9.945  43.219 1.00 50.75 ? 168 LYS B C   1 
ATOM   3690 O  O   . LYS B 1 63  ? 26.432  -11.088 43.270 1.00 50.67 ? 168 LYS B O   1 
ATOM   3691 C  CB  . LYS B 1 63  ? 23.529  -10.445 43.439 1.00 50.86 ? 168 LYS B CB  1 
ATOM   3692 C  CG  . LYS B 1 63  ? 23.589  -10.176 44.946 1.00 50.92 ? 168 LYS B CG  1 
ATOM   3693 C  CD  . LYS B 1 63  ? 22.276  -10.512 45.653 1.00 51.10 ? 168 LYS B CD  1 
ATOM   3694 C  CE  . LYS B 1 63  ? 22.304  -10.069 47.118 1.00 51.26 ? 168 LYS B CE  1 
ATOM   3695 N  NZ  . LYS B 1 63  ? 20.956  -10.094 47.766 1.00 50.94 ? 168 LYS B NZ  1 
ATOM   3696 N  N   . ASP B 1 64  ? 26.631  -8.864  43.644 1.00 50.77 ? 169 ASP B N   1 
ATOM   3697 C  CA  . ASP B 1 64  ? 27.909  -8.910  44.378 1.00 50.79 ? 169 ASP B CA  1 
ATOM   3698 C  C   . ASP B 1 64  ? 29.107  -9.465  43.595 1.00 50.79 ? 169 ASP B C   1 
ATOM   3699 O  O   . ASP B 1 64  ? 30.196  -9.592  44.154 1.00 50.72 ? 169 ASP B O   1 
ATOM   3700 C  CB  . ASP B 1 64  ? 27.752  -9.683  45.699 1.00 50.74 ? 169 ASP B CB  1 
ATOM   3701 C  CG  . ASP B 1 64  ? 26.645  -9.124  46.585 1.00 50.85 ? 169 ASP B CG  1 
ATOM   3702 O  OD1 . ASP B 1 64  ? 26.076  -8.062  46.251 1.00 51.16 ? 169 ASP B OD1 1 
ATOM   3703 O  OD2 . ASP B 1 64  ? 26.347  -9.750  47.626 1.00 51.19 ? 169 ASP B OD2 1 
ATOM   3704 N  N   . ASP B 1 65  ? 28.916  -9.771  42.312 1.00 50.89 ? 170 ASP B N   1 
ATOM   3705 C  CA  . ASP B 1 65  ? 29.983  -10.312 41.472 1.00 51.00 ? 170 ASP B CA  1 
ATOM   3706 C  C   . ASP B 1 65  ? 30.516  -9.200  40.571 1.00 51.08 ? 170 ASP B C   1 
ATOM   3707 O  O   . ASP B 1 65  ? 29.821  -8.737  39.663 1.00 51.04 ? 170 ASP B O   1 
ATOM   3708 C  CB  . ASP B 1 65  ? 29.465  -11.489 40.636 1.00 50.99 ? 170 ASP B CB  1 
ATOM   3709 C  CG  . ASP B 1 65  ? 30.585  -12.317 40.023 1.00 51.01 ? 170 ASP B CG  1 
ATOM   3710 O  OD1 . ASP B 1 65  ? 31.369  -11.776 39.214 1.00 51.39 ? 170 ASP B OD1 1 
ATOM   3711 O  OD2 . ASP B 1 65  ? 30.672  -13.521 40.340 1.00 51.60 ? 170 ASP B OD2 1 
ATOM   3712 N  N   . VAL B 1 66  ? 31.754  -8.783  40.826 1.00 51.15 ? 171 VAL B N   1 
ATOM   3713 C  CA  . VAL B 1 66  ? 32.360  -7.663  40.105 1.00 51.20 ? 171 VAL B CA  1 
ATOM   3714 C  C   . VAL B 1 66  ? 32.679  -8.061  38.661 1.00 51.23 ? 171 VAL B C   1 
ATOM   3715 O  O   . VAL B 1 66  ? 32.399  -7.306  37.727 1.00 51.32 ? 171 VAL B O   1 
ATOM   3716 C  CB  . VAL B 1 66  ? 33.664  -7.159  40.785 1.00 51.31 ? 171 VAL B CB  1 
ATOM   3717 C  CG1 . VAL B 1 66  ? 34.053  -5.786  40.236 1.00 51.42 ? 171 VAL B CG1 1 
ATOM   3718 C  CG2 . VAL B 1 66  ? 33.513  -7.104  42.310 1.00 51.46 ? 171 VAL B CG2 1 
ATOM   3719 N  N   . ALA B 1 67  ? 33.267  -9.245  38.494 1.00 51.12 ? 172 ALA B N   1 
ATOM   3720 C  CA  . ALA B 1 67  ? 33.648  -9.766  37.179 1.00 51.01 ? 172 ALA B CA  1 
ATOM   3721 C  C   . ALA B 1 67  ? 32.462  -9.850  36.220 1.00 51.00 ? 172 ALA B C   1 
ATOM   3722 O  O   . ALA B 1 67  ? 32.542  -9.392  35.079 1.00 51.11 ? 172 ALA B O   1 
ATOM   3723 C  CB  . ALA B 1 67  ? 34.285  -11.136 37.331 1.00 51.03 ? 172 ALA B CB  1 
ATOM   3724 N  N   . GLN B 1 68  ? 31.362  -10.428 36.695 1.00 50.90 ? 173 GLN B N   1 
ATOM   3725 C  CA  . GLN B 1 68  ? 30.172  -10.638 35.864 1.00 50.80 ? 173 GLN B CA  1 
ATOM   3726 C  C   . GLN B 1 68  ? 29.415  -9.362  35.499 1.00 50.66 ? 173 GLN B C   1 
ATOM   3727 O  O   . GLN B 1 68  ? 28.647  -9.358  34.539 1.00 50.64 ? 173 GLN B O   1 
ATOM   3728 C  CB  . GLN B 1 68  ? 29.210  -11.618 36.545 1.00 50.91 ? 173 GLN B CB  1 
ATOM   3729 C  CG  . GLN B 1 68  ? 29.477  -13.067 36.195 1.00 51.30 ? 173 GLN B CG  1 
ATOM   3730 C  CD  . GLN B 1 68  ? 28.919  -13.439 34.830 1.00 51.79 ? 173 GLN B CD  1 
ATOM   3731 O  OE1 . GLN B 1 68  ? 27.702  -13.513 34.644 1.00 51.75 ? 173 GLN B OE1 1 
ATOM   3732 N  NE2 . GLN B 1 68  ? 29.809  -13.673 33.867 1.00 51.85 ? 173 GLN B NE2 1 
ATOM   3733 N  N   . THR B 1 69  ? 29.622  -8.291  36.261 1.00 50.47 ? 174 THR B N   1 
ATOM   3734 C  CA  . THR B 1 69  ? 28.932  -7.027  36.017 1.00 50.31 ? 174 THR B CA  1 
ATOM   3735 C  C   . THR B 1 69  ? 29.539  -6.293  34.818 1.00 50.16 ? 174 THR B C   1 
ATOM   3736 O  O   . THR B 1 69  ? 30.739  -6.030  34.791 1.00 50.13 ? 174 THR B O   1 
ATOM   3737 C  CB  . THR B 1 69  ? 28.986  -6.128  37.264 1.00 50.24 ? 174 THR B CB  1 
ATOM   3738 O  OG1 . THR B 1 69  ? 28.487  -6.856  38.392 1.00 50.12 ? 174 THR B OG1 1 
ATOM   3739 C  CG2 . THR B 1 69  ? 28.144  -4.876  37.075 1.00 50.46 ? 174 THR B CG2 1 
ATOM   3740 N  N   . ASP B 1 70  ? 28.700  -5.975  33.831 1.00 50.06 ? 175 ASP B N   1 
ATOM   3741 C  CA  . ASP B 1 70  ? 29.120  -5.253  32.624 1.00 50.03 ? 175 ASP B CA  1 
ATOM   3742 C  C   . ASP B 1 70  ? 28.186  -4.068  32.375 1.00 49.89 ? 175 ASP B C   1 
ATOM   3743 O  O   . ASP B 1 70  ? 27.035  -4.250  31.988 1.00 49.77 ? 175 ASP B O   1 
ATOM   3744 C  CB  . ASP B 1 70  ? 29.122  -6.197  31.409 1.00 49.97 ? 175 ASP B CB  1 
ATOM   3745 C  CG  . ASP B 1 70  ? 29.512  -5.497  30.098 1.00 49.95 ? 175 ASP B CG  1 
ATOM   3746 O  OD1 . ASP B 1 70  ? 29.783  -4.277  30.108 1.00 49.82 ? 175 ASP B OD1 1 
ATOM   3747 O  OD2 . ASP B 1 70  ? 29.547  -6.175  29.048 1.00 49.00 ? 175 ASP B OD2 1 
ATOM   3748 N  N   . LEU B 1 71  ? 28.698  -2.856  32.575 1.00 49.87 ? 176 LEU B N   1 
ATOM   3749 C  CA  . LEU B 1 71  ? 27.906  -1.640  32.391 1.00 49.94 ? 176 LEU B CA  1 
ATOM   3750 C  C   . LEU B 1 71  ? 27.694  -1.279  30.923 1.00 49.87 ? 176 LEU B C   1 
ATOM   3751 O  O   . LEU B 1 71  ? 26.896  -0.397  30.626 1.00 49.64 ? 176 LEU B O   1 
ATOM   3752 C  CB  . LEU B 1 71  ? 28.572  -0.450  33.083 1.00 50.01 ? 176 LEU B CB  1 
ATOM   3753 C  CG  . LEU B 1 71  ? 28.963  -0.583  34.556 1.00 50.14 ? 176 LEU B CG  1 
ATOM   3754 C  CD1 . LEU B 1 71  ? 29.595  0.717   35.024 1.00 50.15 ? 176 LEU B CD1 1 
ATOM   3755 C  CD2 . LEU B 1 71  ? 27.769  -0.949  35.419 1.00 50.09 ? 176 LEU B CD2 1 
ATOM   3756 N  N   . LEU B 1 72  ? 28.407  -1.948  30.017 1.00 50.01 ? 177 LEU B N   1 
ATOM   3757 C  CA  . LEU B 1 72  ? 28.346  -1.642  28.583 1.00 50.12 ? 177 LEU B CA  1 
ATOM   3758 C  C   . LEU B 1 72  ? 27.304  -2.448  27.808 1.00 50.16 ? 177 LEU B C   1 
ATOM   3759 O  O   . LEU B 1 72  ? 27.074  -2.170  26.634 1.00 50.16 ? 177 LEU B O   1 
ATOM   3760 C  CB  . LEU B 1 72  ? 29.715  -1.862  27.932 1.00 50.02 ? 177 LEU B CB  1 
ATOM   3761 C  CG  . LEU B 1 72  ? 30.930  -1.285  28.663 1.00 50.20 ? 177 LEU B CG  1 
ATOM   3762 C  CD1 . LEU B 1 72  ? 32.163  -1.426  27.794 1.00 50.26 ? 177 LEU B CD1 1 
ATOM   3763 C  CD2 . LEU B 1 72  ? 30.718  0.171   29.058 1.00 50.16 ? 177 LEU B CD2 1 
ATOM   3764 N  N   . GLN B 1 73  ? 26.690  -3.443  28.448 1.00 50.31 ? 178 GLN B N   1 
ATOM   3765 C  CA  . GLN B 1 73  ? 25.714  -4.312  27.779 1.00 50.43 ? 178 GLN B CA  1 
ATOM   3766 C  C   . GLN B 1 73  ? 24.362  -4.301  28.488 1.00 50.41 ? 178 GLN B C   1 
ATOM   3767 O  O   . GLN B 1 73  ? 24.298  -4.379  29.716 1.00 50.35 ? 178 GLN B O   1 
ATOM   3768 C  CB  . GLN B 1 73  ? 26.238  -5.748  27.698 1.00 50.47 ? 178 GLN B CB  1 
ATOM   3769 C  CG  . GLN B 1 73  ? 27.303  -5.965  26.640 1.00 50.63 ? 178 GLN B CG  1 
ATOM   3770 C  CD  . GLN B 1 73  ? 27.693  -7.425  26.506 1.00 50.82 ? 178 GLN B CD  1 
ATOM   3771 O  OE1 . GLN B 1 73  ? 26.996  -8.210  25.867 1.00 51.44 ? 178 GLN B OE1 1 
ATOM   3772 N  NE2 . GLN B 1 73  ? 28.816  -7.793  27.107 1.00 51.66 ? 178 GLN B NE2 1 
ATOM   3773 N  N   . ILE B 1 74  ? 23.291  -4.228  27.695 1.00 50.42 ? 179 ILE B N   1 
ATOM   3774 C  CA  . ILE B 1 74  ? 21.917  -4.164  28.210 1.00 50.42 ? 179 ILE B CA  1 
ATOM   3775 C  C   . ILE B 1 74  ? 21.417  -5.557  28.606 1.00 50.44 ? 179 ILE B C   1 
ATOM   3776 O  O   . ILE B 1 74  ? 21.636  -6.536  27.885 1.00 50.39 ? 179 ILE B O   1 
ATOM   3777 C  CB  . ILE B 1 74  ? 20.942  -3.560  27.158 1.00 50.38 ? 179 ILE B CB  1 
ATOM   3778 C  CG1 . ILE B 1 74  ? 21.359  -2.130  26.793 1.00 50.40 ? 179 ILE B CG1 1 
ATOM   3779 C  CG2 . ILE B 1 74  ? 19.497  -3.582  27.671 1.00 50.27 ? 179 ILE B CG2 1 
ATOM   3780 C  CD1 . ILE B 1 74  ? 20.690  -1.596  25.545 1.00 50.40 ? 179 ILE B CD1 1 
ATOM   3781 N  N   . ASP B 1 75  ? 20.736  -5.629  29.746 1.00 50.40 ? 180 ASP B N   1 
ATOM   3782 C  CA  . ASP B 1 75  ? 20.130  -6.872  30.217 1.00 50.41 ? 180 ASP B CA  1 
ATOM   3783 C  C   . ASP B 1 75  ? 18.983  -7.276  29.275 1.00 50.39 ? 180 ASP B C   1 
ATOM   3784 O  O   . ASP B 1 75  ? 18.113  -6.454  28.977 1.00 50.19 ? 180 ASP B O   1 
ATOM   3785 C  CB  . ASP B 1 75  ? 19.606  -6.686  31.648 1.00 50.49 ? 180 ASP B CB  1 
ATOM   3786 C  CG  . ASP B 1 75  ? 19.431  -7.996  32.388 1.00 50.44 ? 180 ASP B CG  1 
ATOM   3787 O  OD1 . ASP B 1 75  ? 20.387  -8.421  33.066 1.00 50.20 ? 180 ASP B OD1 1 
ATOM   3788 O  OD2 . ASP B 1 75  ? 18.340  -8.595  32.297 1.00 50.74 ? 180 ASP B OD2 1 
ATOM   3789 N  N   . PRO B 1 76  ? 18.980  -8.536  28.791 1.00 50.43 ? 181 PRO B N   1 
ATOM   3790 C  CA  . PRO B 1 76  ? 17.925  -9.006  27.877 1.00 50.44 ? 181 PRO B CA  1 
ATOM   3791 C  C   . PRO B 1 76  ? 16.479  -8.797  28.359 1.00 50.47 ? 181 PRO B C   1 
ATOM   3792 O  O   . PRO B 1 76  ? 15.579  -8.694  27.527 1.00 50.45 ? 181 PRO B O   1 
ATOM   3793 C  CB  . PRO B 1 76  ? 18.225  -10.501 27.737 1.00 50.43 ? 181 PRO B CB  1 
ATOM   3794 C  CG  . PRO B 1 76  ? 19.667  -10.625 28.019 1.00 50.40 ? 181 PRO B CG  1 
ATOM   3795 C  CD  . PRO B 1 76  ? 19.981  -9.589  29.050 1.00 50.37 ? 181 PRO B CD  1 
ATOM   3796 N  N   . ASN B 1 77  ? 16.259  -8.749  29.674 1.00 50.57 ? 182 ASN B N   1 
ATOM   3797 C  CA  . ASN B 1 77  ? 14.922  -8.490  30.239 1.00 50.62 ? 182 ASN B CA  1 
ATOM   3798 C  C   . ASN B 1 77  ? 14.312  -7.155  29.808 1.00 50.66 ? 182 ASN B C   1 
ATOM   3799 O  O   . ASN B 1 77  ? 13.098  -7.062  29.625 1.00 50.85 ? 182 ASN B O   1 
ATOM   3800 C  CB  . ASN B 1 77  ? 14.952  -8.543  31.778 1.00 50.68 ? 182 ASN B CB  1 
ATOM   3801 C  CG  . ASN B 1 77  ? 14.938  -9.963  32.321 1.00 50.90 ? 182 ASN B CG  1 
ATOM   3802 O  OD1 . ASN B 1 77  ? 14.102  -10.782 31.937 1.00 51.08 ? 182 ASN B OD1 1 
ATOM   3803 N  ND2 . ASN B 1 77  ? 15.860  -10.256 33.231 1.00 51.32 ? 182 ASN B ND2 1 
ATOM   3804 N  N   . PHE B 1 78  ? 15.152  -6.133  29.656 1.00 50.62 ? 183 PHE B N   1 
ATOM   3805 C  CA  . PHE B 1 78  ? 14.688  -4.775  29.361 1.00 50.54 ? 183 PHE B CA  1 
ATOM   3806 C  C   . PHE B 1 78  ? 14.600  -4.476  27.865 1.00 50.50 ? 183 PHE B C   1 
ATOM   3807 O  O   . PHE B 1 78  ? 13.906  -3.540  27.463 1.00 50.50 ? 183 PHE B O   1 
ATOM   3808 C  CB  . PHE B 1 78  ? 15.605  -3.748  30.031 1.00 50.67 ? 183 PHE B CB  1 
ATOM   3809 C  CG  . PHE B 1 78  ? 15.703  -3.905  31.524 1.00 50.69 ? 183 PHE B CG  1 
ATOM   3810 C  CD1 . PHE B 1 78  ? 16.915  -4.205  32.128 1.00 51.07 ? 183 PHE B CD1 1 
ATOM   3811 C  CD2 . PHE B 1 78  ? 14.582  -3.757  32.327 1.00 50.94 ? 183 PHE B CD2 1 
ATOM   3812 C  CE1 . PHE B 1 78  ? 17.008  -4.354  33.514 1.00 51.14 ? 183 PHE B CE1 1 
ATOM   3813 C  CE2 . PHE B 1 78  ? 14.667  -3.904  33.707 1.00 50.98 ? 183 PHE B CE2 1 
ATOM   3814 C  CZ  . PHE B 1 78  ? 15.881  -4.202  34.301 1.00 50.89 ? 183 PHE B CZ  1 
ATOM   3815 N  N   . GLY B 1 79  ? 15.307  -5.256  27.049 1.00 50.38 ? 184 GLY B N   1 
ATOM   3816 C  CA  . GLY B 1 79  ? 15.295  -5.073  25.599 1.00 50.35 ? 184 GLY B CA  1 
ATOM   3817 C  C   . GLY B 1 79  ? 16.652  -5.284  24.956 1.00 50.26 ? 184 GLY B C   1 
ATOM   3818 O  O   . GLY B 1 79  ? 17.521  -5.945  25.518 1.00 50.16 ? 184 GLY B O   1 
ATOM   3819 N  N   . SER B 1 80  ? 16.822  -4.722  23.763 1.00 50.33 ? 185 SER B N   1 
ATOM   3820 C  CA  . SER B 1 80  ? 18.080  -4.804  23.026 1.00 50.41 ? 185 SER B CA  1 
ATOM   3821 C  C   . SER B 1 80  ? 18.618  -3.406  22.747 1.00 50.47 ? 185 SER B C   1 
ATOM   3822 O  O   . SER B 1 80  ? 17.955  -2.407  23.033 1.00 50.39 ? 185 SER B O   1 
ATOM   3823 C  CB  . SER B 1 80  ? 17.874  -5.545  21.709 1.00 50.30 ? 185 SER B CB  1 
ATOM   3824 O  OG  . SER B 1 80  ? 17.212  -4.722  20.765 1.00 50.33 ? 185 SER B OG  1 
ATOM   3825 N  N   . LYS B 1 81  ? 19.817  -3.348  22.169 1.00 50.63 ? 186 LYS B N   1 
ATOM   3826 C  CA  . LYS B 1 81  ? 20.491  -2.073  21.888 1.00 50.70 ? 186 LYS B CA  1 
ATOM   3827 C  C   . LYS B 1 81  ? 19.795  -1.323  20.754 1.00 50.75 ? 186 LYS B C   1 
ATOM   3828 O  O   . LYS B 1 81  ? 19.803  -0.093  20.717 1.00 50.70 ? 186 LYS B O   1 
ATOM   3829 C  CB  . LYS B 1 81  ? 21.966  -2.308  21.541 1.00 50.76 ? 186 LYS B CB  1 
ATOM   3830 C  CG  . LYS B 1 81  ? 22.932  -1.286  22.131 1.00 50.92 ? 186 LYS B CG  1 
ATOM   3831 C  CD  . LYS B 1 81  ? 22.875  0.056   21.423 1.00 51.23 ? 186 LYS B CD  1 
ATOM   3832 C  CE  . LYS B 1 81  ? 24.086  0.911   21.784 1.00 51.39 ? 186 LYS B CE  1 
ATOM   3833 N  NZ  . LYS B 1 81  ? 24.088  2.232   21.093 1.00 51.47 ? 186 LYS B NZ  1 
ATOM   3834 N  N   . GLU B 1 82  ? 19.180  -2.071  19.842 1.00 50.78 ? 187 GLU B N   1 
ATOM   3835 C  CA  . GLU B 1 82  ? 18.457  -1.487  18.717 1.00 50.75 ? 187 GLU B CA  1 
ATOM   3836 C  C   . GLU B 1 82  ? 17.159  -0.849  19.204 1.00 50.73 ? 187 GLU B C   1 
ATOM   3837 O  O   . GLU B 1 82  ? 16.761  0.208   18.719 1.00 50.84 ? 187 GLU B O   1 
ATOM   3838 C  CB  . GLU B 1 82  ? 18.163  -2.546  17.657 1.00 50.76 ? 187 GLU B CB  1 
ATOM   3839 C  CG  . GLU B 1 82  ? 19.415  -3.208  17.068 1.00 51.31 ? 187 GLU B CG  1 
ATOM   3840 C  CD  . GLU B 1 82  ? 19.990  -4.351  17.919 1.00 51.83 ? 187 GLU B CD  1 
ATOM   3841 O  OE1 . GLU B 1 82  ? 19.373  -4.742  18.937 1.00 52.02 ? 187 GLU B OE1 1 
ATOM   3842 O  OE2 . GLU B 1 82  ? 21.073  -4.863  17.560 1.00 52.01 ? 187 GLU B OE2 1 
ATOM   3843 N  N   . ASP B 1 83  ? 16.504  -1.494  20.166 1.00 50.64 ? 188 ASP B N   1 
ATOM   3844 C  CA  . ASP B 1 83  ? 15.325  -0.920  20.811 1.00 50.62 ? 188 ASP B CA  1 
ATOM   3845 C  C   . ASP B 1 83  ? 15.683  0.405   21.469 1.00 50.50 ? 188 ASP B C   1 
ATOM   3846 O  O   . ASP B 1 83  ? 15.035  1.424   21.225 1.00 50.40 ? 188 ASP B O   1 
ATOM   3847 C  CB  . ASP B 1 83  ? 14.759  -1.878  21.869 1.00 50.71 ? 188 ASP B CB  1 
ATOM   3848 C  CG  . ASP B 1 83  ? 14.176  -3.150  21.265 1.00 50.96 ? 188 ASP B CG  1 
ATOM   3849 O  OD1 . ASP B 1 83  ? 13.608  -3.090  20.152 1.00 50.99 ? 188 ASP B OD1 1 
ATOM   3850 O  OD2 . ASP B 1 83  ? 14.278  -4.213  21.915 1.00 51.38 ? 188 ASP B OD2 1 
ATOM   3851 N  N   . PHE B 1 84  ? 16.724  0.373   22.300 1.00 50.41 ? 189 PHE B N   1 
ATOM   3852 C  CA  . PHE B 1 84  ? 17.248  1.566   22.974 1.00 50.35 ? 189 PHE B CA  1 
ATOM   3853 C  C   . PHE B 1 84  ? 17.483  2.718   21.986 1.00 50.24 ? 189 PHE B C   1 
ATOM   3854 O  O   . PHE B 1 84  ? 16.993  3.826   22.202 1.00 50.05 ? 189 PHE B O   1 
ATOM   3855 C  CB  . PHE B 1 84  ? 18.543  1.215   23.723 1.00 50.24 ? 189 PHE B CB  1 
ATOM   3856 C  CG  . PHE B 1 84  ? 19.044  2.304   24.640 1.00 50.36 ? 189 PHE B CG  1 
ATOM   3857 C  CD1 . PHE B 1 84  ? 18.463  2.507   25.885 1.00 50.38 ? 189 PHE B CD1 1 
ATOM   3858 C  CD2 . PHE B 1 84  ? 20.113  3.112   24.266 1.00 50.31 ? 189 PHE B CD2 1 
ATOM   3859 C  CE1 . PHE B 1 84  ? 18.929  3.501   26.735 1.00 50.06 ? 189 PHE B CE1 1 
ATOM   3860 C  CE2 . PHE B 1 84  ? 20.583  4.109   25.112 1.00 50.09 ? 189 PHE B CE2 1 
ATOM   3861 C  CZ  . PHE B 1 84  ? 19.991  4.303   26.345 1.00 50.09 ? 189 PHE B CZ  1 
ATOM   3862 N  N   . ASP B 1 85  ? 18.208  2.442   20.899 1.00 50.30 ? 190 ASP B N   1 
ATOM   3863 C  CA  . ASP B 1 85  ? 18.488  3.443   19.852 1.00 50.43 ? 190 ASP B CA  1 
ATOM   3864 C  C   . ASP B 1 85  ? 17.217  4.128   19.330 1.00 50.46 ? 190 ASP B C   1 
ATOM   3865 O  O   . ASP B 1 85  ? 17.184  5.349   19.163 1.00 50.33 ? 190 ASP B O   1 
ATOM   3866 C  CB  . ASP B 1 85  ? 19.219  2.799   18.661 1.00 50.47 ? 190 ASP B CB  1 
ATOM   3867 C  CG  . ASP B 1 85  ? 20.656  2.386   18.984 1.00 50.81 ? 190 ASP B CG  1 
ATOM   3868 O  OD1 . ASP B 1 85  ? 21.251  2.913   19.953 1.00 51.21 ? 190 ASP B OD1 1 
ATOM   3869 O  OD2 . ASP B 1 85  ? 21.193  1.526   18.247 1.00 50.74 ? 190 ASP B OD2 1 
ATOM   3870 N  N   . SER B 1 86  ? 16.183  3.329   19.070 1.00 50.57 ? 191 SER B N   1 
ATOM   3871 C  CA  . SER B 1 86  ? 14.900  3.832   18.579 1.00 50.57 ? 191 SER B CA  1 
ATOM   3872 C  C   . SER B 1 86  ? 14.168  4.695   19.610 1.00 50.59 ? 191 SER B C   1 
ATOM   3873 O  O   . SER B 1 86  ? 13.424  5.605   19.241 1.00 50.54 ? 191 SER B O   1 
ATOM   3874 C  CB  . SER B 1 86  ? 14.007  2.665   18.160 1.00 50.61 ? 191 SER B CB  1 
ATOM   3875 O  OG  . SER B 1 86  ? 12.738  3.124   17.728 1.00 51.12 ? 191 SER B OG  1 
ATOM   3876 N  N   . LEU B 1 87  ? 14.374  4.404   20.893 1.00 50.60 ? 192 LEU B N   1 
ATOM   3877 C  CA  . LEU B 1 87  ? 13.806  5.218   21.965 1.00 50.60 ? 192 LEU B CA  1 
ATOM   3878 C  C   . LEU B 1 87  ? 14.411  6.619   21.974 1.00 50.61 ? 192 LEU B C   1 
ATOM   3879 O  O   . LEU B 1 87  ? 13.689  7.610   22.122 1.00 50.67 ? 192 LEU B O   1 
ATOM   3880 C  CB  . LEU B 1 87  ? 14.029  4.554   23.327 1.00 50.67 ? 192 LEU B CB  1 
ATOM   3881 C  CG  . LEU B 1 87  ? 13.501  5.284   24.568 1.00 50.62 ? 192 LEU B CG  1 
ATOM   3882 C  CD1 . LEU B 1 87  ? 11.987  5.450   24.497 1.00 50.66 ? 192 LEU B CD1 1 
ATOM   3883 C  CD2 . LEU B 1 87  ? 13.905  4.537   25.838 1.00 50.60 ? 192 LEU B CD2 1 
ATOM   3884 N  N   . LEU B 1 88  ? 15.733  6.688   21.818 1.00 50.60 ? 193 LEU B N   1 
ATOM   3885 C  CA  . LEU B 1 88  ? 16.464  7.961   21.826 1.00 50.51 ? 193 LEU B CA  1 
ATOM   3886 C  C   . LEU B 1 88  ? 16.158  8.837   20.617 1.00 50.43 ? 193 LEU B C   1 
ATOM   3887 O  O   . LEU B 1 88  ? 16.112  10.062  20.737 1.00 50.42 ? 193 LEU B O   1 
ATOM   3888 C  CB  . LEU B 1 88  ? 17.974  7.718   21.895 1.00 50.55 ? 193 LEU B CB  1 
ATOM   3889 C  CG  . LEU B 1 88  ? 18.512  7.264   23.250 1.00 50.59 ? 193 LEU B CG  1 
ATOM   3890 C  CD1 . LEU B 1 88  ? 19.981  6.887   23.128 1.00 50.73 ? 193 LEU B CD1 1 
ATOM   3891 C  CD2 . LEU B 1 88  ? 18.312  8.350   24.297 1.00 50.70 ? 193 LEU B CD2 1 
ATOM   3892 N  N   . GLN B 1 89  ? 15.964  8.217   19.457 1.00 50.35 ? 194 GLN B N   1 
ATOM   3893 C  CA  . GLN B 1 89  ? 15.575  8.958   18.257 1.00 50.36 ? 194 GLN B CA  1 
ATOM   3894 C  C   . GLN B 1 89  ? 14.231  9.655   18.488 1.00 50.26 ? 194 GLN B C   1 
ATOM   3895 O  O   . GLN B 1 89  ? 14.085  10.851  18.226 1.00 50.18 ? 194 GLN B O   1 
ATOM   3896 C  CB  . GLN B 1 89  ? 15.494  8.022   17.048 1.00 50.29 ? 194 GLN B CB  1 
ATOM   3897 C  CG  . GLN B 1 89  ? 15.359  8.737   15.709 1.00 50.31 ? 194 GLN B CG  1 
ATOM   3898 C  CD  . GLN B 1 89  ? 15.353  7.782   14.517 1.00 50.48 ? 194 GLN B CD  1 
ATOM   3899 O  OE1 . GLN B 1 89  ? 15.511  8.206   13.371 1.00 50.75 ? 194 GLN B OE1 1 
ATOM   3900 N  NE2 . GLN B 1 89  ? 15.167  6.492   14.783 1.00 50.04 ? 194 GLN B NE2 1 
ATOM   3901 N  N   . SER B 1 90  ? 13.265  8.899   19.002 1.00 50.18 ? 195 SER B N   1 
ATOM   3902 C  CA  . SER B 1 90  ? 11.933  9.423   19.293 1.00 50.24 ? 195 SER B CA  1 
ATOM   3903 C  C   . SER B 1 90  ? 11.949  10.461  20.413 1.00 50.24 ? 195 SER B C   1 
ATOM   3904 O  O   . SER B 1 90  ? 11.213  11.448  20.362 1.00 50.23 ? 195 SER B O   1 
ATOM   3905 C  CB  . SER B 1 90  ? 10.996  8.279   19.675 1.00 50.21 ? 195 SER B CB  1 
ATOM   3906 O  OG  . SER B 1 90  ? 10.962  7.303   18.649 1.00 50.57 ? 195 SER B OG  1 
ATOM   3907 N  N   . ALA B 1 91  ? 12.781  10.226  21.424 1.00 50.18 ? 196 ALA B N   1 
ATOM   3908 C  CA  . ALA B 1 91  ? 12.915  11.150  22.544 1.00 50.26 ? 196 ALA B CA  1 
ATOM   3909 C  C   . ALA B 1 91  ? 13.396  12.537  22.105 1.00 50.21 ? 196 ALA B C   1 
ATOM   3910 O  O   . ALA B 1 91  ? 12.846  13.555  22.533 1.00 49.92 ? 196 ALA B O   1 
ATOM   3911 C  CB  . ALA B 1 91  ? 13.861  10.568  23.592 1.00 50.31 ? 196 ALA B CB  1 
ATOM   3912 N  N   . LYS B 1 92  ? 14.423  12.570  21.258 1.00 50.35 ? 197 LYS B N   1 
ATOM   3913 C  CA  . LYS B 1 92  ? 14.986  13.834  20.776 1.00 50.51 ? 197 LYS B CA  1 
ATOM   3914 C  C   . LYS B 1 92  ? 13.980  14.592  19.918 1.00 50.48 ? 197 LYS B C   1 
ATOM   3915 O  O   . LYS B 1 92  ? 13.802  15.802  20.084 1.00 50.39 ? 197 LYS B O   1 
ATOM   3916 C  CB  . LYS B 1 92  ? 16.276  13.601  19.979 1.00 50.67 ? 197 LYS B CB  1 
ATOM   3917 C  CG  . LYS B 1 92  ? 17.487  13.226  20.830 1.00 50.87 ? 197 LYS B CG  1 
ATOM   3918 C  CD  . LYS B 1 92  ? 18.786  13.521  20.092 1.00 50.86 ? 197 LYS B CD  1 
ATOM   3919 C  CE  . LYS B 1 92  ? 19.991  12.966  20.832 1.00 51.26 ? 197 LYS B CE  1 
ATOM   3920 N  NZ  . LYS B 1 92  ? 20.044  11.475  20.759 1.00 51.81 ? 197 LYS B NZ  1 
ATOM   3921 N  N   . LYS B 1 93  ? 13.316  13.869  19.017 1.00 50.42 ? 198 LYS B N   1 
ATOM   3922 C  CA  . LYS B 1 93  ? 12.302  14.446  18.130 1.00 50.34 ? 198 LYS B CA  1 
ATOM   3923 C  C   . LYS B 1 93  ? 11.111  15.047  18.895 1.00 50.19 ? 198 LYS B C   1 
ATOM   3924 O  O   . LYS B 1 93  ? 10.440  15.944  18.391 1.00 50.30 ? 198 LYS B O   1 
ATOM   3925 C  CB  . LYS B 1 93  ? 11.814  13.386  17.138 1.00 50.37 ? 198 LYS B CB  1 
ATOM   3926 C  CG  . LYS B 1 93  ? 10.970  13.926  15.995 1.00 50.53 ? 198 LYS B CG  1 
ATOM   3927 C  CD  . LYS B 1 93  ? 10.903  12.927  14.836 1.00 50.76 ? 198 LYS B CD  1 
ATOM   3928 C  CE  . LYS B 1 93  ? 9.901   13.357  13.760 1.00 50.96 ? 198 LYS B CE  1 
ATOM   3929 N  NZ  . LYS B 1 93  ? 8.485   13.247  14.226 1.00 50.77 ? 198 LYS B NZ  1 
ATOM   3930 N  N   . LYS B 1 94  ? 10.857  14.558  20.106 1.00 49.96 ? 199 LYS B N   1 
ATOM   3931 C  CA  . LYS B 1 94  ? 9.808   15.110  20.968 1.00 49.85 ? 199 LYS B CA  1 
ATOM   3932 C  C   . LYS B 1 94  ? 10.365  16.064  22.029 1.00 49.69 ? 199 LYS B C   1 
ATOM   3933 O  O   . LYS B 1 94  ? 9.634   16.510  22.909 1.00 49.47 ? 199 LYS B O   1 
ATOM   3934 C  CB  . LYS B 1 94  ? 9.030   13.971  21.629 1.00 49.82 ? 199 LYS B CB  1 
ATOM   3935 C  CG  . LYS B 1 94  ? 8.290   13.095  20.623 1.00 49.82 ? 199 LYS B CG  1 
ATOM   3936 C  CD  . LYS B 1 94  ? 7.693   11.865  21.277 1.00 49.71 ? 199 LYS B CD  1 
ATOM   3937 C  CE  . LYS B 1 94  ? 6.829   11.086  20.304 1.00 49.25 ? 199 LYS B CE  1 
ATOM   3938 N  NZ  . LYS B 1 94  ? 5.637   11.863  19.888 1.00 48.73 ? 199 LYS B NZ  1 
ATOM   3939 N  N   . SER B 1 95  ? 11.657  16.372  21.930 1.00 49.74 ? 200 SER B N   1 
ATOM   3940 C  CA  . SER B 1 95  ? 12.344  17.295  22.843 1.00 49.72 ? 200 SER B CA  1 
ATOM   3941 C  C   . SER B 1 95  ? 12.341  16.844  24.308 1.00 49.72 ? 200 SER B C   1 
ATOM   3942 O  O   . SER B 1 95  ? 12.137  17.653  25.212 1.00 49.80 ? 200 SER B O   1 
ATOM   3943 C  CB  . SER B 1 95  ? 11.768  18.710  22.712 1.00 49.65 ? 200 SER B CB  1 
ATOM   3944 O  OG  . SER B 1 95  ? 11.786  19.135  21.361 1.00 49.35 ? 200 SER B OG  1 
ATOM   3945 N  N   . ILE B 1 96  ? 12.575  15.550  24.522 1.00 49.78 ? 201 ILE B N   1 
ATOM   3946 C  CA  . ILE B 1 96  ? 12.752  14.974  25.860 1.00 49.74 ? 201 ILE B CA  1 
ATOM   3947 C  C   . ILE B 1 96  ? 14.182  14.452  25.966 1.00 49.60 ? 201 ILE B C   1 
ATOM   3948 O  O   . ILE B 1 96  ? 14.687  13.830  25.032 1.00 49.76 ? 201 ILE B O   1 
ATOM   3949 C  CB  . ILE B 1 96  ? 11.806  13.777  26.113 1.00 49.94 ? 201 ILE B CB  1 
ATOM   3950 C  CG1 . ILE B 1 96  ? 10.345  14.137  25.797 1.00 50.50 ? 201 ILE B CG1 1 
ATOM   3951 C  CG2 . ILE B 1 96  ? 11.958  13.258  27.555 1.00 49.81 ? 201 ILE B CG2 1 
ATOM   3952 C  CD1 . ILE B 1 96  ? 9.629   14.910  26.896 1.00 51.15 ? 201 ILE B CD1 1 
ATOM   3953 N  N   . ARG B 1 97  ? 14.823  14.692  27.104 1.00 49.41 ? 202 ARG B N   1 
ATOM   3954 C  CA  . ARG B 1 97  ? 16.191  14.236  27.340 1.00 49.24 ? 202 ARG B CA  1 
ATOM   3955 C  C   . ARG B 1 97  ? 16.198  12.963  28.182 1.00 49.11 ? 202 ARG B C   1 
ATOM   3956 O  O   . ARG B 1 97  ? 15.301  12.735  28.988 1.00 49.18 ? 202 ARG B O   1 
ATOM   3957 C  CB  . ARG B 1 97  ? 16.992  15.336  28.028 1.00 49.26 ? 202 ARG B CB  1 
ATOM   3958 C  CG  . ARG B 1 97  ? 16.992  16.654  27.267 1.00 49.17 ? 202 ARG B CG  1 
ATOM   3959 C  CD  . ARG B 1 97  ? 18.046  16.702  26.184 1.00 49.51 ? 202 ARG B CD  1 
ATOM   3960 N  NE  . ARG B 1 97  ? 18.175  18.052  25.641 1.00 50.01 ? 202 ARG B NE  1 
ATOM   3961 C  CZ  . ARG B 1 97  ? 19.092  18.435  24.749 1.00 50.73 ? 202 ARG B CZ  1 
ATOM   3962 N  NH1 . ARG B 1 97  ? 19.987  17.575  24.269 1.00 50.71 ? 202 ARG B NH1 1 
ATOM   3963 N  NH2 . ARG B 1 97  ? 19.116  19.695  24.330 1.00 50.82 ? 202 ARG B NH2 1 
ATOM   3964 N  N   . VAL B 1 98  ? 17.216  12.131  27.997 1.00 48.96 ? 203 VAL B N   1 
ATOM   3965 C  CA  . VAL B 1 98  ? 17.278  10.841  28.681 1.00 48.78 ? 203 VAL B CA  1 
ATOM   3966 C  C   . VAL B 1 98  ? 18.515  10.742  29.565 1.00 48.52 ? 203 VAL B C   1 
ATOM   3967 O  O   . VAL B 1 98  ? 19.615  11.093  29.150 1.00 48.75 ? 203 VAL B O   1 
ATOM   3968 C  CB  . VAL B 1 98  ? 17.259  9.685   27.670 1.00 48.73 ? 203 VAL B CB  1 
ATOM   3969 C  CG1 . VAL B 1 98  ? 17.190  8.340   28.386 1.00 48.93 ? 203 VAL B CG1 1 
ATOM   3970 C  CG2 . VAL B 1 98  ? 16.080  9.849   26.731 1.00 48.95 ? 203 VAL B CG2 1 
ATOM   3971 N  N   . ILE B 1 99  ? 18.317  10.269  30.789 1.00 48.27 ? 204 ILE B N   1 
ATOM   3972 C  CA  . ILE B 1 99  ? 19.407  10.049  31.729 1.00 48.20 ? 204 ILE B CA  1 
ATOM   3973 C  C   . ILE B 1 99  ? 19.444  8.569   32.100 1.00 47.94 ? 204 ILE B C   1 
ATOM   3974 O  O   . ILE B 1 99  ? 18.412  7.985   32.434 1.00 47.81 ? 204 ILE B O   1 
ATOM   3975 C  CB  . ILE B 1 99  ? 19.240  10.926  32.992 1.00 48.15 ? 204 ILE B CB  1 
ATOM   3976 C  CG1 . ILE B 1 99  ? 19.482  12.394  32.641 1.00 48.43 ? 204 ILE B CG1 1 
ATOM   3977 C  CG2 . ILE B 1 99  ? 20.205  10.492  34.097 1.00 48.19 ? 204 ILE B CG2 1 
ATOM   3978 C  CD1 . ILE B 1 99  ? 18.894  13.364  33.640 1.00 48.54 ? 204 ILE B CD1 1 
ATOM   3979 N  N   . LEU B 1 100 ? 20.634  7.975   32.027 1.00 47.77 ? 205 LEU B N   1 
ATOM   3980 C  CA  . LEU B 1 100 ? 20.839  6.569   32.363 1.00 47.65 ? 205 LEU B CA  1 
ATOM   3981 C  C   . LEU B 1 100 ? 21.419  6.451   33.770 1.00 47.53 ? 205 LEU B C   1 
ATOM   3982 O  O   . LEU B 1 100 ? 22.482  7.001   34.047 1.00 47.59 ? 205 LEU B O   1 
ATOM   3983 C  CB  . LEU B 1 100 ? 21.793  5.929   31.351 1.00 47.59 ? 205 LEU B CB  1 
ATOM   3984 C  CG  . LEU B 1 100 ? 22.078  4.432   31.527 1.00 47.75 ? 205 LEU B CG  1 
ATOM   3985 C  CD1 . LEU B 1 100 ? 20.860  3.607   31.165 1.00 47.75 ? 205 LEU B CD1 1 
ATOM   3986 C  CD2 . LEU B 1 100 ? 23.278  4.009   30.694 1.00 47.74 ? 205 LEU B CD2 1 
ATOM   3987 N  N   . ASP B 1 101 ? 20.728  5.739   34.657 1.00 47.40 ? 206 ASP B N   1 
ATOM   3988 C  CA  . ASP B 1 101 ? 21.257  5.475   35.992 1.00 47.36 ? 206 ASP B CA  1 
ATOM   3989 C  C   . ASP B 1 101 ? 22.289  4.345   35.895 1.00 47.33 ? 206 ASP B C   1 
ATOM   3990 O  O   . ASP B 1 101 ? 21.949  3.227   35.525 1.00 47.59 ? 206 ASP B O   1 
ATOM   3991 C  CB  . ASP B 1 101 ? 20.123  5.104   36.955 1.00 47.44 ? 206 ASP B CB  1 
ATOM   3992 C  CG  . ASP B 1 101 ? 20.598  4.947   38.400 1.00 47.62 ? 206 ASP B CG  1 
ATOM   3993 O  OD1 . ASP B 1 101 ? 21.572  4.203   38.628 1.00 48.67 ? 206 ASP B OD1 1 
ATOM   3994 O  OD2 . ASP B 1 101 ? 19.996  5.556   39.313 1.00 47.39 ? 206 ASP B OD2 1 
ATOM   3995 N  N   . LEU B 1 102 ? 23.546  4.642   36.221 1.00 47.21 ? 207 LEU B N   1 
ATOM   3996 C  CA  . LEU B 1 102 ? 24.642  3.667   36.111 1.00 46.97 ? 207 LEU B CA  1 
ATOM   3997 C  C   . LEU B 1 102 ? 25.093  3.084   37.459 1.00 46.86 ? 207 LEU B C   1 
ATOM   3998 O  O   . LEU B 1 102 ? 26.216  2.583   37.562 1.00 46.65 ? 207 LEU B O   1 
ATOM   3999 C  CB  . LEU B 1 102 ? 25.858  4.304   35.417 1.00 46.98 ? 207 LEU B CB  1 
ATOM   4000 C  CG  . LEU B 1 102 ? 25.857  4.511   33.902 1.00 46.61 ? 207 LEU B CG  1 
ATOM   4001 C  CD1 . LEU B 1 102 ? 27.086  5.313   33.508 1.00 46.43 ? 207 LEU B CD1 1 
ATOM   4002 C  CD2 . LEU B 1 102 ? 25.830  3.194   33.160 1.00 46.52 ? 207 LEU B CD2 1 
ATOM   4003 N  N   . THR B 1 103 ? 24.234  3.137   38.479 1.00 46.72 ? 208 THR B N   1 
ATOM   4004 C  CA  . THR B 1 103 ? 24.551  2.554   39.787 1.00 46.70 ? 208 THR B CA  1 
ATOM   4005 C  C   . THR B 1 103 ? 24.879  1.057   39.621 1.00 46.65 ? 208 THR B C   1 
ATOM   4006 O  O   . THR B 1 103 ? 23.986  0.277   39.305 1.00 46.75 ? 208 THR B O   1 
ATOM   4007 C  CB  . THR B 1 103 ? 23.377  2.725   40.776 1.00 46.74 ? 208 THR B CB  1 
ATOM   4008 O  OG1 . THR B 1 103 ? 22.953  4.095   40.797 1.00 46.69 ? 208 THR B OG1 1 
ATOM   4009 C  CG2 . THR B 1 103 ? 23.786  2.307   42.181 1.00 46.78 ? 208 THR B CG2 1 
ATOM   4010 N  N   . PRO B 1 104 ? 26.154  0.654   39.833 1.00 46.65 ? 209 PRO B N   1 
ATOM   4011 C  CA  . PRO B 1 104 ? 26.641  -0.661  39.349 1.00 46.68 ? 209 PRO B CA  1 
ATOM   4012 C  C   . PRO B 1 104 ? 26.020  -1.925  39.979 1.00 46.69 ? 209 PRO B C   1 
ATOM   4013 O  O   . PRO B 1 104 ? 25.386  -2.703  39.264 1.00 46.65 ? 209 PRO B O   1 
ATOM   4014 C  CB  . PRO B 1 104 ? 28.159  -0.608  39.615 1.00 46.54 ? 209 PRO B CB  1 
ATOM   4015 C  CG  . PRO B 1 104 ? 28.466  0.784   40.014 1.00 46.50 ? 209 PRO B CG  1 
ATOM   4016 C  CD  . PRO B 1 104 ? 27.215  1.394   40.541 1.00 46.60 ? 209 PRO B CD  1 
ATOM   4017 N  N   . ASN B 1 105 ? 26.211  -2.141  41.280 1.00 46.80 ? 210 ASN B N   1 
ATOM   4018 C  CA  . ASN B 1 105 ? 25.678  -3.332  41.959 1.00 46.97 ? 210 ASN B CA  1 
ATOM   4019 C  C   . ASN B 1 105 ? 24.272  -3.047  42.477 1.00 47.09 ? 210 ASN B C   1 
ATOM   4020 O  O   . ASN B 1 105 ? 24.007  -3.107  43.678 1.00 46.92 ? 210 ASN B O   1 
ATOM   4021 C  CB  . ASN B 1 105 ? 26.604  -3.767  43.107 1.00 46.90 ? 210 ASN B CB  1 
ATOM   4022 C  CG  . ASN B 1 105 ? 26.288  -5.170  43.639 1.00 46.80 ? 210 ASN B CG  1 
ATOM   4023 O  OD1 . ASN B 1 105 ? 25.796  -6.038  42.915 1.00 46.47 ? 210 ASN B OD1 1 
ATOM   4024 N  ND2 . ASN B 1 105 ? 26.592  -5.395  44.910 1.00 46.43 ? 210 ASN B ND2 1 
ATOM   4025 N  N   . TYR B 1 106 ? 23.370  -2.742  41.552 1.00 47.42 ? 211 TYR B N   1 
ATOM   4026 C  CA  . TYR B 1 106 ? 22.023  -2.308  41.908 1.00 47.80 ? 211 TYR B CA  1 
ATOM   4027 C  C   . TYR B 1 106 ? 21.104  -3.444  42.366 1.00 48.20 ? 211 TYR B C   1 
ATOM   4028 O  O   . TYR B 1 106 ? 20.060  -3.182  42.967 1.00 48.36 ? 211 TYR B O   1 
ATOM   4029 C  CB  . TYR B 1 106 ? 21.378  -1.523  40.759 1.00 47.75 ? 211 TYR B CB  1 
ATOM   4030 C  CG  . TYR B 1 106 ? 21.075  -2.303  39.496 1.00 47.70 ? 211 TYR B CG  1 
ATOM   4031 C  CD1 . TYR B 1 106 ? 19.803  -2.817  39.260 1.00 47.56 ? 211 TYR B CD1 1 
ATOM   4032 C  CD2 . TYR B 1 106 ? 22.048  -2.488  38.518 1.00 47.67 ? 211 TYR B CD2 1 
ATOM   4033 C  CE1 . TYR B 1 106 ? 19.515  -3.509  38.093 1.00 47.58 ? 211 TYR B CE1 1 
ATOM   4034 C  CE2 . TYR B 1 106 ? 21.770  -3.181  37.352 1.00 47.77 ? 211 TYR B CE2 1 
ATOM   4035 C  CZ  . TYR B 1 106 ? 20.505  -3.689  37.144 1.00 47.76 ? 211 TYR B CZ  1 
ATOM   4036 O  OH  . TYR B 1 106 ? 20.240  -4.377  35.983 1.00 47.81 ? 211 TYR B OH  1 
ATOM   4037 N  N   . ARG B 1 107 ? 21.494  -4.690  42.084 1.00 48.51 ? 212 ARG B N   1 
ATOM   4038 C  CA  . ARG B 1 107 ? 20.755  -5.867  42.543 1.00 48.70 ? 212 ARG B CA  1 
ATOM   4039 C  C   . ARG B 1 107 ? 21.216  -6.343  43.927 1.00 48.94 ? 212 ARG B C   1 
ATOM   4040 O  O   . ARG B 1 107 ? 20.587  -7.217  44.525 1.00 49.06 ? 212 ARG B O   1 
ATOM   4041 C  CB  . ARG B 1 107 ? 20.882  -7.008  41.525 1.00 48.82 ? 212 ARG B CB  1 
ATOM   4042 C  CG  . ARG B 1 107 ? 20.259  -6.701  40.158 1.00 48.90 ? 212 ARG B CG  1 
ATOM   4043 C  CD  . ARG B 1 107 ? 20.003  -7.971  39.346 1.00 48.95 ? 212 ARG B CD  1 
ATOM   4044 N  NE  . ARG B 1 107 ? 18.931  -7.786  38.359 1.00 49.22 ? 212 ARG B NE  1 
ATOM   4045 C  CZ  . ARG B 1 107 ? 19.082  -7.733  37.033 1.00 49.40 ? 212 ARG B CZ  1 
ATOM   4046 N  NH1 . ARG B 1 107 ? 20.278  -7.855  36.463 1.00 49.91 ? 212 ARG B NH1 1 
ATOM   4047 N  NH2 . ARG B 1 107 ? 18.015  -7.559  36.260 1.00 49.28 ? 212 ARG B NH2 1 
ATOM   4048 N  N   . GLY B 1 108 ? 22.316  -5.779  44.422 1.00 49.21 ? 213 GLY B N   1 
ATOM   4049 C  CA  . GLY B 1 108 ? 22.821  -6.076  45.764 1.00 49.36 ? 213 GLY B CA  1 
ATOM   4050 C  C   . GLY B 1 108 ? 22.452  -4.974  46.738 1.00 49.58 ? 213 GLY B C   1 
ATOM   4051 O  O   . GLY B 1 108 ? 21.710  -4.053  46.392 1.00 49.65 ? 213 GLY B O   1 
ATOM   4052 N  N   . GLU B 1 109 ? 22.977  -5.062  47.957 1.00 49.89 ? 214 GLU B N   1 
ATOM   4053 C  CA  . GLU B 1 109 ? 22.661  -4.088  49.009 1.00 50.16 ? 214 GLU B CA  1 
ATOM   4054 C  C   . GLU B 1 109 ? 23.783  -3.070  49.271 1.00 50.34 ? 214 GLU B C   1 
ATOM   4055 O  O   . GLU B 1 109 ? 23.531  -2.013  49.852 1.00 50.45 ? 214 GLU B O   1 
ATOM   4056 C  CB  . GLU B 1 109 ? 22.232  -4.814  50.288 1.00 50.19 ? 214 GLU B CB  1 
ATOM   4057 C  CG  . GLU B 1 109 ? 20.752  -5.225  50.234 1.00 50.44 ? 214 GLU B CG  1 
ATOM   4058 C  CD  . GLU B 1 109 ? 20.388  -6.371  51.165 1.00 50.49 ? 214 GLU B CD  1 
ATOM   4059 O  OE1 . GLU B 1 109 ? 19.174  -6.572  51.398 1.00 50.93 ? 214 GLU B OE1 1 
ATOM   4060 O  OE2 . GLU B 1 109 ? 21.299  -7.074  51.655 1.00 50.56 ? 214 GLU B OE2 1 
ATOM   4061 N  N   . ASN B 1 110 ? 25.008  -3.389  48.853 1.00 50.42 ? 215 ASN B N   1 
ATOM   4062 C  CA  . ASN B 1 110 ? 26.042  -2.374  48.661 1.00 50.39 ? 215 ASN B CA  1 
ATOM   4063 C  C   . ASN B 1 110 ? 26.136  -2.125  47.165 1.00 50.48 ? 215 ASN B C   1 
ATOM   4064 O  O   . ASN B 1 110 ? 26.497  -3.022  46.403 1.00 50.42 ? 215 ASN B O   1 
ATOM   4065 C  CB  . ASN B 1 110 ? 27.395  -2.821  49.224 1.00 50.34 ? 215 ASN B CB  1 
ATOM   4066 C  CG  . ASN B 1 110 ? 28.433  -1.695  49.231 1.00 50.26 ? 215 ASN B CG  1 
ATOM   4067 O  OD1 . ASN B 1 110 ? 28.357  -0.748  48.445 1.00 50.09 ? 215 ASN B OD1 1 
ATOM   4068 N  ND2 . ASN B 1 110 ? 29.408  -1.803  50.120 1.00 49.67 ? 215 ASN B ND2 1 
ATOM   4069 N  N   . SER B 1 111 ? 25.796  -0.906  46.752 1.00 50.66 ? 216 SER B N   1 
ATOM   4070 C  CA  . SER B 1 111 ? 25.706  -0.557  45.337 1.00 50.71 ? 216 SER B CA  1 
ATOM   4071 C  C   . SER B 1 111 ? 27.073  -0.378  44.678 1.00 50.91 ? 216 SER B C   1 
ATOM   4072 O  O   . SER B 1 111 ? 27.187  -0.445  43.452 1.00 50.79 ? 216 SER B O   1 
ATOM   4073 C  CB  . SER B 1 111 ? 24.878  0.712   45.168 1.00 50.64 ? 216 SER B CB  1 
ATOM   4074 O  OG  . SER B 1 111 ? 23.552  0.509   45.621 1.00 50.22 ? 216 SER B OG  1 
ATOM   4075 N  N   . TRP B 1 112 ? 28.100  -0.155  45.495 1.00 51.19 ? 217 TRP B N   1 
ATOM   4076 C  CA  . TRP B 1 112 ? 29.459  0.046   45.004 1.00 51.54 ? 217 TRP B CA  1 
ATOM   4077 C  C   . TRP B 1 112 ? 30.360  -1.135  45.352 1.00 51.88 ? 217 TRP B C   1 
ATOM   4078 O  O   . TRP B 1 112 ? 31.573  -0.982  45.489 1.00 51.91 ? 217 TRP B O   1 
ATOM   4079 C  CB  . TRP B 1 112 ? 30.010  1.354   45.566 1.00 51.37 ? 217 TRP B CB  1 
ATOM   4080 C  CG  . TRP B 1 112 ? 29.145  2.499   45.186 1.00 51.32 ? 217 TRP B CG  1 
ATOM   4081 C  CD1 . TRP B 1 112 ? 28.180  3.087   45.948 1.00 51.14 ? 217 TRP B CD1 1 
ATOM   4082 C  CD2 . TRP B 1 112 ? 29.122  3.165   43.921 1.00 51.25 ? 217 TRP B CD2 1 
ATOM   4083 N  NE1 . TRP B 1 112 ? 27.571  4.093   45.242 1.00 51.06 ? 217 TRP B NE1 1 
ATOM   4084 C  CE2 . TRP B 1 112 ? 28.133  4.163   43.994 1.00 51.19 ? 217 TRP B CE2 1 
ATOM   4085 C  CE3 . TRP B 1 112 ? 29.856  3.025   42.737 1.00 51.22 ? 217 TRP B CE3 1 
ATOM   4086 C  CZ2 . TRP B 1 112 ? 27.853  5.017   42.927 1.00 51.22 ? 217 TRP B CZ2 1 
ATOM   4087 C  CZ3 . TRP B 1 112 ? 29.577  3.872   41.678 1.00 51.14 ? 217 TRP B CZ3 1 
ATOM   4088 C  CH2 . TRP B 1 112 ? 28.583  4.854   41.779 1.00 51.17 ? 217 TRP B CH2 1 
ATOM   4089 N  N   . PHE B 1 113 ? 29.752  -2.315  45.472 1.00 52.36 ? 218 PHE B N   1 
ATOM   4090 C  CA  . PHE B 1 113 ? 30.456  -3.558  45.781 1.00 52.78 ? 218 PHE B CA  1 
ATOM   4091 C  C   . PHE B 1 113 ? 31.207  -3.482  47.109 1.00 53.29 ? 218 PHE B C   1 
ATOM   4092 O  O   . PHE B 1 113 ? 31.149  -2.472  47.811 1.00 53.54 ? 218 PHE B O   1 
ATOM   4093 C  CB  . PHE B 1 113 ? 31.386  -3.959  44.622 1.00 52.72 ? 218 PHE B CB  1 
ATOM   4094 C  CG  . PHE B 1 113 ? 30.651  -4.310  43.358 1.00 52.63 ? 218 PHE B CG  1 
ATOM   4095 C  CD1 . PHE B 1 113 ? 30.569  -3.404  42.310 1.00 52.40 ? 218 PHE B CD1 1 
ATOM   4096 C  CD2 . PHE B 1 113 ? 30.020  -5.542  43.229 1.00 52.45 ? 218 PHE B CD2 1 
ATOM   4097 C  CE1 . PHE B 1 113 ? 29.881  -3.726  41.151 1.00 52.55 ? 218 PHE B CE1 1 
ATOM   4098 C  CE2 . PHE B 1 113 ? 29.330  -5.871  42.074 1.00 52.40 ? 218 PHE B CE2 1 
ATOM   4099 C  CZ  . PHE B 1 113 ? 29.261  -4.963  41.033 1.00 52.52 ? 218 PHE B CZ  1 
ATOM   4100 N  N   . SER B 1 114 ? 31.889  -4.567  47.456 1.00 53.86 ? 219 SER B N   1 
ATOM   4101 C  CA  . SER B 1 114 ? 32.629  -4.658  48.706 1.00 54.21 ? 219 SER B CA  1 
ATOM   4102 C  C   . SER B 1 114 ? 34.141  -4.580  48.456 1.00 54.65 ? 219 SER B C   1 
ATOM   4103 O  O   . SER B 1 114 ? 34.841  -3.789  49.099 1.00 54.77 ? 219 SER B O   1 
ATOM   4104 C  CB  . SER B 1 114 ? 32.270  -5.967  49.414 1.00 54.31 ? 219 SER B CB  1 
ATOM   4105 O  OG  . SER B 1 114 ? 32.582  -5.910  50.793 1.00 54.62 ? 219 SER B OG  1 
ATOM   4106 N  N   . THR B 1 115 ? 34.632  -5.399  47.523 1.00 54.92 ? 220 THR B N   1 
ATOM   4107 C  CA  . THR B 1 115 ? 36.064  -5.478  47.213 1.00 55.08 ? 220 THR B CA  1 
ATOM   4108 C  C   . THR B 1 115 ? 36.495  -4.422  46.182 1.00 55.26 ? 220 THR B C   1 
ATOM   4109 O  O   . THR B 1 115 ? 35.658  -3.694  45.638 1.00 55.20 ? 220 THR B O   1 
ATOM   4110 C  CB  . THR B 1 115 ? 36.461  -6.899  46.726 1.00 55.14 ? 220 THR B CB  1 
ATOM   4111 O  OG1 . THR B 1 115 ? 35.606  -7.297  45.645 1.00 55.51 ? 220 THR B OG1 1 
ATOM   4112 C  CG2 . THR B 1 115 ? 36.353  -7.907  47.861 1.00 54.97 ? 220 THR B CG2 1 
ATOM   4113 N  N   . GLN B 1 116 ? 37.807  -4.384  45.922 1.00 55.45 ? 221 GLN B N   1 
ATOM   4114 C  CA  . GLN B 1 116 ? 38.514  -3.288  45.225 1.00 55.63 ? 221 GLN B CA  1 
ATOM   4115 C  C   . GLN B 1 116 ? 37.674  -2.220  44.504 1.00 55.67 ? 221 GLN B C   1 
ATOM   4116 O  O   . GLN B 1 116 ? 37.101  -2.460  43.436 1.00 55.49 ? 221 GLN B O   1 
ATOM   4117 C  CB  . GLN B 1 116 ? 39.594  -3.848  44.282 1.00 55.69 ? 221 GLN B CB  1 
ATOM   4118 C  CG  . GLN B 1 116 ? 40.873  -4.294  45.025 1.00 55.92 ? 221 GLN B CG  1 
ATOM   4119 C  CD  . GLN B 1 116 ? 42.068  -4.542  44.111 1.00 55.96 ? 221 GLN B CD  1 
ATOM   4120 O  OE1 . GLN B 1 116 ? 43.091  -5.087  44.542 1.00 55.96 ? 221 GLN B OE1 1 
ATOM   4121 N  NE2 . GLN B 1 116 ? 41.947  -4.140  42.846 1.00 56.51 ? 221 GLN B NE2 1 
ATOM   4122 N  N   . VAL B 1 117 ? 37.648  -1.035  45.115 1.00 55.82 ? 222 VAL B N   1 
ATOM   4123 C  CA  . VAL B 1 117 ? 36.923  0.128   44.605 1.00 55.94 ? 222 VAL B CA  1 
ATOM   4124 C  C   . VAL B 1 117 ? 37.503  0.672   43.289 1.00 56.08 ? 222 VAL B C   1 
ATOM   4125 O  O   . VAL B 1 117 ? 36.759  1.216   42.464 1.00 56.23 ? 222 VAL B O   1 
ATOM   4126 C  CB  . VAL B 1 117 ? 36.887  1.265   45.672 1.00 55.95 ? 222 VAL B CB  1 
ATOM   4127 C  CG1 . VAL B 1 117 ? 38.272  1.893   45.856 1.00 55.92 ? 222 VAL B CG1 1 
ATOM   4128 C  CG2 . VAL B 1 117 ? 35.838  2.327   45.315 1.00 55.89 ? 222 VAL B CG2 1 
ATOM   4129 N  N   . ASP B 1 118 ? 38.818  0.531   43.096 1.00 56.07 ? 223 ASP B N   1 
ATOM   4130 C  CA  . ASP B 1 118 ? 39.468  0.961   41.850 1.00 56.02 ? 223 ASP B CA  1 
ATOM   4131 C  C   . ASP B 1 118 ? 38.936  0.181   40.644 1.00 56.02 ? 223 ASP B C   1 
ATOM   4132 O  O   . ASP B 1 118 ? 38.663  0.769   39.592 1.00 56.07 ? 223 ASP B O   1 
ATOM   4133 C  CB  . ASP B 1 118 ? 40.997  0.819   41.938 1.00 56.08 ? 223 ASP B CB  1 
ATOM   4134 C  CG  . ASP B 1 118 ? 41.664  1.981   42.677 1.00 56.40 ? 223 ASP B CG  1 
ATOM   4135 O  OD1 . ASP B 1 118 ? 41.033  3.053   42.826 1.00 56.37 ? 223 ASP B OD1 1 
ATOM   4136 O  OD2 . ASP B 1 118 ? 42.836  1.823   43.098 1.00 56.66 ? 223 ASP B OD2 1 
ATOM   4137 N  N   . THR B 1 119 ? 38.781  -1.134  40.810 1.00 55.81 ? 224 THR B N   1 
ATOM   4138 C  CA  . THR B 1 119 ? 38.208  -2.001  39.774 1.00 55.64 ? 224 THR B CA  1 
ATOM   4139 C  C   . THR B 1 119 ? 36.760  -1.614  39.435 1.00 55.53 ? 224 THR B C   1 
ATOM   4140 O  O   . THR B 1 119 ? 36.313  -1.804  38.302 1.00 55.60 ? 224 THR B O   1 
ATOM   4141 C  CB  . THR B 1 119 ? 38.260  -3.492  40.200 1.00 55.64 ? 224 THR B CB  1 
ATOM   4142 O  OG1 . THR B 1 119 ? 39.614  -3.862  40.496 1.00 55.51 ? 224 THR B OG1 1 
ATOM   4143 C  CG2 . THR B 1 119 ? 37.719  -4.400  39.102 1.00 55.62 ? 224 THR B CG2 1 
ATOM   4144 N  N   . VAL B 1 120 ? 36.037  -1.068  40.413 1.00 55.29 ? 225 VAL B N   1 
ATOM   4145 C  CA  . VAL B 1 120 ? 34.662  -0.612  40.196 1.00 55.12 ? 225 VAL B CA  1 
ATOM   4146 C  C   . VAL B 1 120 ? 34.632  0.736   39.473 1.00 54.91 ? 225 VAL B C   1 
ATOM   4147 O  O   . VAL B 1 120 ? 33.944  0.890   38.467 1.00 54.82 ? 225 VAL B O   1 
ATOM   4148 C  CB  . VAL B 1 120 ? 33.878  -0.488  41.527 1.00 55.12 ? 225 VAL B CB  1 
ATOM   4149 C  CG1 . VAL B 1 120 ? 32.426  -0.075  41.260 1.00 55.11 ? 225 VAL B CG1 1 
ATOM   4150 C  CG2 . VAL B 1 120 ? 33.928  -1.802  42.307 1.00 55.11 ? 225 VAL B CG2 1 
ATOM   4151 N  N   . ALA B 1 121 ? 35.379  1.706   39.990 1.00 54.77 ? 226 ALA B N   1 
ATOM   4152 C  CA  . ALA B 1 121 ? 35.381  3.065   39.441 1.00 54.70 ? 226 ALA B CA  1 
ATOM   4153 C  C   . ALA B 1 121 ? 35.921  3.163   38.007 1.00 54.61 ? 226 ALA B C   1 
ATOM   4154 O  O   . ALA B 1 121 ? 35.512  4.046   37.255 1.00 54.66 ? 226 ALA B O   1 
ATOM   4155 C  CB  . ALA B 1 121 ? 36.164  3.994   40.356 1.00 54.68 ? 226 ALA B CB  1 
ATOM   4156 N  N   . THR B 1 122 ? 36.841  2.274   37.639 1.00 54.50 ? 227 THR B N   1 
ATOM   4157 C  CA  . THR B 1 122 ? 37.393  2.252   36.283 1.00 54.42 ? 227 THR B CA  1 
ATOM   4158 C  C   . THR B 1 122 ? 36.345  1.808   35.264 1.00 54.31 ? 227 THR B C   1 
ATOM   4159 O  O   . THR B 1 122 ? 36.340  2.286   34.128 1.00 54.42 ? 227 THR B O   1 
ATOM   4160 C  CB  . THR B 1 122 ? 38.612  1.306   36.168 1.00 54.61 ? 227 THR B CB  1 
ATOM   4161 O  OG1 . THR B 1 122 ? 39.550  1.581   37.218 1.00 54.94 ? 227 THR B OG1 1 
ATOM   4162 C  CG2 . THR B 1 122 ? 39.304  1.476   34.814 1.00 54.58 ? 227 THR B CG2 1 
ATOM   4163 N  N   . LYS B 1 123 ? 35.474  0.884   35.665 1.00 54.06 ? 228 LYS B N   1 
ATOM   4164 C  CA  . LYS B 1 123 ? 34.351  0.462   34.825 1.00 53.81 ? 228 LYS B CA  1 
ATOM   4165 C  C   . LYS B 1 123 ? 33.440  1.639   34.491 1.00 53.51 ? 228 LYS B C   1 
ATOM   4166 O  O   . LYS B 1 123 ? 32.943  1.745   33.373 1.00 53.57 ? 228 LYS B O   1 
ATOM   4167 C  CB  . LYS B 1 123 ? 33.514  -0.617  35.524 1.00 53.94 ? 228 LYS B CB  1 
ATOM   4168 C  CG  . LYS B 1 123 ? 34.183  -1.973  35.684 1.00 53.86 ? 228 LYS B CG  1 
ATOM   4169 C  CD  . LYS B 1 123 ? 33.331  -2.877  36.572 1.00 53.96 ? 228 LYS B CD  1 
ATOM   4170 C  CE  . LYS B 1 123 ? 33.704  -4.343  36.438 1.00 54.26 ? 228 LYS B CE  1 
ATOM   4171 N  NZ  . LYS B 1 123 ? 33.316  -4.910  35.115 1.00 54.54 ? 228 LYS B NZ  1 
ATOM   4172 N  N   . VAL B 1 124 ? 33.219  2.511   35.471 1.00 53.17 ? 229 VAL B N   1 
ATOM   4173 C  CA  . VAL B 1 124 ? 32.316  3.646   35.305 1.00 52.93 ? 229 VAL B CA  1 
ATOM   4174 C  C   . VAL B 1 124 ? 32.830  4.578   34.214 1.00 52.75 ? 229 VAL B C   1 
ATOM   4175 O  O   . VAL B 1 124 ? 32.059  5.016   33.361 1.00 52.73 ? 229 VAL B O   1 
ATOM   4176 C  CB  . VAL B 1 124 ? 32.136  4.443   36.619 1.00 52.87 ? 229 VAL B CB  1 
ATOM   4177 C  CG1 . VAL B 1 124 ? 31.231  5.652   36.392 1.00 52.76 ? 229 VAL B CG1 1 
ATOM   4178 C  CG2 . VAL B 1 124 ? 31.571  3.546   37.722 1.00 52.69 ? 229 VAL B CG2 1 
ATOM   4179 N  N   . LYS B 1 125 ? 34.133  4.857   34.240 1.00 52.48 ? 230 LYS B N   1 
ATOM   4180 C  CA  . LYS B 1 125 ? 34.768  5.744   33.255 1.00 52.35 ? 230 LYS B CA  1 
ATOM   4181 C  C   . LYS B 1 125 ? 34.422  5.346   31.822 1.00 52.03 ? 230 LYS B C   1 
ATOM   4182 O  O   . LYS B 1 125 ? 34.034  6.190   31.018 1.00 52.14 ? 230 LYS B O   1 
ATOM   4183 C  CB  . LYS B 1 125 ? 36.296  5.740   33.411 1.00 52.46 ? 230 LYS B CB  1 
ATOM   4184 C  CG  . LYS B 1 125 ? 36.813  6.220   34.766 1.00 52.69 ? 230 LYS B CG  1 
ATOM   4185 C  CD  . LYS B 1 125 ? 38.345  6.172   34.837 1.00 52.95 ? 230 LYS B CD  1 
ATOM   4186 C  CE  . LYS B 1 125 ? 38.859  5.981   36.272 1.00 53.30 ? 230 LYS B CE  1 
ATOM   4187 N  NZ  . LYS B 1 125 ? 38.057  6.732   37.293 1.00 53.36 ? 230 LYS B NZ  1 
ATOM   4188 N  N   . ASP B 1 126 ? 34.555  4.056   31.523 1.00 51.63 ? 231 ASP B N   1 
ATOM   4189 C  CA  . ASP B 1 126 ? 34.349  3.530   30.171 1.00 51.30 ? 231 ASP B CA  1 
ATOM   4190 C  C   . ASP B 1 126 ? 32.874  3.488   29.768 1.00 50.92 ? 231 ASP B C   1 
ATOM   4191 O  O   . ASP B 1 126 ? 32.546  3.578   28.583 1.00 50.80 ? 231 ASP B O   1 
ATOM   4192 C  CB  . ASP B 1 126 ? 34.941  2.124   30.058 1.00 51.38 ? 231 ASP B CB  1 
ATOM   4193 C  CG  . ASP B 1 126 ? 36.399  2.066   30.481 1.00 51.81 ? 231 ASP B CG  1 
ATOM   4194 O  OD1 . ASP B 1 126 ? 37.082  3.114   30.452 1.00 52.16 ? 231 ASP B OD1 1 
ATOM   4195 O  OD2 . ASP B 1 126 ? 36.862  0.966   30.850 1.00 52.74 ? 231 ASP B OD2 1 
ATOM   4196 N  N   . ALA B 1 127 ? 31.992  3.332   30.753 1.00 50.46 ? 232 ALA B N   1 
ATOM   4197 C  CA  . ALA B 1 127 ? 30.554  3.345   30.511 1.00 50.07 ? 232 ALA B CA  1 
ATOM   4198 C  C   . ALA B 1 127 ? 30.120  4.739   30.097 1.00 49.68 ? 232 ALA B C   1 
ATOM   4199 O  O   . ALA B 1 127 ? 29.433  4.914   29.087 1.00 49.45 ? 232 ALA B O   1 
ATOM   4200 C  CB  . ALA B 1 127 ? 29.803  2.905   31.756 1.00 49.93 ? 232 ALA B CB  1 
ATOM   4201 N  N   . LEU B 1 128 ? 30.541  5.727   30.882 1.00 49.34 ? 233 LEU B N   1 
ATOM   4202 C  CA  . LEU B 1 128 ? 30.193  7.120   30.635 1.00 49.17 ? 233 LEU B CA  1 
ATOM   4203 C  C   . LEU B 1 128 ? 30.476  7.494   29.183 1.00 48.91 ? 233 LEU B C   1 
ATOM   4204 O  O   . LEU B 1 128 ? 29.583  7.916   28.456 1.00 48.78 ? 233 LEU B O   1 
ATOM   4205 C  CB  . LEU B 1 128 ? 30.972  8.041   31.585 1.00 49.18 ? 233 LEU B CB  1 
ATOM   4206 C  CG  . LEU B 1 128 ? 30.631  7.947   33.081 1.00 49.07 ? 233 LEU B CG  1 
ATOM   4207 C  CD1 . LEU B 1 128 ? 31.679  8.655   33.921 1.00 49.25 ? 233 LEU B CD1 1 
ATOM   4208 C  CD2 . LEU B 1 128 ? 29.269  8.516   33.369 1.00 49.02 ? 233 LEU B CD2 1 
ATOM   4209 N  N   . GLU B 1 129 ? 31.720  7.302   28.766 1.00 48.69 ? 234 GLU B N   1 
ATOM   4210 C  CA  . GLU B 1 129 ? 32.146  7.605   27.402 1.00 48.63 ? 234 GLU B CA  1 
ATOM   4211 C  C   . GLU B 1 129 ? 31.309  6.876   26.342 1.00 48.30 ? 234 GLU B C   1 
ATOM   4212 O  O   . GLU B 1 129 ? 30.884  7.481   25.357 1.00 48.26 ? 234 GLU B O   1 
ATOM   4213 C  CB  . GLU B 1 129 ? 33.634  7.273   27.243 1.00 48.65 ? 234 GLU B CB  1 
ATOM   4214 C  CG  . GLU B 1 129 ? 34.553  8.234   28.024 1.00 49.12 ? 234 GLU B CG  1 
ATOM   4215 C  CD  . GLU B 1 129 ? 35.963  7.692   28.275 1.00 49.51 ? 234 GLU B CD  1 
ATOM   4216 O  OE1 . GLU B 1 129 ? 36.269  6.541   27.877 1.00 51.06 ? 234 GLU B OE1 1 
ATOM   4217 O  OE2 . GLU B 1 129 ? 36.774  8.431   28.880 1.00 50.61 ? 234 GLU B OE2 1 
ATOM   4218 N  N   . PHE B 1 130 ? 31.057  5.589   26.564 1.00 48.00 ? 235 PHE B N   1 
ATOM   4219 C  CA  . PHE B 1 130 ? 30.309  4.751   25.617 1.00 47.80 ? 235 PHE B CA  1 
ATOM   4220 C  C   . PHE B 1 130 ? 28.884  5.249   25.346 1.00 47.61 ? 235 PHE B C   1 
ATOM   4221 O  O   . PHE B 1 130 ? 28.522  5.528   24.200 1.00 47.62 ? 235 PHE B O   1 
ATOM   4222 C  CB  . PHE B 1 130 ? 30.256  3.312   26.138 1.00 47.84 ? 235 PHE B CB  1 
ATOM   4223 C  CG  . PHE B 1 130 ? 29.588  2.347   25.201 1.00 47.82 ? 235 PHE B CG  1 
ATOM   4224 C  CD1 . PHE B 1 130 ? 30.149  2.063   23.964 1.00 47.84 ? 235 PHE B CD1 1 
ATOM   4225 C  CD2 . PHE B 1 130 ? 28.407  1.714   25.559 1.00 48.04 ? 235 PHE B CD2 1 
ATOM   4226 C  CE1 . PHE B 1 130 ? 29.541  1.169   23.092 1.00 47.83 ? 235 PHE B CE1 1 
ATOM   4227 C  CE2 . PHE B 1 130 ? 27.790  0.815   24.694 1.00 48.05 ? 235 PHE B CE2 1 
ATOM   4228 C  CZ  . PHE B 1 130 ? 28.360  0.542   23.458 1.00 47.87 ? 235 PHE B CZ  1 
ATOM   4229 N  N   . TRP B 1 131 ? 28.088  5.357   26.405 1.00 47.23 ? 236 TRP B N   1 
ATOM   4230 C  CA  . TRP B 1 131 ? 26.683  5.755   26.286 1.00 46.93 ? 236 TRP B CA  1 
ATOM   4231 C  C   . TRP B 1 131 ? 26.482  7.185   25.784 1.00 46.64 ? 236 TRP B C   1 
ATOM   4232 O  O   . TRP B 1 131 ? 25.453  7.483   25.184 1.00 46.54 ? 236 TRP B O   1 
ATOM   4233 C  CB  . TRP B 1 131 ? 25.960  5.565   27.622 1.00 46.85 ? 236 TRP B CB  1 
ATOM   4234 C  CG  . TRP B 1 131 ? 25.761  4.126   27.972 1.00 46.82 ? 236 TRP B CG  1 
ATOM   4235 C  CD1 . TRP B 1 131 ? 26.328  3.444   29.014 1.00 46.71 ? 236 TRP B CD1 1 
ATOM   4236 C  CD2 . TRP B 1 131 ? 24.951  3.180   27.265 1.00 46.91 ? 236 TRP B CD2 1 
ATOM   4237 N  NE1 . TRP B 1 131 ? 25.918  2.133   28.999 1.00 46.66 ? 236 TRP B NE1 1 
ATOM   4238 C  CE2 . TRP B 1 131 ? 25.071  1.944   27.938 1.00 46.88 ? 236 TRP B CE2 1 
ATOM   4239 C  CE3 . TRP B 1 131 ? 24.136  3.255   26.128 1.00 46.74 ? 236 TRP B CE3 1 
ATOM   4240 C  CZ2 . TRP B 1 131 ? 24.401  0.794   27.513 1.00 46.67 ? 236 TRP B CZ2 1 
ATOM   4241 C  CZ3 . TRP B 1 131 ? 23.471  2.109   25.706 1.00 46.69 ? 236 TRP B CZ3 1 
ATOM   4242 C  CH2 . TRP B 1 131 ? 23.607  0.897   26.399 1.00 46.67 ? 236 TRP B CH2 1 
ATOM   4243 N  N   . LEU B 1 132 ? 27.447  8.067   26.036 1.00 46.40 ? 237 LEU B N   1 
ATOM   4244 C  CA  . LEU B 1 132 ? 27.416  9.416   25.467 1.00 46.25 ? 237 LEU B CA  1 
ATOM   4245 C  C   . LEU B 1 132 ? 27.526  9.353   23.941 1.00 46.17 ? 237 LEU B C   1 
ATOM   4246 O  O   . LEU B 1 132 ? 26.748  9.992   23.234 1.00 46.17 ? 237 LEU B O   1 
ATOM   4247 C  CB  . LEU B 1 132 ? 28.537  10.285  26.044 1.00 46.11 ? 237 LEU B CB  1 
ATOM   4248 C  CG  . LEU B 1 132 ? 28.404  10.691  27.518 1.00 45.88 ? 237 LEU B CG  1 
ATOM   4249 C  CD1 . LEU B 1 132 ? 29.722  11.241  28.045 1.00 45.66 ? 237 LEU B CD1 1 
ATOM   4250 C  CD2 . LEU B 1 132 ? 27.288  11.700  27.726 1.00 45.65 ? 237 LEU B CD2 1 
ATOM   4251 N  N   . GLN B 1 133 ? 28.485  8.568   23.448 1.00 46.17 ? 238 GLN B N   1 
ATOM   4252 C  CA  . GLN B 1 133 ? 28.680  8.354   22.006 1.00 46.04 ? 238 GLN B CA  1 
ATOM   4253 C  C   . GLN B 1 133 ? 27.456  7.733   21.327 1.00 46.07 ? 238 GLN B C   1 
ATOM   4254 O  O   . GLN B 1 133 ? 27.178  8.013   20.160 1.00 46.15 ? 238 GLN B O   1 
ATOM   4255 C  CB  . GLN B 1 133 ? 29.902  7.468   21.761 1.00 45.95 ? 238 GLN B CB  1 
ATOM   4256 C  CG  . GLN B 1 133 ? 31.224  8.151   22.074 1.00 45.86 ? 238 GLN B CG  1 
ATOM   4257 C  CD  . GLN B 1 133 ? 32.378  7.177   22.234 1.00 45.82 ? 238 GLN B CD  1 
ATOM   4258 O  OE1 . GLN B 1 133 ? 32.266  5.993   21.907 1.00 45.64 ? 238 GLN B OE1 1 
ATOM   4259 N  NE2 . GLN B 1 133 ? 33.495  7.673   22.749 1.00 44.86 ? 238 GLN B NE2 1 
ATOM   4260 N  N   . ALA B 1 134 ? 26.742  6.882   22.058 1.00 45.98 ? 239 ALA B N   1 
ATOM   4261 C  CA  . ALA B 1 134 ? 25.459  6.357   21.602 1.00 45.95 ? 239 ALA B CA  1 
ATOM   4262 C  C   . ALA B 1 134 ? 24.410  7.480   21.541 1.00 46.04 ? 239 ALA B C   1 
ATOM   4263 O  O   . ALA B 1 134 ? 23.624  7.553   20.591 1.00 46.06 ? 239 ALA B O   1 
ATOM   4264 C  CB  . ALA B 1 134 ? 24.993  5.236   22.522 1.00 45.91 ? 239 ALA B CB  1 
ATOM   4265 N  N   . GLY B 1 135 ? 24.398  8.338   22.563 1.00 46.03 ? 240 GLY B N   1 
ATOM   4266 C  CA  . GLY B 1 135 ? 23.579  9.553   22.557 1.00 45.89 ? 240 GLY B CA  1 
ATOM   4267 C  C   . GLY B 1 135 ? 22.749  9.882   23.791 1.00 45.75 ? 240 GLY B C   1 
ATOM   4268 O  O   . GLY B 1 135 ? 21.762  10.605  23.676 1.00 45.81 ? 240 GLY B O   1 
ATOM   4269 N  N   . VAL B 1 136 ? 23.130  9.390   24.969 1.00 45.63 ? 241 VAL B N   1 
ATOM   4270 C  CA  . VAL B 1 136 ? 22.412  9.760   26.196 1.00 45.72 ? 241 VAL B CA  1 
ATOM   4271 C  C   . VAL B 1 136 ? 22.740  11.207  26.572 1.00 45.67 ? 241 VAL B C   1 
ATOM   4272 O  O   . VAL B 1 136 ? 23.770  11.741  26.170 1.00 45.48 ? 241 VAL B O   1 
ATOM   4273 C  CB  . VAL B 1 136 ? 22.715  8.813   27.396 1.00 45.68 ? 241 VAL B CB  1 
ATOM   4274 C  CG1 . VAL B 1 136 ? 22.486  7.360   27.006 1.00 45.54 ? 241 VAL B CG1 1 
ATOM   4275 C  CG2 . VAL B 1 136 ? 24.131  9.018   27.932 1.00 45.94 ? 241 VAL B CG2 1 
ATOM   4276 N  N   . ASP B 1 137 ? 21.853  11.835  27.337 1.00 45.74 ? 242 ASP B N   1 
ATOM   4277 C  CA  . ASP B 1 137 ? 22.024  13.234  27.730 1.00 45.81 ? 242 ASP B CA  1 
ATOM   4278 C  C   . ASP B 1 137 ? 22.567  13.404  29.147 1.00 45.76 ? 242 ASP B C   1 
ATOM   4279 O  O   . ASP B 1 137 ? 22.767  14.532  29.595 1.00 45.78 ? 242 ASP B O   1 
ATOM   4280 C  CB  . ASP B 1 137 ? 20.691  13.970  27.620 1.00 45.93 ? 242 ASP B CB  1 
ATOM   4281 C  CG  . ASP B 1 137 ? 20.098  13.884  26.235 1.00 46.21 ? 242 ASP B CG  1 
ATOM   4282 O  OD1 . ASP B 1 137 ? 19.004  13.304  26.098 1.00 46.25 ? 242 ASP B OD1 1 
ATOM   4283 O  OD2 . ASP B 1 137 ? 20.735  14.382  25.284 1.00 47.10 ? 242 ASP B OD2 1 
ATOM   4284 N  N   . GLY B 1 138 ? 22.796  12.299  29.854 1.00 45.70 ? 243 GLY B N   1 
ATOM   4285 C  CA  . GLY B 1 138 ? 23.285  12.366  31.232 1.00 45.64 ? 243 GLY B CA  1 
ATOM   4286 C  C   . GLY B 1 138 ? 23.256  11.044  31.977 1.00 45.46 ? 243 GLY B C   1 
ATOM   4287 O  O   . GLY B 1 138 ? 22.774  10.039  31.458 1.00 45.34 ? 243 GLY B O   1 
ATOM   4288 N  N   . PHE B 1 139 ? 23.781  11.053  33.199 1.00 45.33 ? 244 PHE B N   1 
ATOM   4289 C  CA  . PHE B 1 139 ? 23.821  9.860   34.040 1.00 45.41 ? 244 PHE B CA  1 
ATOM   4290 C  C   . PHE B 1 139 ? 23.406  10.163  35.478 1.00 45.51 ? 244 PHE B C   1 
ATOM   4291 O  O   . PHE B 1 139 ? 23.545  11.297  35.950 1.00 45.51 ? 244 PHE B O   1 
ATOM   4292 C  CB  . PHE B 1 139 ? 25.231  9.261   34.044 1.00 45.33 ? 244 PHE B CB  1 
ATOM   4293 C  CG  . PHE B 1 139 ? 25.769  8.980   32.675 1.00 45.27 ? 244 PHE B CG  1 
ATOM   4294 C  CD1 . PHE B 1 139 ? 26.629  9.874   32.053 1.00 45.15 ? 244 PHE B CD1 1 
ATOM   4295 C  CD2 . PHE B 1 139 ? 25.392  7.832   31.995 1.00 45.33 ? 244 PHE B CD2 1 
ATOM   4296 C  CE1 . PHE B 1 139 ? 27.115  9.619   30.783 1.00 45.16 ? 244 PHE B CE1 1 
ATOM   4297 C  CE2 . PHE B 1 139 ? 25.870  7.571   30.726 1.00 45.11 ? 244 PHE B CE2 1 
ATOM   4298 C  CZ  . PHE B 1 139 ? 26.732  8.464   30.117 1.00 45.28 ? 244 PHE B CZ  1 
ATOM   4299 N  N   . GLN B 1 140 ? 22.901  9.139   36.167 1.00 45.56 ? 245 GLN B N   1 
ATOM   4300 C  CA  . GLN B 1 140 ? 22.674  9.200   37.612 1.00 45.55 ? 245 GLN B CA  1 
ATOM   4301 C  C   . GLN B 1 140 ? 23.459  8.110   38.325 1.00 45.67 ? 245 GLN B C   1 
ATOM   4302 O  O   . GLN B 1 140 ? 23.625  7.013   37.797 1.00 45.84 ? 245 GLN B O   1 
ATOM   4303 C  CB  . GLN B 1 140 ? 21.189  9.037   37.931 1.00 45.56 ? 245 GLN B CB  1 
ATOM   4304 C  CG  . GLN B 1 140 ? 20.873  9.041   39.418 1.00 45.49 ? 245 GLN B CG  1 
ATOM   4305 C  CD  . GLN B 1 140 ? 19.394  9.005   39.699 1.00 45.31 ? 245 GLN B CD  1 
ATOM   4306 O  OE1 . GLN B 1 140 ? 18.712  10.015  39.589 1.00 44.84 ? 245 GLN B OE1 1 
ATOM   4307 N  NE2 . GLN B 1 140 ? 18.891  7.837   40.080 1.00 45.51 ? 245 GLN B NE2 1 
ATOM   4308 N  N   . VAL B 1 141 ? 23.934  8.422   39.529 1.00 45.89 ? 246 VAL B N   1 
ATOM   4309 C  CA  . VAL B 1 141 ? 24.541  7.434   40.428 1.00 46.09 ? 246 VAL B CA  1 
ATOM   4310 C  C   . VAL B 1 141 ? 23.981  7.616   41.845 1.00 46.33 ? 246 VAL B C   1 
ATOM   4311 O  O   . VAL B 1 141 ? 24.010  8.720   42.384 1.00 46.41 ? 246 VAL B O   1 
ATOM   4312 C  CB  . VAL B 1 141 ? 26.100  7.516   40.449 1.00 46.02 ? 246 VAL B CB  1 
ATOM   4313 C  CG1 . VAL B 1 141 ? 26.700  6.792   39.246 1.00 45.86 ? 246 VAL B CG1 1 
ATOM   4314 C  CG2 . VAL B 1 141 ? 26.590  8.957   40.514 1.00 45.82 ? 246 VAL B CG2 1 
ATOM   4315 N  N   . ARG B 1 142 ? 23.476  6.533   42.438 1.00 46.61 ? 247 ARG B N   1 
ATOM   4316 C  CA  . ARG B 1 142 ? 22.793  6.591   43.736 1.00 46.91 ? 247 ARG B CA  1 
ATOM   4317 C  C   . ARG B 1 142 ? 23.643  6.017   44.872 1.00 46.96 ? 247 ARG B C   1 
ATOM   4318 O  O   . ARG B 1 142 ? 24.622  5.315   44.626 1.00 46.96 ? 247 ARG B O   1 
ATOM   4319 C  CB  . ARG B 1 142 ? 21.442  5.857   43.653 1.00 46.96 ? 247 ARG B CB  1 
ATOM   4320 C  CG  . ARG B 1 142 ? 20.396  6.589   42.795 1.00 47.38 ? 247 ARG B CG  1 
ATOM   4321 C  CD  . ARG B 1 142 ? 19.025  5.903   42.794 1.00 47.66 ? 247 ARG B CD  1 
ATOM   4322 N  NE  . ARG B 1 142 ? 19.034  4.659   42.024 1.00 48.55 ? 247 ARG B NE  1 
ATOM   4323 C  CZ  . ARG B 1 142 ? 19.118  3.433   42.542 1.00 49.47 ? 247 ARG B CZ  1 
ATOM   4324 N  NH1 . ARG B 1 142 ? 19.168  3.232   43.860 1.00 50.38 ? 247 ARG B NH1 1 
ATOM   4325 N  NH2 . ARG B 1 142 ? 19.136  2.383   41.730 1.00 49.46 ? 247 ARG B NH2 1 
ATOM   4326 N  N   . ASP B 1 143 ? 23.259  6.338   46.109 1.00 47.07 ? 248 ASP B N   1 
ATOM   4327 C  CA  . ASP B 1 143 ? 23.887  5.798   47.328 1.00 47.26 ? 248 ASP B CA  1 
ATOM   4328 C  C   . ASP B 1 143 ? 25.383  6.104   47.461 1.00 47.29 ? 248 ASP B C   1 
ATOM   4329 O  O   . ASP B 1 143 ? 26.157  5.243   47.883 1.00 47.27 ? 248 ASP B O   1 
ATOM   4330 C  CB  . ASP B 1 143 ? 23.671  4.275   47.424 1.00 47.38 ? 248 ASP B CB  1 
ATOM   4331 C  CG  . ASP B 1 143 ? 22.202  3.883   47.529 1.00 47.97 ? 248 ASP B CG  1 
ATOM   4332 O  OD1 . ASP B 1 143 ? 21.875  2.729   47.182 1.00 48.41 ? 248 ASP B OD1 1 
ATOM   4333 O  OD2 . ASP B 1 143 ? 21.376  4.711   47.968 1.00 49.39 ? 248 ASP B OD2 1 
ATOM   4334 N  N   . ILE B 1 144 ? 25.791  7.331   47.136 1.00 47.44 ? 249 ILE B N   1 
ATOM   4335 C  CA  . ILE B 1 144 ? 27.230  7.657   47.084 1.00 47.51 ? 249 ILE B CA  1 
ATOM   4336 C  C   . ILE B 1 144 ? 27.897  7.765   48.467 1.00 47.65 ? 249 ILE B C   1 
ATOM   4337 O  O   . ILE B 1 144 ? 29.126  7.831   48.556 1.00 47.64 ? 249 ILE B O   1 
ATOM   4338 C  CB  . ILE B 1 144 ? 27.566  8.918   46.203 1.00 47.45 ? 249 ILE B CB  1 
ATOM   4339 C  CG1 . ILE B 1 144 ? 27.381  10.245  46.959 1.00 47.67 ? 249 ILE B CG1 1 
ATOM   4340 C  CG2 . ILE B 1 144 ? 26.796  8.901   44.885 1.00 47.55 ? 249 ILE B CG2 1 
ATOM   4341 C  CD1 . ILE B 1 144 ? 25.970  10.621  47.293 1.00 47.70 ? 249 ILE B CD1 1 
ATOM   4342 N  N   . GLU B 1 145 ? 27.099  7.768   49.534 1.00 47.73 ? 250 GLU B N   1 
ATOM   4343 C  CA  . GLU B 1 145 ? 27.638  7.715   50.897 1.00 47.70 ? 250 GLU B CA  1 
ATOM   4344 C  C   . GLU B 1 145 ? 28.350  6.389   51.187 1.00 47.66 ? 250 GLU B C   1 
ATOM   4345 O  O   . GLU B 1 145 ? 29.180  6.317   52.092 1.00 47.62 ? 250 GLU B O   1 
ATOM   4346 C  CB  . GLU B 1 145 ? 26.544  7.993   51.947 1.00 47.82 ? 250 GLU B CB  1 
ATOM   4347 C  CG  . GLU B 1 145 ? 25.580  6.832   52.262 1.00 48.20 ? 250 GLU B CG  1 
ATOM   4348 C  CD  . GLU B 1 145 ? 24.448  6.671   51.258 1.00 48.99 ? 250 GLU B CD  1 
ATOM   4349 O  OE1 . GLU B 1 145 ? 23.986  5.522   51.069 1.00 49.49 ? 250 GLU B OE1 1 
ATOM   4350 O  OE2 . GLU B 1 145 ? 24.009  7.684   50.669 1.00 48.92 ? 250 GLU B OE2 1 
ATOM   4351 N  N   . ASN B 1 146 ? 28.018  5.347   50.427 1.00 47.62 ? 251 ASN B N   1 
ATOM   4352 C  CA  . ASN B 1 146 ? 28.697  4.052   50.535 1.00 47.67 ? 251 ASN B CA  1 
ATOM   4353 C  C   . ASN B 1 146 ? 29.935  3.921   49.645 1.00 47.65 ? 251 ASN B C   1 
ATOM   4354 O  O   . ASN B 1 146 ? 30.629  2.908   49.713 1.00 47.58 ? 251 ASN B O   1 
ATOM   4355 C  CB  . ASN B 1 146 ? 27.724  2.914   50.210 1.00 47.66 ? 251 ASN B CB  1 
ATOM   4356 C  CG  . ASN B 1 146 ? 26.676  2.728   51.278 1.00 47.51 ? 251 ASN B CG  1 
ATOM   4357 O  OD1 . ASN B 1 146 ? 26.998  2.412   52.419 1.00 47.49 ? 251 ASN B OD1 1 
ATOM   4358 N  ND2 . ASN B 1 146 ? 25.412  2.921   50.916 1.00 47.22 ? 251 ASN B ND2 1 
ATOM   4359 N  N   . LEU B 1 147 ? 30.206  4.925   48.811 1.00 47.71 ? 252 LEU B N   1 
ATOM   4360 C  CA  . LEU B 1 147 ? 31.375  4.901   47.928 1.00 47.83 ? 252 LEU B CA  1 
ATOM   4361 C  C   . LEU B 1 147 ? 32.544  5.627   48.582 1.00 47.86 ? 252 LEU B C   1 
ATOM   4362 O  O   . LEU B 1 147 ? 32.471  6.834   48.823 1.00 47.82 ? 252 LEU B O   1 
ATOM   4363 C  CB  . LEU B 1 147 ? 31.051  5.555   46.577 1.00 47.95 ? 252 LEU B CB  1 
ATOM   4364 C  CG  . LEU B 1 147 ? 32.167  5.586   45.520 1.00 47.83 ? 252 LEU B CG  1 
ATOM   4365 C  CD1 . LEU B 1 147 ? 32.587  4.178   45.126 1.00 47.84 ? 252 LEU B CD1 1 
ATOM   4366 C  CD2 . LEU B 1 147 ? 31.728  6.380   44.294 1.00 47.75 ? 252 LEU B CD2 1 
ATOM   4367 N  N   . LYS B 1 148 ? 33.622  4.899   48.858 1.00 47.85 ? 253 LYS B N   1 
ATOM   4368 C  CA  . LYS B 1 148 ? 34.778  5.490   49.524 1.00 47.95 ? 253 LYS B CA  1 
ATOM   4369 C  C   . LYS B 1 148 ? 35.565  6.361   48.537 1.00 47.96 ? 253 LYS B C   1 
ATOM   4370 O  O   . LYS B 1 148 ? 35.813  5.949   47.404 1.00 48.03 ? 253 LYS B O   1 
ATOM   4371 C  CB  . LYS B 1 148 ? 35.644  4.403   50.180 1.00 48.06 ? 253 LYS B CB  1 
ATOM   4372 C  CG  . LYS B 1 148 ? 36.444  3.522   49.232 1.00 48.38 ? 253 LYS B CG  1 
ATOM   4373 C  CD  . LYS B 1 148 ? 37.899  3.962   49.161 1.00 48.73 ? 253 LYS B CD  1 
ATOM   4374 C  CE  . LYS B 1 148 ? 38.704  3.414   50.330 1.00 48.86 ? 253 LYS B CE  1 
ATOM   4375 N  NZ  . LYS B 1 148 ? 40.077  3.988   50.382 1.00 48.87 ? 253 LYS B NZ  1 
ATOM   4376 N  N   . ASP B 1 149 ? 35.932  7.567   48.984 1.00 47.86 ? 254 ASP B N   1 
ATOM   4377 C  CA  . ASP B 1 149 ? 36.503  8.623   48.130 1.00 47.76 ? 254 ASP B CA  1 
ATOM   4378 C  C   . ASP B 1 149 ? 35.495  9.148   47.104 1.00 47.59 ? 254 ASP B C   1 
ATOM   4379 O  O   . ASP B 1 149 ? 35.844  9.425   45.958 1.00 47.53 ? 254 ASP B O   1 
ATOM   4380 C  CB  . ASP B 1 149 ? 37.786  8.156   47.430 1.00 47.86 ? 254 ASP B CB  1 
ATOM   4381 C  CG  . ASP B 1 149 ? 38.856  7.731   48.405 1.00 48.47 ? 254 ASP B CG  1 
ATOM   4382 O  OD1 . ASP B 1 149 ? 39.042  8.434   49.423 1.00 49.30 ? 254 ASP B OD1 1 
ATOM   4383 O  OD2 . ASP B 1 149 ? 39.518  6.700   48.152 1.00 49.27 ? 254 ASP B OD2 1 
ATOM   4384 N  N   . ALA B 1 150 ? 34.251  9.306   47.539 1.00 47.44 ? 255 ALA B N   1 
ATOM   4385 C  CA  . ALA B 1 150 ? 33.174  9.758   46.667 1.00 47.41 ? 255 ALA B CA  1 
ATOM   4386 C  C   . ALA B 1 150 ? 33.512  11.058  45.936 1.00 47.37 ? 255 ALA B C   1 
ATOM   4387 O  O   . ALA B 1 150 ? 33.344  11.154  44.721 1.00 47.46 ? 255 ALA B O   1 
ATOM   4388 C  CB  . ALA B 1 150 ? 31.894  9.931   47.472 1.00 47.41 ? 255 ALA B CB  1 
ATOM   4389 N  N   . SER B 1 151 ? 33.990  12.050  46.681 1.00 47.28 ? 256 SER B N   1 
ATOM   4390 C  CA  . SER B 1 151 ? 34.235  13.390  46.136 1.00 47.18 ? 256 SER B CA  1 
ATOM   4391 C  C   . SER B 1 151 ? 35.200  13.407  44.948 1.00 47.07 ? 256 SER B C   1 
ATOM   4392 O  O   . SER B 1 151 ? 34.999  14.161  43.997 1.00 46.91 ? 256 SER B O   1 
ATOM   4393 C  CB  . SER B 1 151 ? 34.781  14.298  47.229 1.00 47.12 ? 256 SER B CB  1 
ATOM   4394 O  OG  . SER B 1 151 ? 36.006  13.786  47.718 1.00 47.28 ? 256 SER B OG  1 
ATOM   4395 N  N   . SER B 1 152 ? 36.245  12.585  45.014 1.00 47.02 ? 257 SER B N   1 
ATOM   4396 C  CA  . SER B 1 152 ? 37.235  12.498  43.936 1.00 47.00 ? 257 SER B CA  1 
ATOM   4397 C  C   . SER B 1 152 ? 36.662  11.881  42.663 1.00 46.95 ? 257 SER B C   1 
ATOM   4398 O  O   . SER B 1 152 ? 36.911  12.375  41.564 1.00 46.93 ? 257 SER B O   1 
ATOM   4399 C  CB  . SER B 1 152 ? 38.451  11.691  44.389 1.00 46.94 ? 257 SER B CB  1 
ATOM   4400 O  OG  . SER B 1 152 ? 39.187  12.411  45.354 1.00 46.95 ? 257 SER B OG  1 
ATOM   4401 N  N   . PHE B 1 153 ? 35.907  10.799  42.814 1.00 46.94 ? 258 PHE B N   1 
ATOM   4402 C  CA  . PHE B 1 153 ? 35.329  10.109  41.665 1.00 47.06 ? 258 PHE B CA  1 
ATOM   4403 C  C   . PHE B 1 153 ? 34.230  10.939  40.995 1.00 47.14 ? 258 PHE B C   1 
ATOM   4404 O  O   . PHE B 1 153 ? 34.079  10.903  39.773 1.00 47.13 ? 258 PHE B O   1 
ATOM   4405 C  CB  . PHE B 1 153 ? 34.798  8.730   42.067 1.00 46.99 ? 258 PHE B CB  1 
ATOM   4406 C  CG  . PHE B 1 153 ? 35.876  7.756   42.451 1.00 46.92 ? 258 PHE B CG  1 
ATOM   4407 C  CD1 . PHE B 1 153 ? 35.947  7.243   43.739 1.00 46.95 ? 258 PHE B CD1 1 
ATOM   4408 C  CD2 . PHE B 1 153 ? 36.829  7.356   41.521 1.00 46.96 ? 258 PHE B CD2 1 
ATOM   4409 C  CE1 . PHE B 1 153 ? 36.946  6.345   44.094 1.00 46.95 ? 258 PHE B CE1 1 
ATOM   4410 C  CE2 . PHE B 1 153 ? 37.835  6.459   41.868 1.00 46.93 ? 258 PHE B CE2 1 
ATOM   4411 C  CZ  . PHE B 1 153 ? 37.893  5.954   43.156 1.00 46.94 ? 258 PHE B CZ  1 
ATOM   4412 N  N   . LEU B 1 154 ? 33.470  11.688  41.788 1.00 47.27 ? 259 LEU B N   1 
ATOM   4413 C  CA  . LEU B 1 154 ? 32.453  12.582  41.235 1.00 47.38 ? 259 LEU B CA  1 
ATOM   4414 C  C   . LEU B 1 154 ? 33.078  13.660  40.353 1.00 47.34 ? 259 LEU B C   1 
ATOM   4415 O  O   . LEU B 1 154 ? 32.577  13.937  39.267 1.00 47.34 ? 259 LEU B O   1 
ATOM   4416 C  CB  . LEU B 1 154 ? 31.622  13.222  42.349 1.00 47.47 ? 259 LEU B CB  1 
ATOM   4417 C  CG  . LEU B 1 154 ? 30.653  12.279  43.068 1.00 47.77 ? 259 LEU B CG  1 
ATOM   4418 C  CD1 . LEU B 1 154 ? 30.083  12.953  44.305 1.00 48.20 ? 259 LEU B CD1 1 
ATOM   4419 C  CD2 . LEU B 1 154 ? 29.531  11.826  42.140 1.00 48.04 ? 259 LEU B CD2 1 
ATOM   4420 N  N   . ALA B 1 155 ? 34.175  14.250  40.822 1.00 47.39 ? 260 ALA B N   1 
ATOM   4421 C  CA  . ALA B 1 155 ? 34.923  15.248  40.052 1.00 47.52 ? 260 ALA B CA  1 
ATOM   4422 C  C   . ALA B 1 155 ? 35.385  14.714  38.691 1.00 47.64 ? 260 ALA B C   1 
ATOM   4423 O  O   . ALA B 1 155 ? 35.252  15.398  37.672 1.00 47.64 ? 260 ALA B O   1 
ATOM   4424 C  CB  . ALA B 1 155 ? 36.129  15.741  40.853 1.00 47.37 ? 260 ALA B CB  1 
ATOM   4425 N  N   . GLU B 1 156 ? 35.930  13.499  38.681 1.00 47.67 ? 261 GLU B N   1 
ATOM   4426 C  CA  . GLU B 1 156 ? 36.417  12.887  37.448 1.00 47.67 ? 261 GLU B CA  1 
ATOM   4427 C  C   . GLU B 1 156 ? 35.267  12.659  36.458 1.00 47.52 ? 261 GLU B C   1 
ATOM   4428 O  O   . GLU B 1 156 ? 35.379  12.996  35.279 1.00 47.43 ? 261 GLU B O   1 
ATOM   4429 C  CB  . GLU B 1 156 ? 37.143  11.569  37.755 1.00 47.73 ? 261 GLU B CB  1 
ATOM   4430 C  CG  . GLU B 1 156 ? 37.915  10.968  36.569 1.00 48.05 ? 261 GLU B CG  1 
ATOM   4431 C  CD  . GLU B 1 156 ? 38.711  9.709   36.937 1.00 48.49 ? 261 GLU B CD  1 
ATOM   4432 O  OE1 . GLU B 1 156 ? 38.729  9.322   38.127 1.00 50.03 ? 261 GLU B OE1 1 
ATOM   4433 O  OE2 . GLU B 1 156 ? 39.325  9.100   36.033 1.00 49.28 ? 261 GLU B OE2 1 
ATOM   4434 N  N   . TRP B 1 157 ? 34.158  12.111  36.947 1.00 47.36 ? 262 TRP B N   1 
ATOM   4435 C  CA  . TRP B 1 157 ? 33.008  11.817  36.089 1.00 47.31 ? 262 TRP B CA  1 
ATOM   4436 C  C   . TRP B 1 157 ? 32.276  13.092  35.660 1.00 47.23 ? 262 TRP B C   1 
ATOM   4437 O  O   . TRP B 1 157 ? 31.686  13.143  34.583 1.00 47.20 ? 262 TRP B O   1 
ATOM   4438 C  CB  . TRP B 1 157 ? 32.041  10.859  36.791 1.00 47.20 ? 262 TRP B CB  1 
ATOM   4439 C  CG  . TRP B 1 157 ? 32.684  9.586   37.256 1.00 47.04 ? 262 TRP B CG  1 
ATOM   4440 C  CD1 . TRP B 1 157 ? 33.723  8.924   36.664 1.00 46.99 ? 262 TRP B CD1 1 
ATOM   4441 C  CD2 . TRP B 1 157 ? 32.315  8.809   38.402 1.00 47.18 ? 262 TRP B CD2 1 
ATOM   4442 N  NE1 . TRP B 1 157 ? 34.035  7.792   37.379 1.00 46.99 ? 262 TRP B NE1 1 
ATOM   4443 C  CE2 . TRP B 1 157 ? 33.186  7.697   38.451 1.00 47.30 ? 262 TRP B CE2 1 
ATOM   4444 C  CE3 . TRP B 1 157 ? 31.340  8.950   39.399 1.00 46.93 ? 262 TRP B CE3 1 
ATOM   4445 C  CZ2 . TRP B 1 157 ? 33.106  6.726   39.457 1.00 47.12 ? 262 TRP B CZ2 1 
ATOM   4446 C  CZ3 . TRP B 1 157 ? 31.262  7.984   40.398 1.00 47.01 ? 262 TRP B CZ3 1 
ATOM   4447 C  CH2 . TRP B 1 157 ? 32.142  6.888   40.419 1.00 47.02 ? 262 TRP B CH2 1 
ATOM   4448 N  N   . GLN B 1 158 ? 32.318  14.110  36.515 1.00 47.24 ? 263 GLN B N   1 
ATOM   4449 C  CA  . GLN B 1 158 ? 31.764  15.432  36.214 1.00 47.12 ? 263 GLN B CA  1 
ATOM   4450 C  C   . GLN B 1 158 ? 32.442  16.048  34.983 1.00 46.98 ? 263 GLN B C   1 
ATOM   4451 O  O   . GLN B 1 158 ? 31.768  16.582  34.102 1.00 46.90 ? 263 GLN B O   1 
ATOM   4452 C  CB  . GLN B 1 158 ? 31.926  16.343  37.445 1.00 47.17 ? 263 GLN B CB  1 
ATOM   4453 C  CG  . GLN B 1 158 ? 31.475  17.790  37.292 1.00 47.45 ? 263 GLN B CG  1 
ATOM   4454 C  CD  . GLN B 1 158 ? 29.982  17.936  37.113 1.00 48.15 ? 263 GLN B CD  1 
ATOM   4455 O  OE1 . GLN B 1 158 ? 29.206  17.073  37.516 1.00 49.39 ? 263 GLN B OE1 1 
ATOM   4456 N  NE2 . GLN B 1 158 ? 29.569  19.036  36.502 1.00 48.20 ? 263 GLN B NE2 1 
ATOM   4457 N  N   . ASN B 1 159 ? 33.770  15.951  34.923 1.00 46.89 ? 264 ASN B N   1 
ATOM   4458 C  CA  . ASN B 1 159 ? 34.554  16.540  33.825 1.00 46.79 ? 264 ASN B CA  1 
ATOM   4459 C  C   . ASN B 1 159 ? 34.421  15.785  32.496 1.00 46.88 ? 264 ASN B C   1 
ATOM   4460 O  O   . ASN B 1 159 ? 34.438  16.394  31.429 1.00 47.13 ? 264 ASN B O   1 
ATOM   4461 C  CB  . ASN B 1 159 ? 36.036  16.635  34.213 1.00 46.52 ? 264 ASN B CB  1 
ATOM   4462 C  CG  . ASN B 1 159 ? 36.277  17.537  35.418 1.00 45.87 ? 264 ASN B CG  1 
ATOM   4463 O  OD1 . ASN B 1 159 ? 35.462  18.399  35.744 1.00 44.76 ? 264 ASN B OD1 1 
ATOM   4464 N  ND2 . ASN B 1 159 ? 37.405  17.334  36.085 1.00 44.82 ? 264 ASN B ND2 1 
ATOM   4465 N  N   . ILE B 1 160 ? 34.299  14.464  32.564 1.00 46.90 ? 265 ILE B N   1 
ATOM   4466 C  CA  . ILE B 1 160 ? 34.089  13.644  31.372 1.00 46.78 ? 265 ILE B CA  1 
ATOM   4467 C  C   . ILE B 1 160 ? 32.721  13.956  30.765 1.00 46.77 ? 265 ILE B C   1 
ATOM   4468 O  O   . ILE B 1 160 ? 32.563  14.000  29.544 1.00 46.87 ? 265 ILE B O   1 
ATOM   4469 C  CB  . ILE B 1 160 ? 34.180  12.129  31.704 1.00 46.73 ? 265 ILE B CB  1 
ATOM   4470 C  CG1 . ILE B 1 160 ? 35.589  11.763  32.176 1.00 46.63 ? 265 ILE B CG1 1 
ATOM   4471 C  CG2 . ILE B 1 160 ? 33.809  11.273  30.491 1.00 46.83 ? 265 ILE B CG2 1 
ATOM   4472 C  CD1 . ILE B 1 160 ? 35.659  10.446  32.925 1.00 46.81 ? 265 ILE B CD1 1 
ATOM   4473 N  N   . THR B 1 161 ? 31.737  14.179  31.629 1.00 46.76 ? 266 THR B N   1 
ATOM   4474 C  CA  . THR B 1 161 ? 30.381  14.457  31.187 1.00 46.76 ? 266 THR B CA  1 
ATOM   4475 C  C   . THR B 1 161 ? 30.297  15.817  30.504 1.00 46.83 ? 266 THR B C   1 
ATOM   4476 O  O   . THR B 1 161 ? 29.748  15.929  29.410 1.00 46.95 ? 266 THR B O   1 
ATOM   4477 C  CB  . THR B 1 161 ? 29.395  14.416  32.365 1.00 46.74 ? 266 THR B CB  1 
ATOM   4478 O  OG1 . THR B 1 161 ? 29.547  13.181  33.072 1.00 46.06 ? 266 THR B OG1 1 
ATOM   4479 C  CG2 . THR B 1 161 ? 27.958  14.540  31.874 1.00 46.93 ? 266 THR B CG2 1 
ATOM   4480 N  N   . LYS B 1 162 ? 30.854  16.840  31.146 1.00 46.87 ? 267 LYS B N   1 
ATOM   4481 C  CA  . LYS B 1 162 ? 30.818  18.201  30.610 1.00 47.01 ? 267 LYS B CA  1 
ATOM   4482 C  C   . LYS B 1 162 ? 31.785  18.392  29.443 1.00 47.03 ? 267 LYS B C   1 
ATOM   4483 O  O   . LYS B 1 162 ? 31.578  19.268  28.606 1.00 47.06 ? 267 LYS B O   1 
ATOM   4484 C  CB  . LYS B 1 162 ? 31.124  19.225  31.709 1.00 47.20 ? 267 LYS B CB  1 
ATOM   4485 C  CG  . LYS B 1 162 ? 30.174  19.171  32.910 1.00 47.73 ? 267 LYS B CG  1 
ATOM   4486 C  CD  . LYS B 1 162 ? 28.756  19.599  32.549 1.00 48.02 ? 267 LYS B CD  1 
ATOM   4487 C  CE  . LYS B 1 162 ? 27.837  19.506  33.751 1.00 47.86 ? 267 LYS B CE  1 
ATOM   4488 N  NZ  . LYS B 1 162 ? 26.446  19.881  33.404 1.00 48.28 ? 267 LYS B NZ  1 
ATOM   4489 N  N   . GLY B 1 163 ? 32.836  17.577  29.387 1.00 47.13 ? 268 GLY B N   1 
ATOM   4490 C  CA  . GLY B 1 163 ? 33.796  17.623  28.282 1.00 47.21 ? 268 GLY B CA  1 
ATOM   4491 C  C   . GLY B 1 163 ? 33.189  17.217  26.950 1.00 47.26 ? 268 GLY B C   1 
ATOM   4492 O  O   . GLY B 1 163 ? 33.550  17.756  25.906 1.00 47.16 ? 268 GLY B O   1 
ATOM   4493 N  N   . PHE B 1 164 ? 32.265  16.261  26.995 1.00 47.32 ? 269 PHE B N   1 
ATOM   4494 C  CA  . PHE B 1 164 ? 31.558  15.794  25.809 1.00 47.46 ? 269 PHE B CA  1 
ATOM   4495 C  C   . PHE B 1 164 ? 30.695  16.916  25.235 1.00 47.55 ? 269 PHE B C   1 
ATOM   4496 O  O   . PHE B 1 164 ? 30.675  17.142  24.023 1.00 47.32 ? 269 PHE B O   1 
ATOM   4497 C  CB  . PHE B 1 164 ? 30.687  14.593  26.180 1.00 47.49 ? 269 PHE B CB  1 
ATOM   4498 C  CG  . PHE B 1 164 ? 30.229  13.782  25.005 1.00 47.45 ? 269 PHE B CG  1 
ATOM   4499 C  CD1 . PHE B 1 164 ? 30.995  12.722  24.536 1.00 47.58 ? 269 PHE B CD1 1 
ATOM   4500 C  CD2 . PHE B 1 164 ? 29.018  14.065  24.376 1.00 47.73 ? 269 PHE B CD2 1 
ATOM   4501 C  CE1 . PHE B 1 164 ? 30.565  11.956  23.448 1.00 47.78 ? 269 PHE B CE1 1 
ATOM   4502 C  CE2 . PHE B 1 164 ? 28.578  13.306  23.289 1.00 47.58 ? 269 PHE B CE2 1 
ATOM   4503 C  CZ  . PHE B 1 164 ? 29.352  12.249  22.825 1.00 47.63 ? 269 PHE B CZ  1 
ATOM   4504 N  N   . SER B 1 165 ? 29.984  17.607  26.125 1.00 47.79 ? 270 SER B N   1 
ATOM   4505 C  CA  . SER B 1 165 ? 29.180  18.779  25.776 1.00 47.93 ? 270 SER B CA  1 
ATOM   4506 C  C   . SER B 1 165 ? 28.716  19.498  27.036 1.00 48.05 ? 270 SER B C   1 
ATOM   4507 O  O   . SER B 1 165 ? 28.581  18.884  28.095 1.00 47.99 ? 270 SER B O   1 
ATOM   4508 C  CB  . SER B 1 165 ? 27.957  18.376  24.948 1.00 47.95 ? 270 SER B CB  1 
ATOM   4509 O  OG  . SER B 1 165 ? 27.016  19.433  24.878 1.00 47.70 ? 270 SER B OG  1 
ATOM   4510 N  N   . GLU B 1 166 ? 28.451  20.795  26.904 1.00 48.33 ? 271 GLU B N   1 
ATOM   4511 C  CA  . GLU B 1 166 ? 27.928  21.607  28.009 1.00 48.56 ? 271 GLU B CA  1 
ATOM   4512 C  C   . GLU B 1 166 ? 26.497  21.222  28.390 1.00 48.51 ? 271 GLU B C   1 
ATOM   4513 O  O   . GLU B 1 166 ? 26.071  21.473  29.516 1.00 48.50 ? 271 GLU B O   1 
ATOM   4514 C  CB  . GLU B 1 166 ? 27.968  23.101  27.664 1.00 48.74 ? 271 GLU B CB  1 
ATOM   4515 C  CG  . GLU B 1 166 ? 29.360  23.720  27.661 1.00 49.73 ? 271 GLU B CG  1 
ATOM   4516 C  CD  . GLU B 1 166 ? 30.100  23.538  26.338 1.00 50.80 ? 271 GLU B CD  1 
ATOM   4517 O  OE1 . GLU B 1 166 ? 30.010  22.438  25.745 1.00 51.33 ? 271 GLU B OE1 1 
ATOM   4518 O  OE2 . GLU B 1 166 ? 30.779  24.495  25.899 1.00 51.12 ? 271 GLU B OE2 1 
ATOM   4519 N  N   . ASP B 1 167 ? 25.766  20.619  27.453 1.00 48.59 ? 272 ASP B N   1 
ATOM   4520 C  CA  . ASP B 1 167 ? 24.387  20.180  27.689 1.00 48.83 ? 272 ASP B CA  1 
ATOM   4521 C  C   . ASP B 1 167 ? 24.298  18.739  28.214 1.00 48.78 ? 272 ASP B C   1 
ATOM   4522 O  O   . ASP B 1 167 ? 23.398  17.997  27.831 1.00 48.80 ? 272 ASP B O   1 
ATOM   4523 C  CB  . ASP B 1 167 ? 23.570  20.276  26.392 1.00 49.03 ? 272 ASP B CB  1 
ATOM   4524 C  CG  . ASP B 1 167 ? 23.536  21.679  25.809 1.00 50.00 ? 272 ASP B CG  1 
ATOM   4525 O  OD1 . ASP B 1 167 ? 24.334  22.547  26.236 1.00 51.25 ? 272 ASP B OD1 1 
ATOM   4526 O  OD2 . ASP B 1 167 ? 22.700  21.908  24.908 1.00 51.18 ? 272 ASP B OD2 1 
ATOM   4527 N  N   . ARG B 1 168 ? 25.216  18.334  29.084 1.00 48.81 ? 273 ARG B N   1 
ATOM   4528 C  CA  . ARG B 1 168 ? 25.176  16.985  29.645 1.00 48.84 ? 273 ARG B CA  1 
ATOM   4529 C  C   . ARG B 1 168 ? 25.219  17.041  31.170 1.00 48.91 ? 273 ARG B C   1 
ATOM   4530 O  O   . ARG B 1 168 ? 26.063  17.721  31.756 1.00 49.02 ? 273 ARG B O   1 
ATOM   4531 C  CB  . ARG B 1 168 ? 26.321  16.139  29.089 1.00 48.74 ? 273 ARG B CB  1 
ATOM   4532 C  CG  . ARG B 1 168 ? 26.251  15.912  27.576 1.00 48.65 ? 273 ARG B CG  1 
ATOM   4533 C  CD  . ARG B 1 168 ? 25.064  15.043  27.190 1.00 48.51 ? 273 ARG B CD  1 
ATOM   4534 N  NE  . ARG B 1 168 ? 25.054  14.654  25.777 1.00 48.68 ? 273 ARG B NE  1 
ATOM   4535 C  CZ  . ARG B 1 168 ? 24.681  15.435  24.761 1.00 48.74 ? 273 ARG B CZ  1 
ATOM   4536 N  NH1 . ARG B 1 168 ? 24.299  16.692  24.959 1.00 48.92 ? 273 ARG B NH1 1 
ATOM   4537 N  NH2 . ARG B 1 168 ? 24.700  14.957  23.523 1.00 48.79 ? 273 ARG B NH2 1 
ATOM   4538 N  N   . LEU B 1 169 ? 24.300  16.320  31.803 1.00 48.91 ? 274 LEU B N   1 
ATOM   4539 C  CA  . LEU B 1 169 ? 24.102  16.401  33.242 1.00 49.03 ? 274 LEU B CA  1 
ATOM   4540 C  C   . LEU B 1 169 ? 24.607  15.153  33.974 1.00 49.14 ? 274 LEU B C   1 
ATOM   4541 O  O   . LEU B 1 169 ? 24.586  14.046  33.431 1.00 49.05 ? 274 LEU B O   1 
ATOM   4542 C  CB  . LEU B 1 169 ? 22.612  16.613  33.524 1.00 49.03 ? 274 LEU B CB  1 
ATOM   4543 C  CG  . LEU B 1 169 ? 22.109  16.619  34.969 1.00 49.01 ? 274 LEU B CG  1 
ATOM   4544 C  CD1 . LEU B 1 169 ? 22.681  17.781  35.768 1.00 49.06 ? 274 LEU B CD1 1 
ATOM   4545 C  CD2 . LEU B 1 169 ? 20.597  16.677  34.970 1.00 49.08 ? 274 LEU B CD2 1 
ATOM   4546 N  N   . LEU B 1 170 ? 25.070  15.354  35.208 1.00 49.33 ? 275 LEU B N   1 
ATOM   4547 C  CA  . LEU B 1 170 ? 25.377  14.265  36.139 1.00 49.40 ? 275 LEU B CA  1 
ATOM   4548 C  C   . LEU B 1 170 ? 24.641  14.507  37.457 1.00 49.42 ? 275 LEU B C   1 
ATOM   4549 O  O   . LEU B 1 170 ? 24.741  15.580  38.041 1.00 49.27 ? 275 LEU B O   1 
ATOM   4550 C  CB  . LEU B 1 170 ? 26.885  14.171  36.383 1.00 49.27 ? 275 LEU B CB  1 
ATOM   4551 C  CG  . LEU B 1 170 ? 27.361  13.202  37.470 1.00 49.25 ? 275 LEU B CG  1 
ATOM   4552 C  CD1 . LEU B 1 170 ? 26.870  11.789  37.203 1.00 49.52 ? 275 LEU B CD1 1 
ATOM   4553 C  CD2 . LEU B 1 170 ? 28.870  13.217  37.569 1.00 49.43 ? 275 LEU B CD2 1 
ATOM   4554 N  N   . ILE B 1 171 ? 23.907  13.499  37.915 1.00 49.89 ? 276 ILE B N   1 
ATOM   4555 C  CA  . ILE B 1 171 ? 23.141  13.578  39.160 1.00 50.22 ? 276 ILE B CA  1 
ATOM   4556 C  C   . ILE B 1 171 ? 23.687  12.570  40.175 1.00 50.42 ? 276 ILE B C   1 
ATOM   4557 O  O   . ILE B 1 171 ? 23.735  11.377  39.898 1.00 50.46 ? 276 ILE B O   1 
ATOM   4558 C  CB  . ILE B 1 171 ? 21.637  13.261  38.915 1.00 50.22 ? 276 ILE B CB  1 
ATOM   4559 C  CG1 . ILE B 1 171 ? 21.068  14.164  37.816 1.00 50.47 ? 276 ILE B CG1 1 
ATOM   4560 C  CG2 . ILE B 1 171 ? 20.827  13.423  40.206 1.00 49.98 ? 276 ILE B CG2 1 
ATOM   4561 C  CD1 . ILE B 1 171 ? 19.791  13.642  37.189 1.00 50.49 ? 276 ILE B CD1 1 
ATOM   4562 N  N   . ALA B 1 172 ? 24.099  13.057  41.342 1.00 50.74 ? 277 ALA B N   1 
ATOM   4563 C  CA  . ALA B 1 172 ? 24.471  12.192  42.466 1.00 50.90 ? 277 ALA B CA  1 
ATOM   4564 C  C   . ALA B 1 172 ? 23.293  12.096  43.422 1.00 51.10 ? 277 ALA B C   1 
ATOM   4565 O  O   . ALA B 1 172 ? 22.452  12.990  43.460 1.00 51.06 ? 277 ALA B O   1 
ATOM   4566 C  CB  . ALA B 1 172 ? 25.683  12.745  43.188 1.00 50.84 ? 277 ALA B CB  1 
ATOM   4567 N  N   . GLY B 1 173 ? 23.234  11.007  44.185 1.00 51.40 ? 278 GLY B N   1 
ATOM   4568 C  CA  . GLY B 1 173 ? 22.167  10.793  45.157 1.00 51.69 ? 278 GLY B CA  1 
ATOM   4569 C  C   . GLY B 1 173 ? 22.667  10.089  46.405 1.00 51.97 ? 278 GLY B C   1 
ATOM   4570 O  O   . GLY B 1 173 ? 23.444  9.140   46.312 1.00 51.84 ? 278 GLY B O   1 
ATOM   4571 N  N   . THR B 1 174 ? 22.209  10.551  47.568 1.00 52.44 ? 279 THR B N   1 
ATOM   4572 C  CA  . THR B 1 174 ? 22.563  9.949   48.856 1.00 52.90 ? 279 THR B CA  1 
ATOM   4573 C  C   . THR B 1 174 ? 21.311  9.516   49.616 1.00 53.33 ? 279 THR B C   1 
ATOM   4574 O  O   . THR B 1 174 ? 20.277  10.169  49.539 1.00 53.57 ? 279 THR B O   1 
ATOM   4575 C  CB  . THR B 1 174 ? 23.398  10.911  49.748 1.00 52.84 ? 279 THR B CB  1 
ATOM   4576 O  OG1 . THR B 1 174 ? 23.602  10.323  51.040 1.00 52.91 ? 279 THR B OG1 1 
ATOM   4577 C  CG2 . THR B 1 174 ? 22.716  12.268  49.913 1.00 52.81 ? 279 THR B CG2 1 
ATOM   4578 N  N   . ASN B 1 175 ? 21.417  8.410   50.346 1.00 53.89 ? 280 ASN B N   1 
ATOM   4579 C  CA  . ASN B 1 175 ? 20.323  7.898   51.165 1.00 54.32 ? 280 ASN B CA  1 
ATOM   4580 C  C   . ASN B 1 175 ? 20.482  8.326   52.636 1.00 54.86 ? 280 ASN B C   1 
ATOM   4581 O  O   . ASN B 1 175 ? 19.788  7.815   53.521 1.00 54.75 ? 280 ASN B O   1 
ATOM   4582 C  CB  . ASN B 1 175 ? 20.271  6.366   51.041 1.00 54.32 ? 280 ASN B CB  1 
ATOM   4583 C  CG  . ASN B 1 175 ? 18.895  5.788   51.347 1.00 54.05 ? 280 ASN B CG  1 
ATOM   4584 O  OD1 . ASN B 1 175 ? 17.868  6.430   51.137 1.00 53.72 ? 280 ASN B OD1 1 
ATOM   4585 N  ND2 . ASN B 1 175 ? 18.875  4.557   51.839 1.00 54.28 ? 280 ASN B ND2 1 
ATOM   4586 N  N   . SER B 1 176 ? 21.396  9.268   52.887 1.00 55.50 ? 281 SER B N   1 
ATOM   4587 C  CA  . SER B 1 176 ? 21.666  9.771   54.238 1.00 55.85 ? 281 SER B CA  1 
ATOM   4588 C  C   . SER B 1 176 ? 20.587  10.736  54.718 1.00 56.27 ? 281 SER B C   1 
ATOM   4589 O  O   . SER B 1 176 ? 19.848  11.312  53.916 1.00 56.25 ? 281 SER B O   1 
ATOM   4590 C  CB  . SER B 1 176 ? 23.024  10.476  54.285 1.00 55.91 ? 281 SER B CB  1 
ATOM   4591 O  OG  . SER B 1 176 ? 23.385  10.804  55.618 1.00 55.86 ? 281 SER B OG  1 
ATOM   4592 N  N   . SER B 1 177 ? 20.532  10.922  56.036 1.00 56.87 ? 282 SER B N   1 
ATOM   4593 C  CA  . SER B 1 177 ? 19.490  11.724  56.688 1.00 57.24 ? 282 SER B CA  1 
ATOM   4594 C  C   . SER B 1 177 ? 19.711  13.239  56.565 1.00 57.70 ? 282 SER B C   1 
ATOM   4595 O  O   . SER B 1 177 ? 18.993  13.901  55.821 1.00 57.82 ? 282 SER B O   1 
ATOM   4596 C  CB  . SER B 1 177 ? 19.368  11.333  58.166 1.00 57.23 ? 282 SER B CB  1 
ATOM   4597 O  OG  . SER B 1 177 ? 20.597  11.522  58.843 1.00 57.06 ? 282 SER B OG  1 
ATOM   4598 N  N   . ASP B 1 178 ? 20.692  13.779  57.294 1.00 58.19 ? 283 ASP B N   1 
ATOM   4599 C  CA  . ASP B 1 178 ? 20.903  15.235  57.384 1.00 58.44 ? 283 ASP B CA  1 
ATOM   4600 C  C   . ASP B 1 178 ? 22.366  15.555  57.715 1.00 58.85 ? 283 ASP B C   1 
ATOM   4601 O  O   . ASP B 1 178 ? 23.129  14.655  58.070 1.00 59.10 ? 283 ASP B O   1 
ATOM   4602 C  CB  . ASP B 1 178 ? 19.969  15.826  58.456 1.00 58.46 ? 283 ASP B CB  1 
ATOM   4603 C  CG  . ASP B 1 178 ? 19.678  17.312  58.245 1.00 58.31 ? 283 ASP B CG  1 
ATOM   4604 O  OD1 . ASP B 1 178 ? 20.613  18.138  58.365 1.00 58.21 ? 283 ASP B OD1 1 
ATOM   4605 O  OD2 . ASP B 1 178 ? 18.505  17.656  57.980 1.00 57.74 ? 283 ASP B OD2 1 
ATOM   4606 N  N   . LEU B 1 179 ? 22.749  16.828  57.570 1.00 59.21 ? 284 LEU B N   1 
ATOM   4607 C  CA  . LEU B 1 179 ? 24.068  17.359  57.989 1.00 59.41 ? 284 LEU B CA  1 
ATOM   4608 C  C   . LEU B 1 179 ? 25.275  16.779  57.238 1.00 59.70 ? 284 LEU B C   1 
ATOM   4609 O  O   . LEU B 1 179 ? 26.186  17.519  56.868 1.00 59.74 ? 284 LEU B O   1 
ATOM   4610 C  CB  . LEU B 1 179 ? 24.287  17.197  59.498 1.00 59.39 ? 284 LEU B CB  1 
ATOM   4611 C  CG  . LEU B 1 179 ? 25.363  18.130  60.076 1.00 59.27 ? 284 LEU B CG  1 
ATOM   4612 C  CD1 . LEU B 1 179 ? 24.756  19.460  60.509 1.00 59.23 ? 284 LEU B CD1 1 
ATOM   4613 C  CD2 . LEU B 1 179 ? 26.088  17.475  61.237 1.00 59.39 ? 284 LEU B CD2 1 
ATOM   4614 N  N   . GLN B 1 180 ? 25.300  15.462  57.057 1.00 60.01 ? 285 GLN B N   1 
ATOM   4615 C  CA  . GLN B 1 180 ? 26.297  14.815  56.211 1.00 60.21 ? 285 GLN B CA  1 
ATOM   4616 C  C   . GLN B 1 180 ? 26.117  15.234  54.751 1.00 60.50 ? 285 GLN B C   1 
ATOM   4617 O  O   . GLN B 1 180 ? 27.094  15.318  54.008 1.00 60.52 ? 285 GLN B O   1 
ATOM   4618 C  CB  . GLN B 1 180 ? 26.197  13.291  56.334 1.00 60.17 ? 285 GLN B CB  1 
ATOM   4619 C  CG  . GLN B 1 180 ? 27.352  12.532  55.692 1.00 60.08 ? 285 GLN B CG  1 
ATOM   4620 C  CD  . GLN B 1 180 ? 27.216  11.020  55.817 1.00 60.15 ? 285 GLN B CD  1 
ATOM   4621 O  OE1 . GLN B 1 180 ? 26.125  10.493  56.045 1.00 60.02 ? 285 GLN B OE1 1 
ATOM   4622 N  NE2 . GLN B 1 180 ? 28.329  10.316  55.656 1.00 59.92 ? 285 GLN B NE2 1 
ATOM   4623 N  N   . GLN B 1 181 ? 24.873  15.494  54.343 1.00 60.78 ? 286 GLN B N   1 
ATOM   4624 C  CA  . GLN B 1 181 ? 24.592  15.912  52.961 1.00 61.06 ? 286 GLN B CA  1 
ATOM   4625 C  C   . GLN B 1 181 ? 24.843  17.397  52.715 1.00 61.29 ? 286 GLN B C   1 
ATOM   4626 O  O   . GLN B 1 181 ? 25.109  17.793  51.576 1.00 61.41 ? 286 GLN B O   1 
ATOM   4627 C  CB  . GLN B 1 181 ? 23.176  15.517  52.522 1.00 61.10 ? 286 GLN B CB  1 
ATOM   4628 C  CG  . GLN B 1 181 ? 22.044  16.095  53.357 1.00 61.25 ? 286 GLN B CG  1 
ATOM   4629 C  CD  . GLN B 1 181 ? 20.944  15.083  53.659 1.00 61.40 ? 286 GLN B CD  1 
ATOM   4630 O  OE1 . GLN B 1 181 ? 21.044  13.896  53.334 1.00 61.96 ? 286 GLN B OE1 1 
ATOM   4631 N  NE2 . GLN B 1 181 ? 19.889  15.556  54.294 1.00 62.07 ? 286 GLN B NE2 1 
ATOM   4632 N  N   . ILE B 1 182 ? 24.756  18.217  53.767 1.00 61.51 ? 287 ILE B N   1 
ATOM   4633 C  CA  . ILE B 1 182 ? 25.254  19.596  53.701 1.00 61.61 ? 287 ILE B CA  1 
ATOM   4634 C  C   . ILE B 1 182 ? 26.781  19.541  53.652 1.00 61.83 ? 287 ILE B C   1 
ATOM   4635 O  O   . ILE B 1 182 ? 27.427  20.369  53.001 1.00 61.75 ? 287 ILE B O   1 
ATOM   4636 C  CB  . ILE B 1 182 ? 24.816  20.457  54.912 1.00 61.58 ? 287 ILE B CB  1 
ATOM   4637 C  CG1 . ILE B 1 182 ? 23.296  20.629  54.955 1.00 61.41 ? 287 ILE B CG1 1 
ATOM   4638 C  CG2 . ILE B 1 182 ? 25.480  21.840  54.853 1.00 61.61 ? 287 ILE B CG2 1 
ATOM   4639 C  CD1 . ILE B 1 182 ? 22.799  21.271  56.246 1.00 61.43 ? 287 ILE B CD1 1 
ATOM   4640 N  N   . LEU B 1 183 ? 27.345  18.560  54.357 1.00 62.16 ? 288 LEU B N   1 
ATOM   4641 C  CA  . LEU B 1 183 ? 28.779  18.292  54.322 1.00 62.41 ? 288 LEU B CA  1 
ATOM   4642 C  C   . LEU B 1 183 ? 29.165  17.745  52.944 1.00 62.70 ? 288 LEU B C   1 
ATOM   4643 O  O   . LEU B 1 183 ? 30.220  18.086  52.415 1.00 62.65 ? 288 LEU B O   1 
ATOM   4644 C  CB  . LEU B 1 183 ? 29.167  17.306  55.436 1.00 62.36 ? 288 LEU B CB  1 
ATOM   4645 C  CG  . LEU B 1 183 ? 30.581  17.373  56.020 1.00 62.41 ? 288 LEU B CG  1 
ATOM   4646 C  CD1 . LEU B 1 183 ? 30.804  18.665  56.804 1.00 62.51 ? 288 LEU B CD1 1 
ATOM   4647 C  CD2 . LEU B 1 183 ? 30.841  16.161  56.915 1.00 62.47 ? 288 LEU B CD2 1 
ATOM   4648 N  N   . SER B 1 184 ? 28.292  16.924  52.356 1.00 63.17 ? 289 SER B N   1 
ATOM   4649 C  CA  . SER B 1 184 ? 28.524  16.355  51.017 1.00 63.51 ? 289 SER B CA  1 
ATOM   4650 C  C   . SER B 1 184 ? 28.531  17.390  49.890 1.00 63.82 ? 289 SER B C   1 
ATOM   4651 O  O   . SER B 1 184 ? 28.916  17.072  48.762 1.00 63.91 ? 289 SER B O   1 
ATOM   4652 C  CB  . SER B 1 184 ? 27.498  15.267  50.692 1.00 63.57 ? 289 SER B CB  1 
ATOM   4653 O  OG  . SER B 1 184 ? 27.715  14.114  51.484 1.00 63.82 ? 289 SER B OG  1 
ATOM   4654 N  N   . LEU B 1 185 ? 28.106  18.617  50.189 1.00 64.13 ? 290 LEU B N   1 
ATOM   4655 C  CA  . LEU B 1 185 ? 28.413  19.765  49.325 1.00 64.40 ? 290 LEU B CA  1 
ATOM   4656 C  C   . LEU B 1 185 ? 29.858  20.271  49.563 1.00 64.57 ? 290 LEU B C   1 
ATOM   4657 O  O   . LEU B 1 185 ? 30.173  21.450  49.363 1.00 64.36 ? 290 LEU B O   1 
ATOM   4658 C  CB  . LEU B 1 185 ? 27.361  20.872  49.485 1.00 64.50 ? 290 LEU B CB  1 
ATOM   4659 C  CG  . LEU B 1 185 ? 26.028  20.517  48.807 1.00 64.71 ? 290 LEU B CG  1 
ATOM   4660 C  CD1 . LEU B 1 185 ? 24.843  21.226  49.455 1.00 64.93 ? 290 LEU B CD1 1 
ATOM   4661 C  CD2 . LEU B 1 185 ? 26.087  20.819  47.311 1.00 64.79 ? 290 LEU B CD2 1 
ATOM   4662 N  N   . LEU B 1 186 ? 30.718  19.357  50.014 1.00 64.84 ? 291 LEU B N   1 
ATOM   4663 C  CA  . LEU B 1 186 ? 32.154  19.443  49.789 1.00 65.05 ? 291 LEU B CA  1 
ATOM   4664 C  C   . LEU B 1 186 ? 32.367  19.594  48.289 1.00 65.24 ? 291 LEU B C   1 
ATOM   4665 O  O   . LEU B 1 186 ? 33.021  20.531  47.829 1.00 65.26 ? 291 LEU B O   1 
ATOM   4666 C  CB  . LEU B 1 186 ? 32.839  18.158  50.283 1.00 65.07 ? 291 LEU B CB  1 
ATOM   4667 C  CG  . LEU B 1 186 ? 34.369  18.060  50.222 1.00 65.06 ? 291 LEU B CG  1 
ATOM   4668 C  CD1 . LEU B 1 186 ? 35.015  18.769  51.418 1.00 65.02 ? 291 LEU B CD1 1 
ATOM   4669 C  CD2 . LEU B 1 186 ? 34.807  16.598  50.167 1.00 65.07 ? 291 LEU B CD2 1 
ATOM   4670 N  N   . GLU B 1 187 ? 31.788  18.661  47.537 1.00 65.50 ? 292 GLU B N   1 
ATOM   4671 C  CA  . GLU B 1 187 ? 31.831  18.690  46.079 1.00 65.66 ? 292 GLU B CA  1 
ATOM   4672 C  C   . GLU B 1 187 ? 31.372  20.029  45.520 1.00 65.91 ? 292 GLU B C   1 
ATOM   4673 O  O   . GLU B 1 187 ? 32.067  20.630  44.694 1.00 66.15 ? 292 GLU B O   1 
ATOM   4674 C  CB  . GLU B 1 187 ? 30.966  17.566  45.479 1.00 65.66 ? 292 GLU B CB  1 
ATOM   4675 C  CG  . GLU B 1 187 ? 31.770  16.433  44.870 1.00 65.62 ? 292 GLU B CG  1 
ATOM   4676 C  CD  . GLU B 1 187 ? 32.642  16.904  43.711 1.00 65.77 ? 292 GLU B CD  1 
ATOM   4677 O  OE1 . GLU B 1 187 ? 32.093  17.445  42.724 1.00 65.53 ? 292 GLU B OE1 1 
ATOM   4678 O  OE2 . GLU B 1 187 ? 33.878  16.742  43.795 1.00 65.80 ? 292 GLU B OE2 1 
ATOM   4679 N  N   . SER B 1 188 ? 30.209  20.487  45.987 1.00 66.01 ? 293 SER B N   1 
ATOM   4680 C  CA  . SER B 1 188 ? 29.524  21.647  45.414 1.00 66.04 ? 293 SER B CA  1 
ATOM   4681 C  C   . SER B 1 188 ? 29.125  21.284  43.982 1.00 66.12 ? 293 SER B C   1 
ATOM   4682 O  O   . SER B 1 188 ? 28.923  20.101  43.684 1.00 66.14 ? 293 SER B O   1 
ATOM   4683 C  CB  . SER B 1 188 ? 30.401  22.914  45.473 1.00 66.15 ? 293 SER B CB  1 
ATOM   4684 O  OG  . SER B 1 188 ? 29.624  24.097  45.325 1.00 66.08 ? 293 SER B OG  1 
ATOM   4685 N  N   . ASN B 1 189 ? 29.007  22.281  43.106 1.00 66.11 ? 294 ASN B N   1 
ATOM   4686 C  CA  . ASN B 1 189 ? 28.560  22.057  41.733 1.00 66.06 ? 294 ASN B CA  1 
ATOM   4687 C  C   . ASN B 1 189 ? 29.421  22.789  40.709 1.00 65.93 ? 294 ASN B C   1 
ATOM   4688 O  O   . ASN B 1 189 ? 29.704  23.979  40.866 1.00 66.17 ? 294 ASN B O   1 
ATOM   4689 C  CB  . ASN B 1 189 ? 27.115  22.546  41.566 1.00 66.31 ? 294 ASN B CB  1 
ATOM   4690 C  CG  . ASN B 1 189 ? 26.205  22.123  42.710 1.00 67.26 ? 294 ASN B CG  1 
ATOM   4691 O  OD1 . ASN B 1 189 ? 26.339  21.023  43.250 1.00 68.69 ? 294 ASN B OD1 1 
ATOM   4692 N  ND2 . ASN B 1 189 ? 25.263  22.994  43.076 1.00 67.96 ? 294 ASN B ND2 1 
ATOM   4693 N  N   . LYS B 1 190 ? 29.850  22.071  39.673 1.00 65.58 ? 295 LYS B N   1 
ATOM   4694 C  CA  . LYS B 1 190 ? 30.151  22.697  38.383 1.00 65.31 ? 295 LYS B CA  1 
ATOM   4695 C  C   . LYS B 1 190 ? 28.756  22.813  37.761 1.00 64.57 ? 295 LYS B C   1 
ATOM   4696 O  O   . LYS B 1 190 ? 28.287  23.910  37.439 1.00 64.51 ? 295 LYS B O   1 
ATOM   4697 C  CB  . LYS B 1 190 ? 31.108  21.830  37.549 1.00 65.41 ? 295 LYS B CB  1 
ATOM   4698 C  CG  . LYS B 1 190 ? 31.673  22.508  36.295 1.00 65.64 ? 295 LYS B CG  1 
ATOM   4699 C  CD  . LYS B 1 190 ? 32.866  23.412  36.616 1.00 65.89 ? 295 LYS B CD  1 
ATOM   4700 C  CE  . LYS B 1 190 ? 33.358  24.157  35.376 1.00 65.78 ? 295 LYS B CE  1 
ATOM   4701 N  NZ  . LYS B 1 190 ? 34.532  25.032  35.662 1.00 65.68 ? 295 LYS B NZ  1 
ATOM   4702 N  N   . ASP B 1 191 ? 28.107  21.662  37.609 1.00 63.68 ? 296 ASP B N   1 
ATOM   4703 C  CA  . ASP B 1 191 ? 26.657  21.552  37.755 1.00 62.98 ? 296 ASP B CA  1 
ATOM   4704 C  C   . ASP B 1 191 ? 26.326  20.090  38.055 1.00 62.55 ? 296 ASP B C   1 
ATOM   4705 O  O   . ASP B 1 191 ? 25.749  19.364  37.235 1.00 62.50 ? 296 ASP B O   1 
ATOM   4706 C  CB  . ASP B 1 191 ? 25.855  22.110  36.567 1.00 63.28 ? 296 ASP B CB  1 
ATOM   4707 C  CG  . ASP B 1 191 ? 24.449  22.591  36.986 1.00 63.55 ? 296 ASP B CG  1 
ATOM   4708 O  OD1 . ASP B 1 191 ? 24.028  23.690  36.545 1.00 63.10 ? 296 ASP B OD1 1 
ATOM   4709 O  OD2 . ASP B 1 191 ? 23.776  21.874  37.770 1.00 63.38 ? 296 ASP B OD2 1 
ATOM   4710 N  N   . LEU B 1 192 ? 26.754  19.685  39.250 1.00 61.76 ? 297 LEU B N   1 
ATOM   4711 C  CA  . LEU B 1 192 ? 26.422  18.400  39.843 1.00 61.21 ? 297 LEU B CA  1 
ATOM   4712 C  C   . LEU B 1 192 ? 25.147  18.564  40.666 1.00 60.64 ? 297 LEU B C   1 
ATOM   4713 O  O   . LEU B 1 192 ? 25.114  19.357  41.605 1.00 60.53 ? 297 LEU B O   1 
ATOM   4714 C  CB  . LEU B 1 192 ? 27.565  17.963  40.761 1.00 61.20 ? 297 LEU B CB  1 
ATOM   4715 C  CG  . LEU B 1 192 ? 27.403  16.653  41.537 1.00 61.40 ? 297 LEU B CG  1 
ATOM   4716 C  CD1 . LEU B 1 192 ? 28.286  15.566  40.945 1.00 61.32 ? 297 LEU B CD1 1 
ATOM   4717 C  CD2 . LEU B 1 192 ? 27.743  16.868  42.997 1.00 61.30 ? 297 LEU B CD2 1 
ATOM   4718 N  N   . LEU B 1 193 ? 24.100  17.822  40.316 1.00 59.97 ? 298 LEU B N   1 
ATOM   4719 C  CA  . LEU B 1 193 ? 22.867  17.815  41.100 1.00 59.49 ? 298 LEU B CA  1 
ATOM   4720 C  C   . LEU B 1 193 ? 22.927  16.741  42.177 1.00 58.99 ? 298 LEU B C   1 
ATOM   4721 O  O   . LEU B 1 193 ? 23.100  15.566  41.870 1.00 59.05 ? 298 LEU B O   1 
ATOM   4722 C  CB  . LEU B 1 193 ? 21.652  17.551  40.207 1.00 59.45 ? 298 LEU B CB  1 
ATOM   4723 C  CG  . LEU B 1 193 ? 21.233  18.633  39.213 1.00 59.50 ? 298 LEU B CG  1 
ATOM   4724 C  CD1 . LEU B 1 193 ? 19.936  18.216  38.531 1.00 59.33 ? 298 LEU B CD1 1 
ATOM   4725 C  CD2 . LEU B 1 193 ? 21.072  19.987  39.892 1.00 59.61 ? 298 LEU B CD2 1 
ATOM   4726 N  N   . LEU B 1 194 ? 22.780  17.144  43.434 1.00 58.42 ? 299 LEU B N   1 
ATOM   4727 C  CA  . LEU B 1 194 ? 22.650  16.199  44.538 1.00 58.12 ? 299 LEU B CA  1 
ATOM   4728 C  C   . LEU B 1 194 ? 21.167  16.008  44.857 1.00 57.74 ? 299 LEU B C   1 
ATOM   4729 O  O   . LEU B 1 194 ? 20.367  16.921  44.670 1.00 57.78 ? 299 LEU B O   1 
ATOM   4730 C  CB  . LEU B 1 194 ? 23.402  16.707  45.773 1.00 58.04 ? 299 LEU B CB  1 
ATOM   4731 C  CG  . LEU B 1 194 ? 23.455  15.785  46.997 1.00 58.15 ? 299 LEU B CG  1 
ATOM   4732 C  CD1 . LEU B 1 194 ? 24.243  14.525  46.693 1.00 58.40 ? 299 LEU B CD1 1 
ATOM   4733 C  CD2 . LEU B 1 194 ? 24.060  16.499  48.187 1.00 58.04 ? 299 LEU B CD2 1 
ATOM   4734 N  N   . THR B 1 195 ? 20.809  14.813  45.320 1.00 57.43 ? 300 THR B N   1 
ATOM   4735 C  CA  . THR B 1 195 ? 19.450  14.516  45.787 1.00 57.19 ? 300 THR B CA  1 
ATOM   4736 C  C   . THR B 1 195 ? 19.536  13.722  47.083 1.00 56.94 ? 300 THR B C   1 
ATOM   4737 O  O   . THR B 1 195 ? 20.449  12.915  47.260 1.00 56.85 ? 300 THR B O   1 
ATOM   4738 C  CB  . THR B 1 195 ? 18.658  13.692  44.766 1.00 57.10 ? 300 THR B CB  1 
ATOM   4739 O  OG1 . THR B 1 195 ? 19.445  12.573  44.351 1.00 57.26 ? 300 THR B OG1 1 
ATOM   4740 C  CG2 . THR B 1 195 ? 18.293  14.532  43.553 1.00 56.91 ? 300 THR B CG2 1 
ATOM   4741 N  N   . SER B 1 196 ? 18.586  13.950  47.985 1.00 56.61 ? 301 SER B N   1 
ATOM   4742 C  CA  . SER B 1 196 ? 18.661  13.373  49.315 1.00 56.51 ? 301 SER B CA  1 
ATOM   4743 C  C   . SER B 1 196 ? 17.337  13.455  50.057 1.00 56.40 ? 301 SER B C   1 
ATOM   4744 O  O   . SER B 1 196 ? 16.366  14.025  49.558 1.00 56.49 ? 301 SER B O   1 
ATOM   4745 C  CB  . SER B 1 196 ? 19.731  14.102  50.127 1.00 56.58 ? 301 SER B CB  1 
ATOM   4746 O  OG  . SER B 1 196 ? 19.321  15.423  50.430 1.00 56.65 ? 301 SER B OG  1 
ATOM   4747 N  N   . SER B 1 197 ? 17.321  12.888  51.262 1.00 56.27 ? 302 SER B N   1 
ATOM   4748 C  CA  . SER B 1 197 ? 16.163  12.934  52.152 1.00 56.24 ? 302 SER B CA  1 
ATOM   4749 C  C   . SER B 1 197 ? 16.315  14.072  53.173 1.00 56.09 ? 302 SER B C   1 
ATOM   4750 O  O   . SER B 1 197 ? 16.099  13.891  54.370 1.00 55.91 ? 302 SER B O   1 
ATOM   4751 C  CB  . SER B 1 197 ? 16.001  11.573  52.840 1.00 56.26 ? 302 SER B CB  1 
ATOM   4752 O  OG  . SER B 1 197 ? 17.265  11.028  53.178 1.00 56.50 ? 302 SER B OG  1 
ATOM   4753 N  N   . TYR B 1 198 ? 16.668  15.252  52.670 1.00 56.03 ? 303 TYR B N   1 
ATOM   4754 C  CA  . TYR B 1 198 ? 16.969  16.419  53.495 1.00 56.07 ? 303 TYR B CA  1 
ATOM   4755 C  C   . TYR B 1 198 ? 15.700  17.046  54.065 1.00 56.14 ? 303 TYR B C   1 
ATOM   4756 O  O   . TYR B 1 198 ? 15.636  17.337  55.260 1.00 56.06 ? 303 TYR B O   1 
ATOM   4757 C  CB  . TYR B 1 198 ? 17.761  17.440  52.660 1.00 55.87 ? 303 TYR B CB  1 
ATOM   4758 C  CG  . TYR B 1 198 ? 18.142  18.721  53.376 1.00 55.84 ? 303 TYR B CG  1 
ATOM   4759 C  CD1 . TYR B 1 198 ? 17.451  19.909  53.138 1.00 55.70 ? 303 TYR B CD1 1 
ATOM   4760 C  CD2 . TYR B 1 198 ? 19.202  18.752  54.272 1.00 55.34 ? 303 TYR B CD2 1 
ATOM   4761 C  CE1 . TYR B 1 198 ? 17.799  21.084  53.787 1.00 55.59 ? 303 TYR B CE1 1 
ATOM   4762 C  CE2 . TYR B 1 198 ? 19.558  19.919  54.919 1.00 55.48 ? 303 TYR B CE2 1 
ATOM   4763 C  CZ  . TYR B 1 198 ? 18.855  21.083  54.677 1.00 55.46 ? 303 TYR B CZ  1 
ATOM   4764 O  OH  . TYR B 1 198 ? 19.212  22.244  55.327 1.00 55.43 ? 303 TYR B OH  1 
ATOM   4765 N  N   . LEU B 1 199 ? 14.696  17.244  53.211 1.00 56.36 ? 304 LEU B N   1 
ATOM   4766 C  CA  . LEU B 1 199 ? 13.420  17.834  53.630 1.00 56.58 ? 304 LEU B CA  1 
ATOM   4767 C  C   . LEU B 1 199 ? 12.431  16.815  54.208 1.00 56.74 ? 304 LEU B C   1 
ATOM   4768 O  O   . LEU B 1 199 ? 11.414  17.205  54.781 1.00 56.81 ? 304 LEU B O   1 
ATOM   4769 C  CB  . LEU B 1 199 ? 12.751  18.548  52.456 1.00 56.50 ? 304 LEU B CB  1 
ATOM   4770 C  CG  . LEU B 1 199 ? 13.545  19.632  51.731 1.00 56.69 ? 304 LEU B CG  1 
ATOM   4771 C  CD1 . LEU B 1 199 ? 12.719  20.152  50.559 1.00 57.05 ? 304 LEU B CD1 1 
ATOM   4772 C  CD2 . LEU B 1 199 ? 13.932  20.770  52.661 1.00 56.58 ? 304 LEU B CD2 1 
ATOM   4773 N  N   . SER B 1 200 ? 12.716  15.524  54.047 1.00 57.01 ? 305 SER B N   1 
ATOM   4774 C  CA  . SER B 1 200 ? 11.809  14.471  54.508 1.00 57.21 ? 305 SER B CA  1 
ATOM   4775 C  C   . SER B 1 200 ? 12.053  14.147  55.974 1.00 57.42 ? 305 SER B C   1 
ATOM   4776 O  O   . SER B 1 200 ? 12.606  13.097  56.305 1.00 57.28 ? 305 SER B O   1 
ATOM   4777 C  CB  . SER B 1 200 ? 11.974  13.204  53.660 1.00 57.28 ? 305 SER B CB  1 
ATOM   4778 O  OG  . SER B 1 200 ? 13.258  12.628  53.822 1.00 57.10 ? 305 SER B OG  1 
ATOM   4779 N  N   . ASP B 1 201 ? 11.638  15.057  56.851 1.00 57.77 ? 306 ASP B N   1 
ATOM   4780 C  CA  . ASP B 1 201 ? 11.828  14.875  58.291 1.00 57.95 ? 306 ASP B CA  1 
ATOM   4781 C  C   . ASP B 1 201 ? 10.983  15.844  59.120 1.00 58.19 ? 306 ASP B C   1 
ATOM   4782 O  O   . ASP B 1 201 ? 10.310  15.428  60.068 1.00 58.23 ? 306 ASP B O   1 
ATOM   4783 C  CB  . ASP B 1 201 ? 13.310  15.024  58.670 1.00 58.03 ? 306 ASP B CB  1 
ATOM   4784 C  CG  . ASP B 1 201 ? 13.683  14.207  59.898 1.00 58.00 ? 306 ASP B CG  1 
ATOM   4785 O  OD1 . ASP B 1 201 ? 13.625  12.958  59.830 1.00 58.03 ? 306 ASP B OD1 1 
ATOM   4786 O  OD2 . ASP B 1 201 ? 14.042  14.812  60.930 1.00 58.54 ? 306 ASP B OD2 1 
ATOM   4787 N  N   . SER B 1 202 ? 11.027  17.130  58.772 1.00 58.33 ? 307 SER B N   1 
ATOM   4788 C  CA  . SER B 1 202 ? 10.304  18.153  59.525 1.00 58.43 ? 307 SER B CA  1 
ATOM   4789 C  C   . SER B 1 202 ? 9.407   19.006  58.633 1.00 58.52 ? 307 SER B C   1 
ATOM   4790 O  O   . SER B 1 202 ? 9.879   19.900  57.922 1.00 58.45 ? 307 SER B O   1 
ATOM   4791 C  CB  . SER B 1 202 ? 11.284  19.042  60.295 1.00 58.56 ? 307 SER B CB  1 
ATOM   4792 O  OG  . SER B 1 202 ? 11.892  18.324  61.358 1.00 58.70 ? 307 SER B OG  1 
ATOM   4793 N  N   . GLY B 1 203 ? 8.111   18.700  58.676 1.00 58.59 ? 308 GLY B N   1 
ATOM   4794 C  CA  . GLY B 1 203 ? 7.075   19.535  58.071 1.00 58.53 ? 308 GLY B CA  1 
ATOM   4795 C  C   . GLY B 1 203 ? 6.028   19.954  59.088 1.00 58.55 ? 308 GLY B C   1 
ATOM   4796 O  O   . GLY B 1 203 ? 4.934   20.384  58.718 1.00 58.59 ? 308 GLY B O   1 
ATOM   4797 N  N   . SER B 1 204 ? 6.364   19.831  60.372 1.00 58.44 ? 309 SER B N   1 
ATOM   4798 C  CA  . SER B 1 204 ? 5.431   20.138  61.455 1.00 58.34 ? 309 SER B CA  1 
ATOM   4799 C  C   . SER B 1 204 ? 5.315   21.644  61.717 1.00 58.26 ? 309 SER B C   1 
ATOM   4800 O  O   . SER B 1 204 ? 4.315   22.104  62.280 1.00 58.32 ? 309 SER B O   1 
ATOM   4801 C  CB  . SER B 1 204 ? 5.858   19.416  62.737 1.00 58.41 ? 309 SER B CB  1 
ATOM   4802 O  OG  . SER B 1 204 ? 7.200   19.725  63.070 1.00 58.59 ? 309 SER B OG  1 
ATOM   4803 N  N   . THR B 1 205 ? 6.340   22.401  61.321 1.00 58.02 ? 310 THR B N   1 
ATOM   4804 C  CA  . THR B 1 205 ? 6.340   23.854  61.484 1.00 57.76 ? 310 THR B CA  1 
ATOM   4805 C  C   . THR B 1 205 ? 6.880   24.540  60.234 1.00 57.55 ? 310 THR B C   1 
ATOM   4806 O  O   . THR B 1 205 ? 7.684   23.968  59.491 1.00 57.40 ? 310 THR B O   1 
ATOM   4807 C  CB  . THR B 1 205 ? 7.199   24.298  62.695 1.00 57.77 ? 310 THR B CB  1 
ATOM   4808 O  OG1 . THR B 1 205 ? 7.244   23.255  63.678 1.00 57.83 ? 310 THR B OG1 1 
ATOM   4809 C  CG2 . THR B 1 205 ? 6.628   25.565  63.323 1.00 57.80 ? 310 THR B CG2 1 
ATOM   4810 N  N   . GLY B 1 206 ? 6.424   25.769  60.011 1.00 57.37 ? 311 GLY B N   1 
ATOM   4811 C  CA  . GLY B 1 206 ? 6.920   26.598  58.917 1.00 57.17 ? 311 GLY B CA  1 
ATOM   4812 C  C   . GLY B 1 206 ? 8.260   27.237  59.241 1.00 56.97 ? 311 GLY B C   1 
ATOM   4813 O  O   . GLY B 1 206 ? 9.118   27.360  58.365 1.00 57.02 ? 311 GLY B O   1 
ATOM   4814 N  N   . GLU B 1 207 ? 8.440   27.649  60.497 1.00 56.69 ? 312 GLU B N   1 
ATOM   4815 C  CA  . GLU B 1 207 ? 9.711   28.229  60.946 1.00 56.52 ? 312 GLU B CA  1 
ATOM   4816 C  C   . GLU B 1 207 ? 10.890  27.267  60.777 1.00 56.29 ? 312 GLU B C   1 
ATOM   4817 O  O   . GLU B 1 207 ? 12.003  27.700  60.476 1.00 56.21 ? 312 GLU B O   1 
ATOM   4818 C  CB  . GLU B 1 207 ? 9.635   28.698  62.408 1.00 56.55 ? 312 GLU B CB  1 
ATOM   4819 C  CG  . GLU B 1 207 ? 9.209   27.622  63.417 1.00 56.82 ? 312 GLU B CG  1 
ATOM   4820 C  CD  . GLU B 1 207 ? 10.078  27.583  64.672 1.00 56.70 ? 312 GLU B CD  1 
ATOM   4821 O  OE1 . GLU B 1 207 ? 11.321  27.524  64.539 1.00 56.81 ? 312 GLU B OE1 1 
ATOM   4822 O  OE2 . GLU B 1 207 ? 9.515   27.586  65.789 1.00 56.61 ? 312 GLU B OE2 1 
ATOM   4823 N  N   . HIS B 1 208 ? 10.640  25.970  60.961 1.00 56.08 ? 313 HIS B N   1 
ATOM   4824 C  CA  . HIS B 1 208 ? 11.691  24.954  60.837 1.00 55.80 ? 313 HIS B CA  1 
ATOM   4825 C  C   . HIS B 1 208 ? 12.037  24.670  59.373 1.00 55.44 ? 313 HIS B C   1 
ATOM   4826 O  O   . HIS B 1 208 ? 13.214  24.577  59.014 1.00 55.34 ? 313 HIS B O   1 
ATOM   4827 C  CB  . HIS B 1 208 ? 11.284  23.659  61.545 1.00 55.83 ? 313 HIS B CB  1 
ATOM   4828 C  CG  . HIS B 1 208 ? 12.435  22.740  61.808 1.00 56.03 ? 313 HIS B CG  1 
ATOM   4829 N  ND1 . HIS B 1 208 ? 12.833  21.769  60.914 1.00 56.20 ? 313 HIS B ND1 1 
ATOM   4830 C  CD2 . HIS B 1 208 ? 13.289  22.660  62.856 1.00 56.22 ? 313 HIS B CD2 1 
ATOM   4831 C  CE1 . HIS B 1 208 ? 13.876  21.124  61.405 1.00 56.31 ? 313 HIS B CE1 1 
ATOM   4832 N  NE2 . HIS B 1 208 ? 14.173  21.646  62.581 1.00 56.50 ? 313 HIS B NE2 1 
ATOM   4833 N  N   . THR B 1 209 ? 11.008  24.536  58.537 1.00 55.09 ? 314 THR B N   1 
ATOM   4834 C  CA  . THR B 1 209 ? 11.191  24.336  57.097 1.00 54.90 ? 314 THR B CA  1 
ATOM   4835 C  C   . THR B 1 209 ? 11.830  25.569  56.440 1.00 54.63 ? 314 THR B C   1 
ATOM   4836 O  O   . THR B 1 209 ? 12.524  25.451  55.430 1.00 54.47 ? 314 THR B O   1 
ATOM   4837 C  CB  . THR B 1 209 ? 9.850   23.999  56.402 1.00 54.80 ? 314 THR B CB  1 
ATOM   4838 O  OG1 . THR B 1 209 ? 9.149   23.006  57.163 1.00 54.64 ? 314 THR B OG1 1 
ATOM   4839 C  CG2 . THR B 1 209 ? 10.083  23.470  54.997 1.00 54.95 ? 314 THR B CG2 1 
ATOM   4840 N  N   . LYS B 1 210 ? 11.596  26.744  57.025 1.00 54.43 ? 315 LYS B N   1 
ATOM   4841 C  CA  . LYS B 1 210 ? 12.244  27.988  56.592 1.00 54.31 ? 315 LYS B CA  1 
ATOM   4842 C  C   . LYS B 1 210 ? 13.752  27.949  56.821 1.00 54.12 ? 315 LYS B C   1 
ATOM   4843 O  O   . LYS B 1 210 ? 14.521  28.312  55.935 1.00 54.15 ? 315 LYS B O   1 
ATOM   4844 C  CB  . LYS B 1 210 ? 11.640  29.195  57.328 1.00 54.27 ? 315 LYS B CB  1 
ATOM   4845 C  CG  . LYS B 1 210 ? 12.325  30.545  57.071 1.00 54.22 ? 315 LYS B CG  1 
ATOM   4846 C  CD  . LYS B 1 210 ? 11.651  31.654  57.875 1.00 54.19 ? 315 LYS B CD  1 
ATOM   4847 C  CE  . LYS B 1 210 ? 12.456  32.950  57.878 1.00 54.17 ? 315 LYS B CE  1 
ATOM   4848 N  NZ  . LYS B 1 210 ? 11.818  34.010  58.730 1.00 53.89 ? 315 LYS B NZ  1 
ATOM   4849 N  N   . SER B 1 211 ? 14.168  27.524  58.012 1.00 54.01 ? 316 SER B N   1 
ATOM   4850 C  CA  . SER B 1 211 ? 15.591  27.502  58.363 1.00 53.96 ? 316 SER B CA  1 
ATOM   4851 C  C   . SER B 1 211 ? 16.312  26.302  57.749 1.00 53.87 ? 316 SER B C   1 
ATOM   4852 O  O   . SER B 1 211 ? 17.535  26.310  57.636 1.00 53.90 ? 316 SER B O   1 
ATOM   4853 C  CB  . SER B 1 211 ? 15.797  27.547  59.885 1.00 53.86 ? 316 SER B CB  1 
ATOM   4854 O  OG  . SER B 1 211 ? 15.172  26.456  60.530 1.00 53.68 ? 316 SER B OG  1 
ATOM   4855 N  N   . LEU B 1 212 ? 15.555  25.278  57.359 1.00 53.82 ? 317 LEU B N   1 
ATOM   4856 C  CA  . LEU B 1 212 ? 16.103  24.153  56.593 1.00 53.84 ? 317 LEU B CA  1 
ATOM   4857 C  C   . LEU B 1 212 ? 16.493  24.577  55.177 1.00 53.84 ? 317 LEU B C   1 
ATOM   4858 O  O   . LEU B 1 212 ? 17.609  24.310  54.726 1.00 53.90 ? 317 LEU B O   1 
ATOM   4859 C  CB  . LEU B 1 212 ? 15.093  23.006  56.513 1.00 53.86 ? 317 LEU B CB  1 
ATOM   4860 C  CG  . LEU B 1 212 ? 15.107  22.045  57.698 1.00 53.87 ? 317 LEU B CG  1 
ATOM   4861 C  CD1 . LEU B 1 212 ? 13.764  21.360  57.837 1.00 54.06 ? 317 LEU B CD1 1 
ATOM   4862 C  CD2 . LEU B 1 212 ? 16.227  21.023  57.546 1.00 53.85 ? 317 LEU B CD2 1 
ATOM   4863 N  N   . VAL B 1 213 ? 15.562  25.232  54.485 1.00 53.78 ? 318 VAL B N   1 
ATOM   4864 C  CA  . VAL B 1 213 ? 15.774  25.662  53.101 1.00 53.71 ? 318 VAL B CA  1 
ATOM   4865 C  C   . VAL B 1 213 ? 16.864  26.741  52.982 1.00 53.67 ? 318 VAL B C   1 
ATOM   4866 O  O   . VAL B 1 213 ? 17.600  26.772  51.993 1.00 53.71 ? 318 VAL B O   1 
ATOM   4867 C  CB  . VAL B 1 213 ? 14.442  26.143  52.453 1.00 53.70 ? 318 VAL B CB  1 
ATOM   4868 C  CG1 . VAL B 1 213 ? 14.688  26.876  51.135 1.00 53.90 ? 318 VAL B CG1 1 
ATOM   4869 C  CG2 . VAL B 1 213 ? 13.508  24.962  52.229 1.00 53.43 ? 318 VAL B CG2 1 
ATOM   4870 N  N   . THR B 1 214 ? 16.979  27.612  53.982 1.00 53.55 ? 319 THR B N   1 
ATOM   4871 C  CA  . THR B 1 214 ? 17.966  28.698  53.931 1.00 53.58 ? 319 THR B CA  1 
ATOM   4872 C  C   . THR B 1 214 ? 19.395  28.212  54.213 1.00 53.59 ? 319 THR B C   1 
ATOM   4873 O  O   . THR B 1 214 ? 20.360  28.799  53.718 1.00 53.58 ? 319 THR B O   1 
ATOM   4874 C  CB  . THR B 1 214 ? 17.604  29.852  54.894 1.00 53.47 ? 319 THR B CB  1 
ATOM   4875 O  OG1 . THR B 1 214 ? 17.427  29.339  56.217 1.00 53.54 ? 319 THR B OG1 1 
ATOM   4876 C  CG2 . THR B 1 214 ? 16.323  30.548  54.442 1.00 53.30 ? 319 THR B CG2 1 
ATOM   4877 N  N   . GLN B 1 215 ? 19.526  27.147  55.004 1.00 53.62 ? 320 GLN B N   1 
ATOM   4878 C  CA  . GLN B 1 215 ? 20.832  26.531  55.274 1.00 53.61 ? 320 GLN B CA  1 
ATOM   4879 C  C   . GLN B 1 215 ? 21.323  25.694  54.093 1.00 53.53 ? 320 GLN B C   1 
ATOM   4880 O  O   . GLN B 1 215 ? 22.525  25.588  53.851 1.00 53.27 ? 320 GLN B O   1 
ATOM   4881 C  CB  . GLN B 1 215 ? 20.764  25.645  56.519 1.00 53.58 ? 320 GLN B CB  1 
ATOM   4882 C  CG  . GLN B 1 215 ? 20.815  26.409  57.827 1.00 53.68 ? 320 GLN B CG  1 
ATOM   4883 C  CD  . GLN B 1 215 ? 20.911  25.499  59.041 1.00 53.80 ? 320 GLN B CD  1 
ATOM   4884 O  OE1 . GLN B 1 215 ? 21.100  25.970  60.163 1.00 54.51 ? 320 GLN B OE1 1 
ATOM   4885 N  NE2 . GLN B 1 215 ? 20.786  24.192  58.824 1.00 53.85 ? 320 GLN B NE2 1 
ATOM   4886 N  N   . TYR B 1 216 ? 20.382  25.085  53.379 1.00 53.61 ? 321 TYR B N   1 
ATOM   4887 C  CA  . TYR B 1 216 ? 20.696  24.245  52.230 1.00 53.64 ? 321 TYR B CA  1 
ATOM   4888 C  C   . TYR B 1 216 ? 21.156  25.098  51.058 1.00 53.63 ? 321 TYR B C   1 
ATOM   4889 O  O   . TYR B 1 216 ? 22.005  24.674  50.276 1.00 53.77 ? 321 TYR B O   1 
ATOM   4890 C  CB  . TYR B 1 216 ? 19.467  23.434  51.842 1.00 53.78 ? 321 TYR B CB  1 
ATOM   4891 C  CG  . TYR B 1 216 ? 19.678  22.421  50.743 1.00 53.79 ? 321 TYR B CG  1 
ATOM   4892 C  CD1 . TYR B 1 216 ? 20.247  21.178  51.005 1.00 54.12 ? 321 TYR B CD1 1 
ATOM   4893 C  CD2 . TYR B 1 216 ? 19.270  22.693  49.444 1.00 54.37 ? 321 TYR B CD2 1 
ATOM   4894 C  CE1 . TYR B 1 216 ? 20.419  20.234  49.986 1.00 54.08 ? 321 TYR B CE1 1 
ATOM   4895 C  CE2 . TYR B 1 216 ? 19.435  21.763  48.422 1.00 54.50 ? 321 TYR B CE2 1 
ATOM   4896 C  CZ  . TYR B 1 216 ? 20.007  20.537  48.696 1.00 54.25 ? 321 TYR B CZ  1 
ATOM   4897 O  OH  . TYR B 1 216 ? 20.162  19.633  47.670 1.00 54.10 ? 321 TYR B OH  1 
ATOM   4898 N  N   . LEU B 1 217 ? 20.594  26.300  50.948 1.00 53.57 ? 322 LEU B N   1 
ATOM   4899 C  CA  . LEU B 1 217 ? 20.989  27.257  49.915 1.00 53.47 ? 322 LEU B CA  1 
ATOM   4900 C  C   . LEU B 1 217 ? 22.288  27.987  50.268 1.00 53.42 ? 322 LEU B C   1 
ATOM   4901 O  O   . LEU B 1 217 ? 23.093  28.268  49.382 1.00 53.60 ? 322 LEU B O   1 
ATOM   4902 C  CB  . LEU B 1 217 ? 19.867  28.264  49.652 1.00 53.51 ? 322 LEU B CB  1 
ATOM   4903 C  CG  . LEU B 1 217 ? 18.659  27.748  48.865 1.00 53.39 ? 322 LEU B CG  1 
ATOM   4904 C  CD1 . LEU B 1 217 ? 17.528  28.766  48.905 1.00 53.48 ? 322 LEU B CD1 1 
ATOM   4905 C  CD2 . LEU B 1 217 ? 19.034  27.432  47.430 1.00 53.40 ? 322 LEU B CD2 1 
ATOM   4906 N  N   . ASN B 1 218 ? 22.502  28.291  51.548 1.00 53.24 ? 323 ASN B N   1 
ATOM   4907 C  CA  . ASN B 1 218 ? 23.808  28.807  51.989 1.00 53.17 ? 323 ASN B CA  1 
ATOM   4908 C  C   . ASN B 1 218 ? 24.937  27.778  51.813 1.00 53.05 ? 323 ASN B C   1 
ATOM   4909 O  O   . ASN B 1 218 ? 26.114  28.134  51.852 1.00 53.16 ? 323 ASN B O   1 
ATOM   4910 C  CB  . ASN B 1 218 ? 23.758  29.293  53.444 1.00 53.23 ? 323 ASN B CB  1 
ATOM   4911 C  CG  . ASN B 1 218 ? 23.224  30.714  53.573 1.00 53.52 ? 323 ASN B CG  1 
ATOM   4912 O  OD1 . ASN B 1 218 ? 23.741  31.514  54.353 1.00 53.77 ? 323 ASN B OD1 1 
ATOM   4913 N  ND2 . ASN B 1 218 ? 22.191  31.033  52.804 1.00 54.01 ? 323 ASN B ND2 1 
ATOM   4914 N  N   . ALA B 1 219 ? 24.568  26.511  51.624 1.00 52.87 ? 324 ALA B N   1 
ATOM   4915 C  CA  . ALA B 1 219 ? 25.522  25.438  51.332 1.00 52.75 ? 324 ALA B CA  1 
ATOM   4916 C  C   . ALA B 1 219 ? 25.832  25.288  49.833 1.00 52.59 ? 324 ALA B C   1 
ATOM   4917 O  O   . ALA B 1 219 ? 26.859  24.709  49.465 1.00 52.50 ? 324 ALA B O   1 
ATOM   4918 C  CB  . ALA B 1 219 ? 24.998  24.119  51.884 1.00 52.84 ? 324 ALA B CB  1 
ATOM   4919 N  N   . THR B 1 220 ? 24.942  25.787  48.977 1.00 52.31 ? 325 THR B N   1 
ATOM   4920 C  CA  . THR B 1 220 ? 25.154  25.744  47.528 1.00 52.04 ? 325 THR B CA  1 
ATOM   4921 C  C   . THR B 1 220 ? 26.212  26.752  47.069 1.00 51.72 ? 325 THR B C   1 
ATOM   4922 O  O   . THR B 1 220 ? 27.077  26.419  46.261 1.00 51.53 ? 325 THR B O   1 
ATOM   4923 C  CB  . THR B 1 220 ? 23.852  26.035  46.757 1.00 52.14 ? 325 THR B CB  1 
ATOM   4924 O  OG1 . THR B 1 220 ? 23.318  27.297  47.179 1.00 52.30 ? 325 THR B OG1 1 
ATOM   4925 C  CG2 . THR B 1 220 ? 22.820  24.937  46.991 1.00 52.03 ? 325 THR B CG2 1 
ATOM   4926 N  N   . GLY B 1 221 ? 26.134  27.977  47.589 1.00 51.32 ? 326 GLY B N   1 
ATOM   4927 C  CA  . GLY B 1 221 ? 27.030  29.057  47.171 1.00 51.06 ? 326 GLY B CA  1 
ATOM   4928 C  C   . GLY B 1 221 ? 26.567  29.708  45.879 1.00 50.77 ? 326 GLY B C   1 
ATOM   4929 O  O   . GLY B 1 221 ? 27.384  30.091  45.035 1.00 50.63 ? 326 GLY B O   1 
ATOM   4930 N  N   . ASN B 1 222 ? 25.247  29.834  45.738 1.00 50.45 ? 327 ASN B N   1 
ATOM   4931 C  CA  . ASN B 1 222 ? 24.604  30.367  44.530 1.00 50.21 ? 327 ASN B CA  1 
ATOM   4932 C  C   . ASN B 1 222 ? 24.838  29.527  43.260 1.00 49.95 ? 327 ASN B C   1 
ATOM   4933 O  O   . ASN B 1 222 ? 24.675  30.012  42.139 1.00 49.87 ? 327 ASN B O   1 
ATOM   4934 C  CB  . ASN B 1 222 ? 24.984  31.841  44.319 1.00 50.20 ? 327 ASN B CB  1 
ATOM   4935 C  CG  . ASN B 1 222 ? 24.335  32.754  45.335 1.00 49.91 ? 327 ASN B CG  1 
ATOM   4936 O  OD1 . ASN B 1 222 ? 25.012  33.480  46.065 1.00 49.33 ? 327 ASN B OD1 1 
ATOM   4937 N  ND2 . ASN B 1 222 ? 23.011  32.714  45.395 1.00 49.89 ? 327 ASN B ND2 1 
ATOM   4938 N  N   . ARG B 1 223 ? 25.182  28.257  43.454 1.00 49.73 ? 328 ARG B N   1 
ATOM   4939 C  CA  . ARG B 1 223 ? 25.289  27.305  42.360 1.00 49.44 ? 328 ARG B CA  1 
ATOM   4940 C  C   . ARG B 1 223 ? 23.913  26.681  42.206 1.00 49.12 ? 328 ARG B C   1 
ATOM   4941 O  O   . ARG B 1 223 ? 23.148  26.618  43.173 1.00 48.97 ? 328 ARG B O   1 
ATOM   4942 C  CB  . ARG B 1 223 ? 26.311  26.206  42.666 1.00 49.55 ? 328 ARG B CB  1 
ATOM   4943 C  CG  . ARG B 1 223 ? 27.622  26.674  43.290 1.00 49.97 ? 328 ARG B CG  1 
ATOM   4944 C  CD  . ARG B 1 223 ? 28.658  27.119  42.276 1.00 50.39 ? 328 ARG B CD  1 
ATOM   4945 N  NE  . ARG B 1 223 ? 29.827  27.676  42.955 1.00 50.77 ? 328 ARG B NE  1 
ATOM   4946 C  CZ  . ARG B 1 223 ? 30.961  28.040  42.358 1.00 51.16 ? 328 ARG B CZ  1 
ATOM   4947 N  NH1 . ARG B 1 223 ? 31.113  27.908  41.042 1.00 51.23 ? 328 ARG B NH1 1 
ATOM   4948 N  NH2 . ARG B 1 223 ? 31.954  28.537  43.090 1.00 50.75 ? 328 ARG B NH2 1 
ATOM   4949 N  N   . TRP B 1 224 ? 23.604  26.228  40.993 1.00 48.65 ? 329 TRP B N   1 
ATOM   4950 C  CA  . TRP B 1 224 ? 22.321  25.607  40.694 1.00 48.54 ? 329 TRP B CA  1 
ATOM   4951 C  C   . TRP B 1 224 ? 22.195  24.279  41.441 1.00 48.54 ? 329 TRP B C   1 
ATOM   4952 O  O   . TRP B 1 224 ? 23.151  23.503  41.503 1.00 48.67 ? 329 TRP B O   1 
ATOM   4953 C  CB  . TRP B 1 224 ? 22.182  25.398  39.184 1.00 48.15 ? 329 TRP B CB  1 
ATOM   4954 C  CG  . TRP B 1 224 ? 20.841  24.891  38.759 1.00 48.05 ? 329 TRP B CG  1 
ATOM   4955 C  CD1 . TRP B 1 224 ? 20.468  23.589  38.639 1.00 47.59 ? 329 TRP B CD1 1 
ATOM   4956 C  CD2 . TRP B 1 224 ? 19.697  25.673  38.395 1.00 47.53 ? 329 TRP B CD2 1 
ATOM   4957 N  NE1 . TRP B 1 224 ? 19.164  23.507  38.227 1.00 47.65 ? 329 TRP B NE1 1 
ATOM   4958 C  CE2 . TRP B 1 224 ? 18.664  24.771  38.068 1.00 47.65 ? 329 TRP B CE2 1 
ATOM   4959 C  CE3 . TRP B 1 224 ? 19.444  27.046  38.314 1.00 47.36 ? 329 TRP B CE3 1 
ATOM   4960 C  CZ2 . TRP B 1 224 ? 17.393  25.196  37.666 1.00 47.46 ? 329 TRP B CZ2 1 
ATOM   4961 C  CZ3 . TRP B 1 224 ? 18.178  27.468  37.915 1.00 47.64 ? 329 TRP B CZ3 1 
ATOM   4962 C  CH2 . TRP B 1 224 ? 17.171  26.543  37.597 1.00 47.50 ? 329 TRP B CH2 1 
ATOM   4963 N  N   . CYS B 1 225 ? 21.017  24.027  42.012 1.00 48.53 ? 330 CYS B N   1 
ATOM   4964 C  CA  . CYS B 1 225 ? 20.806  22.844  42.843 1.00 48.55 ? 330 CYS B CA  1 
ATOM   4965 C  C   . CYS B 1 225 ? 19.432  22.228  42.613 1.00 48.47 ? 330 CYS B C   1 
ATOM   4966 O  O   . CYS B 1 225 ? 18.636  22.740  41.826 1.00 48.45 ? 330 CYS B O   1 
ATOM   4967 C  CB  . CYS B 1 225 ? 20.984  23.200  44.324 1.00 48.65 ? 330 CYS B CB  1 
ATOM   4968 S  SG  . CYS B 1 225 ? 19.508  23.874  45.136 1.00 49.32 ? 330 CYS B SG  1 
ATOM   4969 N  N   . SER B 1 226 ? 19.164  21.124  43.307 1.00 48.39 ? 331 SER B N   1 
ATOM   4970 C  CA  . SER B 1 226 ? 17.918  20.385  43.136 1.00 48.23 ? 331 SER B CA  1 
ATOM   4971 C  C   . SER B 1 226 ? 17.043  20.429  44.381 1.00 48.13 ? 331 SER B C   1 
ATOM   4972 O  O   . SER B 1 226 ? 17.503  20.748  45.482 1.00 48.03 ? 331 SER B O   1 
ATOM   4973 C  CB  . SER B 1 226 ? 18.211  18.921  42.816 1.00 48.25 ? 331 SER B CB  1 
ATOM   4974 O  OG  . SER B 1 226 ? 18.229  18.146  44.005 1.00 47.86 ? 331 SER B OG  1 
ATOM   4975 N  N   . TRP B 1 227 ? 15.778  20.074  44.188 1.00 48.05 ? 332 TRP B N   1 
ATOM   4976 C  CA  . TRP B 1 227 ? 14.828  19.953  45.277 1.00 48.00 ? 332 TRP B CA  1 
ATOM   4977 C  C   . TRP B 1 227 ? 14.018  18.670  45.122 1.00 47.89 ? 332 TRP B C   1 
ATOM   4978 O  O   . TRP B 1 227 ? 13.228  18.530  44.193 1.00 47.65 ? 332 TRP B O   1 
ATOM   4979 C  CB  . TRP B 1 227 ? 13.897  21.161  45.301 1.00 47.94 ? 332 TRP B CB  1 
ATOM   4980 C  CG  . TRP B 1 227 ? 14.576  22.439  45.653 1.00 47.71 ? 332 TRP B CG  1 
ATOM   4981 C  CD1 . TRP B 1 227 ? 14.812  23.490  44.824 1.00 47.74 ? 332 TRP B CD1 1 
ATOM   4982 C  CD2 . TRP B 1 227 ? 15.107  22.807  46.932 1.00 47.68 ? 332 TRP B CD2 1 
ATOM   4983 N  NE1 . TRP B 1 227 ? 15.459  24.491  45.504 1.00 47.77 ? 332 TRP B NE1 1 
ATOM   4984 C  CE2 . TRP B 1 227 ? 15.650  24.098  46.801 1.00 47.80 ? 332 TRP B CE2 1 
ATOM   4985 C  CE3 . TRP B 1 227 ? 15.180  22.167  48.175 1.00 47.92 ? 332 TRP B CE3 1 
ATOM   4986 C  CZ2 . TRP B 1 227 ? 16.254  24.767  47.867 1.00 47.84 ? 332 TRP B CZ2 1 
ATOM   4987 C  CZ3 . TRP B 1 227 ? 15.783  22.831  49.233 1.00 47.65 ? 332 TRP B CZ3 1 
ATOM   4988 C  CH2 . TRP B 1 227 ? 16.307  24.119  49.072 1.00 47.72 ? 332 TRP B CH2 1 
ATOM   4989 N  N   . SER B 1 228 ? 14.234  17.734  46.039 1.00 48.00 ? 333 SER B N   1 
ATOM   4990 C  CA  . SER B 1 228 ? 13.480  16.487  46.073 1.00 48.12 ? 333 SER B CA  1 
ATOM   4991 C  C   . SER B 1 228 ? 13.280  16.039  47.524 1.00 48.05 ? 333 SER B C   1 
ATOM   4992 O  O   . SER B 1 228 ? 13.779  16.679  48.446 1.00 47.95 ? 333 SER B O   1 
ATOM   4993 C  CB  . SER B 1 228 ? 14.210  15.410  45.266 1.00 48.08 ? 333 SER B CB  1 
ATOM   4994 O  OG  . SER B 1 228 ? 15.481  15.132  45.826 1.00 48.05 ? 333 SER B OG  1 
ATOM   4995 N  N   . LEU B 1 229 ? 12.531  14.956  47.718 1.00 48.17 ? 334 LEU B N   1 
ATOM   4996 C  CA  . LEU B 1 229 ? 12.336  14.371  49.051 1.00 48.28 ? 334 LEU B CA  1 
ATOM   4997 C  C   . LEU B 1 229 ? 13.218  13.147  49.266 1.00 48.24 ? 334 LEU B C   1 
ATOM   4998 O  O   . LEU B 1 229 ? 13.389  12.704  50.396 1.00 48.27 ? 334 LEU B O   1 
ATOM   4999 C  CB  . LEU B 1 229 ? 10.867  13.998  49.283 1.00 48.41 ? 334 LEU B CB  1 
ATOM   5000 C  CG  . LEU B 1 229 ? 9.938   15.077  49.862 1.00 48.92 ? 334 LEU B CG  1 
ATOM   5001 C  CD1 . LEU B 1 229 ? 10.239  15.343  51.339 1.00 49.02 ? 334 LEU B CD1 1 
ATOM   5002 C  CD2 . LEU B 1 229 ? 10.009  16.372  49.054 1.00 49.41 ? 334 LEU B CD2 1 
ATOM   5003 N  N   . SER B 1 230 ? 13.760  12.596  48.183 1.00 48.28 ? 335 SER B N   1 
ATOM   5004 C  CA  . SER B 1 230 ? 14.684  11.470  48.267 1.00 48.28 ? 335 SER B CA  1 
ATOM   5005 C  C   . SER B 1 230 ? 15.427  11.283  46.949 1.00 48.21 ? 335 SER B C   1 
ATOM   5006 O  O   . SER B 1 230 ? 15.139  11.956  45.956 1.00 48.04 ? 335 SER B O   1 
ATOM   5007 C  CB  . SER B 1 230 ? 13.946  10.174  48.621 1.00 48.33 ? 335 SER B CB  1 
ATOM   5008 O  OG  . SER B 1 230 ? 13.295  9.626   47.484 1.00 48.51 ? 335 SER B OG  1 
ATOM   5009 N  N   . GLN B 1 231 ? 16.374  10.351  46.959 1.00 48.16 ? 336 GLN B N   1 
ATOM   5010 C  CA  . GLN B 1 231 ? 17.123  9.982   45.759 1.00 48.25 ? 336 GLN B CA  1 
ATOM   5011 C  C   . GLN B 1 231 ? 16.367  9.012   44.826 1.00 48.26 ? 336 GLN B C   1 
ATOM   5012 O  O   . GLN B 1 231 ? 16.803  8.794   43.700 1.00 48.27 ? 336 GLN B O   1 
ATOM   5013 C  CB  . GLN B 1 231 ? 18.481  9.374   46.147 1.00 48.19 ? 336 GLN B CB  1 
ATOM   5014 C  CG  . GLN B 1 231 ? 18.393  8.168   47.077 1.00 48.19 ? 336 GLN B CG  1 
ATOM   5015 C  CD  . GLN B 1 231 ? 19.600  7.259   46.989 1.00 48.26 ? 336 GLN B CD  1 
ATOM   5016 O  OE1 . GLN B 1 231 ? 20.742  7.718   46.970 1.00 48.04 ? 336 GLN B OE1 1 
ATOM   5017 N  NE2 . GLN B 1 231 ? 19.352  5.956   46.938 1.00 48.31 ? 336 GLN B NE2 1 
ATOM   5018 N  N   . ALA B 1 232 ? 15.251  8.436   45.282 1.00 48.32 ? 337 ALA B N   1 
ATOM   5019 C  CA  . ALA B 1 232 ? 14.543  7.401   44.509 1.00 48.33 ? 337 ALA B CA  1 
ATOM   5020 C  C   . ALA B 1 232 ? 13.071  7.178   44.893 1.00 48.36 ? 337 ALA B C   1 
ATOM   5021 O  O   . ALA B 1 232 ? 12.226  7.016   44.011 1.00 48.11 ? 337 ALA B O   1 
ATOM   5022 C  CB  . ALA B 1 232 ? 15.300  6.085   44.593 1.00 48.27 ? 337 ALA B CB  1 
ATOM   5023 N  N   . ARG B 1 233 ? 12.772  7.153   46.194 1.00 48.50 ? 338 ARG B N   1 
ATOM   5024 C  CA  . ARG B 1 233 ? 11.419  6.853   46.690 1.00 48.68 ? 338 ARG B CA  1 
ATOM   5025 C  C   . ARG B 1 233 ? 10.344  7.871   46.273 1.00 48.61 ? 338 ARG B C   1 
ATOM   5026 O  O   . ARG B 1 233 ? 10.654  8.977   45.835 1.00 48.61 ? 338 ARG B O   1 
ATOM   5027 C  CB  . ARG B 1 233 ? 11.422  6.758   48.221 1.00 48.83 ? 338 ARG B CB  1 
ATOM   5028 C  CG  . ARG B 1 233 ? 12.248  5.617   48.816 1.00 49.12 ? 338 ARG B CG  1 
ATOM   5029 C  CD  . ARG B 1 233 ? 11.964  5.489   50.316 1.00 49.66 ? 338 ARG B CD  1 
ATOM   5030 N  NE  . ARG B 1 233 ? 12.978  4.727   51.053 1.00 50.59 ? 338 ARG B NE  1 
ATOM   5031 C  CZ  . ARG B 1 233 ? 14.099  5.230   51.585 1.00 51.46 ? 338 ARG B CZ  1 
ATOM   5032 N  NH1 . ARG B 1 233 ? 14.404  6.523   51.471 1.00 51.53 ? 338 ARG B NH1 1 
ATOM   5033 N  NH2 . ARG B 1 233 ? 14.939  4.425   52.237 1.00 51.31 ? 338 ARG B NH2 1 
ATOM   5034 N  N   . LEU B 1 234 ? 9.079   7.472   46.426 1.00 48.64 ? 339 LEU B N   1 
ATOM   5035 C  CA  . LEU B 1 234 ? 7.915   8.353   46.233 1.00 48.51 ? 339 LEU B CA  1 
ATOM   5036 C  C   . LEU B 1 234 ? 7.705   9.291   47.430 1.00 48.52 ? 339 LEU B C   1 
ATOM   5037 O  O   . LEU B 1 234 ? 8.129   8.980   48.554 1.00 48.43 ? 339 LEU B O   1 
ATOM   5038 C  CB  . LEU B 1 234 ? 6.639   7.519   46.062 1.00 48.43 ? 339 LEU B CB  1 
ATOM   5039 C  CG  . LEU B 1 234 ? 6.491   6.627   44.828 1.00 48.25 ? 339 LEU B CG  1 
ATOM   5040 C  CD1 . LEU B 1 234 ? 5.500   5.511   45.108 1.00 48.04 ? 339 LEU B CD1 1 
ATOM   5041 C  CD2 . LEU B 1 234 ? 6.056   7.428   43.607 1.00 48.10 ? 339 LEU B CD2 1 
ATOM   5042 N  N   . LEU B 1 235 ? 7.022   10.414  47.185 1.00 48.39 ? 340 LEU B N   1 
ATOM   5043 C  CA  . LEU B 1 235 ? 6.653   11.367  48.246 1.00 48.45 ? 340 LEU B CA  1 
ATOM   5044 C  C   . LEU B 1 235 ? 5.782   10.738  49.343 1.00 48.42 ? 340 LEU B C   1 
ATOM   5045 O  O   . LEU B 1 235 ? 5.889   11.104  50.517 1.00 48.30 ? 340 LEU B O   1 
ATOM   5046 C  CB  . LEU B 1 235 ? 5.899   12.572  47.668 1.00 48.41 ? 340 LEU B CB  1 
ATOM   5047 C  CG  . LEU B 1 235 ? 6.617   13.476  46.665 1.00 48.12 ? 340 LEU B CG  1 
ATOM   5048 C  CD1 . LEU B 1 235 ? 5.636   14.485  46.088 1.00 47.87 ? 340 LEU B CD1 1 
ATOM   5049 C  CD2 . LEU B 1 235 ? 7.793   14.182  47.308 1.00 47.96 ? 340 LEU B CD2 1 
ATOM   5050 N  N   . THR B 1 236 ? 4.926   9.797   48.951 1.00 48.38 ? 341 THR B N   1 
ATOM   5051 C  CA  . THR B 1 236 ? 3.984   9.174   49.875 1.00 48.47 ? 341 THR B CA  1 
ATOM   5052 C  C   . THR B 1 236 ? 4.661   8.315   50.946 1.00 48.59 ? 341 THR B C   1 
ATOM   5053 O  O   . THR B 1 236 ? 4.048   8.024   51.975 1.00 48.76 ? 341 THR B O   1 
ATOM   5054 C  CB  . THR B 1 236 ? 2.945   8.315   49.125 1.00 48.49 ? 341 THR B CB  1 
ATOM   5055 O  OG1 . THR B 1 236 ? 3.613   7.312   48.349 1.00 48.56 ? 341 THR B OG1 1 
ATOM   5056 C  CG2 . THR B 1 236 ? 2.087   9.189   48.211 1.00 48.36 ? 341 THR B CG2 1 
ATOM   5057 N  N   . SER B 1 237 ? 5.912   7.916   50.712 1.00 48.62 ? 342 SER B N   1 
ATOM   5058 C  CA  . SER B 1 237 ? 6.697   7.183   51.719 1.00 48.55 ? 342 SER B CA  1 
ATOM   5059 C  C   . SER B 1 237 ? 6.949   8.008   52.980 1.00 48.50 ? 342 SER B C   1 
ATOM   5060 O  O   . SER B 1 237 ? 7.010   7.460   54.082 1.00 48.43 ? 342 SER B O   1 
ATOM   5061 C  CB  . SER B 1 237 ? 8.051   6.759   51.142 1.00 48.65 ? 342 SER B CB  1 
ATOM   5062 O  OG  . SER B 1 237 ? 7.895   5.998   49.958 1.00 48.98 ? 342 SER B OG  1 
ATOM   5063 N  N   . PHE B 1 238 ? 7.102   9.321   52.807 1.00 48.44 ? 343 PHE B N   1 
ATOM   5064 C  CA  . PHE B 1 238 ? 7.492   10.217  53.897 1.00 48.30 ? 343 PHE B CA  1 
ATOM   5065 C  C   . PHE B 1 238 ? 6.345   11.084  54.408 1.00 48.22 ? 343 PHE B C   1 
ATOM   5066 O  O   . PHE B 1 238 ? 6.254   11.337  55.612 1.00 48.19 ? 343 PHE B O   1 
ATOM   5067 C  CB  . PHE B 1 238 ? 8.630   11.131  53.438 1.00 48.37 ? 343 PHE B CB  1 
ATOM   5068 C  CG  . PHE B 1 238 ? 9.766   10.406  52.778 1.00 48.31 ? 343 PHE B CG  1 
ATOM   5069 C  CD1 . PHE B 1 238 ? 9.871   10.374  51.395 1.00 48.51 ? 343 PHE B CD1 1 
ATOM   5070 C  CD2 . PHE B 1 238 ? 10.736  9.764   53.538 1.00 48.25 ? 343 PHE B CD2 1 
ATOM   5071 C  CE1 . PHE B 1 238 ? 10.923  9.707   50.777 1.00 48.58 ? 343 PHE B CE1 1 
ATOM   5072 C  CE2 . PHE B 1 238 ? 11.790  9.096   52.927 1.00 48.35 ? 343 PHE B CE2 1 
ATOM   5073 C  CZ  . PHE B 1 238 ? 11.884  9.071   51.544 1.00 48.30 ? 343 PHE B CZ  1 
ATOM   5074 N  N   . LEU B 1 239 ? 5.488   11.550  53.496 1.00 48.04 ? 344 LEU B N   1 
ATOM   5075 C  CA  . LEU B 1 239 ? 4.384   12.451  53.843 1.00 47.88 ? 344 LEU B CA  1 
ATOM   5076 C  C   . LEU B 1 239 ? 3.037   11.728  53.859 1.00 47.78 ? 344 LEU B C   1 
ATOM   5077 O  O   . LEU B 1 239 ? 2.821   10.806  53.072 1.00 47.86 ? 344 LEU B O   1 
ATOM   5078 C  CB  . LEU B 1 239 ? 4.295   13.603  52.835 1.00 47.84 ? 344 LEU B CB  1 
ATOM   5079 C  CG  . LEU B 1 239 ? 5.538   14.466  52.607 1.00 47.63 ? 344 LEU B CG  1 
ATOM   5080 C  CD1 . LEU B 1 239 ? 5.294   15.422  51.457 1.00 47.60 ? 344 LEU B CD1 1 
ATOM   5081 C  CD2 . LEU B 1 239 ? 5.932   15.227  53.861 1.00 47.31 ? 344 LEU B CD2 1 
ATOM   5082 N  N   . PRO B 1 240 ? 2.123   12.149  54.752 1.00 47.58 ? 345 PRO B N   1 
ATOM   5083 C  CA  . PRO B 1 240 ? 0.735   11.722  54.646 1.00 47.47 ? 345 PRO B CA  1 
ATOM   5084 C  C   . PRO B 1 240 ? 0.027   12.458  53.510 1.00 47.32 ? 345 PRO B C   1 
ATOM   5085 O  O   . PRO B 1 240 ? 0.539   13.466  53.018 1.00 46.98 ? 345 PRO B O   1 
ATOM   5086 C  CB  . PRO B 1 240 ? 0.143   12.119  56.001 1.00 47.50 ? 345 PRO B CB  1 
ATOM   5087 C  CG  . PRO B 1 240 ? 0.937   13.282  56.431 1.00 47.38 ? 345 PRO B CG  1 
ATOM   5088 C  CD  . PRO B 1 240 ? 2.331   13.038  55.911 1.00 47.64 ? 345 PRO B CD  1 
ATOM   5089 N  N   . ALA B 1 241 ? -1.153  11.968  53.129 1.00 47.34 ? 346 ALA B N   1 
ATOM   5090 C  CA  . ALA B 1 241 ? -1.881  12.454  51.941 1.00 47.25 ? 346 ALA B CA  1 
ATOM   5091 C  C   . ALA B 1 241 ? -2.184  13.958  51.926 1.00 47.14 ? 346 ALA B C   1 
ATOM   5092 O  O   . ALA B 1 241 ? -2.117  14.593  50.875 1.00 47.13 ? 346 ALA B O   1 
ATOM   5093 C  CB  . ALA B 1 241 ? -3.182  11.662  51.764 1.00 47.25 ? 346 ALA B CB  1 
ATOM   5094 N  N   . GLN B 1 242 ? -2.495  14.529  53.087 1.00 47.02 ? 347 GLN B N   1 
ATOM   5095 C  CA  . GLN B 1 242 ? -2.987  15.912  53.150 1.00 46.90 ? 347 GLN B CA  1 
ATOM   5096 C  C   . GLN B 1 242 ? -1.880  16.975  53.183 1.00 46.68 ? 347 GLN B C   1 
ATOM   5097 O  O   . GLN B 1 242 ? -2.156  18.153  53.414 1.00 46.77 ? 347 GLN B O   1 
ATOM   5098 C  CB  . GLN B 1 242 ? -3.991  16.110  54.305 1.00 47.05 ? 347 GLN B CB  1 
ATOM   5099 C  CG  . GLN B 1 242 ? -3.854  15.184  55.526 1.00 47.87 ? 347 GLN B CG  1 
ATOM   5100 C  CD  . GLN B 1 242 ? -2.592  15.410  56.348 1.00 48.50 ? 347 GLN B CD  1 
ATOM   5101 O  OE1 . GLN B 1 242 ? -2.129  14.506  57.047 1.00 48.96 ? 347 GLN B OE1 1 
ATOM   5102 N  NE2 . GLN B 1 242 ? -2.043  16.619  56.284 1.00 48.37 ? 347 GLN B NE2 1 
ATOM   5103 N  N   . LEU B 1 243 ? -0.636  16.565  52.944 1.00 46.35 ? 348 LEU B N   1 
ATOM   5104 C  CA  . LEU B 1 243 ? 0.468   17.506  52.755 1.00 46.15 ? 348 LEU B CA  1 
ATOM   5105 C  C   . LEU B 1 243 ? 1.017   17.477  51.328 1.00 45.95 ? 348 LEU B C   1 
ATOM   5106 O  O   . LEU B 1 243 ? 1.891   18.270  50.994 1.00 45.84 ? 348 LEU B O   1 
ATOM   5107 C  CB  . LEU B 1 243 ? 1.596   17.207  53.752 1.00 46.02 ? 348 LEU B CB  1 
ATOM   5108 C  CG  . LEU B 1 243 ? 1.325   17.564  55.217 1.00 45.69 ? 348 LEU B CG  1 
ATOM   5109 C  CD1 . LEU B 1 243 ? 2.336   16.890  56.130 1.00 45.49 ? 348 LEU B CD1 1 
ATOM   5110 C  CD2 . LEU B 1 243 ? 1.335   19.075  55.424 1.00 45.67 ? 348 LEU B CD2 1 
ATOM   5111 N  N   . LEU B 1 244 ? 0.485   16.591  50.487 1.00 45.91 ? 349 LEU B N   1 
ATOM   5112 C  CA  . LEU B 1 244 ? 1.066   16.309  49.167 1.00 45.93 ? 349 LEU B CA  1 
ATOM   5113 C  C   . LEU B 1 244 ? 0.925   17.447  48.162 1.00 45.88 ? 349 LEU B C   1 
ATOM   5114 O  O   . LEU B 1 244 ? 1.802   17.636  47.320 1.00 45.99 ? 349 LEU B O   1 
ATOM   5115 C  CB  . LEU B 1 244 ? 0.462   15.034  48.577 1.00 45.81 ? 349 LEU B CB  1 
ATOM   5116 C  CG  . LEU B 1 244 ? 0.752   13.754  49.362 1.00 45.80 ? 349 LEU B CG  1 
ATOM   5117 C  CD1 . LEU B 1 244 ? 0.010   12.574  48.742 1.00 46.02 ? 349 LEU B CD1 1 
ATOM   5118 C  CD2 . LEU B 1 244 ? 2.254   13.477  49.440 1.00 45.42 ? 349 LEU B CD2 1 
ATOM   5119 N  N   . ARG B 1 245 ? -0.168  18.196  48.251 1.00 45.88 ? 350 ARG B N   1 
ATOM   5120 C  CA  . ARG B 1 245 ? -0.381  19.366  47.393 1.00 45.91 ? 350 ARG B CA  1 
ATOM   5121 C  C   . ARG B 1 245 ? 0.520   20.517  47.816 1.00 45.82 ? 350 ARG B C   1 
ATOM   5122 O  O   . ARG B 1 245 ? 1.070   21.219  46.972 1.00 45.93 ? 350 ARG B O   1 
ATOM   5123 C  CB  . ARG B 1 245 ? -1.837  19.829  47.462 1.00 45.97 ? 350 ARG B CB  1 
ATOM   5124 C  CG  . ARG B 1 245 ? -2.824  18.797  46.993 1.00 45.92 ? 350 ARG B CG  1 
ATOM   5125 C  CD  . ARG B 1 245 ? -4.219  19.063  47.510 1.00 46.12 ? 350 ARG B CD  1 
ATOM   5126 N  NE  . ARG B 1 245 ? -5.130  18.087  46.932 1.00 46.38 ? 350 ARG B NE  1 
ATOM   5127 C  CZ  . ARG B 1 245 ? -5.624  18.145  45.696 1.00 46.72 ? 350 ARG B CZ  1 
ATOM   5128 N  NH1 . ARG B 1 245 ? -5.335  19.160  44.883 1.00 46.37 ? 350 ARG B NH1 1 
ATOM   5129 N  NH2 . ARG B 1 245 ? -6.432  17.178  45.275 1.00 47.14 ? 350 ARG B NH2 1 
ATOM   5130 N  N   . LEU B 1 246 ? 0.649   20.700  49.128 1.00 45.76 ? 351 LEU B N   1 
ATOM   5131 C  CA  . LEU B 1 246 ? 1.450   21.776  49.711 1.00 45.69 ? 351 LEU B CA  1 
ATOM   5132 C  C   . LEU B 1 246 ? 2.921   21.616  49.345 1.00 45.58 ? 351 LEU B C   1 
ATOM   5133 O  O   . LEU B 1 246 ? 3.574   22.574  48.935 1.00 45.40 ? 351 LEU B O   1 
ATOM   5134 C  CB  . LEU B 1 246 ? 1.298   21.777  51.235 1.00 45.67 ? 351 LEU B CB  1 
ATOM   5135 C  CG  . LEU B 1 246 ? 1.549   23.100  51.955 1.00 45.74 ? 351 LEU B CG  1 
ATOM   5136 C  CD1 . LEU B 1 246 ? 0.350   24.011  51.795 1.00 45.70 ? 351 LEU B CD1 1 
ATOM   5137 C  CD2 . LEU B 1 246 ? 1.839   22.864  53.431 1.00 45.75 ? 351 LEU B CD2 1 
ATOM   5138 N  N   . TYR B 1 247 ? 3.432   20.396  49.493 1.00 45.67 ? 352 TYR B N   1 
ATOM   5139 C  CA  . TYR B 1 247 ? 4.829   20.096  49.175 1.00 45.74 ? 352 TYR B CA  1 
ATOM   5140 C  C   . TYR B 1 247 ? 5.107   20.141  47.665 1.00 45.89 ? 352 TYR B C   1 
ATOM   5141 O  O   . TYR B 1 247 ? 6.235   20.422  47.263 1.00 46.00 ? 352 TYR B O   1 
ATOM   5142 C  CB  . TYR B 1 247 ? 5.251   18.740  49.765 1.00 45.57 ? 352 TYR B CB  1 
ATOM   5143 C  CG  . TYR B 1 247 ? 5.833   18.814  51.165 1.00 45.38 ? 352 TYR B CG  1 
ATOM   5144 C  CD1 . TYR B 1 247 ? 7.207   18.783  51.368 1.00 45.28 ? 352 TYR B CD1 1 
ATOM   5145 C  CD2 . TYR B 1 247 ? 5.011   18.906  52.285 1.00 45.54 ? 352 TYR B CD2 1 
ATOM   5146 C  CE1 . TYR B 1 247 ? 7.750   18.846  52.643 1.00 45.15 ? 352 TYR B CE1 1 
ATOM   5147 C  CE2 . TYR B 1 247 ? 5.547   18.972  53.571 1.00 45.31 ? 352 TYR B CE2 1 
ATOM   5148 C  CZ  . TYR B 1 247 ? 6.918   18.942  53.739 1.00 45.39 ? 352 TYR B CZ  1 
ATOM   5149 O  OH  . TYR B 1 247 ? 7.465   19.003  55.000 1.00 45.32 ? 352 TYR B OH  1 
ATOM   5150 N  N   . GLN B 1 248 ? 4.093   19.878  46.835 1.00 45.97 ? 353 GLN B N   1 
ATOM   5151 C  CA  . GLN B 1 248 ? 4.252   19.986  45.371 1.00 45.99 ? 353 GLN B CA  1 
ATOM   5152 C  C   . GLN B 1 248 ? 4.387   21.435  44.905 1.00 45.87 ? 353 GLN B C   1 
ATOM   5153 O  O   . GLN B 1 248 ? 5.219   21.740  44.053 1.00 45.71 ? 353 GLN B O   1 
ATOM   5154 C  CB  . GLN B 1 248 ? 3.099   19.307  44.631 1.00 45.91 ? 353 GLN B CB  1 
ATOM   5155 C  CG  . GLN B 1 248 ? 3.325   17.824  44.393 1.00 46.28 ? 353 GLN B CG  1 
ATOM   5156 C  CD  . GLN B 1 248 ? 2.325   17.213  43.425 1.00 46.63 ? 353 GLN B CD  1 
ATOM   5157 O  OE1 . GLN B 1 248 ? 1.574   17.924  42.741 1.00 47.96 ? 353 GLN B OE1 1 
ATOM   5158 N  NE2 . GLN B 1 248 ? 2.319   15.883  43.351 1.00 46.89 ? 353 GLN B NE2 1 
ATOM   5159 N  N   . LEU B 1 249 ? 3.562   22.318  45.460 1.00 45.83 ? 354 LEU B N   1 
ATOM   5160 C  CA  . LEU B 1 249 ? 3.679   23.754  45.200 1.00 45.81 ? 354 LEU B CA  1 
ATOM   5161 C  C   . LEU B 1 249 ? 5.064   24.272  45.593 1.00 45.69 ? 354 LEU B C   1 
ATOM   5162 O  O   . LEU B 1 249 ? 5.679   25.026  44.843 1.00 45.53 ? 354 LEU B O   1 
ATOM   5163 C  CB  . LEU B 1 249 ? 2.595   24.533  45.966 1.00 45.95 ? 354 LEU B CB  1 
ATOM   5164 C  CG  . LEU B 1 249 ? 2.670   26.072  45.975 1.00 46.01 ? 354 LEU B CG  1 
ATOM   5165 C  CD1 . LEU B 1 249 ? 2.691   26.635  44.553 1.00 45.75 ? 354 LEU B CD1 1 
ATOM   5166 C  CD2 . LEU B 1 249 ? 1.512   26.671  46.781 1.00 45.81 ? 354 LEU B CD2 1 
ATOM   5167 N  N   . MET B 1 250 ? 5.538   23.866  46.771 1.00 45.57 ? 355 MET B N   1 
ATOM   5168 C  CA  . MET B 1 250 ? 6.835   24.312  47.291 1.00 45.47 ? 355 MET B CA  1 
ATOM   5169 C  C   . MET B 1 250 ? 7.973   23.916  46.353 1.00 45.40 ? 355 MET B C   1 
ATOM   5170 O  O   . MET B 1 250 ? 8.809   24.748  46.002 1.00 45.25 ? 355 MET B O   1 
ATOM   5171 C  CB  . MET B 1 250 ? 7.086   23.731  48.691 1.00 45.49 ? 355 MET B CB  1 
ATOM   5172 C  CG  . MET B 1 250 ? 8.255   24.372  49.439 1.00 45.49 ? 355 MET B CG  1 
ATOM   5173 S  SD  . MET B 1 250 ? 8.500   23.727  51.109 1.00 45.07 ? 355 MET B SD  1 
ATOM   5174 C  CE  . MET B 1 250 ? 9.278   22.152  50.789 1.00 45.33 ? 355 MET B CE  1 
ATOM   5175 N  N   . LEU B 1 251 ? 7.981   22.649  45.943 1.00 45.40 ? 356 LEU B N   1 
ATOM   5176 C  CA  . LEU B 1 251 ? 9.032   22.102  45.073 1.00 45.30 ? 356 LEU B CA  1 
ATOM   5177 C  C   . LEU B 1 251 ? 9.058   22.693  43.651 1.00 45.21 ? 356 LEU B C   1 
ATOM   5178 O  O   . LEU B 1 251 ? 10.108  22.713  43.011 1.00 45.15 ? 356 LEU B O   1 
ATOM   5179 C  CB  . LEU B 1 251 ? 8.903   20.573  44.989 1.00 45.31 ? 356 LEU B CB  1 
ATOM   5180 C  CG  . LEU B 1 251 ? 9.203   19.767  46.258 1.00 45.08 ? 356 LEU B CG  1 
ATOM   5181 C  CD1 . LEU B 1 251 ? 8.853   18.302  46.051 1.00 45.11 ? 356 LEU B CD1 1 
ATOM   5182 C  CD2 . LEU B 1 251 ? 10.651  19.897  46.663 1.00 45.33 ? 356 LEU B CD2 1 
ATOM   5183 N  N   . PHE B 1 252 ? 7.907   23.148  43.157 1.00 45.14 ? 357 PHE B N   1 
ATOM   5184 C  CA  . PHE B 1 252 ? 7.821   23.792  41.837 1.00 45.01 ? 357 PHE B CA  1 
ATOM   5185 C  C   . PHE B 1 252 ? 8.143   25.284  41.892 1.00 44.86 ? 357 PHE B C   1 
ATOM   5186 O  O   . PHE B 1 252 ? 8.257   25.925  40.854 1.00 45.07 ? 357 PHE B O   1 
ATOM   5187 C  CB  . PHE B 1 252 ? 6.427   23.603  41.217 1.00 45.19 ? 357 PHE B CB  1 
ATOM   5188 C  CG  . PHE B 1 252 ? 6.301   22.372  40.357 1.00 45.35 ? 357 PHE B CG  1 
ATOM   5189 C  CD1 . PHE B 1 252 ? 5.524   21.298  40.761 1.00 45.52 ? 357 PHE B CD1 1 
ATOM   5190 C  CD2 . PHE B 1 252 ? 6.957   22.295  39.134 1.00 45.82 ? 357 PHE B CD2 1 
ATOM   5191 C  CE1 . PHE B 1 252 ? 5.404   20.167  39.964 1.00 45.74 ? 357 PHE B CE1 1 
ATOM   5192 C  CE2 . PHE B 1 252 ? 6.843   21.170  38.332 1.00 45.60 ? 357 PHE B CE2 1 
ATOM   5193 C  CZ  . PHE B 1 252 ? 6.065   20.103  38.748 1.00 45.93 ? 357 PHE B CZ  1 
ATOM   5194 N  N   . THR B 1 253 ? 8.281   25.834  43.095 1.00 44.60 ? 358 THR B N   1 
ATOM   5195 C  CA  . THR B 1 253 ? 8.508   27.268  43.267 1.00 44.35 ? 358 THR B CA  1 
ATOM   5196 C  C   . THR B 1 253 ? 9.822   27.623  43.978 1.00 44.08 ? 358 THR B C   1 
ATOM   5197 O  O   . THR B 1 253 ? 10.096  28.802  44.169 1.00 43.91 ? 358 THR B O   1 
ATOM   5198 C  CB  . THR B 1 253 ? 7.327   27.931  44.018 1.00 44.25 ? 358 THR B CB  1 
ATOM   5199 O  OG1 . THR B 1 253 ? 7.094   27.251  45.257 1.00 44.06 ? 358 THR B OG1 1 
ATOM   5200 C  CG2 . THR B 1 253 ? 6.070   27.888  43.171 1.00 44.01 ? 358 THR B CG2 1 
ATOM   5201 N  N   . LEU B 1 254 ? 10.629  26.626  44.350 1.00 43.90 ? 359 LEU B N   1 
ATOM   5202 C  CA  . LEU B 1 254 ? 11.958  26.878  44.926 1.00 43.96 ? 359 LEU B CA  1 
ATOM   5203 C  C   . LEU B 1 254 ? 13.041  26.984  43.837 1.00 43.94 ? 359 LEU B C   1 
ATOM   5204 O  O   . LEU B 1 254 ? 12.946  26.337  42.791 1.00 43.98 ? 359 LEU B O   1 
ATOM   5205 C  CB  . LEU B 1 254 ? 12.355  25.787  45.929 1.00 43.92 ? 359 LEU B CB  1 
ATOM   5206 C  CG  . LEU B 1 254 ? 11.702  25.771  47.315 1.00 43.95 ? 359 LEU B CG  1 
ATOM   5207 C  CD1 . LEU B 1 254 ? 12.291  24.628  48.132 1.00 43.98 ? 359 LEU B CD1 1 
ATOM   5208 C  CD2 . LEU B 1 254 ? 11.864  27.095  48.053 1.00 43.72 ? 359 LEU B CD2 1 
ATOM   5209 N  N   . PRO B 1 255 ? 14.077  27.807  44.081 1.00 43.85 ? 360 PRO B N   1 
ATOM   5210 C  CA  . PRO B 1 255 ? 15.132  27.998  43.083 1.00 43.81 ? 360 PRO B CA  1 
ATOM   5211 C  C   . PRO B 1 255 ? 15.981  26.745  42.811 1.00 43.76 ? 360 PRO B C   1 
ATOM   5212 O  O   . PRO B 1 255 ? 16.856  26.396  43.602 1.00 43.57 ? 360 PRO B O   1 
ATOM   5213 C  CB  . PRO B 1 255 ? 15.975  29.140  43.671 1.00 43.79 ? 360 PRO B CB  1 
ATOM   5214 C  CG  . PRO B 1 255 ? 15.675  29.147  45.123 1.00 43.73 ? 360 PRO B CG  1 
ATOM   5215 C  CD  . PRO B 1 255 ? 14.295  28.625  45.291 1.00 43.68 ? 360 PRO B CD  1 
ATOM   5216 N  N   . GLY B 1 256 ? 15.712  26.091  41.681 1.00 43.84 ? 361 GLY B N   1 
ATOM   5217 C  CA  . GLY B 1 256 ? 16.453  24.903  41.257 1.00 43.86 ? 361 GLY B CA  1 
ATOM   5218 C  C   . GLY B 1 256 ? 15.588  23.912  40.499 1.00 43.93 ? 361 GLY B C   1 
ATOM   5219 O  O   . GLY B 1 256 ? 14.380  24.110  40.362 1.00 43.97 ? 361 GLY B O   1 
ATOM   5220 N  N   . THR B 1 257 ? 16.205  22.838  40.010 1.00 44.03 ? 362 THR B N   1 
ATOM   5221 C  CA  . THR B 1 257 ? 15.473  21.771  39.327 1.00 44.13 ? 362 THR B CA  1 
ATOM   5222 C  C   . THR B 1 257 ? 14.729  20.905  40.352 1.00 44.20 ? 362 THR B C   1 
ATOM   5223 O  O   . THR B 1 257 ? 15.328  20.456  41.323 1.00 44.31 ? 362 THR B O   1 
ATOM   5224 C  CB  . THR B 1 257 ? 16.420  20.873  38.488 1.00 44.16 ? 362 THR B CB  1 
ATOM   5225 O  OG1 . THR B 1 257 ? 16.946  21.621  37.389 1.00 43.89 ? 362 THR B OG1 1 
ATOM   5226 C  CG2 . THR B 1 257 ? 15.687  19.651  37.937 1.00 44.09 ? 362 THR B CG2 1 
ATOM   5227 N  N   . PRO B 1 258 ? 13.418  20.680  40.149 1.00 44.34 ? 363 PRO B N   1 
ATOM   5228 C  CA  . PRO B 1 258 ? 12.696  19.718  40.982 1.00 44.58 ? 363 PRO B CA  1 
ATOM   5229 C  C   . PRO B 1 258 ? 12.728  18.301  40.401 1.00 44.78 ? 363 PRO B C   1 
ATOM   5230 O  O   . PRO B 1 258 ? 12.584  18.122  39.186 1.00 44.81 ? 363 PRO B O   1 
ATOM   5231 C  CB  . PRO B 1 258 ? 11.269  20.264  40.974 1.00 44.57 ? 363 PRO B CB  1 
ATOM   5232 C  CG  . PRO B 1 258 ? 11.151  21.024  39.680 1.00 44.33 ? 363 PRO B CG  1 
ATOM   5233 C  CD  . PRO B 1 258 ? 12.528  21.319  39.165 1.00 44.14 ? 363 PRO B CD  1 
ATOM   5234 N  N   . VAL B 1 259 ? 12.907  17.303  41.263 1.00 44.92 ? 364 VAL B N   1 
ATOM   5235 C  CA  . VAL B 1 259 ? 12.979  15.910  40.815 1.00 45.11 ? 364 VAL B CA  1 
ATOM   5236 C  C   . VAL B 1 259 ? 11.864  15.047  41.434 1.00 45.18 ? 364 VAL B C   1 
ATOM   5237 O  O   . VAL B 1 259 ? 11.663  15.047  42.652 1.00 45.09 ? 364 VAL B O   1 
ATOM   5238 C  CB  . VAL B 1 259 ? 14.361  15.286  41.136 1.00 45.19 ? 364 VAL B CB  1 
ATOM   5239 C  CG1 . VAL B 1 259 ? 14.573  14.015  40.329 1.00 45.10 ? 364 VAL B CG1 1 
ATOM   5240 C  CG2 . VAL B 1 259 ? 15.482  16.284  40.846 1.00 45.48 ? 364 VAL B CG2 1 
ATOM   5241 N  N   . PHE B 1 260 ? 11.155  14.311  40.581 1.00 45.19 ? 365 PHE B N   1 
ATOM   5242 C  CA  . PHE B 1 260 ? 10.117  13.387  41.024 1.00 45.32 ? 365 PHE B CA  1 
ATOM   5243 C  C   . PHE B 1 260 ? 10.374  11.969  40.510 1.00 45.37 ? 365 PHE B C   1 
ATOM   5244 O  O   . PHE B 1 260 ? 11.088  11.775  39.526 1.00 45.42 ? 365 PHE B O   1 
ATOM   5245 C  CB  . PHE B 1 260 ? 8.742   13.863  40.542 1.00 45.41 ? 365 PHE B CB  1 
ATOM   5246 C  CG  . PHE B 1 260 ? 8.355   15.227  41.054 1.00 45.58 ? 365 PHE B CG  1 
ATOM   5247 C  CD1 . PHE B 1 260 ? 8.534   16.359  40.265 1.00 45.27 ? 365 PHE B CD1 1 
ATOM   5248 C  CD2 . PHE B 1 260 ? 7.810   15.378  42.328 1.00 45.57 ? 365 PHE B CD2 1 
ATOM   5249 C  CE1 . PHE B 1 260 ? 8.176   17.619  40.735 1.00 45.41 ? 365 PHE B CE1 1 
ATOM   5250 C  CE2 . PHE B 1 260 ? 7.450   16.635  42.808 1.00 45.22 ? 365 PHE B CE2 1 
ATOM   5251 C  CZ  . PHE B 1 260 ? 7.634   17.756  42.012 1.00 45.41 ? 365 PHE B CZ  1 
ATOM   5252 N  N   . SER B 1 261 ? 9.803   10.991  41.210 1.00 45.41 ? 366 SER B N   1 
ATOM   5253 C  CA  . SER B 1 261 ? 9.665   9.624   40.720 1.00 45.36 ? 366 SER B CA  1 
ATOM   5254 C  C   . SER B 1 261 ? 8.322   9.521   40.025 1.00 45.44 ? 366 SER B C   1 
ATOM   5255 O  O   . SER B 1 261 ? 7.460   10.377  40.227 1.00 45.49 ? 366 SER B O   1 
ATOM   5256 C  CB  . SER B 1 261 ? 9.701   8.626   41.874 1.00 45.38 ? 366 SER B CB  1 
ATOM   5257 O  OG  . SER B 1 261 ? 10.915  8.711   42.589 1.00 45.33 ? 366 SER B OG  1 
ATOM   5258 N  N   . TYR B 1 262 ? 8.135   8.475   39.219 1.00 45.43 ? 367 TYR B N   1 
ATOM   5259 C  CA  . TYR B 1 262 ? 6.891   8.313   38.463 1.00 45.31 ? 367 TYR B CA  1 
ATOM   5260 C  C   . TYR B 1 262 ? 5.734   8.049   39.418 1.00 45.34 ? 367 TYR B C   1 
ATOM   5261 O  O   . TYR B 1 262 ? 5.903   7.365   40.425 1.00 45.39 ? 367 TYR B O   1 
ATOM   5262 C  CB  . TYR B 1 262 ? 7.006   7.199   37.401 1.00 45.05 ? 367 TYR B CB  1 
ATOM   5263 C  CG  . TYR B 1 262 ? 7.008   5.775   37.929 1.00 44.68 ? 367 TYR B CG  1 
ATOM   5264 C  CD1 . TYR B 1 262 ? 5.816   5.107   38.206 1.00 44.42 ? 367 TYR B CD1 1 
ATOM   5265 C  CD2 . TYR B 1 262 ? 8.201   5.087   38.125 1.00 44.74 ? 367 TYR B CD2 1 
ATOM   5266 C  CE1 . TYR B 1 262 ? 5.817   3.801   38.685 1.00 44.65 ? 367 TYR B CE1 1 
ATOM   5267 C  CE2 . TYR B 1 262 ? 8.214   3.779   38.596 1.00 44.52 ? 367 TYR B CE2 1 
ATOM   5268 C  CZ  . TYR B 1 262 ? 7.021   3.146   38.875 1.00 44.75 ? 367 TYR B CZ  1 
ATOM   5269 O  OH  . TYR B 1 262 ? 7.034   1.857   39.342 1.00 45.01 ? 367 TYR B OH  1 
ATOM   5270 N  N   . GLY B 1 263 ? 4.571   8.614   39.109 1.00 45.43 ? 368 GLY B N   1 
ATOM   5271 C  CA  . GLY B 1 263 ? 3.384   8.440   39.938 1.00 45.61 ? 368 GLY B CA  1 
ATOM   5272 C  C   . GLY B 1 263 ? 3.226   9.444   41.071 1.00 45.71 ? 368 GLY B C   1 
ATOM   5273 O  O   . GLY B 1 263 ? 2.220   9.414   41.778 1.00 45.74 ? 368 GLY B O   1 
ATOM   5274 N  N   . ASP B 1 264 ? 4.207   10.327  41.259 1.00 45.82 ? 369 ASP B N   1 
ATOM   5275 C  CA  . ASP B 1 264 ? 4.063   11.429  42.218 1.00 45.99 ? 369 ASP B CA  1 
ATOM   5276 C  C   . ASP B 1 264 ? 2.957   12.401  41.777 1.00 45.99 ? 369 ASP B C   1 
ATOM   5277 O  O   . ASP B 1 264 ? 2.307   13.030  42.614 1.00 45.83 ? 369 ASP B O   1 
ATOM   5278 C  CB  . ASP B 1 264 ? 5.388   12.194  42.396 1.00 46.12 ? 369 ASP B CB  1 
ATOM   5279 C  CG  . ASP B 1 264 ? 6.342   11.526  43.389 1.00 46.46 ? 369 ASP B CG  1 
ATOM   5280 O  OD1 . ASP B 1 264 ? 5.881   10.894  44.365 1.00 46.16 ? 369 ASP B OD1 1 
ATOM   5281 O  OD2 . ASP B 1 264 ? 7.573   11.660  43.198 1.00 47.13 ? 369 ASP B OD2 1 
ATOM   5282 N  N   . GLU B 1 265 ? 2.755   12.510  40.463 1.00 45.99 ? 370 GLU B N   1 
ATOM   5283 C  CA  . GLU B 1 265 ? 1.742   13.391  39.891 1.00 45.98 ? 370 GLU B CA  1 
ATOM   5284 C  C   . GLU B 1 265 ? 0.313   12.997  40.279 1.00 45.93 ? 370 GLU B C   1 
ATOM   5285 O  O   . GLU B 1 265 ? -0.539  13.865  40.434 1.00 46.17 ? 370 GLU B O   1 
ATOM   5286 C  CB  . GLU B 1 265 ? 1.889   13.477  38.360 1.00 46.16 ? 370 GLU B CB  1 
ATOM   5287 C  CG  . GLU B 1 265 ? 1.551   12.190  37.560 1.00 46.84 ? 370 GLU B CG  1 
ATOM   5288 C  CD  . GLU B 1 265 ? 2.751   11.278  37.319 1.00 47.37 ? 370 GLU B CD  1 
ATOM   5289 O  OE1 . GLU B 1 265 ? 3.627   11.174  38.208 1.00 47.98 ? 370 GLU B OE1 1 
ATOM   5290 O  OE2 . GLU B 1 265 ? 2.811   10.659  36.236 1.00 47.47 ? 370 GLU B OE2 1 
ATOM   5291 N  N   . ILE B 1 266 ? 0.058   11.700  40.444 1.00 45.83 ? 371 ILE B N   1 
ATOM   5292 C  CA  . ILE B 1 266 ? -1.262  11.206  40.878 1.00 45.73 ? 371 ILE B CA  1 
ATOM   5293 C  C   . ILE B 1 266 ? -1.315  10.851  42.374 1.00 45.63 ? 371 ILE B C   1 
ATOM   5294 O  O   . ILE B 1 266 ? -2.325  10.343  42.856 1.00 45.60 ? 371 ILE B O   1 
ATOM   5295 C  CB  . ILE B 1 266 ? -1.732  9.970   40.046 1.00 45.62 ? 371 ILE B CB  1 
ATOM   5296 C  CG1 . ILE B 1 266 ? -0.657  8.875   40.014 1.00 45.83 ? 371 ILE B CG1 1 
ATOM   5297 C  CG2 . ILE B 1 266 ? -2.091  10.387  38.637 1.00 45.58 ? 371 ILE B CG2 1 
ATOM   5298 C  CD1 . ILE B 1 266 ? -1.183  7.511   39.628 1.00 45.83 ? 371 ILE B CD1 1 
ATOM   5299 N  N   . GLY B 1 267 ? -0.236  11.119  43.104 1.00 45.63 ? 372 GLY B N   1 
ATOM   5300 C  CA  . GLY B 1 267 ? -0.153  10.767  44.520 1.00 45.70 ? 372 GLY B CA  1 
ATOM   5301 C  C   . GLY B 1 267 ? -0.081  9.269   44.761 1.00 45.66 ? 372 GLY B C   1 
ATOM   5302 O  O   . GLY B 1 267 ? -0.641  8.766   45.733 1.00 45.52 ? 372 GLY B O   1 
ATOM   5303 N  N   . LEU B 1 268 ? 0.623   8.560   43.883 1.00 45.83 ? 373 LEU B N   1 
ATOM   5304 C  CA  . LEU B 1 268 ? 0.691   7.099   43.932 1.00 46.10 ? 373 LEU B CA  1 
ATOM   5305 C  C   . LEU B 1 268 ? 1.205   6.592   45.282 1.00 46.33 ? 373 LEU B C   1 
ATOM   5306 O  O   . LEU B 1 268 ? 2.225   7.070   45.783 1.00 46.58 ? 373 LEU B O   1 
ATOM   5307 C  CB  . LEU B 1 268 ? 1.579   6.574   42.795 1.00 45.99 ? 373 LEU B CB  1 
ATOM   5308 C  CG  . LEU B 1 268 ? 1.734   5.056   42.665 1.00 46.07 ? 373 LEU B CG  1 
ATOM   5309 C  CD1 . LEU B 1 268 ? 0.375   4.357   42.564 1.00 45.84 ? 373 LEU B CD1 1 
ATOM   5310 C  CD2 . LEU B 1 268 ? 2.619   4.714   41.465 1.00 46.01 ? 373 LEU B CD2 1 
ATOM   5311 N  N   . ASP B 1 269 ? 0.489   5.625   45.854 1.00 46.63 ? 374 ASP B N   1 
ATOM   5312 C  CA  . ASP B 1 269 ? 0.787   5.088   47.182 1.00 46.75 ? 374 ASP B CA  1 
ATOM   5313 C  C   . ASP B 1 269 ? 0.762   3.552   47.158 1.00 46.90 ? 374 ASP B C   1 
ATOM   5314 O  O   . ASP B 1 269 ? -0.216  2.940   46.720 1.00 46.64 ? 374 ASP B O   1 
ATOM   5315 C  CB  . ASP B 1 269 ? -0.242  5.617   48.187 1.00 46.81 ? 374 ASP B CB  1 
ATOM   5316 C  CG  . ASP B 1 269 ? 0.247   5.571   49.635 1.00 47.03 ? 374 ASP B CG  1 
ATOM   5317 O  OD1 . ASP B 1 269 ? 1.017   4.655   50.010 1.00 47.82 ? 374 ASP B OD1 1 
ATOM   5318 O  OD2 . ASP B 1 269 ? -0.164  6.462   50.411 1.00 47.76 ? 374 ASP B OD2 1 
ATOM   5319 N  N   . ALA B 1 270 ? 1.841   2.942   47.640 1.00 47.21 ? 375 ALA B N   1 
ATOM   5320 C  CA  . ALA B 1 270 ? 1.975   1.490   47.660 1.00 47.49 ? 375 ALA B CA  1 
ATOM   5321 C  C   . ALA B 1 270 ? 1.136   0.834   48.762 1.00 47.78 ? 375 ALA B C   1 
ATOM   5322 O  O   . ALA B 1 270 ? 0.800   -0.349  48.669 1.00 47.83 ? 375 ALA B O   1 
ATOM   5323 C  CB  . ALA B 1 270 ? 3.435   1.106   47.812 1.00 47.49 ? 375 ALA B CB  1 
ATOM   5324 N  N   . ALA B 1 271 ? 0.801   1.593   49.802 1.00 48.10 ? 376 ALA B N   1 
ATOM   5325 C  CA  . ALA B 1 271 ? -0.060  1.085   50.874 1.00 48.44 ? 376 ALA B CA  1 
ATOM   5326 C  C   . ALA B 1 271 ? -1.531  1.021   50.459 1.00 48.68 ? 376 ALA B C   1 
ATOM   5327 O  O   . ALA B 1 271 ? -2.326  0.336   51.103 1.00 48.57 ? 376 ALA B O   1 
ATOM   5328 C  CB  . ALA B 1 271 ? 0.091   1.935   52.124 1.00 48.44 ? 376 ALA B CB  1 
ATOM   5329 N  N   . ALA B 1 272 ? -1.888  1.739   49.395 1.00 49.15 ? 377 ALA B N   1 
ATOM   5330 C  CA  . ALA B 1 272 ? -3.262  1.763   48.895 1.00 49.69 ? 377 ALA B CA  1 
ATOM   5331 C  C   . ALA B 1 272 ? -3.681  0.437   48.260 1.00 50.20 ? 377 ALA B C   1 
ATOM   5332 O  O   . ALA B 1 272 ? -4.845  0.044   48.352 1.00 50.46 ? 377 ALA B O   1 
ATOM   5333 C  CB  . ALA B 1 272 ? -3.441  2.892   47.905 1.00 49.57 ? 377 ALA B CB  1 
ATOM   5334 N  N   . LEU B 1 273 ? -2.733  -0.246  47.621 1.00 50.83 ? 378 LEU B N   1 
ATOM   5335 C  CA  . LEU B 1 273 ? -2.996  -1.527  46.967 1.00 51.27 ? 378 LEU B CA  1 
ATOM   5336 C  C   . LEU B 1 273 ? -2.106  -2.615  47.563 1.00 51.66 ? 378 LEU B C   1 
ATOM   5337 O  O   . LEU B 1 273 ? -0.879  -2.505  47.504 1.00 51.64 ? 378 LEU B O   1 
ATOM   5338 C  CB  . LEU B 1 273 ? -2.746  -1.415  45.464 1.00 51.44 ? 378 LEU B CB  1 
ATOM   5339 C  CG  . LEU B 1 273 ? -3.602  -0.382  44.728 1.00 51.69 ? 378 LEU B CG  1 
ATOM   5340 C  CD1 . LEU B 1 273 ? -3.141  -0.258  43.290 1.00 51.92 ? 378 LEU B CD1 1 
ATOM   5341 C  CD2 . LEU B 1 273 ? -5.083  -0.743  44.797 1.00 51.97 ? 378 LEU B CD2 1 
ATOM   5342 N  N   . PRO B 1 274 ? -2.715  -3.669  48.135 1.00 52.08 ? 379 PRO B N   1 
ATOM   5343 C  CA  . PRO B 1 274 ? -1.920  -4.701  48.805 1.00 52.47 ? 379 PRO B CA  1 
ATOM   5344 C  C   . PRO B 1 274 ? -1.068  -5.529  47.845 1.00 52.87 ? 379 PRO B C   1 
ATOM   5345 O  O   . PRO B 1 274 ? -1.447  -5.713  46.686 1.00 52.96 ? 379 PRO B O   1 
ATOM   5346 C  CB  . PRO B 1 274 ? -2.977  -5.593  49.479 1.00 52.54 ? 379 PRO B CB  1 
ATOM   5347 C  CG  . PRO B 1 274 ? -4.266  -4.850  49.381 1.00 52.41 ? 379 PRO B CG  1 
ATOM   5348 C  CD  . PRO B 1 274 ? -4.155  -3.969  48.192 1.00 52.09 ? 379 PRO B CD  1 
ATOM   5349 N  N   . GLY B 1 275 ? 0.064   -6.029  48.342 1.00 53.30 ? 380 GLY B N   1 
ATOM   5350 C  CA  . GLY B 1 275 ? 1.005   -6.801  47.531 1.00 53.51 ? 380 GLY B CA  1 
ATOM   5351 C  C   . GLY B 1 275 ? 1.711   -5.929  46.509 1.00 53.83 ? 380 GLY B C   1 
ATOM   5352 O  O   . GLY B 1 275 ? 1.695   -6.231  45.313 1.00 53.81 ? 380 GLY B O   1 
ATOM   5353 N  N   . GLN B 1 276 ? 2.323   -4.845  46.988 1.00 54.15 ? 381 GLN B N   1 
ATOM   5354 C  CA  . GLN B 1 276 ? 3.002   -3.869  46.133 1.00 54.34 ? 381 GLN B CA  1 
ATOM   5355 C  C   . GLN B 1 276 ? 4.368   -3.496  46.705 1.00 54.51 ? 381 GLN B C   1 
ATOM   5356 O  O   . GLN B 1 276 ? 4.468   -3.191  47.891 1.00 54.58 ? 381 GLN B O   1 
ATOM   5357 C  CB  . GLN B 1 276 ? 2.148   -2.608  46.001 1.00 54.46 ? 381 GLN B CB  1 
ATOM   5358 C  CG  . GLN B 1 276 ? 1.035   -2.729  44.982 1.00 54.77 ? 381 GLN B CG  1 
ATOM   5359 C  CD  . GLN B 1 276 ? 1.540   -2.576  43.564 1.00 55.02 ? 381 GLN B CD  1 
ATOM   5360 O  OE1 . GLN B 1 276 ? 1.978   -1.496  43.171 1.00 55.06 ? 381 GLN B OE1 1 
ATOM   5361 N  NE2 . GLN B 1 276 ? 1.483   -3.657  42.788 1.00 55.07 ? 381 GLN B NE2 1 
ATOM   5362 N  N   . PRO B 1 277 ? 5.426   -3.515  45.870 1.00 54.71 ? 382 PRO B N   1 
ATOM   5363 C  CA  . PRO B 1 277 ? 6.753   -3.173  46.390 1.00 54.86 ? 382 PRO B CA  1 
ATOM   5364 C  C   . PRO B 1 277 ? 6.895   -1.702  46.798 1.00 55.09 ? 382 PRO B C   1 
ATOM   5365 O  O   . PRO B 1 277 ? 6.344   -0.817  46.138 1.00 55.06 ? 382 PRO B O   1 
ATOM   5366 C  CB  . PRO B 1 277 ? 7.693   -3.494  45.219 1.00 54.75 ? 382 PRO B CB  1 
ATOM   5367 C  CG  . PRO B 1 277 ? 6.890   -4.252  44.240 1.00 54.67 ? 382 PRO B CG  1 
ATOM   5368 C  CD  . PRO B 1 277 ? 5.476   -3.857  44.439 1.00 54.71 ? 382 PRO B CD  1 
ATOM   5369 N  N   . MET B 1 278 ? 7.652   -1.462  47.867 1.00 55.33 ? 383 MET B N   1 
ATOM   5370 C  CA  . MET B 1 278 ? 7.859   -0.113  48.410 1.00 55.55 ? 383 MET B CA  1 
ATOM   5371 C  C   . MET B 1 278 ? 8.581   0.753   47.379 1.00 55.41 ? 383 MET B C   1 
ATOM   5372 O  O   . MET B 1 278 ? 8.247   1.923   47.179 1.00 55.41 ? 383 MET B O   1 
ATOM   5373 C  CB  . MET B 1 278 ? 8.727   -0.134  49.685 1.00 55.69 ? 383 MET B CB  1 
ATOM   5374 C  CG  . MET B 1 278 ? 8.518   -1.296  50.669 1.00 56.39 ? 383 MET B CG  1 
ATOM   5375 S  SD  . MET B 1 278 ? 10.078  -1.862  51.420 1.00 57.03 ? 383 MET B SD  1 
ATOM   5376 C  CE  . MET B 1 278 ? 11.006  -2.437  49.989 1.00 57.30 ? 383 MET B CE  1 
ATOM   5377 N  N   . GLU B 1 279 ? 9.587   0.154   46.746 1.00 55.30 ? 384 GLU B N   1 
ATOM   5378 C  CA  . GLU B 1 279 ? 10.477  0.846   45.822 1.00 55.06 ? 384 GLU B CA  1 
ATOM   5379 C  C   . GLU B 1 279 ? 9.774   1.141   44.495 1.00 54.74 ? 384 GLU B C   1 
ATOM   5380 O  O   . GLU B 1 279 ? 9.813   2.275   44.018 1.00 54.79 ? 384 GLU B O   1 
ATOM   5381 C  CB  . GLU B 1 279 ? 11.731  -0.015  45.585 1.00 55.22 ? 384 GLU B CB  1 
ATOM   5382 C  CG  . GLU B 1 279 ? 12.929  0.705   44.951 1.00 55.50 ? 384 GLU B CG  1 
ATOM   5383 C  CD  . GLU B 1 279 ? 14.088  -0.246  44.605 1.00 55.68 ? 384 GLU B CD  1 
ATOM   5384 O  OE1 . GLU B 1 279 ? 13.944  -1.479  44.792 1.00 56.26 ? 384 GLU B OE1 1 
ATOM   5385 O  OE2 . GLU B 1 279 ? 15.146  0.245   44.141 1.00 56.04 ? 384 GLU B OE2 1 
ATOM   5386 N  N   . ALA B 1 280 ? 9.122   0.128   43.917 1.00 54.27 ? 385 ALA B N   1 
ATOM   5387 C  CA  . ALA B 1 280 ? 8.517   0.245   42.580 1.00 53.87 ? 385 ALA B CA  1 
ATOM   5388 C  C   . ALA B 1 280 ? 7.103   -0.359  42.491 1.00 53.40 ? 385 ALA B C   1 
ATOM   5389 O  O   . ALA B 1 280 ? 6.940   -1.514  42.087 1.00 53.12 ? 385 ALA B O   1 
ATOM   5390 C  CB  . ALA B 1 280 ? 9.429   -0.401  41.542 1.00 53.90 ? 385 ALA B CB  1 
ATOM   5391 N  N   . PRO B 1 281 ? 6.076   0.427   42.863 1.00 52.82 ? 386 PRO B N   1 
ATOM   5392 C  CA  . PRO B 1 281 ? 4.692   0.005   42.682 1.00 52.45 ? 386 PRO B CA  1 
ATOM   5393 C  C   . PRO B 1 281 ? 4.196   0.229   41.255 1.00 52.01 ? 386 PRO B C   1 
ATOM   5394 O  O   . PRO B 1 281 ? 4.861   0.893   40.461 1.00 51.92 ? 386 PRO B O   1 
ATOM   5395 C  CB  . PRO B 1 281 ? 3.928   0.888   43.668 1.00 52.44 ? 386 PRO B CB  1 
ATOM   5396 C  CG  . PRO B 1 281 ? 4.727   2.123   43.764 1.00 52.64 ? 386 PRO B CG  1 
ATOM   5397 C  CD  . PRO B 1 281 ? 6.165   1.756   43.495 1.00 52.80 ? 386 PRO B CD  1 
ATOM   5398 N  N   . VAL B 1 282 ? 3.024   -0.321  40.952 1.00 51.59 ? 387 VAL B N   1 
ATOM   5399 C  CA  . VAL B 1 282 ? 2.454   -0.292  39.604 1.00 51.34 ? 387 VAL B CA  1 
ATOM   5400 C  C   . VAL B 1 282 ? 1.825   1.062   39.279 1.00 51.00 ? 387 VAL B C   1 
ATOM   5401 O  O   . VAL B 1 282 ? 1.101   1.631   40.092 1.00 50.85 ? 387 VAL B O   1 
ATOM   5402 C  CB  . VAL B 1 282 ? 1.388   -1.400  39.443 1.00 51.29 ? 387 VAL B CB  1 
ATOM   5403 C  CG1 . VAL B 1 282 ? 0.657   -1.284  38.107 1.00 51.29 ? 387 VAL B CG1 1 
ATOM   5404 C  CG2 . VAL B 1 282 ? 2.040   -2.765  39.575 1.00 51.41 ? 387 VAL B CG2 1 
ATOM   5405 N  N   . MET B 1 283 ? 2.096   1.561   38.076 1.00 50.68 ? 388 MET B N   1 
ATOM   5406 C  CA  . MET B 1 283 ? 1.528   2.827   37.621 1.00 50.64 ? 388 MET B CA  1 
ATOM   5407 C  C   . MET B 1 283 ? 0.062   2.617   37.255 1.00 50.51 ? 388 MET B C   1 
ATOM   5408 O  O   . MET B 1 283 ? -0.261  1.726   36.470 1.00 50.37 ? 388 MET B O   1 
ATOM   5409 C  CB  . MET B 1 283 ? 2.312   3.353   36.415 1.00 50.41 ? 388 MET B CB  1 
ATOM   5410 C  CG  . MET B 1 283 ? 1.921   4.745   35.921 1.00 50.40 ? 388 MET B CG  1 
ATOM   5411 S  SD  . MET B 1 283 ? 2.008   6.018   37.191 1.00 50.22 ? 388 MET B SD  1 
ATOM   5412 C  CE  . MET B 1 283 ? 1.883   7.511   36.218 1.00 49.93 ? 388 MET B CE  1 
ATOM   5413 N  N   . LEU B 1 284 ? -0.818  3.436   37.831 1.00 50.55 ? 389 LEU B N   1 
ATOM   5414 C  CA  . LEU B 1 284 ? -2.262  3.336   37.589 1.00 50.58 ? 389 LEU B CA  1 
ATOM   5415 C  C   . LEU B 1 284 ? -2.690  4.288   36.471 1.00 50.56 ? 389 LEU B C   1 
ATOM   5416 O  O   . LEU B 1 284 ? -2.903  5.477   36.707 1.00 50.47 ? 389 LEU B O   1 
ATOM   5417 C  CB  . LEU B 1 284 ? -3.044  3.636   38.873 1.00 50.44 ? 389 LEU B CB  1 
ATOM   5418 C  CG  . LEU B 1 284 ? -2.643  2.824   40.111 1.00 50.64 ? 389 LEU B CG  1 
ATOM   5419 C  CD1 . LEU B 1 284 ? -3.324  3.378   41.353 1.00 50.87 ? 389 LEU B CD1 1 
ATOM   5420 C  CD2 . LEU B 1 284 ? -2.957  1.336   39.944 1.00 50.63 ? 389 LEU B CD2 1 
ATOM   5421 N  N   . TRP B 1 285 ? -2.799  3.754   35.256 1.00 50.66 ? 390 TRP B N   1 
ATOM   5422 C  CA  . TRP B 1 285 ? -3.245  4.525   34.094 1.00 50.84 ? 390 TRP B CA  1 
ATOM   5423 C  C   . TRP B 1 285 ? -4.762  4.615   34.062 1.00 51.02 ? 390 TRP B C   1 
ATOM   5424 O  O   . TRP B 1 285 ? -5.328  5.694   33.878 1.00 50.99 ? 390 TRP B O   1 
ATOM   5425 C  CB  . TRP B 1 285 ? -2.753  3.876   32.801 1.00 50.55 ? 390 TRP B CB  1 
ATOM   5426 C  CG  . TRP B 1 285 ? -1.264  3.768   32.722 1.00 50.37 ? 390 TRP B CG  1 
ATOM   5427 C  CD1 . TRP B 1 285 ? -0.507  2.672   33.007 1.00 49.90 ? 390 TRP B CD1 1 
ATOM   5428 C  CD2 . TRP B 1 285 ? -0.349  4.803   32.346 1.00 50.27 ? 390 TRP B CD2 1 
ATOM   5429 N  NE1 . TRP B 1 285 ? 0.822   2.956   32.827 1.00 49.84 ? 390 TRP B NE1 1 
ATOM   5430 C  CE2 . TRP B 1 285 ? 0.949   4.258   32.421 1.00 50.14 ? 390 TRP B CE2 1 
ATOM   5431 C  CE3 . TRP B 1 285 ? -0.501  6.138   31.951 1.00 50.05 ? 390 TRP B CE3 1 
ATOM   5432 C  CZ2 . TRP B 1 285 ? 2.092   5.002   32.115 1.00 50.20 ? 390 TRP B CZ2 1 
ATOM   5433 C  CZ3 . TRP B 1 285 ? 0.636   6.877   31.647 1.00 50.07 ? 390 TRP B CZ3 1 
ATOM   5434 C  CH2 . TRP B 1 285 ? 1.914   6.306   31.731 1.00 50.11 ? 390 TRP B CH2 1 
ATOM   5435 N  N   . ASP B 1 286 ? -5.407  3.467   34.237 1.00 51.46 ? 391 ASP B N   1 
ATOM   5436 C  CA  . ASP B 1 286 ? -6.866  3.369   34.248 1.00 51.82 ? 391 ASP B CA  1 
ATOM   5437 C  C   . ASP B 1 286 ? -7.307  2.257   35.209 1.00 51.94 ? 391 ASP B C   1 
ATOM   5438 O  O   . ASP B 1 286 ? -6.516  1.793   36.027 1.00 51.80 ? 391 ASP B O   1 
ATOM   5439 C  CB  . ASP B 1 286 ? -7.391  3.147   32.817 1.00 51.86 ? 391 ASP B CB  1 
ATOM   5440 C  CG  . ASP B 1 286 ? -6.740  1.957   32.126 1.00 52.28 ? 391 ASP B CG  1 
ATOM   5441 O  OD1 . ASP B 1 286 ? -6.692  0.859   32.723 1.00 52.87 ? 391 ASP B OD1 1 
ATOM   5442 O  OD2 . ASP B 1 286 ? -6.278  2.121   30.976 1.00 52.73 ? 391 ASP B OD2 1 
ATOM   5443 N  N   . GLU B 1 287 ? -8.564  1.841   35.110 1.00 52.40 ? 392 GLU B N   1 
ATOM   5444 C  CA  . GLU B 1 287 ? -9.136  0.844   36.020 1.00 52.83 ? 392 GLU B CA  1 
ATOM   5445 C  C   . GLU B 1 287 ? -8.579  -0.570  35.815 1.00 53.09 ? 392 GLU B C   1 
ATOM   5446 O  O   . GLU B 1 287 ? -8.637  -1.391  36.731 1.00 53.24 ? 392 GLU B O   1 
ATOM   5447 C  CB  . GLU B 1 287 ? -10.668 0.813   35.890 1.00 52.96 ? 392 GLU B CB  1 
ATOM   5448 C  CG  . GLU B 1 287 ? -11.378 2.076   36.395 1.00 53.42 ? 392 GLU B CG  1 
ATOM   5449 C  CD  . GLU B 1 287 ? -11.481 3.181   35.343 1.00 53.98 ? 392 GLU B CD  1 
ATOM   5450 O  OE1 . GLU B 1 287 ? -12.605 3.684   35.125 1.00 54.59 ? 392 GLU B OE1 1 
ATOM   5451 O  OE2 . GLU B 1 287 ? -10.447 3.547   34.737 1.00 53.88 ? 392 GLU B OE2 1 
ATOM   5452 N  N   . SER B 1 288 ? -8.047  -0.853  34.625 1.00 53.31 ? 393 SER B N   1 
ATOM   5453 C  CA  . SER B 1 288 ? -7.498  -2.176  34.315 1.00 53.46 ? 393 SER B CA  1 
ATOM   5454 C  C   . SER B 1 288 ? -6.012  -2.305  34.675 1.00 53.59 ? 393 SER B C   1 
ATOM   5455 O  O   . SER B 1 288 ? -5.397  -3.337  34.408 1.00 53.42 ? 393 SER B O   1 
ATOM   5456 C  CB  . SER B 1 288 ? -7.714  -2.502  32.833 1.00 53.44 ? 393 SER B CB  1 
ATOM   5457 O  OG  . SER B 1 288 ? -7.034  -1.583  31.999 1.00 53.45 ? 393 SER B OG  1 
ATOM   5458 N  N   . SER B 1 289 ? -5.445  -1.268  35.292 1.00 53.99 ? 394 SER B N   1 
ATOM   5459 C  CA  . SER B 1 289 ? -4.027  -1.265  35.678 1.00 54.30 ? 394 SER B CA  1 
ATOM   5460 C  C   . SER B 1 289 ? -3.711  -2.196  36.852 1.00 54.69 ? 394 SER B C   1 
ATOM   5461 O  O   . SER B 1 289 ? -2.544  -2.525  37.086 1.00 54.80 ? 394 SER B O   1 
ATOM   5462 C  CB  . SER B 1 289 ? -3.568  0.152   36.024 1.00 54.14 ? 394 SER B CB  1 
ATOM   5463 O  OG  . SER B 1 289 ? -3.662  0.998   34.899 1.00 53.82 ? 394 SER B OG  1 
ATOM   5464 N  N   . PHE B 1 290 ? -4.743  -2.609  37.587 1.00 55.13 ? 395 PHE B N   1 
ATOM   5465 C  CA  . PHE B 1 290 ? -4.578  -3.518  38.718 1.00 55.34 ? 395 PHE B CA  1 
ATOM   5466 C  C   . PHE B 1 290 ? -5.603  -4.658  38.614 1.00 55.59 ? 395 PHE B C   1 
ATOM   5467 O  O   . PHE B 1 290 ? -6.644  -4.624  39.275 1.00 55.49 ? 395 PHE B O   1 
ATOM   5468 C  CB  . PHE B 1 290 ? -4.727  -2.740  40.033 1.00 55.54 ? 395 PHE B CB  1 
ATOM   5469 C  CG  . PHE B 1 290 ? -4.049  -3.388  41.211 1.00 55.47 ? 395 PHE B CG  1 
ATOM   5470 C  CD1 . PHE B 1 290 ? -2.673  -3.575  41.219 1.00 55.88 ? 395 PHE B CD1 1 
ATOM   5471 C  CD2 . PHE B 1 290 ? -4.781  -3.783  42.322 1.00 55.76 ? 395 PHE B CD2 1 
ATOM   5472 C  CE1 . PHE B 1 290 ? -2.040  -4.169  42.307 1.00 55.96 ? 395 PHE B CE1 1 
ATOM   5473 C  CE2 . PHE B 1 290 ? -4.155  -4.378  43.414 1.00 55.71 ? 395 PHE B CE2 1 
ATOM   5474 C  CZ  . PHE B 1 290 ? -2.784  -4.573  43.404 1.00 55.76 ? 395 PHE B CZ  1 
ATOM   5475 N  N   . PRO B 1 291 ? -5.312  -5.666  37.765 1.00 55.83 ? 396 PRO B N   1 
ATOM   5476 C  CA  . PRO B 1 291 ? -6.210  -6.811  37.588 1.00 55.95 ? 396 PRO B CA  1 
ATOM   5477 C  C   . PRO B 1 291 ? -6.284  -7.675  38.843 1.00 56.19 ? 396 PRO B C   1 
ATOM   5478 O  O   . PRO B 1 291 ? -7.336  -8.259  39.135 1.00 56.28 ? 396 PRO B O   1 
ATOM   5479 C  CB  . PRO B 1 291 ? -5.573  -7.602  36.434 1.00 55.96 ? 396 PRO B CB  1 
ATOM   5480 C  CG  . PRO B 1 291 ? -4.532  -6.716  35.850 1.00 56.00 ? 396 PRO B CG  1 
ATOM   5481 C  CD  . PRO B 1 291 ? -4.104  -5.788  36.930 1.00 55.85 ? 396 PRO B CD  1 
ATOM   5482 N  N   . ASP B 1 292 ? -5.164  -7.771  39.560 1.00 56.40 ? 397 ASP B N   1 
ATOM   5483 C  CA  . ASP B 1 292 ? -5.155  -8.368  40.890 1.00 56.39 ? 397 ASP B CA  1 
ATOM   5484 C  C   . ASP B 1 292 ? -6.109  -7.567  41.773 1.00 56.43 ? 397 ASP B C   1 
ATOM   5485 O  O   . ASP B 1 292 ? -5.905  -6.374  41.984 1.00 56.55 ? 397 ASP B O   1 
ATOM   5486 C  CB  . ASP B 1 292 ? -3.746  -8.344  41.490 1.00 56.54 ? 397 ASP B CB  1 
ATOM   5487 C  CG  . ASP B 1 292 ? -3.712  -8.868  42.921 1.00 56.71 ? 397 ASP B CG  1 
ATOM   5488 O  OD1 . ASP B 1 292 ? -3.823  -10.100 43.113 1.00 57.53 ? 397 ASP B OD1 1 
ATOM   5489 O  OD2 . ASP B 1 292 ? -3.574  -8.046  43.855 1.00 57.09 ? 397 ASP B OD2 1 
ATOM   5490 N  N   . ILE B 1 293 ? -7.149  -8.229  42.273 1.00 56.34 ? 398 ILE B N   1 
ATOM   5491 C  CA  . ILE B 1 293 ? -8.203  -7.575  43.052 1.00 56.25 ? 398 ILE B CA  1 
ATOM   5492 C  C   . ILE B 1 293 ? -8.916  -6.497  42.219 1.00 56.18 ? 398 ILE B C   1 
ATOM   5493 O  O   . ILE B 1 293 ? -8.549  -5.314  42.268 1.00 56.21 ? 398 ILE B O   1 
ATOM   5494 C  CB  . ILE B 1 293 ? -7.681  -6.955  44.386 1.00 56.30 ? 398 ILE B CB  1 
ATOM   5495 C  CG1 . ILE B 1 293 ? -6.721  -7.907  45.106 1.00 56.33 ? 398 ILE B CG1 1 
ATOM   5496 C  CG2 . ILE B 1 293 ? -8.858  -6.634  45.307 1.00 56.33 ? 398 ILE B CG2 1 
ATOM   5497 C  CD1 . ILE B 1 293 ? -5.904  -7.240  46.189 1.00 56.31 ? 398 ILE B CD1 1 
ATOM   5498 N  N   . PRO B 1 294 ? -9.928  -6.907  41.431 1.00 55.98 ? 399 PRO B N   1 
ATOM   5499 C  CA  . PRO B 1 294 ? -10.807 -5.918  40.812 1.00 55.73 ? 399 PRO B CA  1 
ATOM   5500 C  C   . PRO B 1 294 ? -11.748 -5.324  41.861 1.00 55.55 ? 399 PRO B C   1 
ATOM   5501 O  O   . PRO B 1 294 ? -12.046 -5.983  42.866 1.00 55.69 ? 399 PRO B O   1 
ATOM   5502 C  CB  . PRO B 1 294 ? -11.587 -6.740  39.783 1.00 55.85 ? 399 PRO B CB  1 
ATOM   5503 C  CG  . PRO B 1 294 ? -11.625 -8.116  40.356 1.00 55.94 ? 399 PRO B CG  1 
ATOM   5504 C  CD  . PRO B 1 294 ? -10.309 -8.288  41.071 1.00 56.02 ? 399 PRO B CD  1 
ATOM   5505 N  N   . GLY B 1 295 ? -12.211 -4.099  41.631 1.00 55.09 ? 400 GLY B N   1 
ATOM   5506 C  CA  . GLY B 1 295 ? -13.052 -3.401  42.606 1.00 54.71 ? 400 GLY B CA  1 
ATOM   5507 C  C   . GLY B 1 295 ? -12.227 -2.934  43.791 1.00 54.36 ? 400 GLY B C   1 
ATOM   5508 O  O   . GLY B 1 295 ? -12.634 -3.087  44.948 1.00 54.34 ? 400 GLY B O   1 
ATOM   5509 N  N   . ALA B 1 296 ? -11.058 -2.374  43.482 1.00 53.83 ? 401 ALA B N   1 
ATOM   5510 C  CA  . ALA B 1 296 ? -10.104 -1.893  44.481 1.00 53.40 ? 401 ALA B CA  1 
ATOM   5511 C  C   . ALA B 1 296 ? -9.532  -0.538  44.063 1.00 52.95 ? 401 ALA B C   1 
ATOM   5512 O  O   . ALA B 1 296 ? -9.537  0.412   44.845 1.00 53.04 ? 401 ALA B O   1 
ATOM   5513 C  CB  . ALA B 1 296 ? -8.983  -2.903  44.663 1.00 53.45 ? 401 ALA B CB  1 
ATOM   5514 N  N   . VAL B 1 297 ? -9.029  -0.464  42.834 1.00 52.35 ? 402 VAL B N   1 
ATOM   5515 C  CA  . VAL B 1 297 ? -8.608  0.805   42.241 1.00 51.91 ? 402 VAL B CA  1 
ATOM   5516 C  C   . VAL B 1 297 ? -9.840  1.572   41.767 1.00 51.42 ? 402 VAL B C   1 
ATOM   5517 O  O   . VAL B 1 297 ? -10.691 1.017   41.072 1.00 51.38 ? 402 VAL B O   1 
ATOM   5518 C  CB  . VAL B 1 297 ? -7.660  0.589   41.040 1.00 51.91 ? 402 VAL B CB  1 
ATOM   5519 C  CG1 . VAL B 1 297 ? -7.261  1.925   40.419 1.00 51.95 ? 402 VAL B CG1 1 
ATOM   5520 C  CG2 . VAL B 1 297 ? -6.420  -0.180  41.469 1.00 52.05 ? 402 VAL B CG2 1 
ATOM   5521 N  N   . SER B 1 298 ? -9.930  2.845   42.148 1.00 50.89 ? 403 SER B N   1 
ATOM   5522 C  CA  . SER B 1 298 ? -11.038 3.714   41.742 1.00 50.39 ? 403 SER B CA  1 
ATOM   5523 C  C   . SER B 1 298 ? -10.531 4.860   40.861 1.00 49.81 ? 403 SER B C   1 
ATOM   5524 O  O   . SER B 1 298 ? -9.327  5.081   40.751 1.00 49.50 ? 403 SER B O   1 
ATOM   5525 C  CB  . SER B 1 298 ? -11.778 4.250   42.975 1.00 50.35 ? 403 SER B CB  1 
ATOM   5526 O  OG  . SER B 1 298 ? -10.874 4.760   43.939 1.00 50.28 ? 403 SER B OG  1 
ATOM   5527 N  N   . ALA B 1 299 ? -11.464 5.581   40.244 1.00 49.34 ? 404 ALA B N   1 
ATOM   5528 C  CA  . ALA B 1 299 ? -11.148 6.631   39.269 1.00 49.08 ? 404 ALA B CA  1 
ATOM   5529 C  C   . ALA B 1 299 ? -10.243 7.744   39.814 1.00 48.70 ? 404 ALA B C   1 
ATOM   5530 O  O   . ALA B 1 299 ? -9.392  8.263   39.094 1.00 48.48 ? 404 ALA B O   1 
ATOM   5531 C  CB  . ALA B 1 299 ? -12.433 7.227   38.719 1.00 48.95 ? 404 ALA B CB  1 
ATOM   5532 N  N   . ASN B 1 300 ? -10.429 8.100   41.082 1.00 48.49 ? 405 ASN B N   1 
ATOM   5533 C  CA  . ASN B 1 300 ? -9.642  9.165   41.723 1.00 48.30 ? 405 ASN B CA  1 
ATOM   5534 C  C   . ASN B 1 300 ? -8.149  8.853   41.910 1.00 48.09 ? 405 ASN B C   1 
ATOM   5535 O  O   . ASN B 1 300 ? -7.355  9.765   42.154 1.00 47.96 ? 405 ASN B O   1 
ATOM   5536 C  CB  . ASN B 1 300 ? -10.270 9.572   43.070 1.00 48.24 ? 405 ASN B CB  1 
ATOM   5537 C  CG  . ASN B 1 300 ? -10.478 8.391   44.023 1.00 48.27 ? 405 ASN B CG  1 
ATOM   5538 O  OD1 . ASN B 1 300 ? -9.952  7.297   43.818 1.00 48.10 ? 405 ASN B OD1 1 
ATOM   5539 N  ND2 . ASN B 1 300 ? -11.257 8.619   45.074 1.00 48.27 ? 405 ASN B ND2 1 
ATOM   5540 N  N   . MET B 1 301 ? -7.784  7.574   41.791 1.00 47.93 ? 406 MET B N   1 
ATOM   5541 C  CA  . MET B 1 301 ? -6.397  7.112   41.941 1.00 47.83 ? 406 MET B CA  1 
ATOM   5542 C  C   . MET B 1 301 ? -5.646  6.950   40.612 1.00 47.53 ? 406 MET B C   1 
ATOM   5543 O  O   . MET B 1 301 ? -4.439  6.700   40.620 1.00 47.52 ? 406 MET B O   1 
ATOM   5544 C  CB  . MET B 1 301 ? -6.372  5.768   42.684 1.00 47.81 ? 406 MET B CB  1 
ATOM   5545 C  CG  . MET B 1 301 ? -6.835  5.843   44.133 1.00 48.14 ? 406 MET B CG  1 
ATOM   5546 S  SD  . MET B 1 301 ? -7.377  4.248   44.796 1.00 48.47 ? 406 MET B SD  1 
ATOM   5547 C  CE  . MET B 1 301 ? -5.805  3.442   45.093 1.00 48.44 ? 406 MET B CE  1 
ATOM   5548 N  N   . THR B 1 302 ? -6.346  7.090   39.484 1.00 47.28 ? 407 THR B N   1 
ATOM   5549 C  CA  . THR B 1 302 ? -5.760  6.824   38.162 1.00 47.04 ? 407 THR B CA  1 
ATOM   5550 C  C   . THR B 1 302 ? -5.465  8.085   37.359 1.00 46.77 ? 407 THR B C   1 
ATOM   5551 O  O   . THR B 1 302 ? -5.903  9.177   37.705 1.00 46.56 ? 407 THR B O   1 
ATOM   5552 C  CB  . THR B 1 302 ? -6.679  5.926   37.299 1.00 47.02 ? 407 THR B CB  1 
ATOM   5553 O  OG1 . THR B 1 302 ? -7.804  6.680   36.823 1.00 46.53 ? 407 THR B OG1 1 
ATOM   5554 C  CG2 . THR B 1 302 ? -7.158  4.727   38.101 1.00 46.97 ? 407 THR B CG2 1 
ATOM   5555 N  N   . VAL B 1 303 ? -4.722  7.904   36.273 1.00 46.65 ? 408 VAL B N   1 
ATOM   5556 C  CA  . VAL B 1 303 ? -4.428  8.977   35.332 1.00 46.65 ? 408 VAL B CA  1 
ATOM   5557 C  C   . VAL B 1 303 ? -5.692  9.369   34.572 1.00 46.58 ? 408 VAL B C   1 
ATOM   5558 O  O   . VAL B 1 303 ? -6.012  10.552  34.463 1.00 46.75 ? 408 VAL B O   1 
ATOM   5559 C  CB  . VAL B 1 303 ? -3.326  8.559   34.325 1.00 46.64 ? 408 VAL B CB  1 
ATOM   5560 C  CG1 . VAL B 1 303 ? -3.173  9.595   33.210 1.00 46.59 ? 408 VAL B CG1 1 
ATOM   5561 C  CG2 . VAL B 1 303 ? -1.994  8.354   35.046 1.00 46.81 ? 408 VAL B CG2 1 
ATOM   5562 N  N   . LYS B 1 304 ? -6.405  8.374   34.055 1.00 46.41 ? 409 LYS B N   1 
ATOM   5563 C  CA  . LYS B 1 304 ? -7.624  8.613   33.282 1.00 46.37 ? 409 LYS B CA  1 
ATOM   5564 C  C   . LYS B 1 304 ? -8.652  9.436   34.066 1.00 46.29 ? 409 LYS B C   1 
ATOM   5565 O  O   . LYS B 1 304 ? -9.258  10.367  33.526 1.00 46.22 ? 409 LYS B O   1 
ATOM   5566 C  CB  . LYS B 1 304 ? -8.245  7.277   32.858 1.00 46.44 ? 409 LYS B CB  1 
ATOM   5567 C  CG  . LYS B 1 304 ? -9.370  7.390   31.840 1.00 46.35 ? 409 LYS B CG  1 
ATOM   5568 C  CD  . LYS B 1 304 ? -10.101 6.070   31.685 1.00 46.34 ? 409 LYS B CD  1 
ATOM   5569 C  CE  . LYS B 1 304 ? -11.316 6.211   30.789 1.00 46.36 ? 409 LYS B CE  1 
ATOM   5570 N  NZ  . LYS B 1 304 ? -12.207 5.028   30.890 1.00 46.44 ? 409 LYS B NZ  1 
ATOM   5571 N  N   . GLY B 1 305 ? -8.839  9.087   35.336 1.00 46.18 ? 410 GLY B N   1 
ATOM   5572 C  CA  . GLY B 1 305 ? -9.825  9.743   36.186 1.00 46.07 ? 410 GLY B CA  1 
ATOM   5573 C  C   . GLY B 1 305 ? -9.395  11.102  36.703 1.00 46.03 ? 410 GLY B C   1 
ATOM   5574 O  O   . GLY B 1 305 ? -10.218 12.005  36.825 1.00 46.12 ? 410 GLY B O   1 
ATOM   5575 N  N   . GLN B 1 306 ? -8.111  11.259  37.017 1.00 46.03 ? 411 GLN B N   1 
ATOM   5576 C  CA  . GLN B 1 306 ? -7.613  12.543  37.516 1.00 45.91 ? 411 GLN B CA  1 
ATOM   5577 C  C   . GLN B 1 306 ? -7.520  13.593  36.416 1.00 46.08 ? 411 GLN B C   1 
ATOM   5578 O  O   . GLN B 1 306 ? -7.483  14.789  36.707 1.00 46.07 ? 411 GLN B O   1 
ATOM   5579 C  CB  . GLN B 1 306 ? -6.270  12.383  38.222 1.00 45.77 ? 411 GLN B CB  1 
ATOM   5580 C  CG  . GLN B 1 306 ? -6.403  11.761  39.603 1.00 45.52 ? 411 GLN B CG  1 
ATOM   5581 C  CD  . GLN B 1 306 ? -5.134  11.859  40.421 1.00 45.07 ? 411 GLN B CD  1 
ATOM   5582 O  OE1 . GLN B 1 306 ? -4.431  12.863  40.379 1.00 43.31 ? 411 GLN B OE1 1 
ATOM   5583 N  NE2 . GLN B 1 306 ? -4.844  10.816  41.185 1.00 43.75 ? 411 GLN B NE2 1 
ATOM   5584 N  N   . SER B 1 307 ? -7.505  13.149  35.160 1.00 46.22 ? 412 SER B N   1 
ATOM   5585 C  CA  . SER B 1 307 ? -7.516  14.063  34.014 1.00 46.39 ? 412 SER B CA  1 
ATOM   5586 C  C   . SER B 1 307 ? -8.900  14.653  33.713 1.00 46.50 ? 412 SER B C   1 
ATOM   5587 O  O   . SER B 1 307 ? -9.018  15.545  32.872 1.00 46.40 ? 412 SER B O   1 
ATOM   5588 C  CB  . SER B 1 307 ? -6.974  13.357  32.768 1.00 46.44 ? 412 SER B CB  1 
ATOM   5589 O  OG  . SER B 1 307 ? -5.631  12.952  32.967 1.00 46.44 ? 412 SER B OG  1 
ATOM   5590 N  N   . GLU B 1 308 ? -9.935  14.148  34.385 1.00 46.71 ? 413 GLU B N   1 
ATOM   5591 C  CA  . GLU B 1 308 ? -11.295 14.693  34.275 1.00 46.92 ? 413 GLU B CA  1 
ATOM   5592 C  C   . GLU B 1 308 ? -11.583 15.766  35.323 1.00 46.92 ? 413 GLU B C   1 
ATOM   5593 O  O   . GLU B 1 308 ? -12.442 16.623  35.123 1.00 46.90 ? 413 GLU B O   1 
ATOM   5594 C  CB  . GLU B 1 308 ? -12.328 13.579  34.446 1.00 47.01 ? 413 GLU B CB  1 
ATOM   5595 C  CG  . GLU B 1 308 ? -12.240 12.475  33.419 1.00 47.90 ? 413 GLU B CG  1 
ATOM   5596 C  CD  . GLU B 1 308 ? -12.493 12.962  32.002 1.00 49.29 ? 413 GLU B CD  1 
ATOM   5597 O  OE1 . GLU B 1 308 ? -13.223 13.963  31.821 1.00 49.78 ? 413 GLU B OE1 1 
ATOM   5598 O  OE2 . GLU B 1 308 ? -11.961 12.327  31.067 1.00 50.32 ? 413 GLU B OE2 1 
ATOM   5599 N  N   . ASP B 1 309 ? -10.863 15.704  36.439 1.00 47.06 ? 414 ASP B N   1 
ATOM   5600 C  CA  . ASP B 1 309 ? -11.183 16.485  37.627 1.00 47.10 ? 414 ASP B CA  1 
ATOM   5601 C  C   . ASP B 1 309 ? -10.214 17.671  37.779 1.00 47.16 ? 414 ASP B C   1 
ATOM   5602 O  O   . ASP B 1 309 ? -9.005  17.462  37.928 1.00 47.30 ? 414 ASP B O   1 
ATOM   5603 C  CB  . ASP B 1 309 ? -11.124 15.558  38.849 1.00 47.14 ? 414 ASP B CB  1 
ATOM   5604 C  CG  . ASP B 1 309 ? -11.378 16.278  40.155 1.00 47.22 ? 414 ASP B CG  1 
ATOM   5605 O  OD1 . ASP B 1 309 ? -12.063 17.323  40.155 1.00 47.65 ? 414 ASP B OD1 1 
ATOM   5606 O  OD2 . ASP B 1 309 ? -10.891 15.782  41.192 1.00 47.82 ? 414 ASP B OD2 1 
ATOM   5607 N  N   . PRO B 1 310 ? -10.735 18.917  37.728 1.00 47.06 ? 415 PRO B N   1 
ATOM   5608 C  CA  . PRO B 1 310 ? -9.890  20.112  37.928 1.00 46.95 ? 415 PRO B CA  1 
ATOM   5609 C  C   . PRO B 1 310 ? -9.244  20.193  39.317 1.00 46.79 ? 415 PRO B C   1 
ATOM   5610 O  O   . PRO B 1 310 ? -8.150  20.742  39.461 1.00 46.46 ? 415 PRO B O   1 
ATOM   5611 C  CB  . PRO B 1 310 ? -10.869 21.282  37.732 1.00 46.96 ? 415 PRO B CB  1 
ATOM   5612 C  CG  . PRO B 1 310 ? -12.043 20.709  37.014 1.00 47.05 ? 415 PRO B CG  1 
ATOM   5613 C  CD  . PRO B 1 310 ? -12.139 19.284  37.461 1.00 47.06 ? 415 PRO B CD  1 
ATOM   5614 N  N   . GLY B 1 311 ? -9.923  19.643  40.321 1.00 46.77 ? 416 GLY B N   1 
ATOM   5615 C  CA  . GLY B 1 311 ? -9.411  19.609  41.684 1.00 46.78 ? 416 GLY B CA  1 
ATOM   5616 C  C   . GLY B 1 311 ? -8.439  18.480  41.997 1.00 46.82 ? 416 GLY B C   1 
ATOM   5617 O  O   . GLY B 1 311 ? -7.984  18.373  43.130 1.00 46.96 ? 416 GLY B O   1 
ATOM   5618 N  N   . SER B 1 312 ? -8.106  17.641  41.017 1.00 46.77 ? 417 SER B N   1 
ATOM   5619 C  CA  . SER B 1 312 ? -7.196  16.511  41.258 1.00 46.67 ? 417 SER B CA  1 
ATOM   5620 C  C   . SER B 1 312 ? -5.735  16.946  41.431 1.00 46.77 ? 417 SER B C   1 
ATOM   5621 O  O   . SER B 1 312 ? -5.364  18.087  41.127 1.00 46.86 ? 417 SER B O   1 
ATOM   5622 C  CB  . SER B 1 312 ? -7.280  15.487  40.122 1.00 46.57 ? 417 SER B CB  1 
ATOM   5623 O  OG  . SER B 1 312 ? -6.563  15.925  38.985 1.00 45.98 ? 417 SER B OG  1 
ATOM   5624 N  N   . LEU B 1 313 ? -4.917  16.005  41.900 1.00 46.66 ? 418 LEU B N   1 
ATOM   5625 C  CA  . LEU B 1 313 ? -3.493  16.231  42.152 1.00 46.45 ? 418 LEU B CA  1 
ATOM   5626 C  C   . LEU B 1 313 ? -2.683  16.320  40.852 1.00 46.34 ? 418 LEU B C   1 
ATOM   5627 O  O   . LEU B 1 313 ? -1.677  17.023  40.799 1.00 46.34 ? 418 LEU B O   1 
ATOM   5628 C  CB  . LEU B 1 313 ? -2.949  15.114  43.055 1.00 46.45 ? 418 LEU B CB  1 
ATOM   5629 C  CG  . LEU B 1 313 ? -1.617  15.312  43.792 1.00 46.58 ? 418 LEU B CG  1 
ATOM   5630 C  CD1 . LEU B 1 313 ? -1.624  16.533  44.691 1.00 46.75 ? 418 LEU B CD1 1 
ATOM   5631 C  CD2 . LEU B 1 313 ? -1.306  14.084  44.616 1.00 46.58 ? 418 LEU B CD2 1 
ATOM   5632 N  N   . LEU B 1 314 ? -3.125  15.612  39.812 1.00 46.23 ? 419 LEU B N   1 
ATOM   5633 C  CA  . LEU B 1 314 ? -2.488  15.667  38.486 1.00 46.16 ? 419 LEU B CA  1 
ATOM   5634 C  C   . LEU B 1 314 ? -2.750  17.005  37.775 1.00 46.29 ? 419 LEU B C   1 
ATOM   5635 O  O   . LEU B 1 314 ? -1.897  17.488  37.025 1.00 46.29 ? 419 LEU B O   1 
ATOM   5636 C  CB  . LEU B 1 314 ? -2.968  14.500  37.609 1.00 46.01 ? 419 LEU B CB  1 
ATOM   5637 C  CG  . LEU B 1 314 ? -2.552  14.492  36.130 1.00 45.97 ? 419 LEU B CG  1 
ATOM   5638 C  CD1 . LEU B 1 314 ? -1.044  14.417  35.987 1.00 45.75 ? 419 LEU B CD1 1 
ATOM   5639 C  CD2 . LEU B 1 314 ? -3.205  13.340  35.400 1.00 45.90 ? 419 LEU B CD2 1 
ATOM   5640 N  N   . SER B 1 315 ? -3.935  17.582  37.987 1.00 46.38 ? 420 SER B N   1 
ATOM   5641 C  CA  . SER B 1 315 ? -4.269  18.904  37.445 1.00 46.28 ? 420 SER B CA  1 
ATOM   5642 C  C   . SER B 1 315 ? -3.380  19.963  38.074 1.00 46.36 ? 420 SER B C   1 
ATOM   5643 O  O   . SER B 1 315 ? -2.861  20.838  37.389 1.00 46.40 ? 420 SER B O   1 
ATOM   5644 C  CB  . SER B 1 315 ? -5.730  19.254  37.719 1.00 46.21 ? 420 SER B CB  1 
ATOM   5645 O  OG  . SER B 1 315 ? -6.603  18.366  37.056 1.00 45.98 ? 420 SER B OG  1 
ATOM   5646 N  N   . LEU B 1 316 ? -3.213  19.868  39.389 1.00 46.53 ? 421 LEU B N   1 
ATOM   5647 C  CA  . LEU B 1 316 ? -2.327  20.759  40.133 1.00 46.59 ? 421 LEU B CA  1 
ATOM   5648 C  C   . LEU B 1 316 ? -0.880  20.608  39.661 1.00 46.54 ? 421 LEU B C   1 
ATOM   5649 O  O   . LEU B 1 316 ? -0.167  21.598  39.515 1.00 46.64 ? 421 LEU B O   1 
ATOM   5650 C  CB  . LEU B 1 316 ? -2.426  20.463  41.632 1.00 46.53 ? 421 LEU B CB  1 
ATOM   5651 C  CG  . LEU B 1 316 ? -1.783  21.486  42.563 1.00 46.61 ? 421 LEU B CG  1 
ATOM   5652 C  CD1 . LEU B 1 316 ? -2.727  22.647  42.803 1.00 47.15 ? 421 LEU B CD1 1 
ATOM   5653 C  CD2 . LEU B 1 316 ? -1.403  20.835  43.874 1.00 46.94 ? 421 LEU B CD2 1 
ATOM   5654 N  N   . PHE B 1 317 ? -0.456  19.370  39.418 1.00 46.61 ? 422 PHE B N   1 
ATOM   5655 C  CA  . PHE B 1 317 ? 0.897   19.089  38.919 1.00 46.76 ? 422 PHE B CA  1 
ATOM   5656 C  C   . PHE B 1 317 ? 1.132   19.731  37.557 1.00 46.84 ? 422 PHE B C   1 
ATOM   5657 O  O   . PHE B 1 317 ? 2.159   20.372  37.338 1.00 46.75 ? 422 PHE B O   1 
ATOM   5658 C  CB  . PHE B 1 317 ? 1.127   17.580  38.807 1.00 46.75 ? 422 PHE B CB  1 
ATOM   5659 C  CG  . PHE B 1 317 ? 2.553   17.203  38.539 1.00 46.67 ? 422 PHE B CG  1 
ATOM   5660 C  CD1 . PHE B 1 317 ? 3.392   16.830  39.580 1.00 47.10 ? 422 PHE B CD1 1 
ATOM   5661 C  CD2 . PHE B 1 317 ? 3.062   17.221  37.246 1.00 46.85 ? 422 PHE B CD2 1 
ATOM   5662 C  CE1 . PHE B 1 317 ? 4.717   16.478  39.337 1.00 47.04 ? 422 PHE B CE1 1 
ATOM   5663 C  CE2 . PHE B 1 317 ? 4.383   16.878  36.993 1.00 46.73 ? 422 PHE B CE2 1 
ATOM   5664 C  CZ  . PHE B 1 317 ? 5.211   16.503  38.037 1.00 46.99 ? 422 PHE B CZ  1 
ATOM   5665 N  N   . ARG B 1 318 ? 0.171   19.542  36.654 1.00 47.01 ? 423 ARG B N   1 
ATOM   5666 C  CA  . ARG B 1 318 ? 0.245   20.073  35.294 1.00 47.07 ? 423 ARG B CA  1 
ATOM   5667 C  C   . ARG B 1 318 ? 0.142   21.600  35.242 1.00 47.23 ? 423 ARG B C   1 
ATOM   5668 O  O   . ARG B 1 318 ? 0.658   22.217  34.306 1.00 47.22 ? 423 ARG B O   1 
ATOM   5669 C  CB  . ARG B 1 318 ? -0.858  19.462  34.417 1.00 47.19 ? 423 ARG B CB  1 
ATOM   5670 C  CG  . ARG B 1 318 ? -0.623  18.015  33.966 1.00 47.13 ? 423 ARG B CG  1 
ATOM   5671 C  CD  . ARG B 1 318 ? -1.639  17.625  32.889 1.00 46.91 ? 423 ARG B CD  1 
ATOM   5672 N  NE  . ARG B 1 318 ? -1.458  16.261  32.377 1.00 46.61 ? 423 ARG B NE  1 
ATOM   5673 C  CZ  . ARG B 1 318 ? -2.422  15.343  32.252 1.00 46.43 ? 423 ARG B CZ  1 
ATOM   5674 N  NH1 . ARG B 1 318 ? -3.680  15.605  32.594 1.00 46.41 ? 423 ARG B NH1 1 
ATOM   5675 N  NH2 . ARG B 1 318 ? -2.127  14.142  31.766 1.00 46.50 ? 423 ARG B NH2 1 
ATOM   5676 N  N   . ARG B 1 319 ? -0.528  22.208  36.222 1.00 47.27 ? 424 ARG B N   1 
ATOM   5677 C  CA  . ARG B 1 319 ? -0.584  23.673  36.311 1.00 47.52 ? 424 ARG B CA  1 
ATOM   5678 C  C   . ARG B 1 319 ? 0.741   24.255  36.798 1.00 47.60 ? 424 ARG B C   1 
ATOM   5679 O  O   . ARG B 1 319 ? 1.242   25.234  36.234 1.00 47.53 ? 424 ARG B O   1 
ATOM   5680 C  CB  . ARG B 1 319 ? -1.702  24.143  37.243 1.00 47.44 ? 424 ARG B CB  1 
ATOM   5681 C  CG  . ARG B 1 319 ? -3.098  24.090  36.648 1.00 47.81 ? 424 ARG B CG  1 
ATOM   5682 C  CD  . ARG B 1 319 ? -4.054  24.972  37.442 1.00 48.19 ? 424 ARG B CD  1 
ATOM   5683 N  NE  . ARG B 1 319 ? -3.909  26.384  37.083 1.00 49.03 ? 424 ARG B NE  1 
ATOM   5684 C  CZ  . ARG B 1 319 ? -4.501  27.399  37.713 1.00 49.06 ? 424 ARG B CZ  1 
ATOM   5685 N  NH1 . ARG B 1 319 ? -5.285  27.184  38.768 1.00 48.72 ? 424 ARG B NH1 1 
ATOM   5686 N  NH2 . ARG B 1 319 ? -4.296  28.644  37.287 1.00 49.13 ? 424 ARG B NH2 1 
ATOM   5687 N  N   . LEU B 1 320 ? 1.297   23.660  37.851 1.00 47.76 ? 425 LEU B N   1 
ATOM   5688 C  CA  . LEU B 1 320 ? 2.544   24.154  38.438 1.00 47.99 ? 425 LEU B CA  1 
ATOM   5689 C  C   . LEU B 1 320 ? 3.722   24.010  37.471 1.00 48.14 ? 425 LEU B C   1 
ATOM   5690 O  O   . LEU B 1 320 ? 4.575   24.893  37.384 1.00 48.07 ? 425 LEU B O   1 
ATOM   5691 C  CB  . LEU B 1 320 ? 2.847   23.431  39.749 1.00 47.93 ? 425 LEU B CB  1 
ATOM   5692 C  CG  . LEU B 1 320 ? 1.846   23.633  40.888 1.00 47.67 ? 425 LEU B CG  1 
ATOM   5693 C  CD1 . LEU B 1 320 ? 2.059   22.583  41.961 1.00 47.62 ? 425 LEU B CD1 1 
ATOM   5694 C  CD2 . LEU B 1 320 ? 1.951   25.022  41.485 1.00 48.02 ? 425 LEU B CD2 1 
ATOM   5695 N  N   . SER B 1 321 ? 3.754   22.902  36.738 1.00 48.42 ? 426 SER B N   1 
ATOM   5696 C  CA  . SER B 1 321 ? 4.811   22.651  35.757 1.00 48.60 ? 426 SER B CA  1 
ATOM   5697 C  C   . SER B 1 321 ? 4.754   23.612  34.561 1.00 48.86 ? 426 SER B C   1 
ATOM   5698 O  O   . SER B 1 321 ? 5.793   23.988  34.016 1.00 48.90 ? 426 SER B O   1 
ATOM   5699 C  CB  . SER B 1 321 ? 4.737   21.210  35.270 1.00 48.46 ? 426 SER B CB  1 
ATOM   5700 O  OG  . SER B 1 321 ? 5.823   20.915  34.424 1.00 48.66 ? 426 SER B OG  1 
ATOM   5701 N  N   . ASP B 1 322 ? 3.548   24.007  34.159 1.00 49.27 ? 427 ASP B N   1 
ATOM   5702 C  CA  . ASP B 1 322 ? 3.371   24.960  33.057 1.00 49.34 ? 427 ASP B CA  1 
ATOM   5703 C  C   . ASP B 1 322 ? 3.942   26.333  33.408 1.00 49.50 ? 427 ASP B C   1 
ATOM   5704 O  O   . ASP B 1 322 ? 4.638   26.949  32.594 1.00 49.57 ? 427 ASP B O   1 
ATOM   5705 C  CB  . ASP B 1 322 ? 1.891   25.093  32.688 1.00 49.47 ? 427 ASP B CB  1 
ATOM   5706 C  CG  . ASP B 1 322 ? 1.685   25.760  31.339 1.00 49.64 ? 427 ASP B CG  1 
ATOM   5707 O  OD1 . ASP B 1 322 ? 1.487   25.035  30.343 1.00 50.25 ? 427 ASP B OD1 1 
ATOM   5708 O  OD2 . ASP B 1 322 ? 1.733   27.006  31.267 1.00 50.89 ? 427 ASP B OD2 1 
ATOM   5709 N  N   . GLN B 1 323 ? 3.635   26.803  34.618 1.00 49.66 ? 428 GLN B N   1 
ATOM   5710 C  CA  . GLN B 1 323 ? 4.156   28.081  35.127 1.00 49.74 ? 428 GLN B CA  1 
ATOM   5711 C  C   . GLN B 1 323 ? 5.678   28.027  35.264 1.00 49.79 ? 428 GLN B C   1 
ATOM   5712 O  O   . GLN B 1 323 ? 6.399   28.867  34.717 1.00 49.61 ? 428 GLN B O   1 
ATOM   5713 C  CB  . GLN B 1 323 ? 3.536   28.405  36.492 1.00 49.83 ? 428 GLN B CB  1 
ATOM   5714 C  CG  . GLN B 1 323 ? 2.038   28.713  36.466 1.00 49.93 ? 428 GLN B CG  1 
ATOM   5715 C  CD  . GLN B 1 323 ? 1.724   30.078  35.891 1.00 50.02 ? 428 GLN B CD  1 
ATOM   5716 O  OE1 . GLN B 1 323 ? 2.461   31.037  36.101 1.00 50.93 ? 428 GLN B OE1 1 
ATOM   5717 N  NE2 . GLN B 1 323 ? 0.617   30.174  35.170 1.00 50.22 ? 428 GLN B NE2 1 
ATOM   5718 N  N   . ARG B 1 324 ? 6.146   27.016  35.991 1.00 49.91 ? 429 ARG B N   1 
ATOM   5719 C  CA  . ARG B 1 324 ? 7.574   26.774  36.209 1.00 49.86 ? 429 ARG B CA  1 
ATOM   5720 C  C   . ARG B 1 324 ? 8.407   26.802  34.924 1.00 49.83 ? 429 ARG B C   1 
ATOM   5721 O  O   . ARG B 1 324 ? 9.545   27.261  34.940 1.00 49.91 ? 429 ARG B O   1 
ATOM   5722 C  CB  . ARG B 1 324 ? 7.757   25.426  36.924 1.00 49.92 ? 429 ARG B CB  1 
ATOM   5723 C  CG  . ARG B 1 324 ? 9.207   24.967  37.143 1.00 50.09 ? 429 ARG B CG  1 
ATOM   5724 C  CD  . ARG B 1 324 ? 10.033  26.000  37.899 1.00 49.79 ? 429 ARG B CD  1 
ATOM   5725 N  NE  . ARG B 1 324 ? 11.388  25.541  38.189 1.00 49.61 ? 429 ARG B NE  1 
ATOM   5726 C  CZ  . ARG B 1 324 ? 12.346  25.397  37.277 1.00 49.54 ? 429 ARG B CZ  1 
ATOM   5727 N  NH1 . ARG B 1 324 ? 12.114  25.658  35.994 1.00 49.82 ? 429 ARG B NH1 1 
ATOM   5728 N  NH2 . ARG B 1 324 ? 13.549  24.982  37.653 1.00 49.15 ? 429 ARG B NH2 1 
ATOM   5729 N  N   . SER B 1 325 ? 7.850   26.325  33.814 1.00 49.82 ? 430 SER B N   1 
ATOM   5730 C  CA  . SER B 1 325 ? 8.621   26.203  32.571 1.00 49.77 ? 430 SER B CA  1 
ATOM   5731 C  C   . SER B 1 325 ? 8.529   27.414  31.624 1.00 49.65 ? 430 SER B C   1 
ATOM   5732 O  O   . SER B 1 325 ? 9.260   27.459  30.631 1.00 49.40 ? 430 SER B O   1 
ATOM   5733 C  CB  . SER B 1 325 ? 8.234   24.913  31.826 1.00 49.86 ? 430 SER B CB  1 
ATOM   5734 O  OG  . SER B 1 325 ? 6.875   24.923  31.415 1.00 50.13 ? 430 SER B OG  1 
ATOM   5735 N  N   . LYS B 1 326 ? 7.658   28.386  31.916 1.00 49.57 ? 431 LYS B N   1 
ATOM   5736 C  CA  . LYS B 1 326 ? 7.484   29.539  31.015 1.00 49.57 ? 431 LYS B CA  1 
ATOM   5737 C  C   . LYS B 1 326 ? 7.777   30.928  31.618 1.00 49.37 ? 431 LYS B C   1 
ATOM   5738 O  O   . LYS B 1 326 ? 8.233   31.817  30.895 1.00 49.41 ? 431 LYS B O   1 
ATOM   5739 C  CB  . LYS B 1 326 ? 6.098   29.502  30.346 1.00 49.73 ? 431 LYS B CB  1 
ATOM   5740 C  CG  . LYS B 1 326 ? 4.908   29.942  31.199 1.00 50.14 ? 431 LYS B CG  1 
ATOM   5741 C  CD  . LYS B 1 326 ? 3.598   29.761  30.411 1.00 50.36 ? 431 LYS B CD  1 
ATOM   5742 C  CE  . LYS B 1 326 ? 2.430   30.591  30.974 1.00 51.08 ? 431 LYS B CE  1 
ATOM   5743 N  NZ  . LYS B 1 326 ? 1.901   30.079  32.278 1.00 51.63 ? 431 LYS B NZ  1 
ATOM   5744 N  N   . GLU B 1 327 ? 7.536   31.122  32.916 1.00 49.05 ? 432 GLU B N   1 
ATOM   5745 C  CA  . GLU B 1 327 ? 7.791   32.425  33.565 1.00 48.67 ? 432 GLU B CA  1 
ATOM   5746 C  C   . GLU B 1 327 ? 9.236   32.558  34.063 1.00 48.27 ? 432 GLU B C   1 
ATOM   5747 O  O   . GLU B 1 327 ? 9.793   31.622  34.628 1.00 48.00 ? 432 GLU B O   1 
ATOM   5748 C  CB  . GLU B 1 327 ? 6.810   32.658  34.718 1.00 48.63 ? 432 GLU B CB  1 
ATOM   5749 C  CG  . GLU B 1 327 ? 5.380   32.953  34.263 1.00 49.06 ? 432 GLU B CG  1 
ATOM   5750 C  CD  . GLU B 1 327 ? 5.126   34.430  33.948 1.00 49.69 ? 432 GLU B CD  1 
ATOM   5751 O  OE1 . GLU B 1 327 ? 6.094   35.181  33.676 1.00 50.20 ? 432 GLU B OE1 1 
ATOM   5752 O  OE2 . GLU B 1 327 ? 3.945   34.843  33.974 1.00 49.69 ? 432 GLU B OE2 1 
ATOM   5753 N  N   . ARG B 1 328 ? 9.820   33.738  33.864 1.00 48.04 ? 433 ARG B N   1 
ATOM   5754 C  CA  . ARG B 1 328 ? 11.234  33.987  34.180 1.00 47.93 ? 433 ARG B CA  1 
ATOM   5755 C  C   . ARG B 1 328 ? 11.555  34.115  35.663 1.00 47.55 ? 433 ARG B C   1 
ATOM   5756 O  O   . ARG B 1 328 ? 12.678  33.825  36.073 1.00 47.56 ? 433 ARG B O   1 
ATOM   5757 C  CB  . ARG B 1 328 ? 11.735  35.246  33.464 1.00 47.90 ? 433 ARG B CB  1 
ATOM   5758 C  CG  . ARG B 1 328 ? 11.992  35.030  31.989 1.00 48.31 ? 433 ARG B CG  1 
ATOM   5759 C  CD  . ARG B 1 328 ? 13.061  35.957  31.429 1.00 48.78 ? 433 ARG B CD  1 
ATOM   5760 N  NE  . ARG B 1 328 ? 14.020  35.197  30.630 1.00 50.20 ? 433 ARG B NE  1 
ATOM   5761 C  CZ  . ARG B 1 328 ? 13.775  34.678  29.425 1.00 50.40 ? 433 ARG B CZ  1 
ATOM   5762 N  NH1 . ARG B 1 328 ? 12.591  34.833  28.834 1.00 50.75 ? 433 ARG B NH1 1 
ATOM   5763 N  NH2 . ARG B 1 328 ? 14.729  33.998  28.805 1.00 50.30 ? 433 ARG B NH2 1 
ATOM   5764 N  N   . SER B 1 329 ? 10.592  34.572  36.459 1.00 47.30 ? 434 SER B N   1 
ATOM   5765 C  CA  . SER B 1 329 ? 10.788  34.685  37.905 1.00 47.05 ? 434 SER B CA  1 
ATOM   5766 C  C   . SER B 1 329 ? 10.798  33.319  38.595 1.00 46.78 ? 434 SER B C   1 
ATOM   5767 O  O   . SER B 1 329 ? 11.266  33.201  39.726 1.00 46.80 ? 434 SER B O   1 
ATOM   5768 C  CB  . SER B 1 329 ? 9.723   35.587  38.527 1.00 47.02 ? 434 SER B CB  1 
ATOM   5769 O  OG  . SER B 1 329 ? 9.951   36.940  38.186 1.00 46.70 ? 434 SER B OG  1 
ATOM   5770 N  N   . LEU B 1 330 ? 10.282  32.298  37.914 1.00 46.53 ? 435 LEU B N   1 
ATOM   5771 C  CA  . LEU B 1 330 ? 10.323  30.917  38.404 1.00 46.44 ? 435 LEU B CA  1 
ATOM   5772 C  C   . LEU B 1 330 ? 11.457  30.105  37.768 1.00 46.31 ? 435 LEU B C   1 
ATOM   5773 O  O   . LEU B 1 330 ? 11.964  29.166  38.378 1.00 46.25 ? 435 LEU B O   1 
ATOM   5774 C  CB  . LEU B 1 330 ? 8.978   30.228  38.145 1.00 46.30 ? 435 LEU B CB  1 
ATOM   5775 C  CG  . LEU B 1 330 ? 7.760   30.868  38.825 1.00 46.31 ? 435 LEU B CG  1 
ATOM   5776 C  CD1 . LEU B 1 330 ? 6.484   30.156  38.430 1.00 46.12 ? 435 LEU B CD1 1 
ATOM   5777 C  CD2 . LEU B 1 330 ? 7.910   30.880  40.342 1.00 46.18 ? 435 LEU B CD2 1 
ATOM   5778 N  N   . LEU B 1 331 ? 11.846  30.459  36.545 1.00 46.22 ? 436 LEU B N   1 
ATOM   5779 C  CA  . LEU B 1 331 ? 12.933  29.764  35.846 1.00 46.12 ? 436 LEU B CA  1 
ATOM   5780 C  C   . LEU B 1 331 ? 14.295  30.026  36.488 1.00 45.95 ? 436 LEU B C   1 
ATOM   5781 O  O   . LEU B 1 331 ? 15.069  29.092  36.699 1.00 45.73 ? 436 LEU B O   1 
ATOM   5782 C  CB  . LEU B 1 331 ? 12.998  30.184  34.370 1.00 46.14 ? 436 LEU B CB  1 
ATOM   5783 C  CG  . LEU B 1 331 ? 11.984  29.598  33.391 1.00 46.02 ? 436 LEU B CG  1 
ATOM   5784 C  CD1 . LEU B 1 331 ? 12.060  30.353  32.076 1.00 45.84 ? 436 LEU B CD1 1 
ATOM   5785 C  CD2 . LEU B 1 331 ? 12.225  28.119  33.175 1.00 46.10 ? 436 LEU B CD2 1 
ATOM   5786 N  N   . HIS B 1 332 ? 14.585  31.298  36.771 1.00 45.88 ? 437 HIS B N   1 
ATOM   5787 C  CA  . HIS B 1 332 ? 15.890  31.706  37.315 1.00 45.87 ? 437 HIS B CA  1 
ATOM   5788 C  C   . HIS B 1 332 ? 15.827  33.020  38.110 1.00 45.74 ? 437 HIS B C   1 
ATOM   5789 O  O   . HIS B 1 332 ? 16.721  33.856  38.011 1.00 46.02 ? 437 HIS B O   1 
ATOM   5790 C  CB  . HIS B 1 332 ? 16.936  31.801  36.182 1.00 45.84 ? 437 HIS B CB  1 
ATOM   5791 C  CG  . HIS B 1 332 ? 16.500  32.638  35.017 1.00 45.90 ? 437 HIS B CG  1 
ATOM   5792 N  ND1 . HIS B 1 332 ? 16.674  34.005  34.973 1.00 45.91 ? 437 HIS B ND1 1 
ATOM   5793 C  CD2 . HIS B 1 332 ? 15.896  32.299  33.853 1.00 45.65 ? 437 HIS B CD2 1 
ATOM   5794 C  CE1 . HIS B 1 332 ? 16.189  34.472  33.836 1.00 45.83 ? 437 HIS B CE1 1 
ATOM   5795 N  NE2 . HIS B 1 332 ? 15.715  33.457  33.137 1.00 45.73 ? 437 HIS B NE2 1 
ATOM   5796 N  N   . GLY B 1 333 ? 14.774  33.190  38.903 1.00 45.65 ? 438 GLY B N   1 
ATOM   5797 C  CA  . GLY B 1 333 ? 14.638  34.352  39.781 1.00 45.64 ? 438 GLY B CA  1 
ATOM   5798 C  C   . GLY B 1 333 ? 15.357  34.170  41.108 1.00 45.59 ? 438 GLY B C   1 
ATOM   5799 O  O   . GLY B 1 333 ? 15.787  33.069  41.446 1.00 45.68 ? 438 GLY B O   1 
ATOM   5800 N  N   . ASP B 1 334 ? 15.486  35.259  41.860 1.00 45.57 ? 439 ASP B N   1 
ATOM   5801 C  CA  . ASP B 1 334 ? 16.100  35.228  43.189 1.00 45.62 ? 439 ASP B CA  1 
ATOM   5802 C  C   . ASP B 1 334 ? 15.066  34.757  44.218 1.00 45.59 ? 439 ASP B C   1 
ATOM   5803 O  O   . ASP B 1 334 ? 13.912  34.522  43.869 1.00 45.50 ? 439 ASP B O   1 
ATOM   5804 C  CB  . ASP B 1 334 ? 16.633  36.625  43.547 1.00 45.77 ? 439 ASP B CB  1 
ATOM   5805 C  CG  . ASP B 1 334 ? 17.636  36.615  44.691 1.00 45.75 ? 439 ASP B CG  1 
ATOM   5806 O  OD1 . ASP B 1 334 ? 17.989  35.524  45.186 1.00 46.30 ? 439 ASP B OD1 1 
ATOM   5807 O  OD2 . ASP B 1 334 ? 18.070  37.711  45.099 1.00 45.84 ? 439 ASP B OD2 1 
ATOM   5808 N  N   . PHE B 1 335 ? 15.488  34.625  45.477 1.00 45.56 ? 440 PHE B N   1 
ATOM   5809 C  CA  . PHE B 1 335 ? 14.649  34.087  46.552 1.00 45.63 ? 440 PHE B CA  1 
ATOM   5810 C  C   . PHE B 1 335 ? 14.791  34.927  47.823 1.00 45.57 ? 440 PHE B C   1 
ATOM   5811 O  O   . PHE B 1 335 ? 15.902  35.204  48.271 1.00 45.52 ? 440 PHE B O   1 
ATOM   5812 C  CB  . PHE B 1 335 ? 15.056  32.630  46.816 1.00 45.54 ? 440 PHE B CB  1 
ATOM   5813 C  CG  . PHE B 1 335 ? 14.441  32.018  48.053 1.00 45.46 ? 440 PHE B CG  1 
ATOM   5814 C  CD1 . PHE B 1 335 ? 13.275  31.267  47.966 1.00 45.16 ? 440 PHE B CD1 1 
ATOM   5815 C  CD2 . PHE B 1 335 ? 15.050  32.160  49.295 1.00 45.16 ? 440 PHE B CD2 1 
ATOM   5816 C  CE1 . PHE B 1 335 ? 12.716  30.684  49.094 1.00 45.12 ? 440 PHE B CE1 1 
ATOM   5817 C  CE2 . PHE B 1 335 ? 14.492  31.587  50.429 1.00 45.33 ? 440 PHE B CE2 1 
ATOM   5818 C  CZ  . PHE B 1 335 ? 13.322  30.846  50.326 1.00 45.42 ? 440 PHE B CZ  1 
ATOM   5819 N  N   . HIS B 1 336 ? 13.660  35.321  48.399 1.00 45.72 ? 441 HIS B N   1 
ATOM   5820 C  CA  . HIS B 1 336 ? 13.641  36.050  49.669 1.00 45.94 ? 441 HIS B CA  1 
ATOM   5821 C  C   . HIS B 1 336 ? 12.487  35.586  50.550 1.00 46.17 ? 441 HIS B C   1 
ATOM   5822 O  O   . HIS B 1 336 ? 11.340  35.984  50.342 1.00 46.12 ? 441 HIS B O   1 
ATOM   5823 C  CB  . HIS B 1 336 ? 13.518  37.555  49.430 1.00 45.68 ? 441 HIS B CB  1 
ATOM   5824 C  CG  . HIS B 1 336 ? 14.780  38.196  48.951 1.00 45.12 ? 441 HIS B CG  1 
ATOM   5825 N  ND1 . HIS B 1 336 ? 15.086  38.324  47.614 1.00 44.78 ? 441 HIS B ND1 1 
ATOM   5826 C  CD2 . HIS B 1 336 ? 15.810  38.752  49.628 1.00 44.73 ? 441 HIS B CD2 1 
ATOM   5827 C  CE1 . HIS B 1 336 ? 16.253  38.928  47.488 1.00 44.74 ? 441 HIS B CE1 1 
ATOM   5828 N  NE2 . HIS B 1 336 ? 16.713  39.200  48.696 1.00 44.83 ? 441 HIS B NE2 1 
ATOM   5829 N  N   . ALA B 1 337 ? 12.800  34.744  51.531 1.00 46.59 ? 442 ALA B N   1 
ATOM   5830 C  CA  . ALA B 1 337 ? 11.830  34.342  52.544 1.00 46.98 ? 442 ALA B CA  1 
ATOM   5831 C  C   . ALA B 1 337 ? 11.638  35.467  53.542 1.00 47.21 ? 442 ALA B C   1 
ATOM   5832 O  O   . ALA B 1 337 ? 12.453  36.382  53.614 1.00 47.24 ? 442 ALA B O   1 
ATOM   5833 C  CB  . ALA B 1 337 ? 12.294  33.087  53.257 1.00 47.03 ? 442 ALA B CB  1 
ATOM   5834 N  N   . PHE B 1 338 ? 10.554  35.400  54.305 1.00 47.74 ? 443 PHE B N   1 
ATOM   5835 C  CA  . PHE B 1 338 ? 10.313  36.368  55.374 1.00 48.17 ? 443 PHE B CA  1 
ATOM   5836 C  C   . PHE B 1 338 ? 9.334   35.837  56.410 1.00 48.49 ? 443 PHE B C   1 
ATOM   5837 O  O   . PHE B 1 338 ? 8.601   34.885  56.150 1.00 48.75 ? 443 PHE B O   1 
ATOM   5838 C  CB  . PHE B 1 338 ? 9.812   37.697  54.804 1.00 48.34 ? 443 PHE B CB  1 
ATOM   5839 C  CG  . PHE B 1 338 ? 8.503   37.598  54.078 1.00 48.35 ? 443 PHE B CG  1 
ATOM   5840 C  CD1 . PHE B 1 338 ? 7.325   38.008  54.690 1.00 48.54 ? 443 PHE B CD1 1 
ATOM   5841 C  CD2 . PHE B 1 338 ? 8.450   37.111  52.778 1.00 48.44 ? 443 PHE B CD2 1 
ATOM   5842 C  CE1 . PHE B 1 338 ? 6.116   37.927  54.021 1.00 48.64 ? 443 PHE B CE1 1 
ATOM   5843 C  CE2 . PHE B 1 338 ? 7.242   37.025  52.098 1.00 48.33 ? 443 PHE B CE2 1 
ATOM   5844 C  CZ  . PHE B 1 338 ? 6.075   37.431  52.717 1.00 48.68 ? 443 PHE B CZ  1 
ATOM   5845 N  N   . SER B 1 339 ? 9.330   36.469  57.580 1.00 48.88 ? 444 SER B N   1 
ATOM   5846 C  CA  . SER B 1 339 ? 8.540   36.010  58.724 1.00 49.15 ? 444 SER B CA  1 
ATOM   5847 C  C   . SER B 1 339 ? 7.083   36.455  58.627 1.00 49.39 ? 444 SER B C   1 
ATOM   5848 O  O   . SER B 1 339 ? 6.809   37.641  58.450 1.00 49.49 ? 444 SER B O   1 
ATOM   5849 C  CB  . SER B 1 339 ? 9.147   36.550  60.021 1.00 49.13 ? 444 SER B CB  1 
ATOM   5850 O  OG  . SER B 1 339 ? 10.555  36.391  60.019 1.00 49.33 ? 444 SER B OG  1 
ATOM   5851 N  N   . ALA B 1 340 ? 6.160   35.499  58.741 1.00 49.72 ? 445 ALA B N   1 
ATOM   5852 C  CA  . ALA B 1 340 ? 4.716   35.786  58.769 1.00 49.91 ? 445 ALA B CA  1 
ATOM   5853 C  C   . ALA B 1 340 ? 4.012   35.316  60.057 1.00 50.14 ? 445 ALA B C   1 
ATOM   5854 O  O   . ALA B 1 340 ? 2.959   35.852  60.406 1.00 50.31 ? 445 ALA B O   1 
ATOM   5855 C  CB  . ALA B 1 340 ? 4.040   35.178  57.549 1.00 49.93 ? 445 ALA B CB  1 
ATOM   5856 N  N   . GLY B 1 341 ? 4.589   34.333  60.754 1.00 50.30 ? 446 GLY B N   1 
ATOM   5857 C  CA  . GLY B 1 341 ? 3.998   33.772  61.980 1.00 50.32 ? 446 GLY B CA  1 
ATOM   5858 C  C   . GLY B 1 341 ? 4.247   32.269  62.078 1.00 50.51 ? 446 GLY B C   1 
ATOM   5859 O  O   . GLY B 1 341 ? 3.531   31.491  61.434 1.00 50.59 ? 446 GLY B O   1 
ATOM   5860 N  N   . PRO B 1 342 ? 5.260   31.847  62.882 1.00 50.51 ? 447 PRO B N   1 
ATOM   5861 C  CA  . PRO B 1 342 ? 5.691   30.438  62.989 1.00 50.21 ? 447 PRO B CA  1 
ATOM   5862 C  C   . PRO B 1 342 ? 4.534   29.435  62.946 1.00 50.02 ? 447 PRO B C   1 
ATOM   5863 O  O   . PRO B 1 342 ? 3.644   29.466  63.800 1.00 50.12 ? 447 PRO B O   1 
ATOM   5864 C  CB  . PRO B 1 342 ? 6.416   30.402  64.335 1.00 50.36 ? 447 PRO B CB  1 
ATOM   5865 C  CG  . PRO B 1 342 ? 7.037   31.758  64.434 1.00 50.51 ? 447 PRO B CG  1 
ATOM   5866 C  CD  . PRO B 1 342 ? 6.069   32.718  63.761 1.00 50.52 ? 447 PRO B CD  1 
ATOM   5867 N  N   . GLY B 1 343 ? 4.581   28.548  61.957 1.00 49.62 ? 448 GLY B N   1 
ATOM   5868 C  CA  . GLY B 1 343 ? 3.401   27.834  61.477 1.00 49.31 ? 448 GLY B CA  1 
ATOM   5869 C  C   . GLY B 1 343 ? 3.256   28.091  59.980 1.00 49.06 ? 448 GLY B C   1 
ATOM   5870 O  O   . GLY B 1 343 ? 2.876   27.195  59.216 1.00 48.97 ? 448 GLY B O   1 
ATOM   5871 N  N   . LEU B 1 344 ? 3.570   29.322  59.569 1.00 48.61 ? 449 LEU B N   1 
ATOM   5872 C  CA  . LEU B 1 344 ? 3.576   29.720  58.159 1.00 48.16 ? 449 LEU B CA  1 
ATOM   5873 C  C   . LEU B 1 344 ? 4.987   29.733  57.575 1.00 47.77 ? 449 LEU B C   1 
ATOM   5874 O  O   . LEU B 1 344 ? 5.974   29.825  58.304 1.00 47.71 ? 449 LEU B O   1 
ATOM   5875 C  CB  . LEU B 1 344 ? 2.972   31.116  58.001 1.00 48.12 ? 449 LEU B CB  1 
ATOM   5876 C  CG  . LEU B 1 344 ? 1.461   31.244  58.184 1.00 48.14 ? 449 LEU B CG  1 
ATOM   5877 C  CD1 . LEU B 1 344 ? 1.085   32.703  58.377 1.00 48.13 ? 449 LEU B CD1 1 
ATOM   5878 C  CD2 . LEU B 1 344 ? 0.719   30.648  56.998 1.00 48.10 ? 449 LEU B CD2 1 
ATOM   5879 N  N   . PHE B 1 345 ? 5.059   29.638  56.249 1.00 47.29 ? 450 PHE B N   1 
ATOM   5880 C  CA  . PHE B 1 345 ? 6.309   29.782  55.505 1.00 47.03 ? 450 PHE B CA  1 
ATOM   5881 C  C   . PHE B 1 345 ? 5.993   30.480  54.181 1.00 46.68 ? 450 PHE B C   1 
ATOM   5882 O  O   . PHE B 1 345 ? 5.130   30.026  53.426 1.00 46.47 ? 450 PHE B O   1 
ATOM   5883 C  CB  . PHE B 1 345 ? 6.956   28.407  55.282 1.00 47.02 ? 450 PHE B CB  1 
ATOM   5884 C  CG  . PHE B 1 345 ? 8.184   28.428  54.396 1.00 47.08 ? 450 PHE B CG  1 
ATOM   5885 C  CD1 . PHE B 1 345 ? 8.307   27.532  53.339 1.00 46.97 ? 450 PHE B CD1 1 
ATOM   5886 C  CD2 . PHE B 1 345 ? 9.212   29.334  54.618 1.00 46.80 ? 450 PHE B CD2 1 
ATOM   5887 C  CE1 . PHE B 1 345 ? 9.435   27.544  52.521 1.00 46.89 ? 450 PHE B CE1 1 
ATOM   5888 C  CE2 . PHE B 1 345 ? 10.340  29.350  53.802 1.00 46.78 ? 450 PHE B CE2 1 
ATOM   5889 C  CZ  . PHE B 1 345 ? 10.450  28.453  52.754 1.00 46.62 ? 450 PHE B CZ  1 
ATOM   5890 N  N   . SER B 1 346 ? 6.677   31.596  53.925 1.00 46.39 ? 451 SER B N   1 
ATOM   5891 C  CA  . SER B 1 346 ? 6.385   32.453  52.773 1.00 46.13 ? 451 SER B CA  1 
ATOM   5892 C  C   . SER B 1 346 ? 7.662   32.985  52.142 1.00 45.79 ? 451 SER B C   1 
ATOM   5893 O  O   . SER B 1 346 ? 8.655   33.200  52.833 1.00 45.74 ? 451 SER B O   1 
ATOM   5894 C  CB  . SER B 1 346 ? 5.532   33.650  53.201 1.00 46.20 ? 451 SER B CB  1 
ATOM   5895 O  OG  . SER B 1 346 ? 4.892   33.420  54.446 1.00 46.62 ? 451 SER B OG  1 
ATOM   5896 N  N   . TYR B 1 347 ? 7.625   33.220  50.835 1.00 45.48 ? 452 TYR B N   1 
ATOM   5897 C  CA  . TYR B 1 347 ? 8.775   33.780  50.127 1.00 45.29 ? 452 TYR B CA  1 
ATOM   5898 C  C   . TYR B 1 347 ? 8.390   34.455  48.810 1.00 44.94 ? 452 TYR B C   1 
ATOM   5899 O  O   . TYR B 1 347 ? 7.289   34.270  48.312 1.00 44.76 ? 452 TYR B O   1 
ATOM   5900 C  CB  . TYR B 1 347 ? 9.841   32.698  49.898 1.00 45.24 ? 452 TYR B CB  1 
ATOM   5901 C  CG  . TYR B 1 347 ? 9.328   31.422  49.264 1.00 45.37 ? 452 TYR B CG  1 
ATOM   5902 C  CD1 . TYR B 1 347 ? 8.775   30.405  50.041 1.00 45.12 ? 452 TYR B CD1 1 
ATOM   5903 C  CD2 . TYR B 1 347 ? 9.418   31.223  47.887 1.00 45.31 ? 452 TYR B CD2 1 
ATOM   5904 C  CE1 . TYR B 1 347 ? 8.313   29.233  49.459 1.00 45.25 ? 452 TYR B CE1 1 
ATOM   5905 C  CE2 . TYR B 1 347 ? 8.961   30.055  47.298 1.00 44.96 ? 452 TYR B CE2 1 
ATOM   5906 C  CZ  . TYR B 1 347 ? 8.408   29.067  48.085 1.00 45.17 ? 452 TYR B CZ  1 
ATOM   5907 O  OH  . TYR B 1 347 ? 7.952   27.913  47.494 1.00 45.31 ? 452 TYR B OH  1 
ATOM   5908 N  N   . ILE B 1 348 ? 9.308   35.255  48.273 1.00 44.83 ? 453 ILE B N   1 
ATOM   5909 C  CA  . ILE B 1 348 ? 9.114   35.957  47.003 1.00 44.81 ? 453 ILE B CA  1 
ATOM   5910 C  C   . ILE B 1 348 ? 10.054  35.367  45.949 1.00 44.69 ? 453 ILE B C   1 
ATOM   5911 O  O   . ILE B 1 348 ? 11.131  34.872  46.283 1.00 44.53 ? 453 ILE B O   1 
ATOM   5912 C  CB  . ILE B 1 348 ? 9.420   37.477  47.144 1.00 44.78 ? 453 ILE B CB  1 
ATOM   5913 C  CG1 . ILE B 1 348 ? 8.579   38.114  48.256 1.00 45.10 ? 453 ILE B CG1 1 
ATOM   5914 C  CG2 . ILE B 1 348 ? 9.181   38.219  45.829 1.00 44.71 ? 453 ILE B CG2 1 
ATOM   5915 C  CD1 . ILE B 1 348 ? 7.109   38.295  47.917 1.00 45.44 ? 453 ILE B CD1 1 
ATOM   5916 N  N   . ARG B 1 349 ? 9.634   35.409  44.685 1.00 44.59 ? 454 ARG B N   1 
ATOM   5917 C  CA  . ARG B 1 349 ? 10.499  35.057  43.557 1.00 44.62 ? 454 ARG B CA  1 
ATOM   5918 C  C   . ARG B 1 349 ? 10.413  36.142  42.478 1.00 44.51 ? 454 ARG B C   1 
ATOM   5919 O  O   . ARG B 1 349 ? 9.314   36.549  42.091 1.00 44.45 ? 454 ARG B O   1 
ATOM   5920 C  CB  . ARG B 1 349 ? 10.114  33.689  42.989 1.00 44.73 ? 454 ARG B CB  1 
ATOM   5921 C  CG  . ARG B 1 349 ? 10.339  32.532  43.963 1.00 45.10 ? 454 ARG B CG  1 
ATOM   5922 C  CD  . ARG B 1 349 ? 11.785  32.043  43.976 1.00 45.87 ? 454 ARG B CD  1 
ATOM   5923 N  NE  . ARG B 1 349 ? 11.916  30.769  43.270 1.00 46.25 ? 454 ARG B NE  1 
ATOM   5924 C  CZ  . ARG B 1 349 ? 12.492  30.590  42.080 1.00 46.69 ? 454 ARG B CZ  1 
ATOM   5925 N  NH1 . ARG B 1 349 ? 13.071  31.585  41.416 1.00 46.68 ? 454 ARG B NH1 1 
ATOM   5926 N  NH2 . ARG B 1 349 ? 12.516  29.372  41.559 1.00 47.14 ? 454 ARG B NH2 1 
ATOM   5927 N  N   . HIS B 1 350 ? 11.572  36.599  42.000 1.00 44.34 ? 455 HIS B N   1 
ATOM   5928 C  CA  . HIS B 1 350 ? 11.655  37.783  41.137 1.00 44.24 ? 455 HIS B CA  1 
ATOM   5929 C  C   . HIS B 1 350 ? 12.885  37.772  40.226 1.00 44.12 ? 455 HIS B C   1 
ATOM   5930 O  O   . HIS B 1 350 ? 13.961  37.362  40.647 1.00 44.06 ? 455 HIS B O   1 
ATOM   5931 C  CB  . HIS B 1 350 ? 11.677  39.046  42.008 1.00 44.12 ? 455 HIS B CB  1 
ATOM   5932 C  CG  . HIS B 1 350 ? 12.703  39.013  43.102 1.00 44.18 ? 455 HIS B CG  1 
ATOM   5933 N  ND1 . HIS B 1 350 ? 13.877  39.733  43.044 1.00 43.85 ? 455 HIS B ND1 1 
ATOM   5934 C  CD2 . HIS B 1 350 ? 12.730  38.345  44.281 1.00 43.71 ? 455 HIS B CD2 1 
ATOM   5935 C  CE1 . HIS B 1 350 ? 14.580  39.512  44.141 1.00 43.53 ? 455 HIS B CE1 1 
ATOM   5936 N  NE2 . HIS B 1 350 ? 13.907  38.672  44.906 1.00 43.19 ? 455 HIS B NE2 1 
ATOM   5937 N  N   . TRP B 1 351 ? 12.714  38.216  38.981 1.00 44.19 ? 456 TRP B N   1 
ATOM   5938 C  CA  . TRP B 1 351 ? 13.838  38.428  38.057 1.00 44.32 ? 456 TRP B CA  1 
ATOM   5939 C  C   . TRP B 1 351 ? 13.769  39.810  37.402 1.00 44.39 ? 456 TRP B C   1 
ATOM   5940 O  O   . TRP B 1 351 ? 12.805  40.128  36.708 1.00 44.29 ? 456 TRP B O   1 
ATOM   5941 C  CB  . TRP B 1 351 ? 13.882  37.350  36.967 1.00 44.19 ? 456 TRP B CB  1 
ATOM   5942 C  CG  . TRP B 1 351 ? 14.977  37.588  35.948 1.00 44.11 ? 456 TRP B CG  1 
ATOM   5943 C  CD1 . TRP B 1 351 ? 14.832  38.100  34.692 1.00 43.97 ? 456 TRP B CD1 1 
ATOM   5944 C  CD2 . TRP B 1 351 ? 16.380  37.347  36.121 1.00 43.85 ? 456 TRP B CD2 1 
ATOM   5945 N  NE1 . TRP B 1 351 ? 16.053  38.183  34.066 1.00 43.93 ? 456 TRP B NE1 1 
ATOM   5946 C  CE2 . TRP B 1 351 ? 17.022  37.729  34.921 1.00 43.94 ? 456 TRP B CE2 1 
ATOM   5947 C  CE3 . TRP B 1 351 ? 17.156  36.839  37.170 1.00 43.58 ? 456 TRP B CE3 1 
ATOM   5948 C  CZ2 . TRP B 1 351 ? 18.405  37.618  34.741 1.00 43.99 ? 456 TRP B CZ2 1 
ATOM   5949 C  CZ3 . TRP B 1 351 ? 18.530  36.728  36.992 1.00 43.92 ? 456 TRP B CZ3 1 
ATOM   5950 C  CH2 . TRP B 1 351 ? 19.141  37.118  35.786 1.00 44.04 ? 456 TRP B CH2 1 
ATOM   5951 N  N   . ASP B 1 352 ? 14.802  40.616  37.626 1.00 44.58 ? 457 ASP B N   1 
ATOM   5952 C  CA  . ASP B 1 352 ? 14.901  41.957  37.053 1.00 44.84 ? 457 ASP B CA  1 
ATOM   5953 C  C   . ASP B 1 352 ? 13.536  42.670  37.038 1.00 44.96 ? 457 ASP B C   1 
ATOM   5954 O  O   . ASP B 1 352 ? 13.030  43.000  38.100 1.00 44.92 ? 457 ASP B O   1 
ATOM   5955 C  CB  . ASP B 1 352 ? 15.576  41.895  35.671 1.00 44.96 ? 457 ASP B CB  1 
ATOM   5956 C  CG  . ASP B 1 352 ? 16.106  43.254  35.198 1.00 44.79 ? 457 ASP B CG  1 
ATOM   5957 O  OD1 . ASP B 1 352 ? 15.621  44.309  35.657 1.00 44.62 ? 457 ASP B OD1 1 
ATOM   5958 O  OD2 . ASP B 1 352 ? 17.025  43.263  34.354 1.00 45.38 ? 457 ASP B OD2 1 
ATOM   5959 N  N   . GLN B 1 353 ? 12.936  42.887  35.866 1.00 45.28 ? 458 GLN B N   1 
ATOM   5960 C  CA  . GLN B 1 353 ? 11.683  43.654  35.754 1.00 45.50 ? 458 GLN B CA  1 
ATOM   5961 C  C   . GLN B 1 353 ? 10.478  42.812  35.318 1.00 45.54 ? 458 GLN B C   1 
ATOM   5962 O  O   . GLN B 1 353 ? 9.464   43.352  34.879 1.00 45.37 ? 458 GLN B O   1 
ATOM   5963 C  CB  . GLN B 1 353 ? 11.875  44.834  34.796 1.00 45.41 ? 458 GLN B CB  1 
ATOM   5964 C  CG  . GLN B 1 353 ? 12.515  46.040  35.447 1.00 45.71 ? 458 GLN B CG  1 
ATOM   5965 C  CD  . GLN B 1 353 ? 12.562  47.233  34.523 1.00 46.03 ? 458 GLN B CD  1 
ATOM   5966 O  OE1 . GLN B 1 353 ? 12.604  47.082  33.300 1.00 47.50 ? 458 GLN B OE1 1 
ATOM   5967 N  NE2 . GLN B 1 353 ? 12.557  48.432  35.099 1.00 46.42 ? 458 GLN B NE2 1 
ATOM   5968 N  N   . ASN B 1 354 ? 10.586  41.495  35.468 1.00 45.80 ? 459 ASN B N   1 
ATOM   5969 C  CA  . ASN B 1 354 ? 9.490   40.586  35.142 1.00 46.12 ? 459 ASN B CA  1 
ATOM   5970 C  C   . ASN B 1 354 ? 8.443   40.513  36.266 1.00 46.31 ? 459 ASN B C   1 
ATOM   5971 O  O   . ASN B 1 354 ? 8.575   41.180  37.290 1.00 46.18 ? 459 ASN B O   1 
ATOM   5972 C  CB  . ASN B 1 354 ? 10.042  39.197  34.800 1.00 46.05 ? 459 ASN B CB  1 
ATOM   5973 C  CG  . ASN B 1 354 ? 10.848  39.197  33.512 1.00 46.12 ? 459 ASN B CG  1 
ATOM   5974 O  OD1 . ASN B 1 354 ? 10.376  38.743  32.473 1.00 45.99 ? 459 ASN B OD1 1 
ATOM   5975 N  ND2 . ASN B 1 354 ? 12.060  39.734  33.570 1.00 46.41 ? 459 ASN B ND2 1 
ATOM   5976 N  N   . GLU B 1 355 ? 7.394   39.724  36.045 1.00 46.83 ? 460 GLU B N   1 
ATOM   5977 C  CA  . GLU B 1 355 ? 6.282   39.597  36.985 1.00 46.97 ? 460 GLU B CA  1 
ATOM   5978 C  C   . GLU B 1 355 ? 6.721   38.760  38.190 1.00 47.11 ? 460 GLU B C   1 
ATOM   5979 O  O   . GLU B 1 355 ? 7.274   37.672  38.021 1.00 47.13 ? 460 GLU B O   1 
ATOM   5980 C  CB  . GLU B 1 355 ? 5.082   38.935  36.285 1.00 47.17 ? 460 GLU B CB  1 
ATOM   5981 C  CG  . GLU B 1 355 ? 3.710   39.229  36.909 1.00 47.66 ? 460 GLU B CG  1 
ATOM   5982 C  CD  . GLU B 1 355 ? 3.045   40.500  36.368 1.00 49.45 ? 460 GLU B CD  1 
ATOM   5983 O  OE1 . GLU B 1 355 ? 3.748   41.354  35.777 1.00 50.29 ? 460 GLU B OE1 1 
ATOM   5984 O  OE2 . GLU B 1 355 ? 1.810   40.645  36.542 1.00 50.30 ? 460 GLU B OE2 1 
ATOM   5985 N  N   . ARG B 1 356 ? 6.476   39.265  39.398 1.00 47.22 ? 461 ARG B N   1 
ATOM   5986 C  CA  . ARG B 1 356 ? 6.875   38.567  40.626 1.00 47.38 ? 461 ARG B CA  1 
ATOM   5987 C  C   . ARG B 1 356 ? 5.884   37.471  41.012 1.00 47.43 ? 461 ARG B C   1 
ATOM   5988 O  O   . ARG B 1 356 ? 4.785   37.404  40.467 1.00 47.38 ? 461 ARG B O   1 
ATOM   5989 C  CB  . ARG B 1 356 ? 7.016   39.553  41.788 1.00 47.48 ? 461 ARG B CB  1 
ATOM   5990 C  CG  . ARG B 1 356 ? 8.268   40.402  41.735 1.00 47.66 ? 461 ARG B CG  1 
ATOM   5991 C  CD  . ARG B 1 356 ? 8.136   41.612  40.822 1.00 47.87 ? 461 ARG B CD  1 
ATOM   5992 N  NE  . ARG B 1 356 ? 9.342   42.429  40.910 1.00 47.97 ? 461 ARG B NE  1 
ATOM   5993 C  CZ  . ARG B 1 356 ? 10.494  42.161  40.296 1.00 47.99 ? 461 ARG B CZ  1 
ATOM   5994 N  NH1 . ARG B 1 356 ? 10.629  41.099  39.507 1.00 47.68 ? 461 ARG B NH1 1 
ATOM   5995 N  NH2 . ARG B 1 356 ? 11.527  42.973  40.475 1.00 48.30 ? 461 ARG B NH2 1 
ATOM   5996 N  N   . PHE B 1 357 ? 6.289   36.618  41.952 1.00 47.55 ? 462 PHE B N   1 
ATOM   5997 C  CA  . PHE B 1 357 ? 5.418   35.574  42.498 1.00 47.73 ? 462 PHE B CA  1 
ATOM   5998 C  C   . PHE B 1 357 ? 5.609   35.422  44.010 1.00 47.77 ? 462 PHE B C   1 
ATOM   5999 O  O   . PHE B 1 357 ? 6.723   35.198  44.478 1.00 47.76 ? 462 PHE B O   1 
ATOM   6000 C  CB  . PHE B 1 357 ? 5.693   34.233  41.814 1.00 47.94 ? 462 PHE B CB  1 
ATOM   6001 C  CG  . PHE B 1 357 ? 5.312   34.202  40.356 1.00 48.29 ? 462 PHE B CG  1 
ATOM   6002 C  CD1 . PHE B 1 357 ? 6.249   34.489  39.371 1.00 48.28 ? 462 PHE B CD1 1 
ATOM   6003 C  CD2 . PHE B 1 357 ? 4.016   33.885  39.969 1.00 48.34 ? 462 PHE B CD2 1 
ATOM   6004 C  CE1 . PHE B 1 357 ? 5.899   34.462  38.028 1.00 48.18 ? 462 PHE B CE1 1 
ATOM   6005 C  CE2 . PHE B 1 357 ? 3.660   33.856  38.628 1.00 48.21 ? 462 PHE B CE2 1 
ATOM   6006 C  CZ  . PHE B 1 357 ? 4.603   34.144  37.658 1.00 48.14 ? 462 PHE B CZ  1 
ATOM   6007 N  N   . LEU B 1 358 ? 4.516   35.543  44.762 1.00 47.93 ? 463 LEU B N   1 
ATOM   6008 C  CA  . LEU B 1 358 ? 4.526   35.375  46.221 1.00 48.00 ? 463 LEU B CA  1 
ATOM   6009 C  C   . LEU B 1 358 ? 3.941   34.016  46.598 1.00 48.05 ? 463 LEU B C   1 
ATOM   6010 O  O   . LEU B 1 358 ? 2.844   33.674  46.166 1.00 48.01 ? 463 LEU B O   1 
ATOM   6011 C  CB  . LEU B 1 358 ? 3.723   36.498  46.886 1.00 47.96 ? 463 LEU B CB  1 
ATOM   6012 C  CG  . LEU B 1 358 ? 3.260   36.316  48.338 1.00 48.06 ? 463 LEU B CG  1 
ATOM   6013 C  CD1 . LEU B 1 358 ? 4.436   36.173  49.293 1.00 48.18 ? 463 LEU B CD1 1 
ATOM   6014 C  CD2 . LEU B 1 358 ? 2.373   37.482  48.754 1.00 48.00 ? 463 LEU B CD2 1 
ATOM   6015 N  N   . VAL B 1 359 ? 4.668   33.258  47.417 1.00 48.30 ? 464 VAL B N   1 
ATOM   6016 C  CA  . VAL B 1 359 ? 4.255   31.910  47.828 1.00 48.49 ? 464 VAL B CA  1 
ATOM   6017 C  C   . VAL B 1 359 ? 3.980   31.865  49.333 1.00 48.59 ? 464 VAL B C   1 
ATOM   6018 O  O   . VAL B 1 359 ? 4.785   32.340  50.125 1.00 48.49 ? 464 VAL B O   1 
ATOM   6019 C  CB  . VAL B 1 359 ? 5.334   30.874  47.476 1.00 48.43 ? 464 VAL B CB  1 
ATOM   6020 C  CG1 . VAL B 1 359 ? 4.885   29.467  47.874 1.00 48.86 ? 464 VAL B CG1 1 
ATOM   6021 C  CG2 . VAL B 1 359 ? 5.655   30.940  45.996 1.00 48.18 ? 464 VAL B CG2 1 
ATOM   6022 N  N   . VAL B 1 360 ? 2.842   31.284  49.711 1.00 48.86 ? 465 VAL B N   1 
ATOM   6023 C  CA  . VAL B 1 360 ? 2.378   31.276  51.104 1.00 49.08 ? 465 VAL B CA  1 
ATOM   6024 C  C   . VAL B 1 360 ? 1.826   29.890  51.498 1.00 49.23 ? 465 VAL B C   1 
ATOM   6025 O  O   . VAL B 1 360 ? 0.803   29.450  50.973 1.00 49.04 ? 465 VAL B O   1 
ATOM   6026 C  CB  . VAL B 1 360 ? 1.290   32.355  51.320 1.00 49.05 ? 465 VAL B CB  1 
ATOM   6027 C  CG1 . VAL B 1 360 ? 0.966   32.513  52.804 1.00 49.10 ? 465 VAL B CG1 1 
ATOM   6028 C  CG2 . VAL B 1 360 ? 1.731   33.686  50.725 1.00 48.97 ? 465 VAL B CG2 1 
ATOM   6029 N  N   . LEU B 1 361 ? 2.503   29.227  52.437 1.00 49.57 ? 466 LEU B N   1 
ATOM   6030 C  CA  . LEU B 1 361 ? 2.213   27.835  52.797 1.00 49.95 ? 466 LEU B CA  1 
ATOM   6031 C  C   . LEU B 1 361 ? 1.906   27.690  54.283 1.00 50.25 ? 466 LEU B C   1 
ATOM   6032 O  O   . LEU B 1 361 ? 2.627   28.233  55.118 1.00 50.27 ? 466 LEU B O   1 
ATOM   6033 C  CB  . LEU B 1 361 ? 3.421   26.956  52.470 1.00 49.91 ? 466 LEU B CB  1 
ATOM   6034 C  CG  . LEU B 1 361 ? 4.008   27.060  51.063 1.00 49.93 ? 466 LEU B CG  1 
ATOM   6035 C  CD1 . LEU B 1 361 ? 5.439   26.560  51.062 1.00 50.14 ? 466 LEU B CD1 1 
ATOM   6036 C  CD2 . LEU B 1 361 ? 3.157   26.298  50.051 1.00 50.12 ? 466 LEU B CD2 1 
ATOM   6037 N  N   . ASN B 1 362 ? 0.856   26.938  54.608 1.00 50.72 ? 467 ASN B N   1 
ATOM   6038 C  CA  . ASN B 1 362 ? 0.480   26.676  56.000 1.00 51.08 ? 467 ASN B CA  1 
ATOM   6039 C  C   . ASN B 1 362 ? 0.787   25.231  56.399 1.00 51.43 ? 467 ASN B C   1 
ATOM   6040 O  O   . ASN B 1 362 ? 0.072   24.311  56.015 1.00 51.51 ? 467 ASN B O   1 
ATOM   6041 C  CB  . ASN B 1 362 ? -1.010  26.977  56.214 1.00 51.04 ? 467 ASN B CB  1 
ATOM   6042 C  CG  . ASN B 1 362 ? -1.453  26.805  57.667 1.00 50.94 ? 467 ASN B CG  1 
ATOM   6043 O  OD1 . ASN B 1 362 ? -0.639  26.809  58.592 1.00 51.39 ? 467 ASN B OD1 1 
ATOM   6044 N  ND2 . ASN B 1 362 ? -2.758  26.661  57.867 1.00 51.26 ? 467 ASN B ND2 1 
ATOM   6045 N  N   . PHE B 1 363 ? 1.851   25.042  57.172 1.00 51.94 ? 468 PHE B N   1 
ATOM   6046 C  CA  . PHE B 1 363 ? 2.209   23.726  57.701 1.00 52.35 ? 468 PHE B CA  1 
ATOM   6047 C  C   . PHE B 1 363 ? 1.590   23.541  59.093 1.00 52.86 ? 468 PHE B C   1 
ATOM   6048 O  O   . PHE B 1 363 ? 2.307   23.381  60.091 1.00 52.95 ? 468 PHE B O   1 
ATOM   6049 C  CB  . PHE B 1 363 ? 3.733   23.585  57.781 1.00 52.45 ? 468 PHE B CB  1 
ATOM   6050 C  CG  . PHE B 1 363 ? 4.424   23.634  56.447 1.00 52.41 ? 468 PHE B CG  1 
ATOM   6051 C  CD1 . PHE B 1 363 ? 4.766   24.850  55.870 1.00 52.45 ? 468 PHE B CD1 1 
ATOM   6052 C  CD2 . PHE B 1 363 ? 4.748   22.462  55.775 1.00 52.44 ? 468 PHE B CD2 1 
ATOM   6053 C  CE1 . PHE B 1 363 ? 5.411   24.897  54.643 1.00 52.43 ? 468 PHE B CE1 1 
ATOM   6054 C  CE2 . PHE B 1 363 ? 5.391   22.502  54.548 1.00 52.54 ? 468 PHE B CE2 1 
ATOM   6055 C  CZ  . PHE B 1 363 ? 5.725   23.721  53.982 1.00 52.54 ? 468 PHE B CZ  1 
ATOM   6056 N  N   . GLY B 1 364 ? 0.257   23.572  59.152 1.00 53.27 ? 469 GLY B N   1 
ATOM   6057 C  CA  . GLY B 1 364 ? -0.467  23.509  60.423 1.00 53.48 ? 469 GLY B CA  1 
ATOM   6058 C  C   . GLY B 1 364 ? -1.933  23.141  60.270 1.00 53.81 ? 469 GLY B C   1 
ATOM   6059 O  O   . GLY B 1 364 ? -2.540  23.391  59.223 1.00 53.68 ? 469 GLY B O   1 
ATOM   6060 N  N   . ASP B 1 365 ? -2.496  22.558  61.331 1.00 54.22 ? 470 ASP B N   1 
ATOM   6061 C  CA  . ASP B 1 365 ? -3.879  22.063  61.332 1.00 54.49 ? 470 ASP B CA  1 
ATOM   6062 C  C   . ASP B 1 365 ? -4.920  23.160  61.514 1.00 54.71 ? 470 ASP B C   1 
ATOM   6063 O  O   . ASP B 1 365 ? -6.038  23.036  61.023 1.00 54.69 ? 470 ASP B O   1 
ATOM   6064 C  CB  . ASP B 1 365 ? -4.076  21.019  62.435 1.00 54.55 ? 470 ASP B CB  1 
ATOM   6065 C  CG  . ASP B 1 365 ? -3.335  19.726  62.160 1.00 54.94 ? 470 ASP B CG  1 
ATOM   6066 O  OD1 . ASP B 1 365 ? -3.682  18.703  62.789 1.00 55.39 ? 470 ASP B OD1 1 
ATOM   6067 O  OD2 . ASP B 1 365 ? -2.410  19.727  61.318 1.00 55.53 ? 470 ASP B OD2 1 
ATOM   6068 N  N   . VAL B 1 366 ? -4.565  24.217  62.238 1.00 55.07 ? 471 VAL B N   1 
ATOM   6069 C  CA  . VAL B 1 366 ? -5.505  25.304  62.511 1.00 55.36 ? 471 VAL B CA  1 
ATOM   6070 C  C   . VAL B 1 366 ? -5.364  26.392  61.449 1.00 55.60 ? 471 VAL B C   1 
ATOM   6071 O  O   . VAL B 1 366 ? -4.266  26.644  60.945 1.00 55.56 ? 471 VAL B O   1 
ATOM   6072 C  CB  . VAL B 1 366 ? -5.291  25.907  63.923 1.00 55.32 ? 471 VAL B CB  1 
ATOM   6073 C  CG1 . VAL B 1 366 ? -6.441  26.851  64.288 1.00 55.41 ? 471 VAL B CG1 1 
ATOM   6074 C  CG2 . VAL B 1 366 ? -5.162  24.795  64.965 1.00 55.25 ? 471 VAL B CG2 1 
ATOM   6075 N  N   . GLY B 1 367 ? -6.485  27.019  61.103 1.00 56.00 ? 472 GLY B N   1 
ATOM   6076 C  CA  . GLY B 1 367 ? -6.496  28.123  60.153 1.00 56.38 ? 472 GLY B CA  1 
ATOM   6077 C  C   . GLY B 1 367 ? -5.977  29.397  60.795 1.00 56.74 ? 472 GLY B C   1 
ATOM   6078 O  O   . GLY B 1 367 ? -6.443  29.792  61.868 1.00 56.70 ? 472 GLY B O   1 
ATOM   6079 N  N   . LEU B 1 368 ? -5.019  30.041  60.127 1.00 57.17 ? 473 LEU B N   1 
ATOM   6080 C  CA  . LEU B 1 368 ? -4.325  31.212  60.667 1.00 57.45 ? 473 LEU B CA  1 
ATOM   6081 C  C   . LEU B 1 368 ? -4.415  32.417  59.732 1.00 57.69 ? 473 LEU B C   1 
ATOM   6082 O  O   . LEU B 1 368 ? -4.500  32.267  58.513 1.00 57.77 ? 473 LEU B O   1 
ATOM   6083 C  CB  . LEU B 1 368 ? -2.846  30.882  60.893 1.00 57.53 ? 473 LEU B CB  1 
ATOM   6084 C  CG  . LEU B 1 368 ? -2.524  29.584  61.639 1.00 57.73 ? 473 LEU B CG  1 
ATOM   6085 C  CD1 . LEU B 1 368 ? -1.019  29.338  61.629 1.00 57.95 ? 473 LEU B CD1 1 
ATOM   6086 C  CD2 . LEU B 1 368 ? -3.068  29.612  63.067 1.00 57.63 ? 473 LEU B CD2 1 
ATOM   6087 N  N   . SER B 1 369 ? -4.388  33.613  60.313 1.00 58.01 ? 474 SER B N   1 
ATOM   6088 C  CA  . SER B 1 369 ? -4.251  34.840  59.534 1.00 58.26 ? 474 SER B CA  1 
ATOM   6089 C  C   . SER B 1 369 ? -2.808  34.940  59.043 1.00 58.60 ? 474 SER B C   1 
ATOM   6090 O  O   . SER B 1 369 ? -1.883  34.566  59.767 1.00 58.69 ? 474 SER B O   1 
ATOM   6091 C  CB  . SER B 1 369 ? -4.604  36.057  60.386 1.00 58.21 ? 474 SER B CB  1 
ATOM   6092 O  OG  . SER B 1 369 ? -5.899  35.927  60.947 1.00 58.13 ? 474 SER B OG  1 
ATOM   6093 N  N   . ALA B 1 370 ? -2.615  35.429  57.819 1.00 58.95 ? 475 ALA B N   1 
ATOM   6094 C  CA  . ALA B 1 370 ? -1.274  35.527  57.227 1.00 59.19 ? 475 ALA B CA  1 
ATOM   6095 C  C   . ALA B 1 370 ? -0.410  36.593  57.914 1.00 59.51 ? 475 ALA B C   1 
ATOM   6096 O  O   . ALA B 1 370 ? 0.769   36.355  58.189 1.00 59.59 ? 475 ALA B O   1 
ATOM   6097 C  CB  . ALA B 1 370 ? -1.368  35.801  55.729 1.00 59.16 ? 475 ALA B CB  1 
ATOM   6098 N  N   . GLY B 1 371 ? -0.998  37.760  58.181 1.00 59.83 ? 476 GLY B N   1 
ATOM   6099 C  CA  . GLY B 1 371 ? -0.302  38.852  58.872 1.00 60.08 ? 476 GLY B CA  1 
ATOM   6100 C  C   . GLY B 1 371 ? 1.069   39.161  58.292 1.00 60.37 ? 476 GLY B C   1 
ATOM   6101 O  O   . GLY B 1 371 ? 2.058   39.239  59.023 1.00 60.47 ? 476 GLY B O   1 
ATOM   6102 N  N   . LEU B 1 372 ? 1.121   39.339  56.974 1.00 60.65 ? 477 LEU B N   1 
ATOM   6103 C  CA  . LEU B 1 372 ? 2.384   39.535  56.264 1.00 60.84 ? 477 LEU B CA  1 
ATOM   6104 C  C   . LEU B 1 372 ? 2.964   40.931  56.486 1.00 61.05 ? 477 LEU B C   1 
ATOM   6105 O  O   . LEU B 1 372 ? 2.228   41.893  56.715 1.00 61.10 ? 477 LEU B O   1 
ATOM   6106 C  CB  . LEU B 1 372 ? 2.191   39.288  54.765 1.00 60.89 ? 477 LEU B CB  1 
ATOM   6107 C  CG  . LEU B 1 372 ? 1.734   37.882  54.364 1.00 61.00 ? 477 LEU B CG  1 
ATOM   6108 C  CD1 . LEU B 1 372 ? 1.196   37.883  52.938 1.00 61.17 ? 477 LEU B CD1 1 
ATOM   6109 C  CD2 . LEU B 1 372 ? 2.859   36.861  54.513 1.00 60.93 ? 477 LEU B CD2 1 
ATOM   6110 N  N   . GLN B 1 373 ? 4.293   41.020  56.418 1.00 61.35 ? 478 GLN B N   1 
ATOM   6111 C  CA  . GLN B 1 373 ? 5.022   42.283  56.577 1.00 61.46 ? 478 GLN B CA  1 
ATOM   6112 C  C   . GLN B 1 373 ? 6.171   42.372  55.568 1.00 61.69 ? 478 GLN B C   1 
ATOM   6113 O  O   . GLN B 1 373 ? 6.783   41.353  55.219 1.00 61.76 ? 478 GLN B O   1 
ATOM   6114 C  CB  . GLN B 1 373 ? 5.567   42.406  58.002 1.00 61.45 ? 478 GLN B CB  1 
ATOM   6115 C  CG  . GLN B 1 373 ? 4.483   42.504  59.072 1.00 61.48 ? 478 GLN B CG  1 
ATOM   6116 C  CD  . GLN B 1 373 ? 5.040   42.618  60.481 1.00 61.47 ? 478 GLN B CD  1 
ATOM   6117 O  OE1 . GLN B 1 373 ? 6.242   42.797  60.680 1.00 61.50 ? 478 GLN B OE1 1 
ATOM   6118 N  NE2 . GLN B 1 373 ? 4.159   42.516  61.470 1.00 61.47 ? 478 GLN B NE2 1 
ATOM   6119 N  N   . ALA B 1 374 ? 6.456   43.589  55.103 1.00 61.85 ? 479 ALA B N   1 
ATOM   6120 C  CA  . ALA B 1 374 ? 7.525   43.823  54.125 1.00 61.89 ? 479 ALA B CA  1 
ATOM   6121 C  C   . ALA B 1 374 ? 8.886   43.758  54.820 1.00 61.98 ? 479 ALA B C   1 
ATOM   6122 O  O   . ALA B 1 374 ? 9.515   44.788  55.079 1.00 61.94 ? 479 ALA B O   1 
ATOM   6123 C  CB  . ALA B 1 374 ? 7.334   45.180  53.436 1.00 61.91 ? 479 ALA B CB  1 
ATOM   6124 N  N   . SER B 1 375 ? 9.333   42.536  55.107 1.00 62.06 ? 480 SER B N   1 
ATOM   6125 C  CA  . SER B 1 375 ? 10.487  42.308  55.977 1.00 62.09 ? 480 SER B CA  1 
ATOM   6126 C  C   . SER B 1 375 ? 11.774  42.024  55.201 1.00 62.11 ? 480 SER B C   1 
ATOM   6127 O  O   . SER B 1 375 ? 11.972  40.913  54.696 1.00 62.01 ? 480 SER B O   1 
ATOM   6128 C  CB  . SER B 1 375 ? 10.192  41.155  56.939 1.00 62.17 ? 480 SER B CB  1 
ATOM   6129 O  OG  . SER B 1 375 ? 11.240  41.000  57.881 1.00 62.47 ? 480 SER B OG  1 
ATOM   6130 N  N   . ASP B 1 376 ? 12.637  43.042  55.123 1.00 62.16 ? 481 ASP B N   1 
ATOM   6131 C  CA  . ASP B 1 376 ? 13.974  42.940  54.516 1.00 62.08 ? 481 ASP B CA  1 
ATOM   6132 C  C   . ASP B 1 376 ? 13.922  42.378  53.086 1.00 62.07 ? 481 ASP B C   1 
ATOM   6133 O  O   . ASP B 1 376 ? 14.622  41.417  52.740 1.00 62.01 ? 481 ASP B O   1 
ATOM   6134 C  CB  . ASP B 1 376 ? 14.906  42.110  55.417 1.00 62.17 ? 481 ASP B CB  1 
ATOM   6135 C  CG  . ASP B 1 376 ? 16.378  42.479  55.252 1.00 62.30 ? 481 ASP B CG  1 
ATOM   6136 O  OD1 . ASP B 1 376 ? 17.237  41.593  55.450 1.00 62.65 ? 481 ASP B OD1 1 
ATOM   6137 O  OD2 . ASP B 1 376 ? 16.682  43.650  54.933 1.00 62.65 ? 481 ASP B OD2 1 
ATOM   6138 N  N   . LEU B 1 377 ? 13.068  42.994  52.270 1.00 61.97 ? 482 LEU B N   1 
ATOM   6139 C  CA  . LEU B 1 377 ? 12.895  42.627  50.869 1.00 61.82 ? 482 LEU B CA  1 
ATOM   6140 C  C   . LEU B 1 377 ? 13.419  43.772  50.003 1.00 61.72 ? 482 LEU B C   1 
ATOM   6141 O  O   . LEU B 1 377 ? 13.602  44.887  50.499 1.00 61.76 ? 482 LEU B O   1 
ATOM   6142 C  CB  . LEU B 1 377 ? 11.411  42.394  50.565 1.00 61.82 ? 482 LEU B CB  1 
ATOM   6143 C  CG  . LEU B 1 377 ? 10.681  41.354  51.417 1.00 61.85 ? 482 LEU B CG  1 
ATOM   6144 C  CD1 . LEU B 1 377 ? 9.176   41.453  51.217 1.00 61.90 ? 482 LEU B CD1 1 
ATOM   6145 C  CD2 . LEU B 1 377 ? 11.174  39.955  51.091 1.00 62.00 ? 482 LEU B CD2 1 
ATOM   6146 N  N   . PRO B 1 378 ? 13.674  43.504  48.708 1.00 61.57 ? 483 PRO B N   1 
ATOM   6147 C  CA  . PRO B 1 378 ? 13.984  44.583  47.760 1.00 61.45 ? 483 PRO B CA  1 
ATOM   6148 C  C   . PRO B 1 378 ? 12.894  45.666  47.686 1.00 61.36 ? 483 PRO B C   1 
ATOM   6149 O  O   . PRO B 1 378 ? 11.778  45.465  48.178 1.00 61.39 ? 483 PRO B O   1 
ATOM   6150 C  CB  . PRO B 1 378 ? 14.109  43.853  46.415 1.00 61.45 ? 483 PRO B CB  1 
ATOM   6151 C  CG  . PRO B 1 378 ? 14.388  42.436  46.759 1.00 61.45 ? 483 PRO B CG  1 
ATOM   6152 C  CD  . PRO B 1 378 ? 13.727  42.173  48.073 1.00 61.53 ? 483 PRO B CD  1 
ATOM   6153 N  N   . ALA B 1 379 ? 13.229  46.802  47.076 1.00 61.25 ? 484 ALA B N   1 
ATOM   6154 C  CA  . ALA B 1 379 ? 12.293  47.926  46.943 1.00 61.08 ? 484 ALA B CA  1 
ATOM   6155 C  C   . ALA B 1 379 ? 11.188  47.647  45.917 1.00 60.96 ? 484 ALA B C   1 
ATOM   6156 O  O   . ALA B 1 379 ? 10.052  48.099  46.088 1.00 61.02 ? 484 ALA B O   1 
ATOM   6157 C  CB  . ALA B 1 379 ? 13.045  49.213  46.583 1.00 61.03 ? 484 ALA B CB  1 
ATOM   6158 N  N   . SER B 1 380 ? 11.527  46.907  44.861 1.00 60.71 ? 485 SER B N   1 
ATOM   6159 C  CA  . SER B 1 380 ? 10.565  46.545  43.814 1.00 60.56 ? 485 SER B CA  1 
ATOM   6160 C  C   . SER B 1 380 ? 9.821   45.240  44.124 1.00 60.42 ? 485 SER B C   1 
ATOM   6161 O  O   . SER B 1 380 ? 8.729   45.012  43.603 1.00 60.43 ? 485 SER B O   1 
ATOM   6162 C  CB  . SER B 1 380 ? 11.272  46.425  42.463 1.00 60.55 ? 485 SER B CB  1 
ATOM   6163 O  OG  . SER B 1 380 ? 12.316  45.472  42.522 1.00 60.52 ? 485 SER B OG  1 
ATOM   6164 N  N   . ALA B 1 381 ? 10.424  44.394  44.962 1.00 60.22 ? 486 ALA B N   1 
ATOM   6165 C  CA  . ALA B 1 381 ? 9.822   43.128  45.397 1.00 59.99 ? 486 ALA B CA  1 
ATOM   6166 C  C   . ALA B 1 381 ? 9.197   43.217  46.801 1.00 59.80 ? 486 ALA B C   1 
ATOM   6167 O  O   . ALA B 1 381 ? 8.953   42.190  47.442 1.00 59.72 ? 486 ALA B O   1 
ATOM   6168 C  CB  . ALA B 1 381 ? 10.864  42.014  45.351 1.00 59.95 ? 486 ALA B CB  1 
ATOM   6169 N  N   . SER B 1 382 ? 8.942   44.439  47.275 1.00 59.61 ? 487 SER B N   1 
ATOM   6170 C  CA  . SER B 1 382 ? 8.188   44.650  48.516 1.00 59.47 ? 487 SER B CA  1 
ATOM   6171 C  C   . SER B 1 382 ? 6.706   44.353  48.269 1.00 59.32 ? 487 SER B C   1 
ATOM   6172 O  O   . SER B 1 382 ? 6.281   44.199  47.118 1.00 59.34 ? 487 SER B O   1 
ATOM   6173 C  CB  . SER B 1 382 ? 8.384   46.078  49.043 1.00 59.52 ? 487 SER B CB  1 
ATOM   6174 O  OG  . SER B 1 382 ? 8.187   47.042  48.022 1.00 59.52 ? 487 SER B OG  1 
ATOM   6175 N  N   . LEU B 1 383 ? 5.924   44.277  49.345 1.00 59.08 ? 488 LEU B N   1 
ATOM   6176 C  CA  . LEU B 1 383 ? 4.545   43.774  49.261 1.00 58.82 ? 488 LEU B CA  1 
ATOM   6177 C  C   . LEU B 1 383 ? 3.502   44.873  49.035 1.00 58.50 ? 488 LEU B C   1 
ATOM   6178 O  O   . LEU B 1 383 ? 3.405   45.801  49.838 1.00 58.44 ? 488 LEU B O   1 
ATOM   6179 C  CB  . LEU B 1 383 ? 4.193   42.970  50.520 1.00 58.82 ? 488 LEU B CB  1 
ATOM   6180 C  CG  . LEU B 1 383 ? 4.375   41.453  50.391 1.00 59.06 ? 488 LEU B CG  1 
ATOM   6181 C  CD1 . LEU B 1 383 ? 5.756   41.081  49.850 1.00 59.05 ? 488 LEU B CD1 1 
ATOM   6182 C  CD2 . LEU B 1 383 ? 4.116   40.783  51.737 1.00 59.13 ? 488 LEU B CD2 1 
ATOM   6183 N  N   . PRO B 1 384 ? 2.707   44.760  47.947 1.00 58.17 ? 489 PRO B N   1 
ATOM   6184 C  CA  . PRO B 1 384 ? 1.630   45.715  47.657 1.00 57.95 ? 489 PRO B CA  1 
ATOM   6185 C  C   . PRO B 1 384 ? 0.345   45.419  48.433 1.00 57.69 ? 489 PRO B C   1 
ATOM   6186 O  O   . PRO B 1 384 ? 0.257   44.393  49.110 1.00 57.73 ? 489 PRO B O   1 
ATOM   6187 C  CB  . PRO B 1 384 ? 1.390   45.519  46.158 1.00 57.93 ? 489 PRO B CB  1 
ATOM   6188 C  CG  . PRO B 1 384 ? 1.728   44.098  45.910 1.00 58.04 ? 489 PRO B CG  1 
ATOM   6189 C  CD  . PRO B 1 384 ? 2.784   43.705  46.916 1.00 58.15 ? 489 PRO B CD  1 
ATOM   6190 N  N   . ALA B 1 385 ? -0.641  46.309  48.318 1.00 57.35 ? 490 ALA B N   1 
ATOM   6191 C  CA  . ALA B 1 385 ? -1.927  46.146  49.006 1.00 57.10 ? 490 ALA B CA  1 
ATOM   6192 C  C   . ALA B 1 385 ? -2.686  44.916  48.506 1.00 56.83 ? 490 ALA B C   1 
ATOM   6193 O  O   . ALA B 1 385 ? -3.121  44.084  49.301 1.00 56.69 ? 490 ALA B O   1 
ATOM   6194 C  CB  . ALA B 1 385 ? -2.782  47.394  48.835 1.00 57.01 ? 490 ALA B CB  1 
ATOM   6195 N  N   . LYS B 1 386 ? -2.842  44.816  47.187 1.00 56.61 ? 491 LYS B N   1 
ATOM   6196 C  CA  . LYS B 1 386 ? -3.525  43.686  46.563 1.00 56.43 ? 491 LYS B CA  1 
ATOM   6197 C  C   . LYS B 1 386 ? -2.645  43.016  45.500 1.00 56.27 ? 491 LYS B C   1 
ATOM   6198 O  O   . LYS B 1 386 ? -1.663  43.596  45.029 1.00 56.17 ? 491 LYS B O   1 
ATOM   6199 C  CB  . LYS B 1 386 ? -4.864  44.131  45.961 1.00 56.38 ? 491 LYS B CB  1 
ATOM   6200 C  CG  . LYS B 1 386 ? -4.759  45.142  44.820 1.00 56.49 ? 491 LYS B CG  1 
ATOM   6201 C  CD  . LYS B 1 386 ? -6.137  45.481  44.250 1.00 56.53 ? 491 LYS B CD  1 
ATOM   6202 C  CE  . LYS B 1 386 ? -6.044  46.348  42.995 1.00 56.58 ? 491 LYS B CE  1 
ATOM   6203 N  NZ  . LYS B 1 386 ? -5.798  47.787  43.311 1.00 56.62 ? 491 LYS B NZ  1 
ATOM   6204 N  N   . ALA B 1 387 ? -3.008  41.786  45.142 1.00 56.08 ? 492 ALA B N   1 
ATOM   6205 C  CA  . ALA B 1 387 ? -2.277  41.001  44.149 1.00 55.89 ? 492 ALA B CA  1 
ATOM   6206 C  C   . ALA B 1 387 ? -3.168  39.878  43.627 1.00 55.72 ? 492 ALA B C   1 
ATOM   6207 O  O   . ALA B 1 387 ? -4.022  39.377  44.353 1.00 55.70 ? 492 ALA B O   1 
ATOM   6208 C  CB  . ALA B 1 387 ? -1.015  40.429  44.759 1.00 55.86 ? 492 ALA B CB  1 
ATOM   6209 N  N   . ASP B 1 388 ? -2.965  39.484  42.373 1.00 55.61 ? 493 ASP B N   1 
ATOM   6210 C  CA  . ASP B 1 388 ? -3.819  38.476  41.738 1.00 55.59 ? 493 ASP B CA  1 
ATOM   6211 C  C   . ASP B 1 388 ? -3.538  37.071  42.258 1.00 55.40 ? 493 ASP B C   1 
ATOM   6212 O  O   . ASP B 1 388 ? -2.389  36.625  42.274 1.00 55.33 ? 493 ASP B O   1 
ATOM   6213 C  CB  . ASP B 1 388 ? -3.643  38.486  40.213 1.00 55.73 ? 493 ASP B CB  1 
ATOM   6214 C  CG  . ASP B 1 388 ? -4.235  39.726  39.559 1.00 56.31 ? 493 ASP B CG  1 
ATOM   6215 O  OD1 . ASP B 1 388 ? -3.582  40.283  38.649 1.00 57.33 ? 493 ASP B OD1 1 
ATOM   6216 O  OD2 . ASP B 1 388 ? -5.347  40.146  39.951 1.00 57.02 ? 493 ASP B OD2 1 
ATOM   6217 N  N   . LEU B 1 389 ? -4.596  36.380  42.680 1.00 55.22 ? 494 LEU B N   1 
ATOM   6218 C  CA  . LEU B 1 389 ? -4.507  34.963  43.023 1.00 55.13 ? 494 LEU B CA  1 
ATOM   6219 C  C   . LEU B 1 389 ? -4.441  34.148  41.740 1.00 54.94 ? 494 LEU B C   1 
ATOM   6220 O  O   . LEU B 1 389 ? -5.299  34.280  40.868 1.00 54.74 ? 494 LEU B O   1 
ATOM   6221 C  CB  . LEU B 1 389 ? -5.716  34.514  43.848 1.00 55.10 ? 494 LEU B CB  1 
ATOM   6222 C  CG  . LEU B 1 389 ? -5.765  33.022  44.204 1.00 55.02 ? 494 LEU B CG  1 
ATOM   6223 C  CD1 . LEU B 1 389 ? -4.677  32.672  45.206 1.00 54.80 ? 494 LEU B CD1 1 
ATOM   6224 C  CD2 . LEU B 1 389 ? -7.133  32.641  44.743 1.00 55.14 ? 494 LEU B CD2 1 
ATOM   6225 N  N   . LEU B 1 390 ? -3.425  33.299  41.638 1.00 54.97 ? 495 LEU B N   1 
ATOM   6226 C  CA  . LEU B 1 390 ? -3.257  32.434  40.477 1.00 54.93 ? 495 LEU B CA  1 
ATOM   6227 C  C   . LEU B 1 390 ? -3.729  31.013  40.759 1.00 54.76 ? 495 LEU B C   1 
ATOM   6228 O  O   . LEU B 1 390 ? -4.353  30.385  39.907 1.00 54.61 ? 495 LEU B O   1 
ATOM   6229 C  CB  . LEU B 1 390 ? -1.791  32.428  40.046 1.00 54.97 ? 495 LEU B CB  1 
ATOM   6230 C  CG  . LEU B 1 390 ? -1.419  31.741  38.729 1.00 55.14 ? 495 LEU B CG  1 
ATOM   6231 C  CD1 . LEU B 1 390 ? -2.411  32.041  37.608 1.00 55.58 ? 495 LEU B CD1 1 
ATOM   6232 C  CD2 . LEU B 1 390 ? -0.015  32.173  38.324 1.00 55.15 ? 495 LEU B CD2 1 
ATOM   6233 N  N   . LEU B 1 391 ? -3.454  30.518  41.962 1.00 54.67 ? 496 LEU B N   1 
ATOM   6234 C  CA  . LEU B 1 391 ? -3.661  29.107  42.261 1.00 54.65 ? 496 LEU B CA  1 
ATOM   6235 C  C   . LEU B 1 391 ? -3.725  28.838  43.766 1.00 54.55 ? 496 LEU B C   1 
ATOM   6236 O  O   . LEU B 1 391 ? -3.046  29.493  44.555 1.00 54.39 ? 496 LEU B O   1 
ATOM   6237 C  CB  . LEU B 1 391 ? -2.527  28.307  41.612 1.00 54.64 ? 496 LEU B CB  1 
ATOM   6238 C  CG  . LEU B 1 391 ? -2.428  26.788  41.768 1.00 54.77 ? 496 LEU B CG  1 
ATOM   6239 C  CD1 . LEU B 1 391 ? -1.701  26.201  40.557 1.00 54.60 ? 496 LEU B CD1 1 
ATOM   6240 C  CD2 . LEU B 1 391 ? -1.729  26.374  43.072 1.00 54.92 ? 496 LEU B CD2 1 
ATOM   6241 N  N   . SER B 1 392 ? -4.563  27.878  44.150 1.00 54.58 ? 497 SER B N   1 
ATOM   6242 C  CA  . SER B 1 392 ? -4.633  27.389  45.526 1.00 54.59 ? 497 SER B CA  1 
ATOM   6243 C  C   . SER B 1 392 ? -4.642  25.868  45.514 1.00 54.64 ? 497 SER B C   1 
ATOM   6244 O  O   . SER B 1 392 ? -5.063  25.259  44.532 1.00 54.68 ? 497 SER B O   1 
ATOM   6245 C  CB  . SER B 1 392 ? -5.890  27.903  46.229 1.00 54.54 ? 497 SER B CB  1 
ATOM   6246 O  OG  . SER B 1 392 ? -6.033  27.316  47.513 1.00 54.18 ? 497 SER B OG  1 
ATOM   6247 N  N   . THR B 1 393 ? -4.175  25.261  46.603 1.00 54.67 ? 498 THR B N   1 
ATOM   6248 C  CA  . THR B 1 393 ? -4.174  23.806  46.725 1.00 54.81 ? 498 THR B CA  1 
ATOM   6249 C  C   . THR B 1 393 ? -5.580  23.291  47.004 1.00 54.97 ? 498 THR B C   1 
ATOM   6250 O  O   . THR B 1 393 ? -5.908  22.151  46.674 1.00 55.12 ? 498 THR B O   1 
ATOM   6251 C  CB  . THR B 1 393 ? -3.223  23.317  47.836 1.00 54.67 ? 498 THR B CB  1 
ATOM   6252 O  OG1 . THR B 1 393 ? -3.622  23.861  49.097 1.00 54.67 ? 498 THR B OG1 1 
ATOM   6253 C  CG2 . THR B 1 393 ? -1.795  23.730  47.537 1.00 54.66 ? 498 THR B CG2 1 
ATOM   6254 N  N   . GLN B 1 394 ? -6.407  24.141  47.606 1.00 55.24 ? 499 GLN B N   1 
ATOM   6255 C  CA  . GLN B 1 394 ? -7.779  23.787  47.950 1.00 55.39 ? 499 GLN B CA  1 
ATOM   6256 C  C   . GLN B 1 394 ? -8.764  24.560  47.071 1.00 55.59 ? 499 GLN B C   1 
ATOM   6257 O  O   . GLN B 1 394 ? -8.688  25.789  46.999 1.00 55.56 ? 499 GLN B O   1 
ATOM   6258 C  CB  . GLN B 1 394 ? -8.037  24.088  49.423 1.00 55.39 ? 499 GLN B CB  1 
ATOM   6259 C  CG  . GLN B 1 394 ? -7.106  23.327  50.362 1.00 55.36 ? 499 GLN B CG  1 
ATOM   6260 C  CD  . GLN B 1 394 ? -7.366  23.619  51.828 1.00 55.29 ? 499 GLN B CD  1 
ATOM   6261 O  OE1 . GLN B 1 394 ? -8.345  24.275  52.186 1.00 55.42 ? 499 GLN B OE1 1 
ATOM   6262 N  NE2 . GLN B 1 394 ? -6.483  23.128  52.686 1.00 54.80 ? 499 GLN B NE2 1 
ATOM   6263 N  N   . PRO B 1 395 ? -9.665  23.841  46.366 1.00 55.83 ? 500 PRO B N   1 
ATOM   6264 C  CA  . PRO B 1 395 ? -10.750 24.502  45.632 1.00 55.87 ? 500 PRO B CA  1 
ATOM   6265 C  C   . PRO B 1 395 ? -11.698 25.251  46.563 1.00 55.99 ? 500 PRO B C   1 
ATOM   6266 O  O   . PRO B 1 395 ? -11.954 24.793  47.678 1.00 56.08 ? 500 PRO B O   1 
ATOM   6267 C  CB  . PRO B 1 395 ? -11.479 23.338  44.946 1.00 55.97 ? 500 PRO B CB  1 
ATOM   6268 C  CG  . PRO B 1 395 ? -10.491 22.215  44.922 1.00 56.00 ? 500 PRO B CG  1 
ATOM   6269 C  CD  . PRO B 1 395 ? -9.689  22.378  46.170 1.00 55.86 ? 500 PRO B CD  1 
ATOM   6270 N  N   . GLY B 1 396 ? -12.215 26.387  46.096 1.00 56.08 ? 501 GLY B N   1 
ATOM   6271 C  CA  . GLY B 1 396 ? -13.051 27.271  46.916 1.00 56.08 ? 501 GLY B CA  1 
ATOM   6272 C  C   . GLY B 1 396 ? -12.809 28.750  46.649 1.00 56.16 ? 501 GLY B C   1 
ATOM   6273 O  O   . GLY B 1 396 ? -13.722 29.567  46.794 1.00 56.22 ? 501 GLY B O   1 
ATOM   6274 N  N   . ARG B 1 397 ? -11.580 29.089  46.260 1.00 56.20 ? 502 ARG B N   1 
ATOM   6275 C  CA  . ARG B 1 397 ? -11.181 30.474  45.985 1.00 56.15 ? 502 ARG B CA  1 
ATOM   6276 C  C   . ARG B 1 397 ? -11.610 30.897  44.580 1.00 56.14 ? 502 ARG B C   1 
ATOM   6277 O  O   . ARG B 1 397 ? -11.861 30.047  43.717 1.00 56.09 ? 502 ARG B O   1 
ATOM   6278 C  CB  . ARG B 1 397 ? -9.655  30.619  46.094 1.00 56.25 ? 502 ARG B CB  1 
ATOM   6279 C  CG  . ARG B 1 397 ? -9.044  30.122  47.403 1.00 56.26 ? 502 ARG B CG  1 
ATOM   6280 C  CD  . ARG B 1 397 ? -8.780  31.254  48.377 1.00 56.41 ? 502 ARG B CD  1 
ATOM   6281 N  NE  . ARG B 1 397 ? -8.584  30.760  49.740 1.00 56.49 ? 502 ARG B NE  1 
ATOM   6282 C  CZ  . ARG B 1 397 ? -8.066  31.467  50.744 1.00 56.71 ? 502 ARG B CZ  1 
ATOM   6283 N  NH1 . ARG B 1 397 ? -7.662  32.724  50.567 1.00 56.61 ? 502 ARG B NH1 1 
ATOM   6284 N  NH2 . ARG B 1 397 ? -7.946  30.905  51.942 1.00 56.72 ? 502 ARG B NH2 1 
ATOM   6285 N  N   . GLU B 1 398 ? -11.682 32.209  44.354 1.00 56.02 ? 503 GLU B N   1 
ATOM   6286 C  CA  . GLU B 1 398 ? -11.913 32.756  43.013 1.00 55.94 ? 503 GLU B CA  1 
ATOM   6287 C  C   . GLU B 1 398 ? -10.568 33.023  42.333 1.00 55.85 ? 503 GLU B C   1 
ATOM   6288 O  O   . GLU B 1 398 ? -10.076 34.152  42.304 1.00 55.83 ? 503 GLU B O   1 
ATOM   6289 C  CB  . GLU B 1 398 ? -12.775 34.023  43.072 1.00 55.87 ? 503 GLU B CB  1 
ATOM   6290 C  CG  . GLU B 1 398 ? -14.240 33.752  43.429 1.00 55.89 ? 503 GLU B CG  1 
ATOM   6291 C  CD  . GLU B 1 398 ? -15.065 35.022  43.623 1.00 55.96 ? 503 GLU B CD  1 
ATOM   6292 O  OE1 . GLU B 1 398 ? -14.737 36.060  43.009 1.00 56.14 ? 503 GLU B OE1 1 
ATOM   6293 O  OE2 . GLU B 1 398 ? -16.052 34.979  44.389 1.00 55.85 ? 503 GLU B OE2 1 
ATOM   6294 N  N   . GLU B 1 399 ? -9.985  31.956  41.793 1.00 55.83 ? 504 GLU B N   1 
ATOM   6295 C  CA  . GLU B 1 399 ? -8.667  31.998  41.157 1.00 55.81 ? 504 GLU B CA  1 
ATOM   6296 C  C   . GLU B 1 399 ? -8.696  32.890  39.914 1.00 55.76 ? 504 GLU B C   1 
ATOM   6297 O  O   . GLU B 1 399 ? -9.442  32.623  38.974 1.00 55.95 ? 504 GLU B O   1 
ATOM   6298 C  CB  . GLU B 1 399 ? -8.204  30.575  40.792 1.00 55.76 ? 504 GLU B CB  1 
ATOM   6299 C  CG  . GLU B 1 399 ? -8.002  29.654  42.013 1.00 55.91 ? 504 GLU B CG  1 
ATOM   6300 C  CD  . GLU B 1 399 ? -7.596  28.220  41.658 1.00 56.00 ? 504 GLU B CD  1 
ATOM   6301 O  OE1 . GLU B 1 399 ? -8.051  27.688  40.621 1.00 55.83 ? 504 GLU B OE1 1 
ATOM   6302 O  OE2 . GLU B 1 399 ? -6.827  27.613  42.437 1.00 56.44 ? 504 GLU B OE2 1 
ATOM   6303 N  N   . GLY B 1 400 ? -7.894  33.954  39.931 1.00 55.57 ? 505 GLY B N   1 
ATOM   6304 C  CA  . GLY B 1 400 ? -7.859  34.937  38.846 1.00 55.38 ? 505 GLY B CA  1 
ATOM   6305 C  C   . GLY B 1 400 ? -8.488  36.266  39.231 1.00 55.23 ? 505 GLY B C   1 
ATOM   6306 O  O   . GLY B 1 400 ? -9.262  36.836  38.463 1.00 55.24 ? 505 GLY B O   1 
ATOM   6307 N  N   . SER B 1 401 ? -8.157  36.764  40.419 1.00 55.03 ? 506 SER B N   1 
ATOM   6308 C  CA  . SER B 1 401 ? -8.672  38.052  40.880 1.00 54.95 ? 506 SER B CA  1 
ATOM   6309 C  C   . SER B 1 401 ? -7.824  38.612  42.026 1.00 54.86 ? 506 SER B C   1 
ATOM   6310 O  O   . SER B 1 401 ? -7.134  37.854  42.708 1.00 54.99 ? 506 SER B O   1 
ATOM   6311 C  CB  . SER B 1 401 ? -10.125 37.916  41.338 1.00 54.88 ? 506 SER B CB  1 
ATOM   6312 O  OG  . SER B 1 401 ? -10.208 37.159  42.530 1.00 55.00 ? 506 SER B OG  1 
ATOM   6313 N  N   . PRO B 1 402 ? -7.870  39.941  42.240 1.00 54.73 ? 507 PRO B N   1 
ATOM   6314 C  CA  . PRO B 1 402 ? -7.122  40.587  43.330 1.00 54.64 ? 507 PRO B CA  1 
ATOM   6315 C  C   . PRO B 1 402 ? -7.565  40.220  44.758 1.00 54.45 ? 507 PRO B C   1 
ATOM   6316 O  O   . PRO B 1 402 ? -8.743  40.337  45.091 1.00 54.40 ? 507 PRO B O   1 
ATOM   6317 C  CB  . PRO B 1 402 ? -7.366  42.088  43.091 1.00 54.69 ? 507 PRO B CB  1 
ATOM   6318 C  CG  . PRO B 1 402 ? -7.910  42.201  41.722 1.00 54.73 ? 507 PRO B CG  1 
ATOM   6319 C  CD  . PRO B 1 402 ? -8.613  40.926  41.434 1.00 54.76 ? 507 PRO B CD  1 
ATOM   6320 N  N   . LEU B 1 403 ? -6.603  39.798  45.580 1.00 54.29 ? 508 LEU B N   1 
ATOM   6321 C  CA  . LEU B 1 403 ? -6.811  39.546  47.009 1.00 54.16 ? 508 LEU B CA  1 
ATOM   6322 C  C   . LEU B 1 403 ? -6.028  40.568  47.839 1.00 53.99 ? 508 LEU B C   1 
ATOM   6323 O  O   . LEU B 1 403 ? -4.877  40.868  47.523 1.00 53.91 ? 508 LEU B O   1 
ATOM   6324 C  CB  . LEU B 1 403 ? -6.342  38.134  47.378 1.00 54.16 ? 508 LEU B CB  1 
ATOM   6325 C  CG  . LEU B 1 403 ? -7.333  36.988  47.164 1.00 54.25 ? 508 LEU B CG  1 
ATOM   6326 C  CD1 . LEU B 1 403 ? -7.779  36.903  45.714 1.00 54.54 ? 508 LEU B CD1 1 
ATOM   6327 C  CD2 . LEU B 1 403 ? -6.715  35.671  47.612 1.00 54.19 ? 508 LEU B CD2 1 
ATOM   6328 N  N   . GLU B 1 404 ? -6.647  41.086  48.900 1.00 53.83 ? 509 GLU B N   1 
ATOM   6329 C  CA  . GLU B 1 404 ? -5.978  42.015  49.817 1.00 53.75 ? 509 GLU B CA  1 
ATOM   6330 C  C   . GLU B 1 404 ? -5.172  41.240  50.863 1.00 53.62 ? 509 GLU B C   1 
ATOM   6331 O  O   . GLU B 1 404 ? -5.722  40.426  51.600 1.00 53.64 ? 509 GLU B O   1 
ATOM   6332 C  CB  . GLU B 1 404 ? -6.996  42.937  50.495 1.00 53.75 ? 509 GLU B CB  1 
ATOM   6333 C  CG  . GLU B 1 404 ? -7.663  43.919  49.534 1.00 53.72 ? 509 GLU B CG  1 
ATOM   6334 C  CD  . GLU B 1 404 ? -8.789  44.712  50.174 1.00 53.64 ? 509 GLU B CD  1 
ATOM   6335 O  OE1 . GLU B 1 404 ? -8.701  45.016  51.382 1.00 53.46 ? 509 GLU B OE1 1 
ATOM   6336 O  OE2 . GLU B 1 404 ? -9.762  45.039  49.461 1.00 53.35 ? 509 GLU B OE2 1 
ATOM   6337 N  N   . LEU B 1 405 ? -3.873  41.514  50.928 1.00 53.52 ? 510 LEU B N   1 
ATOM   6338 C  CA  . LEU B 1 405 ? -2.938  40.696  51.708 1.00 53.57 ? 510 LEU B CA  1 
ATOM   6339 C  C   . LEU B 1 405 ? -2.991  40.907  53.225 1.00 53.47 ? 510 LEU B C   1 
ATOM   6340 O  O   . LEU B 1 405 ? -2.449  40.095  53.978 1.00 53.39 ? 510 LEU B O   1 
ATOM   6341 C  CB  . LEU B 1 405 ? -1.499  40.920  51.219 1.00 53.58 ? 510 LEU B CB  1 
ATOM   6342 C  CG  . LEU B 1 405 ? -1.066  40.140  49.975 1.00 53.71 ? 510 LEU B CG  1 
ATOM   6343 C  CD1 . LEU B 1 405 ? -1.915  40.493  48.763 1.00 53.88 ? 510 LEU B CD1 1 
ATOM   6344 C  CD2 . LEU B 1 405 ? 0.401   40.401  49.691 1.00 53.76 ? 510 LEU B CD2 1 
ATOM   6345 N  N   . GLU B 1 406 ? -3.631  41.983  53.672 1.00 53.45 ? 511 GLU B N   1 
ATOM   6346 C  CA  . GLU B 1 406 ? -3.638  42.333  55.094 1.00 53.47 ? 511 GLU B CA  1 
ATOM   6347 C  C   . GLU B 1 406 ? -4.620  41.469  55.878 1.00 53.43 ? 511 GLU B C   1 
ATOM   6348 O  O   . GLU B 1 406 ? -4.288  40.974  56.953 1.00 53.52 ? 511 GLU B O   1 
ATOM   6349 C  CB  . GLU B 1 406 ? -3.975  43.814  55.297 1.00 53.51 ? 511 GLU B CB  1 
ATOM   6350 C  CG  . GLU B 1 406 ? -3.019  44.778  54.598 1.00 53.71 ? 511 GLU B CG  1 
ATOM   6351 C  CD  . GLU B 1 406 ? -3.456  45.127  53.183 1.00 53.94 ? 511 GLU B CD  1 
ATOM   6352 O  OE1 . GLU B 1 406 ? -4.506  45.793  53.036 1.00 54.15 ? 511 GLU B OE1 1 
ATOM   6353 O  OE2 . GLU B 1 406 ? -2.750  44.740  52.223 1.00 53.66 ? 511 GLU B OE2 1 
ATOM   6354 N  N   . ARG B 1 407 ? -5.821  41.286  55.332 1.00 53.37 ? 512 ARG B N   1 
ATOM   6355 C  CA  . ARG B 1 407 ? -6.862  40.491  55.991 1.00 53.34 ? 512 ARG B CA  1 
ATOM   6356 C  C   . ARG B 1 407 ? -6.774  39.005  55.621 1.00 53.27 ? 512 ARG B C   1 
ATOM   6357 O  O   . ARG B 1 407 ? -7.485  38.180  56.193 1.00 53.37 ? 512 ARG B O   1 
ATOM   6358 C  CB  . ARG B 1 407 ? -8.254  41.028  55.633 1.00 53.37 ? 512 ARG B CB  1 
ATOM   6359 C  CG  . ARG B 1 407 ? -9.179  41.197  56.832 1.00 53.50 ? 512 ARG B CG  1 
ATOM   6360 C  CD  . ARG B 1 407 ? -8.879  42.499  57.574 1.00 53.48 ? 512 ARG B CD  1 
ATOM   6361 N  NE  . ARG B 1 407 ? -9.571  42.585  58.859 1.00 53.55 ? 512 ARG B NE  1 
ATOM   6362 C  CZ  . ARG B 1 407 ? -9.517  43.634  59.680 1.00 53.69 ? 512 ARG B CZ  1 
ATOM   6363 N  NH1 . ARG B 1 407 ? -8.801  44.709  59.361 1.00 53.96 ? 512 ARG B NH1 1 
ATOM   6364 N  NH2 . ARG B 1 407 ? -10.184 43.611  60.828 1.00 53.50 ? 512 ARG B NH2 1 
ATOM   6365 N  N   . LEU B 1 408 ? -5.894  38.682  54.675 1.00 53.17 ? 513 LEU B N   1 
ATOM   6366 C  CA  . LEU B 1 408 ? -5.769  37.338  54.099 1.00 53.16 ? 513 LEU B CA  1 
ATOM   6367 C  C   . LEU B 1 408 ? -5.527  36.235  55.136 1.00 53.13 ? 513 LEU B C   1 
ATOM   6368 O  O   . LEU B 1 408 ? -4.516  36.251  55.839 1.00 53.04 ? 513 LEU B O   1 
ATOM   6369 C  CB  . LEU B 1 408 ? -4.618  37.338  53.082 1.00 53.22 ? 513 LEU B CB  1 
ATOM   6370 C  CG  . LEU B 1 408 ? -4.411  36.119  52.184 1.00 53.15 ? 513 LEU B CG  1 
ATOM   6371 C  CD1 . LEU B 1 408 ? -5.611  35.919  51.269 1.00 53.23 ? 513 LEU B CD1 1 
ATOM   6372 C  CD2 . LEU B 1 408 ? -3.136  36.297  51.374 1.00 52.99 ? 513 LEU B CD2 1 
ATOM   6373 N  N   . LYS B 1 409 ? -6.454  35.277  55.210 1.00 53.14 ? 514 LYS B N   1 
ATOM   6374 C  CA  . LYS B 1 409 ? -6.337  34.136  56.128 1.00 53.17 ? 514 LYS B CA  1 
ATOM   6375 C  C   . LYS B 1 409 ? -6.221  32.819  55.357 1.00 53.02 ? 514 LYS B C   1 
ATOM   6376 O  O   . LYS B 1 409 ? -6.845  32.653  54.308 1.00 52.91 ? 514 LYS B O   1 
ATOM   6377 C  CB  . LYS B 1 409 ? -7.528  34.089  57.104 1.00 53.20 ? 514 LYS B CB  1 
ATOM   6378 C  CG  . LYS B 1 409 ? -8.894  33.778  56.474 1.00 53.35 ? 514 LYS B CG  1 
ATOM   6379 C  CD  . LYS B 1 409 ? -9.943  33.468  57.542 1.00 53.53 ? 514 LYS B CD  1 
ATOM   6380 C  CE  . LYS B 1 409 ? -11.243 32.930  56.941 1.00 53.78 ? 514 LYS B CE  1 
ATOM   6381 N  NZ  . LYS B 1 409 ? -11.962 33.946  56.116 1.00 53.87 ? 514 LYS B NZ  1 
ATOM   6382 N  N   . LEU B 1 410 ? -5.427  31.892  55.889 1.00 52.92 ? 515 LEU B N   1 
ATOM   6383 C  CA  . LEU B 1 410 ? -5.170  30.600  55.242 1.00 52.97 ? 515 LEU B CA  1 
ATOM   6384 C  C   . LEU B 1 410 ? -5.901  29.456  55.952 1.00 52.96 ? 515 LEU B C   1 
ATOM   6385 O  O   . LEU B 1 410 ? -5.889  29.365  57.182 1.00 52.98 ? 515 LEU B O   1 
ATOM   6386 C  CB  . LEU B 1 410 ? -3.662  30.298  55.219 1.00 52.91 ? 515 LEU B CB  1 
ATOM   6387 C  CG  . LEU B 1 410 ? -2.781  30.871  54.097 1.00 52.88 ? 515 LEU B CG  1 
ATOM   6388 C  CD1 . LEU B 1 410 ? -2.910  30.066  52.814 1.00 52.72 ? 515 LEU B CD1 1 
ATOM   6389 C  CD2 . LEU B 1 410 ? -3.079  32.345  53.837 1.00 53.10 ? 515 LEU B CD2 1 
ATOM   6390 N  N   . GLU B 1 411 ? -6.516  28.576  55.167 1.00 52.99 ? 516 GLU B N   1 
ATOM   6391 C  CA  . GLU B 1 411 ? -7.162  27.373  55.694 1.00 53.04 ? 516 GLU B CA  1 
ATOM   6392 C  C   . GLU B 1 411 ? -6.094  26.330  56.080 1.00 53.00 ? 516 GLU B C   1 
ATOM   6393 O  O   . GLU B 1 411 ? -4.921  26.490  55.732 1.00 53.01 ? 516 GLU B O   1 
ATOM   6394 C  CB  . GLU B 1 411 ? -8.132  26.801  54.649 1.00 53.14 ? 516 GLU B CB  1 
ATOM   6395 C  CG  . GLU B 1 411 ? -9.240  27.767  54.210 1.00 53.38 ? 516 GLU B CG  1 
ATOM   6396 C  CD  . GLU B 1 411 ? -10.199 28.125  55.334 1.00 53.90 ? 516 GLU B CD  1 
ATOM   6397 O  OE1 . GLU B 1 411 ? -10.685 27.204  56.028 1.00 54.05 ? 516 GLU B OE1 1 
ATOM   6398 O  OE2 . GLU B 1 411 ? -10.472 29.332  55.520 1.00 54.19 ? 516 GLU B OE2 1 
ATOM   6399 N  N   . PRO B 1 412 ? -6.487  25.269  56.814 1.00 52.91 ? 517 PRO B N   1 
ATOM   6400 C  CA  . PRO B 1 412 ? -5.535  24.215  57.191 1.00 52.88 ? 517 PRO B CA  1 
ATOM   6401 C  C   . PRO B 1 412 ? -4.830  23.552  56.002 1.00 52.84 ? 517 PRO B C   1 
ATOM   6402 O  O   . PRO B 1 412 ? -5.485  23.132  55.050 1.00 52.87 ? 517 PRO B O   1 
ATOM   6403 C  CB  . PRO B 1 412 ? -6.421  23.191  57.908 1.00 52.88 ? 517 PRO B CB  1 
ATOM   6404 C  CG  . PRO B 1 412 ? -7.556  23.979  58.429 1.00 52.84 ? 517 PRO B CG  1 
ATOM   6405 C  CD  . PRO B 1 412 ? -7.826  24.996  57.366 1.00 52.99 ? 517 PRO B CD  1 
ATOM   6406 N  N   . HIS B 1 413 ? -3.504  23.470  56.069 1.00 52.71 ? 518 HIS B N   1 
ATOM   6407 C  CA  . HIS B 1 413 ? -2.695  22.842  55.022 1.00 52.67 ? 518 HIS B CA  1 
ATOM   6408 C  C   . HIS B 1 413 ? -2.930  23.420  53.605 1.00 52.52 ? 518 HIS B C   1 
ATOM   6409 O  O   . HIS B 1 413 ? -2.823  22.701  52.609 1.00 52.42 ? 518 HIS B O   1 
ATOM   6410 C  CB  . HIS B 1 413 ? -2.893  21.315  55.042 1.00 52.75 ? 518 HIS B CB  1 
ATOM   6411 C  CG  . HIS B 1 413 ? -2.605  20.685  56.371 1.00 52.73 ? 518 HIS B CG  1 
ATOM   6412 N  ND1 . HIS B 1 413 ? -3.534  19.930  57.056 1.00 52.96 ? 518 HIS B ND1 1 
ATOM   6413 C  CD2 . HIS B 1 413 ? -1.492  20.701  57.143 1.00 52.91 ? 518 HIS B CD2 1 
ATOM   6414 C  CE1 . HIS B 1 413 ? -3.003  19.503  58.189 1.00 52.79 ? 518 HIS B CE1 1 
ATOM   6415 N  NE2 . HIS B 1 413 ? -1.766  19.958  58.267 1.00 52.68 ? 518 HIS B NE2 1 
ATOM   6416 N  N   . GLU B 1 414 ? -3.217  24.720  53.522 1.00 52.39 ? 519 GLU B N   1 
ATOM   6417 C  CA  . GLU B 1 414 ? -3.452  25.385  52.232 1.00 52.23 ? 519 GLU B CA  1 
ATOM   6418 C  C   . GLU B 1 414 ? -2.232  26.171  51.747 1.00 51.96 ? 519 GLU B C   1 
ATOM   6419 O  O   . GLU B 1 414 ? -1.542  26.827  52.535 1.00 51.83 ? 519 GLU B O   1 
ATOM   6420 C  CB  . GLU B 1 414 ? -4.655  26.326  52.317 1.00 52.29 ? 519 GLU B CB  1 
ATOM   6421 C  CG  . GLU B 1 414 ? -5.069  26.920  50.968 1.00 52.45 ? 519 GLU B CG  1 
ATOM   6422 C  CD  . GLU B 1 414 ? -6.351  27.729  51.052 1.00 52.60 ? 519 GLU B CD  1 
ATOM   6423 O  OE1 . GLU B 1 414 ? -6.545  28.437  52.062 1.00 52.29 ? 519 GLU B OE1 1 
ATOM   6424 O  OE2 . GLU B 1 414 ? -7.162  27.656  50.102 1.00 53.86 ? 519 GLU B OE2 1 
ATOM   6425 N  N   . GLY B 1 415 ? -1.990  26.108  50.440 1.00 51.60 ? 520 GLY B N   1 
ATOM   6426 C  CA  . GLY B 1 415 ? -0.884  26.814  49.815 1.00 51.42 ? 520 GLY B CA  1 
ATOM   6427 C  C   . GLY B 1 415 ? -1.390  27.744  48.732 1.00 51.25 ? 520 GLY B C   1 
ATOM   6428 O  O   . GLY B 1 415 ? -2.096  27.313  47.825 1.00 51.16 ? 520 GLY B O   1 
ATOM   6429 N  N   . LEU B 1 416 ? -1.026  29.021  48.826 1.00 51.06 ? 521 LEU B N   1 
ATOM   6430 C  CA  . LEU B 1 416 ? -1.447  30.021  47.851 1.00 50.77 ? 521 LEU B CA  1 
ATOM   6431 C  C   . LEU B 1 416 ? -0.276  30.503  47.004 1.00 50.48 ? 521 LEU B C   1 
ATOM   6432 O  O   . LEU B 1 416 ? 0.803   30.781  47.528 1.00 50.25 ? 521 LEU B O   1 
ATOM   6433 C  CB  . LEU B 1 416 ? -2.083  31.213  48.569 1.00 50.78 ? 521 LEU B CB  1 
ATOM   6434 C  CG  . LEU B 1 416 ? -3.344  30.915  49.382 1.00 50.50 ? 521 LEU B CG  1 
ATOM   6435 C  CD1 . LEU B 1 416 ? -3.772  32.150  50.154 1.00 50.41 ? 521 LEU B CD1 1 
ATOM   6436 C  CD2 . LEU B 1 416 ? -4.474  30.425  48.489 1.00 50.25 ? 521 LEU B CD2 1 
ATOM   6437 N  N   . LEU B 1 417 ? -0.508  30.595  45.696 1.00 50.33 ? 522 LEU B N   1 
ATOM   6438 C  CA  . LEU B 1 417 ? 0.440   31.186  44.755 1.00 50.40 ? 522 LEU B CA  1 
ATOM   6439 C  C   . LEU B 1 417 ? -0.155  32.471  44.177 1.00 50.34 ? 522 LEU B C   1 
ATOM   6440 O  O   . LEU B 1 417 ? -1.189  32.429  43.510 1.00 50.39 ? 522 LEU B O   1 
ATOM   6441 C  CB  . LEU B 1 417 ? 0.752   30.200  43.626 1.00 50.35 ? 522 LEU B CB  1 
ATOM   6442 C  CG  . LEU B 1 417 ? 1.690   30.681  42.505 1.00 50.48 ? 522 LEU B CG  1 
ATOM   6443 C  CD1 . LEU B 1 417 ? 3.063   31.065  43.054 1.00 50.55 ? 522 LEU B CD1 1 
ATOM   6444 C  CD2 . LEU B 1 417 ? 1.831   29.621  41.422 1.00 50.26 ? 522 LEU B CD2 1 
ATOM   6445 N  N   . LEU B 1 418 ? 0.501   33.603  44.437 1.00 50.39 ? 523 LEU B N   1 
ATOM   6446 C  CA  . LEU B 1 418 ? 0.039   34.916  43.971 1.00 50.45 ? 523 LEU B CA  1 
ATOM   6447 C  C   . LEU B 1 418 ? 1.087   35.581  43.081 1.00 50.49 ? 523 LEU B C   1 
ATOM   6448 O  O   . LEU B 1 418 ? 2.266   35.248  43.155 1.00 50.43 ? 523 LEU B O   1 
ATOM   6449 C  CB  . LEU B 1 418 ? -0.285  35.824  45.161 1.00 50.36 ? 523 LEU B CB  1 
ATOM   6450 C  CG  . LEU B 1 418 ? -1.515  35.440  45.999 1.00 50.34 ? 523 LEU B CG  1 
ATOM   6451 C  CD1 . LEU B 1 418 ? -1.163  34.450  47.107 1.00 50.40 ? 523 LEU B CD1 1 
ATOM   6452 C  CD2 . LEU B 1 418 ? -2.163  36.673  46.600 1.00 50.35 ? 523 LEU B CD2 1 
ATOM   6453 N  N   . ARG B 1 419 ? 0.650   36.525  42.249 1.00 50.69 ? 524 ARG B N   1 
ATOM   6454 C  CA  . ARG B 1 419 ? 1.543   37.212  41.304 1.00 50.88 ? 524 ARG B CA  1 
ATOM   6455 C  C   . ARG B 1 419 ? 1.283   38.721  41.239 1.00 50.89 ? 524 ARG B C   1 
ATOM   6456 O  O   . ARG B 1 419 ? 0.130   39.155  41.226 1.00 51.08 ? 524 ARG B O   1 
ATOM   6457 C  CB  . ARG B 1 419 ? 1.405   36.594  39.911 1.00 51.04 ? 524 ARG B CB  1 
ATOM   6458 C  CG  . ARG B 1 419 ? -0.015  36.654  39.324 1.00 51.88 ? 524 ARG B CG  1 
ATOM   6459 C  CD  . ARG B 1 419 ? -0.159  37.636  38.153 1.00 52.90 ? 524 ARG B CD  1 
ATOM   6460 N  NE  . ARG B 1 419 ? -0.496  36.940  36.909 1.00 52.96 ? 524 ARG B NE  1 
ATOM   6461 C  CZ  . ARG B 1 419 ? 0.352   36.221  36.178 1.00 53.24 ? 524 ARG B CZ  1 
ATOM   6462 N  NH1 . ARG B 1 419 ? 1.623   36.082  36.539 1.00 53.64 ? 524 ARG B NH1 1 
ATOM   6463 N  NH2 . ARG B 1 419 ? -0.077  35.630  35.069 1.00 53.58 ? 524 ARG B NH2 1 
ATOM   6464 N  N   . PHE B 1 420 ? 2.356   39.514  41.203 1.00 50.82 ? 525 PHE B N   1 
ATOM   6465 C  CA  . PHE B 1 420 ? 2.240   40.974  41.111 1.00 50.79 ? 525 PHE B CA  1 
ATOM   6466 C  C   . PHE B 1 420 ? 3.326   41.593  40.224 1.00 50.77 ? 525 PHE B C   1 
ATOM   6467 O  O   . PHE B 1 420 ? 4.428   41.057  40.125 1.00 50.79 ? 525 PHE B O   1 
ATOM   6468 C  CB  . PHE B 1 420 ? 2.253   41.611  42.505 1.00 50.76 ? 525 PHE B CB  1 
ATOM   6469 C  CG  . PHE B 1 420 ? 3.472   41.283  43.324 1.00 50.75 ? 525 PHE B CG  1 
ATOM   6470 C  CD1 . PHE B 1 420 ? 4.575   42.126  43.322 1.00 50.84 ? 525 PHE B CD1 1 
ATOM   6471 C  CD2 . PHE B 1 420 ? 3.507   40.144  44.118 1.00 50.75 ? 525 PHE B CD2 1 
ATOM   6472 C  CE1 . PHE B 1 420 ? 5.698   41.832  44.087 1.00 50.89 ? 525 PHE B CE1 1 
ATOM   6473 C  CE2 . PHE B 1 420 ? 4.625   39.844  44.886 1.00 50.69 ? 525 PHE B CE2 1 
ATOM   6474 C  CZ  . PHE B 1 420 ? 5.722   40.687  44.870 1.00 50.84 ? 525 PHE B CZ  1 
ATOM   6475 N  N   . PRO B 1 421 ? 3.012   42.724  39.570 1.00 50.83 ? 526 PRO B N   1 
ATOM   6476 C  CA  . PRO B 1 421 ? 3.952   43.352  38.639 1.00 50.83 ? 526 PRO B CA  1 
ATOM   6477 C  C   . PRO B 1 421 ? 5.073   44.144  39.317 1.00 50.83 ? 526 PRO B C   1 
ATOM   6478 O  O   . PRO B 1 421 ? 4.973   44.486  40.496 1.00 50.80 ? 526 PRO B O   1 
ATOM   6479 C  CB  . PRO B 1 421 ? 3.056   44.297  37.835 1.00 50.84 ? 526 PRO B CB  1 
ATOM   6480 C  CG  . PRO B 1 421 ? 1.983   44.685  38.793 1.00 50.85 ? 526 PRO B CG  1 
ATOM   6481 C  CD  . PRO B 1 421 ? 1.745   43.478  39.659 1.00 50.81 ? 526 PRO B CD  1 
ATOM   6482 N  N   . TYR B 1 422 ? 6.125   44.427  38.551 1.00 50.86 ? 527 TYR B N   1 
ATOM   6483 C  CA  . TYR B 1 422 ? 7.245   45.257  38.994 1.00 50.84 ? 527 TYR B CA  1 
ATOM   6484 C  C   . TYR B 1 422 ? 6.772   46.677  39.275 1.00 50.84 ? 527 TYR B C   1 
ATOM   6485 O  O   . TYR B 1 422 ? 6.131   47.298  38.427 1.00 50.72 ? 527 TYR B O   1 
ATOM   6486 C  CB  . TYR B 1 422 ? 8.325   45.295  37.908 1.00 50.83 ? 527 TYR B CB  1 
ATOM   6487 C  CG  . TYR B 1 422 ? 9.541   46.134  38.242 1.00 50.83 ? 527 TYR B CG  1 
ATOM   6488 C  CD1 . TYR B 1 422 ? 10.640  45.567  38.871 1.00 50.95 ? 527 TYR B CD1 1 
ATOM   6489 C  CD2 . TYR B 1 422 ? 9.598   47.489  37.915 1.00 50.88 ? 527 TYR B CD2 1 
ATOM   6490 C  CE1 . TYR B 1 422 ? 11.769  46.320  39.177 1.00 50.93 ? 527 TYR B CE1 1 
ATOM   6491 C  CE2 . TYR B 1 422 ? 10.720  48.258  38.221 1.00 50.75 ? 527 TYR B CE2 1 
ATOM   6492 C  CZ  . TYR B 1 422 ? 11.803  47.664  38.853 1.00 50.99 ? 527 TYR B CZ  1 
ATOM   6493 O  OH  . TYR B 1 422 ? 12.922  48.403  39.163 1.00 50.97 ? 527 TYR B OH  1 
ATOM   6494 N  N   . ALA B 1 423 ? 7.099   47.186  40.460 1.00 50.95 ? 528 ALA B N   1 
ATOM   6495 C  CA  . ALA B 1 423 ? 6.755   48.555  40.841 1.00 51.04 ? 528 ALA B CA  1 
ATOM   6496 C  C   . ALA B 1 423 ? 7.770   49.104  41.840 1.00 51.13 ? 528 ALA B C   1 
ATOM   6497 O  O   . ALA B 1 423 ? 7.882   48.595  42.956 1.00 51.22 ? 528 ALA B O   1 
ATOM   6498 C  CB  . ALA B 1 423 ? 5.360   48.598  41.434 1.00 51.02 ? 528 ALA B CB  1 
ATOM   6499 N  N   . ALA B 1 424 ? 8.507   50.137  41.432 1.00 51.15 ? 529 ALA B N   1 
ATOM   6500 C  CA  . ALA B 1 424 ? 9.496   50.777  42.302 1.00 51.15 ? 529 ALA B CA  1 
ATOM   6501 C  C   . ALA B 1 424 ? 9.639   52.250  41.961 1.00 51.15 ? 529 ALA B C   1 
ATOM   6502 O  O   . ALA B 1 424 ? 9.760   52.616  40.794 1.00 51.11 ? 529 ALA B O   1 
ATOM   6503 C  CB  . ALA B 1 424 ? 10.839  50.080  42.181 1.00 51.21 ? 529 ALA B CB  1 
ATOM   6504 O  OXT . ALA B 1 424 ? 9.638   53.098  42.851 1.00 51.24 ? 529 ALA B OXT 1 
HETATM 6505 ZN ZN  . ZN  C 2 .   ? 18.354  40.491  48.940 1.00 46.03 ? 601 ZN  A ZN  1 
HETATM 6506 O  O   . HOH D 3 .   ? 13.216  93.335  37.663 1.00 35.71 ? 701 HOH A O   1 
HETATM 6507 O  O   . HOH D 3 .   ? 19.576  73.888  45.732 1.00 40.11 ? 702 HOH A O   1 
HETATM 6508 O  O   . HOH D 3 .   ? 30.099  80.420  30.483 1.00 40.25 ? 703 HOH A O   1 
HETATM 6509 O  O   . HOH D 3 .   ? 5.824   85.083  32.724 1.00 35.11 ? 704 HOH A O   1 
HETATM 6510 O  O   . HOH D 3 .   ? 0.316   67.473  34.905 1.00 43.71 ? 705 HOH A O   1 
HETATM 6511 O  O   . HOH D 3 .   ? 23.516  54.915  47.459 1.00 40.98 ? 706 HOH A O   1 
HETATM 6512 O  O   . HOH D 3 .   ? 2.810   74.575  60.187 1.00 34.29 ? 707 HOH A O   1 
HETATM 6513 O  O   . HOH D 3 .   ? 12.622  59.895  51.381 1.00 26.60 ? 708 HOH A O   1 
HETATM 6514 O  O   . HOH D 3 .   ? 20.308  46.204  44.429 1.00 28.73 ? 709 HOH A O   1 
HETATM 6515 O  O   . HOH D 3 .   ? 16.689  68.696  49.921 1.00 32.18 ? 710 HOH A O   1 
HETATM 6516 O  O   . HOH D 3 .   ? 36.964  74.019  53.809 1.00 34.02 ? 711 HOH A O   1 
HETATM 6517 O  O   . HOH D 3 .   ? 0.623   77.770  33.709 1.00 46.13 ? 712 HOH A O   1 
HETATM 6518 O  O   . HOH D 3 .   ? 18.506  77.541  47.876 1.00 29.31 ? 713 HOH A O   1 
HETATM 6519 O  O   . HOH D 3 .   ? 19.046  62.742  57.553 1.00 36.38 ? 714 HOH A O   1 
HETATM 6520 O  O   . HOH D 3 .   ? 3.897   71.322  58.393 1.00 52.88 ? 715 HOH A O   1 
HETATM 6521 O  O   . HOH E 3 .   ? 22.000  1.051   33.420 1.00 28.46 ? 715 HOH B O   1 
HETATM 6522 O  O   . HOH E 3 .   ? 26.843  3.080   19.856 1.00 27.60 ? 716 HOH B O   1 
HETATM 6523 O  O   . HOH E 3 .   ? 19.470  17.058  48.677 1.00 25.48 ? 717 HOH B O   1 
HETATM 6524 O  O   . HOH E 3 .   ? 4.386   -4.836  49.642 1.00 39.32 ? 718 HOH B O   1 
HETATM 6525 O  O   . HOH E 3 .   ? 1.653   -2.569  49.363 1.00 44.80 ? 719 HOH B O   1 
HETATM 6526 O  O   . HOH E 3 .   ? 11.445  24.633  41.248 1.00 28.36 ? 720 HOH B O   1 
HETATM 6527 O  O   . HOH E 3 .   ? 14.656  28.354  39.714 1.00 38.16 ? 721 HOH B O   1 
HETATM 6528 O  O   . HOH E 3 .   ? 14.484  38.523  53.009 1.00 44.83 ? 722 HOH B O   1 
HETATM 6529 O  O   . HOH E 3 .   ? 16.545  37.781  40.583 1.00 37.90 ? 723 HOH B O   1 
HETATM 6530 O  O   . HOH E 3 .   ? 13.262  42.247  33.395 1.00 28.55 ? 724 HOH B O   1 
HETATM 6531 O  O   . HOH E 3 .   ? 18.150  44.953  56.736 1.00 35.42 ? 725 HOH B O   1 
HETATM 6532 O  O   . HOH E 3 .   ? 4.202   45.647  44.697 1.00 55.87 ? 726 HOH B O   1 
HETATM 6533 O  O   . HOH E 3 .   ? 16.925  46.626  35.704 1.00 40.27 ? 727 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   106 ?   ?   ?   A . n 
A 1 2   ARG 2   107 ?   ?   ?   A . n 
A 1 3   TRP 3   108 ?   ?   ?   A . n 
A 1 4   GLY 4   109 ?   ?   ?   A . n 
A 1 5   SER 5   110 ?   ?   ?   A . n 
A 1 6   GLU 6   111 ?   ?   ?   A . n 
A 1 7   LEU 7   112 ?   ?   ?   A . n 
A 1 8   PRO 8   113 ?   ?   ?   A . n 
A 1 9   ALA 9   114 114 ALA ALA A . n 
A 1 10  GLN 10  115 115 GLN GLN A . n 
A 1 11  LYS 11  116 116 LYS LYS A . n 
A 1 12  TRP 12  117 117 TRP TRP A . n 
A 1 13  TRP 13  118 118 TRP TRP A . n 
A 1 14  HIS 14  119 119 HIS HIS A . n 
A 1 15  THR 15  120 120 THR THR A . n 
A 1 16  GLY 16  121 121 GLY GLY A . n 
A 1 17  ALA 17  122 122 ALA ALA A . n 
A 1 18  LEU 18  123 123 LEU LEU A . n 
A 1 19  TYR 19  124 124 TYR TYR A . n 
A 1 20  ARG 20  125 125 ARG ARG A . n 
A 1 21  ILE 21  126 126 ILE ILE A . n 
A 1 22  GLY 22  127 127 GLY GLY A . n 
A 1 23  ASP 23  128 128 ASP ASP A . n 
A 1 24  LEU 24  129 129 LEU LEU A . n 
A 1 25  GLN 25  130 130 GLN GLN A . n 
A 1 26  ALA 26  131 131 ALA ALA A . n 
A 1 27  PHE 27  132 132 PHE PHE A . n 
A 1 28  GLN 28  133 133 GLN GLN A . n 
A 1 29  GLY 29  134 134 GLY GLY A . n 
A 1 30  HIS 30  135 135 HIS HIS A . n 
A 1 31  GLY 31  136 136 GLY GLY A . n 
A 1 32  ALA 32  137 137 ALA ALA A . n 
A 1 33  GLY 33  138 138 GLY GLY A . n 
A 1 34  ASN 34  139 139 ASN ASN A . n 
A 1 35  LEU 35  140 140 LEU LEU A . n 
A 1 36  ALA 36  141 141 ALA ALA A . n 
A 1 37  GLY 37  142 142 GLY GLY A . n 
A 1 38  LEU 38  143 143 LEU LEU A . n 
A 1 39  LYS 39  144 144 LYS LYS A . n 
A 1 40  GLY 40  145 145 GLY GLY A . n 
A 1 41  ARG 41  146 146 ARG ARG A . n 
A 1 42  LEU 42  147 147 LEU LEU A . n 
A 1 43  ASP 43  148 148 ASP ASP A . n 
A 1 44  TYR 44  149 149 TYR TYR A . n 
A 1 45  LEU 45  150 150 LEU LEU A . n 
A 1 46  SER 46  151 151 SER SER A . n 
A 1 47  SER 47  152 152 SER SER A . n 
A 1 48  LEU 48  153 153 LEU LEU A . n 
A 1 49  LYS 49  154 154 LYS LYS A . n 
A 1 50  VAL 50  155 155 VAL VAL A . n 
A 1 51  LYS 51  156 156 LYS LYS A . n 
A 1 52  GLY 52  157 157 GLY GLY A . n 
A 1 53  LEU 53  158 158 LEU LEU A . n 
A 1 54  VAL 54  159 159 VAL VAL A . n 
A 1 55  LEU 55  160 160 LEU LEU A . n 
A 1 56  GLY 56  161 161 GLY GLY A . n 
A 1 57  PRO 57  162 162 PRO PRO A . n 
A 1 58  ILE 58  163 163 ILE ILE A . n 
A 1 59  HIS 59  164 164 HIS HIS A . n 
A 1 60  LYS 60  165 165 LYS LYS A . n 
A 1 61  ASN 61  166 166 ASN ASN A . n 
A 1 62  GLN 62  167 167 GLN GLN A . n 
A 1 63  LYS 63  168 168 LYS LYS A . n 
A 1 64  ASP 64  169 169 ASP ASP A . n 
A 1 65  ASP 65  170 170 ASP ASP A . n 
A 1 66  VAL 66  171 171 VAL VAL A . n 
A 1 67  ALA 67  172 172 ALA ALA A . n 
A 1 68  GLN 68  173 173 GLN GLN A . n 
A 1 69  THR 69  174 174 THR THR A . n 
A 1 70  ASP 70  175 175 ASP ASP A . n 
A 1 71  LEU 71  176 176 LEU LEU A . n 
A 1 72  LEU 72  177 177 LEU LEU A . n 
A 1 73  GLN 73  178 178 GLN GLN A . n 
A 1 74  ILE 74  179 179 ILE ILE A . n 
A 1 75  ASP 75  180 180 ASP ASP A . n 
A 1 76  PRO 76  181 181 PRO PRO A . n 
A 1 77  ASN 77  182 182 ASN ASN A . n 
A 1 78  PHE 78  183 183 PHE PHE A . n 
A 1 79  GLY 79  184 184 GLY GLY A . n 
A 1 80  SER 80  185 185 SER SER A . n 
A 1 81  LYS 81  186 186 LYS LYS A . n 
A 1 82  GLU 82  187 187 GLU GLU A . n 
A 1 83  ASP 83  188 188 ASP ASP A . n 
A 1 84  PHE 84  189 189 PHE PHE A . n 
A 1 85  ASP 85  190 190 ASP ASP A . n 
A 1 86  SER 86  191 191 SER SER A . n 
A 1 87  LEU 87  192 192 LEU LEU A . n 
A 1 88  LEU 88  193 193 LEU LEU A . n 
A 1 89  GLN 89  194 194 GLN GLN A . n 
A 1 90  SER 90  195 195 SER SER A . n 
A 1 91  ALA 91  196 196 ALA ALA A . n 
A 1 92  LYS 92  197 197 LYS LYS A . n 
A 1 93  LYS 93  198 198 LYS LYS A . n 
A 1 94  LYS 94  199 199 LYS LYS A . n 
A 1 95  SER 95  200 200 SER SER A . n 
A 1 96  ILE 96  201 201 ILE ILE A . n 
A 1 97  ARG 97  202 202 ARG ARG A . n 
A 1 98  VAL 98  203 203 VAL VAL A . n 
A 1 99  ILE 99  204 204 ILE ILE A . n 
A 1 100 LEU 100 205 205 LEU LEU A . n 
A 1 101 ASP 101 206 206 ASP ASP A . n 
A 1 102 LEU 102 207 207 LEU LEU A . n 
A 1 103 THR 103 208 208 THR THR A . n 
A 1 104 PRO 104 209 209 PRO PRO A . n 
A 1 105 ASN 105 210 210 ASN ASN A . n 
A 1 106 TYR 106 211 211 TYR TYR A . n 
A 1 107 ARG 107 212 212 ARG ARG A . n 
A 1 108 GLY 108 213 213 GLY GLY A . n 
A 1 109 GLU 109 214 214 GLU GLU A . n 
A 1 110 ASN 110 215 215 ASN ASN A . n 
A 1 111 SER 111 216 216 SER SER A . n 
A 1 112 TRP 112 217 217 TRP TRP A . n 
A 1 113 PHE 113 218 218 PHE PHE A . n 
A 1 114 SER 114 219 219 SER SER A . n 
A 1 115 THR 115 220 220 THR THR A . n 
A 1 116 GLN 116 221 221 GLN GLN A . n 
A 1 117 VAL 117 222 222 VAL VAL A . n 
A 1 118 ASP 118 223 223 ASP ASP A . n 
A 1 119 THR 119 224 224 THR THR A . n 
A 1 120 VAL 120 225 225 VAL VAL A . n 
A 1 121 ALA 121 226 226 ALA ALA A . n 
A 1 122 THR 122 227 227 THR THR A . n 
A 1 123 LYS 123 228 228 LYS LYS A . n 
A 1 124 VAL 124 229 229 VAL VAL A . n 
A 1 125 LYS 125 230 230 LYS LYS A . n 
A 1 126 ASP 126 231 231 ASP ASP A . n 
A 1 127 ALA 127 232 232 ALA ALA A . n 
A 1 128 LEU 128 233 233 LEU LEU A . n 
A 1 129 GLU 129 234 234 GLU GLU A . n 
A 1 130 PHE 130 235 235 PHE PHE A . n 
A 1 131 TRP 131 236 236 TRP TRP A . n 
A 1 132 LEU 132 237 237 LEU LEU A . n 
A 1 133 GLN 133 238 238 GLN GLN A . n 
A 1 134 ALA 134 239 239 ALA ALA A . n 
A 1 135 GLY 135 240 240 GLY GLY A . n 
A 1 136 VAL 136 241 241 VAL VAL A . n 
A 1 137 ASP 137 242 242 ASP ASP A . n 
A 1 138 GLY 138 243 243 GLY GLY A . n 
A 1 139 PHE 139 244 244 PHE PHE A . n 
A 1 140 GLN 140 245 245 GLN GLN A . n 
A 1 141 VAL 141 246 246 VAL VAL A . n 
A 1 142 ARG 142 247 247 ARG ARG A . n 
A 1 143 ASP 143 248 248 ASP ASP A . n 
A 1 144 ILE 144 249 249 ILE ILE A . n 
A 1 145 GLU 145 250 250 GLU GLU A . n 
A 1 146 ASN 146 251 251 ASN ASN A . n 
A 1 147 LEU 147 252 252 LEU LEU A . n 
A 1 148 LYS 148 253 253 LYS LYS A . n 
A 1 149 ASP 149 254 254 ASP ASP A . n 
A 1 150 ALA 150 255 255 ALA ALA A . n 
A 1 151 SER 151 256 256 SER SER A . n 
A 1 152 SER 152 257 257 SER SER A . n 
A 1 153 PHE 153 258 258 PHE PHE A . n 
A 1 154 LEU 154 259 259 LEU LEU A . n 
A 1 155 ALA 155 260 260 ALA ALA A . n 
A 1 156 GLU 156 261 261 GLU GLU A . n 
A 1 157 TRP 157 262 262 TRP TRP A . n 
A 1 158 GLN 158 263 263 GLN GLN A . n 
A 1 159 ASN 159 264 264 ASN ASN A . n 
A 1 160 ILE 160 265 265 ILE ILE A . n 
A 1 161 THR 161 266 266 THR THR A . n 
A 1 162 LYS 162 267 267 LYS LYS A . n 
A 1 163 GLY 163 268 268 GLY GLY A . n 
A 1 164 PHE 164 269 269 PHE PHE A . n 
A 1 165 SER 165 270 270 SER SER A . n 
A 1 166 GLU 166 271 271 GLU GLU A . n 
A 1 167 ASP 167 272 272 ASP ASP A . n 
A 1 168 ARG 168 273 273 ARG ARG A . n 
A 1 169 LEU 169 274 274 LEU LEU A . n 
A 1 170 LEU 170 275 275 LEU LEU A . n 
A 1 171 ILE 171 276 276 ILE ILE A . n 
A 1 172 ALA 172 277 277 ALA ALA A . n 
A 1 173 GLY 173 278 278 GLY GLY A . n 
A 1 174 THR 174 279 279 THR THR A . n 
A 1 175 ASN 175 280 280 ASN ASN A . n 
A 1 176 SER 176 281 281 SER SER A . n 
A 1 177 SER 177 282 282 SER SER A . n 
A 1 178 ASP 178 283 283 ASP ASP A . n 
A 1 179 LEU 179 284 284 LEU LEU A . n 
A 1 180 GLN 180 285 285 GLN GLN A . n 
A 1 181 GLN 181 286 286 GLN GLN A . n 
A 1 182 ILE 182 287 287 ILE ILE A . n 
A 1 183 LEU 183 288 288 LEU LEU A . n 
A 1 184 SER 184 289 289 SER SER A . n 
A 1 185 LEU 185 290 290 LEU LEU A . n 
A 1 186 LEU 186 291 291 LEU LEU A . n 
A 1 187 GLU 187 292 292 GLU GLU A . n 
A 1 188 SER 188 293 293 SER SER A . n 
A 1 189 ASN 189 294 294 ASN ASN A . n 
A 1 190 LYS 190 295 295 LYS LYS A . n 
A 1 191 ASP 191 296 296 ASP ASP A . n 
A 1 192 LEU 192 297 297 LEU LEU A . n 
A 1 193 LEU 193 298 298 LEU LEU A . n 
A 1 194 LEU 194 299 299 LEU LEU A . n 
A 1 195 THR 195 300 300 THR THR A . n 
A 1 196 SER 196 301 301 SER SER A . n 
A 1 197 SER 197 302 302 SER SER A . n 
A 1 198 TYR 198 303 303 TYR TYR A . n 
A 1 199 LEU 199 304 304 LEU LEU A . n 
A 1 200 SER 200 305 305 SER SER A . n 
A 1 201 ASP 201 306 306 ASP ASP A . n 
A 1 202 SER 202 307 307 SER SER A . n 
A 1 203 GLY 203 308 308 GLY GLY A . n 
A 1 204 SER 204 309 309 SER SER A . n 
A 1 205 THR 205 310 310 THR THR A . n 
A 1 206 GLY 206 311 311 GLY GLY A . n 
A 1 207 GLU 207 312 312 GLU GLU A . n 
A 1 208 HIS 208 313 313 HIS HIS A . n 
A 1 209 THR 209 314 314 THR THR A . n 
A 1 210 LYS 210 315 315 LYS LYS A . n 
A 1 211 SER 211 316 316 SER SER A . n 
A 1 212 LEU 212 317 317 LEU LEU A . n 
A 1 213 VAL 213 318 318 VAL VAL A . n 
A 1 214 THR 214 319 319 THR THR A . n 
A 1 215 GLN 215 320 320 GLN GLN A . n 
A 1 216 TYR 216 321 321 TYR TYR A . n 
A 1 217 LEU 217 322 322 LEU LEU A . n 
A 1 218 ASN 218 323 323 ASN ASN A . n 
A 1 219 ALA 219 324 324 ALA ALA A . n 
A 1 220 THR 220 325 325 THR THR A . n 
A 1 221 GLY 221 326 326 GLY GLY A . n 
A 1 222 ASN 222 327 327 ASN ASN A . n 
A 1 223 ARG 223 328 328 ARG ARG A . n 
A 1 224 TRP 224 329 329 TRP TRP A . n 
A 1 225 CYS 225 330 330 CYS CYS A . n 
A 1 226 SER 226 331 331 SER SER A . n 
A 1 227 TRP 227 332 332 TRP TRP A . n 
A 1 228 SER 228 333 333 SER SER A . n 
A 1 229 LEU 229 334 334 LEU LEU A . n 
A 1 230 SER 230 335 335 SER SER A . n 
A 1 231 GLN 231 336 336 GLN GLN A . n 
A 1 232 ALA 232 337 337 ALA ALA A . n 
A 1 233 ARG 233 338 338 ARG ARG A . n 
A 1 234 LEU 234 339 339 LEU LEU A . n 
A 1 235 LEU 235 340 340 LEU LEU A . n 
A 1 236 THR 236 341 341 THR THR A . n 
A 1 237 SER 237 342 342 SER SER A . n 
A 1 238 PHE 238 343 343 PHE PHE A . n 
A 1 239 LEU 239 344 344 LEU LEU A . n 
A 1 240 PRO 240 345 345 PRO PRO A . n 
A 1 241 ALA 241 346 346 ALA ALA A . n 
A 1 242 GLN 242 347 347 GLN GLN A . n 
A 1 243 LEU 243 348 348 LEU LEU A . n 
A 1 244 LEU 244 349 349 LEU LEU A . n 
A 1 245 ARG 245 350 350 ARG ARG A . n 
A 1 246 LEU 246 351 351 LEU LEU A . n 
A 1 247 TYR 247 352 352 TYR TYR A . n 
A 1 248 GLN 248 353 353 GLN GLN A . n 
A 1 249 LEU 249 354 354 LEU LEU A . n 
A 1 250 MET 250 355 355 MET MET A . n 
A 1 251 LEU 251 356 356 LEU LEU A . n 
A 1 252 PHE 252 357 357 PHE PHE A . n 
A 1 253 THR 253 358 358 THR THR A . n 
A 1 254 LEU 254 359 359 LEU LEU A . n 
A 1 255 PRO 255 360 360 PRO PRO A . n 
A 1 256 GLY 256 361 361 GLY GLY A . n 
A 1 257 THR 257 362 362 THR THR A . n 
A 1 258 PRO 258 363 363 PRO PRO A . n 
A 1 259 VAL 259 364 364 VAL VAL A . n 
A 1 260 PHE 260 365 365 PHE PHE A . n 
A 1 261 SER 261 366 366 SER SER A . n 
A 1 262 TYR 262 367 367 TYR TYR A . n 
A 1 263 GLY 263 368 368 GLY GLY A . n 
A 1 264 ASP 264 369 369 ASP ASP A . n 
A 1 265 GLU 265 370 370 GLU GLU A . n 
A 1 266 ILE 266 371 371 ILE ILE A . n 
A 1 267 GLY 267 372 372 GLY GLY A . n 
A 1 268 LEU 268 373 373 LEU LEU A . n 
A 1 269 ASP 269 374 374 ASP ASP A . n 
A 1 270 ALA 270 375 375 ALA ALA A . n 
A 1 271 ALA 271 376 376 ALA ALA A . n 
A 1 272 ALA 272 377 377 ALA ALA A . n 
A 1 273 LEU 273 378 378 LEU LEU A . n 
A 1 274 PRO 274 379 379 PRO PRO A . n 
A 1 275 GLY 275 380 380 GLY GLY A . n 
A 1 276 GLN 276 381 381 GLN GLN A . n 
A 1 277 PRO 277 382 382 PRO PRO A . n 
A 1 278 MET 278 383 383 MET MET A . n 
A 1 279 GLU 279 384 384 GLU GLU A . n 
A 1 280 ALA 280 385 385 ALA ALA A . n 
A 1 281 PRO 281 386 386 PRO PRO A . n 
A 1 282 VAL 282 387 387 VAL VAL A . n 
A 1 283 MET 283 388 388 MET MET A . n 
A 1 284 LEU 284 389 389 LEU LEU A . n 
A 1 285 TRP 285 390 390 TRP TRP A . n 
A 1 286 ASP 286 391 391 ASP ASP A . n 
A 1 287 GLU 287 392 392 GLU GLU A . n 
A 1 288 SER 288 393 393 SER SER A . n 
A 1 289 SER 289 394 394 SER SER A . n 
A 1 290 PHE 290 395 395 PHE PHE A . n 
A 1 291 PRO 291 396 396 PRO PRO A . n 
A 1 292 ASP 292 397 397 ASP ASP A . n 
A 1 293 ILE 293 398 398 ILE ILE A . n 
A 1 294 PRO 294 399 399 PRO PRO A . n 
A 1 295 GLY 295 400 400 GLY GLY A . n 
A 1 296 ALA 296 401 401 ALA ALA A . n 
A 1 297 VAL 297 402 402 VAL VAL A . n 
A 1 298 SER 298 403 403 SER SER A . n 
A 1 299 ALA 299 404 404 ALA ALA A . n 
A 1 300 ASN 300 405 405 ASN ASN A . n 
A 1 301 MET 301 406 406 MET MET A . n 
A 1 302 THR 302 407 407 THR THR A . n 
A 1 303 VAL 303 408 408 VAL VAL A . n 
A 1 304 LYS 304 409 409 LYS LYS A . n 
A 1 305 GLY 305 410 410 GLY GLY A . n 
A 1 306 GLN 306 411 411 GLN GLN A . n 
A 1 307 SER 307 412 412 SER SER A . n 
A 1 308 GLU 308 413 413 GLU GLU A . n 
A 1 309 ASP 309 414 414 ASP ASP A . n 
A 1 310 PRO 310 415 415 PRO PRO A . n 
A 1 311 GLY 311 416 416 GLY GLY A . n 
A 1 312 SER 312 417 417 SER SER A . n 
A 1 313 LEU 313 418 418 LEU LEU A . n 
A 1 314 LEU 314 419 419 LEU LEU A . n 
A 1 315 SER 315 420 420 SER SER A . n 
A 1 316 LEU 316 421 421 LEU LEU A . n 
A 1 317 PHE 317 422 422 PHE PHE A . n 
A 1 318 ARG 318 423 423 ARG ARG A . n 
A 1 319 ARG 319 424 424 ARG ARG A . n 
A 1 320 LEU 320 425 425 LEU LEU A . n 
A 1 321 SER 321 426 426 SER SER A . n 
A 1 322 ASP 322 427 427 ASP ASP A . n 
A 1 323 GLN 323 428 428 GLN GLN A . n 
A 1 324 ARG 324 429 429 ARG ARG A . n 
A 1 325 SER 325 430 430 SER SER A . n 
A 1 326 LYS 326 431 431 LYS LYS A . n 
A 1 327 GLU 327 432 432 GLU GLU A . n 
A 1 328 ARG 328 433 433 ARG ARG A . n 
A 1 329 SER 329 434 434 SER SER A . n 
A 1 330 LEU 330 435 435 LEU LEU A . n 
A 1 331 LEU 331 436 436 LEU LEU A . n 
A 1 332 HIS 332 437 437 HIS HIS A . n 
A 1 333 GLY 333 438 438 GLY GLY A . n 
A 1 334 ASP 334 439 439 ASP ASP A . n 
A 1 335 PHE 335 440 440 PHE PHE A . n 
A 1 336 HIS 336 441 441 HIS HIS A . n 
A 1 337 ALA 337 442 442 ALA ALA A . n 
A 1 338 PHE 338 443 443 PHE PHE A . n 
A 1 339 SER 339 444 444 SER SER A . n 
A 1 340 ALA 340 445 445 ALA ALA A . n 
A 1 341 GLY 341 446 446 GLY GLY A . n 
A 1 342 PRO 342 447 447 PRO PRO A . n 
A 1 343 GLY 343 448 448 GLY GLY A . n 
A 1 344 LEU 344 449 449 LEU LEU A . n 
A 1 345 PHE 345 450 450 PHE PHE A . n 
A 1 346 SER 346 451 451 SER SER A . n 
A 1 347 TYR 347 452 452 TYR TYR A . n 
A 1 348 ILE 348 453 453 ILE ILE A . n 
A 1 349 ARG 349 454 454 ARG ARG A . n 
A 1 350 HIS 350 455 455 HIS HIS A . n 
A 1 351 TRP 351 456 456 TRP TRP A . n 
A 1 352 ASP 352 457 457 ASP ASP A . n 
A 1 353 GLN 353 458 458 GLN GLN A . n 
A 1 354 ASN 354 459 459 ASN ASN A . n 
A 1 355 GLU 355 460 460 GLU GLU A . n 
A 1 356 ARG 356 461 461 ARG ARG A . n 
A 1 357 PHE 357 462 462 PHE PHE A . n 
A 1 358 LEU 358 463 463 LEU LEU A . n 
A 1 359 VAL 359 464 464 VAL VAL A . n 
A 1 360 VAL 360 465 465 VAL VAL A . n 
A 1 361 LEU 361 466 466 LEU LEU A . n 
A 1 362 ASN 362 467 467 ASN ASN A . n 
A 1 363 PHE 363 468 468 PHE PHE A . n 
A 1 364 GLY 364 469 469 GLY GLY A . n 
A 1 365 ASP 365 470 470 ASP ASP A . n 
A 1 366 VAL 366 471 471 VAL VAL A . n 
A 1 367 GLY 367 472 472 GLY GLY A . n 
A 1 368 LEU 368 473 473 LEU LEU A . n 
A 1 369 SER 369 474 474 SER SER A . n 
A 1 370 ALA 370 475 475 ALA ALA A . n 
A 1 371 GLY 371 476 476 GLY GLY A . n 
A 1 372 LEU 372 477 477 LEU LEU A . n 
A 1 373 GLN 373 478 478 GLN GLN A . n 
A 1 374 ALA 374 479 479 ALA ALA A . n 
A 1 375 SER 375 480 480 SER SER A . n 
A 1 376 ASP 376 481 481 ASP ASP A . n 
A 1 377 LEU 377 482 482 LEU LEU A . n 
A 1 378 PRO 378 483 483 PRO PRO A . n 
A 1 379 ALA 379 484 484 ALA ALA A . n 
A 1 380 SER 380 485 485 SER SER A . n 
A 1 381 ALA 381 486 486 ALA ALA A . n 
A 1 382 SER 382 487 487 SER SER A . n 
A 1 383 LEU 383 488 488 LEU LEU A . n 
A 1 384 PRO 384 489 489 PRO PRO A . n 
A 1 385 ALA 385 490 490 ALA ALA A . n 
A 1 386 LYS 386 491 491 LYS LYS A . n 
A 1 387 ALA 387 492 492 ALA ALA A . n 
A 1 388 ASP 388 493 493 ASP ASP A . n 
A 1 389 LEU 389 494 494 LEU LEU A . n 
A 1 390 LEU 390 495 495 LEU LEU A . n 
A 1 391 LEU 391 496 496 LEU LEU A . n 
A 1 392 SER 392 497 497 SER SER A . n 
A 1 393 THR 393 498 498 THR THR A . n 
A 1 394 GLN 394 499 499 GLN GLN A . n 
A 1 395 PRO 395 500 500 PRO PRO A . n 
A 1 396 GLY 396 501 501 GLY GLY A . n 
A 1 397 ARG 397 502 502 ARG ARG A . n 
A 1 398 GLU 398 503 503 GLU GLU A . n 
A 1 399 GLU 399 504 504 GLU GLU A . n 
A 1 400 GLY 400 505 505 GLY GLY A . n 
A 1 401 SER 401 506 506 SER SER A . n 
A 1 402 PRO 402 507 507 PRO PRO A . n 
A 1 403 LEU 403 508 508 LEU LEU A . n 
A 1 404 GLU 404 509 509 GLU GLU A . n 
A 1 405 LEU 405 510 510 LEU LEU A . n 
A 1 406 GLU 406 511 511 GLU GLU A . n 
A 1 407 ARG 407 512 512 ARG ARG A . n 
A 1 408 LEU 408 513 513 LEU LEU A . n 
A 1 409 LYS 409 514 514 LYS LYS A . n 
A 1 410 LEU 410 515 515 LEU LEU A . n 
A 1 411 GLU 411 516 516 GLU GLU A . n 
A 1 412 PRO 412 517 517 PRO PRO A . n 
A 1 413 HIS 413 518 518 HIS HIS A . n 
A 1 414 GLU 414 519 519 GLU GLU A . n 
A 1 415 GLY 415 520 520 GLY GLY A . n 
A 1 416 LEU 416 521 521 LEU LEU A . n 
A 1 417 LEU 417 522 522 LEU LEU A . n 
A 1 418 LEU 418 523 523 LEU LEU A . n 
A 1 419 ARG 419 524 524 ARG ARG A . n 
A 1 420 PHE 420 525 525 PHE PHE A . n 
A 1 421 PRO 421 526 526 PRO PRO A . n 
A 1 422 TYR 422 527 527 TYR TYR A . n 
A 1 423 ALA 423 528 528 ALA ALA A . n 
A 1 424 ALA 424 529 529 ALA ALA A . n 
B 1 1   ASP 1   106 ?   ?   ?   B . n 
B 1 2   ARG 2   107 ?   ?   ?   B . n 
B 1 3   TRP 3   108 ?   ?   ?   B . n 
B 1 4   GLY 4   109 109 GLY GLY B . n 
B 1 5   SER 5   110 110 SER SER B . n 
B 1 6   GLU 6   111 111 GLU GLU B . n 
B 1 7   LEU 7   112 112 LEU LEU B . n 
B 1 8   PRO 8   113 113 PRO PRO B . n 
B 1 9   ALA 9   114 114 ALA ALA B . n 
B 1 10  GLN 10  115 115 GLN GLN B . n 
B 1 11  LYS 11  116 116 LYS LYS B . n 
B 1 12  TRP 12  117 117 TRP TRP B . n 
B 1 13  TRP 13  118 118 TRP TRP B . n 
B 1 14  HIS 14  119 119 HIS HIS B . n 
B 1 15  THR 15  120 120 THR THR B . n 
B 1 16  GLY 16  121 121 GLY GLY B . n 
B 1 17  ALA 17  122 122 ALA ALA B . n 
B 1 18  LEU 18  123 123 LEU LEU B . n 
B 1 19  TYR 19  124 124 TYR TYR B . n 
B 1 20  ARG 20  125 125 ARG ARG B . n 
B 1 21  ILE 21  126 126 ILE ILE B . n 
B 1 22  GLY 22  127 127 GLY GLY B . n 
B 1 23  ASP 23  128 128 ASP ASP B . n 
B 1 24  LEU 24  129 129 LEU LEU B . n 
B 1 25  GLN 25  130 130 GLN GLN B . n 
B 1 26  ALA 26  131 131 ALA ALA B . n 
B 1 27  PHE 27  132 132 PHE PHE B . n 
B 1 28  GLN 28  133 133 GLN GLN B . n 
B 1 29  GLY 29  134 134 GLY GLY B . n 
B 1 30  HIS 30  135 135 HIS HIS B . n 
B 1 31  GLY 31  136 136 GLY GLY B . n 
B 1 32  ALA 32  137 137 ALA ALA B . n 
B 1 33  GLY 33  138 138 GLY GLY B . n 
B 1 34  ASN 34  139 139 ASN ASN B . n 
B 1 35  LEU 35  140 140 LEU LEU B . n 
B 1 36  ALA 36  141 141 ALA ALA B . n 
B 1 37  GLY 37  142 142 GLY GLY B . n 
B 1 38  LEU 38  143 143 LEU LEU B . n 
B 1 39  LYS 39  144 144 LYS LYS B . n 
B 1 40  GLY 40  145 145 GLY GLY B . n 
B 1 41  ARG 41  146 146 ARG ARG B . n 
B 1 42  LEU 42  147 147 LEU LEU B . n 
B 1 43  ASP 43  148 148 ASP ASP B . n 
B 1 44  TYR 44  149 149 TYR TYR B . n 
B 1 45  LEU 45  150 150 LEU LEU B . n 
B 1 46  SER 46  151 151 SER SER B . n 
B 1 47  SER 47  152 152 SER SER B . n 
B 1 48  LEU 48  153 153 LEU LEU B . n 
B 1 49  LYS 49  154 154 LYS LYS B . n 
B 1 50  VAL 50  155 155 VAL VAL B . n 
B 1 51  LYS 51  156 156 LYS LYS B . n 
B 1 52  GLY 52  157 157 GLY GLY B . n 
B 1 53  LEU 53  158 158 LEU LEU B . n 
B 1 54  VAL 54  159 159 VAL VAL B . n 
B 1 55  LEU 55  160 160 LEU LEU B . n 
B 1 56  GLY 56  161 161 GLY GLY B . n 
B 1 57  PRO 57  162 162 PRO PRO B . n 
B 1 58  ILE 58  163 163 ILE ILE B . n 
B 1 59  HIS 59  164 164 HIS HIS B . n 
B 1 60  LYS 60  165 165 LYS LYS B . n 
B 1 61  ASN 61  166 166 ASN ASN B . n 
B 1 62  GLN 62  167 167 GLN GLN B . n 
B 1 63  LYS 63  168 168 LYS LYS B . n 
B 1 64  ASP 64  169 169 ASP ASP B . n 
B 1 65  ASP 65  170 170 ASP ASP B . n 
B 1 66  VAL 66  171 171 VAL VAL B . n 
B 1 67  ALA 67  172 172 ALA ALA B . n 
B 1 68  GLN 68  173 173 GLN GLN B . n 
B 1 69  THR 69  174 174 THR THR B . n 
B 1 70  ASP 70  175 175 ASP ASP B . n 
B 1 71  LEU 71  176 176 LEU LEU B . n 
B 1 72  LEU 72  177 177 LEU LEU B . n 
B 1 73  GLN 73  178 178 GLN GLN B . n 
B 1 74  ILE 74  179 179 ILE ILE B . n 
B 1 75  ASP 75  180 180 ASP ASP B . n 
B 1 76  PRO 76  181 181 PRO PRO B . n 
B 1 77  ASN 77  182 182 ASN ASN B . n 
B 1 78  PHE 78  183 183 PHE PHE B . n 
B 1 79  GLY 79  184 184 GLY GLY B . n 
B 1 80  SER 80  185 185 SER SER B . n 
B 1 81  LYS 81  186 186 LYS LYS B . n 
B 1 82  GLU 82  187 187 GLU GLU B . n 
B 1 83  ASP 83  188 188 ASP ASP B . n 
B 1 84  PHE 84  189 189 PHE PHE B . n 
B 1 85  ASP 85  190 190 ASP ASP B . n 
B 1 86  SER 86  191 191 SER SER B . n 
B 1 87  LEU 87  192 192 LEU LEU B . n 
B 1 88  LEU 88  193 193 LEU LEU B . n 
B 1 89  GLN 89  194 194 GLN GLN B . n 
B 1 90  SER 90  195 195 SER SER B . n 
B 1 91  ALA 91  196 196 ALA ALA B . n 
B 1 92  LYS 92  197 197 LYS LYS B . n 
B 1 93  LYS 93  198 198 LYS LYS B . n 
B 1 94  LYS 94  199 199 LYS LYS B . n 
B 1 95  SER 95  200 200 SER SER B . n 
B 1 96  ILE 96  201 201 ILE ILE B . n 
B 1 97  ARG 97  202 202 ARG ARG B . n 
B 1 98  VAL 98  203 203 VAL VAL B . n 
B 1 99  ILE 99  204 204 ILE ILE B . n 
B 1 100 LEU 100 205 205 LEU LEU B . n 
B 1 101 ASP 101 206 206 ASP ASP B . n 
B 1 102 LEU 102 207 207 LEU LEU B . n 
B 1 103 THR 103 208 208 THR THR B . n 
B 1 104 PRO 104 209 209 PRO PRO B . n 
B 1 105 ASN 105 210 210 ASN ASN B . n 
B 1 106 TYR 106 211 211 TYR TYR B . n 
B 1 107 ARG 107 212 212 ARG ARG B . n 
B 1 108 GLY 108 213 213 GLY GLY B . n 
B 1 109 GLU 109 214 214 GLU GLU B . n 
B 1 110 ASN 110 215 215 ASN ASN B . n 
B 1 111 SER 111 216 216 SER SER B . n 
B 1 112 TRP 112 217 217 TRP TRP B . n 
B 1 113 PHE 113 218 218 PHE PHE B . n 
B 1 114 SER 114 219 219 SER SER B . n 
B 1 115 THR 115 220 220 THR THR B . n 
B 1 116 GLN 116 221 221 GLN GLN B . n 
B 1 117 VAL 117 222 222 VAL VAL B . n 
B 1 118 ASP 118 223 223 ASP ASP B . n 
B 1 119 THR 119 224 224 THR THR B . n 
B 1 120 VAL 120 225 225 VAL VAL B . n 
B 1 121 ALA 121 226 226 ALA ALA B . n 
B 1 122 THR 122 227 227 THR THR B . n 
B 1 123 LYS 123 228 228 LYS LYS B . n 
B 1 124 VAL 124 229 229 VAL VAL B . n 
B 1 125 LYS 125 230 230 LYS LYS B . n 
B 1 126 ASP 126 231 231 ASP ASP B . n 
B 1 127 ALA 127 232 232 ALA ALA B . n 
B 1 128 LEU 128 233 233 LEU LEU B . n 
B 1 129 GLU 129 234 234 GLU GLU B . n 
B 1 130 PHE 130 235 235 PHE PHE B . n 
B 1 131 TRP 131 236 236 TRP TRP B . n 
B 1 132 LEU 132 237 237 LEU LEU B . n 
B 1 133 GLN 133 238 238 GLN GLN B . n 
B 1 134 ALA 134 239 239 ALA ALA B . n 
B 1 135 GLY 135 240 240 GLY GLY B . n 
B 1 136 VAL 136 241 241 VAL VAL B . n 
B 1 137 ASP 137 242 242 ASP ASP B . n 
B 1 138 GLY 138 243 243 GLY GLY B . n 
B 1 139 PHE 139 244 244 PHE PHE B . n 
B 1 140 GLN 140 245 245 GLN GLN B . n 
B 1 141 VAL 141 246 246 VAL VAL B . n 
B 1 142 ARG 142 247 247 ARG ARG B . n 
B 1 143 ASP 143 248 248 ASP ASP B . n 
B 1 144 ILE 144 249 249 ILE ILE B . n 
B 1 145 GLU 145 250 250 GLU GLU B . n 
B 1 146 ASN 146 251 251 ASN ASN B . n 
B 1 147 LEU 147 252 252 LEU LEU B . n 
B 1 148 LYS 148 253 253 LYS LYS B . n 
B 1 149 ASP 149 254 254 ASP ASP B . n 
B 1 150 ALA 150 255 255 ALA ALA B . n 
B 1 151 SER 151 256 256 SER SER B . n 
B 1 152 SER 152 257 257 SER SER B . n 
B 1 153 PHE 153 258 258 PHE PHE B . n 
B 1 154 LEU 154 259 259 LEU LEU B . n 
B 1 155 ALA 155 260 260 ALA ALA B . n 
B 1 156 GLU 156 261 261 GLU GLU B . n 
B 1 157 TRP 157 262 262 TRP TRP B . n 
B 1 158 GLN 158 263 263 GLN GLN B . n 
B 1 159 ASN 159 264 264 ASN ASN B . n 
B 1 160 ILE 160 265 265 ILE ILE B . n 
B 1 161 THR 161 266 266 THR THR B . n 
B 1 162 LYS 162 267 267 LYS LYS B . n 
B 1 163 GLY 163 268 268 GLY GLY B . n 
B 1 164 PHE 164 269 269 PHE PHE B . n 
B 1 165 SER 165 270 270 SER SER B . n 
B 1 166 GLU 166 271 271 GLU GLU B . n 
B 1 167 ASP 167 272 272 ASP ASP B . n 
B 1 168 ARG 168 273 273 ARG ARG B . n 
B 1 169 LEU 169 274 274 LEU LEU B . n 
B 1 170 LEU 170 275 275 LEU LEU B . n 
B 1 171 ILE 171 276 276 ILE ILE B . n 
B 1 172 ALA 172 277 277 ALA ALA B . n 
B 1 173 GLY 173 278 278 GLY GLY B . n 
B 1 174 THR 174 279 279 THR THR B . n 
B 1 175 ASN 175 280 280 ASN ASN B . n 
B 1 176 SER 176 281 281 SER SER B . n 
B 1 177 SER 177 282 282 SER SER B . n 
B 1 178 ASP 178 283 283 ASP ASP B . n 
B 1 179 LEU 179 284 284 LEU LEU B . n 
B 1 180 GLN 180 285 285 GLN GLN B . n 
B 1 181 GLN 181 286 286 GLN GLN B . n 
B 1 182 ILE 182 287 287 ILE ILE B . n 
B 1 183 LEU 183 288 288 LEU LEU B . n 
B 1 184 SER 184 289 289 SER SER B . n 
B 1 185 LEU 185 290 290 LEU LEU B . n 
B 1 186 LEU 186 291 291 LEU LEU B . n 
B 1 187 GLU 187 292 292 GLU GLU B . n 
B 1 188 SER 188 293 293 SER SER B . n 
B 1 189 ASN 189 294 294 ASN ASN B . n 
B 1 190 LYS 190 295 295 LYS LYS B . n 
B 1 191 ASP 191 296 296 ASP ASP B . n 
B 1 192 LEU 192 297 297 LEU LEU B . n 
B 1 193 LEU 193 298 298 LEU LEU B . n 
B 1 194 LEU 194 299 299 LEU LEU B . n 
B 1 195 THR 195 300 300 THR THR B . n 
B 1 196 SER 196 301 301 SER SER B . n 
B 1 197 SER 197 302 302 SER SER B . n 
B 1 198 TYR 198 303 303 TYR TYR B . n 
B 1 199 LEU 199 304 304 LEU LEU B . n 
B 1 200 SER 200 305 305 SER SER B . n 
B 1 201 ASP 201 306 306 ASP ASP B . n 
B 1 202 SER 202 307 307 SER SER B . n 
B 1 203 GLY 203 308 308 GLY GLY B . n 
B 1 204 SER 204 309 309 SER SER B . n 
B 1 205 THR 205 310 310 THR THR B . n 
B 1 206 GLY 206 311 311 GLY GLY B . n 
B 1 207 GLU 207 312 312 GLU GLU B . n 
B 1 208 HIS 208 313 313 HIS HIS B . n 
B 1 209 THR 209 314 314 THR THR B . n 
B 1 210 LYS 210 315 315 LYS LYS B . n 
B 1 211 SER 211 316 316 SER SER B . n 
B 1 212 LEU 212 317 317 LEU LEU B . n 
B 1 213 VAL 213 318 318 VAL VAL B . n 
B 1 214 THR 214 319 319 THR THR B . n 
B 1 215 GLN 215 320 320 GLN GLN B . n 
B 1 216 TYR 216 321 321 TYR TYR B . n 
B 1 217 LEU 217 322 322 LEU LEU B . n 
B 1 218 ASN 218 323 323 ASN ASN B . n 
B 1 219 ALA 219 324 324 ALA ALA B . n 
B 1 220 THR 220 325 325 THR THR B . n 
B 1 221 GLY 221 326 326 GLY GLY B . n 
B 1 222 ASN 222 327 327 ASN ASN B . n 
B 1 223 ARG 223 328 328 ARG ARG B . n 
B 1 224 TRP 224 329 329 TRP TRP B . n 
B 1 225 CYS 225 330 330 CYS CYS B . n 
B 1 226 SER 226 331 331 SER SER B . n 
B 1 227 TRP 227 332 332 TRP TRP B . n 
B 1 228 SER 228 333 333 SER SER B . n 
B 1 229 LEU 229 334 334 LEU LEU B . n 
B 1 230 SER 230 335 335 SER SER B . n 
B 1 231 GLN 231 336 336 GLN GLN B . n 
B 1 232 ALA 232 337 337 ALA ALA B . n 
B 1 233 ARG 233 338 338 ARG ARG B . n 
B 1 234 LEU 234 339 339 LEU LEU B . n 
B 1 235 LEU 235 340 340 LEU LEU B . n 
B 1 236 THR 236 341 341 THR THR B . n 
B 1 237 SER 237 342 342 SER SER B . n 
B 1 238 PHE 238 343 343 PHE PHE B . n 
B 1 239 LEU 239 344 344 LEU LEU B . n 
B 1 240 PRO 240 345 345 PRO PRO B . n 
B 1 241 ALA 241 346 346 ALA ALA B . n 
B 1 242 GLN 242 347 347 GLN GLN B . n 
B 1 243 LEU 243 348 348 LEU LEU B . n 
B 1 244 LEU 244 349 349 LEU LEU B . n 
B 1 245 ARG 245 350 350 ARG ARG B . n 
B 1 246 LEU 246 351 351 LEU LEU B . n 
B 1 247 TYR 247 352 352 TYR TYR B . n 
B 1 248 GLN 248 353 353 GLN GLN B . n 
B 1 249 LEU 249 354 354 LEU LEU B . n 
B 1 250 MET 250 355 355 MET MET B . n 
B 1 251 LEU 251 356 356 LEU LEU B . n 
B 1 252 PHE 252 357 357 PHE PHE B . n 
B 1 253 THR 253 358 358 THR THR B . n 
B 1 254 LEU 254 359 359 LEU LEU B . n 
B 1 255 PRO 255 360 360 PRO PRO B . n 
B 1 256 GLY 256 361 361 GLY GLY B . n 
B 1 257 THR 257 362 362 THR THR B . n 
B 1 258 PRO 258 363 363 PRO PRO B . n 
B 1 259 VAL 259 364 364 VAL VAL B . n 
B 1 260 PHE 260 365 365 PHE PHE B . n 
B 1 261 SER 261 366 366 SER SER B . n 
B 1 262 TYR 262 367 367 TYR TYR B . n 
B 1 263 GLY 263 368 368 GLY GLY B . n 
B 1 264 ASP 264 369 369 ASP ASP B . n 
B 1 265 GLU 265 370 370 GLU GLU B . n 
B 1 266 ILE 266 371 371 ILE ILE B . n 
B 1 267 GLY 267 372 372 GLY GLY B . n 
B 1 268 LEU 268 373 373 LEU LEU B . n 
B 1 269 ASP 269 374 374 ASP ASP B . n 
B 1 270 ALA 270 375 375 ALA ALA B . n 
B 1 271 ALA 271 376 376 ALA ALA B . n 
B 1 272 ALA 272 377 377 ALA ALA B . n 
B 1 273 LEU 273 378 378 LEU LEU B . n 
B 1 274 PRO 274 379 379 PRO PRO B . n 
B 1 275 GLY 275 380 380 GLY GLY B . n 
B 1 276 GLN 276 381 381 GLN GLN B . n 
B 1 277 PRO 277 382 382 PRO PRO B . n 
B 1 278 MET 278 383 383 MET MET B . n 
B 1 279 GLU 279 384 384 GLU GLU B . n 
B 1 280 ALA 280 385 385 ALA ALA B . n 
B 1 281 PRO 281 386 386 PRO PRO B . n 
B 1 282 VAL 282 387 387 VAL VAL B . n 
B 1 283 MET 283 388 388 MET MET B . n 
B 1 284 LEU 284 389 389 LEU LEU B . n 
B 1 285 TRP 285 390 390 TRP TRP B . n 
B 1 286 ASP 286 391 391 ASP ASP B . n 
B 1 287 GLU 287 392 392 GLU GLU B . n 
B 1 288 SER 288 393 393 SER SER B . n 
B 1 289 SER 289 394 394 SER SER B . n 
B 1 290 PHE 290 395 395 PHE PHE B . n 
B 1 291 PRO 291 396 396 PRO PRO B . n 
B 1 292 ASP 292 397 397 ASP ASP B . n 
B 1 293 ILE 293 398 398 ILE ILE B . n 
B 1 294 PRO 294 399 399 PRO PRO B . n 
B 1 295 GLY 295 400 400 GLY GLY B . n 
B 1 296 ALA 296 401 401 ALA ALA B . n 
B 1 297 VAL 297 402 402 VAL VAL B . n 
B 1 298 SER 298 403 403 SER SER B . n 
B 1 299 ALA 299 404 404 ALA ALA B . n 
B 1 300 ASN 300 405 405 ASN ASN B . n 
B 1 301 MET 301 406 406 MET MET B . n 
B 1 302 THR 302 407 407 THR THR B . n 
B 1 303 VAL 303 408 408 VAL VAL B . n 
B 1 304 LYS 304 409 409 LYS LYS B . n 
B 1 305 GLY 305 410 410 GLY GLY B . n 
B 1 306 GLN 306 411 411 GLN GLN B . n 
B 1 307 SER 307 412 412 SER SER B . n 
B 1 308 GLU 308 413 413 GLU GLU B . n 
B 1 309 ASP 309 414 414 ASP ASP B . n 
B 1 310 PRO 310 415 415 PRO PRO B . n 
B 1 311 GLY 311 416 416 GLY GLY B . n 
B 1 312 SER 312 417 417 SER SER B . n 
B 1 313 LEU 313 418 418 LEU LEU B . n 
B 1 314 LEU 314 419 419 LEU LEU B . n 
B 1 315 SER 315 420 420 SER SER B . n 
B 1 316 LEU 316 421 421 LEU LEU B . n 
B 1 317 PHE 317 422 422 PHE PHE B . n 
B 1 318 ARG 318 423 423 ARG ARG B . n 
B 1 319 ARG 319 424 424 ARG ARG B . n 
B 1 320 LEU 320 425 425 LEU LEU B . n 
B 1 321 SER 321 426 426 SER SER B . n 
B 1 322 ASP 322 427 427 ASP ASP B . n 
B 1 323 GLN 323 428 428 GLN GLN B . n 
B 1 324 ARG 324 429 429 ARG ARG B . n 
B 1 325 SER 325 430 430 SER SER B . n 
B 1 326 LYS 326 431 431 LYS LYS B . n 
B 1 327 GLU 327 432 432 GLU GLU B . n 
B 1 328 ARG 328 433 433 ARG ARG B . n 
B 1 329 SER 329 434 434 SER SER B . n 
B 1 330 LEU 330 435 435 LEU LEU B . n 
B 1 331 LEU 331 436 436 LEU LEU B . n 
B 1 332 HIS 332 437 437 HIS HIS B . n 
B 1 333 GLY 333 438 438 GLY GLY B . n 
B 1 334 ASP 334 439 439 ASP ASP B . n 
B 1 335 PHE 335 440 440 PHE PHE B . n 
B 1 336 HIS 336 441 441 HIS HIS B . n 
B 1 337 ALA 337 442 442 ALA ALA B . n 
B 1 338 PHE 338 443 443 PHE PHE B . n 
B 1 339 SER 339 444 444 SER SER B . n 
B 1 340 ALA 340 445 445 ALA ALA B . n 
B 1 341 GLY 341 446 446 GLY GLY B . n 
B 1 342 PRO 342 447 447 PRO PRO B . n 
B 1 343 GLY 343 448 448 GLY GLY B . n 
B 1 344 LEU 344 449 449 LEU LEU B . n 
B 1 345 PHE 345 450 450 PHE PHE B . n 
B 1 346 SER 346 451 451 SER SER B . n 
B 1 347 TYR 347 452 452 TYR TYR B . n 
B 1 348 ILE 348 453 453 ILE ILE B . n 
B 1 349 ARG 349 454 454 ARG ARG B . n 
B 1 350 HIS 350 455 455 HIS HIS B . n 
B 1 351 TRP 351 456 456 TRP TRP B . n 
B 1 352 ASP 352 457 457 ASP ASP B . n 
B 1 353 GLN 353 458 458 GLN GLN B . n 
B 1 354 ASN 354 459 459 ASN ASN B . n 
B 1 355 GLU 355 460 460 GLU GLU B . n 
B 1 356 ARG 356 461 461 ARG ARG B . n 
B 1 357 PHE 357 462 462 PHE PHE B . n 
B 1 358 LEU 358 463 463 LEU LEU B . n 
B 1 359 VAL 359 464 464 VAL VAL B . n 
B 1 360 VAL 360 465 465 VAL VAL B . n 
B 1 361 LEU 361 466 466 LEU LEU B . n 
B 1 362 ASN 362 467 467 ASN ASN B . n 
B 1 363 PHE 363 468 468 PHE PHE B . n 
B 1 364 GLY 364 469 469 GLY GLY B . n 
B 1 365 ASP 365 470 470 ASP ASP B . n 
B 1 366 VAL 366 471 471 VAL VAL B . n 
B 1 367 GLY 367 472 472 GLY GLY B . n 
B 1 368 LEU 368 473 473 LEU LEU B . n 
B 1 369 SER 369 474 474 SER SER B . n 
B 1 370 ALA 370 475 475 ALA ALA B . n 
B 1 371 GLY 371 476 476 GLY GLY B . n 
B 1 372 LEU 372 477 477 LEU LEU B . n 
B 1 373 GLN 373 478 478 GLN GLN B . n 
B 1 374 ALA 374 479 479 ALA ASP B . n 
B 1 375 SER 375 480 480 SER SER B . n 
B 1 376 ASP 376 481 481 ASP ASP B . n 
B 1 377 LEU 377 482 482 LEU LEU B . n 
B 1 378 PRO 378 483 483 PRO PRO B . n 
B 1 379 ALA 379 484 484 ALA ALA B . n 
B 1 380 SER 380 485 485 SER SER B . n 
B 1 381 ALA 381 486 486 ALA ALA B . n 
B 1 382 SER 382 487 487 SER SER B . n 
B 1 383 LEU 383 488 488 LEU LEU B . n 
B 1 384 PRO 384 489 489 PRO PRO B . n 
B 1 385 ALA 385 490 490 ALA ALA B . n 
B 1 386 LYS 386 491 491 LYS LYS B . n 
B 1 387 ALA 387 492 492 ALA ALA B . n 
B 1 388 ASP 388 493 493 ASP ASP B . n 
B 1 389 LEU 389 494 494 LEU LEU B . n 
B 1 390 LEU 390 495 495 LEU LEU B . n 
B 1 391 LEU 391 496 496 LEU LEU B . n 
B 1 392 SER 392 497 497 SER SER B . n 
B 1 393 THR 393 498 498 THR THR B . n 
B 1 394 GLN 394 499 499 GLN GLN B . n 
B 1 395 PRO 395 500 500 PRO PRO B . n 
B 1 396 GLY 396 501 501 GLY GLY B . n 
B 1 397 ARG 397 502 502 ARG ARG B . n 
B 1 398 GLU 398 503 503 GLU GLU B . n 
B 1 399 GLU 399 504 504 GLU GLU B . n 
B 1 400 GLY 400 505 505 GLY GLY B . n 
B 1 401 SER 401 506 506 SER SER B . n 
B 1 402 PRO 402 507 507 PRO PRO B . n 
B 1 403 LEU 403 508 508 LEU LEU B . n 
B 1 404 GLU 404 509 509 GLU GLU B . n 
B 1 405 LEU 405 510 510 LEU LEU B . n 
B 1 406 GLU 406 511 511 GLU GLU B . n 
B 1 407 ARG 407 512 512 ARG ARG B . n 
B 1 408 LEU 408 513 513 LEU LEU B . n 
B 1 409 LYS 409 514 514 LYS LYS B . n 
B 1 410 LEU 410 515 515 LEU LEU B . n 
B 1 411 GLU 411 516 516 GLU GLU B . n 
B 1 412 PRO 412 517 517 PRO PRO B . n 
B 1 413 HIS 413 518 518 HIS HIS B . n 
B 1 414 GLU 414 519 519 GLU GLU B . n 
B 1 415 GLY 415 520 520 GLY GLY B . n 
B 1 416 LEU 416 521 521 LEU LEU B . n 
B 1 417 LEU 417 522 522 LEU LEU B . n 
B 1 418 LEU 418 523 523 LEU LEU B . n 
B 1 419 ARG 419 524 524 ARG ARG B . n 
B 1 420 PHE 420 525 525 PHE PHE B . n 
B 1 421 PRO 421 526 526 PRO PRO B . n 
B 1 422 TYR 422 527 527 TYR TYR B . n 
B 1 423 ALA 423 528 528 ALA ALA B . n 
B 1 424 ALA 424 529 529 ALA ALA B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 ZN  1  601 601 ZN  ZN  A . 
D 3 HOH 1  701 701 HOH HOH A . 
D 3 HOH 2  702 702 HOH HOH A . 
D 3 HOH 3  703 703 HOH HOH A . 
D 3 HOH 4  704 704 HOH HOH A . 
D 3 HOH 5  705 705 HOH HOH A . 
D 3 HOH 6  706 706 HOH HOH A . 
D 3 HOH 7  707 707 HOH HOH A . 
D 3 HOH 8  708 708 HOH HOH A . 
D 3 HOH 9  709 709 HOH HOH A . 
D 3 HOH 10 710 710 HOH HOH A . 
D 3 HOH 11 711 711 HOH HOH A . 
D 3 HOH 12 712 712 HOH HOH A . 
D 3 HOH 13 713 713 HOH HOH A . 
D 3 HOH 14 714 714 HOH HOH A . 
D 3 HOH 15 715 717 HOH HOH A . 
E 3 HOH 1  715 715 HOH HOH B . 
E 3 HOH 2  716 716 HOH HOH B . 
E 3 HOH 3  717 718 HOH HOH B . 
E 3 HOH 4  718 719 HOH HOH B . 
E 3 HOH 5  719 720 HOH HOH B . 
E 3 HOH 6  720 721 HOH HOH B . 
E 3 HOH 7  721 722 HOH HOH B . 
E 3 HOH 8  722 723 HOH HOH B . 
E 3 HOH 9  723 724 HOH HOH B . 
E 3 HOH 10 724 725 HOH HOH B . 
E 3 HOH 11 725 726 HOH HOH B . 
E 3 HOH 12 726 727 HOH HOH B . 
E 3 HOH 13 727 728 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D 
2 1 B,E   
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 NE2 ? B HIS 336 ? B HIS 441 ? 1_555 ZN ? C ZN . ? A ZN 601 ? 1_555 OD1 ? A ASP 334 ? A ASP 439 ? 1_555 115.2 ? 
2 NE2 ? B HIS 336 ? B HIS 441 ? 1_555 ZN ? C ZN . ? A ZN 601 ? 1_555 NE2 ? A HIS 350 ? A HIS 455 ? 1_555 128.1 ? 
3 OD1 ? A ASP 334 ? A ASP 439 ? 1_555 ZN ? C ZN . ? A ZN 601 ? 1_555 NE2 ? A HIS 350 ? A HIS 455 ? 1_555 93.7  ? 
4 NE2 ? B HIS 336 ? B HIS 441 ? 1_555 ZN ? C ZN . ? A ZN 601 ? 1_555 NE2 ? A HIS 336 ? A HIS 441 ? 1_555 109.8 ? 
5 OD1 ? A ASP 334 ? A ASP 439 ? 1_555 ZN ? C ZN . ? A ZN 601 ? 1_555 NE2 ? A HIS 336 ? A HIS 441 ? 1_555 99.9  ? 
6 NE2 ? A HIS 350 ? A HIS 455 ? 1_555 ZN ? C ZN . ? A ZN 601 ? 1_555 NE2 ? A HIS 336 ? A HIS 441 ? 1_555 106.0 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-03-27 
2 'Structure model' 1 1 2007-10-05 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 22.5506 63.7738 48.0242 -0.1352 -0.1301 -0.2360 -0.0316 0.0216  -0.0250 2.3771 2.0151 1.3279 -0.7263 0.3531  -0.0678 
-0.0108 -0.1918 -0.0325 0.2293 0.0083 0.0213  -0.0845 -0.0056 0.0025  'X-RAY DIFFRACTION' 
2 ? refined 12.2752 16.3452 41.0070 -0.1108 -0.1010 -0.1919 -0.0261 -0.0076 0.0012  2.1815 2.3806 1.1911 -0.4118 -0.3476 0.1575  
-0.0138 -0.1341 0.0960  0.2922 0.0333 -0.0758 0.0348  -0.0111 -0.0195 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 114 A 9 A 529 A 424 ? 'X-RAY DIFFRACTION' ? 
2 1 A 601 C 1 A 601 C 1   ? 'X-RAY DIFFRACTION' ? 
3 2 B 109 B 4 B 529 B 424 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.2.0005 ? 1 
DENZO     'data reduction' .        ? 2 
SCALEPACK 'data scaling'   .        ? 3 
AMoRE     phasing          .        ? 4 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ALA 
_pdbx_validate_rmsd_angle.auth_seq_id_1              529 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             C 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ALA 
_pdbx_validate_rmsd_angle.auth_seq_id_2              529 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             O 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ALA 
_pdbx_validate_rmsd_angle.auth_seq_id_3              529 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                163.02 
_pdbx_validate_rmsd_angle.angle_target_value         120.10 
_pdbx_validate_rmsd_angle.angle_deviation            42.92 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.10 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ALA A 137 ? ? -76.84  -93.93  
2  1 GLN A 173 ? ? -91.86  45.02   
3  1 PHE A 218 ? ? 63.52   -65.79  
4  1 VAL A 222 ? ? -86.31  -70.62  
5  1 ASP A 223 ? ? 20.73   -83.04  
6  1 ASP A 272 ? ? -94.17  46.54   
7  1 SER A 293 ? ? -63.36  -82.92  
8  1 ASP A 306 ? ? -162.56 79.73   
9  1 THR A 310 ? ? -139.21 -75.85  
10 1 GLU A 312 ? ? -91.32  33.28   
11 1 ALA A 337 ? ? -149.45 -41.78  
12 1 ALA A 377 ? ? 82.97   -4.38   
13 1 SER A 444 ? ? -110.26 78.19   
14 1 ALA A 445 ? ? -90.76  -144.95 
15 1 ASP A 457 ? ? 51.07   -130.74 
16 1 SER A 480 ? ? 1.45    103.82  
17 1 ASP A 481 ? ? 52.06   79.21   
18 1 SER A 485 ? ? -89.20  36.82   
19 1 SER A 487 ? ? -15.30  84.77   
20 1 HIS B 135 ? ? -63.74  76.24   
21 1 LYS B 168 ? ? -33.89  116.09  
22 1 PHE B 218 ? ? 58.87   -179.15 
23 1 GLN B 221 ? ? -12.03  107.23  
24 1 ASP B 272 ? ? -90.43  38.42   
25 1 SER B 282 ? ? -77.50  -72.62  
26 1 LEU B 284 ? ? 64.43   -44.89  
27 1 LEU B 290 ? ? -79.17  26.48   
28 1 SER B 293 ? ? 64.51   -152.86 
29 1 ASP B 296 ? ? -158.37 67.95   
30 1 SER B 302 ? ? -96.84  48.16   
31 1 ASP B 306 ? ? -165.63 -48.60  
32 1 ALA B 337 ? ? -159.89 -42.66  
33 1 ILE B 398 ? ? 60.76   85.28   
34 1 ALA B 401 ? ? -137.00 -51.69  
35 1 HIS B 437 ? ? -155.21 40.67   
36 1 PRO B 447 ? ? -38.04  120.51  
37 1 ASP B 457 ? ? 38.64   -110.51 
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   LYS 
_pdbx_validate_peptide_omega.auth_asym_id_1   B 
_pdbx_validate_peptide_omega.auth_seq_id_1    295 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   ASP 
_pdbx_validate_peptide_omega.auth_asym_id_2   B 
_pdbx_validate_peptide_omega.auth_seq_id_2    296 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            145.47 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ASP 106 ? A ASP 1 
2  1 Y 1 A ARG 107 ? A ARG 2 
3  1 Y 1 A TRP 108 ? A TRP 3 
4  1 Y 1 A GLY 109 ? A GLY 4 
5  1 Y 1 A SER 110 ? A SER 5 
6  1 Y 1 A GLU 111 ? A GLU 6 
7  1 Y 1 A LEU 112 ? A LEU 7 
8  1 Y 1 A PRO 113 ? A PRO 8 
9  1 Y 1 B ASP 106 ? B ASP 1 
10 1 Y 1 B ARG 107 ? B ARG 2 
11 1 Y 1 B TRP 108 ? B TRP 3 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION' ZN  
3 water      HOH 
#