data_2DJY
# 
_entry.id   2DJY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2DJY         
RCSB  RCSB025503   
WWPDB D_1000025503 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2DJY 
_pdbx_database_status.recvd_initial_deposition_date   2006-04-06 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chong, P.A.'      1 
'Lin, H'           2 
'Wrana, J.L.'      3 
'Forman-Kay, J.D.' 4 
# 
_citation.id                        primary 
_citation.title                     
'An Expanded WW Domain Recognition Motif Revealed by the Interaction between Smad7 and the E3 Ubiquitin Ligase Smurf2.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            281 
_citation.page_first                17069 
_citation.page_last                 17075 
_citation.year                      2006 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16641086 
_citation.pdbx_database_id_DOI      10.1074/jbc.M601493200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chong, P.A.'      1 
primary 'Lin, H.'          2 
primary 'Wrana, J.L.'      3 
primary 'Forman-Kay, J.D.' 4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Smad ubiquitination regulatory factor 2'   4616.053 1 6.3.2.- ? 'WW3 domain'      ? 
2 polymer man 'Mothers against decapentaplegic homolog 7' 2190.409 1 ?       ? 'PY motif region' ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Ubiquitin--protein ligase SMURF2, Smad-specific E3 ubiquitin ligase 2, hSMURF2' 
2 'SMAD 7, Mothers against DPP homolog 7, Smad7, hSMAD7'                           
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no GPLGSGPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLSAN GPLGSGPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLSAN A ? 
2 'polypeptide(L)' no no GPLGSELESPPPPYSRYPMD                       GPLGSELESPPPPYSRYPMD                       B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  PRO n 
1 3  LEU n 
1 4  GLY n 
1 5  SER n 
1 6  GLY n 
1 7  PRO n 
1 8  LEU n 
1 9  PRO n 
1 10 PRO n 
1 11 GLY n 
1 12 TRP n 
1 13 GLU n 
1 14 ILE n 
1 15 ARG n 
1 16 ASN n 
1 17 THR n 
1 18 ALA n 
1 19 THR n 
1 20 GLY n 
1 21 ARG n 
1 22 VAL n 
1 23 TYR n 
1 24 PHE n 
1 25 VAL n 
1 26 ASP n 
1 27 HIS n 
1 28 ASN n 
1 29 ASN n 
1 30 ARG n 
1 31 THR n 
1 32 THR n 
1 33 GLN n 
1 34 PHE n 
1 35 THR n 
1 36 ASP n 
1 37 PRO n 
1 38 ARG n 
1 39 LEU n 
1 40 SER n 
1 41 ALA n 
1 42 ASN n 
2 1  GLY n 
2 2  PRO n 
2 3  LEU n 
2 4  GLY n 
2 5  SER n 
2 6  GLU n 
2 7  LEU n 
2 8  GLU n 
2 9  SER n 
2 10 PRO n 
2 11 PRO n 
2 12 PRO n 
2 13 PRO n 
2 14 TYR n 
2 15 SER n 
2 16 ARG n 
2 17 TYR n 
2 18 PRO n 
2 19 MET n 
2 20 ASP n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo SMURF2                ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 
469008 Escherichia ? ? 'Escherichia coli' ? ? 'BL21 DE3' ? ? ? ? ? ? ? plasmid ? ? ? pGEX6P1 ? ? 
2 1 sample ? ? ? human Homo 'SMAD7, MADH7, MADH8' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 
469008 Escherichia ? ? 'Escherichia coli' ? ? 'BL21 DE3' ? ? ? ? ? ? ? plasmid ? ? ? pGEX6P1 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP SMUF2_HUMAN Q9HAU4 1 GPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLSAN 297 ? 
2 UNP SMAD7_HUMAN O15105 2 ELESPPPPYSRYPMD                       203 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2DJY A 6 ? 42 ? Q9HAU4 297 ? 333 ? 297 333 
2 2 2DJY B 6 ? 20 ? O15105 203 ? 217 ? 203 217 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2DJY GLY A 1 ? UNP Q9HAU4 ? ? 'CLONING ARTIFACT' 292 1  
1 2DJY PRO A 2 ? UNP Q9HAU4 ? ? 'CLONING ARTIFACT' 293 2  
1 2DJY LEU A 3 ? UNP Q9HAU4 ? ? 'CLONING ARTIFACT' 294 3  
1 2DJY GLY A 4 ? UNP Q9HAU4 ? ? 'CLONING ARTIFACT' 295 4  
1 2DJY SER A 5 ? UNP Q9HAU4 ? ? 'CLONING ARTIFACT' 296 5  
2 2DJY GLY B 1 ? UNP O15105 ? ? 'CLONING ARTIFACT' 198 6  
2 2DJY PRO B 2 ? UNP O15105 ? ? 'CLONING ARTIFACT' 199 7  
2 2DJY LEU B 3 ? UNP O15105 ? ? 'CLONING ARTIFACT' 200 8  
2 2DJY GLY B 4 ? UNP O15105 ? ? 'CLONING ARTIFACT' 201 9  
2 2DJY SER B 5 ? UNP O15105 ? ? 'CLONING ARTIFACT' 202 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            1 
_pdbx_nmr_exptl_sample_conditions.pH                  7.2 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      atm 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             INOVA 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.field_strength    500 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_ensemble.entry_id                                      2DJY 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             30 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2DJY 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
processing      NMRPipe 2.3   ? 1 
refinement      Aria    1.2   ? 2 
'data analysis' Nmrview 5.2.2 ? 3 
# 
_exptl.entry_id          2DJY 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2DJY 
_struct.title                     'Solution structure of Smurf2 WW3 domain-Smad7 PY peptide complex' 
_struct.pdbx_descriptor           
'Smad ubiquitination regulatory factor 2 (E.C.6.3.2.-), Mothers against decapentaplegic homolog 7' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2DJY 
_struct_keywords.pdbx_keywords   'LIGASE/SIGNALING PROTEIN' 
_struct_keywords.text            'beta sheet, polyproline type II helix, PPII, LIGASE-SIGNALING PROTEIN COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   3 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TRP A 12 ? ASN A 16 ? TRP A 303 ASN A 307 
A 2 VAL A 22 ? ASP A 26 ? VAL A 313 ASP A 317 
A 3 THR A 31 ? GLN A 33 ? THR A 322 GLN A 324 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 13 ? N GLU A 304 O VAL A 25 ? O VAL A 316 
A 2 3 N PHE A 24 ? N PHE A 315 O GLN A 33 ? O GLN A 324 
# 
_database_PDB_matrix.entry_id          2DJY 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2DJY 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1  ? 9.740   -9.975  -7.424  1.00 0.00 ? 292 GLY A N    1  
ATOM 2     C CA   . GLY A 1 1  ? 9.178   -10.701 -6.251  1.00 0.00 ? 292 GLY A CA   1  
ATOM 3     C C    . GLY A 1 1  ? 8.023   -11.609 -6.628  1.00 0.00 ? 292 GLY A C    1  
ATOM 4     O O    . GLY A 1 1  ? 7.402   -11.422 -7.674  1.00 0.00 ? 292 GLY A O    1  
ATOM 5     H H1   . GLY A 1 1  ? 9.406   -10.411 -8.307  1.00 0.00 ? 292 GLY A H1   1  
ATOM 6     H H2   . GLY A 1 1  ? 10.779  -10.013 -7.403  1.00 0.00 ? 292 GLY A H2   1  
ATOM 7     H H3   . GLY A 1 1  ? 9.439   -8.980  -7.406  1.00 0.00 ? 292 GLY A H3   1  
ATOM 8     H HA2  . GLY A 1 1  ? 9.959   -11.298 -5.803  1.00 0.00 ? 292 GLY A HA2  1  
ATOM 9     H HA3  . GLY A 1 1  ? 8.831   -9.979  -5.526  1.00 0.00 ? 292 GLY A HA3  1  
ATOM 10    N N    . PRO A 1 2  ? 7.710   -12.611 -5.788  1.00 0.00 ? 293 PRO A N    1  
ATOM 11    C CA   . PRO A 1 2  ? 6.615   -13.549 -6.051  1.00 0.00 ? 293 PRO A CA   1  
ATOM 12    C C    . PRO A 1 2  ? 5.247   -12.877 -5.987  1.00 0.00 ? 293 PRO A C    1  
ATOM 13    O O    . PRO A 1 2  ? 4.416   -13.219 -5.145  1.00 0.00 ? 293 PRO A O    1  
ATOM 14    C CB   . PRO A 1 2  ? 6.754   -14.588 -4.936  1.00 0.00 ? 293 PRO A CB   1  
ATOM 15    C CG   . PRO A 1 2  ? 7.477   -13.881 -3.842  1.00 0.00 ? 293 PRO A CG   1  
ATOM 16    C CD   . PRO A 1 2  ? 8.398   -12.903 -4.518  1.00 0.00 ? 293 PRO A CD   1  
ATOM 17    H HA   . PRO A 1 2  ? 6.731   -14.031 -7.011  1.00 0.00 ? 293 PRO A HA   1  
ATOM 18    H HB2  . PRO A 1 2  ? 5.772   -14.909 -4.617  1.00 0.00 ? 293 PRO A HB2  1  
ATOM 19    H HG2  . PRO A 1 2  ? 6.773   -13.359 -3.212  1.00 0.00 ? 293 PRO A HG2  1  
ATOM 20    H HD2  . PRO A 1 2  ? 8.504   -12.011 -3.920  1.00 0.00 ? 293 PRO A HD2  1  
ATOM 21    N N    . LEU A 1 3  ? 5.021   -11.920 -6.881  1.00 0.00 ? 294 LEU A N    1  
ATOM 22    C CA   . LEU A 1 3  ? 3.753   -11.200 -6.925  1.00 0.00 ? 294 LEU A CA   1  
ATOM 23    C C    . LEU A 1 3  ? 2.597   -12.152 -7.214  1.00 0.00 ? 294 LEU A C    1  
ATOM 24    O O    . LEU A 1 3  ? 2.767   -13.371 -7.201  1.00 0.00 ? 294 LEU A O    1  
ATOM 25    C CB   . LEU A 1 3  ? 3.806   -10.100 -7.989  1.00 0.00 ? 294 LEU A CB   1  
ATOM 26    C CG   . LEU A 1 3  ? 3.880   -8.669  -7.447  1.00 0.00 ? 294 LEU A CG   1  
ATOM 27    C CD1  . LEU A 1 3  ? 4.854   -8.584  -6.280  1.00 0.00 ? 294 LEU A CD1  1  
ATOM 28    C CD2  . LEU A 1 3  ? 4.285   -7.704  -8.551  1.00 0.00 ? 294 LEU A CD2  1  
ATOM 29    H H    . LEU A 1 3  ? 5.722   -11.693 -7.526  1.00 0.00 ? 294 LEU A H    1  
ATOM 30    H HA   . LEU A 1 3  ? 3.597   -10.745 -5.958  1.00 0.00 ? 294 LEU A HA   1  
ATOM 31    H HB2  . LEU A 1 3  ? 4.674   -10.272 -8.609  1.00 0.00 ? 294 LEU A HB2  1  
ATOM 32    H HG   . LEU A 1 3  ? 2.903   -8.377  -7.088  1.00 0.00 ? 294 LEU A HG   1  
ATOM 33    H HD11 . LEU A 1 3  ? 5.176   -7.561  -6.154  1.00 0.00 ? 294 LEU A HD11 1  
ATOM 34    H HD12 . LEU A 1 3  ? 4.364   -8.920  -5.378  1.00 0.00 ? 294 LEU A HD12 1  
ATOM 35    H HD13 . LEU A 1 3  ? 5.711   -9.210  -6.479  1.00 0.00 ? 294 LEU A HD13 1  
ATOM 36    H HD21 . LEU A 1 3  ? 5.065   -8.151  -9.150  1.00 0.00 ? 294 LEU A HD21 1  
ATOM 37    H HD22 . LEU A 1 3  ? 3.430   -7.491  -9.175  1.00 0.00 ? 294 LEU A HD22 1  
ATOM 38    H HD23 . LEU A 1 3  ? 4.649   -6.787  -8.113  1.00 0.00 ? 294 LEU A HD23 1  
ATOM 39    N N    . GLY A 1 4  ? 1.421   -11.589 -7.474  1.00 0.00 ? 295 GLY A N    1  
ATOM 40    C CA   . GLY A 1 4  ? 0.256   -12.405 -7.760  1.00 0.00 ? 295 GLY A CA   1  
ATOM 41    C C    . GLY A 1 4  ? -0.492  -11.946 -8.995  1.00 0.00 ? 295 GLY A C    1  
ATOM 42    O O    . GLY A 1 4  ? -1.375  -11.093 -8.911  1.00 0.00 ? 295 GLY A O    1  
ATOM 43    H H    . GLY A 1 4  ? 1.345   -10.611 -7.473  1.00 0.00 ? 295 GLY A H    1  
ATOM 44    H HA2  . GLY A 1 4  ? 0.576   -13.427 -7.905  1.00 0.00 ? 295 GLY A HA2  1  
ATOM 45    H HA3  . GLY A 1 4  ? -0.412  -12.367 -6.912  1.00 0.00 ? 295 GLY A HA3  1  
ATOM 46    N N    . SER A 1 5  ? -0.139  -12.515 -10.145 1.00 0.00 ? 296 SER A N    1  
ATOM 47    C CA   . SER A 1 5  ? -0.786  -12.160 -11.402 1.00 0.00 ? 296 SER A CA   1  
ATOM 48    C C    . SER A 1 5  ? -2.256  -12.566 -11.390 1.00 0.00 ? 296 SER A C    1  
ATOM 49    O O    . SER A 1 5  ? -2.604  -13.686 -11.762 1.00 0.00 ? 296 SER A O    1  
ATOM 50    C CB   . SER A 1 5  ? -0.072  -12.833 -12.576 1.00 0.00 ? 296 SER A CB   1  
ATOM 51    O OG   . SER A 1 5  ? 0.617   -13.998 -12.154 1.00 0.00 ? 296 SER A OG   1  
ATOM 52    H H    . SER A 1 5  ? 0.573   -13.188 -10.147 1.00 0.00 ? 296 SER A H    1  
ATOM 53    H HA   . SER A 1 5  ? -0.721  -11.088 -11.518 1.00 0.00 ? 296 SER A HA   1  
ATOM 54    H HB2  . SER A 1 5  ? -0.799  -13.113 -13.325 1.00 0.00 ? 296 SER A HB2  1  
ATOM 55    H HG   . SER A 1 5  ? 0.505   -14.690 -12.809 1.00 0.00 ? 296 SER A HG   1  
ATOM 56    N N    . GLY A 1 6  ? -3.116  -11.648 -10.958 1.00 0.00 ? 297 GLY A N    1  
ATOM 57    C CA   . GLY A 1 6  ? -4.537  -11.932 -10.905 1.00 0.00 ? 297 GLY A CA   1  
ATOM 58    C C    . GLY A 1 6  ? -5.310  -10.887 -10.122 1.00 0.00 ? 297 GLY A C    1  
ATOM 59    O O    . GLY A 1 6  ? -4.739  -10.194 -9.280  1.00 0.00 ? 297 GLY A O    1  
ATOM 60    H H    . GLY A 1 6  ? -2.781  -10.771 -10.676 1.00 0.00 ? 297 GLY A H    1  
ATOM 61    H HA2  . GLY A 1 6  ? -4.923  -11.969 -11.912 1.00 0.00 ? 297 GLY A HA2  1  
ATOM 62    H HA3  . GLY A 1 6  ? -4.682  -12.895 -10.438 1.00 0.00 ? 297 GLY A HA3  1  
ATOM 63    N N    . PRO A 1 7  ? -6.621  -10.752 -10.382 1.00 0.00 ? 298 PRO A N    1  
ATOM 64    C CA   . PRO A 1 7  ? -7.466  -9.775  -9.689  1.00 0.00 ? 298 PRO A CA   1  
ATOM 65    C C    . PRO A 1 7  ? -7.571  -10.060 -8.195  1.00 0.00 ? 298 PRO A C    1  
ATOM 66    O O    . PRO A 1 7  ? -7.605  -11.218 -7.775  1.00 0.00 ? 298 PRO A O    1  
ATOM 67    C CB   . PRO A 1 7  ? -8.834  -9.933  -10.362 1.00 0.00 ? 298 PRO A CB   1  
ATOM 68    C CG   . PRO A 1 7  ? -8.809  -11.293 -10.972 1.00 0.00 ? 298 PRO A CG   1  
ATOM 69    C CD   . PRO A 1 7  ? -7.382  -11.540 -11.367 1.00 0.00 ? 298 PRO A CD   1  
ATOM 70    H HA   . PRO A 1 7  ? -7.105  -8.768  -9.835  1.00 0.00 ? 298 PRO A HA   1  
ATOM 71    H HB2  . PRO A 1 7  ? -9.615  -9.849  -9.621  1.00 0.00 ? 298 PRO A HB2  1  
ATOM 72    H HG2  . PRO A 1 7  ? -9.131  -12.026 -10.248 1.00 0.00 ? 298 PRO A HG2  1  
ATOM 73    H HD2  . PRO A 1 7  ? -7.144  -12.591 -11.288 1.00 0.00 ? 298 PRO A HD2  1  
ATOM 74    N N    . LEU A 1 8  ? -7.622  -8.998  -7.400  1.00 0.00 ? 299 LEU A N    1  
ATOM 75    C CA   . LEU A 1 8  ? -7.723  -9.131  -5.952  1.00 0.00 ? 299 LEU A CA   1  
ATOM 76    C C    . LEU A 1 8  ? -9.141  -9.513  -5.535  1.00 0.00 ? 299 LEU A C    1  
ATOM 77    O O    . LEU A 1 8  ? -10.102 -9.240  -6.254  1.00 0.00 ? 299 LEU A O    1  
ATOM 78    C CB   . LEU A 1 8  ? -7.316  -7.824  -5.269  1.00 0.00 ? 299 LEU A CB   1  
ATOM 79    C CG   . LEU A 1 8  ? -5.810  -7.570  -5.195  1.00 0.00 ? 299 LEU A CG   1  
ATOM 80    C CD1  . LEU A 1 8  ? -5.529  -6.189  -4.626  1.00 0.00 ? 299 LEU A CD1  1  
ATOM 81    C CD2  . LEU A 1 8  ? -5.130  -8.641  -4.355  1.00 0.00 ? 299 LEU A CD2  1  
ATOM 82    H H    . LEU A 1 8  ? -7.590  -8.102  -7.796  1.00 0.00 ? 299 LEU A H    1  
ATOM 83    H HA   . LEU A 1 8  ? -7.046  -9.913  -5.643  1.00 0.00 ? 299 LEU A HA   1  
ATOM 84    H HB2  . LEU A 1 8  ? -7.773  -7.005  -5.807  1.00 0.00 ? 299 LEU A HB2  1  
ATOM 85    H HG   . LEU A 1 8  ? -5.394  -7.612  -6.191  1.00 0.00 ? 299 LEU A HG   1  
ATOM 86    H HD11 . LEU A 1 8  ? -4.472  -6.087  -4.432  1.00 0.00 ? 299 LEU A HD11 1  
ATOM 87    H HD12 . LEU A 1 8  ? -5.838  -5.436  -5.338  1.00 0.00 ? 299 LEU A HD12 1  
ATOM 88    H HD13 . LEU A 1 8  ? -6.078  -6.061  -3.705  1.00 0.00 ? 299 LEU A HD13 1  
ATOM 89    H HD21 . LEU A 1 8  ? -5.810  -9.467  -4.206  1.00 0.00 ? 299 LEU A HD21 1  
ATOM 90    H HD22 . LEU A 1 8  ? -4.245  -8.991  -4.865  1.00 0.00 ? 299 LEU A HD22 1  
ATOM 91    H HD23 . LEU A 1 8  ? -4.854  -8.225  -3.397  1.00 0.00 ? 299 LEU A HD23 1  
ATOM 92    N N    . PRO A 1 9  ? -9.286  -10.156 -4.363  1.00 0.00 ? 300 PRO A N    1  
ATOM 93    C CA   . PRO A 1 9  ? -10.595 -10.575 -3.851  1.00 0.00 ? 300 PRO A CA   1  
ATOM 94    C C    . PRO A 1 9  ? -11.598 -9.423  -3.834  1.00 0.00 ? 300 PRO A C    1  
ATOM 95    O O    . PRO A 1 9  ? -11.314 -8.339  -4.345  1.00 0.00 ? 300 PRO A O    1  
ATOM 96    C CB   . PRO A 1 9  ? -10.285 -11.047 -2.429  1.00 0.00 ? 300 PRO A CB   1  
ATOM 97    C CG   . PRO A 1 9  ? -8.852  -11.446 -2.465  1.00 0.00 ? 300 PRO A CG   1  
ATOM 98    C CD   . PRO A 1 9  ? -8.189  -10.526 -3.450  1.00 0.00 ? 300 PRO A CD   1  
ATOM 99    H HA   . PRO A 1 9  ? -11.000 -11.393 -4.427  1.00 0.00 ? 300 PRO A HA   1  
ATOM 100   H HB2  . PRO A 1 9  ? -10.456 -10.240 -1.732  1.00 0.00 ? 300 PRO A HB2  1  
ATOM 101   H HG2  . PRO A 1 9  ? -8.412  -11.326 -1.484  1.00 0.00 ? 300 PRO A HG2  1  
ATOM 102   H HD2  . PRO A 1 9  ? -7.795  -9.655  -2.947  1.00 0.00 ? 300 PRO A HD2  1  
ATOM 103   N N    . PRO A 1 10 ? -12.786 -9.641  -3.246  1.00 0.00 ? 301 PRO A N    1  
ATOM 104   C CA   . PRO A 1 10 ? -13.829 -8.619  -3.178  1.00 0.00 ? 301 PRO A CA   1  
ATOM 105   C C    . PRO A 1 10 ? -13.639 -7.655  -2.011  1.00 0.00 ? 301 PRO A C    1  
ATOM 106   O O    . PRO A 1 10 ? -14.555 -7.439  -1.218  1.00 0.00 ? 301 PRO A O    1  
ATOM 107   C CB   . PRO A 1 10 ? -15.095 -9.448  -2.987  1.00 0.00 ? 301 PRO A CB   1  
ATOM 108   C CG   . PRO A 1 10 ? -14.649 -10.646 -2.218  1.00 0.00 ? 301 PRO A CG   1  
ATOM 109   C CD   . PRO A 1 10 ? -13.210 -10.900 -2.606  1.00 0.00 ? 301 PRO A CD   1  
ATOM 110   H HA   . PRO A 1 10 ? -13.895 -8.060  -4.098  1.00 0.00 ? 301 PRO A HA   1  
ATOM 111   H HB2  . PRO A 1 10 ? -15.825 -8.872  -2.436  1.00 0.00 ? 301 PRO A HB2  1  
ATOM 112   H HG2  . PRO A 1 10 ? -14.718 -10.446 -1.160  1.00 0.00 ? 301 PRO A HG2  1  
ATOM 113   H HD2  . PRO A 1 10 ? -12.618 -11.103 -1.727  1.00 0.00 ? 301 PRO A HD2  1  
ATOM 114   N N    . GLY A 1 11 ? -12.447 -7.073  -1.912  1.00 0.00 ? 302 GLY A N    1  
ATOM 115   C CA   . GLY A 1 11 ? -12.171 -6.136  -0.838  1.00 0.00 ? 302 GLY A CA   1  
ATOM 116   C C    . GLY A 1 11 ? -10.776 -5.543  -0.911  1.00 0.00 ? 302 GLY A C    1  
ATOM 117   O O    . GLY A 1 11 ? -10.564 -4.395  -0.520  1.00 0.00 ? 302 GLY A O    1  
ATOM 118   H H    . GLY A 1 11 ? -11.752 -7.287  -2.569  1.00 0.00 ? 302 GLY A H    1  
ATOM 119   H HA2  . GLY A 1 11 ? -12.892 -5.334  -0.884  1.00 0.00 ? 302 GLY A HA2  1  
ATOM 120   H HA3  . GLY A 1 11 ? -12.281 -6.649  0.106   1.00 0.00 ? 302 GLY A HA3  1  
ATOM 121   N N    . TRP A 1 12 ? -9.823  -6.322  -1.410  1.00 0.00 ? 303 TRP A N    1  
ATOM 122   C CA   . TRP A 1 12 ? -8.442  -5.866  -1.519  1.00 0.00 ? 303 TRP A CA   1  
ATOM 123   C C    . TRP A 1 12 ? -8.213  -5.038  -2.774  1.00 0.00 ? 303 TRP A C    1  
ATOM 124   O O    . TRP A 1 12 ? -8.966  -5.127  -3.744  1.00 0.00 ? 303 TRP A O    1  
ATOM 125   C CB   . TRP A 1 12 ? -7.495  -7.062  -1.517  1.00 0.00 ? 303 TRP A CB   1  
ATOM 126   C CG   . TRP A 1 12 ? -7.534  -7.826  -0.237  1.00 0.00 ? 303 TRP A CG   1  
ATOM 127   C CD1  . TRP A 1 12 ? -8.384  -8.841  0.084   1.00 0.00 ? 303 TRP A CD1  1  
ATOM 128   C CD2  . TRP A 1 12 ? -6.693  -7.628  0.899   1.00 0.00 ? 303 TRP A CD2  1  
ATOM 129   N NE1  . TRP A 1 12 ? -8.124  -9.287  1.356   1.00 0.00 ? 303 TRP A NE1  1  
ATOM 130   C CE2  . TRP A 1 12 ? -7.086  -8.557  1.878   1.00 0.00 ? 303 TRP A CE2  1  
ATOM 131   C CE3  . TRP A 1 12 ? -5.643  -6.752  1.181   1.00 0.00 ? 303 TRP A CE3  1  
ATOM 132   C CZ2  . TRP A 1 12 ? -6.464  -8.636  3.121   1.00 0.00 ? 303 TRP A CZ2  1  
ATOM 133   C CZ3  . TRP A 1 12 ? -5.026  -6.829  2.412   1.00 0.00 ? 303 TRP A CZ3  1  
ATOM 134   C CH2  . TRP A 1 12 ? -5.437  -7.765  3.371   1.00 0.00 ? 303 TRP A CH2  1  
ATOM 135   H H    . TRP A 1 12 ? -10.050 -7.227  -1.704  1.00 0.00 ? 303 TRP A H    1  
ATOM 136   H HA   . TRP A 1 12 ? -8.229  -5.253  -0.657  1.00 0.00 ? 303 TRP A HA   1  
ATOM 137   H HB2  . TRP A 1 12 ? -7.769  -7.735  -2.317  1.00 0.00 ? 303 TRP A HB2  1  
ATOM 138   H HD1  . TRP A 1 12 ? -9.146  -9.226  -0.576  1.00 0.00 ? 303 TRP A HD1  1  
ATOM 139   H HE1  . TRP A 1 12 ? -8.603  -10.006 1.812   1.00 0.00 ? 303 TRP A HE1  1  
ATOM 140   H HE3  . TRP A 1 12 ? -5.312  -6.024  0.455   1.00 0.00 ? 303 TRP A HE3  1  
ATOM 141   H HZ2  . TRP A 1 12 ? -6.769  -9.353  3.870   1.00 0.00 ? 303 TRP A HZ2  1  
ATOM 142   H HZ3  . TRP A 1 12 ? -4.214  -6.158  2.647   1.00 0.00 ? 303 TRP A HZ3  1  
ATOM 143   H HH2  . TRP A 1 12 ? -4.926  -7.790  4.320   1.00 0.00 ? 303 TRP A HH2  1  
ATOM 144   N N    . GLU A 1 13 ? -7.160  -4.231  -2.741  1.00 0.00 ? 304 GLU A N    1  
ATOM 145   C CA   . GLU A 1 13 ? -6.799  -3.386  -3.868  1.00 0.00 ? 304 GLU A CA   1  
ATOM 146   C C    . GLU A 1 13 ? -5.315  -3.058  -3.837  1.00 0.00 ? 304 GLU A C    1  
ATOM 147   O O    . GLU A 1 13 ? -4.758  -2.764  -2.780  1.00 0.00 ? 304 GLU A O    1  
ATOM 148   C CB   . GLU A 1 13 ? -7.601  -2.087  -3.857  1.00 0.00 ? 304 GLU A CB   1  
ATOM 149   C CG   . GLU A 1 13 ? -7.261  -1.167  -5.019  1.00 0.00 ? 304 GLU A CG   1  
ATOM 150   C CD   . GLU A 1 13 ? -7.452  0.298   -4.680  1.00 0.00 ? 304 GLU A CD   1  
ATOM 151   O OE1  . GLU A 1 13 ? -7.844  0.596   -3.534  1.00 0.00 ? 304 GLU A OE1  1  
ATOM 152   O OE2  . GLU A 1 13 ? -7.210  1.147   -5.564  1.00 0.00 ? 304 GLU A OE2  1  
ATOM 153   H H    . GLU A 1 13 ? -6.610  -4.202  -1.930  1.00 0.00 ? 304 GLU A H    1  
ATOM 154   H HA   . GLU A 1 13 ? -7.019  -3.928  -4.776  1.00 0.00 ? 304 GLU A HA   1  
ATOM 155   H HB2  . GLU A 1 13 ? -8.653  -2.322  -3.902  1.00 0.00 ? 304 GLU A HB2  1  
ATOM 156   H HG2  . GLU A 1 13 ? -6.227  -1.325  -5.295  1.00 0.00 ? 304 GLU A HG2  1  
ATOM 157   N N    . ILE A 1 14 ? -4.679  -3.109  -4.997  1.00 0.00 ? 305 ILE A N    1  
ATOM 158   C CA   . ILE A 1 14 ? -3.262  -2.806  -5.092  1.00 0.00 ? 305 ILE A CA   1  
ATOM 159   C C    . ILE A 1 14 ? -3.036  -1.297  -5.076  1.00 0.00 ? 305 ILE A C    1  
ATOM 160   O O    . ILE A 1 14 ? -3.908  -0.519  -5.464  1.00 0.00 ? 305 ILE A O    1  
ATOM 161   C CB   . ILE A 1 14 ? -2.637  -3.408  -6.370  1.00 0.00 ? 305 ILE A CB   1  
ATOM 162   C CG1  . ILE A 1 14 ? -2.721  -4.936  -6.332  1.00 0.00 ? 305 ILE A CG1  1  
ATOM 163   C CG2  . ILE A 1 14 ? -1.190  -2.953  -6.524  1.00 0.00 ? 305 ILE A CG2  1  
ATOM 164   C CD1  . ILE A 1 14 ? -1.929  -5.615  -7.429  1.00 0.00 ? 305 ILE A CD1  1  
ATOM 165   H H    . ILE A 1 14 ? -5.174  -3.356  -5.807  1.00 0.00 ? 305 ILE A H    1  
ATOM 166   H HA   . ILE A 1 14 ? -2.768  -3.242  -4.230  1.00 0.00 ? 305 ILE A HA   1  
ATOM 167   H HB   . ILE A 1 14 ? -3.194  -3.046  -7.221  1.00 0.00 ? 305 ILE A HB   1  
ATOM 168   H HG12 . ILE A 1 14 ? -2.340  -5.288  -5.384  1.00 0.00 ? 305 ILE A HG12 1  
ATOM 169   H HG21 . ILE A 1 14 ? -1.169  -1.904  -6.779  1.00 0.00 ? 305 ILE A HG21 1  
ATOM 170   H HG22 . ILE A 1 14 ? -0.667  -3.108  -5.594  1.00 0.00 ? 305 ILE A HG22 1  
ATOM 171   H HG23 . ILE A 1 14 ? -0.712  -3.522  -7.307  1.00 0.00 ? 305 ILE A HG23 1  
ATOM 172   H HD11 . ILE A 1 14 ? -0.902  -5.276  -7.392  1.00 0.00 ? 305 ILE A HD11 1  
ATOM 173   H HD12 . ILE A 1 14 ? -1.960  -6.685  -7.287  1.00 0.00 ? 305 ILE A HD12 1  
ATOM 174   H HD13 . ILE A 1 14 ? -2.357  -5.365  -8.388  1.00 0.00 ? 305 ILE A HD13 1  
ATOM 175   N N    . ARG A 1 15 ? -1.854  -0.902  -4.629  1.00 0.00 ? 306 ARG A N    1  
ATOM 176   C CA   . ARG A 1 15 ? -1.487  0.503   -4.553  1.00 0.00 ? 306 ARG A CA   1  
ATOM 177   C C    . ARG A 1 15 ? 0.025   0.631   -4.415  1.00 0.00 ? 306 ARG A C    1  
ATOM 178   O O    . ARG A 1 15 ? 0.729   -0.374  -4.369  1.00 0.00 ? 306 ARG A O    1  
ATOM 179   C CB   . ARG A 1 15 ? -2.197  1.162   -3.367  1.00 0.00 ? 306 ARG A CB   1  
ATOM 180   C CG   . ARG A 1 15 ? -3.683  1.384   -3.602  1.00 0.00 ? 306 ARG A CG   1  
ATOM 181   C CD   . ARG A 1 15 ? -4.233  2.486   -2.715  1.00 0.00 ? 306 ARG A CD   1  
ATOM 182   N NE   . ARG A 1 15 ? -5.655  2.718   -2.951  1.00 0.00 ? 306 ARG A NE   1  
ATOM 183   C CZ   . ARG A 1 15 ? -6.127  3.392   -3.995  1.00 0.00 ? 306 ARG A CZ   1  
ATOM 184   N NH1  . ARG A 1 15 ? -5.292  3.907   -4.887  1.00 0.00 ? 306 ARG A NH1  1  
ATOM 185   N NH2  . ARG A 1 15 ? -7.434  3.553   -4.146  1.00 0.00 ? 306 ARG A NH2  1  
ATOM 186   H H    . ARG A 1 15 ? -1.208  -1.578  -4.337  1.00 0.00 ? 306 ARG A H    1  
ATOM 187   H HA   . ARG A 1 15 ? -1.801  0.983   -5.469  1.00 0.00 ? 306 ARG A HA   1  
ATOM 188   H HB2  . ARG A 1 15 ? -2.083  0.530   -2.499  1.00 0.00 ? 306 ARG A HB2  1  
ATOM 189   H HG2  . ARG A 1 15 ? -3.836  1.659   -4.635  1.00 0.00 ? 306 ARG A HG2  1  
ATOM 190   H HD2  . ARG A 1 15 ? -4.090  2.206   -1.682  1.00 0.00 ? 306 ARG A HD2  1  
ATOM 191   H HE   . ARG A 1 15 ? -6.290  2.348   -2.302  1.00 0.00 ? 306 ARG A HE   1  
ATOM 192   H HH11 . ARG A 1 15 ? -4.306  3.787   -4.776  1.00 0.00 ? 306 ARG A HH11 1  
ATOM 193   H HH12 . ARG A 1 15 ? -5.649  4.415   -5.671  1.00 0.00 ? 306 ARG A HH12 1  
ATOM 194   H HH21 . ARG A 1 15 ? -8.067  3.166   -3.476  1.00 0.00 ? 306 ARG A HH21 1  
ATOM 195   H HH22 . ARG A 1 15 ? -7.788  4.062   -4.932  1.00 0.00 ? 306 ARG A HH22 1  
ATOM 196   N N    . ASN A 1 16 ? 0.530   1.859   -4.372  1.00 0.00 ? 307 ASN A N    1  
ATOM 197   C CA   . ASN A 1 16 ? 1.965   2.074   -4.226  1.00 0.00 ? 307 ASN A CA   1  
ATOM 198   C C    . ASN A 1 16 ? 2.245   3.206   -3.246  1.00 0.00 ? 307 ASN A C    1  
ATOM 199   O O    . ASN A 1 16 ? 1.421   4.102   -3.065  1.00 0.00 ? 307 ASN A O    1  
ATOM 200   C CB   . ASN A 1 16 ? 2.620   2.367   -5.582  1.00 0.00 ? 307 ASN A CB   1  
ATOM 201   C CG   . ASN A 1 16 ? 1.943   1.642   -6.731  1.00 0.00 ? 307 ASN A CG   1  
ATOM 202   O OD1  . ASN A 1 16 ? 0.995   2.152   -7.330  1.00 0.00 ? 307 ASN A OD1  1  
ATOM 203   N ND2  . ASN A 1 16 ? 2.429   0.447   -7.044  1.00 0.00 ? 307 ASN A ND2  1  
ATOM 204   H H    . ASN A 1 16 ? -0.069  2.630   -4.444  1.00 0.00 ? 307 ASN A H    1  
ATOM 205   H HA   . ASN A 1 16 ? 2.389   1.167   -3.826  1.00 0.00 ? 307 ASN A HA   1  
ATOM 206   H HB2  . ASN A 1 16 ? 2.577   3.427   -5.775  1.00 0.00 ? 307 ASN A HB2  1  
ATOM 207   H HD21 . ASN A 1 16 ? 3.185   0.104   -6.524  1.00 0.00 ? 307 ASN A HD21 1  
ATOM 208   H HD22 . ASN A 1 16 ? 2.012   -0.044  -7.783  1.00 0.00 ? 307 ASN A HD22 1  
ATOM 209   N N    . THR A 1 17 ? 3.413   3.158   -2.615  1.00 0.00 ? 308 THR A N    1  
ATOM 210   C CA   . THR A 1 17 ? 3.797   4.171   -1.640  1.00 0.00 ? 308 THR A CA   1  
ATOM 211   C C    . THR A 1 17 ? 4.561   5.319   -2.290  1.00 0.00 ? 308 THR A C    1  
ATOM 212   O O    . THR A 1 17 ? 5.508   5.852   -1.711  1.00 0.00 ? 308 THR A O    1  
ATOM 213   C CB   . THR A 1 17 ? 4.665   3.564   -0.522  1.00 0.00 ? 308 THR A CB   1  
ATOM 214   O OG1  . THR A 1 17 ? 5.980   3.285   -1.017  1.00 0.00 ? 308 THR A OG1  1  
ATOM 215   C CG2  . THR A 1 17 ? 4.036   2.287   0.011   1.00 0.00 ? 308 THR A CG2  1  
ATOM 216   H H    . THR A 1 17 ? 4.032   2.424   -2.811  1.00 0.00 ? 308 THR A H    1  
ATOM 217   H HA   . THR A 1 17 ? 2.892   4.558   -1.194  1.00 0.00 ? 308 THR A HA   1  
ATOM 218   H HB   . THR A 1 17 ? 4.735   4.278   0.286   1.00 0.00 ? 308 THR A HB   1  
ATOM 219   H HG1  . THR A 1 17 ? 6.519   2.925   -0.309  1.00 0.00 ? 308 THR A HG1  1  
ATOM 220   H HG21 . THR A 1 17 ? 4.275   1.466   -0.648  1.00 0.00 ? 308 THR A HG21 1  
ATOM 221   H HG22 . THR A 1 17 ? 2.965   2.411   0.058   1.00 0.00 ? 308 THR A HG22 1  
ATOM 222   H HG23 . THR A 1 17 ? 4.423   2.078   1.000   1.00 0.00 ? 308 THR A HG23 1  
ATOM 223   N N    . ALA A 1 18 ? 4.147   5.701   -3.494  1.00 0.00 ? 309 ALA A N    1  
ATOM 224   C CA   . ALA A 1 18 ? 4.797   6.791   -4.210  1.00 0.00 ? 309 ALA A CA   1  
ATOM 225   C C    . ALA A 1 18 ? 6.203   6.401   -4.655  1.00 0.00 ? 309 ALA A C    1  
ATOM 226   O O    . ALA A 1 18 ? 6.492   6.349   -5.851  1.00 0.00 ? 309 ALA A O    1  
ATOM 227   C CB   . ALA A 1 18 ? 4.843   8.036   -3.338  1.00 0.00 ? 309 ALA A CB   1  
ATOM 228   H H    . ALA A 1 18 ? 3.388   5.242   -3.908  1.00 0.00 ? 309 ALA A H    1  
ATOM 229   H HA   . ALA A 1 18 ? 4.203   7.017   -5.084  1.00 0.00 ? 309 ALA A HA   1  
ATOM 230   H HB1  . ALA A 1 18 ? 4.125   8.757   -3.700  1.00 0.00 ? 309 ALA A HB1  1  
ATOM 231   H HB2  . ALA A 1 18 ? 4.604   7.770   -2.318  1.00 0.00 ? 309 ALA A HB2  1  
ATOM 232   H HB3  . ALA A 1 18 ? 5.834   8.465   -3.374  1.00 0.00 ? 309 ALA A HB3  1  
ATOM 233   N N    . THR A 1 19 ? 7.074   6.131   -3.687  1.00 0.00 ? 310 THR A N    1  
ATOM 234   C CA   . THR A 1 19 ? 8.452   5.748   -3.979  1.00 0.00 ? 310 THR A CA   1  
ATOM 235   C C    . THR A 1 19 ? 8.513   4.669   -5.058  1.00 0.00 ? 310 THR A C    1  
ATOM 236   O O    . THR A 1 19 ? 9.468   4.606   -5.832  1.00 0.00 ? 310 THR A O    1  
ATOM 237   C CB   . THR A 1 19 ? 9.173   5.237   -2.717  1.00 0.00 ? 310 THR A CB   1  
ATOM 238   O OG1  . THR A 1 19 ? 8.333   5.401   -1.569  1.00 0.00 ? 310 THR A OG1  1  
ATOM 239   C CG2  . THR A 1 19 ? 10.482  5.984   -2.503  1.00 0.00 ? 310 THR A CG2  1  
ATOM 240   H H    . THR A 1 19 ? 6.785   6.193   -2.753  1.00 0.00 ? 310 THR A H    1  
ATOM 241   H HA   . THR A 1 19 ? 8.973   6.626   -4.335  1.00 0.00 ? 310 THR A HA   1  
ATOM 242   H HB   . THR A 1 19 ? 9.394   4.187   -2.845  1.00 0.00 ? 310 THR A HB   1  
ATOM 243   H HG1  . THR A 1 19 ? 8.315   4.584   -1.065  1.00 0.00 ? 310 THR A HG1  1  
ATOM 244   H HG21 . THR A 1 19 ? 10.457  6.487   -1.547  1.00 0.00 ? 310 THR A HG21 1  
ATOM 245   H HG22 . THR A 1 19 ? 10.613  6.713   -3.289  1.00 0.00 ? 310 THR A HG22 1  
ATOM 246   H HG23 . THR A 1 19 ? 11.303  5.284   -2.521  1.00 0.00 ? 310 THR A HG23 1  
ATOM 247   N N    . GLY A 1 20 ? 7.490   3.824   -5.102  1.00 0.00 ? 311 GLY A N    1  
ATOM 248   C CA   . GLY A 1 20 ? 7.449   2.762   -6.089  1.00 0.00 ? 311 GLY A CA   1  
ATOM 249   C C    . GLY A 1 20 ? 7.005   1.437   -5.502  1.00 0.00 ? 311 GLY A C    1  
ATOM 250   O O    . GLY A 1 20 ? 6.531   0.560   -6.224  1.00 0.00 ? 311 GLY A O    1  
ATOM 251   H H    . GLY A 1 20 ? 6.756   3.922   -4.460  1.00 0.00 ? 311 GLY A H    1  
ATOM 252   H HA2  . GLY A 1 20 ? 6.764   3.041   -6.876  1.00 0.00 ? 311 GLY A HA2  1  
ATOM 253   H HA3  . GLY A 1 20 ? 8.437   2.642   -6.513  1.00 0.00 ? 311 GLY A HA3  1  
ATOM 254   N N    . ARG A 1 21 ? 7.157   1.289   -4.190  1.00 0.00 ? 312 ARG A N    1  
ATOM 255   C CA   . ARG A 1 21 ? 6.762   0.058   -3.513  1.00 0.00 ? 312 ARG A CA   1  
ATOM 256   C C    . ARG A 1 21 ? 5.258   -0.102  -3.529  1.00 0.00 ? 312 ARG A C    1  
ATOM 257   O O    . ARG A 1 21 ? 4.511   0.801   -3.153  1.00 0.00 ? 312 ARG A O    1  
ATOM 258   C CB   . ARG A 1 21 ? 7.289   0.032   -2.076  1.00 0.00 ? 312 ARG A CB   1  
ATOM 259   C CG   . ARG A 1 21 ? 7.824   -1.326  -1.645  1.00 0.00 ? 312 ARG A CG   1  
ATOM 260   C CD   . ARG A 1 21 ? 6.748   -2.404  -1.690  1.00 0.00 ? 312 ARG A CD   1  
ATOM 261   N NE   . ARG A 1 21 ? 7.066   -3.451  -2.657  1.00 0.00 ? 312 ARG A NE   1  
ATOM 262   C CZ   . ARG A 1 21 ? 8.129   -4.244  -2.560  1.00 0.00 ? 312 ARG A CZ   1  
ATOM 263   N NH1  . ARG A 1 21 ? 8.968   -4.111  -1.544  1.00 0.00 ? 312 ARG A NH1  1  
ATOM 264   N NH2  . ARG A 1 21 ? 8.351   -5.171  -3.481  1.00 0.00 ? 312 ARG A NH2  1  
ATOM 265   H H    . ARG A 1 21 ? 7.539   2.024   -3.667  1.00 0.00 ? 312 ARG A H    1  
ATOM 266   H HA   . ARG A 1 21 ? 7.183   -0.773  -4.061  1.00 0.00 ? 312 ARG A HA   1  
ATOM 267   H HB2  . ARG A 1 21 ? 8.090   0.752   -1.986  1.00 0.00 ? 312 ARG A HB2  1  
ATOM 268   H HG2  . ARG A 1 21 ? 8.629   -1.610  -2.309  1.00 0.00 ? 312 ARG A HG2  1  
ATOM 269   H HD2  . ARG A 1 21 ? 6.663   -2.849  -0.710  1.00 0.00 ? 312 ARG A HD2  1  
ATOM 270   H HE   . ARG A 1 21 ? 6.459   -3.568  -3.416  1.00 0.00 ? 312 ARG A HE   1  
ATOM 271   H HH11 . ARG A 1 21 ? 8.803   -3.413  -0.846  1.00 0.00 ? 312 ARG A HH11 1  
ATOM 272   H HH12 . ARG A 1 21 ? 9.767   -4.710  -1.472  1.00 0.00 ? 312 ARG A HH12 1  
ATOM 273   H HH21 . ARG A 1 21 ? 7.719   -5.274  -4.250  1.00 0.00 ? 312 ARG A HH21 1  
ATOM 274   H HH22 . ARG A 1 21 ? 9.150   -5.768  -3.408  1.00 0.00 ? 312 ARG A HH22 1  
ATOM 275   N N    . VAL A 1 22 ? 4.830   -1.269  -3.973  1.00 0.00 ? 313 VAL A N    1  
ATOM 276   C CA   . VAL A 1 22 ? 3.421   -1.583  -4.074  1.00 0.00 ? 313 VAL A CA   1  
ATOM 277   C C    . VAL A 1 22 ? 2.913   -2.287  -2.816  1.00 0.00 ? 313 VAL A C    1  
ATOM 278   O O    . VAL A 1 22 ? 3.521   -3.243  -2.335  1.00 0.00 ? 313 VAL A O    1  
ATOM 279   C CB   . VAL A 1 22 ? 3.160   -2.463  -5.316  1.00 0.00 ? 313 VAL A CB   1  
ATOM 280   C CG1  . VAL A 1 22 ? 4.148   -3.614  -5.372  1.00 0.00 ? 313 VAL A CG1  1  
ATOM 281   C CG2  . VAL A 1 22 ? 1.738   -2.977  -5.331  1.00 0.00 ? 313 VAL A CG2  1  
ATOM 282   H H    . VAL A 1 22 ? 5.488   -1.944  -4.240  1.00 0.00 ? 313 VAL A H    1  
ATOM 283   H HA   . VAL A 1 22 ? 2.883   -0.657  -4.199  1.00 0.00 ? 313 VAL A HA   1  
ATOM 284   H HB   . VAL A 1 22 ? 3.303   -1.856  -6.198  1.00 0.00 ? 313 VAL A HB   1  
ATOM 285   H HG11 . VAL A 1 22 ? 3.816   -4.338  -6.102  1.00 0.00 ? 313 VAL A HG11 1  
ATOM 286   H HG12 . VAL A 1 22 ? 5.121   -3.237  -5.654  1.00 0.00 ? 313 VAL A HG12 1  
ATOM 287   H HG13 . VAL A 1 22 ? 4.211   -4.082  -4.401  1.00 0.00 ? 313 VAL A HG13 1  
ATOM 288   H HG21 . VAL A 1 22 ? 1.191   -2.523  -4.521  1.00 0.00 ? 313 VAL A HG21 1  
ATOM 289   H HG22 . VAL A 1 22 ? 1.275   -2.723  -6.271  1.00 0.00 ? 313 VAL A HG22 1  
ATOM 290   H HG23 . VAL A 1 22 ? 1.747   -4.048  -5.207  1.00 0.00 ? 313 VAL A HG23 1  
ATOM 291   N N    . TYR A 1 23 ? 1.791   -1.801  -2.292  1.00 0.00 ? 314 TYR A N    1  
ATOM 292   C CA   . TYR A 1 23 ? 1.182   -2.388  -1.107  1.00 0.00 ? 314 TYR A CA   1  
ATOM 293   C C    . TYR A 1 23 ? -0.255  -2.792  -1.387  1.00 0.00 ? 314 TYR A C    1  
ATOM 294   O O    . TYR A 1 23 ? -0.815  -2.449  -2.427  1.00 0.00 ? 314 TYR A O    1  
ATOM 295   C CB   . TYR A 1 23 ? 1.225   -1.419  0.075   1.00 0.00 ? 314 TYR A CB   1  
ATOM 296   C CG   . TYR A 1 23 ? 0.353   -0.193  -0.075  1.00 0.00 ? 314 TYR A CG   1  
ATOM 297   C CD1  . TYR A 1 23 ? 0.677   0.813   -0.976  1.00 0.00 ? 314 TYR A CD1  1  
ATOM 298   C CD2  . TYR A 1 23 ? -0.791  -0.038  0.699   1.00 0.00 ? 314 TYR A CD2  1  
ATOM 299   C CE1  . TYR A 1 23 ? -0.117  1.936   -1.106  1.00 0.00 ? 314 TYR A CE1  1  
ATOM 300   C CE2  . TYR A 1 23 ? -1.592  1.082   0.572   1.00 0.00 ? 314 TYR A CE2  1  
ATOM 301   C CZ   . TYR A 1 23 ? -1.250  2.066   -0.331  1.00 0.00 ? 314 TYR A CZ   1  
ATOM 302   O OH   . TYR A 1 23 ? -2.043  3.180   -0.454  1.00 0.00 ? 314 TYR A OH   1  
ATOM 303   H H    . TYR A 1 23 ? 1.363   -1.028  -2.714  1.00 0.00 ? 314 TYR A H    1  
ATOM 304   H HA   . TYR A 1 23 ? 1.746   -3.274  -0.853  1.00 0.00 ? 314 TYR A HA   1  
ATOM 305   H HB2  . TYR A 1 23 ? 0.896   -1.943  0.958   1.00 0.00 ? 314 TYR A HB2  1  
ATOM 306   H HD1  . TYR A 1 23 ? 1.565   0.710   -1.580  1.00 0.00 ? 314 TYR A HD1  1  
ATOM 307   H HD2  . TYR A 1 23 ? -1.054  -0.810  1.409   1.00 0.00 ? 314 TYR A HD2  1  
ATOM 308   H HE1  . TYR A 1 23 ? 0.155   2.709   -1.809  1.00 0.00 ? 314 TYR A HE1  1  
ATOM 309   H HE2  . TYR A 1 23 ? -2.473  1.190   1.185   1.00 0.00 ? 314 TYR A HE2  1  
ATOM 310   H HH   . TYR A 1 23 ? -2.224  3.543   0.416   1.00 0.00 ? 314 TYR A HH   1  
ATOM 311   N N    . PHE A 1 24 ? -0.846  -3.524  -0.454  1.00 0.00 ? 315 PHE A N    1  
ATOM 312   C CA   . PHE A 1 24 ? -2.219  -3.971  -0.607  1.00 0.00 ? 315 PHE A CA   1  
ATOM 313   C C    . PHE A 1 24 ? -3.117  -3.322  0.431   1.00 0.00 ? 315 PHE A C    1  
ATOM 314   O O    . PHE A 1 24 ? -2.789  -3.277  1.616   1.00 0.00 ? 315 PHE A O    1  
ATOM 315   C CB   . PHE A 1 24 ? -2.297  -5.495  -0.515  1.00 0.00 ? 315 PHE A CB   1  
ATOM 316   C CG   . PHE A 1 24 ? -1.697  -6.183  -1.707  1.00 0.00 ? 315 PHE A CG   1  
ATOM 317   C CD1  . PHE A 1 24 ? -0.322  -6.292  -1.839  1.00 0.00 ? 315 PHE A CD1  1  
ATOM 318   C CD2  . PHE A 1 24 ? -2.507  -6.709  -2.699  1.00 0.00 ? 315 PHE A CD2  1  
ATOM 319   C CE1  . PHE A 1 24 ? 0.235   -6.915  -2.939  1.00 0.00 ? 315 PHE A CE1  1  
ATOM 320   C CE2  . PHE A 1 24 ? -1.956  -7.335  -3.802  1.00 0.00 ? 315 PHE A CE2  1  
ATOM 321   C CZ   . PHE A 1 24 ? -0.583  -7.438  -3.922  1.00 0.00 ? 315 PHE A CZ   1  
ATOM 322   H H    . PHE A 1 24 ? -0.348  -3.768  0.353   1.00 0.00 ? 315 PHE A H    1  
ATOM 323   H HA   . PHE A 1 24 ? -2.551  -3.659  -1.583  1.00 0.00 ? 315 PHE A HA   1  
ATOM 324   H HB2  . PHE A 1 24 ? -1.769  -5.829  0.366   1.00 0.00 ? 315 PHE A HB2  1  
ATOM 325   H HD1  . PHE A 1 24 ? 0.317   -5.886  -1.070  1.00 0.00 ? 315 PHE A HD1  1  
ATOM 326   H HD2  . PHE A 1 24 ? -3.580  -6.628  -2.605  1.00 0.00 ? 315 PHE A HD2  1  
ATOM 327   H HE1  . PHE A 1 24 ? 1.310   -6.992  -3.032  1.00 0.00 ? 315 PHE A HE1  1  
ATOM 328   H HE2  . PHE A 1 24 ? -2.598  -7.742  -4.569  1.00 0.00 ? 315 PHE A HE2  1  
ATOM 329   H HZ   . PHE A 1 24 ? -0.150  -7.925  -4.784  1.00 0.00 ? 315 PHE A HZ   1  
ATOM 330   N N    . VAL A 1 25 ? -4.252  -2.818  -0.030  1.00 0.00 ? 316 VAL A N    1  
ATOM 331   C CA   . VAL A 1 25 ? -5.204  -2.149  0.839   1.00 0.00 ? 316 VAL A CA   1  
ATOM 332   C C    . VAL A 1 25 ? -6.473  -2.978  1.020   1.00 0.00 ? 316 VAL A C    1  
ATOM 333   O O    . VAL A 1 25 ? -7.216  -3.212  0.066   1.00 0.00 ? 316 VAL A O    1  
ATOM 334   C CB   . VAL A 1 25 ? -5.575  -0.768  0.273   1.00 0.00 ? 316 VAL A CB   1  
ATOM 335   C CG1  . VAL A 1 25 ? -6.297  0.062   1.316   1.00 0.00 ? 316 VAL A CG1  1  
ATOM 336   C CG2  . VAL A 1 25 ? -4.332  -0.045  -0.224  1.00 0.00 ? 316 VAL A CG2  1  
ATOM 337   H H    . VAL A 1 25 ? -4.455  -2.897  -0.985  1.00 0.00 ? 316 VAL A H    1  
ATOM 338   H HA   . VAL A 1 25 ? -4.736  -2.008  1.803   1.00 0.00 ? 316 VAL A HA   1  
ATOM 339   H HB   . VAL A 1 25 ? -6.241  -0.910  -0.564  1.00 0.00 ? 316 VAL A HB   1  
ATOM 340   H HG11 . VAL A 1 25 ? -6.168  1.111   1.094   1.00 0.00 ? 316 VAL A HG11 1  
ATOM 341   H HG12 . VAL A 1 25 ? -7.349  -0.184  1.304   1.00 0.00 ? 316 VAL A HG12 1  
ATOM 342   H HG13 . VAL A 1 25 ? -5.888  -0.153  2.292   1.00 0.00 ? 316 VAL A HG13 1  
ATOM 343   H HG21 . VAL A 1 25 ? -4.333  -0.027  -1.304  1.00 0.00 ? 316 VAL A HG21 1  
ATOM 344   H HG22 . VAL A 1 25 ? -4.330  0.968   0.152   1.00 0.00 ? 316 VAL A HG22 1  
ATOM 345   H HG23 . VAL A 1 25 ? -3.451  -0.561  0.128   1.00 0.00 ? 316 VAL A HG23 1  
ATOM 346   N N    . ASP A 1 26 ? -6.713  -3.421  2.251   1.00 0.00 ? 317 ASP A N    1  
ATOM 347   C CA   . ASP A 1 26 ? -7.895  -4.220  2.563   1.00 0.00 ? 317 ASP A CA   1  
ATOM 348   C C    . ASP A 1 26 ? -9.066  -3.321  2.942   1.00 0.00 ? 317 ASP A C    1  
ATOM 349   O O    . ASP A 1 26 ? -9.030  -2.634  3.963   1.00 0.00 ? 317 ASP A O    1  
ATOM 350   C CB   . ASP A 1 26 ? -7.595  -5.191  3.705   1.00 0.00 ? 317 ASP A CB   1  
ATOM 351   C CG   . ASP A 1 26 ? -8.380  -6.482  3.583   1.00 0.00 ? 317 ASP A CG   1  
ATOM 352   O OD1  . ASP A 1 26 ? -8.990  -6.709  2.517   1.00 0.00 ? 317 ASP A OD1  1  
ATOM 353   O OD2  . ASP A 1 26 ? -8.385  -7.269  4.553   1.00 0.00 ? 317 ASP A OD2  1  
ATOM 354   H H    . ASP A 1 26 ? -6.081  -3.206  2.969   1.00 0.00 ? 317 ASP A H    1  
ATOM 355   H HA   . ASP A 1 26 ? -8.158  -4.786  1.680   1.00 0.00 ? 317 ASP A HA   1  
ATOM 356   H HB2  . ASP A 1 26 ? -6.543  -5.429  3.701   1.00 0.00 ? 317 ASP A HB2  1  
ATOM 357   N N    . HIS A 1 27 ? -10.105 -3.331  2.115   1.00 0.00 ? 318 HIS A N    1  
ATOM 358   C CA   . HIS A 1 27 ? -11.286 -2.513  2.361   1.00 0.00 ? 318 HIS A CA   1  
ATOM 359   C C    . HIS A 1 27 ? -12.245 -3.191  3.336   1.00 0.00 ? 318 HIS A C    1  
ATOM 360   O O    . HIS A 1 27 ? -13.129 -2.544  3.899   1.00 0.00 ? 318 HIS A O    1  
ATOM 361   C CB   . HIS A 1 27 ? -11.993 -2.207  1.042   1.00 0.00 ? 318 HIS A CB   1  
ATOM 362   C CG   . HIS A 1 27 ? -11.276 -1.181  0.228   1.00 0.00 ? 318 HIS A CG   1  
ATOM 363   N ND1  . HIS A 1 27 ? -11.231 0.133   0.619   1.00 0.00 ? 318 HIS A ND1  1  
ATOM 364   C CD2  . HIS A 1 27 ? -10.566 -1.329  -0.916  1.00 0.00 ? 318 HIS A CD2  1  
ATOM 365   C CE1  . HIS A 1 27 ? -10.496 0.753   -0.282  1.00 0.00 ? 318 HIS A CE1  1  
ATOM 366   N NE2  . HIS A 1 27 ? -10.072 -0.091  -1.236  1.00 0.00 ? 318 HIS A NE2  1  
ATOM 367   H H    . HIS A 1 27 ? -10.078 -3.904  1.321   1.00 0.00 ? 318 HIS A H    1  
ATOM 368   H HA   . HIS A 1 27 ? -10.954 -1.581  2.797   1.00 0.00 ? 318 HIS A HA   1  
ATOM 369   H HB2  . HIS A 1 27 ? -12.060 -3.111  0.458   1.00 0.00 ? 318 HIS A HB2  1  
ATOM 370   H HD2  . HIS A 1 27 ? -10.409 -2.243  -1.466  1.00 0.00 ? 318 HIS A HD2  1  
ATOM 371   H HE1  . HIS A 1 27 ? -10.251 1.802   -0.245  1.00 0.00 ? 318 HIS A HE1  1  
ATOM 372   H HE2  . HIS A 1 27 ? -9.389  0.098   -1.914  1.00 0.00 ? 318 HIS A HE2  1  
ATOM 373   N N    . ASN A 1 28 ? -12.070 -4.495  3.536   1.00 0.00 ? 319 ASN A N    1  
ATOM 374   C CA   . ASN A 1 28 ? -12.922 -5.245  4.452   1.00 0.00 ? 319 ASN A CA   1  
ATOM 375   C C    . ASN A 1 28 ? -12.484 -5.019  5.896   1.00 0.00 ? 319 ASN A C    1  
ATOM 376   O O    . ASN A 1 28 ? -13.312 -4.788  6.778   1.00 0.00 ? 319 ASN A O    1  
ATOM 377   C CB   . ASN A 1 28 ? -12.879 -6.737  4.120   1.00 0.00 ? 319 ASN A CB   1  
ATOM 378   C CG   . ASN A 1 28 ? -13.072 -7.008  2.642   1.00 0.00 ? 319 ASN A CG   1  
ATOM 379   O OD1  . ASN A 1 28 ? -13.788 -6.281  1.954   1.00 0.00 ? 319 ASN A OD1  1  
ATOM 380   N ND2  . ASN A 1 28 ? -12.432 -8.060  2.145   1.00 0.00 ? 319 ASN A ND2  1  
ATOM 381   H H    . ASN A 1 28 ? -11.357 -4.965  3.055   1.00 0.00 ? 319 ASN A H    1  
ATOM 382   H HA   . ASN A 1 28 ? -13.932 -4.886  4.334   1.00 0.00 ? 319 ASN A HA   1  
ATOM 383   H HB2  . ASN A 1 28 ? -11.922 -7.139  4.419   1.00 0.00 ? 319 ASN A HB2  1  
ATOM 384   H HD21 . ASN A 1 28 ? -11.879 -8.595  2.751   1.00 0.00 ? 319 ASN A HD21 1  
ATOM 385   H HD22 . ASN A 1 28 ? -12.539 -8.259  1.191   1.00 0.00 ? 319 ASN A HD22 1  
ATOM 386   N N    . ASN A 1 29 ? -11.176 -5.086  6.129   1.00 0.00 ? 320 ASN A N    1  
ATOM 387   C CA   . ASN A 1 29 ? -10.625 -4.885  7.465   1.00 0.00 ? 320 ASN A CA   1  
ATOM 388   C C    . ASN A 1 29 ? -10.148 -3.447  7.653   1.00 0.00 ? 320 ASN A C    1  
ATOM 389   O O    . ASN A 1 29 ? -9.996  -2.979  8.781   1.00 0.00 ? 320 ASN A O    1  
ATOM 390   C CB   . ASN A 1 29 ? -9.464  -5.850  7.715   1.00 0.00 ? 320 ASN A CB   1  
ATOM 391   C CG   . ASN A 1 29 ? -9.877  -7.301  7.576   1.00 0.00 ? 320 ASN A CG   1  
ATOM 392   O OD1  . ASN A 1 29 ? -10.897 -7.723  8.122   1.00 0.00 ? 320 ASN A OD1  1  
ATOM 393   N ND2  . ASN A 1 29 ? -9.083  -8.071  6.845   1.00 0.00 ? 320 ASN A ND2  1  
ATOM 394   H H    . ASN A 1 29 ? -10.568 -5.277  5.385   1.00 0.00 ? 320 ASN A H    1  
ATOM 395   H HA   . ASN A 1 29 ? -11.408 -5.088  8.180   1.00 0.00 ? 320 ASN A HA   1  
ATOM 396   H HB2  . ASN A 1 29 ? -8.676  -5.653  7.002   1.00 0.00 ? 320 ASN A HB2  1  
ATOM 397   H HD21 . ASN A 1 29 ? -8.287  -7.666  6.442   1.00 0.00 ? 320 ASN A HD21 1  
ATOM 398   H HD22 . ASN A 1 29 ? -9.325  -9.013  6.738   1.00 0.00 ? 320 ASN A HD22 1  
ATOM 399   N N    . ARG A 1 30 ? -9.914  -2.750  6.544   1.00 0.00 ? 321 ARG A N    1  
ATOM 400   C CA   . ARG A 1 30 ? -9.454  -1.367  6.590   1.00 0.00 ? 321 ARG A CA   1  
ATOM 401   C C    . ARG A 1 30 ? -8.011  -1.292  7.079   1.00 0.00 ? 321 ARG A C    1  
ATOM 402   O O    . ARG A 1 30 ? -7.716  -0.637  8.079   1.00 0.00 ? 321 ARG A O    1  
ATOM 403   C CB   . ARG A 1 30 ? -10.361 -0.533  7.497   1.00 0.00 ? 321 ARG A CB   1  
ATOM 404   C CG   . ARG A 1 30 ? -11.841 -0.700  7.191   1.00 0.00 ? 321 ARG A CG   1  
ATOM 405   C CD   . ARG A 1 30 ? -12.582 -1.348  8.351   1.00 0.00 ? 321 ARG A CD   1  
ATOM 406   N NE   . ARG A 1 30 ? -13.341 -0.375  9.130   1.00 0.00 ? 321 ARG A NE   1  
ATOM 407   C CZ   . ARG A 1 30 ? -14.395 0.286   8.660   1.00 0.00 ? 321 ARG A CZ   1  
ATOM 408   N NH1  . ARG A 1 30 ? -14.809 0.080   7.418   1.00 0.00 ? 321 ARG A NH1  1  
ATOM 409   N NH2  . ARG A 1 30 ? -15.034 1.154   9.432   1.00 0.00 ? 321 ARG A NH2  1  
ATOM 410   H H    . ARG A 1 30 ? -10.054 -3.174  5.672   1.00 0.00 ? 321 ARG A H    1  
ATOM 411   H HA   . ARG A 1 30 ? -9.501  -0.969  5.588   1.00 0.00 ? 321 ARG A HA   1  
ATOM 412   H HB2  . ARG A 1 30 ? -10.193 -0.823  8.524   1.00 0.00 ? 321 ARG A HB2  1  
ATOM 413   H HG2  . ARG A 1 30 ? -12.271 0.272   7.003   1.00 0.00 ? 321 ARG A HG2  1  
ATOM 414   H HD2  . ARG A 1 30 ? -13.262 -2.089  7.956   1.00 0.00 ? 321 ARG A HD2  1  
ATOM 415   H HE   . ARG A 1 30 ? -13.051 -0.206  10.051  1.00 0.00 ? 321 ARG A HE   1  
ATOM 416   H HH11 . ARG A 1 30 ? -14.327 -0.573  6.833   1.00 0.00 ? 321 ARG A HH11 1  
ATOM 417   H HH12 . ARG A 1 30 ? -15.601 0.579   7.066   1.00 0.00 ? 321 ARG A HH12 1  
ATOM 418   H HH21 . ARG A 1 30 ? -14.725 1.313   10.370  1.00 0.00 ? 321 ARG A HH21 1  
ATOM 419   H HH22 . ARG A 1 30 ? -15.826 1.651   9.077   1.00 0.00 ? 321 ARG A HH22 1  
ATOM 420   N N    . THR A 1 31 ? -7.116  -1.969  6.366   1.00 0.00 ? 322 THR A N    1  
ATOM 421   C CA   . THR A 1 31 ? -5.702  -1.982  6.721   1.00 0.00 ? 322 THR A CA   1  
ATOM 422   C C    . THR A 1 31 ? -4.828  -2.048  5.476   1.00 0.00 ? 322 THR A C    1  
ATOM 423   O O    . THR A 1 31 ? -5.292  -1.791  4.365   1.00 0.00 ? 322 THR A O    1  
ATOM 424   C CB   . THR A 1 31 ? -5.362  -3.169  7.641   1.00 0.00 ? 322 THR A CB   1  
ATOM 425   O OG1  . THR A 1 31 ? -3.992  -3.094  8.053   1.00 0.00 ? 322 THR A OG1  1  
ATOM 426   C CG2  . THR A 1 31 ? -5.609  -4.492  6.932   1.00 0.00 ? 322 THR A CG2  1  
ATOM 427   H H    . THR A 1 31 ? -7.416  -2.473  5.581   1.00 0.00 ? 322 THR A H    1  
ATOM 428   H HA   . THR A 1 31 ? -5.483  -1.067  7.251   1.00 0.00 ? 322 THR A HA   1  
ATOM 429   H HB   . THR A 1 31 ? -5.996  -3.122  8.514   1.00 0.00 ? 322 THR A HB   1  
ATOM 430   H HG1  . THR A 1 31 ? -3.951  -2.938  9.000   1.00 0.00 ? 322 THR A HG1  1  
ATOM 431   H HG21 . THR A 1 31 ? -4.961  -5.250  7.349   1.00 0.00 ? 322 THR A HG21 1  
ATOM 432   H HG22 . THR A 1 31 ? -5.403  -4.381  5.878   1.00 0.00 ? 322 THR A HG22 1  
ATOM 433   H HG23 . THR A 1 31 ? -6.640  -4.786  7.068   1.00 0.00 ? 322 THR A HG23 1  
ATOM 434   N N    . THR A 1 32 ? -3.559  -2.393  5.666   1.00 0.00 ? 323 THR A N    1  
ATOM 435   C CA   . THR A 1 32 ? -2.624  -2.488  4.553   1.00 0.00 ? 323 THR A CA   1  
ATOM 436   C C    . THR A 1 32 ? -1.674  -3.666  4.725   1.00 0.00 ? 323 THR A C    1  
ATOM 437   O O    . THR A 1 32 ? -1.691  -4.349  5.749   1.00 0.00 ? 323 THR A O    1  
ATOM 438   C CB   . THR A 1 32 ? -1.798  -1.199  4.397   1.00 0.00 ? 323 THR A CB   1  
ATOM 439   O OG1  . THR A 1 32 ? -1.371  -0.735  5.684   1.00 0.00 ? 323 THR A OG1  1  
ATOM 440   C CG2  . THR A 1 32 ? -2.621  -0.116  3.709   1.00 0.00 ? 323 THR A CG2  1  
ATOM 441   H H    . THR A 1 32 ? -3.247  -2.590  6.573   1.00 0.00 ? 323 THR A H    1  
ATOM 442   H HA   . THR A 1 32 ? -3.201  -2.631  3.653   1.00 0.00 ? 323 THR A HA   1  
ATOM 443   H HB   . THR A 1 32 ? -0.923  -1.414  3.789   1.00 0.00 ? 323 THR A HB   1  
ATOM 444   H HG1  . THR A 1 32 ? -2.139  -0.574  6.238   1.00 0.00 ? 323 THR A HG1  1  
ATOM 445   H HG21 . THR A 1 32 ? -2.448  0.835   4.194   1.00 0.00 ? 323 THR A HG21 1  
ATOM 446   H HG22 . THR A 1 32 ? -3.673  -0.366  3.773   1.00 0.00 ? 323 THR A HG22 1  
ATOM 447   H HG23 . THR A 1 32 ? -2.331  -0.050  2.671   1.00 0.00 ? 323 THR A HG23 1  
ATOM 448   N N    . GLN A 1 33 ? -0.844  -3.897  3.713   1.00 0.00 ? 324 GLN A N    1  
ATOM 449   C CA   . GLN A 1 33 ? 0.118   -4.991  3.746   1.00 0.00 ? 324 GLN A CA   1  
ATOM 450   C C    . GLN A 1 33 ? 0.809   -5.145  2.398   1.00 0.00 ? 324 GLN A C    1  
ATOM 451   O O    . GLN A 1 33 ? 0.157   -5.336  1.374   1.00 0.00 ? 324 GLN A O    1  
ATOM 452   C CB   . GLN A 1 33 ? -0.569  -6.306  4.126   1.00 0.00 ? 324 GLN A CB   1  
ATOM 453   C CG   . GLN A 1 33 ? -1.974  -6.449  3.562   1.00 0.00 ? 324 GLN A CG   1  
ATOM 454   C CD   . GLN A 1 33 ? -2.121  -7.637  2.631   1.00 0.00 ? 324 GLN A CD   1  
ATOM 455   O OE1  . GLN A 1 33 ? -2.596  -7.501  1.503   1.00 0.00 ? 324 GLN A OE1  1  
ATOM 456   N NE2  . GLN A 1 33 ? -1.717  -8.807  3.099   1.00 0.00 ? 324 GLN A NE2  1  
ATOM 457   H H    . GLN A 1 33 ? -0.883  -3.316  2.924   1.00 0.00 ? 324 GLN A H    1  
ATOM 458   H HA   . GLN A 1 33 ? 0.862   -4.756  4.493   1.00 0.00 ? 324 GLN A HA   1  
ATOM 459   H HB2  . GLN A 1 33 ? 0.026   -7.129  3.758   1.00 0.00 ? 324 GLN A HB2  1  
ATOM 460   H HG2  . GLN A 1 33 ? -2.663  -6.567  4.383   1.00 0.00 ? 324 GLN A HG2  1  
ATOM 461   H HE21 . GLN A 1 33 ? -1.350  -8.839  4.004   1.00 0.00 ? 324 GLN A HE21 1  
ATOM 462   H HE22 . GLN A 1 33 ? -1.806  -9.593  2.521   1.00 0.00 ? 324 GLN A HE22 1  
ATOM 463   N N    . PHE A 1 34 ? 2.133   -5.076  2.409   1.00 0.00 ? 325 PHE A N    1  
ATOM 464   C CA   . PHE A 1 34 ? 2.911   -5.215  1.185   1.00 0.00 ? 325 PHE A CA   1  
ATOM 465   C C    . PHE A 1 34 ? 2.678   -6.587  0.569   1.00 0.00 ? 325 PHE A C    1  
ATOM 466   O O    . PHE A 1 34 ? 2.942   -6.804  -0.613  1.00 0.00 ? 325 PHE A O    1  
ATOM 467   C CB   . PHE A 1 34 ? 4.403   -5.026  1.475   1.00 0.00 ? 325 PHE A CB   1  
ATOM 468   C CG   . PHE A 1 34 ? 4.873   -3.583  1.503   1.00 0.00 ? 325 PHE A CG   1  
ATOM 469   C CD1  . PHE A 1 34 ? 3.995   -2.527  1.272   1.00 0.00 ? 325 PHE A CD1  1  
ATOM 470   C CD2  . PHE A 1 34 ? 6.204   -3.286  1.747   1.00 0.00 ? 325 PHE A CD2  1  
ATOM 471   C CE1  . PHE A 1 34 ? 4.439   -1.217  1.289   1.00 0.00 ? 325 PHE A CE1  1  
ATOM 472   C CE2  . PHE A 1 34 ? 6.650   -1.980  1.760   1.00 0.00 ? 325 PHE A CE2  1  
ATOM 473   C CZ   . PHE A 1 34 ? 5.766   -0.946  1.529   1.00 0.00 ? 325 PHE A CZ   1  
ATOM 474   H H    . PHE A 1 34 ? 2.598   -4.961  3.261   1.00 0.00 ? 325 PHE A H    1  
ATOM 475   H HA   . PHE A 1 34 ? 2.583   -4.465  0.487   1.00 0.00 ? 325 PHE A HA   1  
ATOM 476   H HB2  . PHE A 1 34 ? 4.628   -5.468  2.435   1.00 0.00 ? 325 PHE A HB2  1  
ATOM 477   H HD1  . PHE A 1 34 ? 2.958   -2.732  1.093   1.00 0.00 ? 325 PHE A HD1  1  
ATOM 478   H HD2  . PHE A 1 34 ? 6.900   -4.089  1.933   1.00 0.00 ? 325 PHE A HD2  1  
ATOM 479   H HE1  . PHE A 1 34 ? 3.745   -0.405  1.115   1.00 0.00 ? 325 PHE A HE1  1  
ATOM 480   H HE2  . PHE A 1 34 ? 7.688   -1.768  1.955   1.00 0.00 ? 325 PHE A HE2  1  
ATOM 481   H HZ   . PHE A 1 34 ? 6.115   0.076   1.540   1.00 0.00 ? 325 PHE A HZ   1  
ATOM 482   N N    . THR A 1 35 ? 2.180   -7.508  1.384   1.00 0.00 ? 326 THR A N    1  
ATOM 483   C CA   . THR A 1 35 ? 1.904   -8.856  0.935   1.00 0.00 ? 326 THR A CA   1  
ATOM 484   C C    . THR A 1 35 ? 0.627   -8.921  0.112   1.00 0.00 ? 326 THR A C    1  
ATOM 485   O O    . THR A 1 35 ? -0.236  -8.048  0.211   1.00 0.00 ? 326 THR A O    1  
ATOM 486   C CB   . THR A 1 35 ? 1.769   -9.806  2.130   1.00 0.00 ? 326 THR A CB   1  
ATOM 487   O OG1  . THR A 1 35 ? 2.376   -9.227  3.291   1.00 0.00 ? 326 THR A OG1  1  
ATOM 488   C CG2  . THR A 1 35 ? 2.424   -11.135 1.821   1.00 0.00 ? 326 THR A CG2  1  
ATOM 489   H H    . THR A 1 35 ? 1.999   -7.280  2.317   1.00 0.00 ? 326 THR A H    1  
ATOM 490   H HA   . THR A 1 35 ? 2.735   -9.185  0.329   1.00 0.00 ? 326 THR A HA   1  
ATOM 491   H HB   . THR A 1 35 ? 0.718   -9.972  2.324   1.00 0.00 ? 326 THR A HB   1  
ATOM 492   H HG1  . THR A 1 35 ? 3.325   -9.166  3.160   1.00 0.00 ? 326 THR A HG1  1  
ATOM 493   H HG21 . THR A 1 35 ? 1.816   -11.678 1.112   1.00 0.00 ? 326 THR A HG21 1  
ATOM 494   H HG22 . THR A 1 35 ? 2.522   -11.709 2.730   1.00 0.00 ? 326 THR A HG22 1  
ATOM 495   H HG23 . THR A 1 35 ? 3.402   -10.958 1.398   1.00 0.00 ? 326 THR A HG23 1  
ATOM 496   N N    . ASP A 1 36 ? 0.512   -9.965  -0.698  1.00 0.00 ? 327 ASP A N    1  
ATOM 497   C CA   . ASP A 1 36 ? -0.666  -10.159 -1.528  1.00 0.00 ? 327 ASP A CA   1  
ATOM 498   C C    . ASP A 1 36 ? -1.488  -11.329 -0.996  1.00 0.00 ? 327 ASP A C    1  
ATOM 499   O O    . ASP A 1 36 ? -1.005  -12.460 -0.956  1.00 0.00 ? 327 ASP A O    1  
ATOM 500   C CB   . ASP A 1 36 ? -0.259  -10.424 -2.979  1.00 0.00 ? 327 ASP A CB   1  
ATOM 501   C CG   . ASP A 1 36 ? -1.453  -10.491 -3.911  1.00 0.00 ? 327 ASP A CG   1  
ATOM 502   O OD1  . ASP A 1 36 ? -2.582  -10.226 -3.448  1.00 0.00 ? 327 ASP A OD1  1  
ATOM 503   O OD2  . ASP A 1 36 ? -1.259  -10.808 -5.103  1.00 0.00 ? 327 ASP A OD2  1  
ATOM 504   H H    . ASP A 1 36 ? 1.237   -10.623 -0.739  1.00 0.00 ? 327 ASP A H    1  
ATOM 505   H HA   . ASP A 1 36 ? -1.253  -9.257  -1.485  1.00 0.00 ? 327 ASP A HA   1  
ATOM 506   H HB2  . ASP A 1 36 ? 0.393   -9.631  -3.315  1.00 0.00 ? 327 ASP A HB2  1  
ATOM 507   N N    . PRO A 1 37 ? -2.742  -11.084 -0.578  1.00 0.00 ? 328 PRO A N    1  
ATOM 508   C CA   . PRO A 1 37 ? -3.602  -12.138 -0.043  1.00 0.00 ? 328 PRO A CA   1  
ATOM 509   C C    . PRO A 1 37 ? -3.680  -13.324 -0.990  1.00 0.00 ? 328 PRO A C    1  
ATOM 510   O O    . PRO A 1 37 ? -3.968  -14.448 -0.577  1.00 0.00 ? 328 PRO A O    1  
ATOM 511   C CB   . PRO A 1 37 ? -4.975  -11.470 0.101   1.00 0.00 ? 328 PRO A CB   1  
ATOM 512   C CG   . PRO A 1 37 ? -4.874  -10.188 -0.655  1.00 0.00 ? 328 PRO A CG   1  
ATOM 513   C CD   . PRO A 1 37 ? -3.429  -9.788  -0.613  1.00 0.00 ? 328 PRO A CD   1  
ATOM 514   H HA   . PRO A 1 37 ? -3.256  -12.473 0.925   1.00 0.00 ? 328 PRO A HA   1  
ATOM 515   H HB2  . PRO A 1 37 ? -5.735  -12.113 -0.316  1.00 0.00 ? 328 PRO A HB2  1  
ATOM 516   H HG2  . PRO A 1 37 ? -5.190  -10.340 -1.676  1.00 0.00 ? 328 PRO A HG2  1  
ATOM 517   H HD2  . PRO A 1 37 ? -3.170  -9.232  -1.500  1.00 0.00 ? 328 PRO A HD2  1  
ATOM 518   N N    . ARG A 1 38 ? -3.425  -13.063 -2.268  1.00 0.00 ? 329 ARG A N    1  
ATOM 519   C CA   . ARG A 1 38 ? -3.453  -14.110 -3.275  1.00 0.00 ? 329 ARG A CA   1  
ATOM 520   C C    . ARG A 1 38 ? -2.346  -15.123 -3.007  1.00 0.00 ? 329 ARG A C    1  
ATOM 521   O O    . ARG A 1 38 ? -2.497  -16.314 -3.281  1.00 0.00 ? 329 ARG A O    1  
ATOM 522   C CB   . ARG A 1 38 ? -3.285  -13.513 -4.673  1.00 0.00 ? 329 ARG A CB   1  
ATOM 523   C CG   . ARG A 1 38 ? -4.321  -12.454 -5.016  1.00 0.00 ? 329 ARG A CG   1  
ATOM 524   C CD   . ARG A 1 38 ? -4.053  -11.833 -6.378  1.00 0.00 ? 329 ARG A CD   1  
ATOM 525   N NE   . ARG A 1 38 ? -3.565  -12.816 -7.340  1.00 0.00 ? 329 ARG A NE   1  
ATOM 526   C CZ   . ARG A 1 38 ? -4.351  -13.685 -7.966  1.00 0.00 ? 329 ARG A CZ   1  
ATOM 527   N NH1  . ARG A 1 38 ? -5.658  -13.681 -7.741  1.00 0.00 ? 329 ARG A NH1  1  
ATOM 528   N NH2  . ARG A 1 38 ? -3.831  -14.560 -8.817  1.00 0.00 ? 329 ARG A NH2  1  
ATOM 529   H H    . ARG A 1 38 ? -3.214  -12.146 -2.538  1.00 0.00 ? 329 ARG A H    1  
ATOM 530   H HA   . ARG A 1 38 ? -4.410  -14.603 -3.211  1.00 0.00 ? 329 ARG A HA   1  
ATOM 531   H HB2  . ARG A 1 38 ? -2.306  -13.063 -4.744  1.00 0.00 ? 329 ARG A HB2  1  
ATOM 532   H HG2  . ARG A 1 38 ? -5.299  -12.912 -5.026  1.00 0.00 ? 329 ARG A HG2  1  
ATOM 533   H HD2  . ARG A 1 38 ? -4.971  -11.404 -6.750  1.00 0.00 ? 329 ARG A HD2  1  
ATOM 534   H HE   . ARG A 1 38 ? -2.603  -12.832 -7.526  1.00 0.00 ? 329 ARG A HE   1  
ATOM 535   H HH11 . ARG A 1 38 ? -6.053  -13.022 -7.100  1.00 0.00 ? 329 ARG A HH11 1  
ATOM 536   H HH12 . ARG A 1 38 ? -6.248  -14.335 -8.212  1.00 0.00 ? 329 ARG A HH12 1  
ATOM 537   H HH21 . ARG A 1 38 ? -2.846  -14.564 -8.990  1.00 0.00 ? 329 ARG A HH21 1  
ATOM 538   H HH22 . ARG A 1 38 ? -4.425  -15.214 -9.285  1.00 0.00 ? 329 ARG A HH22 1  
ATOM 539   N N    . LEU A 1 39 ? -1.231  -14.634 -2.470  1.00 0.00 ? 330 LEU A N    1  
ATOM 540   C CA   . LEU A 1 39 ? -0.091  -15.485 -2.155  1.00 0.00 ? 330 LEU A CA   1  
ATOM 541   C C    . LEU A 1 39 ? -0.408  -16.399 -0.977  1.00 0.00 ? 330 LEU A C    1  
ATOM 542   O O    . LEU A 1 39 ? -0.316  -17.622 -1.083  1.00 0.00 ? 330 LEU A O    1  
ATOM 543   C CB   . LEU A 1 39 ? 1.137   -14.629 -1.834  1.00 0.00 ? 330 LEU A CB   1  
ATOM 544   C CG   . LEU A 1 39 ? 1.758   -13.909 -3.032  1.00 0.00 ? 330 LEU A CG   1  
ATOM 545   C CD1  . LEU A 1 39 ? 2.825   -12.928 -2.568  1.00 0.00 ? 330 LEU A CD1  1  
ATOM 546   C CD2  . LEU A 1 39 ? 2.345   -14.913 -4.011  1.00 0.00 ? 330 LEU A CD2  1  
ATOM 547   H H    . LEU A 1 39 ? -1.176  -13.674 -2.280  1.00 0.00 ? 330 LEU A H    1  
ATOM 548   H HA   . LEU A 1 39 ? 0.121   -16.090 -3.022  1.00 0.00 ? 330 LEU A HA   1  
ATOM 549   H HB2  . LEU A 1 39 ? 0.851   -13.888 -1.102  1.00 0.00 ? 330 LEU A HB2  1  
ATOM 550   H HG   . LEU A 1 39 ? 0.990   -13.349 -3.544  1.00 0.00 ? 330 LEU A HG   1  
ATOM 551   H HD11 . LEU A 1 39 ? 2.914   -12.975 -1.494  1.00 0.00 ? 330 LEU A HD11 1  
ATOM 552   H HD12 . LEU A 1 39 ? 3.771   -13.185 -3.021  1.00 0.00 ? 330 LEU A HD12 1  
ATOM 553   H HD13 . LEU A 1 39 ? 2.545   -11.928 -2.863  1.00 0.00 ? 330 LEU A HD13 1  
ATOM 554   H HD21 . LEU A 1 39 ? 2.573   -14.417 -4.943  1.00 0.00 ? 330 LEU A HD21 1  
ATOM 555   H HD22 . LEU A 1 39 ? 3.249   -15.334 -3.598  1.00 0.00 ? 330 LEU A HD22 1  
ATOM 556   H HD23 . LEU A 1 39 ? 1.630   -15.703 -4.189  1.00 0.00 ? 330 LEU A HD23 1  
ATOM 557   N N    . SER A 1 40 ? -0.782  -15.796 0.148   1.00 0.00 ? 331 SER A N    1  
ATOM 558   C CA   . SER A 1 40 ? -1.117  -16.555 1.348   1.00 0.00 ? 331 SER A CA   1  
ATOM 559   C C    . SER A 1 40 ? -2.625  -16.585 1.568   1.00 0.00 ? 331 SER A C    1  
ATOM 560   O O    . SER A 1 40 ? -3.197  -15.661 2.145   1.00 0.00 ? 331 SER A O    1  
ATOM 561   C CB   . SER A 1 40 ? -0.425  -15.946 2.570   1.00 0.00 ? 331 SER A CB   1  
ATOM 562   O OG   . SER A 1 40 ? -0.297  -14.541 2.437   1.00 0.00 ? 331 SER A OG   1  
ATOM 563   H H    . SER A 1 40 ? -0.835  -14.818 0.170   1.00 0.00 ? 331 SER A H    1  
ATOM 564   H HA   . SER A 1 40 ? -0.763  -17.565 1.212   1.00 0.00 ? 331 SER A HA   1  
ATOM 565   H HB2  . SER A 1 40 ? -1.006  -16.159 3.454   1.00 0.00 ? 331 SER A HB2  1  
ATOM 566   H HG   . SER A 1 40 ? 0.321   -14.339 1.730   1.00 0.00 ? 331 SER A HG   1  
ATOM 567   N N    . ALA A 1 41 ? -3.266  -17.654 1.106   1.00 0.00 ? 332 ALA A N    1  
ATOM 568   C CA   . ALA A 1 41 ? -4.709  -17.803 1.253   1.00 0.00 ? 332 ALA A CA   1  
ATOM 569   C C    . ALA A 1 41 ? -5.077  -19.233 1.634   1.00 0.00 ? 332 ALA A C    1  
ATOM 570   O O    . ALA A 1 41 ? -4.204  -20.073 1.845   1.00 0.00 ? 332 ALA A O    1  
ATOM 571   C CB   . ALA A 1 41 ? -5.415  -17.399 -0.036  1.00 0.00 ? 332 ALA A CB   1  
ATOM 572   H H    . ALA A 1 41 ? -2.756  -18.359 0.654   1.00 0.00 ? 332 ALA A H    1  
ATOM 573   H HA   . ALA A 1 41 ? -5.033  -17.136 2.041   1.00 0.00 ? 332 ALA A HA   1  
ATOM 574   H HB1  . ALA A 1 41 ? -5.408  -18.232 -0.725  1.00 0.00 ? 332 ALA A HB1  1  
ATOM 575   H HB2  . ALA A 1 41 ? -6.437  -17.121 0.181   1.00 0.00 ? 332 ALA A HB2  1  
ATOM 576   H HB3  . ALA A 1 41 ? -4.901  -16.560 -0.482  1.00 0.00 ? 332 ALA A HB3  1  
ATOM 577   N N    . ASN A 1 42 ? -6.377  -19.500 1.722   1.00 0.00 ? 333 ASN A N    1  
ATOM 578   C CA   . ASN A 1 42 ? -6.862  -20.829 2.078   1.00 0.00 ? 333 ASN A CA   1  
ATOM 579   C C    . ASN A 1 42 ? -7.970  -21.275 1.130   1.00 0.00 ? 333 ASN A C    1  
ATOM 580   O O    . ASN A 1 42 ? -8.964  -20.532 0.990   1.00 0.00 ? 333 ASN A O    1  
ATOM 581   C CB   . ASN A 1 42 ? -7.374  -20.840 3.519   1.00 0.00 ? 333 ASN A CB   1  
ATOM 582   C CG   . ASN A 1 42 ? -6.579  -21.776 4.408   1.00 0.00 ? 333 ASN A CG   1  
ATOM 583   O OD1  . ASN A 1 42 ? -5.566  -22.336 3.988   1.00 0.00 ? 333 ASN A OD1  1  
ATOM 584   N ND2  . ASN A 1 42 ? -7.035  -21.951 5.643   1.00 0.00 ? 333 ASN A ND2  1  
ATOM 585   O OXT  . ASN A 1 42 ? -7.834  -22.364 0.533   1.00 0.00 ? 333 ASN A OXT  1  
ATOM 586   H H    . ASN A 1 42 ? -7.025  -18.786 1.545   1.00 0.00 ? 333 ASN A H    1  
ATOM 587   H HA   . ASN A 1 42 ? -6.034  -21.517 1.994   1.00 0.00 ? 333 ASN A HA   1  
ATOM 588   H HB2  . ASN A 1 42 ? -7.307  -19.842 3.926   1.00 0.00 ? 333 ASN A HB2  1  
ATOM 589   H HD21 . ASN A 1 42 ? -7.849  -21.473 5.908   1.00 0.00 ? 333 ASN A HD21 1  
ATOM 590   H HD22 . ASN A 1 42 ? -6.540  -22.552 6.239   1.00 0.00 ? 333 ASN A HD22 1  
ATOM 591   N N    . GLY B 2 1  ? 22.953  -13.636 16.458  1.00 0.00 ? 198 GLY B N    1  
ATOM 592   C CA   . GLY B 2 1  ? 21.658  -12.901 16.440  1.00 0.00 ? 198 GLY B CA   1  
ATOM 593   C C    . GLY B 2 1  ? 21.427  -12.164 15.134  1.00 0.00 ? 198 GLY B C    1  
ATOM 594   O O    . GLY B 2 1  ? 21.296  -10.940 15.125  1.00 0.00 ? 198 GLY B O    1  
ATOM 595   H H1   . GLY B 2 1  ? 23.600  -13.238 15.748  1.00 0.00 ? 198 GLY B H1   1  
ATOM 596   H H2   . GLY B 2 1  ? 22.796  -14.642 16.243  1.00 0.00 ? 198 GLY B H2   1  
ATOM 597   H H3   . GLY B 2 1  ? 23.395  -13.559 17.397  1.00 0.00 ? 198 GLY B H3   1  
ATOM 598   H HA2  . GLY B 2 1  ? 20.854  -13.605 16.591  1.00 0.00 ? 198 GLY B HA2  1  
ATOM 599   H HA3  . GLY B 2 1  ? 21.652  -12.186 17.249  1.00 0.00 ? 198 GLY B HA3  1  
ATOM 600   N N    . PRO B 2 2  ? 21.371  -12.892 14.005  1.00 0.00 ? 199 PRO B N    1  
ATOM 601   C CA   . PRO B 2 2  ? 21.151  -12.290 12.687  1.00 0.00 ? 199 PRO B CA   1  
ATOM 602   C C    . PRO B 2 2  ? 19.692  -11.912 12.463  1.00 0.00 ? 199 PRO B C    1  
ATOM 603   O O    . PRO B 2 2  ? 19.062  -12.371 11.509  1.00 0.00 ? 199 PRO B O    1  
ATOM 604   C CB   . PRO B 2 2  ? 21.570  -13.402 11.727  1.00 0.00 ? 199 PRO B CB   1  
ATOM 605   C CG   . PRO B 2 2  ? 21.280  -14.661 12.468  1.00 0.00 ? 199 PRO B CG   1  
ATOM 606   C CD   . PRO B 2 2  ? 21.519  -14.358 13.924  1.00 0.00 ? 199 PRO B CD   1  
ATOM 607   H HA   . PRO B 2 2  ? 21.778  -11.422 12.538  1.00 0.00 ? 199 PRO B HA   1  
ATOM 608   H HB2  . PRO B 2 2  ? 20.991  -13.333 10.818  1.00 0.00 ? 199 PRO B HB2  1  
ATOM 609   H HG2  . PRO B 2 2  ? 20.251  -14.951 12.309  1.00 0.00 ? 199 PRO B HG2  1  
ATOM 610   H HD2  . PRO B 2 2  ? 20.781  -14.852 14.537  1.00 0.00 ? 199 PRO B HD2  1  
ATOM 611   N N    . LEU B 2 3  ? 19.160  -11.071 13.344  1.00 0.00 ? 200 LEU B N    1  
ATOM 612   C CA   . LEU B 2 3  ? 17.771  -10.637 13.241  1.00 0.00 ? 200 LEU B CA   1  
ATOM 613   C C    . LEU B 2 3  ? 17.547  -9.811  11.978  1.00 0.00 ? 200 LEU B C    1  
ATOM 614   O O    . LEU B 2 3  ? 17.704  -8.589  11.988  1.00 0.00 ? 200 LEU B O    1  
ATOM 615   C CB   . LEU B 2 3  ? 17.376  -9.822  14.473  1.00 0.00 ? 200 LEU B CB   1  
ATOM 616   C CG   . LEU B 2 3  ? 16.859  -10.646 15.653  1.00 0.00 ? 200 LEU B CG   1  
ATOM 617   C CD1  . LEU B 2 3  ? 17.425  -10.117 16.962  1.00 0.00 ? 200 LEU B CD1  1  
ATOM 618   C CD2  . LEU B 2 3  ? 15.338  -10.635 15.686  1.00 0.00 ? 200 LEU B CD2  1  
ATOM 619   H H    . LEU B 2 3  ? 19.713  -10.736 14.079  1.00 0.00 ? 200 LEU B H    1  
ATOM 620   H HA   . LEU B 2 3  ? 17.152  -11.520 13.191  1.00 0.00 ? 200 LEU B HA   1  
ATOM 621   H HB2  . LEU B 2 3  ? 18.239  -9.261  14.801  1.00 0.00 ? 200 LEU B HB2  1  
ATOM 622   H HG   . LEU B 2 3  ? 17.184  -11.670 15.540  1.00 0.00 ? 200 LEU B HG   1  
ATOM 623   H HD11 . LEU B 2 3  ? 17.226  -9.058  17.038  1.00 0.00 ? 200 LEU B HD11 1  
ATOM 624   H HD12 . LEU B 2 3  ? 16.959  -10.632 17.789  1.00 0.00 ? 200 LEU B HD12 1  
ATOM 625   H HD13 . LEU B 2 3  ? 18.492  -10.286 16.988  1.00 0.00 ? 200 LEU B HD13 1  
ATOM 626   H HD21 . LEU B 2 3  ? 14.999  -9.913  16.413  1.00 0.00 ? 200 LEU B HD21 1  
ATOM 627   H HD22 . LEU B 2 3  ? 14.960  -10.367 14.710  1.00 0.00 ? 200 LEU B HD22 1  
ATOM 628   H HD23 . LEU B 2 3  ? 14.976  -11.617 15.955  1.00 0.00 ? 200 LEU B HD23 1  
ATOM 629   N N    . GLY B 2 4  ? 17.178  -10.485 10.894  1.00 0.00 ? 201 GLY B N    1  
ATOM 630   C CA   . GLY B 2 4  ? 16.936  -9.796  9.640   1.00 0.00 ? 201 GLY B CA   1  
ATOM 631   C C    . GLY B 2 4  ? 15.505  -9.944  9.163   1.00 0.00 ? 201 GLY B C    1  
ATOM 632   O O    . GLY B 2 4  ? 15.030  -11.057 8.937   1.00 0.00 ? 201 GLY B O    1  
ATOM 633   H H    . GLY B 2 4  ? 17.070  -11.457 10.946  1.00 0.00 ? 201 GLY B H    1  
ATOM 634   H HA2  . GLY B 2 4  ? 17.154  -8.746  9.769   1.00 0.00 ? 201 GLY B HA2  1  
ATOM 635   H HA3  . GLY B 2 4  ? 17.598  -10.199 8.887   1.00 0.00 ? 201 GLY B HA3  1  
ATOM 636   N N    . SER B 2 5  ? 14.814  -8.819  9.011   1.00 0.00 ? 202 SER B N    1  
ATOM 637   C CA   . SER B 2 5  ? 13.428  -8.828  8.559   1.00 0.00 ? 202 SER B CA   1  
ATOM 638   C C    . SER B 2 5  ? 13.129  -7.610  7.692   1.00 0.00 ? 202 SER B C    1  
ATOM 639   O O    . SER B 2 5  ? 13.363  -6.472  8.098   1.00 0.00 ? 202 SER B O    1  
ATOM 640   C CB   . SER B 2 5  ? 12.478  -8.859  9.757   1.00 0.00 ? 202 SER B CB   1  
ATOM 641   O OG   . SER B 2 5  ? 12.670  -10.030 10.532  1.00 0.00 ? 202 SER B OG   1  
ATOM 642   H H    . SER B 2 5  ? 15.246  -7.961  9.208   1.00 0.00 ? 202 SER B H    1  
ATOM 643   H HA   . SER B 2 5  ? 13.277  -9.720  7.970   1.00 0.00 ? 202 SER B HA   1  
ATOM 644   H HB2  . SER B 2 5  ? 12.660  -7.996  10.382  1.00 0.00 ? 202 SER B HB2  1  
ATOM 645   H HG   . SER B 2 5  ? 12.083  -10.010 11.292  1.00 0.00 ? 202 SER B HG   1  
ATOM 646   N N    . GLU B 2 6  ? 12.610  -7.857  6.493   1.00 0.00 ? 203 GLU B N    1  
ATOM 647   C CA   . GLU B 2 6  ? 12.279  -6.782  5.566   1.00 0.00 ? 203 GLU B CA   1  
ATOM 648   C C    . GLU B 2 6  ? 10.769  -6.638  5.416   1.00 0.00 ? 203 GLU B C    1  
ATOM 649   O O    . GLU B 2 6  ? 10.020  -7.594  5.624   1.00 0.00 ? 203 GLU B O    1  
ATOM 650   C CB   . GLU B 2 6  ? 12.914  -7.046  4.200   1.00 0.00 ? 203 GLU B CB   1  
ATOM 651   C CG   . GLU B 2 6  ? 12.937  -5.826  3.294   1.00 0.00 ? 203 GLU B CG   1  
ATOM 652   C CD   . GLU B 2 6  ? 14.186  -5.759  2.438   1.00 0.00 ? 203 GLU B CD   1  
ATOM 653   O OE1  . GLU B 2 6  ? 15.274  -6.108  2.946   1.00 0.00 ? 203 GLU B OE1  1  
ATOM 654   O OE2  . GLU B 2 6  ? 14.079  -5.359  1.260   1.00 0.00 ? 203 GLU B OE2  1  
ATOM 655   H H    . GLU B 2 6  ? 12.446  -8.786  6.227   1.00 0.00 ? 203 GLU B H    1  
ATOM 656   H HA   . GLU B 2 6  ? 12.679  -5.864  5.967   1.00 0.00 ? 203 GLU B HA   1  
ATOM 657   H HB2  . GLU B 2 6  ? 13.930  -7.379  4.346   1.00 0.00 ? 203 GLU B HB2  1  
ATOM 658   H HG2  . GLU B 2 6  ? 12.075  -5.860  2.644   1.00 0.00 ? 203 GLU B HG2  1  
ATOM 659   N N    . LEU B 2 7  ? 10.326  -5.438  5.055   1.00 0.00 ? 204 LEU B N    1  
ATOM 660   C CA   . LEU B 2 7  ? 8.901   -5.172  4.876   1.00 0.00 ? 204 LEU B CA   1  
ATOM 661   C C    . LEU B 2 7  ? 8.137   -5.419  6.176   1.00 0.00 ? 204 LEU B C    1  
ATOM 662   O O    . LEU B 2 7  ? 8.722   -5.401  7.259   1.00 0.00 ? 204 LEU B O    1  
ATOM 663   C CB   . LEU B 2 7  ? 8.340   -6.055  3.758   1.00 0.00 ? 204 LEU B CB   1  
ATOM 664   C CG   . LEU B 2 7  ? 9.207   -6.139  2.497   1.00 0.00 ? 204 LEU B CG   1  
ATOM 665   C CD1  . LEU B 2 7  ? 8.393   -6.680  1.335   1.00 0.00 ? 204 LEU B CD1  1  
ATOM 666   C CD2  . LEU B 2 7  ? 9.790   -4.777  2.145   1.00 0.00 ? 204 LEU B CD2  1  
ATOM 667   H H    . LEU B 2 7  ? 10.974  -4.716  4.904   1.00 0.00 ? 204 LEU B H    1  
ATOM 668   H HA   . LEU B 2 7  ? 8.783   -4.136  4.593   1.00 0.00 ? 204 LEU B HA   1  
ATOM 669   H HB2  . LEU B 2 7  ? 8.211   -7.053  4.149   1.00 0.00 ? 204 LEU B HB2  1  
ATOM 670   H HG   . LEU B 2 7  ? 10.026  -6.820  2.676   1.00 0.00 ? 204 LEU B HG   1  
ATOM 671   H HD11 . LEU B 2 7  ? 8.998   -7.363  0.758   1.00 0.00 ? 204 LEU B HD11 1  
ATOM 672   H HD12 . LEU B 2 7  ? 7.525   -7.199  1.715   1.00 0.00 ? 204 LEU B HD12 1  
ATOM 673   H HD13 . LEU B 2 7  ? 8.075   -5.860  0.708   1.00 0.00 ? 204 LEU B HD13 1  
ATOM 674   H HD21 . LEU B 2 7  ? 10.627  -4.565  2.795   1.00 0.00 ? 204 LEU B HD21 1  
ATOM 675   H HD22 . LEU B 2 7  ? 10.125  -4.784  1.118   1.00 0.00 ? 204 LEU B HD22 1  
ATOM 676   H HD23 . LEU B 2 7  ? 9.033   -4.018  2.272   1.00 0.00 ? 204 LEU B HD23 1  
ATOM 677   N N    . GLU B 2 8  ? 6.830   -5.646  6.065   1.00 0.00 ? 205 GLU B N    1  
ATOM 678   C CA   . GLU B 2 8  ? 6.000   -5.891  7.239   1.00 0.00 ? 205 GLU B CA   1  
ATOM 679   C C    . GLU B 2 8  ? 6.045   -4.699  8.190   1.00 0.00 ? 205 GLU B C    1  
ATOM 680   O O    . GLU B 2 8  ? 6.360   -4.843  9.371   1.00 0.00 ? 205 GLU B O    1  
ATOM 681   C CB   . GLU B 2 8  ? 6.467   -7.157  7.964   1.00 0.00 ? 205 GLU B CB   1  
ATOM 682   C CG   . GLU B 2 8  ? 5.666   -8.397  7.600   1.00 0.00 ? 205 GLU B CG   1  
ATOM 683   C CD   . GLU B 2 8  ? 4.223   -8.314  8.058   1.00 0.00 ? 205 GLU B CD   1  
ATOM 684   O OE1  . GLU B 2 8  ? 3.826   -7.249  8.574   1.00 0.00 ? 205 GLU B OE1  1  
ATOM 685   O OE2  . GLU B 2 8  ? 3.492   -9.314  7.899   1.00 0.00 ? 205 GLU B OE2  1  
ATOM 686   H H    . GLU B 2 8  ? 6.416   -5.647  5.176   1.00 0.00 ? 205 GLU B H    1  
ATOM 687   H HA   . GLU B 2 8  ? 4.982   -6.032  6.905   1.00 0.00 ? 205 GLU B HA   1  
ATOM 688   H HB2  . GLU B 2 8  ? 7.502   -7.337  7.715   1.00 0.00 ? 205 GLU B HB2  1  
ATOM 689   H HG2  . GLU B 2 8  ? 5.681   -8.518  6.527   1.00 0.00 ? 205 GLU B HG2  1  
ATOM 690   N N    . SER B 2 9  ? 5.729   -3.520  7.662   1.00 0.00 ? 206 SER B N    1  
ATOM 691   C CA   . SER B 2 9  ? 5.737   -2.289  8.459   1.00 0.00 ? 206 SER B CA   1  
ATOM 692   C C    . SER B 2 9  ? 5.589   -1.024  7.598   1.00 0.00 ? 206 SER B C    1  
ATOM 693   O O    . SER B 2 9  ? 4.844   -0.112  7.960   1.00 0.00 ? 206 SER B O    1  
ATOM 694   C CB   . SER B 2 9  ? 7.025   -2.195  9.282   1.00 0.00 ? 206 SER B CB   1  
ATOM 695   O OG   . SER B 2 9  ? 6.757   -2.326  10.666  1.00 0.00 ? 206 SER B OG   1  
ATOM 696   H H    . SER B 2 9  ? 5.478   -3.479  6.722   1.00 0.00 ? 206 SER B H    1  
ATOM 697   H HA   . SER B 2 9  ? 4.900   -2.337  9.139   1.00 0.00 ? 206 SER B HA   1  
ATOM 698   H HB2  . SER B 2 9  ? 7.700   -2.984  8.983   1.00 0.00 ? 206 SER B HB2  1  
ATOM 699   H HG   . SER B 2 9  ? 7.199   -1.622  11.147  1.00 0.00 ? 206 SER B HG   1  
ATOM 700   N N    . PRO B 2 10 ? 6.291   -0.945  6.449   1.00 0.00 ? 207 PRO B N    1  
ATOM 701   C CA   . PRO B 2 10 ? 6.249   0.230   5.564   1.00 0.00 ? 207 PRO B CA   1  
ATOM 702   C C    . PRO B 2 10 ? 4.885   0.510   4.911   1.00 0.00 ? 207 PRO B C    1  
ATOM 703   O O    . PRO B 2 10 ? 4.535   1.676   4.729   1.00 0.00 ? 207 PRO B O    1  
ATOM 704   C CB   . PRO B 2 10 ? 7.308   -0.080  4.497   1.00 0.00 ? 207 PRO B CB   1  
ATOM 705   C CG   . PRO B 2 10 ? 8.132   -1.179  5.075   1.00 0.00 ? 207 PRO B CG   1  
ATOM 706   C CD   . PRO B 2 10 ? 7.183   -1.979  5.909   1.00 0.00 ? 207 PRO B CD   1  
ATOM 707   H HA   . PRO B 2 10 ? 6.551   1.111   6.096   1.00 0.00 ? 207 PRO B HA   1  
ATOM 708   H HB2  . PRO B 2 10 ? 6.823   -0.389  3.591   1.00 0.00 ? 207 PRO B HB2  1  
ATOM 709   H HG2  . PRO B 2 10 ? 8.546   -1.787  4.284   1.00 0.00 ? 207 PRO B HG2  1  
ATOM 710   H HD2  . PRO B 2 10 ? 6.634   -2.674  5.288   1.00 0.00 ? 207 PRO B HD2  1  
ATOM 711   N N    . PRO B 2 11 ? 4.094   -0.522  4.535   1.00 0.00 ? 208 PRO B N    1  
ATOM 712   C CA   . PRO B 2 11 ? 2.800   -0.310  3.898   1.00 0.00 ? 208 PRO B CA   1  
ATOM 713   C C    . PRO B 2 11 ? 2.019   0.848   4.504   1.00 0.00 ? 208 PRO B C    1  
ATOM 714   O O    . PRO B 2 11 ? 1.688   0.818   5.689   1.00 0.00 ? 208 PRO B O    1  
ATOM 715   C CB   . PRO B 2 11 ? 2.051   -1.614  4.139   1.00 0.00 ? 208 PRO B CB   1  
ATOM 716   C CG   . PRO B 2 11 ? 3.100   -2.653  4.337   1.00 0.00 ? 208 PRO B CG   1  
ATOM 717   C CD   . PRO B 2 11 ? 4.391   -1.953  4.680   1.00 0.00 ? 208 PRO B CD   1  
ATOM 718   H HA   . PRO B 2 11 ? 2.914   -0.160  2.844   1.00 0.00 ? 208 PRO B HA   1  
ATOM 719   H HB2  . PRO B 2 11 ? 1.421   -1.514  5.009   1.00 0.00 ? 208 PRO B HB2  1  
ATOM 720   H HG2  . PRO B 2 11 ? 2.812   -3.311  5.143   1.00 0.00 ? 208 PRO B HG2  1  
ATOM 721   H HD2  . PRO B 2 11 ? 4.666   -2.186  5.685   1.00 0.00 ? 208 PRO B HD2  1  
ATOM 722   N N    . PRO B 2 12 ? 1.754   1.904   3.712   1.00 0.00 ? 209 PRO B N    1  
ATOM 723   C CA   . PRO B 2 12 ? 0.977   3.061   4.158   1.00 0.00 ? 209 PRO B CA   1  
ATOM 724   C C    . PRO B 2 12 ? -0.304  2.648   4.883   1.00 0.00 ? 209 PRO B C    1  
ATOM 725   O O    . PRO B 2 12 ? -0.522  1.467   5.146   1.00 0.00 ? 209 PRO B O    1  
ATOM 726   C CB   . PRO B 2 12 ? 0.650   3.794   2.845   1.00 0.00 ? 209 PRO B CB   1  
ATOM 727   C CG   . PRO B 2 12 ? 1.125   2.909   1.753   1.00 0.00 ? 209 PRO B CG   1  
ATOM 728   C CD   . PRO B 2 12 ? 2.222   2.097   2.335   1.00 0.00 ? 209 PRO B CD   1  
ATOM 729   H HA   . PRO B 2 12 ? 1.560   3.705   4.799   1.00 0.00 ? 209 PRO B HA   1  
ATOM 730   H HB2  . PRO B 2 12 ? -0.407  3.941   2.771   1.00 0.00 ? 209 PRO B HB2  1  
ATOM 731   H HG2  . PRO B 2 12 ? 0.323   2.267   1.439   1.00 0.00 ? 209 PRO B HG2  1  
ATOM 732   H HD2  . PRO B 2 12 ? 2.310   1.168   1.801   1.00 0.00 ? 209 PRO B HD2  1  
ATOM 733   N N    . PRO B 2 13 ? -1.194  3.605   5.185   1.00 0.00 ? 210 PRO B N    1  
ATOM 734   C CA   . PRO B 2 13 ? -2.425  3.321   5.897   1.00 0.00 ? 210 PRO B CA   1  
ATOM 735   C C    . PRO B 2 13 ? -3.568  2.968   4.962   1.00 0.00 ? 210 PRO B C    1  
ATOM 736   O O    . PRO B 2 13 ? -3.483  3.180   3.751   1.00 0.00 ? 210 PRO B O    1  
ATOM 737   C CB   . PRO B 2 13 ? -2.701  4.637   6.613   1.00 0.00 ? 210 PRO B CB   1  
ATOM 738   C CG   . PRO B 2 13 ? -2.116  5.695   5.730   1.00 0.00 ? 210 PRO B CG   1  
ATOM 739   C CD   . PRO B 2 13 ? -1.103  5.026   4.827   1.00 0.00 ? 210 PRO B CD   1  
ATOM 740   H HA   . PRO B 2 13 ? -2.294  2.535   6.621   1.00 0.00 ? 210 PRO B HA   1  
ATOM 741   H HB2  . PRO B 2 13 ? -3.766  4.764   6.729   1.00 0.00 ? 210 PRO B HB2  1  
ATOM 742   H HG2  . PRO B 2 13 ? -2.899  6.142   5.136   1.00 0.00 ? 210 PRO B HG2  1  
ATOM 743   H HD2  . PRO B 2 13 ? -1.378  5.173   3.792   1.00 0.00 ? 210 PRO B HD2  1  
ATOM 744   N N    . TYR B 2 14 ? -4.636  2.429   5.528   1.00 0.00 ? 211 TYR B N    1  
ATOM 745   C CA   . TYR B 2 14 ? -5.794  2.050   4.741   1.00 0.00 ? 211 TYR B CA   1  
ATOM 746   C C    . TYR B 2 14 ? -6.341  3.262   3.996   1.00 0.00 ? 211 TYR B C    1  
ATOM 747   O O    . TYR B 2 14 ? -6.022  3.481   2.827   1.00 0.00 ? 211 TYR B O    1  
ATOM 748   C CB   . TYR B 2 14 ? -6.878  1.443   5.643   1.00 0.00 ? 211 TYR B CB   1  
ATOM 749   C CG   . TYR B 2 14 ? -8.230  1.315   4.972   1.00 0.00 ? 211 TYR B CG   1  
ATOM 750   C CD1  . TYR B 2 14 ? -8.372  0.586   3.802   1.00 0.00 ? 211 TYR B CD1  1  
ATOM 751   C CD2  . TYR B 2 14 ? -9.355  1.934   5.502   1.00 0.00 ? 211 TYR B CD2  1  
ATOM 752   C CE1  . TYR B 2 14 ? -9.598  0.474   3.174   1.00 0.00 ? 211 TYR B CE1  1  
ATOM 753   C CE2  . TYR B 2 14 ? -10.585 1.829   4.882   1.00 0.00 ? 211 TYR B CE2  1  
ATOM 754   C CZ   . TYR B 2 14 ? -10.702 1.099   3.718   1.00 0.00 ? 211 TYR B CZ   1  
ATOM 755   O OH   . TYR B 2 14 ? -11.925 0.991   3.096   1.00 0.00 ? 211 TYR B OH   1  
ATOM 756   H H    . TYR B 2 14 ? -4.648  2.288   6.497   1.00 0.00 ? 211 TYR B H    1  
ATOM 757   H HA   . TYR B 2 14 ? -5.475  1.311   4.020   1.00 0.00 ? 211 TYR B HA   1  
ATOM 758   H HB2  . TYR B 2 14 ? -6.569  0.455   5.952   1.00 0.00 ? 211 TYR B HB2  1  
ATOM 759   H HD1  . TYR B 2 14 ? -7.506  0.096   3.383   1.00 0.00 ? 211 TYR B HD1  1  
ATOM 760   H HD2  . TYR B 2 14 ? -9.259  2.505   6.413   1.00 0.00 ? 211 TYR B HD2  1  
ATOM 761   H HE1  . TYR B 2 14 ? -9.687  -0.094  2.260   1.00 0.00 ? 211 TYR B HE1  1  
ATOM 762   H HE2  . TYR B 2 14 ? -11.448 2.316   5.309   1.00 0.00 ? 211 TYR B HE2  1  
ATOM 763   H HH   . TYR B 2 14 ? -11.825 1.170   2.158   1.00 0.00 ? 211 TYR B HH   1  
ATOM 764   N N    . SER B 2 15 ? -7.160  4.052   4.685   1.00 0.00 ? 212 SER B N    1  
ATOM 765   C CA   . SER B 2 15 ? -7.754  5.238   4.090   1.00 0.00 ? 212 SER B CA   1  
ATOM 766   C C    . SER B 2 15 ? -8.629  4.853   2.902   1.00 0.00 ? 212 SER B C    1  
ATOM 767   O O    . SER B 2 15 ? -9.849  4.765   3.029   1.00 0.00 ? 212 SER B O    1  
ATOM 768   C CB   . SER B 2 15 ? -6.663  6.220   3.658   1.00 0.00 ? 212 SER B CB   1  
ATOM 769   O OG   . SER B 2 15 ? -6.803  7.462   4.327   1.00 0.00 ? 212 SER B OG   1  
ATOM 770   H H    . SER B 2 15 ? -7.368  3.827   5.617   1.00 0.00 ? 212 SER B H    1  
ATOM 771   H HA   . SER B 2 15 ? -8.374  5.709   4.840   1.00 0.00 ? 212 SER B HA   1  
ATOM 772   H HB2  . SER B 2 15 ? -5.694  5.806   3.894   1.00 0.00 ? 212 SER B HB2  1  
ATOM 773   H HG   . SER B 2 15 ? -7.688  7.805   4.185   1.00 0.00 ? 212 SER B HG   1  
ATOM 774   N N    . ARG B 2 16 ? -7.993  4.618   1.750   1.00 0.00 ? 213 ARG B N    1  
ATOM 775   C CA   . ARG B 2 16 ? -8.693  4.230   0.521   1.00 0.00 ? 213 ARG B CA   1  
ATOM 776   C C    . ARG B 2 16 ? -7.828  4.523   -0.701  1.00 0.00 ? 213 ARG B C    1  
ATOM 777   O O    . ARG B 2 16 ? -7.674  3.678   -1.584  1.00 0.00 ? 213 ARG B O    1  
ATOM 778   C CB   . ARG B 2 16 ? -10.037 4.956   0.382   1.00 0.00 ? 213 ARG B CB   1  
ATOM 779   C CG   . ARG B 2 16 ? -11.225 4.128   0.850   1.00 0.00 ? 213 ARG B CG   1  
ATOM 780   C CD   . ARG B 2 16 ? -12.038 3.597   -0.319  1.00 0.00 ? 213 ARG B CD   1  
ATOM 781   N NE   . ARG B 2 16 ? -13.360 4.213   -0.390  1.00 0.00 ? 213 ARG B NE   1  
ATOM 782   C CZ   . ARG B 2 16 ? -14.297 3.850   -1.258  1.00 0.00 ? 213 ARG B CZ   1  
ATOM 783   N NH1  . ARG B 2 16 ? -14.057 2.880   -2.130  1.00 0.00 ? 213 ARG B NH1  1  
ATOM 784   N NH2  . ARG B 2 16 ? -15.476 4.457   -1.257  1.00 0.00 ? 213 ARG B NH2  1  
ATOM 785   H H    . ARG B 2 16 ? -7.017  4.701   1.726   1.00 0.00 ? 213 ARG B H    1  
ATOM 786   H HA   . ARG B 2 16 ? -8.873  3.166   0.569   1.00 0.00 ? 213 ARG B HA   1  
ATOM 787   H HB2  . ARG B 2 16 ? -10.005 5.863   0.966   1.00 0.00 ? 213 ARG B HB2  1  
ATOM 788   H HG2  . ARG B 2 16 ? -10.863 3.293   1.430   1.00 0.00 ? 213 ARG B HG2  1  
ATOM 789   H HD2  . ARG B 2 16 ? -11.506 3.802   -1.236  1.00 0.00 ? 213 ARG B HD2  1  
ATOM 790   H HE   . ARG B 2 16 ? -13.558 4.933   0.245   1.00 0.00 ? 213 ARG B HE   1  
ATOM 791   H HH11 . ARG B 2 16 ? -13.169 2.420   -2.135  1.00 0.00 ? 213 ARG B HH11 1  
ATOM 792   H HH12 . ARG B 2 16 ? -14.763 2.609   -2.784  1.00 0.00 ? 213 ARG B HH12 1  
ATOM 793   H HH21 . ARG B 2 16 ? -15.660 5.189   -0.600  1.00 0.00 ? 213 ARG B HH21 1  
ATOM 794   H HH22 . ARG B 2 16 ? -16.179 4.184   -1.912  1.00 0.00 ? 213 ARG B HH22 1  
ATOM 795   N N    . TYR B 2 17 ? -7.263  5.726   -0.743  1.00 0.00 ? 214 TYR B N    1  
ATOM 796   C CA   . TYR B 2 17 ? -6.411  6.137   -1.853  1.00 0.00 ? 214 TYR B CA   1  
ATOM 797   C C    . TYR B 2 17 ? -4.964  5.707   -1.618  1.00 0.00 ? 214 TYR B C    1  
ATOM 798   O O    . TYR B 2 17 ? -4.632  5.183   -0.555  1.00 0.00 ? 214 TYR B O    1  
ATOM 799   C CB   . TYR B 2 17 ? -6.487  7.654   -2.041  1.00 0.00 ? 214 TYR B CB   1  
ATOM 800   C CG   . TYR B 2 17 ? -7.862  8.228   -1.802  1.00 0.00 ? 214 TYR B CG   1  
ATOM 801   C CD1  . TYR B 2 17 ? -9.002  7.467   -2.028  1.00 0.00 ? 214 TYR B CD1  1  
ATOM 802   C CD2  . TYR B 2 17 ? -8.021  9.533   -1.357  1.00 0.00 ? 214 TYR B CD2  1  
ATOM 803   C CE1  . TYR B 2 17 ? -10.261 7.990   -1.817  1.00 0.00 ? 214 TYR B CE1  1  
ATOM 804   C CE2  . TYR B 2 17 ? -9.277  10.064  -1.143  1.00 0.00 ? 214 TYR B CE2  1  
ATOM 805   C CZ   . TYR B 2 17 ? -10.395 9.290   -1.374  1.00 0.00 ? 214 TYR B CZ   1  
ATOM 806   O OH   . TYR B 2 17 ? -11.648 9.816   -1.164  1.00 0.00 ? 214 TYR B OH   1  
ATOM 807   H H    . TYR B 2 17 ? -7.425  6.354   -0.009  1.00 0.00 ? 214 TYR B H    1  
ATOM 808   H HA   . TYR B 2 17 ? -6.776  5.654   -2.748  1.00 0.00 ? 214 TYR B HA   1  
ATOM 809   H HB2  . TYR B 2 17 ? -5.805  8.130   -1.353  1.00 0.00 ? 214 TYR B HB2  1  
ATOM 810   H HD1  . TYR B 2 17 ? -8.895  6.450   -2.375  1.00 0.00 ? 214 TYR B HD1  1  
ATOM 811   H HD2  . TYR B 2 17 ? -7.144  10.135  -1.176  1.00 0.00 ? 214 TYR B HD2  1  
ATOM 812   H HE1  . TYR B 2 17 ? -11.133 7.384   -1.999  1.00 0.00 ? 214 TYR B HE1  1  
ATOM 813   H HE2  . TYR B 2 17 ? -9.379  11.080  -0.798  1.00 0.00 ? 214 TYR B HE2  1  
ATOM 814   H HH   . TYR B 2 17 ? -11.673 10.721  -1.483  1.00 0.00 ? 214 TYR B HH   1  
ATOM 815   N N    . PRO B 2 18 ? -4.083  5.925   -2.610  1.00 0.00 ? 215 PRO B N    1  
ATOM 816   C CA   . PRO B 2 18 ? -2.676  5.557   -2.513  1.00 0.00 ? 215 PRO B CA   1  
ATOM 817   C C    . PRO B 2 18 ? -1.826  6.656   -1.891  1.00 0.00 ? 215 PRO B C    1  
ATOM 818   O O    . PRO B 2 18 ? -1.359  7.561   -2.584  1.00 0.00 ? 215 PRO B O    1  
ATOM 819   C CB   . PRO B 2 18 ? -2.283  5.328   -3.969  1.00 0.00 ? 215 PRO B CB   1  
ATOM 820   C CG   . PRO B 2 18 ? -3.198  6.195   -4.775  1.00 0.00 ? 215 PRO B CG   1  
ATOM 821   C CD   . PRO B 2 18 ? -4.388  6.544   -3.907  1.00 0.00 ? 215 PRO B CD   1  
ATOM 822   H HA   . PRO B 2 18 ? -2.547  4.644   -1.954  1.00 0.00 ? 215 PRO B HA   1  
ATOM 823   H HB2  . PRO B 2 18 ? -1.249  5.610   -4.114  1.00 0.00 ? 215 PRO B HB2  1  
ATOM 824   H HG2  . PRO B 2 18 ? -2.680  7.097   -5.068  1.00 0.00 ? 215 PRO B HG2  1  
ATOM 825   H HD2  . PRO B 2 18 ? -4.476  7.616   -3.807  1.00 0.00 ? 215 PRO B HD2  1  
ATOM 826   N N    . MET B 2 19 ? -1.629  6.575   -0.580  1.00 0.00 ? 216 MET B N    1  
ATOM 827   C CA   . MET B 2 19 ? -0.834  7.567   0.131   1.00 0.00 ? 216 MET B CA   1  
ATOM 828   C C    . MET B 2 19 ? 0.209   6.907   1.025   1.00 0.00 ? 216 MET B C    1  
ATOM 829   O O    . MET B 2 19 ? -0.129  6.267   2.018   1.00 0.00 ? 216 MET B O    1  
ATOM 830   C CB   . MET B 2 19 ? -1.745  8.473   0.963   1.00 0.00 ? 216 MET B CB   1  
ATOM 831   C CG   . MET B 2 19 ? -2.308  7.804   2.209   1.00 0.00 ? 216 MET B CG   1  
ATOM 832   S SD   . MET B 2 19 ? -4.016  8.281   2.543   1.00 0.00 ? 216 MET B SD   1  
ATOM 833   C CE   . MET B 2 19 ? -4.862  7.526   1.155   1.00 0.00 ? 216 MET B CE   1  
ATOM 834   H H    . MET B 2 19 ? -2.027  5.832   -0.081  1.00 0.00 ? 216 MET B H    1  
ATOM 835   H HA   . MET B 2 19 ? -0.321  8.164   -0.605  1.00 0.00 ? 216 MET B HA   1  
ATOM 836   H HB2  . MET B 2 19 ? -1.183  9.343   1.271   1.00 0.00 ? 216 MET B HB2  1  
ATOM 837   H HG2  . MET B 2 19 ? -2.268  6.731   2.078   1.00 0.00 ? 216 MET B HG2  1  
ATOM 838   H HE1  . MET B 2 19 ? -4.830  6.452   1.255   1.00 0.00 ? 216 MET B HE1  1  
ATOM 839   H HE2  . MET B 2 19 ? -5.891  7.855   1.139   1.00 0.00 ? 216 MET B HE2  1  
ATOM 840   H HE3  . MET B 2 19 ? -4.377  7.818   0.236   1.00 0.00 ? 216 MET B HE3  1  
ATOM 841   N N    . ASP B 2 20 ? 1.479   7.075   0.664   1.00 0.00 ? 217 ASP B N    1  
ATOM 842   C CA   . ASP B 2 20 ? 2.580   6.500   1.430   1.00 0.00 ? 217 ASP B CA   1  
ATOM 843   C C    . ASP B 2 20 ? 2.431   6.811   2.917   1.00 0.00 ? 217 ASP B C    1  
ATOM 844   O O    . ASP B 2 20 ? 3.193   6.232   3.720   1.00 0.00 ? 217 ASP B O    1  
ATOM 845   C CB   . ASP B 2 20 ? 3.919   7.035   0.920   1.00 0.00 ? 217 ASP B CB   1  
ATOM 846   C CG   . ASP B 2 20 ? 3.879   8.525   0.640   1.00 0.00 ? 217 ASP B CG   1  
ATOM 847   O OD1  . ASP B 2 20 ? 3.099   9.234   1.310   1.00 0.00 ? 217 ASP B OD1  1  
ATOM 848   O OD2  . ASP B 2 20 ? 4.627   8.983   -0.249  1.00 0.00 ? 217 ASP B OD2  1  
ATOM 849   O OXT  . ASP B 2 20 ? 1.553   7.628   3.264   1.00 0.00 ? 217 ASP B OXT  1  
ATOM 850   H H    . ASP B 2 20 ? 1.681   7.599   -0.141  1.00 0.00 ? 217 ASP B H    1  
ATOM 851   H HA   . ASP B 2 20 ? 2.556   5.430   1.291   1.00 0.00 ? 217 ASP B HA   1  
ATOM 852   H HB2  . ASP B 2 20 ? 4.681   6.849   1.663   1.00 0.00 ? 217 ASP B HB2  1  
ATOM 853   N N    . GLY A 1 1  ? 9.668   -10.529 -9.418  1.00 0.00 ? 292 GLY A N    2  
ATOM 854   C CA   . GLY A 1 1  ? 9.209   -11.715 -10.192 1.00 0.00 ? 292 GLY A CA   2  
ATOM 855   C C    . GLY A 1 1  ? 7.701   -11.880 -10.159 1.00 0.00 ? 292 GLY A C    2  
ATOM 856   O O    . GLY A 1 1  ? 6.990   -11.245 -10.935 1.00 0.00 ? 292 GLY A O    2  
ATOM 857   H H1   . GLY A 1 1  ? 9.238   -10.532 -8.471  1.00 0.00 ? 292 GLY A H1   2  
ATOM 858   H H2   . GLY A 1 1  ? 9.393   -9.654  -9.906  1.00 0.00 ? 292 GLY A H2   2  
ATOM 859   H H3   . GLY A 1 1  ? 10.704  -10.546 -9.317  1.00 0.00 ? 292 GLY A H3   2  
ATOM 860   H HA2  . GLY A 1 1  ? 9.525   -11.605 -11.219 1.00 0.00 ? 292 GLY A HA2  2  
ATOM 861   H HA3  . GLY A 1 1  ? 9.668   -12.601 -9.778  1.00 0.00 ? 292 GLY A HA3  2  
ATOM 862   N N    . PRO A 1 2  ? 7.184   -12.736 -9.261  1.00 0.00 ? 293 PRO A N    2  
ATOM 863   C CA   . PRO A 1 2  ? 5.742   -12.973 -9.138  1.00 0.00 ? 293 PRO A CA   2  
ATOM 864   C C    . PRO A 1 2  ? 5.000   -11.747 -8.617  1.00 0.00 ? 293 PRO A C    2  
ATOM 865   O O    . PRO A 1 2  ? 5.586   -10.674 -8.463  1.00 0.00 ? 293 PRO A O    2  
ATOM 866   C CB   . PRO A 1 2  ? 5.651   -14.123 -8.130  1.00 0.00 ? 293 PRO A CB   2  
ATOM 867   C CG   . PRO A 1 2  ? 6.915   -14.046 -7.347  1.00 0.00 ? 293 PRO A CG   2  
ATOM 868   C CD   . PRO A 1 2  ? 7.962   -13.535 -8.298  1.00 0.00 ? 293 PRO A CD   2  
ATOM 869   H HA   . PRO A 1 2  ? 5.311   -13.280 -10.079 1.00 0.00 ? 293 PRO A HA   2  
ATOM 870   H HB2  . PRO A 1 2  ? 4.786   -13.982 -7.498  1.00 0.00 ? 293 PRO A HB2  2  
ATOM 871   H HG2  . PRO A 1 2  ? 6.795   -13.361 -6.520  1.00 0.00 ? 293 PRO A HG2  2  
ATOM 872   H HD2  . PRO A 1 2  ? 8.679   -12.920 -7.775  1.00 0.00 ? 293 PRO A HD2  2  
ATOM 873   N N    . LEU A 1 3  ? 3.710   -11.911 -8.348  1.00 0.00 ? 294 LEU A N    2  
ATOM 874   C CA   . LEU A 1 3  ? 2.889   -10.815 -7.843  1.00 0.00 ? 294 LEU A CA   2  
ATOM 875   C C    . LEU A 1 3  ? 1.467   -11.288 -7.557  1.00 0.00 ? 294 LEU A C    2  
ATOM 876   O O    . LEU A 1 3  ? 0.887   -10.950 -6.525  1.00 0.00 ? 294 LEU A O    2  
ATOM 877   C CB   . LEU A 1 3  ? 2.864   -9.662  -8.849  1.00 0.00 ? 294 LEU A CB   2  
ATOM 878   C CG   . LEU A 1 3  ? 2.974   -8.266  -8.237  1.00 0.00 ? 294 LEU A CG   2  
ATOM 879   C CD1  . LEU A 1 3  ? 1.885   -8.052  -7.197  1.00 0.00 ? 294 LEU A CD1  2  
ATOM 880   C CD2  . LEU A 1 3  ? 4.349   -8.062  -7.619  1.00 0.00 ? 294 LEU A CD2  2  
ATOM 881   H H    . LEU A 1 3  ? 3.298   -12.789 -8.492  1.00 0.00 ? 294 LEU A H    2  
ATOM 882   H HA   . LEU A 1 3  ? 3.332   -10.468 -6.923  1.00 0.00 ? 294 LEU A HA   2  
ATOM 883   H HB2  . LEU A 1 3  ? 3.684   -9.797  -9.540  1.00 0.00 ? 294 LEU A HB2  2  
ATOM 884   H HG   . LEU A 1 3  ? 2.842   -7.527  -9.014  1.00 0.00 ? 294 LEU A HG   2  
ATOM 885   H HD11 . LEU A 1 3  ? 1.082   -8.755  -7.368  1.00 0.00 ? 294 LEU A HD11 2  
ATOM 886   H HD12 . LEU A 1 3  ? 2.294   -8.206  -6.210  1.00 0.00 ? 294 LEU A HD12 2  
ATOM 887   H HD13 . LEU A 1 3  ? 1.504   -7.044  -7.277  1.00 0.00 ? 294 LEU A HD13 2  
ATOM 888   H HD21 . LEU A 1 3  ? 4.437   -7.048  -7.258  1.00 0.00 ? 294 LEU A HD21 2  
ATOM 889   H HD22 . LEU A 1 3  ? 4.480   -8.749  -6.795  1.00 0.00 ? 294 LEU A HD22 2  
ATOM 890   H HD23 . LEU A 1 3  ? 5.110   -8.245  -8.364  1.00 0.00 ? 294 LEU A HD23 2  
ATOM 891   N N    . GLY A 1 4  ? 0.912   -12.070 -8.476  1.00 0.00 ? 295 GLY A N    2  
ATOM 892   C CA   . GLY A 1 4  ? -0.438  -12.573 -8.304  1.00 0.00 ? 295 GLY A CA   2  
ATOM 893   C C    . GLY A 1 4  ? -1.297  -12.367 -9.537  1.00 0.00 ? 295 GLY A C    2  
ATOM 894   O O    . GLY A 1 4  ? -2.106  -11.441 -9.589  1.00 0.00 ? 295 GLY A O    2  
ATOM 895   H H    . GLY A 1 4  ? 1.424   -12.309 -9.277  1.00 0.00 ? 295 GLY A H    2  
ATOM 896   H HA2  . GLY A 1 4  ? -0.391  -13.630 -8.083  1.00 0.00 ? 295 GLY A HA2  2  
ATOM 897   H HA3  . GLY A 1 4  ? -0.897  -12.063 -7.470  1.00 0.00 ? 295 GLY A HA3  2  
ATOM 898   N N    . SER A 1 5  ? -1.120  -13.232 -10.531 1.00 0.00 ? 296 SER A N    2  
ATOM 899   C CA   . SER A 1 5  ? -1.887  -13.139 -11.768 1.00 0.00 ? 296 SER A CA   2  
ATOM 900   C C    . SER A 1 5  ? -3.383  -13.079 -11.476 1.00 0.00 ? 296 SER A C    2  
ATOM 901   O O    . SER A 1 5  ? -3.981  -14.064 -11.043 1.00 0.00 ? 296 SER A O    2  
ATOM 902   C CB   . SER A 1 5  ? -1.580  -14.332 -12.677 1.00 0.00 ? 296 SER A CB   2  
ATOM 903   O OG   . SER A 1 5  ? -1.551  -13.942 -14.039 1.00 0.00 ? 296 SER A OG   2  
ATOM 904   H H    . SER A 1 5  ? -0.460  -13.949 -10.430 1.00 0.00 ? 296 SER A H    2  
ATOM 905   H HA   . SER A 1 5  ? -1.594  -12.230 -12.271 1.00 0.00 ? 296 SER A HA   2  
ATOM 906   H HB2  . SER A 1 5  ? -0.617  -14.744 -12.414 1.00 0.00 ? 296 SER A HB2  2  
ATOM 907   H HG   . SER A 1 5  ? -2.188  -13.239 -14.184 1.00 0.00 ? 296 SER A HG   2  
ATOM 908   N N    . GLY A 1 6  ? -3.980  -11.916 -11.715 1.00 0.00 ? 297 GLY A N    2  
ATOM 909   C CA   . GLY A 1 6  ? -5.401  -11.748 -11.469 1.00 0.00 ? 297 GLY A CA   2  
ATOM 910   C C    . GLY A 1 6  ? -5.682  -10.723 -10.387 1.00 0.00 ? 297 GLY A C    2  
ATOM 911   O O    . GLY A 1 6  ? -4.833  -10.477 -9.530  1.00 0.00 ? 297 GLY A O    2  
ATOM 912   H H    . GLY A 1 6  ? -3.454  -11.167 -12.062 1.00 0.00 ? 297 GLY A H    2  
ATOM 913   H HA2  . GLY A 1 6  ? -5.879  -11.431 -12.384 1.00 0.00 ? 297 GLY A HA2  2  
ATOM 914   H HA3  . GLY A 1 6  ? -5.818  -12.698 -11.167 1.00 0.00 ? 297 GLY A HA3  2  
ATOM 915   N N    . PRO A 1 7  ? -6.876  -10.105 -10.402 1.00 0.00 ? 298 PRO A N    2  
ATOM 916   C CA   . PRO A 1 7  ? -7.253  -9.095  -9.407  1.00 0.00 ? 298 PRO A CA   2  
ATOM 917   C C    . PRO A 1 7  ? -7.415  -9.685  -8.011  1.00 0.00 ? 298 PRO A C    2  
ATOM 918   O O    . PRO A 1 7  ? -7.544  -10.899 -7.846  1.00 0.00 ? 298 PRO A O    2  
ATOM 919   C CB   . PRO A 1 7  ? -8.593  -8.565  -9.925  1.00 0.00 ? 298 PRO A CB   2  
ATOM 920   C CG   . PRO A 1 7  ? -9.139  -9.664  -10.768 1.00 0.00 ? 298 PRO A CG   2  
ATOM 921   C CD   . PRO A 1 7  ? -7.947  -10.341 -11.386 1.00 0.00 ? 298 PRO A CD   2  
ATOM 922   H HA   . PRO A 1 7  ? -6.533  -8.288  -9.371  1.00 0.00 ? 298 PRO A HA   2  
ATOM 923   H HB2  . PRO A 1 7  ? -9.243  -8.346  -9.090  1.00 0.00 ? 298 PRO A HB2  2  
ATOM 924   H HG2  . PRO A 1 7  ? -9.689  -10.361 -10.152 1.00 0.00 ? 298 PRO A HG2  2  
ATOM 925   H HD2  . PRO A 1 7  ? -8.134  -11.398 -11.509 1.00 0.00 ? 298 PRO A HD2  2  
ATOM 926   N N    . LEU A 1 8  ? -7.410  -8.814  -7.009  1.00 0.00 ? 299 LEU A N    2  
ATOM 927   C CA   . LEU A 1 8  ? -7.549  -9.233  -5.620  1.00 0.00 ? 299 LEU A CA   2  
ATOM 928   C C    . LEU A 1 8  ? -9.012  -9.505  -5.272  1.00 0.00 ? 299 LEU A C    2  
ATOM 929   O O    . LEU A 1 8  ? -9.915  -9.108  -6.008  1.00 0.00 ? 299 LEU A O    2  
ATOM 930   C CB   . LEU A 1 8  ? -6.977  -8.156  -4.699  1.00 0.00 ? 299 LEU A CB   2  
ATOM 931   C CG   . LEU A 1 8  ? -5.585  -7.657  -5.086  1.00 0.00 ? 299 LEU A CG   2  
ATOM 932   C CD1  . LEU A 1 8  ? -5.314  -6.292  -4.478  1.00 0.00 ? 299 LEU A CD1  2  
ATOM 933   C CD2  . LEU A 1 8  ? -4.528  -8.657  -4.647  1.00 0.00 ? 299 LEU A CD2  2  
ATOM 934   H H    . LEU A 1 8  ? -7.310  -7.860  -7.210  1.00 0.00 ? 299 LEU A H    2  
ATOM 935   H HA   . LEU A 1 8  ? -6.984  -10.143 -5.490  1.00 0.00 ? 299 LEU A HA   2  
ATOM 936   H HB2  . LEU A 1 8  ? -7.654  -7.313  -4.700  1.00 0.00 ? 299 LEU A HB2  2  
ATOM 937   H HG   . LEU A 1 8  ? -5.529  -7.562  -6.160  1.00 0.00 ? 299 LEU A HG   2  
ATOM 938   H HD11 . LEU A 1 8  ? -4.250  -6.111  -4.456  1.00 0.00 ? 299 LEU A HD11 2  
ATOM 939   H HD12 . LEU A 1 8  ? -5.796  -5.530  -5.073  1.00 0.00 ? 299 LEU A HD12 2  
ATOM 940   H HD13 . LEU A 1 8  ? -5.705  -6.261  -3.471  1.00 0.00 ? 299 LEU A HD13 2  
ATOM 941   H HD21 . LEU A 1 8  ? -4.067  -8.316  -3.731  1.00 0.00 ? 299 LEU A HD21 2  
ATOM 942   H HD22 . LEU A 1 8  ? -4.990  -9.619  -4.480  1.00 0.00 ? 299 LEU A HD22 2  
ATOM 943   H HD23 . LEU A 1 8  ? -3.776  -8.748  -5.417  1.00 0.00 ? 299 LEU A HD23 2  
ATOM 944   N N    . PRO A 1 9  ? -9.264  -10.189 -4.142  1.00 0.00 ? 300 PRO A N    2  
ATOM 945   C CA   . PRO A 1 9  ? -10.626 -10.512 -3.705  1.00 0.00 ? 300 PRO A CA   2  
ATOM 946   C C    . PRO A 1 9  ? -11.525 -9.279  -3.682  1.00 0.00 ? 300 PRO A C    2  
ATOM 947   O O    . PRO A 1 9  ? -11.085 -8.177  -4.013  1.00 0.00 ? 300 PRO A O    2  
ATOM 948   C CB   . PRO A 1 9  ? -10.425 -11.067 -2.292  1.00 0.00 ? 300 PRO A CB   2  
ATOM 949   C CG   . PRO A 1 9  ? -9.032  -11.594 -2.287  1.00 0.00 ? 300 PRO A CG   2  
ATOM 950   C CD   . PRO A 1 9  ? -8.246  -10.694 -3.200  1.00 0.00 ? 300 PRO A CD   2  
ATOM 951   H HA   . PRO A 1 9  ? -11.073 -11.269 -4.333  1.00 0.00 ? 300 PRO A HA   2  
ATOM 952   H HB2  . PRO A 1 9  ? -10.553 -10.276 -1.568  1.00 0.00 ? 300 PRO A HB2  2  
ATOM 953   H HG2  . PRO A 1 9  ? -8.629  -11.555 -1.285  1.00 0.00 ? 300 PRO A HG2  2  
ATOM 954   H HD2  . PRO A 1 9  ? -7.805  -9.886  -2.637  1.00 0.00 ? 300 PRO A HD2  2  
ATOM 955   N N    . PRO A 1 10 ? -12.800 -9.443  -3.293  1.00 0.00 ? 301 PRO A N    2  
ATOM 956   C CA   . PRO A 1 10 ? -13.753 -8.336  -3.240  1.00 0.00 ? 301 PRO A CA   2  
ATOM 957   C C    . PRO A 1 10 ? -13.573 -7.463  -2.003  1.00 0.00 ? 301 PRO A C    2  
ATOM 958   O O    . PRO A 1 10 ? -14.510 -7.262  -1.231  1.00 0.00 ? 301 PRO A O    2  
ATOM 959   C CB   . PRO A 1 10 ? -15.105 -9.044  -3.207  1.00 0.00 ? 301 PRO A CB   2  
ATOM 960   C CG   . PRO A 1 10 ? -14.835 -10.349 -2.541  1.00 0.00 ? 301 PRO A CG   2  
ATOM 961   C CD   . PRO A 1 10 ? -13.411 -10.720 -2.875  1.00 0.00 ? 301 PRO A CD   2  
ATOM 962   H HA   . PRO A 1 10 ? -13.688 -7.720  -4.123  1.00 0.00 ? 301 PRO A HA   2  
ATOM 963   H HB2  . PRO A 1 10 ? -15.811 -8.450  -2.644  1.00 0.00 ? 301 PRO A HB2  2  
ATOM 964   H HG2  . PRO A 1 10 ? -14.951 -10.244 -1.472  1.00 0.00 ? 301 PRO A HG2  2  
ATOM 965   H HD2  . PRO A 1 10 ? -12.915 -11.115 -2.003  1.00 0.00 ? 301 PRO A HD2  2  
ATOM 966   N N    . GLY A 1 11 ? -12.363 -6.946  -1.826  1.00 0.00 ? 302 GLY A N    2  
ATOM 967   C CA   . GLY A 1 11 ? -12.079 -6.096  -0.685  1.00 0.00 ? 302 GLY A CA   2  
ATOM 968   C C    . GLY A 1 11 ? -10.708 -5.455  -0.769  1.00 0.00 ? 302 GLY A C    2  
ATOM 969   O O    . GLY A 1 11 ? -10.526 -4.306  -0.367  1.00 0.00 ? 302 GLY A O    2  
ATOM 970   H H    . GLY A 1 11 ? -11.656 -7.146  -2.473  1.00 0.00 ? 302 GLY A H    2  
ATOM 971   H HA2  . GLY A 1 11 ? -12.826 -5.317  -0.635  1.00 0.00 ? 302 GLY A HA2  2  
ATOM 972   H HA3  . GLY A 1 11 ? -12.132 -6.690  0.215   1.00 0.00 ? 302 GLY A HA3  2  
ATOM 973   N N    . TRP A 1 12 ? -9.740  -6.202  -1.292  1.00 0.00 ? 303 TRP A N    2  
ATOM 974   C CA   . TRP A 1 12 ? -8.378  -5.702  -1.428  1.00 0.00 ? 303 TRP A CA   2  
ATOM 975   C C    . TRP A 1 12 ? -8.191  -4.946  -2.736  1.00 0.00 ? 303 TRP A C    2  
ATOM 976   O O    . TRP A 1 12 ? -8.999  -5.059  -3.657  1.00 0.00 ? 303 TRP A O    2  
ATOM 977   C CB   . TRP A 1 12 ? -7.378  -6.855  -1.367  1.00 0.00 ? 303 TRP A CB   2  
ATOM 978   C CG   . TRP A 1 12 ? -7.427  -7.612  -0.083  1.00 0.00 ? 303 TRP A CG   2  
ATOM 979   C CD1  . TRP A 1 12 ? -8.312  -8.590  0.256   1.00 0.00 ? 303 TRP A CD1  2  
ATOM 980   C CD2  . TRP A 1 12 ? -6.549  -7.454  1.033   1.00 0.00 ? 303 TRP A CD2  2  
ATOM 981   N NE1  . TRP A 1 12 ? -8.044  -9.048  1.524   1.00 0.00 ? 303 TRP A NE1  2  
ATOM 982   C CE2  . TRP A 1 12 ? -6.962  -8.365  2.021   1.00 0.00 ? 303 TRP A CE2  2  
ATOM 983   C CE3  . TRP A 1 12 ? -5.453  -6.628  1.290   1.00 0.00 ? 303 TRP A CE3  2  
ATOM 984   C CZ2  . TRP A 1 12 ? -6.315  -8.473  3.250   1.00 0.00 ? 303 TRP A CZ2  2  
ATOM 985   C CZ3  . TRP A 1 12 ? -4.811  -6.735  2.508   1.00 0.00 ? 303 TRP A CZ3  2  
ATOM 986   C CH2  . TRP A 1 12 ? -5.244  -7.650  3.474   1.00 0.00 ? 303 TRP A CH2  2  
ATOM 987   H H    . TRP A 1 12 ? -9.945  -7.112  -1.589  1.00 0.00 ? 303 TRP A H    2  
ATOM 988   H HA   . TRP A 1 12 ? -8.187  -5.031  -0.606  1.00 0.00 ? 303 TRP A HA   2  
ATOM 989   H HB2  . TRP A 1 12 ? -7.588  -7.546  -2.170  1.00 0.00 ? 303 TRP A HB2  2  
ATOM 990   H HD1  . TRP A 1 12 ? -9.106  -8.940  -0.387  1.00 0.00 ? 303 TRP A HD1  2  
ATOM 991   H HE1  . TRP A 1 12 ? -8.544  -9.747  1.992   1.00 0.00 ? 303 TRP A HE1  2  
ATOM 992   H HE3  . TRP A 1 12 ? -5.104  -5.917  0.554   1.00 0.00 ? 303 TRP A HE3  2  
ATOM 993   H HZ2  . TRP A 1 12 ? -6.636  -9.173  4.005   1.00 0.00 ? 303 TRP A HZ2  2  
ATOM 994   H HZ3  . TRP A 1 12 ? -3.962  -6.103  2.725   1.00 0.00 ? 303 TRP A HZ3  2  
ATOM 995   H HH2  . TRP A 1 12 ? -4.713  -7.696  4.412   1.00 0.00 ? 303 TRP A HH2  2  
ATOM 996   N N    . GLU A 1 13 ? -7.112  -4.176  -2.804  1.00 0.00 ? 304 GLU A N    2  
ATOM 997   C CA   . GLU A 1 13 ? -6.788  -3.408  -3.997  1.00 0.00 ? 304 GLU A CA   2  
ATOM 998   C C    . GLU A 1 13 ? -5.307  -3.058  -4.013  1.00 0.00 ? 304 GLU A C    2  
ATOM 999   O O    . GLU A 1 13 ? -4.725  -2.735  -2.977  1.00 0.00 ? 304 GLU A O    2  
ATOM 1000  C CB   . GLU A 1 13 ? -7.617  -2.128  -4.070  1.00 0.00 ? 304 GLU A CB   2  
ATOM 1001  C CG   . GLU A 1 13 ? -7.493  -1.413  -5.406  1.00 0.00 ? 304 GLU A CG   2  
ATOM 1002  C CD   . GLU A 1 13 ? -8.178  -0.060  -5.413  1.00 0.00 ? 304 GLU A CD   2  
ATOM 1003  O OE1  . GLU A 1 13 ? -9.187  0.098   -4.696  1.00 0.00 ? 304 GLU A OE1  2  
ATOM 1004  O OE2  . GLU A 1 13 ? -7.705  0.841   -6.137  1.00 0.00 ? 304 GLU A OE2  2  
ATOM 1005  H H    . GLU A 1 13 ? -6.518  -4.121  -2.026  1.00 0.00 ? 304 GLU A H    2  
ATOM 1006  H HA   . GLU A 1 13 ? -7.009  -4.021  -4.857  1.00 0.00 ? 304 GLU A HA   2  
ATOM 1007  H HB2  . GLU A 1 13 ? -8.656  -2.373  -3.909  1.00 0.00 ? 304 GLU A HB2  2  
ATOM 1008  H HG2  . GLU A 1 13 ? -6.444  -1.270  -5.627  1.00 0.00 ? 304 GLU A HG2  2  
ATOM 1009  N N    . ILE A 1 14 ? -4.703  -3.121  -5.189  1.00 0.00 ? 305 ILE A N    2  
ATOM 1010  C CA   . ILE A 1 14 ? -3.290  -2.809  -5.331  1.00 0.00 ? 305 ILE A CA   2  
ATOM 1011  C C    . ILE A 1 14 ? -3.057  -1.305  -5.290  1.00 0.00 ? 305 ILE A C    2  
ATOM 1012  O O    . ILE A 1 14 ? -3.927  -0.516  -5.657  1.00 0.00 ? 305 ILE A O    2  
ATOM 1013  C CB   . ILE A 1 14 ? -2.711  -3.365  -6.645  1.00 0.00 ? 305 ILE A CB   2  
ATOM 1014  C CG1  . ILE A 1 14 ? -2.945  -4.877  -6.739  1.00 0.00 ? 305 ILE A CG1  2  
ATOM 1015  C CG2  . ILE A 1 14 ? -1.227  -3.036  -6.742  1.00 0.00 ? 305 ILE A CG2  2  
ATOM 1016  C CD1  . ILE A 1 14 ? -2.158  -5.547  -7.847  1.00 0.00 ? 305 ILE A CD1  2  
ATOM 1017  H H    . ILE A 1 14 ? -5.220  -3.380  -5.981  1.00 0.00 ? 305 ILE A H    2  
ATOM 1018  H HA   . ILE A 1 14 ? -2.761  -3.268  -4.502  1.00 0.00 ? 305 ILE A HA   2  
ATOM 1019  H HB   . ILE A 1 14 ? -3.215  -2.878  -7.468  1.00 0.00 ? 305 ILE A HB   2  
ATOM 1020  H HG12 . ILE A 1 14 ? -2.662  -5.340  -5.807  1.00 0.00 ? 305 ILE A HG12 2  
ATOM 1021  H HG21 . ILE A 1 14 ? -0.721  -3.400  -5.861  1.00 0.00 ? 305 ILE A HG21 2  
ATOM 1022  H HG22 . ILE A 1 14 ? -0.810  -3.511  -7.619  1.00 0.00 ? 305 ILE A HG22 2  
ATOM 1023  H HG23 . ILE A 1 14 ? -1.099  -1.967  -6.816  1.00 0.00 ? 305 ILE A HG23 2  
ATOM 1024  H HD11 . ILE A 1 14 ? -2.200  -6.618  -7.720  1.00 0.00 ? 305 ILE A HD11 2  
ATOM 1025  H HD12 . ILE A 1 14 ? -2.585  -5.279  -8.801  1.00 0.00 ? 305 ILE A HD12 2  
ATOM 1026  H HD13 . ILE A 1 14 ? -1.129  -5.217  -7.807  1.00 0.00 ? 305 ILE A HD13 2  
ATOM 1027  N N    . ARG A 1 15 ? -1.868  -0.928  -4.847  1.00 0.00 ? 306 ARG A N    2  
ATOM 1028  C CA   . ARG A 1 15 ? -1.480  0.471   -4.748  1.00 0.00 ? 306 ARG A CA   2  
ATOM 1029  C C    . ARG A 1 15 ? 0.034   0.561   -4.611  1.00 0.00 ? 306 ARG A C    2  
ATOM 1030  O O    . ARG A 1 15 ? 0.711   -0.462  -4.586  1.00 0.00 ? 306 ARG A O    2  
ATOM 1031  C CB   . ARG A 1 15 ? -2.166  1.126   -3.546  1.00 0.00 ? 306 ARG A CB   2  
ATOM 1032  C CG   . ARG A 1 15 ? -3.664  1.317   -3.732  1.00 0.00 ? 306 ARG A CG   2  
ATOM 1033  C CD   . ARG A 1 15 ? -4.180  2.507   -2.939  1.00 0.00 ? 306 ARG A CD   2  
ATOM 1034  N NE   . ARG A 1 15 ? -5.257  3.204   -3.636  1.00 0.00 ? 306 ARG A NE   2  
ATOM 1035  C CZ   . ARG A 1 15 ? -6.499  2.739   -3.721  1.00 0.00 ? 306 ARG A CZ   2  
ATOM 1036  N NH1  . ARG A 1 15 ? -6.816  1.583   -3.155  1.00 0.00 ? 306 ARG A NH1  2  
ATOM 1037  N NH2  . ARG A 1 15 ? -7.425  3.431   -4.371  1.00 0.00 ? 306 ARG A NH2  2  
ATOM 1038  H H    . ARG A 1 15 ? -1.226  -1.616  -4.575  1.00 0.00 ? 306 ARG A H    2  
ATOM 1039  H HA   . ARG A 1 15 ? -1.785  0.972   -5.655  1.00 0.00 ? 306 ARG A HA   2  
ATOM 1040  H HB2  . ARG A 1 15 ? -2.009  0.506   -2.676  1.00 0.00 ? 306 ARG A HB2  2  
ATOM 1041  H HG2  . ARG A 1 15 ? -3.868  1.481   -4.779  1.00 0.00 ? 306 ARG A HG2  2  
ATOM 1042  H HD2  . ARG A 1 15 ? -4.545  2.159   -1.988  1.00 0.00 ? 306 ARG A HD2  2  
ATOM 1043  H HE   . ARG A 1 15 ? -5.044  4.060   -4.061  1.00 0.00 ? 306 ARG A HE   2  
ATOM 1044  H HH11 . ARG A 1 15 ? -6.121  1.061   -2.661  1.00 0.00 ? 306 ARG A HH11 2  
ATOM 1045  H HH12 . ARG A 1 15 ? -7.751  1.234   -3.220  1.00 0.00 ? 306 ARG A HH12 2  
ATOM 1046  H HH21 . ARG A 1 15 ? -7.189  4.304   -4.799  1.00 0.00 ? 306 ARG A HH21 2  
ATOM 1047  H HH22 . ARG A 1 15 ? -8.360  3.080   -4.433  1.00 0.00 ? 306 ARG A HH22 2  
ATOM 1048  N N    . ASN A 1 16 ? 0.572   1.771   -4.539  1.00 0.00 ? 307 ASN A N    2  
ATOM 1049  C CA   . ASN A 1 16 ? 2.014   1.936   -4.395  1.00 0.00 ? 307 ASN A CA   2  
ATOM 1050  C C    . ASN A 1 16 ? 2.340   3.041   -3.397  1.00 0.00 ? 307 ASN A C    2  
ATOM 1051  O O    . ASN A 1 16 ? 1.549   3.964   -3.196  1.00 0.00 ? 307 ASN A O    2  
ATOM 1052  C CB   . ASN A 1 16 ? 2.669   2.228   -5.748  1.00 0.00 ? 307 ASN A CB   2  
ATOM 1053  C CG   . ASN A 1 16 ? 1.973   1.528   -6.901  1.00 0.00 ? 307 ASN A CG   2  
ATOM 1054  O OD1  . ASN A 1 16 ? 1.016   2.050   -7.474  1.00 0.00 ? 307 ASN A OD1  2  
ATOM 1055  N ND2  . ASN A 1 16 ? 2.449   0.338   -7.244  1.00 0.00 ? 307 ASN A ND2  2  
ATOM 1056  H H    . ASN A 1 16 ? -0.002  2.563   -4.592  1.00 0.00 ? 307 ASN A H    2  
ATOM 1057  H HA   . ASN A 1 16 ? 2.405   1.006   -4.014  1.00 0.00 ? 307 ASN A HA   2  
ATOM 1058  H HB2  . ASN A 1 16 ? 2.647   3.292   -5.932  1.00 0.00 ? 307 ASN A HB2  2  
ATOM 1059  H HD21 . ASN A 1 16 ? 3.214   -0.017  -6.743  1.00 0.00 ? 307 ASN A HD21 2  
ATOM 1060  H HD22 . ASN A 1 16 ? 2.018   -0.138  -7.984  1.00 0.00 ? 307 ASN A HD22 2  
ATOM 1061  N N    . THR A 1 17 ? 3.509   2.940   -2.770  1.00 0.00 ? 308 THR A N    2  
ATOM 1062  C CA   . THR A 1 17 ? 3.933   3.925   -1.782  1.00 0.00 ? 308 THR A CA   2  
ATOM 1063  C C    . THR A 1 17 ? 4.680   5.088   -2.429  1.00 0.00 ? 308 THR A C    2  
ATOM 1064  O O    . THR A 1 17 ? 5.724   5.513   -1.938  1.00 0.00 ? 308 THR A O    2  
ATOM 1065  C CB   . THR A 1 17 ? 4.837   3.288   -0.709  1.00 0.00 ? 308 THR A CB   2  
ATOM 1066  O OG1  . THR A 1 17 ? 6.019   2.751   -1.316  1.00 0.00 ? 308 THR A OG1  2  
ATOM 1067  C CG2  . THR A 1 17 ? 4.097   2.187   0.035   1.00 0.00 ? 308 THR A CG2  2  
ATOM 1068  H H    . THR A 1 17 ? 4.098   2.186   -2.977  1.00 0.00 ? 308 THR A H    2  
ATOM 1069  H HA   . THR A 1 17 ? 3.048   4.306   -1.295  1.00 0.00 ? 308 THR A HA   2  
ATOM 1070  H HB   . THR A 1 17 ? 5.122   4.052   0.000   1.00 0.00 ? 308 THR A HB   2  
ATOM 1071  H HG1  . THR A 1 17 ? 6.790   3.213   -0.981  1.00 0.00 ? 308 THR A HG1  2  
ATOM 1072  H HG21 . THR A 1 17 ? 4.198   1.257   -0.505  1.00 0.00 ? 308 THR A HG21 2  
ATOM 1073  H HG22 . THR A 1 17 ? 3.053   2.448   0.109   1.00 0.00 ? 308 THR A HG22 2  
ATOM 1074  H HG23 . THR A 1 17 ? 4.514   2.076   1.026   1.00 0.00 ? 308 THR A HG23 2  
ATOM 1075  N N    . ALA A 1 18 ? 4.138   5.601   -3.529  1.00 0.00 ? 309 ALA A N    2  
ATOM 1076  C CA   . ALA A 1 18 ? 4.755   6.719   -4.234  1.00 0.00 ? 309 ALA A CA   2  
ATOM 1077  C C    . ALA A 1 18 ? 6.095   6.321   -4.846  1.00 0.00 ? 309 ALA A C    2  
ATOM 1078  O O    . ALA A 1 18 ? 6.233   6.242   -6.067  1.00 0.00 ? 309 ALA A O    2  
ATOM 1079  C CB   . ALA A 1 18 ? 4.936   7.898   -3.290  1.00 0.00 ? 309 ALA A CB   2  
ATOM 1080  H H    . ALA A 1 18 ? 3.304   5.220   -3.875  1.00 0.00 ? 309 ALA A H    2  
ATOM 1081  H HA   . ALA A 1 18 ? 4.086   7.023   -5.026  1.00 0.00 ? 309 ALA A HA   2  
ATOM 1082  H HB1  . ALA A 1 18 ? 4.727   7.584   -2.277  1.00 0.00 ? 309 ALA A HB1  2  
ATOM 1083  H HB2  . ALA A 1 18 ? 5.951   8.259   -3.353  1.00 0.00 ? 309 ALA A HB2  2  
ATOM 1084  H HB3  . ALA A 1 18 ? 4.255   8.689   -3.568  1.00 0.00 ? 309 ALA A HB3  2  
ATOM 1085  N N    . THR A 1 19 ? 7.082   6.070   -3.990  1.00 0.00 ? 310 THR A N    2  
ATOM 1086  C CA   . THR A 1 19 ? 8.417   5.682   -4.439  1.00 0.00 ? 310 THR A CA   2  
ATOM 1087  C C    . THR A 1 19 ? 8.354   4.632   -5.544  1.00 0.00 ? 310 THR A C    2  
ATOM 1088  O O    . THR A 1 19 ? 9.138   4.667   -6.493  1.00 0.00 ? 310 THR A O    2  
ATOM 1089  C CB   . THR A 1 19 ? 9.261   5.131   -3.276  1.00 0.00 ? 310 THR A CB   2  
ATOM 1090  O OG1  . THR A 1 19 ? 8.683   3.916   -2.785  1.00 0.00 ? 310 THR A OG1  2  
ATOM 1091  C CG2  . THR A 1 19 ? 9.354   6.145   -2.146  1.00 0.00 ? 310 THR A CG2  2  
ATOM 1092  H H    . THR A 1 19 ? 6.909   6.149   -3.027  1.00 0.00 ? 310 THR A H    2  
ATOM 1093  H HA   . THR A 1 19 ? 8.908   6.565   -4.823  1.00 0.00 ? 310 THR A HA   2  
ATOM 1094  H HB   . THR A 1 19 ? 10.258  4.926   -3.639  1.00 0.00 ? 310 THR A HB   2  
ATOM 1095  H HG1  . THR A 1 19 ? 9.315   3.466   -2.219  1.00 0.00 ? 310 THR A HG1  2  
ATOM 1096  H HG21 . THR A 1 19 ? 9.475   7.135   -2.560  1.00 0.00 ? 310 THR A HG21 2  
ATOM 1097  H HG22 . THR A 1 19 ? 10.202  5.910   -1.519  1.00 0.00 ? 310 THR A HG22 2  
ATOM 1098  H HG23 . THR A 1 19 ? 8.450   6.111   -1.556  1.00 0.00 ? 310 THR A HG23 2  
ATOM 1099  N N    . GLY A 1 20 ? 7.417   3.699   -5.417  1.00 0.00 ? 311 GLY A N    2  
ATOM 1100  C CA   . GLY A 1 20 ? 7.272   2.655   -6.413  1.00 0.00 ? 311 GLY A CA   2  
ATOM 1101  C C    . GLY A 1 20 ? 6.798   1.345   -5.814  1.00 0.00 ? 311 GLY A C    2  
ATOM 1102  O O    . GLY A 1 20 ? 6.143   0.549   -6.488  1.00 0.00 ? 311 GLY A O    2  
ATOM 1103  H H    . GLY A 1 20 ? 6.819   3.720   -4.639  1.00 0.00 ? 311 GLY A H    2  
ATOM 1104  H HA2  . GLY A 1 20 ? 6.557   2.978   -7.156  1.00 0.00 ? 311 GLY A HA2  2  
ATOM 1105  H HA3  . GLY A 1 20 ? 8.226   2.494   -6.892  1.00 0.00 ? 311 GLY A HA3  2  
ATOM 1106  N N    . ARG A 1 21 ? 7.129   1.122   -4.548  1.00 0.00 ? 312 ARG A N    2  
ATOM 1107  C CA   . ARG A 1 21 ? 6.729   -0.104  -3.862  1.00 0.00 ? 312 ARG A CA   2  
ATOM 1108  C C    . ARG A 1 21 ? 5.226   -0.259  -3.874  1.00 0.00 ? 312 ARG A C    2  
ATOM 1109  O O    . ARG A 1 21 ? 4.485   0.655   -3.516  1.00 0.00 ? 312 ARG A O    2  
ATOM 1110  C CB   . ARG A 1 21 ? 7.246   -0.122  -2.420  1.00 0.00 ? 312 ARG A CB   2  
ATOM 1111  C CG   . ARG A 1 21 ? 7.867   -1.447  -2.014  1.00 0.00 ? 312 ARG A CG   2  
ATOM 1112  C CD   . ARG A 1 21 ? 8.638   -1.318  -0.712  1.00 0.00 ? 312 ARG A CD   2  
ATOM 1113  N NE   . ARG A 1 21 ? 9.814   -2.181  -0.681  1.00 0.00 ? 312 ARG A NE   2  
ATOM 1114  C CZ   . ARG A 1 21 ? 10.699  -2.181  0.311   1.00 0.00 ? 312 ARG A CZ   2  
ATOM 1115  N NH1  . ARG A 1 21 ? 10.537  -1.368  1.346   1.00 0.00 ? 312 ARG A NH1  2  
ATOM 1116  N NH2  . ARG A 1 21 ? 11.746  -2.995  0.268   1.00 0.00 ? 312 ARG A NH2  2  
ATOM 1117  H H    . ARG A 1 21 ? 7.651   1.796   -4.066  1.00 0.00 ? 312 ARG A H    2  
ATOM 1118  H HA   . ARG A 1 21 ? 7.146   -0.943  -4.399  1.00 0.00 ? 312 ARG A HA   2  
ATOM 1119  H HB2  . ARG A 1 21 ? 7.993   0.649   -2.302  1.00 0.00 ? 312 ARG A HB2  2  
ATOM 1120  H HG2  . ARG A 1 21 ? 7.083   -2.179  -1.887  1.00 0.00 ? 312 ARG A HG2  2  
ATOM 1121  H HD2  . ARG A 1 21 ? 8.954   -0.292  -0.596  1.00 0.00 ? 312 ARG A HD2  2  
ATOM 1122  H HE   . ARG A 1 21 ? 9.952   -2.789  -1.437  1.00 0.00 ? 312 ARG A HE   2  
ATOM 1123  H HH11 . ARG A 1 21 ? 9.749   -0.754  1.381   1.00 0.00 ? 312 ARG A HH11 2  
ATOM 1124  H HH12 . ARG A 1 21 ? 11.204  -1.369  2.092   1.00 0.00 ? 312 ARG A HH12 2  
ATOM 1125  H HH21 . ARG A 1 21 ? 11.870  -3.609  -0.510  1.00 0.00 ? 312 ARG A HH21 2  
ATOM 1126  H HH22 . ARG A 1 21 ? 12.410  -2.993  1.016   1.00 0.00 ? 312 ARG A HH22 2  
ATOM 1127  N N    . VAL A 1 22 ? 4.793   -1.434  -4.290  1.00 0.00 ? 313 VAL A N    2  
ATOM 1128  C CA   . VAL A 1 22 ? 3.382   -1.745  -4.380  1.00 0.00 ? 313 VAL A CA   2  
ATOM 1129  C C    . VAL A 1 22 ? 2.886   -2.438  -3.110  1.00 0.00 ? 313 VAL A C    2  
ATOM 1130  O O    . VAL A 1 22 ? 3.463   -3.428  -2.660  1.00 0.00 ? 313 VAL A O    2  
ATOM 1131  C CB   . VAL A 1 22 ? 3.106   -2.635  -5.611  1.00 0.00 ? 313 VAL A CB   2  
ATOM 1132  C CG1  . VAL A 1 22 ? 4.098   -3.781  -5.671  1.00 0.00 ? 313 VAL A CG1  2  
ATOM 1133  C CG2  . VAL A 1 22 ? 1.685   -3.158  -5.603  1.00 0.00 ? 313 VAL A CG2  2  
ATOM 1134  H H    . VAL A 1 22 ? 5.447   -2.119  -4.541  1.00 0.00 ? 313 VAL A H    2  
ATOM 1135  H HA   . VAL A 1 22 ? 2.847   -0.818  -4.505  1.00 0.00 ? 313 VAL A HA   2  
ATOM 1136  H HB   . VAL A 1 22 ? 3.235   -2.034  -6.500  1.00 0.00 ? 313 VAL A HB   2  
ATOM 1137  H HG11 . VAL A 1 22 ? 4.952   -3.485  -6.262  1.00 0.00 ? 313 VAL A HG11 2  
ATOM 1138  H HG12 . VAL A 1 22 ? 4.421   -4.028  -4.670  1.00 0.00 ? 313 VAL A HG12 2  
ATOM 1139  H HG13 . VAL A 1 22 ? 3.627   -4.643  -6.121  1.00 0.00 ? 313 VAL A HG13 2  
ATOM 1140  H HG21 . VAL A 1 22 ? 1.546   -3.827  -6.437  1.00 0.00 ? 313 VAL A HG21 2  
ATOM 1141  H HG22 . VAL A 1 22 ? 1.507   -3.684  -4.680  1.00 0.00 ? 313 VAL A HG22 2  
ATOM 1142  H HG23 . VAL A 1 22 ? 1.001   -2.328  -5.685  1.00 0.00 ? 313 VAL A HG23 2  
ATOM 1143  N N    . TYR A 1 23 ? 1.810   -1.904  -2.541  1.00 0.00 ? 314 TYR A N    2  
ATOM 1144  C CA   . TYR A 1 23 ? 1.216   -2.469  -1.339  1.00 0.00 ? 314 TYR A CA   2  
ATOM 1145  C C    . TYR A 1 23 ? -0.246  -2.806  -1.573  1.00 0.00 ? 314 TYR A C    2  
ATOM 1146  O O    . TYR A 1 23 ? -0.836  -2.399  -2.574  1.00 0.00 ? 314 TYR A O    2  
ATOM 1147  C CB   . TYR A 1 23 ? 1.331   -1.506  -0.160  1.00 0.00 ? 314 TYR A CB   2  
ATOM 1148  C CG   . TYR A 1 23 ? 0.446   -0.282  -0.266  1.00 0.00 ? 314 TYR A CG   2  
ATOM 1149  C CD1  . TYR A 1 23 ? 0.754   0.752   -1.139  1.00 0.00 ? 314 TYR A CD1  2  
ATOM 1150  C CD2  . TYR A 1 23 ? -0.699  -0.164  0.515   1.00 0.00 ? 314 TYR A CD2  2  
ATOM 1151  C CE1  . TYR A 1 23 ? -0.054  1.869   -1.234  1.00 0.00 ? 314 TYR A CE1  2  
ATOM 1152  C CE2  . TYR A 1 23 ? -1.513  0.951   0.419   1.00 0.00 ? 314 TYR A CE2  2  
ATOM 1153  C CZ   . TYR A 1 23 ? -1.187  1.962   -0.455  1.00 0.00 ? 314 TYR A CZ   2  
ATOM 1154  O OH   . TYR A 1 23 ? -1.994  3.068   -0.544  1.00 0.00 ? 314 TYR A OH   2  
ATOM 1155  H H    . TYR A 1 23 ? 1.405   -1.108  -2.944  1.00 0.00 ? 314 TYR A H    2  
ATOM 1156  H HA   . TYR A 1 23 ? 1.749   -3.378  -1.102  1.00 0.00 ? 314 TYR A HA   2  
ATOM 1157  H HB2  . TYR A 1 23 ? 1.051   -2.031  0.738   1.00 0.00 ? 314 TYR A HB2  2  
ATOM 1158  H HD1  . TYR A 1 23 ? 1.642   0.680   -1.747  1.00 0.00 ? 314 TYR A HD1  2  
ATOM 1159  H HD2  . TYR A 1 23 ? -0.951  -0.957  1.205   1.00 0.00 ? 314 TYR A HD2  2  
ATOM 1160  H HE1  . TYR A 1 23 ? 0.206   2.664   -1.914  1.00 0.00 ? 314 TYR A HE1  2  
ATOM 1161  H HE2  . TYR A 1 23 ? -2.393  1.035   1.036   1.00 0.00 ? 314 TYR A HE2  2  
ATOM 1162  H HH   . TYR A 1 23 ? -1.673  3.747   0.053   1.00 0.00 ? 314 TYR A HH   2  
ATOM 1163  N N    . PHE A 1 24 ? -0.825  -3.551  -0.645  1.00 0.00 ? 315 PHE A N    2  
ATOM 1164  C CA   . PHE A 1 24 ? -2.216  -3.939  -0.752  1.00 0.00 ? 315 PHE A CA   2  
ATOM 1165  C C    . PHE A 1 24 ? -3.067  -3.245  0.295   1.00 0.00 ? 315 PHE A C    2  
ATOM 1166  O O    . PHE A 1 24 ? -2.658  -3.078  1.447   1.00 0.00 ? 315 PHE A O    2  
ATOM 1167  C CB   . PHE A 1 24 ? -2.347  -5.454  -0.647  1.00 0.00 ? 315 PHE A CB   2  
ATOM 1168  C CG   . PHE A 1 24 ? -1.625  -6.171  -1.748  1.00 0.00 ? 315 PHE A CG   2  
ATOM 1169  C CD1  . PHE A 1 24 ? -0.241  -6.205  -1.771  1.00 0.00 ? 315 PHE A CD1  2  
ATOM 1170  C CD2  . PHE A 1 24 ? -2.325  -6.800  -2.762  1.00 0.00 ? 315 PHE A CD2  2  
ATOM 1171  C CE1  . PHE A 1 24 ? 0.434   -6.855  -2.785  1.00 0.00 ? 315 PHE A CE1  2  
ATOM 1172  C CE2  . PHE A 1 24 ? -1.656  -7.454  -3.780  1.00 0.00 ? 315 PHE A CE2  2  
ATOM 1173  C CZ   . PHE A 1 24 ? -0.275  -7.482  -3.791  1.00 0.00 ? 315 PHE A CZ   2  
ATOM 1174  H H    . PHE A 1 24 ? -0.301  -3.856  0.123   1.00 0.00 ? 315 PHE A H    2  
ATOM 1175  H HA   . PHE A 1 24 ? -2.559  -3.624  -1.719  1.00 0.00 ? 315 PHE A HA   2  
ATOM 1176  H HB2  . PHE A 1 24 ? -1.932  -5.783  0.295   1.00 0.00 ? 315 PHE A HB2  2  
ATOM 1177  H HD1  . PHE A 1 24 ? 0.312   -5.712  -0.986  1.00 0.00 ? 315 PHE A HD1  2  
ATOM 1178  H HD2  . PHE A 1 24 ? -3.405  -6.776  -2.753  1.00 0.00 ? 315 PHE A HD2  2  
ATOM 1179  H HE1  . PHE A 1 24 ? 1.513   -6.875  -2.791  1.00 0.00 ? 315 PHE A HE1  2  
ATOM 1180  H HE2  . PHE A 1 24 ? -2.212  -7.941  -4.566  1.00 0.00 ? 315 PHE A HE2  2  
ATOM 1181  H HZ   . PHE A 1 24 ? 0.250   -7.992  -4.586  1.00 0.00 ? 315 PHE A HZ   2  
ATOM 1182  N N    . VAL A 1 25 ? -4.256  -2.844  -0.130  1.00 0.00 ? 316 VAL A N    2  
ATOM 1183  C CA   . VAL A 1 25 ? -5.189  -2.145  0.732   1.00 0.00 ? 316 VAL A CA   2  
ATOM 1184  C C    . VAL A 1 25 ? -6.477  -2.941  0.913   1.00 0.00 ? 316 VAL A C    2  
ATOM 1185  O O    . VAL A 1 25 ? -7.220  -3.157  -0.044  1.00 0.00 ? 316 VAL A O    2  
ATOM 1186  C CB   . VAL A 1 25 ? -5.527  -0.762  0.148   1.00 0.00 ? 316 VAL A CB   2  
ATOM 1187  C CG1  . VAL A 1 25 ? -6.276  0.075   1.164   1.00 0.00 ? 316 VAL A CG1  2  
ATOM 1188  C CG2  . VAL A 1 25 ? -4.263  -0.052  -0.311  1.00 0.00 ? 316 VAL A CG2  2  
ATOM 1189  H H    . VAL A 1 25 ? -4.515  -3.029  -1.057  1.00 0.00 ? 316 VAL A H    2  
ATOM 1190  H HA   . VAL A 1 25 ? -4.720  -2.004  1.695   1.00 0.00 ? 316 VAL A HA   2  
ATOM 1191  H HB   . VAL A 1 25 ? -6.166  -0.904  -0.710  1.00 0.00 ? 316 VAL A HB   2  
ATOM 1192  H HG11 . VAL A 1 25 ? -7.203  -0.419  1.418   1.00 0.00 ? 316 VAL A HG11 2  
ATOM 1193  H HG12 . VAL A 1 25 ? -5.671  0.187   2.052   1.00 0.00 ? 316 VAL A HG12 2  
ATOM 1194  H HG13 . VAL A 1 25 ? -6.486  1.047   0.744   1.00 0.00 ? 316 VAL A HG13 2  
ATOM 1195  H HG21 . VAL A 1 25 ? -4.281  0.055   -1.386  1.00 0.00 ? 316 VAL A HG21 2  
ATOM 1196  H HG22 . VAL A 1 25 ? -4.212  0.924   0.147   1.00 0.00 ? 316 VAL A HG22 2  
ATOM 1197  H HG23 . VAL A 1 25 ? -3.398  -0.631  -0.022  1.00 0.00 ? 316 VAL A HG23 2  
ATOM 1198  N N    . ASP A 1 26 ? -6.734  -3.377  2.143   1.00 0.00 ? 317 ASP A N    2  
ATOM 1199  C CA   . ASP A 1 26 ? -7.936  -4.147  2.443   1.00 0.00 ? 317 ASP A CA   2  
ATOM 1200  C C    . ASP A 1 26 ? -9.081  -3.226  2.842   1.00 0.00 ? 317 ASP A C    2  
ATOM 1201  O O    . ASP A 1 26 ? -9.025  -2.560  3.877   1.00 0.00 ? 317 ASP A O    2  
ATOM 1202  C CB   . ASP A 1 26 ? -7.667  -5.150  3.565   1.00 0.00 ? 317 ASP A CB   2  
ATOM 1203  C CG   . ASP A 1 26 ? -8.584  -6.356  3.492   1.00 0.00 ? 317 ASP A CG   2  
ATOM 1204  O OD1  . ASP A 1 26 ? -9.448  -6.391  2.589   1.00 0.00 ? 317 ASP A OD1  2  
ATOM 1205  O OD2  . ASP A 1 26 ? -8.441  -7.264  4.337   1.00 0.00 ? 317 ASP A OD2  2  
ATOM 1206  H H    . ASP A 1 26 ? -6.102  -3.176  2.865   1.00 0.00 ? 317 ASP A H    2  
ATOM 1207  H HA   . ASP A 1 26 ? -8.216  -4.685  1.550   1.00 0.00 ? 317 ASP A HA   2  
ATOM 1208  H HB2  . ASP A 1 26 ? -6.647  -5.493  3.497   1.00 0.00 ? 317 ASP A HB2  2  
ATOM 1209  N N    . HIS A 1 27 ? -10.119 -3.196  2.015   1.00 0.00 ? 318 HIS A N    2  
ATOM 1210  C CA   . HIS A 1 27 ? -11.283 -2.362  2.277   1.00 0.00 ? 318 HIS A CA   2  
ATOM 1211  C C    . HIS A 1 27 ? -12.221 -3.022  3.286   1.00 0.00 ? 318 HIS A C    2  
ATOM 1212  O O    . HIS A 1 27 ? -13.080 -2.361  3.868   1.00 0.00 ? 318 HIS A O    2  
ATOM 1213  C CB   . HIS A 1 27 ? -12.019 -2.067  0.971   1.00 0.00 ? 318 HIS A CB   2  
ATOM 1214  C CG   . HIS A 1 27 ? -11.314 -1.057  0.125   1.00 0.00 ? 318 HIS A CG   2  
ATOM 1215  N ND1  . HIS A 1 27 ? -11.288 0.270   0.475   1.00 0.00 ? 318 HIS A ND1  2  
ATOM 1216  C CD2  . HIS A 1 27 ? -10.602 -1.229  -1.015  1.00 0.00 ? 318 HIS A CD2  2  
ATOM 1217  C CE1  . HIS A 1 27 ? -10.563 0.874   -0.447  1.00 0.00 ? 318 HIS A CE1  2  
ATOM 1218  N NE2  . HIS A 1 27 ? -10.124 0.006   -1.373  1.00 0.00 ? 318 HIS A NE2  2  
ATOM 1219  H H    . HIS A 1 27 ? -10.101 -3.749  1.205   1.00 0.00 ? 318 HIS A H    2  
ATOM 1220  H HA   . HIS A 1 27 ? -10.931 -1.428  2.692   1.00 0.00 ? 318 HIS A HA   2  
ATOM 1221  H HB2  . HIS A 1 27 ? -12.107 -2.978  0.400   1.00 0.00 ? 318 HIS A HB2  2  
ATOM 1222  H HD2  . HIS A 1 27 ? -10.435 -2.158  -1.539  1.00 0.00 ? 318 HIS A HD2  2  
ATOM 1223  H HE1  . HIS A 1 27 ? -10.335 1.927   -0.445  1.00 0.00 ? 318 HIS A HE1  2  
ATOM 1224  H HE2  . HIS A 1 27 ? -9.432  0.180   -2.044  1.00 0.00 ? 318 HIS A HE2  2  
ATOM 1225  N N    . ASN A 1 28 ? -12.056 -4.328  3.490   1.00 0.00 ? 319 ASN A N    2  
ATOM 1226  C CA   . ASN A 1 28 ? -12.886 -5.062  4.439   1.00 0.00 ? 319 ASN A CA   2  
ATOM 1227  C C    . ASN A 1 28 ? -12.435 -4.782  5.869   1.00 0.00 ? 319 ASN A C    2  
ATOM 1228  O O    . ASN A 1 28 ? -13.225 -4.343  6.706   1.00 0.00 ? 319 ASN A O    2  
ATOM 1229  C CB   . ASN A 1 28 ? -12.819 -6.565  4.162   1.00 0.00 ? 319 ASN A CB   2  
ATOM 1230  C CG   . ASN A 1 28 ? -13.047 -6.898  2.701   1.00 0.00 ? 319 ASN A CG   2  
ATOM 1231  O OD1  . ASN A 1 28 ? -13.754 -6.182  1.992   1.00 0.00 ? 319 ASN A OD1  2  
ATOM 1232  N ND2  . ASN A 1 28 ? -12.449 -7.992  2.245   1.00 0.00 ? 319 ASN A ND2  2  
ATOM 1233  H H    . ASN A 1 28 ? -11.365 -4.811  2.989   1.00 0.00 ? 319 ASN A H    2  
ATOM 1234  H HA   . ASN A 1 28 ? -13.905 -4.725  4.320   1.00 0.00 ? 319 ASN A HA   2  
ATOM 1235  H HB2  . ASN A 1 28 ? -11.845 -6.935  4.448   1.00 0.00 ? 319 ASN A HB2  2  
ATOM 1236  H HD21 . ASN A 1 28 ? -11.902 -8.515  2.868   1.00 0.00 ? 319 ASN A HD21 2  
ATOM 1237  H HD22 . ASN A 1 28 ? -12.578 -8.233  1.304   1.00 0.00 ? 319 ASN A HD22 2  
ATOM 1238  N N    . ASN A 1 29 ? -11.160 -5.044  6.141   1.00 0.00 ? 320 ASN A N    2  
ATOM 1239  C CA   . ASN A 1 29 ? -10.595 -4.823  7.468   1.00 0.00 ? 320 ASN A CA   2  
ATOM 1240  C C    . ASN A 1 29 ? -10.056 -3.400  7.614   1.00 0.00 ? 320 ASN A C    2  
ATOM 1241  O O    . ASN A 1 29 ? -9.780  -2.949  8.726   1.00 0.00 ? 320 ASN A O    2  
ATOM 1242  C CB   . ASN A 1 29 ? -9.479  -5.830  7.745   1.00 0.00 ? 320 ASN A CB   2  
ATOM 1243  C CG   . ASN A 1 29 ? -9.886  -7.250  7.412   1.00 0.00 ? 320 ASN A CG   2  
ATOM 1244  O OD1  . ASN A 1 29 ? -10.967 -7.703  7.788   1.00 0.00 ? 320 ASN A OD1  2  
ATOM 1245  N ND2  . ASN A 1 29 ? -9.019  -7.959  6.702   1.00 0.00 ? 320 ASN A ND2  2  
ATOM 1246  H H    . ASN A 1 29 ? -10.584 -5.396  5.431   1.00 0.00 ? 320 ASN A H    2  
ATOM 1247  H HA   . ASN A 1 29 ? -11.384 -4.969  8.190   1.00 0.00 ? 320 ASN A HA   2  
ATOM 1248  H HB2  . ASN A 1 29 ? -8.614  -5.576  7.149   1.00 0.00 ? 320 ASN A HB2  2  
ATOM 1249  H HD21 . ASN A 1 29 ? -8.178  -7.531  6.437   1.00 0.00 ? 320 ASN A HD21 2  
ATOM 1250  H HD22 . ASN A 1 29 ? -9.255  -8.880  6.469   1.00 0.00 ? 320 ASN A HD22 2  
ATOM 1251  N N    . ARG A 1 30 ? -9.900  -2.699  6.492   1.00 0.00 ? 321 ARG A N    2  
ATOM 1252  C CA   . ARG A 1 30 ? -9.394  -1.332  6.514   1.00 0.00 ? 321 ARG A CA   2  
ATOM 1253  C C    . ARG A 1 30 ? -7.941  -1.297  6.977   1.00 0.00 ? 321 ARG A C    2  
ATOM 1254  O O    . ARG A 1 30 ? -7.598  -0.583  7.920   1.00 0.00 ? 321 ARG A O    2  
ATOM 1255  C CB   . ARG A 1 30 ? -10.256 -0.462  7.428   1.00 0.00 ? 321 ARG A CB   2  
ATOM 1256  C CG   . ARG A 1 30 ? -11.727 -0.457  7.048   1.00 0.00 ? 321 ARG A CG   2  
ATOM 1257  C CD   . ARG A 1 30 ? -12.591 -1.036  8.157   1.00 0.00 ? 321 ARG A CD   2  
ATOM 1258  N NE   . ARG A 1 30 ? -13.750 -0.194  8.443   1.00 0.00 ? 321 ARG A NE   2  
ATOM 1259  C CZ   . ARG A 1 30 ? -14.760 -0.573  9.219   1.00 0.00 ? 321 ARG A CZ   2  
ATOM 1260  N NH1  . ARG A 1 30 ? -14.757 -1.776  9.776   1.00 0.00 ? 321 ARG A NH1  2  
ATOM 1261  N NH2  . ARG A 1 30 ? -15.776 0.251   9.437   1.00 0.00 ? 321 ARG A NH2  2  
ATOM 1262  H H    . ARG A 1 30 ? -10.127 -3.108  5.634   1.00 0.00 ? 321 ARG A H    2  
ATOM 1263  H HA   . ARG A 1 30 ? -9.446  -0.944  5.507   1.00 0.00 ? 321 ARG A HA   2  
ATOM 1264  H HB2  . ARG A 1 30 ? -10.168 -0.825  8.440   1.00 0.00 ? 321 ARG A HB2  2  
ATOM 1265  H HG2  . ARG A 1 30 ? -12.037 0.560   6.858   1.00 0.00 ? 321 ARG A HG2  2  
ATOM 1266  H HD2  . ARG A 1 30 ? -12.935 -2.013  7.854   1.00 0.00 ? 321 ARG A HD2  2  
ATOM 1267  H HE   . ARG A 1 30 ? -13.774 0.698   8.038   1.00 0.00 ? 321 ARG A HE   2  
ATOM 1268  H HH11 . ARG A 1 30 ? -13.993 -2.400  9.613   1.00 0.00 ? 321 ARG A HH11 2  
ATOM 1269  H HH12 . ARG A 1 30 ? -15.517 -2.058  10.361  1.00 0.00 ? 321 ARG A HH12 2  
ATOM 1270  H HH21 . ARG A 1 30 ? -15.782 1.158   9.016   1.00 0.00 ? 321 ARG A HH21 2  
ATOM 1271  H HH22 . ARG A 1 30 ? -16.536 -0.036  10.020  1.00 0.00 ? 321 ARG A HH22 2  
ATOM 1272  N N    . THR A 1 31 ? -7.091  -2.068  6.307   1.00 0.00 ? 322 THR A N    2  
ATOM 1273  C CA   . THR A 1 31 ? -5.677  -2.122  6.654   1.00 0.00 ? 322 THR A CA   2  
ATOM 1274  C C    . THR A 1 31 ? -4.802  -2.153  5.409   1.00 0.00 ? 322 THR A C    2  
ATOM 1275  O O    . THR A 1 31 ? -5.270  -1.893  4.300   1.00 0.00 ? 322 THR A O    2  
ATOM 1276  C CB   . THR A 1 31 ? -5.349  -3.347  7.529   1.00 0.00 ? 322 THR A CB   2  
ATOM 1277  O OG1  . THR A 1 31 ? -3.982  -3.297  7.952   1.00 0.00 ? 322 THR A OG1  2  
ATOM 1278  C CG2  . THR A 1 31 ? -5.600  -4.643  6.771   1.00 0.00 ? 322 THR A CG2  2  
ATOM 1279  H H    . THR A 1 31 ? -7.425  -2.613  5.562   1.00 0.00 ? 322 THR A H    2  
ATOM 1280  H HA   . THR A 1 31 ? -5.440  -1.233  7.217   1.00 0.00 ? 322 THR A HA   2  
ATOM 1281  H HB   . THR A 1 31 ? -5.987  -3.329  8.400   1.00 0.00 ? 322 THR A HB   2  
ATOM 1282  H HG1  . THR A 1 31 ? -3.811  -4.007  8.574   1.00 0.00 ? 322 THR A HG1  2  
ATOM 1283  H HG21 . THR A 1 31 ? -5.393  -4.492  5.722   1.00 0.00 ? 322 THR A HG21 2  
ATOM 1284  H HG22 . THR A 1 31 ? -6.630  -4.939  6.896   1.00 0.00 ? 322 THR A HG22 2  
ATOM 1285  H HG23 . THR A 1 31 ? -4.953  -5.416  7.157   1.00 0.00 ? 322 THR A HG23 2  
ATOM 1286  N N    . THR A 1 32 ? -3.530  -2.475  5.601   1.00 0.00 ? 323 THR A N    2  
ATOM 1287  C CA   . THR A 1 32 ? -2.584  -2.535  4.496   1.00 0.00 ? 323 THR A CA   2  
ATOM 1288  C C    . THR A 1 32 ? -1.546  -3.627  4.718   1.00 0.00 ? 323 THR A C    2  
ATOM 1289  O O    . THR A 1 32 ? -1.501  -4.250  5.780   1.00 0.00 ? 323 THR A O    2  
ATOM 1290  C CB   . THR A 1 32 ? -1.850  -1.197  4.312   1.00 0.00 ? 323 THR A CB   2  
ATOM 1291  O OG1  . THR A 1 32 ? -1.410  -0.713  5.585   1.00 0.00 ? 323 THR A OG1  2  
ATOM 1292  C CG2  . THR A 1 32 ? -2.757  -0.164  3.653   1.00 0.00 ? 323 THR A CG2  2  
ATOM 1293  H H    . THR A 1 32 ? -3.221  -2.678  6.508   1.00 0.00 ? 323 THR A H    2  
ATOM 1294  H HA   . THR A 1 32 ? -3.137  -2.749  3.594   1.00 0.00 ? 323 THR A HA   2  
ATOM 1295  H HB   . THR A 1 32 ? -0.986  -1.360  3.675   1.00 0.00 ? 323 THR A HB   2  
ATOM 1296  H HG1  . THR A 1 32 ? -0.458  -0.585  5.567   1.00 0.00 ? 323 THR A HG1  2  
ATOM 1297  H HG21 . THR A 1 32 ? -2.944  0.650   4.343   1.00 0.00 ? 323 THR A HG21 2  
ATOM 1298  H HG22 . THR A 1 32 ? -3.694  -0.628  3.379   1.00 0.00 ? 323 THR A HG22 2  
ATOM 1299  H HG23 . THR A 1 32 ? -2.275  0.220   2.767   1.00 0.00 ? 323 THR A HG23 2  
ATOM 1300  N N    . GLN A 1 33 ? -0.713  -3.855  3.709   1.00 0.00 ? 324 GLN A N    2  
ATOM 1301  C CA   . GLN A 1 33 ? 0.333   -4.869  3.798   1.00 0.00 ? 324 GLN A CA   2  
ATOM 1302  C C    . GLN A 1 33 ? 1.111   -4.966  2.492   1.00 0.00 ? 324 GLN A C    2  
ATOM 1303  O O    . GLN A 1 33 ? 0.576   -4.697  1.421   1.00 0.00 ? 324 GLN A O    2  
ATOM 1304  C CB   . GLN A 1 33 ? -0.262  -6.239  4.146   1.00 0.00 ? 324 GLN A CB   2  
ATOM 1305  C CG   . GLN A 1 33 ? -1.722  -6.407  3.747   1.00 0.00 ? 324 GLN A CG   2  
ATOM 1306  C CD   . GLN A 1 33 ? -2.137  -7.863  3.673   1.00 0.00 ? 324 GLN A CD   2  
ATOM 1307  O OE1  . GLN A 1 33 ? -2.661  -8.420  4.637   1.00 0.00 ? 324 GLN A OE1  2  
ATOM 1308  N NE2  . GLN A 1 33 ? -1.905  -8.486  2.525   1.00 0.00 ? 324 GLN A NE2  2  
ATOM 1309  H H    . GLN A 1 33 ? -0.809  -3.334  2.882   1.00 0.00 ? 324 GLN A H    2  
ATOM 1310  H HA   . GLN A 1 33 ? 1.013   -4.573  4.583   1.00 0.00 ? 324 GLN A HA   2  
ATOM 1311  H HB2  . GLN A 1 33 ? 0.311   -7.001  3.639   1.00 0.00 ? 324 GLN A HB2  2  
ATOM 1312  H HG2  . GLN A 1 33 ? -2.341  -5.909  4.478   1.00 0.00 ? 324 GLN A HG2  2  
ATOM 1313  H HE21 . GLN A 1 33 ? -1.485  -7.979  1.798   1.00 0.00 ? 324 GLN A HE21 2  
ATOM 1314  H HE22 . GLN A 1 33 ? -2.162  -9.430  2.451   1.00 0.00 ? 324 GLN A HE22 2  
ATOM 1315  N N    . PHE A 1 34 ? 2.374   -5.365  2.586   1.00 0.00 ? 325 PHE A N    2  
ATOM 1316  C CA   . PHE A 1 34 ? 3.220   -5.510  1.406   1.00 0.00 ? 325 PHE A CA   2  
ATOM 1317  C C    . PHE A 1 34 ? 3.144   -6.929  0.863   1.00 0.00 ? 325 PHE A C    2  
ATOM 1318  O O    . PHE A 1 34 ? 4.153   -7.501  0.452   1.00 0.00 ? 325 PHE A O    2  
ATOM 1319  C CB   . PHE A 1 34 ? 4.673   -5.177  1.749   1.00 0.00 ? 325 PHE A CB   2  
ATOM 1320  C CG   . PHE A 1 34 ? 5.007   -3.703  1.757   1.00 0.00 ? 325 PHE A CG   2  
ATOM 1321  C CD1  . PHE A 1 34 ? 4.053   -2.734  1.451   1.00 0.00 ? 325 PHE A CD1  2  
ATOM 1322  C CD2  . PHE A 1 34 ? 6.291   -3.287  2.067   1.00 0.00 ? 325 PHE A CD2  2  
ATOM 1323  C CE1  . PHE A 1 34 ? 4.382   -1.391  1.458   1.00 0.00 ? 325 PHE A CE1  2  
ATOM 1324  C CE2  . PHE A 1 34 ? 6.621   -1.949  2.072   1.00 0.00 ? 325 PHE A CE2  2  
ATOM 1325  C CZ   . PHE A 1 34 ? 5.666   -0.999  1.768   1.00 0.00 ? 325 PHE A CZ   2  
ATOM 1326  H H    . PHE A 1 34 ? 2.747   -5.569  3.469   1.00 0.00 ? 325 PHE A H    2  
ATOM 1327  H HA   . PHE A 1 34 ? 2.867   -4.829  0.649   1.00 0.00 ? 325 PHE A HA   2  
ATOM 1328  H HB2  . PHE A 1 34 ? 4.898   -5.573  2.728   1.00 0.00 ? 325 PHE A HB2  2  
ATOM 1329  H HD1  . PHE A 1 34 ? 3.047   -3.034  1.212   1.00 0.00 ? 325 PHE A HD1  2  
ATOM 1330  H HD2  . PHE A 1 34 ? 7.042   -4.024  2.308   1.00 0.00 ? 325 PHE A HD2  2  
ATOM 1331  H HE1  . PHE A 1 34 ? 3.633   -0.646  1.223   1.00 0.00 ? 325 PHE A HE1  2  
ATOM 1332  H HE2  . PHE A 1 34 ? 7.625   -1.643  2.317   1.00 0.00 ? 325 PHE A HE2  2  
ATOM 1333  H HZ   . PHE A 1 34 ? 5.925   0.049   1.772   1.00 0.00 ? 325 PHE A HZ   2  
ATOM 1334  N N    . THR A 1 35 ? 1.945   -7.494  0.863   1.00 0.00 ? 326 THR A N    2  
ATOM 1335  C CA   . THR A 1 35 ? 1.750   -8.846  0.377   1.00 0.00 ? 326 THR A CA   2  
ATOM 1336  C C    . THR A 1 35 ? 0.431   -8.983  -0.368  1.00 0.00 ? 326 THR A C    2  
ATOM 1337  O O    . THR A 1 35 ? -0.529  -8.265  -0.090  1.00 0.00 ? 326 THR A O    2  
ATOM 1338  C CB   . THR A 1 35 ? 1.774   -9.856  1.534   1.00 0.00 ? 326 THR A CB   2  
ATOM 1339  O OG1  . THR A 1 35 ? 2.419   -9.278  2.677   1.00 0.00 ? 326 THR A OG1  2  
ATOM 1340  C CG2  . THR A 1 35 ? 2.505   -11.116 1.120   1.00 0.00 ? 326 THR A CG2  2  
ATOM 1341  H H    . THR A 1 35 ? 1.176   -6.993  1.199   1.00 0.00 ? 326 THR A H    2  
ATOM 1342  H HA   . THR A 1 35 ? 2.561   -9.082  -0.297  1.00 0.00 ? 326 THR A HA   2  
ATOM 1343  H HB   . THR A 1 35 ? 0.757   -10.114 1.794   1.00 0.00 ? 326 THR A HB   2  
ATOM 1344  H HG1  . THR A 1 35 ? 1.897   -9.457  3.463   1.00 0.00 ? 326 THR A HG1  2  
ATOM 1345  H HG21 . THR A 1 35 ? 1.983   -11.573 0.292   1.00 0.00 ? 326 THR A HG21 2  
ATOM 1346  H HG22 . THR A 1 35 ? 2.538   -11.802 1.952   1.00 0.00 ? 326 THR A HG22 2  
ATOM 1347  H HG23 . THR A 1 35 ? 3.510   -10.863 0.819   1.00 0.00 ? 326 THR A HG23 2  
ATOM 1348  N N    . ASP A 1 36 ? 0.388   -9.914  -1.313  1.00 0.00 ? 327 ASP A N    2  
ATOM 1349  C CA   . ASP A 1 36 ? -0.815  -10.151 -2.090  1.00 0.00 ? 327 ASP A CA   2  
ATOM 1350  C C    . ASP A 1 36 ? -1.648  -11.247 -1.432  1.00 0.00 ? 327 ASP A C    2  
ATOM 1351  O O    . ASP A 1 36 ? -1.239  -12.407 -1.415  1.00 0.00 ? 327 ASP A O    2  
ATOM 1352  C CB   . ASP A 1 36 ? -0.453  -10.552 -3.520  1.00 0.00 ? 327 ASP A CB   2  
ATOM 1353  C CG   . ASP A 1 36 ? -1.635  -10.452 -4.464  1.00 0.00 ? 327 ASP A CG   2  
ATOM 1354  O OD1  . ASP A 1 36 ? -2.775  -10.697 -4.017  1.00 0.00 ? 327 ASP A OD1  2  
ATOM 1355  O OD2  . ASP A 1 36 ? -1.420  -10.129 -5.652  1.00 0.00 ? 327 ASP A OD2  2  
ATOM 1356  H H    . ASP A 1 36 ? 1.184   -10.460 -1.488  1.00 0.00 ? 327 ASP A H    2  
ATOM 1357  H HA   . ASP A 1 36 ? -1.379  -9.234  -2.111  1.00 0.00 ? 327 ASP A HA   2  
ATOM 1358  H HB2  . ASP A 1 36 ? 0.329   -9.901  -3.882  1.00 0.00 ? 327 ASP A HB2  2  
ATOM 1359  N N    . PRO A 1 37 ? -2.825  -10.907 -0.880  1.00 0.00 ? 328 PRO A N    2  
ATOM 1360  C CA   . PRO A 1 37 ? -3.686  -11.887 -0.216  1.00 0.00 ? 328 PRO A CA   2  
ATOM 1361  C C    . PRO A 1 37 ? -3.890  -13.123 -1.074  1.00 0.00 ? 328 PRO A C    2  
ATOM 1362  O O    . PRO A 1 37 ? -4.159  -14.211 -0.565  1.00 0.00 ? 328 PRO A O    2  
ATOM 1363  C CB   . PRO A 1 37 ? -5.015  -11.144 -0.015  1.00 0.00 ? 328 PRO A CB   2  
ATOM 1364  C CG   . PRO A 1 37 ? -4.897  -9.898  -0.825  1.00 0.00 ? 328 PRO A CG   2  
ATOM 1365  C CD   . PRO A 1 37 ? -3.433  -9.570  -0.871  1.00 0.00 ? 328 PRO A CD   2  
ATOM 1366  H HA   . PRO A 1 37 ? -3.284  -12.179 0.743   1.00 0.00 ? 328 PRO A HA   2  
ATOM 1367  H HB2  . PRO A 1 37 ? -5.830  -11.763 -0.362  1.00 0.00 ? 328 PRO A HB2  2  
ATOM 1368  H HG2  . PRO A 1 37 ? -5.272  -10.072 -1.821  1.00 0.00 ? 328 PRO A HG2  2  
ATOM 1369  H HD2  . PRO A 1 37 ? -3.204  -9.019  -1.768  1.00 0.00 ? 328 PRO A HD2  2  
ATOM 1370  N N    . ARG A 1 38 ? -3.758  -12.948 -2.383  1.00 0.00 ? 329 ARG A N    2  
ATOM 1371  C CA   . ARG A 1 38 ? -3.919  -14.051 -3.313  1.00 0.00 ? 329 ARG A CA   2  
ATOM 1372  C C    . ARG A 1 38 ? -2.789  -15.060 -3.135  1.00 0.00 ? 329 ARG A C    2  
ATOM 1373  O O    . ARG A 1 38 ? -2.963  -16.255 -3.370  1.00 0.00 ? 329 ARG A O    2  
ATOM 1374  C CB   . ARG A 1 38 ? -3.940  -13.544 -4.756  1.00 0.00 ? 329 ARG A CB   2  
ATOM 1375  C CG   . ARG A 1 38 ? -4.999  -12.485 -5.018  1.00 0.00 ? 329 ARG A CG   2  
ATOM 1376  C CD   . ARG A 1 38 ? -4.859  -11.896 -6.412  1.00 0.00 ? 329 ARG A CD   2  
ATOM 1377  N NE   . ARG A 1 38 ? -4.695  -12.931 -7.430  1.00 0.00 ? 329 ARG A NE   2  
ATOM 1378  C CZ   . ARG A 1 38 ? -5.691  -13.693 -7.872  1.00 0.00 ? 329 ARG A CZ   2  
ATOM 1379  N NH1  . ARG A 1 38 ? -6.916  -13.530 -7.391  1.00 0.00 ? 329 ARG A NH1  2  
ATOM 1380  N NH2  . ARG A 1 38 ? -5.463  -14.616 -8.796  1.00 0.00 ? 329 ARG A NH2  2  
ATOM 1381  H H    . ARG A 1 38 ? -3.548  -12.055 -2.729  1.00 0.00 ? 329 ARG A H    2  
ATOM 1382  H HA   . ARG A 1 38 ? -4.860  -14.530 -3.091  1.00 0.00 ? 329 ARG A HA   2  
ATOM 1383  H HB2  . ARG A 1 38 ? -2.974  -13.120 -4.990  1.00 0.00 ? 329 ARG A HB2  2  
ATOM 1384  H HG2  . ARG A 1 38 ? -5.976  -12.934 -4.924  1.00 0.00 ? 329 ARG A HG2  2  
ATOM 1385  H HD2  . ARG A 1 38 ? -5.746  -11.323 -6.637  1.00 0.00 ? 329 ARG A HD2  2  
ATOM 1386  H HE   . ARG A 1 38 ? -3.799  -13.067 -7.801  1.00 0.00 ? 329 ARG A HE   2  
ATOM 1387  H HH11 . ARG A 1 38 ? -7.092  -12.834 -6.695  1.00 0.00 ? 329 ARG A HH11 2  
ATOM 1388  H HH12 . ARG A 1 38 ? -7.664  -14.104 -7.725  1.00 0.00 ? 329 ARG A HH12 2  
ATOM 1389  H HH21 . ARG A 1 38 ? -4.541  -14.739 -9.162  1.00 0.00 ? 329 ARG A HH21 2  
ATOM 1390  H HH22 . ARG A 1 38 ? -6.213  -15.188 -9.126  1.00 0.00 ? 329 ARG A HH22 2  
ATOM 1391  N N    . LEU A 1 39 ? -1.627  -14.562 -2.716  1.00 0.00 ? 330 LEU A N    2  
ATOM 1392  C CA   . LEU A 1 39 ? -0.459  -15.407 -2.504  1.00 0.00 ? 330 LEU A CA   2  
ATOM 1393  C C    . LEU A 1 39 ? -0.669  -16.339 -1.314  1.00 0.00 ? 330 LEU A C    2  
ATOM 1394  O O    . LEU A 1 39 ? -0.993  -17.514 -1.482  1.00 0.00 ? 330 LEU A O    2  
ATOM 1395  C CB   . LEU A 1 39 ? 0.786   -14.545 -2.279  1.00 0.00 ? 330 LEU A CB   2  
ATOM 1396  C CG   . LEU A 1 39 ? 1.347   -13.881 -3.537  1.00 0.00 ? 330 LEU A CG   2  
ATOM 1397  C CD1  . LEU A 1 39 ? 2.444   -12.893 -3.174  1.00 0.00 ? 330 LEU A CD1  2  
ATOM 1398  C CD2  . LEU A 1 39 ? 1.871   -14.932 -4.504  1.00 0.00 ? 330 LEU A CD2  2  
ATOM 1399  H H    . LEU A 1 39 ? -1.556  -13.599 -2.546  1.00 0.00 ? 330 LEU A H    2  
ATOM 1400  H HA   . LEU A 1 39 ? -0.315  -16.001 -3.391  1.00 0.00 ? 330 LEU A HA   2  
ATOM 1401  H HB2  . LEU A 1 39 ? 0.538   -13.771 -1.566  1.00 0.00 ? 330 LEU A HB2  2  
ATOM 1402  H HG   . LEU A 1 39 ? 0.556   -13.334 -4.031  1.00 0.00 ? 330 LEU A HG   2  
ATOM 1403  H HD11 . LEU A 1 39 ? 2.345   -12.608 -2.138  1.00 0.00 ? 330 LEU A HD11 2  
ATOM 1404  H HD12 . LEU A 1 39 ? 3.409   -13.353 -3.331  1.00 0.00 ? 330 LEU A HD12 2  
ATOM 1405  H HD13 . LEU A 1 39 ? 2.359   -12.015 -3.798  1.00 0.00 ? 330 LEU A HD13 2  
ATOM 1406  H HD21 . LEU A 1 39 ? 2.160   -14.455 -5.430  1.00 0.00 ? 330 LEU A HD21 2  
ATOM 1407  H HD22 . LEU A 1 39 ? 2.730   -15.423 -4.070  1.00 0.00 ? 330 LEU A HD22 2  
ATOM 1408  H HD23 . LEU A 1 39 ? 1.098   -15.659 -4.700  1.00 0.00 ? 330 LEU A HD23 2  
ATOM 1409  N N    . SER A 1 40 ? -0.481  -15.805 -0.110  1.00 0.00 ? 331 SER A N    2  
ATOM 1410  C CA   . SER A 1 40 ? -0.648  -16.588 1.110   1.00 0.00 ? 331 SER A CA   2  
ATOM 1411  C C    . SER A 1 40 ? -2.123  -16.725 1.473   1.00 0.00 ? 331 SER A C    2  
ATOM 1412  O O    . SER A 1 40 ? -2.918  -15.815 1.240   1.00 0.00 ? 331 SER A O    2  
ATOM 1413  C CB   . SER A 1 40 ? 0.113   -15.937 2.267   1.00 0.00 ? 331 SER A CB   2  
ATOM 1414  O OG   . SER A 1 40 ? 0.186   -16.806 3.384   1.00 0.00 ? 331 SER A OG   2  
ATOM 1415  H H    . SER A 1 40 ? -0.223  -14.862 -0.041  1.00 0.00 ? 331 SER A H    2  
ATOM 1416  H HA   . SER A 1 40 ? -0.239  -17.571 0.931   1.00 0.00 ? 331 SER A HA   2  
ATOM 1417  H HB2  . SER A 1 40 ? 1.116   -15.697 1.947   1.00 0.00 ? 331 SER A HB2  2  
ATOM 1418  H HG   . SER A 1 40 ? 1.102   -16.903 3.655   1.00 0.00 ? 331 SER A HG   2  
ATOM 1419  N N    . ALA A 1 41 ? -2.483  -17.871 2.044   1.00 0.00 ? 332 ALA A N    2  
ATOM 1420  C CA   . ALA A 1 41 ? -3.861  -18.128 2.442   1.00 0.00 ? 332 ALA A CA   2  
ATOM 1421  C C    . ALA A 1 41 ? -3.935  -19.264 3.457   1.00 0.00 ? 332 ALA A C    2  
ATOM 1422  O O    . ALA A 1 41 ? -2.910  -19.748 3.937   1.00 0.00 ? 332 ALA A O    2  
ATOM 1423  C CB   . ALA A 1 41 ? -4.715  -18.450 1.222   1.00 0.00 ? 332 ALA A CB   2  
ATOM 1424  H H    . ALA A 1 41 ? -1.803  -18.559 2.201   1.00 0.00 ? 332 ALA A H    2  
ATOM 1425  H HA   . ALA A 1 41 ? -4.249  -17.227 2.899   1.00 0.00 ? 332 ALA A HA   2  
ATOM 1426  H HB1  . ALA A 1 41 ? -5.738  -18.609 1.529   1.00 0.00 ? 332 ALA A HB1  2  
ATOM 1427  H HB2  . ALA A 1 41 ? -4.672  -17.627 0.524   1.00 0.00 ? 332 ALA A HB2  2  
ATOM 1428  H HB3  . ALA A 1 41 ? -4.340  -19.344 0.747   1.00 0.00 ? 332 ALA A HB3  2  
ATOM 1429  N N    . ASN A 1 42 ? -5.154  -19.686 3.777   1.00 0.00 ? 333 ASN A N    2  
ATOM 1430  C CA   . ASN A 1 42 ? -5.362  -20.765 4.736   1.00 0.00 ? 333 ASN A CA   2  
ATOM 1431  C C    . ASN A 1 42 ? -6.067  -21.950 4.082   1.00 0.00 ? 333 ASN A C    2  
ATOM 1432  O O    . ASN A 1 42 ? -7.246  -21.797 3.699   1.00 0.00 ? 333 ASN A O    2  
ATOM 1433  C CB   . ASN A 1 42 ? -6.182  -20.264 5.926   1.00 0.00 ? 333 ASN A CB   2  
ATOM 1434  C CG   . ASN A 1 42 ? -5.730  -18.898 6.403   1.00 0.00 ? 333 ASN A CG   2  
ATOM 1435  O OD1  . ASN A 1 42 ? -4.534  -18.623 6.493   1.00 0.00 ? 333 ASN A OD1  2  
ATOM 1436  N ND2  . ASN A 1 42 ? -6.688  -18.032 6.710   1.00 0.00 ? 333 ASN A ND2  2  
ATOM 1437  O OXT  . ASN A 1 42 ? -5.434  -23.019 3.959   1.00 0.00 ? 333 ASN A OXT  2  
ATOM 1438  H H    . ASN A 1 42 ? -5.932  -19.263 3.358   1.00 0.00 ? 333 ASN A H    2  
ATOM 1439  H HA   . ASN A 1 42 ? -4.394  -21.088 5.088   1.00 0.00 ? 333 ASN A HA   2  
ATOM 1440  H HB2  . ASN A 1 42 ? -7.220  -20.199 5.640   1.00 0.00 ? 333 ASN A HB2  2  
ATOM 1441  H HD21 . ASN A 1 42 ? -7.620  -18.319 6.614   1.00 0.00 ? 333 ASN A HD21 2  
ATOM 1442  H HD22 . ASN A 1 42 ? -6.425  -17.141 7.021   1.00 0.00 ? 333 ASN A HD22 2  
ATOM 1443  N N    . GLY B 2 1  ? 13.347  -4.365  19.657  1.00 0.00 ? 198 GLY B N    2  
ATOM 1444  C CA   . GLY B 2 1  ? 12.687  -3.213  18.983  1.00 0.00 ? 198 GLY B CA   2  
ATOM 1445  C C    . GLY B 2 1  ? 12.838  -3.258  17.473  1.00 0.00 ? 198 GLY B C    2  
ATOM 1446  O O    . GLY B 2 1  ? 11.842  -3.244  16.750  1.00 0.00 ? 198 GLY B O    2  
ATOM 1447  H H1   . GLY B 2 1  ? 14.222  -4.052  20.125  1.00 0.00 ? 198 GLY B H1   2  
ATOM 1448  H H2   . GLY B 2 1  ? 13.583  -5.100  18.961  1.00 0.00 ? 198 GLY B H2   2  
ATOM 1449  H H3   . GLY B 2 1  ? 12.711  -4.772  20.373  1.00 0.00 ? 198 GLY B H3   2  
ATOM 1450  H HA2  . GLY B 2 1  ? 11.635  -3.221  19.229  1.00 0.00 ? 198 GLY B HA2  2  
ATOM 1451  H HA3  . GLY B 2 1  ? 13.124  -2.296  19.351  1.00 0.00 ? 198 GLY B HA3  2  
ATOM 1452  N N    . PRO B 2 2  ? 14.081  -3.314  16.968  1.00 0.00 ? 199 PRO B N    2  
ATOM 1453  C CA   . PRO B 2 2  ? 14.348  -3.361  15.530  1.00 0.00 ? 199 PRO B CA   2  
ATOM 1454  C C    . PRO B 2 2  ? 14.170  -4.762  14.954  1.00 0.00 ? 199 PRO B C    2  
ATOM 1455  O O    . PRO B 2 2  ? 15.106  -5.337  14.398  1.00 0.00 ? 199 PRO B O    2  
ATOM 1456  C CB   . PRO B 2 2  ? 15.809  -2.928  15.444  1.00 0.00 ? 199 PRO B CB   2  
ATOM 1457  C CG   . PRO B 2 2  ? 16.414  -3.413  16.717  1.00 0.00 ? 199 PRO B CG   2  
ATOM 1458  C CD   . PRO B 2 2  ? 15.327  -3.334  17.760  1.00 0.00 ? 199 PRO B CD   2  
ATOM 1459  H HA   . PRO B 2 2  ? 13.728  -2.665  14.986  1.00 0.00 ? 199 PRO B HA   2  
ATOM 1460  H HB2  . PRO B 2 2  ? 16.273  -3.385  14.582  1.00 0.00 ? 199 PRO B HB2  2  
ATOM 1461  H HG2  . PRO B 2 2  ? 16.746  -4.434  16.598  1.00 0.00 ? 199 PRO B HG2  2  
ATOM 1462  H HD2  . PRO B 2 2  ? 15.359  -4.201  18.402  1.00 0.00 ? 199 PRO B HD2  2  
ATOM 1463  N N    . LEU B 2 3  ? 12.965  -5.304  15.090  1.00 0.00 ? 200 LEU B N    2  
ATOM 1464  C CA   . LEU B 2 3  ? 12.666  -6.638  14.585  1.00 0.00 ? 200 LEU B CA   2  
ATOM 1465  C C    . LEU B 2 3  ? 12.343  -6.598  13.095  1.00 0.00 ? 200 LEU B C    2  
ATOM 1466  O O    . LEU B 2 3  ? 12.196  -5.525  12.510  1.00 0.00 ? 200 LEU B O    2  
ATOM 1467  C CB   . LEU B 2 3  ? 11.496  -7.247  15.358  1.00 0.00 ? 200 LEU B CB   2  
ATOM 1468  C CG   . LEU B 2 3  ? 11.471  -6.927  16.854  1.00 0.00 ? 200 LEU B CG   2  
ATOM 1469  C CD1  . LEU B 2 3  ? 10.189  -7.440  17.490  1.00 0.00 ? 200 LEU B CD1  2  
ATOM 1470  C CD2  . LEU B 2 3  ? 12.688  -7.524  17.546  1.00 0.00 ? 200 LEU B CD2  2  
ATOM 1471  H H    . LEU B 2 3  ? 12.259  -4.793  15.538  1.00 0.00 ? 200 LEU B H    2  
ATOM 1472  H HA   . LEU B 2 3  ? 13.543  -7.252  14.734  1.00 0.00 ? 200 LEU B HA   2  
ATOM 1473  H HB2  . LEU B 2 3  ? 10.576  -6.888  14.918  1.00 0.00 ? 200 LEU B HB2  2  
ATOM 1474  H HG   . LEU B 2 3  ? 11.502  -5.855  16.987  1.00 0.00 ? 200 LEU B HG   2  
ATOM 1475  H HD11 . LEU B 2 3  ? 9.485   -6.626  17.589  1.00 0.00 ? 200 LEU B HD11 2  
ATOM 1476  H HD12 . LEU B 2 3  ? 9.762   -8.212  16.867  1.00 0.00 ? 200 LEU B HD12 2  
ATOM 1477  H HD13 . LEU B 2 3  ? 10.410  -7.847  18.466  1.00 0.00 ? 200 LEU B HD13 2  
ATOM 1478  H HD21 . LEU B 2 3  ? 12.578  -8.596  17.603  1.00 0.00 ? 200 LEU B HD21 2  
ATOM 1479  H HD22 . LEU B 2 3  ? 13.577  -7.282  16.983  1.00 0.00 ? 200 LEU B HD22 2  
ATOM 1480  H HD23 . LEU B 2 3  ? 12.772  -7.116  18.543  1.00 0.00 ? 200 LEU B HD23 2  
ATOM 1481  N N    . GLY B 2 4  ? 12.234  -7.775  12.487  1.00 0.00 ? 201 GLY B N    2  
ATOM 1482  C CA   . GLY B 2 4  ? 11.929  -7.852  11.071  1.00 0.00 ? 201 GLY B CA   2  
ATOM 1483  C C    . GLY B 2 4  ? 13.118  -7.498  10.202  1.00 0.00 ? 201 GLY B C    2  
ATOM 1484  O O    . GLY B 2 4  ? 14.266  -7.602  10.634  1.00 0.00 ? 201 GLY B O    2  
ATOM 1485  H H    . GLY B 2 4  ? 12.363  -8.597  13.004  1.00 0.00 ? 201 GLY B H    2  
ATOM 1486  H HA2  . GLY B 2 4  ? 11.613  -8.857  10.838  1.00 0.00 ? 201 GLY B HA2  2  
ATOM 1487  H HA3  . GLY B 2 4  ? 11.120  -7.171  10.851  1.00 0.00 ? 201 GLY B HA3  2  
ATOM 1488  N N    . SER B 2 5  ? 12.844  -7.078  8.972   1.00 0.00 ? 202 SER B N    2  
ATOM 1489  C CA   . SER B 2 5  ? 13.900  -6.707  8.038   1.00 0.00 ? 202 SER B CA   2  
ATOM 1490  C C    . SER B 2 5  ? 13.541  -5.427  7.291   1.00 0.00 ? 202 SER B C    2  
ATOM 1491  O O    . SER B 2 5  ? 14.345  -4.497  7.214   1.00 0.00 ? 202 SER B O    2  
ATOM 1492  C CB   . SER B 2 5  ? 14.145  -7.840  7.039   1.00 0.00 ? 202 SER B CB   2  
ATOM 1493  O OG   . SER B 2 5  ? 12.968  -8.601  6.831   1.00 0.00 ? 202 SER B OG   2  
ATOM 1494  H H    . SER B 2 5  ? 11.909  -7.014  8.685   1.00 0.00 ? 202 SER B H    2  
ATOM 1495  H HA   . SER B 2 5  ? 14.801  -6.538  8.606   1.00 0.00 ? 202 SER B HA   2  
ATOM 1496  H HB2  . SER B 2 5  ? 14.460  -7.423  6.095   1.00 0.00 ? 202 SER B HB2  2  
ATOM 1497  H HG   . SER B 2 5  ? 13.019  -9.416  7.334   1.00 0.00 ? 202 SER B HG   2  
ATOM 1498  N N    . GLU B 2 6  ? 12.332  -5.386  6.741   1.00 0.00 ? 203 GLU B N    2  
ATOM 1499  C CA   . GLU B 2 6  ? 11.870  -4.220  5.998   1.00 0.00 ? 203 GLU B CA   2  
ATOM 1500  C C    . GLU B 2 6  ? 10.375  -4.318  5.701   1.00 0.00 ? 203 GLU B C    2  
ATOM 1501  O O    . GLU B 2 6  ? 9.645   -3.331  5.808   1.00 0.00 ? 203 GLU B O    2  
ATOM 1502  C CB   . GLU B 2 6  ? 12.655  -4.080  4.692   1.00 0.00 ? 203 GLU B CB   2  
ATOM 1503  C CG   . GLU B 2 6  ? 13.179  -2.675  4.441   1.00 0.00 ? 203 GLU B CG   2  
ATOM 1504  C CD   . GLU B 2 6  ? 14.595  -2.481  4.949   1.00 0.00 ? 203 GLU B CD   2  
ATOM 1505  O OE1  . GLU B 2 6  ? 15.513  -3.138  4.414   1.00 0.00 ? 203 GLU B OE1  2  
ATOM 1506  O OE2  . GLU B 2 6  ? 14.785  -1.672  5.881   1.00 0.00 ? 203 GLU B OE2  2  
ATOM 1507  H H    . GLU B 2 6  ? 11.737  -6.159  6.837   1.00 0.00 ? 203 GLU B H    2  
ATOM 1508  H HA   . GLU B 2 6  ? 12.047  -3.347  6.609   1.00 0.00 ? 203 GLU B HA   2  
ATOM 1509  H HB2  . GLU B 2 6  ? 13.497  -4.755  4.718   1.00 0.00 ? 203 GLU B HB2  2  
ATOM 1510  H HG2  . GLU B 2 6  ? 13.167  -2.485  3.378   1.00 0.00 ? 203 GLU B HG2  2  
ATOM 1511  N N    . LEU B 2 7  ? 9.926   -5.512  5.328   1.00 0.00 ? 204 LEU B N    2  
ATOM 1512  C CA   . LEU B 2 7  ? 8.519   -5.736  5.013   1.00 0.00 ? 204 LEU B CA   2  
ATOM 1513  C C    . LEU B 2 7  ? 7.699   -5.935  6.284   1.00 0.00 ? 204 LEU B C    2  
ATOM 1514  O O    . LEU B 2 7  ? 8.251   -6.114  7.370   1.00 0.00 ? 204 LEU B O    2  
ATOM 1515  C CB   . LEU B 2 7  ? 8.368   -6.955  4.100   1.00 0.00 ? 204 LEU B CB   2  
ATOM 1516  C CG   . LEU B 2 7  ? 9.504   -7.156  3.098   1.00 0.00 ? 204 LEU B CG   2  
ATOM 1517  C CD1  . LEU B 2 7  ? 9.193   -8.314  2.162   1.00 0.00 ? 204 LEU B CD1  2  
ATOM 1518  C CD2  . LEU B 2 7  ? 9.747   -5.879  2.307   1.00 0.00 ? 204 LEU B CD2  2  
ATOM 1519  H H    . LEU B 2 7  ? 10.556  -6.260  5.261   1.00 0.00 ? 204 LEU B H    2  
ATOM 1520  H HA   . LEU B 2 7  ? 8.152   -4.863  4.496   1.00 0.00 ? 204 LEU B HA   2  
ATOM 1521  H HB2  . LEU B 2 7  ? 8.302   -7.837  4.721   1.00 0.00 ? 204 LEU B HB2  2  
ATOM 1522  H HG   . LEU B 2 7  ? 10.412  -7.397  3.634   1.00 0.00 ? 204 LEU B HG   2  
ATOM 1523  H HD11 . LEU B 2 7  ? 8.980   -9.199  2.743   1.00 0.00 ? 204 LEU B HD11 2  
ATOM 1524  H HD12 . LEU B 2 7  ? 8.334   -8.067  1.557   1.00 0.00 ? 204 LEU B HD12 2  
ATOM 1525  H HD13 . LEU B 2 7  ? 10.043  -8.499  1.522   1.00 0.00 ? 204 LEU B HD13 2  
ATOM 1526  H HD21 . LEU B 2 7  ? 9.651   -5.027  2.964   1.00 0.00 ? 204 LEU B HD21 2  
ATOM 1527  H HD22 . LEU B 2 7  ? 10.741  -5.899  1.886   1.00 0.00 ? 204 LEU B HD22 2  
ATOM 1528  H HD23 . LEU B 2 7  ? 9.020   -5.804  1.512   1.00 0.00 ? 204 LEU B HD23 2  
ATOM 1529  N N    . GLU B 2 8  ? 6.377   -5.902  6.141   1.00 0.00 ? 205 GLU B N    2  
ATOM 1530  C CA   . GLU B 2 8  ? 5.480   -6.081  7.278   1.00 0.00 ? 205 GLU B CA   2  
ATOM 1531  C C    . GLU B 2 8  ? 5.606   -4.916  8.258   1.00 0.00 ? 205 GLU B C    2  
ATOM 1532  O O    . GLU B 2 8  ? 5.847   -5.111  9.449   1.00 0.00 ? 205 GLU B O    2  
ATOM 1533  C CB   . GLU B 2 8  ? 5.777   -7.409  7.981   1.00 0.00 ? 205 GLU B CB   2  
ATOM 1534  C CG   . GLU B 2 8  ? 4.668   -8.437  7.830   1.00 0.00 ? 205 GLU B CG   2  
ATOM 1535  C CD   . GLU B 2 8  ? 3.400   -8.038  8.557   1.00 0.00 ? 205 GLU B CD   2  
ATOM 1536  O OE1  . GLU B 2 8  ? 3.225   -6.830  8.827   1.00 0.00 ? 205 GLU B OE1  2  
ATOM 1537  O OE2  . GLU B 2 8  ? 2.579   -8.931  8.856   1.00 0.00 ? 205 GLU B OE2  2  
ATOM 1538  H H    . GLU B 2 8  ? 5.998   -5.754  5.249   1.00 0.00 ? 205 GLU B H    2  
ATOM 1539  H HA   . GLU B 2 8  ? 4.468   -6.105  6.899   1.00 0.00 ? 205 GLU B HA   2  
ATOM 1540  H HB2  . GLU B 2 8  ? 6.684   -7.826  7.567   1.00 0.00 ? 205 GLU B HB2  2  
ATOM 1541  H HG2  . GLU B 2 8  ? 4.443   -8.553  6.781   1.00 0.00 ? 205 GLU B HG2  2  
ATOM 1542  N N    . SER B 2 9  ? 5.442   -3.700  7.745   1.00 0.00 ? 206 SER B N    2  
ATOM 1543  C CA   . SER B 2 9  ? 5.535   -2.504  8.580   1.00 0.00 ? 206 SER B CA   2  
ATOM 1544  C C    . SER B 2 9  ? 5.385   -1.205  7.778   1.00 0.00 ? 206 SER B C    2  
ATOM 1545  O O    . SER B 2 9  ? 4.634   -0.313  8.174   1.00 0.00 ? 206 SER B O    2  
ATOM 1546  C CB   . SER B 2 9  ? 6.871   -2.492  9.326   1.00 0.00 ? 206 SER B CB   2  
ATOM 1547  O OG   . SER B 2 9  ? 6.695   -2.120  10.682  1.00 0.00 ? 206 SER B OG   2  
ATOM 1548  H H    . SER B 2 9  ? 5.255   -3.613  6.794   1.00 0.00 ? 206 SER B H    2  
ATOM 1549  H HA   . SER B 2 9  ? 4.739   -2.552  9.306   1.00 0.00 ? 206 SER B HA   2  
ATOM 1550  H HB2  . SER B 2 9  ? 7.309   -3.479  9.291   1.00 0.00 ? 206 SER B HB2  2  
ATOM 1551  H HG   . SER B 2 9  ? 6.913   -2.864  11.250  1.00 0.00 ? 206 SER B HG   2  
ATOM 1552  N N    . PRO B 2 10 ? 6.092   -1.078  6.639   1.00 0.00 ? 207 PRO B N    2  
ATOM 1553  C CA   . PRO B 2 10 ? 6.056   0.132   5.805   1.00 0.00 ? 207 PRO B CA   2  
ATOM 1554  C C    . PRO B 2 10 ? 4.726   0.413   5.087   1.00 0.00 ? 207 PRO B C    2  
ATOM 1555  O O    . PRO B 2 10 ? 4.392   1.583   4.894   1.00 0.00 ? 207 PRO B O    2  
ATOM 1556  C CB   . PRO B 2 10 ? 7.176   -0.095  4.782   1.00 0.00 ? 207 PRO B CB   2  
ATOM 1557  C CG   . PRO B 2 10 ? 7.958   -1.259  5.292   1.00 0.00 ? 207 PRO B CG   2  
ATOM 1558  C CD   . PRO B 2 10 ? 6.987   -2.091  6.070   1.00 0.00 ? 207 PRO B CD   2  
ATOM 1559  H HA   . PRO B 2 10 ? 6.303   0.998   6.390   1.00 0.00 ? 207 PRO B HA   2  
ATOM 1560  H HB2  . PRO B 2 10 ? 6.744   -0.299  3.819   1.00 0.00 ? 207 PRO B HB2  2  
ATOM 1561  H HG2  . PRO B 2 10 ? 8.359   -1.826  4.463   1.00 0.00 ? 207 PRO B HG2  2  
ATOM 1562  H HD2  . PRO B 2 10 ? 6.450   -2.756  5.408   1.00 0.00 ? 207 PRO B HD2  2  
ATOM 1563  N N    . PRO B 2 11 ? 3.946   -0.613  4.663   1.00 0.00 ? 208 PRO B N    2  
ATOM 1564  C CA   . PRO B 2 11 ? 2.686   -0.388  3.964   1.00 0.00 ? 208 PRO B CA   2  
ATOM 1565  C C    . PRO B 2 11 ? 1.901   0.795   4.518   1.00 0.00 ? 208 PRO B C    2  
ATOM 1566  O O    . PRO B 2 11 ? 1.538   0.800   5.694   1.00 0.00 ? 208 PRO B O    2  
ATOM 1567  C CB   . PRO B 2 11 ? 1.904   -1.680  4.176   1.00 0.00 ? 208 PRO B CB   2  
ATOM 1568  C CG   . PRO B 2 11 ? 2.924   -2.733  4.451   1.00 0.00 ? 208 PRO B CG   2  
ATOM 1569  C CD   . PRO B 2 11 ? 4.224   -2.048  4.804   1.00 0.00 ? 208 PRO B CD   2  
ATOM 1570  H HA   . PRO B 2 11 ? 2.853   -0.249  2.919   1.00 0.00 ? 208 PRO B HA   2  
ATOM 1571  H HB2  . PRO B 2 11 ? 1.224   -1.558  5.005   1.00 0.00 ? 208 PRO B HB2  2  
ATOM 1572  H HG2  . PRO B 2 11 ? 2.597   -3.344  5.280   1.00 0.00 ? 208 PRO B HG2  2  
ATOM 1573  H HD2  . PRO B 2 11 ? 4.488   -2.283  5.809   1.00 0.00 ? 208 PRO B HD2  2  
ATOM 1574  N N    . PRO B 2 12 ? 1.681   1.838   3.690   1.00 0.00 ? 209 PRO B N    2  
ATOM 1575  C CA   . PRO B 2 12 ? 0.914   3.023   4.078   1.00 0.00 ? 209 PRO B CA   2  
ATOM 1576  C C    . PRO B 2 12 ? -0.380  2.663   4.807   1.00 0.00 ? 209 PRO B C    2  
ATOM 1577  O O    . PRO B 2 12 ? -0.628  1.502   5.111   1.00 0.00 ? 209 PRO B O    2  
ATOM 1578  C CB   . PRO B 2 12 ? 0.602   3.700   2.733   1.00 0.00 ? 209 PRO B CB   2  
ATOM 1579  C CG   . PRO B 2 12 ? 1.132   2.797   1.681   1.00 0.00 ? 209 PRO B CG   2  
ATOM 1580  C CD   . PRO B 2 12 ? 2.196   1.984   2.325   1.00 0.00 ? 209 PRO B CD   2  
ATOM 1581  H HA   . PRO B 2 12 ? 1.499   3.689   4.693   1.00 0.00 ? 209 PRO B HA   2  
ATOM 1582  H HB2  . PRO B 2 12 ? -0.460  3.809   2.628   1.00 0.00 ? 209 PRO B HB2  2  
ATOM 1583  H HG2  . PRO B 2 12 ? 0.346   2.154   1.338   1.00 0.00 ? 209 PRO B HG2  2  
ATOM 1584  H HD2  . PRO B 2 12 ? 2.283   1.037   1.823   1.00 0.00 ? 209 PRO B HD2  2  
ATOM 1585  N N    . PRO B 2 13 ? -1.247  3.650   5.066   1.00 0.00 ? 210 PRO B N    2  
ATOM 1586  C CA   . PRO B 2 13 ? -2.491  3.423   5.777   1.00 0.00 ? 210 PRO B CA   2  
ATOM 1587  C C    . PRO B 2 13 ? -3.630  3.044   4.850   1.00 0.00 ? 210 PRO B C    2  
ATOM 1588  O O    . PRO B 2 13 ? -3.544  3.228   3.636   1.00 0.00 ? 210 PRO B O    2  
ATOM 1589  C CB   . PRO B 2 13 ? -2.755  4.777   6.414   1.00 0.00 ? 210 PRO B CB   2  
ATOM 1590  C CG   . PRO B 2 13 ? -2.179  5.769   5.456   1.00 0.00 ? 210 PRO B CG   2  
ATOM 1591  C CD   . PRO B 2 13 ? -1.117  5.052   4.651   1.00 0.00 ? 210 PRO B CD   2  
ATOM 1592  H HA   . PRO B 2 13 ? -2.382  2.675   6.545   1.00 0.00 ? 210 PRO B HA   2  
ATOM 1593  H HB2  . PRO B 2 13 ? -3.820  4.911   6.533   1.00 0.00 ? 210 PRO B HB2  2  
ATOM 1594  H HG2  . PRO B 2 13 ? -2.956  6.131   4.800   1.00 0.00 ? 210 PRO B HG2  2  
ATOM 1595  H HD2  . PRO B 2 13 ? -1.322  5.154   3.593   1.00 0.00 ? 210 PRO B HD2  2  
ATOM 1596  N N    . TYR B 2 14 ? -4.699  2.514   5.426   1.00 0.00 ? 211 TYR B N    2  
ATOM 1597  C CA   . TYR B 2 14 ? -5.854  2.121   4.642   1.00 0.00 ? 211 TYR B CA   2  
ATOM 1598  C C    . TYR B 2 14 ? -6.422  3.331   3.904   1.00 0.00 ? 211 TYR B C    2  
ATOM 1599  O O    . TYR B 2 14 ? -6.161  3.527   2.717   1.00 0.00 ? 211 TYR B O    2  
ATOM 1600  C CB   . TYR B 2 14 ? -6.930  1.494   5.542   1.00 0.00 ? 211 TYR B CB   2  
ATOM 1601  C CG   . TYR B 2 14 ? -8.278  1.359   4.865   1.00 0.00 ? 211 TYR B CG   2  
ATOM 1602  C CD1  . TYR B 2 14 ? -8.391  0.703   3.652   1.00 0.00 ? 211 TYR B CD1  2  
ATOM 1603  C CD2  . TYR B 2 14 ? -9.422  1.909   5.426   1.00 0.00 ? 211 TYR B CD2  2  
ATOM 1604  C CE1  . TYR B 2 14 ? -9.608  0.592   3.009   1.00 0.00 ? 211 TYR B CE1  2  
ATOM 1605  C CE2  . TYR B 2 14 ? -10.647 1.800   4.794   1.00 0.00 ? 211 TYR B CE2  2  
ATOM 1606  C CZ   . TYR B 2 14 ? -10.734 1.142   3.585   1.00 0.00 ? 211 TYR B CZ   2  
ATOM 1607  O OH   . TYR B 2 14 ? -11.950 1.035   2.950   1.00 0.00 ? 211 TYR B OH   2  
ATOM 1608  H H    . TYR B 2 14 ? -4.708  2.385   6.398   1.00 0.00 ? 211 TYR B H    2  
ATOM 1609  H HA   . TYR B 2 14 ? -5.525  1.390   3.916   1.00 0.00 ? 211 TYR B HA   2  
ATOM 1610  H HB2  . TYR B 2 14 ? -6.609  0.507   5.842   1.00 0.00 ? 211 TYR B HB2  2  
ATOM 1611  H HD1  . TYR B 2 14 ? -7.508  0.270   3.210   1.00 0.00 ? 211 TYR B HD1  2  
ATOM 1612  H HD2  . TYR B 2 14 ? -9.349  2.423   6.372   1.00 0.00 ? 211 TYR B HD2  2  
ATOM 1613  H HE1  . TYR B 2 14 ? -9.673  0.080   2.060   1.00 0.00 ? 211 TYR B HE1  2  
ATOM 1614  H HE2  . TYR B 2 14 ? -11.528 2.231   5.246   1.00 0.00 ? 211 TYR B HE2  2  
ATOM 1615  H HH   . TYR B 2 14 ? -12.645 0.936   3.604   1.00 0.00 ? 211 TYR B HH   2  
ATOM 1616  N N    . SER B 2 15 ? -7.195  4.138   4.624   1.00 0.00 ? 212 SER B N    2  
ATOM 1617  C CA   . SER B 2 15 ? -7.816  5.323   4.047   1.00 0.00 ? 212 SER B CA   2  
ATOM 1618  C C    . SER B 2 15 ? -8.703  4.940   2.867   1.00 0.00 ? 212 SER B C    2  
ATOM 1619  O O    . SER B 2 15 ? -9.911  4.792   3.022   1.00 0.00 ? 212 SER B O    2  
ATOM 1620  C CB   . SER B 2 15 ? -6.754  6.337   3.617   1.00 0.00 ? 212 SER B CB   2  
ATOM 1621  O OG   . SER B 2 15 ? -6.010  6.797   4.732   1.00 0.00 ? 212 SER B OG   2  
ATOM 1622  H H    . SER B 2 15 ? -7.351  3.930   5.568   1.00 0.00 ? 212 SER B H    2  
ATOM 1623  H HA   . SER B 2 15 ? -8.436  5.770   4.811   1.00 0.00 ? 212 SER B HA   2  
ATOM 1624  H HB2  . SER B 2 15 ? -6.075  5.875   2.917   1.00 0.00 ? 212 SER B HB2  2  
ATOM 1625  H HG   . SER B 2 15 ? -5.071  6.723   4.543   1.00 0.00 ? 212 SER B HG   2  
ATOM 1626  N N    . ARG B 2 16 ? -8.091  4.777   1.690   1.00 0.00 ? 213 ARG B N    2  
ATOM 1627  C CA   . ARG B 2 16 ? -8.812  4.396   0.472   1.00 0.00 ? 213 ARG B CA   2  
ATOM 1628  C C    . ARG B 2 16 ? -7.969  4.694   -0.765  1.00 0.00 ? 213 ARG B C    2  
ATOM 1629  O O    . ARG B 2 16 ? -8.001  3.951   -1.745  1.00 0.00 ? 213 ARG B O    2  
ATOM 1630  C CB   . ARG B 2 16 ? -10.156 5.124   0.367   1.00 0.00 ? 213 ARG B CB   2  
ATOM 1631  C CG   . ARG B 2 16 ? -11.334 4.302   0.864   1.00 0.00 ? 213 ARG B CG   2  
ATOM 1632  C CD   . ARG B 2 16 ? -12.208 3.811   -0.279  1.00 0.00 ? 213 ARG B CD   2  
ATOM 1633  N NE   . ARG B 2 16 ? -13.505 4.484   -0.301  1.00 0.00 ? 213 ARG B NE   2  
ATOM 1634  C CZ   . ARG B 2 16 ? -14.580 3.992   -0.910  1.00 0.00 ? 213 ARG B CZ   2  
ATOM 1635  N NH1  . ARG B 2 16 ? -14.512 2.832   -1.548  1.00 0.00 ? 213 ARG B NH1  2  
ATOM 1636  N NH2  . ARG B 2 16 ? -15.724 4.663   -0.883  1.00 0.00 ? 213 ARG B NH2  2  
ATOM 1637  H H    . ARG B 2 16 ? -7.123  4.914   1.638   1.00 0.00 ? 213 ARG B H    2  
ATOM 1638  H HA   . ARG B 2 16 ? -8.991  3.331   0.518   1.00 0.00 ? 213 ARG B HA   2  
ATOM 1639  H HB2  . ARG B 2 16 ? -10.107 6.031   0.951   1.00 0.00 ? 213 ARG B HB2  2  
ATOM 1640  H HG2  . ARG B 2 16 ? -10.958 3.446   1.407   1.00 0.00 ? 213 ARG B HG2  2  
ATOM 1641  H HD2  . ARG B 2 16 ? -11.698 3.999   -1.212  1.00 0.00 ? 213 ARG B HD2  2  
ATOM 1642  H HE   . ARG B 2 16 ? -13.578 5.343   0.163   1.00 0.00 ? 213 ARG B HE   2  
ATOM 1643  H HH11 . ARG B 2 16 ? -13.649 2.325   -1.571  1.00 0.00 ? 213 ARG B HH11 2  
ATOM 1644  H HH12 . ARG B 2 16 ? -15.321 2.463   -2.004  1.00 0.00 ? 213 ARG B HH12 2  
ATOM 1645  H HH21 . ARG B 2 16 ? -15.779 5.539   -0.402  1.00 0.00 ? 213 ARG B HH21 2  
ATOM 1646  H HH22 . ARG B 2 16 ? -16.532 4.294   -1.343  1.00 0.00 ? 213 ARG B HH22 2  
ATOM 1647  N N    . TYR B 2 17 ? -7.215  5.789   -0.708  1.00 0.00 ? 214 TYR B N    2  
ATOM 1648  C CA   . TYR B 2 17 ? -6.359  6.190   -1.821  1.00 0.00 ? 214 TYR B CA   2  
ATOM 1649  C C    . TYR B 2 17 ? -4.920  5.729   -1.588  1.00 0.00 ? 214 TYR B C    2  
ATOM 1650  O O    . TYR B 2 17 ? -4.601  5.180   -0.534  1.00 0.00 ? 214 TYR B O    2  
ATOM 1651  C CB   . TYR B 2 17 ? -6.406  7.710   -2.001  1.00 0.00 ? 214 TYR B CB   2  
ATOM 1652  C CG   . TYR B 2 17 ? -7.779  8.311   -1.795  1.00 0.00 ? 214 TYR B CG   2  
ATOM 1653  C CD1  . TYR B 2 17 ? -8.928  7.559   -2.004  1.00 0.00 ? 214 TYR B CD1  2  
ATOM 1654  C CD2  . TYR B 2 17 ? -7.924  9.633   -1.395  1.00 0.00 ? 214 TYR B CD2  2  
ATOM 1655  C CE1  . TYR B 2 17 ? -10.182 8.108   -1.823  1.00 0.00 ? 214 TYR B CE1  2  
ATOM 1656  C CE2  . TYR B 2 17 ? -9.174  10.189  -1.214  1.00 0.00 ? 214 TYR B CE2  2  
ATOM 1657  C CZ   . TYR B 2 17 ? -10.300 9.423   -1.427  1.00 0.00 ? 214 TYR B CZ   2  
ATOM 1658  O OH   . TYR B 2 17 ? -11.548 9.975   -1.245  1.00 0.00 ? 214 TYR B OH   2  
ATOM 1659  H H    . TYR B 2 17 ? -7.235  6.341   0.101   1.00 0.00 ? 214 TYR B H    2  
ATOM 1660  H HA   . TYR B 2 17 ? -6.736  5.718   -2.716  1.00 0.00 ? 214 TYR B HA   2  
ATOM 1661  H HB2  . TYR B 2 17 ? -5.735  8.172   -1.293  1.00 0.00 ? 214 TYR B HB2  2  
ATOM 1662  H HD1  . TYR B 2 17 ? -8.832  6.528   -2.315  1.00 0.00 ? 214 TYR B HD1  2  
ATOM 1663  H HD2  . TYR B 2 17 ? -7.040  10.231  -1.229  1.00 0.00 ? 214 TYR B HD2  2  
ATOM 1664  H HE1  . TYR B 2 17 ? -11.061 7.507   -1.992  1.00 0.00 ? 214 TYR B HE1  2  
ATOM 1665  H HE2  . TYR B 2 17 ? -9.264  11.219  -0.904  1.00 0.00 ? 214 TYR B HE2  2  
ATOM 1666  H HH   . TYR B 2 17 ? -11.656 10.725  -1.834  1.00 0.00 ? 214 TYR B HH   2  
ATOM 1667  N N    . PRO B 2 18 ? -4.033  5.936   -2.578  1.00 0.00 ? 215 PRO B N    2  
ATOM 1668  C CA   . PRO B 2 18 ? -2.634  5.544   -2.478  1.00 0.00 ? 215 PRO B CA   2  
ATOM 1669  C C    . PRO B 2 18 ? -1.758  6.644   -1.894  1.00 0.00 ? 215 PRO B C    2  
ATOM 1670  O O    . PRO B 2 18 ? -1.265  7.510   -2.617  1.00 0.00 ? 215 PRO B O    2  
ATOM 1671  C CB   . PRO B 2 18 ? -2.264  5.268   -3.935  1.00 0.00 ? 215 PRO B CB   2  
ATOM 1672  C CG   . PRO B 2 18 ? -3.141  6.175   -4.742  1.00 0.00 ? 215 PRO B CG   2  
ATOM 1673  C CD   . PRO B 2 18 ? -4.324  6.557   -3.878  1.00 0.00 ? 215 PRO B CD   2  
ATOM 1674  H HA   . PRO B 2 18 ? -2.517  4.647   -1.895  1.00 0.00 ? 215 PRO B HA   2  
ATOM 1675  H HB2  . PRO B 2 18 ? -1.220  5.490   -4.091  1.00 0.00 ? 215 PRO B HB2  2  
ATOM 1676  H HG2  . PRO B 2 18 ? -2.588  7.059   -5.022  1.00 0.00 ? 215 PRO B HG2  2  
ATOM 1677  H HD2  . PRO B 2 18 ? -4.386  7.631   -3.782  1.00 0.00 ? 215 PRO B HD2  2  
ATOM 1678  N N    . MET B 2 19 ? -1.569  6.605   -0.580  1.00 0.00 ? 216 MET B N    2  
ATOM 1679  C CA   . MET B 2 19 ? -0.755  7.602   0.103   1.00 0.00 ? 216 MET B CA   2  
ATOM 1680  C C    . MET B 2 19 ? 0.265   6.950   1.027   1.00 0.00 ? 216 MET B C    2  
ATOM 1681  O O    . MET B 2 19 ? -0.093  6.373   2.053   1.00 0.00 ? 216 MET B O    2  
ATOM 1682  C CB   . MET B 2 19 ? -1.649  8.555   0.899   1.00 0.00 ? 216 MET B CB   2  
ATOM 1683  C CG   . MET B 2 19 ? -2.310  7.908   2.108   1.00 0.00 ? 216 MET B CG   2  
ATOM 1684  S SD   . MET B 2 19 ? -4.049  8.359   2.273   1.00 0.00 ? 216 MET B SD   2  
ATOM 1685  C CE   . MET B 2 19 ? -4.786  7.378   0.967   1.00 0.00 ? 216 MET B CE   2  
ATOM 1686  H H    . MET B 2 19 ? -1.985  5.887   -0.057  1.00 0.00 ? 216 MET B H    2  
ATOM 1687  H HA   . MET B 2 19 ? -0.224  8.163   -0.649  1.00 0.00 ? 216 MET B HA   2  
ATOM 1688  H HB2  . MET B 2 19 ? -1.053  9.387   1.243   1.00 0.00 ? 216 MET B HB2  2  
ATOM 1689  H HG2  . MET B 2 19 ? -2.237  6.833   2.015   1.00 0.00 ? 216 MET B HG2  2  
ATOM 1690  H HE1  . MET B 2 19 ? -4.959  6.373   1.323   1.00 0.00 ? 216 MET B HE1  2  
ATOM 1691  H HE2  . MET B 2 19 ? -5.726  7.820   0.669   1.00 0.00 ? 216 MET B HE2  2  
ATOM 1692  H HE3  . MET B 2 19 ? -4.118  7.348   0.118   1.00 0.00 ? 216 MET B HE3  2  
ATOM 1693  N N    . ASP B 2 20 ? 1.539   7.058   0.660   1.00 0.00 ? 217 ASP B N    2  
ATOM 1694  C CA   . ASP B 2 20 ? 2.621   6.482   1.451   1.00 0.00 ? 217 ASP B CA   2  
ATOM 1695  C C    . ASP B 2 20 ? 2.483   6.859   2.923   1.00 0.00 ? 217 ASP B C    2  
ATOM 1696  O O    . ASP B 2 20 ? 1.655   7.743   3.232   1.00 0.00 ? 217 ASP B O    2  
ATOM 1697  C CB   . ASP B 2 20 ? 3.976   6.954   0.919   1.00 0.00 ? 217 ASP B CB   2  
ATOM 1698  C CG   . ASP B 2 20 ? 5.137   6.398   1.719   1.00 0.00 ? 217 ASP B CG   2  
ATOM 1699  O OD1  . ASP B 2 20 ? 5.157   5.173   1.964   1.00 0.00 ? 217 ASP B OD1  2  
ATOM 1700  O OD2  . ASP B 2 20 ? 6.026   7.188   2.103   1.00 0.00 ? 217 ASP B OD2  2  
ATOM 1701  O OXT  . ASP B 2 20 ? 3.203   6.268   3.755   1.00 0.00 ? 217 ASP B OXT  2  
ATOM 1702  H H    . ASP B 2 20 ? 1.757   7.538   -0.166  1.00 0.00 ? 217 ASP B H    2  
ATOM 1703  H HA   . ASP B 2 20 ? 2.565   5.408   1.359   1.00 0.00 ? 217 ASP B HA   2  
ATOM 1704  H HB2  . ASP B 2 20 ? 4.085   6.634   -0.106  1.00 0.00 ? 217 ASP B HB2  2  
ATOM 1705  N N    . GLY A 1 1  ? 9.227   -13.501 -9.822  1.00 0.00 ? 292 GLY A N    3  
ATOM 1706  C CA   . GLY A 1 1  ? 8.136   -12.702 -9.200  1.00 0.00 ? 292 GLY A CA   3  
ATOM 1707  C C    . GLY A 1 1  ? 6.765   -13.088 -9.724  1.00 0.00 ? 292 GLY A C    3  
ATOM 1708  O O    . GLY A 1 1  ? 6.339   -12.598 -10.770 1.00 0.00 ? 292 GLY A O    3  
ATOM 1709  H H1   . GLY A 1 1  ? 9.382   -14.375 -9.283  1.00 0.00 ? 292 GLY A H1   3  
ATOM 1710  H H2   . GLY A 1 1  ? 10.111  -12.952 -9.832  1.00 0.00 ? 292 GLY A H2   3  
ATOM 1711  H H3   . GLY A 1 1  ? 8.976   -13.749 -10.801 1.00 0.00 ? 292 GLY A H3   3  
ATOM 1712  H HA2  . GLY A 1 1  ? 8.157   -12.854 -8.132  1.00 0.00 ? 292 GLY A HA2  3  
ATOM 1713  H HA3  . GLY A 1 1  ? 8.306   -11.656 -9.408  1.00 0.00 ? 292 GLY A HA3  3  
ATOM 1714  N N    . PRO A 1 2  ? 6.046   -13.971 -9.009  1.00 0.00 ? 293 PRO A N    3  
ATOM 1715  C CA   . PRO A 1 2  ? 4.711   -14.415 -9.419  1.00 0.00 ? 293 PRO A CA   3  
ATOM 1716  C C    . PRO A 1 2  ? 3.658   -13.325 -9.249  1.00 0.00 ? 293 PRO A C    3  
ATOM 1717  O O    . PRO A 1 2  ? 2.801   -13.136 -10.113 1.00 0.00 ? 293 PRO A O    3  
ATOM 1718  C CB   . PRO A 1 2  ? 4.426   -15.587 -8.478  1.00 0.00 ? 293 PRO A CB   3  
ATOM 1719  C CG   . PRO A 1 2  ? 5.240   -15.304 -7.263  1.00 0.00 ? 293 PRO A CG   3  
ATOM 1720  C CD   . PRO A 1 2  ? 6.479   -14.602 -7.748  1.00 0.00 ? 293 PRO A CD   3  
ATOM 1721  H HA   . PRO A 1 2  ? 4.707   -14.762 -10.442 1.00 0.00 ? 293 PRO A HA   3  
ATOM 1722  H HB2  . PRO A 1 2  ? 3.370   -15.619 -8.249  1.00 0.00 ? 293 PRO A HB2  3  
ATOM 1723  H HG2  . PRO A 1 2  ? 4.686   -14.665 -6.591  1.00 0.00 ? 293 PRO A HG2  3  
ATOM 1724  H HD2  . PRO A 1 2  ? 6.795   -13.857 -7.033  1.00 0.00 ? 293 PRO A HD2  3  
ATOM 1725  N N    . LEU A 1 3  ? 3.728   -12.611 -8.131  1.00 0.00 ? 294 LEU A N    3  
ATOM 1726  C CA   . LEU A 1 3  ? 2.779   -11.539 -7.847  1.00 0.00 ? 294 LEU A CA   3  
ATOM 1727  C C    . LEU A 1 3  ? 1.343   -12.040 -7.964  1.00 0.00 ? 294 LEU A C    3  
ATOM 1728  O O    . LEU A 1 3  ? 0.505   -11.406 -8.606  1.00 0.00 ? 294 LEU A O    3  
ATOM 1729  C CB   . LEU A 1 3  ? 3.003   -10.365 -8.802  1.00 0.00 ? 294 LEU A CB   3  
ATOM 1730  C CG   . LEU A 1 3  ? 2.637   -8.991  -8.236  1.00 0.00 ? 294 LEU A CG   3  
ATOM 1731  C CD1  . LEU A 1 3  ? 3.535   -8.638  -7.061  1.00 0.00 ? 294 LEU A CD1  3  
ATOM 1732  C CD2  . LEU A 1 3  ? 2.731   -7.926  -9.319  1.00 0.00 ? 294 LEU A CD2  3  
ATOM 1733  H H    . LEU A 1 3  ? 4.432   -12.809 -7.479  1.00 0.00 ? 294 LEU A H    3  
ATOM 1734  H HA   . LEU A 1 3  ? 2.951   -11.206 -6.834  1.00 0.00 ? 294 LEU A HA   3  
ATOM 1735  H HB2  . LEU A 1 3  ? 4.047   -10.349 -9.082  1.00 0.00 ? 294 LEU A HB2  3  
ATOM 1736  H HG   . LEU A 1 3  ? 1.617   -9.017  -7.880  1.00 0.00 ? 294 LEU A HG   3  
ATOM 1737  H HD11 . LEU A 1 3  ? 4.180   -9.476  -6.837  1.00 0.00 ? 294 LEU A HD11 3  
ATOM 1738  H HD12 . LEU A 1 3  ? 4.137   -7.778  -7.313  1.00 0.00 ? 294 LEU A HD12 3  
ATOM 1739  H HD13 . LEU A 1 3  ? 2.926   -8.412  -6.197  1.00 0.00 ? 294 LEU A HD13 3  
ATOM 1740  H HD21 . LEU A 1 3  ? 2.639   -8.391  -10.290 1.00 0.00 ? 294 LEU A HD21 3  
ATOM 1741  H HD22 . LEU A 1 3  ? 1.936   -7.207  -9.188  1.00 0.00 ? 294 LEU A HD22 3  
ATOM 1742  H HD23 . LEU A 1 3  ? 3.685   -7.426  -9.250  1.00 0.00 ? 294 LEU A HD23 3  
ATOM 1743  N N    . GLY A 1 4  ? 1.067   -13.181 -7.340  1.00 0.00 ? 295 GLY A N    3  
ATOM 1744  C CA   . GLY A 1 4  ? -0.269  -13.747 -7.386  1.00 0.00 ? 295 GLY A CA   3  
ATOM 1745  C C    . GLY A 1 4  ? -0.616  -14.305 -8.752  1.00 0.00 ? 295 GLY A C    3  
ATOM 1746  O O    . GLY A 1 4  ? 0.268   -14.556 -9.571  1.00 0.00 ? 295 GLY A O    3  
ATOM 1747  H H    . GLY A 1 4  ? 1.775   -13.642 -6.846  1.00 0.00 ? 295 GLY A H    3  
ATOM 1748  H HA2  . GLY A 1 4  ? -0.336  -14.541 -6.657  1.00 0.00 ? 295 GLY A HA2  3  
ATOM 1749  H HA3  . GLY A 1 4  ? -0.983  -12.978 -7.131  1.00 0.00 ? 295 GLY A HA3  3  
ATOM 1750  N N    . SER A 1 5  ? -1.908  -14.503 -8.999  1.00 0.00 ? 296 SER A N    3  
ATOM 1751  C CA   . SER A 1 5  ? -2.369  -15.035 -10.276 1.00 0.00 ? 296 SER A CA   3  
ATOM 1752  C C    . SER A 1 5  ? -3.427  -14.126 -10.893 1.00 0.00 ? 296 SER A C    3  
ATOM 1753  O O    . SER A 1 5  ? -3.194  -13.499 -11.926 1.00 0.00 ? 296 SER A O    3  
ATOM 1754  C CB   . SER A 1 5  ? -2.932  -16.445 -10.093 1.00 0.00 ? 296 SER A CB   3  
ATOM 1755  O OG   . SER A 1 5  ? -3.761  -16.810 -11.183 1.00 0.00 ? 296 SER A OG   3  
ATOM 1756  H H    . SER A 1 5  ? -2.566  -14.286 -8.306  1.00 0.00 ? 296 SER A H    3  
ATOM 1757  H HA   . SER A 1 5  ? -1.520  -15.080 -10.941 1.00 0.00 ? 296 SER A HA   3  
ATOM 1758  H HB2  . SER A 1 5  ? -2.117  -17.150 -10.026 1.00 0.00 ? 296 SER A HB2  3  
ATOM 1759  H HG   . SER A 1 5  ? -3.505  -17.677 -11.504 1.00 0.00 ? 296 SER A HG   3  
ATOM 1760  N N    . GLY A 1 6  ? -4.590  -14.059 -10.254 1.00 0.00 ? 297 GLY A N    3  
ATOM 1761  C CA   . GLY A 1 6  ? -5.666  -13.223 -10.757 1.00 0.00 ? 297 GLY A CA   3  
ATOM 1762  C C    . GLY A 1 6  ? -5.824  -11.942 -9.961  1.00 0.00 ? 297 GLY A C    3  
ATOM 1763  O O    . GLY A 1 6  ? -5.032  -11.668 -9.059  1.00 0.00 ? 297 GLY A O    3  
ATOM 1764  H H    . GLY A 1 6  ? -4.720  -14.581 -9.434  1.00 0.00 ? 297 GLY A H    3  
ATOM 1765  H HA2  . GLY A 1 6  ? -5.458  -12.972 -11.786 1.00 0.00 ? 297 GLY A HA2  3  
ATOM 1766  H HA3  . GLY A 1 6  ? -6.591  -13.778 -10.712 1.00 0.00 ? 297 GLY A HA3  3  
ATOM 1767  N N    . PRO A 1 7  ? -6.847  -11.129 -10.276 1.00 0.00 ? 298 PRO A N    3  
ATOM 1768  C CA   . PRO A 1 7  ? -7.098  -9.865  -9.574  1.00 0.00 ? 298 PRO A CA   3  
ATOM 1769  C C    . PRO A 1 7  ? -7.420  -10.074 -8.098  1.00 0.00 ? 298 PRO A C    3  
ATOM 1770  O O    . PRO A 1 7  ? -7.909  -11.130 -7.700  1.00 0.00 ? 298 PRO A O    3  
ATOM 1771  C CB   . PRO A 1 7  ? -8.305  -9.270  -10.307 1.00 0.00 ? 298 PRO A CB   3  
ATOM 1772  C CG   . PRO A 1 7  ? -8.947  -10.425 -10.995 1.00 0.00 ? 298 PRO A CG   3  
ATOM 1773  C CD   . PRO A 1 7  ? -7.834  -11.373 -11.340 1.00 0.00 ? 298 PRO A CD   3  
ATOM 1774  H HA   . PRO A 1 7  ? -6.255  -9.194  -9.660  1.00 0.00 ? 298 PRO A HA   3  
ATOM 1775  H HB2  . PRO A 1 7  ? -8.975  -8.815  -9.591  1.00 0.00 ? 298 PRO A HB2  3  
ATOM 1776  H HG2  . PRO A 1 7  ? -9.653  -10.902 -10.331 1.00 0.00 ? 298 PRO A HG2  3  
ATOM 1777  H HD2  . PRO A 1 7  ? -8.185  -12.394 -11.316 1.00 0.00 ? 298 PRO A HD2  3  
ATOM 1778  N N    . LEU A 1 8  ? -7.144  -9.053  -7.297  1.00 0.00 ? 299 LEU A N    3  
ATOM 1779  C CA   . LEU A 1 8  ? -7.392  -9.109  -5.860  1.00 0.00 ? 299 LEU A CA   3  
ATOM 1780  C C    . LEU A 1 8  ? -8.834  -9.516  -5.556  1.00 0.00 ? 299 LEU A C    3  
ATOM 1781  O O    . LEU A 1 8  ? -9.716  -9.386  -6.404  1.00 0.00 ? 299 LEU A O    3  
ATOM 1782  C CB   . LEU A 1 8  ? -7.098  -7.750  -5.227  1.00 0.00 ? 299 LEU A CB   3  
ATOM 1783  C CG   . LEU A 1 8  ? -5.624  -7.344  -5.212  1.00 0.00 ? 299 LEU A CG   3  
ATOM 1784  C CD1  . LEU A 1 8  ? -5.448  -6.018  -4.492  1.00 0.00 ? 299 LEU A CD1  3  
ATOM 1785  C CD2  . LEU A 1 8  ? -4.777  -8.425  -4.556  1.00 0.00 ? 299 LEU A CD2  3  
ATOM 1786  H H    . LEU A 1 8  ? -6.761  -8.237  -7.681  1.00 0.00 ? 299 LEU A H    3  
ATOM 1787  H HA   . LEU A 1 8  ? -6.726  -9.844  -5.437  1.00 0.00 ? 299 LEU A HA   3  
ATOM 1788  H HB2  . LEU A 1 8  ? -7.651  -6.998  -5.770  1.00 0.00 ? 299 LEU A HB2  3  
ATOM 1789  H HG   . LEU A 1 8  ? -5.281  -7.220  -6.229  1.00 0.00 ? 299 LEU A HG   3  
ATOM 1790  H HD11 . LEU A 1 8  ? -4.438  -5.943  -4.117  1.00 0.00 ? 299 LEU A HD11 3  
ATOM 1791  H HD12 . LEU A 1 8  ? -5.637  -5.207  -5.180  1.00 0.00 ? 299 LEU A HD12 3  
ATOM 1792  H HD13 . LEU A 1 8  ? -6.142  -5.962  -3.669  1.00 0.00 ? 299 LEU A HD13 3  
ATOM 1793  H HD21 . LEU A 1 8  ? -3.743  -8.117  -4.548  1.00 0.00 ? 299 LEU A HD21 3  
ATOM 1794  H HD22 . LEU A 1 8  ? -5.115  -8.580  -3.542  1.00 0.00 ? 299 LEU A HD22 3  
ATOM 1795  H HD23 . LEU A 1 8  ? -4.875  -9.346  -5.112  1.00 0.00 ? 299 LEU A HD23 3  
ATOM 1796  N N    . PRO A 1 9  ? -9.084  -10.019 -4.332  1.00 0.00 ? 300 PRO A N    3  
ATOM 1797  C CA   . PRO A 1 9  ? -10.423 -10.439 -3.903  1.00 0.00 ? 300 PRO A CA   3  
ATOM 1798  C C    . PRO A 1 9  ? -11.408 -9.275  -3.879  1.00 0.00 ? 300 PRO A C    3  
ATOM 1799  O O    . PRO A 1 9  ? -11.060 -8.149  -4.234  1.00 0.00 ? 300 PRO A O    3  
ATOM 1800  C CB   . PRO A 1 9  ? -10.202 -10.977 -2.483  1.00 0.00 ? 300 PRO A CB   3  
ATOM 1801  C CG   . PRO A 1 9  ? -8.740  -11.248 -2.392  1.00 0.00 ? 300 PRO A CG   3  
ATOM 1802  C CD   . PRO A 1 9  ? -8.082  -10.228 -3.274  1.00 0.00 ? 300 PRO A CD   3  
ATOM 1803  H HA   . PRO A 1 9  ? -10.814 -11.225 -4.530  1.00 0.00 ? 300 PRO A HA   3  
ATOM 1804  H HB2  . PRO A 1 9  ? -10.511 -10.235 -1.762  1.00 0.00 ? 300 PRO A HB2  3  
ATOM 1805  H HG2  . PRO A 1 9  ? -8.406  -11.134 -1.371  1.00 0.00 ? 300 PRO A HG2  3  
ATOM 1806  H HD2  . PRO A 1 9  ? -7.901  -9.316  -2.727  1.00 0.00 ? 300 PRO A HD2  3  
ATOM 1807  N N    . PRO A 1 10 ? -12.657 -9.536  -3.462  1.00 0.00 ? 301 PRO A N    3  
ATOM 1808  C CA   . PRO A 1 10 ? -13.697 -8.514  -3.391  1.00 0.00 ? 301 PRO A CA   3  
ATOM 1809  C C    . PRO A 1 10 ? -13.546 -7.599  -2.176  1.00 0.00 ? 301 PRO A C    3  
ATOM 1810  O O    . PRO A 1 10 ? -14.479 -7.437  -1.389  1.00 0.00 ? 301 PRO A O    3  
ATOM 1811  C CB   . PRO A 1 10 ? -15.006 -9.317  -3.294  1.00 0.00 ? 301 PRO A CB   3  
ATOM 1812  C CG   . PRO A 1 10 ? -14.624 -10.765 -3.348  1.00 0.00 ? 301 PRO A CG   3  
ATOM 1813  C CD   . PRO A 1 10 ? -13.156 -10.847 -3.040  1.00 0.00 ? 301 PRO A CD   3  
ATOM 1814  H HA   . PRO A 1 10 ? -13.712 -7.911  -4.285  1.00 0.00 ? 301 PRO A HA   3  
ATOM 1815  H HB2  . PRO A 1 10 ? -15.505 -9.082  -2.366  1.00 0.00 ? 301 PRO A HB2  3  
ATOM 1816  H HG2  . PRO A 1 10 ? -15.187 -11.317 -2.610  1.00 0.00 ? 301 PRO A HG2  3  
ATOM 1817  H HD2  . PRO A 1 10 ? -12.994 -11.001 -1.984  1.00 0.00 ? 301 PRO A HD2  3  
ATOM 1818  N N    . GLY A 1 11 ? -12.368 -7.000  -2.027  1.00 0.00 ? 302 GLY A N    3  
ATOM 1819  C CA   . GLY A 1 11 ? -12.133 -6.104  -0.907  1.00 0.00 ? 302 GLY A CA   3  
ATOM 1820  C C    . GLY A 1 11 ? -10.771 -5.441  -0.957  1.00 0.00 ? 302 GLY A C    3  
ATOM 1821  O O    . GLY A 1 11 ? -10.620 -4.290  -0.551  1.00 0.00 ? 302 GLY A O    3  
ATOM 1822  H H    . GLY A 1 11 ? -11.653 -7.172  -2.673  1.00 0.00 ? 302 GLY A H    3  
ATOM 1823  H HA2  . GLY A 1 11 ? -12.892 -5.336  -0.910  1.00 0.00 ? 302 GLY A HA2  3  
ATOM 1824  H HA3  . GLY A 1 11 ? -12.212 -6.666  0.011   1.00 0.00 ? 302 GLY A HA3  3  
ATOM 1825  N N    . TRP A 1 12 ? -9.776  -6.166  -1.455  1.00 0.00 ? 303 TRP A N    3  
ATOM 1826  C CA   . TRP A 1 12 ? -8.423  -5.635  -1.544  1.00 0.00 ? 303 TRP A CA   3  
ATOM 1827  C C    . TRP A 1 12 ? -8.221  -4.815  -2.811  1.00 0.00 ? 303 TRP A C    3  
ATOM 1828  O O    . TRP A 1 12 ? -9.039  -4.854  -3.731  1.00 0.00 ? 303 TRP A O    3  
ATOM 1829  C CB   . TRP A 1 12 ? -7.405  -6.770  -1.505  1.00 0.00 ? 303 TRP A CB   3  
ATOM 1830  C CG   . TRP A 1 12 ? -7.447  -7.556  -0.238  1.00 0.00 ? 303 TRP A CG   3  
ATOM 1831  C CD1  . TRP A 1 12 ? -8.283  -8.589  0.058   1.00 0.00 ? 303 TRP A CD1  3  
ATOM 1832  C CD2  . TRP A 1 12 ? -6.610  -7.372  0.905   1.00 0.00 ? 303 TRP A CD2  3  
ATOM 1833  N NE1  . TRP A 1 12 ? -8.021  -9.060  1.321   1.00 0.00 ? 303 TRP A NE1  3  
ATOM 1834  C CE2  . TRP A 1 12 ? -6.993  -8.329  1.862   1.00 0.00 ? 303 TRP A CE2  3  
ATOM 1835  C CE3  . TRP A 1 12 ? -5.572  -6.489  1.210   1.00 0.00 ? 303 TRP A CE3  3  
ATOM 1836  C CZ2  . TRP A 1 12 ? -6.372  -8.427  3.103   1.00 0.00 ? 303 TRP A CZ2  3  
ATOM 1837  C CZ3  . TRP A 1 12 ? -4.955  -6.587  2.440   1.00 0.00 ? 303 TRP A CZ3  3  
ATOM 1838  C CH2  . TRP A 1 12 ? -5.357  -7.549  3.373   1.00 0.00 ? 303 TRP A CH2  3  
ATOM 1839  H H    . TRP A 1 12 ? -9.955  -7.078  -1.766  1.00 0.00 ? 303 TRP A H    3  
ATOM 1840  H HA   . TRP A 1 12 ? -8.266  -4.999  -0.689  1.00 0.00 ? 303 TRP A HA   3  
ATOM 1841  H HB2  . TRP A 1 12 ? -7.599  -7.446  -2.321  1.00 0.00 ? 303 TRP A HB2  3  
ATOM 1842  H HD1  . TRP A 1 12 ? -9.039  -8.969  -0.613  1.00 0.00 ? 303 TRP A HD1  3  
ATOM 1843  H HE1  . TRP A 1 12 ? -8.491  -9.799  1.759   1.00 0.00 ? 303 TRP A HE1  3  
ATOM 1844  H HE3  . TRP A 1 12 ? -5.249  -5.739  0.501   1.00 0.00 ? 303 TRP A HE3  3  
ATOM 1845  H HZ2  . TRP A 1 12 ? -6.668  -9.164  3.835   1.00 0.00 ? 303 TRP A HZ2  3  
ATOM 1846  H HZ3  . TRP A 1 12 ? -4.150  -5.913  2.694   1.00 0.00 ? 303 TRP A HZ3  3  
ATOM 1847  H HH2  . TRP A 1 12 ? -4.844  -7.589  4.320   1.00 0.00 ? 303 TRP A HH2  3  
ATOM 1848  N N    . GLU A 1 13 ? -7.119  -4.074  -2.846  1.00 0.00 ? 304 GLU A N    3  
ATOM 1849  C CA   . GLU A 1 13 ? -6.782  -3.248  -3.996  1.00 0.00 ? 304 GLU A CA   3  
ATOM 1850  C C    . GLU A 1 13 ? -5.296  -2.923  -4.014  1.00 0.00 ? 304 GLU A C    3  
ATOM 1851  O O    . GLU A 1 13 ? -4.723  -2.536  -2.997  1.00 0.00 ? 304 GLU A O    3  
ATOM 1852  C CB   . GLU A 1 13 ? -7.586  -1.956  -3.988  1.00 0.00 ? 304 GLU A CB   3  
ATOM 1853  C CG   . GLU A 1 13 ? -7.378  -1.134  -5.243  1.00 0.00 ? 304 GLU A CG   3  
ATOM 1854  C CD   . GLU A 1 13 ? -8.658  -0.934  -6.031  1.00 0.00 ? 304 GLU A CD   3  
ATOM 1855  O OE1  . GLU A 1 13 ? -9.380  0.045   -5.750  1.00 0.00 ? 304 GLU A OE1  3  
ATOM 1856  O OE2  . GLU A 1 13 ? -8.938  -1.757  -6.928  1.00 0.00 ? 304 GLU A OE2  3  
ATOM 1857  H H    . GLU A 1 13 ? -6.516  -4.082  -2.072  1.00 0.00 ? 304 GLU A H    3  
ATOM 1858  H HA   . GLU A 1 13 ? -7.026  -3.800  -4.890  1.00 0.00 ? 304 GLU A HA   3  
ATOM 1859  H HB2  . GLU A 1 13 ? -8.636  -2.195  -3.903  1.00 0.00 ? 304 GLU A HB2  3  
ATOM 1860  H HG2  . GLU A 1 13 ? -6.990  -0.173  -4.963  1.00 0.00 ? 304 GLU A HG2  3  
ATOM 1861  N N    . ILE A 1 14 ? -4.677  -3.073  -5.178  1.00 0.00 ? 305 ILE A N    3  
ATOM 1862  C CA   . ILE A 1 14 ? -3.256  -2.794  -5.320  1.00 0.00 ? 305 ILE A CA   3  
ATOM 1863  C C    . ILE A 1 14 ? -3.003  -1.290  -5.348  1.00 0.00 ? 305 ILE A C    3  
ATOM 1864  O O    . ILE A 1 14 ? -3.852  -0.511  -5.782  1.00 0.00 ? 305 ILE A O    3  
ATOM 1865  C CB   . ILE A 1 14 ? -2.679  -3.438  -6.601  1.00 0.00 ? 305 ILE A CB   3  
ATOM 1866  C CG1  . ILE A 1 14 ? -2.820  -4.970  -6.530  1.00 0.00 ? 305 ILE A CG1  3  
ATOM 1867  C CG2  . ILE A 1 14 ? -1.223  -3.015  -6.818  1.00 0.00 ? 305 ILE A CG2  3  
ATOM 1868  C CD1  . ILE A 1 14 ? -1.647  -5.688  -5.899  1.00 0.00 ? 305 ILE A CD1  3  
ATOM 1869  H H    . ILE A 1 14 ? -5.189  -3.373  -5.958  1.00 0.00 ? 305 ILE A H    3  
ATOM 1870  H HA   . ILE A 1 14 ? -2.748  -3.217  -4.466  1.00 0.00 ? 305 ILE A HA   3  
ATOM 1871  H HB   . ILE A 1 14 ? -3.253  -3.075  -7.440  1.00 0.00 ? 305 ILE A HB   3  
ATOM 1872  H HG12 . ILE A 1 14 ? -3.696  -5.214  -5.953  1.00 0.00 ? 305 ILE A HG12 3  
ATOM 1873  H HG21 . ILE A 1 14 ? -0.727  -2.929  -5.862  1.00 0.00 ? 305 ILE A HG21 3  
ATOM 1874  H HG22 . ILE A 1 14 ? -0.719  -3.754  -7.421  1.00 0.00 ? 305 ILE A HG22 3  
ATOM 1875  H HG23 . ILE A 1 14 ? -1.198  -2.060  -7.322  1.00 0.00 ? 305 ILE A HG23 3  
ATOM 1876  H HD11 . ILE A 1 14 ? -1.595  -5.440  -4.851  1.00 0.00 ? 305 ILE A HD11 3  
ATOM 1877  H HD12 . ILE A 1 14 ? -1.777  -6.755  -6.009  1.00 0.00 ? 305 ILE A HD12 3  
ATOM 1878  H HD13 . ILE A 1 14 ? -0.733  -5.386  -6.386  1.00 0.00 ? 305 ILE A HD13 3  
ATOM 1879  N N    . ARG A 1 15 ? -1.829  -0.898  -4.880  1.00 0.00 ? 306 ARG A N    3  
ATOM 1880  C CA   . ARG A 1 15 ? -1.444  0.503   -4.844  1.00 0.00 ? 306 ARG A CA   3  
ATOM 1881  C C    . ARG A 1 15 ? 0.057   0.626   -4.629  1.00 0.00 ? 306 ARG A C    3  
ATOM 1882  O O    . ARG A 1 15 ? 0.736   -0.371  -4.393  1.00 0.00 ? 306 ARG A O    3  
ATOM 1883  C CB   . ARG A 1 15 ? -2.202  1.223   -3.727  1.00 0.00 ? 306 ARG A CB   3  
ATOM 1884  C CG   . ARG A 1 15 ? -3.620  1.609   -4.113  1.00 0.00 ? 306 ARG A CG   3  
ATOM 1885  C CD   . ARG A 1 15 ? -4.120  2.789   -3.297  1.00 0.00 ? 306 ARG A CD   3  
ATOM 1886  N NE   . ARG A 1 15 ? -5.114  3.572   -4.023  1.00 0.00 ? 306 ARG A NE   3  
ATOM 1887  C CZ   . ARG A 1 15 ? -6.342  3.137   -4.289  1.00 0.00 ? 306 ARG A CZ   3  
ATOM 1888  N NH1  . ARG A 1 15 ? -6.720  1.929   -3.893  1.00 0.00 ? 306 ARG A NH1  3  
ATOM 1889  N NH2  . ARG A 1 15 ? -7.192  3.908   -4.953  1.00 0.00 ? 306 ARG A NH2  3  
ATOM 1890  H H    . ARG A 1 15 ? -1.200  -1.570  -4.545  1.00 0.00 ? 306 ARG A H    3  
ATOM 1891  H HA   . ARG A 1 15 ? -1.703  0.948   -5.793  1.00 0.00 ? 306 ARG A HA   3  
ATOM 1892  H HB2  . ARG A 1 15 ? -2.252  0.572   -2.865  1.00 0.00 ? 306 ARG A HB2  3  
ATOM 1893  H HG2  . ARG A 1 15 ? -3.638  1.875   -5.159  1.00 0.00 ? 306 ARG A HG2  3  
ATOM 1894  H HD2  . ARG A 1 15 ? -4.561  2.419   -2.385  1.00 0.00 ? 306 ARG A HD2  3  
ATOM 1895  H HE   . ARG A 1 15 ? -4.855  4.467   -4.327  1.00 0.00 ? 306 ARG A HE   3  
ATOM 1896  H HH11 . ARG A 1 15 ? -6.080  1.344   -3.394  1.00 0.00 ? 306 ARG A HH11 3  
ATOM 1897  H HH12 . ARG A 1 15 ? -7.643  1.603   -4.093  1.00 0.00 ? 306 ARG A HH12 3  
ATOM 1898  H HH21 . ARG A 1 15 ? -6.910  4.819   -5.255  1.00 0.00 ? 306 ARG A HH21 3  
ATOM 1899  H HH22 . ARG A 1 15 ? -8.116  3.580   -5.152  1.00 0.00 ? 306 ARG A HH22 3  
ATOM 1900  N N    . ASN A 1 16 ? 0.580   1.839   -4.723  1.00 0.00 ? 307 ASN A N    3  
ATOM 1901  C CA   . ASN A 1 16 ? 2.009   2.056   -4.525  1.00 0.00 ? 307 ASN A CA   3  
ATOM 1902  C C    . ASN A 1 16 ? 2.251   3.228   -3.584  1.00 0.00 ? 307 ASN A C    3  
ATOM 1903  O O    . ASN A 1 16 ? 1.545   4.236   -3.630  1.00 0.00 ? 307 ASN A O    3  
ATOM 1904  C CB   . ASN A 1 16 ? 2.723   2.286   -5.862  1.00 0.00 ? 307 ASN A CB   3  
ATOM 1905  C CG   . ASN A 1 16 ? 2.091   1.514   -7.006  1.00 0.00 ? 307 ASN A CG   3  
ATOM 1906  O OD1  . ASN A 1 16 ? 0.999   1.847   -7.467  1.00 0.00 ? 307 ASN A OD1  3  
ATOM 1907  N ND2  . ASN A 1 16 ? 2.778   0.477   -7.470  1.00 0.00 ? 307 ASN A ND2  3  
ATOM 1908  H H    . ASN A 1 16 ? 0.000   2.602   -4.928  1.00 0.00 ? 307 ASN A H    3  
ATOM 1909  H HA   . ASN A 1 16 ? 2.409   1.166   -4.067  1.00 0.00 ? 307 ASN A HA   3  
ATOM 1910  H HB2  . ASN A 1 16 ? 2.697   3.338   -6.102  1.00 0.00 ? 307 ASN A HB2  3  
ATOM 1911  H HD21 . ASN A 1 16 ? 3.642   0.270   -7.054  1.00 0.00 ? 307 ASN A HD21 3  
ATOM 1912  H HD22 . ASN A 1 16 ? 2.394   -0.042  -8.208  1.00 0.00 ? 307 ASN A HD22 3  
ATOM 1913  N N    . THR A 1 17 ? 3.257   3.086   -2.731  1.00 0.00 ? 308 THR A N    3  
ATOM 1914  C CA   . THR A 1 17 ? 3.591   4.121   -1.762  1.00 0.00 ? 308 THR A CA   3  
ATOM 1915  C C    . THR A 1 17 ? 4.100   5.380   -2.451  1.00 0.00 ? 308 THR A C    3  
ATOM 1916  O O    . THR A 1 17 ? 3.527   6.458   -2.296  1.00 0.00 ? 308 THR A O    3  
ATOM 1917  C CB   . THR A 1 17 ? 4.650   3.625   -0.762  1.00 0.00 ? 308 THR A CB   3  
ATOM 1918  O OG1  . THR A 1 17 ? 5.825   3.197   -1.462  1.00 0.00 ? 308 THR A OG1  3  
ATOM 1919  C CG2  . THR A 1 17 ? 4.101   2.475   0.071   1.00 0.00 ? 308 THR A CG2  3  
ATOM 1920  H H    . THR A 1 17 ? 3.795   2.267   -2.759  1.00 0.00 ? 308 THR A H    3  
ATOM 1921  H HA   . THR A 1 17 ? 2.693   4.362   -1.213  1.00 0.00 ? 308 THR A HA   3  
ATOM 1922  H HB   . THR A 1 17 ? 4.909   4.438   -0.101  1.00 0.00 ? 308 THR A HB   3  
ATOM 1923  H HG1  . THR A 1 17 ? 6.343   2.620   -0.897  1.00 0.00 ? 308 THR A HG1  3  
ATOM 1924  H HG21 . THR A 1 17 ? 3.026   2.560   0.129   1.00 0.00 ? 308 THR A HG21 3  
ATOM 1925  H HG22 . THR A 1 17 ? 4.521   2.516   1.065   1.00 0.00 ? 308 THR A HG22 3  
ATOM 1926  H HG23 . THR A 1 17 ? 4.362   1.535   -0.391  1.00 0.00 ? 308 THR A HG23 3  
ATOM 1927  N N    . ALA A 1 18 ? 5.178   5.237   -3.212  1.00 0.00 ? 309 ALA A N    3  
ATOM 1928  C CA   . ALA A 1 18 ? 5.766   6.365   -3.924  1.00 0.00 ? 309 ALA A CA   3  
ATOM 1929  C C    . ALA A 1 18 ? 7.048   5.950   -4.634  1.00 0.00 ? 309 ALA A C    3  
ATOM 1930  O O    . ALA A 1 18 ? 7.117   5.949   -5.862  1.00 0.00 ? 309 ALA A O    3  
ATOM 1931  C CB   . ALA A 1 18 ? 6.034   7.512   -2.962  1.00 0.00 ? 309 ALA A CB   3  
ATOM 1932  H H    . ALA A 1 18 ? 5.590   4.352   -3.298  1.00 0.00 ? 309 ALA A H    3  
ATOM 1933  H HA   . ALA A 1 18 ? 5.051   6.703   -4.661  1.00 0.00 ? 309 ALA A HA   3  
ATOM 1934  H HB1  . ALA A 1 18 ? 5.512   7.330   -2.032  1.00 0.00 ? 309 ALA A HB1  3  
ATOM 1935  H HB2  . ALA A 1 18 ? 7.095   7.581   -2.770  1.00 0.00 ? 309 ALA A HB2  3  
ATOM 1936  H HB3  . ALA A 1 18 ? 5.686   8.436   -3.397  1.00 0.00 ? 309 ALA A HB3  3  
ATOM 1937  N N    . THR A 1 19 ? 8.064   5.595   -3.852  1.00 0.00 ? 310 THR A N    3  
ATOM 1938  C CA   . THR A 1 19 ? 9.340   5.171   -4.410  1.00 0.00 ? 310 THR A CA   3  
ATOM 1939  C C    . THR A 1 19 ? 9.143   4.016   -5.386  1.00 0.00 ? 310 THR A C    3  
ATOM 1940  O O    . THR A 1 19 ? 9.906   3.856   -6.339  1.00 0.00 ? 310 THR A O    3  
ATOM 1941  C CB   . THR A 1 19 ? 10.320  4.736   -3.303  1.00 0.00 ? 310 THR A CB   3  
ATOM 1942  O OG1  . THR A 1 19 ? 9.703   3.755   -2.461  1.00 0.00 ? 310 THR A OG1  3  
ATOM 1943  C CG2  . THR A 1 19 ? 10.752  5.930   -2.464  1.00 0.00 ? 310 THR A CG2  3  
ATOM 1944  H H    . THR A 1 19 ? 7.951   5.621   -2.879  1.00 0.00 ? 310 THR A H    3  
ATOM 1945  H HA   . THR A 1 19 ? 9.771   6.009   -4.938  1.00 0.00 ? 310 THR A HA   3  
ATOM 1946  H HB   . THR A 1 19 ? 11.195  4.305   -3.766  1.00 0.00 ? 310 THR A HB   3  
ATOM 1947  H HG1  . THR A 1 19 ? 9.112   4.189   -1.841  1.00 0.00 ? 310 THR A HG1  3  
ATOM 1948  H HG21 . THR A 1 19 ? 11.172  6.689   -3.106  1.00 0.00 ? 310 THR A HG21 3  
ATOM 1949  H HG22 . THR A 1 19 ? 11.494  5.614   -1.746  1.00 0.00 ? 310 THR A HG22 3  
ATOM 1950  H HG23 . THR A 1 19 ? 9.895   6.333   -1.943  1.00 0.00 ? 310 THR A HG23 3  
ATOM 1951  N N    . GLY A 1 20 ? 8.113   3.211   -5.138  1.00 0.00 ? 311 GLY A N    3  
ATOM 1952  C CA   . GLY A 1 20 ? 7.827   2.083   -6.004  1.00 0.00 ? 311 GLY A CA   3  
ATOM 1953  C C    . GLY A 1 20 ? 7.192   0.923   -5.264  1.00 0.00 ? 311 GLY A C    3  
ATOM 1954  O O    . GLY A 1 20 ? 6.472   0.121   -5.859  1.00 0.00 ? 311 GLY A O    3  
ATOM 1955  H H    . GLY A 1 20 ? 7.543   3.387   -4.361  1.00 0.00 ? 311 GLY A H    3  
ATOM 1956  H HA2  . GLY A 1 20 ? 7.153   2.407   -6.782  1.00 0.00 ? 311 GLY A HA2  3  
ATOM 1957  H HA3  . GLY A 1 20 ? 8.748   1.747   -6.455  1.00 0.00 ? 311 GLY A HA3  3  
ATOM 1958  N N    . ARG A 1 21 ? 7.455   0.832   -3.966  1.00 0.00 ? 312 ARG A N    3  
ATOM 1959  C CA   . ARG A 1 21 ? 6.898   -0.242  -3.150  1.00 0.00 ? 312 ARG A CA   3  
ATOM 1960  C C    . ARG A 1 21 ? 5.390   -0.289  -3.275  1.00 0.00 ? 312 ARG A C    3  
ATOM 1961  O O    . ARG A 1 21 ? 4.682   0.644   -2.897  1.00 0.00 ? 312 ARG A O    3  
ATOM 1962  C CB   . ARG A 1 21 ? 7.302   -0.075  -1.685  1.00 0.00 ? 312 ARG A CB   3  
ATOM 1963  C CG   . ARG A 1 21 ? 8.554   -0.851  -1.305  1.00 0.00 ? 312 ARG A CG   3  
ATOM 1964  C CD   . ARG A 1 21 ? 9.132   -0.355  0.019   1.00 0.00 ? 312 ARG A CD   3  
ATOM 1965  N NE   . ARG A 1 21 ? 9.841   0.913   -0.138  1.00 0.00 ? 312 ARG A NE   3  
ATOM 1966  C CZ   . ARG A 1 21 ? 11.079  1.010   -0.614  1.00 0.00 ? 312 ARG A CZ   3  
ATOM 1967  N NH1  . ARG A 1 21 ? 11.740  -0.080  -0.977  1.00 0.00 ? 312 ARG A NH1  3  
ATOM 1968  N NH2  . ARG A 1 21 ? 11.655  2.199   -0.728  1.00 0.00 ? 312 ARG A NH2  3  
ATOM 1969  H H    . ARG A 1 21 ? 8.037   1.499   -3.546  1.00 0.00 ? 312 ARG A H    3  
ATOM 1970  H HA   . ARG A 1 21 ? 7.283   -1.179  -3.522  1.00 0.00 ? 312 ARG A HA   3  
ATOM 1971  H HB2  . ARG A 1 21 ? 7.480   0.971   -1.489  1.00 0.00 ? 312 ARG A HB2  3  
ATOM 1972  H HG2  . ARG A 1 21 ? 8.299   -1.897  -1.211  1.00 0.00 ? 312 ARG A HG2  3  
ATOM 1973  H HD2  . ARG A 1 21 ? 8.321   -0.216  0.719   1.00 0.00 ? 312 ARG A HD2  3  
ATOM 1974  H HE   . ARG A 1 21 ? 9.371   1.731   0.125   1.00 0.00 ? 312 ARG A HE   3  
ATOM 1975  H HH11 . ARG A 1 21 ? 11.309  -0.978  -0.891  1.00 0.00 ? 312 ARG A HH11 3  
ATOM 1976  H HH12 . ARG A 1 21 ? 12.672  -0.005  -1.334  1.00 0.00 ? 312 ARG A HH12 3  
ATOM 1977  H HH21 . ARG A 1 21 ? 11.158  3.024   -0.456  1.00 0.00 ? 312 ARG A HH21 3  
ATOM 1978  H HH22 . ARG A 1 21 ? 12.586  2.271   -1.086  1.00 0.00 ? 312 ARG A HH22 3  
ATOM 1979  N N    . VAL A 1 22 ? 4.918   -1.399  -3.811  1.00 0.00 ? 313 VAL A N    3  
ATOM 1980  C CA   . VAL A 1 22 ? 3.503   -1.618  -4.010  1.00 0.00 ? 313 VAL A CA   3  
ATOM 1981  C C    . VAL A 1 22 ? 2.899   -2.363  -2.824  1.00 0.00 ? 313 VAL A C    3  
ATOM 1982  O O    . VAL A 1 22 ? 3.432   -3.378  -2.375  1.00 0.00 ? 313 VAL A O    3  
ATOM 1983  C CB   . VAL A 1 22 ? 3.267   -2.408  -5.310  1.00 0.00 ? 313 VAL A CB   3  
ATOM 1984  C CG1  . VAL A 1 22 ? 4.131   -3.656  -5.338  1.00 0.00 ? 313 VAL A CG1  3  
ATOM 1985  C CG2  . VAL A 1 22 ? 1.807   -2.765  -5.475  1.00 0.00 ? 313 VAL A CG2  3  
ATOM 1986  H H    . VAL A 1 22 ? 5.548   -2.097  -4.087  1.00 0.00 ? 313 VAL A H    3  
ATOM 1987  H HA   . VAL A 1 22 ? 3.022   -0.658  -4.106  1.00 0.00 ? 313 VAL A HA   3  
ATOM 1988  H HB   . VAL A 1 22 ? 3.558   -1.783  -6.141  1.00 0.00 ? 313 VAL A HB   3  
ATOM 1989  H HG11 . VAL A 1 22 ? 4.624   -3.773  -4.384  1.00 0.00 ? 313 VAL A HG11 3  
ATOM 1990  H HG12 . VAL A 1 22 ? 3.512   -4.518  -5.533  1.00 0.00 ? 313 VAL A HG12 3  
ATOM 1991  H HG13 . VAL A 1 22 ? 4.872   -3.560  -6.116  1.00 0.00 ? 313 VAL A HG13 3  
ATOM 1992  H HG21 . VAL A 1 22 ? 1.266   -2.475  -4.590  1.00 0.00 ? 313 VAL A HG21 3  
ATOM 1993  H HG22 . VAL A 1 22 ? 1.407   -2.245  -6.331  1.00 0.00 ? 313 VAL A HG22 3  
ATOM 1994  H HG23 . VAL A 1 22 ? 1.715   -3.829  -5.622  1.00 0.00 ? 313 VAL A HG23 3  
ATOM 1995  N N    . TYR A 1 23 ? 1.782   -1.848  -2.321  1.00 0.00 ? 314 TYR A N    3  
ATOM 1996  C CA   . TYR A 1 23 ? 1.101   -2.462  -1.192  1.00 0.00 ? 314 TYR A CA   3  
ATOM 1997  C C    . TYR A 1 23 ? -0.339  -2.797  -1.537  1.00 0.00 ? 314 TYR A C    3  
ATOM 1998  O O    . TYR A 1 23 ? -0.865  -2.367  -2.563  1.00 0.00 ? 314 TYR A O    3  
ATOM 1999  C CB   . TYR A 1 23 ? 1.123   -1.533  0.021   1.00 0.00 ? 314 TYR A CB   3  
ATOM 2000  C CG   . TYR A 1 23 ? 0.269   -0.295  -0.141  1.00 0.00 ? 314 TYR A CG   3  
ATOM 2001  C CD1  . TYR A 1 23 ? 0.627   0.705   -1.034  1.00 0.00 ? 314 TYR A CD1  3  
ATOM 2002  C CD2  . TYR A 1 23 ? -0.898  -0.128  0.598   1.00 0.00 ? 314 TYR A CD2  3  
ATOM 2003  C CE1  . TYR A 1 23 ? -0.152  1.835   -1.190  1.00 0.00 ? 314 TYR A CE1  3  
ATOM 2004  C CE2  . TYR A 1 23 ? -1.686  1.001   0.443   1.00 0.00 ? 314 TYR A CE2  3  
ATOM 2005  C CZ   . TYR A 1 23 ? -1.307  1.979   -0.454  1.00 0.00 ? 314 TYR A CZ   3  
ATOM 2006  O OH   . TYR A 1 23 ? -2.086  3.103   -0.612  1.00 0.00 ? 314 TYR A OH   3  
ATOM 2007  H H    . TYR A 1 23 ? 1.407   -1.038  -2.724  1.00 0.00 ? 314 TYR A H    3  
ATOM 2008  H HA   . TYR A 1 23 ? 1.623   -3.373  -0.944  1.00 0.00 ? 314 TYR A HA   3  
ATOM 2009  H HB2  . TYR A 1 23 ? 0.759   -2.073  0.881   1.00 0.00 ? 314 TYR A HB2  3  
ATOM 2010  H HD1  . TYR A 1 23 ? 1.533   0.594   -1.610  1.00 0.00 ? 314 TYR A HD1  3  
ATOM 2011  H HD2  . TYR A 1 23 ? -1.188  -0.895  1.301   1.00 0.00 ? 314 TYR A HD2  3  
ATOM 2012  H HE1  . TYR A 1 23 ? 0.150   2.601   -1.885  1.00 0.00 ? 314 TYR A HE1  3  
ATOM 2013  H HE2  . TYR A 1 23 ? -2.582  1.118   1.030   1.00 0.00 ? 314 TYR A HE2  3  
ATOM 2014  H HH   . TYR A 1 23 ? -3.000  2.891   -0.410  1.00 0.00 ? 314 TYR A HH   3  
ATOM 2015  N N    . PHE A 1 24 ? -0.966  -3.571  -0.667  1.00 0.00 ? 315 PHE A N    3  
ATOM 2016  C CA   . PHE A 1 24 ? -2.345  -3.966  -0.849  1.00 0.00 ? 315 PHE A CA   3  
ATOM 2017  C C    . PHE A 1 24 ? -3.225  -3.307  0.201   1.00 0.00 ? 315 PHE A C    3  
ATOM 2018  O O    . PHE A 1 24 ? -2.895  -3.295  1.390   1.00 0.00 ? 315 PHE A O    3  
ATOM 2019  C CB   . PHE A 1 24 ? -2.465  -5.489  -0.780  1.00 0.00 ? 315 PHE A CB   3  
ATOM 2020  C CG   . PHE A 1 24 ? -1.527  -6.199  -1.716  1.00 0.00 ? 315 PHE A CG   3  
ATOM 2021  C CD1  . PHE A 1 24 ? -0.163  -6.199  -1.475  1.00 0.00 ? 315 PHE A CD1  3  
ATOM 2022  C CD2  . PHE A 1 24 ? -2.006  -6.863  -2.834  1.00 0.00 ? 315 PHE A CD2  3  
ATOM 2023  C CE1  . PHE A 1 24 ? 0.708   -6.848  -2.331  1.00 0.00 ? 315 PHE A CE1  3  
ATOM 2024  C CE2  . PHE A 1 24 ? -1.140  -7.516  -3.693  1.00 0.00 ? 315 PHE A CE2  3  
ATOM 2025  C CZ   . PHE A 1 24 ? 0.219   -7.509  -3.440  1.00 0.00 ? 315 PHE A CZ   3  
ATOM 2026  H H    . PHE A 1 24 ? -0.484  -3.891  0.120   1.00 0.00 ? 315 PHE A H    3  
ATOM 2027  H HA   . PHE A 1 24 ? -2.657  -3.626  -1.821  1.00 0.00 ? 315 PHE A HA   3  
ATOM 2028  H HB2  . PHE A 1 24 ? -2.240  -5.814  0.225   1.00 0.00 ? 315 PHE A HB2  3  
ATOM 2029  H HD1  . PHE A 1 24 ? 0.220   -5.684  -0.606  1.00 0.00 ? 315 PHE A HD1  3  
ATOM 2030  H HD2  . PHE A 1 24 ? -3.068  -6.865  -3.039  1.00 0.00 ? 315 PHE A HD2  3  
ATOM 2031  H HE1  . PHE A 1 24 ? 1.770   -6.837  -2.134  1.00 0.00 ? 315 PHE A HE1  3  
ATOM 2032  H HE2  . PHE A 1 24 ? -1.525  -8.032  -4.560  1.00 0.00 ? 315 PHE A HE2  3  
ATOM 2033  H HZ   . PHE A 1 24 ? 0.896   -8.017  -4.110  1.00 0.00 ? 315 PHE A HZ   3  
ATOM 2034  N N    . VAL A 1 25 ? -4.340  -2.753  -0.257  1.00 0.00 ? 316 VAL A N    3  
ATOM 2035  C CA   . VAL A 1 25 ? -5.278  -2.068  0.618   1.00 0.00 ? 316 VAL A CA   3  
ATOM 2036  C C    . VAL A 1 25 ? -6.531  -2.898  0.856   1.00 0.00 ? 316 VAL A C    3  
ATOM 2037  O O    . VAL A 1 25 ? -7.280  -3.183  -0.077  1.00 0.00 ? 316 VAL A O    3  
ATOM 2038  C CB   . VAL A 1 25 ? -5.692  -0.715  0.017   1.00 0.00 ? 316 VAL A CB   3  
ATOM 2039  C CG1  . VAL A 1 25 ? -6.377  0.139   1.064   1.00 0.00 ? 316 VAL A CG1  3  
ATOM 2040  C CG2  . VAL A 1 25 ? -4.487  0.003   -0.571  1.00 0.00 ? 316 VAL A CG2  3  
ATOM 2041  H H    . VAL A 1 25 ? -4.538  -2.807  -1.215  1.00 0.00 ? 316 VAL A H    3  
ATOM 2042  H HA   . VAL A 1 25 ? -4.788  -1.885  1.563   1.00 0.00 ? 316 VAL A HA   3  
ATOM 2043  H HB   . VAL A 1 25 ? -6.398  -0.900  -0.780  1.00 0.00 ? 316 VAL A HB   3  
ATOM 2044  H HG11 . VAL A 1 25 ? -7.301  -0.335  1.364   1.00 0.00 ? 316 VAL A HG11 3  
ATOM 2045  H HG12 . VAL A 1 25 ? -5.729  0.240   1.924   1.00 0.00 ? 316 VAL A HG12 3  
ATOM 2046  H HG13 . VAL A 1 25 ? -6.587  1.115   0.653   1.00 0.00 ? 316 VAL A HG13 3  
ATOM 2047  H HG21 . VAL A 1 25 ? -4.490  1.034   -0.249  1.00 0.00 ? 316 VAL A HG21 3  
ATOM 2048  H HG22 . VAL A 1 25 ? -3.582  -0.478  -0.232  1.00 0.00 ? 316 VAL A HG22 3  
ATOM 2049  H HG23 . VAL A 1 25 ? -4.535  -0.038  -1.650  1.00 0.00 ? 316 VAL A HG23 3  
ATOM 2050  N N    . ASP A 1 26 ? -6.761  -3.274  2.110   1.00 0.00 ? 317 ASP A N    3  
ATOM 2051  C CA   . ASP A 1 26 ? -7.932  -4.064  2.467   1.00 0.00 ? 317 ASP A CA   3  
ATOM 2052  C C    . ASP A 1 26 ? -9.100  -3.156  2.836   1.00 0.00 ? 317 ASP A C    3  
ATOM 2053  O O    . ASP A 1 26 ? -9.039  -2.416  3.817   1.00 0.00 ? 317 ASP A O    3  
ATOM 2054  C CB   . ASP A 1 26 ? -7.613  -4.999  3.634   1.00 0.00 ? 317 ASP A CB   3  
ATOM 2055  C CG   . ASP A 1 26 ? -8.349  -6.319  3.531   1.00 0.00 ? 317 ASP A CG   3  
ATOM 2056  O OD1  . ASP A 1 26 ? -9.013  -6.551  2.498   1.00 0.00 ? 317 ASP A OD1  3  
ATOM 2057  O OD2  . ASP A 1 26 ? -8.262  -7.123  4.483   1.00 0.00 ? 317 ASP A OD2  3  
ATOM 2058  H H    . ASP A 1 26 ? -6.126  -3.014  2.811   1.00 0.00 ? 317 ASP A H    3  
ATOM 2059  H HA   . ASP A 1 26 ? -8.208  -4.656  1.607   1.00 0.00 ? 317 ASP A HA   3  
ATOM 2060  H HB2  . ASP A 1 26 ? -6.552  -5.199  3.647   1.00 0.00 ? 317 ASP A HB2  3  
ATOM 2061  N N    . HIS A 1 27 ? -10.165 -3.220  2.043   1.00 0.00 ? 318 HIS A N    3  
ATOM 2062  C CA   . HIS A 1 27 ? -11.346 -2.401  2.286   1.00 0.00 ? 318 HIS A CA   3  
ATOM 2063  C C    . HIS A 1 27 ? -12.290 -3.078  3.279   1.00 0.00 ? 318 HIS A C    3  
ATOM 2064  O O    . HIS A 1 27 ? -13.128 -2.420  3.895   1.00 0.00 ? 318 HIS A O    3  
ATOM 2065  C CB   . HIS A 1 27 ? -12.069 -2.120  0.970   1.00 0.00 ? 318 HIS A CB   3  
ATOM 2066  C CG   . HIS A 1 27 ? -11.378 -1.095  0.128   1.00 0.00 ? 318 HIS A CG   3  
ATOM 2067  N ND1  . HIS A 1 27 ? -11.372 0.232   0.479   1.00 0.00 ? 318 HIS A ND1  3  
ATOM 2068  C CD2  . HIS A 1 27 ? -10.674 -1.253  -1.020  1.00 0.00 ? 318 HIS A CD2  3  
ATOM 2069  C CE1  . HIS A 1 27 ? -10.666 0.849   -0.451  1.00 0.00 ? 318 HIS A CE1  3  
ATOM 2070  N NE2  . HIS A 1 27 ? -10.224 -0.010  -1.382  1.00 0.00 ? 318 HIS A NE2  3  
ATOM 2071  H H    . HIS A 1 27 ? -10.155 -3.830  1.277   1.00 0.00 ? 318 HIS A H    3  
ATOM 2072  H HA   . HIS A 1 27 ? -11.016 -1.462  2.707   1.00 0.00 ? 318 HIS A HA   3  
ATOM 2073  H HB2  . HIS A 1 27 ? -12.132 -3.032  0.399   1.00 0.00 ? 318 HIS A HB2  3  
ATOM 2074  H HD2  . HIS A 1 27 ? -10.492 -2.178  -1.546  1.00 0.00 ? 318 HIS A HD2  3  
ATOM 2075  H HE1  . HIS A 1 27 ? -10.464 1.909   -0.457  1.00 0.00 ? 318 HIS A HE1  3  
ATOM 2076  H HE2  . HIS A 1 27 ? -9.559  0.182   -2.076  1.00 0.00 ? 318 HIS A HE2  3  
ATOM 2077  N N    . ASN A 1 28 ? -12.152 -4.394  3.429   1.00 0.00 ? 319 ASN A N    3  
ATOM 2078  C CA   . ASN A 1 28 ? -12.991 -5.146  4.354   1.00 0.00 ? 319 ASN A CA   3  
ATOM 2079  C C    . ASN A 1 28 ? -12.512 -4.964  5.792   1.00 0.00 ? 319 ASN A C    3  
ATOM 2080  O O    . ASN A 1 28 ? -13.258 -4.493  6.650   1.00 0.00 ? 319 ASN A O    3  
ATOM 2081  C CB   . ASN A 1 28 ? -12.986 -6.634  3.997   1.00 0.00 ? 319 ASN A CB   3  
ATOM 2082  C CG   . ASN A 1 28 ? -13.069 -6.876  2.502   1.00 0.00 ? 319 ASN A CG   3  
ATOM 2083  O OD1  . ASN A 1 28 ? -13.585 -6.047  1.754   1.00 0.00 ? 319 ASN A OD1  3  
ATOM 2084  N ND2  . ASN A 1 28 ? -12.558 -8.019  2.063   1.00 0.00 ? 319 ASN A ND2  3  
ATOM 2085  H H    . ASN A 1 28 ? -11.475 -4.870  2.904   1.00 0.00 ? 319 ASN A H    3  
ATOM 2086  H HA   . ASN A 1 28 ? -14.000 -4.768  4.271   1.00 0.00 ? 319 ASN A HA   3  
ATOM 2087  H HB2  . ASN A 1 28 ? -12.074 -7.081  4.362   1.00 0.00 ? 319 ASN A HB2  3  
ATOM 2088  H HD21 . ASN A 1 28 ? -12.160 -8.628  2.718   1.00 0.00 ? 319 ASN A HD21 3  
ATOM 2089  H HD22 . ASN A 1 28 ? -12.601 -8.209  1.103   1.00 0.00 ? 319 ASN A HD22 3  
ATOM 2090  N N    . ASN A 1 29 ? -11.262 -5.342  6.045   1.00 0.00 ? 320 ASN A N    3  
ATOM 2091  C CA   . ASN A 1 29 ? -10.681 -5.224  7.380   1.00 0.00 ? 320 ASN A CA   3  
ATOM 2092  C C    . ASN A 1 29 ? -10.154 -3.815  7.640   1.00 0.00 ? 320 ASN A C    3  
ATOM 2093  O O    . ASN A 1 29 ? -9.884  -3.451  8.784   1.00 0.00 ? 320 ASN A O    3  
ATOM 2094  C CB   . ASN A 1 29 ? -9.551  -6.240  7.562   1.00 0.00 ? 320 ASN A CB   3  
ATOM 2095  C CG   . ASN A 1 29 ? -9.941  -7.630  7.111   1.00 0.00 ? 320 ASN A CG   3  
ATOM 2096  O OD1  . ASN A 1 29 ? -11.092 -8.043  7.252   1.00 0.00 ? 320 ASN A OD1  3  
ATOM 2097  N ND2  . ASN A 1 29 ? -8.979  -8.361  6.565   1.00 0.00 ? 320 ASN A ND2  3  
ATOM 2098  H H    . ASN A 1 29 ? -10.717 -5.708  5.319   1.00 0.00 ? 320 ASN A H    3  
ATOM 2099  H HA   . ASN A 1 29 ? -11.460 -5.440  8.096   1.00 0.00 ? 320 ASN A HA   3  
ATOM 2100  H HB2  . ASN A 1 29 ? -8.694  -5.926  6.985   1.00 0.00 ? 320 ASN A HB2  3  
ATOM 2101  H HD21 . ASN A 1 29 ? -8.085  -7.965  6.486   1.00 0.00 ? 320 ASN A HD21 3  
ATOM 2102  H HD22 . ASN A 1 29 ? -9.200  -9.263  6.261   1.00 0.00 ? 320 ASN A HD22 3  
ATOM 2103  N N    . ARG A 1 30 ? -10.000 -3.027  6.578   1.00 0.00 ? 321 ARG A N    3  
ATOM 2104  C CA   . ARG A 1 30 ? -9.508  -1.659  6.706   1.00 0.00 ? 321 ARG A CA   3  
ATOM 2105  C C    . ARG A 1 30 ? -8.055  -1.641  7.176   1.00 0.00 ? 321 ARG A C    3  
ATOM 2106  O O    . ARG A 1 30 ? -7.751  -1.152  8.264   1.00 0.00 ? 321 ARG A O    3  
ATOM 2107  C CB   . ARG A 1 30 ? -10.388 -0.870  7.678   1.00 0.00 ? 321 ARG A CB   3  
ATOM 2108  C CG   . ARG A 1 30 ? -11.847 -0.808  7.255   1.00 0.00 ? 321 ARG A CG   3  
ATOM 2109  C CD   . ARG A 1 30 ? -12.756 -1.435  8.299   1.00 0.00 ? 321 ARG A CD   3  
ATOM 2110  N NE   . ARG A 1 30 ? -14.133 -0.965  8.181   1.00 0.00 ? 321 ARG A NE   3  
ATOM 2111  C CZ   . ARG A 1 30 ? -14.512 0.278   8.458   1.00 0.00 ? 321 ARG A CZ   3  
ATOM 2112  N NH1  . ARG A 1 30 ? -13.619 1.170   8.865   1.00 0.00 ? 321 ARG A NH1  3  
ATOM 2113  N NH2  . ARG A 1 30 ? -15.785 0.631   8.328   1.00 0.00 ? 321 ARG A NH2  3  
ATOM 2114  H H    . ARG A 1 30 ? -10.220 -3.370  5.687   1.00 0.00 ? 321 ARG A H    3  
ATOM 2115  H HA   . ARG A 1 30 ? -9.562  -1.198  5.732   1.00 0.00 ? 321 ARG A HA   3  
ATOM 2116  H HB2  . ARG A 1 30 ? -10.338 -1.333  8.652   1.00 0.00 ? 321 ARG A HB2  3  
ATOM 2117  H HG2  . ARG A 1 30 ? -12.129 0.224   7.119   1.00 0.00 ? 321 ARG A HG2  3  
ATOM 2118  H HD2  . ARG A 1 30 ? -12.740 -2.508  8.174   1.00 0.00 ? 321 ARG A HD2  3  
ATOM 2119  H HE   . ARG A 1 30 ? -14.809 -1.607  7.881   1.00 0.00 ? 321 ARG A HE   3  
ATOM 2120  H HH11 . ARG A 1 30 ? -12.658 0.907   8.964   1.00 0.00 ? 321 ARG A HH11 3  
ATOM 2121  H HH12 . ARG A 1 30 ? -13.905 2.105   9.074   1.00 0.00 ? 321 ARG A HH12 3  
ATOM 2122  H HH21 . ARG A 1 30 ? -16.459 -0.041  8.021   1.00 0.00 ? 321 ARG A HH21 3  
ATOM 2123  H HH22 . ARG A 1 30 ? -16.068 1.566   8.537   1.00 0.00 ? 321 ARG A HH22 3  
ATOM 2124  N N    . THR A 1 31 ? -7.164  -2.177  6.346   1.00 0.00 ? 322 THR A N    3  
ATOM 2125  C CA   . THR A 1 31 ? -5.742  -2.220  6.671   1.00 0.00 ? 322 THR A CA   3  
ATOM 2126  C C    . THR A 1 31 ? -4.890  -2.250  5.409   1.00 0.00 ? 322 THR A C    3  
ATOM 2127  O O    . THR A 1 31 ? -5.375  -1.972  4.313   1.00 0.00 ? 322 THR A O    3  
ATOM 2128  C CB   . THR A 1 31 ? -5.396  -3.444  7.541   1.00 0.00 ? 322 THR A CB   3  
ATOM 2129  O OG1  . THR A 1 31 ? -4.025  -3.383  7.948   1.00 0.00 ? 322 THR A OG1  3  
ATOM 2130  C CG2  . THR A 1 31 ? -5.648  -4.739  6.782   1.00 0.00 ? 322 THR A CG2  3  
ATOM 2131  H H    . THR A 1 31 ? -7.470  -2.552  5.494   1.00 0.00 ? 322 THR A H    3  
ATOM 2132  H HA   . THR A 1 31 ? -5.500  -1.330  7.229   1.00 0.00 ? 322 THR A HA   3  
ATOM 2133  H HB   . THR A 1 31 ? -6.026  -3.432  8.419   1.00 0.00 ? 322 THR A HB   3  
ATOM 2134  H HG1  . THR A 1 31 ? -3.976  -3.358  8.907   1.00 0.00 ? 322 THR A HG1  3  
ATOM 2135  H HG21 . THR A 1 31 ? -6.697  -4.989  6.834   1.00 0.00 ? 322 THR A HG21 3  
ATOM 2136  H HG22 . THR A 1 31 ? -5.066  -5.534  7.225   1.00 0.00 ? 322 THR A HG22 3  
ATOM 2137  H HG23 . THR A 1 31 ? -5.358  -4.614  5.750   1.00 0.00 ? 322 THR A HG23 3  
ATOM 2138  N N    . THR A 1 32 ? -3.616  -2.591  5.573   1.00 0.00 ? 323 THR A N    3  
ATOM 2139  C CA   . THR A 1 32 ? -2.692  -2.652  4.449   1.00 0.00 ? 323 THR A CA   3  
ATOM 2140  C C    . THR A 1 32 ? -1.650  -3.742  4.649   1.00 0.00 ? 323 THR A C    3  
ATOM 2141  O O    . THR A 1 32 ? -1.582  -4.368  5.706   1.00 0.00 ? 323 THR A O    3  
ATOM 2142  C CB   . THR A 1 32 ? -1.951  -1.319  4.253   1.00 0.00 ? 323 THR A CB   3  
ATOM 2143  O OG1  . THR A 1 32 ? -1.523  -0.818  5.525   1.00 0.00 ? 323 THR A OG1  3  
ATOM 2144  C CG2  . THR A 1 32 ? -2.838  -0.289  3.569   1.00 0.00 ? 323 THR A CG2  3  
ATOM 2145  H H    . THR A 1 32 ? -3.292  -2.812  6.471   1.00 0.00 ? 323 THR A H    3  
ATOM 2146  H HA   . THR A 1 32 ? -3.262  -2.861  3.558   1.00 0.00 ? 323 THR A HA   3  
ATOM 2147  H HB   . THR A 1 32 ? -1.078  -1.495  3.631   1.00 0.00 ? 323 THR A HB   3  
ATOM 2148  H HG1  . THR A 1 32 ? -0.970  -1.473  5.958   1.00 0.00 ? 323 THR A HG1  3  
ATOM 2149  H HG21 . THR A 1 32 ? -2.425  -0.043  2.602   1.00 0.00 ? 323 THR A HG21 3  
ATOM 2150  H HG22 . THR A 1 32 ? -2.890  0.605   4.177   1.00 0.00 ? 323 THR A HG22 3  
ATOM 2151  H HG23 . THR A 1 32 ? -3.832  -0.695  3.443   1.00 0.00 ? 323 THR A HG23 3  
ATOM 2152  N N    . GLN A 1 33 ? -0.839  -3.962  3.623   1.00 0.00 ? 324 GLN A N    3  
ATOM 2153  C CA   . GLN A 1 33 ? 0.222   -4.963  3.690   1.00 0.00 ? 324 GLN A CA   3  
ATOM 2154  C C    . GLN A 1 33 ? 1.029   -4.986  2.400   1.00 0.00 ? 324 GLN A C    3  
ATOM 2155  O O    . GLN A 1 33 ? 0.522   -4.649  1.337   1.00 0.00 ? 324 GLN A O    3  
ATOM 2156  C CB   . GLN A 1 33 ? -0.348  -6.362  3.966   1.00 0.00 ? 324 GLN A CB   3  
ATOM 2157  C CG   . GLN A 1 33 ? -1.832  -6.513  3.665   1.00 0.00 ? 324 GLN A CG   3  
ATOM 2158  C CD   . GLN A 1 33 ? -2.250  -7.965  3.541   1.00 0.00 ? 324 GLN A CD   3  
ATOM 2159  O OE1  . GLN A 1 33 ? -2.875  -8.523  4.444   1.00 0.00 ? 324 GLN A OE1  3  
ATOM 2160  N NE2  . GLN A 1 33 ? -1.902  -8.588  2.421   1.00 0.00 ? 324 GLN A NE2  3  
ATOM 2161  H H    . GLN A 1 33 ? -0.968  -3.453  2.792   1.00 0.00 ? 324 GLN A H    3  
ATOM 2162  H HA   . GLN A 1 33 ? 0.879   -4.688  4.502   1.00 0.00 ? 324 GLN A HA   3  
ATOM 2163  H HB2  . GLN A 1 33 ? 0.185   -7.076  3.359   1.00 0.00 ? 324 GLN A HB2  3  
ATOM 2164  H HG2  . GLN A 1 33 ? -2.399  -6.057  4.463   1.00 0.00 ? 324 GLN A HG2  3  
ATOM 2165  H HE21 . GLN A 1 33 ? -1.401  -8.081  1.747   1.00 0.00 ? 324 GLN A HE21 3  
ATOM 2166  H HE22 . GLN A 1 33 ? -2.158  -9.527  2.315   1.00 0.00 ? 324 GLN A HE22 3  
ATOM 2167  N N    . PHE A 1 34 ? 2.288   -5.395  2.497   1.00 0.00 ? 325 PHE A N    3  
ATOM 2168  C CA   . PHE A 1 34 ? 3.158   -5.478  1.325   1.00 0.00 ? 325 PHE A CA   3  
ATOM 2169  C C    . PHE A 1 34 ? 3.104   -6.879  0.728   1.00 0.00 ? 325 PHE A C    3  
ATOM 2170  O O    . PHE A 1 34 ? 4.053   -7.328  0.085   1.00 0.00 ? 325 PHE A O    3  
ATOM 2171  C CB   . PHE A 1 34 ? 4.605   -5.151  1.706   1.00 0.00 ? 325 PHE A CB   3  
ATOM 2172  C CG   . PHE A 1 34 ? 4.969   -3.684  1.639   1.00 0.00 ? 325 PHE A CG   3  
ATOM 2173  C CD1  . PHE A 1 34 ? 4.012   -2.700  1.402   1.00 0.00 ? 325 PHE A CD1  3  
ATOM 2174  C CD2  . PHE A 1 34 ? 6.288   -3.292  1.807   1.00 0.00 ? 325 PHE A CD2  3  
ATOM 2175  C CE1  . PHE A 1 34 ? 4.372   -1.364  1.337   1.00 0.00 ? 325 PHE A CE1  3  
ATOM 2176  C CE2  . PHE A 1 34 ? 6.647   -1.961  1.741   1.00 0.00 ? 325 PHE A CE2  3  
ATOM 2177  C CZ   . PHE A 1 34 ? 5.688   -0.998  1.506   1.00 0.00 ? 325 PHE A CZ   3  
ATOM 2178  H H    . PHE A 1 34 ? 2.644   -5.647  3.375   1.00 0.00 ? 325 PHE A H    3  
ATOM 2179  H HA   . PHE A 1 34 ? 2.810   -4.768  0.592   1.00 0.00 ? 325 PHE A HA   3  
ATOM 2180  H HB2  . PHE A 1 34 ? 4.783   -5.491  2.713   1.00 0.00 ? 325 PHE A HB2  3  
ATOM 2181  H HD1  . PHE A 1 34 ? 2.979   -2.984  1.272   1.00 0.00 ? 325 PHE A HD1  3  
ATOM 2182  H HD2  . PHE A 1 34 ? 7.042   -4.041  1.993   1.00 0.00 ? 325 PHE A HD2  3  
ATOM 2183  H HE1  . PHE A 1 34 ? 3.624   -0.606  1.156   1.00 0.00 ? 325 PHE A HE1  3  
ATOM 2184  H HE2  . PHE A 1 34 ? 7.678   -1.673  1.878   1.00 0.00 ? 325 PHE A HE2  3  
ATOM 2185  H HZ   . PHE A 1 34 ? 5.970   0.043   1.454   1.00 0.00 ? 325 PHE A HZ   3  
ATOM 2186  N N    . THR A 1 35 ? 1.988   -7.567  0.944   1.00 0.00 ? 326 THR A N    3  
ATOM 2187  C CA   . THR A 1 35 ? 1.819   -8.919  0.447   1.00 0.00 ? 326 THR A CA   3  
ATOM 2188  C C    . THR A 1 35 ? 0.499   -9.090  -0.292  1.00 0.00 ? 326 THR A C    3  
ATOM 2189  O O    . THR A 1 35 ? -0.487  -8.420  0.013   1.00 0.00 ? 326 THR A O    3  
ATOM 2190  C CB   . THR A 1 35 ? 1.869   -9.930  1.601   1.00 0.00 ? 326 THR A CB   3  
ATOM 2191  O OG1  . THR A 1 35 ? 2.496   -9.339  2.746   1.00 0.00 ? 326 THR A OG1  3  
ATOM 2192  C CG2  . THR A 1 35 ? 2.630   -11.173 1.187   1.00 0.00 ? 326 THR A CG2  3  
ATOM 2193  H H    . THR A 1 35 ? 1.262   -7.156  1.450   1.00 0.00 ? 326 THR A H    3  
ATOM 2194  H HA   . THR A 1 35 ? 2.634   -9.135  -0.228  1.00 0.00 ? 326 THR A HA   3  
ATOM 2195  H HB   . THR A 1 35 ? 0.857   -10.213 1.858   1.00 0.00 ? 326 THR A HB   3  
ATOM 2196  H HG1  . THR A 1 35 ? 3.308   -8.905  2.479   1.00 0.00 ? 326 THR A HG1  3  
ATOM 2197  H HG21 . THR A 1 35 ? 2.637   -11.879 2.003   1.00 0.00 ? 326 THR A HG21 3  
ATOM 2198  H HG22 . THR A 1 35 ? 3.645   -10.901 0.934   1.00 0.00 ? 326 THR A HG22 3  
ATOM 2199  H HG23 . THR A 1 35 ? 2.148   -11.615 0.328   1.00 0.00 ? 326 THR A HG23 3  
ATOM 2200  N N    . ASP A 1 36 ? 0.490   -9.994  -1.264  1.00 0.00 ? 327 ASP A N    3  
ATOM 2201  C CA   . ASP A 1 36 ? -0.712  -10.269 -2.035  1.00 0.00 ? 327 ASP A CA   3  
ATOM 2202  C C    . ASP A 1 36 ? -1.560  -11.319 -1.321  1.00 0.00 ? 327 ASP A C    3  
ATOM 2203  O O    . ASP A 1 36 ? -1.176  -12.485 -1.252  1.00 0.00 ? 327 ASP A O    3  
ATOM 2204  C CB   . ASP A 1 36 ? -0.344  -10.760 -3.437  1.00 0.00 ? 327 ASP A CB   3  
ATOM 2205  C CG   . ASP A 1 36 ? -1.563  -11.108 -4.269  1.00 0.00 ? 327 ASP A CG   3  
ATOM 2206  O OD1  . ASP A 1 36 ? -2.647  -10.550 -3.997  1.00 0.00 ? 327 ASP A OD1  3  
ATOM 2207  O OD2  . ASP A 1 36 ? -1.433  -11.940 -5.192  1.00 0.00 ? 327 ASP A OD2  3  
ATOM 2208  H H    . ASP A 1 36 ? 1.311   -10.487 -1.469  1.00 0.00 ? 327 ASP A H    3  
ATOM 2209  H HA   . ASP A 1 36 ? -1.269  -9.353  -2.116  1.00 0.00 ? 327 ASP A HA   3  
ATOM 2210  H HB2  . ASP A 1 36 ? 0.208   -9.985  -3.949  1.00 0.00 ? 327 ASP A HB2  3  
ATOM 2211  N N    . PRO A 1 37 ? -2.724  -10.931 -0.777  1.00 0.00 ? 328 PRO A N    3  
ATOM 2212  C CA   . PRO A 1 37 ? -3.604  -11.859 -0.058  1.00 0.00 ? 328 PRO A CA   3  
ATOM 2213  C C    . PRO A 1 37 ? -3.959  -13.082 -0.892  1.00 0.00 ? 328 PRO A C    3  
ATOM 2214  O O    . PRO A 1 37 ? -4.364  -14.114 -0.358  1.00 0.00 ? 328 PRO A O    3  
ATOM 2215  C CB   . PRO A 1 37 ? -4.862  -11.030 0.229   1.00 0.00 ? 328 PRO A CB   3  
ATOM 2216  C CG   . PRO A 1 37 ? -4.762  -9.854  -0.676  1.00 0.00 ? 328 PRO A CG   3  
ATOM 2217  C CD   . PRO A 1 37 ? -3.297  -9.578  -0.826  1.00 0.00 ? 328 PRO A CD   3  
ATOM 2218  H HA   . PRO A 1 37 ? -3.161  -12.176 0.877   1.00 0.00 ? 328 PRO A HA   3  
ATOM 2219  H HB2  . PRO A 1 37 ? -5.741  -11.621 0.013   1.00 0.00 ? 328 PRO A HB2  3  
ATOM 2220  H HG2  . PRO A 1 37 ? -5.199  -10.089 -1.635  1.00 0.00 ? 328 PRO A HG2  3  
ATOM 2221  H HD2  . PRO A 1 37 ? -3.102  -9.097  -1.771  1.00 0.00 ? 328 PRO A HD2  3  
ATOM 2222  N N    . ARG A 1 38 ? -3.807  -12.961 -2.207  1.00 0.00 ? 329 ARG A N    3  
ATOM 2223  C CA   . ARG A 1 38 ? -4.121  -14.058 -3.110  1.00 0.00 ? 329 ARG A CA   3  
ATOM 2224  C C    . ARG A 1 38 ? -2.973  -15.062 -3.191  1.00 0.00 ? 329 ARG A C    3  
ATOM 2225  O O    . ARG A 1 38 ? -3.186  -16.232 -3.508  1.00 0.00 ? 329 ARG A O    3  
ATOM 2226  C CB   . ARG A 1 38 ? -4.443  -13.521 -4.505  1.00 0.00 ? 329 ARG A CB   3  
ATOM 2227  C CG   . ARG A 1 38 ? -5.687  -12.659 -4.552  1.00 0.00 ? 329 ARG A CG   3  
ATOM 2228  C CD   . ARG A 1 38 ? -6.450  -12.858 -5.847  1.00 0.00 ? 329 ARG A CD   3  
ATOM 2229  N NE   . ARG A 1 38 ? -7.004  -14.206 -5.953  1.00 0.00 ? 329 ARG A NE   3  
ATOM 2230  C CZ   . ARG A 1 38 ? -7.663  -14.649 -7.019  1.00 0.00 ? 329 ARG A CZ   3  
ATOM 2231  N NH1  . ARG A 1 38 ? -7.842  -13.859 -8.068  1.00 0.00 ? 329 ARG A NH1  3  
ATOM 2232  N NH2  . ARG A 1 38 ? -8.141  -15.887 -7.037  1.00 0.00 ? 329 ARG A NH2  3  
ATOM 2233  H H    . ARG A 1 38 ? -3.480  -12.116 -2.577  1.00 0.00 ? 329 ARG A H    3  
ATOM 2234  H HA   . ARG A 1 38 ? -4.994  -14.556 -2.719  1.00 0.00 ? 329 ARG A HA   3  
ATOM 2235  H HB2  . ARG A 1 38 ? -3.611  -12.928 -4.854  1.00 0.00 ? 329 ARG A HB2  3  
ATOM 2236  H HG2  . ARG A 1 38 ? -6.328  -12.922 -3.722  1.00 0.00 ? 329 ARG A HG2  3  
ATOM 2237  H HD2  . ARG A 1 38 ? -7.255  -12.144 -5.884  1.00 0.00 ? 329 ARG A HD2  3  
ATOM 2238  H HE   . ARG A 1 38 ? -6.883  -14.808 -5.190  1.00 0.00 ? 329 ARG A HE   3  
ATOM 2239  H HH11 . ARG A 1 38 ? -7.481  -12.927 -8.058  1.00 0.00 ? 329 ARG A HH11 3  
ATOM 2240  H HH12 . ARG A 1 38 ? -8.336  -14.196 -8.869  1.00 0.00 ? 329 ARG A HH12 3  
ATOM 2241  H HH21 . ARG A 1 38 ? -8.006  -16.486 -6.248  1.00 0.00 ? 329 ARG A HH21 3  
ATOM 2242  H HH22 . ARG A 1 38 ? -8.636  -16.220 -7.838  1.00 0.00 ? 329 ARG A HH22 3  
ATOM 2243  N N    . LEU A 1 39 ? -1.757  -14.604 -2.902  1.00 0.00 ? 330 LEU A N    3  
ATOM 2244  C CA   . LEU A 1 39 ? -0.583  -15.474 -2.952  1.00 0.00 ? 330 LEU A CA   3  
ATOM 2245  C C    . LEU A 1 39 ? -0.835  -16.778 -2.201  1.00 0.00 ? 330 LEU A C    3  
ATOM 2246  O O    . LEU A 1 39 ? -0.647  -17.865 -2.747  1.00 0.00 ? 330 LEU A O    3  
ATOM 2247  C CB   . LEU A 1 39 ? 0.642   -14.768 -2.367  1.00 0.00 ? 330 LEU A CB   3  
ATOM 2248  C CG   . LEU A 1 39 ? 1.572   -14.128 -3.399  1.00 0.00 ? 330 LEU A CG   3  
ATOM 2249  C CD1  . LEU A 1 39 ? 2.646   -13.300 -2.709  1.00 0.00 ? 330 LEU A CD1  3  
ATOM 2250  C CD2  . LEU A 1 39 ? 2.202   -15.195 -4.281  1.00 0.00 ? 330 LEU A CD2  3  
ATOM 2251  H H    . LEU A 1 39 ? -1.646  -13.663 -2.651  1.00 0.00 ? 330 LEU A H    3  
ATOM 2252  H HA   . LEU A 1 39 ? -0.390  -15.702 -3.989  1.00 0.00 ? 330 LEU A HA   3  
ATOM 2253  H HB2  . LEU A 1 39 ? 0.302   -14.000 -1.692  1.00 0.00 ? 330 LEU A HB2  3  
ATOM 2254  H HG   . LEU A 1 39 ? 0.998   -13.466 -4.031  1.00 0.00 ? 330 LEU A HG   3  
ATOM 2255  H HD11 . LEU A 1 39 ? 2.733   -12.342 -3.199  1.00 0.00 ? 330 LEU A HD11 3  
ATOM 2256  H HD12 . LEU A 1 39 ? 2.376   -13.152 -1.673  1.00 0.00 ? 330 LEU A HD12 3  
ATOM 2257  H HD13 . LEU A 1 39 ? 3.592   -13.819 -2.764  1.00 0.00 ? 330 LEU A HD13 3  
ATOM 2258  H HD21 . LEU A 1 39 ? 2.514   -14.751 -5.215  1.00 0.00 ? 330 LEU A HD21 3  
ATOM 2259  H HD22 . LEU A 1 39 ? 3.060   -15.618 -3.779  1.00 0.00 ? 330 LEU A HD22 3  
ATOM 2260  H HD23 . LEU A 1 39 ? 1.480   -15.973 -4.476  1.00 0.00 ? 330 LEU A HD23 3  
ATOM 2261  N N    . SER A 1 40 ? -1.261  -16.662 -0.949  1.00 0.00 ? 331 SER A N    3  
ATOM 2262  C CA   . SER A 1 40 ? -1.538  -17.832 -0.124  1.00 0.00 ? 331 SER A CA   3  
ATOM 2263  C C    . SER A 1 40 ? -3.019  -18.193 -0.171  1.00 0.00 ? 331 SER A C    3  
ATOM 2264  O O    . SER A 1 40 ? -3.806  -17.739 0.658   1.00 0.00 ? 331 SER A O    3  
ATOM 2265  C CB   . SER A 1 40 ? -1.108  -17.578 1.322   1.00 0.00 ? 331 SER A CB   3  
ATOM 2266  O OG   . SER A 1 40 ? -1.509  -18.642 2.167   1.00 0.00 ? 331 SER A OG   3  
ATOM 2267  H H    . SER A 1 40 ? -1.395  -15.768 -0.570  1.00 0.00 ? 331 SER A H    3  
ATOM 2268  H HA   . SER A 1 40 ? -0.965  -18.657 -0.520  1.00 0.00 ? 331 SER A HA   3  
ATOM 2269  H HB2  . SER A 1 40 ? -0.034  -17.487 1.365   1.00 0.00 ? 331 SER A HB2  3  
ATOM 2270  H HG   . SER A 1 40 ? -2.240  -18.354 2.719   1.00 0.00 ? 331 SER A HG   3  
ATOM 2271  N N    . ALA A 1 41 ? -3.393  -19.013 -1.149  1.00 0.00 ? 332 ALA A N    3  
ATOM 2272  C CA   . ALA A 1 41 ? -4.779  -19.437 -1.303  1.00 0.00 ? 332 ALA A CA   3  
ATOM 2273  C C    . ALA A 1 41 ? -4.917  -20.461 -2.425  1.00 0.00 ? 332 ALA A C    3  
ATOM 2274  O O    . ALA A 1 41 ? -5.881  -20.434 -3.189  1.00 0.00 ? 332 ALA A O    3  
ATOM 2275  C CB   . ALA A 1 41 ? -5.674  -18.232 -1.571  1.00 0.00 ? 332 ALA A CB   3  
ATOM 2276  H H    . ALA A 1 41 ? -2.719  -19.340 -1.782  1.00 0.00 ? 332 ALA A H    3  
ATOM 2277  H HA   . ALA A 1 41 ? -5.093  -19.893 -0.374  1.00 0.00 ? 332 ALA A HA   3  
ATOM 2278  H HB1  . ALA A 1 41 ? -5.679  -17.586 -0.705  1.00 0.00 ? 332 ALA A HB1  3  
ATOM 2279  H HB2  . ALA A 1 41 ? -5.297  -17.688 -2.424  1.00 0.00 ? 332 ALA A HB2  3  
ATOM 2280  H HB3  . ALA A 1 41 ? -6.681  -18.569 -1.775  1.00 0.00 ? 332 ALA A HB3  3  
ATOM 2281  N N    . ASN A 1 42 ? -3.946  -21.363 -2.518  1.00 0.00 ? 333 ASN A N    3  
ATOM 2282  C CA   . ASN A 1 42 ? -3.957  -22.398 -3.546  1.00 0.00 ? 333 ASN A CA   3  
ATOM 2283  C C    . ASN A 1 42 ? -4.107  -21.786 -4.935  1.00 0.00 ? 333 ASN A C    3  
ATOM 2284  O O    . ASN A 1 42 ? -5.250  -21.722 -5.433  1.00 0.00 ? 333 ASN A O    3  
ATOM 2285  C CB   . ASN A 1 42 ? -5.091  -23.390 -3.287  1.00 0.00 ? 333 ASN A CB   3  
ATOM 2286  C CG   . ASN A 1 42 ? -4.580  -24.770 -2.924  1.00 0.00 ? 333 ASN A CG   3  
ATOM 2287  O OD1  . ASN A 1 42 ? -4.792  -25.737 -3.657  1.00 0.00 ? 333 ASN A OD1  3  
ATOM 2288  N ND2  . ASN A 1 42 ? -3.903  -24.870 -1.787  1.00 0.00 ? 333 ASN A ND2  3  
ATOM 2289  O OXT  . ASN A 1 42 ? -3.078  -21.377 -5.515  1.00 0.00 ? 333 ASN A OXT  3  
ATOM 2290  H H    . ASN A 1 42 ? -3.202  -21.331 -1.879  1.00 0.00 ? 333 ASN A H    3  
ATOM 2291  H HA   . ASN A 1 42 ? -3.014  -22.922 -3.497  1.00 0.00 ? 333 ASN A HA   3  
ATOM 2292  H HB2  . ASN A 1 42 ? -5.700  -23.027 -2.473  1.00 0.00 ? 333 ASN A HB2  3  
ATOM 2293  H HD21 . ASN A 1 42 ? -3.773  -24.058 -1.253  1.00 0.00 ? 333 ASN A HD21 3  
ATOM 2294  H HD22 . ASN A 1 42 ? -3.560  -25.751 -1.527  1.00 0.00 ? 333 ASN A HD22 3  
ATOM 2295  N N    . GLY B 2 1  ? 24.360  -5.392  7.900   1.00 0.00 ? 198 GLY B N    3  
ATOM 2296  C CA   . GLY B 2 1  ? 23.941  -5.719  9.291   1.00 0.00 ? 198 GLY B CA   3  
ATOM 2297  C C    . GLY B 2 1  ? 22.447  -5.539  9.502   1.00 0.00 ? 198 GLY B C    3  
ATOM 2298  O O    . GLY B 2 1  ? 21.731  -5.187  8.564   1.00 0.00 ? 198 GLY B O    3  
ATOM 2299  H H1   . GLY B 2 1  ? 24.936  -6.166  7.510   1.00 0.00 ? 198 GLY B H1   3  
ATOM 2300  H H2   . GLY B 2 1  ? 24.923  -4.518  7.893   1.00 0.00 ? 198 GLY B H2   3  
ATOM 2301  H H3   . GLY B 2 1  ? 23.524  -5.258  7.297   1.00 0.00 ? 198 GLY B H3   3  
ATOM 2302  H HA2  . GLY B 2 1  ? 24.204  -6.745  9.499   1.00 0.00 ? 198 GLY B HA2  3  
ATOM 2303  H HA3  . GLY B 2 1  ? 24.473  -5.074  9.974   1.00 0.00 ? 198 GLY B HA3  3  
ATOM 2304  N N    . PRO B 2 2  ? 21.937  -5.772  10.728  1.00 0.00 ? 199 PRO B N    3  
ATOM 2305  C CA   . PRO B 2 2  ? 20.513  -5.627  11.026  1.00 0.00 ? 199 PRO B CA   3  
ATOM 2306  C C    . PRO B 2 2  ? 20.135  -4.188  11.359  1.00 0.00 ? 199 PRO B C    3  
ATOM 2307  O O    . PRO B 2 2  ? 20.064  -3.809  12.528  1.00 0.00 ? 199 PRO B O    3  
ATOM 2308  C CB   . PRO B 2 2  ? 20.337  -6.521  12.247  1.00 0.00 ? 199 PRO B CB   3  
ATOM 2309  C CG   . PRO B 2 2  ? 21.636  -6.420  12.971  1.00 0.00 ? 199 PRO B CG   3  
ATOM 2310  C CD   . PRO B 2 2  ? 22.700  -6.196  11.922  1.00 0.00 ? 199 PRO B CD   3  
ATOM 2311  H HA   . PRO B 2 2  ? 19.896  -5.987  10.217  1.00 0.00 ? 199 PRO B HA   3  
ATOM 2312  H HB2  . PRO B 2 2  ? 19.518  -6.156  12.850  1.00 0.00 ? 199 PRO B HB2  3  
ATOM 2313  H HG2  . PRO B 2 2  ? 21.608  -5.586  13.656  1.00 0.00 ? 199 PRO B HG2  3  
ATOM 2314  H HD2  . PRO B 2 2  ? 23.379  -5.420  12.242  1.00 0.00 ? 199 PRO B HD2  3  
ATOM 2315  N N    . LEU B 2 3  ? 19.892  -3.390  10.326  1.00 0.00 ? 200 LEU B N    3  
ATOM 2316  C CA   . LEU B 2 3  ? 19.522  -1.992  10.512  1.00 0.00 ? 200 LEU B CA   3  
ATOM 2317  C C    . LEU B 2 3  ? 18.296  -1.866  11.412  1.00 0.00 ? 200 LEU B C    3  
ATOM 2318  O O    . LEU B 2 3  ? 18.377  -1.327  12.516  1.00 0.00 ? 200 LEU B O    3  
ATOM 2319  C CB   . LEU B 2 3  ? 19.249  -1.329  9.160   1.00 0.00 ? 200 LEU B CB   3  
ATOM 2320  C CG   . LEU B 2 3  ? 20.357  -0.402  8.656   1.00 0.00 ? 200 LEU B CG   3  
ATOM 2321  C CD1  . LEU B 2 3  ? 20.219  -0.173  7.158   1.00 0.00 ? 200 LEU B CD1  3  
ATOM 2322  C CD2  . LEU B 2 3  ? 20.323  0.922   9.405   1.00 0.00 ? 200 LEU B CD2  3  
ATOM 2323  H H    . LEU B 2 3  ? 19.962  -3.749  9.417   1.00 0.00 ? 200 LEU B H    3  
ATOM 2324  H HA   . LEU B 2 3  ? 20.354  -1.493  10.986  1.00 0.00 ? 200 LEU B HA   3  
ATOM 2325  H HB2  . LEU B 2 3  ? 19.097  -2.108  8.425   1.00 0.00 ? 200 LEU B HB2  3  
ATOM 2326  H HG   . LEU B 2 3  ? 21.315  -0.866  8.836   1.00 0.00 ? 200 LEU B HG   3  
ATOM 2327  H HD11 . LEU B 2 3  ? 19.178  -0.231  6.878   1.00 0.00 ? 200 LEU B HD11 3  
ATOM 2328  H HD12 . LEU B 2 3  ? 20.606  0.804   6.906   1.00 0.00 ? 200 LEU B HD12 3  
ATOM 2329  H HD13 . LEU B 2 3  ? 20.777  -0.929  6.625   1.00 0.00 ? 200 LEU B HD13 3  
ATOM 2330  H HD21 . LEU B 2 3  ? 20.443  1.735   8.704   1.00 0.00 ? 200 LEU B HD21 3  
ATOM 2331  H HD22 . LEU B 2 3  ? 19.377  1.022   9.915   1.00 0.00 ? 200 LEU B HD22 3  
ATOM 2332  H HD23 . LEU B 2 3  ? 21.126  0.947   10.127  1.00 0.00 ? 200 LEU B HD23 3  
ATOM 2333  N N    . GLY B 2 4  ? 17.161  -2.368  10.933  1.00 0.00 ? 201 GLY B N    3  
ATOM 2334  C CA   . GLY B 2 4  ? 15.936  -2.303  11.708  1.00 0.00 ? 201 GLY B CA   3  
ATOM 2335  C C    . GLY B 2 4  ? 15.185  -1.001  11.504  1.00 0.00 ? 201 GLY B C    3  
ATOM 2336  O O    . GLY B 2 4  ? 14.695  -0.404  12.462  1.00 0.00 ? 201 GLY B O    3  
ATOM 2337  H H    . GLY B 2 4  ? 17.156  -2.786  10.046  1.00 0.00 ? 201 GLY B H    3  
ATOM 2338  H HA2  . GLY B 2 4  ? 15.296  -3.124  11.418  1.00 0.00 ? 201 GLY B HA2  3  
ATOM 2339  H HA3  . GLY B 2 4  ? 16.180  -2.405  12.755  1.00 0.00 ? 201 GLY B HA3  3  
ATOM 2340  N N    . SER B 2 5  ? 15.092  -0.562  10.254  1.00 0.00 ? 202 SER B N    3  
ATOM 2341  C CA   . SER B 2 5  ? 14.394  0.676   9.929   1.00 0.00 ? 202 SER B CA   3  
ATOM 2342  C C    . SER B 2 5  ? 14.198  0.809   8.422   1.00 0.00 ? 202 SER B C    3  
ATOM 2343  O O    . SER B 2 5  ? 14.724  1.731   7.798   1.00 0.00 ? 202 SER B O    3  
ATOM 2344  C CB   . SER B 2 5  ? 15.173  1.881   10.461  1.00 0.00 ? 202 SER B CB   3  
ATOM 2345  O OG   . SER B 2 5  ? 14.315  2.987   10.681  1.00 0.00 ? 202 SER B OG   3  
ATOM 2346  H H    . SER B 2 5  ? 15.504  -1.082  9.532   1.00 0.00 ? 202 SER B H    3  
ATOM 2347  H HA   . SER B 2 5  ? 13.426  0.646   10.404  1.00 0.00 ? 202 SER B HA   3  
ATOM 2348  H HB2  . SER B 2 5  ? 15.645  1.617   11.395  1.00 0.00 ? 202 SER B HB2  3  
ATOM 2349  H HG   . SER B 2 5  ? 14.824  3.720   11.035  1.00 0.00 ? 202 SER B HG   3  
ATOM 2350  N N    . GLU B 2 6  ? 13.441  -0.118  7.843   1.00 0.00 ? 203 GLU B N    3  
ATOM 2351  C CA   . GLU B 2 6  ? 13.183  -0.100  6.408   1.00 0.00 ? 203 GLU B CA   3  
ATOM 2352  C C    . GLU B 2 6  ? 11.965  -0.948  6.054   1.00 0.00 ? 203 GLU B C    3  
ATOM 2353  O O    . GLU B 2 6  ? 11.089  -0.507  5.310   1.00 0.00 ? 203 GLU B O    3  
ATOM 2354  C CB   . GLU B 2 6  ? 14.407  -0.609  5.645   1.00 0.00 ? 203 GLU B CB   3  
ATOM 2355  C CG   . GLU B 2 6  ? 14.235  -0.595  4.136   1.00 0.00 ? 203 GLU B CG   3  
ATOM 2356  C CD   . GLU B 2 6  ? 15.440  -1.157  3.408   1.00 0.00 ? 203 GLU B CD   3  
ATOM 2357  O OE1  . GLU B 2 6  ? 16.436  -1.495  4.082   1.00 0.00 ? 203 GLU B OE1  3  
ATOM 2358  O OE2  . GLU B 2 6  ? 15.388  -1.259  2.163   1.00 0.00 ? 203 GLU B OE2  3  
ATOM 2359  H H    . GLU B 2 6  ? 13.048  -0.827  8.393   1.00 0.00 ? 203 GLU B H    3  
ATOM 2360  H HA   . GLU B 2 6  ? 12.991  0.922   6.120   1.00 0.00 ? 203 GLU B HA   3  
ATOM 2361  H HB2  . GLU B 2 6  ? 15.256  0.011   5.895   1.00 0.00 ? 203 GLU B HB2  3  
ATOM 2362  H HG2  . GLU B 2 6  ? 13.369  -1.187  3.879   1.00 0.00 ? 203 GLU B HG2  3  
ATOM 2363  N N    . LEU B 2 7  ? 11.913  -2.163  6.591   1.00 0.00 ? 204 LEU B N    3  
ATOM 2364  C CA   . LEU B 2 7  ? 10.802  -3.066  6.316   1.00 0.00 ? 204 LEU B CA   3  
ATOM 2365  C C    . LEU B 2 7  ? 9.945   -3.294  7.557   1.00 0.00 ? 204 LEU B C    3  
ATOM 2366  O O    . LEU B 2 7  ? 9.300   -4.334  7.694   1.00 0.00 ? 204 LEU B O    3  
ATOM 2367  C CB   . LEU B 2 7  ? 11.326  -4.403  5.789   1.00 0.00 ? 204 LEU B CB   3  
ATOM 2368  C CG   . LEU B 2 7  ? 11.360  -4.525  4.265   1.00 0.00 ? 204 LEU B CG   3  
ATOM 2369  C CD1  . LEU B 2 7  ? 11.944  -5.866  3.849   1.00 0.00 ? 204 LEU B CD1  3  
ATOM 2370  C CD2  . LEU B 2 7  ? 9.965   -4.345  3.686   1.00 0.00 ? 204 LEU B CD2  3  
ATOM 2371  H H    . LEU B 2 7  ? 12.636  -2.458  7.182   1.00 0.00 ? 204 LEU B H    3  
ATOM 2372  H HA   . LEU B 2 7  ? 10.189  -2.610  5.554   1.00 0.00 ? 204 LEU B HA   3  
ATOM 2373  H HB2  . LEU B 2 7  ? 12.329  -4.546  6.164   1.00 0.00 ? 204 LEU B HB2  3  
ATOM 2374  H HG   . LEU B 2 7  ? 11.992  -3.748  3.862   1.00 0.00 ? 204 LEU B HG   3  
ATOM 2375  H HD11 . LEU B 2 7  ? 12.975  -5.923  4.164   1.00 0.00 ? 204 LEU B HD11 3  
ATOM 2376  H HD12 . LEU B 2 7  ? 11.381  -6.663  4.312   1.00 0.00 ? 204 LEU B HD12 3  
ATOM 2377  H HD13 . LEU B 2 7  ? 11.890  -5.966  2.775   1.00 0.00 ? 204 LEU B HD13 3  
ATOM 2378  H HD21 . LEU B 2 7  ? 9.726   -5.186  3.052   1.00 0.00 ? 204 LEU B HD21 3  
ATOM 2379  H HD22 . LEU B 2 7  ? 9.246   -4.285  4.490   1.00 0.00 ? 204 LEU B HD22 3  
ATOM 2380  H HD23 . LEU B 2 7  ? 9.932   -3.435  3.105   1.00 0.00 ? 204 LEU B HD23 3  
ATOM 2381  N N    . GLU B 2 8  ? 9.944   -2.320  8.461   1.00 0.00 ? 205 GLU B N    3  
ATOM 2382  C CA   . GLU B 2 8  ? 9.154   -2.416  9.683   1.00 0.00 ? 205 GLU B CA   3  
ATOM 2383  C C    . GLU B 2 8  ? 7.698   -2.063  9.399   1.00 0.00 ? 205 GLU B C    3  
ATOM 2384  O O    . GLU B 2 8  ? 7.182   -1.057  9.887   1.00 0.00 ? 205 GLU B O    3  
ATOM 2385  C CB   . GLU B 2 8  ? 9.726   -1.490  10.761  1.00 0.00 ? 205 GLU B CB   3  
ATOM 2386  C CG   . GLU B 2 8  ? 10.427  -2.232  11.887  1.00 0.00 ? 205 GLU B CG   3  
ATOM 2387  C CD   . GLU B 2 8  ? 11.871  -2.556  11.561  1.00 0.00 ? 205 GLU B CD   3  
ATOM 2388  O OE1  . GLU B 2 8  ? 12.361  -2.091  10.511  1.00 0.00 ? 205 GLU B OE1  3  
ATOM 2389  O OE2  . GLU B 2 8  ? 12.511  -3.274  12.356  1.00 0.00 ? 205 GLU B OE2  3  
ATOM 2390  H H    . GLU B 2 8  ? 10.485  -1.519  8.301   1.00 0.00 ? 205 GLU B H    3  
ATOM 2391  H HA   . GLU B 2 8  ? 9.205   -3.437  10.031  1.00 0.00 ? 205 GLU B HA   3  
ATOM 2392  H HB2  . GLU B 2 8  ? 10.439  -0.821  10.302  1.00 0.00 ? 205 GLU B HB2  3  
ATOM 2393  H HG2  . GLU B 2 8  ? 10.403  -1.617  12.775  1.00 0.00 ? 205 GLU B HG2  3  
ATOM 2394  N N    . SER B 2 9  ? 7.041   -2.901  8.604   1.00 0.00 ? 206 SER B N    3  
ATOM 2395  C CA   . SER B 2 9  ? 5.648   -2.678  8.236   1.00 0.00 ? 206 SER B CA   3  
ATOM 2396  C C    . SER B 2 9  ? 5.481   -1.335  7.528   1.00 0.00 ? 206 SER B C    3  
ATOM 2397  O O    . SER B 2 9  ? 4.779   -0.451  8.018   1.00 0.00 ? 206 SER B O    3  
ATOM 2398  C CB   . SER B 2 9  ? 4.755   -2.727  9.477   1.00 0.00 ? 206 SER B CB   3  
ATOM 2399  O OG   . SER B 2 9  ? 4.259   -4.035  9.698   1.00 0.00 ? 206 SER B OG   3  
ATOM 2400  H H    . SER B 2 9  ? 7.506   -3.689  8.255   1.00 0.00 ? 206 SER B H    3  
ATOM 2401  H HA   . SER B 2 9  ? 5.353   -3.467  7.560   1.00 0.00 ? 206 SER B HA   3  
ATOM 2402  H HB2  . SER B 2 9  ? 5.326   -2.422  10.341  1.00 0.00 ? 206 SER B HB2  3  
ATOM 2403  H HG   . SER B 2 9  ? 3.340   -3.988  9.974   1.00 0.00 ? 206 SER B HG   3  
ATOM 2404  N N    . PRO B 2 10 ? 6.130   -1.164  6.360   1.00 0.00 ? 207 PRO B N    3  
ATOM 2405  C CA   . PRO B 2 10 ? 6.055   0.078   5.588   1.00 0.00 ? 207 PRO B CA   3  
ATOM 2406  C C    . PRO B 2 10 ? 4.691   0.358   4.934   1.00 0.00 ? 207 PRO B C    3  
ATOM 2407  O O    . PRO B 2 10 ? 4.326   1.526   4.798   1.00 0.00 ? 207 PRO B O    3  
ATOM 2408  C CB   . PRO B 2 10 ? 7.137   -0.092  4.511   1.00 0.00 ? 207 PRO B CB   3  
ATOM 2409  C CG   . PRO B 2 10 ? 7.941   -1.277  4.927   1.00 0.00 ? 207 PRO B CG   3  
ATOM 2410  C CD   . PRO B 2 10 ? 7.007   -2.149  5.706   1.00 0.00 ? 207 PRO B CD   3  
ATOM 2411  H HA   . PRO B 2 10 ? 6.313   0.923   6.204   1.00 0.00 ? 207 PRO B HA   3  
ATOM 2412  H HB2  . PRO B 2 10 ? 6.669   -0.252  3.557   1.00 0.00 ? 207 PRO B HB2  3  
ATOM 2413  H HG2  . PRO B 2 10 ? 8.305   -1.800  4.054   1.00 0.00 ? 207 PRO B HG2  3  
ATOM 2414  H HD2  . PRO B 2 10 ? 6.451   -2.789  5.039   1.00 0.00 ? 207 PRO B HD2  3  
ATOM 2415  N N    . PRO B 2 11 ? 3.910   -0.672  4.504   1.00 0.00 ? 208 PRO B N    3  
ATOM 2416  C CA   . PRO B 2 11 ? 2.622   -0.447  3.857   1.00 0.00 ? 208 PRO B CA   3  
ATOM 2417  C C    . PRO B 2 11 ? 1.835   0.717   4.448   1.00 0.00 ? 208 PRO B C    3  
ATOM 2418  O O    . PRO B 2 11 ? 1.481   0.690   5.626   1.00 0.00 ? 208 PRO B O    3  
ATOM 2419  C CB   . PRO B 2 11 ? 1.858   -1.745  4.081   1.00 0.00 ? 208 PRO B CB   3  
ATOM 2420  C CG   . PRO B 2 11 ? 2.888   -2.798  4.323   1.00 0.00 ? 208 PRO B CG   3  
ATOM 2421  C CD   . PRO B 2 11 ? 4.211   -2.113  4.578   1.00 0.00 ? 208 PRO B CD   3  
ATOM 2422  H HA   . PRO B 2 11 ? 2.749   -0.299  2.807   1.00 0.00 ? 208 PRO B HA   3  
ATOM 2423  H HB2  . PRO B 2 11 ? 1.202   -1.630  4.928   1.00 0.00 ? 208 PRO B HB2  3  
ATOM 2424  H HG2  . PRO B 2 11 ? 2.608   -3.383  5.185   1.00 0.00 ? 208 PRO B HG2  3  
ATOM 2425  H HD2  . PRO B 2 11 ? 4.569   -2.387  5.549   1.00 0.00 ? 208 PRO B HD2  3  
ATOM 2426  N N    . PRO B 2 12 ? 1.597   1.777   3.648   1.00 0.00 ? 209 PRO B N    3  
ATOM 2427  C CA   . PRO B 2 12 ? 0.817   2.945   4.066   1.00 0.00 ? 209 PRO B CA   3  
ATOM 2428  C C    . PRO B 2 12 ? -0.469  2.560   4.799   1.00 0.00 ? 209 PRO B C    3  
ATOM 2429  O O    . PRO B 2 12 ? -0.704  1.391   5.079   1.00 0.00 ? 209 PRO B O    3  
ATOM 2430  C CB   . PRO B 2 12 ? 0.489   3.644   2.737   1.00 0.00 ? 209 PRO B CB   3  
ATOM 2431  C CG   . PRO B 2 12 ? 1.046   2.783   1.662   1.00 0.00 ? 209 PRO B CG   3  
ATOM 2432  C CD   . PRO B 2 12 ? 2.115   1.968   2.289   1.00 0.00 ? 209 PRO B CD   3  
ATOM 2433  H HA   . PRO B 2 12 ? 1.401   3.608   4.690   1.00 0.00 ? 209 PRO B HA   3  
ATOM 2434  H HB2  . PRO B 2 12 ? -0.575  3.724   2.632   1.00 0.00 ? 209 PRO B HB2  3  
ATOM 2435  H HG2  . PRO B 2 12 ? 0.275   2.139   1.286   1.00 0.00 ? 209 PRO B HG2  3  
ATOM 2436  H HD2  . PRO B 2 12 ? 2.217   1.037   1.761   1.00 0.00 ? 209 PRO B HD2  3  
ATOM 2437  N N    . PRO B 2 13 ? -1.345  3.536   5.087   1.00 0.00 ? 210 PRO B N    3  
ATOM 2438  C CA   . PRO B 2 13 ? -2.585  3.278   5.802   1.00 0.00 ? 210 PRO B CA   3  
ATOM 2439  C C    . PRO B 2 13 ? -3.692  2.778   4.891   1.00 0.00 ? 210 PRO B C    3  
ATOM 2440  O O    . PRO B 2 13 ? -3.643  2.966   3.675   1.00 0.00 ? 210 PRO B O    3  
ATOM 2441  C CB   . PRO B 2 13 ? -2.940  4.639   6.384   1.00 0.00 ? 210 PRO B CB   3  
ATOM 2442  C CG   . PRO B 2 13 ? -2.339  5.640   5.451   1.00 0.00 ? 210 PRO B CG   3  
ATOM 2443  C CD   . PRO B 2 13 ? -1.218  4.952   4.708   1.00 0.00 ? 210 PRO B CD   3  
ATOM 2444  H HA   . PRO B 2 13 ? -2.436  2.572   6.602   1.00 0.00 ? 210 PRO B HA   3  
ATOM 2445  H HB2  . PRO B 2 13 ? -4.014  4.737   6.429   1.00 0.00 ? 210 PRO B HB2  3  
ATOM 2446  H HG2  . PRO B 2 13 ? -3.089  5.980   4.754   1.00 0.00 ? 210 PRO B HG2  3  
ATOM 2447  H HD2  . PRO B 2 13 ? -1.355  5.072   3.644   1.00 0.00 ? 210 PRO B HD2  3  
ATOM 2448  N N    . TYR B 2 14 ? -4.696  2.141   5.487   1.00 0.00 ? 211 TYR B N    3  
ATOM 2449  C CA   . TYR B 2 14 ? -5.820  1.610   4.727   1.00 0.00 ? 211 TYR B CA   3  
ATOM 2450  C C    . TYR B 2 14 ? -6.348  2.656   3.743   1.00 0.00 ? 211 TYR B C    3  
ATOM 2451  O O    . TYR B 2 14 ? -5.936  2.695   2.584   1.00 0.00 ? 211 TYR B O    3  
ATOM 2452  C CB   . TYR B 2 14 ? -6.939  1.143   5.679   1.00 0.00 ? 211 TYR B CB   3  
ATOM 2453  C CG   . TYR B 2 14 ? -8.307  1.033   5.030   1.00 0.00 ? 211 TYR B CG   3  
ATOM 2454  C CD1  . TYR B 2 14 ? -8.435  0.614   3.713   1.00 0.00 ? 211 TYR B CD1  3  
ATOM 2455  C CD2  . TYR B 2 14 ? -9.462  1.364   5.727   1.00 0.00 ? 211 TYR B CD2  3  
ATOM 2456  C CE1  . TYR B 2 14 ? -9.673  0.525   3.109   1.00 0.00 ? 211 TYR B CE1  3  
ATOM 2457  C CE2  . TYR B 2 14 ? -10.706 1.278   5.129   1.00 0.00 ? 211 TYR B CE2  3  
ATOM 2458  C CZ   . TYR B 2 14 ? -10.805 0.858   3.820   1.00 0.00 ? 211 TYR B CZ   3  
ATOM 2459  O OH   . TYR B 2 14 ? -12.041 0.773   3.219   1.00 0.00 ? 211 TYR B OH   3  
ATOM 2460  H H    . TYR B 2 14 ? -4.679  2.026   6.459   1.00 0.00 ? 211 TYR B H    3  
ATOM 2461  H HA   . TYR B 2 14 ? -5.460  0.760   4.164   1.00 0.00 ? 211 TYR B HA   3  
ATOM 2462  H HB2  . TYR B 2 14 ? -6.682  0.171   6.071   1.00 0.00 ? 211 TYR B HB2  3  
ATOM 2463  H HD1  . TYR B 2 14 ? -7.548  0.352   3.162   1.00 0.00 ? 211 TYR B HD1  3  
ATOM 2464  H HD2  . TYR B 2 14 ? -9.381  1.691   6.753   1.00 0.00 ? 211 TYR B HD2  3  
ATOM 2465  H HE1  . TYR B 2 14 ? -9.748  0.197   2.081   1.00 0.00 ? 211 TYR B HE1  3  
ATOM 2466  H HE2  . TYR B 2 14 ? -11.592 1.540   5.687   1.00 0.00 ? 211 TYR B HE2  3  
ATOM 2467  H HH   . TYR B 2 14 ? -12.519 0.020   3.576   1.00 0.00 ? 211 TYR B HH   3  
ATOM 2468  N N    . SER B 2 15 ? -7.261  3.501   4.215   1.00 0.00 ? 212 SER B N    3  
ATOM 2469  C CA   . SER B 2 15 ? -7.849  4.533   3.371   1.00 0.00 ? 212 SER B CA   3  
ATOM 2470  C C    . SER B 2 15 ? -8.334  3.931   2.058   1.00 0.00 ? 212 SER B C    3  
ATOM 2471  O O    . SER B 2 15 ? -8.514  2.717   1.954   1.00 0.00 ? 212 SER B O    3  
ATOM 2472  C CB   . SER B 2 15 ? -6.832  5.642   3.098   1.00 0.00 ? 212 SER B CB   3  
ATOM 2473  O OG   . SER B 2 15 ? -5.928  5.785   4.180   1.00 0.00 ? 212 SER B OG   3  
ATOM 2474  H H    . SER B 2 15 ? -7.543  3.431   5.150   1.00 0.00 ? 212 SER B H    3  
ATOM 2475  H HA   . SER B 2 15 ? -8.695  4.950   3.897   1.00 0.00 ? 212 SER B HA   3  
ATOM 2476  H HB2  . SER B 2 15 ? -6.273  5.403   2.208   1.00 0.00 ? 212 SER B HB2  3  
ATOM 2477  H HG   . SER B 2 15 ? -5.836  6.715   4.400   1.00 0.00 ? 212 SER B HG   3  
ATOM 2478  N N    . ARG B 2 16 ? -8.545  4.775   1.059   1.00 0.00 ? 213 ARG B N    3  
ATOM 2479  C CA   . ARG B 2 16 ? -9.005  4.303   -0.240  1.00 0.00 ? 213 ARG B CA   3  
ATOM 2480  C C    . ARG B 2 16 ? -8.078  4.748   -1.373  1.00 0.00 ? 213 ARG B C    3  
ATOM 2481  O O    . ARG B 2 16 ? -8.142  4.213   -2.479  1.00 0.00 ? 213 ARG B O    3  
ATOM 2482  C CB   . ARG B 2 16 ? -10.427 4.792   -0.498  1.00 0.00 ? 213 ARG B CB   3  
ATOM 2483  C CG   . ARG B 2 16 ? -11.464 4.125   0.393   1.00 0.00 ? 213 ARG B CG   3  
ATOM 2484  C CD   . ARG B 2 16 ? -12.594 3.518   -0.423  1.00 0.00 ? 213 ARG B CD   3  
ATOM 2485  N NE   . ARG B 2 16 ? -13.900 4.017   -0.002  1.00 0.00 ? 213 ARG B NE   3  
ATOM 2486  C CZ   . ARG B 2 16 ? -14.553 3.568   1.066   1.00 0.00 ? 213 ARG B CZ   3  
ATOM 2487  N NH1  . ARG B 2 16 ? -14.022 2.611   1.816   1.00 0.00 ? 213 ARG B NH1  3  
ATOM 2488  N NH2  . ARG B 2 16 ? -15.735 4.075   1.385   1.00 0.00 ? 213 ARG B NH2  3  
ATOM 2489  H H    . ARG B 2 16 ? -8.404  5.733   1.204   1.00 0.00 ? 213 ARG B H    3  
ATOM 2490  H HA   . ARG B 2 16 ? -9.013  3.224   -0.210  1.00 0.00 ? 213 ARG B HA   3  
ATOM 2491  H HB2  . ARG B 2 16 ? -10.467 5.858   -0.325  1.00 0.00 ? 213 ARG B HB2  3  
ATOM 2492  H HG2  . ARG B 2 16 ? -10.986 3.340   0.964   1.00 0.00 ? 213 ARG B HG2  3  
ATOM 2493  H HD2  . ARG B 2 16 ? -12.441 3.764   -1.463  1.00 0.00 ? 213 ARG B HD2  3  
ATOM 2494  H HE   . ARG B 2 16 ? -14.312 4.723   -0.543  1.00 0.00 ? 213 ARG B HE   3  
ATOM 2495  H HH11 . ARG B 2 16 ? -13.129 2.226   1.580   1.00 0.00 ? 213 ARG B HH11 3  
ATOM 2496  H HH12 . ARG B 2 16 ? -14.513 2.275   2.619   1.00 0.00 ? 213 ARG B HH12 3  
ATOM 2497  H HH21 . ARG B 2 16 ? -16.137 4.796   0.821   1.00 0.00 ? 213 ARG B HH21 3  
ATOM 2498  H HH22 . ARG B 2 16 ? -16.225 3.735   2.188   1.00 0.00 ? 213 ARG B HH22 3  
ATOM 2499  N N    . TYR B 2 17 ? -7.218  5.727   -1.099  1.00 0.00 ? 214 TYR B N    3  
ATOM 2500  C CA   . TYR B 2 17 ? -6.288  6.226   -2.105  1.00 0.00 ? 214 TYR B CA   3  
ATOM 2501  C C    . TYR B 2 17 ? -4.859  5.781   -1.796  1.00 0.00 ? 214 TYR B C    3  
ATOM 2502  O O    . TYR B 2 17 ? -4.599  5.179   -0.754  1.00 0.00 ? 214 TYR B O    3  
ATOM 2503  C CB   . TYR B 2 17 ? -6.359  7.753   -2.181  1.00 0.00 ? 214 TYR B CB   3  
ATOM 2504  C CG   . TYR B 2 17 ? -7.749  8.305   -1.974  1.00 0.00 ? 214 TYR B CG   3  
ATOM 2505  C CD1  . TYR B 2 17 ? -8.866  7.575   -2.356  1.00 0.00 ? 214 TYR B CD1  3  
ATOM 2506  C CD2  . TYR B 2 17 ? -7.942  9.554   -1.403  1.00 0.00 ? 214 TYR B CD2  3  
ATOM 2507  C CE1  . TYR B 2 17 ? -10.139 8.074   -2.173  1.00 0.00 ? 214 TYR B CE1  3  
ATOM 2508  C CE2  . TYR B 2 17 ? -9.213  10.062  -1.217  1.00 0.00 ? 214 TYR B CE2  3  
ATOM 2509  C CZ   . TYR B 2 17 ? -10.308 9.318   -1.603  1.00 0.00 ? 214 TYR B CZ   3  
ATOM 2510  O OH   . TYR B 2 17 ? -11.576 9.820   -1.418  1.00 0.00 ? 214 TYR B OH   3  
ATOM 2511  H H    . TYR B 2 17 ? -7.211  6.125   -0.208  1.00 0.00 ? 214 TYR B H    3  
ATOM 2512  H HA   . TYR B 2 17 ? -6.582  5.813   -3.059  1.00 0.00 ? 214 TYR B HA   3  
ATOM 2513  H HB2  . TYR B 2 17 ? -5.719  8.177   -1.423  1.00 0.00 ? 214 TYR B HB2  3  
ATOM 2514  H HD1  . TYR B 2 17 ? -8.731  6.602   -2.803  1.00 0.00 ? 214 TYR B HD1  3  
ATOM 2515  H HD2  . TYR B 2 17 ? -7.082  10.134  -1.102  1.00 0.00 ? 214 TYR B HD2  3  
ATOM 2516  H HE1  . TYR B 2 17 ? -10.993 7.490   -2.476  1.00 0.00 ? 214 TYR B HE1  3  
ATOM 2517  H HE2  . TYR B 2 17 ? -9.343  11.035  -0.771  1.00 0.00 ? 214 TYR B HE2  3  
ATOM 2518  H HH   . TYR B 2 17 ? -12.160 9.117   -1.126  1.00 0.00 ? 214 TYR B HH   3  
ATOM 2519  N N    . PRO B 2 18 ? -3.914  6.072   -2.706  1.00 0.00 ? 215 PRO B N    3  
ATOM 2520  C CA   . PRO B 2 18 ? -2.513  5.705   -2.546  1.00 0.00 ? 215 PRO B CA   3  
ATOM 2521  C C    . PRO B 2 18 ? -1.703  6.805   -1.867  1.00 0.00 ? 215 PRO B C    3  
ATOM 2522  O O    . PRO B 2 18 ? -1.249  7.744   -2.519  1.00 0.00 ? 215 PRO B O    3  
ATOM 2523  C CB   . PRO B 2 18 ? -2.064  5.524   -3.995  1.00 0.00 ? 215 PRO B CB   3  
ATOM 2524  C CG   . PRO B 2 18 ? -2.885  6.502   -4.778  1.00 0.00 ? 215 PRO B CG   3  
ATOM 2525  C CD   . PRO B 2 18 ? -4.136  6.784   -3.974  1.00 0.00 ? 215 PRO B CD   3  
ATOM 2526  H HA   . PRO B 2 18 ? -2.400  4.778   -2.003  1.00 0.00 ? 215 PRO B HA   3  
ATOM 2527  H HB2  . PRO B 2 18 ? -1.008  5.740   -4.078  1.00 0.00 ? 215 PRO B HB2  3  
ATOM 2528  H HG2  . PRO B 2 18 ? -2.325  7.414   -4.923  1.00 0.00 ? 215 PRO B HG2  3  
ATOM 2529  H HD2  . PRO B 2 18 ? -4.240  7.846   -3.803  1.00 0.00 ? 215 PRO B HD2  3  
ATOM 2530  N N    . MET B 2 19 ? -1.524  6.684   -0.555  1.00 0.00 ? 216 MET B N    3  
ATOM 2531  C CA   . MET B 2 19 ? -0.774  7.681   0.199   1.00 0.00 ? 216 MET B CA   3  
ATOM 2532  C C    . MET B 2 19 ? 0.283   7.036   1.088   1.00 0.00 ? 216 MET B C    3  
ATOM 2533  O O    . MET B 2 19 ? -0.035  6.443   2.116   1.00 0.00 ? 216 MET B O    3  
ATOM 2534  C CB   . MET B 2 19 ? -1.728  8.528   1.045   1.00 0.00 ? 216 MET B CB   3  
ATOM 2535  C CG   . MET B 2 19 ? -2.346  7.777   2.216   1.00 0.00 ? 216 MET B CG   3  
ATOM 2536  S SD   . MET B 2 19 ? -4.112  8.102   2.392   1.00 0.00 ? 216 MET B SD   3  
ATOM 2537  C CE   . MET B 2 19 ? -4.758  7.258   0.950   1.00 0.00 ? 216 MET B CE   3  
ATOM 2538  H H    . MET B 2 19 ? -1.905  5.912   -0.086  1.00 0.00 ? 216 MET B H    3  
ATOM 2539  H HA   . MET B 2 19 ? -0.276  8.320   -0.511  1.00 0.00 ? 216 MET B HA   3  
ATOM 2540  H HB2  . MET B 2 19 ? -1.187  9.376   1.436   1.00 0.00 ? 216 MET B HB2  3  
ATOM 2541  H HG2  . MET B 2 19 ? -2.204  6.715   2.067   1.00 0.00 ? 216 MET B HG2  3  
ATOM 2542  H HE1  . MET B 2 19 ? -4.843  6.204   1.160   1.00 0.00 ? 216 MET B HE1  3  
ATOM 2543  H HE2  . MET B 2 19 ? -5.732  7.657   0.706   1.00 0.00 ? 216 MET B HE2  3  
ATOM 2544  H HE3  . MET B 2 19 ? -4.089  7.407   0.115   1.00 0.00 ? 216 MET B HE3  3  
ATOM 2545  N N    . ASP B 2 20 ? 1.546   7.171   0.686   1.00 0.00 ? 217 ASP B N    3  
ATOM 2546  C CA   . ASP B 2 20 ? 2.663   6.608   1.441   1.00 0.00 ? 217 ASP B CA   3  
ATOM 2547  C C    . ASP B 2 20 ? 2.537   6.934   2.928   1.00 0.00 ? 217 ASP B C    3  
ATOM 2548  O O    . ASP B 2 20 ? 2.598   5.993   3.746   1.00 0.00 ? 217 ASP B O    3  
ATOM 2549  C CB   . ASP B 2 20 ? 3.991   7.145   0.896   1.00 0.00 ? 217 ASP B CB   3  
ATOM 2550  C CG   . ASP B 2 20 ? 5.183   6.716   1.732   1.00 0.00 ? 217 ASP B CG   3  
ATOM 2551  O OD1  . ASP B 2 20 ? 5.536   5.519   1.693   1.00 0.00 ? 217 ASP B OD1  3  
ATOM 2552  O OD2  . ASP B 2 20 ? 5.762   7.579   2.426   1.00 0.00 ? 217 ASP B OD2  3  
ATOM 2553  O OXT  . ASP B 2 20 ? 2.381   8.128   3.260   1.00 0.00 ? 217 ASP B OXT  3  
ATOM 2554  H H    . ASP B 2 20 ? 1.731   7.665   -0.140  1.00 0.00 ? 217 ASP B H    3  
ATOM 2555  H HA   . ASP B 2 20 ? 2.641   5.537   1.316   1.00 0.00 ? 217 ASP B HA   3  
ATOM 2556  H HB2  . ASP B 2 20 ? 4.134   6.780   -0.110  1.00 0.00 ? 217 ASP B HB2  3  
ATOM 2557  N N    . GLY A 1 1  ? 1.805   -5.069  -8.245  1.00 0.00 ? 292 GLY A N    4  
ATOM 2558  C CA   . GLY A 1 1  ? 2.031   -6.508  -8.554  1.00 0.00 ? 292 GLY A CA   4  
ATOM 2559  C C    . GLY A 1 1  ? 3.415   -6.977  -8.148  1.00 0.00 ? 292 GLY A C    4  
ATOM 2560  O O    . GLY A 1 1  ? 4.286   -7.153  -9.001  1.00 0.00 ? 292 GLY A O    4  
ATOM 2561  H H1   . GLY A 1 1  ? 0.847   -4.787  -8.534  1.00 0.00 ? 292 GLY A H1   4  
ATOM 2562  H H2   . GLY A 1 1  ? 2.496   -4.482  -8.755  1.00 0.00 ? 292 GLY A H2   4  
ATOM 2563  H H3   . GLY A 1 1  ? 1.912   -4.900  -7.224  1.00 0.00 ? 292 GLY A H3   4  
ATOM 2564  H HA2  . GLY A 1 1  ? 1.293   -7.097  -8.028  1.00 0.00 ? 292 GLY A HA2  4  
ATOM 2565  H HA3  . GLY A 1 1  ? 1.907   -6.660  -9.616  1.00 0.00 ? 292 GLY A HA3  4  
ATOM 2566  N N    . PRO A 1 2  ? 3.649   -7.191  -6.842  1.00 0.00 ? 293 PRO A N    4  
ATOM 2567  C CA   . PRO A 1 2  ? 4.948   -7.643  -6.337  1.00 0.00 ? 293 PRO A CA   4  
ATOM 2568  C C    . PRO A 1 2  ? 5.234   -9.104  -6.677  1.00 0.00 ? 293 PRO A C    4  
ATOM 2569  O O    . PRO A 1 2  ? 6.270   -9.423  -7.262  1.00 0.00 ? 293 PRO A O    4  
ATOM 2570  C CB   . PRO A 1 2  ? 4.831   -7.454  -4.824  1.00 0.00 ? 293 PRO A CB   4  
ATOM 2571  C CG   . PRO A 1 2  ? 3.370   -7.525  -4.534  1.00 0.00 ? 293 PRO A CG   4  
ATOM 2572  C CD   . PRO A 1 2  ? 2.665   -7.005  -5.758  1.00 0.00 ? 293 PRO A CD   4  
ATOM 2573  H HA   . PRO A 1 2  ? 5.751   -7.027  -6.716  1.00 0.00 ? 293 PRO A HA   4  
ATOM 2574  H HB2  . PRO A 1 2  ? 5.372   -8.240  -4.318  1.00 0.00 ? 293 PRO A HB2  4  
ATOM 2575  H HG2  . PRO A 1 2  ? 3.083   -8.547  -4.342  1.00 0.00 ? 293 PRO A HG2  4  
ATOM 2576  H HD2  . PRO A 1 2  ? 1.771   -7.581  -5.950  1.00 0.00 ? 293 PRO A HD2  4  
ATOM 2577  N N    . LEU A 1 3  ? 4.310   -9.987  -6.313  1.00 0.00 ? 294 LEU A N    4  
ATOM 2578  C CA   . LEU A 1 3  ? 4.466   -11.412 -6.584  1.00 0.00 ? 294 LEU A CA   4  
ATOM 2579  C C    . LEU A 1 3  ? 3.265   -11.949 -7.355  1.00 0.00 ? 294 LEU A C    4  
ATOM 2580  O O    . LEU A 1 3  ? 3.417   -12.658 -8.349  1.00 0.00 ? 294 LEU A O    4  
ATOM 2581  C CB   . LEU A 1 3  ? 4.636   -12.189 -5.278  1.00 0.00 ? 294 LEU A CB   4  
ATOM 2582  C CG   . LEU A 1 3  ? 5.765   -11.695 -4.371  1.00 0.00 ? 294 LEU A CG   4  
ATOM 2583  C CD1  . LEU A 1 3  ? 5.267   -10.588 -3.456  1.00 0.00 ? 294 LEU A CD1  4  
ATOM 2584  C CD2  . LEU A 1 3  ? 6.339   -12.844 -3.557  1.00 0.00 ? 294 LEU A CD2  4  
ATOM 2585  H H    . LEU A 1 3  ? 3.503   -9.674  -5.854  1.00 0.00 ? 294 LEU A H    4  
ATOM 2586  H HA   . LEU A 1 3  ? 5.353   -11.539 -7.187  1.00 0.00 ? 294 LEU A HA   4  
ATOM 2587  H HB2  . LEU A 1 3  ? 3.708   -12.133 -4.726  1.00 0.00 ? 294 LEU A HB2  4  
ATOM 2588  H HG   . LEU A 1 3  ? 6.557   -11.290 -4.985  1.00 0.00 ? 294 LEU A HG   4  
ATOM 2589  H HD11 . LEU A 1 3  ? 4.994   -11.007 -2.500  1.00 0.00 ? 294 LEU A HD11 4  
ATOM 2590  H HD12 . LEU A 1 3  ? 6.048   -9.855  -3.320  1.00 0.00 ? 294 LEU A HD12 4  
ATOM 2591  H HD13 . LEU A 1 3  ? 4.404   -10.114 -3.901  1.00 0.00 ? 294 LEU A HD13 4  
ATOM 2592  H HD21 . LEU A 1 3  ? 6.738   -13.595 -4.223  1.00 0.00 ? 294 LEU A HD21 4  
ATOM 2593  H HD22 . LEU A 1 3  ? 7.126   -12.475 -2.918  1.00 0.00 ? 294 LEU A HD22 4  
ATOM 2594  H HD23 . LEU A 1 3  ? 5.559   -13.281 -2.950  1.00 0.00 ? 294 LEU A HD23 4  
ATOM 2595  N N    . GLY A 1 4  ? 2.071   -11.603 -6.888  1.00 0.00 ? 295 GLY A N    4  
ATOM 2596  C CA   . GLY A 1 4  ? 0.859   -12.054 -7.544  1.00 0.00 ? 295 GLY A CA   4  
ATOM 2597  C C    . GLY A 1 4  ? 0.287   -11.006 -8.478  1.00 0.00 ? 295 GLY A C    4  
ATOM 2598  O O    . GLY A 1 4  ? -0.877  -10.625 -8.355  1.00 0.00 ? 295 GLY A O    4  
ATOM 2599  H H    . GLY A 1 4  ? 2.011   -11.037 -6.090  1.00 0.00 ? 295 GLY A H    4  
ATOM 2600  H HA2  . GLY A 1 4  ? 1.079   -12.945 -8.113  1.00 0.00 ? 295 GLY A HA2  4  
ATOM 2601  H HA3  . GLY A 1 4  ? 0.121   -12.292 -6.792  1.00 0.00 ? 295 GLY A HA3  4  
ATOM 2602  N N    . SER A 1 5  ? 1.109   -10.536 -9.413  1.00 0.00 ? 296 SER A N    4  
ATOM 2603  C CA   . SER A 1 5  ? 0.681   -9.525  -10.372 1.00 0.00 ? 296 SER A CA   4  
ATOM 2604  C C    . SER A 1 5  ? -0.639  -9.921  -11.025 1.00 0.00 ? 296 SER A C    4  
ATOM 2605  O O    . SER A 1 5  ? -0.657  -10.615 -12.041 1.00 0.00 ? 296 SER A O    4  
ATOM 2606  C CB   . SER A 1 5  ? 1.754   -9.319  -11.443 1.00 0.00 ? 296 SER A CB   4  
ATOM 2607  O OG   . SER A 1 5  ? 1.290   -8.464  -12.473 1.00 0.00 ? 296 SER A OG   4  
ATOM 2608  H H    . SER A 1 5  ? 2.025   -10.880 -9.458  1.00 0.00 ? 296 SER A H    4  
ATOM 2609  H HA   . SER A 1 5  ? 0.539   -8.599  -9.834  1.00 0.00 ? 296 SER A HA   4  
ATOM 2610  H HB2  . SER A 1 5  ? 2.629   -8.876  -10.993 1.00 0.00 ? 296 SER A HB2  4  
ATOM 2611  H HG   . SER A 1 5  ? 1.902   -8.490  -13.213 1.00 0.00 ? 296 SER A HG   4  
ATOM 2612  N N    . GLY A 1 6  ? -1.741  -9.477  -10.431 1.00 0.00 ? 297 GLY A N    4  
ATOM 2613  C CA   . GLY A 1 6  ? -3.050  -9.795  -10.966 1.00 0.00 ? 297 GLY A CA   4  
ATOM 2614  C C    . GLY A 1 6  ? -4.174  -9.217  -10.127 1.00 0.00 ? 297 GLY A C    4  
ATOM 2615  O O    . GLY A 1 6  ? -3.925  -8.437  -9.207  1.00 0.00 ? 297 GLY A O    4  
ATOM 2616  H H    . GLY A 1 6  ? -1.664  -8.927  -9.624  1.00 0.00 ? 297 GLY A H    4  
ATOM 2617  H HA2  . GLY A 1 6  ? -3.124  -9.401  -11.968 1.00 0.00 ? 297 GLY A HA2  4  
ATOM 2618  H HA3  . GLY A 1 6  ? -3.160  -10.870 -11.003 1.00 0.00 ? 297 GLY A HA3  4  
ATOM 2619  N N    . PRO A 1 7  ? -5.431  -9.586  -10.424 1.00 0.00 ? 298 PRO A N    4  
ATOM 2620  C CA   . PRO A 1 7  ? -6.599  -9.092  -9.685  1.00 0.00 ? 298 PRO A CA   4  
ATOM 2621  C C    . PRO A 1 7  ? -6.462  -9.278  -8.176  1.00 0.00 ? 298 PRO A C    4  
ATOM 2622  O O    . PRO A 1 7  ? -5.390  -9.614  -7.675  1.00 0.00 ? 298 PRO A O    4  
ATOM 2623  C CB   . PRO A 1 7  ? -7.749  -9.945  -10.225 1.00 0.00 ? 298 PRO A CB   4  
ATOM 2624  C CG   . PRO A 1 7  ? -7.307  -10.359 -11.585 1.00 0.00 ? 298 PRO A CG   4  
ATOM 2625  C CD   . PRO A 1 7  ? -5.814  -10.511 -11.507 1.00 0.00 ? 298 PRO A CD   4  
ATOM 2626  H HA   . PRO A 1 7  ? -6.789  -8.052  -9.899  1.00 0.00 ? 298 PRO A HA   4  
ATOM 2627  H HB2  . PRO A 1 7  ? -7.900  -10.799 -9.581  1.00 0.00 ? 298 PRO A HB2  4  
ATOM 2628  H HG2  . PRO A 1 7  ? -7.767  -11.299 -11.851 1.00 0.00 ? 298 PRO A HG2  4  
ATOM 2629  H HD2  . PRO A 1 7  ? -5.551  -11.528 -11.256 1.00 0.00 ? 298 PRO A HD2  4  
ATOM 2630  N N    . LEU A 1 8  ? -7.557  -9.049  -7.459  1.00 0.00 ? 299 LEU A N    4  
ATOM 2631  C CA   . LEU A 1 8  ? -7.570  -9.191  -6.007  1.00 0.00 ? 299 LEU A CA   4  
ATOM 2632  C C    . LEU A 1 8  ? -8.947  -9.636  -5.523  1.00 0.00 ? 299 LEU A C    4  
ATOM 2633  O O    . LEU A 1 8  ? -9.939  -9.487  -6.237  1.00 0.00 ? 299 LEU A O    4  
ATOM 2634  C CB   . LEU A 1 8  ? -7.190  -7.868  -5.337  1.00 0.00 ? 299 LEU A CB   4  
ATOM 2635  C CG   . LEU A 1 8  ? -5.688  -7.596  -5.246  1.00 0.00 ? 299 LEU A CG   4  
ATOM 2636  C CD1  . LEU A 1 8  ? -5.434  -6.221  -4.648  1.00 0.00 ? 299 LEU A CD1  4  
ATOM 2637  C CD2  . LEU A 1 8  ? -5.003  -8.677  -4.422  1.00 0.00 ? 299 LEU A CD2  4  
ATOM 2638  H H    . LEU A 1 8  ? -8.379  -8.774  -7.917  1.00 0.00 ? 299 LEU A H    4  
ATOM 2639  H HA   . LEU A 1 8  ? -6.845  -9.944  -5.738  1.00 0.00 ? 299 LEU A HA   4  
ATOM 2640  H HB2  . LEU A 1 8  ? -7.648  -7.063  -5.893  1.00 0.00 ? 299 LEU A HB2  4  
ATOM 2641  H HG   . LEU A 1 8  ? -5.264  -7.612  -6.239  1.00 0.00 ? 299 LEU A HG   4  
ATOM 2642  H HD11 . LEU A 1 8  ? -5.917  -6.152  -3.685  1.00 0.00 ? 299 LEU A HD11 4  
ATOM 2643  H HD12 . LEU A 1 8  ? -4.372  -6.071  -4.528  1.00 0.00 ? 299 LEU A HD12 4  
ATOM 2644  H HD13 . LEU A 1 8  ? -5.832  -5.464  -5.307  1.00 0.00 ? 299 LEU A HD13 4  
ATOM 2645  H HD21 . LEU A 1 8  ? -4.242  -9.156  -5.019  1.00 0.00 ? 299 LEU A HD21 4  
ATOM 2646  H HD22 . LEU A 1 8  ? -4.550  -8.231  -3.549  1.00 0.00 ? 299 LEU A HD22 4  
ATOM 2647  H HD23 . LEU A 1 8  ? -5.734  -9.411  -4.113  1.00 0.00 ? 299 LEU A HD23 4  
ATOM 2648  N N    . PRO A 1 9  ? -9.028  -10.190 -4.303  1.00 0.00 ? 300 PRO A N    4  
ATOM 2649  C CA   . PRO A 1 9  ? -10.298 -10.648 -3.734  1.00 0.00 ? 300 PRO A CA   4  
ATOM 2650  C C    . PRO A 1 9  ? -11.342 -9.537  -3.715  1.00 0.00 ? 300 PRO A C    4  
ATOM 2651  O O    . PRO A 1 9  ? -11.059 -8.407  -4.112  1.00 0.00 ? 300 PRO A O    4  
ATOM 2652  C CB   . PRO A 1 9  ? -9.927  -11.063 -2.307  1.00 0.00 ? 300 PRO A CB   4  
ATOM 2653  C CG   . PRO A 1 9  ? -8.467  -11.357 -2.363  1.00 0.00 ? 300 PRO A CG   4  
ATOM 2654  C CD   . PRO A 1 9  ? -7.897  -10.413 -3.384  1.00 0.00 ? 300 PRO A CD   4  
ATOM 2655  H HA   . PRO A 1 9  ? -10.688 -11.499 -4.272  1.00 0.00 ? 300 PRO A HA   4  
ATOM 2656  H HB2  . PRO A 1 9  ? -10.142 -10.253 -1.626  1.00 0.00 ? 300 PRO A HB2  4  
ATOM 2657  H HG2  . PRO A 1 9  ? -8.020  -11.181 -1.396  1.00 0.00 ? 300 PRO A HG2  4  
ATOM 2658  H HD2  . PRO A 1 9  ? -7.591  -9.490  -2.915  1.00 0.00 ? 300 PRO A HD2  4  
ATOM 2659  N N    . PRO A 1 10 ? -12.565 -9.842  -3.256  1.00 0.00 ? 301 PRO A N    4  
ATOM 2660  C CA   . PRO A 1 10 ? -13.647 -8.859  -3.192  1.00 0.00 ? 301 PRO A CA   4  
ATOM 2661  C C    . PRO A 1 10 ? -13.510 -7.912  -2.003  1.00 0.00 ? 301 PRO A C    4  
ATOM 2662  O O    . PRO A 1 10 ? -14.440 -7.762  -1.210  1.00 0.00 ? 301 PRO A O    4  
ATOM 2663  C CB   . PRO A 1 10 ? -14.892 -9.729  -3.042  1.00 0.00 ? 301 PRO A CB   4  
ATOM 2664  C CG   . PRO A 1 10 ? -14.415 -10.943 -2.322  1.00 0.00 ? 301 PRO A CG   4  
ATOM 2665  C CD   . PRO A 1 10 ? -12.993 -11.168 -2.769  1.00 0.00 ? 301 PRO A CD   4  
ATOM 2666  H HA   . PRO A 1 10 ? -13.714 -8.284  -4.103  1.00 0.00 ? 301 PRO A HA   4  
ATOM 2667  H HB2  . PRO A 1 10 ? -15.641 -9.198  -2.471  1.00 0.00 ? 301 PRO A HB2  4  
ATOM 2668  H HG2  . PRO A 1 10 ? -14.450 -10.774 -1.256  1.00 0.00 ? 301 PRO A HG2  4  
ATOM 2669  H HD2  . PRO A 1 10 ? -12.384 -11.487 -1.935  1.00 0.00 ? 301 PRO A HD2  4  
ATOM 2670  N N    . GLY A 1 11 ? -12.349 -7.275  -1.884  1.00 0.00 ? 302 GLY A N    4  
ATOM 2671  C CA   . GLY A 1 11 ? -12.124 -6.350  -0.788  1.00 0.00 ? 302 GLY A CA   4  
ATOM 2672  C C    . GLY A 1 11 ? -10.767 -5.675  -0.854  1.00 0.00 ? 302 GLY A C    4  
ATOM 2673  O O    . GLY A 1 11 ? -10.622 -4.520  -0.459  1.00 0.00 ? 302 GLY A O    4  
ATOM 2674  H H    . GLY A 1 11 ? -11.642 -7.434  -2.541  1.00 0.00 ? 302 GLY A H    4  
ATOM 2675  H HA2  . GLY A 1 11 ? -12.891 -5.590  -0.810  1.00 0.00 ? 302 GLY A HA2  4  
ATOM 2676  H HA3  . GLY A 1 11 ? -12.197 -6.891  0.144   1.00 0.00 ? 302 GLY A HA3  4  
ATOM 2677  N N    . TRP A 1 12 ? -9.767  -6.393  -1.354  1.00 0.00 ? 303 TRP A N    4  
ATOM 2678  C CA   . TRP A 1 12 ? -8.420  -5.847  -1.456  1.00 0.00 ? 303 TRP A CA   4  
ATOM 2679  C C    . TRP A 1 12 ? -8.237  -5.035  -2.731  1.00 0.00 ? 303 TRP A C    4  
ATOM 2680  O O    . TRP A 1 12 ? -9.027  -5.133  -3.671  1.00 0.00 ? 303 TRP A O    4  
ATOM 2681  C CB   . TRP A 1 12 ? -7.385  -6.970  -1.421  1.00 0.00 ? 303 TRP A CB   4  
ATOM 2682  C CG   . TRP A 1 12 ? -7.402  -7.746  -0.145  1.00 0.00 ? 303 TRP A CG   4  
ATOM 2683  C CD1  . TRP A 1 12 ? -8.229  -8.784  0.168   1.00 0.00 ? 303 TRP A CD1  4  
ATOM 2684  C CD2  . TRP A 1 12 ? -6.555  -7.548  0.990   1.00 0.00 ? 303 TRP A CD2  4  
ATOM 2685  N NE1  . TRP A 1 12 ? -7.951  -9.242  1.431   1.00 0.00 ? 303 TRP A NE1  4  
ATOM 2686  C CE2  . TRP A 1 12 ? -6.925  -8.500  1.957   1.00 0.00 ? 303 TRP A CE2  4  
ATOM 2687  C CE3  . TRP A 1 12 ? -5.519  -6.657  1.281   1.00 0.00 ? 303 TRP A CE3  4  
ATOM 2688  C CZ2  . TRP A 1 12 ? -6.294  -8.586  3.196   1.00 0.00 ? 303 TRP A CZ2  4  
ATOM 2689  C CZ3  . TRP A 1 12 ? -4.894  -6.742  2.511   1.00 0.00 ? 303 TRP A CZ3  4  
ATOM 2690  C CH2  . TRP A 1 12 ? -5.283  -7.701  3.454   1.00 0.00 ? 303 TRP A CH2  4  
ATOM 2691  H H    . TRP A 1 12 ? -9.935  -7.310  -1.653  1.00 0.00 ? 303 TRP A H    4  
ATOM 2692  H HA   . TRP A 1 12 ? -8.260  -5.199  -0.607  1.00 0.00 ? 303 TRP A HA   4  
ATOM 2693  H HB2  . TRP A 1 12 ? -7.579  -7.656  -2.232  1.00 0.00 ? 303 TRP A HB2  4  
ATOM 2694  H HD1  . TRP A 1 12 ? -8.988  -9.174  -0.492  1.00 0.00 ? 303 TRP A HD1  4  
ATOM 2695  H HE1  . TRP A 1 12 ? -8.412  -9.978  1.881   1.00 0.00 ? 303 TRP A HE1  4  
ATOM 2696  H HE3  . TRP A 1 12 ? -5.207  -5.911  0.565   1.00 0.00 ? 303 TRP A HE3  4  
ATOM 2697  H HZ2  . TRP A 1 12 ? -6.581  -9.320  3.934   1.00 0.00 ? 303 TRP A HZ2  4  
ATOM 2698  H HZ3  . TRP A 1 12 ? -4.093  -6.062  2.754   1.00 0.00 ? 303 TRP A HZ3  4  
ATOM 2699  H HH2  . TRP A 1 12 ? -4.767  -7.730  4.401   1.00 0.00 ? 303 TRP A HH2  4  
ATOM 2700  N N    . GLU A 1 13 ? -7.183  -4.231  -2.746  1.00 0.00 ? 304 GLU A N    4  
ATOM 2701  C CA   . GLU A 1 13 ? -6.854  -3.400  -3.894  1.00 0.00 ? 304 GLU A CA   4  
ATOM 2702  C C    . GLU A 1 13 ? -5.379  -3.042  -3.867  1.00 0.00 ? 304 GLU A C    4  
ATOM 2703  O O    . GLU A 1 13 ? -4.823  -2.745  -2.809  1.00 0.00 ? 304 GLU A O    4  
ATOM 2704  C CB   . GLU A 1 13 ? -7.695  -2.125  -3.905  1.00 0.00 ? 304 GLU A CB   4  
ATOM 2705  C CG   . GLU A 1 13 ? -7.344  -1.187  -5.047  1.00 0.00 ? 304 GLU A CG   4  
ATOM 2706  C CD   . GLU A 1 13 ? -7.708  0.255   -4.749  1.00 0.00 ? 304 GLU A CD   4  
ATOM 2707  O OE1  . GLU A 1 13 ? -7.137  0.827   -3.796  1.00 0.00 ? 304 GLU A OE1  4  
ATOM 2708  O OE2  . GLU A 1 13 ? -8.563  0.813   -5.469  1.00 0.00 ? 304 GLU A OE2  4  
ATOM 2709  H H    . GLU A 1 13 ? -6.603  -4.196  -1.956  1.00 0.00 ? 304 GLU A H    4  
ATOM 2710  H HA   . GLU A 1 13 ? -7.060  -3.969  -4.788  1.00 0.00 ? 304 GLU A HA   4  
ATOM 2711  H HB2  . GLU A 1 13 ? -8.738  -2.394  -3.993  1.00 0.00 ? 304 GLU A HB2  4  
ATOM 2712  H HG2  . GLU A 1 13 ? -6.282  -1.245  -5.228  1.00 0.00 ? 304 GLU A HG2  4  
ATOM 2713  N N    . ILE A 1 14 ? -4.747  -3.062  -5.029  1.00 0.00 ? 305 ILE A N    4  
ATOM 2714  C CA   . ILE A 1 14 ? -3.332  -2.748  -5.120  1.00 0.00 ? 305 ILE A CA   4  
ATOM 2715  C C    . ILE A 1 14 ? -3.095  -1.245  -5.180  1.00 0.00 ? 305 ILE A C    4  
ATOM 2716  O O    . ILE A 1 14 ? -3.976  -0.472  -5.555  1.00 0.00 ? 305 ILE A O    4  
ATOM 2717  C CB   . ILE A 1 14 ? -2.686  -3.417  -6.348  1.00 0.00 ? 305 ILE A CB   4  
ATOM 2718  C CG1  . ILE A 1 14 ? -2.852  -4.936  -6.269  1.00 0.00 ? 305 ILE A CG1  4  
ATOM 2719  C CG2  . ILE A 1 14 ? -1.212  -3.044  -6.444  1.00 0.00 ? 305 ILE A CG2  4  
ATOM 2720  C CD1  . ILE A 1 14 ? -2.061  -5.685  -7.318  1.00 0.00 ? 305 ILE A CD1  4  
ATOM 2721  H H    . ILE A 1 14 ? -5.243  -3.293  -5.842  1.00 0.00 ? 305 ILE A H    4  
ATOM 2722  H HA   . ILE A 1 14 ? -2.852  -3.139  -4.233  1.00 0.00 ? 305 ILE A HA   4  
ATOM 2723  H HB   . ILE A 1 14 ? -3.183  -3.052  -7.233  1.00 0.00 ? 305 ILE A HB   4  
ATOM 2724  H HG12 . ILE A 1 14 ? -2.523  -5.278  -5.300  1.00 0.00 ? 305 ILE A HG12 4  
ATOM 2725  H HG21 . ILE A 1 14 ? -1.122  -1.991  -6.667  1.00 0.00 ? 305 ILE A HG21 4  
ATOM 2726  H HG22 . ILE A 1 14 ? -0.727  -3.255  -5.502  1.00 0.00 ? 305 ILE A HG22 4  
ATOM 2727  H HG23 . ILE A 1 14 ? -0.744  -3.621  -7.227  1.00 0.00 ? 305 ILE A HG23 4  
ATOM 2728  H HD11 . ILE A 1 14 ? -1.050  -5.303  -7.343  1.00 0.00 ? 305 ILE A HD11 4  
ATOM 2729  H HD12 . ILE A 1 14 ? -2.046  -6.737  -7.074  1.00 0.00 ? 305 ILE A HD12 4  
ATOM 2730  H HD13 . ILE A 1 14 ? -2.525  -5.544  -8.283  1.00 0.00 ? 305 ILE A HD13 4  
ATOM 2731  N N    . ARG A 1 15 ? -1.885  -0.851  -4.806  1.00 0.00 ? 306 ARG A N    4  
ATOM 2732  C CA   . ARG A 1 15 ? -1.482  0.547   -4.804  1.00 0.00 ? 306 ARG A CA   4  
ATOM 2733  C C    . ARG A 1 15 ? 0.029   0.642   -4.648  1.00 0.00 ? 306 ARG A C    4  
ATOM 2734  O O    . ARG A 1 15 ? 0.696   -0.367  -4.436  1.00 0.00 ? 306 ARG A O    4  
ATOM 2735  C CB   . ARG A 1 15 ? -2.175  1.301   -3.666  1.00 0.00 ? 306 ARG A CB   4  
ATOM 2736  C CG   . ARG A 1 15 ? -3.627  1.637   -3.959  1.00 0.00 ? 306 ARG A CG   4  
ATOM 2737  C CD   . ARG A 1 15 ? -4.103  2.836   -3.157  1.00 0.00 ? 306 ARG A CD   4  
ATOM 2738  N NE   . ARG A 1 15 ? -5.436  3.268   -3.567  1.00 0.00 ? 306 ARG A NE   4  
ATOM 2739  C CZ   . ARG A 1 15 ? -5.705  3.811   -4.751  1.00 0.00 ? 306 ARG A CZ   4  
ATOM 2740  N NH1  . ARG A 1 15 ? -4.734  4.009   -5.631  1.00 0.00 ? 306 ARG A NH1  4  
ATOM 2741  N NH2  . ARG A 1 15 ? -6.947  4.162   -5.051  1.00 0.00 ? 306 ARG A NH2  4  
ATOM 2742  H H    . ARG A 1 15 ? -1.238  -1.527  -4.518  1.00 0.00 ? 306 ARG A H    4  
ATOM 2743  H HA   . ARG A 1 15 ? -1.770  0.983   -5.749  1.00 0.00 ? 306 ARG A HA   4  
ATOM 2744  H HB2  . ARG A 1 15 ? -2.143  0.691   -2.775  1.00 0.00 ? 306 ARG A HB2  4  
ATOM 2745  H HG2  . ARG A 1 15 ? -3.730  1.857   -5.010  1.00 0.00 ? 306 ARG A HG2  4  
ATOM 2746  H HD2  . ARG A 1 15 ? -4.130  2.566   -2.112  1.00 0.00 ? 306 ARG A HD2  4  
ATOM 2747  H HE   . ARG A 1 15 ? -6.169  3.141   -2.931  1.00 0.00 ? 306 ARG A HE   4  
ATOM 2748  H HH11 . ARG A 1 15 ? -3.795  3.753   -5.407  1.00 0.00 ? 306 ARG A HH11 4  
ATOM 2749  H HH12 . ARG A 1 15 ? -4.941  4.415   -6.521  1.00 0.00 ? 306 ARG A HH12 4  
ATOM 2750  H HH21 . ARG A 1 15 ? -7.681  4.020   -4.387  1.00 0.00 ? 306 ARG A HH21 4  
ATOM 2751  H HH22 . ARG A 1 15 ? -7.151  4.571   -5.940  1.00 0.00 ? 306 ARG A HH22 4  
ATOM 2752  N N    . ASN A 1 16 ? 0.569   1.847   -4.761  1.00 0.00 ? 307 ASN A N    4  
ATOM 2753  C CA   . ASN A 1 16 ? 2.008   2.038   -4.616  1.00 0.00 ? 307 ASN A CA   4  
ATOM 2754  C C    . ASN A 1 16 ? 2.304   3.145   -3.613  1.00 0.00 ? 307 ASN A C    4  
ATOM 2755  O O    . ASN A 1 16 ? 1.516   4.076   -3.451  1.00 0.00 ? 307 ASN A O    4  
ATOM 2756  C CB   . ASN A 1 16 ? 2.661   2.350   -5.967  1.00 0.00 ? 307 ASN A CB   4  
ATOM 2757  C CG   . ASN A 1 16 ? 1.977   1.646   -7.124  1.00 0.00 ? 307 ASN A CG   4  
ATOM 2758  O OD1  . ASN A 1 16 ? 1.055   2.186   -7.737  1.00 0.00 ? 307 ASN A OD1  4  
ATOM 2759  N ND2  . ASN A 1 16 ? 2.426   0.434   -7.429  1.00 0.00 ? 307 ASN A ND2  4  
ATOM 2760  H H    . ASN A 1 16 ? -0.004  2.619   -4.945  1.00 0.00 ? 307 ASN A H    4  
ATOM 2761  H HA   . ASN A 1 16 ? 2.420   1.118   -4.236  1.00 0.00 ? 307 ASN A HA   4  
ATOM 2762  H HB2  . ASN A 1 16 ? 2.624   3.414   -6.143  1.00 0.00 ? 307 ASN A HB2  4  
ATOM 2763  H HD21 . ASN A 1 16 ? 3.164   0.067   -6.898  1.00 0.00 ? 307 ASN A HD21 4  
ATOM 2764  H HD22 . ASN A 1 16 ? 2.003   -0.044  -8.171  1.00 0.00 ? 307 ASN A HD22 4  
ATOM 2765  N N    . THR A 1 17 ? 3.444   3.035   -2.943  1.00 0.00 ? 308 THR A N    4  
ATOM 2766  C CA   . THR A 1 17 ? 3.839   4.021   -1.946  1.00 0.00 ? 308 THR A CA   4  
ATOM 2767  C C    . THR A 1 17 ? 4.635   5.167   -2.571  1.00 0.00 ? 308 THR A C    4  
ATOM 2768  O O    . THR A 1 17 ? 5.628   5.625   -2.004  1.00 0.00 ? 308 THR A O    4  
ATOM 2769  C CB   . THR A 1 17 ? 4.684   3.377   -0.829  1.00 0.00 ? 308 THR A CB   4  
ATOM 2770  O OG1  . THR A 1 17 ? 5.844   2.750   -1.392  1.00 0.00 ? 308 THR A OG1  4  
ATOM 2771  C CG2  . THR A 1 17 ? 3.873   2.345   -0.056  1.00 0.00 ? 308 THR A CG2  4  
ATOM 2772  H H    . THR A 1 17 ? 4.035   2.276   -3.125  1.00 0.00 ? 308 THR A H    4  
ATOM 2773  H HA   . THR A 1 17 ? 2.936   4.418   -1.501  1.00 0.00 ? 308 THR A HA   4  
ATOM 2774  H HB   . THR A 1 17 ? 4.999   4.150   -0.144  1.00 0.00 ? 308 THR A HB   4  
ATOM 2775  H HG1  . THR A 1 17 ? 6.234   3.332   -2.050  1.00 0.00 ? 308 THR A HG1  4  
ATOM 2776  H HG21 . THR A 1 17 ? 4.439   2.006   0.802   1.00 0.00 ? 308 THR A HG21 4  
ATOM 2777  H HG22 . THR A 1 17 ? 3.656   1.503   -0.697  1.00 0.00 ? 308 THR A HG22 4  
ATOM 2778  H HG23 . THR A 1 17 ? 2.948   2.791   0.278   1.00 0.00 ? 308 THR A HG23 4  
ATOM 2779  N N    . ALA A 1 18 ? 4.196   5.628   -3.739  1.00 0.00 ? 309 ALA A N    4  
ATOM 2780  C CA   . ALA A 1 18 ? 4.868   6.722   -4.434  1.00 0.00 ? 309 ALA A CA   4  
ATOM 2781  C C    . ALA A 1 18 ? 6.244   6.304   -4.941  1.00 0.00 ? 309 ALA A C    4  
ATOM 2782  O O    . ALA A 1 18 ? 6.467   6.199   -6.148  1.00 0.00 ? 309 ALA A O    4  
ATOM 2783  C CB   . ALA A 1 18 ? 4.987   7.932   -3.520  1.00 0.00 ? 309 ALA A CB   4  
ATOM 2784  H H    . ALA A 1 18 ? 3.401   5.227   -4.144  1.00 0.00 ? 309 ALA A H    4  
ATOM 2785  H HA   . ALA A 1 18 ? 4.256   7.002   -5.280  1.00 0.00 ? 309 ALA A HA   4  
ATOM 2786  H HB1  . ALA A 1 18 ? 5.651   7.700   -2.701  1.00 0.00 ? 309 ALA A HB1  4  
ATOM 2787  H HB2  . ALA A 1 18 ? 5.381   8.767   -4.079  1.00 0.00 ? 309 ALA A HB2  4  
ATOM 2788  H HB3  . ALA A 1 18 ? 4.011   8.187   -3.133  1.00 0.00 ? 309 ALA A HB3  4  
ATOM 2789  N N    . THR A 1 19 ? 7.168   6.066   -4.014  1.00 0.00 ? 310 THR A N    4  
ATOM 2790  C CA   . THR A 1 19 ? 8.527   5.666   -4.366  1.00 0.00 ? 310 THR A CA   4  
ATOM 2791  C C    . THR A 1 19 ? 8.530   4.559   -5.417  1.00 0.00 ? 310 THR A C    4  
ATOM 2792  O O    . THR A 1 19 ? 9.386   4.533   -6.302  1.00 0.00 ? 310 THR A O    4  
ATOM 2793  C CB   . THR A 1 19 ? 9.310   5.189   -3.128  1.00 0.00 ? 310 THR A CB   4  
ATOM 2794  O OG1  . THR A 1 19 ? 8.467   5.225   -1.971  1.00 0.00 ? 310 THR A OG1  4  
ATOM 2795  C CG2  . THR A 1 19 ? 10.535  6.061   -2.893  1.00 0.00 ? 310 THR A CG2  4  
ATOM 2796  H H    . THR A 1 19 ? 6.929   6.162   -3.068  1.00 0.00 ? 310 THR A H    4  
ATOM 2797  H HA   . THR A 1 19 ? 9.032   6.531   -4.771  1.00 0.00 ? 310 THR A HA   4  
ATOM 2798  H HB   . THR A 1 19 ? 9.638   4.173   -3.294  1.00 0.00 ? 310 THR A HB   4  
ATOM 2799  H HG1  . THR A 1 19 ? 7.805   4.534   -2.035  1.00 0.00 ? 310 THR A HG1  4  
ATOM 2800  H HG21 . THR A 1 19 ? 10.225  7.086   -2.755  1.00 0.00 ? 310 THR A HG21 4  
ATOM 2801  H HG22 . THR A 1 19 ? 11.192  5.997   -3.748  1.00 0.00 ? 310 THR A HG22 4  
ATOM 2802  H HG23 . THR A 1 19 ? 11.056  5.720   -2.011  1.00 0.00 ? 310 THR A HG23 4  
ATOM 2803  N N    . GLY A 1 20 ? 7.570   3.646   -5.314  1.00 0.00 ? 311 GLY A N    4  
ATOM 2804  C CA   . GLY A 1 20 ? 7.484   2.550   -6.263  1.00 0.00 ? 311 GLY A CA   4  
ATOM 2805  C C    . GLY A 1 20 ? 6.905   1.292   -5.645  1.00 0.00 ? 311 GLY A C    4  
ATOM 2806  O O    . GLY A 1 20 ? 6.190   0.540   -6.308  1.00 0.00 ? 311 GLY A O    4  
ATOM 2807  H H    . GLY A 1 20 ? 6.914   3.716   -4.589  1.00 0.00 ? 311 GLY A H    4  
ATOM 2808  H HA2  . GLY A 1 20 ? 6.858   2.853   -7.090  1.00 0.00 ? 311 GLY A HA2  4  
ATOM 2809  H HA3  . GLY A 1 20 ? 8.474   2.332   -6.635  1.00 0.00 ? 311 GLY A HA3  4  
ATOM 2810  N N    . ARG A 1 21 ? 7.217   1.063   -4.373  1.00 0.00 ? 312 ARG A N    4  
ATOM 2811  C CA   . ARG A 1 21 ? 6.718   -0.117  -3.668  1.00 0.00 ? 312 ARG A CA   4  
ATOM 2812  C C    . ARG A 1 21 ? 5.214   -0.215  -3.769  1.00 0.00 ? 312 ARG A C    4  
ATOM 2813  O O    . ARG A 1 21 ? 4.488   0.755   -3.555  1.00 0.00 ? 312 ARG A O    4  
ATOM 2814  C CB   . ARG A 1 21 ? 7.148   -0.112  -2.194  1.00 0.00 ? 312 ARG A CB   4  
ATOM 2815  C CG   . ARG A 1 21 ? 8.102   -1.241  -1.838  1.00 0.00 ? 312 ARG A CG   4  
ATOM 2816  C CD   . ARG A 1 21 ? 8.046   -1.575  -0.353  1.00 0.00 ? 312 ARG A CD   4  
ATOM 2817  N NE   . ARG A 1 21 ? 9.078   -2.535  0.030   1.00 0.00 ? 312 ARG A NE   4  
ATOM 2818  C CZ   . ARG A 1 21 ? 8.961   -3.851  -0.127  1.00 0.00 ? 312 ARG A CZ   4  
ATOM 2819  N NH1  . ARG A 1 21 ? 7.855   -4.366  -0.647  1.00 0.00 ? 312 ARG A NH1  4  
ATOM 2820  N NH2  . ARG A 1 21 ? 9.952   -4.653  0.236   1.00 0.00 ? 312 ARG A NH2  4  
ATOM 2821  H H    . ARG A 1 21 ? 7.793   1.698   -3.903  1.00 0.00 ? 312 ARG A H    4  
ATOM 2822  H HA   . ARG A 1 21 ? 7.129   -0.991  -4.150  1.00 0.00 ? 312 ARG A HA   4  
ATOM 2823  H HB2  . ARG A 1 21 ? 7.633   0.825   -1.969  1.00 0.00 ? 312 ARG A HB2  4  
ATOM 2824  H HG2  . ARG A 1 21 ? 7.831   -2.121  -2.402  1.00 0.00 ? 312 ARG A HG2  4  
ATOM 2825  H HD2  . ARG A 1 21 ? 8.187   -0.667  0.216   1.00 0.00 ? 312 ARG A HD2  4  
ATOM 2826  H HE   . ARG A 1 21 ? 9.904   -2.181  0.422   1.00 0.00 ? 312 ARG A HE   4  
ATOM 2827  H HH11 . ARG A 1 21 ? 7.104   -3.765  -0.921  1.00 0.00 ? 312 ARG A HH11 4  
ATOM 2828  H HH12 . ARG A 1 21 ? 7.770   -5.355  -0.763  1.00 0.00 ? 312 ARG A HH12 4  
ATOM 2829  H HH21 . ARG A 1 21 ? 10.788  -4.269  0.628   1.00 0.00 ? 312 ARG A HH21 4  
ATOM 2830  H HH22 . ARG A 1 21 ? 9.864   -5.642  0.117   1.00 0.00 ? 312 ARG A HH22 4  
ATOM 2831  N N    . VAL A 1 22 ? 4.764   -1.410  -4.098  1.00 0.00 ? 313 VAL A N    4  
ATOM 2832  C CA   . VAL A 1 22 ? 3.355   -1.687  -4.246  1.00 0.00 ? 313 VAL A CA   4  
ATOM 2833  C C    . VAL A 1 22 ? 2.817   -2.412  -3.013  1.00 0.00 ? 313 VAL A C    4  
ATOM 2834  O O    . VAL A 1 22 ? 3.274   -3.500  -2.666  1.00 0.00 ? 313 VAL A O    4  
ATOM 2835  C CB   . VAL A 1 22 ? 3.103   -2.527  -5.518  1.00 0.00 ? 313 VAL A CB   4  
ATOM 2836  C CG1  . VAL A 1 22 ? 4.113   -3.651  -5.612  1.00 0.00 ? 313 VAL A CG1  4  
ATOM 2837  C CG2  . VAL A 1 22 ? 1.693   -3.071  -5.548  1.00 0.00 ? 313 VAL A CG2  4  
ATOM 2838  H H    . VAL A 1 22 ? 5.408   -2.134  -4.243  1.00 0.00 ? 313 VAL A H    4  
ATOM 2839  H HA   . VAL A 1 22 ? 2.839   -0.748  -4.355  1.00 0.00 ? 313 VAL A HA   4  
ATOM 2840  H HB   . VAL A 1 22 ? 3.233   -1.888  -6.379  1.00 0.00 ? 313 VAL A HB   4  
ATOM 2841  H HG11 . VAL A 1 22 ? 4.331   -4.017  -4.619  1.00 0.00 ? 313 VAL A HG11 4  
ATOM 2842  H HG12 . VAL A 1 22 ? 3.709   -4.451  -6.212  1.00 0.00 ? 313 VAL A HG12 4  
ATOM 2843  H HG13 . VAL A 1 22 ? 5.019   -3.281  -6.066  1.00 0.00 ? 313 VAL A HG13 4  
ATOM 2844  H HG21 . VAL A 1 22 ? 1.099   -2.550  -4.815  1.00 0.00 ? 313 VAL A HG21 4  
ATOM 2845  H HG22 . VAL A 1 22 ? 1.272   -2.923  -6.529  1.00 0.00 ? 313 VAL A HG22 4  
ATOM 2846  H HG23 . VAL A 1 22 ? 1.714   -4.124  -5.316  1.00 0.00 ? 313 VAL A HG23 4  
ATOM 2847  N N    . TYR A 1 23 ? 1.844   -1.790  -2.360  1.00 0.00 ? 314 TYR A N    4  
ATOM 2848  C CA   . TYR A 1 23 ? 1.227   -2.364  -1.172  1.00 0.00 ? 314 TYR A CA   4  
ATOM 2849  C C    . TYR A 1 23 ? -0.212  -2.751  -1.457  1.00 0.00 ? 314 TYR A C    4  
ATOM 2850  O O    . TYR A 1 23 ? -0.725  -2.512  -2.550  1.00 0.00 ? 314 TYR A O    4  
ATOM 2851  C CB   . TYR A 1 23 ? 1.272   -1.375  -0.005  1.00 0.00 ? 314 TYR A CB   4  
ATOM 2852  C CG   . TYR A 1 23 ? 0.332   -0.196  -0.153  1.00 0.00 ? 314 TYR A CG   4  
ATOM 2853  C CD1  . TYR A 1 23 ? 0.625   0.846   -1.024  1.00 0.00 ? 314 TYR A CD1  4  
ATOM 2854  C CD2  . TYR A 1 23 ? -0.850  -0.126  0.577   1.00 0.00 ? 314 TYR A CD2  4  
ATOM 2855  C CE1  . TYR A 1 23 ? -0.229  1.923   -1.165  1.00 0.00 ? 314 TYR A CE1  4  
ATOM 2856  C CE2  . TYR A 1 23 ? -1.714  0.945   0.437   1.00 0.00 ? 314 TYR A CE2  4  
ATOM 2857  C CZ   . TYR A 1 23 ? -1.399  1.966   -0.434  1.00 0.00 ? 314 TYR A CZ   4  
ATOM 2858  O OH   . TYR A 1 23 ? -2.258  3.030   -0.574  1.00 0.00 ? 314 TYR A OH   4  
ATOM 2859  H H    . TYR A 1 23 ? 1.531   -0.926  -2.690  1.00 0.00 ? 314 TYR A H    4  
ATOM 2860  H HA   . TYR A 1 23 ? 1.780   -3.251  -0.904  1.00 0.00 ? 314 TYR A HA   4  
ATOM 2861  H HB2  . TYR A 1 23 ? 1.006   -1.894  0.902   1.00 0.00 ? 314 TYR A HB2  4  
ATOM 2862  H HD1  . TYR A 1 23 ? 1.542   0.811   -1.593  1.00 0.00 ? 314 TYR A HD1  4  
ATOM 2863  H HD2  . TYR A 1 23 ? -1.090  -0.924  1.266   1.00 0.00 ? 314 TYR A HD2  4  
ATOM 2864  H HE1  . TYR A 1 23 ? 0.023   2.725   -1.841  1.00 0.00 ? 314 TYR A HE1  4  
ATOM 2865  H HE2  . TYR A 1 23 ? -2.622  0.988   1.018   1.00 0.00 ? 314 TYR A HE2  4  
ATOM 2866  H HH   . TYR A 1 23 ? -2.428  3.419   0.287   1.00 0.00 ? 314 TYR A HH   4  
ATOM 2867  N N    . PHE A 1 24 ? -0.861  -3.354  -0.474  1.00 0.00 ? 315 PHE A N    4  
ATOM 2868  C CA   . PHE A 1 24 ? -2.242  -3.762  -0.634  1.00 0.00 ? 315 PHE A CA   4  
ATOM 2869  C C    . PHE A 1 24 ? -3.143  -3.089  0.389   1.00 0.00 ? 315 PHE A C    4  
ATOM 2870  O O    . PHE A 1 24 ? -2.767  -2.904  1.550   1.00 0.00 ? 315 PHE A O    4  
ATOM 2871  C CB   . PHE A 1 24 ? -2.359  -5.281  -0.541  1.00 0.00 ? 315 PHE A CB   4  
ATOM 2872  C CG   . PHE A 1 24 ? -1.792  -5.988  -1.737  1.00 0.00 ? 315 PHE A CG   4  
ATOM 2873  C CD1  . PHE A 1 24 ? -0.423  -6.025  -1.948  1.00 0.00 ? 315 PHE A CD1  4  
ATOM 2874  C CD2  . PHE A 1 24 ? -2.624  -6.612  -2.650  1.00 0.00 ? 315 PHE A CD2  4  
ATOM 2875  C CE1  . PHE A 1 24 ? 0.106   -6.673  -3.046  1.00 0.00 ? 315 PHE A CE1  4  
ATOM 2876  C CE2  . PHE A 1 24 ? -2.101  -7.262  -3.752  1.00 0.00 ? 315 PHE A CE2  4  
ATOM 2877  C CZ   . PHE A 1 24 ? -0.735  -7.293  -3.950  1.00 0.00 ? 315 PHE A CZ   4  
ATOM 2878  H H    . PHE A 1 24 ? -0.399  -3.536  0.371   1.00 0.00 ? 315 PHE A H    4  
ATOM 2879  H HA   . PHE A 1 24 ? -2.556  -3.448  -1.615  1.00 0.00 ? 315 PHE A HA   4  
ATOM 2880  H HB2  . PHE A 1 24 ? -1.824  -5.624  0.333   1.00 0.00 ? 315 PHE A HB2  4  
ATOM 2881  H HD1  . PHE A 1 24 ? 0.234   -5.540  -1.241  1.00 0.00 ? 315 PHE A HD1  4  
ATOM 2882  H HD2  . PHE A 1 24 ? -3.693  -6.586  -2.495  1.00 0.00 ? 315 PHE A HD2  4  
ATOM 2883  H HE1  . PHE A 1 24 ? 1.174   -6.694  -3.200  1.00 0.00 ? 315 PHE A HE1  4  
ATOM 2884  H HE2  . PHE A 1 24 ? -2.759  -7.747  -4.458  1.00 0.00 ? 315 PHE A HE2  4  
ATOM 2885  H HZ   . PHE A 1 24 ? -0.324  -7.800  -4.811  1.00 0.00 ? 315 PHE A HZ   4  
ATOM 2886  N N    . VAL A 1 25 ? -4.337  -2.726  -0.064  1.00 0.00 ? 316 VAL A N    4  
ATOM 2887  C CA   . VAL A 1 25 ? -5.316  -2.059  0.775   1.00 0.00 ? 316 VAL A CA   4  
ATOM 2888  C C    . VAL A 1 25 ? -6.525  -2.956  1.026   1.00 0.00 ? 316 VAL A C    4  
ATOM 2889  O O    . VAL A 1 25 ? -7.230  -3.337  0.092   1.00 0.00 ? 316 VAL A O    4  
ATOM 2890  C CB   . VAL A 1 25 ? -5.787  -0.748  0.122   1.00 0.00 ? 316 VAL A CB   4  
ATOM 2891  C CG1  . VAL A 1 25 ? -6.652  0.043   1.081   1.00 0.00 ? 316 VAL A CG1  4  
ATOM 2892  C CG2  . VAL A 1 25 ? -4.595  0.079   -0.339  1.00 0.00 ? 316 VAL A CG2  4  
ATOM 2893  H H    . VAL A 1 25 ? -4.565  -2.913  -0.999  1.00 0.00 ? 316 VAL A H    4  
ATOM 2894  H HA   . VAL A 1 25 ? -4.848  -1.822  1.719   1.00 0.00 ? 316 VAL A HA   4  
ATOM 2895  H HB   . VAL A 1 25 ? -6.382  -0.995  -0.744  1.00 0.00 ? 316 VAL A HB   4  
ATOM 2896  H HG11 . VAL A 1 25 ? -7.394  -0.611  1.515   1.00 0.00 ? 316 VAL A HG11 4  
ATOM 2897  H HG12 . VAL A 1 25 ? -6.034  0.458   1.863   1.00 0.00 ? 316 VAL A HG12 4  
ATOM 2898  H HG13 . VAL A 1 25 ? -7.144  0.842   0.546   1.00 0.00 ? 316 VAL A HG13 4  
ATOM 2899  H HG21 . VAL A 1 25 ? -3.698  -0.521  -0.282  1.00 0.00 ? 316 VAL A HG21 4  
ATOM 2900  H HG22 . VAL A 1 25 ? -4.752  0.397   -1.359  1.00 0.00 ? 316 VAL A HG22 4  
ATOM 2901  H HG23 . VAL A 1 25 ? -4.490  0.945   0.297   1.00 0.00 ? 316 VAL A HG23 4  
ATOM 2902  N N    . ASP A 1 26 ? -6.759  -3.288  2.291   1.00 0.00 ? 317 ASP A N    4  
ATOM 2903  C CA   . ASP A 1 26 ? -7.881  -4.143  2.660   1.00 0.00 ? 317 ASP A CA   4  
ATOM 2904  C C    . ASP A 1 26 ? -9.108  -3.310  3.015   1.00 0.00 ? 317 ASP A C    4  
ATOM 2905  O O    . ASP A 1 26 ? -9.099  -2.559  3.991   1.00 0.00 ? 317 ASP A O    4  
ATOM 2906  C CB   . ASP A 1 26 ? -7.504  -5.035  3.842   1.00 0.00 ? 317 ASP A CB   4  
ATOM 2907  C CG   . ASP A 1 26 ? -8.223  -6.369  3.807   1.00 0.00 ? 317 ASP A CG   4  
ATOM 2908  O OD1  . ASP A 1 26 ? -9.021  -6.589  2.871   1.00 0.00 ? 317 ASP A OD1  4  
ATOM 2909  O OD2  . ASP A 1 26 ? -7.988  -7.193  4.716   1.00 0.00 ? 317 ASP A OD2  4  
ATOM 2910  H H    . ASP A 1 26 ? -6.163  -2.951  2.994   1.00 0.00 ? 317 ASP A H    4  
ATOM 2911  H HA   . ASP A 1 26 ? -8.118  -4.767  1.811   1.00 0.00 ? 317 ASP A HA   4  
ATOM 2912  H HB2  . ASP A 1 26 ? -6.440  -5.219  3.824   1.00 0.00 ? 317 ASP A HB2  4  
ATOM 2913  N N    . HIS A 1 27 ? -10.161 -3.453  2.218   1.00 0.00 ? 318 HIS A N    4  
ATOM 2914  C CA   . HIS A 1 27 ? -11.399 -2.718  2.448   1.00 0.00 ? 318 HIS A CA   4  
ATOM 2915  C C    . HIS A 1 27 ? -12.324 -3.468  3.408   1.00 0.00 ? 318 HIS A C    4  
ATOM 2916  O O    . HIS A 1 27 ? -13.344 -2.930  3.841   1.00 0.00 ? 318 HIS A O    4  
ATOM 2917  C CB   . HIS A 1 27 ? -12.109 -2.453  1.120   1.00 0.00 ? 318 HIS A CB   4  
ATOM 2918  C CG   . HIS A 1 27 ? -11.403 -1.432  0.283   1.00 0.00 ? 318 HIS A CG   4  
ATOM 2919  N ND1  . HIS A 1 27 ? -11.392 -0.109  0.641   1.00 0.00 ? 318 HIS A ND1  4  
ATOM 2920  C CD2  . HIS A 1 27 ? -10.680 -1.590  -0.855  1.00 0.00 ? 318 HIS A CD2  4  
ATOM 2921  C CE1  . HIS A 1 27 ? -10.666 0.508   -0.271  1.00 0.00 ? 318 HIS A CE1  4  
ATOM 2922  N NE2  . HIS A 1 27 ? -10.214 -0.347  -1.201  1.00 0.00 ? 318 HIS A NE2  4  
ATOM 2923  H H    . HIS A 1 27 ? -10.104 -4.066  1.455   1.00 0.00 ? 318 HIS A H    4  
ATOM 2924  H HA   . HIS A 1 27 ? -11.140 -1.771  2.895   1.00 0.00 ? 318 HIS A HA   4  
ATOM 2925  H HB2  . HIS A 1 27 ? -12.164 -3.371  0.555   1.00 0.00 ? 318 HIS A HB2  4  
ATOM 2926  H HD2  . HIS A 1 27 ? -10.495 -2.513  -1.384  1.00 0.00 ? 318 HIS A HD2  4  
ATOM 2927  H HE1  . HIS A 1 27 ? -10.448 1.564   -0.259  1.00 0.00 ? 318 HIS A HE1  4  
ATOM 2928  H HE2  . HIS A 1 27 ? -9.833  -0.101  -2.070  1.00 0.00 ? 318 HIS A HE2  4  
ATOM 2929  N N    . ASN A 1 28 ? -11.969 -4.710  3.738   1.00 0.00 ? 319 ASN A N    4  
ATOM 2930  C CA   . ASN A 1 28 ? -12.766 -5.511  4.659   1.00 0.00 ? 319 ASN A CA   4  
ATOM 2931  C C    . ASN A 1 28 ? -12.300 -5.281  6.092   1.00 0.00 ? 319 ASN A C    4  
ATOM 2932  O O    . ASN A 1 28 ? -13.106 -5.020  6.986   1.00 0.00 ? 319 ASN A O    4  
ATOM 2933  C CB   . ASN A 1 28 ? -12.663 -6.998  4.308   1.00 0.00 ? 319 ASN A CB   4  
ATOM 2934  C CG   . ASN A 1 28 ? -12.609 -7.240  2.812   1.00 0.00 ? 319 ASN A CG   4  
ATOM 2935  O OD1  . ASN A 1 28 ? -13.371 -6.650  2.047   1.00 0.00 ? 319 ASN A OD1  4  
ATOM 2936  N ND2  . ASN A 1 28 ? -11.703 -8.115  2.388   1.00 0.00 ? 319 ASN A ND2  4  
ATOM 2937  H H    . ASN A 1 28 ? -11.156 -5.098  3.355   1.00 0.00 ? 319 ASN A H    4  
ATOM 2938  H HA   . ASN A 1 28 ? -13.795 -5.196  4.570   1.00 0.00 ? 319 ASN A HA   4  
ATOM 2939  H HB2  . ASN A 1 28 ? -11.767 -7.404  4.751   1.00 0.00 ? 319 ASN A HB2  4  
ATOM 2940  H HD21 . ASN A 1 28 ? -11.129 -8.546  3.054   1.00 0.00 ? 319 ASN A HD21 4  
ATOM 2941  H HD22 . ASN A 1 28 ? -11.646 -8.292  1.425   1.00 0.00 ? 319 ASN A HD22 4  
ATOM 2942  N N    . ASN A 1 29 ? -10.990 -5.380  6.301   1.00 0.00 ? 320 ASN A N    4  
ATOM 2943  C CA   . ASN A 1 29 ? -10.405 -5.175  7.621   1.00 0.00 ? 320 ASN A CA   4  
ATOM 2944  C C    . ASN A 1 29 ? -10.006 -3.714  7.827   1.00 0.00 ? 320 ASN A C    4  
ATOM 2945  O O    . ASN A 1 29 ? -9.728  -3.294  8.950   1.00 0.00 ? 320 ASN A O    4  
ATOM 2946  C CB   . ASN A 1 29 ? -9.180  -6.073  7.809   1.00 0.00 ? 320 ASN A CB   4  
ATOM 2947  C CG   . ASN A 1 29 ? -9.534  -7.545  7.798   1.00 0.00 ? 320 ASN A CG   4  
ATOM 2948  O OD1  . ASN A 1 29 ? -9.952  -8.104  8.812   1.00 0.00 ? 320 ASN A OD1  4  
ATOM 2949  N ND2  . ASN A 1 29 ? -9.367  -8.181  6.647   1.00 0.00 ? 320 ASN A ND2  4  
ATOM 2950  H H    . ASN A 1 29 ? -10.403 -5.597  5.547   1.00 0.00 ? 320 ASN A H    4  
ATOM 2951  H HA   . ASN A 1 29 ? -11.149 -5.439  8.357   1.00 0.00 ? 320 ASN A HA   4  
ATOM 2952  H HB2  . ASN A 1 29 ? -8.478  -5.888  7.009   1.00 0.00 ? 320 ASN A HB2  4  
ATOM 2953  H HD21 . ASN A 1 29 ? -9.029  -7.672  5.881   1.00 0.00 ? 320 ASN A HD21 4  
ATOM 2954  H HD22 . ASN A 1 29 ? -9.585  -9.133  6.609   1.00 0.00 ? 320 ASN A HD22 4  
ATOM 2955  N N    . ARG A 1 30 ? -9.976  -2.943  6.741   1.00 0.00 ? 321 ARG A N    4  
ATOM 2956  C CA   . ARG A 1 30 ? -9.609  -1.537  6.818   1.00 0.00 ? 321 ARG A CA   4  
ATOM 2957  C C    . ARG A 1 30 ? -8.166  -1.384  7.274   1.00 0.00 ? 321 ARG A C    4  
ATOM 2958  O O    . ARG A 1 30 ? -7.886  -0.752  8.293   1.00 0.00 ? 321 ARG A O    4  
ATOM 2959  C CB   . ARG A 1 30 ? -10.543 -0.801  7.775   1.00 0.00 ? 321 ARG A CB   4  
ATOM 2960  C CG   . ARG A 1 30 ? -12.002 -0.868  7.357   1.00 0.00 ? 321 ARG A CG   4  
ATOM 2961  C CD   . ARG A 1 30 ? -12.841 -1.614  8.381   1.00 0.00 ? 321 ARG A CD   4  
ATOM 2962  N NE   . ARG A 1 30 ? -13.278 -0.744  9.470   1.00 0.00 ? 321 ARG A NE   4  
ATOM 2963  C CZ   . ARG A 1 30 ? -14.120 0.271   9.308   1.00 0.00 ? 321 ARG A CZ   4  
ATOM 2964  N NH1  . ARG A 1 30 ? -14.607 0.546   8.106   1.00 0.00 ? 321 ARG A NH1  4  
ATOM 2965  N NH2  . ARG A 1 30 ? -14.474 1.014   10.347  1.00 0.00 ? 321 ARG A NH2  4  
ATOM 2966  H H    . ARG A 1 30 ? -10.205 -3.326  5.870   1.00 0.00 ? 321 ARG A H    4  
ATOM 2967  H HA   . ARG A 1 30 ? -9.710  -1.111  5.831   1.00 0.00 ? 321 ARG A HA   4  
ATOM 2968  H HB2  . ARG A 1 30 ? -10.448 -1.238  8.758   1.00 0.00 ? 321 ARG A HB2  4  
ATOM 2969  H HG2  . ARG A 1 30 ? -12.384 0.136   7.252   1.00 0.00 ? 321 ARG A HG2  4  
ATOM 2970  H HD2  . ARG A 1 30 ? -13.711 -2.021  7.888   1.00 0.00 ? 321 ARG A HD2  4  
ATOM 2971  H HE   . ARG A 1 30 ? -12.928 -0.929  10.367  1.00 0.00 ? 321 ARG A HE   4  
ATOM 2972  H HH11 . ARG A 1 30 ? -14.344 -0.013  7.319   1.00 0.00 ? 321 ARG A HH11 4  
ATOM 2973  H HH12 . ARG A 1 30 ? -15.240 1.310   7.986   1.00 0.00 ? 321 ARG A HH12 4  
ATOM 2974  H HH21 . ARG A 1 30 ? -14.109 0.810   11.256  1.00 0.00 ? 321 ARG A HH21 4  
ATOM 2975  H HH22 . ARG A 1 30 ? -15.105 1.780   10.222  1.00 0.00 ? 321 ARG A HH22 4  
ATOM 2976  N N    . THR A 1 31 ? -7.252  -1.971  6.510   1.00 0.00 ? 322 THR A N    4  
ATOM 2977  C CA   . THR A 1 31 ? -5.835  -1.906  6.833   1.00 0.00 ? 322 THR A CA   4  
ATOM 2978  C C    . THR A 1 31 ? -4.981  -1.970  5.574   1.00 0.00 ? 322 THR A C    4  
ATOM 2979  O O    . THR A 1 31 ? -5.474  -1.766  4.464   1.00 0.00 ? 322 THR A O    4  
ATOM 2980  C CB   . THR A 1 31 ? -5.421  -3.046  7.784   1.00 0.00 ? 322 THR A CB   4  
ATOM 2981  O OG1  . THR A 1 31 ? -4.061  -2.872  8.197   1.00 0.00 ? 322 THR A OG1  4  
ATOM 2982  C CG2  . THR A 1 31 ? -5.579  -4.400  7.109   1.00 0.00 ? 322 THR A CG2  4  
ATOM 2983  H H    . THR A 1 31 ? -7.539  -2.457  5.709   1.00 0.00 ? 322 THR A H    4  
ATOM 2984  H HA   . THR A 1 31 ? -5.647  -0.967  7.330   1.00 0.00 ? 322 THR A HA   4  
ATOM 2985  H HB   . THR A 1 31 ? -6.060  -3.018  8.655   1.00 0.00 ? 322 THR A HB   4  
ATOM 2986  H HG1  . THR A 1 31 ? -3.979  -3.083  9.129   1.00 0.00 ? 322 THR A HG1  4  
ATOM 2987  H HG21 . THR A 1 31 ? -6.629  -4.639  7.025   1.00 0.00 ? 322 THR A HG21 4  
ATOM 2988  H HG22 . THR A 1 31 ? -5.084  -5.156  7.698   1.00 0.00 ? 322 THR A HG22 4  
ATOM 2989  H HG23 . THR A 1 31 ? -5.139  -4.365  6.123   1.00 0.00 ? 322 THR A HG23 4  
ATOM 2990  N N    . THR A 1 32 ? -3.699  -2.256  5.753   1.00 0.00 ? 323 THR A N    4  
ATOM 2991  C CA   . THR A 1 32 ? -2.772  -2.340  4.636   1.00 0.00 ? 323 THR A CA   4  
ATOM 2992  C C    . THR A 1 32 ? -1.752  -3.447  4.861   1.00 0.00 ? 323 THR A C    4  
ATOM 2993  O O    . THR A 1 32 ? -1.747  -4.094  5.909   1.00 0.00 ? 323 THR A O    4  
ATOM 2994  C CB   . THR A 1 32 ? -2.014  -1.018  4.440   1.00 0.00 ? 323 THR A CB   4  
ATOM 2995  O OG1  . THR A 1 32 ? -1.563  -0.534  5.710   1.00 0.00 ? 323 THR A OG1  4  
ATOM 2996  C CG2  . THR A 1 32 ? -2.902  0.026   3.775   1.00 0.00 ? 323 THR A CG2  4  
ATOM 2997  H H    . THR A 1 32 ? -3.367  -2.417  6.661   1.00 0.00 ? 323 THR A H    4  
ATOM 2998  H HA   . THR A 1 32 ? -3.339  -2.547  3.742   1.00 0.00 ? 323 THR A HA   4  
ATOM 2999  H HB   . THR A 1 32 ? -1.154  -1.202  3.807   1.00 0.00 ? 323 THR A HB   4  
ATOM 3000  H HG1  . THR A 1 32 ? -1.264  -1.272  6.248   1.00 0.00 ? 323 THR A HG1  4  
ATOM 3001  H HG21 . THR A 1 32 ? -2.680  1.002   4.184   1.00 0.00 ? 323 THR A HG21 4  
ATOM 3002  H HG22 . THR A 1 32 ? -3.938  -0.213  3.958   1.00 0.00 ? 323 THR A HG22 4  
ATOM 3003  H HG23 . THR A 1 32 ? -2.715  0.029   2.710   1.00 0.00 ? 323 THR A HG23 4  
ATOM 3004  N N    . GLN A 1 33 ? -0.889  -3.661  3.877   1.00 0.00 ? 324 GLN A N    4  
ATOM 3005  C CA   . GLN A 1 33 ? 0.146   -4.682  3.991   1.00 0.00 ? 324 GLN A CA   4  
ATOM 3006  C C    . GLN A 1 33 ? 0.924   -4.834  2.690   1.00 0.00 ? 324 GLN A C    4  
ATOM 3007  O O    . GLN A 1 33 ? 0.350   -4.784  1.603   1.00 0.00 ? 324 GLN A O    4  
ATOM 3008  C CB   . GLN A 1 33 ? -0.464  -6.030  4.392   1.00 0.00 ? 324 GLN A CB   4  
ATOM 3009  C CG   . GLN A 1 33 ? -1.887  -6.238  3.898   1.00 0.00 ? 324 GLN A CG   4  
ATOM 3010  C CD   . GLN A 1 33 ? -2.277  -7.704  3.845   1.00 0.00 ? 324 GLN A CD   4  
ATOM 3011  O OE1  . GLN A 1 33 ? -2.699  -8.283  4.846   1.00 0.00 ? 324 GLN A OE1  4  
ATOM 3012  N NE2  . GLN A 1 33 ? -2.135  -8.313  2.672   1.00 0.00 ? 324 GLN A NE2  4  
ATOM 3013  H H    . GLN A 1 33 ? -0.956  -3.132  3.053   1.00 0.00 ? 324 GLN A H    4  
ATOM 3014  H HA   . GLN A 1 33 ? 0.830   -4.368  4.766   1.00 0.00 ? 324 GLN A HA   4  
ATOM 3015  H HB2  . GLN A 1 33 ? 0.149   -6.821  3.988   1.00 0.00 ? 324 GLN A HB2  4  
ATOM 3016  H HG2  . GLN A 1 33 ? -2.564  -5.726  4.564   1.00 0.00 ? 324 GLN A HG2  4  
ATOM 3017  H HE21 . GLN A 1 33 ? -1.793  -7.790  1.918   1.00 0.00 ? 324 GLN A HE21 4  
ATOM 3018  H HE22 . GLN A 1 33 ? -2.381  -9.260  2.610   1.00 0.00 ? 324 GLN A HE22 4  
ATOM 3019  N N    . PHE A 1 34 ? 2.234   -5.023  2.813   1.00 0.00 ? 325 PHE A N    4  
ATOM 3020  C CA   . PHE A 1 34 ? 3.100   -5.205  1.651   1.00 0.00 ? 325 PHE A CA   4  
ATOM 3021  C C    . PHE A 1 34 ? 3.050   -6.654  1.182   1.00 0.00 ? 325 PHE A C    4  
ATOM 3022  O O    . PHE A 1 34 ? 4.086   -7.300  1.026   1.00 0.00 ? 325 PHE A O    4  
ATOM 3023  C CB   . PHE A 1 34 ? 4.546   -4.841  1.999   1.00 0.00 ? 325 PHE A CB   4  
ATOM 3024  C CG   . PHE A 1 34 ? 4.866   -3.366  1.959   1.00 0.00 ? 325 PHE A CG   4  
ATOM 3025  C CD1  . PHE A 1 34 ? 3.902   -2.415  1.641   1.00 0.00 ? 325 PHE A CD1  4  
ATOM 3026  C CD2  . PHE A 1 34 ? 6.153   -2.934  2.235   1.00 0.00 ? 325 PHE A CD2  4  
ATOM 3027  C CE1  . PHE A 1 34 ? 4.222   -1.068  1.604   1.00 0.00 ? 325 PHE A CE1  4  
ATOM 3028  C CE2  . PHE A 1 34 ? 6.474   -1.594  2.196   1.00 0.00 ? 325 PHE A CE2  4  
ATOM 3029  C CZ   . PHE A 1 34 ? 5.508   -0.660  1.881   1.00 0.00 ? 325 PHE A CZ   4  
ATOM 3030  H H    . PHE A 1 34 ? 2.631   -5.042  3.709   1.00 0.00 ? 325 PHE A H    4  
ATOM 3031  H HA   . PHE A 1 34 ? 2.747   -4.564  0.859   1.00 0.00 ? 325 PHE A HA   4  
ATOM 3032  H HB2  . PHE A 1 34 ? 4.763   -5.199  2.994   1.00 0.00 ? 325 PHE A HB2  4  
ATOM 3033  H HD1  . PHE A 1 34 ? 2.893   -2.731  1.427   1.00 0.00 ? 325 PHE A HD1  4  
ATOM 3034  H HD2  . PHE A 1 34 ? 6.912   -3.659  2.485   1.00 0.00 ? 325 PHE A HD2  4  
ATOM 3035  H HE1  . PHE A 1 34 ? 3.466   -0.333  1.363   1.00 0.00 ? 325 PHE A HE1  4  
ATOM 3036  H HE2  . PHE A 1 34 ? 7.480   -1.276  2.416   1.00 0.00 ? 325 PHE A HE2  4  
ATOM 3037  H HZ   . PHE A 1 34 ? 5.761   0.389   1.850   1.00 0.00 ? 325 PHE A HZ   4  
ATOM 3038  N N    . THR A 1 35 ? 1.845   -7.162  0.958   1.00 0.00 ? 326 THR A N    4  
ATOM 3039  C CA   . THR A 1 35 ? 1.670   -8.537  0.526   1.00 0.00 ? 326 THR A CA   4  
ATOM 3040  C C    . THR A 1 35 ? 0.419   -8.693  -0.325  1.00 0.00 ? 326 THR A C    4  
ATOM 3041  O O    . THR A 1 35 ? -0.569  -7.986  -0.131  1.00 0.00 ? 326 THR A O    4  
ATOM 3042  C CB   . THR A 1 35 ? 1.568   -9.485  1.731   1.00 0.00 ? 326 THR A CB   4  
ATOM 3043  O OG1  . THR A 1 35 ? 1.984   -8.812  2.924   1.00 0.00 ? 326 THR A OG1  4  
ATOM 3044  C CG2  . THR A 1 35 ? 2.427   -10.716 1.514   1.00 0.00 ? 326 THR A CG2  4  
ATOM 3045  H H    . THR A 1 35 ? 1.055   -6.598  1.081   1.00 0.00 ? 326 THR A H    4  
ATOM 3046  H HA   . THR A 1 35 ? 2.533   -8.819  -0.059  1.00 0.00 ? 326 THR A HA   4  
ATOM 3047  H HB   . THR A 1 35 ? 0.539   -9.797  1.842   1.00 0.00 ? 326 THR A HB   4  
ATOM 3048  H HG1  . THR A 1 35 ? 1.851   -9.387  3.681   1.00 0.00 ? 326 THR A HG1  4  
ATOM 3049  H HG21 . THR A 1 35 ? 2.297   -11.395 2.343   1.00 0.00 ? 326 THR A HG21 4  
ATOM 3050  H HG22 . THR A 1 35 ? 3.464   -10.422 1.447   1.00 0.00 ? 326 THR A HG22 4  
ATOM 3051  H HG23 . THR A 1 35 ? 2.127   -11.204 0.599   1.00 0.00 ? 326 THR A HG23 4  
ATOM 3052  N N    . ASP A 1 36 ? 0.467   -9.626  -1.265  1.00 0.00 ? 327 ASP A N    4  
ATOM 3053  C CA   . ASP A 1 36 ? -0.668  -9.878  -2.135  1.00 0.00 ? 327 ASP A CA   4  
ATOM 3054  C C    . ASP A 1 36 ? -1.495  -11.037 -1.586  1.00 0.00 ? 327 ASP A C    4  
ATOM 3055  O O    . ASP A 1 36 ? -1.050  -12.184 -1.617  1.00 0.00 ? 327 ASP A O    4  
ATOM 3056  C CB   . ASP A 1 36 ? -0.192  -10.202 -3.553  1.00 0.00 ? 327 ASP A CB   4  
ATOM 3057  C CG   . ASP A 1 36 ? -1.327  -10.200 -4.559  1.00 0.00 ? 327 ASP A CG   4  
ATOM 3058  O OD1  . ASP A 1 36 ? -2.499  -10.141 -4.132  1.00 0.00 ? 327 ASP A OD1  4  
ATOM 3059  O OD2  . ASP A 1 36 ? -1.043  -10.258 -5.774  1.00 0.00 ? 327 ASP A OD2  4  
ATOM 3060  H H    . ASP A 1 36 ? 1.281   -10.162 -1.374  1.00 0.00 ? 327 ASP A H    4  
ATOM 3061  H HA   . ASP A 1 36 ? -1.269  -8.987  -2.158  1.00 0.00 ? 327 ASP A HA   4  
ATOM 3062  H HB2  . ASP A 1 36 ? 0.536   -9.465  -3.859  1.00 0.00 ? 327 ASP A HB2  4  
ATOM 3063  N N    . PRO A 1 37 ? -2.710  -10.765 -1.075  1.00 0.00 ? 328 PRO A N    4  
ATOM 3064  C CA   . PRO A 1 37 ? -3.567  -11.810 -0.521  1.00 0.00 ? 328 PRO A CA   4  
ATOM 3065  C C    . PRO A 1 37 ? -3.691  -12.984 -1.477  1.00 0.00 ? 328 PRO A C    4  
ATOM 3066  O O    . PRO A 1 37 ? -3.960  -14.112 -1.065  1.00 0.00 ? 328 PRO A O    4  
ATOM 3067  C CB   . PRO A 1 37 ? -4.925  -11.121 -0.328  1.00 0.00 ? 328 PRO A CB   4  
ATOM 3068  C CG   . PRO A 1 37 ? -4.814  -9.815  -1.038  1.00 0.00 ? 328 PRO A CG   4  
ATOM 3069  C CD   . PRO A 1 37 ? -3.358  -9.450  -1.015  1.00 0.00 ? 328 PRO A CD   4  
ATOM 3070  H HA   . PRO A 1 37 ? -3.197  -12.159 0.433   1.00 0.00 ? 328 PRO A HA   4  
ATOM 3071  H HB2  . PRO A 1 37 ? -5.705  -11.736 -0.756  1.00 0.00 ? 328 PRO A HB2  4  
ATOM 3072  H HG2  . PRO A 1 37 ? -5.157  -9.920  -2.057  1.00 0.00 ? 328 PRO A HG2  4  
ATOM 3073  H HD2  . PRO A 1 37 ? -3.113  -8.849  -1.875  1.00 0.00 ? 328 PRO A HD2  4  
ATOM 3074  N N    . ARG A 1 38 ? -3.492  -12.706 -2.761  1.00 0.00 ? 329 ARG A N    4  
ATOM 3075  C CA   . ARG A 1 38 ? -3.566  -13.736 -3.780  1.00 0.00 ? 329 ARG A CA   4  
ATOM 3076  C C    . ARG A 1 38 ? -2.467  -14.772 -3.561  1.00 0.00 ? 329 ARG A C    4  
ATOM 3077  O O    . ARG A 1 38 ? -2.625  -15.945 -3.899  1.00 0.00 ? 329 ARG A O    4  
ATOM 3078  C CB   . ARG A 1 38 ? -3.427  -13.122 -5.176  1.00 0.00 ? 329 ARG A CB   4  
ATOM 3079  C CG   . ARG A 1 38 ? -4.634  -12.305 -5.607  1.00 0.00 ? 329 ARG A CG   4  
ATOM 3080  C CD   . ARG A 1 38 ? -4.893  -12.441 -7.100  1.00 0.00 ? 329 ARG A CD   4  
ATOM 3081  N NE   . ARG A 1 38 ? -5.296  -13.797 -7.463  1.00 0.00 ? 329 ARG A NE   4  
ATOM 3082  C CZ   . ARG A 1 38 ? -5.600  -14.166 -8.703  1.00 0.00 ? 329 ARG A CZ   4  
ATOM 3083  N NH1  . ARG A 1 38 ? -5.542  -13.286 -9.692  1.00 0.00 ? 329 ARG A NH1  4  
ATOM 3084  N NH2  . ARG A 1 38 ? -5.961  -15.417 -8.955  1.00 0.00 ? 329 ARG A NH2  4  
ATOM 3085  H H    . ARG A 1 38 ? -3.296  -11.784 -3.029  1.00 0.00 ? 329 ARG A H    4  
ATOM 3086  H HA   . ARG A 1 38 ? -4.528  -14.215 -3.695  1.00 0.00 ? 329 ARG A HA   4  
ATOM 3087  H HB2  . ARG A 1 38 ? -2.561  -12.477 -5.189  1.00 0.00 ? 329 ARG A HB2  4  
ATOM 3088  H HG2  . ARG A 1 38 ? -5.503  -12.651 -5.068  1.00 0.00 ? 329 ARG A HG2  4  
ATOM 3089  H HD2  . ARG A 1 38 ? -5.679  -11.755 -7.380  1.00 0.00 ? 329 ARG A HD2  4  
ATOM 3090  H HE   . ARG A 1 38 ? -5.343  -14.463 -6.747  1.00 0.00 ? 329 ARG A HE   4  
ATOM 3091  H HH11 . ARG A 1 38 ? -5.269  -12.342 -9.506  1.00 0.00 ? 329 ARG A HH11 4  
ATOM 3092  H HH12 . ARG A 1 38 ? -5.772  -13.566 -10.624 1.00 0.00 ? 329 ARG A HH12 4  
ATOM 3093  H HH21 . ARG A 1 38 ? -6.006  -16.083 -8.211  1.00 0.00 ? 329 ARG A HH21 4  
ATOM 3094  H HH22 . ARG A 1 38 ? -6.188  -15.693 -9.888  1.00 0.00 ? 329 ARG A HH22 4  
ATOM 3095  N N    . LEU A 1 39 ? -1.354  -14.321 -2.988  1.00 0.00 ? 330 LEU A N    4  
ATOM 3096  C CA   . LEU A 1 39 ? -0.221  -15.196 -2.720  1.00 0.00 ? 330 LEU A CA   4  
ATOM 3097  C C    . LEU A 1 39 ? -0.614  -16.313 -1.759  1.00 0.00 ? 330 LEU A C    4  
ATOM 3098  O O    . LEU A 1 39 ? -0.539  -17.495 -2.099  1.00 0.00 ? 330 LEU A O    4  
ATOM 3099  C CB   . LEU A 1 39 ? 0.944   -14.392 -2.138  1.00 0.00 ? 330 LEU A CB   4  
ATOM 3100  C CG   . LEU A 1 39 ? 1.787   -13.638 -3.168  1.00 0.00 ? 330 LEU A CG   4  
ATOM 3101  C CD1  . LEU A 1 39 ? 2.704   -12.639 -2.480  1.00 0.00 ? 330 LEU A CD1  4  
ATOM 3102  C CD2  . LEU A 1 39 ? 2.595   -14.614 -4.010  1.00 0.00 ? 330 LEU A CD2  4  
ATOM 3103  H H    . LEU A 1 39 ? -1.295  -13.376 -2.740  1.00 0.00 ? 330 LEU A H    4  
ATOM 3104  H HA   . LEU A 1 39 ? 0.089   -15.632 -3.656  1.00 0.00 ? 330 LEU A HA   4  
ATOM 3105  H HB2  . LEU A 1 39 ? 0.544   -13.675 -1.436  1.00 0.00 ? 330 LEU A HB2  4  
ATOM 3106  H HG   . LEU A 1 39 ? 1.130   -13.089 -3.827  1.00 0.00 ? 330 LEU A HG   4  
ATOM 3107  H HD11 . LEU A 1 39 ? 3.699   -13.053 -2.410  1.00 0.00 ? 330 LEU A HD11 4  
ATOM 3108  H HD12 . LEU A 1 39 ? 2.734   -11.724 -3.054  1.00 0.00 ? 330 LEU A HD12 4  
ATOM 3109  H HD13 . LEU A 1 39 ? 2.331   -12.430 -1.489  1.00 0.00 ? 330 LEU A HD13 4  
ATOM 3110  H HD21 . LEU A 1 39 ? 2.671   -15.559 -3.494  1.00 0.00 ? 330 LEU A HD21 4  
ATOM 3111  H HD22 . LEU A 1 39 ? 2.105   -14.761 -4.961  1.00 0.00 ? 330 LEU A HD22 4  
ATOM 3112  H HD23 . LEU A 1 39 ? 3.585   -14.213 -4.175  1.00 0.00 ? 330 LEU A HD23 4  
ATOM 3113  N N    . SER A 1 40 ? -1.034  -15.931 -0.558  1.00 0.00 ? 331 SER A N    4  
ATOM 3114  C CA   . SER A 1 40 ? -1.441  -16.898 0.454   1.00 0.00 ? 331 SER A CA   4  
ATOM 3115  C C    . SER A 1 40 ? -2.548  -16.326 1.333   1.00 0.00 ? 331 SER A C    4  
ATOM 3116  O O    . SER A 1 40 ? -2.349  -15.331 2.030   1.00 0.00 ? 331 SER A O    4  
ATOM 3117  C CB   . SER A 1 40 ? -0.244  -17.299 1.319   1.00 0.00 ? 331 SER A CB   4  
ATOM 3118  O OG   . SER A 1 40 ? 0.906   -16.545 0.980   1.00 0.00 ? 331 SER A OG   4  
ATOM 3119  H H    . SER A 1 40 ? -1.073  -14.975 -0.348  1.00 0.00 ? 331 SER A H    4  
ATOM 3120  H HA   . SER A 1 40 ? -1.817  -17.773 -0.054  1.00 0.00 ? 331 SER A HA   4  
ATOM 3121  H HB2  . SER A 1 40 ? -0.480  -17.125 2.358   1.00 0.00 ? 331 SER A HB2  4  
ATOM 3122  H HG   . SER A 1 40 ? 1.223   -16.814 0.115   1.00 0.00 ? 331 SER A HG   4  
ATOM 3123  N N    . ALA A 1 41 ? -3.713  -16.961 1.295   1.00 0.00 ? 332 ALA A N    4  
ATOM 3124  C CA   . ALA A 1 41 ? -4.851  -16.513 2.087   1.00 0.00 ? 332 ALA A CA   4  
ATOM 3125  C C    . ALA A 1 41 ? -5.579  -17.696 2.717   1.00 0.00 ? 332 ALA A C    4  
ATOM 3126  O O    . ALA A 1 41 ? -5.157  -18.844 2.573   1.00 0.00 ? 332 ALA A O    4  
ATOM 3127  C CB   . ALA A 1 41 ? -5.809  -15.700 1.225   1.00 0.00 ? 332 ALA A CB   4  
ATOM 3128  H H    . ALA A 1 41 ? -3.811  -17.749 0.721   1.00 0.00 ? 332 ALA A H    4  
ATOM 3129  H HA   . ALA A 1 41 ? -4.477  -15.874 2.876   1.00 0.00 ? 332 ALA A HA   4  
ATOM 3130  H HB1  . ALA A 1 41 ? -5.296  -14.834 0.833   1.00 0.00 ? 332 ALA A HB1  4  
ATOM 3131  H HB2  . ALA A 1 41 ? -6.160  -16.310 0.406   1.00 0.00 ? 332 ALA A HB2  4  
ATOM 3132  H HB3  . ALA A 1 41 ? -6.651  -15.381 1.821   1.00 0.00 ? 332 ALA A HB3  4  
ATOM 3133  N N    . ASN A 1 42 ? -6.672  -17.409 3.414   1.00 0.00 ? 333 ASN A N    4  
ATOM 3134  C CA   . ASN A 1 42 ? -7.458  -18.449 4.067   1.00 0.00 ? 333 ASN A CA   4  
ATOM 3135  C C    . ASN A 1 42 ? -8.638  -18.868 3.197   1.00 0.00 ? 333 ASN A C    4  
ATOM 3136  O O    . ASN A 1 42 ? -9.434  -19.717 3.650   1.00 0.00 ? 333 ASN A O    4  
ATOM 3137  C CB   . ASN A 1 42 ? -7.958  -17.959 5.427   1.00 0.00 ? 333 ASN A CB   4  
ATOM 3138  C CG   . ASN A 1 42 ? -7.172  -18.552 6.580   1.00 0.00 ? 333 ASN A CG   4  
ATOM 3139  O OD1  . ASN A 1 42 ? -7.290  -19.739 6.882   1.00 0.00 ? 333 ASN A OD1  4  
ATOM 3140  N ND2  . ASN A 1 42 ? -6.362  -17.725 7.231   1.00 0.00 ? 333 ASN A ND2  4  
ATOM 3141  O OXT  . ASN A 1 42 ? -8.756  -18.343 2.069   1.00 0.00 ? 333 ASN A OXT  4  
ATOM 3142  H H    . ASN A 1 42 ? -6.958  -16.475 3.492   1.00 0.00 ? 333 ASN A H    4  
ATOM 3143  H HA   . ASN A 1 42 ? -6.815  -19.305 4.217   1.00 0.00 ? 333 ASN A HA   4  
ATOM 3144  H HB2  . ASN A 1 42 ? -7.868  -16.883 5.471   1.00 0.00 ? 333 ASN A HB2  4  
ATOM 3145  H HD21 . ASN A 1 42 ? -6.318  -16.792 6.936   1.00 0.00 ? 333 ASN A HD21 4  
ATOM 3146  H HD22 . ASN A 1 42 ? -5.841  -18.082 7.980   1.00 0.00 ? 333 ASN A HD22 4  
ATOM 3147  N N    . GLY B 2 1  ? -1.184  -13.643 14.212  1.00 0.00 ? 198 GLY B N    4  
ATOM 3148  C CA   . GLY B 2 1  ? -0.087  -13.476 15.204  1.00 0.00 ? 198 GLY B CA   4  
ATOM 3149  C C    . GLY B 2 1  ? 1.283   -13.709 14.598  1.00 0.00 ? 198 GLY B C    4  
ATOM 3150  O O    . GLY B 2 1  ? 2.091   -12.785 14.516  1.00 0.00 ? 198 GLY B O    4  
ATOM 3151  H H1   . GLY B 2 1  ? -1.663  -14.554 14.357  1.00 0.00 ? 198 GLY B H1   4  
ATOM 3152  H H2   . GLY B 2 1  ? -0.798  -13.618 13.246  1.00 0.00 ? 198 GLY B H2   4  
ATOM 3153  H H3   . GLY B 2 1  ? -1.878  -12.877 14.315  1.00 0.00 ? 198 GLY B H3   4  
ATOM 3154  H HA2  . GLY B 2 1  ? -0.125  -12.473 15.603  1.00 0.00 ? 198 GLY B HA2  4  
ATOM 3155  H HA3  . GLY B 2 1  ? -0.236  -14.179 16.011  1.00 0.00 ? 198 GLY B HA3  4  
ATOM 3156  N N    . PRO B 2 2  ? 1.573   -14.947 14.161  1.00 0.00 ? 199 PRO B N    4  
ATOM 3157  C CA   . PRO B 2 2  ? 2.862   -15.288 13.556  1.00 0.00 ? 199 PRO B CA   4  
ATOM 3158  C C    . PRO B 2 2  ? 2.963   -14.826 12.106  1.00 0.00 ? 199 PRO B C    4  
ATOM 3159  O O    . PRO B 2 2  ? 3.248   -15.620 11.209  1.00 0.00 ? 199 PRO B O    4  
ATOM 3160  C CB   . PRO B 2 2  ? 2.880   -16.814 13.631  1.00 0.00 ? 199 PRO B CB   4  
ATOM 3161  C CG   . PRO B 2 2  ? 1.446   -17.208 13.547  1.00 0.00 ? 199 PRO B CG   4  
ATOM 3162  C CD   . PRO B 2 2  ? 0.667   -16.111 14.225  1.00 0.00 ? 199 PRO B CD   4  
ATOM 3163  H HA   . PRO B 2 2  ? 3.687   -14.885 14.123  1.00 0.00 ? 199 PRO B HA   4  
ATOM 3164  H HB2  . PRO B 2 2  ? 3.451   -17.212 12.805  1.00 0.00 ? 199 PRO B HB2  4  
ATOM 3165  H HG2  . PRO B 2 2  ? 1.149   -17.291 12.512  1.00 0.00 ? 199 PRO B HG2  4  
ATOM 3166  H HD2  . PRO B 2 2  ? -0.251  -15.914 13.690  1.00 0.00 ? 199 PRO B HD2  4  
ATOM 3167  N N    . LEU B 2 3  ? 2.726   -13.537 11.882  1.00 0.00 ? 200 LEU B N    4  
ATOM 3168  C CA   . LEU B 2 3  ? 2.791   -12.971 10.540  1.00 0.00 ? 200 LEU B CA   4  
ATOM 3169  C C    . LEU B 2 3  ? 4.222   -12.985 10.015  1.00 0.00 ? 200 LEU B C    4  
ATOM 3170  O O    . LEU B 2 3  ? 4.453   -13.134 8.815   1.00 0.00 ? 200 LEU B O    4  
ATOM 3171  C CB   . LEU B 2 3  ? 2.247   -11.541 10.540  1.00 0.00 ? 200 LEU B CB   4  
ATOM 3172  C CG   . LEU B 2 3  ? 0.722   -11.428 10.493  1.00 0.00 ? 200 LEU B CG   4  
ATOM 3173  C CD1  . LEU B 2 3  ? 0.205   -10.670 11.707  1.00 0.00 ? 200 LEU B CD1  4  
ATOM 3174  C CD2  . LEU B 2 3  ? 0.276   -10.748 9.208   1.00 0.00 ? 200 LEU B CD2  4  
ATOM 3175  H H    . LEU B 2 3  ? 2.505   -12.953 12.636  1.00 0.00 ? 200 LEU B H    4  
ATOM 3176  H HA   . LEU B 2 3  ? 2.177   -13.580 9.893   1.00 0.00 ? 200 LEU B HA   4  
ATOM 3177  H HB2  . LEU B 2 3  ? 2.599   -11.045 11.434  1.00 0.00 ? 200 LEU B HB2  4  
ATOM 3178  H HG   . LEU B 2 3  ? 0.294   -12.419 10.514  1.00 0.00 ? 200 LEU B HG   4  
ATOM 3179  H HD11 . LEU B 2 3  ? 0.129   -11.344 12.547  1.00 0.00 ? 200 LEU B HD11 4  
ATOM 3180  H HD12 . LEU B 2 3  ? 0.888   -9.869  11.949  1.00 0.00 ? 200 LEU B HD12 4  
ATOM 3181  H HD13 . LEU B 2 3  ? -0.769  -10.258 11.487  1.00 0.00 ? 200 LEU B HD13 4  
ATOM 3182  H HD21 . LEU B 2 3  ? 0.782   -9.799  9.108   1.00 0.00 ? 200 LEU B HD21 4  
ATOM 3183  H HD22 . LEU B 2 3  ? 0.522   -11.377 8.365   1.00 0.00 ? 200 LEU B HD22 4  
ATOM 3184  H HD23 . LEU B 2 3  ? -0.791  -10.586 9.237   1.00 0.00 ? 200 LEU B HD23 4  
ATOM 3185  N N    . GLY B 2 4  ? 5.180   -12.833 10.923  1.00 0.00 ? 201 GLY B N    4  
ATOM 3186  C CA   . GLY B 2 4  ? 6.578   -12.833 10.536  1.00 0.00 ? 201 GLY B CA   4  
ATOM 3187  C C    . GLY B 2 4  ? 7.209   -11.459 10.637  1.00 0.00 ? 201 GLY B C    4  
ATOM 3188  O O    . GLY B 2 4  ? 6.797   -10.638 11.457  1.00 0.00 ? 201 GLY B O    4  
ATOM 3189  H H    . GLY B 2 4  ? 4.935   -12.718 11.865  1.00 0.00 ? 201 GLY B H    4  
ATOM 3190  H HA2  . GLY B 2 4  ? 7.117   -13.513 11.179  1.00 0.00 ? 201 GLY B HA2  4  
ATOM 3191  H HA3  . GLY B 2 4  ? 6.657   -13.179 9.515   1.00 0.00 ? 201 GLY B HA3  4  
ATOM 3192  N N    . SER B 2 5  ? 8.212   -11.208 9.803   1.00 0.00 ? 202 SER B N    4  
ATOM 3193  C CA   . SER B 2 5  ? 8.903   -9.924  9.804   1.00 0.00 ? 202 SER B CA   4  
ATOM 3194  C C    . SER B 2 5  ? 8.681   -9.185  8.488   1.00 0.00 ? 202 SER B C    4  
ATOM 3195  O O    . SER B 2 5  ? 8.324   -8.008  8.478   1.00 0.00 ? 202 SER B O    4  
ATOM 3196  C CB   . SER B 2 5  ? 10.400  -10.129 10.042  1.00 0.00 ? 202 SER B CB   4  
ATOM 3197  O OG   . SER B 2 5  ? 10.971  -9.009  10.698  1.00 0.00 ? 202 SER B OG   4  
ATOM 3198  H H    . SER B 2 5  ? 8.494   -11.902 9.171   1.00 0.00 ? 202 SER B H    4  
ATOM 3199  H HA   . SER B 2 5  ? 8.497   -9.330  10.609  1.00 0.00 ? 202 SER B HA   4  
ATOM 3200  H HB2  . SER B 2 5  ? 10.547  -11.004 10.658  1.00 0.00 ? 202 SER B HB2  4  
ATOM 3201  H HG   . SER B 2 5  ? 11.919  -9.137  10.785  1.00 0.00 ? 202 SER B HG   4  
ATOM 3202  N N    . GLU B 2 6  ? 8.895   -9.885  7.378   1.00 0.00 ? 203 GLU B N    4  
ATOM 3203  C CA   . GLU B 2 6  ? 8.717   -9.295  6.056   1.00 0.00 ? 203 GLU B CA   4  
ATOM 3204  C C    . GLU B 2 6  ? 9.672   -8.125  5.848   1.00 0.00 ? 203 GLU B C    4  
ATOM 3205  O O    . GLU B 2 6  ? 10.716  -8.265  5.210   1.00 0.00 ? 203 GLU B O    4  
ATOM 3206  C CB   . GLU B 2 6  ? 7.271   -8.824  5.874   1.00 0.00 ? 203 GLU B CB   4  
ATOM 3207  C CG   . GLU B 2 6  ? 7.041   -8.027  4.598   1.00 0.00 ? 203 GLU B CG   4  
ATOM 3208  C CD   . GLU B 2 6  ? 5.639   -8.202  4.047   1.00 0.00 ? 203 GLU B CD   4  
ATOM 3209  O OE1  . GLU B 2 6  ? 5.408   -9.186  3.312   1.00 0.00 ? 203 GLU B OE1  4  
ATOM 3210  O OE2  . GLU B 2 6  ? 4.773   -7.355  4.348   1.00 0.00 ? 203 GLU B OE2  4  
ATOM 3211  H H    . GLU B 2 6  ? 9.178   -10.821 7.450   1.00 0.00 ? 203 GLU B H    4  
ATOM 3212  H HA   . GLU B 2 6  ? 8.933   -10.057 5.321   1.00 0.00 ? 203 GLU B HA   4  
ATOM 3213  H HB2  . GLU B 2 6  ? 6.623   -9.689  5.854   1.00 0.00 ? 203 GLU B HB2  4  
ATOM 3214  H HG2  . GLU B 2 6  ? 7.201   -6.979  4.805   1.00 0.00 ? 203 GLU B HG2  4  
ATOM 3215  N N    . LEU B 2 7  ? 9.306   -6.971  6.394   1.00 0.00 ? 204 LEU B N    4  
ATOM 3216  C CA   . LEU B 2 7  ? 10.120  -5.770  6.269   1.00 0.00 ? 204 LEU B CA   4  
ATOM 3217  C C    . LEU B 2 7  ? 9.494   -4.616  7.044   1.00 0.00 ? 204 LEU B C    4  
ATOM 3218  O O    . LEU B 2 7  ? 9.183   -3.569  6.475   1.00 0.00 ? 204 LEU B O    4  
ATOM 3219  C CB   . LEU B 2 7  ? 10.275  -5.397  4.793   1.00 0.00 ? 204 LEU B CB   4  
ATOM 3220  C CG   . LEU B 2 7  ? 11.060  -4.113  4.523   1.00 0.00 ? 204 LEU B CG   4  
ATOM 3221  C CD1  . LEU B 2 7  ? 12.265  -4.398  3.638   1.00 0.00 ? 204 LEU B CD1  4  
ATOM 3222  C CD2  . LEU B 2 7  ? 10.161  -3.069  3.882   1.00 0.00 ? 204 LEU B CD2  4  
ATOM 3223  H H    . LEU B 2 7  ? 8.465   -6.927  6.897   1.00 0.00 ? 204 LEU B H    4  
ATOM 3224  H HA   . LEU B 2 7  ? 11.093  -5.981  6.681   1.00 0.00 ? 204 LEU B HA   4  
ATOM 3225  H HB2  . LEU B 2 7  ? 10.774  -6.212  4.288   1.00 0.00 ? 204 LEU B HB2  4  
ATOM 3226  H HG   . LEU B 2 7  ? 11.421  -3.716  5.461   1.00 0.00 ? 204 LEU B HG   4  
ATOM 3227  H HD11 . LEU B 2 7  ? 13.110  -3.824  3.986   1.00 0.00 ? 204 LEU B HD11 4  
ATOM 3228  H HD12 . LEU B 2 7  ? 12.502  -5.452  3.683   1.00 0.00 ? 204 LEU B HD12 4  
ATOM 3229  H HD13 . LEU B 2 7  ? 12.036  -4.124  2.620   1.00 0.00 ? 204 LEU B HD13 4  
ATOM 3230  H HD21 . LEU B 2 7  ? 9.147   -3.209  4.227   1.00 0.00 ? 204 LEU B HD21 4  
ATOM 3231  H HD22 . LEU B 2 7  ? 10.501  -2.082  4.157   1.00 0.00 ? 204 LEU B HD22 4  
ATOM 3232  H HD23 . LEU B 2 7  ? 10.193  -3.175  2.808   1.00 0.00 ? 204 LEU B HD23 4  
ATOM 3233  N N    . GLU B 2 8  ? 9.311   -4.816  8.348   1.00 0.00 ? 205 GLU B N    4  
ATOM 3234  C CA   . GLU B 2 8  ? 8.713   -3.792  9.201   1.00 0.00 ? 205 GLU B CA   4  
ATOM 3235  C C    . GLU B 2 8  ? 7.249   -3.582  8.816   1.00 0.00 ? 205 GLU B C    4  
ATOM 3236  O O    . GLU B 2 8  ? 6.591   -4.511  8.348   1.00 0.00 ? 205 GLU B O    4  
ATOM 3237  C CB   . GLU B 2 8  ? 9.501   -2.483  9.079   1.00 0.00 ? 205 GLU B CB   4  
ATOM 3238  C CG   . GLU B 2 8  ? 11.005  -2.676  8.947   1.00 0.00 ? 205 GLU B CG   4  
ATOM 3239  C CD   . GLU B 2 8  ? 11.544  -3.747  9.877   1.00 0.00 ? 205 GLU B CD   4  
ATOM 3240  O OE1  . GLU B 2 8  ? 10.943  -3.958  10.951  1.00 0.00 ? 205 GLU B OE1  4  
ATOM 3241  O OE2  . GLU B 2 8  ? 12.567  -4.374  9.530   1.00 0.00 ? 205 GLU B OE2  4  
ATOM 3242  H H    . GLU B 2 8  ? 9.581   -5.672  8.743   1.00 0.00 ? 205 GLU B H    4  
ATOM 3243  H HA   . GLU B 2 8  ? 8.759   -4.139  10.222  1.00 0.00 ? 205 GLU B HA   4  
ATOM 3244  H HB2  . GLU B 2 8  ? 9.153   -1.948  8.207   1.00 0.00 ? 205 GLU B HB2  4  
ATOM 3245  H HG2  . GLU B 2 8  ? 11.231  -2.959  7.930   1.00 0.00 ? 205 GLU B HG2  4  
ATOM 3246  N N    . SER B 2 9  ? 6.734   -2.368  9.010   1.00 0.00 ? 206 SER B N    4  
ATOM 3247  C CA   . SER B 2 9  ? 5.352   -2.076  8.653   1.00 0.00 ? 206 SER B CA   4  
ATOM 3248  C C    . SER B 2 9  ? 5.236   -0.766  7.868   1.00 0.00 ? 206 SER B C    4  
ATOM 3249  O O    . SER B 2 9  ? 4.527   0.148   8.290   1.00 0.00 ? 206 SER B O    4  
ATOM 3250  C CB   . SER B 2 9  ? 4.488   -2.003  9.914   1.00 0.00 ? 206 SER B CB   4  
ATOM 3251  O OG   . SER B 2 9  ? 5.136   -2.618  11.014  1.00 0.00 ? 206 SER B OG   4  
ATOM 3252  H H    . SER B 2 9  ? 7.284   -1.662  9.407   1.00 0.00 ? 206 SER B H    4  
ATOM 3253  H HA   . SER B 2 9  ? 4.994   -2.884  8.034   1.00 0.00 ? 206 SER B HA   4  
ATOM 3254  H HB2  . SER B 2 9  ? 4.297   -0.968  10.158  1.00 0.00 ? 206 SER B HB2  4  
ATOM 3255  H HG   . SER B 2 9  ? 4.499   -2.777  11.714  1.00 0.00 ? 206 SER B HG   4  
ATOM 3256  N N    . PRO B 2 10 ? 5.928   -0.649  6.712   1.00 0.00 ? 207 PRO B N    4  
ATOM 3257  C CA   . PRO B 2 10 ? 5.872   0.559   5.884   1.00 0.00 ? 207 PRO B CA   4  
ATOM 3258  C C    . PRO B 2 10 ? 4.529   0.794   5.179   1.00 0.00 ? 207 PRO B C    4  
ATOM 3259  O O    . PRO B 2 10 ? 4.159   1.950   4.974   1.00 0.00 ? 207 PRO B O    4  
ATOM 3260  C CB   . PRO B 2 10 ? 6.982   0.354   4.845   1.00 0.00 ? 207 PRO B CB   4  
ATOM 3261  C CG   . PRO B 2 10 ? 7.782   -0.806  5.331   1.00 0.00 ? 207 PRO B CG   4  
ATOM 3262  C CD   . PRO B 2 10 ? 6.839   -1.651  6.129   1.00 0.00 ? 207 PRO B CD   4  
ATOM 3263  H HA   . PRO B 2 10 ? 6.102   1.432   6.465   1.00 0.00 ? 207 PRO B HA   4  
ATOM 3264  H HB2  . PRO B 2 10 ? 6.541   0.152   3.885   1.00 0.00 ? 207 PRO B HB2  4  
ATOM 3265  H HG2  . PRO B 2 10 ? 8.168   -1.365  4.491   1.00 0.00 ? 207 PRO B HG2  4  
ATOM 3266  H HD2  . PRO B 2 10 ? 6.312   -2.335  5.483   1.00 0.00 ? 207 PRO B HD2  4  
ATOM 3267  N N    . PRO B 2 11 ? 3.769   -0.263  4.780   1.00 0.00 ? 208 PRO B N    4  
ATOM 3268  C CA   . PRO B 2 11 ? 2.501   -0.075  4.088   1.00 0.00 ? 208 PRO B CA   4  
ATOM 3269  C C    . PRO B 2 11 ? 1.684   1.092   4.632   1.00 0.00 ? 208 PRO B C    4  
ATOM 3270  O O    . PRO B 2 11 ? 1.361   1.118   5.820   1.00 0.00 ? 208 PRO B O    4  
ATOM 3271  C CB   . PRO B 2 11 ? 1.749   -1.383  4.311   1.00 0.00 ? 208 PRO B CB   4  
ATOM 3272  C CG   . PRO B 2 11 ? 2.787   -2.411  4.619   1.00 0.00 ? 208 PRO B CG   4  
ATOM 3273  C CD   . PRO B 2 11 ? 4.080   -1.696  4.933   1.00 0.00 ? 208 PRO B CD   4  
ATOM 3274  H HA   . PRO B 2 11 ? 2.659   0.058   3.042   1.00 0.00 ? 208 PRO B HA   4  
ATOM 3275  H HB2  . PRO B 2 11 ? 1.053   -1.263  5.127   1.00 0.00 ? 208 PRO B HB2  4  
ATOM 3276  H HG2  . PRO B 2 11 ? 2.473   -2.992  5.473   1.00 0.00 ? 208 PRO B HG2  4  
ATOM 3277  H HD2  . PRO B 2 11 ? 4.377   -1.924  5.936   1.00 0.00 ? 208 PRO B HD2  4  
ATOM 3278  N N    . PRO B 2 12 ? 1.395   2.100   3.780   1.00 0.00 ? 209 PRO B N    4  
ATOM 3279  C CA   . PRO B 2 12 ? 0.579   3.259   4.150   1.00 0.00 ? 209 PRO B CA   4  
ATOM 3280  C C    . PRO B 2 12 ? -0.678  2.862   4.928   1.00 0.00 ? 209 PRO B C    4  
ATOM 3281  O O    . PRO B 2 12 ? -0.846  1.709   5.303   1.00 0.00 ? 209 PRO B O    4  
ATOM 3282  C CB   . PRO B 2 12 ? 0.194   3.866   2.788   1.00 0.00 ? 209 PRO B CB   4  
ATOM 3283  C CG   . PRO B 2 12 ? 0.758   2.960   1.755   1.00 0.00 ? 209 PRO B CG   4  
ATOM 3284  C CD   . PRO B 2 12 ? 1.882   2.236   2.403   1.00 0.00 ? 209 PRO B CD   4  
ATOM 3285  H HA   . PRO B 2 12 ? 1.145   3.978   4.721   1.00 0.00 ? 209 PRO B HA   4  
ATOM 3286  H HB2  . PRO B 2 12 ? -0.876  3.899   2.707   1.00 0.00 ? 209 PRO B HB2  4  
ATOM 3287  H HG2  . PRO B 2 12 ? 0.004   2.261   1.452   1.00 0.00 ? 209 PRO B HG2  4  
ATOM 3288  H HD2  . PRO B 2 12 ? 2.025   1.282   1.929   1.00 0.00 ? 209 PRO B HD2  4  
ATOM 3289  N N    . PRO B 2 13 ? -1.603  3.806   5.153   1.00 0.00 ? 210 PRO B N    4  
ATOM 3290  C CA   . PRO B 2 13 ? -2.819  3.540   5.901   1.00 0.00 ? 210 PRO B CA   4  
ATOM 3291  C C    . PRO B 2 13 ? -3.958  3.065   5.011   1.00 0.00 ? 210 PRO B C    4  
ATOM 3292  O O    . PRO B 2 13 ? -3.802  2.947   3.796   1.00 0.00 ? 210 PRO B O    4  
ATOM 3293  C CB   . PRO B 2 13 ? -3.142  4.903   6.500   1.00 0.00 ? 210 PRO B CB   4  
ATOM 3294  C CG   . PRO B 2 13 ? -2.589  5.904   5.532   1.00 0.00 ? 210 PRO B CG   4  
ATOM 3295  C CD   . PRO B 2 13 ? -1.567  5.192   4.671   1.00 0.00 ? 210 PRO B CD   4  
ATOM 3296  H HA   . PRO B 2 13 ? -2.652  2.825   6.689   1.00 0.00 ? 210 PRO B HA   4  
ATOM 3297  H HB2  . PRO B 2 13 ? -4.211  5.001   6.600   1.00 0.00 ? 210 PRO B HB2  4  
ATOM 3298  H HG2  . PRO B 2 13 ? -3.386  6.289   4.915   1.00 0.00 ? 210 PRO B HG2  4  
ATOM 3299  H HD2  . PRO B 2 13 ? -1.858  5.238   3.630   1.00 0.00 ? 210 PRO B HD2  4  
ATOM 3300  N N    . TYR B 2 14 ? -5.106  2.793   5.622   1.00 0.00 ? 211 TYR B N    4  
ATOM 3301  C CA   . TYR B 2 14 ? -6.268  2.343   4.873   1.00 0.00 ? 211 TYR B CA   4  
ATOM 3302  C C    . TYR B 2 14 ? -7.169  3.527   4.538   1.00 0.00 ? 211 TYR B C    4  
ATOM 3303  O O    . TYR B 2 14 ? -8.200  3.728   5.179   1.00 0.00 ? 211 TYR B O    4  
ATOM 3304  C CB   . TYR B 2 14 ? -7.072  1.301   5.666   1.00 0.00 ? 211 TYR B CB   4  
ATOM 3305  C CG   . TYR B 2 14 ? -8.427  1.006   5.051   1.00 0.00 ? 211 TYR B CG   4  
ATOM 3306  C CD1  . TYR B 2 14 ? -8.517  0.420   3.800   1.00 0.00 ? 211 TYR B CD1  4  
ATOM 3307  C CD2  . TYR B 2 14 ? -9.606  1.340   5.706   1.00 0.00 ? 211 TYR B CD2  4  
ATOM 3308  C CE1  . TYR B 2 14 ? -9.739  0.167   3.214   1.00 0.00 ? 211 TYR B CE1  4  
ATOM 3309  C CE2  . TYR B 2 14 ? -10.838 1.092   5.125   1.00 0.00 ? 211 TYR B CE2  4  
ATOM 3310  C CZ   . TYR B 2 14 ? -10.898 0.506   3.879   1.00 0.00 ? 211 TYR B CZ   4  
ATOM 3311  O OH   . TYR B 2 14 ? -12.120 0.256   3.297   1.00 0.00 ? 211 TYR B OH   4  
ATOM 3312  H H    . TYR B 2 14 ? -5.172  2.906   6.591   1.00 0.00 ? 211 TYR B H    4  
ATOM 3313  H HA   . TYR B 2 14 ? -5.910  1.892   3.955   1.00 0.00 ? 211 TYR B HA   4  
ATOM 3314  H HB2  . TYR B 2 14 ? -6.517  0.376   5.709   1.00 0.00 ? 211 TYR B HB2  4  
ATOM 3315  H HD1  . TYR B 2 14 ? -7.609  0.155   3.285   1.00 0.00 ? 211 TYR B HD1  4  
ATOM 3316  H HD2  . TYR B 2 14 ? -9.554  1.800   6.681   1.00 0.00 ? 211 TYR B HD2  4  
ATOM 3317  H HE1  . TYR B 2 14 ? -9.783  -0.289  2.236   1.00 0.00 ? 211 TYR B HE1  4  
ATOM 3318  H HE2  . TYR B 2 14 ? -11.746 1.359   5.645   1.00 0.00 ? 211 TYR B HE2  4  
ATOM 3319  H HH   . TYR B 2 14 ? -12.540 1.087   3.068   1.00 0.00 ? 211 TYR B HH   4  
ATOM 3320  N N    . SER B 2 15 ? -6.786  4.307   3.540   1.00 0.00 ? 212 SER B N    4  
ATOM 3321  C CA   . SER B 2 15 ? -7.582  5.457   3.143   1.00 0.00 ? 212 SER B CA   4  
ATOM 3322  C C    . SER B 2 15 ? -8.196  5.269   1.755   1.00 0.00 ? 212 SER B C    4  
ATOM 3323  O O    . SER B 2 15 ? -8.848  6.176   1.243   1.00 0.00 ? 212 SER B O    4  
ATOM 3324  C CB   . SER B 2 15 ? -6.729  6.724   3.167   1.00 0.00 ? 212 SER B CB   4  
ATOM 3325  O OG   . SER B 2 15 ? -5.682  6.616   4.115   1.00 0.00 ? 212 SER B OG   4  
ATOM 3326  H H    . SER B 2 15 ? -5.955  4.106   3.061   1.00 0.00 ? 212 SER B H    4  
ATOM 3327  H HA   . SER B 2 15 ? -8.381  5.563   3.861   1.00 0.00 ? 212 SER B HA   4  
ATOM 3328  H HB2  . SER B 2 15 ? -6.299  6.880   2.191   1.00 0.00 ? 212 SER B HB2  4  
ATOM 3329  H HG   . SER B 2 15 ? -6.012  6.192   4.911   1.00 0.00 ? 212 SER B HG   4  
ATOM 3330  N N    . ARG B 2 16 ? -7.970  4.093   1.148   1.00 0.00 ? 213 ARG B N    4  
ATOM 3331  C CA   . ARG B 2 16 ? -8.500  3.765   -0.184  1.00 0.00 ? 213 ARG B CA   4  
ATOM 3332  C C    . ARG B 2 16 ? -7.590  4.263   -1.305  1.00 0.00 ? 213 ARG B C    4  
ATOM 3333  O O    . ARG B 2 16 ? -7.631  3.740   -2.418  1.00 0.00 ? 213 ARG B O    4  
ATOM 3334  C CB   . ARG B 2 16 ? -9.912  4.320   -0.385  1.00 0.00 ? 213 ARG B CB   4  
ATOM 3335  C CG   . ARG B 2 16 ? -10.897 3.894   0.691   1.00 0.00 ? 213 ARG B CG   4  
ATOM 3336  C CD   . ARG B 2 16 ? -12.238 3.506   0.090   1.00 0.00 ? 213 ARG B CD   4  
ATOM 3337  N NE   . ARG B 2 16 ? -13.328 4.331   0.605   1.00 0.00 ? 213 ARG B NE   4  
ATOM 3338  C CZ   . ARG B 2 16 ? -14.586 4.231   0.188   1.00 0.00 ? 213 ARG B CZ   4  
ATOM 3339  N NH1  . ARG B 2 16 ? -14.909 3.355   -0.753  1.00 0.00 ? 213 ARG B NH1  4  
ATOM 3340  N NH2  . ARG B 2 16 ? -15.524 5.010   0.713   1.00 0.00 ? 213 ARG B NH2  4  
ATOM 3341  H H    . ARG B 2 16 ? -7.429  3.419   1.607   1.00 0.00 ? 213 ARG B H    4  
ATOM 3342  H HA   . ARG B 2 16 ? -8.549  2.687   -0.247  1.00 0.00 ? 213 ARG B HA   4  
ATOM 3343  H HB2  . ARG B 2 16 ? -9.874  5.396   -0.412  1.00 0.00 ? 213 ARG B HB2  4  
ATOM 3344  H HG2  . ARG B 2 16 ? -10.493 3.043   1.222   1.00 0.00 ? 213 ARG B HG2  4  
ATOM 3345  H HD2  . ARG B 2 16 ? -12.183 3.626   -0.981  1.00 0.00 ? 213 ARG B HD2  4  
ATOM 3346  H HE   . ARG B 2 16 ? -13.112 4.989   1.298   1.00 0.00 ? 213 ARG B HE   4  
ATOM 3347  H HH11 . ARG B 2 16 ? -14.205 2.767   -1.151  1.00 0.00 ? 213 ARG B HH11 4  
ATOM 3348  H HH12 . ARG B 2 16 ? -15.857 3.281   -1.064  1.00 0.00 ? 213 ARG B HH12 4  
ATOM 3349  H HH21 . ARG B 2 16 ? -15.283 5.672   1.423   1.00 0.00 ? 213 ARG B HH21 4  
ATOM 3350  H HH22 . ARG B 2 16 ? -16.470 4.934   0.400   1.00 0.00 ? 213 ARG B HH22 4  
ATOM 3351  N N    . TYR B 2 17 ? -6.777  5.274   -1.018  1.00 0.00 ? 214 TYR B N    4  
ATOM 3352  C CA   . TYR B 2 17 ? -5.870  5.830   -2.016  1.00 0.00 ? 214 TYR B CA   4  
ATOM 3353  C C    . TYR B 2 17 ? -4.417  5.485   -1.704  1.00 0.00 ? 214 TYR B C    4  
ATOM 3354  O O    . TYR B 2 17 ? -4.110  4.918   -0.655  1.00 0.00 ? 214 TYR B O    4  
ATOM 3355  C CB   . TYR B 2 17 ? -6.026  7.349   -2.100  1.00 0.00 ? 214 TYR B CB   4  
ATOM 3356  C CG   . TYR B 2 17 ? -7.425  7.838   -1.819  1.00 0.00 ? 214 TYR B CG   4  
ATOM 3357  C CD1  . TYR B 2 17 ? -8.528  7.152   -2.303  1.00 0.00 ? 214 TYR B CD1  4  
ATOM 3358  C CD2  . TYR B 2 17 ? -7.639  8.986   -1.072  1.00 0.00 ? 214 TYR B CD2  4  
ATOM 3359  C CE1  . TYR B 2 17 ? -9.809  7.596   -2.050  1.00 0.00 ? 214 TYR B CE1  4  
ATOM 3360  C CE2  . TYR B 2 17 ? -8.917  9.438   -0.812  1.00 0.00 ? 214 TYR B CE2  4  
ATOM 3361  C CZ   . TYR B 2 17 ? -9.999  8.740   -1.303  1.00 0.00 ? 214 TYR B CZ   4  
ATOM 3362  O OH   . TYR B 2 17 ? -11.276 9.186   -1.047  1.00 0.00 ? 214 TYR B OH   4  
ATOM 3363  H H    . TYR B 2 17 ? -6.790  5.656   -0.124  1.00 0.00 ? 214 TYR B H    4  
ATOM 3364  H HA   . TYR B 2 17 ? -6.131  5.401   -2.970  1.00 0.00 ? 214 TYR B HA   4  
ATOM 3365  H HB2  . TYR B 2 17 ? -5.365  7.813   -1.384  1.00 0.00 ? 214 TYR B HB2  4  
ATOM 3366  H HD1  . TYR B 2 17 ? -8.375  6.257   -2.887  1.00 0.00 ? 214 TYR B HD1  4  
ATOM 3367  H HD2  . TYR B 2 17 ? -6.789  9.530   -0.688  1.00 0.00 ? 214 TYR B HD2  4  
ATOM 3368  H HE1  . TYR B 2 17 ? -10.653 7.047   -2.436  1.00 0.00 ? 214 TYR B HE1  4  
ATOM 3369  H HE2  . TYR B 2 17 ? -9.062  10.333  -0.229  1.00 0.00 ? 214 TYR B HE2  4  
ATOM 3370  H HH   . TYR B 2 17 ? -11.429 10.007  -1.522  1.00 0.00 ? 214 TYR B HH   4  
ATOM 3371  N N    . PRO B 2 18 ? -3.501  5.833   -2.627  1.00 0.00 ? 215 PRO B N    4  
ATOM 3372  C CA   . PRO B 2 18 ? -2.075  5.582   -2.480  1.00 0.00 ? 215 PRO B CA   4  
ATOM 3373  C C    . PRO B 2 18 ? -1.350  6.781   -1.883  1.00 0.00 ? 215 PRO B C    4  
ATOM 3374  O O    . PRO B 2 18 ? -1.025  7.735   -2.590  1.00 0.00 ? 215 PRO B O    4  
ATOM 3375  C CB   . PRO B 2 18 ? -1.649  5.358   -3.930  1.00 0.00 ? 215 PRO B CB   4  
ATOM 3376  C CG   . PRO B 2 18 ? -2.541  6.259   -4.729  1.00 0.00 ? 215 PRO B CG   4  
ATOM 3377  C CD   . PRO B 2 18 ? -3.789  6.500   -3.905  1.00 0.00 ? 215 PRO B CD   4  
ATOM 3378  H HA   . PRO B 2 18 ? -1.878  4.699   -1.892  1.00 0.00 ? 215 PRO B HA   4  
ATOM 3379  H HB2  . PRO B 2 18 ? -0.609  5.622   -4.050  1.00 0.00 ? 215 PRO B HB2  4  
ATOM 3380  H HG2  . PRO B 2 18 ? -2.036  7.194   -4.918  1.00 0.00 ? 215 PRO B HG2  4  
ATOM 3381  H HD2  . PRO B 2 18 ? -3.946  7.558   -3.757  1.00 0.00 ? 215 PRO B HD2  4  
ATOM 3382  N N    . MET B 2 19 ? -1.096  6.731   -0.580  1.00 0.00 ? 216 MET B N    4  
ATOM 3383  C CA   . MET B 2 19 ? -0.422  7.829   0.103   1.00 0.00 ? 216 MET B CA   4  
ATOM 3384  C C    . MET B 2 19 ? 0.765   7.341   0.927   1.00 0.00 ? 216 MET B C    4  
ATOM 3385  O O    . MET B 2 19 ? 0.610   6.940   2.080   1.00 0.00 ? 216 MET B O    4  
ATOM 3386  C CB   . MET B 2 19 ? -1.418  8.568   0.999   1.00 0.00 ? 216 MET B CB   4  
ATOM 3387  C CG   . MET B 2 19 ? -1.948  7.727   2.152   1.00 0.00 ? 216 MET B CG   4  
ATOM 3388  S SD   . MET B 2 19 ? -3.748  7.652   2.184   1.00 0.00 ? 216 MET B SD   4  
ATOM 3389  C CE   . MET B 2 19 ? -4.018  5.897   1.954   1.00 0.00 ? 216 MET B CE   4  
ATOM 3390  H H    . MET B 2 19 ? -1.366  5.941   -0.068  1.00 0.00 ? 216 MET B H    4  
ATOM 3391  H HA   . MET B 2 19 ? -0.061  8.510   -0.651  1.00 0.00 ? 216 MET B HA   4  
ATOM 3392  H HB2  . MET B 2 19 ? -0.935  9.442   1.411   1.00 0.00 ? 216 MET B HB2  4  
ATOM 3393  H HG2  . MET B 2 19 ? -1.563  6.721   2.059   1.00 0.00 ? 216 MET B HG2  4  
ATOM 3394  H HE1  . MET B 2 19 ? -4.931  5.742   1.398   1.00 0.00 ? 216 MET B HE1  4  
ATOM 3395  H HE2  . MET B 2 19 ? -3.189  5.474   1.407   1.00 0.00 ? 216 MET B HE2  4  
ATOM 3396  H HE3  . MET B 2 19 ? -4.097  5.415   2.917   1.00 0.00 ? 216 MET B HE3  4  
ATOM 3397  N N    . ASP B 2 20 ? 1.952   7.392   0.332   1.00 0.00 ? 217 ASP B N    4  
ATOM 3398  C CA   . ASP B 2 20 ? 3.169   6.961   1.012   1.00 0.00 ? 217 ASP B CA   4  
ATOM 3399  C C    . ASP B 2 20 ? 4.363   6.987   0.064   1.00 0.00 ? 217 ASP B C    4  
ATOM 3400  O O    . ASP B 2 20 ? 4.302   7.721   -0.944  1.00 0.00 ? 217 ASP B O    4  
ATOM 3401  C CB   . ASP B 2 20 ? 2.987   5.555   1.584   1.00 0.00 ? 217 ASP B CB   4  
ATOM 3402  C CG   . ASP B 2 20 ? 3.161   5.516   3.090   1.00 0.00 ? 217 ASP B CG   4  
ATOM 3403  O OD1  . ASP B 2 20 ? 2.492   6.310   3.785   1.00 0.00 ? 217 ASP B OD1  4  
ATOM 3404  O OD2  . ASP B 2 20 ? 3.967   4.694   3.573   1.00 0.00 ? 217 ASP B OD2  4  
ATOM 3405  O OXT  . ASP B 2 20 ? 5.352   6.275   0.340   1.00 0.00 ? 217 ASP B OXT  4  
ATOM 3406  H H    . ASP B 2 20 ? 2.013   7.727   -0.587  1.00 0.00 ? 217 ASP B H    4  
ATOM 3407  H HA   . ASP B 2 20 ? 3.354   7.648   1.824   1.00 0.00 ? 217 ASP B HA   4  
ATOM 3408  H HB2  . ASP B 2 20 ? 1.995   5.202   1.346   1.00 0.00 ? 217 ASP B HB2  4  
ATOM 3409  N N    . GLY A 1 1  ? 10.643  -15.245 -6.335  1.00 0.00 ? 292 GLY A N    5  
ATOM 3410  C CA   . GLY A 1 1  ? 9.793   -16.398 -6.742  1.00 0.00 ? 292 GLY A CA   5  
ATOM 3411  C C    . GLY A 1 1  ? 8.349   -15.995 -6.988  1.00 0.00 ? 292 GLY A C    5  
ATOM 3412  O O    . GLY A 1 1  ? 8.035   -15.419 -8.028  1.00 0.00 ? 292 GLY A O    5  
ATOM 3413  H H1   . GLY A 1 1  ? 10.131  -14.647 -5.654  1.00 0.00 ? 292 GLY A H1   5  
ATOM 3414  H H2   . GLY A 1 1  ? 10.889  -14.671 -7.165  1.00 0.00 ? 292 GLY A H2   5  
ATOM 3415  H H3   . GLY A 1 1  ? 11.518  -15.586 -5.890  1.00 0.00 ? 292 GLY A H3   5  
ATOM 3416  H HA2  . GLY A 1 1  ? 10.195  -16.822 -7.651  1.00 0.00 ? 292 GLY A HA2  5  
ATOM 3417  H HA3  . GLY A 1 1  ? 9.823   -17.146 -5.966  1.00 0.00 ? 292 GLY A HA3  5  
ATOM 3418  N N    . PRO A 1 2  ? 7.442   -16.290 -6.040  1.00 0.00 ? 293 PRO A N    5  
ATOM 3419  C CA   . PRO A 1 2  ? 6.022   -15.947 -6.173  1.00 0.00 ? 293 PRO A CA   5  
ATOM 3420  C C    . PRO A 1 2  ? 5.780   -14.442 -6.102  1.00 0.00 ? 293 PRO A C    5  
ATOM 3421  O O    . PRO A 1 2  ? 6.726   -13.656 -6.042  1.00 0.00 ? 293 PRO A O    5  
ATOM 3422  C CB   . PRO A 1 2  ? 5.371   -16.650 -4.980  1.00 0.00 ? 293 PRO A CB   5  
ATOM 3423  C CG   . PRO A 1 2  ? 6.464   -16.783 -3.976  1.00 0.00 ? 293 PRO A CG   5  
ATOM 3424  C CD   . PRO A 1 2  ? 7.728   -16.977 -4.767  1.00 0.00 ? 293 PRO A CD   5  
ATOM 3425  H HA   . PRO A 1 2  ? 5.606   -16.333 -7.093  1.00 0.00 ? 293 PRO A HA   5  
ATOM 3426  H HB2  . PRO A 1 2  ? 4.558   -16.046 -4.602  1.00 0.00 ? 293 PRO A HB2  5  
ATOM 3427  H HG2  . PRO A 1 2  ? 6.527   -15.884 -3.381  1.00 0.00 ? 293 PRO A HG2  5  
ATOM 3428  H HD2  . PRO A 1 2  ? 8.564   -16.517 -4.261  1.00 0.00 ? 293 PRO A HD2  5  
ATOM 3429  N N    . LEU A 1 3  ? 4.511   -14.047 -6.109  1.00 0.00 ? 294 LEU A N    5  
ATOM 3430  C CA   . LEU A 1 3  ? 4.151   -12.635 -6.044  1.00 0.00 ? 294 LEU A CA   5  
ATOM 3431  C C    . LEU A 1 3  ? 2.636   -12.457 -6.034  1.00 0.00 ? 294 LEU A C    5  
ATOM 3432  O O    . LEU A 1 3  ? 2.106   -11.597 -5.330  1.00 0.00 ? 294 LEU A O    5  
ATOM 3433  C CB   . LEU A 1 3  ? 4.758   -11.879 -7.227  1.00 0.00 ? 294 LEU A CB   5  
ATOM 3434  C CG   . LEU A 1 3  ? 5.010   -10.390 -6.984  1.00 0.00 ? 294 LEU A CG   5  
ATOM 3435  C CD1  . LEU A 1 3  ? 3.697   -9.622  -6.981  1.00 0.00 ? 294 LEU A CD1  5  
ATOM 3436  C CD2  . LEU A 1 3  ? 5.754   -10.184 -5.674  1.00 0.00 ? 294 LEU A CD2  5  
ATOM 3437  H H    . LEU A 1 3  ? 3.800   -14.721 -6.158  1.00 0.00 ? 294 LEU A H    5  
ATOM 3438  H HA   . LEU A 1 3  ? 4.554   -12.233 -5.127  1.00 0.00 ? 294 LEU A HA   5  
ATOM 3439  H HB2  . LEU A 1 3  ? 5.699   -12.346 -7.480  1.00 0.00 ? 294 LEU A HB2  5  
ATOM 3440  H HG   . LEU A 1 3  ? 5.622   -10.000 -7.784  1.00 0.00 ? 294 LEU A HG   5  
ATOM 3441  H HD11 . LEU A 1 3  ? 3.754   -8.810  -7.691  1.00 0.00 ? 294 LEU A HD11 5  
ATOM 3442  H HD12 . LEU A 1 3  ? 2.890   -10.285 -7.257  1.00 0.00 ? 294 LEU A HD12 5  
ATOM 3443  H HD13 . LEU A 1 3  ? 3.514   -9.224  -5.993  1.00 0.00 ? 294 LEU A HD13 5  
ATOM 3444  H HD21 . LEU A 1 3  ? 6.340   -9.279  -5.732  1.00 0.00 ? 294 LEU A HD21 5  
ATOM 3445  H HD22 . LEU A 1 3  ? 5.042   -10.099 -4.865  1.00 0.00 ? 294 LEU A HD22 5  
ATOM 3446  H HD23 . LEU A 1 3  ? 6.406   -11.024 -5.494  1.00 0.00 ? 294 LEU A HD23 5  
ATOM 3447  N N    . GLY A 1 4  ? 1.944   -13.275 -6.819  1.00 0.00 ? 295 GLY A N    5  
ATOM 3448  C CA   . GLY A 1 4  ? 0.496   -13.192 -6.890  1.00 0.00 ? 295 GLY A CA   5  
ATOM 3449  C C    . GLY A 1 4  ? 0.017   -12.173 -7.907  1.00 0.00 ? 295 GLY A C    5  
ATOM 3450  O O    . GLY A 1 4  ? -1.139  -11.751 -7.874  1.00 0.00 ? 295 GLY A O    5  
ATOM 3451  H H    . GLY A 1 4  ? 2.420   -13.942 -7.357  1.00 0.00 ? 295 GLY A H    5  
ATOM 3452  H HA2  . GLY A 1 4  ? 0.104   -14.163 -7.158  1.00 0.00 ? 295 GLY A HA2  5  
ATOM 3453  H HA3  . GLY A 1 4  ? 0.113   -12.920 -5.917  1.00 0.00 ? 295 GLY A HA3  5  
ATOM 3454  N N    . SER A 1 5  ? 0.906   -11.776 -8.814  1.00 0.00 ? 296 SER A N    5  
ATOM 3455  C CA   . SER A 1 5  ? 0.563   -10.800 -9.843  1.00 0.00 ? 296 SER A CA   5  
ATOM 3456  C C    . SER A 1 5  ? -0.713  -11.206 -10.572 1.00 0.00 ? 296 SER A C    5  
ATOM 3457  O O    . SER A 1 5  ? -0.667  -11.934 -11.564 1.00 0.00 ? 296 SER A O    5  
ATOM 3458  C CB   . SER A 1 5  ? 1.712   -10.658 -10.844 1.00 0.00 ? 296 SER A CB   5  
ATOM 3459  O OG   . SER A 1 5  ? 1.344   -9.819  -11.924 1.00 0.00 ? 296 SER A OG   5  
ATOM 3460  H H    . SER A 1 5  ? 1.813   -12.148 -8.792  1.00 0.00 ? 296 SER A H    5  
ATOM 3461  H HA   . SER A 1 5  ? 0.400   -9.850  -9.358  1.00 0.00 ? 296 SER A HA   5  
ATOM 3462  H HB2  . SER A 1 5  ? 2.569   -10.230 -10.348 1.00 0.00 ? 296 SER A HB2  5  
ATOM 3463  H HG   . SER A 1 5  ? 1.009   -8.986  -11.583 1.00 0.00 ? 296 SER A HG   5  
ATOM 3464  N N    . GLY A 1 6  ? -1.852  -10.731 -10.078 1.00 0.00 ? 297 GLY A N    5  
ATOM 3465  C CA   . GLY A 1 6  ? -3.120  -11.059 -10.699 1.00 0.00 ? 297 GLY A CA   5  
ATOM 3466  C C    . GLY A 1 6  ? -4.271  -10.226 -10.163 1.00 0.00 ? 297 GLY A C    5  
ATOM 3467  O O    . GLY A 1 6  ? -4.090  -9.052  -9.840  1.00 0.00 ? 297 GLY A O    5  
ATOM 3468  H H    . GLY A 1 6  ? -1.829  -10.153 -9.286  1.00 0.00 ? 297 GLY A H    5  
ATOM 3469  H HA2  . GLY A 1 6  ? -3.039  -10.898 -11.763 1.00 0.00 ? 297 GLY A HA2  5  
ATOM 3470  H HA3  . GLY A 1 6  ? -3.335  -12.103 -10.520 1.00 0.00 ? 297 GLY A HA3  5  
ATOM 3471  N N    . PRO A 1 7  ? -5.475  -10.815 -10.060 1.00 0.00 ? 298 PRO A N    5  
ATOM 3472  C CA   . PRO A 1 7  ? -6.661  -10.111 -9.561  1.00 0.00 ? 298 PRO A CA   5  
ATOM 3473  C C    . PRO A 1 7  ? -6.639  -9.927  -8.046  1.00 0.00 ? 298 PRO A C    5  
ATOM 3474  O O    . PRO A 1 7  ? -5.643  -10.227 -7.389  1.00 0.00 ? 298 PRO A O    5  
ATOM 3475  C CB   . PRO A 1 7  ? -7.808  -11.037 -9.974  1.00 0.00 ? 298 PRO A CB   5  
ATOM 3476  C CG   . PRO A 1 7  ? -7.203  -12.398 -9.993  1.00 0.00 ? 298 PRO A CG   5  
ATOM 3477  C CD   . PRO A 1 7  ? -5.773  -12.214 -10.424 1.00 0.00 ? 298 PRO A CD   5  
ATOM 3478  H HA   . PRO A 1 7  ? -6.780  -9.151  -10.037 1.00 0.00 ? 298 PRO A HA   5  
ATOM 3479  H HB2  . PRO A 1 7  ? -8.609  -10.970 -9.255  1.00 0.00 ? 298 PRO A HB2  5  
ATOM 3480  H HG2  . PRO A 1 7  ? -7.244  -12.830 -9.004  1.00 0.00 ? 298 PRO A HG2  5  
ATOM 3481  H HD2  . PRO A 1 7  ? -5.128  -12.896 -9.890  1.00 0.00 ? 298 PRO A HD2  5  
ATOM 3482  N N    . LEU A 1 8  ? -7.739  -9.412  -7.501  1.00 0.00 ? 299 LEU A N    5  
ATOM 3483  C CA   . LEU A 1 8  ? -7.852  -9.197  -6.064  1.00 0.00 ? 299 LEU A CA   5  
ATOM 3484  C C    . LEU A 1 8  ? -9.260  -9.537  -5.581  1.00 0.00 ? 299 LEU A C    5  
ATOM 3485  O O    . LEU A 1 8  ? -10.242 -9.273  -6.275  1.00 0.00 ? 299 LEU A O    5  
ATOM 3486  C CB   . LEU A 1 8  ? -7.515  -7.744  -5.712  1.00 0.00 ? 299 LEU A CB   5  
ATOM 3487  C CG   . LEU A 1 8  ? -6.024  -7.436  -5.553  1.00 0.00 ? 299 LEU A CG   5  
ATOM 3488  C CD1  . LEU A 1 8  ? -5.829  -6.063  -4.931  1.00 0.00 ? 299 LEU A CD1  5  
ATOM 3489  C CD2  . LEU A 1 8  ? -5.343  -8.503  -4.709  1.00 0.00 ? 299 LEU A CD2  5  
ATOM 3490  H H    . LEU A 1 8  ? -8.488  -9.164  -8.079  1.00 0.00 ? 299 LEU A H    5  
ATOM 3491  H HA   . LEU A 1 8  ? -7.149  -9.853  -5.574  1.00 0.00 ? 299 LEU A HA   5  
ATOM 3492  H HB2  . LEU A 1 8  ? -7.911  -7.108  -6.490  1.00 0.00 ? 299 LEU A HB2  5  
ATOM 3493  H HG   . LEU A 1 8  ? -5.556  -7.428  -6.526  1.00 0.00 ? 299 LEU A HG   5  
ATOM 3494  H HD11 . LEU A 1 8  ? -4.830  -5.987  -4.529  1.00 0.00 ? 299 LEU A HD11 5  
ATOM 3495  H HD12 . LEU A 1 8  ? -5.974  -5.302  -5.684  1.00 0.00 ? 299 LEU A HD12 5  
ATOM 3496  H HD13 . LEU A 1 8  ? -6.547  -5.924  -4.137  1.00 0.00 ? 299 LEU A HD13 5  
ATOM 3497  H HD21 . LEU A 1 8  ? -4.863  -9.222  -5.355  1.00 0.00 ? 299 LEU A HD21 5  
ATOM 3498  H HD22 . LEU A 1 8  ? -4.604  -8.041  -4.073  1.00 0.00 ? 299 LEU A HD22 5  
ATOM 3499  H HD23 . LEU A 1 8  ? -6.080  -9.004  -4.099  1.00 0.00 ? 299 LEU A HD23 5  
ATOM 3500  N N    . PRO A 1 9  ? -9.378  -10.131 -4.380  1.00 0.00 ? 300 PRO A N    5  
ATOM 3501  C CA   . PRO A 1 9  ? -10.677 -10.508 -3.814  1.00 0.00 ? 300 PRO A CA   5  
ATOM 3502  C C    . PRO A 1 9  ? -11.634 -9.322  -3.728  1.00 0.00 ? 300 PRO A C    5  
ATOM 3503  O O    . PRO A 1 9  ? -11.231 -8.176  -3.929  1.00 0.00 ? 300 PRO A O    5  
ATOM 3504  C CB   . PRO A 1 9  ? -10.330 -11.016 -2.412  1.00 0.00 ? 300 PRO A CB   5  
ATOM 3505  C CG   . PRO A 1 9  ? -8.894  -11.408 -2.488  1.00 0.00 ? 300 PRO A CG   5  
ATOM 3506  C CD   . PRO A 1 9  ? -8.262  -10.476 -3.483  1.00 0.00 ? 300 PRO A CD   5  
ATOM 3507  H HA   . PRO A 1 9  ? -11.140 -11.300 -4.382  1.00 0.00 ? 300 PRO A HA   5  
ATOM 3508  H HB2  . PRO A 1 9  ? -10.486 -10.226 -1.692  1.00 0.00 ? 300 PRO A HB2  5  
ATOM 3509  H HG2  . PRO A 1 9  ? -8.430  -11.294 -1.520  1.00 0.00 ? 300 PRO A HG2  5  
ATOM 3510  H HD2  . PRO A 1 9  ? -7.879  -9.596  -2.985  1.00 0.00 ? 300 PRO A HD2  5  
ATOM 3511  N N    . PRO A 1 10 ? -12.917 -9.583  -3.427  1.00 0.00 ? 301 PRO A N    5  
ATOM 3512  C CA   . PRO A 1 10 ? -13.932 -8.530  -3.318  1.00 0.00 ? 301 PRO A CA   5  
ATOM 3513  C C    . PRO A 1 10 ? -13.747 -7.664  -2.074  1.00 0.00 ? 301 PRO A C    5  
ATOM 3514  O O    . PRO A 1 10 ? -14.645 -7.563  -1.238  1.00 0.00 ? 301 PRO A O    5  
ATOM 3515  C CB   . PRO A 1 10 ? -15.244 -9.311  -3.232  1.00 0.00 ? 301 PRO A CB   5  
ATOM 3516  C CG   . PRO A 1 10 ? -14.863 -10.632 -2.660  1.00 0.00 ? 301 PRO A CG   5  
ATOM 3517  C CD   . PRO A 1 10 ? -13.480 -10.923 -3.175  1.00 0.00 ? 301 PRO A CD   5  
ATOM 3518  H HA   . PRO A 1 10 ? -13.942 -7.900  -4.194  1.00 0.00 ? 301 PRO A HA   5  
ATOM 3519  H HB2  . PRO A 1 10 ? -15.937 -8.787  -2.589  1.00 0.00 ? 301 PRO A HB2  5  
ATOM 3520  H HG2  . PRO A 1 10 ? -14.856 -10.578 -1.582  1.00 0.00 ? 301 PRO A HG2  5  
ATOM 3521  H HD2  . PRO A 1 10 ? -12.902 -11.450 -2.430  1.00 0.00 ? 301 PRO A HD2  5  
ATOM 3522  N N    . GLY A 1 11 ? -12.576 -7.043  -1.956  1.00 0.00 ? 302 GLY A N    5  
ATOM 3523  C CA   . GLY A 1 11 ? -12.305 -6.190  -0.812  1.00 0.00 ? 302 GLY A CA   5  
ATOM 3524  C C    . GLY A 1 11 ? -10.919 -5.573  -0.849  1.00 0.00 ? 302 GLY A C    5  
ATOM 3525  O O    . GLY A 1 11 ? -10.713 -4.467  -0.352  1.00 0.00 ? 302 GLY A O    5  
ATOM 3526  H H    . GLY A 1 11 ? -11.895 -7.167  -2.644  1.00 0.00 ? 302 GLY A H    5  
ATOM 3527  H HA2  . GLY A 1 11 ? -13.037 -5.396  -0.791  1.00 0.00 ? 302 GLY A HA2  5  
ATOM 3528  H HA3  . GLY A 1 11 ? -12.402 -6.775  0.089   1.00 0.00 ? 302 GLY A HA3  5  
ATOM 3529  N N    . TRP A 1 12 ? -9.962  -6.287  -1.435  1.00 0.00 ? 303 TRP A N    5  
ATOM 3530  C CA   . TRP A 1 12 ? -8.592  -5.797  -1.518  1.00 0.00 ? 303 TRP A CA   5  
ATOM 3531  C C    . TRP A 1 12 ? -8.359  -4.977  -2.778  1.00 0.00 ? 303 TRP A C    5  
ATOM 3532  O O    . TRP A 1 12 ? -9.153  -5.011  -3.719  1.00 0.00 ? 303 TRP A O    5  
ATOM 3533  C CB   . TRP A 1 12 ? -7.609  -6.966  -1.489  1.00 0.00 ? 303 TRP A CB   5  
ATOM 3534  C CG   . TRP A 1 12 ? -7.675  -7.755  -0.225  1.00 0.00 ? 303 TRP A CG   5  
ATOM 3535  C CD1  . TRP A 1 12 ? -8.545  -8.764  0.062   1.00 0.00 ? 303 TRP A CD1  5  
ATOM 3536  C CD2  . TRP A 1 12 ? -6.840  -7.601  0.925   1.00 0.00 ? 303 TRP A CD2  5  
ATOM 3537  N NE1  . TRP A 1 12 ? -8.309  -9.245  1.323   1.00 0.00 ? 303 TRP A NE1  5  
ATOM 3538  C CE2  . TRP A 1 12 ? -7.263  -8.548  1.876   1.00 0.00 ? 303 TRP A CE2  5  
ATOM 3539  C CE3  . TRP A 1 12 ? -5.777  -6.752  1.244   1.00 0.00 ? 303 TRP A CE3  5  
ATOM 3540  C CZ2  . TRP A 1 12 ? -6.657  -8.669  3.123   1.00 0.00 ? 303 TRP A CZ2  5  
ATOM 3541  C CZ3  . TRP A 1 12 ? -5.176  -6.874  2.481   1.00 0.00 ? 303 TRP A CZ3  5  
ATOM 3542  C CH2  . TRP A 1 12 ? -5.616  -7.826  3.408   1.00 0.00 ? 303 TRP A CH2  5  
ATOM 3543  H H    . TRP A 1 12 ? -10.179 -7.164  -1.811  1.00 0.00 ? 303 TRP A H    5  
ATOM 3544  H HA   . TRP A 1 12 ? -8.412  -5.172  -0.659  1.00 0.00 ? 303 TRP A HA   5  
ATOM 3545  H HB2  . TRP A 1 12 ? -7.826  -7.632  -2.311  1.00 0.00 ? 303 TRP A HB2  5  
ATOM 3546  H HD1  . TRP A 1 12 ? -9.307  -9.119  -0.615  1.00 0.00 ? 303 TRP A HD1  5  
ATOM 3547  H HE1  . TRP A 1 12 ? -8.804  -9.970  1.755   1.00 0.00 ? 303 TRP A HE1  5  
ATOM 3548  H HE3  . TRP A 1 12 ? -5.423  -6.011  0.541   1.00 0.00 ? 303 TRP A HE3  5  
ATOM 3549  H HZ2  . TRP A 1 12 ? -6.984  -9.399  3.850   1.00 0.00 ? 303 TRP A HZ2  5  
ATOM 3550  H HZ3  . TRP A 1 12 ? -4.353  -6.227  2.744   1.00 0.00 ? 303 TRP A HZ3  5  
ATOM 3551  H HH2  . TRP A 1 12 ? -5.117  -7.885  4.361   1.00 0.00 ? 303 TRP A HH2  5  
ATOM 3552  N N    . GLU A 1 13 ? -7.258  -4.239  -2.777  1.00 0.00 ? 304 GLU A N    5  
ATOM 3553  C CA   . GLU A 1 13 ? -6.877  -3.412  -3.910  1.00 0.00 ? 304 GLU A CA   5  
ATOM 3554  C C    . GLU A 1 13 ? -5.381  -3.146  -3.881  1.00 0.00 ? 304 GLU A C    5  
ATOM 3555  O O    . GLU A 1 13 ? -4.795  -2.971  -2.815  1.00 0.00 ? 304 GLU A O    5  
ATOM 3556  C CB   . GLU A 1 13 ? -7.631  -2.085  -3.899  1.00 0.00 ? 304 GLU A CB   5  
ATOM 3557  C CG   . GLU A 1 13 ? -7.231  -1.165  -5.039  1.00 0.00 ? 304 GLU A CG   5  
ATOM 3558  C CD   . GLU A 1 13 ? -7.534  0.291   -4.748  1.00 0.00 ? 304 GLU A CD   5  
ATOM 3559  O OE1  . GLU A 1 13 ? -8.285  0.562   -3.788  1.00 0.00 ? 304 GLU A OE1  5  
ATOM 3560  O OE2  . GLU A 1 13 ? -7.020  1.162   -5.481  1.00 0.00 ? 304 GLU A OE2  5  
ATOM 3561  H H    . GLU A 1 13 ? -6.680  -4.252  -1.985  1.00 0.00 ? 304 GLU A H    5  
ATOM 3562  H HA   . GLU A 1 13 ? -7.121  -3.951  -4.815  1.00 0.00 ? 304 GLU A HA   5  
ATOM 3563  H HB2  . GLU A 1 13 ? -8.689  -2.282  -3.972  1.00 0.00 ? 304 GLU A HB2  5  
ATOM 3564  H HG2  . GLU A 1 13 ? -6.170  -1.270  -5.211  1.00 0.00 ? 304 GLU A HG2  5  
ATOM 3565  N N    . ILE A 1 14 ? -4.763  -3.116  -5.052  1.00 0.00 ? 305 ILE A N    5  
ATOM 3566  C CA   . ILE A 1 14 ? -3.334  -2.870  -5.135  1.00 0.00 ? 305 ILE A CA   5  
ATOM 3567  C C    . ILE A 1 14 ? -3.038  -1.379  -5.242  1.00 0.00 ? 305 ILE A C    5  
ATOM 3568  O O    . ILE A 1 14 ? -3.653  -0.666  -6.034  1.00 0.00 ? 305 ILE A O    5  
ATOM 3569  C CB   . ILE A 1 14 ? -2.702  -3.604  -6.327  1.00 0.00 ? 305 ILE A CB   5  
ATOM 3570  C CG1  . ILE A 1 14 ? -3.042  -5.096  -6.254  1.00 0.00 ? 305 ILE A CG1  5  
ATOM 3571  C CG2  . ILE A 1 14 ? -1.194  -3.384  -6.341  1.00 0.00 ? 305 ILE A CG2  5  
ATOM 3572  C CD1  . ILE A 1 14 ? -2.220  -5.959  -7.184  1.00 0.00 ? 305 ILE A CD1  5  
ATOM 3573  H H    . ILE A 1 14 ? -5.277  -3.259  -5.874  1.00 0.00 ? 305 ILE A H    5  
ATOM 3574  H HA   . ILE A 1 14 ? -2.882  -3.250  -4.228  1.00 0.00 ? 305 ILE A HA   5  
ATOM 3575  H HB   . ILE A 1 14 ? -3.111  -3.190  -7.236  1.00 0.00 ? 305 ILE A HB   5  
ATOM 3576  H HG12 . ILE A 1 14 ? -2.877  -5.446  -5.248  1.00 0.00 ? 305 ILE A HG12 5  
ATOM 3577  H HG21 . ILE A 1 14 ? -0.725  -4.066  -5.648  1.00 0.00 ? 305 ILE A HG21 5  
ATOM 3578  H HG22 . ILE A 1 14 ? -0.813  -3.563  -7.335  1.00 0.00 ? 305 ILE A HG22 5  
ATOM 3579  H HG23 . ILE A 1 14 ? -0.973  -2.367  -6.049  1.00 0.00 ? 305 ILE A HG23 5  
ATOM 3580  H HD11 . ILE A 1 14 ? -1.177  -5.883  -6.914  1.00 0.00 ? 305 ILE A HD11 5  
ATOM 3581  H HD12 . ILE A 1 14 ? -2.542  -6.986  -7.098  1.00 0.00 ? 305 ILE A HD12 5  
ATOM 3582  H HD13 . ILE A 1 14 ? -2.357  -5.621  -8.201  1.00 0.00 ? 305 ILE A HD13 5  
ATOM 3583  N N    . ARG A 1 15 ? -2.091  -0.921  -4.435  1.00 0.00 ? 306 ARG A N    5  
ATOM 3584  C CA   . ARG A 1 15 ? -1.705  0.483   -4.422  1.00 0.00 ? 306 ARG A CA   5  
ATOM 3585  C C    . ARG A 1 15 ? -0.226  0.621   -4.075  1.00 0.00 ? 306 ARG A C    5  
ATOM 3586  O O    . ARG A 1 15 ? 0.352   -0.268  -3.461  1.00 0.00 ? 306 ARG A O    5  
ATOM 3587  C CB   . ARG A 1 15 ? -2.553  1.248   -3.406  1.00 0.00 ? 306 ARG A CB   5  
ATOM 3588  C CG   . ARG A 1 15 ? -3.964  1.543   -3.889  1.00 0.00 ? 306 ARG A CG   5  
ATOM 3589  C CD   . ARG A 1 15 ? -4.597  2.675   -3.098  1.00 0.00 ? 306 ARG A CD   5  
ATOM 3590  N NE   . ARG A 1 15 ? -5.926  3.015   -3.597  1.00 0.00 ? 306 ARG A NE   5  
ATOM 3591  C CZ   . ARG A 1 15 ? -6.143  3.610   -4.765  1.00 0.00 ? 306 ARG A CZ   5  
ATOM 3592  N NH1  . ARG A 1 15 ? -5.121  3.930   -5.548  1.00 0.00 ? 306 ARG A NH1  5  
ATOM 3593  N NH2  . ARG A 1 15 ? -7.380  3.888   -5.151  1.00 0.00 ? 306 ARG A NH2  5  
ATOM 3594  H H    . ARG A 1 15 ? -1.639  -1.544  -3.829  1.00 0.00 ? 306 ARG A H    5  
ATOM 3595  H HA   . ARG A 1 15 ? -1.876  0.889   -5.407  1.00 0.00 ? 306 ARG A HA   5  
ATOM 3596  H HB2  . ARG A 1 15 ? -2.621  0.664   -2.501  1.00 0.00 ? 306 ARG A HB2  5  
ATOM 3597  H HG2  . ARG A 1 15 ? -3.927  1.823   -4.931  1.00 0.00 ? 306 ARG A HG2  5  
ATOM 3598  H HD2  . ARG A 1 15 ? -4.678  2.374   -2.065  1.00 0.00 ? 306 ARG A HD2  5  
ATOM 3599  H HE   . ARG A 1 15 ? -6.695  2.791   -3.032  1.00 0.00 ? 306 ARG A HE   5  
ATOM 3600  H HH11 . ARG A 1 15 ? -4.187  3.724   -5.260  1.00 0.00 ? 306 ARG A HH11 5  
ATOM 3601  H HH12 . ARG A 1 15 ? -5.287  4.376   -6.428  1.00 0.00 ? 306 ARG A HH12 5  
ATOM 3602  H HH21 . ARG A 1 15 ? -8.153  3.651   -4.562  1.00 0.00 ? 306 ARG A HH21 5  
ATOM 3603  H HH22 . ARG A 1 15 ? -7.542  4.335   -6.030  1.00 0.00 ? 306 ARG A HH22 5  
ATOM 3604  N N    . ASN A 1 16 ? 0.381   1.731   -4.473  1.00 0.00 ? 307 ASN A N    5  
ATOM 3605  C CA   . ASN A 1 16 ? 1.795   1.960   -4.191  1.00 0.00 ? 307 ASN A CA   5  
ATOM 3606  C C    . ASN A 1 16 ? 1.976   3.126   -3.224  1.00 0.00 ? 307 ASN A C    5  
ATOM 3607  O O    . ASN A 1 16 ? 1.097   3.978   -3.091  1.00 0.00 ? 307 ASN A O    5  
ATOM 3608  C CB   . ASN A 1 16 ? 2.561   2.233   -5.484  1.00 0.00 ? 307 ASN A CB   5  
ATOM 3609  C CG   . ASN A 1 16 ? 2.159   1.295   -6.606  1.00 0.00 ? 307 ASN A CG   5  
ATOM 3610  O OD1  . ASN A 1 16 ? 0.973   1.108   -6.879  1.00 0.00 ? 307 ASN A OD1  5  
ATOM 3611  N ND2  . ASN A 1 16 ? 3.147   0.701   -7.264  1.00 0.00 ? 307 ASN A ND2  5  
ATOM 3612  H H    . ASN A 1 16 ? -0.128  2.411   -4.964  1.00 0.00 ? 307 ASN A H    5  
ATOM 3613  H HA   . ASN A 1 16 ? 2.188   1.066   -3.732  1.00 0.00 ? 307 ASN A HA   5  
ATOM 3614  H HB2  . ASN A 1 16 ? 2.366   3.242   -5.799  1.00 0.00 ? 307 ASN A HB2  5  
ATOM 3615  H HD21 . ASN A 1 16 ? 4.068   0.897   -6.991  1.00 0.00 ? 307 ASN A HD21 5  
ATOM 3616  H HD22 . ASN A 1 16 ? 2.915   0.091   -7.994  1.00 0.00 ? 307 ASN A HD22 5  
ATOM 3617  N N    . THR A 1 17 ? 3.124   3.160   -2.557  1.00 0.00 ? 308 THR A N    5  
ATOM 3618  C CA   . THR A 1 17 ? 3.418   4.216   -1.596  1.00 0.00 ? 308 THR A CA   5  
ATOM 3619  C C    . THR A 1 17 ? 3.901   5.484   -2.293  1.00 0.00 ? 308 THR A C    5  
ATOM 3620  O O    . THR A 1 17 ? 3.304   6.550   -2.140  1.00 0.00 ? 308 THR A O    5  
ATOM 3621  C CB   . THR A 1 17 ? 4.477   3.761   -0.576  1.00 0.00 ? 308 THR A CB   5  
ATOM 3622  O OG1  . THR A 1 17 ? 5.737   3.561   -1.230  1.00 0.00 ? 308 THR A OG1  5  
ATOM 3623  C CG2  . THR A 1 17 ? 4.042   2.473   0.107   1.00 0.00 ? 308 THR A CG2  5  
ATOM 3624  H H    . THR A 1 17 ? 3.790   2.458   -2.715  1.00 0.00 ? 308 THR A H    5  
ATOM 3625  H HA   . THR A 1 17 ? 2.506   4.438   -1.060  1.00 0.00 ? 308 THR A HA   5  
ATOM 3626  H HB   . THR A 1 17 ? 4.587   4.530   0.175   1.00 0.00 ? 308 THR A HB   5  
ATOM 3627  H HG1  . THR A 1 17 ? 6.344   3.122   -0.630  1.00 0.00 ? 308 THR A HG1  5  
ATOM 3628  H HG21 . THR A 1 17 ? 2.963   2.447   0.162   1.00 0.00 ? 308 THR A HG21 5  
ATOM 3629  H HG22 . THR A 1 17 ? 4.457   2.432   1.103   1.00 0.00 ? 308 THR A HG22 5  
ATOM 3630  H HG23 . THR A 1 17 ? 4.393   1.626   -0.462  1.00 0.00 ? 308 THR A HG23 5  
ATOM 3631  N N    . ALA A 1 18 ? 4.981   5.365   -3.058  1.00 0.00 ? 309 ALA A N    5  
ATOM 3632  C CA   . ALA A 1 18 ? 5.535   6.508   -3.771  1.00 0.00 ? 309 ALA A CA   5  
ATOM 3633  C C    . ALA A 1 18 ? 6.804   6.128   -4.527  1.00 0.00 ? 309 ALA A C    5  
ATOM 3634  O O    . ALA A 1 18 ? 6.827   6.123   -5.758  1.00 0.00 ? 309 ALA A O    5  
ATOM 3635  C CB   . ALA A 1 18 ? 5.816   7.646   -2.803  1.00 0.00 ? 309 ALA A CB   5  
ATOM 3636  H H    . ALA A 1 18 ? 5.414   4.490   -3.143  1.00 0.00 ? 309 ALA A H    5  
ATOM 3637  H HA   . ALA A 1 18 ? 4.795   6.847   -4.482  1.00 0.00 ? 309 ALA A HA   5  
ATOM 3638  H HB1  . ALA A 1 18 ? 5.499   7.359   -1.810  1.00 0.00 ? 309 ALA A HB1  5  
ATOM 3639  H HB2  . ALA A 1 18 ? 6.874   7.860   -2.796  1.00 0.00 ? 309 ALA A HB2  5  
ATOM 3640  H HB3  . ALA A 1 18 ? 5.272   8.525   -3.114  1.00 0.00 ? 309 ALA A HB3  5  
ATOM 3641  N N    . THR A 1 19 ? 7.861   5.813   -3.784  1.00 0.00 ? 310 THR A N    5  
ATOM 3642  C CA   . THR A 1 19 ? 9.133   5.432   -4.387  1.00 0.00 ? 310 THR A CA   5  
ATOM 3643  C C    . THR A 1 19 ? 8.936   4.347   -5.438  1.00 0.00 ? 310 THR A C    5  
ATOM 3644  O O    . THR A 1 19 ? 9.743   4.204   -6.358  1.00 0.00 ? 310 THR A O    5  
ATOM 3645  C CB   . THR A 1 19 ? 10.130  4.928   -3.327  1.00 0.00 ? 310 THR A CB   5  
ATOM 3646  O OG1  . THR A 1 19 ? 9.919   5.615   -2.088  1.00 0.00 ? 310 THR A OG1  5  
ATOM 3647  C CG2  . THR A 1 19 ? 11.564  5.139   -3.790  1.00 0.00 ? 310 THR A CG2  5  
ATOM 3648  H H    . THR A 1 19 ? 7.783   5.836   -2.806  1.00 0.00 ? 310 THR A H    5  
ATOM 3649  H HA   . THR A 1 19 ? 9.553   6.307   -4.860  1.00 0.00 ? 310 THR A HA   5  
ATOM 3650  H HB   . THR A 1 19 ? 9.968   3.871   -3.176  1.00 0.00 ? 310 THR A HB   5  
ATOM 3651  H HG1  . THR A 1 19 ? 9.943   4.986   -1.364  1.00 0.00 ? 310 THR A HG1  5  
ATOM 3652  H HG21 . THR A 1 19 ? 12.235  5.017   -2.953  1.00 0.00 ? 310 THR A HG21 5  
ATOM 3653  H HG22 . THR A 1 19 ? 11.669  6.136   -4.193  1.00 0.00 ? 310 THR A HG22 5  
ATOM 3654  H HG23 . THR A 1 19 ? 11.805  4.413   -4.553  1.00 0.00 ? 310 THR A HG23 5  
ATOM 3655  N N    . GLY A 1 20 ? 7.860   3.582   -5.294  1.00 0.00 ? 311 GLY A N    5  
ATOM 3656  C CA   . GLY A 1 20 ? 7.570   2.520   -6.236  1.00 0.00 ? 311 GLY A CA   5  
ATOM 3657  C C    . GLY A 1 20 ? 7.057   1.271   -5.552  1.00 0.00 ? 311 GLY A C    5  
ATOM 3658  O O    . GLY A 1 20 ? 6.326   0.481   -6.152  1.00 0.00 ? 311 GLY A O    5  
ATOM 3659  H H    . GLY A 1 20 ? 7.256   3.739   -4.538  1.00 0.00 ? 311 GLY A H    5  
ATOM 3660  H HA2  . GLY A 1 20 ? 6.820   2.865   -6.932  1.00 0.00 ? 311 GLY A HA2  5  
ATOM 3661  H HA3  . GLY A 1 20 ? 8.471   2.277   -6.780  1.00 0.00 ? 311 GLY A HA3  5  
ATOM 3662  N N    . ARG A 1 21 ? 7.440   1.088   -4.293  1.00 0.00 ? 312 ARG A N    5  
ATOM 3663  C CA   . ARG A 1 21 ? 7.004   -0.074  -3.526  1.00 0.00 ? 312 ARG A CA   5  
ATOM 3664  C C    . ARG A 1 21 ? 5.497   -0.226  -3.598  1.00 0.00 ? 312 ARG A C    5  
ATOM 3665  O O    . ARG A 1 21 ? 4.770   0.749   -3.787  1.00 0.00 ? 312 ARG A O    5  
ATOM 3666  C CB   . ARG A 1 21 ? 7.447   0.036   -2.063  1.00 0.00 ? 312 ARG A CB   5  
ATOM 3667  C CG   . ARG A 1 21 ? 8.618   -0.867  -1.709  1.00 0.00 ? 312 ARG A CG   5  
ATOM 3668  C CD   . ARG A 1 21 ? 9.012   -0.712  -0.248  1.00 0.00 ? 312 ARG A CD   5  
ATOM 3669  N NE   . ARG A 1 21 ? 10.064  -1.649  0.141   1.00 0.00 ? 312 ARG A NE   5  
ATOM 3670  C CZ   . ARG A 1 21 ? 11.333  -1.529  -0.233  1.00 0.00 ? 312 ARG A CZ   5  
ATOM 3671  N NH1  . ARG A 1 21 ? 11.706  -0.525  -1.013  1.00 0.00 ? 312 ARG A NH1  5  
ATOM 3672  N NH2  . ARG A 1 21 ? 12.232  -2.416  0.172   1.00 0.00 ? 312 ARG A NH2  5  
ATOM 3673  H H    . ARG A 1 21 ? 8.031   1.748   -3.873  1.00 0.00 ? 312 ARG A H    5  
ATOM 3674  H HA   . ARG A 1 21 ? 7.450   -0.951  -3.968  1.00 0.00 ? 312 ARG A HA   5  
ATOM 3675  H HB2  . ARG A 1 21 ? 7.732   1.056   -1.857  1.00 0.00 ? 312 ARG A HB2  5  
ATOM 3676  H HG2  . ARG A 1 21 ? 8.335   -1.893  -1.889  1.00 0.00 ? 312 ARG A HG2  5  
ATOM 3677  H HD2  . ARG A 1 21 ? 9.366   0.297   -0.085  1.00 0.00 ? 312 ARG A HD2  5  
ATOM 3678  H HE   . ARG A 1 21 ? 9.810   -2.402  0.714   1.00 0.00 ? 312 ARG A HE   5  
ATOM 3679  H HH11 . ARG A 1 21 ? 11.031  0.146   -1.321  1.00 0.00 ? 312 ARG A HH11 5  
ATOM 3680  H HH12 . ARG A 1 21 ? 12.662  -0.437  -1.293  1.00 0.00 ? 312 ARG A HH12 5  
ATOM 3681  H HH21 . ARG A 1 21 ? 11.955  -3.177  0.760   1.00 0.00 ? 312 ARG A HH21 5  
ATOM 3682  H HH22 . ARG A 1 21 ? 13.187  -2.325  -0.109  1.00 0.00 ? 312 ARG A HH22 5  
ATOM 3683  N N    . VAL A 1 22 ? 5.032   -1.456  -3.448  1.00 0.00 ? 313 VAL A N    5  
ATOM 3684  C CA   . VAL A 1 22 ? 3.610   -1.738  -3.513  1.00 0.00 ? 313 VAL A CA   5  
ATOM 3685  C C    . VAL A 1 22 ? 3.035   -2.061  -2.161  1.00 0.00 ? 313 VAL A C    5  
ATOM 3686  O O    . VAL A 1 22 ? 3.741   -2.170  -1.159  1.00 0.00 ? 313 VAL A O    5  
ATOM 3687  C CB   . VAL A 1 22 ? 3.266   -2.938  -4.427  1.00 0.00 ? 313 VAL A CB   5  
ATOM 3688  C CG1  . VAL A 1 22 ? 2.200   -2.536  -5.410  1.00 0.00 ? 313 VAL A CG1  5  
ATOM 3689  C CG2  . VAL A 1 22 ? 4.488   -3.497  -5.131  1.00 0.00 ? 313 VAL A CG2  5  
ATOM 3690  H H    . VAL A 1 22 ? 5.659   -2.193  -3.293  1.00 0.00 ? 313 VAL A H    5  
ATOM 3691  H HA   . VAL A 1 22 ? 3.111   -0.863  -3.906  1.00 0.00 ? 313 VAL A HA   5  
ATOM 3692  H HB   . VAL A 1 22 ? 2.852   -3.729  -3.814  1.00 0.00 ? 313 VAL A HB   5  
ATOM 3693  H HG11 . VAL A 1 22 ? 2.152   -3.260  -6.207  1.00 0.00 ? 313 VAL A HG11 5  
ATOM 3694  H HG12 . VAL A 1 22 ? 1.251   -2.493  -4.893  1.00 0.00 ? 313 VAL A HG12 5  
ATOM 3695  H HG13 . VAL A 1 22 ? 2.439   -1.563  -5.813  1.00 0.00 ? 313 VAL A HG13 5  
ATOM 3696  H HG21 . VAL A 1 22 ? 5.234   -3.747  -4.393  1.00 0.00 ? 313 VAL A HG21 5  
ATOM 3697  H HG22 . VAL A 1 22 ? 4.207   -4.387  -5.674  1.00 0.00 ? 313 VAL A HG22 5  
ATOM 3698  H HG23 . VAL A 1 22 ? 4.881   -2.762  -5.813  1.00 0.00 ? 313 VAL A HG23 5  
ATOM 3699  N N    . TYR A 1 23 ? 1.728   -2.213  -2.164  1.00 0.00 ? 314 TYR A N    5  
ATOM 3700  C CA   . TYR A 1 23 ? 1.010   -2.605  -0.987  1.00 0.00 ? 314 TYR A CA   5  
ATOM 3701  C C    . TYR A 1 23 ? -0.439  -2.882  -1.310  1.00 0.00 ? 314 TYR A C    5  
ATOM 3702  O O    . TYR A 1 23 ? -0.980  -2.371  -2.290  1.00 0.00 ? 314 TYR A O    5  
ATOM 3703  C CB   . TYR A 1 23 ? 1.113   -1.576  0.137   1.00 0.00 ? 314 TYR A CB   5  
ATOM 3704  C CG   . TYR A 1 23 ? 0.244   -0.347  -0.043  1.00 0.00 ? 314 TYR A CG   5  
ATOM 3705  C CD1  . TYR A 1 23 ? 0.582   0.640   -0.957  1.00 0.00 ? 314 TYR A CD1  5  
ATOM 3706  C CD2  . TYR A 1 23 ? -0.911  -0.173  0.713   1.00 0.00 ? 314 TYR A CD2  5  
ATOM 3707  C CE1  . TYR A 1 23 ? -0.207  1.763   -1.117  1.00 0.00 ? 314 TYR A CE1  5  
ATOM 3708  C CE2  . TYR A 1 23 ? -1.706  0.947   0.556   1.00 0.00 ? 314 TYR A CE2  5  
ATOM 3709  C CZ   . TYR A 1 23 ? -1.349  1.911   -0.360  1.00 0.00 ? 314 TYR A CZ   5  
ATOM 3710  O OH   . TYR A 1 23 ? -2.136  3.027   -0.518  1.00 0.00 ? 314 TYR A OH   5  
ATOM 3711  H H    . TYR A 1 23 ? 1.232   -2.037  -2.994  1.00 0.00 ? 314 TYR A H    5  
ATOM 3712  H HA   . TYR A 1 23 ? 1.464   -3.524  -0.667  1.00 0.00 ? 314 TYR A HA   5  
ATOM 3713  H HB2  . TYR A 1 23 ? 0.812   -2.049  1.058   1.00 0.00 ? 314 TYR A HB2  5  
ATOM 3714  H HD1  . TYR A 1 23 ? 1.477   0.527   -1.547  1.00 0.00 ? 314 TYR A HD1  5  
ATOM 3715  H HD2  . TYR A 1 23 ? -1.186  -0.932  1.434   1.00 0.00 ? 314 TYR A HD2  5  
ATOM 3716  H HE1  . TYR A 1 23 ? 0.075   2.519   -1.829  1.00 0.00 ? 314 TYR A HE1  5  
ATOM 3717  H HE2  . TYR A 1 23 ? -2.593  1.072   1.158   1.00 0.00 ? 314 TYR A HE2  5  
ATOM 3718  H HH   . TYR A 1 23 ? -2.087  3.568   0.272   1.00 0.00 ? 314 TYR A HH   5  
ATOM 3719  N N    . PHE A 1 24 ? -1.062  -3.694  -0.479  1.00 0.00 ? 315 PHE A N    5  
ATOM 3720  C CA   . PHE A 1 24 ? -2.444  -4.045  -0.687  1.00 0.00 ? 315 PHE A CA   5  
ATOM 3721  C C    . PHE A 1 24 ? -3.333  -3.441  0.383   1.00 0.00 ? 315 PHE A C    5  
ATOM 3722  O O    . PHE A 1 24 ? -3.022  -3.484  1.575   1.00 0.00 ? 315 PHE A O    5  
ATOM 3723  C CB   . PHE A 1 24 ? -2.586  -5.563  -0.740  1.00 0.00 ? 315 PHE A CB   5  
ATOM 3724  C CG   . PHE A 1 24 ? -1.961  -6.160  -1.970  1.00 0.00 ? 315 PHE A CG   5  
ATOM 3725  C CD1  . PHE A 1 24 ? -0.613  -5.971  -2.242  1.00 0.00 ? 315 PHE A CD1  5  
ATOM 3726  C CD2  . PHE A 1 24 ? -2.721  -6.899  -2.855  1.00 0.00 ? 315 PHE A CD2  5  
ATOM 3727  C CE1  . PHE A 1 24 ? -0.038  -6.512  -3.377  1.00 0.00 ? 315 PHE A CE1  5  
ATOM 3728  C CE2  . PHE A 1 24 ? -2.153  -7.445  -3.993  1.00 0.00 ? 315 PHE A CE2  5  
ATOM 3729  C CZ   . PHE A 1 24 ? -0.810  -7.250  -4.253  1.00 0.00 ? 315 PHE A CZ   5  
ATOM 3730  H H    . PHE A 1 24 ? -0.579  -4.072  0.284   1.00 0.00 ? 315 PHE A H    5  
ATOM 3731  H HA   . PHE A 1 24 ? -2.732  -3.631  -1.635  1.00 0.00 ? 315 PHE A HA   5  
ATOM 3732  H HB2  . PHE A 1 24 ? -2.104  -5.995  0.124   1.00 0.00 ? 315 PHE A HB2  5  
ATOM 3733  H HD1  . PHE A 1 24 ? -0.008  -5.396  -1.556  1.00 0.00 ? 315 PHE A HD1  5  
ATOM 3734  H HD2  . PHE A 1 24 ? -3.771  -7.049  -2.650  1.00 0.00 ? 315 PHE A HD2  5  
ATOM 3735  H HE1  . PHE A 1 24 ? 1.014   -6.355  -3.581  1.00 0.00 ? 315 PHE A HE1  5  
ATOM 3736  H HE2  . PHE A 1 24 ? -2.758  -8.021  -4.676  1.00 0.00 ? 315 PHE A HE2  5  
ATOM 3737  H HZ   . PHE A 1 24 ? -0.364  -7.673  -5.142  1.00 0.00 ? 315 PHE A HZ   5  
ATOM 3738  N N    . VAL A 1 25 ? -4.443  -2.875  -0.065  1.00 0.00 ? 316 VAL A N    5  
ATOM 3739  C CA   . VAL A 1 25 ? -5.392  -2.227  0.820   1.00 0.00 ? 316 VAL A CA   5  
ATOM 3740  C C    . VAL A 1 25 ? -6.640  -3.078  1.016   1.00 0.00 ? 316 VAL A C    5  
ATOM 3741  O O    . VAL A 1 25 ? -7.333  -3.412  0.055   1.00 0.00 ? 316 VAL A O    5  
ATOM 3742  C CB   . VAL A 1 25 ? -5.805  -0.853  0.258   1.00 0.00 ? 316 VAL A CB   5  
ATOM 3743  C CG1  . VAL A 1 25 ? -6.475  -0.015  1.327   1.00 0.00 ? 316 VAL A CG1  5  
ATOM 3744  C CG2  . VAL A 1 25 ? -4.602  -0.124  -0.320  1.00 0.00 ? 316 VAL A CG2  5  
ATOM 3745  H H    . VAL A 1 25 ? -4.630  -2.897  -1.028  1.00 0.00 ? 316 VAL A H    5  
ATOM 3746  H HA   . VAL A 1 25 ? -4.911  -2.077  1.774   1.00 0.00 ? 316 VAL A HA   5  
ATOM 3747  H HB   . VAL A 1 25 ? -6.518  -1.013  -0.538  1.00 0.00 ? 316 VAL A HB   5  
ATOM 3748  H HG11 . VAL A 1 25 ? -7.547  -0.137  1.259   1.00 0.00 ? 316 VAL A HG11 5  
ATOM 3749  H HG12 . VAL A 1 25 ? -6.138  -0.336  2.302   1.00 0.00 ? 316 VAL A HG12 5  
ATOM 3750  H HG13 . VAL A 1 25 ? -6.219  1.024   1.182   1.00 0.00 ? 316 VAL A HG13 5  
ATOM 3751  H HG21 . VAL A 1 25 ? -4.754  0.942   -0.238  1.00 0.00 ? 316 VAL A HG21 5  
ATOM 3752  H HG22 . VAL A 1 25 ? -3.715  -0.406  0.226   1.00 0.00 ? 316 VAL A HG22 5  
ATOM 3753  H HG23 . VAL A 1 25 ? -4.486  -0.392  -1.360  1.00 0.00 ? 316 VAL A HG23 5  
ATOM 3754  N N    . ASP A 1 26 ? -6.924  -3.424  2.268   1.00 0.00 ? 317 ASP A N    5  
ATOM 3755  C CA   . ASP A 1 26 ? -8.094  -4.230  2.591   1.00 0.00 ? 317 ASP A CA   5  
ATOM 3756  C C    . ASP A 1 26 ? -9.272  -3.337  2.965   1.00 0.00 ? 317 ASP A C    5  
ATOM 3757  O O    . ASP A 1 26 ? -9.259  -2.681  4.007   1.00 0.00 ? 317 ASP A O    5  
ATOM 3758  C CB   . ASP A 1 26 ? -7.781  -5.187  3.742   1.00 0.00 ? 317 ASP A CB   5  
ATOM 3759  C CG   . ASP A 1 26 ? -8.593  -6.464  3.667   1.00 0.00 ? 317 ASP A CG   5  
ATOM 3760  O OD1  . ASP A 1 26 ? -9.196  -6.723  2.605   1.00 0.00 ? 317 ASP A OD1  5  
ATOM 3761  O OD2  . ASP A 1 26 ? -8.625  -7.207  4.671   1.00 0.00 ? 317 ASP A OD2  5  
ATOM 3762  H H    . ASP A 1 26 ? -6.331  -3.129  2.990   1.00 0.00 ? 317 ASP A H    5  
ATOM 3763  H HA   . ASP A 1 26 ? -8.354  -4.804  1.716   1.00 0.00 ? 317 ASP A HA   5  
ATOM 3764  H HB2  . ASP A 1 26 ? -6.733  -5.445  3.714   1.00 0.00 ? 317 ASP A HB2  5  
ATOM 3765  N N    . HIS A 1 27 ? -10.287 -3.319  2.108   1.00 0.00 ? 318 HIS A N    5  
ATOM 3766  C CA   . HIS A 1 27 ? -11.472 -2.504  2.345   1.00 0.00 ? 318 HIS A CA   5  
ATOM 3767  C C    . HIS A 1 27 ? -12.434 -3.183  3.321   1.00 0.00 ? 318 HIS A C    5  
ATOM 3768  O O    . HIS A 1 27 ? -13.379 -2.558  3.804   1.00 0.00 ? 318 HIS A O    5  
ATOM 3769  C CB   . HIS A 1 27 ? -12.169 -2.200  1.021   1.00 0.00 ? 318 HIS A CB   5  
ATOM 3770  C CG   . HIS A 1 27 ? -11.447 -1.161  0.222   1.00 0.00 ? 318 HIS A CG   5  
ATOM 3771  N ND1  . HIS A 1 27 ? -11.408 0.147   0.631   1.00 0.00 ? 318 HIS A ND1  5  
ATOM 3772  C CD2  . HIS A 1 27 ? -10.724 -1.291  -0.919  1.00 0.00 ? 318 HIS A CD2  5  
ATOM 3773  C CE1  . HIS A 1 27 ? -10.666 0.782   -0.253  1.00 0.00 ? 318 HIS A CE1  5  
ATOM 3774  N NE2  . HIS A 1 27 ? -10.229 -0.046  -1.215  1.00 0.00 ? 318 HIS A NE2  5  
ATOM 3775  H H    . HIS A 1 27 ? -10.240 -3.869  1.299   1.00 0.00 ? 318 HIS A H    5  
ATOM 3776  H HA   . HIS A 1 27 ? -11.143 -1.570  2.781   1.00 0.00 ? 318 HIS A HA   5  
ATOM 3777  H HB2  . HIS A 1 27 ? -12.224 -3.102  0.431   1.00 0.00 ? 318 HIS A HB2  5  
ATOM 3778  H HD2  . HIS A 1 27 ? -10.556 -2.196  -1.480  1.00 0.00 ? 318 HIS A HD2  5  
ATOM 3779  H HE1  . HIS A 1 27 ? -10.419 1.830   -0.195  1.00 0.00 ? 318 HIS A HE1  5  
ATOM 3780  H HE2  . HIS A 1 27 ? -9.846  0.226   -2.076  1.00 0.00 ? 318 HIS A HE2  5  
ATOM 3781  N N    . ASN A 1 28 ? -12.193 -4.462  3.608   1.00 0.00 ? 319 ASN A N    5  
ATOM 3782  C CA   . ASN A 1 28 ? -13.032 -5.206  4.540   1.00 0.00 ? 319 ASN A CA   5  
ATOM 3783  C C    . ASN A 1 28 ? -12.593 -4.932  5.975   1.00 0.00 ? 319 ASN A C    5  
ATOM 3784  O O    . ASN A 1 28 ? -13.395 -4.525  6.816   1.00 0.00 ? 319 ASN A O    5  
ATOM 3785  C CB   . ASN A 1 28 ? -12.953 -6.705  4.249   1.00 0.00 ? 319 ASN A CB   5  
ATOM 3786  C CG   . ASN A 1 28 ? -13.029 -7.013  2.768   1.00 0.00 ? 319 ASN A CG   5  
ATOM 3787  O OD1  . ASN A 1 28 ? -13.703 -6.315  2.010   1.00 0.00 ? 319 ASN A OD1  5  
ATOM 3788  N ND2  . ASN A 1 28 ? -12.335 -8.064  2.346   1.00 0.00 ? 319 ASN A ND2  5  
ATOM 3789  H H    . ASN A 1 28 ? -11.438 -4.917  3.182   1.00 0.00 ? 319 ASN A H    5  
ATOM 3790  H HA   . ASN A 1 28 ? -14.051 -4.872  4.415   1.00 0.00 ? 319 ASN A HA   5  
ATOM 3791  H HB2  . ASN A 1 28 ? -12.019 -7.092  4.631   1.00 0.00 ? 319 ASN A HB2  5  
ATOM 3792  H HD21 . ASN A 1 28 ? -11.821 -8.575  3.007   1.00 0.00 ? 319 ASN A HD21 5  
ATOM 3793  H HD22 . ASN A 1 28 ? -12.367 -8.288  1.393   1.00 0.00 ? 319 ASN A HD22 5  
ATOM 3794  N N    . ASN A 1 29 ? -11.311 -5.160  6.244   1.00 0.00 ? 320 ASN A N    5  
ATOM 3795  C CA   . ASN A 1 29 ? -10.750 -4.933  7.572   1.00 0.00 ? 320 ASN A CA   5  
ATOM 3796  C C    . ASN A 1 29 ? -10.243 -3.499  7.714   1.00 0.00 ? 320 ASN A C    5  
ATOM 3797  O O    . ASN A 1 29 ? -10.029 -3.018  8.826   1.00 0.00 ? 320 ASN A O    5  
ATOM 3798  C CB   . ASN A 1 29 ? -9.607  -5.913  7.842   1.00 0.00 ? 320 ASN A CB   5  
ATOM 3799  C CG   . ASN A 1 29 ? -10.051 -7.359  7.755   1.00 0.00 ? 320 ASN A CG   5  
ATOM 3800  O OD1  . ASN A 1 29 ? -11.033 -7.759  8.378   1.00 0.00 ? 320 ASN A OD1  5  
ATOM 3801  N ND2  . ASN A 1 29 ? -9.322  -8.151  6.979   1.00 0.00 ? 320 ASN A ND2  5  
ATOM 3802  H H    . ASN A 1 29 ? -10.726 -5.492  5.531   1.00 0.00 ? 320 ASN A H    5  
ATOM 3803  H HA   . ASN A 1 29 ? -11.534 -5.099  8.295   1.00 0.00 ? 320 ASN A HA   5  
ATOM 3804  H HB2  . ASN A 1 29 ? -8.823  -5.755  7.117   1.00 0.00 ? 320 ASN A HB2  5  
ATOM 3805  H HD21 . ASN A 1 29 ? -8.551  -7.763  6.514   1.00 0.00 ? 320 ASN A HD21 5  
ATOM 3806  H HD22 . ASN A 1 29 ? -9.584  -9.091  6.902   1.00 0.00 ? 320 ASN A HD22 5  
ATOM 3807  N N    . ARG A 1 30 ? -10.050 -2.821  6.583   1.00 0.00 ? 321 ARG A N    5  
ATOM 3808  C CA   . ARG A 1 30 ? -9.563  -1.447  6.587   1.00 0.00 ? 321 ARG A CA   5  
ATOM 3809  C C    . ARG A 1 30 ? -8.117  -1.388  7.068   1.00 0.00 ? 321 ARG A C    5  
ATOM 3810  O O    . ARG A 1 30 ? -7.812  -0.749  8.075   1.00 0.00 ? 321 ARG A O    5  
ATOM 3811  C CB   . ARG A 1 30 ? -10.449 -0.567  7.472   1.00 0.00 ? 321 ARG A CB   5  
ATOM 3812  C CG   . ARG A 1 30 ? -11.920 -0.617  7.092   1.00 0.00 ? 321 ARG A CG   5  
ATOM 3813  C CD   . ARG A 1 30 ? -12.777 -1.180  8.217   1.00 0.00 ? 321 ARG A CD   5  
ATOM 3814  N NE   . ARG A 1 30 ? -12.992 -0.205  9.289   1.00 0.00 ? 321 ARG A NE   5  
ATOM 3815  C CZ   . ARG A 1 30 ? -12.319 -0.181  10.443  1.00 0.00 ? 321 ARG A CZ   5  
ATOM 3816  N NH1  . ARG A 1 30 ? -11.363 -1.066  10.702  1.00 0.00 ? 321 ARG A NH1  5  
ATOM 3817  N NH2  . ARG A 1 30 ? -12.606 0.746   11.348  1.00 0.00 ? 321 ARG A NH2  5  
ATOM 3818  H H    . ARG A 1 30 ? -10.237 -3.253  5.726   1.00 0.00 ? 321 ARG A H    5  
ATOM 3819  H HA   . ARG A 1 30 ? -9.606  -1.079  5.573   1.00 0.00 ? 321 ARG A HA   5  
ATOM 3820  H HB2  . ARG A 1 30 ? -10.350 -0.888  8.496   1.00 0.00 ? 321 ARG A HB2  5  
ATOM 3821  H HG2  . ARG A 1 30 ? -12.257 0.383   6.866   1.00 0.00 ? 321 ARG A HG2  5  
ATOM 3822  H HD2  . ARG A 1 30 ? -13.736 -1.461  7.809   1.00 0.00 ? 321 ARG A HD2  5  
ATOM 3823  H HE   . ARG A 1 30 ? -13.684 0.472   9.142   1.00 0.00 ? 321 ARG A HE   5  
ATOM 3824  H HH11 . ARG A 1 30 ? -11.129 -1.767  10.033  1.00 0.00 ? 321 ARG A HH11 5  
ATOM 3825  H HH12 . ARG A 1 30 ? -10.874 -1.029  11.573  1.00 0.00 ? 321 ARG A HH12 5  
ATOM 3826  H HH21 . ARG A 1 30 ? -13.323 1.419   11.165  1.00 0.00 ? 321 ARG A HH21 5  
ATOM 3827  H HH22 . ARG A 1 30 ? -12.107 0.770   12.215  1.00 0.00 ? 321 ARG A HH22 5  
ATOM 3828  N N    . THR A 1 31 ? -7.232  -2.063  6.340   1.00 0.00 ? 322 THR A N    5  
ATOM 3829  C CA   . THR A 1 31 ? -5.817  -2.090  6.690   1.00 0.00 ? 322 THR A CA   5  
ATOM 3830  C C    . THR A 1 31 ? -4.939  -2.145  5.448   1.00 0.00 ? 322 THR A C    5  
ATOM 3831  O O    . THR A 1 31 ? -5.404  -1.899  4.335   1.00 0.00 ? 322 THR A O    5  
ATOM 3832  C CB   . THR A 1 31 ? -5.481  -3.289  7.597   1.00 0.00 ? 322 THR A CB   5  
ATOM 3833  O OG1  . THR A 1 31 ? -4.115  -3.215  8.022   1.00 0.00 ? 322 THR A OG1  5  
ATOM 3834  C CG2  . THR A 1 31 ? -5.718  -4.604  6.871   1.00 0.00 ? 322 THR A CG2  5  
ATOM 3835  H H    . THR A 1 31 ? -7.538  -2.553  5.548   1.00 0.00 ? 322 THR A H    5  
ATOM 3836  H HA   . THR A 1 31 ? -5.591  -1.184  7.232   1.00 0.00 ? 322 THR A HA   5  
ATOM 3837  H HB   . THR A 1 31 ? -6.122  -3.255  8.466   1.00 0.00 ? 322 THR A HB   5  
ATOM 3838  H HG1  . THR A 1 31 ? -4.080  -3.178  8.982   1.00 0.00 ? 322 THR A HG1  5  
ATOM 3839  H HG21 . THR A 1 31 ? -5.095  -5.372  7.305   1.00 0.00 ? 322 THR A HG21 5  
ATOM 3840  H HG22 . THR A 1 31 ? -5.471  -4.489  5.826   1.00 0.00 ? 322 THR A HG22 5  
ATOM 3841  H HG23 . THR A 1 31 ? -6.756  -4.887  6.967   1.00 0.00 ? 322 THR A HG23 5  
ATOM 3842  N N    . THR A 1 32 ? -3.667  -2.470  5.647   1.00 0.00 ? 323 THR A N    5  
ATOM 3843  C CA   . THR A 1 32 ? -2.716  -2.550  4.547   1.00 0.00 ? 323 THR A CA   5  
ATOM 3844  C C    . THR A 1 32 ? -1.711  -3.675  4.766   1.00 0.00 ? 323 THR A C    5  
ATOM 3845  O O    . THR A 1 32 ? -1.617  -4.231  5.861   1.00 0.00 ? 323 THR A O    5  
ATOM 3846  C CB   . THR A 1 32 ? -1.947  -1.228  4.375   1.00 0.00 ? 323 THR A CB   5  
ATOM 3847  O OG1  . THR A 1 32 ? -1.492  -0.766  5.652   1.00 0.00 ? 323 THR A OG1  5  
ATOM 3848  C CG2  . THR A 1 32 ? -2.830  -0.167  3.728   1.00 0.00 ? 323 THR A CG2  5  
ATOM 3849  H H    . THR A 1 32 ? -3.361  -2.663  6.557   1.00 0.00 ? 323 THR A H    5  
ATOM 3850  H HA   . THR A 1 32 ? -3.270  -2.743  3.640   1.00 0.00 ? 323 THR A HA   5  
ATOM 3851  H HB   . THR A 1 32 ? -1.087  -1.406  3.737   1.00 0.00 ? 323 THR A HB   5  
ATOM 3852  H HG1  . THR A 1 32 ? -0.553  -0.577  5.609   1.00 0.00 ? 323 THR A HG1  5  
ATOM 3853  H HG21 . THR A 1 32 ? -2.597  0.802   4.149   1.00 0.00 ? 323 THR A HG21 5  
ATOM 3854  H HG22 . THR A 1 32 ? -3.870  -0.399  3.912   1.00 0.00 ? 323 THR A HG22 5  
ATOM 3855  H HG23 . THR A 1 32 ? -2.648  -0.149  2.664   1.00 0.00 ? 323 THR A HG23 5  
ATOM 3856  N N    . GLN A 1 33 ? -0.960  -4.005  3.720   1.00 0.00 ? 324 GLN A N    5  
ATOM 3857  C CA   . GLN A 1 33 ? 0.044   -5.062  3.807   1.00 0.00 ? 324 GLN A CA   5  
ATOM 3858  C C    . GLN A 1 33 ? 0.819   -5.198  2.501   1.00 0.00 ? 324 GLN A C    5  
ATOM 3859  O O    . GLN A 1 33 ? 0.231   -5.248  1.421   1.00 0.00 ? 324 GLN A O    5  
ATOM 3860  C CB   . GLN A 1 33 ? -0.608  -6.405  4.158   1.00 0.00 ? 324 GLN A CB   5  
ATOM 3861  C CG   . GLN A 1 33 ? -2.063  -6.525  3.732   1.00 0.00 ? 324 GLN A CG   5  
ATOM 3862  C CD   . GLN A 1 33 ? -2.534  -7.965  3.686   1.00 0.00 ? 324 GLN A CD   5  
ATOM 3863  O OE1  . GLN A 1 33 ? -3.041  -8.496  4.674   1.00 0.00 ? 324 GLN A OE1  5  
ATOM 3864  N NE2  . GLN A 1 33 ? -2.362  -8.606  2.537   1.00 0.00 ? 324 GLN A NE2  5  
ATOM 3865  H H    . GLN A 1 33 ? -1.088  -3.532  2.871   1.00 0.00 ? 324 GLN A H    5  
ATOM 3866  H HA   . GLN A 1 33 ? 0.735   -4.795  4.591   1.00 0.00 ? 324 GLN A HA   5  
ATOM 3867  H HB2  . GLN A 1 33 ? -0.053  -7.193  3.672   1.00 0.00 ? 324 GLN A HB2  5  
ATOM 3868  H HG2  . GLN A 1 33 ? -2.676  -5.984  4.437   1.00 0.00 ? 324 GLN A HG2  5  
ATOM 3869  H HE21 . GLN A 1 33 ? -1.948  -8.121  1.793   1.00 0.00 ? 324 GLN A HE21 5  
ATOM 3870  H HE22 . GLN A 1 33 ? -2.657  -9.538  2.478   1.00 0.00 ? 324 GLN A HE22 5  
ATOM 3871  N N    . PHE A 1 34 ? 2.142   -5.267  2.609   1.00 0.00 ? 325 PHE A N    5  
ATOM 3872  C CA   . PHE A 1 34 ? 3.002   -5.413  1.438   1.00 0.00 ? 325 PHE A CA   5  
ATOM 3873  C C    . PHE A 1 34 ? 2.925   -6.840  0.914   1.00 0.00 ? 325 PHE A C    5  
ATOM 3874  O O    . PHE A 1 34 ? 3.938   -7.538  0.846   1.00 0.00 ? 325 PHE A O    5  
ATOM 3875  C CB   . PHE A 1 34 ? 4.457   -5.097  1.798   1.00 0.00 ? 325 PHE A CB   5  
ATOM 3876  C CG   . PHE A 1 34 ? 4.837   -3.637  1.735   1.00 0.00 ? 325 PHE A CG   5  
ATOM 3877  C CD1  . PHE A 1 34 ? 3.901   -2.648  1.464   1.00 0.00 ? 325 PHE A CD1  5  
ATOM 3878  C CD2  . PHE A 1 34 ? 6.154   -3.259  1.948   1.00 0.00 ? 325 PHE A CD2  5  
ATOM 3879  C CE1  . PHE A 1 34 ? 4.277   -1.316  1.405   1.00 0.00 ? 325 PHE A CE1  5  
ATOM 3880  C CE2  . PHE A 1 34 ? 6.530   -1.933  1.890   1.00 0.00 ? 325 PHE A CE2  5  
ATOM 3881  C CZ   . PHE A 1 34 ? 5.591   -0.962  1.617   1.00 0.00 ? 325 PHE A CZ   5  
ATOM 3882  H H    . PHE A 1 34 ? 2.550   -5.229  3.499   1.00 0.00 ? 325 PHE A H    5  
ATOM 3883  H HA   . PHE A 1 34 ? 2.660   -4.733  0.672   1.00 0.00 ? 325 PHE A HA   5  
ATOM 3884  H HB2  . PHE A 1 34 ? 4.648   -5.445  2.800   1.00 0.00 ? 325 PHE A HB2  5  
ATOM 3885  H HD1  . PHE A 1 34 ? 2.870   -2.922  1.299   1.00 0.00 ? 325 PHE A HD1  5  
ATOM 3886  H HD2  . PHE A 1 34 ? 6.892   -4.016  2.164   1.00 0.00 ? 325 PHE A HD2  5  
ATOM 3887  H HE1  . PHE A 1 34 ? 3.544   -0.550  1.199   1.00 0.00 ? 325 PHE A HE1  5  
ATOM 3888  H HE2  . PHE A 1 34 ? 7.558   -1.657  2.060   1.00 0.00 ? 325 PHE A HE2  5  
ATOM 3889  H HZ   . PHE A 1 34 ? 5.885   0.077   1.571   1.00 0.00 ? 325 PHE A HZ   5  
ATOM 3890  N N    . THR A 1 35 ? 1.730   -7.277  0.544   1.00 0.00 ? 326 THR A N    5  
ATOM 3891  C CA   . THR A 1 35 ? 1.553   -8.632  0.057   1.00 0.00 ? 326 THR A CA   5  
ATOM 3892  C C    . THR A 1 35 ? 0.221   -8.816  -0.654  1.00 0.00 ? 326 THR A C    5  
ATOM 3893  O O    . THR A 1 35 ? -0.752  -8.118  -0.371  1.00 0.00 ? 326 THR A O    5  
ATOM 3894  C CB   . THR A 1 35 ? 1.633   -9.637  1.215   1.00 0.00 ? 326 THR A CB   5  
ATOM 3895  O OG1  . THR A 1 35 ? 2.286   -9.037  2.340   1.00 0.00 ? 326 THR A OG1  5  
ATOM 3896  C CG2  . THR A 1 35 ? 2.388   -10.882 0.793   1.00 0.00 ? 326 THR A CG2  5  
ATOM 3897  H H    . THR A 1 35 ? 0.957   -6.679  0.596   1.00 0.00 ? 326 THR A H    5  
ATOM 3898  H HA   . THR A 1 35 ? 2.355   -8.848  -0.634  1.00 0.00 ? 326 THR A HA   5  
ATOM 3899  H HB   . THR A 1 35 ? 0.629   -9.920  1.498   1.00 0.00 ? 326 THR A HB   5  
ATOM 3900  H HG1  . THR A 1 35 ? 3.236   -9.041  2.201   1.00 0.00 ? 326 THR A HG1  5  
ATOM 3901  H HG21 . THR A 1 35 ? 2.641   -11.462 1.667   1.00 0.00 ? 326 THR A HG21 5  
ATOM 3902  H HG22 . THR A 1 35 ? 3.292   -10.594 0.276   1.00 0.00 ? 326 THR A HG22 5  
ATOM 3903  H HG23 . THR A 1 35 ? 1.766   -11.471 0.135   1.00 0.00 ? 326 THR A HG23 5  
ATOM 3904  N N    . ASP A 1 36 ? 0.191   -9.765  -1.582  1.00 0.00 ? 327 ASP A N    5  
ATOM 3905  C CA   . ASP A 1 36 ? -1.021  -10.068 -2.324  1.00 0.00 ? 327 ASP A CA   5  
ATOM 3906  C C    . ASP A 1 36 ? -1.785  -11.191 -1.627  1.00 0.00 ? 327 ASP A C    5  
ATOM 3907  O O    . ASP A 1 36 ? -1.328  -12.334 -1.608  1.00 0.00 ? 327 ASP A O    5  
ATOM 3908  C CB   . ASP A 1 36 ? -0.681  -10.478 -3.758  1.00 0.00 ? 327 ASP A CB   5  
ATOM 3909  C CG   . ASP A 1 36 ? -1.900  -10.482 -4.661  1.00 0.00 ? 327 ASP A CG   5  
ATOM 3910  O OD1  . ASP A 1 36 ? -3.031  -10.499 -4.132  1.00 0.00 ? 327 ASP A OD1  5  
ATOM 3911  O OD2  . ASP A 1 36 ? -1.723  -10.467 -5.897  1.00 0.00 ? 327 ASP A OD2  5  
ATOM 3912  H H    . ASP A 1 36 ? 1.007   -10.271 -1.773  1.00 0.00 ? 327 ASP A H    5  
ATOM 3913  H HA   . ASP A 1 36 ? -1.625  -9.178  -2.345  1.00 0.00 ? 327 ASP A HA   5  
ATOM 3914  H HB2  . ASP A 1 36 ? 0.041   -9.785  -4.163  1.00 0.00 ? 327 ASP A HB2  5  
ATOM 3915  N N    . PRO A 1 37 ? -2.960  -10.894 -1.042  1.00 0.00 ? 328 PRO A N    5  
ATOM 3916  C CA   . PRO A 1 37 ? -3.761  -11.896 -0.335  1.00 0.00 ? 328 PRO A CA   5  
ATOM 3917  C C    . PRO A 1 37 ? -3.909  -13.180 -1.139  1.00 0.00 ? 328 PRO A C    5  
ATOM 3918  O O    . PRO A 1 37 ? -3.992  -14.272 -0.575  1.00 0.00 ? 328 PRO A O    5  
ATOM 3919  C CB   . PRO A 1 37 ? -5.127  -11.220 -0.146  1.00 0.00 ? 328 PRO A CB   5  
ATOM 3920  C CG   . PRO A 1 37 ? -5.071  -9.970  -0.960  1.00 0.00 ? 328 PRO A CG   5  
ATOM 3921  C CD   . PRO A 1 37 ? -3.623  -9.585  -1.033  1.00 0.00 ? 328 PRO A CD   5  
ATOM 3922  H HA   . PRO A 1 37 ? -3.335  -12.126 0.632   1.00 0.00 ? 328 PRO A HA   5  
ATOM 3923  H HB2  . PRO A 1 37 ? -5.906  -11.880 -0.495  1.00 0.00 ? 328 PRO A HB2  5  
ATOM 3924  H HG2  . PRO A 1 37 ? -5.459  -10.161 -1.950  1.00 0.00 ? 328 PRO A HG2  5  
ATOM 3925  H HD2  . PRO A 1 37 ? -3.429  -9.034  -1.939  1.00 0.00 ? 328 PRO A HD2  5  
ATOM 3926  N N    . ARG A 1 38 ? -3.945  -13.042 -2.459  1.00 0.00 ? 329 ARG A N    5  
ATOM 3927  C CA   . ARG A 1 38 ? -4.082  -14.189 -3.339  1.00 0.00 ? 329 ARG A CA   5  
ATOM 3928  C C    . ARG A 1 38 ? -2.960  -15.195 -3.106  1.00 0.00 ? 329 ARG A C    5  
ATOM 3929  O O    . ARG A 1 38 ? -3.151  -16.402 -3.257  1.00 0.00 ? 329 ARG A O    5  
ATOM 3930  C CB   . ARG A 1 38 ? -4.077  -13.738 -4.800  1.00 0.00 ? 329 ARG A CB   5  
ATOM 3931  C CG   . ARG A 1 38 ? -5.120  -12.676 -5.112  1.00 0.00 ? 329 ARG A CG   5  
ATOM 3932  C CD   . ARG A 1 38 ? -5.594  -12.752 -6.557  1.00 0.00 ? 329 ARG A CD   5  
ATOM 3933  N NE   . ARG A 1 38 ? -5.791  -14.131 -6.998  1.00 0.00 ? 329 ARG A NE   5  
ATOM 3934  C CZ   . ARG A 1 38 ? -4.985  -14.792 -7.838  1.00 0.00 ? 329 ARG A CZ   5  
ATOM 3935  N NH1  . ARG A 1 38 ? -3.886  -14.227 -8.330  1.00 0.00 ? 329 ARG A NH1  5  
ATOM 3936  N NH2  . ARG A 1 38 ? -5.277  -16.040 -8.175  1.00 0.00 ? 329 ARG A NH2  5  
ATOM 3937  H H    . ARG A 1 38 ? -3.885  -12.145 -2.849  1.00 0.00 ? 329 ARG A H    5  
ATOM 3938  H HA   . ARG A 1 38 ? -5.028  -14.658 -3.119  1.00 0.00 ? 329 ARG A HA   5  
ATOM 3939  H HB2  . ARG A 1 38 ? -3.103  -13.336 -5.037  1.00 0.00 ? 329 ARG A HB2  5  
ATOM 3940  H HG2  . ARG A 1 38 ? -5.969  -12.818 -4.461  1.00 0.00 ? 329 ARG A HG2  5  
ATOM 3941  H HD2  . ARG A 1 38 ? -6.534  -12.226 -6.635  1.00 0.00 ? 329 ARG A HD2  5  
ATOM 3942  H HE   . ARG A 1 38 ? -6.574  -14.599 -6.647  1.00 0.00 ? 329 ARG A HE   5  
ATOM 3943  H HH11 . ARG A 1 38 ? -3.641  -13.295 -8.080  1.00 0.00 ? 329 ARG A HH11 5  
ATOM 3944  H HH12 . ARG A 1 38 ? -3.302  -14.742 -8.957  1.00 0.00 ? 329 ARG A HH12 5  
ATOM 3945  H HH21 . ARG A 1 38 ? -6.094  -16.481 -7.803  1.00 0.00 ? 329 ARG A HH21 5  
ATOM 3946  H HH22 . ARG A 1 38 ? -4.680  -16.543 -8.801  1.00 0.00 ? 329 ARG A HH22 5  
ATOM 3947  N N    . LEU A 1 39 ? -1.788  -14.687 -2.736  1.00 0.00 ? 330 LEU A N    5  
ATOM 3948  C CA   . LEU A 1 39 ? -0.624  -15.534 -2.486  1.00 0.00 ? 330 LEU A CA   5  
ATOM 3949  C C    . LEU A 1 39 ? -0.983  -16.731 -1.609  1.00 0.00 ? 330 LEU A C    5  
ATOM 3950  O O    . LEU A 1 39 ? -0.921  -17.877 -2.054  1.00 0.00 ? 330 LEU A O    5  
ATOM 3951  C CB   . LEU A 1 39 ? 0.490   -14.719 -1.826  1.00 0.00 ? 330 LEU A CB   5  
ATOM 3952  C CG   . LEU A 1 39 ? 1.329   -13.874 -2.786  1.00 0.00 ? 330 LEU A CG   5  
ATOM 3953  C CD1  . LEU A 1 39 ? 2.419   -13.131 -2.030  1.00 0.00 ? 330 LEU A CD1  5  
ATOM 3954  C CD2  . LEU A 1 39 ? 1.935   -14.749 -3.873  1.00 0.00 ? 330 LEU A CD2  5  
ATOM 3955  H H    . LEU A 1 39 ? -1.702  -13.717 -2.627  1.00 0.00 ? 330 LEU A H    5  
ATOM 3956  H HA   . LEU A 1 39 ? -0.272  -15.896 -3.439  1.00 0.00 ? 330 LEU A HA   5  
ATOM 3957  H HB2  . LEU A 1 39 ? 0.040   -14.061 -1.096  1.00 0.00 ? 330 LEU A HB2  5  
ATOM 3958  H HG   . LEU A 1 39 ? 0.693   -13.141 -3.260  1.00 0.00 ? 330 LEU A HG   5  
ATOM 3959  H HD11 . LEU A 1 39 ? 2.158   -13.072 -0.985  1.00 0.00 ? 330 LEU A HD11 5  
ATOM 3960  H HD12 . LEU A 1 39 ? 3.355   -13.657 -2.138  1.00 0.00 ? 330 LEU A HD12 5  
ATOM 3961  H HD13 . LEU A 1 39 ? 2.519   -12.133 -2.433  1.00 0.00 ? 330 LEU A HD13 5  
ATOM 3962  H HD21 . LEU A 1 39 ? 1.818   -15.788 -3.606  1.00 0.00 ? 330 LEU A HD21 5  
ATOM 3963  H HD22 . LEU A 1 39 ? 1.432   -14.559 -4.810  1.00 0.00 ? 330 LEU A HD22 5  
ATOM 3964  H HD23 . LEU A 1 39 ? 2.986   -14.519 -3.975  1.00 0.00 ? 330 LEU A HD23 5  
ATOM 3965  N N    . SER A 1 40 ? -1.357  -16.459 -0.364  1.00 0.00 ? 331 SER A N    5  
ATOM 3966  C CA   . SER A 1 40 ? -1.722  -17.517 0.571   1.00 0.00 ? 331 SER A CA   5  
ATOM 3967  C C    . SER A 1 40 ? -3.233  -17.725 0.602   1.00 0.00 ? 331 SER A C    5  
ATOM 3968  O O    . SER A 1 40 ? -4.003  -16.780 0.432   1.00 0.00 ? 331 SER A O    5  
ATOM 3969  C CB   . SER A 1 40 ? -1.212  -17.186 1.975   1.00 0.00 ? 331 SER A CB   5  
ATOM 3970  O OG   . SER A 1 40 ? 0.141   -16.766 1.940   1.00 0.00 ? 331 SER A OG   5  
ATOM 3971  H H    . SER A 1 40 ? -1.388  -15.525 -0.066  1.00 0.00 ? 331 SER A H    5  
ATOM 3972  H HA   . SER A 1 40 ? -1.253  -18.430 0.234   1.00 0.00 ? 331 SER A HA   5  
ATOM 3973  H HB2  . SER A 1 40 ? -1.810  -16.392 2.396   1.00 0.00 ? 331 SER A HB2  5  
ATOM 3974  H HG   . SER A 1 40 ? 0.240   -15.961 2.455   1.00 0.00 ? 331 SER A HG   5  
ATOM 3975  N N    . ALA A 1 41 ? -3.647  -18.968 0.821   1.00 0.00 ? 332 ALA A N    5  
ATOM 3976  C CA   . ALA A 1 41 ? -5.065  -19.305 0.876   1.00 0.00 ? 332 ALA A CA   5  
ATOM 3977  C C    . ALA A 1 41 ? -5.274  -20.680 1.504   1.00 0.00 ? 332 ALA A C    5  
ATOM 3978  O O    . ALA A 1 41 ? -4.363  -21.238 2.117   1.00 0.00 ? 332 ALA A O    5  
ATOM 3979  C CB   . ALA A 1 41 ? -5.673  -19.263 -0.520  1.00 0.00 ? 332 ALA A CB   5  
ATOM 3980  H H    . ALA A 1 41 ? -2.983  -19.678 0.947   1.00 0.00 ? 332 ALA A H    5  
ATOM 3981  H HA   . ALA A 1 41 ? -5.561  -18.562 1.486   1.00 0.00 ? 332 ALA A HA   5  
ATOM 3982  H HB1  . ALA A 1 41 ? -5.404  -18.335 -1.004  1.00 0.00 ? 332 ALA A HB1  5  
ATOM 3983  H HB2  . ALA A 1 41 ? -5.297  -20.092 -1.101  1.00 0.00 ? 332 ALA A HB2  5  
ATOM 3984  H HB3  . ALA A 1 41 ? -6.749  -19.332 -0.448  1.00 0.00 ? 332 ALA A HB3  5  
ATOM 3985  N N    . ASN A 1 42 ? -6.479  -21.220 1.350   1.00 0.00 ? 333 ASN A N    5  
ATOM 3986  C CA   . ASN A 1 42 ? -6.804  -22.530 1.901   1.00 0.00 ? 333 ASN A CA   5  
ATOM 3987  C C    . ASN A 1 42 ? -8.268  -22.879 1.649   1.00 0.00 ? 333 ASN A C    5  
ATOM 3988  O O    . ASN A 1 42 ? -8.905  -22.192 0.823   1.00 0.00 ? 333 ASN A O    5  
ATOM 3989  C CB   . ASN A 1 42 ? -6.512  -22.563 3.402   1.00 0.00 ? 333 ASN A CB   5  
ATOM 3990  C CG   . ASN A 1 42 ? -7.063  -21.350 4.125   1.00 0.00 ? 333 ASN A CG   5  
ATOM 3991  O OD1  . ASN A 1 42 ? -8.268  -21.244 4.353   1.00 0.00 ? 333 ASN A OD1  5  
ATOM 3992  N ND2  . ASN A 1 42 ? -6.182  -20.427 4.489   1.00 0.00 ? 333 ASN A ND2  5  
ATOM 3993  O OXT  . ASN A 1 42 ? -8.765  -23.835 2.279   1.00 0.00 ? 333 ASN A OXT  5  
ATOM 3994  H H    . ASN A 1 42 ? -7.165  -20.725 0.855   1.00 0.00 ? 333 ASN A H    5  
ATOM 3995  H HA   . ASN A 1 42 ? -6.183  -23.261 1.406   1.00 0.00 ? 333 ASN A HA   5  
ATOM 3996  H HB2  . ASN A 1 42 ? -6.958  -23.448 3.830   1.00 0.00 ? 333 ASN A HB2  5  
ATOM 3997  H HD21 . ASN A 1 42 ? -5.237  -20.579 4.275   1.00 0.00 ? 333 ASN A HD21 5  
ATOM 3998  H HD22 . ASN A 1 42 ? -6.510  -19.632 4.958   1.00 0.00 ? 333 ASN A HD22 5  
ATOM 3999  N N    . GLY B 2 1  ? 22.203  -3.199  -4.099  1.00 0.00 ? 198 GLY B N    5  
ATOM 4000  C CA   . GLY B 2 1  ? 21.375  -2.679  -2.976  1.00 0.00 ? 198 GLY B CA   5  
ATOM 4001  C C    . GLY B 2 1  ? 21.414  -3.591  -1.762  1.00 0.00 ? 198 GLY B C    5  
ATOM 4002  O O    . GLY B 2 1  ? 22.013  -4.664  -1.818  1.00 0.00 ? 198 GLY B O    5  
ATOM 4003  H H1   . GLY B 2 1  ? 22.115  -4.235  -4.159  1.00 0.00 ? 198 GLY B H1   5  
ATOM 4004  H H2   . GLY B 2 1  ? 23.203  -2.956  -3.948  1.00 0.00 ? 198 GLY B H2   5  
ATOM 4005  H H3   . GLY B 2 1  ? 21.889  -2.782  -4.999  1.00 0.00 ? 198 GLY B H3   5  
ATOM 4006  H HA2  . GLY B 2 1  ? 21.744  -1.704  -2.699  1.00 0.00 ? 198 GLY B HA2  5  
ATOM 4007  H HA3  . GLY B 2 1  ? 20.354  -2.588  -3.316  1.00 0.00 ? 198 GLY B HA3  5  
ATOM 4008  N N    . PRO B 2 2  ? 20.785  -3.193  -0.638  1.00 0.00 ? 199 PRO B N    5  
ATOM 4009  C CA   . PRO B 2 2  ? 20.771  -4.011  0.582   1.00 0.00 ? 199 PRO B CA   5  
ATOM 4010  C C    . PRO B 2 2  ? 19.960  -5.291  0.406   1.00 0.00 ? 199 PRO B C    5  
ATOM 4011  O O    . PRO B 2 2  ? 20.424  -6.382  0.738   1.00 0.00 ? 199 PRO B O    5  
ATOM 4012  C CB   . PRO B 2 2  ? 20.115  -3.099  1.622   1.00 0.00 ? 199 PRO B CB   5  
ATOM 4013  C CG   . PRO B 2 2  ? 19.298  -2.141  0.827   1.00 0.00 ? 199 PRO B CG   5  
ATOM 4014  C CD   . PRO B 2 2  ? 20.044  -1.927  -0.459  1.00 0.00 ? 199 PRO B CD   5  
ATOM 4015  H HA   . PRO B 2 2  ? 21.772  -4.263  0.898   1.00 0.00 ? 199 PRO B HA   5  
ATOM 4016  H HB2  . PRO B 2 2  ? 19.500  -3.690  2.284   1.00 0.00 ? 199 PRO B HB2  5  
ATOM 4017  H HG2  . PRO B 2 2  ? 18.325  -2.565  0.630   1.00 0.00 ? 199 PRO B HG2  5  
ATOM 4018  H HD2  . PRO B 2 2  ? 19.349  -1.763  -1.269  1.00 0.00 ? 199 PRO B HD2  5  
ATOM 4019  N N    . LEU B 2 3  ? 18.746  -5.147  -0.114  1.00 0.00 ? 200 LEU B N    5  
ATOM 4020  C CA   . LEU B 2 3  ? 17.870  -6.292  -0.337  1.00 0.00 ? 200 LEU B CA   5  
ATOM 4021  C C    . LEU B 2 3  ? 17.674  -7.089  0.948   1.00 0.00 ? 200 LEU B C    5  
ATOM 4022  O O    . LEU B 2 3  ? 18.379  -8.067  1.195   1.00 0.00 ? 200 LEU B O    5  
ATOM 4023  C CB   . LEU B 2 3  ? 18.447  -7.196  -1.429  1.00 0.00 ? 200 LEU B CB   5  
ATOM 4024  C CG   . LEU B 2 3  ? 17.426  -7.732  -2.434  1.00 0.00 ? 200 LEU B CG   5  
ATOM 4025  C CD1  . LEU B 2 3  ? 18.071  -7.935  -3.796  1.00 0.00 ? 200 LEU B CD1  5  
ATOM 4026  C CD2  . LEU B 2 3  ? 16.818  -9.034  -1.932  1.00 0.00 ? 200 LEU B CD2  5  
ATOM 4027  H H    . LEU B 2 3  ? 18.431  -4.251  -0.355  1.00 0.00 ? 200 LEU B H    5  
ATOM 4028  H HA   . LEU B 2 3  ? 16.911  -5.916  -0.664  1.00 0.00 ? 200 LEU B HA   5  
ATOM 4029  H HB2  . LEU B 2 3  ? 19.196  -6.637  -1.970  1.00 0.00 ? 200 LEU B HB2  5  
ATOM 4030  H HG   . LEU B 2 3  ? 16.629  -7.012  -2.546  1.00 0.00 ? 200 LEU B HG   5  
ATOM 4031  H HD11 . LEU B 2 3  ? 17.302  -8.031  -4.548  1.00 0.00 ? 200 LEU B HD11 5  
ATOM 4032  H HD12 . LEU B 2 3  ? 18.696  -7.085  -4.029  1.00 0.00 ? 200 LEU B HD12 5  
ATOM 4033  H HD13 . LEU B 2 3  ? 18.674  -8.830  -3.779  1.00 0.00 ? 200 LEU B HD13 5  
ATOM 4034  H HD21 . LEU B 2 3  ? 15.783  -9.087  -2.233  1.00 0.00 ? 200 LEU B HD21 5  
ATOM 4035  H HD22 . LEU B 2 3  ? 17.359  -9.869  -2.352  1.00 0.00 ? 200 LEU B HD22 5  
ATOM 4036  H HD23 . LEU B 2 3  ? 16.882  -9.070  -0.854  1.00 0.00 ? 200 LEU B HD23 5  
ATOM 4037  N N    . GLY B 2 4  ? 16.711  -6.668  1.762   1.00 0.00 ? 201 GLY B N    5  
ATOM 4038  C CA   . GLY B 2 4  ? 16.441  -7.359  3.009   1.00 0.00 ? 201 GLY B CA   5  
ATOM 4039  C C    . GLY B 2 4  ? 15.821  -6.454  4.057   1.00 0.00 ? 201 GLY B C    5  
ATOM 4040  O O    . GLY B 2 4  ? 14.600  -6.394  4.190   1.00 0.00 ? 201 GLY B O    5  
ATOM 4041  H H    . GLY B 2 4  ? 16.181  -5.882  1.513   1.00 0.00 ? 201 GLY B H    5  
ATOM 4042  H HA2  . GLY B 2 4  ? 15.765  -8.178  2.814   1.00 0.00 ? 201 GLY B HA2  5  
ATOM 4043  H HA3  . GLY B 2 4  ? 17.368  -7.755  3.394   1.00 0.00 ? 201 GLY B HA3  5  
ATOM 4044  N N    . SER B 2 5  ? 16.667  -5.751  4.804   1.00 0.00 ? 202 SER B N    5  
ATOM 4045  C CA   . SER B 2 5  ? 16.197  -4.850  5.850   1.00 0.00 ? 202 SER B CA   5  
ATOM 4046  C C    . SER B 2 5  ? 15.283  -3.770  5.277   1.00 0.00 ? 202 SER B C    5  
ATOM 4047  O O    . SER B 2 5  ? 14.900  -3.822  4.108   1.00 0.00 ? 202 SER B O    5  
ATOM 4048  C CB   . SER B 2 5  ? 17.384  -4.201  6.565   1.00 0.00 ? 202 SER B CB   5  
ATOM 4049  O OG   . SER B 2 5  ? 17.871  -3.085  5.838   1.00 0.00 ? 202 SER B OG   5  
ATOM 4050  H H    . SER B 2 5  ? 17.631  -5.841  4.648   1.00 0.00 ? 202 SER B H    5  
ATOM 4051  H HA   . SER B 2 5  ? 15.637  -5.435  6.563   1.00 0.00 ? 202 SER B HA   5  
ATOM 4052  H HB2  . SER B 2 5  ? 17.075  -3.869  7.544   1.00 0.00 ? 202 SER B HB2  5  
ATOM 4053  H HG   . SER B 2 5  ? 18.829  -3.061  5.894   1.00 0.00 ? 202 SER B HG   5  
ATOM 4054  N N    . GLU B 2 6  ? 14.937  -2.794  6.112   1.00 0.00 ? 203 GLU B N    5  
ATOM 4055  C CA   . GLU B 2 6  ? 14.067  -1.699  5.696   1.00 0.00 ? 203 GLU B CA   5  
ATOM 4056  C C    . GLU B 2 6  ? 12.661  -2.201  5.388   1.00 0.00 ? 203 GLU B C    5  
ATOM 4057  O O    . GLU B 2 6  ? 12.202  -2.130  4.248   1.00 0.00 ? 203 GLU B O    5  
ATOM 4058  C CB   . GLU B 2 6  ? 14.648  -0.994  4.467   1.00 0.00 ? 203 GLU B CB   5  
ATOM 4059  C CG   . GLU B 2 6  ? 13.849  0.225   4.032   1.00 0.00 ? 203 GLU B CG   5  
ATOM 4060  C CD   . GLU B 2 6  ? 14.418  0.883   2.790   1.00 0.00 ? 203 GLU B CD   5  
ATOM 4061  O OE1  . GLU B 2 6  ? 15.578  1.342   2.839   1.00 0.00 ? 203 GLU B OE1  5  
ATOM 4062  O OE2  . GLU B 2 6  ? 13.703  0.940   1.768   1.00 0.00 ? 203 GLU B OE2  5  
ATOM 4063  H H    . GLU B 2 6  ? 15.276  -2.810  7.030   1.00 0.00 ? 203 GLU B H    5  
ATOM 4064  H HA   . GLU B 2 6  ? 14.012  -0.993  6.511   1.00 0.00 ? 203 GLU B HA   5  
ATOM 4065  H HB2  . GLU B 2 6  ? 15.655  -0.677  4.691   1.00 0.00 ? 203 GLU B HB2  5  
ATOM 4066  H HG2  . GLU B 2 6  ? 12.834  -0.080  3.825   1.00 0.00 ? 203 GLU B HG2  5  
ATOM 4067  N N    . LEU B 2 7  ? 11.978  -2.709  6.409   1.00 0.00 ? 204 LEU B N    5  
ATOM 4068  C CA   . LEU B 2 7  ? 10.622  -3.217  6.238   1.00 0.00 ? 204 LEU B CA   5  
ATOM 4069  C C    . LEU B 2 7  ? 9.793   -3.023  7.512   1.00 0.00 ? 204 LEU B C    5  
ATOM 4070  O O    . LEU B 2 7  ? 9.228   -1.951  7.727   1.00 0.00 ? 204 LEU B O    5  
ATOM 4071  C CB   . LEU B 2 7  ? 10.652  -4.692  5.828   1.00 0.00 ? 204 LEU B CB   5  
ATOM 4072  C CG   . LEU B 2 7  ? 10.968  -4.952  4.355   1.00 0.00 ? 204 LEU B CG   5  
ATOM 4073  C CD1  . LEU B 2 7  ? 11.016  -6.447  4.078   1.00 0.00 ? 204 LEU B CD1  5  
ATOM 4074  C CD2  . LEU B 2 7  ? 9.938   -4.277  3.460   1.00 0.00 ? 204 LEU B CD2  5  
ATOM 4075  H H    . LEU B 2 7  ? 12.395  -2.744  7.295   1.00 0.00 ? 204 LEU B H    5  
ATOM 4076  H HA   . LEU B 2 7  ? 10.161  -2.648  5.443   1.00 0.00 ? 204 LEU B HA   5  
ATOM 4077  H HB2  . LEU B 2 7  ? 11.397  -5.194  6.429   1.00 0.00 ? 204 LEU B HB2  5  
ATOM 4078  H HG   . LEU B 2 7  ? 11.939  -4.538  4.122   1.00 0.00 ? 204 LEU B HG   5  
ATOM 4079  H HD11 . LEU B 2 7  ? 10.907  -6.621  3.017   1.00 0.00 ? 204 LEU B HD11 5  
ATOM 4080  H HD12 . LEU B 2 7  ? 11.962  -6.845  4.414   1.00 0.00 ? 204 LEU B HD12 5  
ATOM 4081  H HD13 . LEU B 2 7  ? 10.212  -6.937  4.607   1.00 0.00 ? 204 LEU B HD13 5  
ATOM 4082  H HD21 . LEU B 2 7  ? 10.293  -3.297  3.179   1.00 0.00 ? 204 LEU B HD21 5  
ATOM 4083  H HD22 . LEU B 2 7  ? 9.786   -4.873  2.572   1.00 0.00 ? 204 LEU B HD22 5  
ATOM 4084  H HD23 . LEU B 2 7  ? 9.004   -4.182  3.995   1.00 0.00 ? 204 LEU B HD23 5  
ATOM 4085  N N    . GLU B 2 8  ? 9.731   -4.049  8.362   1.00 0.00 ? 205 GLU B N    5  
ATOM 4086  C CA   . GLU B 2 8  ? 8.953   -3.968  9.594   1.00 0.00 ? 205 GLU B CA   5  
ATOM 4087  C C    . GLU B 2 8  ? 7.463   -3.872  9.277   1.00 0.00 ? 205 GLU B C    5  
ATOM 4088  O O    . GLU B 2 8  ? 6.707   -4.817  9.503   1.00 0.00 ? 205 GLU B O    5  
ATOM 4089  C CB   . GLU B 2 8  ? 9.393   -2.759  10.424  1.00 0.00 ? 205 GLU B CB   5  
ATOM 4090  C CG   . GLU B 2 8  ? 9.833   -3.115  11.832  1.00 0.00 ? 205 GLU B CG   5  
ATOM 4091  C CD   . GLU B 2 8  ? 9.689   -1.958  12.800  1.00 0.00 ? 205 GLU B CD   5  
ATOM 4092  O OE1  . GLU B 2 8  ? 8.623   -1.307  12.792  1.00 0.00 ? 205 GLU B OE1  5  
ATOM 4093  O OE2  . GLU B 2 8  ? 10.641  -1.703  13.566  1.00 0.00 ? 205 GLU B OE2  5  
ATOM 4094  H H    . GLU B 2 8  ? 10.226  -4.871  8.165   1.00 0.00 ? 205 GLU B H    5  
ATOM 4095  H HA   . GLU B 2 8  ? 9.131   -4.870  10.163  1.00 0.00 ? 205 GLU B HA   5  
ATOM 4096  H HB2  . GLU B 2 8  ? 10.219  -2.279  9.926   1.00 0.00 ? 205 GLU B HB2  5  
ATOM 4097  H HG2  . GLU B 2 8  ? 9.231   -3.936  12.181  1.00 0.00 ? 205 GLU B HG2  5  
ATOM 4098  N N    . SER B 2 9  ? 7.052   -2.723  8.752   1.00 0.00 ? 206 SER B N    5  
ATOM 4099  C CA   . SER B 2 9  ? 5.657   -2.499  8.390   1.00 0.00 ? 206 SER B CA   5  
ATOM 4100  C C    . SER B 2 9  ? 5.497   -1.178  7.640   1.00 0.00 ? 206 SER B C    5  
ATOM 4101  O O    . SER B 2 9  ? 4.807   -0.273  8.109   1.00 0.00 ? 206 SER B O    5  
ATOM 4102  C CB   . SER B 2 9  ? 4.776   -2.498  9.640   1.00 0.00 ? 206 SER B CB   5  
ATOM 4103  O OG   . SER B 2 9  ? 3.402   -2.489  9.296   1.00 0.00 ? 206 SER B OG   5  
ATOM 4104  H H    . SER B 2 9  ? 7.703   -2.007  8.603   1.00 0.00 ? 206 SER B H    5  
ATOM 4105  H HA   . SER B 2 9  ? 5.349   -3.307  7.743   1.00 0.00 ? 206 SER B HA   5  
ATOM 4106  H HB2  . SER B 2 9  ? 4.983   -3.382  10.224  1.00 0.00 ? 206 SER B HB2  5  
ATOM 4107  H HG   . SER B 2 9  ? 3.039   -1.613  9.447   1.00 0.00 ? 206 SER B HG   5  
ATOM 4108  N N    . PRO B 2 10 ? 6.134   -1.050  6.462   1.00 0.00 ? 207 PRO B N    5  
ATOM 4109  C CA   . PRO B 2 10 ? 6.065   0.168   5.651   1.00 0.00 ? 207 PRO B CA   5  
ATOM 4110  C C    . PRO B 2 10 ? 4.700   0.439   4.998   1.00 0.00 ? 207 PRO B C    5  
ATOM 4111  O O    . PRO B 2 10 ? 4.346   1.606   4.823   1.00 0.00 ? 207 PRO B O    5  
ATOM 4112  C CB   . PRO B 2 10 ? 7.139   -0.045  4.575   1.00 0.00 ? 207 PRO B CB   5  
ATOM 4113  C CG   . PRO B 2 10 ? 7.935   -1.223  5.025   1.00 0.00 ? 207 PRO B CG   5  
ATOM 4114  C CD   . PRO B 2 10 ? 6.993   -2.064  5.827   1.00 0.00 ? 207 PRO B CD   5  
ATOM 4115  H HA   . PRO B 2 10 ? 6.333   1.029   6.239   1.00 0.00 ? 207 PRO B HA   5  
ATOM 4116  H HB2  . PRO B 2 10 ? 6.665   -0.230  3.628   1.00 0.00 ? 207 PRO B HB2  5  
ATOM 4117  H HG2  . PRO B 2 10 ? 8.294   -1.773  4.168   1.00 0.00 ? 207 PRO B HG2  5  
ATOM 4118  H HD2  . PRO B 2 10 ? 6.427   -2.712  5.178   1.00 0.00 ? 207 PRO B HD2  5  
ATOM 4119  N N    . PRO B 2 11 ? 3.906   -0.596  4.612   1.00 0.00 ? 208 PRO B N    5  
ATOM 4120  C CA   . PRO B 2 11 ? 2.616   -0.377  3.970   1.00 0.00 ? 208 PRO B CA   5  
ATOM 4121  C C    . PRO B 2 11 ? 1.842   0.799   4.552   1.00 0.00 ? 208 PRO B C    5  
ATOM 4122  O O    . PRO B 2 11 ? 1.512   0.798   5.738   1.00 0.00 ? 208 PRO B O    5  
ATOM 4123  C CB   . PRO B 2 11 ? 1.849   -1.667  4.222   1.00 0.00 ? 208 PRO B CB   5  
ATOM 4124  C CG   . PRO B 2 11 ? 2.878   -2.720  4.457   1.00 0.00 ? 208 PRO B CG   5  
ATOM 4125  C CD   . PRO B 2 11 ? 4.197   -2.035  4.728   1.00 0.00 ? 208 PRO B CD   5  
ATOM 4126  H HA   . PRO B 2 11 ? 2.735   -0.244  2.916   1.00 0.00 ? 208 PRO B HA   5  
ATOM 4127  H HB2  . PRO B 2 11 ? 1.208   -1.540  5.078   1.00 0.00 ? 208 PRO B HB2  5  
ATOM 4128  H HG2  . PRO B 2 11 ? 2.595   -3.317  5.310   1.00 0.00 ? 208 PRO B HG2  5  
ATOM 4129  H HD2  . PRO B 2 11 ? 4.533   -2.285  5.712   1.00 0.00 ? 208 PRO B HD2  5  
ATOM 4130  N N    . PRO B 2 12 ? 1.588   1.841   3.736   1.00 0.00 ? 209 PRO B N    5  
ATOM 4131  C CA   . PRO B 2 12 ? 0.817   3.015   4.148   1.00 0.00 ? 209 PRO B CA   5  
ATOM 4132  C C    . PRO B 2 12 ? -0.469  2.631   4.884   1.00 0.00 ? 209 PRO B C    5  
ATOM 4133  O O    . PRO B 2 12 ? -0.688  1.464   5.195   1.00 0.00 ? 209 PRO B O    5  
ATOM 4134  C CB   . PRO B 2 12 ? 0.495   3.710   2.813   1.00 0.00 ? 209 PRO B CB   5  
ATOM 4135  C CG   . PRO B 2 12 ? 0.982   2.798   1.747   1.00 0.00 ? 209 PRO B CG   5  
ATOM 4136  C CD   . PRO B 2 12 ? 2.071   2.001   2.361   1.00 0.00 ? 209 PRO B CD   5  
ATOM 4137  H HA   . PRO B 2 12 ? 1.404   3.675   4.770   1.00 0.00 ? 209 PRO B HA   5  
ATOM 4138  H HB2  . PRO B 2 12 ? -0.564  3.847   2.727   1.00 0.00 ? 209 PRO B HB2  5  
ATOM 4139  H HG2  . PRO B 2 12 ? 0.183   2.148   1.442   1.00 0.00 ? 209 PRO B HG2  5  
ATOM 4140  H HD2  . PRO B 2 12 ? 2.166   1.060   1.852   1.00 0.00 ? 209 PRO B HD2  5  
ATOM 4141  N N    . PRO B 2 13 ? -1.359  3.599   5.147   1.00 0.00 ? 210 PRO B N    5  
ATOM 4142  C CA   . PRO B 2 13 ? -2.595  3.341   5.862   1.00 0.00 ? 210 PRO B CA   5  
ATOM 4143  C C    . PRO B 2 13 ? -3.728  2.937   4.933   1.00 0.00 ? 210 PRO B C    5  
ATOM 4144  O O    . PRO B 2 13 ? -3.623  3.071   3.714   1.00 0.00 ? 210 PRO B O    5  
ATOM 4145  C CB   . PRO B 2 13 ? -2.889  4.684   6.516   1.00 0.00 ? 210 PRO B CB   5  
ATOM 4146  C CG   . PRO B 2 13 ? -2.291  5.708   5.600   1.00 0.00 ? 210 PRO B CG   5  
ATOM 4147  C CD   . PRO B 2 13 ? -1.264  5.006   4.739   1.00 0.00 ? 210 PRO B CD   5  
ATOM 4148  H HA   . PRO B 2 13 ? -2.465  2.588   6.621   1.00 0.00 ? 210 PRO B HA   5  
ATOM 4149  H HB2  . PRO B 2 13 ? -3.957  4.811   6.604   1.00 0.00 ? 210 PRO B HB2  5  
ATOM 4150  H HG2  . PRO B 2 13 ? -3.065  6.131   4.978   1.00 0.00 ? 210 PRO B HG2  5  
ATOM 4151  H HD2  . PRO B 2 13 ? -1.523  5.114   3.693   1.00 0.00 ? 210 PRO B HD2  5  
ATOM 4152  N N    . TYR B 2 14 ? -4.812  2.443   5.516   1.00 0.00 ? 211 TYR B N    5  
ATOM 4153  C CA   . TYR B 2 14 ? -5.961  2.024   4.736   1.00 0.00 ? 211 TYR B CA   5  
ATOM 4154  C C    . TYR B 2 14 ? -6.509  3.206   3.941   1.00 0.00 ? 211 TYR B C    5  
ATOM 4155  O O    . TYR B 2 14 ? -6.207  3.364   2.760   1.00 0.00 ? 211 TYR B O    5  
ATOM 4156  C CB   . TYR B 2 14 ? -7.047  1.441   5.654   1.00 0.00 ? 211 TYR B CB   5  
ATOM 4157  C CG   . TYR B 2 14 ? -8.402  1.308   4.993   1.00 0.00 ? 211 TYR B CG   5  
ATOM 4158  C CD1  . TYR B 2 14 ? -8.549  0.584   3.821   1.00 0.00 ? 211 TYR B CD1  5  
ATOM 4159  C CD2  . TYR B 2 14 ? -9.526  1.921   5.533   1.00 0.00 ? 211 TYR B CD2  5  
ATOM 4160  C CE1  . TYR B 2 14 ? -9.780  0.471   3.200   1.00 0.00 ? 211 TYR B CE1  5  
ATOM 4161  C CE2  . TYR B 2 14 ? -10.761 1.809   4.922   1.00 0.00 ? 211 TYR B CE2  5  
ATOM 4162  C CZ   . TYR B 2 14 ? -10.883 1.084   3.756   1.00 0.00 ? 211 TYR B CZ   5  
ATOM 4163  O OH   . TYR B 2 14 ? -12.109 0.973   3.142   1.00 0.00 ? 211 TYR B OH   5  
ATOM 4164  H H    . TYR B 2 14 ? -4.840  2.369   6.492   1.00 0.00 ? 211 TYR B H    5  
ATOM 4165  H HA   . TYR B 2 14 ? -5.630  1.261   4.045   1.00 0.00 ? 211 TYR B HA   5  
ATOM 4166  H HB2  . TYR B 2 14 ? -6.740  0.458   5.980   1.00 0.00 ? 211 TYR B HB2  5  
ATOM 4167  H HD1  . TYR B 2 14 ? -7.684  0.100   3.395   1.00 0.00 ? 211 TYR B HD1  5  
ATOM 4168  H HD2  . TYR B 2 14 ? -9.426  2.488   6.446   1.00 0.00 ? 211 TYR B HD2  5  
ATOM 4169  H HE1  . TYR B 2 14 ? -9.871  -0.095  2.285   1.00 0.00 ? 211 TYR B HE1  5  
ATOM 4170  H HE2  . TYR B 2 14 ? -11.624 2.291   5.358   1.00 0.00 ? 211 TYR B HE2  5  
ATOM 4171  H HH   . TYR B 2 14 ? -12.127 1.528   2.359   1.00 0.00 ? 211 TYR B HH   5  
ATOM 4172  N N    . SER B 2 15 ? -7.307  4.035   4.608   1.00 0.00 ? 212 SER B N    5  
ATOM 4173  C CA   . SER B 2 15 ? -7.899  5.204   3.971   1.00 0.00 ? 212 SER B CA   5  
ATOM 4174  C C    . SER B 2 15 ? -8.747  4.796   2.770   1.00 0.00 ? 212 SER B C    5  
ATOM 4175  O O    . SER B 2 15 ? -9.966  4.675   2.880   1.00 0.00 ? 212 SER B O    5  
ATOM 4176  C CB   . SER B 2 15 ? -6.803  6.183   3.542   1.00 0.00 ? 212 SER B CB   5  
ATOM 4177  O OG   . SER B 2 15 ? -6.894  7.398   4.266   1.00 0.00 ? 212 SER B OG   5  
ATOM 4178  H H    . SER B 2 15 ? -7.502  3.855   5.550   1.00 0.00 ? 212 SER B H    5  
ATOM 4179  H HA   . SER B 2 15 ? -8.536  5.688   4.697   1.00 0.00 ? 212 SER B HA   5  
ATOM 4180  H HB2  . SER B 2 15 ? -5.836  5.740   3.727   1.00 0.00 ? 212 SER B HB2  5  
ATOM 4181  H HG   . SER B 2 15 ? -6.726  8.137   3.675   1.00 0.00 ? 212 SER B HG   5  
ATOM 4182  N N    . ARG B 2 16 ? -8.092  4.584   1.627   1.00 0.00 ? 213 ARG B N    5  
ATOM 4183  C CA   . ARG B 2 16 ? -8.768  4.183   0.389   1.00 0.00 ? 213 ARG B CA   5  
ATOM 4184  C C    . ARG B 2 16 ? -7.880  4.467   -0.818  1.00 0.00 ? 213 ARG B C    5  
ATOM 4185  O O    . ARG B 2 16 ? -7.695  3.611   -1.683  1.00 0.00 ? 213 ARG B O    5  
ATOM 4186  C CB   . ARG B 2 16 ? -10.109 4.909   0.222   1.00 0.00 ? 213 ARG B CB   5  
ATOM 4187  C CG   . ARG B 2 16 ? -11.306 4.085   0.670   1.00 0.00 ? 213 ARG B CG   5  
ATOM 4188  C CD   . ARG B 2 16 ? -12.099 3.554   -0.512  1.00 0.00 ? 213 ARG B CD   5  
ATOM 4189  N NE   . ARG B 2 16 ? -13.284 4.363   -0.782  1.00 0.00 ? 213 ARG B NE   5  
ATOM 4190  C CZ   . ARG B 2 16 ? -14.335 3.927   -1.468  1.00 0.00 ? 213 ARG B CZ   5  
ATOM 4191  N NH1  . ARG B 2 16 ? -14.349 2.693   -1.953  1.00 0.00 ? 213 ARG B NH1  5  
ATOM 4192  N NH2  . ARG B 2 16 ? -15.374 4.725   -1.669  1.00 0.00 ? 213 ARG B NH2  5  
ATOM 4193  H H    . ARG B 2 16 ? -7.119  4.695   1.615   1.00 0.00 ? 213 ARG B H    5  
ATOM 4194  H HA   . ARG B 2 16 ? -8.949  3.119   0.444   1.00 0.00 ? 213 ARG B HA   5  
ATOM 4195  H HB2  . ARG B 2 16 ? -10.087 5.819   0.804   1.00 0.00 ? 213 ARG B HB2  5  
ATOM 4196  H HG2  . ARG B 2 16 ? -10.957 3.250   1.257   1.00 0.00 ? 213 ARG B HG2  5  
ATOM 4197  H HD2  . ARG B 2 16 ? -11.465 3.557   -1.386  1.00 0.00 ? 213 ARG B HD2  5  
ATOM 4198  H HE   . ARG B 2 16 ? -13.296 5.279   -0.435  1.00 0.00 ? 213 ARG B HE   5  
ATOM 4199  H HH11 . ARG B 2 16 ? -13.567 2.088   -1.803  1.00 0.00 ? 213 ARG B HH11 5  
ATOM 4200  H HH12 . ARG B 2 16 ? -15.142 2.367   -2.468  1.00 0.00 ? 213 ARG B HH12 5  
ATOM 4201  H HH21 . ARG B 2 16 ? -15.367 5.656   -1.305  1.00 0.00 ? 213 ARG B HH21 5  
ATOM 4202  H HH22 . ARG B 2 16 ? -16.164 4.396   -2.186  1.00 0.00 ? 213 ARG B HH22 5  
ATOM 4203  N N    . TYR B 2 17 ? -7.332  5.678   -0.865  1.00 0.00 ? 214 TYR B N    5  
ATOM 4204  C CA   . TYR B 2 17 ? -6.458  6.087   -1.959  1.00 0.00 ? 214 TYR B CA   5  
ATOM 4205  C C    . TYR B 2 17 ? -5.012  5.676   -1.680  1.00 0.00 ? 214 TYR B C    5  
ATOM 4206  O O    . TYR B 2 17 ? -4.699  5.186   -0.595  1.00 0.00 ? 214 TYR B O    5  
ATOM 4207  C CB   . TYR B 2 17 ? -6.552  7.601   -2.164  1.00 0.00 ? 214 TYR B CB   5  
ATOM 4208  C CG   . TYR B 2 17 ? -7.950  8.148   -1.999  1.00 0.00 ? 214 TYR B CG   5  
ATOM 4209  C CD1  . TYR B 2 17 ? -9.060  7.362   -2.279  1.00 0.00 ? 214 TYR B CD1  5  
ATOM 4210  C CD2  . TYR B 2 17 ? -8.160  9.452   -1.571  1.00 0.00 ? 214 TYR B CD2  5  
ATOM 4211  C CE1  . TYR B 2 17 ? -10.339 7.859   -2.136  1.00 0.00 ? 214 TYR B CE1  5  
ATOM 4212  C CE2  . TYR B 2 17 ? -9.436  9.957   -1.426  1.00 0.00 ? 214 TYR B CE2  5  
ATOM 4213  C CZ   . TYR B 2 17 ? -10.523 9.158   -1.709  1.00 0.00 ? 214 TYR B CZ   5  
ATOM 4214  O OH   . TYR B 2 17 ? -11.797 9.657   -1.566  1.00 0.00 ? 214 TYR B OH   5  
ATOM 4215  H H    . TYR B 2 17 ? -7.522  6.314   -0.145  1.00 0.00 ? 214 TYR B H    5  
ATOM 4216  H HA   . TYR B 2 17 ? -6.792  5.590   -2.857  1.00 0.00 ? 214 TYR B HA   5  
ATOM 4217  H HB2  . TYR B 2 17 ? -5.915  8.097   -1.449  1.00 0.00 ? 214 TYR B HB2  5  
ATOM 4218  H HD1  . TYR B 2 17 ? -8.913  6.346   -2.612  1.00 0.00 ? 214 TYR B HD1  5  
ATOM 4219  H HD2  . TYR B 2 17 ? -7.307  10.076  -1.350  1.00 0.00 ? 214 TYR B HD2  5  
ATOM 4220  H HE1  . TYR B 2 17 ? -11.187 7.231   -2.358  1.00 0.00 ? 214 TYR B HE1  5  
ATOM 4221  H HE2  . TYR B 2 17 ? -9.579  10.974  -1.093  1.00 0.00 ? 214 TYR B HE2  5  
ATOM 4222  H HH   . TYR B 2 17 ? -12.361 8.991   -1.168  1.00 0.00 ? 214 TYR B HH   5  
ATOM 4223  N N    . PRO B 2 18 ? -4.114  5.865   -2.661  1.00 0.00 ? 215 PRO B N    5  
ATOM 4224  C CA   . PRO B 2 18 ? -2.707  5.509   -2.519  1.00 0.00 ? 215 PRO B CA   5  
ATOM 4225  C C    . PRO B 2 18 ? -1.881  6.623   -1.885  1.00 0.00 ? 215 PRO B C    5  
ATOM 4226  O O    . PRO B 2 18 ? -1.414  7.530   -2.572  1.00 0.00 ? 215 PRO B O    5  
ATOM 4227  C CB   . PRO B 2 18 ? -2.271  5.267   -3.964  1.00 0.00 ? 215 PRO B CB   5  
ATOM 4228  C CG   . PRO B 2 18 ? -3.162  6.132   -4.800  1.00 0.00 ? 215 PRO B CG   5  
ATOM 4229  C CD   . PRO B 2 18 ? -4.400  6.436   -3.987  1.00 0.00 ? 215 PRO B CD   5  
ATOM 4230  H HA   . PRO B 2 18 ? -2.585  4.602   -1.947  1.00 0.00 ? 215 PRO B HA   5  
ATOM 4231  H HB2  . PRO B 2 18 ? -1.233  5.545   -4.082  1.00 0.00 ? 215 PRO B HB2  5  
ATOM 4232  H HG2  . PRO B 2 18 ? -2.649  7.049   -5.047  1.00 0.00 ? 215 PRO B HG2  5  
ATOM 4233  H HD2  . PRO B 2 18 ? -4.545  7.501   -3.918  1.00 0.00 ? 215 PRO B HD2  5  
ATOM 4234  N N    . MET B 2 19 ? -1.704  6.547   -0.570  1.00 0.00 ? 216 MET B N    5  
ATOM 4235  C CA   . MET B 2 19 ? -0.933  7.550   0.153   1.00 0.00 ? 216 MET B CA   5  
ATOM 4236  C C    . MET B 2 19 ? 0.112   6.901   1.054   1.00 0.00 ? 216 MET B C    5  
ATOM 4237  O O    . MET B 2 19 ? -0.222  6.290   2.067   1.00 0.00 ? 216 MET B O    5  
ATOM 4238  C CB   . MET B 2 19 ? -1.863  8.443   0.980   1.00 0.00 ? 216 MET B CB   5  
ATOM 4239  C CG   . MET B 2 19 ? -2.438  7.762   2.215   1.00 0.00 ? 216 MET B CG   5  
ATOM 4240  S SD   . MET B 2 19 ? -4.109  8.320   2.603   1.00 0.00 ? 216 MET B SD   5  
ATOM 4241  C CE   . MET B 2 19 ? -5.011  7.715   1.178   1.00 0.00 ? 216 MET B CE   5  
ATOM 4242  H H    . MET B 2 19 ? -2.102  5.799   -0.075  1.00 0.00 ? 216 MET B H    5  
ATOM 4243  H HA   . MET B 2 19 ? -0.421  8.157   -0.577  1.00 0.00 ? 216 MET B HA   5  
ATOM 4244  H HB2  . MET B 2 19 ? -1.312  9.314   1.303   1.00 0.00 ? 216 MET B HB2  5  
ATOM 4245  H HG2  . MET B 2 19 ? -2.460  6.693   2.048   1.00 0.00 ? 216 MET B HG2  5  
ATOM 4246  H HE1  . MET B 2 19 ? -6.072  7.767   1.375   1.00 0.00 ? 216 MET B HE1  5  
ATOM 4247  H HE2  . MET B 2 19 ? -4.774  8.322   0.317   1.00 0.00 ? 216 MET B HE2  5  
ATOM 4248  H HE3  . MET B 2 19 ? -4.731  6.690   0.985   1.00 0.00 ? 216 MET B HE3  5  
ATOM 4249  N N    . ASP B 2 20 ? 1.381   7.047   0.677   1.00 0.00 ? 217 ASP B N    5  
ATOM 4250  C CA   . ASP B 2 20 ? 2.486   6.478   1.444   1.00 0.00 ? 217 ASP B CA   5  
ATOM 4251  C C    . ASP B 2 20 ? 2.334   6.776   2.933   1.00 0.00 ? 217 ASP B C    5  
ATOM 4252  O O    . ASP B 2 20 ? 2.816   5.963   3.750   1.00 0.00 ? 217 ASP B O    5  
ATOM 4253  C CB   . ASP B 2 20 ? 3.821   7.029   0.939   1.00 0.00 ? 217 ASP B CB   5  
ATOM 4254  C CG   . ASP B 2 20 ? 3.762   8.517   0.656   1.00 0.00 ? 217 ASP B CG   5  
ATOM 4255  O OD1  . ASP B 2 20 ? 2.928   8.931   -0.177  1.00 0.00 ? 217 ASP B OD1  5  
ATOM 4256  O OD2  . ASP B 2 20 ? 4.550   9.269   1.267   1.00 0.00 ? 217 ASP B OD2  5  
ATOM 4257  O OXT  . ASP B 2 20 ? 1.736   7.820   3.269   1.00 0.00 ? 217 ASP B OXT  5  
ATOM 4258  H H    . ASP B 2 20 ? 1.579   7.551   -0.141  1.00 0.00 ? 217 ASP B H    5  
ATOM 4259  H HA   . ASP B 2 20 ? 2.472   5.408   1.300   1.00 0.00 ? 217 ASP B HA   5  
ATOM 4260  H HB2  . ASP B 2 20 ? 4.581   6.853   1.686   1.00 0.00 ? 217 ASP B HB2  5  
ATOM 4261  N N    . GLY A 1 1  ? 9.310   -10.298 -10.149 1.00 0.00 ? 292 GLY A N    6  
ATOM 4262  C CA   . GLY A 1 1  ? 8.124   -9.553  -9.643  1.00 0.00 ? 292 GLY A CA   6  
ATOM 4263  C C    . GLY A 1 1  ? 6.862   -10.395 -9.647  1.00 0.00 ? 292 GLY A C    6  
ATOM 4264  O O    . GLY A 1 1  ? 5.947   -10.137 -10.430 1.00 0.00 ? 292 GLY A O    6  
ATOM 4265  H H1   . GLY A 1 1  ? 9.722   -10.875 -9.386  1.00 0.00 ? 292 GLY A H1   6  
ATOM 4266  H H2   . GLY A 1 1  ? 10.032  -9.633  -10.492 1.00 0.00 ? 292 GLY A H2   6  
ATOM 4267  H H3   . GLY A 1 1  ? 9.032   -10.924 -10.931 1.00 0.00 ? 292 GLY A H3   6  
ATOM 4268  H HA2  . GLY A 1 1  ? 8.323   -9.227  -8.632  1.00 0.00 ? 292 GLY A HA2  6  
ATOM 4269  H HA3  . GLY A 1 1  ? 7.967   -8.685  -10.265 1.00 0.00 ? 292 GLY A HA3  6  
ATOM 4270  N N    . PRO A 1 2  ? 6.786   -11.418 -8.779  1.00 0.00 ? 293 PRO A N    6  
ATOM 4271  C CA   . PRO A 1 2  ? 5.616   -12.298 -8.695  1.00 0.00 ? 293 PRO A CA   6  
ATOM 4272  C C    . PRO A 1 2  ? 4.339   -11.538 -8.351  1.00 0.00 ? 293 PRO A C    6  
ATOM 4273  O O    . PRO A 1 2  ? 3.456   -11.378 -9.194  1.00 0.00 ? 293 PRO A O    6  
ATOM 4274  C CB   . PRO A 1 2  ? 5.973   -13.282 -7.572  1.00 0.00 ? 293 PRO A CB   6  
ATOM 4275  C CG   . PRO A 1 2  ? 7.091   -12.639 -6.822  1.00 0.00 ? 293 PRO A CG   6  
ATOM 4276  C CD   . PRO A 1 2  ? 7.834   -11.799 -7.820  1.00 0.00 ? 293 PRO A CD   6  
ATOM 4277  H HA   . PRO A 1 2  ? 5.468   -12.842 -9.616  1.00 0.00 ? 293 PRO A HA   6  
ATOM 4278  H HB2  . PRO A 1 2  ? 5.112   -13.434 -6.938  1.00 0.00 ? 293 PRO A HB2  6  
ATOM 4279  H HG2  . PRO A 1 2  ? 6.696   -12.019 -6.031  1.00 0.00 ? 293 PRO A HG2  6  
ATOM 4280  H HD2  . PRO A 1 2  ? 8.255   -10.927 -7.341  1.00 0.00 ? 293 PRO A HD2  6  
ATOM 4281  N N    . LEU A 1 3  ? 4.246   -11.069 -7.111  1.00 0.00 ? 294 LEU A N    6  
ATOM 4282  C CA   . LEU A 1 3  ? 3.072   -10.330 -6.662  1.00 0.00 ? 294 LEU A CA   6  
ATOM 4283  C C    . LEU A 1 3  ? 1.812   -11.180 -6.795  1.00 0.00 ? 294 LEU A C    6  
ATOM 4284  O O    . LEU A 1 3  ? 1.379   -11.820 -5.838  1.00 0.00 ? 294 LEU A O    6  
ATOM 4285  C CB   . LEU A 1 3  ? 2.919   -9.035  -7.464  1.00 0.00 ? 294 LEU A CB   6  
ATOM 4286  C CG   . LEU A 1 3  ? 3.773   -7.866  -6.975  1.00 0.00 ? 294 LEU A CG   6  
ATOM 4287  C CD1  . LEU A 1 3  ? 3.217   -7.309  -5.672  1.00 0.00 ? 294 LEU A CD1  6  
ATOM 4288  C CD2  . LEU A 1 3  ? 5.218   -8.301  -6.797  1.00 0.00 ? 294 LEU A CD2  6  
ATOM 4289  H H    . LEU A 1 3  ? 4.982   -11.224 -6.484  1.00 0.00 ? 294 LEU A H    6  
ATOM 4290  H HA   . LEU A 1 3  ? 3.215   -10.083 -5.621  1.00 0.00 ? 294 LEU A HA   6  
ATOM 4291  H HB2  . LEU A 1 3  ? 3.180   -9.240  -8.492  1.00 0.00 ? 294 LEU A HB2  6  
ATOM 4292  H HG   . LEU A 1 3  ? 3.748   -7.076  -7.712  1.00 0.00 ? 294 LEU A HG   6  
ATOM 4293  H HD11 . LEU A 1 3  ? 3.013   -8.122  -4.992  1.00 0.00 ? 294 LEU A HD11 6  
ATOM 4294  H HD12 . LEU A 1 3  ? 3.941   -6.642  -5.228  1.00 0.00 ? 294 LEU A HD12 6  
ATOM 4295  H HD13 . LEU A 1 3  ? 2.304   -6.769  -5.872  1.00 0.00 ? 294 LEU A HD13 6  
ATOM 4296  H HD21 . LEU A 1 3  ? 5.818   -7.452  -6.503  1.00 0.00 ? 294 LEU A HD21 6  
ATOM 4297  H HD22 . LEU A 1 3  ? 5.274   -9.062  -6.032  1.00 0.00 ? 294 LEU A HD22 6  
ATOM 4298  H HD23 . LEU A 1 3  ? 5.592   -8.699  -7.729  1.00 0.00 ? 294 LEU A HD23 6  
ATOM 4299  N N    . GLY A 1 4  ? 1.228   -11.184 -7.991  1.00 0.00 ? 295 GLY A N    6  
ATOM 4300  C CA   . GLY A 1 4  ? 0.025   -11.960 -8.226  1.00 0.00 ? 295 GLY A CA   6  
ATOM 4301  C C    . GLY A 1 4  ? -0.556  -11.723 -9.607  1.00 0.00 ? 295 GLY A C    6  
ATOM 4302  O O    . GLY A 1 4  ? -0.754  -10.579 -10.016 1.00 0.00 ? 295 GLY A O    6  
ATOM 4303  H H    . GLY A 1 4  ? 1.618   -10.657 -8.718  1.00 0.00 ? 295 GLY A H    6  
ATOM 4304  H HA2  . GLY A 1 4  ? 0.260   -13.009 -8.122  1.00 0.00 ? 295 GLY A HA2  6  
ATOM 4305  H HA3  . GLY A 1 4  ? -0.714  -11.692 -7.486  1.00 0.00 ? 295 GLY A HA3  6  
ATOM 4306  N N    . SER A 1 5  ? -0.828  -12.807 -10.325 1.00 0.00 ? 296 SER A N    6  
ATOM 4307  C CA   . SER A 1 5  ? -1.385  -12.716 -11.668 1.00 0.00 ? 296 SER A CA   6  
ATOM 4308  C C    . SER A 1 5  ? -2.858  -12.319 -11.625 1.00 0.00 ? 296 SER A C    6  
ATOM 4309  O O    . SER A 1 5  ? -3.220  -11.197 -11.979 1.00 0.00 ? 296 SER A O    6  
ATOM 4310  C CB   . SER A 1 5  ? -1.227  -14.051 -12.400 1.00 0.00 ? 296 SER A CB   6  
ATOM 4311  O OG   . SER A 1 5  ? -0.157  -14.002 -13.327 1.00 0.00 ? 296 SER A OG   6  
ATOM 4312  H H    . SER A 1 5  ? -0.649  -13.691 -9.941  1.00 0.00 ? 296 SER A H    6  
ATOM 4313  H HA   . SER A 1 5  ? -0.837  -11.957 -12.204 1.00 0.00 ? 296 SER A HA   6  
ATOM 4314  H HB2  . SER A 1 5  ? -1.028  -14.831 -11.681 1.00 0.00 ? 296 SER A HB2  6  
ATOM 4315  H HG   . SER A 1 5  ? 0.675   -14.123 -12.861 1.00 0.00 ? 296 SER A HG   6  
ATOM 4316  N N    . GLY A 1 6  ? -3.704  -13.249 -11.190 1.00 0.00 ? 297 GLY A N    6  
ATOM 4317  C CA   . GLY A 1 6  ? -5.127  -12.979 -11.111 1.00 0.00 ? 297 GLY A CA   6  
ATOM 4318  C C    . GLY A 1 6  ? -5.440  -11.716 -10.329 1.00 0.00 ? 297 GLY A C    6  
ATOM 4319  O O    . GLY A 1 6  ? -4.621  -11.261 -9.530  1.00 0.00 ? 297 GLY A O    6  
ATOM 4320  H H    . GLY A 1 6  ? -3.357  -14.124 -10.919 1.00 0.00 ? 297 GLY A H    6  
ATOM 4321  H HA2  . GLY A 1 6  ? -5.518  -12.874 -12.111 1.00 0.00 ? 297 GLY A HA2  6  
ATOM 4322  H HA3  . GLY A 1 6  ? -5.614  -13.814 -10.631 1.00 0.00 ? 297 GLY A HA3  6  
ATOM 4323  N N    . PRO A 1 7  ? -6.627  -11.124 -10.544 1.00 0.00 ? 298 PRO A N    6  
ATOM 4324  C CA   . PRO A 1 7  ? -7.042  -9.901  -9.847  1.00 0.00 ? 298 PRO A CA   6  
ATOM 4325  C C    . PRO A 1 7  ? -7.177  -10.116 -8.345  1.00 0.00 ? 298 PRO A C    6  
ATOM 4326  O O    . PRO A 1 7  ? -7.265  -11.250 -7.874  1.00 0.00 ? 298 PRO A O    6  
ATOM 4327  C CB   . PRO A 1 7  ? -8.409  -9.570  -10.463 1.00 0.00 ? 298 PRO A CB   6  
ATOM 4328  C CG   . PRO A 1 7  ? -8.475  -10.362 -11.725 1.00 0.00 ? 298 PRO A CG   6  
ATOM 4329  C CD   . PRO A 1 7  ? -7.656  -11.596 -11.481 1.00 0.00 ? 298 PRO A CD   6  
ATOM 4330  H HA   . PRO A 1 7  ? -6.354  -9.089  -10.033 1.00 0.00 ? 298 PRO A HA   6  
ATOM 4331  H HB2  . PRO A 1 7  ? -9.192  -9.857  -9.776  1.00 0.00 ? 298 PRO A HB2  6  
ATOM 4332  H HG2  . PRO A 1 7  ? -9.500  -10.628 -11.938 1.00 0.00 ? 298 PRO A HG2  6  
ATOM 4333  H HD2  . PRO A 1 7  ? -8.262  -12.371 -11.034 1.00 0.00 ? 298 PRO A HD2  6  
ATOM 4334  N N    . LEU A 1 8  ? -7.194  -9.020  -7.596  1.00 0.00 ? 299 LEU A N    6  
ATOM 4335  C CA   . LEU A 1 8  ? -7.320  -9.088  -6.144  1.00 0.00 ? 299 LEU A CA   6  
ATOM 4336  C C    . LEU A 1 8  ? -8.734  -9.491  -5.737  1.00 0.00 ? 299 LEU A C    6  
ATOM 4337  O O    . LEU A 1 8  ? -9.691  -9.261  -6.477  1.00 0.00 ? 299 LEU A O    6  
ATOM 4338  C CB   . LEU A 1 8  ? -6.967  -7.740  -5.517  1.00 0.00 ? 299 LEU A CB   6  
ATOM 4339  C CG   . LEU A 1 8  ? -5.471  -7.460  -5.385  1.00 0.00 ? 299 LEU A CG   6  
ATOM 4340  C CD1  . LEU A 1 8  ? -5.241  -6.052  -4.858  1.00 0.00 ? 299 LEU A CD1  6  
ATOM 4341  C CD2  . LEU A 1 8  ? -4.816  -8.488  -4.475  1.00 0.00 ? 299 LEU A CD2  6  
ATOM 4342  H H    . LEU A 1 8  ? -7.119  -8.143  -8.028  1.00 0.00 ? 299 LEU A H    6  
ATOM 4343  H HA   . LEU A 1 8  ? -6.628  -9.835  -5.787  1.00 0.00 ? 299 LEU A HA   6  
ATOM 4344  H HB2  . LEU A 1 8  ? -7.407  -6.959  -6.121  1.00 0.00 ? 299 LEU A HB2  6  
ATOM 4345  H HG   . LEU A 1 8  ? -5.010  -7.532  -6.360  1.00 0.00 ? 299 LEU A HG   6  
ATOM 4346  H HD11 . LEU A 1 8  ? -5.878  -5.880  -4.004  1.00 0.00 ? 299 LEU A HD11 6  
ATOM 4347  H HD12 . LEU A 1 8  ? -4.207  -5.942  -4.565  1.00 0.00 ? 299 LEU A HD12 6  
ATOM 4348  H HD13 . LEU A 1 8  ? -5.474  -5.335  -5.632  1.00 0.00 ? 299 LEU A HD13 6  
ATOM 4349  H HD21 . LEU A 1 8  ? -3.961  -8.920  -4.974  1.00 0.00 ? 299 LEU A HD21 6  
ATOM 4350  H HD22 . LEU A 1 8  ? -4.496  -8.009  -3.561  1.00 0.00 ? 299 LEU A HD22 6  
ATOM 4351  H HD23 . LEU A 1 8  ? -5.527  -9.267  -4.242  1.00 0.00 ? 299 LEU A HD23 6  
ATOM 4352  N N    . PRO A 1 9  ? -8.882  -10.101 -4.548  1.00 0.00 ? 300 PRO A N    6  
ATOM 4353  C CA   . PRO A 1 9  ? -10.188 -10.532 -4.038  1.00 0.00 ? 300 PRO A CA   6  
ATOM 4354  C C    . PRO A 1 9  ? -11.164 -9.367  -3.894  1.00 0.00 ? 300 PRO A C    6  
ATOM 4355  O O    . PRO A 1 9  ? -10.767 -8.204  -3.971  1.00 0.00 ? 300 PRO A O    6  
ATOM 4356  C CB   . PRO A 1 9  ? -9.864  -11.133 -2.665  1.00 0.00 ? 300 PRO A CB   6  
ATOM 4357  C CG   . PRO A 1 9  ? -8.409  -11.454 -2.714  1.00 0.00 ? 300 PRO A CG   6  
ATOM 4358  C CD   . PRO A 1 9  ? -7.792  -10.421 -3.612  1.00 0.00 ? 300 PRO A CD   6  
ATOM 4359  H HA   . PRO A 1 9  ? -10.626 -11.291 -4.672  1.00 0.00 ? 300 PRO A HA   6  
ATOM 4360  H HB2  . PRO A 1 9  ? -10.084 -10.411 -1.893  1.00 0.00 ? 300 PRO A HB2  6  
ATOM 4361  H HG2  . PRO A 1 9  ? -7.986  -11.390 -1.722  1.00 0.00 ? 300 PRO A HG2  6  
ATOM 4362  H HD2  . PRO A 1 9  ? -7.500  -9.551  -3.044  1.00 0.00 ? 300 PRO A HD2  6  
ATOM 4363  N N    . PRO A 1 10 ? -12.457 -9.666  -3.681  1.00 0.00 ? 301 PRO A N    6  
ATOM 4364  C CA   . PRO A 1 10 ? -13.495 -8.639  -3.533  1.00 0.00 ? 301 PRO A CA   6  
ATOM 4365  C C    . PRO A 1 10 ? -13.314 -7.799  -2.271  1.00 0.00 ? 301 PRO A C    6  
ATOM 4366  O O    . PRO A 1 10 ? -14.177 -7.792  -1.393  1.00 0.00 ? 301 PRO A O    6  
ATOM 4367  C CB   . PRO A 1 10 ? -14.802 -9.441  -3.453  1.00 0.00 ? 301 PRO A CB   6  
ATOM 4368  C CG   . PRO A 1 10 ? -14.456 -10.815 -3.920  1.00 0.00 ? 301 PRO A CG   6  
ATOM 4369  C CD   . PRO A 1 10 ? -13.013 -11.021 -3.570  1.00 0.00 ? 301 PRO A CD   6  
ATOM 4370  H HA   . PRO A 1 10 ? -13.525 -7.986  -4.393  1.00 0.00 ? 301 PRO A HA   6  
ATOM 4371  H HB2  . PRO A 1 10 ? -15.157 -9.450  -2.432  1.00 0.00 ? 301 PRO A HB2  6  
ATOM 4372  H HG2  . PRO A 1 10 ? -15.073 -11.541 -3.410  1.00 0.00 ? 301 PRO A HG2  6  
ATOM 4373  H HD2  . PRO A 1 10 ? -12.916 -11.399 -2.562  1.00 0.00 ? 301 PRO A HD2  6  
ATOM 4374  N N    . GLY A 1 11 ? -12.189 -7.097  -2.184  1.00 0.00 ? 302 GLY A N    6  
ATOM 4375  C CA   . GLY A 1 11 ? -11.932 -6.259  -1.025  1.00 0.00 ? 302 GLY A CA   6  
ATOM 4376  C C    . GLY A 1 11 ? -10.555 -5.620  -1.043  1.00 0.00 ? 302 GLY A C    6  
ATOM 4377  O O    . GLY A 1 11 ? -10.365 -4.535  -0.497  1.00 0.00 ? 302 GLY A O    6  
ATOM 4378  H H    . GLY A 1 11 ? -11.528 -7.154  -2.903  1.00 0.00 ? 302 GLY A H    6  
ATOM 4379  H HA2  . GLY A 1 11 ? -12.675 -5.477  -0.993  1.00 0.00 ? 302 GLY A HA2  6  
ATOM 4380  H HA3  . GLY A 1 11 ? -12.024 -6.861  -0.134  1.00 0.00 ? 302 GLY A HA3  6  
ATOM 4381  N N    . TRP A 1 12 ? -9.591  -6.289  -1.667  1.00 0.00 ? 303 TRP A N    6  
ATOM 4382  C CA   . TRP A 1 12 ? -8.228  -5.772  -1.734  1.00 0.00 ? 303 TRP A CA   6  
ATOM 4383  C C    . TRP A 1 12 ? -7.984  -4.978  -3.010  1.00 0.00 ? 303 TRP A C    6  
ATOM 4384  O O    . TRP A 1 12 ? -8.639  -5.195  -4.030  1.00 0.00 ? 303 TRP A O    6  
ATOM 4385  C CB   . TRP A 1 12 ? -7.228  -6.921  -1.643  1.00 0.00 ? 303 TRP A CB   6  
ATOM 4386  C CG   . TRP A 1 12 ? -7.347  -7.699  -0.373  1.00 0.00 ? 303 TRP A CG   6  
ATOM 4387  C CD1  . TRP A 1 12 ? -8.195  -8.739  -0.131  1.00 0.00 ? 303 TRP A CD1  6  
ATOM 4388  C CD2  . TRP A 1 12 ? -6.601  -7.496  0.829   1.00 0.00 ? 303 TRP A CD2  6  
ATOM 4389  N NE1  . TRP A 1 12 ? -8.026  -9.194  1.152   1.00 0.00 ? 303 TRP A NE1  6  
ATOM 4390  C CE2  . TRP A 1 12 ? -7.049  -8.449  1.762   1.00 0.00 ? 303 TRP A CE2  6  
ATOM 4391  C CE3  . TRP A 1 12 ? -5.595  -6.602  1.205   1.00 0.00 ? 303 TRP A CE3  6  
ATOM 4392  C CZ2  . TRP A 1 12 ? -6.526  -8.531  3.051   1.00 0.00 ? 303 TRP A CZ2  6  
ATOM 4393  C CZ3  . TRP A 1 12 ? -5.077  -6.685  2.483   1.00 0.00 ? 303 TRP A CZ3  6  
ATOM 4394  C CH2  . TRP A 1 12 ? -5.542  -7.642  3.392   1.00 0.00 ? 303 TRP A CH2  6  
ATOM 4395  H H    . TRP A 1 12 ? -9.796  -7.150  -2.087  1.00 0.00 ? 303 TRP A H    6  
ATOM 4396  H HA   . TRP A 1 12 ? -8.084  -5.119  -0.887  1.00 0.00 ? 303 TRP A HA   6  
ATOM 4397  H HB2  . TRP A 1 12 ? -7.390  -7.599  -2.468  1.00 0.00 ? 303 TRP A HB2  6  
ATOM 4398  H HD1  . TRP A 1 12 ? -8.896  -9.133  -0.851  1.00 0.00 ? 303 TRP A HD1  6  
ATOM 4399  H HE1  . TRP A 1 12 ? -8.522  -9.932  1.562   1.00 0.00 ? 303 TRP A HE1  6  
ATOM 4400  H HE3  . TRP A 1 12 ? -5.225  -5.857  0.518   1.00 0.00 ? 303 TRP A HE3  6  
ATOM 4401  H HZ2  . TRP A 1 12 ? -6.874  -9.263  3.764   1.00 0.00 ? 303 TRP A HZ2  6  
ATOM 4402  H HZ3  . TRP A 1 12 ? -4.300  -6.001  2.792   1.00 0.00 ? 303 TRP A HZ3  6  
ATOM 4403  H HH2  . TRP A 1 12 ? -5.106  -7.670  4.378   1.00 0.00 ? 303 TRP A HH2  6  
ATOM 4404  N N    . GLU A 1 13 ? -7.030  -4.056  -2.938  1.00 0.00 ? 304 GLU A N    6  
ATOM 4405  C CA   . GLU A 1 13 ? -6.670  -3.226  -4.081  1.00 0.00 ? 304 GLU A CA   6  
ATOM 4406  C C    . GLU A 1 13 ? -5.182  -2.901  -4.065  1.00 0.00 ? 304 GLU A C    6  
ATOM 4407  O O    . GLU A 1 13 ? -4.628  -2.538  -3.028  1.00 0.00 ? 304 GLU A O    6  
ATOM 4408  C CB   . GLU A 1 13 ? -7.479  -1.933  -4.083  1.00 0.00 ? 304 GLU A CB   6  
ATOM 4409  C CG   . GLU A 1 13 ? -7.215  -1.074  -5.304  1.00 0.00 ? 304 GLU A CG   6  
ATOM 4410  C CD   . GLU A 1 13 ? -8.486  -0.691  -6.037  1.00 0.00 ? 304 GLU A CD   6  
ATOM 4411  O OE1  . GLU A 1 13 ? -9.565  -0.728  -5.411  1.00 0.00 ? 304 GLU A OE1  6  
ATOM 4412  O OE2  . GLU A 1 13 ? -8.400  -0.356  -7.237  1.00 0.00 ? 304 GLU A OE2  6  
ATOM 4413  H H    . GLU A 1 13 ? -6.556  -3.927  -2.090  1.00 0.00 ? 304 GLU A H    6  
ATOM 4414  H HA   . GLU A 1 13 ? -6.895  -3.777  -4.980  1.00 0.00 ? 304 GLU A HA   6  
ATOM 4415  H HB2  . GLU A 1 13 ? -8.531  -2.176  -4.056  1.00 0.00 ? 304 GLU A HB2  6  
ATOM 4416  H HG2  . GLU A 1 13 ? -6.715  -0.176  -4.989  1.00 0.00 ? 304 GLU A HG2  6  
ATOM 4417  N N    . ILE A 1 14 ? -4.540  -3.034  -5.221  1.00 0.00 ? 305 ILE A N    6  
ATOM 4418  C CA   . ILE A 1 14 ? -3.115  -2.753  -5.335  1.00 0.00 ? 305 ILE A CA   6  
ATOM 4419  C C    . ILE A 1 14 ? -2.862  -1.253  -5.438  1.00 0.00 ? 305 ILE A C    6  
ATOM 4420  O O    . ILE A 1 14 ? -3.589  -0.529  -6.118  1.00 0.00 ? 305 ILE A O    6  
ATOM 4421  C CB   . ILE A 1 14 ? -2.493  -3.458  -6.561  1.00 0.00 ? 305 ILE A CB   6  
ATOM 4422  C CG1  . ILE A 1 14 ? -2.656  -4.976  -6.443  1.00 0.00 ? 305 ILE A CG1  6  
ATOM 4423  C CG2  . ILE A 1 14 ? -1.020  -3.087  -6.708  1.00 0.00 ? 305 ILE A CG2  6  
ATOM 4424  C CD1  . ILE A 1 14 ? -1.875  -5.754  -7.480  1.00 0.00 ? 305 ILE A CD1  6  
ATOM 4425  H H    . ILE A 1 14 ? -5.037  -3.324  -6.013  1.00 0.00 ? 305 ILE A H    6  
ATOM 4426  H HA   . ILE A 1 14 ? -2.628  -3.129  -4.441  1.00 0.00 ? 305 ILE A HA   6  
ATOM 4427  H HB   . ILE A 1 14 ? -3.013  -3.117  -7.444  1.00 0.00 ? 305 ILE A HB   6  
ATOM 4428  H HG12 . ILE A 1 14 ? -2.316  -5.294  -5.468  1.00 0.00 ? 305 ILE A HG12 6  
ATOM 4429  H HG21 . ILE A 1 14 ? -0.418  -3.982  -6.693  1.00 0.00 ? 305 ILE A HG21 6  
ATOM 4430  H HG22 . ILE A 1 14 ? -0.872  -2.569  -7.644  1.00 0.00 ? 305 ILE A HG22 6  
ATOM 4431  H HG23 . ILE A 1 14 ? -0.728  -2.444  -5.892  1.00 0.00 ? 305 ILE A HG23 6  
ATOM 4432  H HD11 . ILE A 1 14 ? -2.311  -5.590  -8.456  1.00 0.00 ? 305 ILE A HD11 6  
ATOM 4433  H HD12 . ILE A 1 14 ? -0.848  -5.416  -7.484  1.00 0.00 ? 305 ILE A HD12 6  
ATOM 4434  H HD13 . ILE A 1 14 ? -1.908  -6.806  -7.243  1.00 0.00 ? 305 ILE A HD13 6  
ATOM 4435  N N    . ARG A 1 15 ? -1.820  -0.805  -4.756  1.00 0.00 ? 306 ARG A N    6  
ATOM 4436  C CA   . ARG A 1 15 ? -1.437  0.598   -4.757  1.00 0.00 ? 306 ARG A CA   6  
ATOM 4437  C C    . ARG A 1 15 ? 0.060   0.715   -4.509  1.00 0.00 ? 306 ARG A C    6  
ATOM 4438  O O    . ARG A 1 15 ? 0.698   -0.262  -4.135  1.00 0.00 ? 306 ARG A O    6  
ATOM 4439  C CB   . ARG A 1 15 ? -2.215  1.354   -3.680  1.00 0.00 ? 306 ARG A CB   6  
ATOM 4440  C CG   . ARG A 1 15 ? -3.513  1.961   -4.186  1.00 0.00 ? 306 ARG A CG   6  
ATOM 4441  C CD   . ARG A 1 15 ? -4.401  2.415   -3.039  1.00 0.00 ? 306 ARG A CD   6  
ATOM 4442  N NE   . ARG A 1 15 ? -5.767  1.920   -3.176  1.00 0.00 ? 306 ARG A NE   6  
ATOM 4443  C CZ   . ARG A 1 15 ? -6.676  2.481   -3.967  1.00 0.00 ? 306 ARG A CZ   6  
ATOM 4444  N NH1  . ARG A 1 15 ? -6.362  3.548   -4.688  1.00 0.00 ? 306 ARG A NH1  6  
ATOM 4445  N NH2  . ARG A 1 15 ? -7.899  1.972   -4.038  1.00 0.00 ? 306 ARG A NH2  6  
ATOM 4446  H H    . ARG A 1 15 ? -1.288  -1.440  -4.233  1.00 0.00 ? 306 ARG A H    6  
ATOM 4447  H HA   . ARG A 1 15 ? -1.670  1.012   -5.726  1.00 0.00 ? 306 ARG A HA   6  
ATOM 4448  H HB2  . ARG A 1 15 ? -2.451  0.672   -2.878  1.00 0.00 ? 306 ARG A HB2  6  
ATOM 4449  H HG2  . ARG A 1 15 ? -3.284  2.810   -4.811  1.00 0.00 ? 306 ARG A HG2  6  
ATOM 4450  H HD2  . ARG A 1 15 ? -3.986  2.047   -2.111  1.00 0.00 ? 306 ARG A HD2  6  
ATOM 4451  H HE   . ARG A 1 15 ? -6.019  1.131   -2.654  1.00 0.00 ? 306 ARG A HE   6  
ATOM 4452  H HH11 . ARG A 1 15 ? -5.440  3.932   -4.636  1.00 0.00 ? 306 ARG A HH11 6  
ATOM 4453  H HH12 . ARG A 1 15 ? -7.046  3.969   -5.283  1.00 0.00 ? 306 ARG A HH12 6  
ATOM 4454  H HH21 . ARG A 1 15 ? -8.138  1.166   -3.497  1.00 0.00 ? 306 ARG A HH21 6  
ATOM 4455  H HH22 . ARG A 1 15 ? -8.582  2.395   -4.634  1.00 0.00 ? 306 ARG A HH22 6  
ATOM 4456  N N    . ASN A 1 16 ? 0.627   1.895   -4.725  1.00 0.00 ? 307 ASN A N    6  
ATOM 4457  C CA   . ASN A 1 16 ? 2.059   2.085   -4.507  1.00 0.00 ? 307 ASN A CA   6  
ATOM 4458  C C    . ASN A 1 16 ? 2.318   3.269   -3.584  1.00 0.00 ? 307 ASN A C    6  
ATOM 4459  O O    . ASN A 1 16 ? 1.615   4.279   -3.635  1.00 0.00 ? 307 ASN A O    6  
ATOM 4460  C CB   . ASN A 1 16 ? 2.804   2.277   -5.834  1.00 0.00 ? 307 ASN A CB   6  
ATOM 4461  C CG   . ASN A 1 16 ? 2.144   1.556   -6.994  1.00 0.00 ? 307 ASN A CG   6  
ATOM 4462  O OD1  . ASN A 1 16 ? 1.118   1.996   -7.513  1.00 0.00 ? 307 ASN A OD1  6  
ATOM 4463  N ND2  . ASN A 1 16 ? 2.732   0.439   -7.407  1.00 0.00 ? 307 ASN A ND2  6  
ATOM 4464  H H    . ASN A 1 16 ? 0.078   2.647   -5.033  1.00 0.00 ? 307 ASN A H    6  
ATOM 4465  H HA   . ASN A 1 16 ? 2.432   1.193   -4.027  1.00 0.00 ? 307 ASN A HA   6  
ATOM 4466  H HB2  . ASN A 1 16 ? 2.847   3.329   -6.067  1.00 0.00 ? 307 ASN A HB2  6  
ATOM 4467  H HD21 . ASN A 1 16 ? 3.546   0.147   -6.945  1.00 0.00 ? 307 ASN A HD21 6  
ATOM 4468  H HD22 . ASN A 1 16 ? 2.328   -0.047  -8.155  1.00 0.00 ? 307 ASN A HD22 6  
ATOM 4469  N N    . THR A 1 17 ? 3.335   3.135   -2.739  1.00 0.00 ? 308 THR A N    6  
ATOM 4470  C CA   . THR A 1 17 ? 3.694   4.184   -1.795  1.00 0.00 ? 308 THR A CA   6  
ATOM 4471  C C    . THR A 1 17 ? 4.145   5.450   -2.515  1.00 0.00 ? 308 THR A C    6  
ATOM 4472  O O    . THR A 1 17 ? 3.487   6.487   -2.437  1.00 0.00 ? 308 THR A O    6  
ATOM 4473  C CB   . THR A 1 17 ? 4.813   3.718   -0.846  1.00 0.00 ? 308 THR A CB   6  
ATOM 4474  O OG1  . THR A 1 17 ? 5.899   3.165   -1.600  1.00 0.00 ? 308 THR A OG1  6  
ATOM 4475  C CG2  . THR A 1 17 ? 4.284   2.678   0.130   1.00 0.00 ? 308 THR A CG2  6  
ATOM 4476  H H    . THR A 1 17 ? 3.858   2.307   -2.752  1.00 0.00 ? 308 THR A H    6  
ATOM 4477  H HA   . THR A 1 17 ? 2.821   4.413   -1.201  1.00 0.00 ? 308 THR A HA   6  
ATOM 4478  H HB   . THR A 1 17 ? 5.170   4.569   -0.284  1.00 0.00 ? 308 THR A HB   6  
ATOM 4479  H HG1  . THR A 1 17 ? 6.726   3.331   -1.139  1.00 0.00 ? 308 THR A HG1  6  
ATOM 4480  H HG21 . THR A 1 17 ? 4.576   1.690   -0.195  1.00 0.00 ? 308 THR A HG21 6  
ATOM 4481  H HG22 . THR A 1 17 ? 3.206   2.740   0.163   1.00 0.00 ? 308 THR A HG22 6  
ATOM 4482  H HG23 . THR A 1 17 ? 4.688   2.867   1.115   1.00 0.00 ? 308 THR A HG23 6  
ATOM 4483  N N    . ALA A 1 18 ? 5.267   5.355   -3.218  1.00 0.00 ? 309 ALA A N    6  
ATOM 4484  C CA   . ALA A 1 18 ? 5.810   6.493   -3.951  1.00 0.00 ? 309 ALA A CA   6  
ATOM 4485  C C    . ALA A 1 18 ? 7.157   6.145   -4.571  1.00 0.00 ? 309 ALA A C    6  
ATOM 4486  O O    . ALA A 1 18 ? 7.319   6.179   -5.792  1.00 0.00 ? 309 ALA A O    6  
ATOM 4487  C CB   . ALA A 1 18 ? 5.945   7.695   -3.030  1.00 0.00 ? 309 ALA A CB   6  
ATOM 4488  H H    . ALA A 1 18 ? 5.744   4.499   -3.245  1.00 0.00 ? 309 ALA A H    6  
ATOM 4489  H HA   . ALA A 1 18 ? 5.115   6.746   -4.739  1.00 0.00 ? 309 ALA A HA   6  
ATOM 4490  H HB1  . ALA A 1 18 ? 5.386   7.517   -2.123  1.00 0.00 ? 309 ALA A HB1  6  
ATOM 4491  H HB2  . ALA A 1 18 ? 6.986   7.847   -2.789  1.00 0.00 ? 309 ALA A HB2  6  
ATOM 4492  H HB3  . ALA A 1 18 ? 5.558   8.573   -3.526  1.00 0.00 ? 309 ALA A HB3  6  
ATOM 4493  N N    . THR A 1 19 ? 8.123   5.814   -3.722  1.00 0.00 ? 310 THR A N    6  
ATOM 4494  C CA   . THR A 1 19 ? 9.453   5.449   -4.188  1.00 0.00 ? 310 THR A CA   6  
ATOM 4495  C C    . THR A 1 19 ? 9.383   4.286   -5.174  1.00 0.00 ? 310 THR A C    6  
ATOM 4496  O O    . THR A 1 19 ? 10.294  4.082   -5.976  1.00 0.00 ? 310 THR A O    6  
ATOM 4497  C CB   . THR A 1 19 ? 10.373  5.058   -3.019  1.00 0.00 ? 310 THR A CB   6  
ATOM 4498  O OG1  . THR A 1 19 ? 11.695  4.789   -3.499  1.00 0.00 ? 310 THR A OG1  6  
ATOM 4499  C CG2  . THR A 1 19 ? 9.830   3.836   -2.301  1.00 0.00 ? 310 THR A CG2  6  
ATOM 4500  H H    . THR A 1 19 ? 7.935   5.813   -2.759  1.00 0.00 ? 310 THR A H    6  
ATOM 4501  H HA   . THR A 1 19 ? 9.880   6.305   -4.683  1.00 0.00 ? 310 THR A HA   6  
ATOM 4502  H HB   . THR A 1 19 ? 10.411  5.880   -2.318  1.00 0.00 ? 310 THR A HB   6  
ATOM 4503  H HG1  . THR A 1 19 ? 11.740  3.885   -3.819  1.00 0.00 ? 310 THR A HG1  6  
ATOM 4504  H HG21 . THR A 1 19 ? 10.278  3.764   -1.321  1.00 0.00 ? 310 THR A HG21 6  
ATOM 4505  H HG22 . THR A 1 19 ? 10.066  2.951   -2.872  1.00 0.00 ? 310 THR A HG22 6  
ATOM 4506  H HG23 . THR A 1 19 ? 8.759   3.926   -2.202  1.00 0.00 ? 310 THR A HG23 6  
ATOM 4507  N N    . GLY A 1 20 ? 8.291   3.526   -5.108  1.00 0.00 ? 311 GLY A N    6  
ATOM 4508  C CA   . GLY A 1 20 ? 8.117   2.397   -6.001  1.00 0.00 ? 311 GLY A CA   6  
ATOM 4509  C C    . GLY A 1 20 ? 7.851   1.099   -5.261  1.00 0.00 ? 311 GLY A C    6  
ATOM 4510  O O    . GLY A 1 20 ? 8.436   0.065   -5.581  1.00 0.00 ? 311 GLY A O    6  
ATOM 4511  H H    . GLY A 1 20 ? 7.601   3.735   -4.446  1.00 0.00 ? 311 GLY A H    6  
ATOM 4512  H HA2  . GLY A 1 20 ? 7.281   2.598   -6.657  1.00 0.00 ? 311 GLY A HA2  6  
ATOM 4513  H HA3  . GLY A 1 20 ? 9.008   2.282   -6.597  1.00 0.00 ? 311 GLY A HA3  6  
ATOM 4514  N N    . ARG A 1 21 ? 6.968   1.152   -4.269  1.00 0.00 ? 312 ARG A N    6  
ATOM 4515  C CA   . ARG A 1 21 ? 6.623   -0.029  -3.489  1.00 0.00 ? 312 ARG A CA   6  
ATOM 4516  C C    . ARG A 1 21 ? 5.128   -0.248  -3.494  1.00 0.00 ? 312 ARG A C    6  
ATOM 4517  O O    . ARG A 1 21 ? 4.355   0.557   -2.975  1.00 0.00 ? 312 ARG A O    6  
ATOM 4518  C CB   . ARG A 1 21 ? 7.144   0.092   -2.057  1.00 0.00 ? 312 ARG A CB   6  
ATOM 4519  C CG   . ARG A 1 21 ? 7.669   -1.217  -1.486  1.00 0.00 ? 312 ARG A CG   6  
ATOM 4520  C CD   . ARG A 1 21 ? 6.605   -2.307  -1.487  1.00 0.00 ? 312 ARG A CD   6  
ATOM 4521  N NE   . ARG A 1 21 ? 6.931   -3.387  -2.414  1.00 0.00 ? 312 ARG A NE   6  
ATOM 4522  C CZ   . ARG A 1 21 ? 7.858   -4.307  -2.173  1.00 0.00 ? 312 ARG A CZ   6  
ATOM 4523  N NH1  . ARG A 1 21 ? 8.551   -4.272  -1.042  1.00 0.00 ? 312 ARG A NH1  6  
ATOM 4524  N NH2  . ARG A 1 21 ? 8.098   -5.260  -3.063  1.00 0.00 ? 312 ARG A NH2  6  
ATOM 4525  H H    . ARG A 1 21 ? 6.536   2.005   -4.059  1.00 0.00 ? 312 ARG A H    6  
ATOM 4526  H HA   . ARG A 1 21 ? 7.077   -0.886  -3.964  1.00 0.00 ? 312 ARG A HA   6  
ATOM 4527  H HB2  . ARG A 1 21 ? 7.949   0.813   -2.041  1.00 0.00 ? 312 ARG A HB2  6  
ATOM 4528  H HG2  . ARG A 1 21 ? 8.507   -1.547  -2.084  1.00 0.00 ? 312 ARG A HG2  6  
ATOM 4529  H HD2  . ARG A 1 21 ? 6.528   -2.716  -0.491  1.00 0.00 ? 312 ARG A HD2  6  
ATOM 4530  H HE   . ARG A 1 21 ? 6.433   -3.428  -3.257  1.00 0.00 ? 312 ARG A HE   6  
ATOM 4531  H HH11 . ARG A 1 21 ? 8.374   -3.554  -0.370  1.00 0.00 ? 312 ARG A HH11 6  
ATOM 4532  H HH12 . ARG A 1 21 ? 9.248   -4.965  -0.862  1.00 0.00 ? 312 ARG A HH12 6  
ATOM 4533  H HH21 . ARG A 1 21 ? 7.579   -5.288  -3.918  1.00 0.00 ? 312 ARG A HH21 6  
ATOM 4534  H HH22 . ARG A 1 21 ? 8.796   -5.952  -2.878  1.00 0.00 ? 312 ARG A HH22 6  
ATOM 4535  N N    . VAL A 1 22 ? 4.741   -1.358  -4.091  1.00 0.00 ? 313 VAL A N    6  
ATOM 4536  C CA   . VAL A 1 22 ? 3.349   -1.720  -4.206  1.00 0.00 ? 313 VAL A CA   6  
ATOM 4537  C C    . VAL A 1 22 ? 2.857   -2.473  -2.969  1.00 0.00 ? 313 VAL A C    6  
ATOM 4538  O O    . VAL A 1 22 ? 3.375   -3.534  -2.624  1.00 0.00 ? 313 VAL A O    6  
ATOM 4539  C CB   . VAL A 1 22 ? 3.129   -2.583  -5.460  1.00 0.00 ? 313 VAL A CB   6  
ATOM 4540  C CG1  . VAL A 1 22 ? 4.087   -3.760  -5.463  1.00 0.00 ? 313 VAL A CG1  6  
ATOM 4541  C CG2  . VAL A 1 22 ? 1.696   -3.056  -5.543  1.00 0.00 ? 313 VAL A CG2  6  
ATOM 4542  H H    . VAL A 1 22 ? 5.419   -1.954  -4.469  1.00 0.00 ? 313 VAL A H    6  
ATOM 4543  H HA   . VAL A 1 22 ? 2.779   -0.813  -4.316  1.00 0.00 ? 313 VAL A HA   6  
ATOM 4544  H HB   . VAL A 1 22 ? 3.335   -1.979  -6.330  1.00 0.00 ? 313 VAL A HB   6  
ATOM 4545  H HG11 . VAL A 1 22 ? 3.527   -4.681  -5.518  1.00 0.00 ? 313 VAL A HG11 6  
ATOM 4546  H HG12 . VAL A 1 22 ? 4.745   -3.683  -6.316  1.00 0.00 ? 313 VAL A HG12 6  
ATOM 4547  H HG13 . VAL A 1 22 ? 4.674   -3.746  -4.556  1.00 0.00 ? 313 VAL A HG13 6  
ATOM 4548  H HG21 . VAL A 1 22 ? 1.061   -2.343  -5.041  1.00 0.00 ? 313 VAL A HG21 6  
ATOM 4549  H HG22 . VAL A 1 22 ? 1.407   -3.137  -6.578  1.00 0.00 ? 313 VAL A HG22 6  
ATOM 4550  H HG23 . VAL A 1 22 ? 1.611   -4.018  -5.064  1.00 0.00 ? 313 VAL A HG23 6  
ATOM 4551  N N    . TYR A 1 23 ? 1.851   -1.907  -2.312  1.00 0.00 ? 314 TYR A N    6  
ATOM 4552  C CA   . TYR A 1 23 ? 1.259   -2.522  -1.134  1.00 0.00 ? 314 TYR A CA   6  
ATOM 4553  C C    . TYR A 1 23 ? -0.169  -2.941  -1.436  1.00 0.00 ? 314 TYR A C    6  
ATOM 4554  O O    . TYR A 1 23 ? -0.642  -2.796  -2.563  1.00 0.00 ? 314 TYR A O    6  
ATOM 4555  C CB   . TYR A 1 23 ? 1.278   -1.566  0.062   1.00 0.00 ? 314 TYR A CB   6  
ATOM 4556  C CG   . TYR A 1 23 ? 0.442   -0.316  -0.116  1.00 0.00 ? 314 TYR A CG   6  
ATOM 4557  C CD1  . TYR A 1 23 ? 0.816   0.674   -1.014  1.00 0.00 ? 314 TYR A CD1  6  
ATOM 4558  C CD2  . TYR A 1 23 ? -0.723  -0.126  0.620   1.00 0.00 ? 314 TYR A CD2  6  
ATOM 4559  C CE1  . TYR A 1 23 ? 0.054   1.813   -1.179  1.00 0.00 ? 314 TYR A CE1  6  
ATOM 4560  C CE2  . TYR A 1 23 ? -1.490  1.014   0.460   1.00 0.00 ? 314 TYR A CE2  6  
ATOM 4561  C CZ   . TYR A 1 23 ? -1.097  1.977   -0.441  1.00 0.00 ? 314 TYR A CZ   6  
ATOM 4562  O OH   . TYR A 1 23 ? -1.855  3.107   -0.601  1.00 0.00 ? 314 TYR A OH   6  
ATOM 4563  H H    . TYR A 1 23 ? 1.493   -1.057  -2.636  1.00 0.00 ? 314 TYR A H    6  
ATOM 4564  H HA   . TYR A 1 23 ? 1.837   -3.401  -0.893  1.00 0.00 ? 314 TYR A HA   6  
ATOM 4565  H HB2  . TYR A 1 23 ? 0.897   -2.088  0.925   1.00 0.00 ? 314 TYR A HB2  6  
ATOM 4566  H HD1  . TYR A 1 23 ? 1.720   0.549   -1.589  1.00 0.00 ? 314 TYR A HD1  6  
ATOM 4567  H HD2  . TYR A 1 23 ? -1.024  -0.880  1.332   1.00 0.00 ? 314 TYR A HD2  6  
ATOM 4568  H HE1  . TYR A 1 23 ? 0.366   2.572   -1.878  1.00 0.00 ? 314 TYR A HE1  6  
ATOM 4569  H HE2  . TYR A 1 23 ? -2.388  1.151   1.044   1.00 0.00 ? 314 TYR A HE2  6  
ATOM 4570  H HH   . TYR A 1 23 ? -2.751  2.861   -0.844  1.00 0.00 ? 314 TYR A HH   6  
ATOM 4571  N N    . PHE A 1 24 ? -0.857  -3.459  -0.430  1.00 0.00 ? 315 PHE A N    6  
ATOM 4572  C CA   . PHE A 1 24 ? -2.231  -3.892  -0.612  1.00 0.00 ? 315 PHE A CA   6  
ATOM 4573  C C    . PHE A 1 24 ? -3.152  -3.225  0.394   1.00 0.00 ? 315 PHE A C    6  
ATOM 4574  O O    . PHE A 1 24 ? -2.851  -3.161  1.588   1.00 0.00 ? 315 PHE A O    6  
ATOM 4575  C CB   . PHE A 1 24 ? -2.330  -5.412  -0.508  1.00 0.00 ? 315 PHE A CB   6  
ATOM 4576  C CG   . PHE A 1 24 ? -1.707  -6.120  -1.675  1.00 0.00 ? 315 PHE A CG   6  
ATOM 4577  C CD1  . PHE A 1 24 ? -0.337  -6.319  -1.731  1.00 0.00 ? 315 PHE A CD1  6  
ATOM 4578  C CD2  . PHE A 1 24 ? -2.491  -6.580  -2.720  1.00 0.00 ? 315 PHE A CD2  6  
ATOM 4579  C CE1  . PHE A 1 24 ? 0.240   -6.964  -2.810  1.00 0.00 ? 315 PHE A CE1  6  
ATOM 4580  C CE2  . PHE A 1 24 ? -1.921  -7.226  -3.801  1.00 0.00 ? 315 PHE A CE2  6  
ATOM 4581  C CZ   . PHE A 1 24 ? -0.553  -7.419  -3.845  1.00 0.00 ? 315 PHE A CZ   6  
ATOM 4582  H H    . PHE A 1 24 ? -0.433  -3.552  0.448   1.00 0.00 ? 315 PHE A H    6  
ATOM 4583  H HA   . PHE A 1 24 ? -2.535  -3.587  -1.601  1.00 0.00 ? 315 PHE A HA   6  
ATOM 4584  H HB2  . PHE A 1 24 ? -1.828  -5.741  0.390   1.00 0.00 ? 315 PHE A HB2  6  
ATOM 4585  H HD1  . PHE A 1 24 ? 0.283   -5.965  -0.922  1.00 0.00 ? 315 PHE A HD1  6  
ATOM 4586  H HD2  . PHE A 1 24 ? -3.561  -6.429  -2.684  1.00 0.00 ? 315 PHE A HD2  6  
ATOM 4587  H HE1  . PHE A 1 24 ? 1.310   -7.111  -2.842  1.00 0.00 ? 315 PHE A HE1  6  
ATOM 4588  H HE2  . PHE A 1 24 ? -2.543  -7.581  -4.610  1.00 0.00 ? 315 PHE A HE2  6  
ATOM 4589  H HZ   . PHE A 1 24 ? -0.105  -7.923  -4.688  1.00 0.00 ? 315 PHE A HZ   6  
ATOM 4590  N N    . VAL A 1 25 ? -4.276  -2.731  -0.102  1.00 0.00 ? 316 VAL A N    6  
ATOM 4591  C CA   . VAL A 1 25 ? -5.248  -2.052  0.737   1.00 0.00 ? 316 VAL A CA   6  
ATOM 4592  C C    . VAL A 1 25 ? -6.474  -2.923  0.979   1.00 0.00 ? 316 VAL A C    6  
ATOM 4593  O O    . VAL A 1 25 ? -7.196  -3.271  0.042   1.00 0.00 ? 316 VAL A O    6  
ATOM 4594  C CB   . VAL A 1 25 ? -5.699  -0.720  0.105   1.00 0.00 ? 316 VAL A CB   6  
ATOM 4595  C CG1  . VAL A 1 25 ? -6.328  0.186   1.150   1.00 0.00 ? 316 VAL A CG1  6  
ATOM 4596  C CG2  . VAL A 1 25 ? -4.531  -0.022  -0.578  1.00 0.00 ? 316 VAL A CG2  6  
ATOM 4597  H H    . VAL A 1 25 ? -4.457  -2.826  -1.060  1.00 0.00 ? 316 VAL A H    6  
ATOM 4598  H HA   . VAL A 1 25 ? -4.777  -1.839  1.684   1.00 0.00 ? 316 VAL A HA   6  
ATOM 4599  H HB   . VAL A 1 25 ? -6.445  -0.936  -0.645  1.00 0.00 ? 316 VAL A HB   6  
ATOM 4600  H HG11 . VAL A 1 25 ? -6.221  1.216   0.845   1.00 0.00 ? 316 VAL A HG11 6  
ATOM 4601  H HG12 . VAL A 1 25 ? -7.377  -0.055  1.247   1.00 0.00 ? 316 VAL A HG12 6  
ATOM 4602  H HG13 . VAL A 1 25 ? -5.836  0.039   2.099   1.00 0.00 ? 316 VAL A HG13 6  
ATOM 4603  H HG21 . VAL A 1 25 ? -4.611  -0.150  -1.648  1.00 0.00 ? 316 VAL A HG21 6  
ATOM 4604  H HG22 . VAL A 1 25 ? -4.548  1.030   -0.337  1.00 0.00 ? 316 VAL A HG22 6  
ATOM 4605  H HG23 . VAL A 1 25 ? -3.602  -0.455  -0.234  1.00 0.00 ? 316 VAL A HG23 6  
ATOM 4606  N N    . ASP A 1 26 ? -6.702  -3.276  2.238   1.00 0.00 ? 317 ASP A N    6  
ATOM 4607  C CA   . ASP A 1 26 ? -7.847  -4.100  2.605   1.00 0.00 ? 317 ASP A CA   6  
ATOM 4608  C C    . ASP A 1 26 ? -9.059  -3.228  2.904   1.00 0.00 ? 317 ASP A C    6  
ATOM 4609  O O    . ASP A 1 26 ? -9.072  -2.481  3.883   1.00 0.00 ? 317 ASP A O    6  
ATOM 4610  C CB   . ASP A 1 26 ? -7.519  -4.963  3.823   1.00 0.00 ? 317 ASP A CB   6  
ATOM 4611  C CG   . ASP A 1 26 ? -8.245  -6.293  3.799   1.00 0.00 ? 317 ASP A CG   6  
ATOM 4612  O OD1  . ASP A 1 26 ? -8.960  -6.561  2.810   1.00 0.00 ? 317 ASP A OD1  6  
ATOM 4613  O OD2  . ASP A 1 26 ? -8.100  -7.067  4.769   1.00 0.00 ? 317 ASP A OD2  6  
ATOM 4614  H H    . ASP A 1 26 ? -6.085  -2.976  2.938   1.00 0.00 ? 317 ASP A H    6  
ATOM 4615  H HA   . ASP A 1 26 ? -8.076  -4.743  1.768   1.00 0.00 ? 317 ASP A HA   6  
ATOM 4616  H HB2  . ASP A 1 26 ? -6.456  -5.153  3.849   1.00 0.00 ? 317 ASP A HB2  6  
ATOM 4617  N N    . HIS A 1 27 ? -10.076 -3.327  2.056   1.00 0.00 ? 318 HIS A N    6  
ATOM 4618  C CA   . HIS A 1 27 ? -11.292 -2.544  2.231   1.00 0.00 ? 318 HIS A CA   6  
ATOM 4619  C C    . HIS A 1 27 ? -12.246 -3.225  3.209   1.00 0.00 ? 318 HIS A C    6  
ATOM 4620  O O    . HIS A 1 27 ? -13.128 -2.581  3.779   1.00 0.00 ? 318 HIS A O    6  
ATOM 4621  C CB   . HIS A 1 27 ? -11.976 -2.324  0.881   1.00 0.00 ? 318 HIS A CB   6  
ATOM 4622  C CG   . HIS A 1 27 ? -11.343 -1.235  0.073   1.00 0.00 ? 318 HIS A CG   6  
ATOM 4623  N ND1  . HIS A 1 27 ? -11.432 0.079   0.456   1.00 0.00 ? 318 HIS A ND1  6  
ATOM 4624  C CD2  . HIS A 1 27 ? -10.615 -1.316  -1.068  1.00 0.00 ? 318 HIS A CD2  6  
ATOM 4625  C CE1  . HIS A 1 27 ? -10.762 0.767   -0.449  1.00 0.00 ? 318 HIS A CE1  6  
ATOM 4626  N NE2  . HIS A 1 27 ? -10.248 -0.035  -1.394  1.00 0.00 ? 318 HIS A NE2  6  
ATOM 4627  H H    . HIS A 1 27 ? -10.010 -3.945  1.296   1.00 0.00 ? 318 HIS A H    6  
ATOM 4628  H HA   . HIS A 1 27 ? -11.009 -1.584  2.637   1.00 0.00 ? 318 HIS A HA   6  
ATOM 4629  H HB2  . HIS A 1 27 ? -11.927 -3.236  0.308   1.00 0.00 ? 318 HIS A HB2  6  
ATOM 4630  H HD2  . HIS A 1 27 ? -10.367 -2.213  -1.616  1.00 0.00 ? 318 HIS A HD2  6  
ATOM 4631  H HE1  . HIS A 1 27 ? -10.636 1.839   -0.427  1.00 0.00 ? 318 HIS A HE1  6  
ATOM 4632  H HE2  . HIS A 1 27 ? -9.858  0.252   -2.246  1.00 0.00 ? 318 HIS A HE2  6  
ATOM 4633  N N    . ASN A 1 28 ? -12.066 -4.529  3.402   1.00 0.00 ? 319 ASN A N    6  
ATOM 4634  C CA   . ASN A 1 28 ? -12.906 -5.289  4.320   1.00 0.00 ? 319 ASN A CA   6  
ATOM 4635  C C    . ASN A 1 28 ? -12.497 -5.019  5.765   1.00 0.00 ? 319 ASN A C    6  
ATOM 4636  O O    . ASN A 1 28 ? -13.337 -4.993  6.665   1.00 0.00 ? 319 ASN A O    6  
ATOM 4637  C CB   . ASN A 1 28 ? -12.805 -6.785  4.019   1.00 0.00 ? 319 ASN A CB   6  
ATOM 4638  C CG   . ASN A 1 28 ? -12.872 -7.082  2.534   1.00 0.00 ? 319 ASN A CG   6  
ATOM 4639  O OD1  . ASN A 1 28 ? -13.562 -6.393  1.782   1.00 0.00 ? 319 ASN A OD1  6  
ATOM 4640  N ND2  . ASN A 1 28 ? -12.152 -8.110  2.101   1.00 0.00 ? 319 ASN A ND2  6  
ATOM 4641  H H    . ASN A 1 28 ? -11.354 -4.993  2.914   1.00 0.00 ? 319 ASN A H    6  
ATOM 4642  H HA   . ASN A 1 28 ? -13.928 -4.968  4.180   1.00 0.00 ? 319 ASN A HA   6  
ATOM 4643  H HB2  . ASN A 1 28 ? -11.867 -7.160  4.400   1.00 0.00 ? 319 ASN A HB2  6  
ATOM 4644  H HD21 . ASN A 1 28 ? -11.626 -8.616  2.756   1.00 0.00 ? 319 ASN A HD21 6  
ATOM 4645  H HD22 . ASN A 1 28 ? -12.177 -8.323  1.145   1.00 0.00 ? 319 ASN A HD22 6  
ATOM 4646  N N    . ASN A 1 29 ? -11.200 -4.817  5.977   1.00 0.00 ? 320 ASN A N    6  
ATOM 4647  C CA   . ASN A 1 29 ? -10.671 -4.545  7.309   1.00 0.00 ? 320 ASN A CA   6  
ATOM 4648  C C    . ASN A 1 29 ? -10.235 -3.086  7.433   1.00 0.00 ? 320 ASN A C    6  
ATOM 4649  O O    . ASN A 1 29 ? -10.150 -2.547  8.536   1.00 0.00 ? 320 ASN A O    6  
ATOM 4650  C CB   . ASN A 1 29 ? -9.489  -5.468  7.613   1.00 0.00 ? 320 ASN A CB   6  
ATOM 4651  C CG   . ASN A 1 29 ? -9.911  -6.918  7.752   1.00 0.00 ? 320 ASN A CG   6  
ATOM 4652  O OD1  . ASN A 1 29 ? -10.730 -7.260  8.604   1.00 0.00 ? 320 ASN A OD1  6  
ATOM 4653  N ND2  . ASN A 1 29 ? -9.349  -7.777  6.910   1.00 0.00 ? 320 ASN A ND2  6  
ATOM 4654  H H    . ASN A 1 29 ? -10.582 -4.853  5.217   1.00 0.00 ? 320 ASN A H    6  
ATOM 4655  H HA   . ASN A 1 29 ? -11.459 -4.734  8.022   1.00 0.00 ? 320 ASN A HA   6  
ATOM 4656  H HB2  . ASN A 1 29 ? -8.769  -5.401  6.810   1.00 0.00 ? 320 ASN A HB2  6  
ATOM 4657  H HD21 . ASN A 1 29 ? -8.704  -7.431  6.258   1.00 0.00 ? 320 ASN A HD21 6  
ATOM 4658  H HD22 . ASN A 1 29 ? -9.602  -8.720  6.975   1.00 0.00 ? 320 ASN A HD22 6  
ATOM 4659  N N    . ARG A 1 30 ? -9.962  -2.453  6.295   1.00 0.00 ? 321 ARG A N    6  
ATOM 4660  C CA   . ARG A 1 30 ? -9.535  -1.057  6.273   1.00 0.00 ? 321 ARG A CA   6  
ATOM 4661  C C    . ARG A 1 30 ? -8.097  -0.917  6.760   1.00 0.00 ? 321 ARG A C    6  
ATOM 4662  O O    . ARG A 1 30 ? -7.790  -0.047  7.574   1.00 0.00 ? 321 ARG A O    6  
ATOM 4663  C CB   . ARG A 1 30 ? -10.464 -0.200  7.133   1.00 0.00 ? 321 ARG A CB   6  
ATOM 4664  C CG   . ARG A 1 30 ? -11.937 -0.499  6.911   1.00 0.00 ? 321 ARG A CG   6  
ATOM 4665  C CD   . ARG A 1 30 ? -12.568 -1.130  8.141   1.00 0.00 ? 321 ARG A CD   6  
ATOM 4666  N NE   . ARG A 1 30 ? -13.871 -0.547  8.447   1.00 0.00 ? 321 ARG A NE   6  
ATOM 4667  C CZ   . ARG A 1 30 ? -14.760 -1.114  9.253   1.00 0.00 ? 321 ARG A CZ   6  
ATOM 4668  N NH1  . ARG A 1 30 ? -14.484 -2.272  9.838   1.00 0.00 ? 321 ARG A NH1  6  
ATOM 4669  N NH2  . ARG A 1 30 ? -15.927 -0.526  9.478   1.00 0.00 ? 321 ARG A NH2  6  
ATOM 4670  H H    . ARG A 1 30 ? -10.048 -2.935  5.446   1.00 0.00 ? 321 ARG A H    6  
ATOM 4671  H HA   . ARG A 1 30 ? -9.589  -0.713  5.251   1.00 0.00 ? 321 ARG A HA   6  
ATOM 4672  H HB2  . ARG A 1 30 ? -10.236 -0.373  8.174   1.00 0.00 ? 321 ARG A HB2  6  
ATOM 4673  H HG2  . ARG A 1 30 ? -12.452 0.422   6.686   1.00 0.00 ? 321 ARG A HG2  6  
ATOM 4674  H HD2  . ARG A 1 30 ? -12.691 -2.188  7.964   1.00 0.00 ? 321 ARG A HD2  6  
ATOM 4675  H HE   . ARG A 1 30 ? -14.094 0.311   8.028   1.00 0.00 ? 321 ARG A HE   6  
ATOM 4676  H HH11 . ARG A 1 30 ? -13.605 -2.719  9.672   1.00 0.00 ? 321 ARG A HH11 6  
ATOM 4677  H HH12 . ARG A 1 30 ? -15.155 -2.700  10.444  1.00 0.00 ? 321 ARG A HH12 6  
ATOM 4678  H HH21 . ARG A 1 30 ? -16.139 0.348   9.040   1.00 0.00 ? 321 ARG A HH21 6  
ATOM 4679  H HH22 . ARG A 1 30 ? -16.595 -0.955  10.086  1.00 0.00 ? 321 ARG A HH22 6  
ATOM 4680  N N    . THR A 1 31 ? -7.221  -1.778  6.256   1.00 0.00 ? 322 THR A N    6  
ATOM 4681  C CA   . THR A 1 31 ? -5.816  -1.748  6.639   1.00 0.00 ? 322 THR A CA   6  
ATOM 4682  C C    . THR A 1 31 ? -4.914  -1.863  5.417   1.00 0.00 ? 322 THR A C    6  
ATOM 4683  O O    . THR A 1 31 ? -5.356  -1.657  4.287   1.00 0.00 ? 322 THR A O    6  
ATOM 4684  C CB   . THR A 1 31 ? -5.472  -2.874  7.634   1.00 0.00 ? 322 THR A CB   6  
ATOM 4685  O OG1  . THR A 1 31 ? -4.121  -2.728  8.089   1.00 0.00 ? 322 THR A OG1  6  
ATOM 4686  C CG2  . THR A 1 31 ? -5.650  -4.243  6.996   1.00 0.00 ? 322 THR A CG2  6  
ATOM 4687  H H    . THR A 1 31 ? -7.528  -2.450  5.610   1.00 0.00 ? 322 THR A H    6  
ATOM 4688  H HA   . THR A 1 31 ? -5.624  -0.801  7.119   1.00 0.00 ? 322 THR A HA   6  
ATOM 4689  H HB   . THR A 1 31 ? -6.138  -2.799  8.481   1.00 0.00 ? 322 THR A HB   6  
ATOM 4690  H HG1  . THR A 1 31 ? -3.858  -3.519  8.567   1.00 0.00 ? 322 THR A HG1  6  
ATOM 4691  H HG21 . THR A 1 31 ? -4.976  -4.946  7.460   1.00 0.00 ? 322 THR A HG21 6  
ATOM 4692  H HG22 . THR A 1 31 ? -5.432  -4.180  5.939   1.00 0.00 ? 322 THR A HG22 6  
ATOM 4693  H HG23 . THR A 1 31 ? -6.668  -4.574  7.135   1.00 0.00 ? 322 THR A HG23 6  
ATOM 4694  N N    . THR A 1 32 ? -3.650  -2.193  5.648   1.00 0.00 ? 323 THR A N    6  
ATOM 4695  C CA   . THR A 1 32 ? -2.689  -2.328  4.564   1.00 0.00 ? 323 THR A CA   6  
ATOM 4696  C C    . THR A 1 32 ? -1.720  -3.471  4.821   1.00 0.00 ? 323 THR A C    6  
ATOM 4697  O O    . THR A 1 32 ? -1.700  -4.056  5.905   1.00 0.00 ? 323 THR A O    6  
ATOM 4698  C CB   . THR A 1 32 ? -1.882  -1.032  4.368   1.00 0.00 ? 323 THR A CB   6  
ATOM 4699  O OG1  . THR A 1 32 ? -1.462  -0.529  5.642   1.00 0.00 ? 323 THR A OG1  6  
ATOM 4700  C CG2  . THR A 1 32 ? -2.719  0.021   3.652   1.00 0.00 ? 323 THR A CG2  6  
ATOM 4701  H H    . THR A 1 32 ? -3.356  -2.351  6.570   1.00 0.00 ? 323 THR A H    6  
ATOM 4702  H HA   . THR A 1 32 ? -3.238  -2.527  3.656   1.00 0.00 ? 323 THR A HA   6  
ATOM 4703  H HB   . THR A 1 32 ? -1.003  -1.253  3.766   1.00 0.00 ? 323 THR A HB   6  
ATOM 4704  H HG1  . THR A 1 32 ? -0.578  -0.848  5.836   1.00 0.00 ? 323 THR A HG1  6  
ATOM 4705  H HG21 . THR A 1 32 ? -2.473  1.002   4.036   1.00 0.00 ? 323 THR A HG21 6  
ATOM 4706  H HG22 . THR A 1 32 ? -3.771  -0.176  3.818   1.00 0.00 ? 323 THR A HG22 6  
ATOM 4707  H HG23 . THR A 1 32 ? -2.512  -0.013  2.593   1.00 0.00 ? 323 THR A HG23 6  
ATOM 4708  N N    . GLN A 1 33 ? -0.918  -3.784  3.813   1.00 0.00 ? 324 GLN A N    6  
ATOM 4709  C CA   . GLN A 1 33 ? 0.070   -4.850  3.919   1.00 0.00 ? 324 GLN A CA   6  
ATOM 4710  C C    . GLN A 1 33 ? 0.805   -5.029  2.598   1.00 0.00 ? 324 GLN A C    6  
ATOM 4711  O O    . GLN A 1 33 ? 0.189   -5.121  1.537   1.00 0.00 ? 324 GLN A O    6  
ATOM 4712  C CB   . GLN A 1 33 ? -0.591  -6.166  4.336   1.00 0.00 ? 324 GLN A CB   6  
ATOM 4713  C CG   . GLN A 1 33 ? -2.020  -6.324  3.844   1.00 0.00 ? 324 GLN A CG   6  
ATOM 4714  C CD   . GLN A 1 33 ? -2.452  -7.776  3.777   1.00 0.00 ? 324 GLN A CD   6  
ATOM 4715  O OE1  . GLN A 1 33 ? -3.044  -8.304  4.719   1.00 0.00 ? 324 GLN A OE1  6  
ATOM 4716  N NE2  . GLN A 1 33 ? -2.155  -8.431  2.661   1.00 0.00 ? 324 GLN A NE2  6  
ATOM 4717  H H    . GLN A 1 33 ? -0.993  -3.286  2.971   1.00 0.00 ? 324 GLN A H    6  
ATOM 4718  H HA   . GLN A 1 33 ? 0.784   -4.560  4.675   1.00 0.00 ? 324 GLN A HA   6  
ATOM 4719  H HB2  . GLN A 1 33 ? -0.007  -6.987  3.947   1.00 0.00 ? 324 GLN A HB2  6  
ATOM 4720  H HG2  . GLN A 1 33 ? -2.679  -5.798  4.519   1.00 0.00 ? 324 GLN A HG2  6  
ATOM 4721  H HE21 . GLN A 1 33 ? -1.680  -7.947  1.953   1.00 0.00 ? 324 GLN A HE21 6  
ATOM 4722  H HE22 . GLN A 1 33 ? -2.421  -9.372  2.591   1.00 0.00 ? 324 GLN A HE22 6  
ATOM 4723  N N    . PHE A 1 34 ? 2.127   -5.085  2.671   1.00 0.00 ? 325 PHE A N    6  
ATOM 4724  C CA   . PHE A 1 34 ? 2.953   -5.249  1.482   1.00 0.00 ? 325 PHE A CA   6  
ATOM 4725  C C    . PHE A 1 34 ? 2.766   -6.631  0.872   1.00 0.00 ? 325 PHE A C    6  
ATOM 4726  O O    . PHE A 1 34 ? 3.175   -6.879  -0.262  1.00 0.00 ? 325 PHE A O    6  
ATOM 4727  C CB   . PHE A 1 34 ? 4.426   -5.033  1.833   1.00 0.00 ? 325 PHE A CB   6  
ATOM 4728  C CG   . PHE A 1 34 ? 4.891   -3.592  1.756   1.00 0.00 ? 325 PHE A CG   6  
ATOM 4729  C CD1  . PHE A 1 34 ? 4.007   -2.551  1.474   1.00 0.00 ? 325 PHE A CD1  6  
ATOM 4730  C CD2  . PHE A 1 34 ? 6.224   -3.280  1.965   1.00 0.00 ? 325 PHE A CD2  6  
ATOM 4731  C CE1  . PHE A 1 34 ? 4.448   -1.244  1.400   1.00 0.00 ? 325 PHE A CE1  6  
ATOM 4732  C CE2  . PHE A 1 34 ? 6.666   -1.973  1.895   1.00 0.00 ? 325 PHE A CE2  6  
ATOM 4733  C CZ   . PHE A 1 34 ? 5.779   -0.956  1.610   1.00 0.00 ? 325 PHE A CZ   6  
ATOM 4734  H H    . PHE A 1 34 ? 2.559   -5.036  3.549   1.00 0.00 ? 325 PHE A H    6  
ATOM 4735  H HA   . PHE A 1 34 ? 2.649   -4.513  0.757   1.00 0.00 ? 325 PHE A HA   6  
ATOM 4736  H HB2  . PHE A 1 34 ? 4.597   -5.384  2.840   1.00 0.00 ? 325 PHE A HB2  6  
ATOM 4737  H HD1  . PHE A 1 34 ? 2.965   -2.768  1.315   1.00 0.00 ? 325 PHE A HD1  6  
ATOM 4738  H HD2  . PHE A 1 34 ? 6.924   -4.070  2.190   1.00 0.00 ? 325 PHE A HD2  6  
ATOM 4739  H HE1  . PHE A 1 34 ? 3.750   -0.445  1.182   1.00 0.00 ? 325 PHE A HE1  6  
ATOM 4740  H HE2  . PHE A 1 34 ? 7.708   -1.748  2.065   1.00 0.00 ? 325 PHE A HE2  6  
ATOM 4741  H HZ   . PHE A 1 34 ? 6.126   0.065   1.552   1.00 0.00 ? 325 PHE A HZ   6  
ATOM 4742  N N    . THR A 1 35 ? 2.147   -7.530  1.628   1.00 0.00 ? 326 THR A N    6  
ATOM 4743  C CA   . THR A 1 35 ? 1.913   -8.880  1.157   1.00 0.00 ? 326 THR A CA   6  
ATOM 4744  C C    . THR A 1 35 ? 0.689   -8.953  0.259   1.00 0.00 ? 326 THR A C    6  
ATOM 4745  O O    . THR A 1 35 ? -0.186  -8.088  0.309   1.00 0.00 ? 326 THR A O    6  
ATOM 4746  C CB   . THR A 1 35 ? 1.723   -9.848  2.331   1.00 0.00 ? 326 THR A CB   6  
ATOM 4747  O OG1  . THR A 1 35 ? 2.245   -9.273  3.536   1.00 0.00 ? 326 THR A OG1  6  
ATOM 4748  C CG2  . THR A 1 35 ? 2.422   -11.155 2.041   1.00 0.00 ? 326 THR A CG2  6  
ATOM 4749  H H    . THR A 1 35 ? 1.844   -7.283  2.524   1.00 0.00 ? 326 THR A H    6  
ATOM 4750  H HA   . THR A 1 35 ? 2.781   -9.195  0.597   1.00 0.00 ? 326 THR A HA   6  
ATOM 4751  H HB   . THR A 1 35 ? 0.667   -10.039 2.458   1.00 0.00 ? 326 THR A HB   6  
ATOM 4752  H HG1  . THR A 1 35 ? 3.057   -8.800  3.341   1.00 0.00 ? 326 THR A HG1  6  
ATOM 4753  H HG21 . THR A 1 35 ? 1.872   -11.692 1.282   1.00 0.00 ? 326 THR A HG21 6  
ATOM 4754  H HG22 . THR A 1 35 ? 2.469   -11.747 2.943   1.00 0.00 ? 326 THR A HG22 6  
ATOM 4755  H HG23 . THR A 1 35 ? 3.423   -10.950 1.688   1.00 0.00 ? 326 THR A HG23 6  
ATOM 4756  N N    . ASP A 1 36 ? 0.635   -9.992  -0.565  1.00 0.00 ? 327 ASP A N    6  
ATOM 4757  C CA   . ASP A 1 36 ? -0.489  -10.190 -1.464  1.00 0.00 ? 327 ASP A CA   6  
ATOM 4758  C C    . ASP A 1 36 ? -1.406  -11.284 -0.921  1.00 0.00 ? 327 ASP A C    6  
ATOM 4759  O O    . ASP A 1 36 ? -0.991  -12.436 -0.793  1.00 0.00 ? 327 ASP A O    6  
ATOM 4760  C CB   . ASP A 1 36 ? 0.003   -10.567 -2.862  1.00 0.00 ? 327 ASP A CB   6  
ATOM 4761  C CG   . ASP A 1 36 ? -1.132  -10.698 -3.858  1.00 0.00 ? 327 ASP A CG   6  
ATOM 4762  O OD1  . ASP A 1 36 ? -2.289  -10.417 -3.480  1.00 0.00 ? 327 ASP A OD1  6  
ATOM 4763  O OD2  . ASP A 1 36 ? -0.864  -11.082 -5.016  1.00 0.00 ? 327 ASP A OD2  6  
ATOM 4764  H H    . ASP A 1 36 ? 1.368   -10.641 -0.568  1.00 0.00 ? 327 ASP A H    6  
ATOM 4765  H HA   . ASP A 1 36 ? -1.031  -9.261  -1.519  1.00 0.00 ? 327 ASP A HA   6  
ATOM 4766  H HB2  . ASP A 1 36 ? 0.680   -9.804  -3.216  1.00 0.00 ? 327 ASP A HB2  6  
ATOM 4767  N N    . PRO A 1 37 ? -2.664  -10.947 -0.591  1.00 0.00 ? 328 PRO A N    6  
ATOM 4768  C CA   . PRO A 1 37 ? -3.619  -11.917 -0.052  1.00 0.00 ? 328 PRO A CA   6  
ATOM 4769  C C    . PRO A 1 37 ? -3.740  -13.136 -0.950  1.00 0.00 ? 328 PRO A C    6  
ATOM 4770  O O    . PRO A 1 37 ? -4.065  -14.231 -0.492  1.00 0.00 ? 328 PRO A O    6  
ATOM 4771  C CB   . PRO A 1 37 ? -4.946  -11.150 -0.001  1.00 0.00 ? 328 PRO A CB   6  
ATOM 4772  C CG   . PRO A 1 37 ? -4.729  -9.930  -0.829  1.00 0.00 ? 328 PRO A CG   6  
ATOM 4773  C CD   . PRO A 1 37 ? -3.264  -9.616  -0.733  1.00 0.00 ? 328 PRO A CD   6  
ATOM 4774  H HA   . PRO A 1 37 ? -3.341  -12.231 0.944   1.00 0.00 ? 328 PRO A HA   6  
ATOM 4775  H HB2  . PRO A 1 37 ? -5.735  -11.766 -0.405  1.00 0.00 ? 328 PRO A HB2  6  
ATOM 4776  H HG2  . PRO A 1 37 ? -5.002  -10.131 -1.856  1.00 0.00 ? 328 PRO A HG2  6  
ATOM 4777  H HD2  . PRO A 1 37 ? -2.927  -9.130  -1.635  1.00 0.00 ? 328 PRO A HD2  6  
ATOM 4778  N N    . ARG A 1 38 ? -3.471  -12.937 -2.236  1.00 0.00 ? 329 ARG A N    6  
ATOM 4779  C CA   . ARG A 1 38 ? -3.535  -14.022 -3.200  1.00 0.00 ? 329 ARG A CA   6  
ATOM 4780  C C    . ARG A 1 38 ? -2.409  -15.017 -2.943  1.00 0.00 ? 329 ARG A C    6  
ATOM 4781  O O    . ARG A 1 38 ? -2.591  -16.228 -3.069  1.00 0.00 ? 329 ARG A O    6  
ATOM 4782  C CB   . ARG A 1 38 ? -3.435  -13.479 -4.627  1.00 0.00 ? 329 ARG A CB   6  
ATOM 4783  C CG   . ARG A 1 38 ? -4.590  -12.572 -5.019  1.00 0.00 ? 329 ARG A CG   6  
ATOM 4784  C CD   . ARG A 1 38 ? -4.463  -12.103 -6.459  1.00 0.00 ? 329 ARG A CD   6  
ATOM 4785  N NE   . ARG A 1 38 ? -3.993  -13.167 -7.343  1.00 0.00 ? 329 ARG A NE   6  
ATOM 4786  C CZ   . ARG A 1 38 ? -4.786  -14.097 -7.866  1.00 0.00 ? 329 ARG A CZ   6  
ATOM 4787  N NH1  . ARG A 1 38 ? -6.083  -14.099 -7.591  1.00 0.00 ? 329 ARG A NH1  6  
ATOM 4788  N NH2  . ARG A 1 38 ? -4.281  -15.029 -8.664  1.00 0.00 ? 329 ARG A NH2  6  
ATOM 4789  H H    . ARG A 1 38 ? -3.226  -12.038 -2.541  1.00 0.00 ? 329 ARG A H    6  
ATOM 4790  H HA   . ARG A 1 38 ? -4.484  -14.520 -3.074  1.00 0.00 ? 329 ARG A HA   6  
ATOM 4791  H HB2  . ARG A 1 38 ? -2.517  -12.918 -4.724  1.00 0.00 ? 329 ARG A HB2  6  
ATOM 4792  H HG2  . ARG A 1 38 ? -5.516  -13.116 -4.908  1.00 0.00 ? 329 ARG A HG2  6  
ATOM 4793  H HD2  . ARG A 1 38 ? -5.430  -11.766 -6.801  1.00 0.00 ? 329 ARG A HD2  6  
ATOM 4794  H HE   . ARG A 1 38 ? -3.036  -13.188 -7.559  1.00 0.00 ? 329 ARG A HE   6  
ATOM 4795  H HH11 . ARG A 1 38 ? -6.467  -13.400 -6.988  1.00 0.00 ? 329 ARG A HH11 6  
ATOM 4796  H HH12 . ARG A 1 38 ? -6.676  -14.800 -7.986  1.00 0.00 ? 329 ARG A HH12 6  
ATOM 4797  H HH21 . ARG A 1 38 ? -3.304  -15.032 -8.874  1.00 0.00 ? 329 ARG A HH21 6  
ATOM 4798  H HH22 . ARG A 1 38 ? -4.880  -15.728 -9.057  1.00 0.00 ? 329 ARG A HH22 6  
ATOM 4799  N N    . LEU A 1 39 ? -1.241  -14.490 -2.580  1.00 0.00 ? 330 LEU A N    6  
ATOM 4800  C CA   . LEU A 1 39 ? -0.077  -15.320 -2.297  1.00 0.00 ? 330 LEU A CA   6  
ATOM 4801  C C    . LEU A 1 39 ? -0.327  -16.212 -1.085  1.00 0.00 ? 330 LEU A C    6  
ATOM 4802  O O    . LEU A 1 39 ? 0.000   -17.398 -1.096  1.00 0.00 ? 330 LEU A O    6  
ATOM 4803  C CB   . LEU A 1 39 ? 1.155   -14.445 -2.055  1.00 0.00 ? 330 LEU A CB   6  
ATOM 4804  C CG   . LEU A 1 39 ? 1.726   -13.770 -3.304  1.00 0.00 ? 330 LEU A CG   6  
ATOM 4805  C CD1  . LEU A 1 39 ? 2.902   -12.876 -2.938  1.00 0.00 ? 330 LEU A CD1  6  
ATOM 4806  C CD2  . LEU A 1 39 ? 2.145   -14.812 -4.330  1.00 0.00 ? 330 LEU A CD2  6  
ATOM 4807  H H    . LEU A 1 39 ? -1.163  -13.515 -2.505  1.00 0.00 ? 330 LEU A H    6  
ATOM 4808  H HA   . LEU A 1 39 ? 0.101   -15.944 -3.158  1.00 0.00 ? 330 LEU A HA   6  
ATOM 4809  H HB2  . LEU A 1 39 ? 0.890   -13.676 -1.344  1.00 0.00 ? 330 LEU A HB2  6  
ATOM 4810  H HG   . LEU A 1 39 ? 0.963   -13.149 -3.750  1.00 0.00 ? 330 LEU A HG   6  
ATOM 4811  H HD11 . LEU A 1 39 ? 3.042   -12.131 -3.708  1.00 0.00 ? 330 LEU A HD11 6  
ATOM 4812  H HD12 . LEU A 1 39 ? 2.704   -12.387 -1.996  1.00 0.00 ? 330 LEU A HD12 6  
ATOM 4813  H HD13 . LEU A 1 39 ? 3.796   -13.476 -2.851  1.00 0.00 ? 330 LEU A HD13 6  
ATOM 4814  H HD21 . LEU A 1 39 ? 1.274   -15.356 -4.663  1.00 0.00 ? 330 LEU A HD21 6  
ATOM 4815  H HD22 . LEU A 1 39 ? 2.608   -14.321 -5.173  1.00 0.00 ? 330 LEU A HD22 6  
ATOM 4816  H HD23 . LEU A 1 39 ? 2.847   -15.498 -3.880  1.00 0.00 ? 330 LEU A HD23 6  
ATOM 4817  N N    . SER A 1 40 ? -0.908  -15.633 -0.039  1.00 0.00 ? 331 SER A N    6  
ATOM 4818  C CA   . SER A 1 40 ? -1.201  -16.374 1.182   1.00 0.00 ? 331 SER A CA   6  
ATOM 4819  C C    . SER A 1 40 ? -2.608  -16.962 1.139   1.00 0.00 ? 331 SER A C    6  
ATOM 4820  O O    . SER A 1 40 ? -3.535  -16.425 1.745   1.00 0.00 ? 331 SER A O    6  
ATOM 4821  C CB   . SER A 1 40 ? -1.053  -15.464 2.404   1.00 0.00 ? 331 SER A CB   6  
ATOM 4822  O OG   . SER A 1 40 ? -0.052  -14.484 2.192   1.00 0.00 ? 331 SER A OG   6  
ATOM 4823  H H    . SER A 1 40 ? -1.147  -14.684 -0.090  1.00 0.00 ? 331 SER A H    6  
ATOM 4824  H HA   . SER A 1 40 ? -0.488  -17.181 1.258   1.00 0.00 ? 331 SER A HA   6  
ATOM 4825  H HB2  . SER A 1 40 ? -1.992  -14.965 2.596   1.00 0.00 ? 331 SER A HB2  6  
ATOM 4826  H HG   . SER A 1 40 ? -0.436  -13.609 2.285   1.00 0.00 ? 331 SER A HG   6  
ATOM 4827  N N    . ALA A 1 41 ? -2.761  -18.068 0.418   1.00 0.00 ? 332 ALA A N    6  
ATOM 4828  C CA   . ALA A 1 41 ? -4.055  -18.727 0.297   1.00 0.00 ? 332 ALA A CA   6  
ATOM 4829  C C    . ALA A 1 41 ? -3.894  -20.243 0.229   1.00 0.00 ? 332 ALA A C    6  
ATOM 4830  O O    . ALA A 1 41 ? -4.606  -20.920 -0.512  1.00 0.00 ? 332 ALA A O    6  
ATOM 4831  C CB   . ALA A 1 41 ? -4.794  -18.217 -0.934  1.00 0.00 ? 332 ALA A CB   6  
ATOM 4832  H H    . ALA A 1 41 ? -1.985  -18.449 -0.044  1.00 0.00 ? 332 ALA A H    6  
ATOM 4833  H HA   . ALA A 1 41 ? -4.640  -18.477 1.172   1.00 0.00 ? 332 ALA A HA   6  
ATOM 4834  H HB1  . ALA A 1 41 ? -5.743  -18.726 -1.023  1.00 0.00 ? 332 ALA A HB1  6  
ATOM 4835  H HB2  . ALA A 1 41 ? -4.963  -17.154 -0.840  1.00 0.00 ? 332 ALA A HB2  6  
ATOM 4836  H HB3  . ALA A 1 41 ? -4.199  -18.409 -1.816  1.00 0.00 ? 332 ALA A HB3  6  
ATOM 4837  N N    . ASN A 1 42 ? -2.954  -20.768 1.008   1.00 0.00 ? 333 ASN A N    6  
ATOM 4838  C CA   . ASN A 1 42 ? -2.699  -22.203 1.038   1.00 0.00 ? 333 ASN A CA   6  
ATOM 4839  C C    . ASN A 1 42 ? -3.524  -22.880 2.128   1.00 0.00 ? 333 ASN A C    6  
ATOM 4840  O O    . ASN A 1 42 ? -2.987  -23.786 2.799   1.00 0.00 ? 333 ASN A O    6  
ATOM 4841  C CB   . ASN A 1 42 ? -1.210  -22.474 1.264   1.00 0.00 ? 333 ASN A CB   6  
ATOM 4842  C CG   . ASN A 1 42 ? -0.327  -21.668 0.331   1.00 0.00 ? 333 ASN A CG   6  
ATOM 4843  O OD1  . ASN A 1 42 ? -0.049  -20.496 0.579   1.00 0.00 ? 333 ASN A OD1  6  
ATOM 4844  N ND2  . ASN A 1 42 ? 0.120   -22.296 -0.750  1.00 0.00 ? 333 ASN A ND2  6  
ATOM 4845  O OXT  . ASN A 1 42 ? -4.699  -22.497 2.303   1.00 0.00 ? 333 ASN A OXT  6  
ATOM 4846  H H    . ASN A 1 42 ? -2.419  -20.175 1.578   1.00 0.00 ? 333 ASN A H    6  
ATOM 4847  H HA   . ASN A 1 42 ? -2.989  -22.610 0.080   1.00 0.00 ? 333 ASN A HA   6  
ATOM 4848  H HB2  . ASN A 1 42 ? -0.955  -22.218 2.280   1.00 0.00 ? 333 ASN A HB2  6  
ATOM 4849  H HD21 . ASN A 1 42 ? -0.143  -23.231 -0.885  1.00 0.00 ? 333 ASN A HD21 6  
ATOM 4850  H HD22 . ASN A 1 42 ? 0.693   -21.799 -1.371  1.00 0.00 ? 333 ASN A HD22 6  
ATOM 4851  N N    . GLY B 2 1  ? 11.180  -11.182 6.600   1.00 0.00 ? 198 GLY B N    6  
ATOM 4852  C CA   . GLY B 2 1  ? 11.006  -11.988 7.840   1.00 0.00 ? 198 GLY B CA   6  
ATOM 4853  C C    . GLY B 2 1  ? 11.340  -13.455 7.625   1.00 0.00 ? 198 GLY B C    6  
ATOM 4854  O O    . GLY B 2 1  ? 11.735  -13.841 6.525   1.00 0.00 ? 198 GLY B O    6  
ATOM 4855  H H1   . GLY B 2 1  ? 12.190  -10.997 6.432   1.00 0.00 ? 198 GLY B H1   6  
ATOM 4856  H H2   . GLY B 2 1  ? 10.684  -10.274 6.693   1.00 0.00 ? 198 GLY B H2   6  
ATOM 4857  H H3   . GLY B 2 1  ? 10.792  -11.695 5.783   1.00 0.00 ? 198 GLY B H3   6  
ATOM 4858  H HA2  . GLY B 2 1  ? 11.655  -11.589 8.605   1.00 0.00 ? 198 GLY B HA2  6  
ATOM 4859  H HA3  . GLY B 2 1  ? 9.981   -11.903 8.167   1.00 0.00 ? 198 GLY B HA3  6  
ATOM 4860  N N    . PRO B 2 2  ? 11.191  -14.308 8.657   1.00 0.00 ? 199 PRO B N    6  
ATOM 4861  C CA   . PRO B 2 2  ? 11.488  -15.734 8.543   1.00 0.00 ? 199 PRO B CA   6  
ATOM 4862  C C    . PRO B 2 2  ? 10.340  -16.516 7.915   1.00 0.00 ? 199 PRO B C    6  
ATOM 4863  O O    . PRO B 2 2  ? 10.557  -17.523 7.242   1.00 0.00 ? 199 PRO B O    6  
ATOM 4864  C CB   . PRO B 2 2  ? 11.694  -16.155 9.995   1.00 0.00 ? 199 PRO B CB   6  
ATOM 4865  C CG   . PRO B 2 2  ? 10.795  -15.258 10.774  1.00 0.00 ? 199 PRO B CG   6  
ATOM 4866  C CD   . PRO B 2 2  ? 10.721  -13.955 10.015  1.00 0.00 ? 199 PRO B CD   6  
ATOM 4867  H HA   . PRO B 2 2  ? 12.394  -15.909 7.981   1.00 0.00 ? 199 PRO B HA   6  
ATOM 4868  H HB2  . PRO B 2 2  ? 11.420  -17.193 10.115  1.00 0.00 ? 199 PRO B HB2  6  
ATOM 4869  H HG2  . PRO B 2 2  ? 9.813   -15.702 10.849  1.00 0.00 ? 199 PRO B HG2  6  
ATOM 4870  H HD2  . PRO B 2 2  ? 9.702   -13.598 9.990   1.00 0.00 ? 199 PRO B HD2  6  
ATOM 4871  N N    . LEU B 2 3  ? 9.118   -16.044 8.139   1.00 0.00 ? 200 LEU B N    6  
ATOM 4872  C CA   . LEU B 2 3  ? 7.934   -16.699 7.596   1.00 0.00 ? 200 LEU B CA   6  
ATOM 4873  C C    . LEU B 2 3  ? 7.448   -15.987 6.337   1.00 0.00 ? 200 LEU B C    6  
ATOM 4874  O O    . LEU B 2 3  ? 6.252   -15.965 6.046   1.00 0.00 ? 200 LEU B O    6  
ATOM 4875  C CB   . LEU B 2 3  ? 6.817   -16.729 8.641   1.00 0.00 ? 200 LEU B CB   6  
ATOM 4876  C CG   . LEU B 2 3  ? 7.061   -17.670 9.822   1.00 0.00 ? 200 LEU B CG   6  
ATOM 4877  C CD1  . LEU B 2 3  ? 6.199   -17.269 11.009  1.00 0.00 ? 200 LEU B CD1  6  
ATOM 4878  C CD2  . LEU B 2 3  ? 6.781   -19.111 9.420   1.00 0.00 ? 200 LEU B CD2  6  
ATOM 4879  H H    . LEU B 2 3  ? 9.009   -15.236 8.685   1.00 0.00 ? 200 LEU B H    6  
ATOM 4880  H HA   . LEU B 2 3  ? 8.204   -17.711 7.341   1.00 0.00 ? 200 LEU B HA   6  
ATOM 4881  H HB2  . LEU B 2 3  ? 6.684   -15.728 9.024   1.00 0.00 ? 200 LEU B HB2  6  
ATOM 4882  H HG   . LEU B 2 3  ? 8.096   -17.601 10.121  1.00 0.00 ? 200 LEU B HG   6  
ATOM 4883  H HD11 . LEU B 2 3  ? 5.301   -17.869 11.021  1.00 0.00 ? 200 LEU B HD11 6  
ATOM 4884  H HD12 . LEU B 2 3  ? 6.750   -17.427 11.923  1.00 0.00 ? 200 LEU B HD12 6  
ATOM 4885  H HD13 . LEU B 2 3  ? 5.933   -16.226 10.924  1.00 0.00 ? 200 LEU B HD13 6  
ATOM 4886  H HD21 . LEU B 2 3  ? 5.720   -19.303 9.483   1.00 0.00 ? 200 LEU B HD21 6  
ATOM 4887  H HD22 . LEU B 2 3  ? 7.118   -19.274 8.406   1.00 0.00 ? 200 LEU B HD22 6  
ATOM 4888  H HD23 . LEU B 2 3  ? 7.307   -19.779 10.085  1.00 0.00 ? 200 LEU B HD23 6  
ATOM 4889  N N    . GLY B 2 4  ? 8.384   -15.405 5.594   1.00 0.00 ? 201 GLY B N    6  
ATOM 4890  C CA   . GLY B 2 4  ? 8.033   -14.700 4.375   1.00 0.00 ? 201 GLY B CA   6  
ATOM 4891  C C    . GLY B 2 4  ? 9.232   -14.047 3.716   1.00 0.00 ? 201 GLY B C    6  
ATOM 4892  O O    . GLY B 2 4  ? 10.279  -13.879 4.342   1.00 0.00 ? 201 GLY B O    6  
ATOM 4893  H H    . GLY B 2 4  ? 9.322   -15.454 5.876   1.00 0.00 ? 201 GLY B H    6  
ATOM 4894  H HA2  . GLY B 2 4  ? 7.591   -15.400 3.682   1.00 0.00 ? 201 GLY B HA2  6  
ATOM 4895  H HA3  . GLY B 2 4  ? 7.308   -13.936 4.612   1.00 0.00 ? 201 GLY B HA3  6  
ATOM 4896  N N    . SER B 2 5  ? 9.080   -13.679 2.449   1.00 0.00 ? 202 SER B N    6  
ATOM 4897  C CA   . SER B 2 5  ? 10.158  -13.041 1.703   1.00 0.00 ? 202 SER B CA   6  
ATOM 4898  C C    . SER B 2 5  ? 10.126  -11.527 1.888   1.00 0.00 ? 202 SER B C    6  
ATOM 4899  O O    . SER B 2 5  ? 11.169  -10.874 1.917   1.00 0.00 ? 202 SER B O    6  
ATOM 4900  C CB   . SER B 2 5  ? 10.052  -13.385 0.217   1.00 0.00 ? 202 SER B CB   6  
ATOM 4901  O OG   . SER B 2 5  ? 11.084  -14.275 -0.177  1.00 0.00 ? 202 SER B OG   6  
ATOM 4902  H H    . SER B 2 5  ? 8.221   -13.840 2.003   1.00 0.00 ? 202 SER B H    6  
ATOM 4903  H HA   . SER B 2 5  ? 11.095  -13.420 2.085   1.00 0.00 ? 202 SER B HA   6  
ATOM 4904  H HB2  . SER B 2 5  ? 9.097   -13.854 0.025   1.00 0.00 ? 202 SER B HB2  6  
ATOM 4905  H HG   . SER B 2 5  ? 11.899  -13.784 -0.301  1.00 0.00 ? 202 SER B HG   6  
ATOM 4906  N N    . GLU B 2 6  ? 8.923   -10.976 2.013   1.00 0.00 ? 203 GLU B N    6  
ATOM 4907  C CA   . GLU B 2 6  ? 8.756   -9.538  2.194   1.00 0.00 ? 203 GLU B CA   6  
ATOM 4908  C C    . GLU B 2 6  ? 8.698   -9.178  3.676   1.00 0.00 ? 203 GLU B C    6  
ATOM 4909  O O    . GLU B 2 6  ? 8.945   -10.020 4.540   1.00 0.00 ? 203 GLU B O    6  
ATOM 4910  C CB   . GLU B 2 6  ? 7.483   -9.059  1.491   1.00 0.00 ? 203 GLU B CB   6  
ATOM 4911  C CG   . GLU B 2 6  ? 7.734   -7.996  0.436   1.00 0.00 ? 203 GLU B CG   6  
ATOM 4912  C CD   . GLU B 2 6  ? 8.171   -8.583  -0.891  1.00 0.00 ? 203 GLU B CD   6  
ATOM 4913  O OE1  . GLU B 2 6  ? 7.308   -9.120  -1.616  1.00 0.00 ? 203 GLU B OE1  6  
ATOM 4914  O OE2  . GLU B 2 6  ? 9.378   -8.509  -1.204  1.00 0.00 ? 203 GLU B OE2  6  
ATOM 4915  H H    . GLU B 2 6  ? 8.128   -11.549 1.982   1.00 0.00 ? 203 GLU B H    6  
ATOM 4916  H HA   . GLU B 2 6  ? 9.608   -9.047  1.749   1.00 0.00 ? 203 GLU B HA   6  
ATOM 4917  H HB2  . GLU B 2 6  ? 7.010   -9.904  1.015   1.00 0.00 ? 203 GLU B HB2  6  
ATOM 4918  H HG2  . GLU B 2 6  ? 6.823   -7.438  0.281   1.00 0.00 ? 203 GLU B HG2  6  
ATOM 4919  N N    . LEU B 2 7  ? 8.370   -7.922  3.961   1.00 0.00 ? 204 LEU B N    6  
ATOM 4920  C CA   . LEU B 2 7  ? 8.278   -7.448  5.337   1.00 0.00 ? 204 LEU B CA   6  
ATOM 4921  C C    . LEU B 2 7  ? 6.902   -6.854  5.617   1.00 0.00 ? 204 LEU B C    6  
ATOM 4922  O O    . LEU B 2 7  ? 6.079   -6.719  4.712   1.00 0.00 ? 204 LEU B O    6  
ATOM 4923  C CB   . LEU B 2 7  ? 9.362   -6.403  5.611   1.00 0.00 ? 204 LEU B CB   6  
ATOM 4924  C CG   . LEU B 2 7  ? 9.743   -5.534  4.411   1.00 0.00 ? 204 LEU B CG   6  
ATOM 4925  C CD1  . LEU B 2 7  ? 8.603   -4.594  4.048   1.00 0.00 ? 204 LEU B CD1  6  
ATOM 4926  C CD2  . LEU B 2 7  ? 11.010  -4.748  4.707   1.00 0.00 ? 204 LEU B CD2  6  
ATOM 4927  H H    . LEU B 2 7  ? 8.185   -7.299  3.227   1.00 0.00 ? 204 LEU B H    6  
ATOM 4928  H HA   . LEU B 2 7  ? 8.433   -8.293  5.990   1.00 0.00 ? 204 LEU B HA   6  
ATOM 4929  H HB2  . LEU B 2 7  ? 9.014   -5.755  6.403   1.00 0.00 ? 204 LEU B HB2  6  
ATOM 4930  H HG   . LEU B 2 7  ? 9.935   -6.171  3.560   1.00 0.00 ? 204 LEU B HG   6  
ATOM 4931  H HD11 . LEU B 2 7  ? 7.672   -5.142  4.045   1.00 0.00 ? 204 LEU B HD11 6  
ATOM 4932  H HD12 . LEU B 2 7  ? 8.549   -3.796  4.773   1.00 0.00 ? 204 LEU B HD12 6  
ATOM 4933  H HD13 . LEU B 2 7  ? 8.779   -4.179  3.066   1.00 0.00 ? 204 LEU B HD13 6  
ATOM 4934  H HD21 . LEU B 2 7  ? 11.607  -5.285  5.430   1.00 0.00 ? 204 LEU B HD21 6  
ATOM 4935  H HD22 . LEU B 2 7  ? 11.576  -4.620  3.796   1.00 0.00 ? 204 LEU B HD22 6  
ATOM 4936  H HD23 . LEU B 2 7  ? 10.748  -3.779  5.106   1.00 0.00 ? 204 LEU B HD23 6  
ATOM 4937  N N    . GLU B 2 8  ? 6.658   -6.500  6.874   1.00 0.00 ? 205 GLU B N    6  
ATOM 4938  C CA   . GLU B 2 8  ? 5.381   -5.919  7.267   1.00 0.00 ? 205 GLU B CA   6  
ATOM 4939  C C    . GLU B 2 8  ? 5.584   -4.748  8.224   1.00 0.00 ? 205 GLU B C    6  
ATOM 4940  O O    . GLU B 2 8  ? 5.752   -4.938  9.429   1.00 0.00 ? 205 GLU B O    6  
ATOM 4941  C CB   . GLU B 2 8  ? 4.492   -6.979  7.919   1.00 0.00 ? 205 GLU B CB   6  
ATOM 4942  C CG   . GLU B 2 8  ? 3.062   -6.515  8.141   1.00 0.00 ? 205 GLU B CG   6  
ATOM 4943  C CD   . GLU B 2 8  ? 2.044   -7.426  7.486   1.00 0.00 ? 205 GLU B CD   6  
ATOM 4944  O OE1  . GLU B 2 8  ? 2.399   -8.095  6.492   1.00 0.00 ? 205 GLU B OE1  6  
ATOM 4945  O OE2  . GLU B 2 8  ? 0.893   -7.472  7.965   1.00 0.00 ? 205 GLU B OE2  6  
ATOM 4946  H H    . GLU B 2 8  ? 7.353   -6.633  7.553   1.00 0.00 ? 205 GLU B H    6  
ATOM 4947  H HA   . GLU B 2 8  ? 4.894   -5.557  6.374   1.00 0.00 ? 205 GLU B HA   6  
ATOM 4948  H HB2  . GLU B 2 8  ? 4.469   -7.853  7.286   1.00 0.00 ? 205 GLU B HB2  6  
ATOM 4949  H HG2  . GLU B 2 8  ? 2.866   -6.485  9.203   1.00 0.00 ? 205 GLU B HG2  6  
ATOM 4950  N N    . SER B 2 9  ? 5.564   -3.538  7.676   1.00 0.00 ? 206 SER B N    6  
ATOM 4951  C CA   . SER B 2 9  ? 5.747   -2.333  8.483   1.00 0.00 ? 206 SER B CA   6  
ATOM 4952  C C    . SER B 2 9  ? 5.599   -1.040  7.663   1.00 0.00 ? 206 SER B C    6  
ATOM 4953  O O    . SER B 2 9  ? 4.890   -0.123  8.079   1.00 0.00 ? 206 SER B O    6  
ATOM 4954  C CB   . SER B 2 9  ? 7.116   -2.364  9.171   1.00 0.00 ? 206 SER B CB   6  
ATOM 4955  O OG   . SER B 2 9  ? 7.612   -1.056  9.398   1.00 0.00 ? 206 SER B OG   6  
ATOM 4956  H H    . SER B 2 9  ? 5.423   -3.459  6.716   1.00 0.00 ? 206 SER B H    6  
ATOM 4957  H HA   . SER B 2 9  ? 4.982   -2.338  9.246   1.00 0.00 ? 206 SER B HA   6  
ATOM 4958  H HB2  . SER B 2 9  ? 7.024   -2.868  10.122  1.00 0.00 ? 206 SER B HB2  6  
ATOM 4959  H HG   . SER B 2 9  ? 8.571   -1.079  9.431   1.00 0.00 ? 206 SER B HG   6  
ATOM 4960  N N    . PRO B 2 10 ? 6.261   -0.941  6.492   1.00 0.00 ? 207 PRO B N    6  
ATOM 4961  C CA   . PRO B 2 10 ? 6.211   0.259   5.647   1.00 0.00 ? 207 PRO B CA   6  
ATOM 4962  C C    . PRO B 2 10 ? 4.853   0.552   4.982   1.00 0.00 ? 207 PRO B C    6  
ATOM 4963  O O    . PRO B 2 10 ? 4.517   1.723   4.804   1.00 0.00 ? 207 PRO B O    6  
ATOM 4964  C CB   . PRO B 2 10 ? 7.283   -0.001  4.579   1.00 0.00 ? 207 PRO B CB   6  
ATOM 4965  C CG   . PRO B 2 10 ? 8.074   -1.161  5.080   1.00 0.00 ? 207 PRO B CG   6  
ATOM 4966  C CD   . PRO B 2 10 ? 7.117   -1.974  5.895   1.00 0.00 ? 207 PRO B CD   6  
ATOM 4967  H HA   . PRO B 2 10 ? 6.499   1.127   6.213   1.00 0.00 ? 207 PRO B HA   6  
ATOM 4968  H HB2  . PRO B 2 10 ? 6.807   -0.227  3.641   1.00 0.00 ? 207 PRO B HB2  6  
ATOM 4969  H HG2  . PRO B 2 10 ? 8.444   -1.741  4.247   1.00 0.00 ? 207 PRO B HG2  6  
ATOM 4970  H HD2  . PRO B 2 10 ? 6.547   -2.628  5.253   1.00 0.00 ? 207 PRO B HD2  6  
ATOM 4971  N N    . PRO B 2 11 ? 4.048   -0.469  4.592   1.00 0.00 ? 208 PRO B N    6  
ATOM 4972  C CA   . PRO B 2 11 ? 2.771   -0.237  3.933   1.00 0.00 ? 208 PRO B CA   6  
ATOM 4973  C C    . PRO B 2 11 ? 2.001   0.950   4.494   1.00 0.00 ? 208 PRO B C    6  
ATOM 4974  O O    . PRO B 2 11 ? 1.659   0.966   5.676   1.00 0.00 ? 208 PRO B O    6  
ATOM 4975  C CB   . PRO B 2 11 ? 1.982   -1.513  4.185   1.00 0.00 ? 208 PRO B CB   6  
ATOM 4976  C CG   . PRO B 2 11 ? 2.990   -2.575  4.457   1.00 0.00 ? 208 PRO B CG   6  
ATOM 4977  C CD   . PRO B 2 11 ? 4.312   -1.903  4.737   1.00 0.00 ? 208 PRO B CD   6  
ATOM 4978  H HA   . PRO B 2 11 ? 2.905   -0.116  2.879   1.00 0.00 ? 208 PRO B HA   6  
ATOM 4979  H HB2  . PRO B 2 11 ? 1.323   -1.365  5.023   1.00 0.00 ? 208 PRO B HB2  6  
ATOM 4980  H HG2  . PRO B 2 11 ? 2.682   -3.153  5.315   1.00 0.00 ? 208 PRO B HG2  6  
ATOM 4981  H HD2  . PRO B 2 11 ? 4.622   -2.133  5.731   1.00 0.00 ? 208 PRO B HD2  6  
ATOM 4982  N N    . PRO B 2 12 ? 1.761   1.981   3.661   1.00 0.00 ? 209 PRO B N    6  
ATOM 4983  C CA   . PRO B 2 12 ? 0.987   3.164   4.046   1.00 0.00 ? 209 PRO B CA   6  
ATOM 4984  C C    . PRO B 2 12 ? -0.308  2.794   4.766   1.00 0.00 ? 209 PRO B C    6  
ATOM 4985  O O    . PRO B 2 12 ? -0.534  1.633   5.098   1.00 0.00 ? 209 PRO B O    6  
ATOM 4986  C CB   . PRO B 2 12 ? 0.676   3.830   2.692   1.00 0.00 ? 209 PRO B CB   6  
ATOM 4987  C CG   . PRO B 2 12 ? 1.169   2.893   1.656   1.00 0.00 ? 209 PRO B CG   6  
ATOM 4988  C CD   . PRO B 2 12 ? 2.264   2.126   2.294   1.00 0.00 ? 209 PRO B CD   6  
ATOM 4989  H HA   . PRO B 2 12 ? 1.565   3.837   4.661   1.00 0.00 ? 209 PRO B HA   6  
ATOM 4990  H HB2  . PRO B 2 12 ? -0.383  3.962   2.595   1.00 0.00 ? 209 PRO B HB2  6  
ATOM 4991  H HG2  . PRO B 2 12 ? 0.377   2.227   1.375   1.00 0.00 ? 209 PRO B HG2  6  
ATOM 4992  H HD2  . PRO B 2 12 ? 2.383   1.178   1.801   1.00 0.00 ? 209 PRO B HD2  6  
ATOM 4993  N N    . PRO B 2 13 ? -1.199  3.769   4.993   1.00 0.00 ? 210 PRO B N    6  
ATOM 4994  C CA   . PRO B 2 13 ? -2.452  3.534   5.678   1.00 0.00 ? 210 PRO B CA   6  
ATOM 4995  C C    . PRO B 2 13 ? -3.568  3.202   4.704   1.00 0.00 ? 210 PRO B C    6  
ATOM 4996  O O    . PRO B 2 13 ? -3.361  3.178   3.491   1.00 0.00 ? 210 PRO B O    6  
ATOM 4997  C CB   . PRO B 2 13 ? -2.707  4.875   6.354   1.00 0.00 ? 210 PRO B CB   6  
ATOM 4998  C CG   . PRO B 2 13 ? -2.095  5.892   5.441   1.00 0.00 ? 210 PRO B CG   6  
ATOM 4999  C CD   . PRO B 2 13 ? -1.087  5.171   4.571   1.00 0.00 ? 210 PRO B CD   6  
ATOM 5000  H HA   . PRO B 2 13 ? -2.368  2.755   6.421   1.00 0.00 ? 210 PRO B HA   6  
ATOM 5001  H HB2  . PRO B 2 13 ? -3.771  5.026   6.460   1.00 0.00 ? 210 PRO B HB2  6  
ATOM 5002  H HG2  . PRO B 2 13 ? -2.863  6.334   4.825   1.00 0.00 ? 210 PRO B HG2  6  
ATOM 5003  H HD2  . PRO B 2 13 ? -1.355  5.272   3.528   1.00 0.00 ? 210 PRO B HD2  6  
ATOM 5004  N N    . TYR B 2 14 ? -4.751  2.946   5.235   1.00 0.00 ? 211 TYR B N    6  
ATOM 5005  C CA   . TYR B 2 14 ? -5.893  2.623   4.400   1.00 0.00 ? 211 TYR B CA   6  
ATOM 5006  C C    . TYR B 2 14 ? -6.421  3.886   3.714   1.00 0.00 ? 211 TYR B C    6  
ATOM 5007  O O    . TYR B 2 14 ? -5.977  4.236   2.620   1.00 0.00 ? 211 TYR B O    6  
ATOM 5008  C CB   . TYR B 2 14 ? -6.985  1.954   5.242   1.00 0.00 ? 211 TYR B CB   6  
ATOM 5009  C CG   . TYR B 2 14 ? -8.305  1.807   4.525   1.00 0.00 ? 211 TYR B CG   6  
ATOM 5010  C CD1  . TYR B 2 14 ? -8.449  0.904   3.484   1.00 0.00 ? 211 TYR B CD1  6  
ATOM 5011  C CD2  . TYR B 2 14 ? -9.406  2.573   4.890   1.00 0.00 ? 211 TYR B CD2  6  
ATOM 5012  C CE1  . TYR B 2 14 ? -9.656  0.764   2.821   1.00 0.00 ? 211 TYR B CE1  6  
ATOM 5013  C CE2  . TYR B 2 14 ? -10.615 2.439   4.235   1.00 0.00 ? 211 TYR B CE2  6  
ATOM 5014  C CZ   . TYR B 2 14 ? -10.734 1.535   3.201   1.00 0.00 ? 211 TYR B CZ   6  
ATOM 5015  O OH   . TYR B 2 14 ? -11.938 1.402   2.547   1.00 0.00 ? 211 TYR B OH   6  
ATOM 5016  H H    . TYR B 2 14 ? -4.859  2.971   6.209   1.00 0.00 ? 211 TYR B H    6  
ATOM 5017  H HA   . TYR B 2 14 ? -5.556  1.930   3.641   1.00 0.00 ? 211 TYR B HA   6  
ATOM 5018  H HB2  . TYR B 2 14 ? -6.654  0.968   5.528   1.00 0.00 ? 211 TYR B HB2  6  
ATOM 5019  H HD1  . TYR B 2 14 ? -7.599  0.301   3.194   1.00 0.00 ? 211 TYR B HD1  6  
ATOM 5020  H HD2  . TYR B 2 14 ? -9.309  3.281   5.699   1.00 0.00 ? 211 TYR B HD2  6  
ATOM 5021  H HE1  . TYR B 2 14 ? -9.749  0.056   2.011   1.00 0.00 ? 211 TYR B HE1  6  
ATOM 5022  H HE2  . TYR B 2 14 ? -11.459 3.042   4.532   1.00 0.00 ? 211 TYR B HE2  6  
ATOM 5023  H HH   . TYR B 2 14 ? -12.102 0.473   2.365   1.00 0.00 ? 211 TYR B HH   6  
ATOM 5024  N N    . SER B 2 15 ? -7.367  4.567   4.360   1.00 0.00 ? 212 SER B N    6  
ATOM 5025  C CA   . SER B 2 15 ? -7.949  5.793   3.814   1.00 0.00 ? 212 SER B CA   6  
ATOM 5026  C C    . SER B 2 15 ? -8.387  5.633   2.356   1.00 0.00 ? 212 SER B C    6  
ATOM 5027  O O    . SER B 2 15 ? -8.547  6.624   1.644   1.00 0.00 ? 212 SER B O    6  
ATOM 5028  C CB   . SER B 2 15 ? -6.953  6.948   3.933   1.00 0.00 ? 212 SER B CB   6  
ATOM 5029  O OG   . SER B 2 15 ? -5.707  6.497   4.431   1.00 0.00 ? 212 SER B OG   6  
ATOM 5030  H H    . SER B 2 15 ? -7.677  4.246   5.230   1.00 0.00 ? 212 SER B H    6  
ATOM 5031  H HA   . SER B 2 15 ? -8.820  6.029   4.407   1.00 0.00 ? 212 SER B HA   6  
ATOM 5032  H HB2  . SER B 2 15 ? -6.800  7.390   2.960   1.00 0.00 ? 212 SER B HB2  6  
ATOM 5033  H HG   . SER B 2 15 ? -5.747  6.432   5.388   1.00 0.00 ? 212 SER B HG   6  
ATOM 5034  N N    . ARG B 2 16 ? -8.591  4.393   1.920   1.00 0.00 ? 213 ARG B N    6  
ATOM 5035  C CA   . ARG B 2 16 ? -9.021  4.110   0.549   1.00 0.00 ? 213 ARG B CA   6  
ATOM 5036  C C    . ARG B 2 16 ? -7.986  4.522   -0.509  1.00 0.00 ? 213 ARG B C    6  
ATOM 5037  O O    . ARG B 2 16 ? -7.524  3.683   -1.284  1.00 0.00 ? 213 ARG B O    6  
ATOM 5038  C CB   . ARG B 2 16 ? -10.359 4.802   0.265   1.00 0.00 ? 213 ARG B CB   6  
ATOM 5039  C CG   . ARG B 2 16 ? -11.524 4.197   1.023   1.00 0.00 ? 213 ARG B CG   6  
ATOM 5040  C CD   . ARG B 2 16 ? -12.630 3.740   0.088   1.00 0.00 ? 213 ARG B CD   6  
ATOM 5041  N NE   . ARG B 2 16 ? -13.865 4.490   0.297   1.00 0.00 ? 213 ARG B NE   6  
ATOM 5042  C CZ   . ARG B 2 16 ? -14.625 4.366   1.380   1.00 0.00 ? 213 ARG B CZ   6  
ATOM 5043  N NH1  . ARG B 2 16 ? -14.279 3.525   2.344   1.00 0.00 ? 213 ARG B NH1  6  
ATOM 5044  N NH2  . ARG B 2 16 ? -15.732 5.086   1.500   1.00 0.00 ? 213 ARG B NH2  6  
ATOM 5045  H H    . ARG B 2 16 ? -8.473  3.644   2.537   1.00 0.00 ? 213 ARG B H    6  
ATOM 5046  H HA   . ARG B 2 16 ? -9.171  3.044   0.475   1.00 0.00 ? 213 ARG B HA   6  
ATOM 5047  H HB2  . ARG B 2 16 ? -10.285 5.842   0.542   1.00 0.00 ? 213 ARG B HB2  6  
ATOM 5048  H HG2  . ARG B 2 16 ? -11.170 3.348   1.585   1.00 0.00 ? 213 ARG B HG2  6  
ATOM 5049  H HD2  . ARG B 2 16 ? -12.305 3.881   -0.932  1.00 0.00 ? 213 ARG B HD2  6  
ATOM 5050  H HE   . ARG B 2 16 ? -14.141 5.117   -0.403  1.00 0.00 ? 213 ARG B HE   6  
ATOM 5051  H HH11 . ARG B 2 16 ? -13.443 2.981   2.257   1.00 0.00 ? 213 ARG B HH11 6  
ATOM 5052  H HH12 . ARG B 2 16 ? -14.852 3.433   3.157   1.00 0.00 ? 213 ARG B HH12 6  
ATOM 5053  H HH21 . ARG B 2 16 ? -15.996 5.721   0.775   1.00 0.00 ? 213 ARG B HH21 6  
ATOM 5054  H HH22 . ARG B 2 16 ? -16.304 4.992   2.315   1.00 0.00 ? 213 ARG B HH22 6  
ATOM 5055  N N    . TYR B 2 17 ? -7.622  5.803   -0.543  1.00 0.00 ? 214 TYR B N    6  
ATOM 5056  C CA   . TYR B 2 17 ? -6.677  6.307   -1.537  1.00 0.00 ? 214 TYR B CA   6  
ATOM 5057  C C    . TYR B 2 17 ? -5.241  5.901   -1.223  1.00 0.00 ? 214 TYR B C    6  
ATOM 5058  O O    . TYR B 2 17 ? -4.930  5.483   -0.108  1.00 0.00 ? 214 TYR B O    6  
ATOM 5059  C CB   . TYR B 2 17 ? -6.788  7.832   -1.638  1.00 0.00 ? 214 TYR B CB   6  
ATOM 5060  C CG   . TYR B 2 17 ? -8.214  8.347   -1.619  1.00 0.00 ? 214 TYR B CG   6  
ATOM 5061  C CD1  . TYR B 2 17 ? -9.286  7.509   -1.912  1.00 0.00 ? 214 TYR B CD1  6  
ATOM 5062  C CD2  . TYR B 2 17 ? -8.487  9.670   -1.302  1.00 0.00 ? 214 TYR B CD2  6  
ATOM 5063  C CE1  . TYR B 2 17 ? -10.584 7.975   -1.891  1.00 0.00 ? 214 TYR B CE1  6  
ATOM 5064  C CE2  . TYR B 2 17 ? -9.785  10.145  -1.279  1.00 0.00 ? 214 TYR B CE2  6  
ATOM 5065  C CZ   . TYR B 2 17 ? -10.830 9.293   -1.572  1.00 0.00 ? 214 TYR B CZ   6  
ATOM 5066  O OH   . TYR B 2 17 ? -12.123 9.762   -1.549  1.00 0.00 ? 214 TYR B OH   6  
ATOM 5067  H H    . TYR B 2 17 ? -7.988  6.424   0.115   1.00 0.00 ? 214 TYR B H    6  
ATOM 5068  H HA   . TYR B 2 17 ? -6.952  5.880   -2.490  1.00 0.00 ? 214 TYR B HA   6  
ATOM 5069  H HB2  . TYR B 2 17 ? -6.266  8.278   -0.804  1.00 0.00 ? 214 TYR B HB2  6  
ATOM 5070  H HD1  . TYR B 2 17 ? -9.090  6.477   -2.162  1.00 0.00 ? 214 TYR B HD1  6  
ATOM 5071  H HD2  . TYR B 2 17 ? -7.668  10.335  -1.073  1.00 0.00 ? 214 TYR B HD2  6  
ATOM 5072  H HE1  . TYR B 2 17 ? -11.399 7.304   -2.118  1.00 0.00 ? 214 TYR B HE1  6  
ATOM 5073  H HE2  . TYR B 2 17 ? -9.976  11.177  -1.030  1.00 0.00 ? 214 TYR B HE2  6  
ATOM 5074  H HH   . TYR B 2 17 ? -12.683 9.132   -1.090  1.00 0.00 ? 214 TYR B HH   6  
ATOM 5075  N N    . PRO B 2 18 ? -4.343  6.019   -2.222  1.00 0.00 ? 215 PRO B N    6  
ATOM 5076  C CA   . PRO B 2 18 ? -2.937  5.661   -2.073  1.00 0.00 ? 215 PRO B CA   6  
ATOM 5077  C C    . PRO B 2 18 ? -2.079  6.803   -1.537  1.00 0.00 ? 215 PRO B C    6  
ATOM 5078  O O    . PRO B 2 18 ? -1.723  7.723   -2.274  1.00 0.00 ? 215 PRO B O    6  
ATOM 5079  C CB   . PRO B 2 18 ? -2.528  5.315   -3.502  1.00 0.00 ? 215 PRO B CB   6  
ATOM 5080  C CG   . PRO B 2 18 ? -3.392  6.171   -4.372  1.00 0.00 ? 215 PRO B CG   6  
ATOM 5081  C CD   . PRO B 2 18 ? -4.641  6.496   -3.586  1.00 0.00 ? 215 PRO B CD   6  
ATOM 5082  H HA   . PRO B 2 18 ? -2.820  4.799   -1.442  1.00 0.00 ? 215 PRO B HA   6  
ATOM 5083  H HB2  . PRO B 2 18 ? -1.479  5.539   -3.646  1.00 0.00 ? 215 PRO B HB2  6  
ATOM 5084  H HG2  . PRO B 2 18 ? -2.868  7.081   -4.624  1.00 0.00 ? 215 PRO B HG2  6  
ATOM 5085  H HD2  . PRO B 2 18 ? -4.818  7.560   -3.588  1.00 0.00 ? 215 PRO B HD2  6  
ATOM 5086  N N    . MET B 2 19 ? -1.749  6.737   -0.250  1.00 0.00 ? 216 MET B N    6  
ATOM 5087  C CA   . MET B 2 19 ? -0.923  7.764   0.375   1.00 0.00 ? 216 MET B CA   6  
ATOM 5088  C C    . MET B 2 19 ? 0.215   7.148   1.178   1.00 0.00 ? 216 MET B C    6  
ATOM 5089  O O    . MET B 2 19 ? -0.008  6.546   2.227   1.00 0.00 ? 216 MET B O    6  
ATOM 5090  C CB   . MET B 2 19 ? -1.778  8.658   1.275   1.00 0.00 ? 216 MET B CB   6  
ATOM 5091  C CG   . MET B 2 19 ? -2.332  7.938   2.494   1.00 0.00 ? 216 MET B CG   6  
ATOM 5092  S SD   . MET B 2 19 ? -4.046  8.379   2.845   1.00 0.00 ? 216 MET B SD   6  
ATOM 5093  C CE   . MET B 2 19 ? -4.877  7.672   1.424   1.00 0.00 ? 216 MET B CE   6  
ATOM 5094  H H    . MET B 2 19 ? -2.067  5.984   0.289   1.00 0.00 ? 216 MET B H    6  
ATOM 5095  H HA   . MET B 2 19 ? -0.495  8.361   -0.412  1.00 0.00 ? 216 MET B HA   6  
ATOM 5096  H HB2  . MET B 2 19 ? -1.175  9.487   1.614   1.00 0.00 ? 216 MET B HB2  6  
ATOM 5097  H HG2  . MET B 2 19 ? -2.279  6.874   2.321   1.00 0.00 ? 216 MET B HG2  6  
ATOM 5098  H HE1  . MET B 2 19 ? -4.145  7.402   0.677   1.00 0.00 ? 216 MET B HE1  6  
ATOM 5099  H HE2  . MET B 2 19 ? -5.423  6.791   1.727   1.00 0.00 ? 216 MET B HE2  6  
ATOM 5100  H HE3  . MET B 2 19 ? -5.563  8.396   1.012   1.00 0.00 ? 216 MET B HE3  6  
ATOM 5101  N N    . ASP B 2 20 ? 1.436   7.318   0.682   1.00 0.00 ? 217 ASP B N    6  
ATOM 5102  C CA   . ASP B 2 20 ? 2.619   6.783   1.347   1.00 0.00 ? 217 ASP B CA   6  
ATOM 5103  C C    . ASP B 2 20 ? 2.626   7.145   2.828   1.00 0.00 ? 217 ASP B C    6  
ATOM 5104  O O    . ASP B 2 20 ? 1.748   7.928   3.250   1.00 0.00 ? 217 ASP B O    6  
ATOM 5105  C CB   . ASP B 2 20 ? 3.887   7.316   0.675   1.00 0.00 ? 217 ASP B CB   6  
ATOM 5106  C CG   . ASP B 2 20 ? 3.862   8.822   0.505   1.00 0.00 ? 217 ASP B CG   6  
ATOM 5107  O OD1  . ASP B 2 20 ? 3.038   9.317   -0.293  1.00 0.00 ? 217 ASP B OD1  6  
ATOM 5108  O OD2  . ASP B 2 20 ? 4.668   9.508   1.171   1.00 0.00 ? 217 ASP B OD2  6  
ATOM 5109  O OXT  . ASP B 2 20 ? 3.508   6.643   3.556   1.00 0.00 ? 217 ASP B OXT  6  
ATOM 5110  H H    . ASP B 2 20 ? 1.545   7.817   -0.155  1.00 0.00 ? 217 ASP B H    6  
ATOM 5111  H HA   . ASP B 2 20 ? 2.597   5.709   1.250   1.00 0.00 ? 217 ASP B HA   6  
ATOM 5112  H HB2  . ASP B 2 20 ? 4.744   7.055   1.277   1.00 0.00 ? 217 ASP B HB2  6  
ATOM 5113  N N    . GLY A 1 1  ? 6.693   -14.456 -6.145  1.00 0.00 ? 292 GLY A N    7  
ATOM 5114  C CA   . GLY A 1 1  ? 7.161   -14.231 -7.539  1.00 0.00 ? 292 GLY A CA   7  
ATOM 5115  C C    . GLY A 1 1  ? 6.474   -13.051 -8.200  1.00 0.00 ? 292 GLY A C    7  
ATOM 5116  O O    . GLY A 1 1  ? 6.888   -11.907 -8.015  1.00 0.00 ? 292 GLY A O    7  
ATOM 5117  H H1   . GLY A 1 1  ? 5.807   -15.001 -6.148  1.00 0.00 ? 292 GLY A H1   7  
ATOM 5118  H H2   . GLY A 1 1  ? 6.523   -13.545 -5.673  1.00 0.00 ? 292 GLY A H2   7  
ATOM 5119  H H3   . GLY A 1 1  ? 7.410   -14.984 -5.607  1.00 0.00 ? 292 GLY A H3   7  
ATOM 5120  H HA2  . GLY A 1 1  ? 8.226   -14.051 -7.526  1.00 0.00 ? 292 GLY A HA2  7  
ATOM 5121  H HA3  . GLY A 1 1  ? 6.965   -15.119 -8.121  1.00 0.00 ? 292 GLY A HA3  7  
ATOM 5122  N N    . PRO A 1 2  ? 5.410   -13.303 -8.982  1.00 0.00 ? 293 PRO A N    7  
ATOM 5123  C CA   . PRO A 1 2  ? 4.668   -12.244 -9.672  1.00 0.00 ? 293 PRO A CA   7  
ATOM 5124  C C    . PRO A 1 2  ? 3.760   -11.463 -8.727  1.00 0.00 ? 293 PRO A C    7  
ATOM 5125  O O    . PRO A 1 2  ? 3.815   -11.637 -7.510  1.00 0.00 ? 293 PRO A O    7  
ATOM 5126  C CB   . PRO A 1 2  ? 3.837   -13.015 -10.695 1.00 0.00 ? 293 PRO A CB   7  
ATOM 5127  C CG   . PRO A 1 2  ? 3.614   -14.348 -10.068 1.00 0.00 ? 293 PRO A CG   7  
ATOM 5128  C CD   . PRO A 1 2  ? 4.848   -14.640 -9.257  1.00 0.00 ? 293 PRO A CD   7  
ATOM 5129  H HA   . PRO A 1 2  ? 5.332   -11.561 -10.181 1.00 0.00 ? 293 PRO A HA   7  
ATOM 5130  H HB2  . PRO A 1 2  ? 2.905   -12.497 -10.871 1.00 0.00 ? 293 PRO A HB2  7  
ATOM 5131  H HG2  . PRO A 1 2  ? 2.745   -14.311 -9.428  1.00 0.00 ? 293 PRO A HG2  7  
ATOM 5132  H HD2  . PRO A 1 2  ? 4.585   -15.142 -8.337  1.00 0.00 ? 293 PRO A HD2  7  
ATOM 5133  N N    . LEU A 1 3  ? 2.925   -10.601 -9.298  1.00 0.00 ? 294 LEU A N    7  
ATOM 5134  C CA   . LEU A 1 3  ? 2.004   -9.792  -8.509  1.00 0.00 ? 294 LEU A CA   7  
ATOM 5135  C C    . LEU A 1 3  ? 0.573   -10.300 -8.657  1.00 0.00 ? 294 LEU A C    7  
ATOM 5136  O O    . LEU A 1 3  ? -0.382  -9.527  -8.579  1.00 0.00 ? 294 LEU A O    7  
ATOM 5137  C CB   . LEU A 1 3  ? 2.084   -8.324  -8.934  1.00 0.00 ? 294 LEU A CB   7  
ATOM 5138  C CG   . LEU A 1 3  ? 2.794   -7.400  -7.944  1.00 0.00 ? 294 LEU A CG   7  
ATOM 5139  C CD1  . LEU A 1 3  ? 1.958   -7.223  -6.686  1.00 0.00 ? 294 LEU A CD1  7  
ATOM 5140  C CD2  . LEU A 1 3  ? 4.170   -7.946  -7.598  1.00 0.00 ? 294 LEU A CD2  7  
ATOM 5141  H H    . LEU A 1 3  ? 2.930   -10.505 -10.273 1.00 0.00 ? 294 LEU A H    7  
ATOM 5142  H HA   . LEU A 1 3  ? 2.295   -9.873  -7.472  1.00 0.00 ? 294 LEU A HA   7  
ATOM 5143  H HB2  . LEU A 1 3  ? 2.606   -8.274  -9.879  1.00 0.00 ? 294 LEU A HB2  7  
ATOM 5144  H HG   . LEU A 1 3  ? 2.922   -6.428  -8.398  1.00 0.00 ? 294 LEU A HG   7  
ATOM 5145  H HD11 . LEU A 1 3  ? 1.108   -6.593  -6.904  1.00 0.00 ? 294 LEU A HD11 7  
ATOM 5146  H HD12 . LEU A 1 3  ? 1.612   -8.188  -6.345  1.00 0.00 ? 294 LEU A HD12 7  
ATOM 5147  H HD13 . LEU A 1 3  ? 2.559   -6.763  -5.916  1.00 0.00 ? 294 LEU A HD13 7  
ATOM 5148  H HD21 . LEU A 1 3  ? 4.438   -8.720  -8.304  1.00 0.00 ? 294 LEU A HD21 7  
ATOM 5149  H HD22 . LEU A 1 3  ? 4.896   -7.149  -7.645  1.00 0.00 ? 294 LEU A HD22 7  
ATOM 5150  H HD23 . LEU A 1 3  ? 4.154   -8.360  -6.600  1.00 0.00 ? 294 LEU A HD23 7  
ATOM 5151  N N    . GLY A 1 4  ? 0.433   -11.604 -8.872  1.00 0.00 ? 295 GLY A N    7  
ATOM 5152  C CA   . GLY A 1 4  ? -0.883  -12.192 -9.028  1.00 0.00 ? 295 GLY A CA   7  
ATOM 5153  C C    . GLY A 1 4  ? -1.379  -12.133 -10.460 1.00 0.00 ? 295 GLY A C    7  
ATOM 5154  O O    . GLY A 1 4  ? -1.208  -11.122 -11.140 1.00 0.00 ? 295 GLY A O    7  
ATOM 5155  H H    . GLY A 1 4  ? 1.230   -12.171 -8.923  1.00 0.00 ? 295 GLY A H    7  
ATOM 5156  H HA2  . GLY A 1 4  ? -0.844  -13.225 -8.716  1.00 0.00 ? 295 GLY A HA2  7  
ATOM 5157  H HA3  . GLY A 1 4  ? -1.580  -11.662 -8.395  1.00 0.00 ? 295 GLY A HA3  7  
ATOM 5158  N N    . SER A 1 5  ? -1.994  -13.219 -10.917 1.00 0.00 ? 296 SER A N    7  
ATOM 5159  C CA   . SER A 1 5  ? -2.516  -13.284 -12.276 1.00 0.00 ? 296 SER A CA   7  
ATOM 5160  C C    . SER A 1 5  ? -3.772  -12.431 -12.413 1.00 0.00 ? 296 SER A C    7  
ATOM 5161  O O    . SER A 1 5  ? -3.793  -11.453 -13.161 1.00 0.00 ? 296 SER A O    7  
ATOM 5162  C CB   . SER A 1 5  ? -2.827  -14.732 -12.656 1.00 0.00 ? 296 SER A CB   7  
ATOM 5163  O OG   . SER A 1 5  ? -3.777  -14.792 -13.707 1.00 0.00 ? 296 SER A OG   7  
ATOM 5164  H H    . SER A 1 5  ? -2.099  -13.992 -10.326 1.00 0.00 ? 296 SER A H    7  
ATOM 5165  H HA   . SER A 1 5  ? -1.758  -12.900 -12.942 1.00 0.00 ? 296 SER A HA   7  
ATOM 5166  H HB2  . SER A 1 5  ? -1.919  -15.220 -12.981 1.00 0.00 ? 296 SER A HB2  7  
ATOM 5167  H HG   . SER A 1 5  ? -3.399  -15.259 -14.455 1.00 0.00 ? 296 SER A HG   7  
ATOM 5168  N N    . GLY A 1 6  ? -4.817  -12.809 -11.685 1.00 0.00 ? 297 GLY A N    7  
ATOM 5169  C CA   . GLY A 1 6  ? -6.063  -12.068 -11.735 1.00 0.00 ? 297 GLY A CA   7  
ATOM 5170  C C    . GLY A 1 6  ? -6.162  -11.032 -10.632 1.00 0.00 ? 297 GLY A C    7  
ATOM 5171  O O    . GLY A 1 6  ? -5.409  -11.085 -9.660  1.00 0.00 ? 297 GLY A O    7  
ATOM 5172  H H    . GLY A 1 6  ? -4.742  -13.598 -11.109 1.00 0.00 ? 297 GLY A H    7  
ATOM 5173  H HA2  . GLY A 1 6  ? -6.135  -11.570 -12.690 1.00 0.00 ? 297 GLY A HA2  7  
ATOM 5174  H HA3  . GLY A 1 6  ? -6.886  -12.760 -11.638 1.00 0.00 ? 297 GLY A HA3  7  
ATOM 5175  N N    . PRO A 1 7  ? -7.089  -10.069 -10.756 1.00 0.00 ? 298 PRO A N    7  
ATOM 5176  C CA   . PRO A 1 7  ? -7.273  -9.016  -9.753  1.00 0.00 ? 298 PRO A CA   7  
ATOM 5177  C C    . PRO A 1 7  ? -7.414  -9.577  -8.342  1.00 0.00 ? 298 PRO A C    7  
ATOM 5178  O O    . PRO A 1 7  ? -7.459  -10.791 -8.147  1.00 0.00 ? 298 PRO A O    7  
ATOM 5179  C CB   . PRO A 1 7  ? -8.569  -8.331  -10.190 1.00 0.00 ? 298 PRO A CB   7  
ATOM 5180  C CG   . PRO A 1 7  ? -8.650  -8.579  -11.656 1.00 0.00 ? 298 PRO A CG   7  
ATOM 5181  C CD   . PRO A 1 7  ? -8.030  -9.929  -11.884 1.00 0.00 ? 298 PRO A CD   7  
ATOM 5182  H HA   . PRO A 1 7  ? -6.462  -8.304  -9.775  1.00 0.00 ? 298 PRO A HA   7  
ATOM 5183  H HB2  . PRO A 1 7  ? -9.406  -8.772  -9.666  1.00 0.00 ? 298 PRO A HB2  7  
ATOM 5184  H HG2  . PRO A 1 7  ? -9.684  -8.583  -11.971 1.00 0.00 ? 298 PRO A HG2  7  
ATOM 5185  H HD2  . PRO A 1 7  ? -8.784  -10.702 -11.854 1.00 0.00 ? 298 PRO A HD2  7  
ATOM 5186  N N    . LEU A 1 8  ? -7.482  -8.682  -7.362  1.00 0.00 ? 299 LEU A N    7  
ATOM 5187  C CA   . LEU A 1 8  ? -7.613  -9.082  -5.966  1.00 0.00 ? 299 LEU A CA   7  
ATOM 5188  C C    . LEU A 1 8  ? -9.070  -9.367  -5.609  1.00 0.00 ? 299 LEU A C    7  
ATOM 5189  O O    . LEU A 1 8  ? -9.982  -9.014  -6.358  1.00 0.00 ? 299 LEU A O    7  
ATOM 5190  C CB   . LEU A 1 8  ? -7.062  -7.990  -5.052  1.00 0.00 ? 299 LEU A CB   7  
ATOM 5191  C CG   . LEU A 1 8  ? -5.587  -7.649  -5.260  1.00 0.00 ? 299 LEU A CG   7  
ATOM 5192  C CD1  . LEU A 1 8  ? -5.281  -6.259  -4.727  1.00 0.00 ? 299 LEU A CD1  7  
ATOM 5193  C CD2  . LEU A 1 8  ? -4.705  -8.688  -4.585  1.00 0.00 ? 299 LEU A CD2  7  
ATOM 5194  H H    . LEU A 1 8  ? -7.441  -7.728  -7.583  1.00 0.00 ? 299 LEU A H    7  
ATOM 5195  H HA   . LEU A 1 8  ? -7.036  -9.984  -5.824  1.00 0.00 ? 299 LEU A HA   7  
ATOM 5196  H HB2  . LEU A 1 8  ? -7.643  -7.092  -5.207  1.00 0.00 ? 299 LEU A HB2  7  
ATOM 5197  H HG   . LEU A 1 8  ? -5.366  -7.656  -6.318  1.00 0.00 ? 299 LEU A HG   7  
ATOM 5198  H HD11 . LEU A 1 8  ? -5.838  -6.091  -3.816  1.00 0.00 ? 299 LEU A HD11 7  
ATOM 5199  H HD12 . LEU A 1 8  ? -4.225  -6.174  -4.522  1.00 0.00 ? 299 LEU A HD12 7  
ATOM 5200  H HD13 . LEU A 1 8  ? -5.565  -5.520  -5.463  1.00 0.00 ? 299 LEU A HD13 7  
ATOM 5201  H HD21 . LEU A 1 8  ? -4.172  -8.228  -3.766  1.00 0.00 ? 299 LEU A HD21 7  
ATOM 5202  H HD22 . LEU A 1 8  ? -5.319  -9.492  -4.208  1.00 0.00 ? 299 LEU A HD22 7  
ATOM 5203  H HD23 . LEU A 1 8  ? -3.998  -9.080  -5.300  1.00 0.00 ? 299 LEU A HD23 7  
ATOM 5204  N N    . PRO A 1 9  ? -9.308  -10.014 -4.452  1.00 0.00 ? 300 PRO A N    7  
ATOM 5205  C CA   . PRO A 1 9  ? -10.661 -10.344 -3.991  1.00 0.00 ? 300 PRO A CA   7  
ATOM 5206  C C    . PRO A 1 9  ? -11.521 -9.100  -3.781  1.00 0.00 ? 300 PRO A C    7  
ATOM 5207  O O    . PRO A 1 9  ? -11.039 -7.974  -3.913  1.00 0.00 ? 300 PRO A O    7  
ATOM 5208  C CB   . PRO A 1 9  ? -10.429 -11.064 -2.658  1.00 0.00 ? 300 PRO A CB   7  
ATOM 5209  C CG   . PRO A 1 9  ? -9.010  -11.516 -2.703  1.00 0.00 ? 300 PRO A CG   7  
ATOM 5210  C CD   . PRO A 1 9  ? -8.280  -10.480 -3.507  1.00 0.00 ? 300 PRO A CD   7  
ATOM 5211  H HA   . PRO A 1 9  ? -11.160 -11.010 -4.681  1.00 0.00 ? 300 PRO A HA   7  
ATOM 5212  H HB2  . PRO A 1 9  ? -10.599 -10.378 -1.841  1.00 0.00 ? 300 PRO A HB2  7  
ATOM 5213  H HG2  . PRO A 1 9  ? -8.609  -11.570 -1.703  1.00 0.00 ? 300 PRO A HG2  7  
ATOM 5214  H HD2  . PRO A 1 9  ? -7.945  -9.674  -2.869  1.00 0.00 ? 300 PRO A HD2  7  
ATOM 5215  N N    . PRO A 1 10 ? -12.810 -9.289  -3.449  1.00 0.00 ? 301 PRO A N    7  
ATOM 5216  C CA   . PRO A 1 10 ? -13.744 -8.181  -3.227  1.00 0.00 ? 301 PRO A CA   7  
ATOM 5217  C C    . PRO A 1 10 ? -13.449 -7.412  -1.942  1.00 0.00 ? 301 PRO A C    7  
ATOM 5218  O O    . PRO A 1 10 ? -14.302 -7.312  -1.061  1.00 0.00 ? 301 PRO A O    7  
ATOM 5219  C CB   . PRO A 1 10 ? -15.116 -8.869  -3.130  1.00 0.00 ? 301 PRO A CB   7  
ATOM 5220  C CG   . PRO A 1 10 ? -14.897 -10.275 -3.583  1.00 0.00 ? 301 PRO A CG   7  
ATOM 5221  C CD   . PRO A 1 10 ? -13.464 -10.590 -3.274  1.00 0.00 ? 301 PRO A CD   7  
ATOM 5222  H HA   . PRO A 1 10 ? -13.742 -7.496  -4.059  1.00 0.00 ? 301 PRO A HA   7  
ATOM 5223  H HB2  . PRO A 1 10 ? -15.463 -8.838  -2.108  1.00 0.00 ? 301 PRO A HB2  7  
ATOM 5224  H HG2  . PRO A 1 10 ? -15.552 -10.942 -3.043  1.00 0.00 ? 301 PRO A HG2  7  
ATOM 5225  H HD2  . PRO A 1 10 ? -13.364 -10.942 -2.257  1.00 0.00 ? 301 PRO A HD2  7  
ATOM 5226  N N    . GLY A 1 11 ? -12.241 -6.866  -1.841  1.00 0.00 ? 302 GLY A N    7  
ATOM 5227  C CA   . GLY A 1 11 ? -11.874 -6.109  -0.659  1.00 0.00 ? 302 GLY A CA   7  
ATOM 5228  C C    . GLY A 1 11 ? -10.472 -5.537  -0.734  1.00 0.00 ? 302 GLY A C    7  
ATOM 5229  O O    . GLY A 1 11 ? -10.209 -4.453  -0.211  1.00 0.00 ? 302 GLY A O    7  
ATOM 5230  H H    . GLY A 1 11 ? -11.595 -6.985  -2.568  1.00 0.00 ? 302 GLY A H    7  
ATOM 5231  H HA2  . GLY A 1 11 ? -12.574 -5.295  -0.537  1.00 0.00 ? 302 GLY A HA2  7  
ATOM 5232  H HA3  . GLY A 1 11 ? -11.940 -6.756  0.202   1.00 0.00 ? 302 GLY A HA3  7  
ATOM 5233  N N    . TRP A 1 12 ? -9.566  -6.259  -1.382  1.00 0.00 ? 303 TRP A N    7  
ATOM 5234  C CA   . TRP A 1 12 ? -8.185  -5.809  -1.506  1.00 0.00 ? 303 TRP A CA   7  
ATOM 5235  C C    . TRP A 1 12 ? -7.951  -5.070  -2.818  1.00 0.00 ? 303 TRP A C    7  
ATOM 5236  O O    . TRP A 1 12 ? -8.548  -5.394  -3.844  1.00 0.00 ? 303 TRP A O    7  
ATOM 5237  C CB   . TRP A 1 12 ? -7.230  -6.998  -1.422  1.00 0.00 ? 303 TRP A CB   7  
ATOM 5238  C CG   . TRP A 1 12 ? -7.377  -7.789  -0.164  1.00 0.00 ? 303 TRP A CG   7  
ATOM 5239  C CD1  . TRP A 1 12 ? -8.299  -8.761  0.090   1.00 0.00 ? 303 TRP A CD1  7  
ATOM 5240  C CD2  . TRP A 1 12 ? -6.572  -7.678  1.010   1.00 0.00 ? 303 TRP A CD2  7  
ATOM 5241  N NE1  . TRP A 1 12 ? -8.118  -9.261  1.356   1.00 0.00 ? 303 TRP A NE1  7  
ATOM 5242  C CE2  . TRP A 1 12 ? -7.063  -8.610  1.942   1.00 0.00 ? 303 TRP A CE2  7  
ATOM 5243  C CE3  . TRP A 1 12 ? -5.484  -6.877  1.364   1.00 0.00 ? 303 TRP A CE3  7  
ATOM 5244  C CZ2  . TRP A 1 12 ? -6.499  -8.765  3.206   1.00 0.00 ? 303 TRP A CZ2  7  
ATOM 5245  C CZ3  . TRP A 1 12 ? -4.928  -7.030  2.617   1.00 0.00 ? 303 TRP A CZ3  7  
ATOM 5246  C CH2  . TRP A 1 12 ? -5.435  -7.967  3.525   1.00 0.00 ? 303 TRP A CH2  7  
ATOM 5247  H H    . TRP A 1 12 ? -9.829  -7.114  -1.782  1.00 0.00 ? 303 TRP A H    7  
ATOM 5248  H HA   . TRP A 1 12 ? -7.980  -5.139  -0.687  1.00 0.00 ? 303 TRP A HA   7  
ATOM 5249  H HB2  . TRP A 1 12 ? -7.418  -7.659  -2.251  1.00 0.00 ? 303 TRP A HB2  7  
ATOM 5250  H HD1  . TRP A 1 12 ? -9.055  -9.079  -0.613  1.00 0.00 ? 303 TRP A HD1  7  
ATOM 5251  H HE1  . TRP A 1 12 ? -8.654  -9.966  1.770   1.00 0.00 ? 303 TRP A HE1  7  
ATOM 5252  H HE3  . TRP A 1 12 ? -5.080  -6.148  0.676   1.00 0.00 ? 303 TRP A HE3  7  
ATOM 5253  H HZ2  . TRP A 1 12 ? -6.879  -9.482  3.918   1.00 0.00 ? 303 TRP A HZ2  7  
ATOM 5254  H HZ3  . TRP A 1 12 ? -4.087  -6.419  2.908   1.00 0.00 ? 303 TRP A HZ3  7  
ATOM 5255  H HH2  . TRP A 1 12 ? -4.968  -8.048  4.493   1.00 0.00 ? 303 TRP A HH2  7  
ATOM 5256  N N    . GLU A 1 13 ? -7.076  -4.072  -2.769  1.00 0.00 ? 304 GLU A N    7  
ATOM 5257  C CA   . GLU A 1 13 ? -6.734  -3.294  -3.951  1.00 0.00 ? 304 GLU A CA   7  
ATOM 5258  C C    . GLU A 1 13 ? -5.250  -2.962  -3.957  1.00 0.00 ? 304 GLU A C    7  
ATOM 5259  O O    . GLU A 1 13 ? -4.679  -2.603  -2.926  1.00 0.00 ? 304 GLU A O    7  
ATOM 5260  C CB   . GLU A 1 13 ? -7.543  -1.999  -4.015  1.00 0.00 ? 304 GLU A CB   7  
ATOM 5261  C CG   . GLU A 1 13 ? -7.238  -1.168  -5.250  1.00 0.00 ? 304 GLU A CG   7  
ATOM 5262  C CD   . GLU A 1 13 ? -7.575  0.299   -5.068  1.00 0.00 ? 304 GLU A CD   7  
ATOM 5263  O OE1  . GLU A 1 13 ? -8.332  0.621   -4.126  1.00 0.00 ? 304 GLU A OE1  7  
ATOM 5264  O OE2  . GLU A 1 13 ? -7.084  1.126   -5.865  1.00 0.00 ? 304 GLU A OE2  7  
ATOM 5265  H H    . GLU A 1 13 ? -6.651  -3.852  -1.912  1.00 0.00 ? 304 GLU A H    7  
ATOM 5266  H HA   . GLU A 1 13 ? -6.960  -3.894  -4.820  1.00 0.00 ? 304 GLU A HA   7  
ATOM 5267  H HB2  . GLU A 1 13 ? -8.593  -2.242  -4.016  1.00 0.00 ? 304 GLU A HB2  7  
ATOM 5268  H HG2  . GLU A 1 13 ? -6.184  -1.254  -5.475  1.00 0.00 ? 304 GLU A HG2  7  
ATOM 5269  N N    . ILE A 1 14 ? -4.628  -3.082  -5.121  1.00 0.00 ? 305 ILE A N    7  
ATOM 5270  C CA   . ILE A 1 14 ? -3.211  -2.790  -5.254  1.00 0.00 ? 305 ILE A CA   7  
ATOM 5271  C C    . ILE A 1 14 ? -2.972  -1.286  -5.361  1.00 0.00 ? 305 ILE A C    7  
ATOM 5272  O O    . ILE A 1 14 ? -3.749  -0.559  -5.979  1.00 0.00 ? 305 ILE A O    7  
ATOM 5273  C CB   . ILE A 1 14 ? -2.604  -3.489  -6.489  1.00 0.00 ? 305 ILE A CB   7  
ATOM 5274  C CG1  . ILE A 1 14 ? -2.716  -5.007  -6.349  1.00 0.00 ? 305 ILE A CG1  7  
ATOM 5275  C CG2  . ILE A 1 14 ? -1.149  -3.077  -6.687  1.00 0.00 ? 305 ILE A CG2  7  
ATOM 5276  C CD1  . ILE A 1 14 ? -2.005  -5.764  -7.447  1.00 0.00 ? 305 ILE A CD1  7  
ATOM 5277  H H    . ILE A 1 14 ? -5.134  -3.374  -5.908  1.00 0.00 ? 305 ILE A H    7  
ATOM 5278  H HA   . ILE A 1 14 ? -2.708  -3.165  -4.369  1.00 0.00 ? 305 ILE A HA   7  
ATOM 5279  H HB   . ILE A 1 14 ? -3.160  -3.175  -7.360  1.00 0.00 ? 305 ILE A HB   7  
ATOM 5280  H HG12 . ILE A 1 14 ? -2.284  -5.308  -5.406  1.00 0.00 ? 305 ILE A HG12 7  
ATOM 5281  H HG21 . ILE A 1 14 ? -1.070  -2.442  -7.556  1.00 0.00 ? 305 ILE A HG21 7  
ATOM 5282  H HG22 . ILE A 1 14 ? -0.808  -2.538  -5.816  1.00 0.00 ? 305 ILE A HG22 7  
ATOM 5283  H HG23 . ILE A 1 14 ? -0.538  -3.954  -6.827  1.00 0.00 ? 305 ILE A HG23 7  
ATOM 5284  H HD11 . ILE A 1 14 ? -1.005  -5.366  -7.566  1.00 0.00 ? 305 ILE A HD11 7  
ATOM 5285  H HD12 . ILE A 1 14 ? -1.949  -6.809  -7.188  1.00 0.00 ? 305 ILE A HD12 7  
ATOM 5286  H HD13 . ILE A 1 14 ? -2.549  -5.649  -8.373  1.00 0.00 ? 305 ILE A HD13 7  
ATOM 5287  N N    . ARG A 1 15 ? -1.886  -0.840  -4.750  1.00 0.00 ? 306 ARG A N    7  
ATOM 5288  C CA   . ARG A 1 15 ? -1.501  0.562   -4.770  1.00 0.00 ? 306 ARG A CA   7  
ATOM 5289  C C    . ARG A 1 15 ? -0.001  0.666   -4.543  1.00 0.00 ? 306 ARG A C    7  
ATOM 5290  O O    . ARG A 1 15 ? 0.663   -0.346  -4.358  1.00 0.00 ? 306 ARG A O    7  
ATOM 5291  C CB   . ARG A 1 15 ? -2.260  1.341   -3.696  1.00 0.00 ? 306 ARG A CB   7  
ATOM 5292  C CG   . ARG A 1 15 ? -3.514  2.022   -4.218  1.00 0.00 ? 306 ARG A CG   7  
ATOM 5293  C CD   . ARG A 1 15 ? -4.289  2.695   -3.099  1.00 0.00 ? 306 ARG A CD   7  
ATOM 5294  N NE   . ARG A 1 15 ? -5.731  2.593   -3.296  1.00 0.00 ? 306 ARG A NE   7  
ATOM 5295  C CZ   . ARG A 1 15 ? -6.390  3.220   -4.264  1.00 0.00 ? 306 ARG A CZ   7  
ATOM 5296  N NH1  . ARG A 1 15 ? -5.736  3.990   -5.124  1.00 0.00 ? 306 ARG A NH1  7  
ATOM 5297  N NH2  . ARG A 1 15 ? -7.702  3.075   -4.378  1.00 0.00 ? 306 ARG A NH2  7  
ATOM 5298  H H    . ARG A 1 15 ? -1.322  -1.478  -4.265  1.00 0.00 ? 306 ARG A H    7  
ATOM 5299  H HA   . ARG A 1 15 ? -1.741  0.964   -5.743  1.00 0.00 ? 306 ARG A HA   7  
ATOM 5300  H HB2  . ARG A 1 15 ? -2.549  0.660   -2.908  1.00 0.00 ? 306 ARG A HB2  7  
ATOM 5301  H HG2  . ARG A 1 15 ? -3.230  2.767   -4.946  1.00 0.00 ? 306 ARG A HG2  7  
ATOM 5302  H HD2  . ARG A 1 15 ? -4.028  2.224   -2.163  1.00 0.00 ? 306 ARG A HD2  7  
ATOM 5303  H HE   . ARG A 1 15 ? -6.235  2.028   -2.673  1.00 0.00 ? 306 ARG A HE   7  
ATOM 5304  H HH11 . ARG A 1 15 ? -4.746  4.101   -5.043  1.00 0.00 ? 306 ARG A HH11 7  
ATOM 5305  H HH12 . ARG A 1 15 ? -6.234  4.461   -5.852  1.00 0.00 ? 306 ARG A HH12 7  
ATOM 5306  H HH21 . ARG A 1 15 ? -8.198  2.494   -3.732  1.00 0.00 ? 306 ARG A HH21 7  
ATOM 5307  H HH22 . ARG A 1 15 ? -8.197  3.548   -5.107  1.00 0.00 ? 306 ARG A HH22 7  
ATOM 5308  N N    . ASN A 1 16 ? 0.542   1.873   -4.564  1.00 0.00 ? 307 ASN A N    7  
ATOM 5309  C CA   . ASN A 1 16 ? 1.975   2.042   -4.351  1.00 0.00 ? 307 ASN A CA   7  
ATOM 5310  C C    . ASN A 1 16 ? 2.250   3.135   -3.327  1.00 0.00 ? 307 ASN A C    7  
ATOM 5311  O O    . ASN A 1 16 ? 1.403   3.993   -3.076  1.00 0.00 ? 307 ASN A O    7  
ATOM 5312  C CB   . ASN A 1 16 ? 2.696   2.348   -5.669  1.00 0.00 ? 307 ASN A CB   7  
ATOM 5313  C CG   . ASN A 1 16 ? 2.048   1.674   -6.863  1.00 0.00 ? 307 ASN A CG   7  
ATOM 5314  O OD1  . ASN A 1 16 ? 1.066   2.170   -7.414  1.00 0.00 ? 307 ASN A OD1  7  
ATOM 5315  N ND2  . ASN A 1 16 ? 2.598   0.535   -7.270  1.00 0.00 ? 307 ASN A ND2  7  
ATOM 5316  H H    . ASN A 1 16 ? -0.023  2.659   -4.725  1.00 0.00 ? 307 ASN A H    7  
ATOM 5317  H HA   . ASN A 1 16 ? 2.352   1.109   -3.960  1.00 0.00 ? 307 ASN A HA   7  
ATOM 5318  H HB2  . ASN A 1 16 ? 2.693   3.414   -5.834  1.00 0.00 ? 307 ASN A HB2  7  
ATOM 5319  H HD21 . ASN A 1 16 ? 3.378   0.198   -6.783  1.00 0.00 ? 307 ASN A HD21 7  
ATOM 5320  H HD22 . ASN A 1 16 ? 2.198   0.077   -8.038  1.00 0.00 ? 307 ASN A HD22 7  
ATOM 5321  N N    . THR A 1 17 ? 3.442   3.099   -2.741  1.00 0.00 ? 308 THR A N    7  
ATOM 5322  C CA   . THR A 1 17 ? 3.831   4.080   -1.737  1.00 0.00 ? 308 THR A CA   7  
ATOM 5323  C C    . THR A 1 17 ? 4.500   5.296   -2.375  1.00 0.00 ? 308 THR A C    7  
ATOM 5324  O O    . THR A 1 17 ? 5.501   5.801   -1.868  1.00 0.00 ? 308 THR A O    7  
ATOM 5325  C CB   . THR A 1 17 ? 4.793   3.464   -0.701  1.00 0.00 ? 308 THR A CB   7  
ATOM 5326  O OG1  . THR A 1 17 ? 5.965   2.963   -1.354  1.00 0.00 ? 308 THR A OG1  7  
ATOM 5327  C CG2  . THR A 1 17 ? 4.113   2.338   0.065   1.00 0.00 ? 308 THR A CG2  7  
ATOM 5328  H H    . THR A 1 17 ? 4.075   2.394   -2.991  1.00 0.00 ? 308 THR A H    7  
ATOM 5329  H HA   . THR A 1 17 ? 2.938   4.400   -1.222  1.00 0.00 ? 308 THR A HA   7  
ATOM 5330  H HB   . THR A 1 17 ? 5.082   4.233   0.002   1.00 0.00 ? 308 THR A HB   7  
ATOM 5331  H HG1  . THR A 1 17 ? 6.746   3.357   -0.960  1.00 0.00 ? 308 THR A HG1  7  
ATOM 5332  H HG21 . THR A 1 17 ? 3.056   2.549   0.141   1.00 0.00 ? 308 THR A HG21 7  
ATOM 5333  H HG22 . THR A 1 17 ? 4.541   2.262   1.055   1.00 0.00 ? 308 THR A HG22 7  
ATOM 5334  H HG23 . THR A 1 17 ? 4.256   1.406   -0.461  1.00 0.00 ? 308 THR A HG23 7  
ATOM 5335  N N    . ALA A 1 18 ? 3.937   5.765   -3.487  1.00 0.00 ? 309 ALA A N    7  
ATOM 5336  C CA   . ALA A 1 18 ? 4.479   6.920   -4.192  1.00 0.00 ? 309 ALA A CA   7  
ATOM 5337  C C    . ALA A 1 18 ? 5.836   6.601   -4.808  1.00 0.00 ? 309 ALA A C    7  
ATOM 5338  O O    . ALA A 1 18 ? 5.991   6.604   -6.030  1.00 0.00 ? 309 ALA A O    7  
ATOM 5339  C CB   . ALA A 1 18 ? 4.593   8.107   -3.249  1.00 0.00 ? 309 ALA A CB   7  
ATOM 5340  H H    . ALA A 1 18 ? 3.138   5.324   -3.841  1.00 0.00 ? 309 ALA A H    7  
ATOM 5341  H HA   . ALA A 1 18 ? 3.789   7.183   -4.981  1.00 0.00 ? 309 ALA A HA   7  
ATOM 5342  H HB1  . ALA A 1 18 ? 4.135   7.861   -2.302  1.00 0.00 ? 309 ALA A HB1  7  
ATOM 5343  H HB2  . ALA A 1 18 ? 5.635   8.345   -3.095  1.00 0.00 ? 309 ALA A HB2  7  
ATOM 5344  H HB3  . ALA A 1 18 ? 4.089   8.960   -3.681  1.00 0.00 ? 309 ALA A HB3  7  
ATOM 5345  N N    . THR A 1 19 ? 6.816   6.326   -3.955  1.00 0.00 ? 310 THR A N    7  
ATOM 5346  C CA   . THR A 1 19 ? 8.162   6.006   -4.413  1.00 0.00 ? 310 THR A CA   7  
ATOM 5347  C C    . THR A 1 19 ? 8.141   4.907   -5.471  1.00 0.00 ? 310 THR A C    7  
ATOM 5348  O O    . THR A 1 19 ? 8.829   5.001   -6.487  1.00 0.00 ? 310 THR A O    7  
ATOM 5349  C CB   . THR A 1 19 ? 9.064   5.567   -3.244  1.00 0.00 ? 310 THR A CB   7  
ATOM 5350  O OG1  . THR A 1 19 ? 8.383   5.762   -1.999  1.00 0.00 ? 310 THR A OG1  7  
ATOM 5351  C CG2  . THR A 1 19 ? 10.364  6.355   -3.242  1.00 0.00 ? 310 THR A CG2  7  
ATOM 5352  H H    . THR A 1 19 ? 6.631   6.342   -2.993  1.00 0.00 ? 310 THR A H    7  
ATOM 5353  H HA   . THR A 1 19 ? 8.585   6.900   -4.849  1.00 0.00 ? 310 THR A HA   7  
ATOM 5354  H HB   . THR A 1 19 ? 9.297   4.519   -3.359  1.00 0.00 ? 310 THR A HB   7  
ATOM 5355  H HG1  . THR A 1 19 ? 7.899   4.964   -1.770  1.00 0.00 ? 310 THR A HG1  7  
ATOM 5356  H HG21 . THR A 1 19 ? 10.814  6.304   -2.262  1.00 0.00 ? 310 THR A HG21 7  
ATOM 5357  H HG22 . THR A 1 19 ? 10.160  7.386   -3.492  1.00 0.00 ? 310 THR A HG22 7  
ATOM 5358  H HG23 . THR A 1 19 ? 11.041  5.935   -3.971  1.00 0.00 ? 310 THR A HG23 7  
ATOM 5359  N N    . GLY A 1 20 ? 7.346   3.867   -5.231  1.00 0.00 ? 311 GLY A N    7  
ATOM 5360  C CA   . GLY A 1 20 ? 7.261   2.772   -6.181  1.00 0.00 ? 311 GLY A CA   7  
ATOM 5361  C C    . GLY A 1 20 ? 6.674   1.510   -5.578  1.00 0.00 ? 311 GLY A C    7  
ATOM 5362  O O    . GLY A 1 20 ? 5.780   0.896   -6.160  1.00 0.00 ? 311 GLY A O    7  
ATOM 5363  H H    . GLY A 1 20 ? 6.815   3.843   -4.408  1.00 0.00 ? 311 GLY A H    7  
ATOM 5364  H HA2  . GLY A 1 20 ? 6.642   3.081   -7.010  1.00 0.00 ? 311 GLY A HA2  7  
ATOM 5365  H HA3  . GLY A 1 20 ? 8.252   2.554   -6.550  1.00 0.00 ? 311 GLY A HA3  7  
ATOM 5366  N N    . ARG A 1 21 ? 7.175   1.119   -4.407  1.00 0.00 ? 312 ARG A N    7  
ATOM 5367  C CA   . ARG A 1 21 ? 6.697   -0.089  -3.726  1.00 0.00 ? 312 ARG A CA   7  
ATOM 5368  C C    . ARG A 1 21 ? 5.187   -0.201  -3.782  1.00 0.00 ? 312 ARG A C    7  
ATOM 5369  O O    . ARG A 1 21 ? 4.461   0.763   -3.544  1.00 0.00 ? 312 ARG A O    7  
ATOM 5370  C CB   . ARG A 1 21 ? 7.172   -0.130  -2.268  1.00 0.00 ? 312 ARG A CB   7  
ATOM 5371  C CG   . ARG A 1 21 ? 8.055   -1.328  -1.951  1.00 0.00 ? 312 ARG A CG   7  
ATOM 5372  C CD   . ARG A 1 21 ? 7.235   -2.534  -1.506  1.00 0.00 ? 312 ARG A CD   7  
ATOM 5373  N NE   . ARG A 1 21 ? 8.044   -3.749  -1.442  1.00 0.00 ? 312 ARG A NE   7  
ATOM 5374  C CZ   . ARG A 1 21 ? 8.985   -3.960  -0.526  1.00 0.00 ? 312 ARG A CZ   7  
ATOM 5375  N NH1  . ARG A 1 21 ? 9.229   -3.046  0.403   1.00 0.00 ? 312 ARG A NH1  7  
ATOM 5376  N NH2  . ARG A 1 21 ? 9.683   -5.087  -0.539  1.00 0.00 ? 312 ARG A NH2  7  
ATOM 5377  H H    . ARG A 1 21 ? 7.886   1.653   -3.994  1.00 0.00 ? 312 ARG A H    7  
ATOM 5378  H HA   . ARG A 1 21 ? 7.100   -0.944  -4.250  1.00 0.00 ? 312 ARG A HA   7  
ATOM 5379  H HB2  . ARG A 1 21 ? 7.732   0.767   -2.054  1.00 0.00 ? 312 ARG A HB2  7  
ATOM 5380  H HG2  . ARG A 1 21 ? 8.618   -1.591  -2.834  1.00 0.00 ? 312 ARG A HG2  7  
ATOM 5381  H HD2  . ARG A 1 21 ? 6.826   -2.335  -0.527  1.00 0.00 ? 312 ARG A HD2  7  
ATOM 5382  H HE   . ARG A 1 21 ? 7.879   -4.440  -2.115  1.00 0.00 ? 312 ARG A HE   7  
ATOM 5383  H HH11 . ARG A 1 21 ? 8.703   -2.195  0.418   1.00 0.00 ? 312 ARG A HH11 7  
ATOM 5384  H HH12 . ARG A 1 21 ? 9.938   -3.207  1.089   1.00 0.00 ? 312 ARG A HH12 7  
ATOM 5385  H HH21 . ARG A 1 21 ? 9.500   -5.779  -1.237  1.00 0.00 ? 312 ARG A HH21 7  
ATOM 5386  H HH22 . ARG A 1 21 ? 10.390  -5.246  0.150   1.00 0.00 ? 312 ARG A HH22 7  
ATOM 5387  N N    . VAL A 1 22 ? 4.734   -1.401  -4.099  1.00 0.00 ? 313 VAL A N    7  
ATOM 5388  C CA   . VAL A 1 22 ? 3.320   -1.686  -4.213  1.00 0.00 ? 313 VAL A CA   7  
ATOM 5389  C C    . VAL A 1 22 ? 2.805   -2.408  -2.969  1.00 0.00 ? 313 VAL A C    7  
ATOM 5390  O O    . VAL A 1 22 ? 3.336   -3.447  -2.574  1.00 0.00 ? 313 VAL A O    7  
ATOM 5391  C CB   . VAL A 1 22 ? 3.052   -2.547  -5.467  1.00 0.00 ? 313 VAL A CB   7  
ATOM 5392  C CG1  . VAL A 1 22 ? 4.034   -3.699  -5.532  1.00 0.00 ? 313 VAL A CG1  7  
ATOM 5393  C CG2  . VAL A 1 22 ? 1.629   -3.061  -5.493  1.00 0.00 ? 313 VAL A CG2  7  
ATOM 5394  H H    . VAL A 1 22 ? 5.377   -2.122  -4.260  1.00 0.00 ? 313 VAL A H    7  
ATOM 5395  H HA   . VAL A 1 22 ? 2.797   -0.750  -4.323  1.00 0.00 ? 313 VAL A HA   7  
ATOM 5396  H HB   . VAL A 1 22 ? 3.201   -1.931  -6.342  1.00 0.00 ? 313 VAL A HB   7  
ATOM 5397  H HG11 . VAL A 1 22 ? 4.059   -4.201  -4.576  1.00 0.00 ? 313 VAL A HG11 7  
ATOM 5398  H HG12 . VAL A 1 22 ? 3.724   -4.393  -6.297  1.00 0.00 ? 313 VAL A HG12 7  
ATOM 5399  H HG13 . VAL A 1 22 ? 5.017   -3.317  -5.766  1.00 0.00 ? 313 VAL A HG13 7  
ATOM 5400  H HG21 . VAL A 1 22 ? 1.607   -4.061  -5.090  1.00 0.00 ? 313 VAL A HG21 7  
ATOM 5401  H HG22 . VAL A 1 22 ? 1.008   -2.417  -4.895  1.00 0.00 ? 313 VAL A HG22 7  
ATOM 5402  H HG23 . VAL A 1 22 ? 1.273   -3.071  -6.509  1.00 0.00 ? 313 VAL A HG23 7  
ATOM 5403  N N    . TYR A 1 23 ? 1.771   -1.846  -2.359  1.00 0.00 ? 314 TYR A N    7  
ATOM 5404  C CA   . TYR A 1 23 ? 1.168   -2.437  -1.176  1.00 0.00 ? 314 TYR A CA   7  
ATOM 5405  C C    . TYR A 1 23 ? -0.279  -2.802  -1.445  1.00 0.00 ? 314 TYR A C    7  
ATOM 5406  O O    . TYR A 1 23 ? -0.836  -2.450  -2.485  1.00 0.00 ? 314 TYR A O    7  
ATOM 5407  C CB   . TYR A 1 23 ? 1.243   -1.484  0.016   1.00 0.00 ? 314 TYR A CB   7  
ATOM 5408  C CG   . TYR A 1 23 ? 0.367   -0.258  -0.106  1.00 0.00 ? 314 TYR A CG   7  
ATOM 5409  C CD1  . TYR A 1 23 ? 0.682   0.759   -0.996  1.00 0.00 ? 314 TYR A CD1  7  
ATOM 5410  C CD2  . TYR A 1 23 ? -0.773  -0.118  0.674   1.00 0.00 ? 314 TYR A CD2  7  
ATOM 5411  C CE1  . TYR A 1 23 ? -0.117  1.880   -1.109  1.00 0.00 ? 314 TYR A CE1  7  
ATOM 5412  C CE2  . TYR A 1 23 ? -1.578  1.001   0.567   1.00 0.00 ? 314 TYR A CE2  7  
ATOM 5413  C CZ   . TYR A 1 23 ? -1.248  1.996   -0.327  1.00 0.00 ? 314 TYR A CZ   7  
ATOM 5414  O OH   . TYR A 1 23 ? -2.045  3.111   -0.435  1.00 0.00 ? 314 TYR A OH   7  
ATOM 5415  H H    . TYR A 1 23 ? 1.402   -1.013  -2.718  1.00 0.00 ? 314 TYR A H    7  
ATOM 5416  H HA   . TYR A 1 23 ? 1.715   -3.338  -0.941  1.00 0.00 ? 314 TYR A HA   7  
ATOM 5417  H HB2  . TYR A 1 23 ? 0.931   -2.017  0.901   1.00 0.00 ? 314 TYR A HB2  7  
ATOM 5418  H HD1  . TYR A 1 23 ? 1.567   0.668   -1.608  1.00 0.00 ? 314 TYR A HD1  7  
ATOM 5419  H HD2  . TYR A 1 23 ? -1.027  -0.898  1.378   1.00 0.00 ? 314 TYR A HD2  7  
ATOM 5420  H HE1  . TYR A 1 23 ? 0.151   2.662   -1.801  1.00 0.00 ? 314 TYR A HE1  7  
ATOM 5421  H HE2  . TYR A 1 23 ? -2.457  1.095   1.185   1.00 0.00 ? 314 TYR A HE2  7  
ATOM 5422  H HH   . TYR A 1 23 ? -2.926  2.908   -0.110  1.00 0.00 ? 314 TYR A HH   7  
ATOM 5423  N N    . PHE A 1 24 ? -0.885  -3.509  -0.504  1.00 0.00 ? 315 PHE A N    7  
ATOM 5424  C CA   . PHE A 1 24 ? -2.268  -3.915  -0.645  1.00 0.00 ? 315 PHE A CA   7  
ATOM 5425  C C    . PHE A 1 24 ? -3.138  -3.224  0.386   1.00 0.00 ? 315 PHE A C    7  
ATOM 5426  O O    . PHE A 1 24 ? -2.744  -3.054  1.541   1.00 0.00 ? 315 PHE A O    7  
ATOM 5427  C CB   . PHE A 1 24 ? -2.392  -5.432  -0.541  1.00 0.00 ? 315 PHE A CB   7  
ATOM 5428  C CG   . PHE A 1 24 ? -1.733  -6.140  -1.688  1.00 0.00 ? 315 PHE A CG   7  
ATOM 5429  C CD1  . PHE A 1 24 ? -0.355  -6.267  -1.738  1.00 0.00 ? 315 PHE A CD1  7  
ATOM 5430  C CD2  . PHE A 1 24 ? -2.489  -6.666  -2.721  1.00 0.00 ? 315 PHE A CD2  7  
ATOM 5431  C CE1  . PHE A 1 24 ? 0.259   -6.908  -2.796  1.00 0.00 ? 315 PHE A CE1  7  
ATOM 5432  C CE2  . PHE A 1 24 ? -1.882  -7.308  -3.785  1.00 0.00 ? 315 PHE A CE2  7  
ATOM 5433  C CZ   . PHE A 1 24 ? -0.506  -7.429  -3.821  1.00 0.00 ? 315 PHE A CZ   7  
ATOM 5434  H H    . PHE A 1 24 ? -0.389  -3.763  0.302   1.00 0.00 ? 315 PHE A H    7  
ATOM 5435  H HA   . PHE A 1 24 ? -2.596  -3.604  -1.623  1.00 0.00 ? 315 PHE A HA   7  
ATOM 5436  H HB2  . PHE A 1 24 ? -1.925  -5.766  0.374   1.00 0.00 ? 315 PHE A HB2  7  
ATOM 5437  H HD1  . PHE A 1 24 ? 0.242   -5.858  -0.935  1.00 0.00 ? 315 PHE A HD1  7  
ATOM 5438  H HD2  . PHE A 1 24 ? -3.566  -6.568  -2.690  1.00 0.00 ? 315 PHE A HD2  7  
ATOM 5439  H HE1  . PHE A 1 24 ? 1.335   -6.999  -2.823  1.00 0.00 ? 315 PHE A HE1  7  
ATOM 5440  H HE2  . PHE A 1 24 ? -2.480  -7.714  -4.585  1.00 0.00 ? 315 PHE A HE2  7  
ATOM 5441  H HZ   . PHE A 1 24 ? -0.029  -7.930  -4.651  1.00 0.00 ? 315 PHE A HZ   7  
ATOM 5442  N N    . VAL A 1 25 ? -4.323  -2.825  -0.046  1.00 0.00 ? 316 VAL A N    7  
ATOM 5443  C CA   . VAL A 1 25 ? -5.252  -2.121  0.817   1.00 0.00 ? 316 VAL A CA   7  
ATOM 5444  C C    . VAL A 1 25 ? -6.484  -2.960  1.139   1.00 0.00 ? 316 VAL A C    7  
ATOM 5445  O O    . VAL A 1 25 ? -7.273  -3.288  0.252   1.00 0.00 ? 316 VAL A O    7  
ATOM 5446  C CB   . VAL A 1 25 ? -5.698  -0.802  0.165   1.00 0.00 ? 316 VAL A CB   7  
ATOM 5447  C CG1  . VAL A 1 25 ? -6.376  0.085   1.184   1.00 0.00 ? 316 VAL A CG1  7  
ATOM 5448  C CG2  . VAL A 1 25 ? -4.513  -0.088  -0.468  1.00 0.00 ? 316 VAL A CG2  7  
ATOM 5449  H H    . VAL A 1 25 ? -4.581  -3.013  -0.973  1.00 0.00 ? 316 VAL A H    7  
ATOM 5450  H HA   . VAL A 1 25 ? -4.738  -1.884  1.737   1.00 0.00 ? 316 VAL A HA   7  
ATOM 5451  H HB   . VAL A 1 25 ? -6.411  -1.030  -0.613  1.00 0.00 ? 316 VAL A HB   7  
ATOM 5452  H HG11 . VAL A 1 25 ? -6.685  1.004   0.712   1.00 0.00 ? 316 VAL A HG11 7  
ATOM 5453  H HG12 . VAL A 1 25 ? -7.238  -0.427  1.581   1.00 0.00 ? 316 VAL A HG12 7  
ATOM 5454  H HG13 . VAL A 1 25 ? -5.684  0.304   1.985   1.00 0.00 ? 316 VAL A HG13 7  
ATOM 5455  H HG21 . VAL A 1 25 ? -4.633  0.979   -0.354  1.00 0.00 ? 316 VAL A HG21 7  
ATOM 5456  H HG22 . VAL A 1 25 ? -3.602  -0.401  0.019   1.00 0.00 ? 316 VAL A HG22 7  
ATOM 5457  H HG23 . VAL A 1 25 ? -4.462  -0.335  -1.518  1.00 0.00 ? 316 VAL A HG23 7  
ATOM 5458  N N    . ASP A 1 26 ? -6.635  -3.309  2.415   1.00 0.00 ? 317 ASP A N    7  
ATOM 5459  C CA   . ASP A 1 26 ? -7.769  -4.093  2.870   1.00 0.00 ? 317 ASP A CA   7  
ATOM 5460  C C    . ASP A 1 26 ? -8.971  -3.185  3.107   1.00 0.00 ? 317 ASP A C    7  
ATOM 5461  O O    . ASP A 1 26 ? -8.988  -2.402  4.057   1.00 0.00 ? 317 ASP A O    7  
ATOM 5462  C CB   . ASP A 1 26 ? -7.451  -4.855  4.170   1.00 0.00 ? 317 ASP A CB   7  
ATOM 5463  C CG   . ASP A 1 26 ? -5.966  -5.019  4.498   1.00 0.00 ? 317 ASP A CG   7  
ATOM 5464  O OD1  . ASP A 1 26 ? -5.133  -4.217  4.031   1.00 0.00 ? 317 ASP A OD1  7  
ATOM 5465  O OD2  . ASP A 1 26 ? -5.640  -5.958  5.253   1.00 0.00 ? 317 ASP A OD2  7  
ATOM 5466  H H    . ASP A 1 26 ? -5.960  -3.042  3.068   1.00 0.00 ? 317 ASP A H    7  
ATOM 5467  H HA   . ASP A 1 26 ? -8.015  -4.804  2.094   1.00 0.00 ? 317 ASP A HA   7  
ATOM 5468  H HB2  . ASP A 1 26 ? -7.916  -4.341  4.995   1.00 0.00 ? 317 ASP A HB2  7  
ATOM 5469  N N    . HIS A 1 27 ? -9.974  -3.287  2.243   1.00 0.00 ? 318 HIS A N    7  
ATOM 5470  C CA   . HIS A 1 27 ? -11.173 -2.467  2.375   1.00 0.00 ? 318 HIS A CA   7  
ATOM 5471  C C    . HIS A 1 27 ? -12.167 -3.110  3.335   1.00 0.00 ? 318 HIS A C    7  
ATOM 5472  O O    . HIS A 1 27 ? -12.999 -2.428  3.932   1.00 0.00 ? 318 HIS A O    7  
ATOM 5473  C CB   . HIS A 1 27 ? -11.816 -2.242  1.007   1.00 0.00 ? 318 HIS A CB   7  
ATOM 5474  C CG   . HIS A 1 27 ? -11.074 -1.241  0.179   1.00 0.00 ? 318 HIS A CG   7  
ATOM 5475  N ND1  . HIS A 1 27 ? -11.076 0.091   0.503   1.00 0.00 ? 318 HIS A ND1  7  
ATOM 5476  C CD2  . HIS A 1 27 ? -10.306 -1.429  -0.922  1.00 0.00 ? 318 HIS A CD2  7  
ATOM 5477  C CE1  . HIS A 1 27 ? -10.312 0.684   -0.393  1.00 0.00 ? 318 HIS A CE1  7  
ATOM 5478  N NE2  . HIS A 1 27 ? -9.824  -0.197  -1.280  1.00 0.00 ? 318 HIS A NE2  7  
ATOM 5479  H H    . HIS A 1 27 ? -9.907  -3.927  1.503   1.00 0.00 ? 318 HIS A H    7  
ATOM 5480  H HA   . HIS A 1 27 ? -10.873 -1.511  2.779   1.00 0.00 ? 318 HIS A HA   7  
ATOM 5481  H HB2  . HIS A 1 27 ? -11.840 -3.175  0.465   1.00 0.00 ? 318 HIS A HB2  7  
ATOM 5482  H HD2  . HIS A 1 27 ? -10.104 -2.365  -1.419  1.00 0.00 ? 318 HIS A HD2  7  
ATOM 5483  H HE1  . HIS A 1 27 ? -10.094 1.740   -0.401  1.00 0.00 ? 318 HIS A HE1  7  
ATOM 5484  H HE2  . HIS A 1 27 ? -9.118  -0.024  -1.939  1.00 0.00 ? 318 HIS A HE2  7  
ATOM 5485  N N    . ASN A 1 28 ? -12.073 -4.428  3.478   1.00 0.00 ? 319 ASN A N    7  
ATOM 5486  C CA   . ASN A 1 28 ? -12.950 -5.162  4.375   1.00 0.00 ? 319 ASN A CA   7  
ATOM 5487  C C    . ASN A 1 28 ? -12.498 -5.001  5.823   1.00 0.00 ? 319 ASN A C    7  
ATOM 5488  O O    . ASN A 1 28 ? -13.307 -4.738  6.713   1.00 0.00 ? 319 ASN A O    7  
ATOM 5489  C CB   . ASN A 1 28 ? -12.971 -6.645  3.999   1.00 0.00 ? 319 ASN A CB   7  
ATOM 5490  C CG   . ASN A 1 28 ? -11.595 -7.192  3.662   1.00 0.00 ? 319 ASN A CG   7  
ATOM 5491  O OD1  . ASN A 1 28 ? -10.579 -6.678  4.128   1.00 0.00 ? 319 ASN A OD1  7  
ATOM 5492  N ND2  . ASN A 1 28 ? -11.557 -8.238  2.846   1.00 0.00 ? 319 ASN A ND2  7  
ATOM 5493  H H    . ASN A 1 28 ? -11.405 -4.919  2.963   1.00 0.00 ? 319 ASN A H    7  
ATOM 5494  H HA   . ASN A 1 28 ? -13.946 -4.759  4.271   1.00 0.00 ? 319 ASN A HA   7  
ATOM 5495  H HB2  . ASN A 1 28 ? -13.357 -7.205  4.829   1.00 0.00 ? 319 ASN A HB2  7  
ATOM 5496  H HD21 . ASN A 1 28 ? -12.403 -8.596  2.512   1.00 0.00 ? 319 ASN A HD21 7  
ATOM 5497  H HD22 . ASN A 1 28 ? -10.681 -8.609  2.612   1.00 0.00 ? 319 ASN A HD22 7  
ATOM 5498  N N    . ASN A 1 29 ? -11.198 -5.163  6.049   1.00 0.00 ? 320 ASN A N    7  
ATOM 5499  C CA   . ASN A 1 29 ? -10.627 -5.039  7.386   1.00 0.00 ? 320 ASN A CA   7  
ATOM 5500  C C    . ASN A 1 29 ? -10.128 -3.620  7.650   1.00 0.00 ? 320 ASN A C    7  
ATOM 5501  O O    . ASN A 1 29 ? -9.966  -3.217  8.801   1.00 0.00 ? 320 ASN A O    7  
ATOM 5502  C CB   . ASN A 1 29 ? -9.477  -6.034  7.565   1.00 0.00 ? 320 ASN A CB   7  
ATOM 5503  C CG   . ASN A 1 29 ? -9.818  -7.411  7.036   1.00 0.00 ? 320 ASN A CG   7  
ATOM 5504  O OD1  . ASN A 1 29 ? -10.835 -7.998  7.405   1.00 0.00 ? 320 ASN A OD1  7  
ATOM 5505  N ND2  . ASN A 1 29 ? -8.964  -7.937  6.165   1.00 0.00 ? 320 ASN A ND2  7  
ATOM 5506  H H    . ASN A 1 29 ? -10.608 -5.377  5.297   1.00 0.00 ? 320 ASN A H    7  
ATOM 5507  H HA   . ASN A 1 29 ? -11.404 -5.271  8.099   1.00 0.00 ? 320 ASN A HA   7  
ATOM 5508  H HB2  . ASN A 1 29 ? -8.608  -5.671  7.035   1.00 0.00 ? 320 ASN A HB2  7  
ATOM 5509  H HD21 . ASN A 1 29 ? -8.174  -7.413  5.918   1.00 0.00 ? 320 ASN A HD21 7  
ATOM 5510  H HD22 . ASN A 1 29 ? -9.160  -8.826  5.805   1.00 0.00 ? 320 ASN A HD22 7  
ATOM 5511  N N    . ARG A 1 30 ? -9.880  -2.869  6.579   1.00 0.00 ? 321 ARG A N    7  
ATOM 5512  C CA   . ARG A 1 30 ? -9.397  -1.497  6.703   1.00 0.00 ? 321 ARG A CA   7  
ATOM 5513  C C    . ARG A 1 30 ? -7.956  -1.468  7.198   1.00 0.00 ? 321 ARG A C    7  
ATOM 5514  O O    . ARG A 1 30 ? -7.682  -1.013  8.310   1.00 0.00 ? 321 ARG A O    7  
ATOM 5515  C CB   . ARG A 1 30 ? -10.285 -0.702  7.660   1.00 0.00 ? 321 ARG A CB   7  
ATOM 5516  C CG   . ARG A 1 30 ? -11.771 -0.836  7.370   1.00 0.00 ? 321 ARG A CG   7  
ATOM 5517  C CD   . ARG A 1 30 ? -12.520 -1.404  8.565   1.00 0.00 ? 321 ARG A CD   7  
ATOM 5518  N NE   . ARG A 1 30 ? -13.851 -0.820  8.705   1.00 0.00 ? 321 ARG A NE   7  
ATOM 5519  C CZ   . ARG A 1 30 ? -14.874 -1.120  7.910   1.00 0.00 ? 321 ARG A CZ   7  
ATOM 5520  N NH1  . ARG A 1 30 ? -14.716 -1.992  6.923   1.00 0.00 ? 321 ARG A NH1  7  
ATOM 5521  N NH2  . ARG A 1 30 ? -16.055 -0.546  8.103   1.00 0.00 ? 321 ARG A NH2  7  
ATOM 5522  H H    . ARG A 1 30 ? -10.023 -3.244  5.685   1.00 0.00 ? 321 ARG A H    7  
ATOM 5523  H HA   . ARG A 1 30 ? -9.439  -1.041  5.724   1.00 0.00 ? 321 ARG A HA   7  
ATOM 5524  H HB2  . ARG A 1 30 ? -10.104 -1.044  8.668   1.00 0.00 ? 321 ARG A HB2  7  
ATOM 5525  H HG2  . ARG A 1 30 ? -12.172 0.138   7.135   1.00 0.00 ? 321 ARG A HG2  7  
ATOM 5526  H HD2  . ARG A 1 30 ? -12.618 -2.472  8.438   1.00 0.00 ? 321 ARG A HD2  7  
ATOM 5527  H HE   . ARG A 1 30 ? -13.989 -0.174  9.428   1.00 0.00 ? 321 ARG A HE   7  
ATOM 5528  H HH11 . ARG A 1 30 ? -13.827 -2.424  6.776   1.00 0.00 ? 321 ARG A HH11 7  
ATOM 5529  H HH12 . ARG A 1 30 ? -15.487 -2.216  6.327   1.00 0.00 ? 321 ARG A HH12 7  
ATOM 5530  H HH21 . ARG A 1 30 ? -16.176 0.111   8.846   1.00 0.00 ? 321 ARG A HH21 7  
ATOM 5531  H HH22 . ARG A 1 30 ? -16.824 -0.772  7.504   1.00 0.00 ? 321 ARG A HH22 7  
ATOM 5532  N N    . THR A 1 31 ? -7.039  -1.957  6.371   1.00 0.00 ? 322 THR A N    7  
ATOM 5533  C CA   . THR A 1 31 ? -5.625  -1.988  6.731   1.00 0.00 ? 322 THR A CA   7  
ATOM 5534  C C    . THR A 1 31 ? -4.748  -2.022  5.484   1.00 0.00 ? 322 THR A C    7  
ATOM 5535  O O    . THR A 1 31 ? -5.208  -1.716  4.385   1.00 0.00 ? 322 THR A O    7  
ATOM 5536  C CB   . THR A 1 31 ? -5.281  -3.202  7.630   1.00 0.00 ? 322 THR A CB   7  
ATOM 5537  O OG1  . THR A 1 31 ? -4.824  -4.301  6.831   1.00 0.00 ? 322 THR A OG1  7  
ATOM 5538  C CG2  . THR A 1 31 ? -6.482  -3.645  8.455   1.00 0.00 ? 322 THR A CG2  7  
ATOM 5539  H H    . THR A 1 31 ? -7.318  -2.301  5.497   1.00 0.00 ? 322 THR A H    7  
ATOM 5540  H HA   . THR A 1 31 ? -5.403  -1.086  7.280   1.00 0.00 ? 322 THR A HA   7  
ATOM 5541  H HB   . THR A 1 31 ? -4.492  -2.909  8.306   1.00 0.00 ? 322 THR A HB   7  
ATOM 5542  H HG1  . THR A 1 31 ? -4.665  -5.062  7.394   1.00 0.00 ? 322 THR A HG1  7  
ATOM 5543  H HG21 . THR A 1 31 ? -7.298  -3.898  7.793   1.00 0.00 ? 322 THR A HG21 7  
ATOM 5544  H HG22 . THR A 1 31 ? -6.785  -2.843  9.111   1.00 0.00 ? 322 THR A HG22 7  
ATOM 5545  H HG23 . THR A 1 31 ? -6.214  -4.510  9.043   1.00 0.00 ? 322 THR A HG23 7  
ATOM 5546  N N    . THR A 1 32 ? -3.488  -2.403  5.660   1.00 0.00 ? 323 THR A N    7  
ATOM 5547  C CA   . THR A 1 32 ? -2.554  -2.475  4.546   1.00 0.00 ? 323 THR A CA   7  
ATOM 5548  C C    . THR A 1 32 ? -1.552  -3.609  4.733   1.00 0.00 ? 323 THR A C    7  
ATOM 5549  O O    . THR A 1 32 ? -1.495  -4.233  5.793   1.00 0.00 ? 323 THR A O    7  
ATOM 5550  C CB   . THR A 1 32 ? -1.778  -1.157  4.375   1.00 0.00 ? 323 THR A CB   7  
ATOM 5551  O OG1  . THR A 1 32 ? -1.300  -0.712  5.650   1.00 0.00 ? 323 THR A OG1  7  
ATOM 5552  C CG2  . THR A 1 32 ? -2.661  -0.082  3.753   1.00 0.00 ? 323 THR A CG2  7  
ATOM 5553  H H    . THR A 1 32 ? -3.180  -2.643  6.559   1.00 0.00 ? 323 THR A H    7  
ATOM 5554  H HA   . THR A 1 32 ? -3.125  -2.652  3.648   1.00 0.00 ? 323 THR A HA   7  
ATOM 5555  H HB   . THR A 1 32 ? -0.930  -1.335  3.722   1.00 0.00 ? 323 THR A HB   7  
ATOM 5556  H HG1  . THR A 1 32 ? -2.046  -0.517  6.222   1.00 0.00 ? 323 THR A HG1  7  
ATOM 5557  H HG21 . THR A 1 32 ? -2.287  0.896   4.022   1.00 0.00 ? 323 THR A HG21 7  
ATOM 5558  H HG22 . THR A 1 32 ? -3.674  -0.191  4.116   1.00 0.00 ? 323 THR A HG22 7  
ATOM 5559  H HG23 . THR A 1 32 ? -2.652  -0.188  2.677   1.00 0.00 ? 323 THR A HG23 7  
ATOM 5560  N N    . GLN A 1 33 ? -0.765  -3.866  3.695   1.00 0.00 ? 324 GLN A N    7  
ATOM 5561  C CA   . GLN A 1 33 ? 0.245   -4.918  3.741   1.00 0.00 ? 324 GLN A CA   7  
ATOM 5562  C C    . GLN A 1 33 ? 0.899   -5.097  2.376   1.00 0.00 ? 324 GLN A C    7  
ATOM 5563  O O    . GLN A 1 33 ? 0.217   -5.222  1.361   1.00 0.00 ? 324 GLN A O    7  
ATOM 5564  C CB   . GLN A 1 33 ? -0.370  -6.241  4.207   1.00 0.00 ? 324 GLN A CB   7  
ATOM 5565  C CG   . GLN A 1 33 ? -1.830  -6.413  3.823   1.00 0.00 ? 324 GLN A CG   7  
ATOM 5566  C CD   . GLN A 1 33 ? -2.252  -7.869  3.772   1.00 0.00 ? 324 GLN A CD   7  
ATOM 5567  O OE1  . GLN A 1 33 ? -2.806  -8.401  4.734   1.00 0.00 ? 324 GLN A OE1  7  
ATOM 5568  N NE2  . GLN A 1 33 ? -1.990  -8.523  2.646   1.00 0.00 ? 324 GLN A NE2  7  
ATOM 5569  H H    . GLN A 1 33 ? -0.867  -3.337  2.877   1.00 0.00 ? 324 GLN A H    7  
ATOM 5570  H HA   . GLN A 1 33 ? 1.002   -4.616  4.449   1.00 0.00 ? 324 GLN A HA   7  
ATOM 5571  H HB2  . GLN A 1 33 ? 0.192   -7.057  3.775   1.00 0.00 ? 324 GLN A HB2  7  
ATOM 5572  H HG2  . GLN A 1 33 ? -2.442  -5.904  4.552   1.00 0.00 ? 324 GLN A HG2  7  
ATOM 5573  H HE21 . GLN A 1 33 ? -1.546  -8.037  1.920   1.00 0.00 ? 324 GLN A HE21 7  
ATOM 5574  H HE22 . GLN A 1 33 ? -2.251  -9.466  2.588   1.00 0.00 ? 324 GLN A HE22 7  
ATOM 5575  N N    . PHE A 1 34 ? 2.226   -5.122  2.363   1.00 0.00 ? 325 PHE A N    7  
ATOM 5576  C CA   . PHE A 1 34 ? 2.981   -5.278  1.125   1.00 0.00 ? 325 PHE A CA   7  
ATOM 5577  C C    . PHE A 1 34 ? 2.757   -6.653  0.508   1.00 0.00 ? 325 PHE A C    7  
ATOM 5578  O O    . PHE A 1 34 ? 3.127   -6.892  -0.642  1.00 0.00 ? 325 PHE A O    7  
ATOM 5579  C CB   . PHE A 1 34 ? 4.476   -5.069  1.388   1.00 0.00 ? 325 PHE A CB   7  
ATOM 5580  C CG   . PHE A 1 34 ? 4.908   -3.618  1.482   1.00 0.00 ? 325 PHE A CG   7  
ATOM 5581  C CD1  . PHE A 1 34 ? 4.014   -2.576  1.247   1.00 0.00 ? 325 PHE A CD1  7  
ATOM 5582  C CD2  . PHE A 1 34 ? 6.220   -3.296  1.796   1.00 0.00 ? 325 PHE A CD2  7  
ATOM 5583  C CE1  . PHE A 1 34 ? 4.420   -1.258  1.327   1.00 0.00 ? 325 PHE A CE1  7  
ATOM 5584  C CE2  . PHE A 1 34 ? 6.628   -1.979  1.872   1.00 0.00 ? 325 PHE A CE2  7  
ATOM 5585  C CZ   . PHE A 1 34 ? 5.728   -0.961  1.636   1.00 0.00 ? 325 PHE A CZ   7  
ATOM 5586  H H    . PHE A 1 34 ? 2.711   -5.055  3.211   1.00 0.00 ? 325 PHE A H    7  
ATOM 5587  H HA   . PHE A 1 34 ? 2.637   -4.533  0.427   1.00 0.00 ? 325 PHE A HA   7  
ATOM 5588  H HB2  . PHE A 1 34 ? 4.734   -5.554  2.318   1.00 0.00 ? 325 PHE A HB2  7  
ATOM 5589  H HD1  . PHE A 1 34 ? 2.992   -2.801  1.013   1.00 0.00 ? 325 PHE A HD1  7  
ATOM 5590  H HD2  . PHE A 1 34 ? 6.927   -4.086  1.987   1.00 0.00 ? 325 PHE A HD2  7  
ATOM 5591  H HE1  . PHE A 1 34 ? 3.712   -0.460  1.147   1.00 0.00 ? 325 PHE A HE1  7  
ATOM 5592  H HE2  . PHE A 1 34 ? 7.651   -1.746  2.121   1.00 0.00 ? 325 PHE A HE2  7  
ATOM 5593  H HZ   . PHE A 1 34 ? 6.048   0.069   1.696   1.00 0.00 ? 325 PHE A HZ   7  
ATOM 5594  N N    . THR A 1 35 ? 2.152   -7.554  1.269   1.00 0.00 ? 326 THR A N    7  
ATOM 5595  C CA   . THR A 1 35 ? 1.894   -8.896  0.786   1.00 0.00 ? 326 THR A CA   7  
ATOM 5596  C C    . THR A 1 35 ? 0.605   -8.967  -0.017  1.00 0.00 ? 326 THR A C    7  
ATOM 5597  O O    . THR A 1 35 ? -0.295  -8.147  0.156   1.00 0.00 ? 326 THR A O    7  
ATOM 5598  C CB   . THR A 1 35 ? 1.812   -9.894  1.946   1.00 0.00 ? 326 THR A CB   7  
ATOM 5599  O OG1  . THR A 1 35 ? 2.454   -9.354  3.108   1.00 0.00 ? 326 THR A OG1  7  
ATOM 5600  C CG2  . THR A 1 35 ? 2.472   -11.195 1.554   1.00 0.00 ? 326 THR A CG2  7  
ATOM 5601  H H    . THR A 1 35 ? 1.877   -7.317  2.177   1.00 0.00 ? 326 THR A H    7  
ATOM 5602  H HA   . THR A 1 35 ? 2.719   -9.185  0.152   1.00 0.00 ? 326 THR A HA   7  
ATOM 5603  H HB   . THR A 1 35 ? 0.772   -10.085 2.169   1.00 0.00 ? 326 THR A HB   7  
ATOM 5604  H HG1  . THR A 1 35 ? 2.085   -9.761  3.896   1.00 0.00 ? 326 THR A HG1  7  
ATOM 5605  H HG21 . THR A 1 35 ? 1.865   -11.690 0.810   1.00 0.00 ? 326 THR A HG21 7  
ATOM 5606  H HG22 . THR A 1 35 ? 2.569   -11.826 2.423   1.00 0.00 ? 326 THR A HG22 7  
ATOM 5607  H HG23 . THR A 1 35 ? 3.450   -10.986 1.142   1.00 0.00 ? 326 THR A HG23 7  
ATOM 5608  N N    . ASP A 1 36 ? 0.523   -9.959  -0.897  1.00 0.00 ? 327 ASP A N    7  
ATOM 5609  C CA   . ASP A 1 36 ? -0.657  -10.148 -1.723  1.00 0.00 ? 327 ASP A CA   7  
ATOM 5610  C C    . ASP A 1 36 ? -1.505  -11.293 -1.176  1.00 0.00 ? 327 ASP A C    7  
ATOM 5611  O O    . ASP A 1 36 ? -1.045  -12.433 -1.119  1.00 0.00 ? 327 ASP A O    7  
ATOM 5612  C CB   . ASP A 1 36 ? -0.254  -10.448 -3.169  1.00 0.00 ? 327 ASP A CB   7  
ATOM 5613  C CG   . ASP A 1 36 ? -1.417  -10.308 -4.132  1.00 0.00 ? 327 ASP A CG   7  
ATOM 5614  O OD1  . ASP A 1 36 ? -2.552  -10.078 -3.663  1.00 0.00 ? 327 ASP A OD1  7  
ATOM 5615  O OD2  . ASP A 1 36 ? -1.192  -10.428 -5.355  1.00 0.00 ? 327 ASP A OD2  7  
ATOM 5616  H H    . ASP A 1 36 ? 1.275   -10.582 -0.989  1.00 0.00 ? 327 ASP A H    7  
ATOM 5617  H HA   . ASP A 1 36 ? -1.225  -9.234  -1.699  1.00 0.00 ? 327 ASP A HA   7  
ATOM 5618  H HB2  . ASP A 1 36 ? 0.524   -9.763  -3.471  1.00 0.00 ? 327 ASP A HB2  7  
ATOM 5619  N N    . PRO A 1 37 ? -2.755  -11.017 -0.766  1.00 0.00 ? 328 PRO A N    7  
ATOM 5620  C CA   . PRO A 1 37 ? -3.641  -12.045 -0.223  1.00 0.00 ? 328 PRO A CA   7  
ATOM 5621  C C    . PRO A 1 37 ? -3.716  -13.245 -1.150  1.00 0.00 ? 328 PRO A C    7  
ATOM 5622  O O    . PRO A 1 37 ? -3.823  -14.386 -0.704  1.00 0.00 ? 328 PRO A O    7  
ATOM 5623  C CB   . PRO A 1 37 ? -5.005  -11.352 -0.117  1.00 0.00 ? 328 PRO A CB   7  
ATOM 5624  C CG   . PRO A 1 37 ? -4.865  -10.077 -0.877  1.00 0.00 ? 328 PRO A CG   7  
ATOM 5625  C CD   . PRO A 1 37 ? -3.410  -9.707  -0.812  1.00 0.00 ? 328 PRO A CD   7  
ATOM 5626  H HA   . PRO A 1 37 ? -3.317  -12.368 0.757   1.00 0.00 ? 328 PRO A HA   7  
ATOM 5627  H HB2  . PRO A 1 37 ? -5.766  -11.987 -0.550  1.00 0.00 ? 328 PRO A HB2  7  
ATOM 5628  H HG2  . PRO A 1 37 ? -5.166  -10.228 -1.903  1.00 0.00 ? 328 PRO A HG2  7  
ATOM 5629  H HD2  . PRO A 1 37 ? -3.126  -9.157  -1.696  1.00 0.00 ? 328 PRO A HD2  7  
ATOM 5630  N N    . ARG A 1 38 ? -3.657  -12.974 -2.449  1.00 0.00 ? 329 ARG A N    7  
ATOM 5631  C CA   . ARG A 1 38 ? -3.694  -14.030 -3.444  1.00 0.00 ? 329 ARG A CA   7  
ATOM 5632  C C    . ARG A 1 38 ? -2.459  -14.915 -3.312  1.00 0.00 ? 329 ARG A C    7  
ATOM 5633  O O    . ARG A 1 38 ? -2.471  -16.083 -3.701  1.00 0.00 ? 329 ARG A O    7  
ATOM 5634  C CB   . ARG A 1 38 ? -3.767  -13.436 -4.851  1.00 0.00 ? 329 ARG A CB   7  
ATOM 5635  C CG   . ARG A 1 38 ? -4.948  -12.501 -5.058  1.00 0.00 ? 329 ARG A CG   7  
ATOM 5636  C CD   . ARG A 1 38 ? -5.070  -12.075 -6.511  1.00 0.00 ? 329 ARG A CD   7  
ATOM 5637  N NE   . ARG A 1 38 ? -4.803  -13.181 -7.426  1.00 0.00 ? 329 ARG A NE   7  
ATOM 5638  C CZ   . ARG A 1 38 ? -5.706  -14.102 -7.753  1.00 0.00 ? 329 ARG A CZ   7  
ATOM 5639  N NH1  . ARG A 1 38 ? -6.928  -14.045 -7.242  1.00 0.00 ? 329 ARG A NH1  7  
ATOM 5640  N NH2  . ARG A 1 38 ? -5.387  -15.080 -8.590  1.00 0.00 ? 329 ARG A NH2  7  
ATOM 5641  H H    . ARG A 1 38 ? -3.590  -12.042 -2.743  1.00 0.00 ? 329 ARG A H    7  
ATOM 5642  H HA   . ARG A 1 38 ? -4.573  -14.622 -3.262  1.00 0.00 ? 329 ARG A HA   7  
ATOM 5643  H HB2  . ARG A 1 38 ? -2.859  -12.883 -5.043  1.00 0.00 ? 329 ARG A HB2  7  
ATOM 5644  H HG2  . ARG A 1 38 ? -5.853  -13.011 -4.766  1.00 0.00 ? 329 ARG A HG2  7  
ATOM 5645  H HD2  . ARG A 1 38 ? -6.070  -11.709 -6.684  1.00 0.00 ? 329 ARG A HD2  7  
ATOM 5646  H HE   . ARG A 1 38 ? -3.905  -13.243 -7.814  1.00 0.00 ? 329 ARG A HE   7  
ATOM 5647  H HH11 . ARG A 1 38 ? -7.172  -13.310 -6.611  1.00 0.00 ? 329 ARG A HH11 7  
ATOM 5648  H HH12 . ARG A 1 38 ? -7.606  -14.738 -7.488  1.00 0.00 ? 329 ARG A HH12 7  
ATOM 5649  H HH21 . ARG A 1 38 ? -4.466  -15.126 -8.977  1.00 0.00 ? 329 ARG A HH21 7  
ATOM 5650  H HH22 . ARG A 1 38 ? -6.066  -15.773 -8.833  1.00 0.00 ? 329 ARG A HH22 7  
ATOM 5651  N N    . LEU A 1 39 ? -1.391  -14.344 -2.758  1.00 0.00 ? 330 LEU A N    7  
ATOM 5652  C CA   . LEU A 1 39 ? -0.141  -15.065 -2.568  1.00 0.00 ? 330 LEU A CA   7  
ATOM 5653  C C    . LEU A 1 39 ? 0.271   -15.051 -1.099  1.00 0.00 ? 330 LEU A C    7  
ATOM 5654  O O    . LEU A 1 39 ? 1.453   -14.934 -0.776  1.00 0.00 ? 330 LEU A O    7  
ATOM 5655  C CB   . LEU A 1 39 ? 0.957   -14.438 -3.427  1.00 0.00 ? 330 LEU A CB   7  
ATOM 5656  C CG   . LEU A 1 39 ? 0.485   -13.893 -4.776  1.00 0.00 ? 330 LEU A CG   7  
ATOM 5657  C CD1  . LEU A 1 39 ? 1.439   -12.823 -5.285  1.00 0.00 ? 330 LEU A CD1  7  
ATOM 5658  C CD2  . LEU A 1 39 ? 0.359   -15.020 -5.789  1.00 0.00 ? 330 LEU A CD2  7  
ATOM 5659  H H    . LEU A 1 39 ? -1.444  -13.408 -2.474  1.00 0.00 ? 330 LEU A H    7  
ATOM 5660  H HA   . LEU A 1 39 ? -0.294  -16.085 -2.880  1.00 0.00 ? 330 LEU A HA   7  
ATOM 5661  H HB2  . LEU A 1 39 ? 1.403   -13.626 -2.869  1.00 0.00 ? 330 LEU A HB2  7  
ATOM 5662  H HG   . LEU A 1 39 ? -0.491  -13.442 -4.654  1.00 0.00 ? 330 LEU A HG   7  
ATOM 5663  H HD11 . LEU A 1 39 ? 2.090   -12.510 -4.483  1.00 0.00 ? 330 LEU A HD11 7  
ATOM 5664  H HD12 . LEU A 1 39 ? 2.032   -13.226 -6.093  1.00 0.00 ? 330 LEU A HD12 7  
ATOM 5665  H HD13 . LEU A 1 39 ? 0.872   -11.976 -5.643  1.00 0.00 ? 330 LEU A HD13 7  
ATOM 5666  H HD21 . LEU A 1 39 ? 1.298   -15.147 -6.305  1.00 0.00 ? 330 LEU A HD21 7  
ATOM 5667  H HD22 . LEU A 1 39 ? 0.102   -15.937 -5.277  1.00 0.00 ? 330 LEU A HD22 7  
ATOM 5668  H HD23 . LEU A 1 39 ? -0.414  -14.778 -6.503  1.00 0.00 ? 330 LEU A HD23 7  
ATOM 5669  N N    . SER A 1 40 ? -0.714  -15.174 -0.216  1.00 0.00 ? 331 SER A N    7  
ATOM 5670  C CA   . SER A 1 40 ? -0.461  -15.174 1.220   1.00 0.00 ? 331 SER A CA   7  
ATOM 5671  C C    . SER A 1 40 ? 0.491   -16.302 1.606   1.00 0.00 ? 331 SER A C    7  
ATOM 5672  O O    . SER A 1 40 ? 0.318   -17.446 1.185   1.00 0.00 ? 331 SER A O    7  
ATOM 5673  C CB   . SER A 1 40 ? -1.774  -15.313 1.991   1.00 0.00 ? 331 SER A CB   7  
ATOM 5674  O OG   . SER A 1 40 ? -1.565  -15.174 3.386   1.00 0.00 ? 331 SER A OG   7  
ATOM 5675  H H    . SER A 1 40 ? -1.635  -15.269 -0.538  1.00 0.00 ? 331 SER A H    7  
ATOM 5676  H HA   . SER A 1 40 ? -0.003  -14.230 1.475   1.00 0.00 ? 331 SER A HA   7  
ATOM 5677  H HB2  . SER A 1 40 ? -2.463  -14.547 1.666   1.00 0.00 ? 331 SER A HB2  7  
ATOM 5678  H HG   . SER A 1 40 ? -1.907  -14.327 3.679   1.00 0.00 ? 331 SER A HG   7  
ATOM 5679  N N    . ALA A 1 41 ? 1.497   -15.970 2.410   1.00 0.00 ? 332 ALA A N    7  
ATOM 5680  C CA   . ALA A 1 41 ? 2.477   -16.954 2.854   1.00 0.00 ? 332 ALA A CA   7  
ATOM 5681  C C    . ALA A 1 41 ? 2.332   -17.236 4.345   1.00 0.00 ? 332 ALA A C    7  
ATOM 5682  O O    . ALA A 1 41 ? 1.428   -16.718 5.001   1.00 0.00 ? 332 ALA A O    7  
ATOM 5683  C CB   . ALA A 1 41 ? 3.888   -16.473 2.540   1.00 0.00 ? 332 ALA A CB   7  
ATOM 5684  H H    . ALA A 1 41 ? 1.583   -15.042 2.710   1.00 0.00 ? 332 ALA A H    7  
ATOM 5685  H HA   . ALA A 1 41 ? 2.300   -17.870 2.307   1.00 0.00 ? 332 ALA A HA   7  
ATOM 5686  H HB1  . ALA A 1 41 ? 3.973   -16.269 1.482   1.00 0.00 ? 332 ALA A HB1  7  
ATOM 5687  H HB2  . ALA A 1 41 ? 4.091   -15.569 3.096   1.00 0.00 ? 332 ALA A HB2  7  
ATOM 5688  H HB3  . ALA A 1 41 ? 4.601   -17.235 2.819   1.00 0.00 ? 332 ALA A HB3  7  
ATOM 5689  N N    . ASN A 1 42 ? 3.231   -18.058 4.876   1.00 0.00 ? 333 ASN A N    7  
ATOM 5690  C CA   . ASN A 1 42 ? 3.205   -18.410 6.291   1.00 0.00 ? 333 ASN A CA   7  
ATOM 5691  C C    . ASN A 1 42 ? 4.406   -17.816 7.020   1.00 0.00 ? 333 ASN A C    7  
ATOM 5692  O O    . ASN A 1 42 ? 4.975   -18.512 7.888   1.00 0.00 ? 333 ASN A O    7  
ATOM 5693  C CB   . ASN A 1 42 ? 3.191   -19.931 6.458   1.00 0.00 ? 333 ASN A CB   7  
ATOM 5694  C CG   . ASN A 1 42 ? 2.282   -20.380 7.585   1.00 0.00 ? 333 ASN A CG   7  
ATOM 5695  O OD1  . ASN A 1 42 ? 1.910   -19.589 8.452   1.00 0.00 ? 333 ASN A OD1  7  
ATOM 5696  N ND2  . ASN A 1 42 ? 1.918   -21.658 7.577   1.00 0.00 ? 333 ASN A ND2  7  
ATOM 5697  O OXT  . ASN A 1 42 ? 4.769   -16.660 6.716   1.00 0.00 ? 333 ASN A OXT  7  
ATOM 5698  H H    . ASN A 1 42 ? 3.929   -18.437 4.303   1.00 0.00 ? 333 ASN A H    7  
ATOM 5699  H HA   . ASN A 1 42 ? 2.302   -18.002 6.718   1.00 0.00 ? 333 ASN A HA   7  
ATOM 5700  H HB2  . ASN A 1 42 ? 2.847   -20.385 5.541   1.00 0.00 ? 333 ASN A HB2  7  
ATOM 5701  H HD21 . ASN A 1 42 ? 2.252   -22.230 6.857   1.00 0.00 ? 333 ASN A HD21 7  
ATOM 5702  H HD22 . ASN A 1 42 ? 1.329   -21.976 8.294   1.00 0.00 ? 333 ASN A HD22 7  
ATOM 5703  N N    . GLY B 2 1  ? 14.109  -14.700 15.343  1.00 0.00 ? 198 GLY B N    7  
ATOM 5704  C CA   . GLY B 2 1  ? 15.111  -14.014 14.482  1.00 0.00 ? 198 GLY B CA   7  
ATOM 5705  C C    . GLY B 2 1  ? 14.894  -14.289 13.006  1.00 0.00 ? 198 GLY B C    7  
ATOM 5706  O O    . GLY B 2 1  ? 15.809  -14.743 12.318  1.00 0.00 ? 198 GLY B O    7  
ATOM 5707  H H1   . GLY B 2 1  ? 13.345  -14.043 15.597  1.00 0.00 ? 198 GLY B H1   7  
ATOM 5708  H H2   . GLY B 2 1  ? 14.561  -15.043 16.215  1.00 0.00 ? 198 GLY B H2   7  
ATOM 5709  H H3   . GLY B 2 1  ? 13.699  -15.513 14.838  1.00 0.00 ? 198 GLY B H3   7  
ATOM 5710  H HA2  . GLY B 2 1  ? 15.046  -12.950 14.653  1.00 0.00 ? 198 GLY B HA2  7  
ATOM 5711  H HA3  . GLY B 2 1  ? 16.098  -14.353 14.759  1.00 0.00 ? 198 GLY B HA3  7  
ATOM 5712  N N    . PRO B 2 2  ? 13.684  -14.019 12.488  1.00 0.00 ? 199 PRO B N    7  
ATOM 5713  C CA   . PRO B 2 2  ? 13.361  -14.244 11.074  1.00 0.00 ? 199 PRO B CA   7  
ATOM 5714  C C    . PRO B 2 2  ? 14.137  -13.311 10.150  1.00 0.00 ? 199 PRO B C    7  
ATOM 5715  O O    . PRO B 2 2  ? 14.411  -13.648 8.998   1.00 0.00 ? 199 PRO B O    7  
ATOM 5716  C CB   . PRO B 2 2  ? 11.860  -13.948 10.996  1.00 0.00 ? 199 PRO B CB   7  
ATOM 5717  C CG   . PRO B 2 2  ? 11.587  -13.049 12.151  1.00 0.00 ? 199 PRO B CG   7  
ATOM 5718  C CD   . PRO B 2 2  ? 12.537  -13.473 13.236  1.00 0.00 ? 199 PRO B CD   7  
ATOM 5719  H HA   . PRO B 2 2  ? 13.546  -15.268 10.786  1.00 0.00 ? 199 PRO B HA   7  
ATOM 5720  H HB2  . PRO B 2 2  ? 11.636  -13.464 10.056  1.00 0.00 ? 199 PRO B HB2  7  
ATOM 5721  H HG2  . PRO B 2 2  ? 11.770  -12.023 11.871  1.00 0.00 ? 199 PRO B HG2  7  
ATOM 5722  H HD2  . PRO B 2 2  ? 12.834  -12.622 13.832  1.00 0.00 ? 199 PRO B HD2  7  
ATOM 5723  N N    . LEU B 2 3  ? 14.489  -12.137 10.664  1.00 0.00 ? 200 LEU B N    7  
ATOM 5724  C CA   . LEU B 2 3  ? 15.233  -11.153 9.887   1.00 0.00 ? 200 LEU B CA   7  
ATOM 5725  C C    . LEU B 2 3  ? 14.390  -10.614 8.736   1.00 0.00 ? 200 LEU B C    7  
ATOM 5726  O O    . LEU B 2 3  ? 14.259  -11.257 7.695   1.00 0.00 ? 200 LEU B O    7  
ATOM 5727  C CB   . LEU B 2 3  ? 16.526  -11.766 9.344   1.00 0.00 ? 200 LEU B CB   7  
ATOM 5728  C CG   . LEU B 2 3  ? 17.485  -10.774 8.684   1.00 0.00 ? 200 LEU B CG   7  
ATOM 5729  C CD1  . LEU B 2 3  ? 17.970  -9.747  9.696   1.00 0.00 ? 200 LEU B CD1  7  
ATOM 5730  C CD2  . LEU B 2 3  ? 18.663  -11.506 8.059   1.00 0.00 ? 200 LEU B CD2  7  
ATOM 5731  H H    . LEU B 2 3  ? 14.241  -11.928 11.589  1.00 0.00 ? 200 LEU B H    7  
ATOM 5732  H HA   . LEU B 2 3  ? 15.484  -10.335 10.546  1.00 0.00 ? 200 LEU B HA   7  
ATOM 5733  H HB2  . LEU B 2 3  ? 17.043  -12.245 10.162  1.00 0.00 ? 200 LEU B HB2  7  
ATOM 5734  H HG   . LEU B 2 3  ? 16.963  -10.246 7.899   1.00 0.00 ? 200 LEU B HG   7  
ATOM 5735  H HD11 . LEU B 2 3  ? 19.045  -9.807  9.783   1.00 0.00 ? 200 LEU B HD11 7  
ATOM 5736  H HD12 . LEU B 2 3  ? 17.690  -8.757  9.368   1.00 0.00 ? 200 LEU B HD12 7  
ATOM 5737  H HD13 . LEU B 2 3  ? 17.520  -9.949  10.657  1.00 0.00 ? 200 LEU B HD13 7  
ATOM 5738  H HD21 . LEU B 2 3  ? 18.303  -12.362 7.506   1.00 0.00 ? 200 LEU B HD21 7  
ATOM 5739  H HD22 . LEU B 2 3  ? 19.187  -10.840 7.390   1.00 0.00 ? 200 LEU B HD22 7  
ATOM 5740  H HD23 . LEU B 2 3  ? 19.335  -11.837 8.838   1.00 0.00 ? 200 LEU B HD23 7  
ATOM 5741  N N    . GLY B 2 4  ? 13.820  -9.430  8.932   1.00 0.00 ? 201 GLY B N    7  
ATOM 5742  C CA   . GLY B 2 4  ? 12.997  -8.824  7.902   1.00 0.00 ? 201 GLY B CA   7  
ATOM 5743  C C    . GLY B 2 4  ? 13.490  -7.448  7.499   1.00 0.00 ? 201 GLY B C    7  
ATOM 5744  O O    . GLY B 2 4  ? 13.686  -6.579  8.349   1.00 0.00 ? 201 GLY B O    7  
ATOM 5745  H H    . GLY B 2 4  ? 13.959  -8.964  9.783   1.00 0.00 ? 201 GLY B H    7  
ATOM 5746  H HA2  . GLY B 2 4  ? 13.000  -9.464  7.032   1.00 0.00 ? 201 GLY B HA2  7  
ATOM 5747  H HA3  . GLY B 2 4  ? 11.985  -8.739  8.270   1.00 0.00 ? 201 GLY B HA3  7  
ATOM 5748  N N    . SER B 2 5  ? 13.691  -7.250  6.201   1.00 0.00 ? 202 SER B N    7  
ATOM 5749  C CA   . SER B 2 5  ? 14.162  -5.969  5.686   1.00 0.00 ? 202 SER B CA   7  
ATOM 5750  C C    . SER B 2 5  ? 13.135  -4.871  5.944   1.00 0.00 ? 202 SER B C    7  
ATOM 5751  O O    . SER B 2 5  ? 13.387  -3.938  6.707   1.00 0.00 ? 202 SER B O    7  
ATOM 5752  C CB   . SER B 2 5  ? 14.452  -6.072  4.187   1.00 0.00 ? 202 SER B CB   7  
ATOM 5753  O OG   . SER B 2 5  ? 14.607  -4.789  3.607   1.00 0.00 ? 202 SER B OG   7  
ATOM 5754  H H    . SER B 2 5  ? 13.518  -7.983  5.572   1.00 0.00 ? 202 SER B H    7  
ATOM 5755  H HA   . SER B 2 5  ? 15.076  -5.720  6.204   1.00 0.00 ? 202 SER B HA   7  
ATOM 5756  H HB2  . SER B 2 5  ? 15.362  -6.634  4.036   1.00 0.00 ? 202 SER B HB2  7  
ATOM 5757  H HG   . SER B 2 5  ? 14.570  -4.862  2.650   1.00 0.00 ? 202 SER B HG   7  
ATOM 5758  N N    . GLU B 2 6  ? 11.977  -4.991  5.304   1.00 0.00 ? 203 GLU B N    7  
ATOM 5759  C CA   . GLU B 2 6  ? 10.908  -4.012  5.463   1.00 0.00 ? 203 GLU B CA   7  
ATOM 5760  C C    . GLU B 2 6  ? 9.705   -4.380  4.602   1.00 0.00 ? 203 GLU B C    7  
ATOM 5761  O O    . GLU B 2 6  ? 9.437   -3.737  3.586   1.00 0.00 ? 203 GLU B O    7  
ATOM 5762  C CB   . GLU B 2 6  ? 11.406  -2.614  5.093   1.00 0.00 ? 203 GLU B CB   7  
ATOM 5763  C CG   . GLU B 2 6  ? 12.010  -2.533  3.702   1.00 0.00 ? 203 GLU B CG   7  
ATOM 5764  C CD   . GLU B 2 6  ? 13.057  -1.442  3.584   1.00 0.00 ? 203 GLU B CD   7  
ATOM 5765  O OE1  . GLU B 2 6  ? 13.080  -0.545  4.453   1.00 0.00 ? 203 GLU B OE1  7  
ATOM 5766  O OE2  . GLU B 2 6  ? 13.855  -1.485  2.623   1.00 0.00 ? 203 GLU B OE2  7  
ATOM 5767  H H    . GLU B 2 6  ? 11.838  -5.756  4.707   1.00 0.00 ? 203 GLU B H    7  
ATOM 5768  H HA   . GLU B 2 6  ? 10.608  -4.015  6.500   1.00 0.00 ? 203 GLU B HA   7  
ATOM 5769  H HB2  . GLU B 2 6  ? 10.578  -1.925  5.143   1.00 0.00 ? 203 GLU B HB2  7  
ATOM 5770  H HG2  . GLU B 2 6  ? 12.473  -3.481  3.467   1.00 0.00 ? 203 GLU B HG2  7  
ATOM 5771  N N    . LEU B 2 7  ? 8.983   -5.416  5.013   1.00 0.00 ? 204 LEU B N    7  
ATOM 5772  C CA   . LEU B 2 7  ? 7.811   -5.871  4.274   1.00 0.00 ? 204 LEU B CA   7  
ATOM 5773  C C    . LEU B 2 7  ? 6.540   -5.700  5.100   1.00 0.00 ? 204 LEU B C    7  
ATOM 5774  O O    . LEU B 2 7  ? 5.554   -5.136  4.629   1.00 0.00 ? 204 LEU B O    7  
ATOM 5775  C CB   . LEU B 2 7  ? 7.978   -7.336  3.868   1.00 0.00 ? 204 LEU B CB   7  
ATOM 5776  C CG   . LEU B 2 7  ? 7.858   -7.607  2.368   1.00 0.00 ? 204 LEU B CG   7  
ATOM 5777  C CD1  . LEU B 2 7  ? 8.723   -6.633  1.582   1.00 0.00 ? 204 LEU B CD1  7  
ATOM 5778  C CD2  . LEU B 2 7  ? 8.249   -9.042  2.054   1.00 0.00 ? 204 LEU B CD2  7  
ATOM 5779  H H    . LEU B 2 7  ? 9.244   -5.887  5.833   1.00 0.00 ? 204 LEU B H    7  
ATOM 5780  H HA   . LEU B 2 7  ? 7.729   -5.268  3.382   1.00 0.00 ? 204 LEU B HA   7  
ATOM 5781  H HB2  . LEU B 2 7  ? 8.952   -7.670  4.197   1.00 0.00 ? 204 LEU B HB2  7  
ATOM 5782  H HG   . LEU B 2 7  ? 6.832   -7.463  2.064   1.00 0.00 ? 204 LEU B HG   7  
ATOM 5783  H HD11 . LEU B 2 7  ? 9.211   -5.954  2.265   1.00 0.00 ? 204 LEU B HD11 7  
ATOM 5784  H HD12 . LEU B 2 7  ? 9.468   -7.182  1.026   1.00 0.00 ? 204 LEU B HD12 7  
ATOM 5785  H HD13 . LEU B 2 7  ? 8.103   -6.073  0.898   1.00 0.00 ? 204 LEU B HD13 7  
ATOM 5786  H HD21 . LEU B 2 7  ? 9.117   -9.047  1.412   1.00 0.00 ? 204 LEU B HD21 7  
ATOM 5787  H HD22 . LEU B 2 7  ? 8.477   -9.563  2.972   1.00 0.00 ? 204 LEU B HD22 7  
ATOM 5788  H HD23 . LEU B 2 7  ? 7.428   -9.536  1.553   1.00 0.00 ? 204 LEU B HD23 7  
ATOM 5789  N N    . GLU B 2 8  ? 6.572   -6.192  6.335   1.00 0.00 ? 205 GLU B N    7  
ATOM 5790  C CA   . GLU B 2 8  ? 5.420   -6.095  7.223   1.00 0.00 ? 205 GLU B CA   7  
ATOM 5791  C C    . GLU B 2 8  ? 5.575   -4.926  8.193   1.00 0.00 ? 205 GLU B C    7  
ATOM 5792  O O    . GLU B 2 8  ? 5.781   -5.122  9.390   1.00 0.00 ? 205 GLU B O    7  
ATOM 5793  C CB   . GLU B 2 8  ? 5.239   -7.400  8.000   1.00 0.00 ? 205 GLU B CB   7  
ATOM 5794  C CG   . GLU B 2 8  ? 4.285   -8.377  7.332   1.00 0.00 ? 205 GLU B CG   7  
ATOM 5795  C CD   . GLU B 2 8  ? 3.049   -8.649  8.166   1.00 0.00 ? 205 GLU B CD   7  
ATOM 5796  O OE1  . GLU B 2 8  ? 2.085   -7.861  8.072   1.00 0.00 ? 205 GLU B OE1  7  
ATOM 5797  O OE2  . GLU B 2 8  ? 3.044   -9.649  8.914   1.00 0.00 ? 205 GLU B OE2  7  
ATOM 5798  H H    . GLU B 2 8  ? 7.387   -6.629  6.655   1.00 0.00 ? 205 GLU B H    7  
ATOM 5799  H HA   . GLU B 2 8  ? 4.546   -5.925  6.613   1.00 0.00 ? 205 GLU B HA   7  
ATOM 5800  H HB2  . GLU B 2 8  ? 6.202   -7.882  8.100   1.00 0.00 ? 205 GLU B HB2  7  
ATOM 5801  H HG2  . GLU B 2 8  ? 3.976   -7.967  6.382   1.00 0.00 ? 205 GLU B HG2  7  
ATOM 5802  N N    . SER B 2 9  ? 5.474   -3.709  7.665   1.00 0.00 ? 206 SER B N    7  
ATOM 5803  C CA   . SER B 2 9  ? 5.602   -2.508  8.490   1.00 0.00 ? 206 SER B CA   7  
ATOM 5804  C C    . SER B 2 9  ? 5.479   -1.210  7.676   1.00 0.00 ? 206 SER B C    7  
ATOM 5805  O O    . SER B 2 9  ? 4.753   -0.298  8.072   1.00 0.00 ? 206 SER B O    7  
ATOM 5806  C CB   . SER B 2 9  ? 6.937   -2.527  9.242   1.00 0.00 ? 206 SER B CB   7  
ATOM 5807  O OG   . SER B 2 9  ? 7.379   -1.214  9.542   1.00 0.00 ? 206 SER B OG   7  
ATOM 5808  H H    . SER B 2 9  ? 5.309   -3.623  6.709   1.00 0.00 ? 206 SER B H    7  
ATOM 5809  H HA   . SER B 2 9  ? 4.803   -2.529  9.216   1.00 0.00 ? 206 SER B HA   7  
ATOM 5810  H HB2  . SER B 2 9  ? 6.818   -3.071  10.167  1.00 0.00 ? 206 SER B HB2  7  
ATOM 5811  H HG   . SER B 2 9  ? 8.318   -1.230  9.744   1.00 0.00 ? 206 SER B HG   7  
ATOM 5812  N N    . PRO B 2 10 ? 6.182   -1.106  6.531   1.00 0.00 ? 207 PRO B N    7  
ATOM 5813  C CA   . PRO B 2 10 ? 6.167   0.100   5.692   1.00 0.00 ? 207 PRO B CA   7  
ATOM 5814  C C    . PRO B 2 10 ? 4.824   0.420   5.014   1.00 0.00 ? 207 PRO B C    7  
ATOM 5815  O O    . PRO B 2 10 ? 4.499   1.596   4.853   1.00 0.00 ? 207 PRO B O    7  
ATOM 5816  C CB   . PRO B 2 10 ? 7.251   -0.172  4.641   1.00 0.00 ? 207 PRO B CB   7  
ATOM 5817  C CG   . PRO B 2 10 ? 8.028   -1.331  5.165   1.00 0.00 ? 207 PRO B CG   7  
ATOM 5818  C CD   . PRO B 2 10 ? 7.051   -2.141  5.957   1.00 0.00 ? 207 PRO B CD   7  
ATOM 5819  H HA   . PRO B 2 10 ? 6.458   0.958   6.262   1.00 0.00 ? 207 PRO B HA   7  
ATOM 5820  H HB2  . PRO B 2 10 ? 6.789   -0.403  3.701   1.00 0.00 ? 207 PRO B HB2  7  
ATOM 5821  H HG2  . PRO B 2 10 ? 8.421   -1.913  4.344   1.00 0.00 ? 207 PRO B HG2  7  
ATOM 5822  H HD2  . PRO B 2 10 ? 6.494   -2.797  5.304   1.00 0.00 ? 207 PRO B HD2  7  
ATOM 5823  N N    . PRO B 2 11 ? 4.023   -0.588  4.597   1.00 0.00 ? 208 PRO B N    7  
ATOM 5824  C CA   . PRO B 2 11 ? 2.748   -0.341  3.934   1.00 0.00 ? 208 PRO B CA   7  
ATOM 5825  C C    . PRO B 2 11 ? 1.979   0.835   4.528   1.00 0.00 ? 208 PRO B C    7  
ATOM 5826  O O    . PRO B 2 11 ? 1.653   0.823   5.715   1.00 0.00 ? 208 PRO B O    7  
ATOM 5827  C CB   . PRO B 2 11 ? 1.966   -1.630  4.156   1.00 0.00 ? 208 PRO B CB   7  
ATOM 5828  C CG   . PRO B 2 11 ? 2.996   -2.694  4.318   1.00 0.00 ? 208 PRO B CG   7  
ATOM 5829  C CD   . PRO B 2 11 ? 4.289   -2.026  4.719   1.00 0.00 ? 208 PRO B CD   7  
ATOM 5830  H HA   . PRO B 2 11 ? 2.888   -0.194  2.883   1.00 0.00 ? 208 PRO B HA   7  
ATOM 5831  H HB2  . PRO B 2 11 ? 1.351   -1.533  5.038   1.00 0.00 ? 208 PRO B HB2  7  
ATOM 5832  H HG2  . PRO B 2 11 ? 2.685   -3.385  5.086   1.00 0.00 ? 208 PRO B HG2  7  
ATOM 5833  H HD2  . PRO B 2 11 ? 4.527   -2.281  5.726   1.00 0.00 ? 208 PRO B HD2  7  
ATOM 5834  N N    . PRO B 2 12 ? 1.729   1.887   3.722   1.00 0.00 ? 209 PRO B N    7  
ATOM 5835  C CA   . PRO B 2 12 ? 0.964   3.064   4.145   1.00 0.00 ? 209 PRO B CA   7  
ATOM 5836  C C    . PRO B 2 12 ? -0.318  2.688   4.893   1.00 0.00 ? 209 PRO B C    7  
ATOM 5837  O O    . PRO B 2 12 ? -0.537  1.524   5.213   1.00 0.00 ? 209 PRO B O    7  
ATOM 5838  C CB   . PRO B 2 12 ? 0.630   3.761   2.813   1.00 0.00 ? 209 PRO B CB   7  
ATOM 5839  C CG   . PRO B 2 12 ? 1.123   2.858   1.742   1.00 0.00 ? 209 PRO B CG   7  
ATOM 5840  C CD   . PRO B 2 12 ? 2.214   2.058   2.351   1.00 0.00 ? 209 PRO B CD   7  
ATOM 5841  H HA   . PRO B 2 12 ? 1.558   3.723   4.761   1.00 0.00 ? 209 PRO B HA   7  
ATOM 5842  H HB2  . PRO B 2 12 ? -0.430  3.885   2.733   1.00 0.00 ? 209 PRO B HB2  7  
ATOM 5843  H HG2  . PRO B 2 12 ? 0.327   2.209   1.430   1.00 0.00 ? 209 PRO B HG2  7  
ATOM 5844  H HD2  . PRO B 2 12 ? 2.311   1.120   1.834   1.00 0.00 ? 209 PRO B HD2  7  
ATOM 5845  N N    . PRO B 2 13 ? -1.210  3.657   5.155   1.00 0.00 ? 210 PRO B N    7  
ATOM 5846  C CA   . PRO B 2 13 ? -2.441  3.398   5.877   1.00 0.00 ? 210 PRO B CA   7  
ATOM 5847  C C    . PRO B 2 13 ? -3.572  2.961   4.960   1.00 0.00 ? 210 PRO B C    7  
ATOM 5848  O O    . PRO B 2 13 ? -3.446  3.007   3.737   1.00 0.00 ? 210 PRO B O    7  
ATOM 5849  C CB   . PRO B 2 13 ? -2.751  4.747   6.513   1.00 0.00 ? 210 PRO B CB   7  
ATOM 5850  C CG   . PRO B 2 13 ? -2.144  5.769   5.601   1.00 0.00 ? 210 PRO B CG   7  
ATOM 5851  C CD   . PRO B 2 13 ? -1.121  5.063   4.738   1.00 0.00 ? 210 PRO B CD   7  
ATOM 5852  H HA   . PRO B 2 13 ? -2.299  2.658   6.649   1.00 0.00 ? 210 PRO B HA   7  
ATOM 5853  H HB2  . PRO B 2 13 ? -3.821  4.870   6.585   1.00 0.00 ? 210 PRO B HB2  7  
ATOM 5854  H HG2  . PRO B 2 13 ? -2.913  6.199   4.979   1.00 0.00 ? 210 PRO B HG2  7  
ATOM 5855  H HD2  . PRO B 2 13 ? -1.385  5.166   3.695   1.00 0.00 ? 210 PRO B HD2  7  
ATOM 5856  N N    . TYR B 2 14 ? -4.676  2.537   5.558   1.00 0.00 ? 211 TYR B N    7  
ATOM 5857  C CA   . TYR B 2 14 ? -5.827  2.092   4.792   1.00 0.00 ? 211 TYR B CA   7  
ATOM 5858  C C    . TYR B 2 14 ? -6.405  3.252   3.987   1.00 0.00 ? 211 TYR B C    7  
ATOM 5859  O O    . TYR B 2 14 ? -6.127  3.393   2.797   1.00 0.00 ? 211 TYR B O    7  
ATOM 5860  C CB   . TYR B 2 14 ? -6.898  1.506   5.725   1.00 0.00 ? 211 TYR B CB   7  
ATOM 5861  C CG   . TYR B 2 14 ? -8.241  1.296   5.058   1.00 0.00 ? 211 TYR B CG   7  
ATOM 5862  C CD1  . TYR B 2 14 ? -8.325  0.688   3.816   1.00 0.00 ? 211 TYR B CD1  7  
ATOM 5863  C CD2  . TYR B 2 14 ? -9.417  1.721   5.663   1.00 0.00 ? 211 TYR B CD2  7  
ATOM 5864  C CE1  . TYR B 2 14 ? -9.544  0.503   3.191   1.00 0.00 ? 211 TYR B CE1  7  
ATOM 5865  C CE2  . TYR B 2 14 ? -10.641 1.542   5.046   1.00 0.00 ? 211 TYR B CE2  7  
ATOM 5866  C CZ   . TYR B 2 14 ? -10.699 0.933   3.810   1.00 0.00 ? 211 TYR B CZ   7  
ATOM 5867  O OH   . TYR B 2 14 ? -11.915 0.753   3.191   1.00 0.00 ? 211 TYR B OH   7  
ATOM 5868  H H    . TYR B 2 14 ? -4.720  2.530   6.536   1.00 0.00 ? 211 TYR B H    7  
ATOM 5869  H HA   . TYR B 2 14 ? -5.489  1.325   4.108   1.00 0.00 ? 211 TYR B HA   7  
ATOM 5870  H HB2  . TYR B 2 14 ? -6.560  0.548   6.092   1.00 0.00 ? 211 TYR B HB2  7  
ATOM 5871  H HD1  . TYR B 2 14 ? -7.419  0.350   3.339   1.00 0.00 ? 211 TYR B HD1  7  
ATOM 5872  H HD2  . TYR B 2 14 ? -9.368  2.197   6.630   1.00 0.00 ? 211 TYR B HD2  7  
ATOM 5873  H HE1  . TYR B 2 14 ? -9.586  0.029   2.221   1.00 0.00 ? 211 TYR B HE1  7  
ATOM 5874  H HE2  . TYR B 2 14 ? -11.545 1.878   5.532   1.00 0.00 ? 211 TYR B HE2  7  
ATOM 5875  H HH   . TYR B 2 14 ? -11.848 1.015   2.270   1.00 0.00 ? 211 TYR B HH   7  
ATOM 5876  N N    . SER B 2 15 ? -7.206  4.079   4.652   1.00 0.00 ? 212 SER B N    7  
ATOM 5877  C CA   . SER B 2 15 ? -7.831  5.228   4.007   1.00 0.00 ? 212 SER B CA   7  
ATOM 5878  C C    . SER B 2 15 ? -8.630  4.793   2.781   1.00 0.00 ? 212 SER B C    7  
ATOM 5879  O O    . SER B 2 15 ? -9.838  4.569   2.868   1.00 0.00 ? 212 SER B O    7  
ATOM 5880  C CB   . SER B 2 15 ? -6.770  6.262   3.618   1.00 0.00 ? 212 SER B CB   7  
ATOM 5881  O OG   . SER B 2 15 ? -5.462  5.747   3.799   1.00 0.00 ? 212 SER B OG   7  
ATOM 5882  H H    . SER B 2 15 ? -7.383  3.911   5.601   1.00 0.00 ? 212 SER B H    7  
ATOM 5883  H HA   . SER B 2 15 ? -8.509  5.675   4.720   1.00 0.00 ? 212 SER B HA   7  
ATOM 5884  H HB2  . SER B 2 15 ? -6.896  6.532   2.582   1.00 0.00 ? 212 SER B HB2  7  
ATOM 5885  H HG   . SER B 2 15 ? -5.109  6.055   4.638   1.00 0.00 ? 212 SER B HG   7  
ATOM 5886  N N    . ARG B 2 16 ? -7.953  4.672   1.640   1.00 0.00 ? 213 ARG B N    7  
ATOM 5887  C CA   . ARG B 2 16 ? -8.601  4.257   0.393   1.00 0.00 ? 213 ARG B CA   7  
ATOM 5888  C C    . ARG B 2 16 ? -7.703  4.550   -0.805  1.00 0.00 ? 213 ARG B C    7  
ATOM 5889  O O    . ARG B 2 16 ? -7.545  3.714   -1.695  1.00 0.00 ? 213 ARG B O    7  
ATOM 5890  C CB   . ARG B 2 16 ? -9.948  4.965   0.214   1.00 0.00 ? 213 ARG B CB   7  
ATOM 5891  C CG   . ARG B 2 16 ? -11.140 4.099   0.583   1.00 0.00 ? 213 ARG B CG   7  
ATOM 5892  C CD   . ARG B 2 16 ? -11.786 3.482   -0.647  1.00 0.00 ? 213 ARG B CD   7  
ATOM 5893  N NE   . ARG B 2 16 ? -12.886 4.297   -1.150  1.00 0.00 ? 213 ARG B NE   7  
ATOM 5894  C CZ   . ARG B 2 16 ? -14.050 4.429   -0.522  1.00 0.00 ? 213 ARG B CZ   7  
ATOM 5895  N NH1  . ARG B 2 16 ? -14.266 3.789   0.620   1.00 0.00 ? 213 ARG B NH1  7  
ATOM 5896  N NH2  . ARG B 2 16 ? -15.000 5.198   -1.035  1.00 0.00 ? 213 ARG B NH2  7  
ATOM 5897  H H    . ARG B 2 16 ? -6.992  4.862   1.634   1.00 0.00 ? 213 ARG B H    7  
ATOM 5898  H HA   . ARG B 2 16 ? -8.769  3.192   0.448   1.00 0.00 ? 213 ARG B HA   7  
ATOM 5899  H HB2  . ARG B 2 16 ? -9.964  5.847   0.836   1.00 0.00 ? 213 ARG B HB2  7  
ATOM 5900  H HG2  . ARG B 2 16 ? -10.810 3.307   1.238   1.00 0.00 ? 213 ARG B HG2  7  
ATOM 5901  H HD2  . ARG B 2 16 ? -11.038 3.385   -1.421  1.00 0.00 ? 213 ARG B HD2  7  
ATOM 5902  H HE   . ARG B 2 16 ? -12.750 4.775   -1.995  1.00 0.00 ? 213 ARG B HE   7  
ATOM 5903  H HH11 . ARG B 2 16 ? -13.553 3.206   1.010   1.00 0.00 ? 213 ARG B HH11 7  
ATOM 5904  H HH12 . ARG B 2 16 ? -15.143 3.890   1.091   1.00 0.00 ? 213 ARG B HH12 7  
ATOM 5905  H HH21 . ARG B 2 16 ? -14.840 5.683   -1.895  1.00 0.00 ? 213 ARG B HH21 7  
ATOM 5906  H HH22 . ARG B 2 16 ? -15.875 5.296   -0.561  1.00 0.00 ? 213 ARG B HH22 7  
ATOM 5907  N N    . TYR B 2 17 ? -7.122  5.744   -0.818  1.00 0.00 ? 214 TYR B N    7  
ATOM 5908  C CA   . TYR B 2 17 ? -6.239  6.157   -1.903  1.00 0.00 ? 214 TYR B CA   7  
ATOM 5909  C C    . TYR B 2 17 ? -4.796  5.742   -1.620  1.00 0.00 ? 214 TYR B C    7  
ATOM 5910  O O    . TYR B 2 17 ? -4.493  5.226   -0.545  1.00 0.00 ? 214 TYR B O    7  
ATOM 5911  C CB   . TYR B 2 17 ? -6.328  7.673   -2.097  1.00 0.00 ? 214 TYR B CB   7  
ATOM 5912  C CG   . TYR B 2 17 ? -7.721  8.224   -1.915  1.00 0.00 ? 214 TYR B CG   7  
ATOM 5913  C CD1  . TYR B 2 17 ? -8.836  7.452   -2.209  1.00 0.00 ? 214 TYR B CD1  7  
ATOM 5914  C CD2  . TYR B 2 17 ? -7.919  9.517   -1.455  1.00 0.00 ? 214 TYR B CD2  7  
ATOM 5915  C CE1  . TYR B 2 17 ? -10.112 7.954   -2.049  1.00 0.00 ? 214 TYR B CE1  7  
ATOM 5916  C CE2  . TYR B 2 17 ? -9.191  10.027  -1.291  1.00 0.00 ? 214 TYR B CE2  7  
ATOM 5917  C CZ   . TYR B 2 17 ? -10.285 9.242   -1.589  1.00 0.00 ? 214 TYR B CZ   7  
ATOM 5918  O OH   . TYR B 2 17 ? -11.555 9.746   -1.429  1.00 0.00 ? 214 TYR B OH   7  
ATOM 5919  H H    . TYR B 2 17 ? -7.291  6.365   -0.079  1.00 0.00 ? 214 TYR B H    7  
ATOM 5920  H HA   . TYR B 2 17 ? -6.572  5.668   -2.806  1.00 0.00 ? 214 TYR B HA   7  
ATOM 5921  H HB2  . TYR B 2 17 ? -5.682  8.159   -1.383  1.00 0.00 ? 214 TYR B HB2  7  
ATOM 5922  H HD1  . TYR B 2 17 ? -8.697  6.443   -2.568  1.00 0.00 ? 214 TYR B HD1  7  
ATOM 5923  H HD2  . TYR B 2 17 ? -7.061  10.130  -1.221  1.00 0.00 ? 214 TYR B HD2  7  
ATOM 5924  H HE1  . TYR B 2 17 ? -10.965 7.337   -2.283  1.00 0.00 ? 214 TYR B HE1  7  
ATOM 5925  H HE2  . TYR B 2 17 ? -9.325  11.036  -0.933  1.00 0.00 ? 214 TYR B HE2  7  
ATOM 5926  H HH   . TYR B 2 17 ? -11.598 10.631  -1.799  1.00 0.00 ? 214 TYR B HH   7  
ATOM 5927  N N    . PRO B 2 18 ? -3.885  5.964   -2.585  1.00 0.00 ? 215 PRO B N    7  
ATOM 5928  C CA   . PRO B 2 18 ? -2.481  5.607   -2.441  1.00 0.00 ? 215 PRO B CA   7  
ATOM 5929  C C    . PRO B 2 18 ? -1.664  6.723   -1.799  1.00 0.00 ? 215 PRO B C    7  
ATOM 5930  O O    . PRO B 2 18 ? -1.194  7.632   -2.482  1.00 0.00 ? 215 PRO B O    7  
ATOM 5931  C CB   . PRO B 2 18 ? -2.043  5.376   -3.885  1.00 0.00 ? 215 PRO B CB   7  
ATOM 5932  C CG   . PRO B 2 18 ? -2.920  6.264   -4.712  1.00 0.00 ? 215 PRO B CG   7  
ATOM 5933  C CD   . PRO B 2 18 ? -4.152  6.582   -3.893  1.00 0.00 ? 215 PRO B CD   7  
ATOM 5934  H HA   . PRO B 2 18 ? -2.360  4.698   -1.872  1.00 0.00 ? 215 PRO B HA   7  
ATOM 5935  H HB2  . PRO B 2 18 ? -1.000  5.642   -3.997  1.00 0.00 ? 215 PRO B HB2  7  
ATOM 5936  H HG2  . PRO B 2 18 ? -2.392  7.174   -4.950  1.00 0.00 ? 215 PRO B HG2  7  
ATOM 5937  H HD2  . PRO B 2 18 ? -4.267  7.650   -3.794  1.00 0.00 ? 215 PRO B HD2  7  
ATOM 5938  N N    . MET B 2 19 ? -1.499  6.646   -0.483  1.00 0.00 ? 216 MET B N    7  
ATOM 5939  C CA   . MET B 2 19 ? -0.743  7.654   0.246   1.00 0.00 ? 216 MET B CA   7  
ATOM 5940  C C    . MET B 2 19 ? 0.295   7.013   1.161   1.00 0.00 ? 216 MET B C    7  
ATOM 5941  O O    . MET B 2 19 ? -0.041  6.447   2.201   1.00 0.00 ? 216 MET B O    7  
ATOM 5942  C CB   . MET B 2 19 ? -1.693  8.545   1.052   1.00 0.00 ? 216 MET B CB   7  
ATOM 5943  C CG   . MET B 2 19 ? -2.281  7.870   2.285   1.00 0.00 ? 216 MET B CG   7  
ATOM 5944  S SD   . MET B 2 19 ? -3.953  8.435   2.655   1.00 0.00 ? 216 MET B SD   7  
ATOM 5945  C CE   . MET B 2 19 ? -4.894  7.556   1.411   1.00 0.00 ? 216 MET B CE   7  
ATOM 5946  H H    . MET B 2 19 ? -1.891  5.893   0.007   1.00 0.00 ? 216 MET B H    7  
ATOM 5947  H HA   . MET B 2 19 ? -0.225  8.261   -0.479  1.00 0.00 ? 216 MET B HA   7  
ATOM 5948  H HB2  . MET B 2 19 ? -1.158  9.426   1.373   1.00 0.00 ? 216 MET B HB2  7  
ATOM 5949  H HG2  . MET B 2 19 ? -2.305  6.803   2.122   1.00 0.00 ? 216 MET B HG2  7  
ATOM 5950  H HE1  . MET B 2 19 ? -4.925  6.505   1.658   1.00 0.00 ? 216 MET B HE1  7  
ATOM 5951  H HE2  . MET B 2 19 ? -5.901  7.946   1.378   1.00 0.00 ? 216 MET B HE2  7  
ATOM 5952  H HE3  . MET B 2 19 ? -4.427  7.686   0.446   1.00 0.00 ? 216 MET B HE3  7  
ATOM 5953  N N    . ASP B 2 20 ? 1.560   7.110   0.763   1.00 0.00 ? 217 ASP B N    7  
ATOM 5954  C CA   . ASP B 2 20 ? 2.655   6.544   1.540   1.00 0.00 ? 217 ASP B CA   7  
ATOM 5955  C C    . ASP B 2 20 ? 2.584   6.999   2.994   1.00 0.00 ? 217 ASP B C    7  
ATOM 5956  O O    . ASP B 2 20 ? 2.850   6.169   3.889   1.00 0.00 ? 217 ASP B O    7  
ATOM 5957  C CB   . ASP B 2 20 ? 3.998   6.951   0.931   1.00 0.00 ? 217 ASP B CB   7  
ATOM 5958  C CG   . ASP B 2 20 ? 4.146   8.455   0.814   1.00 0.00 ? 217 ASP B CG   7  
ATOM 5959  O OD1  . ASP B 2 20 ? 3.145   9.168   1.040   1.00 0.00 ? 217 ASP B OD1  7  
ATOM 5960  O OD2  . ASP B 2 20 ? 5.262   8.920   0.497   1.00 0.00 ? 217 ASP B OD2  7  
ATOM 5961  O OXT  . ASP B 2 20 ? 2.263   8.185   3.227   1.00 0.00 ? 217 ASP B OXT  7  
ATOM 5962  H H    . ASP B 2 20 ? 1.761   7.575   -0.077  1.00 0.00 ? 217 ASP B H    7  
ATOM 5963  H HA   . ASP B 2 20 ? 2.566   5.469   1.505   1.00 0.00 ? 217 ASP B HA   7  
ATOM 5964  H HB2  . ASP B 2 20 ? 4.797   6.577   1.555   1.00 0.00 ? 217 ASP B HB2  7  
ATOM 5965  N N    . GLY A 1 1  ? 8.028   -11.661 -12.304 1.00 0.00 ? 292 GLY A N    8  
ATOM 5966  C CA   . GLY A 1 1  ? 7.644   -11.840 -10.876 1.00 0.00 ? 292 GLY A CA   8  
ATOM 5967  C C    . GLY A 1 1  ? 6.312   -12.555 -10.718 1.00 0.00 ? 292 GLY A C    8  
ATOM 5968  O O    . GLY A 1 1  ? 5.341   -12.208 -11.390 1.00 0.00 ? 292 GLY A O    8  
ATOM 5969  H H1   . GLY A 1 1  ? 8.049   -12.582 -12.787 1.00 0.00 ? 292 GLY A H1   8  
ATOM 5970  H H2   . GLY A 1 1  ? 8.971   -11.226 -12.369 1.00 0.00 ? 292 GLY A H2   8  
ATOM 5971  H H3   . GLY A 1 1  ? 7.342   -11.045 -12.784 1.00 0.00 ? 292 GLY A H3   8  
ATOM 5972  H HA2  . GLY A 1 1  ? 8.413   -12.411 -10.381 1.00 0.00 ? 292 GLY A HA2  8  
ATOM 5973  H HA3  . GLY A 1 1  ? 7.576   -10.868 -10.410 1.00 0.00 ? 292 GLY A HA3  8  
ATOM 5974  N N    . PRO A 1 2  ? 6.235   -13.565 -9.833  1.00 0.00 ? 293 PRO A N    8  
ATOM 5975  C CA   . PRO A 1 2  ? 4.999   -14.319 -9.602  1.00 0.00 ? 293 PRO A CA   8  
ATOM 5976  C C    . PRO A 1 2  ? 3.977   -13.528 -8.794  1.00 0.00 ? 293 PRO A C    8  
ATOM 5977  O O    . PRO A 1 2  ? 3.617   -13.913 -7.682  1.00 0.00 ? 293 PRO A O    8  
ATOM 5978  C CB   . PRO A 1 2  ? 5.476   -15.536 -8.812  1.00 0.00 ? 293 PRO A CB   8  
ATOM 5979  C CG   . PRO A 1 2  ? 6.684   -15.059 -8.085  1.00 0.00 ? 293 PRO A CG   8  
ATOM 5980  C CD   . PRO A 1 2  ? 7.344   -14.054 -8.990  1.00 0.00 ? 293 PRO A CD   8  
ATOM 5981  H HA   . PRO A 1 2  ? 4.552   -14.641 -10.532 1.00 0.00 ? 293 PRO A HA   8  
ATOM 5982  H HB2  . PRO A 1 2  ? 4.700   -15.853 -8.130  1.00 0.00 ? 293 PRO A HB2  8  
ATOM 5983  H HG2  . PRO A 1 2  ? 6.392   -14.591 -7.156  1.00 0.00 ? 293 PRO A HG2  8  
ATOM 5984  H HD2  . PRO A 1 2  ? 7.771   -13.248 -8.411  1.00 0.00 ? 293 PRO A HD2  8  
ATOM 5985  N N    . LEU A 1 3  ? 3.511   -12.419 -9.360  1.00 0.00 ? 294 LEU A N    8  
ATOM 5986  C CA   . LEU A 1 3  ? 2.528   -11.576 -8.690  1.00 0.00 ? 294 LEU A CA   8  
ATOM 5987  C C    . LEU A 1 3  ? 1.341   -12.402 -8.208  1.00 0.00 ? 294 LEU A C    8  
ATOM 5988  O O    . LEU A 1 3  ? 1.076   -12.488 -7.009  1.00 0.00 ? 294 LEU A O    8  
ATOM 5989  C CB   . LEU A 1 3  ? 2.047   -10.471 -9.632  1.00 0.00 ? 294 LEU A CB   8  
ATOM 5990  C CG   . LEU A 1 3  ? 2.838   -9.165  -9.556  1.00 0.00 ? 294 LEU A CG   8  
ATOM 5991  C CD1  . LEU A 1 3  ? 2.452   -8.378  -8.313  1.00 0.00 ? 294 LEU A CD1  8  
ATOM 5992  C CD2  . LEU A 1 3  ? 4.333   -9.450  -9.565  1.00 0.00 ? 294 LEU A CD2  8  
ATOM 5993  H H    . LEU A 1 3  ? 3.836   -12.161 -10.248 1.00 0.00 ? 294 LEU A H    8  
ATOM 5994  H HA   . LEU A 1 3  ? 3.008   -11.124 -7.835  1.00 0.00 ? 294 LEU A HA   8  
ATOM 5995  H HB2  . LEU A 1 3  ? 2.100   -10.843 -10.645 1.00 0.00 ? 294 LEU A HB2  8  
ATOM 5996  H HG   . LEU A 1 3  ? 2.607   -8.561  -10.420 1.00 0.00 ? 294 LEU A HG   8  
ATOM 5997  H HD11 . LEU A 1 3  ? 1.388   -8.466  -8.148  1.00 0.00 ? 294 LEU A HD11 8  
ATOM 5998  H HD12 . LEU A 1 3  ? 2.982   -8.771  -7.458  1.00 0.00 ? 294 LEU A HD12 8  
ATOM 5999  H HD13 . LEU A 1 3  ? 2.710   -7.339  -8.451  1.00 0.00 ? 294 LEU A HD13 8  
ATOM 6000  H HD21 . LEU A 1 3  ? 4.655   -9.718  -8.570  1.00 0.00 ? 294 LEU A HD21 8  
ATOM 6001  H HD22 . LEU A 1 3  ? 4.540   -10.265 -10.243 1.00 0.00 ? 294 LEU A HD22 8  
ATOM 6002  H HD23 . LEU A 1 3  ? 4.865   -8.568  -9.889  1.00 0.00 ? 294 LEU A HD23 8  
ATOM 6003  N N    . GLY A 1 4  ? 0.628   -13.010 -9.153  1.00 0.00 ? 295 GLY A N    8  
ATOM 6004  C CA   . GLY A 1 4  ? -0.523  -13.821 -8.805  1.00 0.00 ? 295 GLY A CA   8  
ATOM 6005  C C    . GLY A 1 4  ? -1.087  -14.569 -9.997  1.00 0.00 ? 295 GLY A C    8  
ATOM 6006  O O    . GLY A 1 4  ? -0.344  -15.198 -10.752 1.00 0.00 ? 295 GLY A O    8  
ATOM 6007  H H    . GLY A 1 4  ? 0.888   -12.907 -10.092 1.00 0.00 ? 295 GLY A H    8  
ATOM 6008  H HA2  . GLY A 1 4  ? -0.232  -14.536 -8.050  1.00 0.00 ? 295 GLY A HA2  8  
ATOM 6009  H HA3  . GLY A 1 4  ? -1.292  -13.180 -8.401  1.00 0.00 ? 295 GLY A HA3  8  
ATOM 6010  N N    . SER A 1 5  ? -2.402  -14.501 -10.167 1.00 0.00 ? 296 SER A N    8  
ATOM 6011  C CA   . SER A 1 5  ? -3.067  -15.177 -11.275 1.00 0.00 ? 296 SER A CA   8  
ATOM 6012  C C    . SER A 1 5  ? -4.488  -14.653 -11.459 1.00 0.00 ? 296 SER A C    8  
ATOM 6013  O O    . SER A 1 5  ? -5.427  -15.428 -11.638 1.00 0.00 ? 296 SER A O    8  
ATOM 6014  C CB   . SER A 1 5  ? -3.097  -16.687 -11.031 1.00 0.00 ? 296 SER A CB   8  
ATOM 6015  O OG   . SER A 1 5  ? -1.886  -17.133 -10.445 1.00 0.00 ? 296 SER A OG   8  
ATOM 6016  H H    . SER A 1 5  ? -2.940  -13.983 -9.532  1.00 0.00 ? 296 SER A H    8  
ATOM 6017  H HA   . SER A 1 5  ? -2.502  -14.978 -12.173 1.00 0.00 ? 296 SER A HA   8  
ATOM 6018  H HB2  . SER A 1 5  ? -3.914  -16.926 -10.366 1.00 0.00 ? 296 SER A HB2  8  
ATOM 6019  H HG   . SER A 1 5  ? -1.836  -18.090 -10.502 1.00 0.00 ? 296 SER A HG   8  
ATOM 6020  N N    . GLY A 1 6  ? -4.638  -13.332 -11.413 1.00 0.00 ? 297 GLY A N    8  
ATOM 6021  C CA   . GLY A 1 6  ? -5.948  -12.729 -11.576 1.00 0.00 ? 297 GLY A CA   8  
ATOM 6022  C C    . GLY A 1 6  ? -6.112  -11.464 -10.752 1.00 0.00 ? 297 GLY A C    8  
ATOM 6023  O O    . GLY A 1 6  ? -5.137  -10.951 -10.203 1.00 0.00 ? 297 GLY A O    8  
ATOM 6024  H H    . GLY A 1 6  ? -3.853  -12.763 -11.268 1.00 0.00 ? 297 GLY A H    8  
ATOM 6025  H HA2  . GLY A 1 6  ? -6.094  -12.488 -12.618 1.00 0.00 ? 297 GLY A HA2  8  
ATOM 6026  H HA3  . GLY A 1 6  ? -6.700  -13.442 -11.272 1.00 0.00 ? 297 GLY A HA3  8  
ATOM 6027  N N    . PRO A 1 7  ? -7.343  -10.938 -10.651 1.00 0.00 ? 298 PRO A N    8  
ATOM 6028  C CA   . PRO A 1 7  ? -7.623  -9.724  -9.883  1.00 0.00 ? 298 PRO A CA   8  
ATOM 6029  C C    . PRO A 1 7  ? -7.758  -9.998  -8.389  1.00 0.00 ? 298 PRO A C    8  
ATOM 6030  O O    . PRO A 1 7  ? -8.154  -11.090 -7.983  1.00 0.00 ? 298 PRO A O    8  
ATOM 6031  C CB   . PRO A 1 7  ? -8.954  -9.258  -10.465 1.00 0.00 ? 298 PRO A CB   8  
ATOM 6032  C CG   . PRO A 1 7  ? -9.644  -10.514 -10.871 1.00 0.00 ? 298 PRO A CG   8  
ATOM 6033  C CD   . PRO A 1 7  ? -8.562  -11.483 -11.279 1.00 0.00 ? 298 PRO A CD   8  
ATOM 6034  H HA   . PRO A 1 7  ? -6.869  -8.968  -10.046 1.00 0.00 ? 298 PRO A HA   8  
ATOM 6035  H HB2  . PRO A 1 7  ? -9.513  -8.723  -9.710  1.00 0.00 ? 298 PRO A HB2  8  
ATOM 6036  H HG2  . PRO A 1 7  ? -10.204 -10.910 -10.036 1.00 0.00 ? 298 PRO A HG2  8  
ATOM 6037  H HD2  . PRO A 1 7  ? -8.779  -12.472 -10.901 1.00 0.00 ? 298 PRO A HD2  8  
ATOM 6038  N N    . LEU A 1 8  ? -7.427  -9.001  -7.575  1.00 0.00 ? 299 LEU A N    8  
ATOM 6039  C CA   . LEU A 1 8  ? -7.513  -9.137  -6.125  1.00 0.00 ? 299 LEU A CA   8  
ATOM 6040  C C    . LEU A 1 8  ? -8.926  -9.525  -5.698  1.00 0.00 ? 299 LEU A C    8  
ATOM 6041  O O    . LEU A 1 8  ? -9.886  -9.315  -6.439  1.00 0.00 ? 299 LEU A O    8  
ATOM 6042  C CB   . LEU A 1 8  ? -7.109  -7.829  -5.444  1.00 0.00 ? 299 LEU A CB   8  
ATOM 6043  C CG   . LEU A 1 8  ? -5.606  -7.546  -5.418  1.00 0.00 ? 299 LEU A CG   8  
ATOM 6044  C CD1  . LEU A 1 8  ? -5.334  -6.178  -4.813  1.00 0.00 ? 299 LEU A CD1  8  
ATOM 6045  C CD2  . LEU A 1 8  ? -4.876  -8.630  -4.640  1.00 0.00 ? 299 LEU A CD2  8  
ATOM 6046  H H    . LEU A 1 8  ? -7.117  -8.154  -7.958  1.00 0.00 ? 299 LEU A H    8  
ATOM 6047  H HA   . LEU A 1 8  ? -6.832  -9.918  -5.824  1.00 0.00 ? 299 LEU A HA   8  
ATOM 6048  H HB2  . LEU A 1 8  ? -7.598  -7.014  -5.956  1.00 0.00 ? 299 LEU A HB2  8  
ATOM 6049  H HG   . LEU A 1 8  ? -5.228  -7.547  -6.430  1.00 0.00 ? 299 LEU A HG   8  
ATOM 6050  H HD11 . LEU A 1 8  ? -4.304  -6.125  -4.492  1.00 0.00 ? 299 LEU A HD11 8  
ATOM 6051  H HD12 . LEU A 1 8  ? -5.520  -5.415  -5.553  1.00 0.00 ? 299 LEU A HD12 8  
ATOM 6052  H HD13 . LEU A 1 8  ? -5.983  -6.024  -3.965  1.00 0.00 ? 299 LEU A HD13 8  
ATOM 6053  H HD21 . LEU A 1 8  ? -4.041  -8.991  -5.223  1.00 0.00 ? 299 LEU A HD21 8  
ATOM 6054  H HD22 . LEU A 1 8  ? -4.514  -8.223  -3.708  1.00 0.00 ? 299 LEU A HD22 8  
ATOM 6055  H HD23 . LEU A 1 8  ? -5.553  -9.446  -4.436  1.00 0.00 ? 299 LEU A HD23 8  
ATOM 6056  N N    . PRO A 1 9  ? -9.072  -10.096 -4.489  1.00 0.00 ? 300 PRO A N    8  
ATOM 6057  C CA   . PRO A 1 9  ? -10.378 -10.505 -3.965  1.00 0.00 ? 300 PRO A CA   8  
ATOM 6058  C C    . PRO A 1 9  ? -11.370 -9.347  -3.941  1.00 0.00 ? 300 PRO A C    8  
ATOM 6059  O O    . PRO A 1 9  ? -11.017 -8.212  -4.261  1.00 0.00 ? 300 PRO A O    8  
ATOM 6060  C CB   . PRO A 1 9  ? -10.070 -10.975 -2.541  1.00 0.00 ? 300 PRO A CB   8  
ATOM 6061  C CG   . PRO A 1 9  ? -8.621  -11.321 -2.556  1.00 0.00 ? 300 PRO A CG   8  
ATOM 6062  C CD   . PRO A 1 9  ? -7.980  -10.387 -3.542  1.00 0.00 ? 300 PRO A CD   8  
ATOM 6063  H HA   . PRO A 1 9  ? -10.795 -11.322 -4.537  1.00 0.00 ? 300 PRO A HA   8  
ATOM 6064  H HB2  . PRO A 1 9  ? -10.278 -10.177 -1.844  1.00 0.00 ? 300 PRO A HB2  8  
ATOM 6065  H HG2  . PRO A 1 9  ? -8.198  -11.174 -1.572  1.00 0.00 ? 300 PRO A HG2  8  
ATOM 6066  H HD2  . PRO A 1 9  ? -7.646  -9.488  -3.049  1.00 0.00 ? 300 PRO A HD2  8  
ATOM 6067  N N    . PRO A 1 10 ? -12.629 -9.619  -3.560  1.00 0.00 ? 301 PRO A N    8  
ATOM 6068  C CA   . PRO A 1 10 ? -13.676 -8.597  -3.494  1.00 0.00 ? 301 PRO A CA   8  
ATOM 6069  C C    . PRO A 1 10 ? -13.514 -7.657  -2.301  1.00 0.00 ? 301 PRO A C    8  
ATOM 6070  O O    . PRO A 1 10 ? -14.439 -7.489  -1.506  1.00 0.00 ? 301 PRO A O    8  
ATOM 6071  C CB   . PRO A 1 10 ? -14.977 -9.409  -3.357  1.00 0.00 ? 301 PRO A CB   8  
ATOM 6072  C CG   . PRO A 1 10 ? -14.590 -10.840 -3.556  1.00 0.00 ? 301 PRO A CG   8  
ATOM 6073  C CD   . PRO A 1 10 ? -13.141 -10.939 -3.179  1.00 0.00 ? 301 PRO A CD   8  
ATOM 6074  H HA   . PRO A 1 10 ? -13.712 -8.015  -4.403  1.00 0.00 ? 301 PRO A HA   8  
ATOM 6075  H HB2  . PRO A 1 10 ? -15.395 -9.252  -2.375  1.00 0.00 ? 301 PRO A HB2  8  
ATOM 6076  H HG2  . PRO A 1 10 ? -15.186 -11.474 -2.917  1.00 0.00 ? 301 PRO A HG2  8  
ATOM 6077  H HD2  . PRO A 1 10 ? -13.034 -11.108 -2.118  1.00 0.00 ? 301 PRO A HD2  8  
ATOM 6078  N N    . GLY A 1 11 ? -12.339 -7.044  -2.176  1.00 0.00 ? 302 GLY A N    8  
ATOM 6079  C CA   . GLY A 1 11 ? -12.101 -6.127  -1.077  1.00 0.00 ? 302 GLY A CA   8  
ATOM 6080  C C    . GLY A 1 11 ? -10.711 -5.521  -1.102  1.00 0.00 ? 302 GLY A C    8  
ATOM 6081  O O    . GLY A 1 11 ? -10.523 -4.369  -0.708  1.00 0.00 ? 302 GLY A O    8  
ATOM 6082  H H    . GLY A 1 11 ? -11.629 -7.219  -2.827  1.00 0.00 ? 302 GLY A H    8  
ATOM 6083  H HA2  . GLY A 1 11 ? -12.828 -5.329  -1.127  1.00 0.00 ? 302 GLY A HA2  8  
ATOM 6084  H HA3  . GLY A 1 11 ? -12.231 -6.657  -0.146  1.00 0.00 ? 302 GLY A HA3  8  
ATOM 6085  N N    . TRP A 1 12 ? -9.734  -6.292  -1.566  1.00 0.00 ? 303 TRP A N    8  
ATOM 6086  C CA   . TRP A 1 12 ? -8.357  -5.820  -1.629  1.00 0.00 ? 303 TRP A CA   8  
ATOM 6087  C C    . TRP A 1 12 ? -8.087  -5.038  -2.907  1.00 0.00 ? 303 TRP A C    8  
ATOM 6088  O O    . TRP A 1 12 ? -8.832  -5.135  -3.881  1.00 0.00 ? 303 TRP A O    8  
ATOM 6089  C CB   . TRP A 1 12 ? -7.386  -6.995  -1.548  1.00 0.00 ? 303 TRP A CB   8  
ATOM 6090  C CG   . TRP A 1 12 ? -7.495  -7.764  -0.274  1.00 0.00 ? 303 TRP A CG   8  
ATOM 6091  C CD1  . TRP A 1 12 ? -8.377  -8.764  0.002   1.00 0.00 ? 303 TRP A CD1  8  
ATOM 6092  C CD2  . TRP A 1 12 ? -6.687  -7.600  0.895   1.00 0.00 ? 303 TRP A CD2  8  
ATOM 6093  N NE1  . TRP A 1 12 ? -8.174  -9.232  1.276   1.00 0.00 ? 303 TRP A NE1  8  
ATOM 6094  C CE2  . TRP A 1 12 ? -7.139  -8.534  1.845   1.00 0.00 ? 303 TRP A CE2  8  
ATOM 6095  C CE3  . TRP A 1 12 ? -5.626  -6.756  1.228   1.00 0.00 ? 303 TRP A CE3  8  
ATOM 6096  C CZ2  . TRP A 1 12 ? -6.564  -8.644  3.108   1.00 0.00 ? 303 TRP A CZ2  8  
ATOM 6097  C CZ3  . TRP A 1 12 ? -5.056  -6.866  2.482   1.00 0.00 ? 303 TRP A CZ3  8  
ATOM 6098  C CH2  . TRP A 1 12 ? -5.526  -7.805  3.408   1.00 0.00 ? 303 TRP A CH2  8  
ATOM 6099  H H    . TRP A 1 12 ? -9.944  -7.200  -1.870  1.00 0.00 ? 303 TRP A H    8  
ATOM 6100  H HA   . TRP A 1 12 ? -8.190  -5.172  -0.783  1.00 0.00 ? 303 TRP A HA   8  
ATOM 6101  H HB2  . TRP A 1 12 ? -7.584  -7.673  -2.364  1.00 0.00 ? 303 TRP A HB2  8  
ATOM 6102  H HD1  . TRP A 1 12 ? -9.123  -9.123  -0.690  1.00 0.00 ? 303 TRP A HD1  8  
ATOM 6103  H HE1  . TRP A 1 12 ? -8.686  -9.947  1.704   1.00 0.00 ? 303 TRP A HE1  8  
ATOM 6104  H HE3  . TRP A 1 12 ? -5.250  -6.025  0.527   1.00 0.00 ? 303 TRP A HE3  8  
ATOM 6105  H HZ2  . TRP A 1 12 ? -6.914  -9.362  3.833   1.00 0.00 ? 303 TRP A HZ2  8  
ATOM 6106  H HZ3  . TRP A 1 12 ? -4.234  -6.221  2.758   1.00 0.00 ? 303 TRP A HZ3  8  
ATOM 6107  H HH2  . TRP A 1 12 ? -5.049  -7.856  4.374   1.00 0.00 ? 303 TRP A HH2  8  
ATOM 6108  N N    . GLU A 1 13 ? -7.009  -4.266  -2.886  1.00 0.00 ? 304 GLU A N    8  
ATOM 6109  C CA   . GLU A 1 13 ? -6.607  -3.476  -4.038  1.00 0.00 ? 304 GLU A CA   8  
ATOM 6110  C C    . GLU A 1 13 ? -5.112  -3.197  -3.993  1.00 0.00 ? 304 GLU A C    8  
ATOM 6111  O O    . GLU A 1 13 ? -4.529  -3.053  -2.918  1.00 0.00 ? 304 GLU A O    8  
ATOM 6112  C CB   . GLU A 1 13 ? -7.374  -2.157  -4.097  1.00 0.00 ? 304 GLU A CB   8  
ATOM 6113  C CG   . GLU A 1 13 ? -7.122  -1.382  -5.378  1.00 0.00 ? 304 GLU A CG   8  
ATOM 6114  C CD   . GLU A 1 13 ? -7.674  0.028   -5.329  1.00 0.00 ? 304 GLU A CD   8  
ATOM 6115  O OE1  . GLU A 1 13 ? -8.693  0.242   -4.638  1.00 0.00 ? 304 GLU A OE1  8  
ATOM 6116  O OE2  . GLU A 1 13 ? -7.089  0.918   -5.980  1.00 0.00 ? 304 GLU A OE2  8  
ATOM 6117  H H    . GLU A 1 13 ? -6.467  -4.227  -2.070  1.00 0.00 ? 304 GLU A H    8  
ATOM 6118  H HA   . GLU A 1 13 ? -6.826  -4.049  -4.924  1.00 0.00 ? 304 GLU A HA   8  
ATOM 6119  H HB2  . GLU A 1 13 ? -8.432  -2.364  -4.023  1.00 0.00 ? 304 GLU A HB2  8  
ATOM 6120  H HG2  . GLU A 1 13 ? -6.054  -1.331  -5.546  1.00 0.00 ? 304 GLU A HG2  8  
ATOM 6121  N N    . ILE A 1 14 ? -4.497  -3.121  -5.163  1.00 0.00 ? 305 ILE A N    8  
ATOM 6122  C CA   . ILE A 1 14 ? -3.069  -2.863  -5.252  1.00 0.00 ? 305 ILE A CA   8  
ATOM 6123  C C    . ILE A 1 14 ? -2.788  -1.373  -5.392  1.00 0.00 ? 305 ILE A C    8  
ATOM 6124  O O    . ILE A 1 14 ? -3.520  -0.649  -6.067  1.00 0.00 ? 305 ILE A O    8  
ATOM 6125  C CB   . ILE A 1 14 ? -2.442  -3.619  -6.436  1.00 0.00 ? 305 ILE A CB   8  
ATOM 6126  C CG1  . ILE A 1 14 ? -2.714  -5.118  -6.294  1.00 0.00 ? 305 ILE A CG1  8  
ATOM 6127  C CG2  . ILE A 1 14 ? -0.948  -3.338  -6.512  1.00 0.00 ? 305 ILE A CG2  8  
ATOM 6128  C CD1  . ILE A 1 14 ? -1.940  -5.975  -7.270  1.00 0.00 ? 305 ILE A CD1  8  
ATOM 6129  H H    . ILE A 1 14 ? -5.014  -3.241  -5.986  1.00 0.00 ? 305 ILE A H    8  
ATOM 6130  H HA   . ILE A 1 14 ? -2.609  -3.221  -4.341  1.00 0.00 ? 305 ILE A HA   8  
ATOM 6131  H HB   . ILE A 1 14 ? -2.898  -3.261  -7.346  1.00 0.00 ? 305 ILE A HB   8  
ATOM 6132  H HG12 . ILE A 1 14 ? -2.447  -5.432  -5.296  1.00 0.00 ? 305 ILE A HG12 8  
ATOM 6133  H HG21 . ILE A 1 14 ? -0.451  -3.809  -5.678  1.00 0.00 ? 305 ILE A HG21 8  
ATOM 6134  H HG22 . ILE A 1 14 ? -0.555  -3.733  -7.436  1.00 0.00 ? 305 ILE A HG22 8  
ATOM 6135  H HG23 . ILE A 1 14 ? -0.782  -2.271  -6.476  1.00 0.00 ? 305 ILE A HG23 8  
ATOM 6136  H HD11 . ILE A 1 14 ? -0.896  -5.700  -7.239  1.00 0.00 ? 305 ILE A HD11 8  
ATOM 6137  H HD12 . ILE A 1 14 ? -2.047  -7.014  -6.996  1.00 0.00 ? 305 ILE A HD12 8  
ATOM 6138  H HD13 . ILE A 1 14 ? -2.325  -5.821  -8.266  1.00 0.00 ? 305 ILE A HD13 8  
ATOM 6139  N N    . ARG A 1 15 ? -1.719  -0.924  -4.747  1.00 0.00 ? 306 ARG A N    8  
ATOM 6140  C CA   . ARG A 1 15 ? -1.333  0.478   -4.785  1.00 0.00 ? 306 ARG A CA   8  
ATOM 6141  C C    . ARG A 1 15 ? 0.161   0.625   -4.522  1.00 0.00 ? 306 ARG A C    8  
ATOM 6142  O O    . ARG A 1 15 ? 0.850   -0.359  -4.268  1.00 0.00 ? 306 ARG A O    8  
ATOM 6143  C CB   . ARG A 1 15 ? -2.140  1.267   -3.752  1.00 0.00 ? 306 ARG A CB   8  
ATOM 6144  C CG   . ARG A 1 15 ? -3.510  1.696   -4.255  1.00 0.00 ? 306 ARG A CG   8  
ATOM 6145  C CD   . ARG A 1 15 ? -4.263  2.502   -3.211  1.00 0.00 ? 306 ARG A CD   8  
ATOM 6146  N NE   . ARG A 1 15 ? -5.599  2.878   -3.669  1.00 0.00 ? 306 ARG A NE   8  
ATOM 6147  C CZ   . ARG A 1 15 ? -6.679  2.114   -3.527  1.00 0.00 ? 306 ARG A CZ   8  
ATOM 6148  N NH1  . ARG A 1 15 ? -6.591  0.925   -2.944  1.00 0.00 ? 306 ARG A NH1  8  
ATOM 6149  N NH2  . ARG A 1 15 ? -7.854  2.537   -3.975  1.00 0.00 ? 306 ARG A NH2  8  
ATOM 6150  H H    . ARG A 1 15 ? -1.174  -1.555  -4.231  1.00 0.00 ? 306 ARG A H    8  
ATOM 6151  H HA   . ARG A 1 15 ? -1.554  0.858   -5.771  1.00 0.00 ? 306 ARG A HA   8  
ATOM 6152  H HB2  . ARG A 1 15 ? -2.280  0.650   -2.876  1.00 0.00 ? 306 ARG A HB2  8  
ATOM 6153  H HG2  . ARG A 1 15 ? -3.383  2.302   -5.139  1.00 0.00 ? 306 ARG A HG2  8  
ATOM 6154  H HD2  . ARG A 1 15 ? -4.350  1.914   -2.311  1.00 0.00 ? 306 ARG A HD2  8  
ATOM 6155  H HE   . ARG A 1 15 ? -5.697  3.750   -4.108  1.00 0.00 ? 306 ARG A HE   8  
ATOM 6156  H HH11 . ARG A 1 15 ? -5.710  0.596   -2.610  1.00 0.00 ? 306 ARG A HH11 8  
ATOM 6157  H HH12 . ARG A 1 15 ? -7.407  0.358   -2.839  1.00 0.00 ? 306 ARG A HH12 8  
ATOM 6158  H HH21 . ARG A 1 15 ? -7.927  3.430   -4.418  1.00 0.00 ? 306 ARG A HH21 8  
ATOM 6159  H HH22 . ARG A 1 15 ? -8.666  1.964   -3.868  1.00 0.00 ? 306 ARG A HH22 8  
ATOM 6160  N N    . ASN A 1 16 ? 0.663   1.851   -4.590  1.00 0.00 ? 307 ASN A N    8  
ATOM 6161  C CA   . ASN A 1 16 ? 2.080   2.101   -4.353  1.00 0.00 ? 307 ASN A CA   8  
ATOM 6162  C C    . ASN A 1 16 ? 2.278   3.171   -3.287  1.00 0.00 ? 307 ASN A C    8  
ATOM 6163  O O    . ASN A 1 16 ? 1.377   3.963   -3.014  1.00 0.00 ? 307 ASN A O    8  
ATOM 6164  C CB   . ASN A 1 16 ? 2.771   2.521   -5.648  1.00 0.00 ? 307 ASN A CB   8  
ATOM 6165  C CG   . ASN A 1 16 ? 2.552   1.525   -6.770  1.00 0.00 ? 307 ASN A CG   8  
ATOM 6166  O OD1  . ASN A 1 16 ? 1.435   1.363   -7.261  1.00 0.00 ? 307 ASN A OD1  8  
ATOM 6167  N ND2  . ASN A 1 16 ? 3.620   0.852   -7.182  1.00 0.00 ? 307 ASN A ND2  8  
ATOM 6168  H H    . ASN A 1 16 ? 0.074   2.603   -4.807  1.00 0.00 ? 307 ASN A H    8  
ATOM 6169  H HA   . ASN A 1 16 ? 2.522   1.180   -4.004  1.00 0.00 ? 307 ASN A HA   8  
ATOM 6170  H HB2  . ASN A 1 16 ? 2.380   3.475   -5.957  1.00 0.00 ? 307 ASN A HB2  8  
ATOM 6171  H HD21 . ASN A 1 16 ? 4.479   1.032   -6.746  1.00 0.00 ? 307 ASN A HD21 8  
ATOM 6172  H HD22 . ASN A 1 16 ? 3.505   0.200   -7.905  1.00 0.00 ? 307 ASN A HD22 8  
ATOM 6173  N N    . THR A 1 17 ? 3.469   3.198   -2.702  1.00 0.00 ? 308 THR A N    8  
ATOM 6174  C CA   . THR A 1 17 ? 3.781   4.166   -1.660  1.00 0.00 ? 308 THR A CA   8  
ATOM 6175  C C    . THR A 1 17 ? 4.682   5.268   -2.199  1.00 0.00 ? 308 THR A C    8  
ATOM 6176  O O    . THR A 1 17 ? 4.383   6.455   -2.068  1.00 0.00 ? 308 THR A O    8  
ATOM 6177  C CB   . THR A 1 17 ? 4.473   3.501   -0.453  1.00 0.00 ? 308 THR A CB   8  
ATOM 6178  O OG1  . THR A 1 17 ? 5.806   3.112   -0.806  1.00 0.00 ? 308 THR A OG1  8  
ATOM 6179  C CG2  . THR A 1 17 ? 3.694   2.284   0.021   1.00 0.00 ? 308 THR A CG2  8  
ATOM 6180  H H    . THR A 1 17 ? 4.160   2.561   -2.991  1.00 0.00 ? 308 THR A H    8  
ATOM 6181  H HA   . THR A 1 17 ? 2.851   4.604   -1.321  1.00 0.00 ? 308 THR A HA   8  
ATOM 6182  H HB   . THR A 1 17 ? 4.519   4.217   0.355   1.00 0.00 ? 308 THR A HB   8  
ATOM 6183  H HG1  . THR A 1 17 ? 5.773   2.460   -1.509  1.00 0.00 ? 308 THR A HG1  8  
ATOM 6184  H HG21 . THR A 1 17 ? 4.017   2.013   1.018   1.00 0.00 ? 308 THR A HG21 8  
ATOM 6185  H HG22 . THR A 1 17 ? 3.874   1.457   -0.650  1.00 0.00 ? 308 THR A HG22 8  
ATOM 6186  H HG23 . THR A 1 17 ? 2.640   2.516   0.034   1.00 0.00 ? 308 THR A HG23 8  
ATOM 6187  N N    . ALA A 1 18 ? 5.789   4.860   -2.808  1.00 0.00 ? 309 ALA A N    8  
ATOM 6188  C CA   . ALA A 1 18 ? 6.746   5.798   -3.375  1.00 0.00 ? 309 ALA A CA   8  
ATOM 6189  C C    . ALA A 1 18 ? 7.953   5.057   -3.933  1.00 0.00 ? 309 ALA A C    8  
ATOM 6190  O O    . ALA A 1 18 ? 8.394   4.057   -3.366  1.00 0.00 ? 309 ALA A O    8  
ATOM 6191  C CB   . ALA A 1 18 ? 7.177   6.810   -2.329  1.00 0.00 ? 309 ALA A CB   8  
ATOM 6192  H H    . ALA A 1 18 ? 5.966   3.899   -2.878  1.00 0.00 ? 309 ALA A H    8  
ATOM 6193  H HA   . ALA A 1 18 ? 6.258   6.330   -4.180  1.00 0.00 ? 309 ALA A HA   8  
ATOM 6194  H HB1  . ALA A 1 18 ? 8.155   6.544   -1.954  1.00 0.00 ? 309 ALA A HB1  8  
ATOM 6195  H HB2  . ALA A 1 18 ? 7.216   7.792   -2.773  1.00 0.00 ? 309 ALA A HB2  8  
ATOM 6196  H HB3  . ALA A 1 18 ? 6.468   6.808   -1.515  1.00 0.00 ? 309 ALA A HB3  8  
ATOM 6197  N N    . THR A 1 19 ? 8.485   5.550   -5.045  1.00 0.00 ? 310 THR A N    8  
ATOM 6198  C CA   . THR A 1 19 ? 9.634   4.917   -5.683  1.00 0.00 ? 310 THR A CA   8  
ATOM 6199  C C    . THR A 1 19 ? 9.229   3.627   -6.401  1.00 0.00 ? 310 THR A C    8  
ATOM 6200  O O    . THR A 1 19 ? 10.080  2.921   -6.942  1.00 0.00 ? 310 THR A O    8  
ATOM 6201  C CB   . THR A 1 19 ? 10.741  4.595   -4.660  1.00 0.00 ? 310 THR A CB   8  
ATOM 6202  O OG1  . THR A 1 19 ? 10.723  5.554   -3.596  1.00 0.00 ? 310 THR A OG1  8  
ATOM 6203  C CG2  . THR A 1 19 ? 12.110  4.597   -5.324  1.00 0.00 ? 310 THR A CG2  8  
ATOM 6204  H H    . THR A 1 19 ? 8.098   6.354   -5.447  1.00 0.00 ? 310 THR A H    8  
ATOM 6205  H HA   . THR A 1 19 ? 10.034  5.610   -6.408  1.00 0.00 ? 310 THR A HA   8  
ATOM 6206  H HB   . THR A 1 19 ? 10.558  3.612   -4.251  1.00 0.00 ? 310 THR A HB   8  
ATOM 6207  H HG1  . THR A 1 19 ? 11.483  5.416   -3.026  1.00 0.00 ? 310 THR A HG1  8  
ATOM 6208  H HG21 . THR A 1 19 ? 12.701  5.409   -4.928  1.00 0.00 ? 310 THR A HG21 8  
ATOM 6209  H HG22 . THR A 1 19 ? 11.993  4.724   -6.391  1.00 0.00 ? 310 THR A HG22 8  
ATOM 6210  H HG23 . THR A 1 19 ? 12.607  3.660   -5.125  1.00 0.00 ? 310 THR A HG23 8  
ATOM 6211  N N    . GLY A 1 20 ? 7.930   3.324   -6.406  1.00 0.00 ? 311 GLY A N    8  
ATOM 6212  C CA   . GLY A 1 20 ? 7.450   2.126   -7.063  1.00 0.00 ? 311 GLY A CA   8  
ATOM 6213  C C    . GLY A 1 20 ? 7.007   1.055   -6.089  1.00 0.00 ? 311 GLY A C    8  
ATOM 6214  O O    . GLY A 1 20 ? 6.304   0.119   -6.471  1.00 0.00 ? 311 GLY A O    8  
ATOM 6215  H H    . GLY A 1 20 ? 7.290   3.919   -5.966  1.00 0.00 ? 311 GLY A H    8  
ATOM 6216  H HA2  . GLY A 1 20 ? 6.607   2.390   -7.684  1.00 0.00 ? 311 GLY A HA2  8  
ATOM 6217  H HA3  . GLY A 1 20 ? 8.236   1.729   -7.688  1.00 0.00 ? 311 GLY A HA3  8  
ATOM 6218  N N    . ARG A 1 21 ? 7.410   1.183   -4.829  1.00 0.00 ? 312 ARG A N    8  
ATOM 6219  C CA   . ARG A 1 21 ? 7.026   0.203   -3.818  1.00 0.00 ? 312 ARG A CA   8  
ATOM 6220  C C    . ARG A 1 21 ? 5.522   0.037   -3.794  1.00 0.00 ? 312 ARG A C    8  
ATOM 6221  O O    . ARG A 1 21 ? 4.773   1.011   -3.878  1.00 0.00 ? 312 ARG A O    8  
ATOM 6222  C CB   . ARG A 1 21 ? 7.538   0.597   -2.427  1.00 0.00 ? 312 ARG A CB   8  
ATOM 6223  C CG   . ARG A 1 21 ? 8.666   -0.297  -1.927  1.00 0.00 ? 312 ARG A CG   8  
ATOM 6224  C CD   . ARG A 1 21 ? 8.334   -0.948  -0.586  1.00 0.00 ? 312 ARG A CD   8  
ATOM 6225  N NE   . ARG A 1 21 ? 9.238   -2.054  -0.284  1.00 0.00 ? 312 ARG A NE   8  
ATOM 6226  C CZ   . ARG A 1 21 ? 10.524  -1.895  0.016   1.00 0.00 ? 312 ARG A CZ   8  
ATOM 6227  N NH1  . ARG A 1 21 ? 11.048  -0.678  0.071   1.00 0.00 ? 312 ARG A NH1  8  
ATOM 6228  N NH2  . ARG A 1 21 ? 11.284  -2.952  0.266   1.00 0.00 ? 312 ARG A NH2  8  
ATOM 6229  H H    . ARG A 1 21 ? 7.975   1.943   -4.579  1.00 0.00 ? 312 ARG A H    8  
ATOM 6230  H HA   . ARG A 1 21 ? 7.457   -0.745  -4.099  1.00 0.00 ? 312 ARG A HA   8  
ATOM 6231  H HB2  . ARG A 1 21 ? 7.900   1.614   -2.459  1.00 0.00 ? 312 ARG A HB2  8  
ATOM 6232  H HG2  . ARG A 1 21 ? 8.839   -1.075  -2.657  1.00 0.00 ? 312 ARG A HG2  8  
ATOM 6233  H HD2  . ARG A 1 21 ? 8.413   -0.208  0.200   1.00 0.00 ? 312 ARG A HD2  8  
ATOM 6234  H HE   . ARG A 1 21 ? 8.870   -2.962  -0.313  1.00 0.00 ? 312 ARG A HE   8  
ATOM 6235  H HH11 . ARG A 1 21 ? 10.477  0.122   -0.113  1.00 0.00 ? 312 ARG A HH11 8  
ATOM 6236  H HH12 . ARG A 1 21 ? 12.015  -0.560  0.297   1.00 0.00 ? 312 ARG A HH12 8  
ATOM 6237  H HH21 . ARG A 1 21 ? 10.892  -3.871  0.228   1.00 0.00 ? 312 ARG A HH21 8  
ATOM 6238  H HH22 . ARG A 1 21 ? 12.251  -2.831  0.491   1.00 0.00 ? 312 ARG A HH22 8  
ATOM 6239  N N    . VAL A 1 22 ? 5.085   -1.205  -3.678  1.00 0.00 ? 313 VAL A N    8  
ATOM 6240  C CA   . VAL A 1 22 ? 3.666   -1.504  -3.673  1.00 0.00 ? 313 VAL A CA   8  
ATOM 6241  C C    . VAL A 1 22 ? 3.145   -1.816  -2.297  1.00 0.00 ? 313 VAL A C    8  
ATOM 6242  O O    . VAL A 1 22 ? 3.891   -1.930  -1.324  1.00 0.00 ? 313 VAL A O    8  
ATOM 6243  C CB   . VAL A 1 22 ? 3.303   -2.723  -4.557  1.00 0.00 ? 313 VAL A CB   8  
ATOM 6244  C CG1  . VAL A 1 22 ? 2.198   -2.350  -5.507  1.00 0.00 ? 313 VAL A CG1  8  
ATOM 6245  C CG2  . VAL A 1 22 ? 4.503   -3.279  -5.299  1.00 0.00 ? 313 VAL A CG2  8  
ATOM 6246  H H    . VAL A 1 22 ? 5.729   -1.938  -3.595  1.00 0.00 ? 313 VAL A H    8  
ATOM 6247  H HA   . VAL A 1 22 ? 3.143   -0.645  -4.060  1.00 0.00 ? 313 VAL A HA   8  
ATOM 6248  H HB   . VAL A 1 22 ? 2.923   -3.510  -3.916  1.00 0.00 ? 313 VAL A HB   8  
ATOM 6249  H HG11 . VAL A 1 22 ? 1.258   -2.379  -4.973  1.00 0.00 ? 313 VAL A HG11 8  
ATOM 6250  H HG12 . VAL A 1 22 ? 2.377   -1.354  -5.882  1.00 0.00 ? 313 VAL A HG12 8  
ATOM 6251  H HG13 . VAL A 1 22 ? 2.175   -3.051  -6.326  1.00 0.00 ? 313 VAL A HG13 8  
ATOM 6252  H HG21 . VAL A 1 22 ? 4.184   -4.092  -5.933  1.00 0.00 ? 313 VAL A HG21 8  
ATOM 6253  H HG22 . VAL A 1 22 ? 4.951   -2.502  -5.897  1.00 0.00 ? 313 VAL A HG22 8  
ATOM 6254  H HG23 . VAL A 1 22 ? 5.221   -3.645  -4.580  1.00 0.00 ? 313 VAL A HG23 8  
ATOM 6255  N N    . TYR A 1 23 ? 1.835   -1.949  -2.248  1.00 0.00 ? 314 TYR A N    8  
ATOM 6256  C CA   . TYR A 1 23 ? 1.160   -2.335  -1.043  1.00 0.00 ? 314 TYR A CA   8  
ATOM 6257  C C    . TYR A 1 23 ? -0.292  -2.639  -1.317  1.00 0.00 ? 314 TYR A C    8  
ATOM 6258  O O    . TYR A 1 23 ? -0.907  -2.052  -2.207  1.00 0.00 ? 314 TYR A O    8  
ATOM 6259  C CB   . TYR A 1 23 ? 1.282   -1.296  0.068   1.00 0.00 ? 314 TYR A CB   8  
ATOM 6260  C CG   . TYR A 1 23 ? 0.361   -0.099  -0.061  1.00 0.00 ? 314 TYR A CG   8  
ATOM 6261  C CD1  . TYR A 1 23 ? 0.645   0.935   -0.942  1.00 0.00 ? 314 TYR A CD1  8  
ATOM 6262  C CD2  . TYR A 1 23 ? -0.790  -0.001  0.716   1.00 0.00 ? 314 TYR A CD2  8  
ATOM 6263  C CE1  . TYR A 1 23 ? -0.192  2.030   -1.050  1.00 0.00 ? 314 TYR A CE1  8  
ATOM 6264  C CE2  . TYR A 1 23 ? -1.632  1.093   0.611   1.00 0.00 ? 314 TYR A CE2  8  
ATOM 6265  C CZ   . TYR A 1 23 ? -1.329  2.104   -0.275  1.00 0.00 ? 314 TYR A CZ   8  
ATOM 6266  O OH   . TYR A 1 23 ? -2.163  3.193   -0.383  1.00 0.00 ? 314 TYR A OH   8  
ATOM 6267  H H    . TYR A 1 23 ? 1.309   -1.764  -3.056  1.00 0.00 ? 314 TYR A H    8  
ATOM 6268  H HA   . TYR A 1 23 ? 1.638   -3.245  -0.729  1.00 0.00 ? 314 TYR A HA   8  
ATOM 6269  H HB2  . TYR A 1 23 ? 1.045   -1.779  1.002   1.00 0.00 ? 314 TYR A HB2  8  
ATOM 6270  H HD1  . TYR A 1 23 ? 1.534   0.878   -1.550  1.00 0.00 ? 314 TYR A HD1  8  
ATOM 6271  H HD2  . TYR A 1 23 ? -1.021  -0.792  1.414   1.00 0.00 ? 314 TYR A HD2  8  
ATOM 6272  H HE1  . TYR A 1 23 ? 0.050   2.824   -1.734  1.00 0.00 ? 314 TYR A HE1  8  
ATOM 6273  H HE2  . TYR A 1 23 ? -2.516  1.156   1.225   1.00 0.00 ? 314 TYR A HE2  8  
ATOM 6274  H HH   . TYR A 1 23 ? -3.021  2.909   -0.708  1.00 0.00 ? 314 TYR A HH   8  
ATOM 6275  N N    . PHE A 1 24 ? -0.836  -3.558  -0.547  1.00 0.00 ? 315 PHE A N    8  
ATOM 6276  C CA   . PHE A 1 24 ? -2.211  -3.944  -0.722  1.00 0.00 ? 315 PHE A CA   8  
ATOM 6277  C C    . PHE A 1 24 ? -3.097  -3.337  0.349   1.00 0.00 ? 315 PHE A C    8  
ATOM 6278  O O    . PHE A 1 24 ? -2.747  -3.307  1.530   1.00 0.00 ? 315 PHE A O    8  
ATOM 6279  C CB   . PHE A 1 24 ? -2.331  -5.465  -0.746  1.00 0.00 ? 315 PHE A CB   8  
ATOM 6280  C CG   . PHE A 1 24 ? -1.683  -6.081  -1.955  1.00 0.00 ? 315 PHE A CG   8  
ATOM 6281  C CD1  . PHE A 1 24 ? -0.330  -5.903  -2.198  1.00 0.00 ? 315 PHE A CD1  8  
ATOM 6282  C CD2  . PHE A 1 24 ? -2.428  -6.827  -2.849  1.00 0.00 ? 315 PHE A CD2  8  
ATOM 6283  C CE1  . PHE A 1 24 ? 0.269   -6.461  -3.312  1.00 0.00 ? 315 PHE A CE1  8  
ATOM 6284  C CE2  . PHE A 1 24 ? -1.838  -7.388  -3.967  1.00 0.00 ? 315 PHE A CE2  8  
ATOM 6285  C CZ   . PHE A 1 24 ? -0.488  -7.204  -4.199  1.00 0.00 ? 315 PHE A CZ   8  
ATOM 6286  H H    . PHE A 1 24 ? -0.298  -3.989  0.149   1.00 0.00 ? 315 PHE A H    8  
ATOM 6287  H HA   . PHE A 1 24 ? -2.521  -3.550  -1.670  1.00 0.00 ? 315 PHE A HA   8  
ATOM 6288  H HB2  . PHE A 1 24 ? -1.853  -5.873  0.133   1.00 0.00 ? 315 PHE A HB2  8  
ATOM 6289  H HD1  . PHE A 1 24 ? 0.261   -5.324  -1.505  1.00 0.00 ? 315 PHE A HD1  8  
ATOM 6290  H HD2  . PHE A 1 24 ? -3.483  -6.968  -2.669  1.00 0.00 ? 315 PHE A HD2  8  
ATOM 6291  H HE1  . PHE A 1 24 ? 1.325   -6.313  -3.492  1.00 0.00 ? 315 PHE A HE1  8  
ATOM 6292  H HE2  . PHE A 1 24 ? -2.431  -7.969  -4.658  1.00 0.00 ? 315 PHE A HE2  8  
ATOM 6293  H HZ   . PHE A 1 24 ? -0.024  -7.642  -5.070  1.00 0.00 ? 315 PHE A HZ   8  
ATOM 6294  N N    . VAL A 1 25 ? -4.248  -2.850  -0.088  1.00 0.00 ? 316 VAL A N    8  
ATOM 6295  C CA   . VAL A 1 25 ? -5.202  -2.215  0.801   1.00 0.00 ? 316 VAL A CA   8  
ATOM 6296  C C    . VAL A 1 25 ? -6.452  -3.067  0.980   1.00 0.00 ? 316 VAL A C    8  
ATOM 6297  O O    . VAL A 1 25 ? -7.098  -3.451  0.006   1.00 0.00 ? 316 VAL A O    8  
ATOM 6298  C CB   . VAL A 1 25 ? -5.608  -0.835  0.259   1.00 0.00 ? 316 VAL A CB   8  
ATOM 6299  C CG1  . VAL A 1 25 ? -6.395  -0.070  1.304   1.00 0.00 ? 316 VAL A CG1  8  
ATOM 6300  C CG2  . VAL A 1 25 ? -4.380  -0.049  -0.175  1.00 0.00 ? 316 VAL A CG2  8  
ATOM 6301  H H    . VAL A 1 25 ? -4.465  -2.926  -1.041  1.00 0.00 ? 316 VAL A H    8  
ATOM 6302  H HA   . VAL A 1 25 ? -4.726  -2.076  1.760   1.00 0.00 ? 316 VAL A HA   8  
ATOM 6303  H HB   . VAL A 1 25 ? -6.242  -0.980  -0.605  1.00 0.00 ? 316 VAL A HB   8  
ATOM 6304  H HG11 . VAL A 1 25 ? -7.369  0.183   0.910   1.00 0.00 ? 316 VAL A HG11 8  
ATOM 6305  H HG12 . VAL A 1 25 ? -6.508  -0.688  2.181   1.00 0.00 ? 316 VAL A HG12 8  
ATOM 6306  H HG13 . VAL A 1 25 ? -5.863  0.834   1.565   1.00 0.00 ? 316 VAL A HG13 8  
ATOM 6307  H HG21 . VAL A 1 25 ? -3.490  -0.616  0.058   1.00 0.00 ? 316 VAL A HG21 8  
ATOM 6308  H HG22 . VAL A 1 25 ? -4.424  0.130   -1.239  1.00 0.00 ? 316 VAL A HG22 8  
ATOM 6309  H HG23 . VAL A 1 25 ? -4.353  0.894   0.349   1.00 0.00 ? 316 VAL A HG23 8  
ATOM 6310  N N    . ASP A 1 26 ? -6.785  -3.362  2.233   1.00 0.00 ? 317 ASP A N    8  
ATOM 6311  C CA   . ASP A 1 26 ? -7.963  -4.162  2.540   1.00 0.00 ? 317 ASP A CA   8  
ATOM 6312  C C    . ASP A 1 26 ? -9.153  -3.263  2.850   1.00 0.00 ? 317 ASP A C    8  
ATOM 6313  O O    . ASP A 1 26 ? -9.146  -2.528  3.839   1.00 0.00 ? 317 ASP A O    8  
ATOM 6314  C CB   . ASP A 1 26 ? -7.694  -5.089  3.724   1.00 0.00 ? 317 ASP A CB   8  
ATOM 6315  C CG   . ASP A 1 26 ? -8.615  -6.293  3.729   1.00 0.00 ? 317 ASP A CG   8  
ATOM 6316  O OD1  . ASP A 1 26 ? -8.989  -6.759  2.631   1.00 0.00 ? 317 ASP A OD1  8  
ATOM 6317  O OD2  . ASP A 1 26 ? -8.964  -6.768  4.828   1.00 0.00 ? 317 ASP A OD2  8  
ATOM 6318  H H    . ASP A 1 26 ? -6.225  -3.034  2.969   1.00 0.00 ? 317 ASP A H    8  
ATOM 6319  H HA   . ASP A 1 26 ? -8.196  -4.760  1.670   1.00 0.00 ? 317 ASP A HA   8  
ATOM 6320  H HB2  . ASP A 1 26 ? -6.674  -5.438  3.678   1.00 0.00 ? 317 ASP A HB2  8  
ATOM 6321  N N    . HIS A 1 27 ? -10.170 -3.323  2.001   1.00 0.00 ? 318 HIS A N    8  
ATOM 6322  C CA   . HIS A 1 27 ? -11.364 -2.511  2.185   1.00 0.00 ? 318 HIS A CA   8  
ATOM 6323  C C    . HIS A 1 27 ? -12.376 -3.202  3.099   1.00 0.00 ? 318 HIS A C    8  
ATOM 6324  O O    . HIS A 1 27 ? -13.340 -2.581  3.546   1.00 0.00 ? 318 HIS A O    8  
ATOM 6325  C CB   . HIS A 1 27 ? -11.991 -2.190  0.829   1.00 0.00 ? 318 HIS A CB   8  
ATOM 6326  C CG   . HIS A 1 27 ? -11.223 -1.154  0.069   1.00 0.00 ? 318 HIS A CG   8  
ATOM 6327  N ND1  . HIS A 1 27 ? -11.242 0.165   0.449   1.00 0.00 ? 318 HIS A ND1  8  
ATOM 6328  C CD2  . HIS A 1 27 ? -10.412 -1.293  -1.009  1.00 0.00 ? 318 HIS A CD2  8  
ATOM 6329  C CE1  . HIS A 1 27 ? -10.447 0.796   -0.395  1.00 0.00 ? 318 HIS A CE1  8  
ATOM 6330  N NE2  . HIS A 1 27 ? -9.922  -0.045  -1.298  1.00 0.00 ? 318 HIS A NE2  8  
ATOM 6331  H H    . HIS A 1 27 ? -10.116 -3.928  1.231   1.00 0.00 ? 318 HIS A H    8  
ATOM 6332  H HA   . HIS A 1 27 ? -11.059 -1.584  2.650   1.00 0.00 ? 318 HIS A HA   8  
ATOM 6333  H HB2  . HIS A 1 27 ? -12.026 -3.088  0.231   1.00 0.00 ? 318 HIS A HB2  8  
ATOM 6334  H HD2  . HIS A 1 27 ? -10.190 -2.208  -1.540  1.00 0.00 ? 318 HIS A HD2  8  
ATOM 6335  H HE1  . HIS A 1 27 ? -10.239 1.854   -0.354  1.00 0.00 ? 318 HIS A HE1  8  
ATOM 6336  H HE2  . HIS A 1 27 ? -9.182  0.154   -1.909  1.00 0.00 ? 318 HIS A HE2  8  
ATOM 6337  N N    . ASN A 1 28 ? -12.156 -4.487  3.376   1.00 0.00 ? 319 ASN A N    8  
ATOM 6338  C CA   . ASN A 1 28 ? -13.049 -5.239  4.251   1.00 0.00 ? 319 ASN A CA   8  
ATOM 6339  C C    . ASN A 1 28 ? -12.653 -5.041  5.711   1.00 0.00 ? 319 ASN A C    8  
ATOM 6340  O O    . ASN A 1 28 ? -13.502 -4.796  6.568   1.00 0.00 ? 319 ASN A O    8  
ATOM 6341  C CB   . ASN A 1 28 ? -13.015 -6.728  3.901   1.00 0.00 ? 319 ASN A CB   8  
ATOM 6342  C CG   . ASN A 1 28 ? -13.130 -6.979  2.411   1.00 0.00 ? 319 ASN A CG   8  
ATOM 6343  O OD1  . ASN A 1 28 ? -13.811 -6.243  1.695   1.00 0.00 ? 319 ASN A OD1  8  
ATOM 6344  N ND2  . ASN A 1 28 ? -12.463 -8.024  1.935   1.00 0.00 ? 319 ASN A ND2  8  
ATOM 6345  H H    . ASN A 1 28 ? -11.383 -4.941  2.982   1.00 0.00 ? 319 ASN A H    8  
ATOM 6346  H HA   . ASN A 1 28 ? -14.051 -4.864  4.105   1.00 0.00 ? 319 ASN A HA   8  
ATOM 6347  H HB2  . ASN A 1 28 ? -12.084 -7.151  4.247   1.00 0.00 ? 319 ASN A HB2  8  
ATOM 6348  H HD21 . ASN A 1 28 ? -11.943 -8.565  2.565   1.00 0.00 ? 319 ASN A HD21 8  
ATOM 6349  H HD22 . ASN A 1 28 ? -12.520 -8.213  0.975   1.00 0.00 ? 319 ASN A HD22 8  
ATOM 6350  N N    . ASN A 1 29 ? -11.356 -5.151  5.984   1.00 0.00 ? 320 ASN A N    8  
ATOM 6351  C CA   . ASN A 1 29 ? -10.840 -4.980  7.339   1.00 0.00 ? 320 ASN A CA   8  
ATOM 6352  C C    . ASN A 1 29 ? -10.333 -3.558  7.560   1.00 0.00 ? 320 ASN A C    8  
ATOM 6353  O O    . ASN A 1 29 ? -10.192 -3.115  8.700   1.00 0.00 ? 320 ASN A O    8  
ATOM 6354  C CB   . ASN A 1 29 ? -9.709  -5.973  7.610   1.00 0.00 ? 320 ASN A CB   8  
ATOM 6355  C CG   . ASN A 1 29 ? -10.099 -7.399  7.285   1.00 0.00 ? 320 ASN A CG   8  
ATOM 6356  O OD1  . ASN A 1 29 ? -11.266 -7.775  7.387   1.00 0.00 ? 320 ASN A OD1  8  
ATOM 6357  N ND2  . ASN A 1 29 ? -9.119  -8.200  6.892   1.00 0.00 ? 320 ASN A ND2  8  
ATOM 6358  H H    . ASN A 1 29 ? -10.730 -5.351  5.257   1.00 0.00 ? 320 ASN A H    8  
ATOM 6359  H HA   . ASN A 1 29 ? -11.648 -5.172  8.028   1.00 0.00 ? 320 ASN A HA   8  
ATOM 6360  H HB2  . ASN A 1 29 ? -8.850  -5.711  7.008   1.00 0.00 ? 320 ASN A HB2  8  
ATOM 6361  H HD21 . ASN A 1 29 ? -8.213  -7.831  6.838   1.00 0.00 ? 320 ASN A HD21 8  
ATOM 6362  H HD22 . ASN A 1 29 ? -9.341  -9.123  6.669   1.00 0.00 ? 320 ASN A HD22 8  
ATOM 6363  N N    . ARG A 1 30 ? -10.056 -2.848  6.468   1.00 0.00 ? 321 ARG A N    8  
ATOM 6364  C CA   . ARG A 1 30 ? -9.557  -1.480  6.552   1.00 0.00 ? 321 ARG A CA   8  
ATOM 6365  C C    . ARG A 1 30 ? -8.119  -1.470  7.054   1.00 0.00 ? 321 ARG A C    8  
ATOM 6366  O O    . ARG A 1 30 ? -7.830  -0.958  8.137   1.00 0.00 ? 321 ARG A O    8  
ATOM 6367  C CB   . ARG A 1 30 ? -10.447 -0.640  7.475   1.00 0.00 ? 321 ARG A CB   8  
ATOM 6368  C CG   . ARG A 1 30 ? -11.930 -0.755  7.157   1.00 0.00 ? 321 ARG A CG   8  
ATOM 6369  C CD   . ARG A 1 30 ? -12.708 -1.360  8.316   1.00 0.00 ? 321 ARG A CD   8  
ATOM 6370  N NE   . ARG A 1 30 ? -13.687 -0.426  8.865   1.00 0.00 ? 321 ARG A NE   8  
ATOM 6371  C CZ   . ARG A 1 30 ? -14.539 -0.737  9.837   1.00 0.00 ? 321 ARG A CZ   8  
ATOM 6372  N NH1  . ARG A 1 30 ? -14.531 -1.954  10.365  1.00 0.00 ? 321 ARG A NH1  8  
ATOM 6373  N NH2  . ARG A 1 30 ? -15.401 0.167   10.281  1.00 0.00 ? 321 ARG A NH2  8  
ATOM 6374  H H    . ARG A 1 30 ? -10.184 -3.254  5.587   1.00 0.00 ? 321 ARG A H    8  
ATOM 6375  H HA   . ARG A 1 30 ? -9.582  -1.058  5.559   1.00 0.00 ? 321 ARG A HA   8  
ATOM 6376  H HB2  . ARG A 1 30 ? -10.291 -0.956  8.495   1.00 0.00 ? 321 ARG A HB2  8  
ATOM 6377  H HG2  . ARG A 1 30 ? -12.320 0.231   6.952   1.00 0.00 ? 321 ARG A HG2  8  
ATOM 6378  H HD2  . ARG A 1 30 ? -13.226 -2.240  7.963   1.00 0.00 ? 321 ARG A HD2  8  
ATOM 6379  H HE   . ARG A 1 30 ? -13.710 0.480   8.490   1.00 0.00 ? 321 ARG A HE   8  
ATOM 6380  H HH11 . ARG A 1 30 ? -13.883 -2.639  10.032  1.00 0.00 ? 321 ARG A HH11 8  
ATOM 6381  H HH12 . ARG A 1 30 ? -15.172 -2.185  11.096  1.00 0.00 ? 321 ARG A HH12 8  
ATOM 6382  H HH21 . ARG A 1 30 ? -15.409 1.086   9.886   1.00 0.00 ? 321 ARG A HH21 8  
ATOM 6383  H HH22 . ARG A 1 30 ? -16.041 -0.068  11.012  1.00 0.00 ? 321 ARG A HH22 8  
ATOM 6384  N N    . THR A 1 31 ? -7.218  -2.043  6.260   1.00 0.00 ? 322 THR A N    8  
ATOM 6385  C CA   . THR A 1 31 ? -5.808  -2.109  6.626   1.00 0.00 ? 322 THR A CA   8  
ATOM 6386  C C    . THR A 1 31 ? -4.917  -2.090  5.390   1.00 0.00 ? 322 THR A C    8  
ATOM 6387  O O    . THR A 1 31 ? -5.366  -1.765  4.291   1.00 0.00 ? 322 THR A O    8  
ATOM 6388  C CB   . THR A 1 31 ? -5.491  -3.375  7.458   1.00 0.00 ? 322 THR A CB   8  
ATOM 6389  O OG1  . THR A 1 31 ? -5.124  -4.457  6.591   1.00 0.00 ? 322 THR A OG1  8  
ATOM 6390  C CG2  . THR A 1 31 ? -6.685  -3.792  8.308   1.00 0.00 ? 322 THR A CG2  8  
ATOM 6391  H H    . THR A 1 31 ? -7.510  -2.430  5.408   1.00 0.00 ? 322 THR A H    8  
ATOM 6392  H HA   . THR A 1 31 ? -5.580  -1.244  7.228   1.00 0.00 ? 322 THR A HA   8  
ATOM 6393  H HB   . THR A 1 31 ? -4.662  -3.155  8.114   1.00 0.00 ? 322 THR A HB   8  
ATOM 6394  H HG1  . THR A 1 31 ? -5.917  -4.889  6.266   1.00 0.00 ? 322 THR A HG1  8  
ATOM 6395  H HG21 . THR A 1 31 ? -6.380  -4.557  9.006   1.00 0.00 ? 322 THR A HG21 8  
ATOM 6396  H HG22 . THR A 1 31 ? -7.464  -4.178  7.667   1.00 0.00 ? 322 THR A HG22 8  
ATOM 6397  H HG23 . THR A 1 31 ? -7.056  -2.935  8.851   1.00 0.00 ? 322 THR A HG23 8  
ATOM 6398  N N    . THR A 1 32 ? -3.653  -2.445  5.584   1.00 0.00 ? 323 THR A N    8  
ATOM 6399  C CA   . THR A 1 32 ? -2.686  -2.471  4.496   1.00 0.00 ? 323 THR A CA   8  
ATOM 6400  C C    . THR A 1 32 ? -1.661  -3.580  4.714   1.00 0.00 ? 323 THR A C    8  
ATOM 6401  O O    . THR A 1 32 ? -1.644  -4.218  5.766   1.00 0.00 ? 323 THR A O    8  
ATOM 6402  C CB   . THR A 1 32 ? -1.946  -1.127  4.368   1.00 0.00 ? 323 THR A CB   8  
ATOM 6403  O OG1  . THR A 1 32 ? -1.503  -0.696  5.660   1.00 0.00 ? 323 THR A OG1  8  
ATOM 6404  C CG2  . THR A 1 32 ? -2.849  -0.063  3.752   1.00 0.00 ? 323 THR A CG2  8  
ATOM 6405  H H    . THR A 1 32 ? -3.365  -2.703  6.484   1.00 0.00 ? 323 THR A H    8  
ATOM 6406  H HA   . THR A 1 32 ? -3.223  -2.657  3.578   1.00 0.00 ? 323 THR A HA   8  
ATOM 6407  H HB   . THR A 1 32 ? -1.084  -1.266  3.727   1.00 0.00 ? 323 THR A HB   8  
ATOM 6408  H HG1  . THR A 1 32 ? -1.043  -1.416  6.097   1.00 0.00 ? 323 THR A HG1  8  
ATOM 6409  H HG21 . THR A 1 32 ? -3.860  -0.193  4.113   1.00 0.00 ? 323 THR A HG21 8  
ATOM 6410  H HG22 . THR A 1 32 ? -2.837  -0.160  2.675   1.00 0.00 ? 323 THR A HG22 8  
ATOM 6411  H HG23 . THR A 1 32 ? -2.493  0.921   4.030   1.00 0.00 ? 323 THR A HG23 8  
ATOM 6412  N N    . GLN A 1 33 ? -0.809  -3.808  3.720   1.00 0.00 ? 324 GLN A N    8  
ATOM 6413  C CA   . GLN A 1 33 ? 0.216   -4.846  3.826   1.00 0.00 ? 324 GLN A CA   8  
ATOM 6414  C C    . GLN A 1 33 ? 0.999   -4.992  2.525   1.00 0.00 ? 324 GLN A C    8  
ATOM 6415  O O    . GLN A 1 33 ? 0.423   -5.003  1.440   1.00 0.00 ? 324 GLN A O    8  
ATOM 6416  C CB   . GLN A 1 33 ? -0.415  -6.194  4.204   1.00 0.00 ? 324 GLN A CB   8  
ATOM 6417  C CG   . GLN A 1 33 ? -1.870  -6.344  3.784   1.00 0.00 ? 324 GLN A CG   8  
ATOM 6418  C CD   . GLN A 1 33 ? -2.300  -7.794  3.677   1.00 0.00 ? 324 GLN A CD   8  
ATOM 6419  O OE1  . GLN A 1 33 ? -2.907  -8.343  4.595   1.00 0.00 ? 324 GLN A OE1  8  
ATOM 6420  N NE2  . GLN A 1 33 ? -1.986  -8.423  2.550   1.00 0.00 ? 324 GLN A NE2  8  
ATOM 6421  H H    . GLN A 1 33 ? -0.871  -3.274  2.899   1.00 0.00 ? 324 GLN A H    8  
ATOM 6422  H HA   . GLN A 1 33 ? 0.900   -4.551  4.608   1.00 0.00 ? 324 GLN A HA   8  
ATOM 6423  H HB2  . GLN A 1 33 ? 0.151   -6.983  3.732   1.00 0.00 ? 324 GLN A HB2  8  
ATOM 6424  H HG2  . GLN A 1 33 ? -2.495  -5.854  4.515   1.00 0.00 ? 324 GLN A HG2  8  
ATOM 6425  H HE21 . GLN A 1 33 ? -1.500  -7.924  1.861   1.00 0.00 ? 324 GLN A HE21 8  
ATOM 6426  H HE22 . GLN A 1 33 ? -2.252  -9.361  2.454   1.00 0.00 ? 324 GLN A HE22 8  
ATOM 6427  N N    . PHE A 1 34 ? 2.319   -5.116  2.646   1.00 0.00 ? 325 PHE A N    8  
ATOM 6428  C CA   . PHE A 1 34 ? 3.186   -5.275  1.482   1.00 0.00 ? 325 PHE A CA   8  
ATOM 6429  C C    . PHE A 1 34 ? 3.123   -6.708  0.978   1.00 0.00 ? 325 PHE A C    8  
ATOM 6430  O O    . PHE A 1 34 ? 4.146   -7.387  0.890   1.00 0.00 ? 325 PHE A O    8  
ATOM 6431  C CB   . PHE A 1 34 ? 4.634   -4.933  1.841   1.00 0.00 ? 325 PHE A CB   8  
ATOM 6432  C CG   . PHE A 1 34 ? 4.963   -3.458  1.843   1.00 0.00 ? 325 PHE A CG   8  
ATOM 6433  C CD1  . PHE A 1 34 ? 3.997   -2.495  1.574   1.00 0.00 ? 325 PHE A CD1  8  
ATOM 6434  C CD2  . PHE A 1 34 ? 6.256   -3.040  2.113   1.00 0.00 ? 325 PHE A CD2  8  
ATOM 6435  C CE1  . PHE A 1 34 ? 4.323   -1.149  1.572   1.00 0.00 ? 325 PHE A CE1  8  
ATOM 6436  C CE2  . PHE A 1 34 ? 6.581   -1.700  2.115   1.00 0.00 ? 325 PHE A CE2  8  
ATOM 6437  C CZ   . PHE A 1 34 ? 5.614   -0.755  1.843   1.00 0.00 ? 325 PHE A CZ   8  
ATOM 6438  H H    . PHE A 1 34 ? 2.719   -5.104  3.539   1.00 0.00 ? 325 PHE A H    8  
ATOM 6439  H HA   . PHE A 1 34 ? 2.840   -4.609  0.705   1.00 0.00 ? 325 PHE A HA   8  
ATOM 6440  H HB2  . PHE A 1 34 ? 4.848   -5.321  2.824   1.00 0.00 ? 325 PHE A HB2  8  
ATOM 6441  H HD1  . PHE A 1 34 ? 2.985   -2.801  1.365   1.00 0.00 ? 325 PHE A HD1  8  
ATOM 6442  H HD2  . PHE A 1 34 ? 7.016   -3.776  2.329   1.00 0.00 ? 325 PHE A HD2  8  
ATOM 6443  H HE1  . PHE A 1 34 ? 3.565   -0.407  1.367   1.00 0.00 ? 325 PHE A HE1  8  
ATOM 6444  H HE2  . PHE A 1 34 ? 7.592   -1.392  2.328   1.00 0.00 ? 325 PHE A HE2  8  
ATOM 6445  H HZ   . PHE A 1 34 ? 5.869   0.295   1.842   1.00 0.00 ? 325 PHE A HZ   8  
ATOM 6446  N N    . THR A 1 35 ? 1.925   -7.166  0.644   1.00 0.00 ? 326 THR A N    8  
ATOM 6447  C CA   . THR A 1 35 ? 1.750   -8.528  0.175   1.00 0.00 ? 326 THR A CA   8  
ATOM 6448  C C    . THR A 1 35 ? 0.443   -8.701  -0.583  1.00 0.00 ? 326 THR A C    8  
ATOM 6449  O O    . THR A 1 35 ? -0.512  -7.952  -0.381  1.00 0.00 ? 326 THR A O    8  
ATOM 6450  C CB   . THR A 1 35 ? 1.767   -9.515  1.352   1.00 0.00 ? 326 THR A CB   8  
ATOM 6451  O OG1  . THR A 1 35 ? 2.425   -8.924  2.479   1.00 0.00 ? 326 THR A OG1  8  
ATOM 6452  C CG2  . THR A 1 35 ? 2.474   -10.796 0.964   1.00 0.00 ? 326 THR A CG2  8  
ATOM 6453  H H    . THR A 1 35 ? 1.146   -6.577  0.710   1.00 0.00 ? 326 THR A H    8  
ATOM 6454  H HA   . THR A 1 35 ? 2.574   -8.767  -0.480  1.00 0.00 ? 326 THR A HA   8  
ATOM 6455  H HB   . THR A 1 35 ? 0.748   -9.750  1.621   1.00 0.00 ? 326 THR A HB   8  
ATOM 6456  H HG1  . THR A 1 35 ? 1.856   -8.253  2.866   1.00 0.00 ? 326 THR A HG1  8  
ATOM 6457  H HG21 . THR A 1 35 ? 2.007   -11.209 0.083   1.00 0.00 ? 326 THR A HG21 8  
ATOM 6458  H HG22 . THR A 1 35 ? 2.405   -11.504 1.776   1.00 0.00 ? 326 THR A HG22 8  
ATOM 6459  H HG23 . THR A 1 35 ? 3.513   -10.583 0.757   1.00 0.00 ? 326 THR A HG23 8  
ATOM 6460  N N    . ASP A 1 36 ? 0.414   -9.697  -1.460  1.00 0.00 ? 327 ASP A N    8  
ATOM 6461  C CA   . ASP A 1 36 ? -0.777  -9.990  -2.237  1.00 0.00 ? 327 ASP A CA   8  
ATOM 6462  C C    . ASP A 1 36 ? -1.581  -11.090 -1.549  1.00 0.00 ? 327 ASP A C    8  
ATOM 6463  O O    . ASP A 1 36 ? -1.122  -12.228 -1.454  1.00 0.00 ? 327 ASP A O    8  
ATOM 6464  C CB   . ASP A 1 36 ? -0.396  -10.426 -3.653  1.00 0.00 ? 327 ASP A CB   8  
ATOM 6465  C CG   . ASP A 1 36 ? -1.604  -10.814 -4.483  1.00 0.00 ? 327 ASP A CG   8  
ATOM 6466  O OD1  . ASP A 1 36 ? -2.733  -10.747 -3.954  1.00 0.00 ? 327 ASP A OD1  8  
ATOM 6467  O OD2  . ASP A 1 36 ? -1.421  -11.185 -5.661  1.00 0.00 ? 327 ASP A OD2  8  
ATOM 6468  H H    . ASP A 1 36 ? 1.213   -10.248 -1.587  1.00 0.00 ? 327 ASP A H    8  
ATOM 6469  H HA   . ASP A 1 36 ? -1.366  -9.090  -2.290  1.00 0.00 ? 327 ASP A HA   8  
ATOM 6470  H HB2  . ASP A 1 36 ? 0.112   -9.612  -4.149  1.00 0.00 ? 327 ASP A HB2  8  
ATOM 6471  N N    . PRO A 1 37 ? -2.793  -10.778 -1.057  1.00 0.00 ? 328 PRO A N    8  
ATOM 6472  C CA   . PRO A 1 37 ? -3.631  -11.760 -0.369  1.00 0.00 ? 328 PRO A CA   8  
ATOM 6473  C C    . PRO A 1 37 ? -3.801  -13.023 -1.195  1.00 0.00 ? 328 PRO A C    8  
ATOM 6474  O O    . PRO A 1 37 ? -4.045  -14.104 -0.660  1.00 0.00 ? 328 PRO A O    8  
ATOM 6475  C CB   . PRO A 1 37 ? -4.977  -11.046 -0.190  1.00 0.00 ? 328 PRO A CB   8  
ATOM 6476  C CG   . PRO A 1 37 ? -4.906  -9.848  -1.074  1.00 0.00 ? 328 PRO A CG   8  
ATOM 6477  C CD   . PRO A 1 37 ? -3.456  -9.473  -1.149  1.00 0.00 ? 328 PRO A CD   8  
ATOM 6478  H HA   . PRO A 1 37 ? -3.225  -12.017 0.599   1.00 0.00 ? 328 PRO A HA   8  
ATOM 6479  H HB2  . PRO A 1 37 ? -5.778  -11.707 -0.486  1.00 0.00 ? 328 PRO A HB2  8  
ATOM 6480  H HG2  . PRO A 1 37 ? -5.280  -10.095 -2.057  1.00 0.00 ? 328 PRO A HG2  8  
ATOM 6481  H HD2  . PRO A 1 37 ? -3.245  -8.988  -2.090  1.00 0.00 ? 328 PRO A HD2  8  
ATOM 6482  N N    . ARG A 1 38 ? -3.670  -12.874 -2.507  1.00 0.00 ? 329 ARG A N    8  
ATOM 6483  C CA   . ARG A 1 38 ? -3.798  -14.000 -3.414  1.00 0.00 ? 329 ARG A CA   8  
ATOM 6484  C C    . ARG A 1 38 ? -2.591  -14.922 -3.286  1.00 0.00 ? 329 ARG A C    8  
ATOM 6485  O O    . ARG A 1 38 ? -2.703  -16.138 -3.437  1.00 0.00 ? 329 ARG A O    8  
ATOM 6486  C CB   . ARG A 1 38 ? -3.932  -13.514 -4.857  1.00 0.00 ? 329 ARG A CB   8  
ATOM 6487  C CG   . ARG A 1 38 ? -4.991  -12.440 -5.044  1.00 0.00 ? 329 ARG A CG   8  
ATOM 6488  C CD   . ARG A 1 38 ? -5.689  -12.578 -6.387  1.00 0.00 ? 329 ARG A CD   8  
ATOM 6489  N NE   . ARG A 1 38 ? -6.555  -13.754 -6.433  1.00 0.00 ? 329 ARG A NE   8  
ATOM 6490  C CZ   . ARG A 1 38 ? -7.241  -14.120 -7.511  1.00 0.00 ? 329 ARG A CZ   8  
ATOM 6491  N NH1  . ARG A 1 38 ? -7.167  -13.402 -8.622  1.00 0.00 ? 329 ARG A NH1  8  
ATOM 6492  N NH2  . ARG A 1 38 ? -8.002  -15.206 -7.477  1.00 0.00 ? 329 ARG A NH2  8  
ATOM 6493  H H    . ARG A 1 38 ? -3.482  -11.985 -2.873  1.00 0.00 ? 329 ARG A H    8  
ATOM 6494  H HA   . ARG A 1 38 ? -4.689  -14.542 -3.138  1.00 0.00 ? 329 ARG A HA   8  
ATOM 6495  H HB2  . ARG A 1 38 ? -2.982  -13.112 -5.179  1.00 0.00 ? 329 ARG A HB2  8  
ATOM 6496  H HG2  . ARG A 1 38 ? -5.726  -12.531 -4.257  1.00 0.00 ? 329 ARG A HG2  8  
ATOM 6497  H HD2  . ARG A 1 38 ? -6.285  -11.695 -6.562  1.00 0.00 ? 329 ARG A HD2  8  
ATOM 6498  H HE   . ARG A 1 38 ? -6.626  -14.297 -5.622  1.00 0.00 ? 329 ARG A HE   8  
ATOM 6499  H HH11 . ARG A 1 38 ? -6.595  -12.583 -8.649  1.00 0.00 ? 329 ARG A HH11 8  
ATOM 6500  H HH12 . ARG A 1 38 ? -7.684  -13.679 -9.433  1.00 0.00 ? 329 ARG A HH12 8  
ATOM 6501  H HH21 . ARG A 1 38 ? -8.060  -15.749 -6.640  1.00 0.00 ? 329 ARG A HH21 8  
ATOM 6502  H HH22 . ARG A 1 38 ? -8.518  -15.480 -8.289  1.00 0.00 ? 329 ARG A HH22 8  
ATOM 6503  N N    . LEU A 1 39 ? -1.436  -14.326 -3.005  1.00 0.00 ? 330 LEU A N    8  
ATOM 6504  C CA   . LEU A 1 39 ? -0.199  -15.081 -2.852  1.00 0.00 ? 330 LEU A CA   8  
ATOM 6505  C C    . LEU A 1 39 ? -0.226  -15.894 -1.555  1.00 0.00 ? 330 LEU A C    8  
ATOM 6506  O O    . LEU A 1 39 ? -1.256  -15.964 -0.886  1.00 0.00 ? 330 LEU A O    8  
ATOM 6507  C CB   . LEU A 1 39 ? 1.000   -14.128 -2.860  1.00 0.00 ? 330 LEU A CB   8  
ATOM 6508  C CG   . LEU A 1 39 ? 1.376   -13.577 -4.237  1.00 0.00 ? 330 LEU A CG   8  
ATOM 6509  C CD1  . LEU A 1 39 ? 2.649   -12.751 -4.152  1.00 0.00 ? 330 LEU A CD1  8  
ATOM 6510  C CD2  . LEU A 1 39 ? 1.541   -14.713 -5.237  1.00 0.00 ? 330 LEU A CD2  8  
ATOM 6511  H H    . LEU A 1 39 ? -1.416  -13.352 -2.899  1.00 0.00 ? 330 LEU A H    8  
ATOM 6512  H HA   . LEU A 1 39 ? -0.119  -15.755 -3.691  1.00 0.00 ? 330 LEU A HA   8  
ATOM 6513  H HB2  . LEU A 1 39 ? 0.773   -13.293 -2.213  1.00 0.00 ? 330 LEU A HB2  8  
ATOM 6514  H HG   . LEU A 1 39 ? 0.583   -12.933 -4.589  1.00 0.00 ? 330 LEU A HG   8  
ATOM 6515  H HD11 . LEU A 1 39 ? 3.505   -13.408 -4.125  1.00 0.00 ? 330 LEU A HD11 8  
ATOM 6516  H HD12 . LEU A 1 39 ? 2.717   -12.106 -5.015  1.00 0.00 ? 330 LEU A HD12 8  
ATOM 6517  H HD13 . LEU A 1 39 ? 2.628   -12.150 -3.255  1.00 0.00 ? 330 LEU A HD13 8  
ATOM 6518  H HD21 . LEU A 1 39 ? 2.130   -14.371 -6.076  1.00 0.00 ? 330 LEU A HD21 8  
ATOM 6519  H HD22 . LEU A 1 39 ? 2.042   -15.543 -4.760  1.00 0.00 ? 330 LEU A HD22 8  
ATOM 6520  H HD23 . LEU A 1 39 ? 0.569   -15.030 -5.585  1.00 0.00 ? 330 LEU A HD23 8  
ATOM 6521  N N    . SER A 1 40 ? 0.906   -16.505 -1.199  1.00 0.00 ? 331 SER A N    8  
ATOM 6522  C CA   . SER A 1 40 ? 0.990   -17.306 0.019   1.00 0.00 ? 331 SER A CA   8  
ATOM 6523  C C    . SER A 1 40 ? 0.387   -16.562 1.209   1.00 0.00 ? 331 SER A C    8  
ATOM 6524  O O    . SER A 1 40 ? 0.995   -15.638 1.748   1.00 0.00 ? 331 SER A O    8  
ATOM 6525  C CB   . SER A 1 40 ? 2.446   -17.667 0.318   1.00 0.00 ? 331 SER A CB   8  
ATOM 6526  O OG   . SER A 1 40 ? 3.307   -16.574 0.050   1.00 0.00 ? 331 SER A OG   8  
ATOM 6527  H H    . SER A 1 40 ? 1.700   -16.422 -1.767  1.00 0.00 ? 331 SER A H    8  
ATOM 6528  H HA   . SER A 1 40 ? 0.430   -18.214 -0.141  1.00 0.00 ? 331 SER A HA   8  
ATOM 6529  H HB2  . SER A 1 40 ? 2.542   -17.937 1.358   1.00 0.00 ? 331 SER A HB2  8  
ATOM 6530  H HG   . SER A 1 40 ? 3.897   -16.441 0.796   1.00 0.00 ? 331 SER A HG   8  
ATOM 6531  N N    . ALA A 1 41 ? -0.811  -16.974 1.610   1.00 0.00 ? 332 ALA A N    8  
ATOM 6532  C CA   . ALA A 1 41 ? -1.498  -16.345 2.732   1.00 0.00 ? 332 ALA A CA   8  
ATOM 6533  C C    . ALA A 1 41 ? -2.167  -17.389 3.620   1.00 0.00 ? 332 ALA A C    8  
ATOM 6534  O O    . ALA A 1 41 ? -1.930  -18.589 3.473   1.00 0.00 ? 332 ALA A O    8  
ATOM 6535  C CB   . ALA A 1 41 ? -2.528  -15.344 2.225   1.00 0.00 ? 332 ALA A CB   8  
ATOM 6536  H H    . ALA A 1 41 ? -1.243  -17.717 1.141   1.00 0.00 ? 332 ALA A H    8  
ATOM 6537  H HA   . ALA A 1 41 ? -0.761  -15.810 3.316   1.00 0.00 ? 332 ALA A HA   8  
ATOM 6538  H HB1  . ALA A 1 41 ? -2.691  -14.579 2.971   1.00 0.00 ? 332 ALA A HB1  8  
ATOM 6539  H HB2  . ALA A 1 41 ? -2.168  -14.887 1.313   1.00 0.00 ? 332 ALA A HB2  8  
ATOM 6540  H HB3  . ALA A 1 41 ? -3.459  -15.855 2.027   1.00 0.00 ? 332 ALA A HB3  8  
ATOM 6541  N N    . ASN A 1 42 ? -3.007  -16.924 4.539   1.00 0.00 ? 333 ASN A N    8  
ATOM 6542  C CA   . ASN A 1 42 ? -3.714  -17.816 5.452   1.00 0.00 ? 333 ASN A CA   8  
ATOM 6543  C C    . ASN A 1 42 ? -2.735  -18.566 6.350   1.00 0.00 ? 333 ASN A C    8  
ATOM 6544  O O    . ASN A 1 42 ? -2.799  -18.375 7.582   1.00 0.00 ? 333 ASN A O    8  
ATOM 6545  C CB   . ASN A 1 42 ? -4.568  -18.810 4.666   1.00 0.00 ? 333 ASN A CB   8  
ATOM 6546  C CG   . ASN A 1 42 ? -6.053  -18.542 4.814   1.00 0.00 ? 333 ASN A CG   8  
ATOM 6547  O OD1  . ASN A 1 42 ? -6.760  -19.270 5.511   1.00 0.00 ? 333 ASN A OD1  8  
ATOM 6548  N ND2  . ASN A 1 42 ? -6.533  -17.495 4.156   1.00 0.00 ? 333 ASN A ND2  8  
ATOM 6549  O OXT  . ASN A 1 42 ? -1.913  -19.339 5.814   1.00 0.00 ? 333 ASN A OXT  8  
ATOM 6550  H H    . ASN A 1 42 ? -3.156  -15.958 4.605   1.00 0.00 ? 333 ASN A H    8  
ATOM 6551  H HA   . ASN A 1 42 ? -4.360  -17.211 6.071   1.00 0.00 ? 333 ASN A HA   8  
ATOM 6552  H HB2  . ASN A 1 42 ? -4.313  -18.746 3.618   1.00 0.00 ? 333 ASN A HB2  8  
ATOM 6553  H HD21 . ASN A 1 42 ? -5.912  -16.960 3.619   1.00 0.00 ? 333 ASN A HD21 8  
ATOM 6554  H HD22 . ASN A 1 42 ? -7.490  -17.298 4.233   1.00 0.00 ? 333 ASN A HD22 8  
ATOM 6555  N N    . GLY B 2 1  ? -2.554  -13.270 10.580  1.00 0.00 ? 198 GLY B N    8  
ATOM 6556  C CA   . GLY B 2 1  ? -1.392  -12.865 9.741   1.00 0.00 ? 198 GLY B CA   8  
ATOM 6557  C C    . GLY B 2 1  ? -0.177  -12.493 10.571  1.00 0.00 ? 198 GLY B C    8  
ATOM 6558  O O    . GLY B 2 1  ? 0.315   -11.369 10.481  1.00 0.00 ? 198 GLY B O    8  
ATOM 6559  H H1   . GLY B 2 1  ? -2.628  -14.308 10.612  1.00 0.00 ? 198 GLY B H1   8  
ATOM 6560  H H2   . GLY B 2 1  ? -3.434  -12.883 10.184  1.00 0.00 ? 198 GLY B H2   8  
ATOM 6561  H H3   . GLY B 2 1  ? -2.437  -12.912 11.550  1.00 0.00 ? 198 GLY B H3   8  
ATOM 6562  H HA2  . GLY B 2 1  ? -1.131  -13.685 9.088   1.00 0.00 ? 198 GLY B HA2  8  
ATOM 6563  H HA3  . GLY B 2 1  ? -1.677  -12.016 9.138   1.00 0.00 ? 198 GLY B HA3  8  
ATOM 6564  N N    . PRO B 2 2  ? 0.330   -13.425 11.394  1.00 0.00 ? 199 PRO B N    8  
ATOM 6565  C CA   . PRO B 2 2  ? 1.497   -13.179 12.242  1.00 0.00 ? 199 PRO B CA   8  
ATOM 6566  C C    . PRO B 2 2  ? 2.807   -13.249 11.464  1.00 0.00 ? 199 PRO B C    8  
ATOM 6567  O O    . PRO B 2 2  ? 3.770   -12.552 11.785  1.00 0.00 ? 199 PRO B O    8  
ATOM 6568  C CB   . PRO B 2 2  ? 1.422   -14.311 13.264  1.00 0.00 ? 199 PRO B CB   8  
ATOM 6569  C CG   . PRO B 2 2  ? 0.769   -15.430 12.529  1.00 0.00 ? 199 PRO B CG   8  
ATOM 6570  C CD   . PRO B 2 2  ? -0.199  -14.794 11.566  1.00 0.00 ? 199 PRO B CD   8  
ATOM 6571  H HA   . PRO B 2 2  ? 1.428   -12.227 12.748  1.00 0.00 ? 199 PRO B HA   8  
ATOM 6572  H HB2  . PRO B 2 2  ? 2.419   -14.576 13.587  1.00 0.00 ? 199 PRO B HB2  8  
ATOM 6573  H HG2  . PRO B 2 2  ? 1.514   -16.000 11.993  1.00 0.00 ? 199 PRO B HG2  8  
ATOM 6574  H HD2  . PRO B 2 2  ? -0.199  -15.326 10.625  1.00 0.00 ? 199 PRO B HD2  8  
ATOM 6575  N N    . LEU B 2 3  ? 2.834   -14.094 10.439  1.00 0.00 ? 200 LEU B N    8  
ATOM 6576  C CA   . LEU B 2 3  ? 4.026   -14.260 9.613   1.00 0.00 ? 200 LEU B CA   8  
ATOM 6577  C C    . LEU B 2 3  ? 4.409   -12.946 8.942   1.00 0.00 ? 200 LEU B C    8  
ATOM 6578  O O    . LEU B 2 3  ? 3.582   -12.303 8.295   1.00 0.00 ? 200 LEU B O    8  
ATOM 6579  C CB   . LEU B 2 3  ? 3.790   -15.339 8.554   1.00 0.00 ? 200 LEU B CB   8  
ATOM 6580  C CG   . LEU B 2 3  ? 5.008   -16.205 8.229   1.00 0.00 ? 200 LEU B CG   8  
ATOM 6581  C CD1  . LEU B 2 3  ? 4.641   -17.288 7.226   1.00 0.00 ? 200 LEU B CD1  8  
ATOM 6582  C CD2  . LEU B 2 3  ? 6.144   -15.346 7.698   1.00 0.00 ? 200 LEU B CD2  8  
ATOM 6583  H H    . LEU B 2 3  ? 2.033   -14.620 10.232  1.00 0.00 ? 200 LEU B H    8  
ATOM 6584  H HA   . LEU B 2 3  ? 4.834   -14.571 10.258  1.00 0.00 ? 200 LEU B HA   8  
ATOM 6585  H HB2  . LEU B 2 3  ? 2.996   -15.985 8.900   1.00 0.00 ? 200 LEU B HB2  8  
ATOM 6586  H HG   . LEU B 2 3  ? 5.348   -16.690 9.133   1.00 0.00 ? 200 LEU B HG   8  
ATOM 6587  H HD11 . LEU B 2 3  ? 4.898   -16.959 6.230   1.00 0.00 ? 200 LEU B HD11 8  
ATOM 6588  H HD12 . LEU B 2 3  ? 5.183   -18.192 7.457   1.00 0.00 ? 200 LEU B HD12 8  
ATOM 6589  H HD13 . LEU B 2 3  ? 3.579   -17.482 7.277   1.00 0.00 ? 200 LEU B HD13 8  
ATOM 6590  H HD21 . LEU B 2 3  ? 5.754   -14.393 7.374   1.00 0.00 ? 200 LEU B HD21 8  
ATOM 6591  H HD22 . LEU B 2 3  ? 6.873   -15.189 8.480   1.00 0.00 ? 200 LEU B HD22 8  
ATOM 6592  H HD23 . LEU B 2 3  ? 6.614   -15.845 6.864   1.00 0.00 ? 200 LEU B HD23 8  
ATOM 6593  N N    . GLY B 2 4  ? 5.669   -12.550 9.100   1.00 0.00 ? 201 GLY B N    8  
ATOM 6594  C CA   . GLY B 2 4  ? 6.138   -11.315 8.502   1.00 0.00 ? 201 GLY B CA   8  
ATOM 6595  C C    . GLY B 2 4  ? 7.633   -11.124 8.657   1.00 0.00 ? 201 GLY B C    8  
ATOM 6596  O O    . GLY B 2 4  ? 8.424   -11.901 8.123   1.00 0.00 ? 201 GLY B O    8  
ATOM 6597  H H    . GLY B 2 4  ? 6.284   -13.101 9.628   1.00 0.00 ? 201 GLY B H    8  
ATOM 6598  H HA2  . GLY B 2 4  ? 5.895   -11.323 7.450   1.00 0.00 ? 201 GLY B HA2  8  
ATOM 6599  H HA3  . GLY B 2 4  ? 5.628   -10.485 8.970   1.00 0.00 ? 201 GLY B HA3  8  
ATOM 6600  N N    . SER B 2 5  ? 8.021   -10.087 9.393   1.00 0.00 ? 202 SER B N    8  
ATOM 6601  C CA   . SER B 2 5  ? 9.432   -9.794  9.617   1.00 0.00 ? 202 SER B CA   8  
ATOM 6602  C C    . SER B 2 5  ? 10.165  -9.608  8.292   1.00 0.00 ? 202 SER B C    8  
ATOM 6603  O O    . SER B 2 5  ? 10.549  -10.579 7.642   1.00 0.00 ? 202 SER B O    8  
ATOM 6604  C CB   . SER B 2 5  ? 10.088  -10.916 10.424  1.00 0.00 ? 202 SER B CB   8  
ATOM 6605  O OG   . SER B 2 5  ? 10.819  -10.396 11.521  1.00 0.00 ? 202 SER B OG   8  
ATOM 6606  H H    . SER B 2 5  ? 7.343   -9.505  9.794   1.00 0.00 ? 202 SER B H    8  
ATOM 6607  H HA   . SER B 2 5  ? 9.494   -8.874  10.180  1.00 0.00 ? 202 SER B HA   8  
ATOM 6608  H HB2  . SER B 2 5  ? 9.324   -11.581 10.800  1.00 0.00 ? 202 SER B HB2  8  
ATOM 6609  H HG   . SER B 2 5  ? 10.235  -10.295 12.277  1.00 0.00 ? 202 SER B HG   8  
ATOM 6610  N N    . GLU B 2 6  ? 10.355  -8.352  7.899   1.00 0.00 ? 203 GLU B N    8  
ATOM 6611  C CA   . GLU B 2 6  ? 11.042  -8.039  6.651   1.00 0.00 ? 203 GLU B CA   8  
ATOM 6612  C C    . GLU B 2 6  ? 11.287  -6.539  6.526   1.00 0.00 ? 203 GLU B C    8  
ATOM 6613  O O    . GLU B 2 6  ? 12.362  -6.108  6.110   1.00 0.00 ? 203 GLU B O    8  
ATOM 6614  C CB   . GLU B 2 6  ? 10.222  -8.533  5.454   1.00 0.00 ? 203 GLU B CB   8  
ATOM 6615  C CG   . GLU B 2 6  ? 8.984   -7.695  5.169   1.00 0.00 ? 203 GLU B CG   8  
ATOM 6616  C CD   . GLU B 2 6  ? 8.120   -8.290  4.074   1.00 0.00 ? 203 GLU B CD   8  
ATOM 6617  O OE1  . GLU B 2 6  ? 7.495   -9.344  4.317   1.00 0.00 ? 203 GLU B OE1  8  
ATOM 6618  O OE2  . GLU B 2 6  ? 8.067   -7.700  2.974   1.00 0.00 ? 203 GLU B OE2  8  
ATOM 6619  H H    . GLU B 2 6  ? 10.025  -7.620  8.460   1.00 0.00 ? 203 GLU B H    8  
ATOM 6620  H HA   . GLU B 2 6  ? 11.994  -8.548  6.659   1.00 0.00 ? 203 GLU B HA   8  
ATOM 6621  H HB2  . GLU B 2 6  ? 10.850  -8.519  4.575   1.00 0.00 ? 203 GLU B HB2  8  
ATOM 6622  H HG2  . GLU B 2 6  ? 8.395   -7.626  6.073   1.00 0.00 ? 203 GLU B HG2  8  
ATOM 6623  N N    . LEU B 2 7  ? 10.284  -5.750  6.895   1.00 0.00 ? 204 LEU B N    8  
ATOM 6624  C CA   . LEU B 2 7  ? 10.384  -4.298  6.820   1.00 0.00 ? 204 LEU B CA   8  
ATOM 6625  C C    . LEU B 2 7  ? 9.616   -3.633  7.961   1.00 0.00 ? 204 LEU B C    8  
ATOM 6626  O O    . LEU B 2 7  ? 9.280   -2.452  7.887   1.00 0.00 ? 204 LEU B O    8  
ATOM 6627  C CB   . LEU B 2 7  ? 9.840   -3.815  5.475   1.00 0.00 ? 204 LEU B CB   8  
ATOM 6628  C CG   . LEU B 2 7  ? 10.832  -3.038  4.609   1.00 0.00 ? 204 LEU B CG   8  
ATOM 6629  C CD1  . LEU B 2 7  ? 12.168  -3.759  4.548   1.00 0.00 ? 204 LEU B CD1  8  
ATOM 6630  C CD2  . LEU B 2 7  ? 10.268  -2.845  3.212   1.00 0.00 ? 204 LEU B CD2  8  
ATOM 6631  H H    . LEU B 2 7  ? 9.455   -6.155  7.227   1.00 0.00 ? 204 LEU B H    8  
ATOM 6632  H HA   . LEU B 2 7  ? 11.426  -4.029  6.893   1.00 0.00 ? 204 LEU B HA   8  
ATOM 6633  H HB2  . LEU B 2 7  ? 9.507   -4.677  4.916   1.00 0.00 ? 204 LEU B HB2  8  
ATOM 6634  H HG   . LEU B 2 7  ? 10.996  -2.062  5.044   1.00 0.00 ? 204 LEU B HG   8  
ATOM 6635  H HD11 . LEU B 2 7  ? 12.002  -4.812  4.384   1.00 0.00 ? 204 LEU B HD11 8  
ATOM 6636  H HD12 . LEU B 2 7  ? 12.756  -3.357  3.737   1.00 0.00 ? 204 LEU B HD12 8  
ATOM 6637  H HD13 . LEU B 2 7  ? 12.698  -3.618  5.479   1.00 0.00 ? 204 LEU B HD13 8  
ATOM 6638  H HD21 . LEU B 2 7  ? 10.190  -1.790  2.998   1.00 0.00 ? 204 LEU B HD21 8  
ATOM 6639  H HD22 . LEU B 2 7  ? 10.926  -3.310  2.494   1.00 0.00 ? 204 LEU B HD22 8  
ATOM 6640  H HD23 . LEU B 2 7  ? 9.290   -3.300  3.153   1.00 0.00 ? 204 LEU B HD23 8  
ATOM 6641  N N    . GLU B 2 8  ? 9.349   -4.394  9.020   1.00 0.00 ? 205 GLU B N    8  
ATOM 6642  C CA   . GLU B 2 8  ? 8.609   -3.877  10.166  1.00 0.00 ? 205 GLU B CA   8  
ATOM 6643  C C    . GLU B 2 8  ? 7.135   -3.705  9.808   1.00 0.00 ? 205 GLU B C    8  
ATOM 6644  O O    . GLU B 2 8  ? 6.283   -4.459  10.279  1.00 0.00 ? 205 GLU B O    8  
ATOM 6645  C CB   . GLU B 2 8  ? 9.205   -2.548  10.641  1.00 0.00 ? 205 GLU B CB   8  
ATOM 6646  C CG   . GLU B 2 8  ? 8.866   -2.212  12.084  1.00 0.00 ? 205 GLU B CG   8  
ATOM 6647  C CD   . GLU B 2 8  ? 10.051  -1.658  12.849  1.00 0.00 ? 205 GLU B CD   8  
ATOM 6648  O OE1  . GLU B 2 8  ? 11.043  -1.262  12.203  1.00 0.00 ? 205 GLU B OE1  8  
ATOM 6649  O OE2  . GLU B 2 8  ? 9.985   -1.618  14.097  1.00 0.00 ? 205 GLU B OE2  8  
ATOM 6650  H H    . GLU B 2 8  ? 9.659   -5.323  9.032   1.00 0.00 ? 205 GLU B H    8  
ATOM 6651  H HA   . GLU B 2 8  ? 8.687   -4.602  10.964  1.00 0.00 ? 205 GLU B HA   8  
ATOM 6652  H HB2  . GLU B 2 8  ? 10.280  -2.596  10.549  1.00 0.00 ? 205 GLU B HB2  8  
ATOM 6653  H HG2  . GLU B 2 8  ? 8.076   -1.477  12.093  1.00 0.00 ? 205 GLU B HG2  8  
ATOM 6654  N N    . SER B 2 9  ? 6.836   -2.710  8.972   1.00 0.00 ? 206 SER B N    8  
ATOM 6655  C CA   . SER B 2 9  ? 5.462   -2.455  8.541   1.00 0.00 ? 206 SER B CA   8  
ATOM 6656  C C    . SER B 2 9  ? 5.339   -1.111  7.825   1.00 0.00 ? 206 SER B C    8  
ATOM 6657  O O    . SER B 2 9  ? 4.639   -0.214  8.296   1.00 0.00 ? 206 SER B O    8  
ATOM 6658  C CB   . SER B 2 9  ? 4.507   -2.486  9.740   1.00 0.00 ? 206 SER B CB   8  
ATOM 6659  O OG   . SER B 2 9  ? 3.856   -3.741  9.842   1.00 0.00 ? 206 SER B OG   8  
ATOM 6660  H H    . SER B 2 9  ? 7.555   -2.132  8.640   1.00 0.00 ? 206 SER B H    8  
ATOM 6661  H HA   . SER B 2 9  ? 5.182   -3.239  7.854   1.00 0.00 ? 206 SER B HA   8  
ATOM 6662  H HB2  . SER B 2 9  ? 5.066   -2.311  10.647  1.00 0.00 ? 206 SER B HB2  8  
ATOM 6663  H HG   . SER B 2 9  ? 4.492   -4.444  9.692   1.00 0.00 ? 206 SER B HG   8  
ATOM 6664  N N    . PRO B 2 10 ? 6.015   -0.950  6.671   1.00 0.00 ? 207 PRO B N    8  
ATOM 6665  C CA   . PRO B 2 10 ? 5.968   0.289   5.895   1.00 0.00 ? 207 PRO B CA   8  
ATOM 6666  C C    . PRO B 2 10 ? 4.623   0.564   5.202   1.00 0.00 ? 207 PRO B C    8  
ATOM 6667  O O    . PRO B 2 10 ? 4.271   1.731   5.029   1.00 0.00 ? 207 PRO B O    8  
ATOM 6668  C CB   . PRO B 2 10 ? 7.082   0.119   4.855   1.00 0.00 ? 207 PRO B CB   8  
ATOM 6669  C CG   . PRO B 2 10 ? 7.868   -1.069  5.298   1.00 0.00 ? 207 PRO B CG   8  
ATOM 6670  C CD   . PRO B 2 10 ? 6.901   -1.941  6.039   1.00 0.00 ? 207 PRO B CD   8  
ATOM 6671  H HA   . PRO B 2 10 ? 6.202   1.135   6.517   1.00 0.00 ? 207 PRO B HA   8  
ATOM 6672  H HB2  . PRO B 2 10 ? 6.646   -0.037  3.885   1.00 0.00 ? 207 PRO B HB2  8  
ATOM 6673  H HG2  . PRO B 2 10 ? 8.262   -1.590  4.439   1.00 0.00 ? 207 PRO B HG2  8  
ATOM 6674  H HD2  . PRO B 2 10 ? 6.364   -2.570  5.348   1.00 0.00 ? 207 PRO B HD2  8  
ATOM 6675  N N    . PRO B 2 11 ? 3.847   -0.471  4.774   1.00 0.00 ? 208 PRO B N    8  
ATOM 6676  C CA   . PRO B 2 11 ? 2.573   -0.252  4.101   1.00 0.00 ? 208 PRO B CA   8  
ATOM 6677  C C    . PRO B 2 11 ? 1.783   0.913   4.678   1.00 0.00 ? 208 PRO B C    8  
ATOM 6678  O O    . PRO B 2 11 ? 1.425   0.895   5.856   1.00 0.00 ? 208 PRO B O    8  
ATOM 6679  C CB   . PRO B 2 11 ? 1.808   -1.551  4.327   1.00 0.00 ? 208 PRO B CB   8  
ATOM 6680  C CG   . PRO B 2 11 ? 2.844   -2.599  4.542   1.00 0.00 ? 208 PRO B CG   8  
ATOM 6681  C CD   . PRO B 2 11 ? 4.147   -1.909  4.864   1.00 0.00 ? 208 PRO B CD   8  
ATOM 6682  H HA   . PRO B 2 11 ? 2.715   -0.109  3.052   1.00 0.00 ? 208 PRO B HA   8  
ATOM 6683  H HB2  . PRO B 2 11 ? 1.162   -1.446  5.185   1.00 0.00 ? 208 PRO B HB2  8  
ATOM 6684  H HG2  . PRO B 2 11 ? 2.552   -3.233  5.365   1.00 0.00 ? 208 PRO B HG2  8  
ATOM 6685  H HD2  . PRO B 2 11 ? 4.459   -2.181  5.851   1.00 0.00 ? 208 PRO B HD2  8  
ATOM 6686  N N    . PRO B 2 12 ? 1.547   1.965   3.871   1.00 0.00 ? 209 PRO B N    8  
ATOM 6687  C CA   . PRO B 2 12 ? 0.767   3.131   4.287   1.00 0.00 ? 209 PRO B CA   8  
ATOM 6688  C C    . PRO B 2 12 ? -0.533  2.735   4.993   1.00 0.00 ? 209 PRO B C    8  
ATOM 6689  O O    . PRO B 2 12 ? -0.759  1.563   5.280   1.00 0.00 ? 209 PRO B O    8  
ATOM 6690  C CB   . PRO B 2 12 ? 0.475   3.849   2.961   1.00 0.00 ? 209 PRO B CB   8  
ATOM 6691  C CG   . PRO B 2 12 ? 0.983   2.960   1.887   1.00 0.00 ? 209 PRO B CG   8  
ATOM 6692  C CD   . PRO B 2 12 ? 2.058   2.145   2.507   1.00 0.00 ? 209 PRO B CD   8  
ATOM 6693  H HA   . PRO B 2 12 ? 1.342   3.779   4.932   1.00 0.00 ? 209 PRO B HA   8  
ATOM 6694  H HB2  . PRO B 2 12 ? -0.581  3.988   2.853   1.00 0.00 ? 209 PRO B HB2  8  
ATOM 6695  H HG2  . PRO B 2 12 ? 0.189   2.321   1.551   1.00 0.00 ? 209 PRO B HG2  8  
ATOM 6696  H HD2  . PRO B 2 12 ? 2.155   1.211   1.983   1.00 0.00 ? 209 PRO B HD2  8  
ATOM 6697  N N    . PRO B 2 13 ? -1.431  3.697   5.254   1.00 0.00 ? 210 PRO B N    8  
ATOM 6698  C CA   . PRO B 2 13 ? -2.675  3.423   5.947   1.00 0.00 ? 210 PRO B CA   8  
ATOM 6699  C C    . PRO B 2 13 ? -3.787  2.998   5.004   1.00 0.00 ? 210 PRO B C    8  
ATOM 6700  O O    . PRO B 2 13 ? -3.625  3.022   3.784   1.00 0.00 ? 210 PRO B O    8  
ATOM 6701  C CB   . PRO B 2 13 ? -3.003  4.760   6.594   1.00 0.00 ? 210 PRO B CB   8  
ATOM 6702  C CG   . PRO B 2 13 ? -2.392  5.795   5.702   1.00 0.00 ? 210 PRO B CG   8  
ATOM 6703  C CD   . PRO B 2 13 ? -1.340  5.109   4.859   1.00 0.00 ? 210 PRO B CD   8  
ATOM 6704  H HA   . PRO B 2 13 ? -2.545  2.674   6.710   1.00 0.00 ? 210 PRO B HA   8  
ATOM 6705  H HB2  . PRO B 2 13 ? -4.075  4.872   6.651   1.00 0.00 ? 210 PRO B HB2  8  
ATOM 6706  H HG2  . PRO B 2 13 ? -3.155  6.216   5.064   1.00 0.00 ? 210 PRO B HG2  8  
ATOM 6707  H HD2  . PRO B 2 13 ? -1.577  5.223   3.810   1.00 0.00 ? 210 PRO B HD2  8  
ATOM 6708  N N    . TYR B 2 14 ? -4.917  2.610   5.577   1.00 0.00 ? 211 TYR B N    8  
ATOM 6709  C CA   . TYR B 2 14 ? -6.054  2.181   4.784   1.00 0.00 ? 211 TYR B CA   8  
ATOM 6710  C C    . TYR B 2 14 ? -6.604  3.347   3.966   1.00 0.00 ? 211 TYR B C    8  
ATOM 6711  O O    . TYR B 2 14 ? -6.312  3.476   2.778   1.00 0.00 ? 211 TYR B O    8  
ATOM 6712  C CB   . TYR B 2 14 ? -7.153  1.604   5.688   1.00 0.00 ? 211 TYR B CB   8  
ATOM 6713  C CG   . TYR B 2 14 ? -8.475  1.392   4.980   1.00 0.00 ? 211 TYR B CG   8  
ATOM 6714  C CD1  . TYR B 2 14 ? -8.524  0.727   3.768   1.00 0.00 ? 211 TYR B CD1  8  
ATOM 6715  C CD2  . TYR B 2 14 ? -9.665  1.870   5.516   1.00 0.00 ? 211 TYR B CD2  8  
ATOM 6716  C CE1  . TYR B 2 14 ? -9.718  0.539   3.100   1.00 0.00 ? 211 TYR B CE1  8  
ATOM 6717  C CE2  . TYR B 2 14 ? -10.867 1.684   4.858   1.00 0.00 ? 211 TYR B CE2  8  
ATOM 6718  C CZ   . TYR B 2 14 ? -10.888 1.019   3.650   1.00 0.00 ? 211 TYR B CZ   8  
ATOM 6719  O OH   . TYR B 2 14 ? -12.081 0.833   2.991   1.00 0.00 ? 211 TYR B OH   8  
ATOM 6720  H H    . TYR B 2 14 ? -4.987  2.613   6.554   1.00 0.00 ? 211 TYR B H    8  
ATOM 6721  H HA   . TYR B 2 14 ? -5.710  1.411   4.107   1.00 0.00 ? 211 TYR B HA   8  
ATOM 6722  H HB2  . TYR B 2 14 ? -6.828  0.650   6.074   1.00 0.00 ? 211 TYR B HB2  8  
ATOM 6723  H HD1  . TYR B 2 14 ? -7.608  0.350   3.345   1.00 0.00 ? 211 TYR B HD1  8  
ATOM 6724  H HD2  . TYR B 2 14 ? -9.643  2.392   6.460   1.00 0.00 ? 211 TYR B HD2  8  
ATOM 6725  H HE1  . TYR B 2 14 ? -9.731  0.018   2.153   1.00 0.00 ? 211 TYR B HE1  8  
ATOM 6726  H HE2  . TYR B 2 14 ? -11.783 2.060   5.290   1.00 0.00 ? 211 TYR B HE2  8  
ATOM 6727  H HH   . TYR B 2 14 ? -12.463 -0.009  3.247   1.00 0.00 ? 211 TYR B HH   8  
ATOM 6728  N N    . SER B 2 15 ? -7.398  4.193   4.616   1.00 0.00 ? 212 SER B N    8  
ATOM 6729  C CA   . SER B 2 15 ? -7.996  5.341   3.948   1.00 0.00 ? 212 SER B CA   8  
ATOM 6730  C C    . SER B 2 15 ? -8.840  4.887   2.762   1.00 0.00 ? 212 SER B C    8  
ATOM 6731  O O    . SER B 2 15 ? -10.051 4.712   2.887   1.00 0.00 ? 212 SER B O    8  
ATOM 6732  C CB   . SER B 2 15 ? -6.913  6.317   3.487   1.00 0.00 ? 212 SER B CB   8  
ATOM 6733  O OG   . SER B 2 15 ? -7.456  7.325   2.650   1.00 0.00 ? 212 SER B OG   8  
ATOM 6734  H H    . SER B 2 15 ? -7.583  4.042   5.566   1.00 0.00 ? 212 SER B H    8  
ATOM 6735  H HA   . SER B 2 15 ? -8.638  5.840   4.660   1.00 0.00 ? 212 SER B HA   8  
ATOM 6736  H HB2  . SER B 2 15 ? -6.465  6.787   4.350   1.00 0.00 ? 212 SER B HB2  8  
ATOM 6737  H HG   . SER B 2 15 ? -7.746  6.933   1.823   1.00 0.00 ? 212 SER B HG   8  
ATOM 6738  N N    . ARG B 2 16 ? -8.189  4.695   1.613   1.00 0.00 ? 213 ARG B N    8  
ATOM 6739  C CA   . ARG B 2 16 ? -8.865  4.252   0.391   1.00 0.00 ? 213 ARG B CA   8  
ATOM 6740  C C    . ARG B 2 16 ? -7.997  4.539   -0.830  1.00 0.00 ? 213 ARG B C    8  
ATOM 6741  O O    . ARG B 2 16 ? -7.913  3.726   -1.749  1.00 0.00 ? 213 ARG B O    8  
ATOM 6742  C CB   . ARG B 2 16 ? -10.229 4.936   0.229   1.00 0.00 ? 213 ARG B CB   8  
ATOM 6743  C CG   . ARG B 2 16 ? -11.398 4.077   0.687   1.00 0.00 ? 213 ARG B CG   8  
ATOM 6744  C CD   . ARG B 2 16 ? -12.197 3.539   -0.489  1.00 0.00 ? 213 ARG B CD   8  
ATOM 6745  N NE   . ARG B 2 16 ? -13.567 4.045   -0.495  1.00 0.00 ? 213 ARG B NE   8  
ATOM 6746  C CZ   . ARG B 2 16 ? -14.456 3.775   0.454   1.00 0.00 ? 213 ARG B CZ   8  
ATOM 6747  N NH1  . ARG B 2 16 ? -14.120 3.008   1.483   1.00 0.00 ? 213 ARG B NH1  8  
ATOM 6748  N NH2  . ARG B 2 16 ? -15.684 4.272   0.378   1.00 0.00 ? 213 ARG B NH2  8  
ATOM 6749  H H    . ARG B 2 16 ? -7.222  4.853   1.586   1.00 0.00 ? 213 ARG B H    8  
ATOM 6750  H HA   . ARG B 2 16 ? -9.012  3.184   0.467   1.00 0.00 ? 213 ARG B HA   8  
ATOM 6751  H HB2  . ARG B 2 16 ? -10.232 5.848   0.806   1.00 0.00 ? 213 ARG B HB2  8  
ATOM 6752  H HG2  . ARG B 2 16 ? -11.016 3.245   1.259   1.00 0.00 ? 213 ARG B HG2  8  
ATOM 6753  H HD2  . ARG B 2 16 ? -11.709 3.835   -1.405  1.00 0.00 ? 213 ARG B HD2  8  
ATOM 6754  H HE   . ARG B 2 16 ? -13.837 4.614   -1.247  1.00 0.00 ? 213 ARG B HE   8  
ATOM 6755  H HH11 . ARG B 2 16 ? -13.195 2.633   1.546   1.00 0.00 ? 213 ARG B HH11 8  
ATOM 6756  H HH12 . ARG B 2 16 ? -14.791 2.807   2.197   1.00 0.00 ? 213 ARG B HH12 8  
ATOM 6757  H HH21 . ARG B 2 16 ? -15.941 4.851   -0.397  1.00 0.00 ? 213 ARG B HH21 8  
ATOM 6758  H HH22 . ARG B 2 16 ? -16.352 4.067   1.093   1.00 0.00 ? 213 ARG B HH22 8  
ATOM 6759  N N    . TYR B 2 17 ? -7.353  5.702   -0.830  1.00 0.00 ? 214 TYR B N    8  
ATOM 6760  C CA   . TYR B 2 17 ? -6.489  6.103   -1.935  1.00 0.00 ? 214 TYR B CA   8  
ATOM 6761  C C    . TYR B 2 17 ? -5.038  5.712   -1.663  1.00 0.00 ? 214 TYR B C    8  
ATOM 6762  O O    . TYR B 2 17 ? -4.704  5.253   -0.571  1.00 0.00 ? 214 TYR B O    8  
ATOM 6763  C CB   . TYR B 2 17 ? -6.587  7.612   -2.163  1.00 0.00 ? 214 TYR B CB   8  
ATOM 6764  C CG   . TYR B 2 17 ? -7.970  8.170   -1.944  1.00 0.00 ? 214 TYR B CG   8  
ATOM 6765  C CD1  . TYR B 2 17 ? -9.095  7.407   -2.219  1.00 0.00 ? 214 TYR B CD1  8  
ATOM 6766  C CD2  . TYR B 2 17 ? -8.151  9.462   -1.469  1.00 0.00 ? 214 TYR B CD2  8  
ATOM 6767  C CE1  . TYR B 2 17 ? -10.363 7.914   -2.030  1.00 0.00 ? 214 TYR B CE1  8  
ATOM 6768  C CE2  . TYR B 2 17 ? -9.416  9.977   -1.275  1.00 0.00 ? 214 TYR B CE2  8  
ATOM 6769  C CZ   . TYR B 2 17 ? -10.521 9.200   -1.556  1.00 0.00 ? 214 TYR B CZ   8  
ATOM 6770  O OH   . TYR B 2 17 ? -11.784 9.710   -1.365  1.00 0.00 ? 214 TYR B OH   8  
ATOM 6771  H H    . TYR B 2 17 ? -7.462  6.306   -0.067  1.00 0.00 ? 214 TYR B H    8  
ATOM 6772  H HA   . TYR B 2 17 ? -6.825  5.592   -2.824  1.00 0.00 ? 214 TYR B HA   8  
ATOM 6773  H HB2  . TYR B 2 17 ? -5.915  8.117   -1.486  1.00 0.00 ? 214 TYR B HB2  8  
ATOM 6774  H HD1  . TYR B 2 17 ? -8.968  6.400   -2.589  1.00 0.00 ? 214 TYR B HD1  8  
ATOM 6775  H HD2  . TYR B 2 17 ? -7.284  10.067  -1.252  1.00 0.00 ? 214 TYR B HD2  8  
ATOM 6776  H HE1  . TYR B 2 17 ? -11.224 7.304   -2.251  1.00 0.00 ? 214 TYR B HE1  8  
ATOM 6777  H HE2  . TYR B 2 17 ? -9.536  10.983  -0.906  1.00 0.00 ? 214 TYR B HE2  8  
ATOM 6778  H HH   . TYR B 2 17 ? -12.386 9.320   -2.001  1.00 0.00 ? 214 TYR B HH   8  
ATOM 6779  N N    . PRO B 2 18 ? -4.154  5.892   -2.660  1.00 0.00 ? 215 PRO B N    8  
ATOM 6780  C CA   . PRO B 2 18 ? -2.741  5.566   -2.529  1.00 0.00 ? 215 PRO B CA   8  
ATOM 6781  C C    . PRO B 2 18 ? -1.947  6.706   -1.914  1.00 0.00 ? 215 PRO B C    8  
ATOM 6782  O O    . PRO B 2 18 ? -1.542  7.643   -2.604  1.00 0.00 ? 215 PRO B O    8  
ATOM 6783  C CB   . PRO B 2 18 ? -2.308  5.312   -3.972  1.00 0.00 ? 215 PRO B CB   8  
ATOM 6784  C CG   . PRO B 2 18 ? -3.243  6.114   -4.823  1.00 0.00 ? 215 PRO B CG   8  
ATOM 6785  C CD   . PRO B 2 18 ? -4.466  6.433   -3.992  1.00 0.00 ? 215 PRO B CD   8  
ATOM 6786  H HA   . PRO B 2 18 ? -2.592  4.673   -1.939  1.00 0.00 ? 215 PRO B HA   8  
ATOM 6787  H HB2  . PRO B 2 18 ? -1.286  5.633   -4.104  1.00 0.00 ? 215 PRO B HB2  8  
ATOM 6788  H HG2  . PRO B 2 18 ? -2.759  7.028   -5.131  1.00 0.00 ? 215 PRO B HG2  8  
ATOM 6789  H HD2  . PRO B 2 18 ? -4.613  7.499   -3.944  1.00 0.00 ? 215 PRO B HD2  8  
ATOM 6790  N N    . MET B 2 19 ? -1.728  6.617   -0.610  1.00 0.00 ? 216 MET B N    8  
ATOM 6791  C CA   . MET B 2 19 ? -0.984  7.638   0.107   1.00 0.00 ? 216 MET B CA   8  
ATOM 6792  C C    . MET B 2 19 ? 0.120   7.012   0.941   1.00 0.00 ? 216 MET B C    8  
ATOM 6793  O O    . MET B 2 19 ? -0.138  6.204   1.827   1.00 0.00 ? 216 MET B O    8  
ATOM 6794  C CB   . MET B 2 19 ? -1.921  8.487   0.985   1.00 0.00 ? 216 MET B CB   8  
ATOM 6795  C CG   . MET B 2 19 ? -2.481  7.775   2.215   1.00 0.00 ? 216 MET B CG   8  
ATOM 6796  S SD   . MET B 2 19 ? -3.667  6.480   1.806   1.00 0.00 ? 216 MET B SD   8  
ATOM 6797  C CE   . MET B 2 19 ? -5.059  7.456   1.245   1.00 0.00 ? 216 MET B CE   8  
ATOM 6798  H H    . MET B 2 19 ? -2.062  5.837   -0.123  1.00 0.00 ? 216 MET B H    8  
ATOM 6799  H HA   . MET B 2 19 ? -0.525  8.278   -0.630  1.00 0.00 ? 216 MET B HA   8  
ATOM 6800  H HB2  . MET B 2 19 ? -1.380  9.357   1.322   1.00 0.00 ? 216 MET B HB2  8  
ATOM 6801  H HG2  . MET B 2 19 ? -1.669  7.335   2.771   1.00 0.00 ? 216 MET B HG2  8  
ATOM 6802  H HE1  . MET B 2 19 ? -4.747  8.095   0.433   1.00 0.00 ? 216 MET B HE1  8  
ATOM 6803  H HE2  . MET B 2 19 ? -5.846  6.798   0.904   1.00 0.00 ? 216 MET B HE2  8  
ATOM 6804  H HE3  . MET B 2 19 ? -5.426  8.062   2.061   1.00 0.00 ? 216 MET B HE3  8  
ATOM 6805  N N    . ASP B 2 20 ? 1.357   7.375   0.626   1.00 0.00 ? 217 ASP B N    8  
ATOM 6806  C CA   . ASP B 2 20 ? 2.520   6.859   1.341   1.00 0.00 ? 217 ASP B CA   8  
ATOM 6807  C C    . ASP B 2 20 ? 2.325   6.959   2.851   1.00 0.00 ? 217 ASP B C    8  
ATOM 6808  O O    . ASP B 2 20 ? 1.486   7.774   3.286   1.00 0.00 ? 217 ASP B O    8  
ATOM 6809  C CB   . ASP B 2 20 ? 3.778   7.625   0.927   1.00 0.00 ? 217 ASP B CB   8  
ATOM 6810  C CG   . ASP B 2 20 ? 3.643   9.120   1.146   1.00 0.00 ? 217 ASP B CG   8  
ATOM 6811  O OD1  . ASP B 2 20 ? 2.721   9.726   0.561   1.00 0.00 ? 217 ASP B OD1  8  
ATOM 6812  O OD2  . ASP B 2 20 ? 4.460   9.684   1.903   1.00 0.00 ? 217 ASP B OD2  8  
ATOM 6813  O OXT  . ASP B 2 20 ? 3.015   6.220   3.586   1.00 0.00 ? 217 ASP B OXT  8  
ATOM 6814  H H    . ASP B 2 20 ? 1.491   8.000   -0.116  1.00 0.00 ? 217 ASP B H    8  
ATOM 6815  H HA   . ASP B 2 20 ? 2.639   5.819   1.073   1.00 0.00 ? 217 ASP B HA   8  
ATOM 6816  H HB2  . ASP B 2 20 ? 4.616   7.269   1.506   1.00 0.00 ? 217 ASP B HB2  8  
ATOM 6817  N N    . GLY A 1 1  ? 9.468   -8.559  -5.132  1.00 0.00 ? 292 GLY A N    9  
ATOM 6818  C CA   . GLY A 1 1  ? 8.330   -7.766  -4.591  1.00 0.00 ? 292 GLY A CA   9  
ATOM 6819  C C    . GLY A 1 1  ? 6.985   -8.399  -4.893  1.00 0.00 ? 292 GLY A C    9  
ATOM 6820  O O    . GLY A 1 1  ? 6.880   -9.236  -5.790  1.00 0.00 ? 292 GLY A O    9  
ATOM 6821  H H1   . GLY A 1 1  ? 9.152   -9.521  -5.369  1.00 0.00 ? 292 GLY A H1   9  
ATOM 6822  H H2   . GLY A 1 1  ? 10.229  -8.620  -4.425  1.00 0.00 ? 292 GLY A H2   9  
ATOM 6823  H H3   . GLY A 1 1  ? 9.842   -8.107  -5.990  1.00 0.00 ? 292 GLY A H3   9  
ATOM 6824  H HA2  . GLY A 1 1  ? 8.442   -7.681  -3.520  1.00 0.00 ? 292 GLY A HA2  9  
ATOM 6825  H HA3  . GLY A 1 1  ? 8.356   -6.777  -5.024  1.00 0.00 ? 292 GLY A HA3  9  
ATOM 6826  N N    . PRO A 1 2  ? 5.931   -8.018  -4.151  1.00 0.00 ? 293 PRO A N    9  
ATOM 6827  C CA   . PRO A 1 2  ? 4.582   -8.559  -4.351  1.00 0.00 ? 293 PRO A CA   9  
ATOM 6828  C C    . PRO A 1 2  ? 4.133   -8.494  -5.806  1.00 0.00 ? 293 PRO A C    9  
ATOM 6829  O O    . PRO A 1 2  ? 4.911   -8.143  -6.694  1.00 0.00 ? 293 PRO A O    9  
ATOM 6830  C CB   . PRO A 1 2  ? 3.711   -7.652  -3.484  1.00 0.00 ? 293 PRO A CB   9  
ATOM 6831  C CG   . PRO A 1 2  ? 4.623   -7.183  -2.407  1.00 0.00 ? 293 PRO A CG   9  
ATOM 6832  C CD   . PRO A 1 2  ? 5.972   -7.035  -3.052  1.00 0.00 ? 293 PRO A CD   9  
ATOM 6833  H HA   . PRO A 1 2  ? 4.508   -9.577  -3.999  1.00 0.00 ? 293 PRO A HA   9  
ATOM 6834  H HB2  . PRO A 1 2  ? 3.342   -6.830  -4.079  1.00 0.00 ? 293 PRO A HB2  9  
ATOM 6835  H HG2  . PRO A 1 2  ? 4.281   -6.232  -2.024  1.00 0.00 ? 293 PRO A HG2  9  
ATOM 6836  H HD2  . PRO A 1 2  ? 6.101   -6.033  -3.435  1.00 0.00 ? 293 PRO A HD2  9  
ATOM 6837  N N    . LEU A 1 3  ? 2.868   -8.832  -6.043  1.00 0.00 ? 294 LEU A N    9  
ATOM 6838  C CA   . LEU A 1 3  ? 2.309   -8.822  -7.390  1.00 0.00 ? 294 LEU A CA   9  
ATOM 6839  C C    . LEU A 1 3  ? 0.828   -9.230  -7.374  1.00 0.00 ? 294 LEU A C    9  
ATOM 6840  O O    . LEU A 1 3  ? -0.038  -8.397  -7.107  1.00 0.00 ? 294 LEU A O    9  
ATOM 6841  C CB   . LEU A 1 3  ? 3.124   -9.734  -8.321  1.00 0.00 ? 294 LEU A CB   9  
ATOM 6842  C CG   . LEU A 1 3  ? 3.976   -10.816 -7.634  1.00 0.00 ? 294 LEU A CG   9  
ATOM 6843  C CD1  . LEU A 1 3  ? 3.208   -11.525 -6.521  1.00 0.00 ? 294 LEU A CD1  9  
ATOM 6844  C CD2  . LEU A 1 3  ? 4.464   -11.825 -8.663  1.00 0.00 ? 294 LEU A CD2  9  
ATOM 6845  H H    . LEU A 1 3  ? 2.298   -9.097  -5.292  1.00 0.00 ? 294 LEU A H    9  
ATOM 6846  H HA   . LEU A 1 3  ? 2.375   -7.808  -7.758  1.00 0.00 ? 294 LEU A HA   9  
ATOM 6847  H HB2  . LEU A 1 3  ? 2.444   -10.220 -9.003  1.00 0.00 ? 294 LEU A HB2  9  
ATOM 6848  H HG   . LEU A 1 3  ? 4.844   -10.351 -7.193  1.00 0.00 ? 294 LEU A HG   9  
ATOM 6849  H HD11 . LEU A 1 3  ? 2.299   -10.987 -6.297  1.00 0.00 ? 294 LEU A HD11 9  
ATOM 6850  H HD12 . LEU A 1 3  ? 2.962   -12.527 -6.835  1.00 0.00 ? 294 LEU A HD12 9  
ATOM 6851  H HD13 . LEU A 1 3  ? 3.823   -11.569 -5.634  1.00 0.00 ? 294 LEU A HD13 9  
ATOM 6852  H HD21 . LEU A 1 3  ? 4.686   -11.316 -9.589  1.00 0.00 ? 294 LEU A HD21 9  
ATOM 6853  H HD22 . LEU A 1 3  ? 5.356   -12.310 -8.296  1.00 0.00 ? 294 LEU A HD22 9  
ATOM 6854  H HD23 . LEU A 1 3  ? 3.696   -12.565 -8.834  1.00 0.00 ? 294 LEU A HD23 9  
ATOM 6855  N N    . GLY A 1 4  ? 0.530   -10.502 -7.661  1.00 0.00 ? 295 GLY A N    9  
ATOM 6856  C CA   . GLY A 1 4  ? -0.849  -10.953 -7.660  1.00 0.00 ? 295 GLY A CA   9  
ATOM 6857  C C    . GLY A 1 4  ? -1.216  -11.701 -8.927  1.00 0.00 ? 295 GLY A C    9  
ATOM 6858  O O    . GLY A 1 4  ? -1.867  -12.744 -8.874  1.00 0.00 ? 295 GLY A O    9  
ATOM 6859  H H    . GLY A 1 4  ? 1.241   -11.136 -7.871  1.00 0.00 ? 295 GLY A H    9  
ATOM 6860  H HA2  . GLY A 1 4  ? -1.002  -11.607 -6.814  1.00 0.00 ? 295 GLY A HA2  9  
ATOM 6861  H HA3  . GLY A 1 4  ? -1.497  -10.097 -7.561  1.00 0.00 ? 295 GLY A HA3  9  
ATOM 6862  N N    . SER A 1 5  ? -0.798  -11.167 -10.070 1.00 0.00 ? 296 SER A N    9  
ATOM 6863  C CA   . SER A 1 5  ? -1.086  -11.791 -11.357 1.00 0.00 ? 296 SER A CA   9  
ATOM 6864  C C    . SER A 1 5  ? -2.575  -12.094 -11.494 1.00 0.00 ? 296 SER A C    9  
ATOM 6865  O O    . SER A 1 5  ? -2.967  -13.016 -12.208 1.00 0.00 ? 296 SER A O    9  
ATOM 6866  C CB   . SER A 1 5  ? -0.277  -13.079 -11.516 1.00 0.00 ? 296 SER A CB   9  
ATOM 6867  O OG   . SER A 1 5  ? -0.942  -14.178 -10.917 1.00 0.00 ? 296 SER A OG   9  
ATOM 6868  H H    . SER A 1 5  ? -0.282  -10.334 -10.048 1.00 0.00 ? 296 SER A H    9  
ATOM 6869  H HA   . SER A 1 5  ? -0.799  -11.098 -12.133 1.00 0.00 ? 296 SER A HA   9  
ATOM 6870  H HB2  . SER A 1 5  ? -0.140  -13.288 -12.566 1.00 0.00 ? 296 SER A HB2  9  
ATOM 6871  H HG   . SER A 1 5  ? -1.502  -14.607 -11.568 1.00 0.00 ? 296 SER A HG   9  
ATOM 6872  N N    . GLY A 1 6  ? -3.400  -11.311 -10.805 1.00 0.00 ? 297 GLY A N    9  
ATOM 6873  C CA   . GLY A 1 6  ? -4.836  -11.513 -10.864 1.00 0.00 ? 297 GLY A CA   9  
ATOM 6874  C C    . GLY A 1 6  ? -5.598  -10.493 -10.040 1.00 0.00 ? 297 GLY A C    9  
ATOM 6875  O O    . GLY A 1 6  ? -5.158  -10.122 -8.951  1.00 0.00 ? 297 GLY A O    9  
ATOM 6876  H H    . GLY A 1 6  ? -3.030  -10.591 -10.252 1.00 0.00 ? 297 GLY A H    9  
ATOM 6877  H HA2  . GLY A 1 6  ? -5.155  -11.441 -11.893 1.00 0.00 ? 297 GLY A HA2  9  
ATOM 6878  H HA3  . GLY A 1 6  ? -5.065  -12.501 -10.496 1.00 0.00 ? 297 GLY A HA3  9  
ATOM 6879  N N    . PRO A 1 7  ? -6.753  -10.018 -10.536 1.00 0.00 ? 298 PRO A N    9  
ATOM 6880  C CA   . PRO A 1 7  ? -7.570  -9.031  -9.825  1.00 0.00 ? 298 PRO A CA   9  
ATOM 6881  C C    . PRO A 1 7  ? -7.852  -9.442  -8.384  1.00 0.00 ? 298 PRO A C    9  
ATOM 6882  O O    . PRO A 1 7  ? -8.450  -10.488 -8.132  1.00 0.00 ? 298 PRO A O    9  
ATOM 6883  C CB   . PRO A 1 7  ? -8.867  -8.992  -10.636 1.00 0.00 ? 298 PRO A CB   9  
ATOM 6884  C CG   . PRO A 1 7  ? -8.468  -9.414  -12.008 1.00 0.00 ? 298 PRO A CG   9  
ATOM 6885  C CD   . PRO A 1 7  ? -7.353  -10.407 -11.827 1.00 0.00 ? 298 PRO A CD   9  
ATOM 6886  H HA   . PRO A 1 7  ? -7.106  -8.056  -9.835  1.00 0.00 ? 298 PRO A HA   9  
ATOM 6887  H HB2  . PRO A 1 7  ? -9.585  -9.675  -10.205 1.00 0.00 ? 298 PRO A HB2  9  
ATOM 6888  H HG2  . PRO A 1 7  ? -9.306  -9.876  -12.508 1.00 0.00 ? 298 PRO A HG2  9  
ATOM 6889  H HD2  . PRO A 1 7  ? -7.748  -11.412 -11.782 1.00 0.00 ? 298 PRO A HD2  9  
ATOM 6890  N N    . LEU A 1 8  ? -7.418  -8.612  -7.444  1.00 0.00 ? 299 LEU A N    9  
ATOM 6891  C CA   . LEU A 1 8  ? -7.621  -8.886  -6.025  1.00 0.00 ? 299 LEU A CA   9  
ATOM 6892  C C    . LEU A 1 8  ? -9.097  -9.139  -5.724  1.00 0.00 ? 299 LEU A C    9  
ATOM 6893  O O    . LEU A 1 8  ? -9.968  -8.782  -6.516  1.00 0.00 ? 299 LEU A O    9  
ATOM 6894  C CB   . LEU A 1 8  ? -7.114  -7.716  -5.181  1.00 0.00 ? 299 LEU A CB   9  
ATOM 6895  C CG   . LEU A 1 8  ? -5.621  -7.415  -5.313  1.00 0.00 ? 299 LEU A CG   9  
ATOM 6896  C CD1  . LEU A 1 8  ? -5.314  -6.014  -4.809  1.00 0.00 ? 299 LEU A CD1  9  
ATOM 6897  C CD2  . LEU A 1 8  ? -4.802  -8.447  -4.553  1.00 0.00 ? 299 LEU A CD2  9  
ATOM 6898  H H    . LEU A 1 8  ? -6.949  -7.793  -7.709  1.00 0.00 ? 299 LEU A H    9  
ATOM 6899  H HA   . LEU A 1 8  ? -7.056  -9.771  -5.774  1.00 0.00 ? 299 LEU A HA   9  
ATOM 6900  H HB2  . LEU A 1 8  ? -7.664  -6.829  -5.464  1.00 0.00 ? 299 LEU A HB2  9  
ATOM 6901  H HG   . LEU A 1 8  ? -5.341  -7.465  -6.355  1.00 0.00 ? 299 LEU A HG   9  
ATOM 6902  H HD11 . LEU A 1 8  ? -5.500  -5.299  -5.596  1.00 0.00 ? 299 LEU A HD11 9  
ATOM 6903  H HD12 . LEU A 1 8  ? -5.948  -5.790  -3.963  1.00 0.00 ? 299 LEU A HD12 9  
ATOM 6904  H HD13 . LEU A 1 8  ? -4.279  -5.957  -4.508  1.00 0.00 ? 299 LEU A HD13 9  
ATOM 6905  H HD21 . LEU A 1 8  ? -5.282  -9.412  -4.624  1.00 0.00 ? 299 LEU A HD21 9  
ATOM 6906  H HD22 . LEU A 1 8  ? -3.811  -8.506  -4.977  1.00 0.00 ? 299 LEU A HD22 9  
ATOM 6907  H HD23 . LEU A 1 8  ? -4.731  -8.156  -3.514  1.00 0.00 ? 299 LEU A HD23 9  
ATOM 6908  N N    . PRO A 1 9  ? -9.393  -9.760  -4.568  1.00 0.00 ? 300 PRO A N    9  
ATOM 6909  C CA   . PRO A 1 9  ? -10.771 -10.054 -4.163  1.00 0.00 ? 300 PRO A CA   9  
ATOM 6910  C C    . PRO A 1 9  ? -11.649 -8.805  -4.179  1.00 0.00 ? 300 PRO A C    9  
ATOM 6911  O O    . PRO A 1 9  ? -11.216 -7.742  -4.621  1.00 0.00 ? 300 PRO A O    9  
ATOM 6912  C CB   . PRO A 1 9  ? -10.623 -10.590 -2.737  1.00 0.00 ? 300 PRO A CB   9  
ATOM 6913  C CG   . PRO A 1 9  ? -9.226  -11.102 -2.662  1.00 0.00 ? 300 PRO A CG   9  
ATOM 6914  C CD   . PRO A 1 9  ? -8.411  -10.223 -3.570  1.00 0.00 ? 300 PRO A CD   9  
ATOM 6915  H HA   . PRO A 1 9  ? -11.216 -10.812 -4.793  1.00 0.00 ? 300 PRO A HA   9  
ATOM 6916  H HB2  . PRO A 1 9  ? -10.790 -9.790  -2.030  1.00 0.00 ? 300 PRO A HB2  9  
ATOM 6917  H HG2  . PRO A 1 9  ? -8.863  -11.031 -1.648  1.00 0.00 ? 300 PRO A HG2  9  
ATOM 6918  H HD2  . PRO A 1 9  ? -8.000  -9.389  -3.018  1.00 0.00 ? 300 PRO A HD2  9  
ATOM 6919  N N    . PRO A 1 10 ? -12.897 -8.917  -3.693  1.00 0.00 ? 301 PRO A N    9  
ATOM 6920  C CA   . PRO A 1 10 ? -13.830 -7.794  -3.657  1.00 0.00 ? 301 PRO A CA   9  
ATOM 6921  C C    . PRO A 1 10 ? -13.636 -6.896  -2.436  1.00 0.00 ? 301 PRO A C    9  
ATOM 6922  O O    . PRO A 1 10 ? -14.471 -6.037  -2.152  1.00 0.00 ? 301 PRO A O    9  
ATOM 6923  C CB   . PRO A 1 10 ? -15.187 -8.489  -3.604  1.00 0.00 ? 301 PRO A CB   9  
ATOM 6924  C CG   . PRO A 1 10 ? -14.930 -9.755  -2.857  1.00 0.00 ? 301 PRO A CG   9  
ATOM 6925  C CD   . PRO A 1 10 ? -13.501 -10.149 -3.150  1.00 0.00 ? 301 PRO A CD   9  
ATOM 6926  H HA   . PRO A 1 10 ? -13.763 -7.197  -4.553  1.00 0.00 ? 301 PRO A HA   9  
ATOM 6927  H HB2  . PRO A 1 10 ? -15.897 -7.860  -3.086  1.00 0.00 ? 301 PRO A HB2  9  
ATOM 6928  H HG2  . PRO A 1 10 ? -15.061 -9.587  -1.798  1.00 0.00 ? 301 PRO A HG2  9  
ATOM 6929  H HD2  . PRO A 1 10 ? -13.004 -10.452 -2.241  1.00 0.00 ? 301 PRO A HD2  9  
ATOM 6930  N N    . GLY A 1 11 ? -12.537 -7.097  -1.716  1.00 0.00 ? 302 GLY A N    9  
ATOM 6931  C CA   . GLY A 1 11 ? -12.266 -6.289  -0.542  1.00 0.00 ? 302 GLY A CA   9  
ATOM 6932  C C    . GLY A 1 11 ? -10.812 -5.870  -0.443  1.00 0.00 ? 302 GLY A C    9  
ATOM 6933  O O    . GLY A 1 11 ? -10.350 -5.467  0.621   1.00 0.00 ? 302 GLY A O    9  
ATOM 6934  H H    . GLY A 1 11 ? -11.906 -7.797  -1.981  1.00 0.00 ? 302 GLY A H    9  
ATOM 6935  H HA2  . GLY A 1 11 ? -12.881 -5.403  -0.579  1.00 0.00 ? 302 GLY A HA2  9  
ATOM 6936  H HA3  . GLY A 1 11 ? -12.524 -6.855  0.338   1.00 0.00 ? 302 GLY A HA3  9  
ATOM 6937  N N    . TRP A 1 12 ? -10.088 -5.974  -1.552  1.00 0.00 ? 303 TRP A N    9  
ATOM 6938  C CA   . TRP A 1 12 ? -8.682  -5.595  -1.580  1.00 0.00 ? 303 TRP A CA   9  
ATOM 6939  C C    . TRP A 1 12 ? -8.385  -4.704  -2.777  1.00 0.00 ? 303 TRP A C    9  
ATOM 6940  O O    . TRP A 1 12 ? -9.235  -4.507  -3.644  1.00 0.00 ? 303 TRP A O    9  
ATOM 6941  C CB   . TRP A 1 12 ? -7.798  -6.839  -1.636  1.00 0.00 ? 303 TRP A CB   9  
ATOM 6942  C CG   . TRP A 1 12 ? -7.828  -7.646  -0.378  1.00 0.00 ? 303 TRP A CG   9  
ATOM 6943  C CD1  . TRP A 1 12 ? -8.676  -8.672  -0.088  1.00 0.00 ? 303 TRP A CD1  9  
ATOM 6944  C CD2  . TRP A 1 12 ? -6.975  -7.491  0.760   1.00 0.00 ? 303 TRP A CD2  9  
ATOM 6945  N NE1  . TRP A 1 12 ? -8.400  -9.172  1.162   1.00 0.00 ? 303 TRP A NE1  9  
ATOM 6946  C CE2  . TRP A 1 12 ? -7.359  -8.463  1.702   1.00 0.00 ? 303 TRP A CE2  9  
ATOM 6947  C CE3  . TRP A 1 12 ? -5.921  -6.628  1.072   1.00 0.00 ? 303 TRP A CE3  9  
ATOM 6948  C CZ2  . TRP A 1 12 ? -6.726  -8.594  2.935   1.00 0.00 ? 303 TRP A CZ2  9  
ATOM 6949  C CZ3  . TRP A 1 12 ? -5.294  -6.759  2.296   1.00 0.00 ? 303 TRP A CZ3  9  
ATOM 6950  C CH2  . TRP A 1 12 ? -5.698  -7.735  3.215   1.00 0.00 ? 303 TRP A CH2  9  
ATOM 6951  H H    . TRP A 1 12 ? -10.506 -6.317  -2.368  1.00 0.00 ? 303 TRP A H    9  
ATOM 6952  H HA   . TRP A 1 12 ? -8.465  -5.050  -0.675  1.00 0.00 ? 303 TRP A HA   9  
ATOM 6953  H HB2  . TRP A 1 12 ? -8.130  -7.473  -2.443  1.00 0.00 ? 303 TRP A HB2  9  
ATOM 6954  H HD1  . TRP A 1 12 ? -9.447  -9.028  -0.757  1.00 0.00 ? 303 TRP A HD1  9  
ATOM 6955  H HE1  . TRP A 1 12 ? -8.871  -9.914  1.595   1.00 0.00 ? 303 TRP A HE1  9  
ATOM 6956  H HE3  . TRP A 1 12 ? -5.596  -5.868  0.376   1.00 0.00 ? 303 TRP A HE3  9  
ATOM 6957  H HZ2  . TRP A 1 12 ? -7.025  -9.342  3.655   1.00 0.00 ? 303 TRP A HZ2  9  
ATOM 6958  H HZ3  . TRP A 1 12 ? -4.479  -6.100  2.555   1.00 0.00 ? 303 TRP A HZ3  9  
ATOM 6959  H HH2  . TRP A 1 12 ? -5.181  -7.800  4.158   1.00 0.00 ? 303 TRP A HH2  9  
ATOM 6960  N N    . GLU A 1 13 ? -7.173  -4.168  -2.816  1.00 0.00 ? 304 GLU A N    9  
ATOM 6961  C CA   . GLU A 1 13 ? -6.759  -3.303  -3.909  1.00 0.00 ? 304 GLU A CA   9  
ATOM 6962  C C    . GLU A 1 13 ? -5.275  -2.982  -3.824  1.00 0.00 ? 304 GLU A C    9  
ATOM 6963  O O    . GLU A 1 13 ? -4.765  -2.624  -2.763  1.00 0.00 ? 304 GLU A O    9  
ATOM 6964  C CB   . GLU A 1 13 ? -7.566  -2.009  -3.907  1.00 0.00 ? 304 GLU A CB   9  
ATOM 6965  C CG   . GLU A 1 13 ? -7.320  -1.159  -5.137  1.00 0.00 ? 304 GLU A CG   9  
ATOM 6966  C CD   . GLU A 1 13 ? -8.580  -0.913  -5.943  1.00 0.00 ? 304 GLU A CD   9  
ATOM 6967  O OE1  . GLU A 1 13 ? -9.566  -1.655  -5.744  1.00 0.00 ? 304 GLU A OE1  9  
ATOM 6968  O OE2  . GLU A 1 13 ? -8.581  0.020   -6.774  1.00 0.00 ? 304 GLU A OE2  9  
ATOM 6969  H H    . GLU A 1 13 ? -6.542  -4.356  -2.089  1.00 0.00 ? 304 GLU A H    9  
ATOM 6970  H HA   . GLU A 1 13 ? -6.947  -3.823  -4.834  1.00 0.00 ? 304 GLU A HA   9  
ATOM 6971  H HB2  . GLU A 1 13 ? -8.618  -2.252  -3.863  1.00 0.00 ? 304 GLU A HB2  9  
ATOM 6972  H HG2  . GLU A 1 13 ? -6.919  -0.212  -4.825  1.00 0.00 ? 304 GLU A HG2  9  
ATOM 6973  N N    . ILE A 1 14 ? -4.587  -3.109  -4.951  1.00 0.00 ? 305 ILE A N    9  
ATOM 6974  C CA   . ILE A 1 14 ? -3.160  -2.825  -5.006  1.00 0.00 ? 305 ILE A CA   9  
ATOM 6975  C C    . ILE A 1 14 ? -2.924  -1.321  -5.019  1.00 0.00 ? 305 ILE A C    9  
ATOM 6976  O O    . ILE A 1 14 ? -3.736  -0.560  -5.544  1.00 0.00 ? 305 ILE A O    9  
ATOM 6977  C CB   . ILE A 1 14 ? -2.499  -3.453  -6.254  1.00 0.00 ? 305 ILE A CB   9  
ATOM 6978  C CG1  . ILE A 1 14 ? -2.681  -4.975  -6.248  1.00 0.00 ? 305 ILE A CG1  9  
ATOM 6979  C CG2  . ILE A 1 14 ? -1.020  -3.084  -6.311  1.00 0.00 ? 305 ILE A CG2  9  
ATOM 6980  C CD1  . ILE A 1 14 ? -1.832  -5.697  -7.272  1.00 0.00 ? 305 ILE A CD1  9  
ATOM 6981  H H    . ILE A 1 14 ? -5.051  -3.392  -5.767  1.00 0.00 ? 305 ILE A H    9  
ATOM 6982  H HA   . ILE A 1 14 ? -2.697  -3.247  -4.119  1.00 0.00 ? 305 ILE A HA   9  
ATOM 6983  H HB   . ILE A 1 14 ? -2.979  -3.043  -7.130  1.00 0.00 ? 305 ILE A HB   9  
ATOM 6984  H HG12 . ILE A 1 14 ? -2.420  -5.357  -5.274  1.00 0.00 ? 305 ILE A HG12 9  
ATOM 6985  H HG21 . ILE A 1 14 ? -0.536  -3.398  -5.398  1.00 0.00 ? 305 ILE A HG21 9  
ATOM 6986  H HG22 . ILE A 1 14 ? -0.559  -3.579  -7.153  1.00 0.00 ? 305 ILE A HG22 9  
ATOM 6987  H HG23 . ILE A 1 14 ? -0.920  -2.015  -6.422  1.00 0.00 ? 305 ILE A HG23 9  
ATOM 6988  H HD11 . ILE A 1 14 ? -2.278  -6.654  -7.500  1.00 0.00 ? 305 ILE A HD11 9  
ATOM 6989  H HD12 . ILE A 1 14 ? -1.771  -5.105  -8.172  1.00 0.00 ? 305 ILE A HD12 9  
ATOM 6990  H HD13 . ILE A 1 14 ? -0.839  -5.848  -6.873  1.00 0.00 ? 305 ILE A HD13 9  
ATOM 6991  N N    . ARG A 1 15 ? -1.808  -0.904  -4.445  1.00 0.00 ? 306 ARG A N    9  
ATOM 6992  C CA   . ARG A 1 15 ? -1.462  0.508   -4.385  1.00 0.00 ? 306 ARG A CA   9  
ATOM 6993  C C    . ARG A 1 15 ? 0.020   0.674   -4.094  1.00 0.00 ? 306 ARG A C    9  
ATOM 6994  O O    . ARG A 1 15 ? 0.613   -0.150  -3.414  1.00 0.00 ? 306 ARG A O    9  
ATOM 6995  C CB   . ARG A 1 15 ? -2.297  1.201   -3.309  1.00 0.00 ? 306 ARG A CB   9  
ATOM 6996  C CG   . ARG A 1 15 ? -3.761  1.355   -3.688  1.00 0.00 ? 306 ARG A CG   9  
ATOM 6997  C CD   . ARG A 1 15 ? -4.448  2.431   -2.862  1.00 0.00 ? 306 ARG A CD   9  
ATOM 6998  N NE   . ARG A 1 15 ? -5.903  2.314   -2.913  1.00 0.00 ? 306 ARG A NE   9  
ATOM 6999  C CZ   . ARG A 1 15 ? -6.626  2.574   -3.999  1.00 0.00 ? 306 ARG A CZ   9  
ATOM 7000  N NH1  . ARG A 1 15 ? -6.032  2.977   -5.113  1.00 0.00 ? 306 ARG A NH1  9  
ATOM 7001  N NH2  . ARG A 1 15 ? -7.945  2.437   -3.971  1.00 0.00 ? 306 ARG A NH2  9  
ATOM 7002  H H    . ARG A 1 15 ? -1.199  -1.561  -4.047  1.00 0.00 ? 306 ARG A H    9  
ATOM 7003  H HA   . ARG A 1 15 ? -1.684  0.948   -5.346  1.00 0.00 ? 306 ARG A HA   9  
ATOM 7004  H HB2  . ARG A 1 15 ? -2.242  0.621   -2.400  1.00 0.00 ? 306 ARG A HB2  9  
ATOM 7005  H HG2  . ARG A 1 15 ? -3.826  1.623   -4.732  1.00 0.00 ? 306 ARG A HG2  9  
ATOM 7006  H HD2  . ARG A 1 15 ? -4.124  2.340   -1.836  1.00 0.00 ? 306 ARG A HD2  9  
ATOM 7007  H HE   . ARG A 1 15 ? -6.365  2.026   -2.097  1.00 0.00 ? 306 ARG A HE   9  
ATOM 7008  H HH11 . ARG A 1 15 ? -5.038  3.087   -5.138  1.00 0.00 ? 306 ARG A HH11 9  
ATOM 7009  H HH12 . ARG A 1 15 ? -6.576  3.170   -5.929  1.00 0.00 ? 306 ARG A HH12 9  
ATOM 7010  H HH21 . ARG A 1 15 ? -8.398  2.138   -3.132  1.00 0.00 ? 306 ARG A HH21 9  
ATOM 7011  H HH22 . ARG A 1 15 ? -8.486  2.634   -4.789  1.00 0.00 ? 306 ARG A HH22 9  
ATOM 7012  N N    . ASN A 1 16 ? 0.619   1.734   -4.614  1.00 0.00 ? 307 ASN A N    9  
ATOM 7013  C CA   . ASN A 1 16 ? 2.039   1.979   -4.390  1.00 0.00 ? 307 ASN A CA   9  
ATOM 7014  C C    . ASN A 1 16 ? 2.249   3.047   -3.330  1.00 0.00 ? 307 ASN A C    9  
ATOM 7015  O O    . ASN A 1 16 ? 1.348   3.833   -3.037  1.00 0.00 ? 307 ASN A O    9  
ATOM 7016  C CB   . ASN A 1 16 ? 2.723   2.393   -5.689  1.00 0.00 ? 307 ASN A CB   9  
ATOM 7017  C CG   . ASN A 1 16 ? 2.439   1.431   -6.825  1.00 0.00 ? 307 ASN A CG   9  
ATOM 7018  O OD1  . ASN A 1 16 ? 1.295   1.276   -7.250  1.00 0.00 ? 307 ASN A OD1  9  
ATOM 7019  N ND2  . ASN A 1 16 ? 3.483   0.777   -7.323  1.00 0.00 ? 307 ASN A ND2  9  
ATOM 7020  H H    . ASN A 1 16 ? 0.101   2.364   -5.157  1.00 0.00 ? 307 ASN A H    9  
ATOM 7021  H HA   . ASN A 1 16 ? 2.481   1.058   -4.041  1.00 0.00 ? 307 ASN A HA   9  
ATOM 7022  H HB2  . ASN A 1 16 ? 2.369   3.367   -5.972  1.00 0.00 ? 307 ASN A HB2  9  
ATOM 7023  H HD21 . ASN A 1 16 ? 4.366   0.950   -6.934  1.00 0.00 ? 307 ASN A HD21 9  
ATOM 7024  H HD22 . ASN A 1 16 ? 3.327   0.149   -8.058  1.00 0.00 ? 307 ASN A HD22 9  
ATOM 7025  N N    . THR A 1 17 ? 3.448   3.079   -2.767  1.00 0.00 ? 308 THR A N    9  
ATOM 7026  C CA   . THR A 1 17 ? 3.775   4.049   -1.734  1.00 0.00 ? 308 THR A CA   9  
ATOM 7027  C C    . THR A 1 17 ? 4.695   5.129   -2.282  1.00 0.00 ? 308 THR A C    9  
ATOM 7028  O O    . THR A 1 17 ? 4.406   6.321   -2.182  1.00 0.00 ? 308 THR A O    9  
ATOM 7029  C CB   . THR A 1 17 ? 4.457   3.379   -0.525  1.00 0.00 ? 308 THR A CB   9  
ATOM 7030  O OG1  . THR A 1 17 ? 5.802   3.018   -0.861  1.00 0.00 ? 308 THR A OG1  9  
ATOM 7031  C CG2  . THR A 1 17 ? 3.690   2.141   -0.087  1.00 0.00 ? 308 THR A CG2  9  
ATOM 7032  H H    . THR A 1 17 ? 4.136   2.443   -3.066  1.00 0.00 ? 308 THR A H    9  
ATOM 7033  H HA   . THR A 1 17 ? 2.852   4.502   -1.398  1.00 0.00 ? 308 THR A HA   9  
ATOM 7034  H HB   . THR A 1 17 ? 4.476   4.082   0.294   1.00 0.00 ? 308 THR A HB   9  
ATOM 7035  H HG1  . THR A 1 17 ? 6.414   3.510   -0.309  1.00 0.00 ? 308 THR A HG1  9  
ATOM 7036  H HG21 . THR A 1 17 ? 4.011   1.849   0.904   1.00 0.00 ? 308 THR A HG21 9  
ATOM 7037  H HG22 . THR A 1 17 ? 3.881   1.336   -0.779  1.00 0.00 ? 308 THR A HG22 9  
ATOM 7038  H HG23 . THR A 1 17 ? 2.632   2.362   -0.074  1.00 0.00 ? 308 THR A HG23 9  
ATOM 7039  N N    . ALA A 1 18 ? 5.805   4.696   -2.867  1.00 0.00 ? 309 ALA A N    9  
ATOM 7040  C CA   . ALA A 1 18 ? 6.779   5.613   -3.437  1.00 0.00 ? 309 ALA A CA   9  
ATOM 7041  C C    . ALA A 1 18 ? 7.977   4.850   -3.989  1.00 0.00 ? 309 ALA A C    9  
ATOM 7042  O O    . ALA A 1 18 ? 8.324   3.778   -3.492  1.00 0.00 ? 309 ALA A O    9  
ATOM 7043  C CB   . ALA A 1 18 ? 7.220   6.622   -2.394  1.00 0.00 ? 309 ALA A CB   9  
ATOM 7044  H H    . ALA A 1 18 ? 5.973   3.731   -2.917  1.00 0.00 ? 309 ALA A H    9  
ATOM 7045  H HA   . ALA A 1 18 ? 6.302   6.148   -4.245  1.00 0.00 ? 309 ALA A HA   9  
ATOM 7046  H HB1  . ALA A 1 18 ? 7.011   6.234   -1.409  1.00 0.00 ? 309 ALA A HB1  9  
ATOM 7047  H HB2  . ALA A 1 18 ? 8.280   6.804   -2.493  1.00 0.00 ? 309 ALA A HB2  9  
ATOM 7048  H HB3  . ALA A 1 18 ? 6.680   7.546   -2.538  1.00 0.00 ? 309 ALA A HB3  9  
ATOM 7049  N N    . THR A 1 19 ? 8.606   5.407   -5.017  1.00 0.00 ? 310 THR A N    9  
ATOM 7050  C CA   . THR A 1 19 ? 9.755   4.766   -5.644  1.00 0.00 ? 310 THR A CA   9  
ATOM 7051  C C    . THR A 1 19 ? 9.365   3.428   -6.274  1.00 0.00 ? 310 THR A C    9  
ATOM 7052  O O    . THR A 1 19 ? 10.228  2.623   -6.621  1.00 0.00 ? 310 THR A O    9  
ATOM 7053  C CB   . THR A 1 19 ? 10.898  4.536   -4.638  1.00 0.00 ? 310 THR A CB   9  
ATOM 7054  O OG1  . THR A 1 19 ? 10.671  3.327   -3.904  1.00 0.00 ? 310 THR A OG1  9  
ATOM 7055  C CG2  . THR A 1 19 ? 11.014  5.706   -3.672  1.00 0.00 ? 310 THR A CG2  9  
ATOM 7056  H H    . THR A 1 19 ? 8.292   6.268   -5.361  1.00 0.00 ? 310 THR A H    9  
ATOM 7057  H HA   . THR A 1 19 ? 10.117  5.424   -6.421  1.00 0.00 ? 310 THR A HA   9  
ATOM 7058  H HB   . THR A 1 19 ? 11.827  4.447   -5.184  1.00 0.00 ? 310 THR A HB   9  
ATOM 7059  H HG1  . THR A 1 19 ? 10.039  3.492   -3.201  1.00 0.00 ? 310 THR A HG1  9  
ATOM 7060  H HG21 . THR A 1 19 ? 11.880  5.567   -3.041  1.00 0.00 ? 310 THR A HG21 9  
ATOM 7061  H HG22 . THR A 1 19 ? 10.126  5.756   -3.059  1.00 0.00 ? 310 THR A HG22 9  
ATOM 7062  H HG23 . THR A 1 19 ? 11.119  6.625   -4.230  1.00 0.00 ? 310 THR A HG23 9  
ATOM 7063  N N    . GLY A 1 20 ? 8.060   3.196   -6.420  1.00 0.00 ? 311 GLY A N    9  
ATOM 7064  C CA   . GLY A 1 20 ? 7.586   1.961   -7.012  1.00 0.00 ? 311 GLY A CA   9  
ATOM 7065  C C    . GLY A 1 20 ? 7.154   0.930   -5.988  1.00 0.00 ? 311 GLY A C    9  
ATOM 7066  O O    . GLY A 1 20 ? 6.510   -0.058  -6.339  1.00 0.00 ? 311 GLY A O    9  
ATOM 7067  H H    . GLY A 1 20 ? 7.413   3.871   -6.132  1.00 0.00 ? 311 GLY A H    9  
ATOM 7068  H HA2  . GLY A 1 20 ? 6.737   2.189   -7.641  1.00 0.00 ? 311 GLY A HA2  9  
ATOM 7069  H HA3  . GLY A 1 20 ? 8.371   1.542   -7.623  1.00 0.00 ? 311 GLY A HA3  9  
ATOM 7070  N N    . ARG A 1 21 ? 7.502   1.147   -4.723  1.00 0.00 ? 312 ARG A N    9  
ATOM 7071  C CA   . ARG A 1 21 ? 7.118   0.206   -3.674  1.00 0.00 ? 312 ARG A CA   9  
ATOM 7072  C C    . ARG A 1 21 ? 5.617   -0.011  -3.697  1.00 0.00 ? 312 ARG A C    9  
ATOM 7073  O O    . ARG A 1 21 ? 4.846   0.925   -3.903  1.00 0.00 ? 312 ARG A O    9  
ATOM 7074  C CB   . ARG A 1 21 ? 7.562   0.693   -2.289  1.00 0.00 ? 312 ARG A CB   9  
ATOM 7075  C CG   . ARG A 1 21 ? 8.229   -0.389  -1.456  1.00 0.00 ? 312 ARG A CG   9  
ATOM 7076  C CD   . ARG A 1 21 ? 8.764   0.161   -0.144  1.00 0.00 ? 312 ARG A CD   9  
ATOM 7077  N NE   . ARG A 1 21 ? 9.911   -0.600  0.341   1.00 0.00 ? 312 ARG A NE   9  
ATOM 7078  C CZ   . ARG A 1 21 ? 11.110  -0.569  -0.230  1.00 0.00 ? 312 ARG A CZ   9  
ATOM 7079  N NH1  . ARG A 1 21 ? 11.313  0.178   -1.306  1.00 0.00 ? 312 ARG A NH1  9  
ATOM 7080  N NH2  . ARG A 1 21 ? 12.106  -1.285  0.273   1.00 0.00 ? 312 ARG A NH2  9  
ATOM 7081  H H    . ARG A 1 21 ? 8.023   1.946   -4.495  1.00 0.00 ? 312 ARG A H    9  
ATOM 7082  H HA   . ARG A 1 21 ? 7.593   -0.737  -3.888  1.00 0.00 ? 312 ARG A HA   9  
ATOM 7083  H HB2  . ARG A 1 21 ? 8.260   1.508   -2.406  1.00 0.00 ? 312 ARG A HB2  9  
ATOM 7084  H HG2  . ARG A 1 21 ? 7.505   -1.161  -1.242  1.00 0.00 ? 312 ARG A HG2  9  
ATOM 7085  H HD2  . ARG A 1 21 ? 9.062   1.188   -0.294  1.00 0.00 ? 312 ARG A HD2  9  
ATOM 7086  H HE   . ARG A 1 21 ? 9.781   -1.162  1.134   1.00 0.00 ? 312 ARG A HE   9  
ATOM 7087  H HH11 . ARG A 1 21 ? 10.564  0.718   -1.689  1.00 0.00 ? 312 ARG A HH11 9  
ATOM 7088  H HH12 . ARG A 1 21 ? 12.216  0.201   -1.735  1.00 0.00 ? 312 ARG A HH12 9  
ATOM 7089  H HH21 . ARG A 1 21 ? 11.955  -1.850  1.085   1.00 0.00 ? 312 ARG A HH21 9  
ATOM 7090  H HH22 . ARG A 1 21 ? 13.007  -1.260  -0.158  1.00 0.00 ? 312 ARG A HH22 9  
ATOM 7091  N N    . VAL A 1 22 ? 5.208   -1.252  -3.486  1.00 0.00 ? 313 VAL A N    9  
ATOM 7092  C CA   . VAL A 1 22 ? 3.798   -1.591  -3.519  1.00 0.00 ? 313 VAL A CA   9  
ATOM 7093  C C    . VAL A 1 22 ? 3.250   -1.948  -2.162  1.00 0.00 ? 313 VAL A C    9  
ATOM 7094  O O    . VAL A 1 22 ? 3.979   -2.107  -1.184  1.00 0.00 ? 313 VAL A O    9  
ATOM 7095  C CB   . VAL A 1 22 ? 3.492   -2.800  -4.437  1.00 0.00 ? 313 VAL A CB   9  
ATOM 7096  C CG1  . VAL A 1 22 ? 2.401   -2.442  -5.409  1.00 0.00 ? 313 VAL A CG1  9  
ATOM 7097  C CG2  . VAL A 1 22 ? 4.726   -3.311  -5.155  1.00 0.00 ? 313 VAL A CG2  9  
ATOM 7098  H H    . VAL A 1 22 ? 5.866   -1.955  -3.307  1.00 0.00 ? 313 VAL A H    9  
ATOM 7099  H HA   . VAL A 1 22 ? 3.259   -0.738  -3.901  1.00 0.00 ? 313 VAL A HA   9  
ATOM 7100  H HB   . VAL A 1 22 ? 3.118   -3.608  -3.821  1.00 0.00 ? 313 VAL A HB   9  
ATOM 7101  H HG11 . VAL A 1 22 ? 1.473   -2.325  -4.863  1.00 0.00 ? 313 VAL A HG11 9  
ATOM 7102  H HG12 . VAL A 1 22 ? 2.655   -1.516  -5.902  1.00 0.00 ? 313 VAL A HG12 9  
ATOM 7103  H HG13 . VAL A 1 22 ? 2.297   -3.227  -6.141  1.00 0.00 ? 313 VAL A HG13 9  
ATOM 7104  H HG21 . VAL A 1 22 ? 5.492   -3.525  -4.425  1.00 0.00 ? 313 VAL A HG21 9  
ATOM 7105  H HG22 . VAL A 1 22 ? 4.478   -4.212  -5.692  1.00 0.00 ? 313 VAL A HG22 9  
ATOM 7106  H HG23 . VAL A 1 22 ? 5.081   -2.560  -5.844  1.00 0.00 ? 313 VAL A HG23 9  
ATOM 7107  N N    . TYR A 1 23 ? 1.940   -2.074  -2.141  1.00 0.00 ? 314 TYR A N    9  
ATOM 7108  C CA   . TYR A 1 23 ? 1.235   -2.497  -0.964  1.00 0.00 ? 314 TYR A CA   9  
ATOM 7109  C C    . TYR A 1 23 ? -0.206  -2.825  -1.289  1.00 0.00 ? 314 TYR A C    9  
ATOM 7110  O O    . TYR A 1 23 ? -0.782  -2.284  -2.233  1.00 0.00 ? 314 TYR A O    9  
ATOM 7111  C CB   . TYR A 1 23 ? 1.299   -1.475  0.171   1.00 0.00 ? 314 TYR A CB   9  
ATOM 7112  C CG   . TYR A 1 23 ? 0.385   -0.280  0.005   1.00 0.00 ? 314 TYR A CG   9  
ATOM 7113  C CD1  . TYR A 1 23 ? 0.679   0.728   -0.902  1.00 0.00 ? 314 TYR A CD1  9  
ATOM 7114  C CD2  . TYR A 1 23 ? -0.777  -0.163  0.762   1.00 0.00 ? 314 TYR A CD2  9  
ATOM 7115  C CE1  . TYR A 1 23 ? -0.155  1.819   -1.053  1.00 0.00 ? 314 TYR A CE1  9  
ATOM 7116  C CE2  . TYR A 1 23 ? -1.620  0.924   0.613   1.00 0.00 ? 314 TYR A CE2  9  
ATOM 7117  C CZ   . TYR A 1 23 ? -1.305  1.911   -0.297  1.00 0.00 ? 314 TYR A CZ   9  
ATOM 7118  O OH   . TYR A 1 23 ? -2.137  2.993   -0.446  1.00 0.00 ? 314 TYR A OH   9  
ATOM 7119  H H    . TYR A 1 23 ? 1.429   -1.852  -2.951  1.00 0.00 ? 314 TYR A H    9  
ATOM 7120  H HA   . TYR A 1 23 ? 1.722   -3.400  -0.656  1.00 0.00 ? 314 TYR A HA   9  
ATOM 7121  H HB2  . TYR A 1 23 ? 1.008   -1.971  1.081   1.00 0.00 ? 314 TYR A HB2  9  
ATOM 7122  H HD1  . TYR A 1 23 ? 1.580   0.657   -1.492  1.00 0.00 ? 314 TYR A HD1  9  
ATOM 7123  H HD2  . TYR A 1 23 ? -1.016  -0.939  1.480   1.00 0.00 ? 314 TYR A HD2  9  
ATOM 7124  H HE1  . TYR A 1 23 ? 0.097   2.595   -1.758  1.00 0.00 ? 314 TYR A HE1  9  
ATOM 7125  H HE2  . TYR A 1 23 ? -2.512  1.006   1.213   1.00 0.00 ? 314 TYR A HE2  9  
ATOM 7126  H HH   . TYR A 1 23 ? -1.613  3.796   -0.480  1.00 0.00 ? 314 TYR A HH   9  
ATOM 7127  N N    . PHE A 1 24 ? -0.784  -3.717  -0.503  1.00 0.00 ? 315 PHE A N    9  
ATOM 7128  C CA   . PHE A 1 24 ? -2.155  -4.118  -0.720  1.00 0.00 ? 315 PHE A CA   9  
ATOM 7129  C C    . PHE A 1 24 ? -3.070  -3.585  0.371   1.00 0.00 ? 315 PHE A C    9  
ATOM 7130  O O    . PHE A 1 24 ? -2.844  -3.802  1.562   1.00 0.00 ? 315 PHE A O    9  
ATOM 7131  C CB   . PHE A 1 24 ? -2.244  -5.641  -0.831  1.00 0.00 ? 315 PHE A CB   9  
ATOM 7132  C CG   . PHE A 1 24 ? -1.494  -6.181  -2.019  1.00 0.00 ? 315 PHE A CG   9  
ATOM 7133  C CD1  . PHE A 1 24 ? -0.118  -6.032  -2.107  1.00 0.00 ? 315 PHE A CD1  9  
ATOM 7134  C CD2  . PHE A 1 24 ? -2.161  -6.817  -3.052  1.00 0.00 ? 315 PHE A CD2  9  
ATOM 7135  C CE1  . PHE A 1 24 ? 0.576   -6.508  -3.203  1.00 0.00 ? 315 PHE A CE1  9  
ATOM 7136  C CE2  . PHE A 1 24 ? -1.471  -7.293  -4.153  1.00 0.00 ? 315 PHE A CE2  9  
ATOM 7137  C CZ   . PHE A 1 24 ? -0.101  -7.137  -4.227  1.00 0.00 ? 315 PHE A CZ   9  
ATOM 7138  H H    . PHE A 1 24 ? -0.276  -4.117  0.232   1.00 0.00 ? 315 PHE A H    9  
ATOM 7139  H HA   . PHE A 1 24 ? -2.460  -3.677  -1.650  1.00 0.00 ? 315 PHE A HA   9  
ATOM 7140  H HB2  . PHE A 1 24 ? -1.827  -6.087  0.060   1.00 0.00 ? 315 PHE A HB2  9  
ATOM 7141  H HD1  . PHE A 1 24 ? 0.415   -5.545  -1.306  1.00 0.00 ? 315 PHE A HD1  9  
ATOM 7142  H HD2  . PHE A 1 24 ? -3.231  -6.940  -2.996  1.00 0.00 ? 315 PHE A HD2  9  
ATOM 7143  H HE1  . PHE A 1 24 ? 1.648   -6.383  -3.259  1.00 0.00 ? 315 PHE A HE1  9  
ATOM 7144  H HE2  . PHE A 1 24 ? -2.002  -7.787  -4.952  1.00 0.00 ? 315 PHE A HE2  9  
ATOM 7145  H HZ   . PHE A 1 24 ? 0.440   -7.507  -5.086  1.00 0.00 ? 315 PHE A HZ   9  
ATOM 7146  N N    . VAL A 1 25 ? -4.105  -2.878  -0.065  1.00 0.00 ? 316 VAL A N    9  
ATOM 7147  C CA   . VAL A 1 25 ? -5.074  -2.280  0.838   1.00 0.00 ? 316 VAL A CA   9  
ATOM 7148  C C    . VAL A 1 25 ? -6.251  -3.213  1.090   1.00 0.00 ? 316 VAL A C    9  
ATOM 7149  O O    . VAL A 1 25 ? -6.769  -3.841  0.166   1.00 0.00 ? 316 VAL A O    9  
ATOM 7150  C CB   . VAL A 1 25 ? -5.605  -0.951  0.264   1.00 0.00 ? 316 VAL A CB   9  
ATOM 7151  C CG1  . VAL A 1 25 ? -6.292  -0.138  1.345   1.00 0.00 ? 316 VAL A CG1  9  
ATOM 7152  C CG2  . VAL A 1 25 ? -4.481  -0.152  -0.380  1.00 0.00 ? 316 VAL A CG2  9  
ATOM 7153  H H    . VAL A 1 25 ? -4.220  -2.757  -1.031  1.00 0.00 ? 316 VAL A H    9  
ATOM 7154  H HA   . VAL A 1 25 ? -4.578  -2.072  1.774   1.00 0.00 ? 316 VAL A HA   9  
ATOM 7155  H HB   . VAL A 1 25 ? -6.335  -1.181  -0.498  1.00 0.00 ? 316 VAL A HB   9  
ATOM 7156  H HG11 . VAL A 1 25 ? -6.374  0.891   1.024   1.00 0.00 ? 316 VAL A HG11 9  
ATOM 7157  H HG12 . VAL A 1 25 ? -7.278  -0.541  1.524   1.00 0.00 ? 316 VAL A HG12 9  
ATOM 7158  H HG13 . VAL A 1 25 ? -5.712  -0.186  2.255   1.00 0.00 ? 316 VAL A HG13 9  
ATOM 7159  H HG21 . VAL A 1 25 ? -3.529  -0.546  -0.058  1.00 0.00 ? 316 VAL A HG21 9  
ATOM 7160  H HG22 . VAL A 1 25 ? -4.558  -0.227  -1.455  1.00 0.00 ? 316 VAL A HG22 9  
ATOM 7161  H HG23 . VAL A 1 25 ? -4.562  0.883   -0.085  1.00 0.00 ? 316 VAL A HG23 9  
ATOM 7162  N N    . ASP A 1 26 ? -6.668  -3.299  2.350   1.00 0.00 ? 317 ASP A N    9  
ATOM 7163  C CA   . ASP A 1 26 ? -7.793  -4.146  2.727   1.00 0.00 ? 317 ASP A CA   9  
ATOM 7164  C C    . ASP A 1 26 ? -9.021  -3.297  3.030   1.00 0.00 ? 317 ASP A C    9  
ATOM 7165  O O    . ASP A 1 26 ? -8.998  -2.453  3.927   1.00 0.00 ? 317 ASP A O    9  
ATOM 7166  C CB   . ASP A 1 26 ? -7.438  -5.000  3.943   1.00 0.00 ? 317 ASP A CB   9  
ATOM 7167  C CG   . ASP A 1 26 ? -8.205  -6.307  3.974   1.00 0.00 ? 317 ASP A CG   9  
ATOM 7168  O OD1  . ASP A 1 26 ? -9.049  -6.522  3.080   1.00 0.00 ? 317 ASP A OD1  9  
ATOM 7169  O OD2  . ASP A 1 26 ? -7.960  -7.116  4.893   1.00 0.00 ? 317 ASP A OD2  9  
ATOM 7170  H H    . ASP A 1 26 ? -6.206  -2.781  3.042   1.00 0.00 ? 317 ASP A H    9  
ATOM 7171  H HA   . ASP A 1 26 ? -8.014  -4.795  1.893   1.00 0.00 ? 317 ASP A HA   9  
ATOM 7172  H HB2  . ASP A 1 26 ? -6.383  -5.223  3.926   1.00 0.00 ? 317 ASP A HB2  9  
ATOM 7173  N N    . HIS A 1 27 ? -10.089 -3.528  2.279   1.00 0.00 ? 318 HIS A N    9  
ATOM 7174  C CA   . HIS A 1 27 ? -11.327 -2.782  2.459   1.00 0.00 ? 318 HIS A CA   9  
ATOM 7175  C C    . HIS A 1 27 ? -12.286 -3.507  3.403   1.00 0.00 ? 318 HIS A C    9  
ATOM 7176  O O    . HIS A 1 27 ? -13.272 -2.927  3.860   1.00 0.00 ? 318 HIS A O    9  
ATOM 7177  C CB   . HIS A 1 27 ? -11.988 -2.543  1.101   1.00 0.00 ? 318 HIS A CB   9  
ATOM 7178  C CG   . HIS A 1 27 ? -11.275 -1.514  0.283   1.00 0.00 ? 318 HIS A CG   9  
ATOM 7179  N ND1  . HIS A 1 27 ? -11.257 -0.195  0.662   1.00 0.00 ? 318 HIS A ND1  9  
ATOM 7180  C CD2  . HIS A 1 27 ? -10.545 -1.659  -0.851  1.00 0.00 ? 318 HIS A CD2  9  
ATOM 7181  C CE1  . HIS A 1 27 ? -10.518 0.429   -0.233  1.00 0.00 ? 318 HIS A CE1  9  
ATOM 7182  N NE2  . HIS A 1 27 ? -10.066 -0.415  -1.173  1.00 0.00 ? 318 HIS A NE2  9  
ATOM 7183  H H    . HIS A 1 27 ? -10.046 -4.218  1.586   1.00 0.00 ? 318 HIS A H    9  
ATOM 7184  H HA   . HIS A 1 27 ? -11.073 -1.826  2.892   1.00 0.00 ? 318 HIS A HA   9  
ATOM 7185  H HB2  . HIS A 1 27 ? -11.993 -3.466  0.543   1.00 0.00 ? 318 HIS A HB2  9  
ATOM 7186  H HD2  . HIS A 1 27 ? -10.368 -2.574  -1.396  1.00 0.00 ? 318 HIS A HD2  9  
ATOM 7187  H HE1  . HIS A 1 27 ? -10.291 1.482   -0.201  1.00 0.00 ? 318 HIS A HE1  9  
ATOM 7188  H HE2  . HIS A 1 27 ? -9.655  -0.162  -2.026  1.00 0.00 ? 318 HIS A HE2  9  
ATOM 7189  N N    . ASN A 1 28 ? -11.997 -4.775  3.696   1.00 0.00 ? 319 ASN A N    9  
ATOM 7190  C CA   . ASN A 1 28 ? -12.835 -5.558  4.596   1.00 0.00 ? 319 ASN A CA   9  
ATOM 7191  C C    . ASN A 1 28 ? -12.430 -5.321  6.047   1.00 0.00 ? 319 ASN A C    9  
ATOM 7192  O O    . ASN A 1 28 ? -13.280 -5.198  6.929   1.00 0.00 ? 319 ASN A O    9  
ATOM 7193  C CB   . ASN A 1 28 ? -12.728 -7.048  4.266   1.00 0.00 ? 319 ASN A CB   9  
ATOM 7194  C CG   . ASN A 1 28 ? -12.930 -7.331  2.791   1.00 0.00 ? 319 ASN A CG   9  
ATOM 7195  O OD1  . ASN A 1 28 ? -13.747 -6.690  2.131   1.00 0.00 ? 319 ASN A OD1  9  
ATOM 7196  N ND2  . ASN A 1 28 ? -12.185 -8.300  2.269   1.00 0.00 ? 319 ASN A ND2  9  
ATOM 7197  H H    . ASN A 1 28 ? -11.208 -5.194  3.295   1.00 0.00 ? 319 ASN A H    9  
ATOM 7198  H HA   . ASN A 1 28 ? -13.859 -5.239  4.461   1.00 0.00 ? 319 ASN A HA   9  
ATOM 7199  H HB2  . ASN A 1 28 ? -11.749 -7.404  4.550   1.00 0.00 ? 319 ASN A HB2  9  
ATOM 7200  H HD21 . ASN A 1 28 ? -11.556 -8.769  2.857   1.00 0.00 ? 319 ASN A HD21 9  
ATOM 7201  H HD22 . ASN A 1 28 ? -12.294 -8.507  1.318   1.00 0.00 ? 319 ASN A HD22 9  
ATOM 7202  N N    . ASN A 1 29 ? -11.124 -5.258  6.283   1.00 0.00 ? 320 ASN A N    9  
ATOM 7203  C CA   . ASN A 1 29 ? -10.594 -5.036  7.624   1.00 0.00 ? 320 ASN A CA   9  
ATOM 7204  C C    . ASN A 1 29 ? -10.130 -3.590  7.810   1.00 0.00 ? 320 ASN A C    9  
ATOM 7205  O O    . ASN A 1 29 ? -9.881  -3.155  8.934   1.00 0.00 ? 320 ASN A O    9  
ATOM 7206  C CB   . ASN A 1 29 ? -9.429  -5.991  7.897   1.00 0.00 ? 320 ASN A CB   9  
ATOM 7207  C CG   . ASN A 1 29 ? -9.834  -7.445  7.774   1.00 0.00 ? 320 ASN A CG   9  
ATOM 7208  O OD1  . ASN A 1 29 ? -10.335 -8.046  8.724   1.00 0.00 ? 320 ASN A OD1  9  
ATOM 7209  N ND2  . ASN A 1 29 ? -9.616  -8.018  6.598   1.00 0.00 ? 320 ASN A ND2  9  
ATOM 7210  H H    . ASN A 1 29 ? -10.499 -5.364  5.535   1.00 0.00 ? 320 ASN A H    9  
ATOM 7211  H HA   . ASN A 1 29 ? -11.385 -5.241  8.330   1.00 0.00 ? 320 ASN A HA   9  
ATOM 7212  H HB2  . ASN A 1 29 ? -8.640  -5.800  7.185   1.00 0.00 ? 320 ASN A HB2  9  
ATOM 7213  H HD21 . ASN A 1 29 ? -9.213  -7.478  5.887   1.00 0.00 ? 320 ASN A HD21 9  
ATOM 7214  H HD22 . ASN A 1 29 ? -9.865  -8.957  6.488   1.00 0.00 ? 320 ASN A HD22 9  
ATOM 7215  N N    . ARG A 1 30 ? -10.013 -2.852  6.708   1.00 0.00 ? 321 ARG A N    9  
ATOM 7216  C CA   . ARG A 1 30 ? -9.578  -1.461  6.764   1.00 0.00 ? 321 ARG A CA   9  
ATOM 7217  C C    . ARG A 1 30 ? -8.136  -1.359  7.251   1.00 0.00 ? 321 ARG A C    9  
ATOM 7218  O O    . ARG A 1 30 ? -7.857  -0.737  8.275   1.00 0.00 ? 321 ARG A O    9  
ATOM 7219  C CB   . ARG A 1 30 ? -10.499 -0.651  7.676   1.00 0.00 ? 321 ARG A CB   9  
ATOM 7220  C CG   . ARG A 1 30 ? -11.947 -0.643  7.218   1.00 0.00 ? 321 ARG A CG   9  
ATOM 7221  C CD   . ARG A 1 30 ? -12.869 -1.245  8.266   1.00 0.00 ? 321 ARG A CD   9  
ATOM 7222  N NE   . ARG A 1 30 ? -14.138 -0.529  8.354   1.00 0.00 ? 321 ARG A NE   9  
ATOM 7223  C CZ   . ARG A 1 30 ? -14.305 0.595   9.044   1.00 0.00 ? 321 ARG A CZ   9  
ATOM 7224  N NH1  . ARG A 1 30 ? -13.285 1.128   9.703   1.00 0.00 ? 321 ARG A NH1  9  
ATOM 7225  N NH2  . ARG A 1 30 ? -15.491 1.186   9.074   1.00 0.00 ? 321 ARG A NH2  9  
ATOM 7226  H H    . ARG A 1 30 ? -10.223 -3.248  5.838   1.00 0.00 ? 321 ARG A H    9  
ATOM 7227  H HA   . ARG A 1 30 ? -9.634  -1.058  5.764   1.00 0.00 ? 321 ARG A HA   9  
ATOM 7228  H HB2  . ARG A 1 30 ? -10.461 -1.068  8.672   1.00 0.00 ? 321 ARG A HB2  9  
ATOM 7229  H HG2  . ARG A 1 30 ? -12.250 0.376   7.030   1.00 0.00 ? 321 ARG A HG2  9  
ATOM 7230  H HD2  . ARG A 1 30 ? -13.064 -2.274  8.006   1.00 0.00 ? 321 ARG A HD2  9  
ATOM 7231  H HE   . ARG A 1 30 ? -14.906 -0.905  7.876   1.00 0.00 ? 321 ARG A HE   9  
ATOM 7232  H HH11 . ARG A 1 30 ? -12.389 0.685   9.681   1.00 0.00 ? 321 ARG A HH11 9  
ATOM 7233  H HH12 . ARG A 1 30 ? -13.413 1.973   10.221  1.00 0.00 ? 321 ARG A HH12 9  
ATOM 7234  H HH21 . ARG A 1 30 ? -16.262 0.786   8.578   1.00 0.00 ? 321 ARG A HH21 9  
ATOM 7235  H HH22 . ARG A 1 30 ? -15.615 2.032   9.595   1.00 0.00 ? 321 ARG A HH22 9  
ATOM 7236  N N    . THR A 1 31 ? -7.225  -1.975  6.507   1.00 0.00 ? 322 THR A N    9  
ATOM 7237  C CA   . THR A 1 31 ? -5.808  -1.956  6.855   1.00 0.00 ? 322 THR A CA   9  
ATOM 7238  C C    . THR A 1 31 ? -4.940  -2.081  5.609   1.00 0.00 ? 322 THR A C    9  
ATOM 7239  O O    . THR A 1 31 ? -5.408  -1.860  4.493   1.00 0.00 ? 322 THR A O    9  
ATOM 7240  C CB   . THR A 1 31 ? -5.450  -3.083  7.843   1.00 0.00 ? 322 THR A CB   9  
ATOM 7241  O OG1  . THR A 1 31 ? -4.088  -2.945  8.268   1.00 0.00 ? 322 THR A OG1  9  
ATOM 7242  C CG2  . THR A 1 31 ? -5.647  -4.452  7.209   1.00 0.00 ? 322 THR A CG2  9  
ATOM 7243  H H    . THR A 1 31 ? -7.512  -2.453  5.701   1.00 0.00 ? 322 THR A H    9  
ATOM 7244  H HA   . THR A 1 31 ? -5.596  -1.010  7.329   1.00 0.00 ? 322 THR A HA   9  
ATOM 7245  H HB   . THR A 1 31 ? -6.096  -3.006  8.704   1.00 0.00 ? 322 THR A HB   9  
ATOM 7246  H HG1  . THR A 1 31 ? -4.052  -2.390  9.051   1.00 0.00 ? 322 THR A HG1  9  
ATOM 7247  H HG21 . THR A 1 31 ? -5.357  -4.413  6.169   1.00 0.00 ? 322 THR A HG21 9  
ATOM 7248  H HG22 . THR A 1 31 ? -6.685  -4.738  7.284   1.00 0.00 ? 322 THR A HG22 9  
ATOM 7249  H HG23 . THR A 1 31 ? -5.037  -5.178  7.724   1.00 0.00 ? 322 THR A HG23 9  
ATOM 7250  N N    . THR A 1 32 ? -3.674  -2.436  5.803   1.00 0.00 ? 323 THR A N    9  
ATOM 7251  C CA   . THR A 1 32 ? -2.751  -2.580  4.685   1.00 0.00 ? 323 THR A CA   9  
ATOM 7252  C C    . THR A 1 32 ? -1.799  -3.750  4.891   1.00 0.00 ? 323 THR A C    9  
ATOM 7253  O O    . THR A 1 32 ? -1.780  -4.377  5.951   1.00 0.00 ? 323 THR A O    9  
ATOM 7254  C CB   . THR A 1 32 ? -1.919  -1.301  4.472   1.00 0.00 ? 323 THR A CB   9  
ATOM 7255  O OG1  . THR A 1 32 ? -1.464  -0.801  5.736   1.00 0.00 ? 323 THR A OG1  9  
ATOM 7256  C CG2  . THR A 1 32 ? -2.743  -0.233  3.763   1.00 0.00 ? 323 THR A CG2  9  
ATOM 7257  H H    . THR A 1 32 ? -3.356  -2.606  6.714   1.00 0.00 ? 323 THR A H    9  
ATOM 7258  H HA   . THR A 1 32 ? -3.335  -2.754  3.795   1.00 0.00 ? 323 THR A HA   9  
ATOM 7259  H HB   . THR A 1 32 ? -1.058  -1.544  3.857   1.00 0.00 ? 323 THR A HB   9  
ATOM 7260  H HG1  . THR A 1 32 ? -1.160  -1.532  6.279   1.00 0.00 ? 323 THR A HG1  9  
ATOM 7261  H HG21 . THR A 1 32 ? -2.545  0.734   4.208   1.00 0.00 ? 323 THR A HG21 9  
ATOM 7262  H HG22 . THR A 1 32 ? -3.794  -0.464  3.862   1.00 0.00 ? 323 THR A HG22 9  
ATOM 7263  H HG23 . THR A 1 32 ? -2.477  -0.210  2.717   1.00 0.00 ? 323 THR A HG23 9  
ATOM 7264  N N    . GLN A 1 33 ? -1.012  -4.035  3.863   1.00 0.00 ? 324 GLN A N    9  
ATOM 7265  C CA   . GLN A 1 33 ? -0.040  -5.119  3.909   1.00 0.00 ? 324 GLN A CA   9  
ATOM 7266  C C    . GLN A 1 33 ? 0.645   -5.271  2.559   1.00 0.00 ? 324 GLN A C    9  
ATOM 7267  O O    . GLN A 1 33 ? -0.016  -5.421  1.533   1.00 0.00 ? 324 GLN A O    9  
ATOM 7268  C CB   . GLN A 1 33 ? -0.708  -6.439  4.303   1.00 0.00 ? 324 GLN A CB   9  
ATOM 7269  C CG   . GLN A 1 33 ? -2.167  -6.546  3.893   1.00 0.00 ? 324 GLN A CG   9  
ATOM 7270  C CD   . GLN A 1 33 ? -2.654  -7.981  3.868   1.00 0.00 ? 324 GLN A CD   9  
ATOM 7271  O OE1  . GLN A 1 33 ? -3.226  -8.473  4.842   1.00 0.00 ? 324 GLN A OE1  9  
ATOM 7272  N NE2  . GLN A 1 33 ? -2.423  -8.665  2.754   1.00 0.00 ? 324 GLN A NE2  9  
ATOM 7273  H H    . GLN A 1 33 ? -1.088  -3.501  3.044   1.00 0.00 ? 324 GLN A H    9  
ATOM 7274  H HA   . GLN A 1 33 ? 0.704   -4.866  4.649   1.00 0.00 ? 324 GLN A HA   9  
ATOM 7275  H HB2  . GLN A 1 33 ? -0.171  -7.251  3.835   1.00 0.00 ? 324 GLN A HB2  9  
ATOM 7276  H HG2  . GLN A 1 33 ? -2.768  -5.989  4.596   1.00 0.00 ? 324 GLN A HG2  9  
ATOM 7277  H HE21 . GLN A 1 33 ? -1.957  -8.210  2.021   1.00 0.00 ? 324 GLN A HE21 9  
ATOM 7278  H HE22 . GLN A 1 33 ? -2.724  -9.596  2.710   1.00 0.00 ? 324 GLN A HE22 9  
ATOM 7279  N N    . PHE A 1 34 ? 1.971   -5.243  2.565   1.00 0.00 ? 325 PHE A N    9  
ATOM 7280  C CA   . PHE A 1 34 ? 2.733   -5.370  1.333   1.00 0.00 ? 325 PHE A CA   9  
ATOM 7281  C C    . PHE A 1 34 ? 2.456   -6.712  0.672   1.00 0.00 ? 325 PHE A C    9  
ATOM 7282  O O    . PHE A 1 34 ? 2.713   -6.895  -0.518  1.00 0.00 ? 325 PHE A O    9  
ATOM 7283  C CB   . PHE A 1 34 ? 4.229   -5.224  1.605   1.00 0.00 ? 325 PHE A CB   9  
ATOM 7284  C CG   . PHE A 1 34 ? 4.750   -3.826  1.381   1.00 0.00 ? 325 PHE A CG   9  
ATOM 7285  C CD1  . PHE A 1 34 ? 3.936   -2.719  1.583   1.00 0.00 ? 325 PHE A CD1  9  
ATOM 7286  C CD2  . PHE A 1 34 ? 6.051   -3.621  0.952   1.00 0.00 ? 325 PHE A CD2  9  
ATOM 7287  C CE1  . PHE A 1 34 ? 4.412   -1.439  1.364   1.00 0.00 ? 325 PHE A CE1  9  
ATOM 7288  C CE2  . PHE A 1 34 ? 6.532   -2.345  0.732   1.00 0.00 ? 325 PHE A CE2  9  
ATOM 7289  C CZ   . PHE A 1 34 ? 5.711   -1.254  0.937   1.00 0.00 ? 325 PHE A CZ   9  
ATOM 7290  H H    . PHE A 1 34 ? 2.445   -5.165  3.417   1.00 0.00 ? 325 PHE A H    9  
ATOM 7291  H HA   . PHE A 1 34 ? 2.420   -4.583  0.668   1.00 0.00 ? 325 PHE A HA   9  
ATOM 7292  H HB2  . PHE A 1 34 ? 4.431   -5.505  2.628   1.00 0.00 ? 325 PHE A HB2  9  
ATOM 7293  H HD1  . PHE A 1 34 ? 2.921   -2.860  1.917   1.00 0.00 ? 325 PHE A HD1  9  
ATOM 7294  H HD2  . PHE A 1 34 ? 6.696   -4.471  0.792   1.00 0.00 ? 325 PHE A HD2  9  
ATOM 7295  H HE1  . PHE A 1 34 ? 3.766   -0.583  1.523   1.00 0.00 ? 325 PHE A HE1  9  
ATOM 7296  H HE2  . PHE A 1 34 ? 7.548   -2.201  0.398   1.00 0.00 ? 325 PHE A HE2  9  
ATOM 7297  H HZ   . PHE A 1 34 ? 6.085   -0.255  0.763   1.00 0.00 ? 325 PHE A HZ   9  
ATOM 7298  N N    . THR A 1 35 ? 1.926   -7.646  1.452   1.00 0.00 ? 326 THR A N    9  
ATOM 7299  C CA   . THR A 1 35 ? 1.614   -8.968  0.953   1.00 0.00 ? 326 THR A CA   9  
ATOM 7300  C C    . THR A 1 35 ? 0.309   -8.979  0.171   1.00 0.00 ? 326 THR A C    9  
ATOM 7301  O O    . THR A 1 35 ? -0.592  -8.181  0.430   1.00 0.00 ? 326 THR A O    9  
ATOM 7302  C CB   . THR A 1 35 ? 1.508   -9.978  2.102   1.00 0.00 ? 326 THR A CB   9  
ATOM 7303  O OG1  . THR A 1 35 ? 2.145   -9.459  3.276   1.00 0.00 ? 326 THR A OG1  9  
ATOM 7304  C CG2  . THR A 1 35 ? 2.152   -11.286 1.705   1.00 0.00 ? 326 THR A CG2  9  
ATOM 7305  H H    . THR A 1 35 ? 1.746   -7.444  2.393   1.00 0.00 ? 326 THR A H    9  
ATOM 7306  H HA   . THR A 1 35 ? 2.417   -9.278  0.302   1.00 0.00 ? 326 THR A HA   9  
ATOM 7307  H HB   . THR A 1 35 ? 0.463   -10.156 2.314   1.00 0.00 ? 326 THR A HB   9  
ATOM 7308  H HG1  . THR A 1 35 ? 2.938   -8.979  3.023   1.00 0.00 ? 326 THR A HG1  9  
ATOM 7309  H HG21 . THR A 1 35 ? 2.115   -11.974 2.535   1.00 0.00 ? 326 THR A HG21 9  
ATOM 7310  H HG22 . THR A 1 35 ? 3.182   -11.105 1.430   1.00 0.00 ? 326 THR A HG22 9  
ATOM 7311  H HG23 . THR A 1 35 ? 1.620   -11.703 0.862   1.00 0.00 ? 326 THR A HG23 9  
ATOM 7312  N N    . ASP A 1 36 ? 0.218   -9.893  -0.787  1.00 0.00 ? 327 ASP A N    9  
ATOM 7313  C CA   . ASP A 1 36 ? -0.976  -10.026 -1.602  1.00 0.00 ? 327 ASP A CA   9  
ATOM 7314  C C    . ASP A 1 36 ? -1.795  -11.228 -1.141  1.00 0.00 ? 327 ASP A C    9  
ATOM 7315  O O    . ASP A 1 36 ? -1.316  -12.360 -1.186  1.00 0.00 ? 327 ASP A O    9  
ATOM 7316  C CB   . ASP A 1 36 ? -0.596  -10.194 -3.071  1.00 0.00 ? 327 ASP A CB   9  
ATOM 7317  C CG   . ASP A 1 36 ? -1.804  -10.188 -3.987  1.00 0.00 ? 327 ASP A CG   9  
ATOM 7318  O OD1  . ASP A 1 36 ? -2.935  -10.329 -3.477  1.00 0.00 ? 327 ASP A OD1  9  
ATOM 7319  O OD2  . ASP A 1 36 ? -1.619  -10.043 -5.213  1.00 0.00 ? 327 ASP A OD2  9  
ATOM 7320  H H    . ASP A 1 36 ? 0.975   -10.493 -0.950  1.00 0.00 ? 327 ASP A H    9  
ATOM 7321  H HA   . ASP A 1 36 ? -1.557  -9.125  -1.488  1.00 0.00 ? 327 ASP A HA   9  
ATOM 7322  H HB2  . ASP A 1 36 ? 0.060   -9.390  -3.362  1.00 0.00 ? 327 ASP A HB2  9  
ATOM 7323  N N    . PRO A 1 37 ? -3.042  -11.009 -0.690  1.00 0.00 ? 328 PRO A N    9  
ATOM 7324  C CA   . PRO A 1 37 ? -3.905  -12.095 -0.221  1.00 0.00 ? 328 PRO A CA   9  
ATOM 7325  C C    . PRO A 1 37 ? -4.017  -13.207 -1.251  1.00 0.00 ? 328 PRO A C    9  
ATOM 7326  O O    . PRO A 1 37 ? -4.194  -14.375 -0.904  1.00 0.00 ? 328 PRO A O    9  
ATOM 7327  C CB   . PRO A 1 37 ? -5.269  -11.424 -0.007  1.00 0.00 ? 328 PRO A CB   9  
ATOM 7328  C CG   . PRO A 1 37 ? -5.164  -10.097 -0.677  1.00 0.00 ? 328 PRO A CG   9  
ATOM 7329  C CD   . PRO A 1 37 ? -3.716  -9.709  -0.608  1.00 0.00 ? 328 PRO A CD   9  
ATOM 7330  H HA   . PRO A 1 37 ? -3.552  -12.505 0.714   1.00 0.00 ? 328 PRO A HA   9  
ATOM 7331  H HB2  . PRO A 1 37 ? -6.043  -12.030 -0.456  1.00 0.00 ? 328 PRO A HB2  9  
ATOM 7332  H HG2  . PRO A 1 37 ? -5.481  -10.179 -1.706  1.00 0.00 ? 328 PRO A HG2  9  
ATOM 7333  H HD2  . PRO A 1 37 ? -3.456  -9.077  -1.443  1.00 0.00 ? 328 PRO A HD2  9  
ATOM 7334  N N    . ARG A 1 38 ? -3.912  -12.834 -2.520  1.00 0.00 ? 329 ARG A N    9  
ATOM 7335  C CA   . ARG A 1 38 ? -3.995  -13.800 -3.604  1.00 0.00 ? 329 ARG A CA   9  
ATOM 7336  C C    . ARG A 1 38 ? -2.792  -14.735 -3.579  1.00 0.00 ? 329 ARG A C    9  
ATOM 7337  O O    . ARG A 1 38 ? -2.886  -15.897 -3.976  1.00 0.00 ? 329 ARG A O    9  
ATOM 7338  C CB   . ARG A 1 38 ? -4.075  -13.081 -4.952  1.00 0.00 ? 329 ARG A CB   9  
ATOM 7339  C CG   . ARG A 1 38 ? -5.342  -12.262 -5.132  1.00 0.00 ? 329 ARG A CG   9  
ATOM 7340  C CD   . ARG A 1 38 ? -5.407  -11.630 -6.514  1.00 0.00 ? 329 ARG A CD   9  
ATOM 7341  N NE   . ARG A 1 38 ? -4.875  -12.513 -7.549  1.00 0.00 ? 329 ARG A NE   9  
ATOM 7342  C CZ   . ARG A 1 38 ? -5.544  -13.545 -8.053  1.00 0.00 ? 329 ARG A CZ   9  
ATOM 7343  N NH1  . ARG A 1 38 ? -6.766  -13.823 -7.618  1.00 0.00 ? 329 ARG A NH1  9  
ATOM 7344  N NH2  . ARG A 1 38 ? -4.991  -14.300 -8.991  1.00 0.00 ? 329 ARG A NH2  9  
ATOM 7345  H H    . ARG A 1 38 ? -3.776  -11.888 -2.732  1.00 0.00 ? 329 ARG A H    9  
ATOM 7346  H HA   . ARG A 1 38 ? -4.895  -14.378 -3.459  1.00 0.00 ? 329 ARG A HA   9  
ATOM 7347  H HB2  . ARG A 1 38 ? -3.226  -12.418 -5.044  1.00 0.00 ? 329 ARG A HB2  9  
ATOM 7348  H HG2  . ARG A 1 38 ? -6.198  -12.907 -5.001  1.00 0.00 ? 329 ARG A HG2  9  
ATOM 7349  H HD2  . ARG A 1 38 ? -6.438  -11.403 -6.744  1.00 0.00 ? 329 ARG A HD2  9  
ATOM 7350  H HE   . ARG A 1 38 ? -3.973  -12.328 -7.883  1.00 0.00 ? 329 ARG A HE   9  
ATOM 7351  H HH11 . ARG A 1 38 ? -7.185  -13.255 -6.910  1.00 0.00 ? 329 ARG A HH11 9  
ATOM 7352  H HH12 . ARG A 1 38 ? -7.267  -14.600 -7.999  1.00 0.00 ? 329 ARG A HH12 9  
ATOM 7353  H HH21 . ARG A 1 38 ? -4.069  -14.095 -9.320  1.00 0.00 ? 329 ARG A HH21 9  
ATOM 7354  H HH22 . ARG A 1 38 ? -5.495  -15.076 -9.369  1.00 0.00 ? 329 ARG A HH22 9  
ATOM 7355  N N    . LEU A 1 39 ? -1.659  -14.218 -3.109  1.00 0.00 ? 330 LEU A N    9  
ATOM 7356  C CA   . LEU A 1 39 ? -0.434  -15.004 -3.025  1.00 0.00 ? 330 LEU A CA   9  
ATOM 7357  C C    . LEU A 1 39 ? -0.489  -15.963 -1.841  1.00 0.00 ? 330 LEU A C    9  
ATOM 7358  O O    . LEU A 1 39 ? -0.651  -17.172 -2.014  1.00 0.00 ? 330 LEU A O    9  
ATOM 7359  C CB   . LEU A 1 39 ? 0.784   -14.086 -2.895  1.00 0.00 ? 330 LEU A CB   9  
ATOM 7360  C CG   . LEU A 1 39 ? 1.093   -13.238 -4.130  1.00 0.00 ? 330 LEU A CG   9  
ATOM 7361  C CD1  . LEU A 1 39 ? 2.277   -12.320 -3.862  1.00 0.00 ? 330 LEU A CD1  9  
ATOM 7362  C CD2  . LEU A 1 39 ? 1.364   -14.125 -5.335  1.00 0.00 ? 330 LEU A CD2  9  
ATOM 7363  H H    . LEU A 1 39 ? -1.648  -13.284 -2.811  1.00 0.00 ? 330 LEU A H    9  
ATOM 7364  H HA   . LEU A 1 39 ? -0.345  -15.577 -3.935  1.00 0.00 ? 330 LEU A HA   9  
ATOM 7365  H HB2  . LEU A 1 39 ? 0.619   -13.422 -2.059  1.00 0.00 ? 330 LEU A HB2  9  
ATOM 7366  H HG   . LEU A 1 39 ? 0.237   -12.620 -4.357  1.00 0.00 ? 330 LEU A HG   9  
ATOM 7367  H HD11 . LEU A 1 39 ? 3.178   -12.774 -4.249  1.00 0.00 ? 330 LEU A HD11 9  
ATOM 7368  H HD12 . LEU A 1 39 ? 2.115   -11.370 -4.350  1.00 0.00 ? 330 LEU A HD12 9  
ATOM 7369  H HD13 . LEU A 1 39 ? 2.381   -12.166 -2.799  1.00 0.00 ? 330 LEU A HD13 9  
ATOM 7370  H HD21 . LEU A 1 39 ? 1.175   -15.155 -5.075  1.00 0.00 ? 330 LEU A HD21 9  
ATOM 7371  H HD22 . LEU A 1 39 ? 0.714   -13.834 -6.149  1.00 0.00 ? 330 LEU A HD22 9  
ATOM 7372  H HD23 . LEU A 1 39 ? 2.395   -14.013 -5.640  1.00 0.00 ? 330 LEU A HD23 9  
ATOM 7373  N N    . SER A 1 40 ? -0.353  -15.416 -0.638  1.00 0.00 ? 331 SER A N    9  
ATOM 7374  C CA   . SER A 1 40 ? -0.390  -16.219 0.578   1.00 0.00 ? 331 SER A CA   9  
ATOM 7375  C C    . SER A 1 40 ? -1.829  -16.554 0.961   1.00 0.00 ? 331 SER A C    9  
ATOM 7376  O O    . SER A 1 40 ? -2.654  -15.661 1.152   1.00 0.00 ? 331 SER A O    9  
ATOM 7377  C CB   . SER A 1 40 ? 0.296   -15.476 1.727   1.00 0.00 ? 331 SER A CB   9  
ATOM 7378  O OG   . SER A 1 40 ? 1.658   -15.849 1.837   1.00 0.00 ? 331 SER A OG   9  
ATOM 7379  H H    . SER A 1 40 ? -0.224  -14.447 -0.566  1.00 0.00 ? 331 SER A H    9  
ATOM 7380  H HA   . SER A 1 40 ? 0.142   -17.138 0.386   1.00 0.00 ? 331 SER A HA   9  
ATOM 7381  H HB2  . SER A 1 40 ? 0.241   -14.412 1.549   1.00 0.00 ? 331 SER A HB2  9  
ATOM 7382  H HG   . SER A 1 40 ? 2.124   -15.207 2.379   1.00 0.00 ? 331 SER A HG   9  
ATOM 7383  N N    . ALA A 1 41 ? -2.122  -17.846 1.069   1.00 0.00 ? 332 ALA A N    9  
ATOM 7384  C CA   . ALA A 1 41 ? -3.460  -18.299 1.430   1.00 0.00 ? 332 ALA A CA   9  
ATOM 7385  C C    . ALA A 1 41 ? -3.411  -19.268 2.607   1.00 0.00 ? 332 ALA A C    9  
ATOM 7386  O O    . ALA A 1 41 ? -3.992  -20.352 2.556   1.00 0.00 ? 332 ALA A O    9  
ATOM 7387  C CB   . ALA A 1 41 ? -4.137  -18.953 0.233   1.00 0.00 ? 332 ALA A CB   9  
ATOM 7388  H H    . ALA A 1 41 ? -1.421  -18.511 0.902   1.00 0.00 ? 332 ALA A H    9  
ATOM 7389  H HA   . ALA A 1 41 ? -4.039  -17.431 1.716   1.00 0.00 ? 332 ALA A HA   9  
ATOM 7390  H HB1  . ALA A 1 41 ? -4.186  -18.250 -0.586  1.00 0.00 ? 332 ALA A HB1  9  
ATOM 7391  H HB2  . ALA A 1 41 ? -3.568  -19.820 -0.072  1.00 0.00 ? 332 ALA A HB2  9  
ATOM 7392  H HB3  . ALA A 1 41 ? -5.137  -19.259 0.505   1.00 0.00 ? 332 ALA A HB3  9  
ATOM 7393  N N    . ASN A 1 42 ? -2.714  -18.869 3.666   1.00 0.00 ? 333 ASN A N    9  
ATOM 7394  C CA   . ASN A 1 42 ? -2.586  -19.702 4.856   1.00 0.00 ? 333 ASN A CA   9  
ATOM 7395  C C    . ASN A 1 42 ? -3.008  -18.935 6.104   1.00 0.00 ? 333 ASN A C    9  
ATOM 7396  O O    . ASN A 1 42 ? -3.540  -17.815 5.958   1.00 0.00 ? 333 ASN A O    9  
ATOM 7397  C CB   . ASN A 1 42 ? -1.145  -20.191 5.007   1.00 0.00 ? 333 ASN A CB   9  
ATOM 7398  C CG   . ASN A 1 42 ? -1.056  -21.699 5.140   1.00 0.00 ? 333 ASN A CG   9  
ATOM 7399  O OD1  . ASN A 1 42 ? -0.231  -22.343 4.492   1.00 0.00 ? 333 ASN A OD1  9  
ATOM 7400  N ND2  . ASN A 1 42 ? -1.908  -22.271 5.982   1.00 0.00 ? 333 ASN A ND2  9  
ATOM 7401  O OXT  . ASN A 1 42 ? -2.802  -19.461 7.218   1.00 0.00 ? 333 ASN A OXT  9  
ATOM 7402  H H    . ASN A 1 42 ? -2.275  -17.993 3.647   1.00 0.00 ? 333 ASN A H    9  
ATOM 7403  H HA   . ASN A 1 42 ? -3.236  -20.555 4.734   1.00 0.00 ? 333 ASN A HA   9  
ATOM 7404  H HB2  . ASN A 1 42 ? -0.576  -19.891 4.139   1.00 0.00 ? 333 ASN A HB2  9  
ATOM 7405  H HD21 . ASN A 1 42 ? -2.538  -21.696 6.464   1.00 0.00 ? 333 ASN A HD21 9  
ATOM 7406  H HD22 . ASN A 1 42 ? -1.872  -23.245 6.088   1.00 0.00 ? 333 ASN A HD22 9  
ATOM 7407  N N    . GLY B 2 1  ? 18.280  -8.128  -4.504  1.00 0.00 ? 198 GLY B N    9  
ATOM 7408  C CA   . GLY B 2 1  ? 19.243  -6.992  -4.537  1.00 0.00 ? 198 GLY B CA   9  
ATOM 7409  C C    . GLY B 2 1  ? 19.402  -6.325  -3.184  1.00 0.00 ? 198 GLY B C    9  
ATOM 7410  O O    . GLY B 2 1  ? 20.474  -6.387  -2.582  1.00 0.00 ? 198 GLY B O    9  
ATOM 7411  H H1   . GLY B 2 1  ? 17.401  -7.865  -4.995  1.00 0.00 ? 198 GLY B H1   9  
ATOM 7412  H H2   . GLY B 2 1  ? 18.053  -8.375  -3.520  1.00 0.00 ? 198 GLY B H2   9  
ATOM 7413  H H3   . GLY B 2 1  ? 18.692  -8.959  -4.973  1.00 0.00 ? 198 GLY B H3   9  
ATOM 7414  H HA2  . GLY B 2 1  ? 20.206  -7.361  -4.859  1.00 0.00 ? 198 GLY B HA2  9  
ATOM 7415  H HA3  . GLY B 2 1  ? 18.895  -6.258  -5.250  1.00 0.00 ? 198 GLY B HA3  9  
ATOM 7416  N N    . PRO B 2 2  ? 18.341  -5.673  -2.676  1.00 0.00 ? 199 PRO B N    9  
ATOM 7417  C CA   . PRO B 2 2  ? 18.378  -4.991  -1.379  1.00 0.00 ? 199 PRO B CA   9  
ATOM 7418  C C    . PRO B 2 2  ? 18.445  -5.970  -0.211  1.00 0.00 ? 199 PRO B C    9  
ATOM 7419  O O    . PRO B 2 2  ? 18.905  -5.624  0.877   1.00 0.00 ? 199 PRO B O    9  
ATOM 7420  C CB   . PRO B 2 2  ? 17.062  -4.212  -1.348  1.00 0.00 ? 199 PRO B CB   9  
ATOM 7421  C CG   . PRO B 2 2  ? 16.151  -4.976  -2.246  1.00 0.00 ? 199 PRO B CG   9  
ATOM 7422  C CD   . PRO B 2 2  ? 17.022  -5.553  -3.327  1.00 0.00 ? 199 PRO B CD   9  
ATOM 7423  H HA   . PRO B 2 2  ? 19.209  -4.303  -1.318  1.00 0.00 ? 199 PRO B HA   9  
ATOM 7424  H HB2  . PRO B 2 2  ? 16.685  -4.177  -0.337  1.00 0.00 ? 199 PRO B HB2  9  
ATOM 7425  H HG2  . PRO B 2 2  ? 15.668  -5.767  -1.692  1.00 0.00 ? 199 PRO B HG2  9  
ATOM 7426  H HD2  . PRO B 2 2  ? 16.654  -6.520  -3.634  1.00 0.00 ? 199 PRO B HD2  9  
ATOM 7427  N N    . LEU B 2 3  ? 17.980  -7.194  -0.444  1.00 0.00 ? 200 LEU B N    9  
ATOM 7428  C CA   . LEU B 2 3  ? 17.988  -8.224  0.588   1.00 0.00 ? 200 LEU B CA   9  
ATOM 7429  C C    . LEU B 2 3  ? 17.010  -7.881  1.707   1.00 0.00 ? 200 LEU B C    9  
ATOM 7430  O O    . LEU B 2 3  ? 17.378  -7.858  2.881   1.00 0.00 ? 200 LEU B O    9  
ATOM 7431  C CB   . LEU B 2 3  ? 19.397  -8.392  1.164   1.00 0.00 ? 200 LEU B CB   9  
ATOM 7432  C CG   . LEU B 2 3  ? 20.537  -8.263  0.149   1.00 0.00 ? 200 LEU B CG   9  
ATOM 7433  C CD1  . LEU B 2 3  ? 21.643  -7.378  0.700   1.00 0.00 ? 200 LEU B CD1  9  
ATOM 7434  C CD2  . LEU B 2 3  ? 21.082  -9.635  -0.216  1.00 0.00 ? 200 LEU B CD2  9  
ATOM 7435  H H    . LEU B 2 3  ? 17.625  -7.409  -1.331  1.00 0.00 ? 200 LEU B H    9  
ATOM 7436  H HA   . LEU B 2 3  ? 17.683  -9.153  0.131   1.00 0.00 ? 200 LEU B HA   9  
ATOM 7437  H HB2  . LEU B 2 3  ? 19.540  -7.644  1.931   1.00 0.00 ? 200 LEU B HB2  9  
ATOM 7438  H HG   . LEU B 2 3  ? 20.159  -7.802  -0.752  1.00 0.00 ? 200 LEU B HG   9  
ATOM 7439  H HD11 . LEU B 2 3  ? 21.214  -6.629  1.348   1.00 0.00 ? 200 LEU B HD11 9  
ATOM 7440  H HD12 . LEU B 2 3  ? 22.342  -7.982  1.260   1.00 0.00 ? 200 LEU B HD12 9  
ATOM 7441  H HD13 . LEU B 2 3  ? 22.158  -6.896  -0.117  1.00 0.00 ? 200 LEU B HD13 9  
ATOM 7442  H HD21 . LEU B 2 3  ? 20.328  -10.385 -0.026  1.00 0.00 ? 200 LEU B HD21 9  
ATOM 7443  H HD22 . LEU B 2 3  ? 21.350  -9.649  -1.262  1.00 0.00 ? 200 LEU B HD22 9  
ATOM 7444  H HD23 . LEU B 2 3  ? 21.957  -9.845  0.382   1.00 0.00 ? 200 LEU B HD23 9  
ATOM 7445  N N    . GLY B 2 4  ? 15.761  -7.615  1.336   1.00 0.00 ? 201 GLY B N    9  
ATOM 7446  C CA   . GLY B 2 4  ? 14.752  -7.278  2.324   1.00 0.00 ? 201 GLY B CA   9  
ATOM 7447  C C    . GLY B 2 4  ? 13.543  -6.597  1.712   1.00 0.00 ? 201 GLY B C    9  
ATOM 7448  O O    . GLY B 2 4  ? 13.373  -5.385  1.845   1.00 0.00 ? 201 GLY B O    9  
ATOM 7449  H H    . GLY B 2 4  ? 15.523  -7.649  0.387   1.00 0.00 ? 201 GLY B H    9  
ATOM 7450  H HA2  . GLY B 2 4  ? 14.429  -8.184  2.815   1.00 0.00 ? 201 GLY B HA2  9  
ATOM 7451  H HA3  . GLY B 2 4  ? 15.190  -6.619  3.058   1.00 0.00 ? 201 GLY B HA3  9  
ATOM 7452  N N    . SER B 2 5  ? 12.705  -7.378  1.040   1.00 0.00 ? 202 SER B N    9  
ATOM 7453  C CA   . SER B 2 5  ? 11.505  -6.843  0.404   1.00 0.00 ? 202 SER B CA   9  
ATOM 7454  C C    . SER B 2 5  ? 10.253  -7.254  1.173   1.00 0.00 ? 202 SER B C    9  
ATOM 7455  O O    . SER B 2 5  ? 10.300  -8.137  2.029   1.00 0.00 ? 202 SER B O    9  
ATOM 7456  C CB   . SER B 2 5  ? 11.411  -7.328  -1.044  1.00 0.00 ? 202 SER B CB   9  
ATOM 7457  O OG   . SER B 2 5  ? 11.994  -6.393  -1.935  1.00 0.00 ? 202 SER B OG   9  
ATOM 7458  H H    . SER B 2 5  ? 12.897  -8.336  0.968   1.00 0.00 ? 202 SER B H    9  
ATOM 7459  H HA   . SER B 2 5  ? 11.579  -5.766  0.410   1.00 0.00 ? 202 SER B HA   9  
ATOM 7460  H HB2  . SER B 2 5  ? 11.931  -8.270  -1.140  1.00 0.00 ? 202 SER B HB2  9  
ATOM 7461  H HG   . SER B 2 5  ? 11.327  -6.076  -2.549  1.00 0.00 ? 202 SER B HG   9  
ATOM 7462  N N    . GLU B 2 6  ? 9.135   -6.606  0.863   1.00 0.00 ? 203 GLU B N    9  
ATOM 7463  C CA   . GLU B 2 6  ? 7.868   -6.904  1.523   1.00 0.00 ? 203 GLU B CA   9  
ATOM 7464  C C    . GLU B 2 6  ? 7.897   -6.467  2.984   1.00 0.00 ? 203 GLU B C    9  
ATOM 7465  O O    . GLU B 2 6  ? 7.265   -5.479  3.359   1.00 0.00 ? 203 GLU B O    9  
ATOM 7466  C CB   . GLU B 2 6  ? 7.561   -8.399  1.430   1.00 0.00 ? 203 GLU B CB   9  
ATOM 7467  C CG   . GLU B 2 6  ? 6.286   -8.711  0.665   1.00 0.00 ? 203 GLU B CG   9  
ATOM 7468  C CD   . GLU B 2 6  ? 5.863   -10.160 0.803   1.00 0.00 ? 203 GLU B CD   9  
ATOM 7469  O OE1  . GLU B 2 6  ? 5.268   -10.508 1.845   1.00 0.00 ? 203 GLU B OE1  9  
ATOM 7470  O OE2  . GLU B 2 6  ? 6.128   -10.948 -0.129  1.00 0.00 ? 203 GLU B OE2  9  
ATOM 7471  H H    . GLU B 2 6  ? 9.161   -5.910  0.173   1.00 0.00 ? 203 GLU B H    9  
ATOM 7472  H HA   . GLU B 2 6  ? 7.092   -6.355  1.011   1.00 0.00 ? 203 GLU B HA   9  
ATOM 7473  H HB2  . GLU B 2 6  ? 8.382   -8.894  0.933   1.00 0.00 ? 203 GLU B HB2  9  
ATOM 7474  H HG2  . GLU B 2 6  ? 5.492   -8.084  1.043   1.00 0.00 ? 203 GLU B HG2  9  
ATOM 7475  N N    . LEU B 2 7  ? 8.628   -7.215  3.807   1.00 0.00 ? 204 LEU B N    9  
ATOM 7476  C CA   . LEU B 2 7  ? 8.747   -6.908  5.236   1.00 0.00 ? 204 LEU B CA   9  
ATOM 7477  C C    . LEU B 2 7  ? 7.392   -6.532  5.841   1.00 0.00 ? 204 LEU B C    9  
ATOM 7478  O O    . LEU B 2 7  ? 6.343   -6.858  5.285   1.00 0.00 ? 204 LEU B O    9  
ATOM 7479  C CB   . LEU B 2 7  ? 9.759   -5.779  5.450   1.00 0.00 ? 204 LEU B CB   9  
ATOM 7480  C CG   . LEU B 2 7  ? 9.261   -4.370  5.117   1.00 0.00 ? 204 LEU B CG   9  
ATOM 7481  C CD1  . LEU B 2 7  ? 9.947   -3.344  6.005   1.00 0.00 ? 204 LEU B CD1  9  
ATOM 7482  C CD2  . LEU B 2 7  ? 9.503   -4.051  3.648   1.00 0.00 ? 204 LEU B CD2  9  
ATOM 7483  H H    . LEU B 2 7  ? 9.104   -7.993  3.443   1.00 0.00 ? 204 LEU B H    9  
ATOM 7484  H HA   . LEU B 2 7  ? 9.108   -7.797  5.735   1.00 0.00 ? 204 LEU B HA   9  
ATOM 7485  H HB2  . LEU B 2 7  ? 10.063  -5.792  6.487   1.00 0.00 ? 204 LEU B HB2  9  
ATOM 7486  H HG   . LEU B 2 7  ? 8.199   -4.313  5.302   1.00 0.00 ? 204 LEU B HG   9  
ATOM 7487  H HD11 . LEU B 2 7  ? 11.018  -3.441  5.906   1.00 0.00 ? 204 LEU B HD11 9  
ATOM 7488  H HD12 . LEU B 2 7  ? 9.648   -2.351  5.706   1.00 0.00 ? 204 LEU B HD12 9  
ATOM 7489  H HD13 . LEU B 2 7  ? 9.664   -3.512  7.033   1.00 0.00 ? 204 LEU B HD13 9  
ATOM 7490  H HD21 . LEU B 2 7  ? 10.257  -3.281  3.565   1.00 0.00 ? 204 LEU B HD21 9  
ATOM 7491  H HD22 . LEU B 2 7  ? 9.839   -4.940  3.136   1.00 0.00 ? 204 LEU B HD22 9  
ATOM 7492  H HD23 . LEU B 2 7  ? 8.583   -3.703  3.199   1.00 0.00 ? 204 LEU B HD23 9  
ATOM 7493  N N    . GLU B 2 8  ? 7.421   -5.843  6.981   1.00 0.00 ? 205 GLU B N    9  
ATOM 7494  C CA   . GLU B 2 8  ? 6.193   -5.431  7.654   1.00 0.00 ? 205 GLU B CA   9  
ATOM 7495  C C    . GLU B 2 8  ? 6.381   -4.105  8.385   1.00 0.00 ? 205 GLU B C    9  
ATOM 7496  O O    . GLU B 2 8  ? 6.901   -4.066  9.499   1.00 0.00 ? 205 GLU B O    9  
ATOM 7497  C CB   . GLU B 2 8  ? 5.746   -6.508  8.643   1.00 0.00 ? 205 GLU B CB   9  
ATOM 7498  C CG   . GLU B 2 8  ? 4.784   -7.523  8.049   1.00 0.00 ? 205 GLU B CG   9  
ATOM 7499  C CD   . GLU B 2 8  ? 3.397   -7.437  8.656   1.00 0.00 ? 205 GLU B CD   9  
ATOM 7500  O OE1  . GLU B 2 8  ? 3.026   -6.346  9.137   1.00 0.00 ? 205 GLU B OE1  9  
ATOM 7501  O OE2  . GLU B 2 8  ? 2.683   -8.462  8.651   1.00 0.00 ? 205 GLU B OE2  9  
ATOM 7502  H H    . GLU B 2 8  ? 8.285   -5.607  7.378   1.00 0.00 ? 205 GLU B H    9  
ATOM 7503  H HA   . GLU B 2 8  ? 5.429   -5.309  6.901   1.00 0.00 ? 205 GLU B HA   9  
ATOM 7504  H HB2  . GLU B 2 8  ? 6.619   -7.036  9.000   1.00 0.00 ? 205 GLU B HB2  9  
ATOM 7505  H HG2  . GLU B 2 8  ? 4.706   -7.346  6.986   1.00 0.00 ? 205 GLU B HG2  9  
ATOM 7506  N N    . SER B 2 9  ? 5.954   -3.016  7.746   1.00 0.00 ? 206 SER B N    9  
ATOM 7507  C CA   . SER B 2 9  ? 6.068   -1.679  8.335   1.00 0.00 ? 206 SER B CA   9  
ATOM 7508  C C    . SER B 2 9  ? 5.765   -0.566  7.322   1.00 0.00 ? 206 SER B C    9  
ATOM 7509  O O    . SER B 2 9  ? 5.042   0.379   7.634   1.00 0.00 ? 206 SER B O    9  
ATOM 7510  C CB   . SER B 2 9  ? 7.468   -1.470  8.921   1.00 0.00 ? 206 SER B CB   9  
ATOM 7511  O OG   . SER B 2 9  ? 7.406   -1.225  10.316  1.00 0.00 ? 206 SER B OG   9  
ATOM 7512  H H    . SER B 2 9  ? 5.557   -3.116  6.862   1.00 0.00 ? 206 SER B H    9  
ATOM 7513  H HA   . SER B 2 9  ? 5.348   -1.615  9.137   1.00 0.00 ? 206 SER B HA   9  
ATOM 7514  H HB2  . SER B 2 9  ? 8.064   -2.354  8.751   1.00 0.00 ? 206 SER B HB2  9  
ATOM 7515  H HG   . SER B 2 9  ? 8.148   -0.676  10.578  1.00 0.00 ? 206 SER B HG   9  
ATOM 7516  N N    . PRO B 2 10 ? 6.313   -0.662  6.095   1.00 0.00 ? 207 PRO B N    9  
ATOM 7517  C CA   . PRO B 2 10 ? 6.120   0.356   5.048   1.00 0.00 ? 207 PRO B CA   9  
ATOM 7518  C C    . PRO B 2 10 ? 4.669   0.537   4.578   1.00 0.00 ? 207 PRO B C    9  
ATOM 7519  O O    . PRO B 2 10 ? 4.237   1.671   4.369   1.00 0.00 ? 207 PRO B O    9  
ATOM 7520  C CB   . PRO B 2 10 ? 6.990   -0.148  3.890   1.00 0.00 ? 207 PRO B CB   9  
ATOM 7521  C CG   . PRO B 2 10 ? 7.928   -1.125  4.505   1.00 0.00 ? 207 PRO B CG   9  
ATOM 7522  C CD   . PRO B 2 10 ? 7.159   -1.764  5.617   1.00 0.00 ? 207 PRO B CD   9  
ATOM 7523  H HA   . PRO B 2 10 ? 6.495   1.310   5.371   1.00 0.00 ? 207 PRO B HA   9  
ATOM 7524  H HB2  . PRO B 2 10 ? 6.365   -0.617  3.152   1.00 0.00 ? 207 PRO B HB2  9  
ATOM 7525  H HG2  . PRO B 2 10 ? 8.222   -1.864  3.775   1.00 0.00 ? 207 PRO B HG2  9  
ATOM 7526  H HD2  . PRO B 2 10 ? 6.555   -2.575  5.236   1.00 0.00 ? 207 PRO B HD2  9  
ATOM 7527  N N    . PRO B 2 11 ? 3.890   -0.555  4.394   1.00 0.00 ? 208 PRO B N    9  
ATOM 7528  C CA   . PRO B 2 11 ? 2.515   -0.455  3.923   1.00 0.00 ? 208 PRO B CA   9  
ATOM 7529  C C    . PRO B 2 11 ? 1.763   0.712   4.536   1.00 0.00 ? 208 PRO B C    9  
ATOM 7530  O O    . PRO B 2 11 ? 1.414   0.673   5.715   1.00 0.00 ? 208 PRO B O    9  
ATOM 7531  C CB   . PRO B 2 11 ? 1.871   -1.769  4.346   1.00 0.00 ? 208 PRO B CB   9  
ATOM 7532  C CG   . PRO B 2 11 ? 2.994   -2.729  4.561   1.00 0.00 ? 208 PRO B CG   9  
ATOM 7533  C CD   . PRO B 2 11 ? 4.280   -1.948  4.626   1.00 0.00 ? 208 PRO B CD   9  
ATOM 7534  H HA   . PRO B 2 11 ? 2.475   -0.380  2.856   1.00 0.00 ? 208 PRO B HA   9  
ATOM 7535  H HB2  . PRO B 2 11 ? 1.297   -1.615  5.244   1.00 0.00 ? 208 PRO B HB2  9  
ATOM 7536  H HG2  . PRO B 2 11 ? 2.841   -3.260  5.488   1.00 0.00 ? 208 PRO B HG2  9  
ATOM 7537  H HD2  . PRO B 2 11 ? 4.715   -2.062  5.593   1.00 0.00 ? 208 PRO B HD2  9  
ATOM 7538  N N    . PRO B 2 12 ? 1.567   1.794   3.757   1.00 0.00 ? 209 PRO B N    9  
ATOM 7539  C CA   . PRO B 2 12 ? 0.818   2.974   4.191   1.00 0.00 ? 209 PRO B CA   9  
ATOM 7540  C C    . PRO B 2 12 ? -0.484  2.606   4.910   1.00 0.00 ? 209 PRO B C    9  
ATOM 7541  O O    . PRO B 2 12 ? -0.732  1.441   5.203   1.00 0.00 ? 209 PRO B O    9  
ATOM 7542  C CB   . PRO B 2 12 ? 0.520   3.699   2.867   1.00 0.00 ? 209 PRO B CB   9  
ATOM 7543  C CG   . PRO B 2 12 ? 1.047   2.831   1.787   1.00 0.00 ? 209 PRO B CG   9  
ATOM 7544  C CD   . PRO B 2 12 ? 2.106   1.999   2.405   1.00 0.00 ? 209 PRO B CD   9  
ATOM 7545  H HA   . PRO B 2 12 ? 1.414   3.611   4.827   1.00 0.00 ? 209 PRO B HA   9  
ATOM 7546  H HB2  . PRO B 2 12 ? -0.536  3.814   2.760   1.00 0.00 ? 209 PRO B HB2  9  
ATOM 7547  H HG2  . PRO B 2 12 ? 0.258   2.202   1.425   1.00 0.00 ? 209 PRO B HG2  9  
ATOM 7548  H HD2  . PRO B 2 12 ? 2.208   1.076   1.861   1.00 0.00 ? 209 PRO B HD2  9  
ATOM 7549  N N    . PRO B 2 13 ? -1.367  3.585   5.170   1.00 0.00 ? 210 PRO B N    9  
ATOM 7550  C CA   . PRO B 2 13 ? -2.610  3.333   5.875   1.00 0.00 ? 210 PRO B CA   9  
ATOM 7551  C C    . PRO B 2 13 ? -3.725  2.890   4.943   1.00 0.00 ? 210 PRO B C    9  
ATOM 7552  O O    . PRO B 2 13 ? -3.621  3.023   3.724   1.00 0.00 ? 210 PRO B O    9  
ATOM 7553  C CB   . PRO B 2 13 ? -2.929  4.686   6.493   1.00 0.00 ? 210 PRO B CB   9  
ATOM 7554  C CG   . PRO B 2 13 ? -2.326  5.696   5.569   1.00 0.00 ? 210 PRO B CG   9  
ATOM 7555  C CD   . PRO B 2 13 ? -1.258  4.994   4.761   1.00 0.00 ? 210 PRO B CD   9  
ATOM 7556  H HA   . PRO B 2 13 ? -2.481  2.599   6.655   1.00 0.00 ? 210 PRO B HA   9  
ATOM 7557  H HB2  . PRO B 2 13 ? -4.000  4.801   6.560   1.00 0.00 ? 210 PRO B HB2  9  
ATOM 7558  H HG2  . PRO B 2 13 ? -3.090  6.082   4.911   1.00 0.00 ? 210 PRO B HG2  9  
ATOM 7559  H HD2  . PRO B 2 13 ? -1.469  5.098   3.707   1.00 0.00 ? 210 PRO B HD2  9  
ATOM 7560  N N    . TYR B 2 14 ? -4.794  2.364   5.525   1.00 0.00 ? 211 TYR B N    9  
ATOM 7561  C CA   . TYR B 2 14 ? -5.928  1.902   4.746   1.00 0.00 ? 211 TYR B CA   9  
ATOM 7562  C C    . TYR B 2 14 ? -6.549  3.064   3.977   1.00 0.00 ? 211 TYR B C    9  
ATOM 7563  O O    . TYR B 2 14 ? -6.244  3.281   2.804   1.00 0.00 ? 211 TYR B O    9  
ATOM 7564  C CB   . TYR B 2 14 ? -6.971  1.246   5.665   1.00 0.00 ? 211 TYR B CB   9  
ATOM 7565  C CG   . TYR B 2 14 ? -8.321  1.042   5.012   1.00 0.00 ? 211 TYR B CG   9  
ATOM 7566  C CD1  . TYR B 2 14 ? -8.433  0.322   3.834   1.00 0.00 ? 211 TYR B CD1  9  
ATOM 7567  C CD2  . TYR B 2 14 ? -9.476  1.582   5.564   1.00 0.00 ? 211 TYR B CD2  9  
ATOM 7568  C CE1  . TYR B 2 14 ? -9.656  0.141   3.220   1.00 0.00 ? 211 TYR B CE1  9  
ATOM 7569  C CE2  . TYR B 2 14 ? -10.706 1.408   4.958   1.00 0.00 ? 211 TYR B CE2  9  
ATOM 7570  C CZ   . TYR B 2 14 ? -10.790 0.687   3.785   1.00 0.00 ? 211 TYR B CZ   9  
ATOM 7571  O OH   . TYR B 2 14 ? -12.011 0.510   3.175   1.00 0.00 ? 211 TYR B OH   9  
ATOM 7572  H H    . TYR B 2 14 ? -4.821  2.290   6.501   1.00 0.00 ? 211 TYR B H    9  
ATOM 7573  H HA   . TYR B 2 14 ? -5.564  1.169   4.039   1.00 0.00 ? 211 TYR B HA   9  
ATOM 7574  H HB2  . TYR B 2 14 ? -6.607  0.279   5.977   1.00 0.00 ? 211 TYR B HB2  9  
ATOM 7575  H HD1  . TYR B 2 14 ? -7.546  -0.106  3.398   1.00 0.00 ? 211 TYR B HD1  9  
ATOM 7576  H HD2  . TYR B 2 14 ? -9.404  2.146   6.484   1.00 0.00 ? 211 TYR B HD2  9  
ATOM 7577  H HE1  . TYR B 2 14 ? -9.720  -0.420  2.300   1.00 0.00 ? 211 TYR B HE1  9  
ATOM 7578  H HE2  . TYR B 2 14 ? -11.593 1.835   5.403   1.00 0.00 ? 211 TYR B HE2  9  
ATOM 7579  H HH   . TYR B 2 14 ? -12.708 0.555   3.835   1.00 0.00 ? 211 TYR B HH   9  
ATOM 7580  N N    . SER B 2 15 ? -7.419  3.811   4.648   1.00 0.00 ? 212 SER B N    9  
ATOM 7581  C CA   . SER B 2 15 ? -8.084  4.950   4.031   1.00 0.00 ? 212 SER B CA   9  
ATOM 7582  C C    . SER B 2 15 ? -8.906  4.506   2.824   1.00 0.00 ? 212 SER B C    9  
ATOM 7583  O O    . SER B 2 15 ? -10.117 4.314   2.927   1.00 0.00 ? 212 SER B O    9  
ATOM 7584  C CB   . SER B 2 15 ? -7.053  6.000   3.615   1.00 0.00 ? 212 SER B CB   9  
ATOM 7585  O OG   . SER B 2 15 ? -7.231  7.204   4.340   1.00 0.00 ? 212 SER B OG   9  
ATOM 7586  H H    . SER B 2 15 ? -7.618  3.591   5.582   1.00 0.00 ? 212 SER B H    9  
ATOM 7587  H HA   . SER B 2 15 ? -8.748  5.382   4.764   1.00 0.00 ? 212 SER B HA   9  
ATOM 7588  H HB2  . SER B 2 15 ? -6.060  5.623   3.806   1.00 0.00 ? 212 SER B HB2  9  
ATOM 7589  H HG   . SER B 2 15 ? -7.748  7.820   3.817   1.00 0.00 ? 212 SER B HG   9  
ATOM 7590  N N    . ARG B 2 16 ? -8.240  4.345   1.679   1.00 0.00 ? 213 ARG B N    9  
ATOM 7591  C CA   . ARG B 2 16 ? -8.904  3.920   0.445   1.00 0.00 ? 213 ARG B CA   9  
ATOM 7592  C C    . ARG B 2 16 ? -8.021  4.200   -0.767  1.00 0.00 ? 213 ARG B C    9  
ATOM 7593  O O    . ARG B 2 16 ? -7.824  3.333   -1.617  1.00 0.00 ? 213 ARG B O    9  
ATOM 7594  C CB   . ARG B 2 16 ? -10.253 4.627   0.273   1.00 0.00 ? 213 ARG B CB   9  
ATOM 7595  C CG   . ARG B 2 16 ? -11.445 3.772   0.673   1.00 0.00 ? 213 ARG B CG   9  
ATOM 7596  C CD   . ARG B 2 16 ? -12.091 3.113   -0.535  1.00 0.00 ? 213 ARG B CD   9  
ATOM 7597  N NE   . ARG B 2 16 ? -13.335 3.772   -0.920  1.00 0.00 ? 213 ARG B NE   9  
ATOM 7598  C CZ   . ARG B 2 16 ? -14.426 3.788   -0.161  1.00 0.00 ? 213 ARG B CZ   9  
ATOM 7599  N NH1  . ARG B 2 16 ? -14.421 3.190   1.023   1.00 0.00 ? 213 ARG B NH1  9  
ATOM 7600  N NH2  . ARG B 2 16 ? -15.522 4.401   -0.586  1.00 0.00 ? 213 ARG B NH2  9  
ATOM 7601  H H    . ARG B 2 16 ? -7.275  4.509   1.665   1.00 0.00 ? 213 ARG B H    9  
ATOM 7602  H HA   . ARG B 2 16 ? -9.072  2.855   0.512   1.00 0.00 ? 213 ARG B HA   9  
ATOM 7603  H HB2  . ARG B 2 16 ? -10.259 5.521   0.881   1.00 0.00 ? 213 ARG B HB2  9  
ATOM 7604  H HG2  . ARG B 2 16 ? -11.111 3.002   1.354   1.00 0.00 ? 213 ARG B HG2  9  
ATOM 7605  H HD2  . ARG B 2 16 ? -11.400 3.157   -1.364  1.00 0.00 ? 213 ARG B HD2  9  
ATOM 7606  H HE   . ARG B 2 16 ? -13.360 4.222   -1.790  1.00 0.00 ? 213 ARG B HE   9  
ATOM 7607  H HH11 . ARG B 2 16 ? -13.597 2.727   1.346   1.00 0.00 ? 213 ARG B HH11 9  
ATOM 7608  H HH12 . ARG B 2 16 ? -15.243 3.204   1.593   1.00 0.00 ? 213 ARG B HH12 9  
ATOM 7609  H HH21 . ARG B 2 16 ? -15.528 4.853   -1.478  1.00 0.00 ? 213 ARG B HH21 9  
ATOM 7610  H HH22 . ARG B 2 16 ? -16.342 4.413   -0.014  1.00 0.00 ? 213 ARG B HH22 9  
ATOM 7611  N N    . TYR B 2 17 ? -7.487  5.416   -0.838  1.00 0.00 ? 214 TYR B N    9  
ATOM 7612  C CA   . TYR B 2 17 ? -6.630  5.816   -1.951  1.00 0.00 ? 214 TYR B CA   9  
ATOM 7613  C C    . TYR B 2 17 ? -5.168  5.468   -1.676  1.00 0.00 ? 214 TYR B C    9  
ATOM 7614  O O    . TYR B 2 17 ? -4.818  5.053   -0.571  1.00 0.00 ? 214 TYR B O    9  
ATOM 7615  C CB   . TYR B 2 17 ? -6.775  7.319   -2.207  1.00 0.00 ? 214 TYR B CB   9  
ATOM 7616  C CG   . TYR B 2 17 ? -8.189  7.828   -2.056  1.00 0.00 ? 214 TYR B CG   9  
ATOM 7617  C CD1  . TYR B 2 17 ? -9.276  6.990   -2.269  1.00 0.00 ? 214 TYR B CD1  9  
ATOM 7618  C CD2  . TYR B 2 17 ? -8.437  9.148   -1.705  1.00 0.00 ? 214 TYR B CD2  9  
ATOM 7619  C CE1  . TYR B 2 17 ? -10.569 7.452   -2.138  1.00 0.00 ? 214 TYR B CE1  9  
ATOM 7620  C CE2  . TYR B 2 17 ? -9.729  9.618   -1.571  1.00 0.00 ? 214 TYR B CE2  9  
ATOM 7621  C CZ   . TYR B 2 17 ? -10.791 8.768   -1.788  1.00 0.00 ? 214 TYR B CZ   9  
ATOM 7622  O OH   . TYR B 2 17 ? -12.080 9.232   -1.657  1.00 0.00 ? 214 TYR B OH   9  
ATOM 7623  H H    . TYR B 2 17 ? -7.673  6.060   -0.124  1.00 0.00 ? 214 TYR B H    9  
ATOM 7624  H HA   . TYR B 2 17 ? -6.955  5.280   -2.829  1.00 0.00 ? 214 TYR B HA   9  
ATOM 7625  H HB2  . TYR B 2 17 ? -6.152  7.859   -1.510  1.00 0.00 ? 214 TYR B HB2  9  
ATOM 7626  H HD1  . TYR B 2 17 ? -9.099  5.960   -2.543  1.00 0.00 ? 214 TYR B HD1  9  
ATOM 7627  H HD2  . TYR B 2 17 ? -7.603  9.812   -1.537  1.00 0.00 ? 214 TYR B HD2  9  
ATOM 7628  H HE1  . TYR B 2 17 ? -11.399 6.785   -2.309  1.00 0.00 ? 214 TYR B HE1  9  
ATOM 7629  H HE2  . TYR B 2 17 ? -9.900  10.648  -1.298  1.00 0.00 ? 214 TYR B HE2  9  
ATOM 7630  H HH   . TYR B 2 17 ? -12.277 9.371   -0.727  1.00 0.00 ? 214 TYR B HH   9  
ATOM 7631  N N    . PRO B 2 18 ? -4.291  5.631   -2.685  1.00 0.00 ? 215 PRO B N    9  
ATOM 7632  C CA   . PRO B 2 18 ? -2.871  5.332   -2.553  1.00 0.00 ? 215 PRO B CA   9  
ATOM 7633  C C    . PRO B 2 18 ? -2.084  6.496   -1.968  1.00 0.00 ? 215 PRO B C    9  
ATOM 7634  O O    . PRO B 2 18 ? -1.738  7.444   -2.675  1.00 0.00 ? 215 PRO B O    9  
ATOM 7635  C CB   . PRO B 2 18 ? -2.440  5.049   -3.992  1.00 0.00 ? 215 PRO B CB   9  
ATOM 7636  C CG   . PRO B 2 18 ? -3.395  5.809   -4.858  1.00 0.00 ? 215 PRO B CG   9  
ATOM 7637  C CD   . PRO B 2 18 ? -4.621  6.126   -4.031  1.00 0.00 ? 215 PRO B CD   9  
ATOM 7638  H HA   . PRO B 2 18 ? -2.708  4.454   -1.947  1.00 0.00 ? 215 PRO B HA   9  
ATOM 7639  H HB2  . PRO B 2 18 ? -1.424  5.390   -4.138  1.00 0.00 ? 215 PRO B HB2  9  
ATOM 7640  H HG2  . PRO B 2 18 ? -2.930  6.725   -5.193  1.00 0.00 ? 215 PRO B HG2  9  
ATOM 7641  H HD2  . PRO B 2 18 ? -4.790  7.191   -4.014  1.00 0.00 ? 215 PRO B HD2  9  
ATOM 7642  N N    . MET B 2 19 ? -1.802  6.417   -0.673  1.00 0.00 ? 216 MET B N    9  
ATOM 7643  C CA   . MET B 2 19 ? -1.057  7.464   0.011   1.00 0.00 ? 216 MET B CA   9  
ATOM 7644  C C    . MET B 2 19 ? 0.093   6.887   0.822   1.00 0.00 ? 216 MET B C    9  
ATOM 7645  O O    . MET B 2 19 ? -0.120  6.161   1.791   1.00 0.00 ? 216 MET B O    9  
ATOM 7646  C CB   . MET B 2 19 ? -1.988  8.264   0.924   1.00 0.00 ? 216 MET B CB   9  
ATOM 7647  C CG   . MET B 2 19 ? -2.697  7.410   1.964   1.00 0.00 ? 216 MET B CG   9  
ATOM 7648  S SD   . MET B 2 19 ? -4.335  8.043   2.386   1.00 0.00 ? 216 MET B SD   9  
ATOM 7649  C CE   . MET B 2 19 ? -5.317  7.409   1.029   1.00 0.00 ? 216 MET B CE   9  
ATOM 7650  H H    . MET B 2 19 ? -2.108  5.638   -0.163  1.00 0.00 ? 216 MET B H    9  
ATOM 7651  H HA   . MET B 2 19 ? -0.649  8.120   -0.740  1.00 0.00 ? 216 MET B HA   9  
ATOM 7652  H HB2  . MET B 2 19 ? -1.408  9.015   1.441   1.00 0.00 ? 216 MET B HB2  9  
ATOM 7653  H HG2  . MET B 2 19 ? -2.803  6.408   1.574   1.00 0.00 ? 216 MET B HG2  9  
ATOM 7654  H HE1  . MET B 2 19 ? -4.816  7.611   0.094   1.00 0.00 ? 216 MET B HE1  9  
ATOM 7655  H HE2  . MET B 2 19 ? -5.448  6.342   1.145   1.00 0.00 ? 216 MET B HE2  9  
ATOM 7656  H HE3  . MET B 2 19 ? -6.284  7.891   1.028   1.00 0.00 ? 216 MET B HE3  9  
ATOM 7657  N N    . ASP B 2 20 ? 1.314   7.227   0.419   1.00 0.00 ? 217 ASP B N    9  
ATOM 7658  C CA   . ASP B 2 20 ? 2.519   6.759   1.100   1.00 0.00 ? 217 ASP B CA   9  
ATOM 7659  C C    . ASP B 2 20 ? 2.371   6.848   2.617   1.00 0.00 ? 217 ASP B C    9  
ATOM 7660  O O    . ASP B 2 20 ? 3.192   6.232   3.328   1.00 0.00 ? 217 ASP B O    9  
ATOM 7661  C CB   . ASP B 2 20 ? 3.727   7.585   0.651   1.00 0.00 ? 217 ASP B CB   9  
ATOM 7662  C CG   . ASP B 2 20 ? 3.569   9.059   0.974   1.00 0.00 ? 217 ASP B CG   9  
ATOM 7663  O OD1  . ASP B 2 20 ? 2.885   9.765   0.204   1.00 0.00 ? 217 ASP B OD1  9  
ATOM 7664  O OD2  . ASP B 2 20 ? 4.128   9.505   1.998   1.00 0.00 ? 217 ASP B OD2  9  
ATOM 7665  O OXT  . ASP B 2 20 ? 1.435   7.533   3.080   1.00 0.00 ? 217 ASP B OXT  9  
ATOM 7666  H H    . ASP B 2 20 ? 1.406   7.807   -0.366  1.00 0.00 ? 217 ASP B H    9  
ATOM 7667  H HA   . ASP B 2 20 ? 2.679   5.728   0.824   1.00 0.00 ? 217 ASP B HA   9  
ATOM 7668  H HB2  . ASP B 2 20 ? 4.612   7.220   1.149   1.00 0.00 ? 217 ASP B HB2  9  
ATOM 7669  N N    . GLY A 1 1  ? 9.332   -12.966 -8.579  1.00 0.00 ? 292 GLY A N    10 
ATOM 7670  C CA   . GLY A 1 1  ? 8.644   -14.274 -8.398  1.00 0.00 ? 292 GLY A CA   10 
ATOM 7671  C C    . GLY A 1 1  ? 7.257   -14.291 -9.011  1.00 0.00 ? 292 GLY A C    10 
ATOM 7672  O O    . GLY A 1 1  ? 7.007   -13.603 -10.000 1.00 0.00 ? 292 GLY A O    10 
ATOM 7673  H H1   . GLY A 1 1  ? 10.360  -13.087 -8.486  1.00 0.00 ? 292 GLY A H1   10 
ATOM 7674  H H2   . GLY A 1 1  ? 9.007   -12.289 -7.860  1.00 0.00 ? 292 GLY A H2   10 
ATOM 7675  H H3   . GLY A 1 1  ? 9.122   -12.580 -9.522  1.00 0.00 ? 292 GLY A H3   10 
ATOM 7676  H HA2  . GLY A 1 1  ? 9.240   -15.047 -8.861  1.00 0.00 ? 292 GLY A HA2  10 
ATOM 7677  H HA3  . GLY A 1 1  ? 8.562   -14.481 -7.341  1.00 0.00 ? 292 GLY A HA3  10 
ATOM 7678  N N    . PRO A 1 2  ? 6.326   -15.076 -8.440  1.00 0.00 ? 293 PRO A N    10 
ATOM 7679  C CA   . PRO A 1 2  ? 4.955   -15.170 -8.950  1.00 0.00 ? 293 PRO A CA   10 
ATOM 7680  C C    . PRO A 1 2  ? 4.177   -13.873 -8.757  1.00 0.00 ? 293 PRO A C    10 
ATOM 7681  O O    . PRO A 1 2  ? 3.366   -13.494 -9.602  1.00 0.00 ? 293 PRO A O    10 
ATOM 7682  C CB   . PRO A 1 2  ? 4.338   -16.298 -8.118  1.00 0.00 ? 293 PRO A CB   10 
ATOM 7683  C CG   . PRO A 1 2  ? 5.145   -16.337 -6.866  1.00 0.00 ? 293 PRO A CG   10 
ATOM 7684  C CD   . PRO A 1 2  ? 6.539   -15.925 -7.255  1.00 0.00 ? 293 PRO A CD   10 
ATOM 7685  H HA   . PRO A 1 2  ? 4.941   -15.442 -9.995  1.00 0.00 ? 293 PRO A HA   10 
ATOM 7686  H HB2  . PRO A 1 2  ? 3.302   -16.070 -7.914  1.00 0.00 ? 293 PRO A HB2  10 
ATOM 7687  H HG2  . PRO A 1 2  ? 4.738   -15.644 -6.145  1.00 0.00 ? 293 PRO A HG2  10 
ATOM 7688  H HD2  . PRO A 1 2  ? 7.003   -15.365 -6.457  1.00 0.00 ? 293 PRO A HD2  10 
ATOM 7689  N N    . LEU A 1 3  ? 4.430   -13.197 -7.641  1.00 0.00 ? 294 LEU A N    10 
ATOM 7690  C CA   . LEU A 1 3  ? 3.754   -11.940 -7.336  1.00 0.00 ? 294 LEU A CA   10 
ATOM 7691  C C    . LEU A 1 3  ? 2.257   -12.161 -7.141  1.00 0.00 ? 294 LEU A C    10 
ATOM 7692  O O    . LEU A 1 3  ? 1.756   -12.126 -6.017  1.00 0.00 ? 294 LEU A O    10 
ATOM 7693  C CB   . LEU A 1 3  ? 3.993   -10.922 -8.453  1.00 0.00 ? 294 LEU A CB   10 
ATOM 7694  C CG   . LEU A 1 3  ? 3.349   -9.552  -8.229  1.00 0.00 ? 294 LEU A CG   10 
ATOM 7695  C CD1  . LEU A 1 3  ? 4.098   -8.775  -7.158  1.00 0.00 ? 294 LEU A CD1  10 
ATOM 7696  C CD2  . LEU A 1 3  ? 3.307   -8.765  -9.532  1.00 0.00 ? 294 LEU A CD2  10 
ATOM 7697  H H    . LEU A 1 3  ? 5.089   -13.552 -7.007  1.00 0.00 ? 294 LEU A H    10 
ATOM 7698  H HA   . LEU A 1 3  ? 4.171   -11.556 -6.416  1.00 0.00 ? 294 LEU A HA   10 
ATOM 7699  H HB2  . LEU A 1 3  ? 5.059   -10.783 -8.563  1.00 0.00 ? 294 LEU A HB2  10 
ATOM 7700  H HG   . LEU A 1 3  ? 2.332   -9.692  -7.890  1.00 0.00 ? 294 LEU A HG   10 
ATOM 7701  H HD11 . LEU A 1 3  ? 4.377   -7.806  -7.545  1.00 0.00 ? 294 LEU A HD11 10 
ATOM 7702  H HD12 . LEU A 1 3  ? 3.462   -8.647  -6.294  1.00 0.00 ? 294 LEU A HD12 10 
ATOM 7703  H HD13 . LEU A 1 3  ? 4.987   -9.318  -6.873  1.00 0.00 ? 294 LEU A HD13 10 
ATOM 7704  H HD21 . LEU A 1 3  ? 2.717   -9.303  -10.259 1.00 0.00 ? 294 LEU A HD21 10 
ATOM 7705  H HD22 . LEU A 1 3  ? 2.862   -7.797  -9.352  1.00 0.00 ? 294 LEU A HD22 10 
ATOM 7706  H HD23 . LEU A 1 3  ? 4.311   -8.636  -9.906  1.00 0.00 ? 294 LEU A HD23 10 
ATOM 7707  N N    . GLY A 1 4  ? 1.548   -12.387 -8.242  1.00 0.00 ? 295 GLY A N    10 
ATOM 7708  C CA   . GLY A 1 4  ? 0.117   -12.611 -8.172  1.00 0.00 ? 295 GLY A CA   10 
ATOM 7709  C C    . GLY A 1 4  ? -0.599  -12.189 -9.440  1.00 0.00 ? 295 GLY A C    10 
ATOM 7710  O O    . GLY A 1 4  ? -1.220  -11.127 -9.487  1.00 0.00 ? 295 GLY A O    10 
ATOM 7711  H H    . GLY A 1 4  ? 2.002   -12.404 -9.111  1.00 0.00 ? 295 GLY A H    10 
ATOM 7712  H HA2  . GLY A 1 4  ? -0.064  -13.663 -8.003  1.00 0.00 ? 295 GLY A HA2  10 
ATOM 7713  H HA3  . GLY A 1 4  ? -0.285  -12.049 -7.342  1.00 0.00 ? 295 GLY A HA3  10 
ATOM 7714  N N    . SER A 1 5  ? -0.510  -13.023 -10.472 1.00 0.00 ? 296 SER A N    10 
ATOM 7715  C CA   . SER A 1 5  ? -1.154  -12.731 -11.747 1.00 0.00 ? 296 SER A CA   10 
ATOM 7716  C C    . SER A 1 5  ? -2.673  -12.738 -11.604 1.00 0.00 ? 296 SER A C    10 
ATOM 7717  O O    . SER A 1 5  ? -3.280  -13.785 -11.377 1.00 0.00 ? 296 SER A O    10 
ATOM 7718  C CB   . SER A 1 5  ? -0.726  -13.749 -12.805 1.00 0.00 ? 296 SER A CB   10 
ATOM 7719  O OG   . SER A 1 5  ? 0.347   -14.550 -12.339 1.00 0.00 ? 296 SER A OG   10 
ATOM 7720  H H    . SER A 1 5  ? 0.000   -13.854 -10.373 1.00 0.00 ? 296 SER A H    10 
ATOM 7721  H HA   . SER A 1 5  ? -0.839  -11.746 -12.060 1.00 0.00 ? 296 SER A HA   10 
ATOM 7722  H HB2  . SER A 1 5  ? -1.560  -14.393 -13.042 1.00 0.00 ? 296 SER A HB2  10 
ATOM 7723  H HG   . SER A 1 5  ? 0.555   -15.220 -12.994 1.00 0.00 ? 296 SER A HG   10 
ATOM 7724  N N    . GLY A 1 6  ? -3.280  -11.564 -11.737 1.00 0.00 ? 297 GLY A N    10 
ATOM 7725  C CA   . GLY A 1 6  ? -4.722  -11.459 -11.617 1.00 0.00 ? 297 GLY A CA   10 
ATOM 7726  C C    . GLY A 1 6  ? -5.142  -10.500 -10.519 1.00 0.00 ? 297 GLY A C    10 
ATOM 7727  O O    . GLY A 1 6  ? -4.383  -10.263 -9.578  1.00 0.00 ? 297 GLY A O    10 
ATOM 7728  H H    . GLY A 1 6  ? -2.745  -10.763 -11.916 1.00 0.00 ? 297 GLY A H    10 
ATOM 7729  H HA2  . GLY A 1 6  ? -5.126  -11.113 -12.557 1.00 0.00 ? 297 GLY A HA2  10 
ATOM 7730  H HA3  . GLY A 1 6  ? -5.127  -12.436 -11.400 1.00 0.00 ? 297 GLY A HA3  10 
ATOM 7731  N N    . PRO A 1 7  ? -6.354  -9.930  -10.612 1.00 0.00 ? 298 PRO A N    10 
ATOM 7732  C CA   . PRO A 1 7  ? -6.862  -8.986  -9.611  1.00 0.00 ? 298 PRO A CA   10 
ATOM 7733  C C    . PRO A 1 7  ? -6.933  -9.598  -8.216  1.00 0.00 ? 298 PRO A C    10 
ATOM 7734  O O    . PRO A 1 7  ? -6.628  -10.776 -8.026  1.00 0.00 ? 298 PRO A O    10 
ATOM 7735  C CB   . PRO A 1 7  ? -8.268  -8.639  -10.116 1.00 0.00 ? 298 PRO A CB   10 
ATOM 7736  C CG   . PRO A 1 7  ? -8.257  -8.991  -11.565 1.00 0.00 ? 298 PRO A CG   10 
ATOM 7737  C CD   . PRO A 1 7  ? -7.323  -10.157 -11.697 1.00 0.00 ? 298 PRO A CD   10 
ATOM 7738  H HA   . PRO A 1 7  ? -6.259  -8.089  -9.576  1.00 0.00 ? 298 PRO A HA   10 
ATOM 7739  H HB2  . PRO A 1 7  ? -9.000  -9.221  -9.574  1.00 0.00 ? 298 PRO A HB2  10 
ATOM 7740  H HG2  . PRO A 1 7  ? -9.251  -9.268  -11.883 1.00 0.00 ? 298 PRO A HG2  10 
ATOM 7741  H HD2  . PRO A 1 7  ? -7.854  -11.086 -11.552 1.00 0.00 ? 298 PRO A HD2  10 
ATOM 7742  N N    . LEU A 1 8  ? -7.338  -8.789  -7.243  1.00 0.00 ? 299 LEU A N    10 
ATOM 7743  C CA   . LEU A 1 8  ? -7.452  -9.241  -5.861  1.00 0.00 ? 299 LEU A CA   10 
ATOM 7744  C C    . LEU A 1 8  ? -8.902  -9.586  -5.521  1.00 0.00 ? 299 LEU A C    10 
ATOM 7745  O O    . LEU A 1 8  ? -9.816  -9.252  -6.275  1.00 0.00 ? 299 LEU A O    10 
ATOM 7746  C CB   . LEU A 1 8  ? -6.929  -8.156  -4.917  1.00 0.00 ? 299 LEU A CB   10 
ATOM 7747  C CG   . LEU A 1 8  ? -5.549  -7.603  -5.277  1.00 0.00 ? 299 LEU A CG   10 
ATOM 7748  C CD1  . LEU A 1 8  ? -5.372  -6.198  -4.725  1.00 0.00 ? 299 LEU A CD1  10 
ATOM 7749  C CD2  . LEU A 1 8  ? -4.458  -8.525  -4.755  1.00 0.00 ? 299 LEU A CD2  10 
ATOM 7750  H H    . LEU A 1 8  ? -7.567  -7.860  -7.461  1.00 0.00 ? 299 LEU A H    10 
ATOM 7751  H HA   . LEU A 1 8  ? -6.845  -10.127 -5.749  1.00 0.00 ? 299 LEU A HA   10 
ATOM 7752  H HB2  . LEU A 1 8  ? -7.635  -7.337  -4.917  1.00 0.00 ? 299 LEU A HB2  10 
ATOM 7753  H HG   . LEU A 1 8  ? -5.459  -7.553  -6.352  1.00 0.00 ? 299 LEU A HG   10 
ATOM 7754  H HD11 . LEU A 1 8  ? -5.807  -5.485  -5.409  1.00 0.00 ? 299 LEU A HD11 10 
ATOM 7755  H HD12 . LEU A 1 8  ? -5.862  -6.123  -3.767  1.00 0.00 ? 299 LEU A HD12 10 
ATOM 7756  H HD13 . LEU A 1 8  ? -4.318  -5.988  -4.609  1.00 0.00 ? 299 LEU A HD13 10 
ATOM 7757  H HD21 . LEU A 1 8  ? -4.895  -9.461  -4.443  1.00 0.00 ? 299 LEU A HD21 10 
ATOM 7758  H HD22 . LEU A 1 8  ? -3.735  -8.707  -5.537  1.00 0.00 ? 299 LEU A HD22 10 
ATOM 7759  H HD23 . LEU A 1 8  ? -3.966  -8.059  -3.913  1.00 0.00 ? 299 LEU A HD23 10 
ATOM 7760  N N    . PRO A 1 9  ? -9.133  -10.263 -4.381  1.00 0.00 ? 300 PRO A N    10 
ATOM 7761  C CA   . PRO A 1 9  ? -10.483 -10.652 -3.954  1.00 0.00 ? 300 PRO A CA   10 
ATOM 7762  C C    . PRO A 1 9  ? -11.443 -9.464  -3.928  1.00 0.00 ? 300 PRO A C    10 
ATOM 7763  O O    . PRO A 1 9  ? -11.083 -8.360  -4.339  1.00 0.00 ? 300 PRO A O    10 
ATOM 7764  C CB   . PRO A 1 9  ? -10.266 -11.210 -2.546  1.00 0.00 ? 300 PRO A CB   10 
ATOM 7765  C CG   . PRO A 1 9  ? -8.847  -11.664 -2.538  1.00 0.00 ? 300 PRO A CG   10 
ATOM 7766  C CD   . PRO A 1 9  ? -8.105  -10.699 -3.416  1.00 0.00 ? 300 PRO A CD   10 
ATOM 7767  H HA   . PRO A 1 9  ? -10.889 -11.423 -4.592  1.00 0.00 ? 300 PRO A HA   10 
ATOM 7768  H HB2  . PRO A 1 9  ? -10.439 -10.435 -1.814  1.00 0.00 ? 300 PRO A HB2  10 
ATOM 7769  H HG2  . PRO A 1 9  ? -8.457  -11.633 -1.531  1.00 0.00 ? 300 PRO A HG2  10 
ATOM 7770  H HD2  . PRO A 1 9  ? -7.742  -9.867  -2.833  1.00 0.00 ? 300 PRO A HD2  10 
ATOM 7771  N N    . PRO A 1 10 ? -12.680 -9.673  -3.445  1.00 0.00 ? 301 PRO A N    10 
ATOM 7772  C CA   . PRO A 1 10 ? -13.689 -8.618  -3.382  1.00 0.00 ? 301 PRO A CA   10 
ATOM 7773  C C    . PRO A 1 10 ? -13.538 -7.724  -2.156  1.00 0.00 ? 301 PRO A C    10 
ATOM 7774  O O    . PRO A 1 10 ? -14.475 -7.565  -1.371  1.00 0.00 ? 301 PRO A O    10 
ATOM 7775  C CB   . PRO A 1 10 ? -14.995 -9.404  -3.320  1.00 0.00 ? 301 PRO A CB   10 
ATOM 7776  C CG   . PRO A 1 10 ? -14.641 -10.663 -2.603  1.00 0.00 ? 301 PRO A CG   10 
ATOM 7777  C CD   . PRO A 1 10 ? -13.194 -10.954 -2.922  1.00 0.00 ? 301 PRO A CD   10 
ATOM 7778  H HA   . PRO A 1 10 ? -13.675 -8.008  -4.272  1.00 0.00 ? 301 PRO A HA   10 
ATOM 7779  H HB2  . PRO A 1 10 ? -15.736 -8.834  -2.780  1.00 0.00 ? 301 PRO A HB2  10 
ATOM 7780  H HG2  . PRO A 1 10 ? -14.768 -10.524 -1.540  1.00 0.00 ? 301 PRO A HG2  10 
ATOM 7781  H HD2  . PRO A 1 10 ? -12.666 -11.242 -2.026  1.00 0.00 ? 301 PRO A HD2  10 
ATOM 7782  N N    . GLY A 1 11 ? -12.356 -7.142  -1.996  1.00 0.00 ? 302 GLY A N    10 
ATOM 7783  C CA   . GLY A 1 11 ? -12.106 -6.265  -0.868  1.00 0.00 ? 302 GLY A CA   10 
ATOM 7784  C C    . GLY A 1 11 ? -10.735 -5.622  -0.922  1.00 0.00 ? 302 GLY A C    10 
ATOM 7785  O O    . GLY A 1 11 ? -10.561 -4.476  -0.506  1.00 0.00 ? 302 GLY A O    10 
ATOM 7786  H H    . GLY A 1 11 ? -11.644 -7.317  -2.645  1.00 0.00 ? 302 GLY A H    10 
ATOM 7787  H HA2  . GLY A 1 11 ? -12.855 -5.485  -0.859  1.00 0.00 ? 302 GLY A HA2  10 
ATOM 7788  H HA3  . GLY A 1 11 ? -12.188 -6.837  0.044   1.00 0.00 ? 302 GLY A HA3  10 
ATOM 7789  N N    . TRP A 1 12 ? -9.757  -6.362  -1.434  1.00 0.00 ? 303 TRP A N    10 
ATOM 7790  C CA   . TRP A 1 12 ? -8.394  -5.860  -1.536  1.00 0.00 ? 303 TRP A CA   10 
ATOM 7791  C C    . TRP A 1 12 ? -8.185  -5.048  -2.805  1.00 0.00 ? 303 TRP A C    10 
ATOM 7792  O O    . TRP A 1 12 ? -8.973  -5.124  -3.749  1.00 0.00 ? 303 TRP A O    10 
ATOM 7793  C CB   . TRP A 1 12 ? -7.404  -7.020  -1.509  1.00 0.00 ? 303 TRP A CB   10 
ATOM 7794  C CG   . TRP A 1 12 ? -7.449  -7.793  -0.234  1.00 0.00 ? 303 TRP A CG   10 
ATOM 7795  C CD1  . TRP A 1 12 ? -8.290  -8.821  0.070   1.00 0.00 ? 303 TRP A CD1  10 
ATOM 7796  C CD2  . TRP A 1 12 ? -6.624  -7.591  0.913   1.00 0.00 ? 303 TRP A CD2  10 
ATOM 7797  N NE1  . TRP A 1 12 ? -8.039  -9.271  1.342   1.00 0.00 ? 303 TRP A NE1  10 
ATOM 7798  C CE2  . TRP A 1 12 ? -7.016  -8.532  1.881   1.00 0.00 ? 303 TRP A CE2  10 
ATOM 7799  C CE3  . TRP A 1 12 ? -5.590  -6.702  1.213   1.00 0.00 ? 303 TRP A CE3  10 
ATOM 7800  C CZ2  . TRP A 1 12 ? -6.406  -8.610  3.130   1.00 0.00 ? 303 TRP A CZ2  10 
ATOM 7801  C CZ3  . TRP A 1 12 ? -4.986  -6.780  2.451   1.00 0.00 ? 303 TRP A CZ3  10 
ATOM 7802  C CH2  . TRP A 1 12 ? -5.394  -7.728  3.398   1.00 0.00 ? 303 TRP A CH2  10 
ATOM 7803  H H    . TRP A 1 12 ? -9.955  -7.268  -1.744  1.00 0.00 ? 303 TRP A H    10 
ATOM 7804  H HA   . TRP A 1 12 ? -8.210  -5.225  -0.683  1.00 0.00 ? 303 TRP A HA   10 
ATOM 7805  H HB2  . TRP A 1 12 ? -7.628  -7.699  -2.319  1.00 0.00 ? 303 TRP A HB2  10 
ATOM 7806  H HD1  . TRP A 1 12 ? -9.041  -9.211  -0.601  1.00 0.00 ? 303 TRP A HD1  10 
ATOM 7807  H HE1  . TRP A 1 12 ? -8.513  -10.000 1.788   1.00 0.00 ? 303 TRP A HE1  10 
ATOM 7808  H HE3  . TRP A 1 12 ? -5.260  -5.965  0.495   1.00 0.00 ? 303 TRP A HE3  10 
ATOM 7809  H HZ2  . TRP A 1 12 ? -6.710  -9.336  3.871   1.00 0.00 ? 303 TRP A HZ2  10 
ATOM 7810  H HZ3  . TRP A 1 12 ? -4.186  -6.100  2.701   1.00 0.00 ? 303 TRP A HZ3  10 
ATOM 7811  H HH2  . TRP A 1 12 ? -4.894  -7.751  4.353   1.00 0.00 ? 303 TRP A HH2  10 
ATOM 7812  N N    . GLU A 1 13 ? -7.112  -4.270  -2.812  1.00 0.00 ? 304 GLU A N    10 
ATOM 7813  C CA   . GLU A 1 13 ? -6.764  -3.446  -3.959  1.00 0.00 ? 304 GLU A CA   10 
ATOM 7814  C C    . GLU A 1 13 ? -5.290  -3.085  -3.922  1.00 0.00 ? 304 GLU A C    10 
ATOM 7815  O O    . GLU A 1 13 ? -4.748  -2.751  -2.868  1.00 0.00 ? 304 GLU A O    10 
ATOM 7816  C CB   . GLU A 1 13 ? -7.599  -2.169  -3.992  1.00 0.00 ? 304 GLU A CB   10 
ATOM 7817  C CG   . GLU A 1 13 ? -7.394  -1.360  -5.262  1.00 0.00 ? 304 GLU A CG   10 
ATOM 7818  C CD   . GLU A 1 13 ? -7.938  0.051   -5.152  1.00 0.00 ? 304 GLU A CD   10 
ATOM 7819  O OE1  . GLU A 1 13 ? -9.092  0.209   -4.700  1.00 0.00 ? 304 GLU A OE1  10 
ATOM 7820  O OE2  . GLU A 1 13 ? -7.212  0.998   -5.520  1.00 0.00 ? 304 GLU A OE2  10 
ATOM 7821  H H    . GLU A 1 13 ? -6.536  -4.248  -2.020  1.00 0.00 ? 304 GLU A H    10 
ATOM 7822  H HA   . GLU A 1 13 ? -6.962  -4.020  -4.852  1.00 0.00 ? 304 GLU A HA   10 
ATOM 7823  H HB2  . GLU A 1 13 ? -8.644  -2.430  -3.917  1.00 0.00 ? 304 GLU A HB2  10 
ATOM 7824  H HG2  . GLU A 1 13 ? -6.334  -1.307  -5.471  1.00 0.00 ? 304 GLU A HG2  10 
ATOM 7825  N N    . ILE A 1 14 ? -4.642  -3.152  -5.075  1.00 0.00 ? 305 ILE A N    10 
ATOM 7826  C CA   . ILE A 1 14 ? -3.230  -2.825  -5.165  1.00 0.00 ? 305 ILE A CA   10 
ATOM 7827  C C    . ILE A 1 14 ? -3.029  -1.316  -5.162  1.00 0.00 ? 305 ILE A C    10 
ATOM 7828  O O    . ILE A 1 14 ? -3.923  -0.553  -5.525  1.00 0.00 ? 305 ILE A O    10 
ATOM 7829  C CB   . ILE A 1 14 ? -2.590  -3.422  -6.437  1.00 0.00 ? 305 ILE A CB   10 
ATOM 7830  C CG1  . ILE A 1 14 ? -2.674  -4.948  -6.409  1.00 0.00 ? 305 ILE A CG1  10 
ATOM 7831  C CG2  . ILE A 1 14 ? -1.143  -2.971  -6.574  1.00 0.00 ? 305 ILE A CG2  10 
ATOM 7832  C CD1  . ILE A 1 14 ? -1.925  -5.608  -7.543  1.00 0.00 ? 305 ILE A CD1  10 
ATOM 7833  H H    . ILE A 1 14 ? -5.126  -3.422  -5.883  1.00 0.00 ? 305 ILE A H    10 
ATOM 7834  H HA   . ILE A 1 14 ? -2.730  -3.247  -4.300  1.00 0.00 ? 305 ILE A HA   10 
ATOM 7835  H HB   . ILE A 1 14 ? -3.138  -3.056  -7.293  1.00 0.00 ? 305 ILE A HB   10 
ATOM 7836  H HG12 . ILE A 1 14 ? -2.256  -5.309  -5.481  1.00 0.00 ? 305 ILE A HG12 10 
ATOM 7837  H HG21 . ILE A 1 14 ? -0.660  -3.537  -7.357  1.00 0.00 ? 305 ILE A HG21 10 
ATOM 7838  H HG22 . ILE A 1 14 ? -1.116  -1.920  -6.820  1.00 0.00 ? 305 ILE A HG22 10 
ATOM 7839  H HG23 . ILE A 1 14 ? -0.626  -3.135  -5.641  1.00 0.00 ? 305 ILE A HG23 10 
ATOM 7840  H HD11 . ILE A 1 14 ? -1.850  -6.669  -7.355  1.00 0.00 ? 305 ILE A HD11 10 
ATOM 7841  H HD12 . ILE A 1 14 ? -2.456  -5.441  -8.467  1.00 0.00 ? 305 ILE A HD12 10 
ATOM 7842  H HD13 . ILE A 1 14 ? -0.933  -5.183  -7.614  1.00 0.00 ? 305 ILE A HD13 10 
ATOM 7843  N N    . ARG A 1 15 ? -1.841  -0.903  -4.752  1.00 0.00 ? 306 ARG A N    10 
ATOM 7844  C CA   . ARG A 1 15 ? -1.489  0.504   -4.692  1.00 0.00 ? 306 ARG A CA   10 
ATOM 7845  C C    . ARG A 1 15 ? 0.017   0.647   -4.542  1.00 0.00 ? 306 ARG A C    10 
ATOM 7846  O O    . ARG A 1 15 ? 0.717   -0.350  -4.406  1.00 0.00 ? 306 ARG A O    10 
ATOM 7847  C CB   . ARG A 1 15 ? -2.204  1.173   -3.518  1.00 0.00 ? 306 ARG A CB   10 
ATOM 7848  C CG   . ARG A 1 15 ? -3.670  1.462   -3.789  1.00 0.00 ? 306 ARG A CG   10 
ATOM 7849  C CD   . ARG A 1 15 ? -4.175  2.625   -2.953  1.00 0.00 ? 306 ARG A CD   10 
ATOM 7850  N NE   . ARG A 1 15 ? -5.148  3.437   -3.675  1.00 0.00 ? 306 ARG A NE   10 
ATOM 7851  C CZ   . ARG A 1 15 ? -6.434  3.122   -3.782  1.00 0.00 ? 306 ARG A CZ   10 
ATOM 7852  N NH1  . ARG A 1 15 ? -6.895  2.012   -3.221  1.00 0.00 ? 306 ARG A NH1  10 
ATOM 7853  N NH2  . ARG A 1 15 ? -7.260  3.914   -4.452  1.00 0.00 ? 306 ARG A NH2  10 
ATOM 7854  H H    . ARG A 1 15 ? -1.178  -1.569  -4.478  1.00 0.00 ? 306 ARG A H    10 
ATOM 7855  H HA   . ARG A 1 15 ? -1.800  0.972   -5.614  1.00 0.00 ? 306 ARG A HA   10 
ATOM 7856  H HB2  . ARG A 1 15 ? -2.140  0.524   -2.657  1.00 0.00 ? 306 ARG A HB2  10 
ATOM 7857  H HG2  . ARG A 1 15 ? -3.792  1.706   -4.833  1.00 0.00 ? 306 ARG A HG2  10 
ATOM 7858  H HD2  . ARG A 1 15 ? -4.638  2.235   -2.059  1.00 0.00 ? 306 ARG A HD2  10 
ATOM 7859  H HE   . ARG A 1 15 ? -4.827  4.258   -4.102  1.00 0.00 ? 306 ARG A HE   10 
ATOM 7860  H HH11 . ARG A 1 15 ? -6.275  1.412   -2.717  1.00 0.00 ? 306 ARG A HH11 10 
ATOM 7861  H HH12 . ARG A 1 15 ? -7.864  1.776   -3.302  1.00 0.00 ? 306 ARG A HH12 10 
ATOM 7862  H HH21 . ARG A 1 15 ? -6.916  4.751   -4.877  1.00 0.00 ? 306 ARG A HH21 10 
ATOM 7863  H HH22 . ARG A 1 15 ? -8.227  3.675   -4.532  1.00 0.00 ? 306 ARG A HH22 10 
ATOM 7864  N N    . ASN A 1 16 ? 0.514   1.876   -4.575  1.00 0.00 ? 307 ASN A N    10 
ATOM 7865  C CA   . ASN A 1 16 ? 1.947   2.112   -4.428  1.00 0.00 ? 307 ASN A CA   10 
ATOM 7866  C C    . ASN A 1 16 ? 2.203   3.314   -3.529  1.00 0.00 ? 307 ASN A C    10 
ATOM 7867  O O    . ASN A 1 16 ? 1.503   4.323   -3.607  1.00 0.00 ? 307 ASN A O    10 
ATOM 7868  C CB   . ASN A 1 16 ? 2.620   2.318   -5.790  1.00 0.00 ? 307 ASN A CB   10 
ATOM 7869  C CG   . ASN A 1 16 ? 1.955   1.528   -6.902  1.00 0.00 ? 307 ASN A CG   10 
ATOM 7870  O OD1  . ASN A 1 16 ? 0.961   1.964   -7.481  1.00 0.00 ? 307 ASN A OD1  10 
ATOM 7871  N ND2  . ASN A 1 16 ? 2.506   0.358   -7.205  1.00 0.00 ? 307 ASN A ND2  10 
ATOM 7872  H H    . ASN A 1 16 ? -0.089  2.638   -4.701  1.00 0.00 ? 307 ASN A H    10 
ATOM 7873  H HA   . ASN A 1 16 ? 2.374   1.238   -3.958  1.00 0.00 ? 307 ASN A HA   10 
ATOM 7874  H HB2  . ASN A 1 16 ? 2.586   3.366   -6.048  1.00 0.00 ? 307 ASN A HB2  10 
ATOM 7875  H HD21 . ASN A 1 16 ? 3.298   0.075   -6.700  1.00 0.00 ? 307 ASN A HD21 10 
ATOM 7876  H HD22 . ASN A 1 16 ? 2.100   -0.174  -7.920  1.00 0.00 ? 307 ASN A HD22 10 
ATOM 7877  N N    . THR A 1 17 ? 3.213   3.198   -2.676  1.00 0.00 ? 308 THR A N    10 
ATOM 7878  C CA   . THR A 1 17 ? 3.559   4.267   -1.751  1.00 0.00 ? 308 THR A CA   10 
ATOM 7879  C C    . THR A 1 17 ? 3.986   5.529   -2.492  1.00 0.00 ? 308 THR A C    10 
ATOM 7880  O O    . THR A 1 17 ? 3.324   6.563   -2.403  1.00 0.00 ? 308 THR A O    10 
ATOM 7881  C CB   . THR A 1 17 ? 4.681   3.829   -0.792  1.00 0.00 ? 308 THR A CB   10 
ATOM 7882  O OG1  . THR A 1 17 ? 5.792   3.315   -1.536  1.00 0.00 ? 308 THR A OG1  10 
ATOM 7883  C CG2  . THR A 1 17 ? 4.173   2.767   0.172   1.00 0.00 ? 308 THR A CG2  10 
ATOM 7884  H H    . THR A 1 17 ? 3.742   2.373   -2.673  1.00 0.00 ? 308 THR A H    10 
ATOM 7885  H HA   . THR A 1 17 ? 2.682   4.491   -1.161  1.00 0.00 ? 308 THR A HA   10 
ATOM 7886  H HB   . THR A 1 17 ? 5.005   4.687   -0.221  1.00 0.00 ? 308 THR A HB   10 
ATOM 7887  H HG1  . THR A 1 17 ? 5.571   2.447   -1.882  1.00 0.00 ? 308 THR A HG1  10 
ATOM 7888  H HG21 . THR A 1 17 ? 4.574   2.950   1.157   1.00 0.00 ? 308 THR A HG21 10 
ATOM 7889  H HG22 . THR A 1 17 ? 4.486   1.790   -0.166  1.00 0.00 ? 308 THR A HG22 10 
ATOM 7890  H HG23 . THR A 1 17 ? 3.093   2.807   0.208   1.00 0.00 ? 308 THR A HG23 10 
ATOM 7891  N N    . ALA A 1 18 ? 5.091   5.440   -3.223  1.00 0.00 ? 309 ALA A N    10 
ATOM 7892  C CA   . ALA A 1 18 ? 5.599   6.581   -3.977  1.00 0.00 ? 309 ALA A CA   10 
ATOM 7893  C C    . ALA A 1 18 ? 6.938   6.253   -4.629  1.00 0.00 ? 309 ALA A C    10 
ATOM 7894  O O    . ALA A 1 18 ? 7.083   6.335   -5.849  1.00 0.00 ? 309 ALA A O    10 
ATOM 7895  C CB   . ALA A 1 18 ? 5.730   7.795   -3.070  1.00 0.00 ? 309 ALA A CB   10 
ATOM 7896  H H    . ALA A 1 18 ? 5.577   4.590   -3.255  1.00 0.00 ? 309 ALA A H    10 
ATOM 7897  H HA   . ALA A 1 18 ? 4.881   6.814   -4.750  1.00 0.00 ? 309 ALA A HA   10 
ATOM 7898  H HB1  . ALA A 1 18 ? 6.188   7.498   -2.137  1.00 0.00 ? 309 ALA A HB1  10 
ATOM 7899  H HB2  . ALA A 1 18 ? 6.344   8.540   -3.552  1.00 0.00 ? 309 ALA A HB2  10 
ATOM 7900  H HB3  . ALA A 1 18 ? 4.750   8.204   -2.876  1.00 0.00 ? 309 ALA A HB3  10 
ATOM 7901  N N    . THR A 1 19 ? 7.914   5.883   -3.808  1.00 0.00 ? 310 THR A N    10 
ATOM 7902  C CA   . THR A 1 19 ? 9.241   5.536   -4.304  1.00 0.00 ? 310 THR A CA   10 
ATOM 7903  C C    . THR A 1 19 ? 9.192   4.315   -5.222  1.00 0.00 ? 310 THR A C    10 
ATOM 7904  O O    . THR A 1 19 ? 10.147  4.036   -5.946  1.00 0.00 ? 310 THR A O    10 
ATOM 7905  C CB   . THR A 1 19 ? 10.213  5.248   -3.144  1.00 0.00 ? 310 THR A CB   10 
ATOM 7906  O OG1  . THR A 1 19 ? 10.278  6.378   -2.266  1.00 0.00 ? 310 THR A OG1  10 
ATOM 7907  C CG2  . THR A 1 19 ? 11.603  4.929   -3.673  1.00 0.00 ? 310 THR A CG2  10 
ATOM 7908  H H    . THR A 1 19 ? 7.739   5.842   -2.844  1.00 0.00 ? 310 THR A H    10 
ATOM 7909  H HA   . THR A 1 19 ? 9.620   6.379   -4.862  1.00 0.00 ? 310 THR A HA   10 
ATOM 7910  H HB   . THR A 1 19 ? 9.849   4.393   -2.593  1.00 0.00 ? 310 THR A HB   10 
ATOM 7911  H HG1  . THR A 1 19 ? 10.560  7.151   -2.759  1.00 0.00 ? 310 THR A HG1  10 
ATOM 7912  H HG21 . THR A 1 19 ? 12.305  4.916   -2.852  1.00 0.00 ? 310 THR A HG21 10 
ATOM 7913  H HG22 . THR A 1 19 ? 11.899  5.684   -4.387  1.00 0.00 ? 310 THR A HG22 10 
ATOM 7914  H HG23 . THR A 1 19 ? 11.593  3.963   -4.154  1.00 0.00 ? 310 THR A HG23 10 
ATOM 7915  N N    . GLY A 1 20 ? 8.076   3.590   -5.186  1.00 0.00 ? 311 GLY A N    10 
ATOM 7916  C CA   . GLY A 1 20 ? 7.929   2.413   -6.021  1.00 0.00 ? 311 GLY A CA   10 
ATOM 7917  C C    . GLY A 1 20 ? 7.714   1.143   -5.218  1.00 0.00 ? 311 GLY A C    10 
ATOM 7918  O O    . GLY A 1 20 ? 8.256   0.090   -5.554  1.00 0.00 ? 311 GLY A O    10 
ATOM 7919  H H    . GLY A 1 20 ? 7.346   3.857   -4.594  1.00 0.00 ? 311 GLY A H    10 
ATOM 7920  H HA2  . GLY A 1 20 ? 7.082   2.555   -6.676  1.00 0.00 ? 311 GLY A HA2  10 
ATOM 7921  H HA3  . GLY A 1 20 ? 8.819   2.298   -6.623  1.00 0.00 ? 311 GLY A HA3  10 
ATOM 7922  N N    . ARG A 1 21 ? 6.922   1.241   -4.155  1.00 0.00 ? 312 ARG A N    10 
ATOM 7923  C CA   . ARG A 1 21 ? 6.628   0.089   -3.312  1.00 0.00 ? 312 ARG A CA   10 
ATOM 7924  C C    . ARG A 1 21 ? 5.142   -0.188  -3.312  1.00 0.00 ? 312 ARG A C    10 
ATOM 7925  O O    . ARG A 1 21 ? 4.355   0.524   -2.689  1.00 0.00 ? 312 ARG A O    10 
ATOM 7926  C CB   . ARG A 1 21 ? 7.126   0.317   -1.883  1.00 0.00 ? 312 ARG A CB   10 
ATOM 7927  C CG   . ARG A 1 21 ? 7.966   -0.830  -1.332  1.00 0.00 ? 312 ARG A CG   10 
ATOM 7928  C CD   . ARG A 1 21 ? 7.189   -2.143  -1.284  1.00 0.00 ? 312 ARG A CD   10 
ATOM 7929  N NE   . ARG A 1 21 ? 7.667   -3.093  -2.284  1.00 0.00 ? 312 ARG A NE   10 
ATOM 7930  C CZ   . ARG A 1 21 ? 7.296   -4.369  -2.322  1.00 0.00 ? 312 ARG A CZ   10 
ATOM 7931  N NH1  . ARG A 1 21 ? 6.441   -4.841  -1.427  1.00 0.00 ? 312 ARG A NH1  10 
ATOM 7932  N NH2  . ARG A 1 21 ? 7.782   -5.176  -3.257  1.00 0.00 ? 312 ARG A NH2  10 
ATOM 7933  H H    . ARG A 1 21 ? 6.521   2.105   -3.934  1.00 0.00 ? 312 ARG A H    10 
ATOM 7934  H HA   . ARG A 1 21 ? 7.126   -0.770  -3.736  1.00 0.00 ? 312 ARG A HA   10 
ATOM 7935  H HB2  . ARG A 1 21 ? 7.728   1.212   -1.866  1.00 0.00 ? 312 ARG A HB2  10 
ATOM 7936  H HG2  . ARG A 1 21 ? 8.831   -0.962  -1.965  1.00 0.00 ? 312 ARG A HG2  10 
ATOM 7937  H HD2  . ARG A 1 21 ? 7.311   -2.579  -0.303  1.00 0.00 ? 312 ARG A HD2  10 
ATOM 7938  H HE   . ARG A 1 21 ? 8.297   -2.764  -2.958  1.00 0.00 ? 312 ARG A HE   10 
ATOM 7939  H HH11 . ARG A 1 21 ? 6.071   -4.236  -0.721  1.00 0.00 ? 312 ARG A HH11 10 
ATOM 7940  H HH12 . ARG A 1 21 ? 6.164   -5.802  -1.457  1.00 0.00 ? 312 ARG A HH12 10 
ATOM 7941  H HH21 . ARG A 1 21 ? 8.427   -4.823  -3.936  1.00 0.00 ? 312 ARG A HH21 10 
ATOM 7942  H HH22 . ARG A 1 21 ? 7.502   -6.135  -3.284  1.00 0.00 ? 312 ARG A HH22 10 
ATOM 7943  N N    . VAL A 1 22 ? 4.775   -1.234  -4.023  1.00 0.00 ? 313 VAL A N    10 
ATOM 7944  C CA   . VAL A 1 22 ? 3.389   -1.626  -4.145  1.00 0.00 ? 313 VAL A CA   10 
ATOM 7945  C C    . VAL A 1 22 ? 2.886   -2.324  -2.882  1.00 0.00 ? 313 VAL A C    10 
ATOM 7946  O O    . VAL A 1 22 ? 3.468   -3.309  -2.425  1.00 0.00 ? 313 VAL A O    10 
ATOM 7947  C CB   . VAL A 1 22 ? 3.199   -2.548  -5.366  1.00 0.00 ? 313 VAL A CB   10 
ATOM 7948  C CG1  . VAL A 1 22 ? 4.226   -3.663  -5.351  1.00 0.00 ? 313 VAL A CG1  10 
ATOM 7949  C CG2  . VAL A 1 22 ? 1.794   -3.113  -5.407  1.00 0.00 ? 313 VAL A CG2  10 
ATOM 7950  H H    . VAL A 1 22 ? 5.461   -1.763  -4.481  1.00 0.00 ? 313 VAL A H    10 
ATOM 7951  H HA   . VAL A 1 22 ? 2.811   -0.732  -4.305  1.00 0.00 ? 313 VAL A HA   10 
ATOM 7952  H HB   . VAL A 1 22 ? 3.350   -1.963  -6.261  1.00 0.00 ? 313 VAL A HB   10 
ATOM 7953  H HG11 . VAL A 1 22 ? 5.173   -3.282  -5.704  1.00 0.00 ? 313 VAL A HG11 10 
ATOM 7954  H HG12 . VAL A 1 22 ? 4.339   -4.031  -4.341  1.00 0.00 ? 313 VAL A HG12 10 
ATOM 7955  H HG13 . VAL A 1 22 ? 3.897   -4.466  -5.992  1.00 0.00 ? 313 VAL A HG13 10 
ATOM 7956  H HG21 . VAL A 1 22 ? 1.168   -2.549  -4.735  1.00 0.00 ? 313 VAL A HG21 10 
ATOM 7957  H HG22 . VAL A 1 22 ? 1.408   -3.043  -6.411  1.00 0.00 ? 313 VAL A HG22 10 
ATOM 7958  H HG23 . VAL A 1 22 ? 1.819   -4.146  -5.098  1.00 0.00 ? 313 VAL A HG23 10 
ATOM 7959  N N    . TYR A 1 23 ? 1.798   -1.801  -2.326  1.00 0.00 ? 314 TYR A N    10 
ATOM 7960  C CA   . TYR A 1 23 ? 1.191   -2.378  -1.135  1.00 0.00 ? 314 TYR A CA   10 
ATOM 7961  C C    . TYR A 1 23 ? -0.248  -2.772  -1.415  1.00 0.00 ? 314 TYR A C    10 
ATOM 7962  O O    . TYR A 1 23 ? -0.812  -2.411  -2.447  1.00 0.00 ? 314 TYR A O    10 
ATOM 7963  C CB   . TYR A 1 23 ? 1.234   -1.402  0.042   1.00 0.00 ? 314 TYR A CB   10 
ATOM 7964  C CG   . TYR A 1 23 ? 0.373   -0.171  -0.133  1.00 0.00 ? 314 TYR A CG   10 
ATOM 7965  C CD1  . TYR A 1 23 ? 0.729   0.833   -1.022  1.00 0.00 ? 314 TYR A CD1  10 
ATOM 7966  C CD2  . TYR A 1 23 ? -0.799  -0.012  0.600   1.00 0.00 ? 314 TYR A CD2  10 
ATOM 7967  C CE1  . TYR A 1 23 ? -0.055  1.959   -1.181  1.00 0.00 ? 314 TYR A CE1  10 
ATOM 7968  C CE2  . TYR A 1 23 ? -1.590  1.112   0.447   1.00 0.00 ? 314 TYR A CE2  10 
ATOM 7969  C CZ   . TYR A 1 23 ? -1.214  2.094   -0.445  1.00 0.00 ? 314 TYR A CZ   10 
ATOM 7970  O OH   . TYR A 1 23 ? -1.997  3.213   -0.601  1.00 0.00 ? 314 TYR A OH   10 
ATOM 7971  H H    . TYR A 1 23 ? 1.393   -1.006  -2.730  1.00 0.00 ? 314 TYR A H    10 
ATOM 7972  H HA   . TYR A 1 23 ? 1.750   -3.265  -0.876  1.00 0.00 ? 314 TYR A HA   10 
ATOM 7973  H HB2  . TYR A 1 23 ? 0.889   -1.915  0.925   1.00 0.00 ? 314 TYR A HB2  10 
ATOM 7974  H HD1  . TYR A 1 23 ? 1.636   0.728   -1.597  1.00 0.00 ? 314 TYR A HD1  10 
ATOM 7975  H HD2  . TYR A 1 23 ? -1.086  -0.783  1.302   1.00 0.00 ? 314 TYR A HD2  10 
ATOM 7976  H HE1  . TYR A 1 23 ? 0.245   2.729   -1.872  1.00 0.00 ? 314 TYR A HE1  10 
ATOM 7977  H HE2  . TYR A 1 23 ? -2.493  1.224   1.028   1.00 0.00 ? 314 TYR A HE2  10 
ATOM 7978  H HH   . TYR A 1 23 ? -2.432  3.418   0.231   1.00 0.00 ? 314 TYR A HH   10 
ATOM 7979  N N    . PHE A 1 24 ? -0.839  -3.514  -0.492  1.00 0.00 ? 315 PHE A N    10 
ATOM 7980  C CA   . PHE A 1 24 ? -2.212  -3.953  -0.649  1.00 0.00 ? 315 PHE A CA   10 
ATOM 7981  C C    . PHE A 1 24 ? -3.117  -3.295  0.377   1.00 0.00 ? 315 PHE A C    10 
ATOM 7982  O O    . PHE A 1 24 ? -2.768  -3.175  1.551   1.00 0.00 ? 315 PHE A O    10 
ATOM 7983  C CB   . PHE A 1 24 ? -2.293  -5.475  -0.554  1.00 0.00 ? 315 PHE A CB   10 
ATOM 7984  C CG   . PHE A 1 24 ? -1.572  -6.163  -1.676  1.00 0.00 ? 315 PHE A CG   10 
ATOM 7985  C CD1  . PHE A 1 24 ? -0.190  -6.263  -1.668  1.00 0.00 ? 315 PHE A CD1  10 
ATOM 7986  C CD2  . PHE A 1 24 ? -2.274  -6.694  -2.744  1.00 0.00 ? 315 PHE A CD2  10 
ATOM 7987  C CE1  . PHE A 1 24 ? 0.479   -6.884  -2.705  1.00 0.00 ? 315 PHE A CE1  10 
ATOM 7988  C CE2  . PHE A 1 24 ? -1.611  -7.318  -3.784  1.00 0.00 ? 315 PHE A CE2  10 
ATOM 7989  C CZ   . PHE A 1 24 ? -0.233  -7.413  -3.764  1.00 0.00 ? 315 PHE A CZ   10 
ATOM 7990  H H    . PHE A 1 24 ? -0.340  -3.775  0.309   1.00 0.00 ? 315 PHE A H    10 
ATOM 7991  H HA   . PHE A 1 24 ? -2.536  -3.646  -1.629  1.00 0.00 ? 315 PHE A HA   10 
ATOM 7992  H HB2  . PHE A 1 24 ? -1.852  -5.800  0.380   1.00 0.00 ? 315 PHE A HB2  10 
ATOM 7993  H HD1  . PHE A 1 24 ? 0.365   -5.851  -0.840  1.00 0.00 ? 315 PHE A HD1  10 
ATOM 7994  H HD2  . PHE A 1 24 ? -3.351  -6.618  -2.760  1.00 0.00 ? 315 PHE A HD2  10 
ATOM 7995  H HE1  . PHE A 1 24 ? 1.557   -6.954  -2.689  1.00 0.00 ? 315 PHE A HE1  10 
ATOM 7996  H HE2  . PHE A 1 24 ? -2.168  -7.730  -4.612  1.00 0.00 ? 315 PHE A HE2  10 
ATOM 7997  H HZ   . PHE A 1 24 ? 0.287   -7.899  -4.577  1.00 0.00 ? 315 PHE A HZ   10 
ATOM 7998  N N    . VAL A 1 25 ? -4.283  -2.867  -0.087  1.00 0.00 ? 316 VAL A N    10 
ATOM 7999  C CA   . VAL A 1 25 ? -5.249  -2.198  0.765   1.00 0.00 ? 316 VAL A CA   10 
ATOM 8000  C C    . VAL A 1 25 ? -6.500  -3.046  0.967   1.00 0.00 ? 316 VAL A C    10 
ATOM 8001  O O    . VAL A 1 25 ? -7.195  -3.382  0.009   1.00 0.00 ? 316 VAL A O    10 
ATOM 8002  C CB   . VAL A 1 25 ? -5.653  -0.839  0.166   1.00 0.00 ? 316 VAL A CB   10 
ATOM 8003  C CG1  . VAL A 1 25 ? -6.356  0.012   1.203   1.00 0.00 ? 316 VAL A CG1  10 
ATOM 8004  C CG2  . VAL A 1 25 ? -4.436  -0.117  -0.389  1.00 0.00 ? 316 VAL A CG2  10 
ATOM 8005  H H    . VAL A 1 25 ? -4.500  -3.008  -1.033  1.00 0.00 ? 316 VAL A H    10 
ATOM 8006  H HA   . VAL A 1 25 ? -4.786  -2.020  1.725   1.00 0.00 ? 316 VAL A HA   10 
ATOM 8007  H HB   . VAL A 1 25 ? -6.342  -1.017  -0.647  1.00 0.00 ? 316 VAL A HB   10 
ATOM 8008  H HG11 . VAL A 1 25 ? -6.498  1.010   0.815   1.00 0.00 ? 316 VAL A HG11 10 
ATOM 8009  H HG12 . VAL A 1 25 ? -7.317  -0.425  1.436   1.00 0.00 ? 316 VAL A HG12 10 
ATOM 8010  H HG13 . VAL A 1 25 ? -5.754  0.056   2.100   1.00 0.00 ? 316 VAL A HG13 10 
ATOM 8011  H HG21 . VAL A 1 25 ? -4.526  -0.031  -1.462  1.00 0.00 ? 316 VAL A HG21 10 
ATOM 8012  H HG22 . VAL A 1 25 ? -4.372  0.869   0.046   1.00 0.00 ? 316 VAL A HG22 10 
ATOM 8013  H HG23 . VAL A 1 25 ? -3.544  -0.676  -0.147  1.00 0.00 ? 316 VAL A HG23 10 
ATOM 8014  N N    . ASP A 1 26 ? -6.777  -3.390  2.220   1.00 0.00 ? 317 ASP A N    10 
ATOM 8015  C CA   . ASP A 1 26 ? -7.948  -4.192  2.551   1.00 0.00 ? 317 ASP A CA   10 
ATOM 8016  C C    . ASP A 1 26 ? -9.126  -3.294  2.913   1.00 0.00 ? 317 ASP A C    10 
ATOM 8017  O O    . ASP A 1 26 ? -9.077  -2.559  3.900   1.00 0.00 ? 317 ASP A O    10 
ATOM 8018  C CB   . ASP A 1 26 ? -7.638  -5.133  3.713   1.00 0.00 ? 317 ASP A CB   10 
ATOM 8019  C CG   . ASP A 1 26 ? -8.457  -6.406  3.656   1.00 0.00 ? 317 ASP A CG   10 
ATOM 8020  O OD1  . ASP A 1 26 ? -9.307  -6.526  2.749   1.00 0.00 ? 317 ASP A OD1  10 
ATOM 8021  O OD2  . ASP A 1 26 ? -8.249  -7.281  4.519   1.00 0.00 ? 317 ASP A OD2  10 
ATOM 8022  H H    . ASP A 1 26 ? -6.178  -3.097  2.939   1.00 0.00 ? 317 ASP A H    10 
ATOM 8023  H HA   . ASP A 1 26 ? -8.208  -4.779  1.682   1.00 0.00 ? 317 ASP A HA   10 
ATOM 8024  H HB2  . ASP A 1 26 ? -6.592  -5.397  3.686   1.00 0.00 ? 317 ASP A HB2  10 
ATOM 8025  N N    . HIS A 1 27 ? -10.181 -3.359  2.112   1.00 0.00 ? 318 HIS A N    10 
ATOM 8026  C CA   . HIS A 1 27 ? -11.367 -2.546  2.345   1.00 0.00 ? 318 HIS A CA   10 
ATOM 8027  C C    . HIS A 1 27 ? -12.332 -3.223  3.319   1.00 0.00 ? 318 HIS A C    10 
ATOM 8028  O O    . HIS A 1 27 ? -13.274 -2.596  3.804   1.00 0.00 ? 318 HIS A O    10 
ATOM 8029  C CB   . HIS A 1 27 ? -12.062 -2.247  1.018   1.00 0.00 ? 318 HIS A CB   10 
ATOM 8030  C CG   . HIS A 1 27 ? -11.344 -1.210  0.216   1.00 0.00 ? 318 HIS A CG   10 
ATOM 8031  N ND1  . HIS A 1 27 ? -11.307 0.100   0.621   1.00 0.00 ? 318 HIS A ND1  10 
ATOM 8032  C CD2  . HIS A 1 27 ? -10.628 -1.340  -0.927  1.00 0.00 ? 318 HIS A CD2  10 
ATOM 8033  C CE1  . HIS A 1 27 ? -10.573 0.736   -0.272  1.00 0.00 ? 318 HIS A CE1  10 
ATOM 8034  N NE2  . HIS A 1 27 ? -10.140 -0.095  -1.233  1.00 0.00 ? 318 HIS A NE2  10 
ATOM 8035  H H    . HIS A 1 27 ? -10.162 -3.969  1.345   1.00 0.00 ? 318 HIS A H    10 
ATOM 8036  H HA   . HIS A 1 27 ? -11.042 -1.612  2.778   1.00 0.00 ? 318 HIS A HA   10 
ATOM 8037  H HB2  . HIS A 1 27 ? -12.110 -3.151  0.429   1.00 0.00 ? 318 HIS A HB2  10 
ATOM 8038  H HD2  . HIS A 1 27 ? -10.463 -2.249  -1.488  1.00 0.00 ? 318 HIS A HD2  10 
ATOM 8039  H HE1  . HIS A 1 27 ? -10.335 1.786   -0.222  1.00 0.00 ? 318 HIS A HE1  10 
ATOM 8040  H HE2  . HIS A 1 27 ? -9.759  0.174   -2.095  1.00 0.00 ? 318 HIS A HE2  10 
ATOM 8041  N N    . ASN A 1 28 ? -12.097 -4.502  3.608   1.00 0.00 ? 319 ASN A N    10 
ATOM 8042  C CA   . ASN A 1 28 ? -12.944 -5.241  4.536   1.00 0.00 ? 319 ASN A CA   10 
ATOM 8043  C C    . ASN A 1 28 ? -12.475 -5.028  5.972   1.00 0.00 ? 319 ASN A C    10 
ATOM 8044  O O    . ASN A 1 28 ? -13.263 -4.671  6.848   1.00 0.00 ? 319 ASN A O    10 
ATOM 8045  C CB   . ASN A 1 28 ? -12.929 -6.734  4.203   1.00 0.00 ? 319 ASN A CB   10 
ATOM 8046  C CG   . ASN A 1 28 ? -13.020 -6.997  2.712   1.00 0.00 ? 319 ASN A CG   10 
ATOM 8047  O OD1  . ASN A 1 28 ? -13.627 -6.225  1.970   1.00 0.00 ? 319 ASN A OD1  10 
ATOM 8048  N ND2  . ASN A 1 28 ? -12.417 -8.093  2.268   1.00 0.00 ? 319 ASN A ND2  10 
ATOM 8049  H H    . ASN A 1 28 ? -11.342 -4.961  3.185   1.00 0.00 ? 319 ASN A H    10 
ATOM 8050  H HA   . ASN A 1 28 ? -13.952 -4.867  4.437   1.00 0.00 ? 319 ASN A HA   10 
ATOM 8051  H HB2  . ASN A 1 28 ? -12.010 -7.169  4.569   1.00 0.00 ? 319 ASN A HB2  10 
ATOM 8052  H HD21 . ASN A 1 28 ? -11.952 -8.661  2.917   1.00 0.00 ? 319 ASN A HD21 10 
ATOM 8053  H HD22 . ASN A 1 28 ? -12.460 -8.289  1.309   1.00 0.00 ? 319 ASN A HD22 10 
ATOM 8054  N N    . ASN A 1 29 ? -11.185 -5.249  6.203   1.00 0.00 ? 320 ASN A N    10 
ATOM 8055  C CA   . ASN A 1 29 ? -10.601 -5.077  7.528   1.00 0.00 ? 320 ASN A CA   10 
ATOM 8056  C C    . ASN A 1 29 ? -10.097 -3.648  7.730   1.00 0.00 ? 320 ASN A C    10 
ATOM 8057  O O    . ASN A 1 29 ? -9.819  -3.238  8.857   1.00 0.00 ? 320 ASN A O    10 
ATOM 8058  C CB   . ASN A 1 29 ? -9.450  -6.064  7.735   1.00 0.00 ? 320 ASN A CB   10 
ATOM 8059  C CG   . ASN A 1 29 ? -9.892  -7.505  7.588   1.00 0.00 ? 320 ASN A CG   10 
ATOM 8060  O OD1  . ASN A 1 29 ? -10.344 -8.130  8.547   1.00 0.00 ? 320 ASN A OD1  10 
ATOM 8061  N ND2  . ASN A 1 29 ? -9.759  -8.039  6.384   1.00 0.00 ? 320 ASN A ND2  10 
ATOM 8062  H H    . ASN A 1 29 ? -10.610 -5.535  5.462   1.00 0.00 ? 320 ASN A H    10 
ATOM 8063  H HA   . ASN A 1 29 ? -11.371 -5.280  8.258   1.00 0.00 ? 320 ASN A HA   10 
ATOM 8064  H HB2  . ASN A 1 29 ? -8.678  -5.869  7.004   1.00 0.00 ? 320 ASN A HB2  10 
ATOM 8065  H HD21 . ASN A 1 29 ? -9.391  -7.482  5.668   1.00 0.00 ? 320 ASN A HD21 10 
ATOM 8066  H HD22 . ASN A 1 29 ? -10.031 -8.969  6.259   1.00 0.00 ? 320 ASN A HD22 10 
ATOM 8067  N N    . ARG A 1 30 ? -9.978  -2.894  6.639   1.00 0.00 ? 321 ARG A N    10 
ATOM 8068  C CA   . ARG A 1 30 ? -9.506  -1.516  6.711   1.00 0.00 ? 321 ARG A CA   10 
ATOM 8069  C C    . ARG A 1 30 ? -8.056  -1.462  7.178   1.00 0.00 ? 321 ARG A C    10 
ATOM 8070  O O    . ARG A 1 30 ? -7.755  -0.917  8.240   1.00 0.00 ? 321 ARG A O    10 
ATOM 8071  C CB   . ARG A 1 30 ? -10.394 -0.705  7.655   1.00 0.00 ? 321 ARG A CB   10 
ATOM 8072  C CG   . ARG A 1 30 ? -11.856 -0.689  7.243   1.00 0.00 ? 321 ARG A CG   10 
ATOM 8073  C CD   . ARG A 1 30 ? -12.735 -1.373  8.278   1.00 0.00 ? 321 ARG A CD   10 
ATOM 8074  N NE   . ARG A 1 30 ? -14.021 -0.701  8.435   1.00 0.00 ? 321 ARG A NE   10 
ATOM 8075  C CZ   . ARG A 1 30 ? -14.197 0.391   9.173   1.00 0.00 ? 321 ARG A CZ   10 
ATOM 8076  N NH1  . ARG A 1 30 ? -13.170 0.931   9.816   1.00 0.00 ? 321 ARG A NH1  10 
ATOM 8077  N NH2  . ARG A 1 30 ? -15.398 0.944   9.269   1.00 0.00 ? 321 ARG A NH2  10 
ATOM 8078  H H    . ARG A 1 30 ? -10.212 -3.269  5.766   1.00 0.00 ? 321 ARG A H    10 
ATOM 8079  H HA   . ARG A 1 30 ? -9.570  -1.093  5.721   1.00 0.00 ? 321 ARG A HA   10 
ATOM 8080  H HB2  . ARG A 1 30 ? -10.326 -1.127  8.649   1.00 0.00 ? 321 ARG A HB2  10 
ATOM 8081  H HG2  . ARG A 1 30 ? -12.177 0.335   7.133   1.00 0.00 ? 321 ARG A HG2  10 
ATOM 8082  H HD2  . ARG A 1 30 ? -12.910 -2.392  7.965   1.00 0.00 ? 321 ARG A HD2  10 
ATOM 8083  H HE   . ARG A 1 30 ? -14.794 -1.082  7.969   1.00 0.00 ? 321 ARG A HE   10 
ATOM 8084  H HH11 . ARG A 1 30 ? -12.263 0.517   9.747   1.00 0.00 ? 321 ARG A HH11 10 
ATOM 8085  H HH12 . ARG A 1 30 ? -13.304 1.753   10.370  1.00 0.00 ? 321 ARG A HH12 10 
ATOM 8086  H HH21 . ARG A 1 30 ? -16.174 0.540   8.785   1.00 0.00 ? 321 ARG A HH21 10 
ATOM 8087  H HH22 . ARG A 1 30 ? -15.529 1.765   9.826   1.00 0.00 ? 321 ARG A HH22 10 
ATOM 8088  N N    . THR A 1 31 ? -7.160  -2.030  6.377   1.00 0.00 ? 322 THR A N    10 
ATOM 8089  C CA   . THR A 1 31 ? -5.740  -2.046  6.711   1.00 0.00 ? 322 THR A CA   10 
ATOM 8090  C C    . THR A 1 31 ? -4.874  -2.078  5.458   1.00 0.00 ? 322 THR A C    10 
ATOM 8091  O O    . THR A 1 31 ? -5.349  -1.810  4.354   1.00 0.00 ? 322 THR A O    10 
ATOM 8092  C CB   . THR A 1 31 ? -5.385  -3.254  7.601   1.00 0.00 ? 322 THR A CB   10 
ATOM 8093  O OG1  . THR A 1 31 ? -4.022  -3.162  8.030   1.00 0.00 ? 322 THR A OG1  10 
ATOM 8094  C CG2  . THR A 1 31 ? -5.600  -4.566  6.857   1.00 0.00 ? 322 THR A CG2  10 
ATOM 8095  H H    . THR A 1 31 ? -7.459  -2.446  5.541   1.00 0.00 ? 322 THR A H    10 
ATOM 8096  H HA   . THR A 1 31 ? -5.518  -1.145  7.261   1.00 0.00 ? 322 THR A HA   10 
ATOM 8097  H HB   . THR A 1 31 ? -6.028  -3.242  8.469   1.00 0.00 ? 322 THR A HB   10 
ATOM 8098  H HG1  . THR A 1 31 ? -3.941  -2.474  8.696   1.00 0.00 ? 322 THR A HG1  10 
ATOM 8099  H HG21 . THR A 1 31 ? -6.612  -4.906  7.013   1.00 0.00 ? 322 THR A HG21 10 
ATOM 8100  H HG22 . THR A 1 31 ? -4.909  -5.308  7.229   1.00 0.00 ? 322 THR A HG22 10 
ATOM 8101  H HG23 . THR A 1 31 ? -5.430  -4.414  5.801   1.00 0.00 ? 322 THR A HG23 10 
ATOM 8102  N N    . THR A 1 32 ? -3.601  -2.409  5.640   1.00 0.00 ? 323 THR A N    10 
ATOM 8103  C CA   . THR A 1 32 ? -2.662  -2.478  4.529   1.00 0.00 ? 323 THR A CA   10 
ATOM 8104  C C    . THR A 1 32 ? -1.688  -3.633  4.716   1.00 0.00 ? 323 THR A C    10 
ATOM 8105  O O    . THR A 1 32 ? -1.698  -4.309  5.745   1.00 0.00 ? 323 THR A O    10 
ATOM 8106  C CB   . THR A 1 32 ? -1.863  -1.170  4.375   1.00 0.00 ? 323 THR A CB   10 
ATOM 8107  O OG1  . THR A 1 32 ? -1.421  -0.715  5.659   1.00 0.00 ? 323 THR A OG1  10 
ATOM 8108  C CG2  . THR A 1 32 ? -2.713  -0.091  3.713   1.00 0.00 ? 323 THR A CG2  10 
ATOM 8109  H H    . THR A 1 32 ? -3.288  -2.619  6.543   1.00 0.00 ? 323 THR A H    10 
ATOM 8110  H HA   . THR A 1 32 ? -3.230  -2.638  3.625   1.00 0.00 ? 323 THR A HA   10 
ATOM 8111  H HB   . THR A 1 32 ? -0.995  -1.363  3.751   1.00 0.00 ? 323 THR A HB   10 
ATOM 8112  H HG1  . THR A 1 32 ? -0.914  -1.409  6.088   1.00 0.00 ? 323 THR A HG1  10 
ATOM 8113  H HG21 . THR A 1 32 ? -2.399  0.883   4.063   1.00 0.00 ? 323 THR A HG21 10 
ATOM 8114  H HG22 . THR A 1 32 ? -3.753  -0.247  3.966   1.00 0.00 ? 323 THR A HG22 10 
ATOM 8115  H HG23 . THR A 1 32 ? -2.592  -0.146  2.641   1.00 0.00 ? 323 THR A HG23 10 
ATOM 8116  N N    . GLN A 1 33 ? -0.847  -3.856  3.714   1.00 0.00 ? 324 GLN A N    10 
ATOM 8117  C CA   . GLN A 1 33 ? 0.137   -4.930  3.769   1.00 0.00 ? 324 GLN A CA   10 
ATOM 8118  C C    . GLN A 1 33 ? 0.849   -5.082  2.433   1.00 0.00 ? 324 GLN A C    10 
ATOM 8119  O O    . GLN A 1 33 ? 0.212   -5.232  1.393   1.00 0.00 ? 324 GLN A O    10 
ATOM 8120  C CB   . GLN A 1 33 ? -0.529  -6.256  4.151   1.00 0.00 ? 324 GLN A CB   10 
ATOM 8121  C CG   . GLN A 1 33 ? -1.940  -6.417  3.606   1.00 0.00 ? 324 GLN A CG   10 
ATOM 8122  C CD   . GLN A 1 33 ? -2.086  -7.611  2.686   1.00 0.00 ? 324 GLN A CD   10 
ATOM 8123  O OE1  . GLN A 1 33 ? -2.569  -7.487  1.561   1.00 0.00 ? 324 GLN A OE1  10 
ATOM 8124  N NE2  . GLN A 1 33 ? -1.665  -8.773  3.157   1.00 0.00 ? 324 GLN A NE2  10 
ATOM 8125  H H    . GLN A 1 33 ? -0.892  -3.288  2.916   1.00 0.00 ? 324 GLN A H    10 
ATOM 8126  H HA   . GLN A 1 33 ? 0.865   -4.674  4.523   1.00 0.00 ? 324 GLN A HA   10 
ATOM 8127  H HB2  . GLN A 1 33 ? 0.072   -7.069  3.771   1.00 0.00 ? 324 GLN A HB2  10 
ATOM 8128  H HG2  . GLN A 1 33 ? -2.619  -6.537  4.435   1.00 0.00 ? 324 GLN A HG2  10 
ATOM 8129  H HE21 . GLN A 1 33 ? -1.287  -8.792  4.057   1.00 0.00 ? 324 GLN A HE21 10 
ATOM 8130  H HE22 . GLN A 1 33 ? -1.757  -9.564  2.588   1.00 0.00 ? 324 GLN A HE22 10 
ATOM 8131  N N    . PHE A 1 34 ? 2.174   -5.054  2.470   1.00 0.00 ? 325 PHE A N    10 
ATOM 8132  C CA   . PHE A 1 34 ? 2.968   -5.195  1.256   1.00 0.00 ? 325 PHE A CA   10 
ATOM 8133  C C    . PHE A 1 34 ? 2.756   -6.575  0.651   1.00 0.00 ? 325 PHE A C    10 
ATOM 8134  O O    . PHE A 1 34 ? 3.080   -6.812  -0.514  1.00 0.00 ? 325 PHE A O    10 
ATOM 8135  C CB   . PHE A 1 34 ? 4.455   -4.982  1.560   1.00 0.00 ? 325 PHE A CB   10 
ATOM 8136  C CG   . PHE A 1 34 ? 4.895   -3.532  1.601   1.00 0.00 ? 325 PHE A CG   10 
ATOM 8137  C CD1  . PHE A 1 34 ? 4.012   -2.489  1.323   1.00 0.00 ? 325 PHE A CD1  10 
ATOM 8138  C CD2  . PHE A 1 34 ? 6.208   -3.214  1.908   1.00 0.00 ? 325 PHE A CD2  10 
ATOM 8139  C CE1  . PHE A 1 34 ? 4.434   -1.173  1.355   1.00 0.00 ? 325 PHE A CE1  10 
ATOM 8140  C CE2  . PHE A 1 34 ? 6.633   -1.902  1.937   1.00 0.00 ? 325 PHE A CE2  10 
ATOM 8141  C CZ   . PHE A 1 34 ? 5.745   -0.881  1.660   1.00 0.00 ? 325 PHE A CZ   10 
ATOM 8142  H H    . PHE A 1 34 ? 2.628   -4.968  3.332   1.00 0.00 ? 325 PHE A H    10 
ATOM 8143  H HA   . PHE A 1 34 ? 2.637   -4.456  0.548   1.00 0.00 ? 325 PHE A HA   10 
ATOM 8144  H HB2  . PHE A 1 34 ? 4.683   -5.425  2.520   1.00 0.00 ? 325 PHE A HB2  10 
ATOM 8145  H HD1  . PHE A 1 34 ? 2.986   -2.710  1.091   1.00 0.00 ? 325 PHE A HD1  10 
ATOM 8146  H HD2  . PHE A 1 34 ? 6.906   -4.005  2.131   1.00 0.00 ? 325 PHE A HD2  10 
ATOM 8147  H HE1  . PHE A 1 34 ? 3.736   -0.370  1.144   1.00 0.00 ? 325 PHE A HE1  10 
ATOM 8148  H HE2  . PHE A 1 34 ? 7.660   -1.676  2.181   1.00 0.00 ? 325 PHE A HE2  10 
ATOM 8149  H HZ   . PHE A 1 34 ? 6.079   0.146   1.682   1.00 0.00 ? 325 PHE A HZ   10 
ATOM 8150  N N    . THR A 1 35 ? 2.210   -7.482  1.450   1.00 0.00 ? 326 THR A N    10 
ATOM 8151  C CA   . THR A 1 35 ? 1.950   -8.834  1.007   1.00 0.00 ? 326 THR A CA   10 
ATOM 8152  C C    . THR A 1 35 ? 0.674   -8.917  0.182   1.00 0.00 ? 326 THR A C    10 
ATOM 8153  O O    . THR A 1 35 ? -0.214  -8.073  0.303   1.00 0.00 ? 326 THR A O    10 
ATOM 8154  C CB   . THR A 1 35 ? 1.817   -9.779  2.208   1.00 0.00 ? 326 THR A CB   10 
ATOM 8155  O OG1  . THR A 1 35 ? 2.413   -9.187  3.368   1.00 0.00 ? 326 THR A OG1  10 
ATOM 8156  C CG2  . THR A 1 35 ? 2.485   -11.101 1.906   1.00 0.00 ? 326 THR A CG2  10 
ATOM 8157  H H    . THR A 1 35 ? 1.984   -7.240  2.370   1.00 0.00 ? 326 THR A H    10 
ATOM 8158  H HA   . THR A 1 35 ? 2.784   -9.161  0.407   1.00 0.00 ? 326 THR A HA   10 
ATOM 8159  H HB   . THR A 1 35 ? 0.766   -9.952  2.397   1.00 0.00 ? 326 THR A HB   10 
ATOM 8160  H HG1  . THR A 1 35 ? 3.364   -9.319  3.344   1.00 0.00 ? 326 THR A HG1  10 
ATOM 8161  H HG21 . THR A 1 35 ? 2.613   -11.657 2.822   1.00 0.00 ? 326 THR A HG21 10 
ATOM 8162  H HG22 . THR A 1 35 ? 3.451   -10.914 1.458   1.00 0.00 ? 326 THR A HG22 10 
ATOM 8163  H HG23 . THR A 1 35 ? 1.869   -11.664 1.221   1.00 0.00 ? 326 THR A HG23 10 
ATOM 8164  N N    . ASP A 1 36 ? 0.590   -9.942  -0.656  1.00 0.00 ? 327 ASP A N    10 
ATOM 8165  C CA   . ASP A 1 36 ? -0.580  -10.149 -1.492  1.00 0.00 ? 327 ASP A CA   10 
ATOM 8166  C C    . ASP A 1 36 ? -1.416  -11.305 -0.946  1.00 0.00 ? 327 ASP A C    10 
ATOM 8167  O O    . ASP A 1 36 ? -0.942  -12.441 -0.892  1.00 0.00 ? 327 ASP A O    10 
ATOM 8168  C CB   . ASP A 1 36 ? -0.161  -10.441 -2.934  1.00 0.00 ? 327 ASP A CB   10 
ATOM 8169  C CG   . ASP A 1 36 ? -1.336  -10.423 -3.891  1.00 0.00 ? 327 ASP A CG   10 
ATOM 8170  O OD1  . ASP A 1 36 ? -2.489  -10.502 -3.418  1.00 0.00 ? 327 ASP A OD1  10 
ATOM 8171  O OD2  . ASP A 1 36 ? -1.104  -10.327 -5.115  1.00 0.00 ? 327 ASP A OD2  10 
ATOM 8172  H H    . ASP A 1 36 ? 1.336   -10.578 -0.711  1.00 0.00 ? 327 ASP A H    10 
ATOM 8173  H HA   . ASP A 1 36 ? -1.163  -9.244  -1.471  1.00 0.00 ? 327 ASP A HA   10 
ATOM 8174  H HB2  . ASP A 1 36 ? 0.551   -9.695  -3.253  1.00 0.00 ? 327 ASP A HB2  10 
ATOM 8175  N N    . PRO A 1 37 ? -2.669  -11.045 -0.534  1.00 0.00 ? 328 PRO A N    10 
ATOM 8176  C CA   . PRO A 1 37 ? -3.545  -12.084 0.015   1.00 0.00 ? 328 PRO A CA   10 
ATOM 8177  C C    . PRO A 1 37 ? -3.637  -13.287 -0.909  1.00 0.00 ? 328 PRO A C    10 
ATOM 8178  O O    . PRO A 1 37 ? -3.917  -14.402 -0.468  1.00 0.00 ? 328 PRO A O    10 
ATOM 8179  C CB   . PRO A 1 37 ? -4.910  -11.396 0.141   1.00 0.00 ? 328 PRO A CB   10 
ATOM 8180  C CG   . PRO A 1 37 ? -4.791  -10.139 -0.651  1.00 0.00 ? 328 PRO A CG   10 
ATOM 8181  C CD   . PRO A 1 37 ? -3.345  -9.743  -0.580  1.00 0.00 ? 328 PRO A CD   10 
ATOM 8182  H HA   . PRO A 1 37 ? -3.208  -12.405 0.990   1.00 0.00 ? 328 PRO A HA   10 
ATOM 8183  H HB2  . PRO A 1 37 ? -5.678  -12.042 -0.259  1.00 0.00 ? 328 PRO A HB2  10 
ATOM 8184  H HG2  . PRO A 1 37 ? -5.080  -10.323 -1.675  1.00 0.00 ? 328 PRO A HG2  10 
ATOM 8185  H HD2  . PRO A 1 37 ? -3.066  -9.183  -1.459  1.00 0.00 ? 328 PRO A HD2  10 
ATOM 8186  N N    . ARG A 1 38 ? -3.401  -13.053 -2.194  1.00 0.00 ? 329 ARG A N    10 
ATOM 8187  C CA   . ARG A 1 38 ? -3.451  -14.121 -3.178  1.00 0.00 ? 329 ARG A CA   10 
ATOM 8188  C C    . ARG A 1 38 ? -2.259  -15.057 -3.004  1.00 0.00 ? 329 ARG A C    10 
ATOM 8189  O O    . ARG A 1 38 ? -2.325  -16.237 -3.348  1.00 0.00 ? 329 ARG A O    10 
ATOM 8190  C CB   . ARG A 1 38 ? -3.460  -13.544 -4.595  1.00 0.00 ? 329 ARG A CB   10 
ATOM 8191  C CG   . ARG A 1 38 ? -4.568  -12.531 -4.829  1.00 0.00 ? 329 ARG A CG   10 
ATOM 8192  C CD   . ARG A 1 38 ? -4.304  -11.695 -6.072  1.00 0.00 ? 329 ARG A CD   10 
ATOM 8193  N NE   . ARG A 1 38 ? -3.916  -12.520 -7.213  1.00 0.00 ? 329 ARG A NE   10 
ATOM 8194  C CZ   . ARG A 1 38 ? -4.775  -13.234 -7.933  1.00 0.00 ? 329 ARG A CZ   10 
ATOM 8195  N NH1  . ARG A 1 38 ? -6.067  -13.224 -7.631  1.00 0.00 ? 329 ARG A NH1  10 
ATOM 8196  N NH2  . ARG A 1 38 ? -4.344  -13.958 -8.956  1.00 0.00 ? 329 ARG A NH2  10 
ATOM 8197  H H    . ARG A 1 38 ? -3.191  -12.141 -2.485  1.00 0.00 ? 329 ARG A H    10 
ATOM 8198  H HA   . ARG A 1 38 ? -4.361  -14.674 -3.016  1.00 0.00 ? 329 ARG A HA   10 
ATOM 8199  H HB2  . ARG A 1 38 ? -2.513  -13.059 -4.781  1.00 0.00 ? 329 ARG A HB2  10 
ATOM 8200  H HG2  . ARG A 1 38 ? -5.503  -13.057 -4.954  1.00 0.00 ? 329 ARG A HG2  10 
ATOM 8201  H HD2  . ARG A 1 38 ? -5.204  -11.153 -6.322  1.00 0.00 ? 329 ARG A HD2  10 
ATOM 8202  H HE   . ARG A 1 38 ? -2.966  -12.542 -7.455  1.00 0.00 ? 329 ARG A HE   10 
ATOM 8203  H HH11 . ARG A 1 38 ? -6.396  -12.679 -6.859  1.00 0.00 ? 329 ARG A HH11 10 
ATOM 8204  H HH12 . ARG A 1 38 ? -6.712  -13.762 -8.174  1.00 0.00 ? 329 ARG A HH12 10 
ATOM 8205  H HH21 . ARG A 1 38 ? -3.370  -13.969 -9.187  1.00 0.00 ? 329 ARG A HH21 10 
ATOM 8206  H HH22 . ARG A 1 38 ? -4.992  -14.495 -9.497  1.00 0.00 ? 329 ARG A HH22 10 
ATOM 8207  N N    . LEU A 1 39 ? -1.167  -14.516 -2.467  1.00 0.00 ? 330 LEU A N    10 
ATOM 8208  C CA   . LEU A 1 39 ? 0.043   -15.293 -2.238  1.00 0.00 ? 330 LEU A CA   10 
ATOM 8209  C C    . LEU A 1 39 ? -0.058  -16.074 -0.932  1.00 0.00 ? 330 LEU A C    10 
ATOM 8210  O O    . LEU A 1 39 ? -0.168  -17.300 -0.936  1.00 0.00 ? 330 LEU A O    10 
ATOM 8211  C CB   . LEU A 1 39 ? 1.266   -14.373 -2.199  1.00 0.00 ? 330 LEU A CB   10 
ATOM 8212  C CG   . LEU A 1 39 ? 1.612   -13.698 -3.528  1.00 0.00 ? 330 LEU A CG   10 
ATOM 8213  C CD1  . LEU A 1 39 ? 2.796   -12.759 -3.357  1.00 0.00 ? 330 LEU A CD1  10 
ATOM 8214  C CD2  . LEU A 1 39 ? 1.908   -14.743 -4.593  1.00 0.00 ? 330 LEU A CD2  10 
ATOM 8215  H H    . LEU A 1 39 ? -1.177  -13.567 -2.220  1.00 0.00 ? 330 LEU A H    10 
ATOM 8216  H HA   . LEU A 1 39 ? 0.152   -15.989 -3.054  1.00 0.00 ? 330 LEU A HA   10 
ATOM 8217  H HB2  . LEU A 1 39 ? 1.087   -13.603 -1.464  1.00 0.00 ? 330 LEU A HB2  10 
ATOM 8218  H HG   . LEU A 1 39 ? 0.767   -13.113 -3.857  1.00 0.00 ? 330 LEU A HG   10 
ATOM 8219  H HD11 . LEU A 1 39 ? 3.033   -12.667 -2.307  1.00 0.00 ? 330 LEU A HD11 10 
ATOM 8220  H HD12 . LEU A 1 39 ? 3.651   -13.157 -3.884  1.00 0.00 ? 330 LEU A HD12 10 
ATOM 8221  H HD13 . LEU A 1 39 ? 2.546   -11.788 -3.756  1.00 0.00 ? 330 LEU A HD13 10 
ATOM 8222  H HD21 . LEU A 1 39 ? 2.280   -15.641 -4.122  1.00 0.00 ? 330 LEU A HD21 10 
ATOM 8223  H HD22 . LEU A 1 39 ? 1.002   -14.970 -5.136  1.00 0.00 ? 330 LEU A HD22 10 
ATOM 8224  H HD23 . LEU A 1 39 ? 2.651   -14.360 -5.276  1.00 0.00 ? 330 LEU A HD23 10 
ATOM 8225  N N    . SER A 1 40 ? -0.021  -15.353 0.185   1.00 0.00 ? 331 SER A N    10 
ATOM 8226  C CA   . SER A 1 40 ? -0.108  -15.975 1.500   1.00 0.00 ? 331 SER A CA   10 
ATOM 8227  C C    . SER A 1 40 ? -1.398  -16.776 1.638   1.00 0.00 ? 331 SER A C    10 
ATOM 8228  O O    . SER A 1 40 ? -2.495  -16.219 1.594   1.00 0.00 ? 331 SER A O    10 
ATOM 8229  C CB   . SER A 1 40 ? -0.036  -14.910 2.595   1.00 0.00 ? 331 SER A CB   10 
ATOM 8230  O OG   . SER A 1 40 ? 1.024   -14.000 2.352   1.00 0.00 ? 331 SER A OG   10 
ATOM 8231  H H    . SER A 1 40 ? 0.068   -14.379 0.121   1.00 0.00 ? 331 SER A H    10 
ATOM 8232  H HA   . SER A 1 40 ? 0.731   -16.645 1.607   1.00 0.00 ? 331 SER A HA   10 
ATOM 8233  H HB2  . SER A 1 40 ? -0.965  -14.360 2.622   1.00 0.00 ? 331 SER A HB2  10 
ATOM 8234  H HG   . SER A 1 40 ? 0.967   -13.268 2.971   1.00 0.00 ? 331 SER A HG   10 
ATOM 8235  N N    . ALA A 1 41 ? -1.259  -18.087 1.802   1.00 0.00 ? 332 ALA A N    10 
ATOM 8236  C CA   . ALA A 1 41 ? -2.413  -18.964 1.947   1.00 0.00 ? 332 ALA A CA   10 
ATOM 8237  C C    . ALA A 1 41 ? -1.993  -20.344 2.443   1.00 0.00 ? 332 ALA A C    10 
ATOM 8238  O O    . ALA A 1 41 ? -2.447  -21.366 1.927   1.00 0.00 ? 332 ALA A O    10 
ATOM 8239  C CB   . ALA A 1 41 ? -3.156  -19.080 0.621   1.00 0.00 ? 332 ALA A CB   10 
ATOM 8240  H H    . ALA A 1 41 ? -0.358  -18.473 1.827   1.00 0.00 ? 332 ALA A H    10 
ATOM 8241  H HA   . ALA A 1 41 ? -3.080  -18.520 2.672   1.00 0.00 ? 332 ALA A HA   10 
ATOM 8242  H HB1  . ALA A 1 41 ? -3.253  -18.100 0.176   1.00 0.00 ? 332 ALA A HB1  10 
ATOM 8243  H HB2  . ALA A 1 41 ? -2.602  -19.724 -0.046  1.00 0.00 ? 332 ALA A HB2  10 
ATOM 8244  H HB3  . ALA A 1 41 ? -4.138  -19.498 0.792   1.00 0.00 ? 332 ALA A HB3  10 
ATOM 8245  N N    . ASN A 1 42 ? -1.123  -20.365 3.447   1.00 0.00 ? 333 ASN A N    10 
ATOM 8246  C CA   . ASN A 1 42 ? -0.643  -21.619 4.015   1.00 0.00 ? 333 ASN A CA   10 
ATOM 8247  C C    . ASN A 1 42 ? -0.116  -22.545 2.924   1.00 0.00 ? 333 ASN A C    10 
ATOM 8248  O O    . ASN A 1 42 ? -0.937  -23.251 2.301   1.00 0.00 ? 333 ASN A O    10 
ATOM 8249  C CB   . ASN A 1 42 ? -1.764  -22.313 4.791   1.00 0.00 ? 333 ASN A CB   10 
ATOM 8250  C CG   . ASN A 1 42 ? -1.238  -23.359 5.754   1.00 0.00 ? 333 ASN A CG   10 
ATOM 8251  O OD1  . ASN A 1 42 ? -0.034  -23.605 5.825   1.00 0.00 ? 333 ASN A OD1  10 
ATOM 8252  N ND2  . ASN A 1 42 ? -2.141  -23.981 6.503   1.00 0.00 ? 333 ASN A ND2  10 
ATOM 8253  O OXT  . ASN A 1 42 ? 1.113   -22.557 2.702   1.00 0.00 ? 333 ASN A OXT  10 
ATOM 8254  H H    . ASN A 1 42 ? -0.797  -19.518 3.815   1.00 0.00 ? 333 ASN A H    10 
ATOM 8255  H HA   . ASN A 1 42 ? 0.163   -21.388 4.695   1.00 0.00 ? 333 ASN A HA   10 
ATOM 8256  H HB2  . ASN A 1 42 ? -2.313  -21.574 5.357   1.00 0.00 ? 333 ASN A HB2  10 
ATOM 8257  H HD21 . ASN A 1 42 ? -3.083  -23.735 6.393   1.00 0.00 ? 333 ASN A HD21 10 
ATOM 8258  H HD22 . ASN A 1 42 ? -1.828  -24.663 7.135   1.00 0.00 ? 333 ASN A HD22 10 
ATOM 8259  N N    . GLY B 2 1  ? 11.679  -12.512 7.960   1.00 0.00 ? 198 GLY B N    10 
ATOM 8260  C CA   . GLY B 2 1  ? 12.212  -11.122 7.932   1.00 0.00 ? 198 GLY B CA   10 
ATOM 8261  C C    . GLY B 2 1  ? 13.275  -10.894 8.993   1.00 0.00 ? 198 GLY B C    10 
ATOM 8262  O O    . GLY B 2 1  ? 13.737  -11.851 9.614   1.00 0.00 ? 198 GLY B O    10 
ATOM 8263  H H1   . GLY B 2 1  ? 11.003  -12.620 8.743   1.00 0.00 ? 198 GLY B H1   10 
ATOM 8264  H H2   . GLY B 2 1  ? 12.455  -13.191 8.090   1.00 0.00 ? 198 GLY B H2   10 
ATOM 8265  H H3   . GLY B 2 1  ? 11.193  -12.726 7.065   1.00 0.00 ? 198 GLY B H3   10 
ATOM 8266  H HA2  . GLY B 2 1  ? 12.642  -10.936 6.958   1.00 0.00 ? 198 GLY B HA2  10 
ATOM 8267  H HA3  . GLY B 2 1  ? 11.394  -10.436 8.095   1.00 0.00 ? 198 GLY B HA3  10 
ATOM 8268  N N    . PRO B 2 2  ? 13.688  -9.634  9.236   1.00 0.00 ? 199 PRO B N    10 
ATOM 8269  C CA   . PRO B 2 2  ? 14.708  -9.325  10.241  1.00 0.00 ? 199 PRO B CA   10 
ATOM 8270  C C    . PRO B 2 2  ? 14.185  -9.508  11.662  1.00 0.00 ? 199 PRO B C    10 
ATOM 8271  O O    . PRO B 2 2  ? 14.883  -10.034 12.528  1.00 0.00 ? 199 PRO B O    10 
ATOM 8272  C CB   . PRO B 2 2  ? 15.053  -7.847  9.990   1.00 0.00 ? 199 PRO B CB   10 
ATOM 8273  C CG   . PRO B 2 2  ? 14.356  -7.468  8.722   1.00 0.00 ? 199 PRO B CG   10 
ATOM 8274  C CD   . PRO B 2 2  ? 13.202  -8.416  8.568   1.00 0.00 ? 199 PRO B CD   10 
ATOM 8275  H HA   . PRO B 2 2  ? 15.591  -9.936  10.107  1.00 0.00 ? 199 PRO B HA   10 
ATOM 8276  H HB2  . PRO B 2 2  ? 14.702  -7.252  10.820  1.00 0.00 ? 199 PRO B HB2  10 
ATOM 8277  H HG2  . PRO B 2 2  ? 13.996  -6.453  8.793   1.00 0.00 ? 199 PRO B HG2  10 
ATOM 8278  H HD2  . PRO B 2 2  ? 12.325  -8.026  9.065   1.00 0.00 ? 199 PRO B HD2  10 
ATOM 8279  N N    . LEU B 2 3  ? 12.951  -9.070  11.893  1.00 0.00 ? 200 LEU B N    10 
ATOM 8280  C CA   . LEU B 2 3  ? 12.334  -9.187  13.210  1.00 0.00 ? 200 LEU B CA   10 
ATOM 8281  C C    . LEU B 2 3  ? 11.176  -10.187 13.206  1.00 0.00 ? 200 LEU B C    10 
ATOM 8282  O O    . LEU B 2 3  ? 10.500  -10.362 14.219  1.00 0.00 ? 200 LEU B O    10 
ATOM 8283  C CB   . LEU B 2 3  ? 11.837  -7.820  13.685  1.00 0.00 ? 200 LEU B CB   10 
ATOM 8284  C CG   . LEU B 2 3  ? 11.023  -7.034  12.656  1.00 0.00 ? 200 LEU B CG   10 
ATOM 8285  C CD1  . LEU B 2 3  ? 10.032  -6.113  13.349  1.00 0.00 ? 200 LEU B CD1  10 
ATOM 8286  C CD2  . LEU B 2 3  ? 11.943  -6.239  11.743  1.00 0.00 ? 200 LEU B CD2  10 
ATOM 8287  H H    . LEU B 2 3  ? 12.443  -8.662  11.161  1.00 0.00 ? 200 LEU B H    10 
ATOM 8288  H HA   . LEU B 2 3  ? 13.091  -9.538  13.895  1.00 0.00 ? 200 LEU B HA   10 
ATOM 8289  H HB2  . LEU B 2 3  ? 11.223  -7.970  14.561  1.00 0.00 ? 200 LEU B HB2  10 
ATOM 8290  H HG   . LEU B 2 3  ? 10.461  -7.728  12.046  1.00 0.00 ? 200 LEU B HG   10 
ATOM 8291  H HD11 . LEU B 2 3  ? 10.569  -5.362  13.908  1.00 0.00 ? 200 LEU B HD11 10 
ATOM 8292  H HD12 . LEU B 2 3  ? 9.407   -5.635  12.610  1.00 0.00 ? 200 LEU B HD12 10 
ATOM 8293  H HD13 . LEU B 2 3  ? 9.414   -6.689  14.022  1.00 0.00 ? 200 LEU B HD13 10 
ATOM 8294  H HD21 . LEU B 2 3  ? 11.578  -6.293  10.728  1.00 0.00 ? 200 LEU B HD21 10 
ATOM 8295  H HD22 . LEU B 2 3  ? 11.965  -5.208  12.062  1.00 0.00 ? 200 LEU B HD22 10 
ATOM 8296  H HD23 . LEU B 2 3  ? 12.941  -6.651  11.789  1.00 0.00 ? 200 LEU B HD23 10 
ATOM 8297  N N    . GLY B 2 4  ? 10.949  -10.845 12.068  1.00 0.00 ? 201 GLY B N    10 
ATOM 8298  C CA   . GLY B 2 4  ? 9.870   -11.811 11.977  1.00 0.00 ? 201 GLY B CA   10 
ATOM 8299  C C    . GLY B 2 4  ? 8.653   -11.255 11.263  1.00 0.00 ? 201 GLY B C    10 
ATOM 8300  O O    . GLY B 2 4  ? 7.698   -10.813 11.902  1.00 0.00 ? 201 GLY B O    10 
ATOM 8301  H H    . GLY B 2 4  ? 11.515  -10.676 11.288  1.00 0.00 ? 201 GLY B H    10 
ATOM 8302  H HA2  . GLY B 2 4  ? 10.223  -12.679 11.440  1.00 0.00 ? 201 GLY B HA2  10 
ATOM 8303  H HA3  . GLY B 2 4  ? 9.583   -12.109 12.975  1.00 0.00 ? 201 GLY B HA3  10 
ATOM 8304  N N    . SER B 2 5  ? 8.688   -11.275 9.934   1.00 0.00 ? 202 SER B N    10 
ATOM 8305  C CA   . SER B 2 5  ? 7.582   -10.769 9.129   1.00 0.00 ? 202 SER B CA   10 
ATOM 8306  C C    . SER B 2 5  ? 7.948   -10.755 7.648   1.00 0.00 ? 202 SER B C    10 
ATOM 8307  O O    . SER B 2 5  ? 7.548   -11.638 6.891   1.00 0.00 ? 202 SER B O    10 
ATOM 8308  C CB   . SER B 2 5  ? 7.193   -9.362  9.583   1.00 0.00 ? 202 SER B CB   10 
ATOM 8309  O OG   . SER B 2 5  ? 6.193   -9.409  10.585  1.00 0.00 ? 202 SER B OG   10 
ATOM 8310  H H    . SER B 2 5  ? 9.478   -11.642 9.483   1.00 0.00 ? 202 SER B H    10 
ATOM 8311  H HA   . SER B 2 5  ? 6.739   -11.430 9.272   1.00 0.00 ? 202 SER B HA   10 
ATOM 8312  H HB2  . SER B 2 5  ? 8.062   -8.862  9.985   1.00 0.00 ? 202 SER B HB2  10 
ATOM 8313  H HG   . SER B 2 5  ? 6.395   -8.766  11.270  1.00 0.00 ? 202 SER B HG   10 
ATOM 8314  N N    . GLU B 2 6  ? 8.710   -9.744  7.244   1.00 0.00 ? 203 GLU B N    10 
ATOM 8315  C CA   . GLU B 2 6  ? 9.129   -9.614  5.853   1.00 0.00 ? 203 GLU B CA   10 
ATOM 8316  C C    . GLU B 2 6  ? 10.040  -8.405  5.673   1.00 0.00 ? 203 GLU B C    10 
ATOM 8317  O O    . GLU B 2 6  ? 11.028  -8.463  4.940   1.00 0.00 ? 203 GLU B O    10 
ATOM 8318  C CB   . GLU B 2 6  ? 7.908   -9.484  4.940   1.00 0.00 ? 203 GLU B CB   10 
ATOM 8319  C CG   . GLU B 2 6  ? 7.169   -8.163  5.088   1.00 0.00 ? 203 GLU B CG   10 
ATOM 8320  C CD   . GLU B 2 6  ? 5.714   -8.261  4.671   1.00 0.00 ? 203 GLU B CD   10 
ATOM 8321  O OE1  . GLU B 2 6  ? 5.350   -9.261  4.017   1.00 0.00 ? 203 GLU B OE1  10 
ATOM 8322  O OE2  . GLU B 2 6  ? 4.939   -7.339  5.000   1.00 0.00 ? 203 GLU B OE2  10 
ATOM 8323  H H    . GLU B 2 6  ? 8.998   -9.070  7.895   1.00 0.00 ? 203 GLU B H    10 
ATOM 8324  H HA   . GLU B 2 6  ? 9.676   -10.505 5.586   1.00 0.00 ? 203 GLU B HA   10 
ATOM 8325  H HB2  . GLU B 2 6  ? 8.229   -9.581  3.913   1.00 0.00 ? 203 GLU B HB2  10 
ATOM 8326  H HG2  . GLU B 2 6  ? 7.209   -7.857  6.122   1.00 0.00 ? 203 GLU B HG2  10 
ATOM 8327  N N    . LEU B 2 7  ? 9.699   -7.314  6.350   1.00 0.00 ? 204 LEU B N    10 
ATOM 8328  C CA   . LEU B 2 7  ? 10.474  -6.079  6.269   1.00 0.00 ? 204 LEU B CA   10 
ATOM 8329  C C    . LEU B 2 7  ? 9.739   -4.944  6.977   1.00 0.00 ? 204 LEU B C    10 
ATOM 8330  O O    . LEU B 2 7  ? 9.201   -4.044  6.333   1.00 0.00 ? 204 LEU B O    10 
ATOM 8331  C CB   . LEU B 2 7  ? 10.733  -5.712  4.803   1.00 0.00 ? 204 LEU B CB   10 
ATOM 8332  C CG   . LEU B 2 7  ? 11.229  -4.286  4.564   1.00 0.00 ? 204 LEU B CG   10 
ATOM 8333  C CD1  . LEU B 2 7  ? 12.489  -4.294  3.712   1.00 0.00 ? 204 LEU B CD1  10 
ATOM 8334  C CD2  . LEU B 2 7  ? 10.140  -3.455  3.907   1.00 0.00 ? 204 LEU B CD2  10 
ATOM 8335  H H    . LEU B 2 7  ? 8.904   -7.339  6.923   1.00 0.00 ? 204 LEU B H    10 
ATOM 8336  H HA   . LEU B 2 7  ? 11.419  -6.243  6.760   1.00 0.00 ? 204 LEU B HA   10 
ATOM 8337  H HB2  . LEU B 2 7  ? 11.469  -6.396  4.407   1.00 0.00 ? 204 LEU B HB2  10 
ATOM 8338  H HG   . LEU B 2 7  ? 11.471  -3.832  5.514   1.00 0.00 ? 204 LEU B HG   10 
ATOM 8339  H HD11 . LEU B 2 7  ? 13.223  -4.946  4.161   1.00 0.00 ? 204 LEU B HD11 10 
ATOM 8340  H HD12 . LEU B 2 7  ? 12.250  -4.651  2.720   1.00 0.00 ? 204 LEU B HD12 10 
ATOM 8341  H HD13 . LEU B 2 7  ? 12.887  -3.292  3.648   1.00 0.00 ? 204 LEU B HD13 10 
ATOM 8342  H HD21 . LEU B 2 7  ? 10.291  -3.443  2.838   1.00 0.00 ? 204 LEU B HD21 10 
ATOM 8343  H HD22 . LEU B 2 7  ? 9.176   -3.890  4.130   1.00 0.00 ? 204 LEU B HD22 10 
ATOM 8344  H HD23 . LEU B 2 7  ? 10.179  -2.446  4.289   1.00 0.00 ? 204 LEU B HD23 10 
ATOM 8345  N N    . GLU B 2 8  ? 9.712   -4.993  8.306   1.00 0.00 ? 205 GLU B N    10 
ATOM 8346  C CA   . GLU B 2 8  ? 9.034   -3.966  9.087   1.00 0.00 ? 205 GLU B CA   10 
ATOM 8347  C C    . GLU B 2 8  ? 7.585   -3.824  8.620   1.00 0.00 ? 205 GLU B C    10 
ATOM 8348  O O    . GLU B 2 8  ? 6.998   -4.779  8.111   1.00 0.00 ? 205 GLU B O    10 
ATOM 8349  C CB   . GLU B 2 8  ? 9.775   -2.632  8.951   1.00 0.00 ? 205 GLU B CB   10 
ATOM 8350  C CG   . GLU B 2 8  ? 9.938   -1.892  10.268  1.00 0.00 ? 205 GLU B CG   10 
ATOM 8351  C CD   . GLU B 2 8  ? 9.558   -0.428  10.163  1.00 0.00 ? 205 GLU B CD   10 
ATOM 8352  O OE1  . GLU B 2 8  ? 9.436   0.074   9.025   1.00 0.00 ? 205 GLU B OE1  10 
ATOM 8353  O OE2  . GLU B 2 8  ? 9.379   0.215   11.218  1.00 0.00 ? 205 GLU B OE2  10 
ATOM 8354  H H    . GLU B 2 8  ? 10.155  -5.736  8.769   1.00 0.00 ? 205 GLU B H    10 
ATOM 8355  H HA   . GLU B 2 8  ? 9.040   -4.271  10.123  1.00 0.00 ? 205 GLU B HA   10 
ATOM 8356  H HB2  . GLU B 2 8  ? 10.757  -2.819  8.543   1.00 0.00 ? 205 GLU B HB2  10 
ATOM 8357  H HG2  . GLU B 2 8  ? 9.307   -2.359  11.009  1.00 0.00 ? 205 GLU B HG2  10 
ATOM 8358  N N    . SER B 2 9  ? 7.004   -2.637  8.792   1.00 0.00 ? 206 SER B N    10 
ATOM 8359  C CA   . SER B 2 9  ? 5.629   -2.400  8.366   1.00 0.00 ? 206 SER B CA   10 
ATOM 8360  C C    . SER B 2 9  ? 5.500   -1.070  7.626   1.00 0.00 ? 206 SER B C    10 
ATOM 8361  O O    . SER B 2 9  ? 4.800   -0.166  8.082   1.00 0.00 ? 206 SER B O    10 
ATOM 8362  C CB   . SER B 2 9  ? 4.691   -2.415  9.575   1.00 0.00 ? 206 SER B CB   10 
ATOM 8363  O OG   . SER B 2 9  ? 4.736   -3.665  10.240  1.00 0.00 ? 206 SER B OG   10 
ATOM 8364  H H    . SER B 2 9  ? 7.503   -1.911  9.219   1.00 0.00 ? 206 SER B H    10 
ATOM 8365  H HA   . SER B 2 9  ? 5.349   -3.199  7.697   1.00 0.00 ? 206 SER B HA   10 
ATOM 8366  H HB2  . SER B 2 9  ? 4.988   -1.642  10.268  1.00 0.00 ? 206 SER B HB2  10 
ATOM 8367  H HG   . SER B 2 9  ? 5.426   -3.648  10.907  1.00 0.00 ? 206 SER B HG   10 
ATOM 8368  N N    . PRO B 2 10 ? 6.178   -0.930  6.468   1.00 0.00 ? 207 PRO B N    10 
ATOM 8369  C CA   . PRO B 2 10 ? 6.131   0.292   5.666   1.00 0.00 ? 207 PRO B CA   10 
ATOM 8370  C C    . PRO B 2 10 ? 4.784   0.564   4.980   1.00 0.00 ? 207 PRO B C    10 
ATOM 8371  O O    . PRO B 2 10 ? 4.432   1.729   4.797   1.00 0.00 ? 207 PRO B O    10 
ATOM 8372  C CB   . PRO B 2 10 ? 7.235   0.091   4.619   1.00 0.00 ? 207 PRO B CB   10 
ATOM 8373  C CG   . PRO B 2 10 ? 8.028   -1.077  5.094   1.00 0.00 ? 207 PRO B CG   10 
ATOM 8374  C CD   . PRO B 2 10 ? 7.067   -1.931  5.858   1.00 0.00 ? 207 PRO B CD   10 
ATOM 8375  H HA   . PRO B 2 10 ? 6.379   1.147   6.264   1.00 0.00 ? 207 PRO B HA   10 
ATOM 8376  H HB2  . PRO B 2 10 ? 6.790   -0.100  3.660   1.00 0.00 ? 207 PRO B HB2  10 
ATOM 8377  H HG2  . PRO B 2 10 ? 8.424   -1.620  4.250   1.00 0.00 ? 207 PRO B HG2  10 
ATOM 8378  H HD2  . PRO B 2 10 ? 6.528   -2.578  5.185   1.00 0.00 ? 207 PRO B HD2  10 
ATOM 8379  N N    . PRO B 2 11 ? 4.003   -0.472  4.572   1.00 0.00 ? 208 PRO B N    10 
ATOM 8380  C CA   . PRO B 2 11 ? 2.727   -0.252  3.904   1.00 0.00 ? 208 PRO B CA   10 
ATOM 8381  C C    . PRO B 2 11 ? 1.933   0.901   4.500   1.00 0.00 ? 208 PRO B C    10 
ATOM 8382  O O    . PRO B 2 11 ? 1.596   0.874   5.684   1.00 0.00 ? 208 PRO B O    10 
ATOM 8383  C CB   . PRO B 2 11 ? 1.965   -1.550  4.114   1.00 0.00 ? 208 PRO B CB   10 
ATOM 8384  C CG   . PRO B 2 11 ? 2.997   -2.597  4.346   1.00 0.00 ? 208 PRO B CG   10 
ATOM 8385  C CD   . PRO B 2 11 ? 4.295   -1.909  4.689   1.00 0.00 ? 208 PRO B CD   10 
ATOM 8386  H HA   . PRO B 2 11 ? 2.869   -0.095  2.856   1.00 0.00 ? 208 PRO B HA   10 
ATOM 8387  H HB2  . PRO B 2 11 ? 1.307   -1.446  4.959   1.00 0.00 ? 208 PRO B HB2  10 
ATOM 8388  H HG2  . PRO B 2 11 ? 2.692   -3.235  5.161   1.00 0.00 ? 208 PRO B HG2  10 
ATOM 8389  H HD2  . PRO B 2 11 ? 4.586   -2.168  5.687   1.00 0.00 ? 208 PRO B HD2  10 
ATOM 8390  N N    . PRO B 2 12 ? 1.669   1.951   3.702   1.00 0.00 ? 209 PRO B N    10 
ATOM 8391  C CA   . PRO B 2 12 ? 0.880   3.105   4.131   1.00 0.00 ? 209 PRO B CA   10 
ATOM 8392  C C    . PRO B 2 12 ? -0.398  2.695   4.869   1.00 0.00 ? 209 PRO B C    10 
ATOM 8393  O O    . PRO B 2 12 ? -0.608  1.519   5.160   1.00 0.00 ? 209 PRO B O    10 
ATOM 8394  C CB   . PRO B 2 12 ? 0.548   3.813   2.806   1.00 0.00 ? 209 PRO B CB   10 
ATOM 8395  C CG   . PRO B 2 12 ? 1.063   2.934   1.726   1.00 0.00 ? 209 PRO B CG   10 
ATOM 8396  C CD   . PRO B 2 12 ? 2.159   2.143   2.335   1.00 0.00 ? 209 PRO B CD   10 
ATOM 8397  H HA   . PRO B 2 12 ? 1.458   3.765   4.760   1.00 0.00 ? 209 PRO B HA   10 
ATOM 8398  H HB2  . PRO B 2 12 ? -0.513  3.927   2.718   1.00 0.00 ? 209 PRO B HB2  10 
ATOM 8399  H HG2  . PRO B 2 12 ? 0.281   2.278   1.396   1.00 0.00 ? 209 PRO B HG2  10 
ATOM 8400  H HD2  . PRO B 2 12 ? 2.272   1.211   1.809   1.00 0.00 ? 209 PRO B HD2  10 
ATOM 8401  N N    . PRO B 2 13 ? -1.295  3.653   5.149   1.00 0.00 ? 210 PRO B N    10 
ATOM 8402  C CA   . PRO B 2 13 ? -2.521  3.379   5.872   1.00 0.00 ? 210 PRO B CA   10 
ATOM 8403  C C    . PRO B 2 13 ? -3.663  2.981   4.952   1.00 0.00 ? 210 PRO B C    10 
ATOM 8404  O O    . PRO B 2 13 ? -3.615  3.221   3.746   1.00 0.00 ? 210 PRO B O    10 
ATOM 8405  C CB   . PRO B 2 13 ? -2.814  4.713   6.544   1.00 0.00 ? 210 PRO B CB   10 
ATOM 8406  C CG   . PRO B 2 13 ? -2.229  5.751   5.638   1.00 0.00 ? 210 PRO B CG   10 
ATOM 8407  C CD   . PRO B 2 13 ? -1.220  5.062   4.746   1.00 0.00 ? 210 PRO B CD   10 
ATOM 8408  H HA   . PRO B 2 13 ? -2.379  2.618   6.621   1.00 0.00 ? 210 PRO B HA   10 
ATOM 8409  H HB2  . PRO B 2 13 ? -3.882  4.833   6.644   1.00 0.00 ? 210 PRO B HB2  10 
ATOM 8410  H HG2  . PRO B 2 13 ? -3.011  6.187   5.036   1.00 0.00 ? 210 PRO B HG2  10 
ATOM 8411  H HD2  . PRO B 2 13 ? -1.505  5.172   3.708   1.00 0.00 ? 210 PRO B HD2  10 
ATOM 8412  N N    . TYR B 2 14 ? -4.690  2.375   5.528   1.00 0.00 ? 211 TYR B N    10 
ATOM 8413  C CA   . TYR B 2 14 ? -5.844  1.950   4.758   1.00 0.00 ? 211 TYR B CA   10 
ATOM 8414  C C    . TYR B 2 14 ? -6.494  3.149   4.069   1.00 0.00 ? 211 TYR B C    10 
ATOM 8415  O O    . TYR B 2 14 ? -6.212  3.437   2.907   1.00 0.00 ? 211 TYR B O    10 
ATOM 8416  C CB   . TYR B 2 14 ? -6.859  1.234   5.665   1.00 0.00 ? 211 TYR B CB   10 
ATOM 8417  C CG   . TYR B 2 14 ? -8.236  1.088   5.050   1.00 0.00 ? 211 TYR B CG   10 
ATOM 8418  C CD1  . TYR B 2 14 ? -8.396  0.489   3.811   1.00 0.00 ? 211 TYR B CD1  10 
ATOM 8419  C CD2  . TYR B 2 14 ? -9.367  1.562   5.702   1.00 0.00 ? 211 TYR B CD2  10 
ATOM 8420  C CE1  . TYR B 2 14 ? -9.644  0.362   3.234   1.00 0.00 ? 211 TYR B CE1  10 
ATOM 8421  C CE2  . TYR B 2 14 ? -10.621 1.441   5.132   1.00 0.00 ? 211 TYR B CE2  10 
ATOM 8422  C CZ   . TYR B 2 14 ? -10.753 0.841   3.898   1.00 0.00 ? 211 TYR B CZ   10 
ATOM 8423  O OH   . TYR B 2 14 ? -11.999 0.719   3.326   1.00 0.00 ? 211 TYR B OH   10 
ATOM 8424  H H    . TYR B 2 14 ? -4.670  2.210   6.494   1.00 0.00 ? 211 TYR B H    10 
ATOM 8425  H HA   . TYR B 2 14 ? -5.499  1.260   4.001   1.00 0.00 ? 211 TYR B HA   10 
ATOM 8426  H HB2  . TYR B 2 14 ? -6.491  0.244   5.890   1.00 0.00 ? 211 TYR B HB2  10 
ATOM 8427  H HD1  . TYR B 2 14 ? -7.525  0.113   3.299   1.00 0.00 ? 211 TYR B HD1  10 
ATOM 8428  H HD2  . TYR B 2 14 ? -9.259  2.032   6.668   1.00 0.00 ? 211 TYR B HD2  10 
ATOM 8429  H HE1  . TYR B 2 14 ? -9.744  -0.104  2.265   1.00 0.00 ? 211 TYR B HE1  10 
ATOM 8430  H HE2  . TYR B 2 14 ? -11.490 1.816   5.653   1.00 0.00 ? 211 TYR B HE2  10 
ATOM 8431  H HH   . TYR B 2 14 ? -12.003 1.154   2.470   1.00 0.00 ? 211 TYR B HH   10 
ATOM 8432  N N    . SER B 2 15 ? -7.361  3.842   4.801   1.00 0.00 ? 212 SER B N    10 
ATOM 8433  C CA   . SER B 2 15 ? -8.062  5.001   4.267   1.00 0.00 ? 212 SER B CA   10 
ATOM 8434  C C    . SER B 2 15 ? -8.861  4.617   3.025   1.00 0.00 ? 212 SER B C    10 
ATOM 8435  O O    . SER B 2 15 ? -10.056 4.343   3.113   1.00 0.00 ? 212 SER B O    10 
ATOM 8436  C CB   . SER B 2 15 ? -7.077  6.126   3.946   1.00 0.00 ? 212 SER B CB   10 
ATOM 8437  O OG   . SER B 2 15 ? -6.458  6.613   5.124   1.00 0.00 ? 212 SER B OG   10 
ATOM 8438  H H    . SER B 2 15 ? -7.532  3.568   5.727   1.00 0.00 ? 212 SER B H    10 
ATOM 8439  H HA   . SER B 2 15 ? -8.750  5.345   5.025   1.00 0.00 ? 212 SER B HA   10 
ATOM 8440  H HB2  . SER B 2 15 ? -6.312  5.756   3.280   1.00 0.00 ? 212 SER B HB2  10 
ATOM 8441  H HG   . SER B 2 15 ? -7.131  6.879   5.753   1.00 0.00 ? 212 SER B HG   10 
ATOM 8442  N N    . ARG B 2 16 ? -8.194  4.596   1.870   1.00 0.00 ? 213 ARG B N    10 
ATOM 8443  C CA   . ARG B 2 16 ? -8.841  4.237   0.607   1.00 0.00 ? 213 ARG B CA   10 
ATOM 8444  C C    . ARG B 2 16 ? -7.944  4.580   -0.578  1.00 0.00 ? 213 ARG B C    10 
ATOM 8445  O O    . ARG B 2 16 ? -7.650  3.728   -1.416  1.00 0.00 ? 213 ARG B O    10 
ATOM 8446  C CB   . ARG B 2 16 ? -10.182 4.960   0.459   1.00 0.00 ? 213 ARG B CB   10 
ATOM 8447  C CG   . ARG B 2 16 ? -11.380 4.102   0.826   1.00 0.00 ? 213 ARG B CG   10 
ATOM 8448  C CD   . ARG B 2 16 ? -12.066 3.536   -0.406  1.00 0.00 ? 213 ARG B CD   10 
ATOM 8449  N NE   . ARG B 2 16 ? -13.272 4.283   -0.750  1.00 0.00 ? 213 ARG B NE   10 
ATOM 8450  C CZ   . ARG B 2 16 ? -13.877 4.203   -1.930  1.00 0.00 ? 213 ARG B CZ   10 
ATOM 8451  N NH1  . ARG B 2 16 ? -13.390 3.413   -2.876  1.00 0.00 ? 213 ARG B NH1  10 
ATOM 8452  N NH2  . ARG B 2 16 ? -14.972 4.914   -2.166  1.00 0.00 ? 213 ARG B NH2  10 
ATOM 8453  H H    . ARG B 2 16 ? -7.242  4.826   1.866   1.00 0.00 ? 213 ARG B H    10 
ATOM 8454  H HA   . ARG B 2 16 ? -9.014  3.172   0.615   1.00 0.00 ? 213 ARG B HA   10 
ATOM 8455  H HB2  . ARG B 2 16 ? -10.181 5.831   1.097   1.00 0.00 ? 213 ARG B HB2  10 
ATOM 8456  H HG2  . ARG B 2 16 ? -11.047 3.283   1.445   1.00 0.00 ? 213 ARG B HG2  10 
ATOM 8457  H HD2  . ARG B 2 16 ? -11.379 3.580   -1.237  1.00 0.00 ? 213 ARG B HD2  10 
ATOM 8458  H HE   . ARG B 2 16 ? -13.651 4.875   -0.065  1.00 0.00 ? 213 ARG B HE   10 
ATOM 8459  H HH11 . ARG B 2 16 ? -12.564 2.876   -2.702  1.00 0.00 ? 213 ARG B HH11 10 
ATOM 8460  H HH12 . ARG B 2 16 ? -13.847 3.354   -3.764  1.00 0.00 ? 213 ARG B HH12 10 
ATOM 8461  H HH21 . ARG B 2 16 ? -15.343 5.512   -1.456  1.00 0.00 ? 213 ARG B HH21 10 
ATOM 8462  H HH22 . ARG B 2 16 ? -15.426 4.853   -3.055  1.00 0.00 ? 213 ARG B HH22 10 
ATOM 8463  N N    . TYR B 2 17 ? -7.515  5.835   -0.636  1.00 0.00 ? 214 TYR B N    10 
ATOM 8464  C CA   . TYR B 2 17 ? -6.656  6.305   -1.717  1.00 0.00 ? 214 TYR B CA   10 
ATOM 8465  C C    . TYR B 2 17 ? -5.203  5.907   -1.475  1.00 0.00 ? 214 TYR B C    10 
ATOM 8466  O O    . TYR B 2 17 ? -4.855  5.426   -0.396  1.00 0.00 ? 214 TYR B O    10 
ATOM 8467  C CB   . TYR B 2 17 ? -6.776  7.825   -1.852  1.00 0.00 ? 214 TYR B CB   10 
ATOM 8468  C CG   . TYR B 2 17 ? -8.184  8.332   -1.646  1.00 0.00 ? 214 TYR B CG   10 
ATOM 8469  C CD1  . TYR B 2 17 ? -9.278  7.547   -1.984  1.00 0.00 ? 214 TYR B CD1  10 
ATOM 8470  C CD2  . TYR B 2 17 ? -8.420  9.593   -1.115  1.00 0.00 ? 214 TYR B CD2  10 
ATOM 8471  C CE1  . TYR B 2 17 ? -10.566 8.002   -1.800  1.00 0.00 ? 214 TYR B CE1  10 
ATOM 8472  C CE2  . TYR B 2 17 ? -9.706  10.057  -0.928  1.00 0.00 ? 214 TYR B CE2  10 
ATOM 8473  C CZ   . TYR B 2 17 ? -10.777 9.258   -1.271  1.00 0.00 ? 214 TYR B CZ   10 
ATOM 8474  O OH   . TYR B 2 17 ? -12.062 9.715   -1.086  1.00 0.00 ? 214 TYR B OH   10 
ATOM 8475  H H    . TYR B 2 17 ? -7.782  6.463   0.066   1.00 0.00 ? 214 TYR B H    10 
ATOM 8476  H HA   . TYR B 2 17 ? -6.994  5.844   -2.633  1.00 0.00 ? 214 TYR B HA   10 
ATOM 8477  H HB2  . TYR B 2 17 ? -6.142  8.299   -1.120  1.00 0.00 ? 214 TYR B HB2  10 
ATOM 8478  H HD1  . TYR B 2 17 ? -9.110  6.564   -2.399  1.00 0.00 ? 214 TYR B HD1  10 
ATOM 8479  H HD2  . TYR B 2 17 ? -7.579  10.215  -0.848  1.00 0.00 ? 214 TYR B HD2  10 
ATOM 8480  H HE1  . TYR B 2 17 ? -11.400 7.374   -2.070  1.00 0.00 ? 214 TYR B HE1  10 
ATOM 8481  H HE2  . TYR B 2 17 ? -9.869  11.039  -0.514  1.00 0.00 ? 214 TYR B HE2  10 
ATOM 8482  H HH   . TYR B 2 17 ? -12.058 10.674  -1.036  1.00 0.00 ? 214 TYR B HH   10 
ATOM 8483  N N    . PRO B 2 18 ? -4.335  6.099   -2.482  1.00 0.00 ? 215 PRO B N    10 
ATOM 8484  C CA   . PRO B 2 18 ? -2.922  5.757   -2.381  1.00 0.00 ? 215 PRO B CA   10 
ATOM 8485  C C    . PRO B 2 18 ? -2.094  6.878   -1.772  1.00 0.00 ? 215 PRO B C    10 
ATOM 8486  O O    . PRO B 2 18 ? -1.722  7.832   -2.455  1.00 0.00 ? 215 PRO B O    10 
ATOM 8487  C CB   . PRO B 2 18 ? -2.527  5.515   -3.836  1.00 0.00 ? 215 PRO B CB   10 
ATOM 8488  C CG   . PRO B 2 18 ? -3.442  6.379   -4.644  1.00 0.00 ? 215 PRO B CG   10 
ATOM 8489  C CD   . PRO B 2 18 ? -4.665  6.665   -3.801  1.00 0.00 ? 215 PRO B CD   10 
ATOM 8490  H HA   . PRO B 2 18 ? -2.775  4.855   -1.806  1.00 0.00 ? 215 PRO B HA   10 
ATOM 8491  H HB2  . PRO B 2 18 ? -1.493  5.791   -3.982  1.00 0.00 ? 215 PRO B HB2  10 
ATOM 8492  H HG2  . PRO B 2 18 ? -2.941  7.303   -4.893  1.00 0.00 ? 215 PRO B HG2  10 
ATOM 8493  H HD2  . PRO B 2 18 ? -4.828  7.729   -3.729  1.00 0.00 ? 215 PRO B HD2  10 
ATOM 8494  N N    . MET B 2 19 ? -1.808  6.752   -0.483  1.00 0.00 ? 216 MET B N    10 
ATOM 8495  C CA   . MET B 2 19 ? -1.021  7.752   0.224   1.00 0.00 ? 216 MET B CA   10 
ATOM 8496  C C    . MET B 2 19 ? 0.094   7.099   1.027   1.00 0.00 ? 216 MET B C    10 
ATOM 8497  O O    . MET B 2 19 ? -0.159  6.352   1.968   1.00 0.00 ? 216 MET B O    10 
ATOM 8498  C CB   . MET B 2 19 ? -1.917  8.625   1.121   1.00 0.00 ? 216 MET B CB   10 
ATOM 8499  C CG   . MET B 2 19 ? -2.466  7.933   2.369   1.00 0.00 ? 216 MET B CG   10 
ATOM 8500  S SD   . MET B 2 19 ? -3.619  6.594   1.998   1.00 0.00 ? 216 MET B SD   10 
ATOM 8501  C CE   . MET B 2 19 ? -4.992  7.498   1.288   1.00 0.00 ? 216 MET B CE   10 
ATOM 8502  H H    . MET B 2 19 ? -2.119  5.959   -0.001  1.00 0.00 ? 216 MET B H    10 
ATOM 8503  H HA   . MET B 2 19 ? -0.564  8.380   -0.524  1.00 0.00 ? 216 MET B HA   10 
ATOM 8504  H HB2  . MET B 2 19 ? -1.346  9.482   1.443   1.00 0.00 ? 216 MET B HB2  10 
ATOM 8505  H HG2  . MET B 2 19 ? -1.645  7.531   2.940   1.00 0.00 ? 216 MET B HG2  10 
ATOM 8506  H HE1  . MET B 2 19 ? -5.302  8.278   1.968   1.00 0.00 ? 216 MET B HE1  10 
ATOM 8507  H HE2  . MET B 2 19 ? -4.687  7.939   0.350   1.00 0.00 ? 216 MET B HE2  10 
ATOM 8508  H HE3  . MET B 2 19 ? -5.818  6.822   1.115   1.00 0.00 ? 216 MET B HE3  10 
ATOM 8509  N N    . ASP B 2 20 ? 1.333   7.375   0.631   1.00 0.00 ? 217 ASP B N    10 
ATOM 8510  C CA   . ASP B 2 20 ? 2.499   6.817   1.308   1.00 0.00 ? 217 ASP B CA   10 
ATOM 8511  C C    . ASP B 2 20 ? 2.413   7.040   2.814   1.00 0.00 ? 217 ASP B C    10 
ATOM 8512  O O    . ASP B 2 20 ? 2.079   8.171   3.226   1.00 0.00 ? 217 ASP B O    10 
ATOM 8513  C CB   . ASP B 2 20 ? 3.783   7.442   0.761   1.00 0.00 ? 217 ASP B CB   10 
ATOM 8514  C CG   . ASP B 2 20 ? 3.657   8.937   0.548   1.00 0.00 ? 217 ASP B CG   10 
ATOM 8515  O OD1  . ASP B 2 20 ? 2.656   9.521   1.016   1.00 0.00 ? 217 ASP B OD1  10 
ATOM 8516  O OD2  . ASP B 2 20 ? 4.559   9.524   -0.086  1.00 0.00 ? 217 ASP B OD2  10 
ATOM 8517  O OXT  . ASP B 2 20 ? 2.678   6.080   3.569   1.00 0.00 ? 217 ASP B OXT  10 
ATOM 8518  H H    . ASP B 2 20 ? 1.466   7.968   -0.138  1.00 0.00 ? 217 ASP B H    10 
ATOM 8519  H HA   . ASP B 2 20 ? 2.517   5.755   1.113   1.00 0.00 ? 217 ASP B HA   10 
ATOM 8520  H HB2  . ASP B 2 20 ? 4.587   7.264   1.459   1.00 0.00 ? 217 ASP B HB2  10 
ATOM 8521  N N    . GLY A 1 1  ? 10.531  -12.421 -8.775  1.00 0.00 ? 292 GLY A N    11 
ATOM 8522  C CA   . GLY A 1 1  ? 9.715   -13.239 -7.836  1.00 0.00 ? 292 GLY A CA   11 
ATOM 8523  C C    . GLY A 1 1  ? 8.240   -13.239 -8.194  1.00 0.00 ? 292 GLY A C    11 
ATOM 8524  O O    . GLY A 1 1  ? 7.783   -12.372 -8.940  1.00 0.00 ? 292 GLY A O    11 
ATOM 8525  H H1   . GLY A 1 1  ? 10.035  -12.321 -9.685  1.00 0.00 ? 292 GLY A H1   11 
ATOM 8526  H H2   . GLY A 1 1  ? 11.450  -12.878 -8.943  1.00 0.00 ? 292 GLY A H2   11 
ATOM 8527  H H3   . GLY A 1 1  ? 10.694  -11.474 -8.376  1.00 0.00 ? 292 GLY A H3   11 
ATOM 8528  H HA2  . GLY A 1 1  ? 10.079  -14.256 -7.853  1.00 0.00 ? 292 GLY A HA2  11 
ATOM 8529  H HA3  . GLY A 1 1  ? 9.832   -12.844 -6.838  1.00 0.00 ? 292 GLY A HA3  11 
ATOM 8530  N N    . PRO A 1 2  ? 7.467   -14.208 -7.674  1.00 0.00 ? 293 PRO A N    11 
ATOM 8531  C CA   . PRO A 1 2  ? 6.029   -14.306 -7.950  1.00 0.00 ? 293 PRO A CA   11 
ATOM 8532  C C    . PRO A 1 2  ? 5.254   -13.115 -7.401  1.00 0.00 ? 293 PRO A C    11 
ATOM 8533  O O    . PRO A 1 2  ? 5.842   -12.159 -6.894  1.00 0.00 ? 293 PRO A O    11 
ATOM 8534  C CB   . PRO A 1 2  ? 5.609   -15.594 -7.232  1.00 0.00 ? 293 PRO A CB   11 
ATOM 8535  C CG   . PRO A 1 2  ? 6.657   -15.817 -6.197  1.00 0.00 ? 293 PRO A CG   11 
ATOM 8536  C CD   . PRO A 1 2  ? 7.933   -15.281 -6.781  1.00 0.00 ? 293 PRO A CD   11 
ATOM 8537  H HA   . PRO A 1 2  ? 5.837   -14.402 -9.009  1.00 0.00 ? 293 PRO A HA   11 
ATOM 8538  H HB2  . PRO A 1 2  ? 4.636   -15.457 -6.785  1.00 0.00 ? 293 PRO A HB2  11 
ATOM 8539  H HG2  . PRO A 1 2  ? 6.403   -15.279 -5.294  1.00 0.00 ? 293 PRO A HG2  11 
ATOM 8540  H HD2  . PRO A 1 2  ? 8.570   -14.887 -6.001  1.00 0.00 ? 293 PRO A HD2  11 
ATOM 8541  N N    . LEU A 1 3  ? 3.929   -13.175 -7.505  1.00 0.00 ? 294 LEU A N    11 
ATOM 8542  C CA   . LEU A 1 3  ? 3.075   -12.098 -7.017  1.00 0.00 ? 294 LEU A CA   11 
ATOM 8543  C C    . LEU A 1 3  ? 1.669   -12.608 -6.717  1.00 0.00 ? 294 LEU A C    11 
ATOM 8544  O O    . LEU A 1 3  ? 1.208   -12.553 -5.576  1.00 0.00 ? 294 LEU A O    11 
ATOM 8545  C CB   . LEU A 1 3  ? 3.012   -10.965 -8.044  1.00 0.00 ? 294 LEU A CB   11 
ATOM 8546  C CG   . LEU A 1 3  ? 2.029   -9.843  -7.710  1.00 0.00 ? 294 LEU A CG   11 
ATOM 8547  C CD1  . LEU A 1 3  ? 2.489   -9.078  -6.478  1.00 0.00 ? 294 LEU A CD1  11 
ATOM 8548  C CD2  . LEU A 1 3  ? 1.871   -8.902  -8.896  1.00 0.00 ? 294 LEU A CD2  11 
ATOM 8549  H H    . LEU A 1 3  ? 3.517   -13.964 -7.917  1.00 0.00 ? 294 LEU A H    11 
ATOM 8550  H HA   . LEU A 1 3  ? 3.509   -11.720 -6.104  1.00 0.00 ? 294 LEU A HA   11 
ATOM 8551  H HB2  . LEU A 1 3  ? 4.000   -10.537 -8.137  1.00 0.00 ? 294 LEU A HB2  11 
ATOM 8552  H HG   . LEU A 1 3  ? 1.062   -10.273 -7.493  1.00 0.00 ? 294 LEU A HG   11 
ATOM 8553  H HD11 . LEU A 1 3  ? 2.988   -8.171  -6.782  1.00 0.00 ? 294 LEU A HD11 11 
ATOM 8554  H HD12 . LEU A 1 3  ? 1.633   -8.832  -5.867  1.00 0.00 ? 294 LEU A HD12 11 
ATOM 8555  H HD13 . LEU A 1 3  ? 3.173   -9.692  -5.909  1.00 0.00 ? 294 LEU A HD13 11 
ATOM 8556  H HD21 . LEU A 1 3  ? 1.839   -7.882  -8.546  1.00 0.00 ? 294 LEU A HD21 11 
ATOM 8557  H HD22 . LEU A 1 3  ? 2.710   -9.026  -9.567  1.00 0.00 ? 294 LEU A HD22 11 
ATOM 8558  H HD23 . LEU A 1 3  ? 0.955   -9.133  -9.419  1.00 0.00 ? 294 LEU A HD23 11 
ATOM 8559  N N    . GLY A 1 4  ? 0.990   -13.104 -7.747  1.00 0.00 ? 295 GLY A N    11 
ATOM 8560  C CA   . GLY A 1 4  ? -0.358  -13.615 -7.570  1.00 0.00 ? 295 GLY A CA   11 
ATOM 8561  C C    . GLY A 1 4  ? -0.902  -14.271 -8.824  1.00 0.00 ? 295 GLY A C    11 
ATOM 8562  O O    . GLY A 1 4  ? -0.234  -15.103 -9.437  1.00 0.00 ? 295 GLY A O    11 
ATOM 8563  H H    . GLY A 1 4  ? 1.409   -13.125 -8.634  1.00 0.00 ? 295 GLY A H    11 
ATOM 8564  H HA2  . GLY A 1 4  ? -0.353  -14.342 -6.771  1.00 0.00 ? 295 GLY A HA2  11 
ATOM 8565  H HA3  . GLY A 1 4  ? -1.008  -12.798 -7.294  1.00 0.00 ? 295 GLY A HA3  11 
ATOM 8566  N N    . SER A 1 5  ? -2.118  -13.895 -9.206  1.00 0.00 ? 296 SER A N    11 
ATOM 8567  C CA   . SER A 1 5  ? -2.752  -14.456 -10.395 1.00 0.00 ? 296 SER A CA   11 
ATOM 8568  C C    . SER A 1 5  ? -3.870  -13.548 -10.899 1.00 0.00 ? 296 SER A C    11 
ATOM 8569  O O    . SER A 1 5  ? -4.988  -14.002 -11.143 1.00 0.00 ? 296 SER A O    11 
ATOM 8570  C CB   . SER A 1 5  ? -3.310  -15.848 -10.093 1.00 0.00 ? 296 SER A CB   11 
ATOM 8571  O OG   . SER A 1 5  ? -2.607  -16.460 -9.027  1.00 0.00 ? 296 SER A OG   11 
ATOM 8572  H H    . SER A 1 5  ? -2.601  -13.226 -8.678  1.00 0.00 ? 296 SER A H    11 
ATOM 8573  H HA   . SER A 1 5  ? -1.998  -14.539 -11.164 1.00 0.00 ? 296 SER A HA   11 
ATOM 8574  H HB2  . SER A 1 5  ? -4.352  -15.763 -9.819  1.00 0.00 ? 296 SER A HB2  11 
ATOM 8575  H HG   . SER A 1 5  ? -3.220  -16.962 -8.485  1.00 0.00 ? 296 SER A HG   11 
ATOM 8576  N N    . GLY A 1 6  ? -3.562  -12.264 -11.054 1.00 0.00 ? 297 GLY A N    11 
ATOM 8577  C CA   . GLY A 1 6  ? -4.553  -11.319 -11.531 1.00 0.00 ? 297 GLY A CA   11 
ATOM 8578  C C    . GLY A 1 6  ? -5.047  -10.386 -10.440 1.00 0.00 ? 297 GLY A C    11 
ATOM 8579  O O    . GLY A 1 6  ? -4.292  -10.034 -9.534  1.00 0.00 ? 297 GLY A O    11 
ATOM 8580  H H    . GLY A 1 6  ? -2.655  -11.958 -10.844 1.00 0.00 ? 297 GLY A H    11 
ATOM 8581  H HA2  . GLY A 1 6  ? -4.118  -10.728 -12.323 1.00 0.00 ? 297 GLY A HA2  11 
ATOM 8582  H HA3  . GLY A 1 6  ? -5.395  -11.867 -11.927 1.00 0.00 ? 297 GLY A HA3  11 
ATOM 8583  N N    . PRO A 1 7  ? -6.324  -9.969  -10.502 1.00 0.00 ? 298 PRO A N    11 
ATOM 8584  C CA   . PRO A 1 7  ? -6.912  -9.064  -9.508  1.00 0.00 ? 298 PRO A CA   11 
ATOM 8585  C C    . PRO A 1 7  ? -7.058  -9.717  -8.138  1.00 0.00 ? 298 PRO A C    11 
ATOM 8586  O O    . PRO A 1 7  ? -6.918  -10.932 -7.998  1.00 0.00 ? 298 PRO A O    11 
ATOM 8587  C CB   . PRO A 1 7  ? -8.286  -8.732  -10.092 1.00 0.00 ? 298 PRO A CB   11 
ATOM 8588  C CG   . PRO A 1 7  ? -8.608  -9.878  -10.988 1.00 0.00 ? 298 PRO A CG   11 
ATOM 8589  C CD   . PRO A 1 7  ? -7.293  -10.347 -11.546 1.00 0.00 ? 298 PRO A CD   11 
ATOM 8590  H HA   . PRO A 1 7  ? -6.332  -8.158  -9.410  1.00 0.00 ? 298 PRO A HA   11 
ATOM 8591  H HB2  . PRO A 1 7  ? -9.008  -8.640  -9.293  1.00 0.00 ? 298 PRO A HB2  11 
ATOM 8592  H HG2  . PRO A 1 7  ? -9.077  -10.667 -10.420 1.00 0.00 ? 298 PRO A HG2  11 
ATOM 8593  H HD2  . PRO A 1 7  ? -7.305  -11.417 -11.692 1.00 0.00 ? 298 PRO A HD2  11 
ATOM 8594  N N    . LEU A 1 8  ? -7.344  -8.899  -7.131  1.00 0.00 ? 299 LEU A N    11 
ATOM 8595  C CA   . LEU A 1 8  ? -7.509  -9.386  -5.766  1.00 0.00 ? 299 LEU A CA   11 
ATOM 8596  C C    . LEU A 1 8  ? -8.978  -9.669  -5.462  1.00 0.00 ? 299 LEU A C    11 
ATOM 8597  O O    . LEU A 1 8  ? -9.862  -9.282  -6.227  1.00 0.00 ? 299 LEU A O    11 
ATOM 8598  C CB   . LEU A 1 8  ? -6.954  -8.359  -4.778  1.00 0.00 ? 299 LEU A CB   11 
ATOM 8599  C CG   . LEU A 1 8  ? -5.592  -7.780  -5.156  1.00 0.00 ? 299 LEU A CG   11 
ATOM 8600  C CD1  . LEU A 1 8  ? -5.430  -6.376  -4.593  1.00 0.00 ? 299 LEU A CD1  11 
ATOM 8601  C CD2  . LEU A 1 8  ? -4.477  -8.689  -4.661  1.00 0.00 ? 299 LEU A CD2  11 
ATOM 8602  H H    . LEU A 1 8  ? -7.448  -7.941  -7.309  1.00 0.00 ? 299 LEU A H    11 
ATOM 8603  H HA   . LEU A 1 8  ? -6.950  -10.305 -5.670  1.00 0.00 ? 299 LEU A HA   11 
ATOM 8604  H HB2  . LEU A 1 8  ? -7.661  -7.546  -4.699  1.00 0.00 ? 299 LEU A HB2  11 
ATOM 8605  H HG   . LEU A 1 8  ? -5.520  -7.716  -6.232  1.00 0.00 ? 299 LEU A HG   11 
ATOM 8606  H HD11 . LEU A 1 8  ? -5.989  -5.679  -5.199  1.00 0.00 ? 299 LEU A HD11 11 
ATOM 8607  H HD12 . LEU A 1 8  ? -5.801  -6.349  -3.579  1.00 0.00 ? 299 LEU A HD12 11 
ATOM 8608  H HD13 . LEU A 1 8  ? -4.385  -6.102  -4.601  1.00 0.00 ? 299 LEU A HD13 11 
ATOM 8609  H HD21 . LEU A 1 8  ? -4.049  -8.278  -3.759  1.00 0.00 ? 299 LEU A HD21 11 
ATOM 8610  H HD22 . LEU A 1 8  ? -4.879  -9.670  -4.453  1.00 0.00 ? 299 LEU A HD22 11 
ATOM 8611  H HD23 . LEU A 1 8  ? -3.714  -8.768  -5.421  1.00 0.00 ? 299 LEU A HD23 11 
ATOM 8612  N N    . PRO A 1 9  ? -9.262  -10.350 -4.337  1.00 0.00 ? 300 PRO A N    11 
ATOM 8613  C CA   . PRO A 1 9  ? -10.634 -10.681 -3.941  1.00 0.00 ? 300 PRO A CA   11 
ATOM 8614  C C    . PRO A 1 9  ? -11.522 -9.441  -3.879  1.00 0.00 ? 300 PRO A C    11 
ATOM 8615  O O    . PRO A 1 9  ? -11.083 -8.340  -4.214  1.00 0.00 ? 300 PRO A O    11 
ATOM 8616  C CB   . PRO A 1 9  ? -10.469 -11.302 -2.550  1.00 0.00 ? 300 PRO A CB   11 
ATOM 8617  C CG   . PRO A 1 9  ? -9.067  -11.805 -2.524  1.00 0.00 ? 300 PRO A CG   11 
ATOM 8618  C CD   . PRO A 1 9  ? -8.272  -10.842 -3.360  1.00 0.00 ? 300 PRO A CD   11 
ATOM 8619  H HA   . PRO A 1 9  ? -11.075 -11.403 -4.613  1.00 0.00 ? 300 PRO A HA   11 
ATOM 8620  H HB2  . PRO A 1 9  ? -10.635 -10.549 -1.794  1.00 0.00 ? 300 PRO A HB2  11 
ATOM 8621  H HG2  . PRO A 1 9  ? -8.698  -11.814 -1.509  1.00 0.00 ? 300 PRO A HG2  11 
ATOM 8622  H HD2  . PRO A 1 9  ? -7.899  -10.036 -2.747  1.00 0.00 ? 300 PRO A HD2  11 
ATOM 8623  N N    . PRO A 1 10 ? -12.784 -9.600  -3.449  1.00 0.00 ? 301 PRO A N    11 
ATOM 8624  C CA   . PRO A 1 10 ? -13.727 -8.487  -3.356  1.00 0.00 ? 301 PRO A CA   11 
ATOM 8625  C C    . PRO A 1 10 ? -13.527 -7.652  -2.096  1.00 0.00 ? 301 PRO A C    11 
ATOM 8626  O O    . PRO A 1 10 ? -14.441 -7.503  -1.285  1.00 0.00 ? 301 PRO A O    11 
ATOM 8627  C CB   . PRO A 1 10 ? -15.082 -9.187  -3.331  1.00 0.00 ? 301 PRO A CB   11 
ATOM 8628  C CG   . PRO A 1 10 ? -14.816 -10.505 -2.683  1.00 0.00 ? 301 PRO A CG   11 
ATOM 8629  C CD   . PRO A 1 10 ? -13.393 -10.874 -3.022  1.00 0.00 ? 301 PRO A CD   11 
ATOM 8630  H HA   . PRO A 1 10 ? -13.665 -7.847  -4.221  1.00 0.00 ? 301 PRO A HA   11 
ATOM 8631  H HB2  . PRO A 1 10 ? -15.784 -8.599  -2.757  1.00 0.00 ? 301 PRO A HB2  11 
ATOM 8632  H HG2  . PRO A 1 10 ? -14.935 -10.417 -1.614  1.00 0.00 ? 301 PRO A HG2  11 
ATOM 8633  H HD2  . PRO A 1 10 ? -12.891 -11.264 -2.148  1.00 0.00 ? 301 PRO A HD2  11 
ATOM 8634  N N    . GLY A 1 11 ? -12.325 -7.108  -1.940  1.00 0.00 ? 302 GLY A N    11 
ATOM 8635  C CA   . GLY A 1 11 ? -12.026 -6.290  -0.781  1.00 0.00 ? 302 GLY A CA   11 
ATOM 8636  C C    . GLY A 1 11 ? -10.648 -5.662  -0.849  1.00 0.00 ? 302 GLY A C    11 
ATOM 8637  O O    . GLY A 1 11 ? -10.448 -4.536  -0.390  1.00 0.00 ? 302 GLY A O    11 
ATOM 8638  H H    . GLY A 1 11 ? -11.635 -7.267  -2.616  1.00 0.00 ? 302 GLY A H    11 
ATOM 8639  H HA2  . GLY A 1 11 ? -12.764 -5.505  -0.708  1.00 0.00 ? 302 GLY A HA2  11 
ATOM 8640  H HA3  . GLY A 1 11 ? -12.083 -6.905  0.105   1.00 0.00 ? 302 GLY A HA3  11 
ATOM 8641  N N    . TRP A 1 12 ? -9.696  -6.387  -1.427  1.00 0.00 ? 303 TRP A N    11 
ATOM 8642  C CA   . TRP A 1 12 ? -8.329  -5.899  -1.549  1.00 0.00 ? 303 TRP A CA   11 
ATOM 8643  C C    . TRP A 1 12 ? -8.116  -5.137  -2.849  1.00 0.00 ? 303 TRP A C    11 
ATOM 8644  O O    . TRP A 1 12 ? -8.805  -5.368  -3.842  1.00 0.00 ? 303 TRP A O    11 
ATOM 8645  C CB   . TRP A 1 12 ? -7.346  -7.065  -1.478  1.00 0.00 ? 303 TRP A CB   11 
ATOM 8646  C CG   . TRP A 1 12 ? -7.436  -7.827  -0.200  1.00 0.00 ? 303 TRP A CG   11 
ATOM 8647  C CD1  . TRP A 1 12 ? -8.290  -8.849  0.085   1.00 0.00 ? 303 TRP A CD1  11 
ATOM 8648  C CD2  . TRP A 1 12 ? -6.644  -7.621  0.972   1.00 0.00 ? 303 TRP A CD2  11 
ATOM 8649  N NE1  . TRP A 1 12 ? -8.083  -9.290  1.369   1.00 0.00 ? 303 TRP A NE1  11 
ATOM 8650  C CE2  . TRP A 1 12 ? -7.073  -8.552  1.934   1.00 0.00 ? 303 TRP A CE2  11 
ATOM 8651  C CE3  . TRP A 1 12 ? -5.613  -6.738  1.297   1.00 0.00 ? 303 TRP A CE3  11 
ATOM 8652  C CZ2  . TRP A 1 12 ? -6.504  -8.625  3.203   1.00 0.00 ? 303 TRP A CZ2  11 
ATOM 8653  C CZ3  . TRP A 1 12 ? -5.049  -6.809  2.556   1.00 0.00 ? 303 TRP A CZ3  11 
ATOM 8654  C CH2  . TRP A 1 12 ? -5.495  -7.747  3.495   1.00 0.00 ? 303 TRP A CH2  11 
ATOM 8655  H H    . TRP A 1 12 ? -9.916  -7.276  -1.774  1.00 0.00 ? 303 TRP A H    11 
ATOM 8656  H HA   . TRP A 1 12 ? -8.140  -5.233  -0.721  1.00 0.00 ? 303 TRP A HA   11 
ATOM 8657  H HB2  . TRP A 1 12 ? -7.546  -7.748  -2.290  1.00 0.00 ? 303 TRP A HB2  11 
ATOM 8658  H HD1  . TRP A 1 12 ? -9.019  -9.238  -0.610  1.00 0.00 ? 303 TRP A HD1  11 
ATOM 8659  H HE1  . TRP A 1 12 ? -8.574  -10.014 1.805   1.00 0.00 ? 303 TRP A HE1  11 
ATOM 8660  H HE3  . TRP A 1 12 ? -5.255  -6.009  0.583   1.00 0.00 ? 303 TRP A HE3  11 
ATOM 8661  H HZ2  . TRP A 1 12 ? -6.837  -9.342  3.939   1.00 0.00 ? 303 TRP A HZ2  11 
ATOM 8662  H HZ3  . TRP A 1 12 ? -4.251  -6.133  2.825   1.00 0.00 ? 303 TRP A HZ3  11 
ATOM 8663  H HH2  . TRP A 1 12 ? -5.024  -7.766  4.465   1.00 0.00 ? 303 TRP A HH2  11 
ATOM 8664  N N    . GLU A 1 13 ? -7.151  -4.228  -2.826  1.00 0.00 ? 304 GLU A N    11 
ATOM 8665  C CA   . GLU A 1 13 ? -6.813  -3.434  -3.996  1.00 0.00 ? 304 GLU A CA   11 
ATOM 8666  C C    . GLU A 1 13 ? -5.323  -3.143  -4.019  1.00 0.00 ? 304 GLU A C    11 
ATOM 8667  O O    . GLU A 1 13 ? -4.714  -2.887  -2.981  1.00 0.00 ? 304 GLU A O    11 
ATOM 8668  C CB   . GLU A 1 13 ? -7.586  -2.118  -4.012  1.00 0.00 ? 304 GLU A CB   11 
ATOM 8669  C CG   . GLU A 1 13 ? -7.247  -1.242  -5.209  1.00 0.00 ? 304 GLU A CG   11 
ATOM 8670  C CD   . GLU A 1 13 ? -7.442  0.235   -4.928  1.00 0.00 ? 304 GLU A CD   11 
ATOM 8671  O OE1  . GLU A 1 13 ? -8.254  0.568   -4.039  1.00 0.00 ? 304 GLU A OE1  11 
ATOM 8672  O OE2  . GLU A 1 13 ? -6.783  1.058   -5.598  1.00 0.00 ? 304 GLU A OE2  11 
ATOM 8673  H H    . GLU A 1 13 ? -6.650  -4.088  -1.995  1.00 0.00 ? 304 GLU A H    11 
ATOM 8674  H HA   . GLU A 1 13 ? -7.072  -4.007  -4.873  1.00 0.00 ? 304 GLU A HA   11 
ATOM 8675  H HB2  . GLU A 1 13 ? -8.644  -2.331  -4.034  1.00 0.00 ? 304 GLU A HB2  11 
ATOM 8676  H HG2  . GLU A 1 13 ? -6.213  -1.409  -5.478  1.00 0.00 ? 304 GLU A HG2  11 
ATOM 8677  N N    . ILE A 1 14 ? -4.740  -3.180  -5.205  1.00 0.00 ? 305 ILE A N    11 
ATOM 8678  C CA   . ILE A 1 14 ? -3.321  -2.915  -5.351  1.00 0.00 ? 305 ILE A CA   11 
ATOM 8679  C C    . ILE A 1 14 ? -3.059  -1.421  -5.497  1.00 0.00 ? 305 ILE A C    11 
ATOM 8680  O O    . ILE A 1 14 ? -3.743  -0.723  -6.245  1.00 0.00 ? 305 ILE A O    11 
ATOM 8681  C CB   . ILE A 1 14 ? -2.728  -3.654  -6.564  1.00 0.00 ? 305 ILE A CB   11 
ATOM 8682  C CG1  . ILE A 1 14 ? -2.932  -5.165  -6.411  1.00 0.00 ? 305 ILE A CG1  11 
ATOM 8683  C CG2  . ILE A 1 14 ? -1.250  -3.320  -6.713  1.00 0.00 ? 305 ILE A CG2  11 
ATOM 8684  C CD1  . ILE A 1 14 ? -2.118  -5.989  -7.385  1.00 0.00 ? 305 ILE A CD1  11 
ATOM 8685  H H    . ILE A 1 14 ? -5.274  -3.393  -6.000  1.00 0.00 ? 305 ILE A H    11 
ATOM 8686  H HA   . ILE A 1 14 ? -2.822  -3.272  -4.457  1.00 0.00 ? 305 ILE A HA   11 
ATOM 8687  H HB   . ILE A 1 14 ? -3.239  -3.316  -7.451  1.00 0.00 ? 305 ILE A HB   11 
ATOM 8688  H HG12 . ILE A 1 14 ? -2.649  -5.460  -5.412  1.00 0.00 ? 305 ILE A HG12 11 
ATOM 8689  H HG21 . ILE A 1 14 ? -0.858  -3.805  -7.594  1.00 0.00 ? 305 ILE A HG21 11 
ATOM 8690  H HG22 . ILE A 1 14 ? -1.132  -2.250  -6.806  1.00 0.00 ? 305 ILE A HG22 11 
ATOM 8691  H HG23 . ILE A 1 14 ? -0.718  -3.669  -5.843  1.00 0.00 ? 305 ILE A HG23 11 
ATOM 8692  H HD11 . ILE A 1 14 ? -1.083  -5.670  -7.347  1.00 0.00 ? 305 ILE A HD11 11 
ATOM 8693  H HD12 . ILE A 1 14 ? -2.185  -7.033  -7.117  1.00 0.00 ? 305 ILE A HD12 11 
ATOM 8694  H HD13 . ILE A 1 14 ? -2.501  -5.847  -8.384  1.00 0.00 ? 305 ILE A HD13 11 
ATOM 8695  N N    . ARG A 1 15 ? -2.058  -0.947  -4.772  1.00 0.00 ? 306 ARG A N    11 
ATOM 8696  C CA   . ARG A 1 15 ? -1.672  0.454   -4.802  1.00 0.00 ? 306 ARG A CA   11 
ATOM 8697  C C    . ARG A 1 15 ? -0.161  0.568   -4.672  1.00 0.00 ? 306 ARG A C    11 
ATOM 8698  O O    . ARG A 1 15 ? 0.524   -0.442  -4.539  1.00 0.00 ? 306 ARG A O    11 
ATOM 8699  C CB   . ARG A 1 15 ? -2.359  1.215   -3.668  1.00 0.00 ? 306 ARG A CB   11 
ATOM 8700  C CG   . ARG A 1 15 ? -3.685  1.844   -4.069  1.00 0.00 ? 306 ARG A CG   11 
ATOM 8701  C CD   . ARG A 1 15 ? -4.422  2.403   -2.863  1.00 0.00 ? 306 ARG A CD   11 
ATOM 8702  N NE   . ARG A 1 15 ? -5.870  2.389   -3.052  1.00 0.00 ? 306 ARG A NE   11 
ATOM 8703  C CZ   . ARG A 1 15 ? -6.515  3.210   -3.876  1.00 0.00 ? 306 ARG A CZ   11 
ATOM 8704  N NH1  . ARG A 1 15 ? -5.839  4.100   -4.590  1.00 0.00 ? 306 ARG A NH1  11 
ATOM 8705  N NH2  . ARG A 1 15 ? -7.833  3.138   -3.988  1.00 0.00 ? 306 ARG A NH2  11 
ATOM 8706  H H    . ARG A 1 15 ? -1.560  -1.562  -4.193  1.00 0.00 ? 306 ARG A H    11 
ATOM 8707  H HA   . ARG A 1 15 ? -1.980  0.869   -5.751  1.00 0.00 ? 306 ARG A HA   11 
ATOM 8708  H HB2  . ARG A 1 15 ? -2.544  0.532   -2.854  1.00 0.00 ? 306 ARG A HB2  11 
ATOM 8709  H HG2  . ARG A 1 15 ? -3.495  2.648   -4.766  1.00 0.00 ? 306 ARG A HG2  11 
ATOM 8710  H HD2  . ARG A 1 15 ? -4.176  1.805   -1.998  1.00 0.00 ? 306 ARG A HD2  11 
ATOM 8711  H HE   . ARG A 1 15 ? -6.389  1.737   -2.536  1.00 0.00 ? 306 ARG A HE   11 
ATOM 8712  H HH11 . ARG A 1 15 ? -4.844  4.156   -4.509  1.00 0.00 ? 306 ARG A HH11 11 
ATOM 8713  H HH12 . ARG A 1 15 ? -6.326  4.717   -5.208  1.00 0.00 ? 306 ARG A HH12 11 
ATOM 8714  H HH21 . ARG A 1 15 ? -8.344  2.467   -3.452  1.00 0.00 ? 306 ARG A HH21 11 
ATOM 8715  H HH22 . ARG A 1 15 ? -8.316  3.756   -4.610  1.00 0.00 ? 306 ARG A HH22 11 
ATOM 8716  N N    . ASN A 1 16 ? 0.360   1.787   -4.720  1.00 0.00 ? 307 ASN A N    11 
ATOM 8717  C CA   . ASN A 1 16 ? 1.798   1.993   -4.591  1.00 0.00 ? 307 ASN A CA   11 
ATOM 8718  C C    . ASN A 1 16 ? 2.093   3.171   -3.674  1.00 0.00 ? 307 ASN A C    11 
ATOM 8719  O O    . ASN A 1 16 ? 1.468   4.226   -3.776  1.00 0.00 ? 307 ASN A O    11 
ATOM 8720  C CB   . ASN A 1 16 ? 2.442   2.210   -5.960  1.00 0.00 ? 307 ASN A CB   11 
ATOM 8721  C CG   . ASN A 1 16 ? 1.839   1.318   -7.028  1.00 0.00 ? 307 ASN A CG   11 
ATOM 8722  O OD1  . ASN A 1 16 ? 0.772   1.609   -7.568  1.00 0.00 ? 307 ASN A OD1  11 
ATOM 8723  N ND2  . ASN A 1 16 ? 2.523   0.222   -7.337  1.00 0.00 ? 307 ASN A ND2  11 
ATOM 8724  H H    . ASN A 1 16 ? -0.229  2.559   -4.847  1.00 0.00 ? 307 ASN A H    11 
ATOM 8725  H HA   . ASN A 1 16 ? 2.216   1.102   -4.147  1.00 0.00 ? 307 ASN A HA   11 
ATOM 8726  H HB2  . ASN A 1 16 ? 2.309   3.239   -6.258  1.00 0.00 ? 307 ASN A HB2  11 
ATOM 8727  H HD21 . ASN A 1 16 ? 3.366   0.055   -6.866  1.00 0.00 ? 307 ASN A HD21 11 
ATOM 8728  H HD22 . ASN A 1 16 ? 2.157   -0.374  -8.022  1.00 0.00 ? 307 ASN A HD22 11 
ATOM 8729  N N    . THR A 1 17 ? 3.052   2.981   -2.777  1.00 0.00 ? 308 THR A N    11 
ATOM 8730  C CA   . THR A 1 17 ? 3.431   4.020   -1.830  1.00 0.00 ? 308 THR A CA   11 
ATOM 8731  C C    . THR A 1 17 ? 3.777   5.321   -2.541  1.00 0.00 ? 308 THR A C    11 
ATOM 8732  O O    . THR A 1 17 ? 3.093   6.330   -2.375  1.00 0.00 ? 308 THR A O    11 
ATOM 8733  C CB   . THR A 1 17 ? 4.624   3.576   -0.965  1.00 0.00 ? 308 THR A CB   11 
ATOM 8734  O OG1  . THR A 1 17 ? 5.706   3.146   -1.799  1.00 0.00 ? 308 THR A OG1  11 
ATOM 8735  C CG2  . THR A 1 17 ? 4.212   2.447   -0.032  1.00 0.00 ? 308 THR A CG2  11 
ATOM 8736  H H    . THR A 1 17 ? 3.520   2.120   -2.754  1.00 0.00 ? 308 THR A H    11 
ATOM 8737  H HA   . THR A 1 17 ? 2.588   4.195   -1.177  1.00 0.00 ? 308 THR A HA   11 
ATOM 8738  H HB   . THR A 1 17 ? 4.950   4.415   -0.367  1.00 0.00 ? 308 THR A HB   11 
ATOM 8739  H HG1  . THR A 1 17 ? 5.539   2.251   -2.105  1.00 0.00 ? 308 THR A HG1  11 
ATOM 8740  H HG21 . THR A 1 17 ? 3.133   2.415   0.032   1.00 0.00 ? 308 THR A HG21 11 
ATOM 8741  H HG22 . THR A 1 17 ? 4.628   2.618   0.950   1.00 0.00 ? 308 THR A HG22 11 
ATOM 8742  H HG23 . THR A 1 17 ? 4.577   1.506   -0.416  1.00 0.00 ? 308 THR A HG23 11 
ATOM 8743  N N    . ALA A 1 18 ? 4.841   5.294   -3.336  1.00 0.00 ? 309 ALA A N    11 
ATOM 8744  C CA   . ALA A 1 18 ? 5.275   6.476   -4.072  1.00 0.00 ? 309 ALA A CA   11 
ATOM 8745  C C    . ALA A 1 18 ? 6.597   6.220   -4.783  1.00 0.00 ? 309 ALA A C    11 
ATOM 8746  O O    . ALA A 1 18 ? 6.688   6.326   -6.007  1.00 0.00 ? 309 ALA A O    11 
ATOM 8747  C CB   . ALA A 1 18 ? 5.399   7.667   -3.133  1.00 0.00 ? 309 ALA A CB   11 
ATOM 8748  H H    . ALA A 1 18 ? 5.346   4.460   -3.431  1.00 0.00 ? 309 ALA A H    11 
ATOM 8749  H HA   . ALA A 1 18 ? 4.520   6.706   -4.810  1.00 0.00 ? 309 ALA A HA   11 
ATOM 8750  H HB1  . ALA A 1 18 ? 5.760   7.331   -2.172  1.00 0.00 ? 309 ALA A HB1  11 
ATOM 8751  H HB2  . ALA A 1 18 ? 6.093   8.383   -3.548  1.00 0.00 ? 309 ALA A HB2  11 
ATOM 8752  H HB3  . ALA A 1 18 ? 4.432   8.132   -3.011  1.00 0.00 ? 309 ALA A HB3  11 
ATOM 8753  N N    . THR A 1 19 ? 7.623   5.885   -4.008  1.00 0.00 ? 310 THR A N    11 
ATOM 8754  C CA   . THR A 1 19 ? 8.939   5.609   -4.567  1.00 0.00 ? 310 THR A CA   11 
ATOM 8755  C C    . THR A 1 19 ? 8.881   4.421   -5.519  1.00 0.00 ? 310 THR A C    11 
ATOM 8756  O O    . THR A 1 19 ? 9.661   4.332   -6.467  1.00 0.00 ? 310 THR A O    11 
ATOM 8757  C CB   . THR A 1 19 ? 9.972   5.322   -3.461  1.00 0.00 ? 310 THR A CB   11 
ATOM 8758  O OG1  . THR A 1 19 ? 9.384   5.538   -2.172  1.00 0.00 ? 310 THR A OG1  11 
ATOM 8759  C CG2  . THR A 1 19 ? 11.195  6.213   -3.620  1.00 0.00 ? 310 THR A CG2  11 
ATOM 8760  H H    . THR A 1 19 ? 7.491   5.822   -3.039  1.00 0.00 ? 310 THR A H    11 
ATOM 8761  H HA   . THR A 1 19 ? 9.260   6.483   -5.114  1.00 0.00 ? 310 THR A HA   11 
ATOM 8762  H HB   . THR A 1 19 ? 10.285  4.291   -3.537  1.00 0.00 ? 310 THR A HB   11 
ATOM 8763  H HG1  . THR A 1 19 ? 10.078  5.653   -1.519  1.00 0.00 ? 310 THR A HG1  11 
ATOM 8764  H HG21 . THR A 1 19 ? 11.552  6.511   -2.647  1.00 0.00 ? 310 THR A HG21 11 
ATOM 8765  H HG22 . THR A 1 19 ? 10.928  7.091   -4.190  1.00 0.00 ? 310 THR A HG22 11 
ATOM 8766  H HG23 . THR A 1 19 ? 11.970  5.670   -4.139  1.00 0.00 ? 310 THR A HG23 11 
ATOM 8767  N N    . GLY A 1 20 ? 7.950   3.510   -5.256  1.00 0.00 ? 311 GLY A N    11 
ATOM 8768  C CA   . GLY A 1 20 ? 7.796   2.341   -6.101  1.00 0.00 ? 311 GLY A CA   11 
ATOM 8769  C C    . GLY A 1 20 ? 7.662   1.056   -5.307  1.00 0.00 ? 311 GLY A C    11 
ATOM 8770  O O    . GLY A 1 20 ? 8.339   0.067   -5.595  1.00 0.00 ? 311 GLY A O    11 
ATOM 8771  H H    . GLY A 1 20 ? 7.362   3.635   -4.483  1.00 0.00 ? 311 GLY A H    11 
ATOM 8772  H HA2  . GLY A 1 20 ? 6.911   2.466   -6.707  1.00 0.00 ? 311 GLY A HA2  11 
ATOM 8773  H HA3  . GLY A 1 20 ? 8.655   2.263   -6.749  1.00 0.00 ? 311 GLY A HA3  11 
ATOM 8774  N N    . ARG A 1 21 ? 6.789   1.068   -4.307  1.00 0.00 ? 312 ARG A N    11 
ATOM 8775  C CA   . ARG A 1 21 ? 6.562   -0.110  -3.477  1.00 0.00 ? 312 ARG A CA   11 
ATOM 8776  C C    . ARG A 1 21 ? 5.083   -0.405  -3.373  1.00 0.00 ? 312 ARG A C    11 
ATOM 8777  O O    . ARG A 1 21 ? 4.378   0.124   -2.514  1.00 0.00 ? 312 ARG A O    11 
ATOM 8778  C CB   . ARG A 1 21 ? 7.169   0.075   -2.088  1.00 0.00 ? 312 ARG A CB   11 
ATOM 8779  C CG   . ARG A 1 21 ? 8.433   -0.738  -1.865  1.00 0.00 ? 312 ARG A CG   11 
ATOM 8780  C CD   . ARG A 1 21 ? 8.990   -0.535  -0.465  1.00 0.00 ? 312 ARG A CD   11 
ATOM 8781  N NE   . ARG A 1 21 ? 10.282  -1.192  -0.289  1.00 0.00 ? 312 ARG A NE   11 
ATOM 8782  C CZ   . ARG A 1 21 ? 10.886  -1.322  0.886   1.00 0.00 ? 312 ARG A CZ   11 
ATOM 8783  N NH1  . ARG A 1 21 ? 10.319  -0.841  1.983   1.00 0.00 ? 312 ARG A NH1  11 
ATOM 8784  N NH2  . ARG A 1 21 ? 12.060  -1.935  0.965   1.00 0.00 ? 312 ARG A NH2  11 
ATOM 8785  H H    . ARG A 1 21 ? 6.283   1.886   -4.122  1.00 0.00 ? 312 ARG A H    11 
ATOM 8786  H HA   . ARG A 1 21 ? 7.028   -0.954  -3.962  1.00 0.00 ? 312 ARG A HA   11 
ATOM 8787  H HB2  . ARG A 1 21 ? 7.407   1.120   -1.948  1.00 0.00 ? 312 ARG A HB2  11 
ATOM 8788  H HG2  . ARG A 1 21 ? 8.205   -1.785  -2.002  1.00 0.00 ? 312 ARG A HG2  11 
ATOM 8789  H HD2  . ARG A 1 21 ? 9.107   0.524   -0.286  1.00 0.00 ? 312 ARG A HD2  11 
ATOM 8790  H HE   . ARG A 1 21 ? 10.719  -1.554  -1.088  1.00 0.00 ? 312 ARG A HE   11 
ATOM 8791  H HH11 . ARG A 1 21 ? 9.434   -0.377  1.925   1.00 0.00 ? 312 ARG A HH11 11 
ATOM 8792  H HH12 . ARG A 1 21 ? 10.776  -0.939  2.867   1.00 0.00 ? 312 ARG A HH12 11 
ATOM 8793  H HH21 . ARG A 1 21 ? 12.491  -2.300  0.140   1.00 0.00 ? 312 ARG A HH21 11 
ATOM 8794  H HH22 . ARG A 1 21 ? 12.515  -2.031  1.850   1.00 0.00 ? 312 ARG A HH22 11 
ATOM 8795  N N    . VAL A 1 22 ? 4.630   -1.263  -4.266  1.00 0.00 ? 313 VAL A N    11 
ATOM 8796  C CA   . VAL A 1 22 ? 3.242   -1.657  -4.318  1.00 0.00 ? 313 VAL A CA   11 
ATOM 8797  C C    . VAL A 1 22 ? 2.808   -2.345  -3.024  1.00 0.00 ? 313 VAL A C    11 
ATOM 8798  O O    . VAL A 1 22 ? 3.492   -3.233  -2.516  1.00 0.00 ? 313 VAL A O    11 
ATOM 8799  C CB   . VAL A 1 22 ? 2.996   -2.598  -5.519  1.00 0.00 ? 313 VAL A CB   11 
ATOM 8800  C CG1  . VAL A 1 22 ? 4.068   -3.669  -5.578  1.00 0.00 ? 313 VAL A CG1  11 
ATOM 8801  C CG2  . VAL A 1 22 ? 1.621   -3.228  -5.450  1.00 0.00 ? 313 VAL A CG2  11 
ATOM 8802  H H    . VAL A 1 22 ? 5.257   -1.643  -4.916  1.00 0.00 ? 313 VAL A H    11 
ATOM 8803  H HA   . VAL A 1 22 ? 2.652   -0.767  -4.459  1.00 0.00 ? 313 VAL A HA   11 
ATOM 8804  H HB   . VAL A 1 22 ? 3.051   -2.016  -6.426  1.00 0.00 ? 313 VAL A HB   11 
ATOM 8805  H HG11 . VAL A 1 22 ? 3.609   -4.643  -5.477  1.00 0.00 ? 313 VAL A HG11 11 
ATOM 8806  H HG12 . VAL A 1 22 ? 4.584   -3.608  -6.523  1.00 0.00 ? 313 VAL A HG12 11 
ATOM 8807  H HG13 . VAL A 1 22 ? 4.770   -3.518  -4.772  1.00 0.00 ? 313 VAL A HG13 11 
ATOM 8808  H HG21 . VAL A 1 22 ? 1.542   -3.800  -4.538  1.00 0.00 ? 313 VAL A HG21 11 
ATOM 8809  H HG22 . VAL A 1 22 ? 0.873   -2.453  -5.457  1.00 0.00 ? 313 VAL A HG22 11 
ATOM 8810  H HG23 . VAL A 1 22 ? 1.481   -3.877  -6.298  1.00 0.00 ? 313 VAL A HG23 11 
ATOM 8811  N N    . TYR A 1 23 ? 1.665   -1.920  -2.503  1.00 0.00 ? 314 TYR A N    11 
ATOM 8812  C CA   . TYR A 1 23 ? 1.105   -2.506  -1.297  1.00 0.00 ? 314 TYR A CA   11 
ATOM 8813  C C    . TYR A 1 23 ? -0.351  -2.865  -1.529  1.00 0.00 ? 314 TYR A C    11 
ATOM 8814  O O    . TYR A 1 23 ? -0.957  -2.425  -2.506  1.00 0.00 ? 314 TYR A O    11 
ATOM 8815  C CB   . TYR A 1 23 ? 1.219   -1.560  -0.103  1.00 0.00 ? 314 TYR A CB   11 
ATOM 8816  C CG   . TYR A 1 23 ? 0.370   -0.314  -0.210  1.00 0.00 ? 314 TYR A CG   11 
ATOM 8817  C CD1  . TYR A 1 23 ? 0.705   0.707   -1.089  1.00 0.00 ? 314 TYR A CD1  11 
ATOM 8818  C CD2  . TYR A 1 23 ? -0.768  -0.158  0.572   1.00 0.00 ? 314 TYR A CD2  11 
ATOM 8819  C CE1  . TYR A 1 23 ? -0.070  1.845   -1.186  1.00 0.00 ? 314 TYR A CE1  11 
ATOM 8820  C CE2  . TYR A 1 23 ? -1.549  0.978   0.478   1.00 0.00 ? 314 TYR A CE2  11 
ATOM 8821  C CZ   . TYR A 1 23 ? -1.197  1.975   -0.403  1.00 0.00 ? 314 TYR A CZ   11 
ATOM 8822  O OH   . TYR A 1 23 ? -1.969  3.105   -0.494  1.00 0.00 ? 314 TYR A OH   11 
ATOM 8823  H H    . TYR A 1 23 ? 1.184   -1.189  -2.945  1.00 0.00 ? 314 TYR A H    11 
ATOM 8824  H HA   . TYR A 1 23 ? 1.655   -3.411  -1.083  1.00 0.00 ? 314 TYR A HA   11 
ATOM 8825  H HB2  . TYR A 1 23 ? 0.906   -2.089  0.783   1.00 0.00 ? 314 TYR A HB2  11 
ATOM 8826  H HD1  . TYR A 1 23 ? 1.589   0.607   -1.698  1.00 0.00 ? 314 TYR A HD1  11 
ATOM 8827  H HD2  . TYR A 1 23 ? -1.041  -0.942  1.265   1.00 0.00 ? 314 TYR A HD2  11 
ATOM 8828  H HE1  . TYR A 1 23 ? 0.211   2.628   -1.872  1.00 0.00 ? 314 TYR A HE1  11 
ATOM 8829  H HE2  . TYR A 1 23 ? -2.426  1.086   1.097   1.00 0.00 ? 314 TYR A HE2  11 
ATOM 8830  H HH   . TYR A 1 23 ? -2.105  3.471   0.382   1.00 0.00 ? 314 TYR A HH   11 
ATOM 8831  N N    . PHE A 1 24 ? -0.911  -3.660  -0.635  1.00 0.00 ? 315 PHE A N    11 
ATOM 8832  C CA   . PHE A 1 24 ? -2.295  -4.067  -0.771  1.00 0.00 ? 315 PHE A CA   11 
ATOM 8833  C C    . PHE A 1 24 ? -3.170  -3.406  0.275   1.00 0.00 ? 315 PHE A C    11 
ATOM 8834  O O    . PHE A 1 24 ? -2.823  -3.347  1.455   1.00 0.00 ? 315 PHE A O    11 
ATOM 8835  C CB   . PHE A 1 24 ? -2.403  -5.585  -0.699  1.00 0.00 ? 315 PHE A CB   11 
ATOM 8836  C CG   . PHE A 1 24 ? -1.661  -6.262  -1.814  1.00 0.00 ? 315 PHE A CG   11 
ATOM 8837  C CD1  . PHE A 1 24 ? -0.283  -6.394  -1.766  1.00 0.00 ? 315 PHE A CD1  11 
ATOM 8838  C CD2  . PHE A 1 24 ? -2.340  -6.746  -2.916  1.00 0.00 ? 315 PHE A CD2  11 
ATOM 8839  C CE1  . PHE A 1 24 ? 0.405   -7.002  -2.799  1.00 0.00 ? 315 PHE A CE1  11 
ATOM 8840  C CE2  . PHE A 1 24 ? -1.660  -7.357  -3.952  1.00 0.00 ? 315 PHE A CE2  11 
ATOM 8841  C CZ   . PHE A 1 24 ? -0.285  -7.485  -3.894  1.00 0.00 ? 315 PHE A CZ   11 
ATOM 8842  H H    . PHE A 1 24 ? -0.384  -3.981  0.126   1.00 0.00 ? 315 PHE A H    11 
ATOM 8843  H HA   . PHE A 1 24 ? -2.626  -3.739  -1.739  1.00 0.00 ? 315 PHE A HA   11 
ATOM 8844  H HB2  . PHE A 1 24 ? -1.992  -5.930  0.238   1.00 0.00 ? 315 PHE A HB2  11 
ATOM 8845  H HD1  . PHE A 1 24 ? 0.254   -6.018  -0.908  1.00 0.00 ? 315 PHE A HD1  11 
ATOM 8846  H HD2  . PHE A 1 24 ? -3.415  -6.642  -2.962  1.00 0.00 ? 315 PHE A HD2  11 
ATOM 8847  H HE1  . PHE A 1 24 ? 1.481   -7.097  -2.753  1.00 0.00 ? 315 PHE A HE1  11 
ATOM 8848  H HE2  . PHE A 1 24 ? -2.200  -7.732  -4.808  1.00 0.00 ? 315 PHE A HE2  11 
ATOM 8849  H HZ   . PHE A 1 24 ? 0.249   -7.962  -4.703  1.00 0.00 ? 315 PHE A HZ   11 
ATOM 8850  N N    . VAL A 1 25 ? -4.310  -2.908  -0.177  1.00 0.00 ? 316 VAL A N    11 
ATOM 8851  C CA   . VAL A 1 25 ? -5.247  -2.223  0.695   1.00 0.00 ? 316 VAL A CA   11 
ATOM 8852  C C    . VAL A 1 25 ? -6.521  -3.038  0.893   1.00 0.00 ? 316 VAL A C    11 
ATOM 8853  O O    . VAL A 1 25 ? -7.258  -3.297  -0.058  1.00 0.00 ? 316 VAL A O    11 
ATOM 8854  C CB   . VAL A 1 25 ? -5.613  -0.844  0.117   1.00 0.00 ? 316 VAL A CB   11 
ATOM 8855  C CG1  . VAL A 1 25 ? -6.279  0.020   1.169   1.00 0.00 ? 316 VAL A CG1  11 
ATOM 8856  C CG2  . VAL A 1 25 ? -4.378  -0.154  -0.444  1.00 0.00 ? 316 VAL A CG2  11 
ATOM 8857  H H    . VAL A 1 25 ? -4.528  -3.005  -1.127  1.00 0.00 ? 316 VAL A H    11 
ATOM 8858  H HA   . VAL A 1 25 ? -4.768  -2.078  1.651   1.00 0.00 ? 316 VAL A HA   11 
ATOM 8859  H HB   . VAL A 1 25 ? -6.314  -0.990  -0.691  1.00 0.00 ? 316 VAL A HB   11 
ATOM 8860  H HG11 . VAL A 1 25 ? -7.347  -0.128  1.129   1.00 0.00 ? 316 VAL A HG11 11 
ATOM 8861  H HG12 . VAL A 1 25 ? -5.913  -0.257  2.147   1.00 0.00 ? 316 VAL A HG12 11 
ATOM 8862  H HG13 . VAL A 1 25 ? -6.049  1.058   0.979   1.00 0.00 ? 316 VAL A HG13 11 
ATOM 8863  H HG21 . VAL A 1 25 ? -4.415  -0.173  -1.523  1.00 0.00 ? 316 VAL A HG21 11 
ATOM 8864  H HG22 . VAL A 1 25 ? -4.353  0.871   -0.103  1.00 0.00 ? 316 VAL A HG22 11 
ATOM 8865  H HG23 . VAL A 1 25 ? -3.492  -0.669  -0.103  1.00 0.00 ? 316 VAL A HG23 11 
ATOM 8866  N N    . ASP A 1 26 ? -6.773  -3.436  2.135   1.00 0.00 ? 317 ASP A N    11 
ATOM 8867  C CA   . ASP A 1 26 ? -7.963  -4.214  2.461   1.00 0.00 ? 317 ASP A CA   11 
ATOM 8868  C C    . ASP A 1 26 ? -9.131  -3.292  2.790   1.00 0.00 ? 317 ASP A C    11 
ATOM 8869  O O    . ASP A 1 26 ? -9.078  -2.528  3.754   1.00 0.00 ? 317 ASP A O    11 
ATOM 8870  C CB   . ASP A 1 26 ? -7.690  -5.141  3.644   1.00 0.00 ? 317 ASP A CB   11 
ATOM 8871  C CG   . ASP A 1 26 ? -8.434  -6.457  3.531   1.00 0.00 ? 317 ASP A CG   11 
ATOM 8872  O OD1  . ASP A 1 26 ? -9.036  -6.710  2.466   1.00 0.00 ? 317 ASP A OD1  11 
ATOM 8873  O OD2  . ASP A 1 26 ? -8.416  -7.235  4.508   1.00 0.00 ? 317 ASP A OD2  11 
ATOM 8874  H H    . ASP A 1 26 ? -6.143  -3.204  2.850   1.00 0.00 ? 317 ASP A H    11 
ATOM 8875  H HA   . ASP A 1 26 ? -8.219  -4.810  1.598   1.00 0.00 ? 317 ASP A HA   11 
ATOM 8876  H HB2  . ASP A 1 26 ? -6.632  -5.350  3.696   1.00 0.00 ? 317 ASP A HB2  11 
ATOM 8877  N N    . HIS A 1 27 ? -10.182 -3.368  1.984   1.00 0.00 ? 318 HIS A N    11 
ATOM 8878  C CA   . HIS A 1 27 ? -11.362 -2.538  2.191   1.00 0.00 ? 318 HIS A CA   11 
ATOM 8879  C C    . HIS A 1 27 ? -12.322 -3.180  3.192   1.00 0.00 ? 318 HIS A C    11 
ATOM 8880  O O    . HIS A 1 27 ? -13.196 -2.509  3.740   1.00 0.00 ? 318 HIS A O    11 
ATOM 8881  C CB   . HIS A 1 27 ? -12.066 -2.284  0.858   1.00 0.00 ? 318 HIS A CB   11 
ATOM 8882  C CG   . HIS A 1 27 ? -11.395 -1.229  0.037   1.00 0.00 ? 318 HIS A CG   11 
ATOM 8883  N ND1  . HIS A 1 27 ? -11.413 0.090   0.419   1.00 0.00 ? 318 HIS A ND1  11 
ATOM 8884  C CD2  . HIS A 1 27 ? -10.682 -1.349  -1.109  1.00 0.00 ? 318 HIS A CD2  11 
ATOM 8885  C CE1  . HIS A 1 27 ? -10.713 0.740   -0.492  1.00 0.00 ? 318 HIS A CE1  11 
ATOM 8886  N NE2  . HIS A 1 27 ? -10.252 -0.089  -1.440  1.00 0.00 ? 318 HIS A NE2  11 
ATOM 8887  H H    . HIS A 1 27 ? -10.165 -3.995  1.232   1.00 0.00 ? 318 HIS A H    11 
ATOM 8888  H HA   . HIS A 1 27 ? -11.029 -1.592  2.593   1.00 0.00 ? 318 HIS A HA   11 
ATOM 8889  H HB2  . HIS A 1 27 ? -12.077 -3.197  0.282   1.00 0.00 ? 318 HIS A HB2  11 
ATOM 8890  H HD2  . HIS A 1 27 ? -10.486 -2.258  -1.657  1.00 0.00 ? 318 HIS A HD2  11 
ATOM 8891  H HE1  . HIS A 1 27 ? -10.527 1.802   -0.469  1.00 0.00 ? 318 HIS A HE1  11 
ATOM 8892  H HE2  . HIS A 1 27 ? -9.857  0.176   -2.298  1.00 0.00 ? 318 HIS A HE2  11 
ATOM 8893  N N    . ASN A 1 28 ? -12.158 -4.480  3.429   1.00 0.00 ? 319 ASN A N    11 
ATOM 8894  C CA   . ASN A 1 28 ? -13.006 -5.193  4.377   1.00 0.00 ? 319 ASN A CA   11 
ATOM 8895  C C    . ASN A 1 28 ? -12.570 -4.893  5.807   1.00 0.00 ? 319 ASN A C    11 
ATOM 8896  O O    . ASN A 1 28 ? -13.397 -4.635  6.680   1.00 0.00 ? 319 ASN A O    11 
ATOM 8897  C CB   . ASN A 1 28 ? -12.951 -6.701  4.119   1.00 0.00 ? 319 ASN A CB   11 
ATOM 8898  C CG   . ASN A 1 28 ? -13.072 -7.042  2.648   1.00 0.00 ? 319 ASN A CG   11 
ATOM 8899  O OD1  . ASN A 1 28 ? -13.730 -6.334  1.886   1.00 0.00 ? 319 ASN A OD1  11 
ATOM 8900  N ND2  . ASN A 1 28 ? -12.436 -8.135  2.240   1.00 0.00 ? 319 ASN A ND2  11 
ATOM 8901  H H    . ASN A 1 28 ? -11.455 -4.971  2.955   1.00 0.00 ? 319 ASN A H    11 
ATOM 8902  H HA   . ASN A 1 28 ? -14.020 -4.848  4.241   1.00 0.00 ? 319 ASN A HA   11 
ATOM 8903  H HB2  . ASN A 1 28 ? -12.011 -7.088  4.483   1.00 0.00 ? 319 ASN A HB2  11 
ATOM 8904  H HD21 . ASN A 1 28 ? -11.931 -8.651  2.903   1.00 0.00 ? 319 ASN A HD21 11 
ATOM 8905  H HD22 . ASN A 1 28 ? -12.498 -8.382  1.294   1.00 0.00 ? 319 ASN A HD22 11 
ATOM 8906  N N    . ASN A 1 29 ? -11.261 -4.929  6.034   1.00 0.00 ? 320 ASN A N    11 
ATOM 8907  C CA   . ASN A 1 29 ? -10.698 -4.656  7.352   1.00 0.00 ? 320 ASN A CA   11 
ATOM 8908  C C    . ASN A 1 29 ? -10.108 -3.244  7.422   1.00 0.00 ? 320 ASN A C    11 
ATOM 8909  O O    . ASN A 1 29 ? -9.749  -2.770  8.501   1.00 0.00 ? 320 ASN A O    11 
ATOM 8910  C CB   . ASN A 1 29 ? -9.620  -5.686  7.691   1.00 0.00 ? 320 ASN A CB   11 
ATOM 8911  C CG   . ASN A 1 29 ? -10.142 -7.106  7.636   1.00 0.00 ? 320 ASN A CG   11 
ATOM 8912  O OD1  . ASN A 1 29 ? -10.702 -7.615  8.606   1.00 0.00 ? 320 ASN A OD1  11 
ATOM 8913  N ND2  . ASN A 1 29 ? -9.957  -7.755  6.493   1.00 0.00 ? 320 ASN A ND2  11 
ATOM 8914  H H    . ASN A 1 29 ? -10.655 -5.146  5.295   1.00 0.00 ? 320 ASN A H    11 
ATOM 8915  H HA   . ASN A 1 29 ? -11.497 -4.733  8.074   1.00 0.00 ? 320 ASN A HA   11 
ATOM 8916  H HB2  . ASN A 1 29 ? -8.808  -5.597  6.985   1.00 0.00 ? 320 ASN A HB2  11 
ATOM 8917  H HD21 . ASN A 1 29 ? -9.504  -7.285  5.762   1.00 0.00 ? 320 ASN A HD21 11 
ATOM 8918  H HD22 . ASN A 1 29 ? -10.281 -8.673  6.426   1.00 0.00 ? 320 ASN A HD22 11 
ATOM 8919  N N    . ARG A 1 30 ? -10.008 -2.577  6.272   1.00 0.00 ? 321 ARG A N    11 
ATOM 8920  C CA   . ARG A 1 30 ? -9.463  -1.227  6.216   1.00 0.00 ? 321 ARG A CA   11 
ATOM 8921  C C    . ARG A 1 30 ? -8.026  -1.190  6.722   1.00 0.00 ? 321 ARG A C    11 
ATOM 8922  O O    . ARG A 1 30 ? -7.692  -0.413  7.617   1.00 0.00 ? 321 ARG A O    11 
ATOM 8923  C CB   . ARG A 1 30 ? -10.329 -0.267  7.032   1.00 0.00 ? 321 ARG A CB   11 
ATOM 8924  C CG   . ARG A 1 30 ? -11.789 -0.262  6.612   1.00 0.00 ? 321 ARG A CG   11 
ATOM 8925  C CD   . ARG A 1 30 ? -12.653 -1.042  7.589   1.00 0.00 ? 321 ARG A CD   11 
ATOM 8926  N NE   . ARG A 1 30 ? -13.199 -0.188  8.641   1.00 0.00 ? 321 ARG A NE   11 
ATOM 8927  C CZ   . ARG A 1 30 ? -14.017 -0.626  9.593   1.00 0.00 ? 321 ARG A CZ   11 
ATOM 8928  N NH1  . ARG A 1 30 ? -14.384 -1.900  9.620   1.00 0.00 ? 321 ARG A NH1  11 
ATOM 8929  N NH2  . ARG A 1 30 ? -14.468 0.211   10.517  1.00 0.00 ? 321 ARG A NH2  11 
ATOM 8930  H H    . ARG A 1 30 ? -10.310 -2.998  5.444   1.00 0.00 ? 321 ARG A H    11 
ATOM 8931  H HA   . ARG A 1 30 ? -9.473  -0.911  5.184   1.00 0.00 ? 321 ARG A HA   11 
ATOM 8932  H HB2  . ARG A 1 30 ? -10.276 -0.549  8.073   1.00 0.00 ? 321 ARG A HB2  11 
ATOM 8933  H HG2  . ARG A 1 30 ? -12.138 0.757   6.573   1.00 0.00 ? 321 ARG A HG2  11 
ATOM 8934  H HD2  . ARG A 1 30 ? -13.469 -1.494  7.046   1.00 0.00 ? 321 ARG A HD2  11 
ATOM 8935  H HE   . ARG A 1 30 ? -12.941 0.757   8.637   1.00 0.00 ? 321 ARG A HE   11 
ATOM 8936  H HH11 . ARG A 1 30 ? -14.045 -2.532  8.924   1.00 0.00 ? 321 ARG A HH11 11 
ATOM 8937  H HH12 . ARG A 1 30 ? -14.999 -2.228  10.337  1.00 0.00 ? 321 ARG A HH12 11 
ATOM 8938  H HH21 . ARG A 1 30 ? -14.194 1.172   10.499  1.00 0.00 ? 321 ARG A HH21 11 
ATOM 8939  H HH22 . ARG A 1 30 ? -15.085 -0.120  11.232  1.00 0.00 ? 321 ARG A HH22 11 
ATOM 8940  N N    . THR A 1 31 ? -7.179  -2.036  6.145   1.00 0.00 ? 322 THR A N    11 
ATOM 8941  C CA   . THR A 1 31 ? -5.776  -2.092  6.532   1.00 0.00 ? 322 THR A CA   11 
ATOM 8942  C C    . THR A 1 31 ? -4.878  -2.158  5.305   1.00 0.00 ? 322 THR A C    11 
ATOM 8943  O O    . THR A 1 31 ? -5.324  -1.909  4.184   1.00 0.00 ? 322 THR A O    11 
ATOM 8944  C CB   . THR A 1 31 ? -5.475  -3.299  7.442   1.00 0.00 ? 322 THR A CB   11 
ATOM 8945  O OG1  . THR A 1 31 ? -4.129  -3.225  7.925   1.00 0.00 ? 322 THR A OG1  11 
ATOM 8946  C CG2  . THR A 1 31 ? -5.676  -4.610  6.697   1.00 0.00 ? 322 THR A CG2  11 
ATOM 8947  H H    . THR A 1 31 ? -7.507  -2.635  5.441   1.00 0.00 ? 322 THR A H    11 
ATOM 8948  H HA   . THR A 1 31 ? -5.545  -1.190  7.079   1.00 0.00 ? 322 THR A HA   11 
ATOM 8949  H HB   . THR A 1 31 ? -6.152  -3.273  8.282   1.00 0.00 ? 322 THR A HB   11 
ATOM 8950  H HG1  . THR A 1 31 ? -4.089  -2.626  8.674   1.00 0.00 ? 322 THR A HG1  11 
ATOM 8951  H HG21 . THR A 1 31 ? -6.610  -5.057  7.002   1.00 0.00 ? 322 THR A HG21 11 
ATOM 8952  H HG22 . THR A 1 31 ? -4.863  -5.282  6.927   1.00 0.00 ? 322 THR A HG22 11 
ATOM 8953  H HG23 . THR A 1 31 ? -5.697  -4.422  5.634   1.00 0.00 ? 322 THR A HG23 11 
ATOM 8954  N N    . THR A 1 32 ? -3.615  -2.499  5.522   1.00 0.00 ? 323 THR A N    11 
ATOM 8955  C CA   . THR A 1 32 ? -2.657  -2.590  4.430   1.00 0.00 ? 323 THR A CA   11 
ATOM 8956  C C    . THR A 1 32 ? -1.668  -3.727  4.651   1.00 0.00 ? 323 THR A C    11 
ATOM 8957  O O    . THR A 1 32 ? -1.623  -4.332  5.721   1.00 0.00 ? 323 THR A O    11 
ATOM 8958  C CB   . THR A 1 32 ? -1.873  -1.276  4.258   1.00 0.00 ? 323 THR A CB   11 
ATOM 8959  O OG1  . THR A 1 32 ? -1.433  -0.802  5.536   1.00 0.00 ? 323 THR A OG1  11 
ATOM 8960  C CG2  . THR A 1 32 ? -2.734  -0.213  3.584   1.00 0.00 ? 323 THR A CG2  11 
ATOM 8961  H H    . THR A 1 32 ? -3.324  -2.699  6.436   1.00 0.00 ? 323 THR A H    11 
ATOM 8962  H HA   . THR A 1 32 ? -3.210  -2.776  3.523   1.00 0.00 ? 323 THR A HA   11 
ATOM 8963  H HB   . THR A 1 32 ? -1.003  -1.469  3.633   1.00 0.00 ? 323 THR A HB   11 
ATOM 8964  H HG1  . THR A 1 32 ? -2.187  -0.480  6.034   1.00 0.00 ? 323 THR A HG1  11 
ATOM 8965  H HG21 . THR A 1 32 ? -3.778  -0.424  3.768   1.00 0.00 ? 323 THR A HG21 11 
ATOM 8966  H HG22 . THR A 1 32 ? -2.548  -0.221  2.521   1.00 0.00 ? 323 THR A HG22 11 
ATOM 8967  H HG23 . THR A 1 32 ? -2.488  0.760   3.988   1.00 0.00 ? 323 THR A HG23 11 
ATOM 8968  N N    . GLN A 1 33 ? -0.877  -4.006  3.624   1.00 0.00 ? 324 GLN A N    11 
ATOM 8969  C CA   . GLN A 1 33 ? 0.127   -5.061  3.686   1.00 0.00 ? 324 GLN A CA   11 
ATOM 8970  C C    . GLN A 1 33 ? 0.805   -5.222  2.332   1.00 0.00 ? 324 GLN A C    11 
ATOM 8971  O O    . GLN A 1 33 ? 0.141   -5.329  1.302   1.00 0.00 ? 324 GLN A O    11 
ATOM 8972  C CB   . GLN A 1 33 ? -0.494  -6.390  4.127   1.00 0.00 ? 324 GLN A CB   11 
ATOM 8973  C CG   . GLN A 1 33 ? -1.958  -6.545  3.749   1.00 0.00 ? 324 GLN A CG   11 
ATOM 8974  C CD   . GLN A 1 33 ? -2.372  -7.998  3.619   1.00 0.00 ? 324 GLN A CD   11 
ATOM 8975  O OE1  . GLN A 1 33 ? -2.987  -8.563  4.524   1.00 0.00 ? 324 GLN A OE1  11 
ATOM 8976  N NE2  . GLN A 1 33 ? -2.035  -8.612  2.491   1.00 0.00 ? 324 GLN A NE2  11 
ATOM 8977  H H    . GLN A 1 33 ? -0.970  -3.489  2.797   1.00 0.00 ? 324 GLN A H    11 
ATOM 8978  H HA   . GLN A 1 33 ? 0.871   -4.763  4.410   1.00 0.00 ? 324 GLN A HA   11 
ATOM 8979  H HB2  . GLN A 1 33 ? 0.058   -7.199  3.673   1.00 0.00 ? 324 GLN A HB2  11 
ATOM 8980  H HG2  . GLN A 1 33 ? -2.564  -6.081  4.514   1.00 0.00 ? 324 GLN A HG2  11 
ATOM 8981  H HE21 . GLN A 1 33 ? -1.545  -8.100  1.815   1.00 0.00 ? 324 GLN A HE21 11 
ATOM 8982  H HE22 . GLN A 1 33 ? -2.290  -9.551  2.381   1.00 0.00 ? 324 GLN A HE22 11 
ATOM 8983  N N    . PHE A 1 34 ? 2.128   -5.248  2.345   1.00 0.00 ? 325 PHE A N    11 
ATOM 8984  C CA   . PHE A 1 34 ? 2.906   -5.379  1.120   1.00 0.00 ? 325 PHE A CA   11 
ATOM 8985  C C    . PHE A 1 34 ? 2.687   -6.741  0.480   1.00 0.00 ? 325 PHE A C    11 
ATOM 8986  O O    . PHE A 1 34 ? 2.974   -6.938  -0.700  1.00 0.00 ? 325 PHE A O    11 
ATOM 8987  C CB   . PHE A 1 34 ? 4.392   -5.178  1.420   1.00 0.00 ? 325 PHE A CB   11 
ATOM 8988  C CG   . PHE A 1 34 ? 4.854   -3.733  1.413   1.00 0.00 ? 325 PHE A CG   11 
ATOM 8989  C CD1  . PHE A 1 34 ? 3.971   -2.681  1.173   1.00 0.00 ? 325 PHE A CD1  11 
ATOM 8990  C CD2  . PHE A 1 34 ? 6.186   -3.430  1.645   1.00 0.00 ? 325 PHE A CD2  11 
ATOM 8991  C CE1  . PHE A 1 34 ? 4.412   -1.371  1.167   1.00 0.00 ? 325 PHE A CE1  11 
ATOM 8992  C CE2  . PHE A 1 34 ? 6.627   -2.122  1.641   1.00 0.00 ? 325 PHE A CE2  11 
ATOM 8993  C CZ   . PHE A 1 34 ? 5.739   -1.092  1.401   1.00 0.00 ? 325 PHE A CZ   11 
ATOM 8994  H H    . PHE A 1 34 ? 2.596   -5.204  3.204   1.00 0.00 ? 325 PHE A H    11 
ATOM 8995  H HA   . PHE A 1 34 ? 2.577   -4.621  0.429   1.00 0.00 ? 325 PHE A HA   11 
ATOM 8996  H HB2  . PHE A 1 34 ? 4.605   -5.588  2.397   1.00 0.00 ? 325 PHE A HB2  11 
ATOM 8997  H HD1  . PHE A 1 34 ? 2.930   -2.889  0.996   1.00 0.00 ? 325 PHE A HD1  11 
ATOM 8998  H HD2  . PHE A 1 34 ? 6.884   -4.229  1.838   1.00 0.00 ? 325 PHE A HD2  11 
ATOM 8999  H HE1  . PHE A 1 34 ? 3.715   -0.562  0.987   1.00 0.00 ? 325 PHE A HE1  11 
ATOM 9000  H HE2  . PHE A 1 34 ? 7.667   -1.902  1.825   1.00 0.00 ? 325 PHE A HE2  11 
ATOM 9001  H HZ   . PHE A 1 34 ? 6.087   -0.070  1.396   1.00 0.00 ? 325 PHE A HZ   11 
ATOM 9002  N N    . THR A 1 35 ? 2.176   -7.680  1.264   1.00 0.00 ? 326 THR A N    11 
ATOM 9003  C CA   . THR A 1 35 ? 1.925   -9.019  0.774   1.00 0.00 ? 326 THR A CA   11 
ATOM 9004  C C    . THR A 1 35 ? 0.632   -9.093  -0.023  1.00 0.00 ? 326 THR A C    11 
ATOM 9005  O O    . THR A 1 35 ? -0.265  -8.266  0.147   1.00 0.00 ? 326 THR A O    11 
ATOM 9006  C CB   . THR A 1 35 ? 1.851   -10.025 1.928   1.00 0.00 ? 326 THR A CB   11 
ATOM 9007  O OG1  . THR A 1 35 ? 2.527   -9.507  3.080   1.00 0.00 ? 326 THR A OG1  11 
ATOM 9008  C CG2  . THR A 1 35 ? 2.479   -11.333 1.510   1.00 0.00 ? 326 THR A CG2  11 
ATOM 9009  H H    . THR A 1 35 ? 1.970   -7.472  2.198   1.00 0.00 ? 326 THR A H    11 
ATOM 9010  H HA   . THR A 1 35 ? 2.748   -9.300  0.133   1.00 0.00 ? 326 THR A HA   11 
ATOM 9011  H HB   . THR A 1 35 ? 0.813   -10.200 2.172   1.00 0.00 ? 326 THR A HB   11 
ATOM 9012  H HG1  . THR A 1 35 ? 3.474   -9.621  2.973   1.00 0.00 ? 326 THR A HG1  11 
ATOM 9013  H HG21 . THR A 1 35 ? 1.823   -11.836 0.814   1.00 0.00 ? 326 THR A HG21 11 
ATOM 9014  H HG22 . THR A 1 35 ? 2.634   -11.953 2.379   1.00 0.00 ? 326 THR A HG22 11 
ATOM 9015  H HG23 . THR A 1 35 ? 3.429   -11.132 1.032   1.00 0.00 ? 326 THR A HG23 11 
ATOM 9016  N N    . ASP A 1 36 ? 0.545   -10.090 -0.896  1.00 0.00 ? 327 ASP A N    11 
ATOM 9017  C CA   . ASP A 1 36 ? -0.642  -10.285 -1.711  1.00 0.00 ? 327 ASP A CA   11 
ATOM 9018  C C    . ASP A 1 36 ? -1.535  -11.354 -1.083  1.00 0.00 ? 327 ASP A C    11 
ATOM 9019  O O    . ASP A 1 36 ? -1.131  -12.510 -0.966  1.00 0.00 ? 327 ASP A O    11 
ATOM 9020  C CB   . ASP A 1 36 ? -0.250  -10.698 -3.131  1.00 0.00 ? 327 ASP A CB   11 
ATOM 9021  C CG   . ASP A 1 36 ? -1.441  -10.731 -4.070  1.00 0.00 ? 327 ASP A CG   11 
ATOM 9022  O OD1  . ASP A 1 36 ? -2.521  -10.243 -3.678  1.00 0.00 ? 327 ASP A OD1  11 
ATOM 9023  O OD2  . ASP A 1 36 ? -1.291  -11.244 -5.200  1.00 0.00 ? 327 ASP A OD2  11 
ATOM 9024  H H    . ASP A 1 36 ? 1.297   -10.711 -0.991  1.00 0.00 ? 327 ASP A H    11 
ATOM 9025  H HA   . ASP A 1 36 ? -1.171  -9.349  -1.749  1.00 0.00 ? 327 ASP A HA   11 
ATOM 9026  H HB2  . ASP A 1 36 ? 0.470   -9.994  -3.519  1.00 0.00 ? 327 ASP A HB2  11 
ATOM 9027  N N    . PRO A 1 37 ? -2.761  -10.989 -0.668  1.00 0.00 ? 328 PRO A N    11 
ATOM 9028  C CA   . PRO A 1 37 ? -3.686  -11.936 -0.041  1.00 0.00 ? 328 PRO A CA   11 
ATOM 9029  C C    . PRO A 1 37 ? -3.831  -13.204 -0.863  1.00 0.00 ? 328 PRO A C    11 
ATOM 9030  O O    . PRO A 1 37 ? -4.058  -14.286 -0.323  1.00 0.00 ? 328 PRO A O    11 
ATOM 9031  C CB   . PRO A 1 37 ? -5.018  -11.176 0.018   1.00 0.00 ? 328 PRO A CB   11 
ATOM 9032  C CG   . PRO A 1 37 ? -4.824  -9.964  -0.828  1.00 0.00 ? 328 PRO A CG   11 
ATOM 9033  C CD   . PRO A 1 37 ? -3.356  -9.656  -0.787  1.00 0.00 ? 328 PRO A CD   11 
ATOM 9034  H HA   . PRO A 1 37 ? -3.369  -12.191 0.960   1.00 0.00 ? 328 PRO A HA   11 
ATOM 9035  H HB2  . PRO A 1 37 ? -5.808  -11.803 -0.370  1.00 0.00 ? 328 PRO A HB2  11 
ATOM 9036  H HG2  . PRO A 1 37 ? -5.133  -10.172 -1.842  1.00 0.00 ? 328 PRO A HG2  11 
ATOM 9037  H HD2  . PRO A 1 37 ? -3.055  -9.169  -1.701  1.00 0.00 ? 328 PRO A HD2  11 
ATOM 9038  N N    . ARG A 1 38 ? -3.695  -13.061 -2.176  1.00 0.00 ? 329 ARG A N    11 
ATOM 9039  C CA   . ARG A 1 38 ? -3.801  -14.198 -3.074  1.00 0.00 ? 329 ARG A CA   11 
ATOM 9040  C C    . ARG A 1 38 ? -2.710  -15.217 -2.766  1.00 0.00 ? 329 ARG A C    11 
ATOM 9041  O O    . ARG A 1 38 ? -2.904  -16.422 -2.926  1.00 0.00 ? 329 ARG A O    11 
ATOM 9042  C CB   . ARG A 1 38 ? -3.696  -13.742 -4.530  1.00 0.00 ? 329 ARG A CB   11 
ATOM 9043  C CG   . ARG A 1 38 ? -4.509  -12.496 -4.839  1.00 0.00 ? 329 ARG A CG   11 
ATOM 9044  C CD   . ARG A 1 38 ? -5.008  -12.497 -6.274  1.00 0.00 ? 329 ARG A CD   11 
ATOM 9045  N NE   . ARG A 1 38 ? -5.992  -13.551 -6.509  1.00 0.00 ? 329 ARG A NE   11 
ATOM 9046  C CZ   . ARG A 1 38 ? -6.413  -13.910 -7.717  1.00 0.00 ? 329 ARG A CZ   11 
ATOM 9047  N NH1  . ARG A 1 38 ? -5.935  -13.302 -8.794  1.00 0.00 ? 329 ARG A NH1  11 
ATOM 9048  N NH2  . ARG A 1 38 ? -7.310  -14.877 -7.849  1.00 0.00 ? 329 ARG A NH2  11 
ATOM 9049  H H    . ARG A 1 38 ? -3.519  -12.172 -2.547  1.00 0.00 ? 329 ARG A H    11 
ATOM 9050  H HA   . ARG A 1 38 ? -4.767  -14.653 -2.914  1.00 0.00 ? 329 ARG A HA   11 
ATOM 9051  H HB2  . ARG A 1 38 ? -2.660  -13.534 -4.755  1.00 0.00 ? 329 ARG A HB2  11 
ATOM 9052  H HG2  . ARG A 1 38 ? -5.359  -12.458 -4.175  1.00 0.00 ? 329 ARG A HG2  11 
ATOM 9053  H HD2  . ARG A 1 38 ? -5.461  -11.541 -6.486  1.00 0.00 ? 329 ARG A HD2  11 
ATOM 9054  H HE   . ARG A 1 38 ? -6.358  -14.013 -5.726  1.00 0.00 ? 329 ARG A HE   11 
ATOM 9055  H HH11 . ARG A 1 38 ? -5.258  -12.572 -8.698  1.00 0.00 ? 329 ARG A HH11 11 
ATOM 9056  H HH12 . ARG A 1 38 ? -6.252  -13.574 -9.703  1.00 0.00 ? 329 ARG A HH12 11 
ATOM 9057  H HH21 . ARG A 1 38 ? -7.671  -15.338 -7.039  1.00 0.00 ? 329 ARG A HH21 11 
ATOM 9058  H HH22 . ARG A 1 38 ? -7.626  -15.145 -8.759  1.00 0.00 ? 329 ARG A HH22 11 
ATOM 9059  N N    . LEU A 1 39 ? -1.559  -14.717 -2.322  1.00 0.00 ? 330 LEU A N    11 
ATOM 9060  C CA   . LEU A 1 39 ? -0.428  -15.574 -1.984  1.00 0.00 ? 330 LEU A CA   11 
ATOM 9061  C C    . LEU A 1 39 ? -0.740  -16.421 -0.756  1.00 0.00 ? 330 LEU A C    11 
ATOM 9062  O O    . LEU A 1 39 ? -0.737  -17.650 -0.819  1.00 0.00 ? 330 LEU A O    11 
ATOM 9063  C CB   . LEU A 1 39 ? 0.820   -14.725 -1.729  1.00 0.00 ? 330 LEU A CB   11 
ATOM 9064  C CG   . LEU A 1 39 ? 1.445   -14.098 -2.977  1.00 0.00 ? 330 LEU A CG   11 
ATOM 9065  C CD1  . LEU A 1 39 ? 2.552   -13.130 -2.590  1.00 0.00 ? 330 LEU A CD1  11 
ATOM 9066  C CD2  . LEU A 1 39 ? 1.979   -15.177 -3.905  1.00 0.00 ? 330 LEU A CD2  11 
ATOM 9067  H H    . LEU A 1 39 ? -1.468  -13.747 -2.220  1.00 0.00 ? 330 LEU A H    11 
ATOM 9068  H HA   . LEU A 1 39 ? -0.243  -16.228 -2.822  1.00 0.00 ? 330 LEU A HA   11 
ATOM 9069  H HB2  . LEU A 1 39 ? 0.555   -13.931 -1.046  1.00 0.00 ? 330 LEU A HB2  11 
ATOM 9070  H HG   . LEU A 1 39 ? 0.687   -13.541 -3.510  1.00 0.00 ? 330 LEU A HG   11 
ATOM 9071  H HD11 . LEU A 1 39 ? 3.506   -13.635 -2.641  1.00 0.00 ? 330 LEU A HD11 11 
ATOM 9072  H HD12 . LEU A 1 39 ? 2.553   -12.292 -3.271  1.00 0.00 ? 330 LEU A HD12 11 
ATOM 9073  H HD13 . LEU A 1 39 ? 2.386   -12.776 -1.583  1.00 0.00 ? 330 LEU A HD13 11 
ATOM 9074  H HD21 . LEU A 1 39 ? 1.954   -16.132 -3.400  1.00 0.00 ? 330 LEU A HD21 11 
ATOM 9075  H HD22 . LEU A 1 39 ? 1.367   -15.223 -4.794  1.00 0.00 ? 330 LEU A HD22 11 
ATOM 9076  H HD23 . LEU A 1 39 ? 2.998   -14.944 -4.181  1.00 0.00 ? 330 LEU A HD23 11 
ATOM 9077  N N    . SER A 1 40 ? -1.008  -15.755 0.364   1.00 0.00 ? 331 SER A N    11 
ATOM 9078  C CA   . SER A 1 40 ? -1.325  -16.443 1.609   1.00 0.00 ? 331 SER A CA   11 
ATOM 9079  C C    . SER A 1 40 ? -2.683  -15.999 2.142   1.00 0.00 ? 331 SER A C    11 
ATOM 9080  O O    . SER A 1 40 ? -3.017  -14.814 2.109   1.00 0.00 ? 331 SER A O    11 
ATOM 9081  C CB   . SER A 1 40 ? -0.241  -16.176 2.655   1.00 0.00 ? 331 SER A CB   11 
ATOM 9082  O OG   . SER A 1 40 ? -0.275  -14.828 3.091   1.00 0.00 ? 331 SER A OG   11 
ATOM 9083  H H    . SER A 1 40 ? -0.994  -14.776 0.350   1.00 0.00 ? 331 SER A H    11 
ATOM 9084  H HA   . SER A 1 40 ? -1.361  -17.503 1.403   1.00 0.00 ? 331 SER A HA   11 
ATOM 9085  H HB2  . SER A 1 40 ? -0.398  -16.820 3.507   1.00 0.00 ? 331 SER A HB2  11 
ATOM 9086  H HG   . SER A 1 40 ? 0.168   -14.755 3.940   1.00 0.00 ? 331 SER A HG   11 
ATOM 9087  N N    . ALA A 1 41 ? -3.464  -16.956 2.632   1.00 0.00 ? 332 ALA A N    11 
ATOM 9088  C CA   . ALA A 1 41 ? -4.787  -16.660 3.168   1.00 0.00 ? 332 ALA A CA   11 
ATOM 9089  C C    . ALA A 1 41 ? -4.953  -17.227 4.574   1.00 0.00 ? 332 ALA A C    11 
ATOM 9090  O O    . ALA A 1 41 ? -4.011  -17.771 5.151   1.00 0.00 ? 332 ALA A O    11 
ATOM 9091  C CB   . ALA A 1 41 ? -5.864  -17.214 2.244   1.00 0.00 ? 332 ALA A CB   11 
ATOM 9092  H H    . ALA A 1 41 ? -3.143  -17.882 2.633   1.00 0.00 ? 332 ALA A H    11 
ATOM 9093  H HA   . ALA A 1 41 ? -4.897  -15.584 3.209   1.00 0.00 ? 332 ALA A HA   11 
ATOM 9094  H HB1  . ALA A 1 41 ? -5.684  -16.874 1.235   1.00 0.00 ? 332 ALA A HB1  11 
ATOM 9095  H HB2  . ALA A 1 41 ? -5.838  -18.293 2.271   1.00 0.00 ? 332 ALA A HB2  11 
ATOM 9096  H HB3  . ALA A 1 41 ? -6.835  -16.870 2.573   1.00 0.00 ? 332 ALA A HB3  11 
ATOM 9097  N N    . ASN A 1 42 ? -6.159  -17.097 5.119   1.00 0.00 ? 333 ASN A N    11 
ATOM 9098  C CA   . ASN A 1 42 ? -6.451  -17.596 6.457   1.00 0.00 ? 333 ASN A CA   11 
ATOM 9099  C C    . ASN A 1 42 ? -7.924  -17.973 6.587   1.00 0.00 ? 333 ASN A C    11 
ATOM 9100  O O    . ASN A 1 42 ? -8.242  -19.172 6.443   1.00 0.00 ? 333 ASN A O    11 
ATOM 9101  C CB   . ASN A 1 42 ? -6.088  -16.545 7.507   1.00 0.00 ? 333 ASN A CB   11 
ATOM 9102  C CG   . ASN A 1 42 ? -6.407  -17.001 8.919   1.00 0.00 ? 333 ASN A CG   11 
ATOM 9103  O OD1  . ASN A 1 42 ? -6.756  -18.160 9.145   1.00 0.00 ? 333 ASN A OD1  11 
ATOM 9104  N ND2  . ASN A 1 42 ? -6.289  -16.089 9.875   1.00 0.00 ? 333 ASN A ND2  11 
ATOM 9105  O OXT  . ASN A 1 42 ? -8.746  -17.066 6.832   1.00 0.00 ? 333 ASN A OXT  11 
ATOM 9106  H H    . ASN A 1 42 ? -6.868  -16.654 4.608   1.00 0.00 ? 333 ASN A H    11 
ATOM 9107  H HA   . ASN A 1 42 ? -5.851  -18.478 6.621   1.00 0.00 ? 333 ASN A HA   11 
ATOM 9108  H HB2  . ASN A 1 42 ? -5.031  -16.335 7.448   1.00 0.00 ? 333 ASN A HB2  11 
ATOM 9109  H HD21 . ASN A 1 42 ? -6.007  -15.185 9.622   1.00 0.00 ? 333 ASN A HD21 11 
ATOM 9110  H HD22 . ASN A 1 42 ? -6.489  -16.356 10.797  1.00 0.00 ? 333 ASN A HD22 11 
ATOM 9111  N N    . GLY B 2 1  ? 14.019  -7.036  10.600  1.00 0.00 ? 198 GLY B N    11 
ATOM 9112  C CA   . GLY B 2 1  ? 15.158  -6.772  9.677   1.00 0.00 ? 198 GLY B CA   11 
ATOM 9113  C C    . GLY B 2 1  ? 15.972  -8.019  9.383   1.00 0.00 ? 198 GLY B C    11 
ATOM 9114  O O    . GLY B 2 1  ? 16.113  -8.408  8.224   1.00 0.00 ? 198 GLY B O    11 
ATOM 9115  H H1   . GLY B 2 1  ? 13.117  -6.843  10.119  1.00 0.00 ? 198 GLY B H1   11 
ATOM 9116  H H2   . GLY B 2 1  ? 14.090  -6.426  11.439  1.00 0.00 ? 198 GLY B H2   11 
ATOM 9117  H H3   . GLY B 2 1  ? 14.030  -8.030  10.906  1.00 0.00 ? 198 GLY B H3   11 
ATOM 9118  H HA2  . GLY B 2 1  ? 14.770  -6.381  8.747   1.00 0.00 ? 198 GLY B HA2  11 
ATOM 9119  H HA3  . GLY B 2 1  ? 15.804  -6.030  10.123  1.00 0.00 ? 198 GLY B HA3  11 
ATOM 9120  N N    . PRO B 2 2  ? 16.525  -8.668  10.422  1.00 0.00 ? 199 PRO B N    11 
ATOM 9121  C CA   . PRO B 2 2  ? 17.330  -9.877  10.265  1.00 0.00 ? 199 PRO B CA   11 
ATOM 9122  C C    . PRO B 2 2  ? 16.494  -11.154 10.285  1.00 0.00 ? 199 PRO B C    11 
ATOM 9123  O O    . PRO B 2 2  ? 16.996  -12.227 10.621  1.00 0.00 ? 199 PRO B O    11 
ATOM 9124  C CB   . PRO B 2 2  ? 18.236  -9.819  11.489  1.00 0.00 ? 199 PRO B CB   11 
ATOM 9125  C CG   . PRO B 2 2  ? 17.397  -9.182  12.546  1.00 0.00 ? 199 PRO B CG   11 
ATOM 9126  C CD   . PRO B 2 2  ? 16.423  -8.266  11.837  1.00 0.00 ? 199 PRO B CD   11 
ATOM 9127  H HA   . PRO B 2 2  ? 17.928  -9.846  9.367   1.00 0.00 ? 199 PRO B HA   11 
ATOM 9128  H HB2  . PRO B 2 2  ? 18.535  -10.820 11.768  1.00 0.00 ? 199 PRO B HB2  11 
ATOM 9129  H HG2  . PRO B 2 2  ? 16.861  -9.942  13.094  1.00 0.00 ? 199 PRO B HG2  11 
ATOM 9130  H HD2  . PRO B 2 2  ? 15.421  -8.423  12.209  1.00 0.00 ? 199 PRO B HD2  11 
ATOM 9131  N N    . LEU B 2 3  ? 15.219  -11.037 9.926   1.00 0.00 ? 200 LEU B N    11 
ATOM 9132  C CA   . LEU B 2 3  ? 14.324  -12.188 9.908   1.00 0.00 ? 200 LEU B CA   11 
ATOM 9133  C C    . LEU B 2 3  ? 13.901  -12.530 8.483   1.00 0.00 ? 200 LEU B C    11 
ATOM 9134  O O    . LEU B 2 3  ? 12.852  -13.133 8.264   1.00 0.00 ? 200 LEU B O    11 
ATOM 9135  C CB   . LEU B 2 3  ? 13.088  -11.911 10.766  1.00 0.00 ? 200 LEU B CB   11 
ATOM 9136  C CG   . LEU B 2 3  ? 12.287  -10.671 10.366  1.00 0.00 ? 200 LEU B CG   11 
ATOM 9137  C CD1  . LEU B 2 3  ? 11.220  -11.031 9.344   1.00 0.00 ? 200 LEU B CD1  11 
ATOM 9138  C CD2  . LEU B 2 3  ? 11.661  -10.024 11.592  1.00 0.00 ? 200 LEU B CD2  11 
ATOM 9139  H H    . LEU B 2 3  ? 14.874  -10.159 9.666   1.00 0.00 ? 200 LEU B H    11 
ATOM 9140  H HA   . LEU B 2 3  ? 14.858  -13.029 10.324  1.00 0.00 ? 200 LEU B HA   11 
ATOM 9141  H HB2  . LEU B 2 3  ? 12.435  -12.771 10.707  1.00 0.00 ? 200 LEU B HB2  11 
ATOM 9142  H HG   . LEU B 2 3  ? 12.953  -9.952  9.911   1.00 0.00 ? 200 LEU B HG   11 
ATOM 9143  H HD11 . LEU B 2 3  ? 10.385  -10.352 9.439   1.00 0.00 ? 200 LEU B HD11 11 
ATOM 9144  H HD12 . LEU B 2 3  ? 11.633  -10.956 8.349   1.00 0.00 ? 200 LEU B HD12 11 
ATOM 9145  H HD13 . LEU B 2 3  ? 10.883  -12.043 9.517   1.00 0.00 ? 200 LEU B HD13 11 
ATOM 9146  H HD21 . LEU B 2 3  ? 10.657  -9.702  11.357  1.00 0.00 ? 200 LEU B HD21 11 
ATOM 9147  H HD22 . LEU B 2 3  ? 11.629  -10.739 12.400  1.00 0.00 ? 200 LEU B HD22 11 
ATOM 9148  H HD23 . LEU B 2 3  ? 12.252  -9.170  11.889  1.00 0.00 ? 200 LEU B HD23 11 
ATOM 9149  N N    . GLY B 2 4  ? 14.727  -12.142 7.516   1.00 0.00 ? 201 GLY B N    11 
ATOM 9150  C CA   . GLY B 2 4  ? 14.420  -12.417 6.125   1.00 0.00 ? 201 GLY B CA   11 
ATOM 9151  C C    . GLY B 2 4  ? 13.859  -11.207 5.405   1.00 0.00 ? 201 GLY B C    11 
ATOM 9152  O O    . GLY B 2 4  ? 12.687  -10.869 5.565   1.00 0.00 ? 201 GLY B O    11 
ATOM 9153  H H    . GLY B 2 4  ? 15.551  -11.665 7.749   1.00 0.00 ? 201 GLY B H    11 
ATOM 9154  H HA2  . GLY B 2 4  ? 15.322  -12.735 5.624   1.00 0.00 ? 201 GLY B HA2  11 
ATOM 9155  H HA3  . GLY B 2 4  ? 13.695  -13.217 6.080   1.00 0.00 ? 201 GLY B HA3  11 
ATOM 9156  N N    . SER B 2 5  ? 14.698  -10.553 4.609   1.00 0.00 ? 202 SER B N    11 
ATOM 9157  C CA   . SER B 2 5  ? 14.280  -9.373  3.862   1.00 0.00 ? 202 SER B CA   11 
ATOM 9158  C C    . SER B 2 5  ? 13.610  -8.356  4.781   1.00 0.00 ? 202 SER B C    11 
ATOM 9159  O O    . SER B 2 5  ? 13.537  -8.556  5.994   1.00 0.00 ? 202 SER B O    11 
ATOM 9160  C CB   . SER B 2 5  ? 13.324  -9.770  2.736   1.00 0.00 ? 202 SER B CB   11 
ATOM 9161  O OG   . SER B 2 5  ? 12.144  -10.360 3.254   1.00 0.00 ? 202 SER B OG   11 
ATOM 9162  H H    . SER B 2 5  ? 15.622  -10.872 4.522   1.00 0.00 ? 202 SER B H    11 
ATOM 9163  H HA   . SER B 2 5  ? 15.163  -8.925  3.431   1.00 0.00 ? 202 SER B HA   11 
ATOM 9164  H HB2  . SER B 2 5  ? 13.053  -8.892  2.169   1.00 0.00 ? 202 SER B HB2  11 
ATOM 9165  H HG   . SER B 2 5  ? 11.504  -9.673  3.456   1.00 0.00 ? 202 SER B HG   11 
ATOM 9166  N N    . GLU B 2 6  ? 13.122  -7.268  4.195   1.00 0.00 ? 203 GLU B N    11 
ATOM 9167  C CA   . GLU B 2 6  ? 12.459  -6.218  4.963   1.00 0.00 ? 203 GLU B CA   11 
ATOM 9168  C C    . GLU B 2 6  ? 11.045  -5.972  4.444   1.00 0.00 ? 203 GLU B C    11 
ATOM 9169  O O    . GLU B 2 6  ? 10.840  -5.159  3.543   1.00 0.00 ? 203 GLU B O    11 
ATOM 9170  C CB   . GLU B 2 6  ? 13.269  -4.922  4.897   1.00 0.00 ? 203 GLU B CB   11 
ATOM 9171  C CG   . GLU B 2 6  ? 12.614  -3.758  5.621   1.00 0.00 ? 203 GLU B CG   11 
ATOM 9172  C CD   . GLU B 2 6  ? 12.772  -2.446  4.878   1.00 0.00 ? 203 GLU B CD   11 
ATOM 9173  O OE1  . GLU B 2 6  ? 13.808  -1.775  5.072   1.00 0.00 ? 203 GLU B OE1  11 
ATOM 9174  O OE2  . GLU B 2 6  ? 11.859  -2.089  4.104   1.00 0.00 ? 203 GLU B OE2  11 
ATOM 9175  H H    . GLU B 2 6  ? 13.209  -7.167  3.225   1.00 0.00 ? 203 GLU B H    11 
ATOM 9176  H HA   . GLU B 2 6  ? 12.404  -6.544  5.991   1.00 0.00 ? 203 GLU B HA   11 
ATOM 9177  H HB2  . GLU B 2 6  ? 14.240  -5.093  5.337   1.00 0.00 ? 203 GLU B HB2  11 
ATOM 9178  H HG2  . GLU B 2 6  ? 11.561  -3.966  5.731   1.00 0.00 ? 203 GLU B HG2  11 
ATOM 9179  N N    . LEU B 2 7  ? 10.071  -6.677  5.014   1.00 0.00 ? 204 LEU B N    11 
ATOM 9180  C CA   . LEU B 2 7  ? 8.680   -6.526  4.603   1.00 0.00 ? 204 LEU B CA   11 
ATOM 9181  C C    . LEU B 2 7  ? 7.741   -6.637  5.801   1.00 0.00 ? 204 LEU B C    11 
ATOM 9182  O O    . LEU B 2 7  ? 8.152   -7.038  6.890   1.00 0.00 ? 204 LEU B O    11 
ATOM 9183  C CB   . LEU B 2 7  ? 8.320   -7.582  3.555   1.00 0.00 ? 204 LEU B CB   11 
ATOM 9184  C CG   . LEU B 2 7  ? 7.772   -7.028  2.238   1.00 0.00 ? 204 LEU B CG   11 
ATOM 9185  C CD1  . LEU B 2 7  ? 8.801   -6.131  1.567   1.00 0.00 ? 204 LEU B CD1  11 
ATOM 9186  C CD2  . LEU B 2 7  ? 7.367   -8.164  1.311   1.00 0.00 ? 204 LEU B CD2  11 
ATOM 9187  H H    . LEU B 2 7  ? 10.292  -7.313  5.726   1.00 0.00 ? 204 LEU B H    11 
ATOM 9188  H HA   . LEU B 2 7  ? 8.569   -5.546  4.165   1.00 0.00 ? 204 LEU B HA   11 
ATOM 9189  H HB2  . LEU B 2 7  ? 9.207   -8.159  3.337   1.00 0.00 ? 204 LEU B HB2  11 
ATOM 9190  H HG   . LEU B 2 7  ? 6.894   -6.433  2.444   1.00 0.00 ? 204 LEU B HG   11 
ATOM 9191  H HD11 . LEU B 2 7  ? 8.853   -5.187  2.091   1.00 0.00 ? 204 LEU B HD11 11 
ATOM 9192  H HD12 . LEU B 2 7  ? 9.769   -6.610  1.593   1.00 0.00 ? 204 LEU B HD12 11 
ATOM 9193  H HD13 . LEU B 2 7  ? 8.513   -5.958  0.541   1.00 0.00 ? 204 LEU B HD13 11 
ATOM 9194  H HD21 . LEU B 2 7  ? 6.455   -8.617  1.674   1.00 0.00 ? 204 LEU B HD21 11 
ATOM 9195  H HD22 . LEU B 2 7  ? 7.205   -7.776  0.317   1.00 0.00 ? 204 LEU B HD22 11 
ATOM 9196  H HD23 . LEU B 2 7  ? 8.151   -8.905  1.285   1.00 0.00 ? 204 LEU B HD23 11 
ATOM 9197  N N    . GLU B 2 8  ? 6.478   -6.279  5.590   1.00 0.00 ? 205 GLU B N    11 
ATOM 9198  C CA   . GLU B 2 8  ? 5.477   -6.337  6.652   1.00 0.00 ? 205 GLU B CA   11 
ATOM 9199  C C    . GLU B 2 8  ? 5.717   -5.239  7.688   1.00 0.00 ? 205 GLU B C    11 
ATOM 9200  O O    . GLU B 2 8  ? 5.967   -5.515  8.862   1.00 0.00 ? 205 GLU B O    11 
ATOM 9201  C CB   . GLU B 2 8  ? 5.491   -7.717  7.320   1.00 0.00 ? 205 GLU B CB   11 
ATOM 9202  C CG   . GLU B 2 8  ? 4.185   -8.479  7.174   1.00 0.00 ? 205 GLU B CG   11 
ATOM 9203  C CD   . GLU B 2 8  ? 4.374   -9.981  7.237   1.00 0.00 ? 205 GLU B CD   11 
ATOM 9204  O OE1  . GLU B 2 8  ? 4.564   -10.509 8.352   1.00 0.00 ? 205 GLU B OE1  11 
ATOM 9205  O OE2  . GLU B 2 8  ? 4.333   -10.630 6.170   1.00 0.00 ? 205 GLU B OE2  11 
ATOM 9206  H H    . GLU B 2 8  ? 6.214   -5.966  4.700   1.00 0.00 ? 205 GLU B H    11 
ATOM 9207  H HA   . GLU B 2 8  ? 4.509   -6.177  6.200   1.00 0.00 ? 205 GLU B HA   11 
ATOM 9208  H HB2  . GLU B 2 8  ? 6.278   -8.309  6.880   1.00 0.00 ? 205 GLU B HB2  11 
ATOM 9209  H HG2  . GLU B 2 8  ? 3.519   -8.182  7.970   1.00 0.00 ? 205 GLU B HG2  11 
ATOM 9210  N N    . SER B 2 9  ? 5.641   -3.990  7.240   1.00 0.00 ? 206 SER B N    11 
ATOM 9211  C CA   . SER B 2 9  ? 5.848   -2.847  8.129   1.00 0.00 ? 206 SER B CA   11 
ATOM 9212  C C    . SER B 2 9  ? 5.665   -1.500  7.416   1.00 0.00 ? 206 SER B C    11 
ATOM 9213  O O    . SER B 2 9  ? 4.959   -0.623  7.914   1.00 0.00 ? 206 SER B O    11 
ATOM 9214  C CB   . SER B 2 9  ? 7.246   -2.913  8.746   1.00 0.00 ? 206 SER B CB   11 
ATOM 9215  O OG   . SER B 2 9  ? 7.190   -3.361  10.088  1.00 0.00 ? 206 SER B OG   11 
ATOM 9216  H H    . SER B 2 9  ? 5.442   -3.840  6.300   1.00 0.00 ? 206 SER B H    11 
ATOM 9217  H HA   . SER B 2 9  ? 5.120   -2.915  8.923   1.00 0.00 ? 206 SER B HA   11 
ATOM 9218  H HB2  . SER B 2 9  ? 7.857   -3.598  8.177   1.00 0.00 ? 206 SER B HB2  11 
ATOM 9219  H HG   . SER B 2 9  ? 7.151   -4.320  10.105  1.00 0.00 ? 206 SER B HG   11 
ATOM 9220  N N    . PRO B 2 10 ? 6.299   -1.316  6.242   1.00 0.00 ? 207 PRO B N    11 
ATOM 9221  C CA   . PRO B 2 10 ? 6.229   -0.061  5.476   1.00 0.00 ? 207 PRO B CA   11 
ATOM 9222  C C    . PRO B 2 10 ? 4.865   0.270   4.842   1.00 0.00 ? 207 PRO B C    11 
ATOM 9223  O O    . PRO B 2 10 ? 4.534   1.449   4.728   1.00 0.00 ? 207 PRO B O    11 
ATOM 9224  C CB   . PRO B 2 10 ? 7.289   -0.245  4.381   1.00 0.00 ? 207 PRO B CB   11 
ATOM 9225  C CG   . PRO B 2 10 ? 8.081   -1.444  4.778   1.00 0.00 ? 207 PRO B CG   11 
ATOM 9226  C CD   . PRO B 2 10 ? 7.145   -2.305  5.563   1.00 0.00 ? 207 PRO B CD   11 
ATOM 9227  H HA   . PRO B 2 10 ? 6.518   0.770   6.091   1.00 0.00 ? 207 PRO B HA   11 
ATOM 9228  H HB2  . PRO B 2 10 ? 6.803   -0.393  3.432   1.00 0.00 ? 207 PRO B HB2  11 
ATOM 9229  H HG2  . PRO B 2 10 ? 8.425   -1.967  3.898   1.00 0.00 ? 207 PRO B HG2  11 
ATOM 9230  H HD2  . PRO B 2 10 ? 6.562   -2.924  4.898   1.00 0.00 ? 207 PRO B HD2  11 
ATOM 9231  N N    . PRO B 2 11 ? 4.054   -0.728  4.410   1.00 0.00 ? 208 PRO B N    11 
ATOM 9232  C CA   . PRO B 2 11 ? 2.769   -0.463  3.777   1.00 0.00 ? 208 PRO B CA   11 
ATOM 9233  C C    . PRO B 2 11 ? 2.017   0.710   4.388   1.00 0.00 ? 208 PRO B C    11 
ATOM 9234  O O    . PRO B 2 11 ? 1.686   0.683   5.573   1.00 0.00 ? 208 PRO B O    11 
ATOM 9235  C CB   . PRO B 2 11 ? 1.976   -1.741  4.005   1.00 0.00 ? 208 PRO B CB   11 
ATOM 9236  C CG   . PRO B 2 11 ? 2.988   -2.818  4.180   1.00 0.00 ? 208 PRO B CG   11 
ATOM 9237  C CD   . PRO B 2 11 ? 4.313   -2.168  4.486   1.00 0.00 ? 208 PRO B CD   11 
ATOM 9238  H HA   . PRO B 2 11 ? 2.887   -0.311  2.724   1.00 0.00 ? 208 PRO B HA   11 
ATOM 9239  H HB2  . PRO B 2 11 ? 1.360   -1.626  4.880   1.00 0.00 ? 208 PRO B HB2  11 
ATOM 9240  H HG2  . PRO B 2 11 ? 2.695   -3.459  4.997   1.00 0.00 ? 208 PRO B HG2  11 
ATOM 9241  H HD2  . PRO B 2 11 ? 4.626   -2.444  5.464   1.00 0.00 ? 208 PRO B HD2  11 
ATOM 9242  N N    . PRO B 2 12 ? 1.782   1.775   3.601   1.00 0.00 ? 209 PRO B N    11 
ATOM 9243  C CA   . PRO B 2 12 ? 1.025   2.945   4.044   1.00 0.00 ? 209 PRO B CA   11 
ATOM 9244  C C    . PRO B 2 12 ? -0.271  2.544   4.746   1.00 0.00 ? 209 PRO B C    11 
ATOM 9245  O O    . PRO B 2 12 ? -0.506  1.367   5.007   1.00 0.00 ? 209 PRO B O    11 
ATOM 9246  C CB   . PRO B 2 12 ? 0.722   3.686   2.729   1.00 0.00 ? 209 PRO B CB   11 
ATOM 9247  C CG   . PRO B 2 12 ? 1.197   2.796   1.640   1.00 0.00 ? 209 PRO B CG   11 
ATOM 9248  C CD   . PRO B 2 12 ? 2.273   1.968   2.234   1.00 0.00 ? 209 PRO B CD   11 
ATOM 9249  H HA   . PRO B 2 12 ? 1.611   3.576   4.695   1.00 0.00 ? 209 PRO B HA   11 
ATOM 9250  H HB2  . PRO B 2 12 ? -0.335  3.844   2.644   1.00 0.00 ? 209 PRO B HB2  11 
ATOM 9251  H HG2  . PRO B 2 12 ? 0.389   2.164   1.321   1.00 0.00 ? 209 PRO B HG2  11 
ATOM 9252  H HD2  . PRO B 2 12 ? 2.359   1.040   1.700   1.00 0.00 ? 209 PRO B HD2  11 
ATOM 9253  N N    . PRO B 2 13 ? -1.152  3.509   5.035   1.00 0.00 ? 210 PRO B N    11 
ATOM 9254  C CA   . PRO B 2 13 ? -2.402  3.241   5.715   1.00 0.00 ? 210 PRO B CA   11 
ATOM 9255  C C    . PRO B 2 13 ? -3.533  2.977   4.738   1.00 0.00 ? 210 PRO B C    11 
ATOM 9256  O O    . PRO B 2 13 ? -3.372  3.134   3.528   1.00 0.00 ? 210 PRO B O    11 
ATOM 9257  C CB   . PRO B 2 13 ? -2.638  4.542   6.470   1.00 0.00 ? 210 PRO B CB   11 
ATOM 9258  C CG   . PRO B 2 13 ? -2.041  5.604   5.602   1.00 0.00 ? 210 PRO B CG   11 
ATOM 9259  C CD   . PRO B 2 13 ? -1.034  4.931   4.693   1.00 0.00 ? 210 PRO B CD   11 
ATOM 9260  H HA   . PRO B 2 13 ? -2.316  2.421   6.410   1.00 0.00 ? 210 PRO B HA   11 
ATOM 9261  H HB2  . PRO B 2 13 ? -3.699  4.689   6.605   1.00 0.00 ? 210 PRO B HB2  11 
ATOM 9262  H HG2  . PRO B 2 13 ? -2.817  6.066   5.011   1.00 0.00 ? 210 PRO B HG2  11 
ATOM 9263  H HD2  . PRO B 2 13 ? -1.301  5.094   3.658   1.00 0.00 ? 210 PRO B HD2  11 
ATOM 9264  N N    . TYR B 2 14 ? -4.675  2.573   5.266   1.00 0.00 ? 211 TYR B N    11 
ATOM 9265  C CA   . TYR B 2 14 ? -5.830  2.297   4.433   1.00 0.00 ? 211 TYR B CA   11 
ATOM 9266  C C    . TYR B 2 14 ? -6.318  3.586   3.766   1.00 0.00 ? 211 TYR B C    11 
ATOM 9267  O O    . TYR B 2 14 ? -5.856  3.943   2.683   1.00 0.00 ? 211 TYR B O    11 
ATOM 9268  C CB   . TYR B 2 14 ? -6.937  1.653   5.276   1.00 0.00 ? 211 TYR B CB   11 
ATOM 9269  C CG   . TYR B 2 14 ? -8.270  1.559   4.573   1.00 0.00 ? 211 TYR B CG   11 
ATOM 9270  C CD1  . TYR B 2 14 ? -8.440  0.715   3.486   1.00 0.00 ? 211 TYR B CD1  11 
ATOM 9271  C CD2  . TYR B 2 14 ? -9.356  2.315   4.994   1.00 0.00 ? 211 TYR B CD2  11 
ATOM 9272  C CE1  . TYR B 2 14 ? -9.656  0.625   2.836   1.00 0.00 ? 211 TYR B CE1  11 
ATOM 9273  C CE2  . TYR B 2 14 ? -10.576 2.230   4.352   1.00 0.00 ? 211 TYR B CE2  11 
ATOM 9274  C CZ   . TYR B 2 14 ? -10.723 1.385   3.274   1.00 0.00 ? 211 TYR B CZ   11 
ATOM 9275  O OH   . TYR B 2 14 ? -11.939 1.301   2.633   1.00 0.00 ? 211 TYR B OH   11 
ATOM 9276  H H    . TYR B 2 14 ? -4.743  2.459   6.236   1.00 0.00 ? 211 TYR B H    11 
ATOM 9277  H HA   . TYR B 2 14 ? -5.520  1.602   3.664   1.00 0.00 ? 211 TYR B HA   11 
ATOM 9278  H HB2  . TYR B 2 14 ? -6.636  0.652   5.546   1.00 0.00 ? 211 TYR B HB2  11 
ATOM 9279  H HD1  . TYR B 2 14 ? -7.604  0.120   3.154   1.00 0.00 ? 211 TYR B HD1  11 
ATOM 9280  H HD2  . TYR B 2 14 ? -9.238  2.976   5.839   1.00 0.00 ? 211 TYR B HD2  11 
ATOM 9281  H HE1  . TYR B 2 14 ? -9.768  -0.036  1.990   1.00 0.00 ? 211 TYR B HE1  11 
ATOM 9282  H HE2  . TYR B 2 14 ? -11.409 2.824   4.697   1.00 0.00 ? 211 TYR B HE2  11 
ATOM 9283  H HH   . TYR B 2 14 ? -11.853 0.767   1.840   1.00 0.00 ? 211 TYR B HH   11 
ATOM 9284  N N    . SER B 2 15 ? -7.252  4.281   4.415   1.00 0.00 ? 212 SER B N    11 
ATOM 9285  C CA   . SER B 2 15 ? -7.790  5.537   3.894   1.00 0.00 ? 212 SER B CA   11 
ATOM 9286  C C    . SER B 2 15 ? -8.227  5.432   2.428   1.00 0.00 ? 212 SER B C    11 
ATOM 9287  O O    . SER B 2 15 ? -8.381  6.451   1.755   1.00 0.00 ? 212 SER B O    11 
ATOM 9288  C CB   . SER B 2 15 ? -6.755  6.652   4.046   1.00 0.00 ? 212 SER B CB   11 
ATOM 9289  O OG   . SER B 2 15 ? -5.550  6.158   4.603   1.00 0.00 ? 212 SER B OG   11 
ATOM 9290  H H    . SER B 2 15 ? -7.581  3.951   5.275   1.00 0.00 ? 212 SER B H    11 
ATOM 9291  H HA   . SER B 2 15 ? -8.655  5.789   4.489   1.00 0.00 ? 212 SER B HA   11 
ATOM 9292  H HB2  . SER B 2 15 ? -6.542  7.077   3.078   1.00 0.00 ? 212 SER B HB2  11 
ATOM 9293  H HG   . SER B 2 15 ? -5.574  6.253   5.557   1.00 0.00 ? 212 SER B HG   11 
ATOM 9294  N N    . ARG B 2 16 ? -8.442  4.210   1.941   1.00 0.00 ? 213 ARG B N    11 
ATOM 9295  C CA   . ARG B 2 16 ? -8.877  3.988   0.561   1.00 0.00 ? 213 ARG B CA   11 
ATOM 9296  C C    . ARG B 2 16 ? -7.843  4.440   -0.482  1.00 0.00 ? 213 ARG B C    11 
ATOM 9297  O O    . ARG B 2 16 ? -7.362  3.630   -1.274  1.00 0.00 ? 213 ARG B O    11 
ATOM 9298  C CB   . ARG B 2 16 ? -10.207 4.704   0.308   1.00 0.00 ? 213 ARG B CB   11 
ATOM 9299  C CG   . ARG B 2 16 ? -11.403 3.986   0.906   1.00 0.00 ? 213 ARG B CG   11 
ATOM 9300  C CD   . ARG B 2 16 ? -12.431 3.629   -0.154  1.00 0.00 ? 213 ARG B CD   11 
ATOM 9301  N NE   . ARG B 2 16 ? -13.542 4.577   -0.178  1.00 0.00 ? 213 ARG B NE   11 
ATOM 9302  C CZ   . ARG B 2 16 ? -14.589 4.463   -0.989  1.00 0.00 ? 213 ARG B CZ   11 
ATOM 9303  N NH1  . ARG B 2 16 ? -14.666 3.449   -1.839  1.00 0.00 ? 213 ARG B NH1  11 
ATOM 9304  N NH2  . ARG B 2 16 ? -15.560 5.365   -0.951  1.00 0.00 ? 213 ARG B NH2  11 
ATOM 9305  H H    . ARG B 2 16 ? -8.335  3.437   2.530   1.00 0.00 ? 213 ARG B H    11 
ATOM 9306  H HA   . ARG B 2 16 ? -9.035  2.927   0.441   1.00 0.00 ? 213 ARG B HA   11 
ATOM 9307  H HB2  . ARG B 2 16 ? -10.163 5.692   0.738   1.00 0.00 ? 213 ARG B HB2  11 
ATOM 9308  H HG2  . ARG B 2 16 ? -11.063 3.082   1.381   1.00 0.00 ? 213 ARG B HG2  11 
ATOM 9309  H HD2  . ARG B 2 16 ? -11.948 3.631   -1.119  1.00 0.00 ? 213 ARG B HD2  11 
ATOM 9310  H HE   . ARG B 2 16 ? -13.507 5.334   0.442   1.00 0.00 ? 213 ARG B HE   11 
ATOM 9311  H HH11 . ARG B 2 16 ? -13.936 2.766   -1.872  1.00 0.00 ? 213 ARG B HH11 11 
ATOM 9312  H HH12 . ARG B 2 16 ? -15.455 3.366   -2.449  1.00 0.00 ? 213 ARG B HH12 11 
ATOM 9313  H HH21 . ARG B 2 16 ? -15.506 6.131   -0.310  1.00 0.00 ? 213 ARG B HH21 11 
ATOM 9314  H HH22 . ARG B 2 16 ? -16.346 5.278   -1.563  1.00 0.00 ? 213 ARG B HH22 11 
ATOM 9315  N N    . TYR B 2 17 ? -7.507  5.728   -0.481  1.00 0.00 ? 214 TYR B N    11 
ATOM 9316  C CA   . TYR B 2 17 ? -6.576  6.287   -1.459  1.00 0.00 ? 214 TYR B CA   11 
ATOM 9317  C C    . TYR B 2 17 ? -5.148  5.781   -1.267  1.00 0.00 ? 214 TYR B C    11 
ATOM 9318  O O    . TYR B 2 17 ? -4.816  5.195   -0.237  1.00 0.00 ? 214 TYR B O    11 
ATOM 9319  C CB   . TYR B 2 17 ? -6.605  7.816   -1.392  1.00 0.00 ? 214 TYR B CB   11 
ATOM 9320  C CG   . TYR B 2 17 ? -7.991  8.393   -1.189  1.00 0.00 ? 214 TYR B CG   11 
ATOM 9321  C CD1  . TYR B 2 17 ? -9.129  7.671   -1.534  1.00 0.00 ? 214 TYR B CD1  11 
ATOM 9322  C CD2  . TYR B 2 17 ? -8.159  9.659   -0.647  1.00 0.00 ? 214 TYR B CD2  11 
ATOM 9323  C CE1  . TYR B 2 17 ? -10.391 8.192   -1.344  1.00 0.00 ? 214 TYR B CE1  11 
ATOM 9324  C CE2  . TYR B 2 17 ? -9.419  10.190  -0.453  1.00 0.00 ? 214 TYR B CE2  11 
ATOM 9325  C CZ   . TYR B 2 17 ? -10.532 9.453   -0.801  1.00 0.00 ? 214 TYR B CZ   11 
ATOM 9326  O OH   . TYR B 2 17 ? -11.789 9.978   -0.609  1.00 0.00 ? 214 TYR B OH   11 
ATOM 9327  H H    . TYR B 2 17 ? -7.887  6.320   0.198   1.00 0.00 ? 214 TYR B H    11 
ATOM 9328  H HA   . TYR B 2 17 ? -6.915  5.982   -2.438  1.00 0.00 ? 214 TYR B HA   11 
ATOM 9329  H HB2  . TYR B 2 17 ? -5.988  8.145   -0.570  1.00 0.00 ? 214 TYR B HB2  11 
ATOM 9330  H HD1  . TYR B 2 17 ? -9.014  6.684   -1.959  1.00 0.00 ? 214 TYR B HD1  11 
ATOM 9331  H HD2  . TYR B 2 17 ? -7.285  10.232  -0.374  1.00 0.00 ? 214 TYR B HD2  11 
ATOM 9332  H HE1  . TYR B 2 17 ? -11.259 7.611   -1.614  1.00 0.00 ? 214 TYR B HE1  11 
ATOM 9333  H HE2  . TYR B 2 17 ? -9.529  11.176  -0.030  1.00 0.00 ? 214 TYR B HE2  11 
ATOM 9334  H HH   . TYR B 2 17 ? -12.224 9.510   0.108   1.00 0.00 ? 214 TYR B HH   11 
ATOM 9335  N N    . PRO B 2 18 ? -4.286  6.008   -2.279  1.00 0.00 ? 215 PRO B N    11 
ATOM 9336  C CA   . PRO B 2 18 ? -2.891  5.588   -2.256  1.00 0.00 ? 215 PRO B CA   11 
ATOM 9337  C C    . PRO B 2 18 ? -1.964  6.664   -1.707  1.00 0.00 ? 215 PRO B C    11 
ATOM 9338  O O    . PRO B 2 18 ? -1.511  7.539   -2.446  1.00 0.00 ? 215 PRO B O    11 
ATOM 9339  C CB   . PRO B 2 18 ? -2.609  5.349   -3.736  1.00 0.00 ? 215 PRO B CB   11 
ATOM 9340  C CG   . PRO B 2 18 ? -3.431  6.380   -4.439  1.00 0.00 ? 215 PRO B CG   11 
ATOM 9341  C CD   . PRO B 2 18 ? -4.613  6.687   -3.547  1.00 0.00 ? 215 PRO B CD   11 
ATOM 9342  H HA   . PRO B 2 18 ? -2.760  4.673   -1.702  1.00 0.00 ? 215 PRO B HA   11 
ATOM 9343  H HB2  . PRO B 2 18 ? -1.553  5.481   -3.935  1.00 0.00 ? 215 PRO B HB2  11 
ATOM 9344  H HG2  . PRO B 2 18 ? -2.842  7.272   -4.591  1.00 0.00 ? 215 PRO B HG2  11 
ATOM 9345  H HD2  . PRO B 2 18 ? -4.704  7.753   -3.398  1.00 0.00 ? 215 PRO B HD2  11 
ATOM 9346  N N    . MET B 2 19 ? -1.685  6.602   -0.412  1.00 0.00 ? 216 MET B N    11 
ATOM 9347  C CA   . MET B 2 19 ? -0.811  7.581   0.220   1.00 0.00 ? 216 MET B CA   11 
ATOM 9348  C C    . MET B 2 19 ? 0.265   6.903   1.059   1.00 0.00 ? 216 MET B C    11 
ATOM 9349  O O    . MET B 2 19 ? -0.030  6.269   2.070   1.00 0.00 ? 216 MET B O    11 
ATOM 9350  C CB   . MET B 2 19 ? -1.632  8.539   1.082   1.00 0.00 ? 216 MET B CB   11 
ATOM 9351  C CG   . MET B 2 19 ? -2.236  7.882   2.313   1.00 0.00 ? 216 MET B CG   11 
ATOM 9352  S SD   . MET B 2 19 ? -3.953  8.361   2.583   1.00 0.00 ? 216 MET B SD   11 
ATOM 9353  C CE   . MET B 2 19 ? -4.792  7.307   1.403   1.00 0.00 ? 216 MET B CE   11 
ATOM 9354  H H    . MET B 2 19 ? -2.073  5.883   0.129   1.00 0.00 ? 216 MET B H    11 
ATOM 9355  H HA   . MET B 2 19 ? -0.326  8.141   -0.565  1.00 0.00 ? 216 MET B HA   11 
ATOM 9356  H HB2  . MET B 2 19 ? -0.997  9.349   1.407   1.00 0.00 ? 216 MET B HB2  11 
ATOM 9357  H HG2  . MET B 2 19 ? -2.192  6.810   2.189   1.00 0.00 ? 216 MET B HG2  11 
ATOM 9358  H HE1  . MET B 2 19 ? -5.832  7.590   1.340   1.00 0.00 ? 216 MET B HE1  11 
ATOM 9359  H HE2  . MET B 2 19 ? -4.331  7.415   0.432   1.00 0.00 ? 216 MET B HE2  11 
ATOM 9360  H HE3  . MET B 2 19 ? -4.719  6.278   1.723   1.00 0.00 ? 216 MET B HE3  11 
ATOM 9361  N N    . ASP B 2 20 ? 1.515   7.053   0.630   1.00 0.00 ? 217 ASP B N    11 
ATOM 9362  C CA   . ASP B 2 20 ? 2.648   6.462   1.334   1.00 0.00 ? 217 ASP B CA   11 
ATOM 9363  C C    . ASP B 2 20 ? 2.587   6.771   2.826   1.00 0.00 ? 217 ASP B C    11 
ATOM 9364  O O    . ASP B 2 20 ? 3.178   6.003   3.613   1.00 0.00 ? 217 ASP B O    11 
ATOM 9365  C CB   . ASP B 2 20 ? 3.963   6.980   0.749   1.00 0.00 ? 217 ASP B CB   11 
ATOM 9366  C CG   . ASP B 2 20 ? 4.056   8.492   0.783   1.00 0.00 ? 217 ASP B CG   11 
ATOM 9367  O OD1  . ASP B 2 20 ? 3.604   9.091   1.782   1.00 0.00 ? 217 ASP B OD1  11 
ATOM 9368  O OD2  . ASP B 2 20 ? 4.580   9.078   -0.187  1.00 0.00 ? 217 ASP B OD2  11 
ATOM 9369  O OXT  . ASP B 2 20 ? 1.950   7.781   3.196   1.00 0.00 ? 217 ASP B OXT  11 
ATOM 9370  H H    . ASP B 2 20 ? 1.679   7.574   -0.184  1.00 0.00 ? 217 ASP B H    11 
ATOM 9371  H HA   . ASP B 2 20 ? 2.601   5.392   1.197   1.00 0.00 ? 217 ASP B HA   11 
ATOM 9372  H HB2  . ASP B 2 20 ? 4.787   6.575   1.316   1.00 0.00 ? 217 ASP B HB2  11 
ATOM 9373  N N    . GLY A 1 1  ? 10.432  -14.128 -3.503  1.00 0.00 ? 292 GLY A N    12 
ATOM 9374  C CA   . GLY A 1 1  ? 9.224   -13.367 -3.081  1.00 0.00 ? 292 GLY A CA   12 
ATOM 9375  C C    . GLY A 1 1  ? 8.277   -13.094 -4.234  1.00 0.00 ? 292 GLY A C    12 
ATOM 9376  O O    . GLY A 1 1  ? 8.370   -12.050 -4.881  1.00 0.00 ? 292 GLY A O    12 
ATOM 9377  H H1   . GLY A 1 1  ? 10.739  -14.763 -2.737  1.00 0.00 ? 292 GLY A H1   12 
ATOM 9378  H H2   . GLY A 1 1  ? 11.207  -13.473 -3.727  1.00 0.00 ? 292 GLY A H2   12 
ATOM 9379  H H3   . GLY A 1 1  ? 10.218  -14.699 -4.347  1.00 0.00 ? 292 GLY A H3   12 
ATOM 9380  H HA2  . GLY A 1 1  ? 8.699   -13.934 -2.326  1.00 0.00 ? 292 GLY A HA2  12 
ATOM 9381  H HA3  . GLY A 1 1  ? 9.536   -12.425 -2.656  1.00 0.00 ? 292 GLY A HA3  12 
ATOM 9382  N N    . PRO A 1 2  ? 7.349   -14.024 -4.519  1.00 0.00 ? 293 PRO A N    12 
ATOM 9383  C CA   . PRO A 1 2  ? 6.382   -13.868 -5.611  1.00 0.00 ? 293 PRO A CA   12 
ATOM 9384  C C    . PRO A 1 2  ? 5.445   -12.685 -5.390  1.00 0.00 ? 293 PRO A C    12 
ATOM 9385  O O    . PRO A 1 2  ? 5.745   -11.781 -4.610  1.00 0.00 ? 293 PRO A O    12 
ATOM 9386  C CB   . PRO A 1 2  ? 5.591   -15.184 -5.594  1.00 0.00 ? 293 PRO A CB   12 
ATOM 9387  C CG   . PRO A 1 2  ? 6.421   -16.134 -4.800  1.00 0.00 ? 293 PRO A CG   12 
ATOM 9388  C CD   . PRO A 1 2  ? 7.169   -15.296 -3.804  1.00 0.00 ? 293 PRO A CD   12 
ATOM 9389  H HA   . PRO A 1 2  ? 6.879   -13.756 -6.564  1.00 0.00 ? 293 PRO A HA   12 
ATOM 9390  H HB2  . PRO A 1 2  ? 4.628   -15.019 -5.133  1.00 0.00 ? 293 PRO A HB2  12 
ATOM 9391  H HG2  . PRO A 1 2  ? 5.783   -16.841 -4.290  1.00 0.00 ? 293 PRO A HG2  12 
ATOM 9392  H HD2  . PRO A 1 2  ? 6.581   -15.157 -2.908  1.00 0.00 ? 293 PRO A HD2  12 
ATOM 9393  N N    . LEU A 1 3  ? 4.310   -12.701 -6.080  1.00 0.00 ? 294 LEU A N    12 
ATOM 9394  C CA   . LEU A 1 3  ? 3.325   -11.632 -5.959  1.00 0.00 ? 294 LEU A CA   12 
ATOM 9395  C C    . LEU A 1 3  ? 1.908   -12.187 -6.062  1.00 0.00 ? 294 LEU A C    12 
ATOM 9396  O O    . LEU A 1 3  ? 1.035   -11.835 -5.269  1.00 0.00 ? 294 LEU A O    12 
ATOM 9397  C CB   . LEU A 1 3  ? 3.553   -10.577 -7.044  1.00 0.00 ? 294 LEU A CB   12 
ATOM 9398  C CG   . LEU A 1 3  ? 3.365   -9.129  -6.589  1.00 0.00 ? 294 LEU A CG   12 
ATOM 9399  C CD1  . LEU A 1 3  ? 4.329   -8.795  -5.460  1.00 0.00 ? 294 LEU A CD1  12 
ATOM 9400  C CD2  . LEU A 1 3  ? 3.559   -8.174  -7.756  1.00 0.00 ? 294 LEU A CD2  12 
ATOM 9401  H H    . LEU A 1 3  ? 4.130   -13.450 -6.684  1.00 0.00 ? 294 LEU A H    12 
ATOM 9402  H HA   . LEU A 1 3  ? 3.451   -11.173 -4.990  1.00 0.00 ? 294 LEU A HA   12 
ATOM 9403  H HB2  . LEU A 1 3  ? 4.561   -10.687 -7.416  1.00 0.00 ? 294 LEU A HB2  12 
ATOM 9404  H HG   . LEU A 1 3  ? 2.359   -9.003  -6.215  1.00 0.00 ? 294 LEU A HG   12 
ATOM 9405  H HD11 . LEU A 1 3  ? 3.864   -9.023  -4.511  1.00 0.00 ? 294 LEU A HD11 12 
ATOM 9406  H HD12 . LEU A 1 3  ? 5.229   -9.382  -5.570  1.00 0.00 ? 294 LEU A HD12 12 
ATOM 9407  H HD13 . LEU A 1 3  ? 4.575   -7.745  -5.496  1.00 0.00 ? 294 LEU A HD13 12 
ATOM 9408  H HD21 . LEU A 1 3  ? 3.405   -8.705  -8.685  1.00 0.00 ? 294 LEU A HD21 12 
ATOM 9409  H HD22 . LEU A 1 3  ? 2.848   -7.365  -7.682  1.00 0.00 ? 294 LEU A HD22 12 
ATOM 9410  H HD23 . LEU A 1 3  ? 4.562   -7.774  -7.732  1.00 0.00 ? 294 LEU A HD23 12 
ATOM 9411  N N    . GLY A 1 4  ? 1.689   -13.054 -7.043  1.00 0.00 ? 295 GLY A N    12 
ATOM 9412  C CA   . GLY A 1 4  ? 0.376   -13.645 -7.232  1.00 0.00 ? 295 GLY A CA   12 
ATOM 9413  C C    . GLY A 1 4  ? -0.067  -13.623 -8.682  1.00 0.00 ? 295 GLY A C    12 
ATOM 9414  O O    . GLY A 1 4  ? 0.401   -12.801 -9.469  1.00 0.00 ? 295 GLY A O    12 
ATOM 9415  H H    . GLY A 1 4  ? 2.423   -13.297 -7.645  1.00 0.00 ? 295 GLY A H    12 
ATOM 9416  H HA2  . GLY A 1 4  ? 0.401   -14.668 -6.890  1.00 0.00 ? 295 GLY A HA2  12 
ATOM 9417  H HA3  . GLY A 1 4  ? -0.341  -13.095 -6.641  1.00 0.00 ? 295 GLY A HA3  12 
ATOM 9418  N N    . SER A 1 5  ? -0.972  -14.530 -9.035  1.00 0.00 ? 296 SER A N    12 
ATOM 9419  C CA   . SER A 1 5  ? -1.480  -14.612 -10.400 1.00 0.00 ? 296 SER A CA   12 
ATOM 9420  C C    . SER A 1 5  ? -3.005  -14.643 -10.410 1.00 0.00 ? 296 SER A C    12 
ATOM 9421  O O    . SER A 1 5  ? -3.615  -15.712 -10.365 1.00 0.00 ? 296 SER A O    12 
ATOM 9422  C CB   . SER A 1 5  ? -0.927  -15.855 -11.100 1.00 0.00 ? 296 SER A CB   12 
ATOM 9423  O OG   . SER A 1 5  ? -0.921  -15.688 -12.508 1.00 0.00 ? 296 SER A OG   12 
ATOM 9424  H H    . SER A 1 5  ? -1.308  -15.158 -8.362  1.00 0.00 ? 296 SER A H    12 
ATOM 9425  H HA   . SER A 1 5  ? -1.147  -13.733 -10.931 1.00 0.00 ? 296 SER A HA   12 
ATOM 9426  H HB2  . SER A 1 5  ? 0.085   -16.033 -10.768 1.00 0.00 ? 296 SER A HB2  12 
ATOM 9427  H HG   . SER A 1 5  ? -1.817  -15.545 -12.817 1.00 0.00 ? 296 SER A HG   12 
ATOM 9428  N N    . GLY A 1 6  ? -3.613  -13.463 -10.466 1.00 0.00 ? 297 GLY A N    12 
ATOM 9429  C CA   . GLY A 1 6  ? -5.061  -13.372 -10.477 1.00 0.00 ? 297 GLY A CA   12 
ATOM 9430  C C    . GLY A 1 6  ? -5.560  -12.074 -9.871  1.00 0.00 ? 297 GLY A C    12 
ATOM 9431  O O    . GLY A 1 6  ? -4.796  -11.360 -9.227  1.00 0.00 ? 297 GLY A O    12 
ATOM 9432  H H    . GLY A 1 6  ? -3.073  -12.646 -10.501 1.00 0.00 ? 297 GLY A H    12 
ATOM 9433  H HA2  . GLY A 1 6  ? -5.408  -13.437 -11.498 1.00 0.00 ? 297 GLY A HA2  12 
ATOM 9434  H HA3  . GLY A 1 6  ? -5.468  -14.199 -9.915  1.00 0.00 ? 297 GLY A HA3  12 
ATOM 9435  N N    . PRO A 1 7  ? -6.847  -11.741 -10.067 1.00 0.00 ? 298 PRO A N    12 
ATOM 9436  C CA   . PRO A 1 7  ? -7.442  -10.511 -9.531  1.00 0.00 ? 298 PRO A CA   12 
ATOM 9437  C C    . PRO A 1 7  ? -7.589  -10.546 -8.012  1.00 0.00 ? 298 PRO A C    12 
ATOM 9438  O O    . PRO A 1 7  ? -7.464  -11.600 -7.389  1.00 0.00 ? 298 PRO A O    12 
ATOM 9439  C CB   . PRO A 1 7  ? -8.826  -10.450 -10.195 1.00 0.00 ? 298 PRO A CB   12 
ATOM 9440  C CG   . PRO A 1 7  ? -8.800  -11.478 -11.278 1.00 0.00 ? 298 PRO A CG   12 
ATOM 9441  C CD   . PRO A 1 7  ? -7.822  -12.524 -10.833 1.00 0.00 ? 298 PRO A CD   12 
ATOM 9442  H HA   . PRO A 1 7  ? -6.867  -9.639  -9.812  1.00 0.00 ? 298 PRO A HA   12 
ATOM 9443  H HB2  . PRO A 1 7  ? -9.588  -10.673 -9.461  1.00 0.00 ? 298 PRO A HB2  12 
ATOM 9444  H HG2  . PRO A 1 7  ? -9.782  -11.912 -11.399 1.00 0.00 ? 298 PRO A HG2  12 
ATOM 9445  H HD2  . PRO A 1 7  ? -8.308  -13.259 -10.208 1.00 0.00 ? 298 PRO A HD2  12 
ATOM 9446  N N    . LEU A 1 8  ? -7.857  -9.383  -7.424  1.00 0.00 ? 299 LEU A N    12 
ATOM 9447  C CA   . LEU A 1 8  ? -8.030  -9.270  -5.980  1.00 0.00 ? 299 LEU A CA   12 
ATOM 9448  C C    . LEU A 1 8  ? -9.489  -9.496  -5.593  1.00 0.00 ? 299 LEU A C    12 
ATOM 9449  O O    . LEU A 1 8  ? -10.398 -9.158  -6.351  1.00 0.00 ? 299 LEU A O    12 
ATOM 9450  C CB   . LEU A 1 8  ? -7.573  -7.893  -5.494  1.00 0.00 ? 299 LEU A CB   12 
ATOM 9451  C CG   . LEU A 1 8  ? -6.063  -7.732  -5.310  1.00 0.00 ? 299 LEU A CG   12 
ATOM 9452  C CD1  . LEU A 1 8  ? -5.735  -6.336  -4.806  1.00 0.00 ? 299 LEU A CD1  12 
ATOM 9453  C CD2  . LEU A 1 8  ? -5.528  -8.785  -4.352  1.00 0.00 ? 299 LEU A CD2  12 
ATOM 9454  H H    . LEU A 1 8  ? -7.937  -8.577  -7.977  1.00 0.00 ? 299 LEU A H    12 
ATOM 9455  H HA   . LEU A 1 8  ? -7.423  -10.029 -5.509  1.00 0.00 ? 299 LEU A HA   12 
ATOM 9456  H HB2  . LEU A 1 8  ? -7.907  -7.155  -6.210  1.00 0.00 ? 299 LEU A HB2  12 
ATOM 9457  H HG   . LEU A 1 8  ? -5.573  -7.866  -6.264  1.00 0.00 ? 299 LEU A HG   12 
ATOM 9458  H HD11 . LEU A 1 8  ? -6.371  -6.097  -3.967  1.00 0.00 ? 299 LEU A HD11 12 
ATOM 9459  H HD12 . LEU A 1 8  ? -4.701  -6.299  -4.496  1.00 0.00 ? 299 LEU A HD12 12 
ATOM 9460  H HD13 . LEU A 1 8  ? -5.900  -5.619  -5.597  1.00 0.00 ? 299 LEU A HD13 12 
ATOM 9461  H HD21 . LEU A 1 8  ? -4.796  -9.395  -4.860  1.00 0.00 ? 299 LEU A HD21 12 
ATOM 9462  H HD22 . LEU A 1 8  ? -5.065  -8.299  -3.505  1.00 0.00 ? 299 LEU A HD22 12 
ATOM 9463  H HD23 . LEU A 1 8  ? -6.341  -9.408  -4.010  1.00 0.00 ? 299 LEU A HD23 12 
ATOM 9464  N N    . PRO A 1 9  ? -9.732  -10.070 -4.402  1.00 0.00 ? 300 PRO A N    12 
ATOM 9465  C CA   . PRO A 1 9  ? -11.092 -10.332 -3.919  1.00 0.00 ? 300 PRO A CA   12 
ATOM 9466  C C    . PRO A 1 9  ? -11.955 -9.074  -3.938  1.00 0.00 ? 300 PRO A C    12 
ATOM 9467  O O    . PRO A 1 9  ? -11.543 -8.041  -4.466  1.00 0.00 ? 300 PRO A O    12 
ATOM 9468  C CB   . PRO A 1 9  ? -10.878 -10.820 -2.484  1.00 0.00 ? 300 PRO A CB   12 
ATOM 9469  C CG   . PRO A 1 9  ? -9.484  -11.343 -2.460  1.00 0.00 ? 300 PRO A CG   12 
ATOM 9470  C CD   . PRO A 1 9  ? -8.707  -10.506 -3.437  1.00 0.00 ? 300 PRO A CD   12 
ATOM 9471  H HA   . PRO A 1 9  ? -11.574 -11.107 -4.499  1.00 0.00 ? 300 PRO A HA   12 
ATOM 9472  H HB2  . PRO A 1 9  ? -11.005 -9.995  -1.800  1.00 0.00 ? 300 PRO A HB2  12 
ATOM 9473  H HG2  . PRO A 1 9  ? -9.071  -11.239 -1.466  1.00 0.00 ? 300 PRO A HG2  12 
ATOM 9474  H HD2  . PRO A 1 9  ? -8.262  -9.658  -2.938  1.00 0.00 ? 300 PRO A HD2  12 
ATOM 9475  N N    . PRO A 1 10 ? -13.167 -9.140  -3.359  1.00 0.00 ? 301 PRO A N    12 
ATOM 9476  C CA   . PRO A 1 10 ? -14.082 -8.003  -3.320  1.00 0.00 ? 301 PRO A CA   12 
ATOM 9477  C C    . PRO A 1 10 ? -13.804 -7.045  -2.164  1.00 0.00 ? 301 PRO A C    12 
ATOM 9478  O O    . PRO A 1 10 ? -14.628 -6.186  -1.851  1.00 0.00 ? 301 PRO A O    12 
ATOM 9479  C CB   . PRO A 1 10 ? -15.441 -8.674  -3.146  1.00 0.00 ? 301 PRO A CB   12 
ATOM 9480  C CG   . PRO A 1 10 ? -15.154 -9.911  -2.361  1.00 0.00 ? 301 PRO A CG   12 
ATOM 9481  C CD   . PRO A 1 10 ? -13.746 -10.333 -2.711  1.00 0.00 ? 301 PRO A CD   12 
ATOM 9482  H HA   . PRO A 1 10 ? -14.068 -7.455  -4.249  1.00 0.00 ? 301 PRO A HA   12 
ATOM 9483  H HB2  . PRO A 1 10 ? -16.107 -8.012  -2.611  1.00 0.00 ? 301 PRO A HB2  12 
ATOM 9484  H HG2  . PRO A 1 10 ? -15.227 -9.699  -1.305  1.00 0.00 ? 301 PRO A HG2  12 
ATOM 9485  H HD2  . PRO A 1 10 ? -13.200 -10.587 -1.816  1.00 0.00 ? 301 PRO A HD2  12 
ATOM 9486  N N    . GLY A 1 11 ? -12.644 -7.193  -1.532  1.00 0.00 ? 302 GLY A N    12 
ATOM 9487  C CA   . GLY A 1 11 ? -12.292 -6.322  -0.424  1.00 0.00 ? 302 GLY A CA   12 
ATOM 9488  C C    . GLY A 1 11 ? -10.823 -5.948  -0.411  1.00 0.00 ? 302 GLY A C    12 
ATOM 9489  O O    . GLY A 1 11 ? -10.315 -5.449  0.593   1.00 0.00 ? 302 GLY A O    12 
ATOM 9490  H H    . GLY A 1 11 ? -12.023 -7.895  -1.817  1.00 0.00 ? 302 GLY A H    12 
ATOM 9491  H HA2  . GLY A 1 11 ? -12.878 -5.418  -0.493  1.00 0.00 ? 302 GLY A HA2  12 
ATOM 9492  H HA3  . GLY A 1 11 ? -12.532 -6.821  0.503   1.00 0.00 ? 302 GLY A HA3  12 
ATOM 9493  N N    . TRP A 1 12 ? -10.135 -6.191  -1.522  1.00 0.00 ? 303 TRP A N    12 
ATOM 9494  C CA   . TRP A 1 12 ? -8.716  -5.868  -1.622  1.00 0.00 ? 303 TRP A CA   12 
ATOM 9495  C C    . TRP A 1 12 ? -8.424  -5.066  -2.879  1.00 0.00 ? 303 TRP A C    12 
ATOM 9496  O O    . TRP A 1 12 ? -9.167  -5.129  -3.859  1.00 0.00 ? 303 TRP A O    12 
ATOM 9497  C CB   . TRP A 1 12 ? -7.874  -7.141  -1.641  1.00 0.00 ? 303 TRP A CB   12 
ATOM 9498  C CG   . TRP A 1 12 ? -7.929  -7.919  -0.367  1.00 0.00 ? 303 TRP A CG   12 
ATOM 9499  C CD1  . TRP A 1 12 ? -8.766  -8.953  -0.083  1.00 0.00 ? 303 TRP A CD1  12 
ATOM 9500  C CD2  . TRP A 1 12 ? -7.106  -7.735  0.787   1.00 0.00 ? 303 TRP A CD2  12 
ATOM 9501  N NE1  . TRP A 1 12 ? -8.518  -9.425  1.183   1.00 0.00 ? 303 TRP A NE1  12 
ATOM 9502  C CE2  . TRP A 1 12 ? -7.501  -8.695  1.737   1.00 0.00 ? 303 TRP A CE2  12 
ATOM 9503  C CE3  . TRP A 1 12 ? -6.072  -6.853  1.109   1.00 0.00 ? 303 TRP A CE3  12 
ATOM 9504  C CZ2  . TRP A 1 12 ? -6.897  -8.798  2.985   1.00 0.00 ? 303 TRP A CZ2  12 
ATOM 9505  C CZ3  . TRP A 1 12 ? -5.473  -6.958  2.348   1.00 0.00 ? 303 TRP A CZ3  12 
ATOM 9506  C CH2  . TRP A 1 12 ? -5.887  -7.924  3.273   1.00 0.00 ? 303 TRP A CH2  12 
ATOM 9507  H H    . TRP A 1 12 ? -10.587 -6.598  -2.289  1.00 0.00 ? 303 TRP A H    12 
ATOM 9508  H HA   . TRP A 1 12 ? -8.446  -5.280  -0.759  1.00 0.00 ? 303 TRP A HA   12 
ATOM 9509  H HB2  . TRP A 1 12 ? -8.225  -7.781  -2.436  1.00 0.00 ? 303 TRP A HB2  12 
ATOM 9510  H HD1  . TRP A 1 12 ? -9.509  -9.333  -0.764  1.00 0.00 ? 303 TRP A HD1  12 
ATOM 9511  H HE1  . TRP A 1 12 ? -8.991  -10.163 1.617   1.00 0.00 ? 303 TRP A HE1  12 
ATOM 9512  H HE3  . TRP A 1 12 ? -5.740  -6.100  0.410   1.00 0.00 ? 303 TRP A HE3  12 
ATOM 9513  H HZ2  . TRP A 1 12 ? -7.204  -9.538  3.709   1.00 0.00 ? 303 TRP A HZ2  12 
ATOM 9514  H HZ3  . TRP A 1 12 ? -4.672  -6.285  2.615   1.00 0.00 ? 303 TRP A HZ3  12 
ATOM 9515  H HH2  . TRP A 1 12 ? -5.387  -7.973  4.228   1.00 0.00 ? 303 TRP A HH2  12 
ATOM 9516  N N    . GLU A 1 13 ? -7.333  -4.315  -2.843  1.00 0.00 ? 304 GLU A N    12 
ATOM 9517  C CA   . GLU A 1 13 ? -6.921  -3.515  -3.985  1.00 0.00 ? 304 GLU A CA   12 
ATOM 9518  C C    . GLU A 1 13 ? -5.428  -3.242  -3.938  1.00 0.00 ? 304 GLU A C    12 
ATOM 9519  O O    . GLU A 1 13 ? -4.875  -2.923  -2.885  1.00 0.00 ? 304 GLU A O    12 
ATOM 9520  C CB   . GLU A 1 13 ? -7.681  -2.191  -4.029  1.00 0.00 ? 304 GLU A CB   12 
ATOM 9521  C CG   . GLU A 1 13 ? -7.262  -1.301  -5.189  1.00 0.00 ? 304 GLU A CG   12 
ATOM 9522  C CD   . GLU A 1 13 ? -7.470  0.172   -4.898  1.00 0.00 ? 304 GLU A CD   12 
ATOM 9523  O OE1  . GLU A 1 13 ? -8.081  0.492   -3.857  1.00 0.00 ? 304 GLU A OE1  12 
ATOM 9524  O OE2  . GLU A 1 13 ? -7.021  1.006   -5.713  1.00 0.00 ? 304 GLU A OE2  12 
ATOM 9525  H H    . GLU A 1 13 ? -6.793  -4.293  -2.023  1.00 0.00 ? 304 GLU A H    12 
ATOM 9526  H HA   . GLU A 1 13 ? -7.144  -4.078  -4.880  1.00 0.00 ? 304 GLU A HA   12 
ATOM 9527  H HB2  . GLU A 1 13 ? -8.737  -2.396  -4.120  1.00 0.00 ? 304 GLU A HB2  12 
ATOM 9528  H HG2  . GLU A 1 13 ? -6.214  -1.469  -5.394  1.00 0.00 ? 304 GLU A HG2  12 
ATOM 9529  N N    . ILE A 1 14 ? -4.778  -3.369  -5.085  1.00 0.00 ? 305 ILE A N    12 
ATOM 9530  C CA   . ILE A 1 14 ? -3.350  -3.123  -5.176  1.00 0.00 ? 305 ILE A CA   12 
ATOM 9531  C C    . ILE A 1 14 ? -3.080  -1.629  -5.281  1.00 0.00 ? 305 ILE A C    12 
ATOM 9532  O O    . ILE A 1 14 ? -3.893  -0.879  -5.823  1.00 0.00 ? 305 ILE A O    12 
ATOM 9533  C CB   . ILE A 1 14 ? -2.725  -3.840  -6.388  1.00 0.00 ? 305 ILE A CB   12 
ATOM 9534  C CG1  . ILE A 1 14 ? -2.945  -5.352  -6.286  1.00 0.00 ? 305 ILE A CG1  12 
ATOM 9535  C CG2  . ILE A 1 14 ? -1.239  -3.519  -6.486  1.00 0.00 ? 305 ILE A CG2  12 
ATOM 9536  C CD1  . ILE A 1 14 ? -2.180  -6.144  -7.321  1.00 0.00 ? 305 ILE A CD1  12 
ATOM 9537  H H    . ILE A 1 14 ? -5.272  -3.630  -5.890  1.00 0.00 ? 305 ILE A H    12 
ATOM 9538  H HA   . ILE A 1 14 ? -2.886  -3.504  -4.274  1.00 0.00 ? 305 ILE A HA   12 
ATOM 9539  H HB   . ILE A 1 14 ? -3.206  -3.473  -7.282  1.00 0.00 ? 305 ILE A HB   12 
ATOM 9540  H HG12 . ILE A 1 14 ? -2.629  -5.690  -5.311  1.00 0.00 ? 305 ILE A HG12 12 
ATOM 9541  H HG21 . ILE A 1 14 ? -1.114  -2.477  -6.746  1.00 0.00 ? 305 ILE A HG21 12 
ATOM 9542  H HG22 . ILE A 1 14 ? -0.764  -3.711  -5.536  1.00 0.00 ? 305 ILE A HG22 12 
ATOM 9543  H HG23 . ILE A 1 14 ? -0.786  -4.136  -7.248  1.00 0.00 ? 305 ILE A HG23 12 
ATOM 9544  H HD11 . ILE A 1 14 ? -2.368  -5.728  -8.299  1.00 0.00 ? 305 ILE A HD11 12 
ATOM 9545  H HD12 . ILE A 1 14 ? -1.123  -6.093  -7.103  1.00 0.00 ? 305 ILE A HD12 12 
ATOM 9546  H HD13 . ILE A 1 14 ? -2.504  -7.173  -7.297  1.00 0.00 ? 305 ILE A HD13 12 
ATOM 9547  N N    . ARG A 1 15 ? -1.940  -1.202  -4.764  1.00 0.00 ? 306 ARG A N    12 
ATOM 9548  C CA   . ARG A 1 15 ? -1.571  0.204   -4.802  1.00 0.00 ? 306 ARG A CA   12 
ATOM 9549  C C    . ARG A 1 15 ? -0.075  0.374   -4.588  1.00 0.00 ? 306 ARG A C    12 
ATOM 9550  O O    . ARG A 1 15 ? 0.640   -0.593  -4.338  1.00 0.00 ? 306 ARG A O    12 
ATOM 9551  C CB   . ARG A 1 15 ? -2.348  0.979   -3.737  1.00 0.00 ? 306 ARG A CB   12 
ATOM 9552  C CG   . ARG A 1 15 ? -3.686  1.507   -4.229  1.00 0.00 ? 306 ARG A CG   12 
ATOM 9553  C CD   . ARG A 1 15 ? -4.286  2.502   -3.250  1.00 0.00 ? 306 ARG A CD   12 
ATOM 9554  N NE   . ARG A 1 15 ? -5.731  2.629   -3.415  1.00 0.00 ? 306 ARG A NE   12 
ATOM 9555  C CZ   . ARG A 1 15 ? -6.303  3.252   -4.440  1.00 0.00 ? 306 ARG A CZ   12 
ATOM 9556  N NH1  . ARG A 1 15 ? -5.554  3.796   -5.388  1.00 0.00 ? 306 ARG A NH1  12 
ATOM 9557  N NH2  . ARG A 1 15 ? -7.625  3.330   -4.517  1.00 0.00 ? 306 ARG A NH2  12 
ATOM 9558  H H    . ARG A 1 15 ? -1.331  -1.846  -4.347  1.00 0.00 ? 306 ARG A H    12 
ATOM 9559  H HA   . ARG A 1 15 ? -1.831  0.590   -5.776  1.00 0.00 ? 306 ARG A HA   12 
ATOM 9560  H HB2  . ARG A 1 15 ? -2.530  0.327   -2.895  1.00 0.00 ? 306 ARG A HB2  12 
ATOM 9561  H HG2  . ARG A 1 15 ? -3.541  1.997   -5.180  1.00 0.00 ? 306 ARG A HG2  12 
ATOM 9562  H HD2  . ARG A 1 15 ? -4.075  2.172   -2.244  1.00 0.00 ? 306 ARG A HD2  12 
ATOM 9563  H HE   . ARG A 1 15 ? -6.303  2.232   -2.725  1.00 0.00 ? 306 ARG A HE   12 
ATOM 9564  H HH11 . ARG A 1 15 ? -4.557  3.739   -5.333  1.00 0.00 ? 306 ARG A HH11 12 
ATOM 9565  H HH12 . ARG A 1 15 ? -5.985  4.265   -6.159  1.00 0.00 ? 306 ARG A HH12 12 
ATOM 9566  H HH21 . ARG A 1 15 ? -8.193  2.921   -3.803  1.00 0.00 ? 306 ARG A HH21 12 
ATOM 9567  H HH22 . ARG A 1 15 ? -8.052  3.801   -5.289  1.00 0.00 ? 306 ARG A HH22 12 
ATOM 9568  N N    . ASN A 1 16 ? 0.396   1.608   -4.694  1.00 0.00 ? 307 ASN A N    12 
ATOM 9569  C CA   . ASN A 1 16 ? 1.810   1.897   -4.508  1.00 0.00 ? 307 ASN A CA   12 
ATOM 9570  C C    . ASN A 1 16 ? 1.998   3.007   -3.485  1.00 0.00 ? 307 ASN A C    12 
ATOM 9571  O O    . ASN A 1 16 ? 1.113   3.837   -3.282  1.00 0.00 ? 307 ASN A O    12 
ATOM 9572  C CB   . ASN A 1 16 ? 2.451   2.290   -5.835  1.00 0.00 ? 307 ASN A CB   12 
ATOM 9573  C CG   . ASN A 1 16 ? 2.202   1.266   -6.925  1.00 0.00 ? 307 ASN A CG   12 
ATOM 9574  O OD1  . ASN A 1 16 ? 1.060   1.017   -7.309  1.00 0.00 ? 307 ASN A OD1  12 
ATOM 9575  N ND2  . ASN A 1 16 ? 3.274   0.667   -7.431  1.00 0.00 ? 307 ASN A ND2  12 
ATOM 9576  H H    . ASN A 1 16 ? -0.220  2.341   -4.903  1.00 0.00 ? 307 ASN A H    12 
ATOM 9577  H HA   . ASN A 1 16 ? 2.285   0.999   -4.139  1.00 0.00 ? 307 ASN A HA   12 
ATOM 9578  H HB2  . ASN A 1 16 ? 2.039   3.231   -6.153  1.00 0.00 ? 307 ASN A HB2  12 
ATOM 9579  H HD21 . ASN A 1 16 ? 4.154   0.916   -7.077  1.00 0.00 ? 307 ASN A HD21 12 
ATOM 9580  H HD22 . ASN A 1 16 ? 3.141   0.000   -8.138  1.00 0.00 ? 307 ASN A HD22 12 
ATOM 9581  N N    . THR A 1 17 ? 3.163   3.025   -2.850  1.00 0.00 ? 308 THR A N    12 
ATOM 9582  C CA   . THR A 1 17 ? 3.460   4.024   -1.835  1.00 0.00 ? 308 THR A CA   12 
ATOM 9583  C C    . THR A 1 17 ? 3.878   5.350   -2.462  1.00 0.00 ? 308 THR A C    12 
ATOM 9584  O O    . THR A 1 17 ? 3.235   6.377   -2.244  1.00 0.00 ? 308 THR A O    12 
ATOM 9585  C CB   . THR A 1 17 ? 4.563   3.533   -0.883  1.00 0.00 ? 308 THR A CB   12 
ATOM 9586  O OG1  . THR A 1 17 ? 5.750   3.216   -1.622  1.00 0.00 ? 308 THR A OG1  12 
ATOM 9587  C CG2  . THR A 1 17 ? 4.088   2.305   -0.120  1.00 0.00 ? 308 THR A CG2  12 
ATOM 9588  H H    . THR A 1 17 ? 3.841   2.351   -3.074  1.00 0.00 ? 308 THR A H    12 
ATOM 9589  H HA   . THR A 1 17 ? 2.563   4.183   -1.256  1.00 0.00 ? 308 THR A HA   12 
ATOM 9590  H HB   . THR A 1 17 ? 4.785   4.317   -0.173  1.00 0.00 ? 308 THR A HB   12 
ATOM 9591  H HG1  . THR A 1 17 ? 5.624   2.389   -2.092  1.00 0.00 ? 308 THR A HG1  12 
ATOM 9592  H HG21 . THR A 1 17 ? 3.008   2.317   -0.064  1.00 0.00 ? 308 THR A HG21 12 
ATOM 9593  H HG22 . THR A 1 17 ? 4.505   2.313   0.877   1.00 0.00 ? 308 THR A HG22 12 
ATOM 9594  H HG23 . THR A 1 17 ? 4.412   1.412   -0.635  1.00 0.00 ? 308 THR A HG23 12 
ATOM 9595  N N    . ALA A 1 18 ? 4.953   5.324   -3.243  1.00 0.00 ? 309 ALA A N    12 
ATOM 9596  C CA   . ALA A 1 18 ? 5.448   6.531   -3.897  1.00 0.00 ? 309 ALA A CA   12 
ATOM 9597  C C    . ALA A 1 18 ? 6.766   6.266   -4.615  1.00 0.00 ? 309 ALA A C    12 
ATOM 9598  O O    . ALA A 1 18 ? 7.036   6.841   -5.669  1.00 0.00 ? 309 ALA A O    12 
ATOM 9599  C CB   . ALA A 1 18 ? 5.614   7.652   -2.883  1.00 0.00 ? 309 ALA A CB   12 
ATOM 9600  H H    . ALA A 1 18 ? 5.423   4.476   -3.383  1.00 0.00 ? 309 ALA A H    12 
ATOM 9601  H HA   . ALA A 1 18 ? 4.710   6.842   -4.623  1.00 0.00 ? 309 ALA A HA   12 
ATOM 9602  H HB1  . ALA A 1 18 ? 6.666   7.848   -2.734  1.00 0.00 ? 309 ALA A HB1  12 
ATOM 9603  H HB2  . ALA A 1 18 ? 5.130   8.543   -3.250  1.00 0.00 ? 309 ALA A HB2  12 
ATOM 9604  H HB3  . ALA A 1 18 ? 5.166   7.357   -1.945  1.00 0.00 ? 309 ALA A HB3  12 
ATOM 9605  N N    . THR A 1 19 ? 7.586   5.395   -4.037  1.00 0.00 ? 310 THR A N    12 
ATOM 9606  C CA   . THR A 1 19 ? 8.874   5.053   -4.625  1.00 0.00 ? 310 THR A CA   12 
ATOM 9607  C C    . THR A 1 19 ? 8.763   3.805   -5.497  1.00 0.00 ? 310 THR A C    12 
ATOM 9608  O O    . THR A 1 19 ? 9.752   3.110   -5.732  1.00 0.00 ? 310 THR A O    12 
ATOM 9609  C CB   . THR A 1 19 ? 9.943   4.816   -3.543  1.00 0.00 ? 310 THR A CB   12 
ATOM 9610  O OG1  . THR A 1 19 ? 9.495   5.342   -2.288  1.00 0.00 ? 310 THR A OG1  12 
ATOM 9611  C CG2  . THR A 1 19 ? 11.260  5.471   -3.932  1.00 0.00 ? 310 THR A CG2  12 
ATOM 9612  H H    . THR A 1 19 ? 7.317   4.972   -3.193  1.00 0.00 ? 310 THR A H    12 
ATOM 9613  H HA   . THR A 1 19 ? 9.191   5.882   -5.240  1.00 0.00 ? 310 THR A HA   12 
ATOM 9614  H HB   . THR A 1 19 ? 10.103  3.752   -3.442  1.00 0.00 ? 310 THR A HB   12 
ATOM 9615  H HG1  . THR A 1 19 ? 9.068   6.189   -2.429  1.00 0.00 ? 310 THR A HG1  12 
ATOM 9616  H HG21 . THR A 1 19 ? 11.555  6.169   -3.164  1.00 0.00 ? 310 THR A HG21 12 
ATOM 9617  H HG22 . THR A 1 19 ? 11.138  5.995   -4.869  1.00 0.00 ? 310 THR A HG22 12 
ATOM 9618  H HG23 . THR A 1 19 ? 12.020  4.712   -4.041  1.00 0.00 ? 310 THR A HG23 12 
ATOM 9619  N N    . GLY A 1 20 ? 7.553   3.529   -5.974  1.00 0.00 ? 311 GLY A N    12 
ATOM 9620  C CA   . GLY A 1 20 ? 7.333   2.367   -6.813  1.00 0.00 ? 311 GLY A CA   12 
ATOM 9621  C C    . GLY A 1 20 ? 6.887   1.155   -6.020  1.00 0.00 ? 311 GLY A C    12 
ATOM 9622  O O    . GLY A 1 20 ? 6.239   0.258   -6.557  1.00 0.00 ? 311 GLY A O    12 
ATOM 9623  H H    . GLY A 1 20 ? 6.803   4.119   -5.755  1.00 0.00 ? 311 GLY A H    12 
ATOM 9624  H HA2  . GLY A 1 20 ? 6.570   2.604   -7.540  1.00 0.00 ? 311 GLY A HA2  12 
ATOM 9625  H HA3  . GLY A 1 20 ? 8.250   2.128   -7.331  1.00 0.00 ? 311 GLY A HA3  12 
ATOM 9626  N N    . ARG A 1 21 ? 7.236   1.126   -4.738  1.00 0.00 ? 312 ARG A N    12 
ATOM 9627  C CA   . ARG A 1 21 ? 6.858   0.012   -3.874  1.00 0.00 ? 312 ARG A CA   12 
ATOM 9628  C C    . ARG A 1 21 ? 5.352   -0.171  -3.882  1.00 0.00 ? 312 ARG A C    12 
ATOM 9629  O O    . ARG A 1 21 ? 4.598   0.795   -3.993  1.00 0.00 ? 312 ARG A O    12 
ATOM 9630  C CB   . ARG A 1 21 ? 7.356   0.232   -2.442  1.00 0.00 ? 312 ARG A CB   12 
ATOM 9631  C CG   . ARG A 1 21 ? 7.888   -1.027  -1.778  1.00 0.00 ? 312 ARG A CG   12 
ATOM 9632  C CD   . ARG A 1 21 ? 8.729   -0.697  -0.555  1.00 0.00 ? 312 ARG A CD   12 
ATOM 9633  N NE   . ARG A 1 21 ? 9.698   -1.746  -0.256  1.00 0.00 ? 312 ARG A NE   12 
ATOM 9634  C CZ   . ARG A 1 21 ? 10.681  -1.610  0.629   1.00 0.00 ? 312 ARG A CZ   12 
ATOM 9635  N NH1  . ARG A 1 21 ? 10.819  -0.474  1.300   1.00 0.00 ? 312 ARG A NH1  12 
ATOM 9636  N NH2  . ARG A 1 21 ? 11.523  -2.611  0.846   1.00 0.00 ? 312 ARG A NH2  12 
ATOM 9637  H H    . ARG A 1 21 ? 7.758   1.868   -4.367  1.00 0.00 ? 312 ARG A H    12 
ATOM 9638  H HA   . ARG A 1 21 ? 7.305   -0.885  -4.274  1.00 0.00 ? 312 ARG A HA   12 
ATOM 9639  H HB2  . ARG A 1 21 ? 8.149   0.966   -2.454  1.00 0.00 ? 312 ARG A HB2  12 
ATOM 9640  H HG2  . ARG A 1 21 ? 7.055   -1.643  -1.475  1.00 0.00 ? 312 ARG A HG2  12 
ATOM 9641  H HD2  . ARG A 1 21 ? 9.258   0.226   -0.737  1.00 0.00 ? 312 ARG A HD2  12 
ATOM 9642  H HE   . ARG A 1 21 ? 9.615   -2.595  -0.740  1.00 0.00 ? 312 ARG A HE   12 
ATOM 9643  H HH11 . ARG A 1 21 ? 10.184  0.282   1.140   1.00 0.00 ? 312 ARG A HH11 12 
ATOM 9644  H HH12 . ARG A 1 21 ? 11.557  -0.375  1.967   1.00 0.00 ? 312 ARG A HH12 12 
ATOM 9645  H HH21 . ARG A 1 21 ? 11.420  -3.469  0.342   1.00 0.00 ? 312 ARG A HH21 12 
ATOM 9646  H HH22 . ARG A 1 21 ? 12.262  -2.507  1.512   1.00 0.00 ? 312 ARG A HH22 12 
ATOM 9647  N N    . VAL A 1 22 ? 4.920   -1.417  -3.762  1.00 0.00 ? 313 VAL A N    12 
ATOM 9648  C CA   . VAL A 1 22 ? 3.502   -1.727  -3.779  1.00 0.00 ? 313 VAL A CA   12 
ATOM 9649  C C    . VAL A 1 22 ? 2.977   -2.076  -2.413  1.00 0.00 ? 313 VAL A C    12 
ATOM 9650  O O    . VAL A 1 22 ? 3.722   -2.204  -1.441  1.00 0.00 ? 313 VAL A O    12 
ATOM 9651  C CB   . VAL A 1 22 ? 3.153   -2.928  -4.692  1.00 0.00 ? 313 VAL A CB   12 
ATOM 9652  C CG1  . VAL A 1 22 ? 2.057   -2.539  -5.646  1.00 0.00 ? 313 VAL A CG1  12 
ATOM 9653  C CG2  . VAL A 1 22 ? 4.362   -3.474  -5.428  1.00 0.00 ? 313 VAL A CG2  12 
ATOM 9654  H H    . VAL A 1 22 ? 5.567   -2.144  -3.661  1.00 0.00 ? 313 VAL A H    12 
ATOM 9655  H HA   . VAL A 1 22 ? 2.974   -0.860  -4.148  1.00 0.00 ? 313 VAL A HA   12 
ATOM 9656  H HB   . VAL A 1 22 ? 2.765   -3.725  -4.071  1.00 0.00 ? 313 VAL A HB   12 
ATOM 9657  H HG11 . VAL A 1 22 ? 1.113   -2.571  -5.118  1.00 0.00 ? 313 VAL A HG11 12 
ATOM 9658  H HG12 . VAL A 1 22 ? 2.241   -1.538  -6.006  1.00 0.00 ? 313 VAL A HG12 12 
ATOM 9659  H HG13 . VAL A 1 22 ? 2.038   -3.228  -6.474  1.00 0.00 ? 313 VAL A HG13 12 
ATOM 9660  H HG21 . VAL A 1 22 ? 5.036   -2.667  -5.667  1.00 0.00 ? 313 VAL A HG21 12 
ATOM 9661  H HG22 . VAL A 1 22 ? 4.861   -4.192  -4.794  1.00 0.00 ? 313 VAL A HG22 12 
ATOM 9662  H HG23 . VAL A 1 22 ? 4.038   -3.960  -6.335  1.00 0.00 ? 313 VAL A HG23 12 
ATOM 9663  N N    . TYR A 1 23 ? 1.669   -2.228  -2.368  1.00 0.00 ? 314 TYR A N    12 
ATOM 9664  C CA   . TYR A 1 23 ? 1.005   -2.652  -1.168  1.00 0.00 ? 314 TYR A CA   12 
ATOM 9665  C C    . TYR A 1 23 ? -0.443  -2.991  -1.436  1.00 0.00 ? 314 TYR A C    12 
ATOM 9666  O O    . TYR A 1 23 ? -1.058  -2.463  -2.363  1.00 0.00 ? 314 TYR A O    12 
ATOM 9667  C CB   . TYR A 1 23 ? 1.106   -1.624  -0.047  1.00 0.00 ? 314 TYR A CB   12 
ATOM 9668  C CG   . TYR A 1 23 ? 0.227   -0.409  -0.220  1.00 0.00 ? 314 TYR A CG   12 
ATOM 9669  C CD1  . TYR A 1 23 ? 0.551   0.582   -1.132  1.00 0.00 ? 314 TYR A CD1  12 
ATOM 9670  C CD2  . TYR A 1 23 ? -0.922  -0.248  0.546   1.00 0.00 ? 314 TYR A CD2  12 
ATOM 9671  C CE1  . TYR A 1 23 ? -0.247  1.699   -1.284  1.00 0.00 ? 314 TYR A CE1  12 
ATOM 9672  C CE2  . TYR A 1 23 ? -1.727  0.867   0.399   1.00 0.00 ? 314 TYR A CE2  12 
ATOM 9673  C CZ   . TYR A 1 23 ? -1.386  1.836   -0.519  1.00 0.00 ? 314 TYR A CZ   12 
ATOM 9674  O OH   . TYR A 1 23 ? -2.182  2.947   -0.667  1.00 0.00 ? 314 TYR A OH   12 
ATOM 9675  H H    . TYR A 1 23 ? 1.137   -2.026  -3.169  1.00 0.00 ? 314 TYR A H    12 
ATOM 9676  H HA   . TYR A 1 23 ? 1.508   -3.551  -0.867  1.00 0.00 ? 314 TYR A HA   12 
ATOM 9677  H HB2  . TYR A 1 23 ? 0.814   -2.100  0.876   1.00 0.00 ? 314 TYR A HB2  12 
ATOM 9678  H HD1  . TYR A 1 23 ? 1.441   0.474   -1.732  1.00 0.00 ? 314 TYR A HD1  12 
ATOM 9679  H HD2  . TYR A 1 23 ? -1.183  -1.010  1.268   1.00 0.00 ? 314 TYR A HD2  12 
ATOM 9680  H HE1  . TYR A 1 23 ? 0.029   2.460   -1.993  1.00 0.00 ? 314 TYR A HE1  12 
ATOM 9681  H HE2  . TYR A 1 23 ? -2.613  0.977   1.004   1.00 0.00 ? 314 TYR A HE2  12 
ATOM 9682  H HH   . TYR A 1 23 ? -2.620  3.140   0.166   1.00 0.00 ? 314 TYR A HH   12 
ATOM 9683  N N    . PHE A 1 24 ? -0.984  -3.876  -0.617  1.00 0.00 ? 315 PHE A N    12 
ATOM 9684  C CA   . PHE A 1 24 ? -2.357  -4.294  -0.778  1.00 0.00 ? 315 PHE A CA   12 
ATOM 9685  C C    . PHE A 1 24 ? -3.240  -3.717  0.313   1.00 0.00 ? 315 PHE A C    12 
ATOM 9686  O O    . PHE A 1 24 ? -2.986  -3.887  1.505   1.00 0.00 ? 315 PHE A O    12 
ATOM 9687  C CB   . PHE A 1 24 ? -2.437  -5.819  -0.824  1.00 0.00 ? 315 PHE A CB   12 
ATOM 9688  C CG   . PHE A 1 24 ? -1.689  -6.397  -1.993  1.00 0.00 ? 315 PHE A CG   12 
ATOM 9689  C CD1  . PHE A 1 24 ? -0.313  -6.245  -2.096  1.00 0.00 ? 315 PHE A CD1  12 
ATOM 9690  C CD2  . PHE A 1 24 ? -2.361  -7.069  -3.001  1.00 0.00 ? 315 PHE A CD2  12 
ATOM 9691  C CE1  . PHE A 1 24 ? 0.378   -6.754  -3.180  1.00 0.00 ? 315 PHE A CE1  12 
ATOM 9692  C CE2  . PHE A 1 24 ? -1.675  -7.584  -4.085  1.00 0.00 ? 315 PHE A CE2  12 
ATOM 9693  C CZ   . PHE A 1 24 ? -0.305  -7.425  -4.175  1.00 0.00 ? 315 PHE A CZ   12 
ATOM 9694  H H    . PHE A 1 24 ? -0.445  -4.258  0.106   1.00 0.00 ? 315 PHE A H    12 
ATOM 9695  H HA   . PHE A 1 24 ? -2.691  -3.896  -1.716  1.00 0.00 ? 315 PHE A HA   12 
ATOM 9696  H HB2  . PHE A 1 24 ? -2.011  -6.226  0.082   1.00 0.00 ? 315 PHE A HB2  12 
ATOM 9697  H HD1  . PHE A 1 24 ? 0.221   -5.728  -1.313  1.00 0.00 ? 315 PHE A HD1  12 
ATOM 9698  H HD2  . PHE A 1 24 ? -3.432  -7.193  -2.931  1.00 0.00 ? 315 PHE A HD2  12 
ATOM 9699  H HE1  . PHE A 1 24 ? 1.451   -6.624  -3.250  1.00 0.00 ? 315 PHE A HE1  12 
ATOM 9700  H HE2  . PHE A 1 24 ? -2.211  -8.108  -4.863  1.00 0.00 ? 315 PHE A HE2  12 
ATOM 9701  H HZ   . PHE A 1 24 ? 0.230   -7.825  -5.024  1.00 0.00 ? 315 PHE A HZ   12 
ATOM 9702  N N    . VAL A 1 25 ? -4.286  -3.029  -0.125  1.00 0.00 ? 316 VAL A N    12 
ATOM 9703  C CA   . VAL A 1 25 ? -5.218  -2.384  0.780   1.00 0.00 ? 316 VAL A CA   12 
ATOM 9704  C C    . VAL A 1 25 ? -6.413  -3.273  1.109   1.00 0.00 ? 316 VAL A C    12 
ATOM 9705  O O    . VAL A 1 25 ? -7.133  -3.726  0.218   1.00 0.00 ? 316 VAL A O    12 
ATOM 9706  C CB   . VAL A 1 25 ? -5.727  -1.064  0.177   1.00 0.00 ? 316 VAL A CB   12 
ATOM 9707  C CG1  . VAL A 1 25 ? -6.455  -0.253  1.228   1.00 0.00 ? 316 VAL A CG1  12 
ATOM 9708  C CG2  . VAL A 1 25 ? -4.576  -0.268  -0.419  1.00 0.00 ? 316 VAL A CG2  12 
ATOM 9709  H H    . VAL A 1 25 ? -4.436  -2.956  -1.090  1.00 0.00 ? 316 VAL A H    12 
ATOM 9710  H HA   . VAL A 1 25 ? -4.692  -2.155  1.694   1.00 0.00 ? 316 VAL A HA   12 
ATOM 9711  H HB   . VAL A 1 25 ? -6.425  -1.297  -0.614  1.00 0.00 ? 316 VAL A HB   12 
ATOM 9712  H HG11 . VAL A 1 25 ? -5.780  0.480   1.648   1.00 0.00 ? 316 VAL A HG11 12 
ATOM 9713  H HG12 . VAL A 1 25 ? -7.298  0.248   0.776   1.00 0.00 ? 316 VAL A HG12 12 
ATOM 9714  H HG13 . VAL A 1 25 ? -6.803  -0.913  2.008   1.00 0.00 ? 316 VAL A HG13 12 
ATOM 9715  H HG21 . VAL A 1 25 ? -4.675  -0.242  -1.494  1.00 0.00 ? 316 VAL A HG21 12 
ATOM 9716  H HG22 . VAL A 1 25 ? -4.597  0.740   -0.030  1.00 0.00 ? 316 VAL A HG22 12 
ATOM 9717  H HG23 . VAL A 1 25 ? -3.640  -0.737  -0.153  1.00 0.00 ? 316 VAL A HG23 12 
ATOM 9718  N N    . ASP A 1 26 ? -6.604  -3.518  2.402   1.00 0.00 ? 317 ASP A N    12 
ATOM 9719  C CA   . ASP A 1 26 ? -7.708  -4.326  2.888   1.00 0.00 ? 317 ASP A CA   12 
ATOM 9720  C C    . ASP A 1 26 ? -8.917  -3.435  3.162   1.00 0.00 ? 317 ASP A C    12 
ATOM 9721  O O    . ASP A 1 26 ? -8.899  -2.626  4.090   1.00 0.00 ? 317 ASP A O    12 
ATOM 9722  C CB   . ASP A 1 26 ? -7.336  -5.080  4.181   1.00 0.00 ? 317 ASP A CB   12 
ATOM 9723  C CG   . ASP A 1 26 ? -5.851  -5.069  4.548   1.00 0.00 ? 317 ASP A CG   12 
ATOM 9724  O OD1  . ASP A 1 26 ? -5.148  -4.090  4.231   1.00 0.00 ? 317 ASP A OD1  12 
ATOM 9725  O OD2  . ASP A 1 26 ? -5.399  -6.044  5.178   1.00 0.00 ? 317 ASP A OD2  12 
ATOM 9726  H H    . ASP A 1 26 ? -5.974  -3.155  3.052   1.00 0.00 ? 317 ASP A H    12 
ATOM 9727  H HA   . ASP A 1 26 ? -7.966  -5.043  2.120   1.00 0.00 ? 317 ASP A HA   12 
ATOM 9728  H HB2  . ASP A 1 26 ? -7.882  -4.646  5.004   1.00 0.00 ? 317 ASP A HB2  12 
ATOM 9729  N N    . HIS A 1 27 ? -9.961  -3.580  2.357   1.00 0.00 ? 318 HIS A N    12 
ATOM 9730  C CA   . HIS A 1 27 ? -11.165 -2.773  2.524   1.00 0.00 ? 318 HIS A CA   12 
ATOM 9731  C C    . HIS A 1 27 ? -12.138 -3.413  3.516   1.00 0.00 ? 318 HIS A C    12 
ATOM 9732  O O    . HIS A 1 27 ? -13.105 -2.779  3.938   1.00 0.00 ? 318 HIS A O    12 
ATOM 9733  C CB   . HIS A 1 27 ? -11.841 -2.558  1.172   1.00 0.00 ? 318 HIS A CB   12 
ATOM 9734  C CG   . HIS A 1 27 ? -11.124 -1.560  0.319   1.00 0.00 ? 318 HIS A CG   12 
ATOM 9735  N ND1  . HIS A 1 27 ? -11.169 -0.217  0.602   1.00 0.00 ? 318 HIS A ND1  12 
ATOM 9736  C CD2  . HIS A 1 27 ? -10.344 -1.756  -0.773  1.00 0.00 ? 318 HIS A CD2  12 
ATOM 9737  C CE1  . HIS A 1 27 ? -10.419 0.372   -0.313  1.00 0.00 ? 318 HIS A CE1  12 
ATOM 9738  N NE2  . HIS A 1 27 ? -9.899  -0.521  -1.169  1.00 0.00 ? 318 HIS A NE2  12 
ATOM 9739  H H    . HIS A 1 27 ? -9.926  -4.246  1.636   1.00 0.00 ? 318 HIS A H    12 
ATOM 9740  H HA   . HIS A 1 27 ? -10.862 -1.810  2.915   1.00 0.00 ? 318 HIS A HA   12 
ATOM 9741  H HB2  . HIS A 1 27 ? -11.873 -3.496  0.637   1.00 0.00 ? 318 HIS A HB2  12 
ATOM 9742  H HD2  . HIS A 1 27 ? -10.109 -2.701  -1.239  1.00 0.00 ? 318 HIS A HD2  12 
ATOM 9743  H HE1  . HIS A 1 27 ? -10.238 1.434   -0.357  1.00 0.00 ? 318 HIS A HE1  12 
ATOM 9744  H HE2  . HIS A 1 27 ? -9.470  -0.314  -2.025  1.00 0.00 ? 318 HIS A HE2  12 
ATOM 9745  N N    . ASN A 1 28 ? -11.884 -4.668  3.885   1.00 0.00 ? 319 ASN A N    12 
ATOM 9746  C CA   . ASN A 1 28 ? -12.737 -5.369  4.837   1.00 0.00 ? 319 ASN A CA   12 
ATOM 9747  C C    . ASN A 1 28 ? -12.260 -5.120  6.264   1.00 0.00 ? 319 ASN A C    12 
ATOM 9748  O O    . ASN A 1 28 ? -13.035 -4.711  7.127   1.00 0.00 ? 319 ASN A O    12 
ATOM 9749  C CB   . ASN A 1 28 ? -12.742 -6.870  4.547   1.00 0.00 ? 319 ASN A CB   12 
ATOM 9750  C CG   . ASN A 1 28 ? -12.860 -7.176  3.067   1.00 0.00 ? 319 ASN A CG   12 
ATOM 9751  O OD1  . ASN A 1 28 ? -13.676 -6.585  2.362   1.00 0.00 ? 319 ASN A OD1  12 
ATOM 9752  N ND2  . ASN A 1 28 ? -12.041 -8.108  2.591   1.00 0.00 ? 319 ASN A ND2  12 
ATOM 9753  H H    . ASN A 1 28 ? -11.111 -5.134  3.507   1.00 0.00 ? 319 ASN A H    12 
ATOM 9754  H HA   . ASN A 1 28 ? -13.741 -4.984  4.731   1.00 0.00 ? 319 ASN A HA   12 
ATOM 9755  H HB2  . ASN A 1 28 ? -11.823 -7.304  4.913   1.00 0.00 ? 319 ASN A HB2  12 
ATOM 9756  H HD21 . ASN A 1 28 ? -11.416 -8.537  3.212   1.00 0.00 ? 319 ASN A HD21 12 
ATOM 9757  H HD22 . ASN A 1 28 ? -12.097 -8.331  1.638   1.00 0.00 ? 319 ASN A HD22 12 
ATOM 9758  N N    . ASN A 1 29 ? -10.975 -5.369  6.501   1.00 0.00 ? 320 ASN A N    12 
ATOM 9759  C CA   . ASN A 1 29 ? -10.386 -5.170  7.821   1.00 0.00 ? 320 ASN A CA   12 
ATOM 9760  C C    . ASN A 1 29 ? -9.969  -3.715  8.024   1.00 0.00 ? 320 ASN A C    12 
ATOM 9761  O O    . ASN A 1 29 ? -9.735  -3.283  9.153   1.00 0.00 ? 320 ASN A O    12 
ATOM 9762  C CB   . ASN A 1 29 ? -9.176  -6.088  8.009   1.00 0.00 ? 320 ASN A CB   12 
ATOM 9763  C CG   . ASN A 1 29 ? -9.537  -7.555  7.891   1.00 0.00 ? 320 ASN A CG   12 
ATOM 9764  O OD1  . ASN A 1 29 ? -10.276 -8.094  8.716   1.00 0.00 ? 320 ASN A OD1  12 
ATOM 9765  N ND2  . ASN A 1 29 ? -9.014  -8.210  6.862   1.00 0.00 ? 320 ASN A ND2  12 
ATOM 9766  H H    . ASN A 1 29 ? -10.408 -5.695  5.771   1.00 0.00 ? 320 ASN A H    12 
ATOM 9767  H HA   . ASN A 1 29 ? -11.135 -5.422  8.558   1.00 0.00 ? 320 ASN A HA   12 
ATOM 9768  H HB2  . ASN A 1 29 ? -8.436  -5.859  7.257   1.00 0.00 ? 320 ASN A HB2  12 
ATOM 9769  H HD21 . ASN A 1 29 ? -8.433  -7.716  6.246   1.00 0.00 ? 320 ASN A HD21 12 
ATOM 9770  H HD22 . ASN A 1 29 ? -9.230  -9.158  6.760   1.00 0.00 ? 320 ASN A HD22 12 
ATOM 9771  N N    . ARG A 1 30 ? -9.871  -2.962  6.928   1.00 0.00 ? 321 ARG A N    12 
ATOM 9772  C CA   . ARG A 1 30 ? -9.482  -1.559  6.998   1.00 0.00 ? 321 ARG A CA   12 
ATOM 9773  C C    . ARG A 1 30 ? -8.044  -1.416  7.478   1.00 0.00 ? 321 ARG A C    12 
ATOM 9774  O O    . ARG A 1 30 ? -7.787  -1.014  8.612   1.00 0.00 ? 321 ARG A O    12 
ATOM 9775  C CB   . ARG A 1 30 ? -10.433 -0.794  7.918   1.00 0.00 ? 321 ARG A CB   12 
ATOM 9776  C CG   . ARG A 1 30 ? -11.879 -0.844  7.456   1.00 0.00 ? 321 ARG A CG   12 
ATOM 9777  C CD   . ARG A 1 30 ? -12.783 -1.451  8.517   1.00 0.00 ? 321 ARG A CD   12 
ATOM 9778  N NE   . ARG A 1 30 ? -14.142 -0.923  8.447   1.00 0.00 ? 321 ARG A NE   12 
ATOM 9779  C CZ   . ARG A 1 30 ? -14.469 0.314   8.805   1.00 0.00 ? 321 ARG A CZ   12 
ATOM 9780  N NH1  . ARG A 1 30 ? -13.537 1.145   9.252   1.00 0.00 ? 321 ARG A NH1  12 
ATOM 9781  N NH2  . ARG A 1 30 ? -15.727 0.723   8.715   1.00 0.00 ? 321 ARG A NH2  12 
ATOM 9782  H H    . ARG A 1 30 ? -10.059 -3.358  6.053   1.00 0.00 ? 321 ARG A H    12 
ATOM 9783  H HA   . ARG A 1 30 ? -9.556  -1.148  6.001   1.00 0.00 ? 321 ARG A HA   12 
ATOM 9784  H HB2  . ARG A 1 30 ? -10.376 -1.216  8.910   1.00 0.00 ? 321 ARG A HB2  12 
ATOM 9785  H HG2  . ARG A 1 30 ? -12.215 0.159   7.239   1.00 0.00 ? 321 ARG A HG2  12 
ATOM 9786  H HD2  . ARG A 1 30 ? -12.816 -2.521  8.374   1.00 0.00 ? 321 ARG A HD2  12 
ATOM 9787  H HE   . ARG A 1 30 ? -14.846 -1.520  8.119   1.00 0.00 ? 321 ARG A HE   12 
ATOM 9788  H HH11 . ARG A 1 30 ? -12.587 0.841   9.320   1.00 0.00 ? 321 ARG A HH11 12 
ATOM 9789  H HH12 . ARG A 1 30 ? -13.784 2.076   9.519   1.00 0.00 ? 321 ARG A HH12 12 
ATOM 9790  H HH21 . ARG A 1 30 ? -16.432 0.099   8.379   1.00 0.00 ? 321 ARG A HH21 12 
ATOM 9791  H HH22 . ARG A 1 30 ? -15.972 1.655   8.985   1.00 0.00 ? 321 ARG A HH22 12 
ATOM 9792  N N    . THR A 1 31 ? -7.110  -1.749  6.595   1.00 0.00 ? 322 THR A N    12 
ATOM 9793  C CA   . THR A 1 31 ? -5.689  -1.671  6.900   1.00 0.00 ? 322 THR A CA   12 
ATOM 9794  C C    . THR A 1 31 ? -4.868  -1.860  5.629   1.00 0.00 ? 322 THR A C    12 
ATOM 9795  O O    . THR A 1 31 ? -5.360  -1.606  4.529   1.00 0.00 ? 322 THR A O    12 
ATOM 9796  C CB   . THR A 1 31 ? -5.284  -2.732  7.943   1.00 0.00 ? 322 THR A CB   12 
ATOM 9797  O OG1  . THR A 1 31 ? -3.905  -2.571  8.298   1.00 0.00 ? 322 THR A OG1  12 
ATOM 9798  C CG2  . THR A 1 31 ? -5.511  -4.135  7.401   1.00 0.00 ? 322 THR A CG2  12 
ATOM 9799  H H    . THR A 1 31 ? -7.388  -2.055  5.707   1.00 0.00 ? 322 THR A H    12 
ATOM 9800  H HA   . THR A 1 31 ? -5.483  -0.693  7.306   1.00 0.00 ? 322 THR A HA   12 
ATOM 9801  H HB   . THR A 1 31 ? -5.894  -2.599  8.826   1.00 0.00 ? 322 THR A HB   12 
ATOM 9802  H HG1  . THR A 1 31 ? -3.820  -1.862  8.941   1.00 0.00 ? 322 THR A HG1  12 
ATOM 9803  H HG21 . THR A 1 31 ? -5.382  -4.853  8.198   1.00 0.00 ? 322 THR A HG21 12 
ATOM 9804  H HG22 . THR A 1 31 ? -4.798  -4.336  6.616   1.00 0.00 ? 322 THR A HG22 12 
ATOM 9805  H HG23 . THR A 1 31 ? -6.513  -4.211  7.006   1.00 0.00 ? 322 THR A HG23 12 
ATOM 9806  N N    . THR A 1 32 ? -3.623  -2.306  5.770   1.00 0.00 ? 323 THR A N    12 
ATOM 9807  C CA   . THR A 1 32 ? -2.773  -2.525  4.611   1.00 0.00 ? 323 THR A CA   12 
ATOM 9808  C C    . THR A 1 32 ? -1.877  -3.742  4.802   1.00 0.00 ? 323 THR A C    12 
ATOM 9809  O O    . THR A 1 32 ? -1.849  -4.347  5.874   1.00 0.00 ? 323 THR A O    12 
ATOM 9810  C CB   . THR A 1 32 ? -1.890  -1.302  4.314   1.00 0.00 ? 323 THR A CB   12 
ATOM 9811  O OG1  . THR A 1 32 ? -1.347  -0.793  5.537   1.00 0.00 ? 323 THR A OG1  12 
ATOM 9812  C CG2  . THR A 1 32 ? -2.692  -0.212  3.611   1.00 0.00 ? 323 THR A CG2  12 
ATOM 9813  H H    . THR A 1 32 ? -3.270  -2.488  6.664   1.00 0.00 ? 323 THR A H    12 
ATOM 9814  H HA   . THR A 1 32 ? -3.416  -2.692  3.761   1.00 0.00 ? 323 THR A HA   12 
ATOM 9815  H HB   . THR A 1 32 ? -1.077  -1.609  3.664   1.00 0.00 ? 323 THR A HB   12 
ATOM 9816  H HG1  . THR A 1 32 ? -0.552  -1.283  5.763   1.00 0.00 ? 323 THR A HG1  12 
ATOM 9817  H HG21 . THR A 1 32 ? -2.306  0.759   3.890   1.00 0.00 ? 323 THR A HG21 12 
ATOM 9818  H HG22 . THR A 1 32 ? -3.730  -0.283  3.904   1.00 0.00 ? 323 THR A HG22 12 
ATOM 9819  H HG23 . THR A 1 32 ? -2.610  -0.340  2.541   1.00 0.00 ? 323 THR A HG23 12 
ATOM 9820  N N    . GLN A 1 33 ? -1.148  -4.090  3.751   1.00 0.00 ? 324 GLN A N    12 
ATOM 9821  C CA   . GLN A 1 33 ? -0.241  -5.229  3.786   1.00 0.00 ? 324 GLN A CA   12 
ATOM 9822  C C    . GLN A 1 33 ? 0.468   -5.386  2.450   1.00 0.00 ? 324 GLN A C    12 
ATOM 9823  O O    . GLN A 1 33 ? -0.170  -5.597  1.418   1.00 0.00 ? 324 GLN A O    12 
ATOM 9824  C CB   . GLN A 1 33 ? -0.993  -6.521  4.130   1.00 0.00 ? 324 GLN A CB   12 
ATOM 9825  C CG   . GLN A 1 33 ? -2.391  -6.601  3.535   1.00 0.00 ? 324 GLN A CG   12 
ATOM 9826  C CD   . GLN A 1 33 ? -2.557  -7.756  2.567   1.00 0.00 ? 324 GLN A CD   12 
ATOM 9827  O OE1  . GLN A 1 33 ? -3.035  -7.579  1.447   1.00 0.00 ? 324 GLN A OE1  12 
ATOM 9828  N NE2  . GLN A 1 33 ? -2.165  -8.949  2.993   1.00 0.00 ? 324 GLN A NE2  12 
ATOM 9829  H H    . GLN A 1 33 ? -1.220  -3.565  2.926   1.00 0.00 ? 324 GLN A H    12 
ATOM 9830  H HA   . GLN A 1 33 ? 0.497   -5.039  4.551   1.00 0.00 ? 324 GLN A HA   12 
ATOM 9831  H HB2  . GLN A 1 33 ? -0.423  -7.361  3.763   1.00 0.00 ? 324 GLN A HB2  12 
ATOM 9832  H HG2  . GLN A 1 33 ? -3.101  -6.721  4.338   1.00 0.00 ? 324 GLN A HG2  12 
ATOM 9833  H HE21 . GLN A 1 33 ? -1.796  -9.017  3.894   1.00 0.00 ? 324 GLN A HE21 12 
ATOM 9834  H HE22 . GLN A 1 33 ? -2.266  -9.713  2.389   1.00 0.00 ? 324 GLN A HE22 12 
ATOM 9835  N N    . PHE A 1 34 ? 1.792   -5.288  2.473   1.00 0.00 ? 325 PHE A N    12 
ATOM 9836  C CA   . PHE A 1 34 ? 2.581   -5.432  1.258   1.00 0.00 ? 325 PHE A CA   12 
ATOM 9837  C C    . PHE A 1 34 ? 2.311   -6.790  0.629   1.00 0.00 ? 325 PHE A C    12 
ATOM 9838  O O    . PHE A 1 34 ? 2.551   -6.999  -0.560  1.00 0.00 ? 325 PHE A O    12 
ATOM 9839  C CB   . PHE A 1 34 ? 4.077   -5.285  1.567   1.00 0.00 ? 325 PHE A CB   12 
ATOM 9840  C CG   . PHE A 1 34 ? 4.606   -3.864  1.507   1.00 0.00 ? 325 PHE A CG   12 
ATOM 9841  C CD1  . PHE A 1 34 ? 3.765   -2.781  1.271   1.00 0.00 ? 325 PHE A CD1  12 
ATOM 9842  C CD2  . PHE A 1 34 ? 5.961   -3.617  1.672   1.00 0.00 ? 325 PHE A CD2  12 
ATOM 9843  C CE1  . PHE A 1 34 ? 4.264   -1.493  1.204   1.00 0.00 ? 325 PHE A CE1  12 
ATOM 9844  C CE2  . PHE A 1 34 ? 6.462   -2.333  1.601   1.00 0.00 ? 325 PHE A CE2  12 
ATOM 9845  C CZ   . PHE A 1 34 ? 5.613   -1.272  1.366   1.00 0.00 ? 325 PHE A CZ   12 
ATOM 9846  H H    . PHE A 1 34 ? 2.245   -5.145  3.328   1.00 0.00 ? 325 PHE A H    12 
ATOM 9847  H HA   . PHE A 1 34 ? 2.279   -4.668  0.564   1.00 0.00 ? 325 PHE A HA   12 
ATOM 9848  H HB2  . PHE A 1 34 ? 4.267   -5.671  2.557   1.00 0.00 ? 325 PHE A HB2  12 
ATOM 9849  H HD1  . PHE A 1 34 ? 2.712   -2.947  1.153   1.00 0.00 ? 325 PHE A HD1  12 
ATOM 9850  H HD2  . PHE A 1 34 ? 6.631   -4.441  1.861   1.00 0.00 ? 325 PHE A HD2  12 
ATOM 9851  H HE1  . PHE A 1 34 ? 3.598   -0.659  1.023   1.00 0.00 ? 325 PHE A HE1  12 
ATOM 9852  H HE2  . PHE A 1 34 ? 7.518   -2.159  1.736   1.00 0.00 ? 325 PHE A HE2  12 
ATOM 9853  H HZ   . PHE A 1 34 ? 6.005   -0.267  1.310   1.00 0.00 ? 325 PHE A HZ   12 
ATOM 9854  N N    . THR A 1 35 ? 1.808   -7.713  1.442   1.00 0.00 ? 326 THR A N    12 
ATOM 9855  C CA   . THR A 1 35 ? 1.495   -9.047  0.984   1.00 0.00 ? 326 THR A CA   12 
ATOM 9856  C C    . THR A 1 35 ? 0.237   -9.071  0.126   1.00 0.00 ? 326 THR A C    12 
ATOM 9857  O O    . THR A 1 35 ? -0.651  -8.230  0.275   1.00 0.00 ? 326 THR A O    12 
ATOM 9858  C CB   . THR A 1 35 ? 1.294   -9.996  2.172   1.00 0.00 ? 326 THR A CB   12 
ATOM 9859  O OG1  . THR A 1 35 ? 1.843   -9.416  3.363   1.00 0.00 ? 326 THR A OG1  12 
ATOM 9860  C CG2  . THR A 1 35 ? 1.958   -11.329 1.900   1.00 0.00 ? 326 THR A CG2  12 
ATOM 9861  H H    . THR A 1 35 ? 1.658   -7.495  2.383   1.00 0.00 ? 326 THR A H    12 
ATOM 9862  H HA   . THR A 1 35 ? 2.328   -9.405  0.400   1.00 0.00 ? 326 THR A HA   12 
ATOM 9863  H HB   . THR A 1 35 ? 0.234   -10.156 2.313   1.00 0.00 ? 326 THR A HB   12 
ATOM 9864  H HG1  . THR A 1 35 ? 1.430   -9.813  4.133   1.00 0.00 ? 326 THR A HG1  12 
ATOM 9865  H HG21 . THR A 1 35 ? 1.871   -11.960 2.770   1.00 0.00 ? 326 THR A HG21 12 
ATOM 9866  H HG22 . THR A 1 35 ? 3.002   -11.166 1.673   1.00 0.00 ? 326 THR A HG22 12 
ATOM 9867  H HG23 . THR A 1 35 ? 1.473   -11.803 1.059   1.00 0.00 ? 326 THR A HG23 12 
ATOM 9868  N N    . ASP A 1 36 ? 0.174   -10.043 -0.773  1.00 0.00 ? 327 ASP A N    12 
ATOM 9869  C CA   . ASP A 1 36 ? -0.973  -10.209 -1.651  1.00 0.00 ? 327 ASP A CA   12 
ATOM 9870  C C    . ASP A 1 36 ? -1.830  -11.378 -1.170  1.00 0.00 ? 327 ASP A C    12 
ATOM 9871  O O    . ASP A 1 36 ? -1.371  -12.519 -1.156  1.00 0.00 ? 327 ASP A O    12 
ATOM 9872  C CB   . ASP A 1 36 ? -0.499  -10.464 -3.081  1.00 0.00 ? 327 ASP A CB   12 
ATOM 9873  C CG   . ASP A 1 36 ? -1.642  -10.518 -4.071  1.00 0.00 ? 327 ASP A CG   12 
ATOM 9874  O OD1  . ASP A 1 36 ? -2.736  -10.013 -3.744  1.00 0.00 ? 327 ASP A OD1  12 
ATOM 9875  O OD2  . ASP A 1 36 ? -1.444  -11.067 -5.174  1.00 0.00 ? 327 ASP A OD2  12 
ATOM 9876  H H    . ASP A 1 36 ? 0.925   -10.665 -0.852  1.00 0.00 ? 327 ASP A H    12 
ATOM 9877  H HA   . ASP A 1 36 ? -1.551  -9.300  -1.623  1.00 0.00 ? 327 ASP A HA   12 
ATOM 9878  H HB2  . ASP A 1 36 ? 0.173   -9.672  -3.378  1.00 0.00 ? 327 ASP A HB2  12 
ATOM 9879  N N    . PRO A 1 37 ? -3.087  -11.120 -0.768  1.00 0.00 ? 328 PRO A N    12 
ATOM 9880  C CA   . PRO A 1 37 ? -3.980  -12.172 -0.277  1.00 0.00 ? 328 PRO A CA   12 
ATOM 9881  C C    . PRO A 1 37 ? -4.141  -13.300 -1.287  1.00 0.00 ? 328 PRO A C    12 
ATOM 9882  O O    . PRO A 1 37 ? -4.483  -14.427 -0.927  1.00 0.00 ? 328 PRO A O    12 
ATOM 9883  C CB   . PRO A 1 37 ? -5.317  -11.454 -0.055  1.00 0.00 ? 328 PRO A CB   12 
ATOM 9884  C CG   . PRO A 1 37 ? -5.201  -10.174 -0.806  1.00 0.00 ? 328 PRO A CG   12 
ATOM 9885  C CD   . PRO A 1 37 ? -3.746  -9.807  -0.773  1.00 0.00 ? 328 PRO A CD   12 
ATOM 9886  H HA   . PRO A 1 37 ? -3.627  -12.577 0.662   1.00 0.00 ? 328 PRO A HA   12 
ATOM 9887  H HB2  . PRO A 1 37 ? -6.122  -12.064 -0.439  1.00 0.00 ? 328 PRO A HB2  12 
ATOM 9888  H HG2  . PRO A 1 37 ? -5.528  -10.314 -1.826  1.00 0.00 ? 328 PRO A HG2  12 
ATOM 9889  H HD2  . PRO A 1 37 ? -3.486  -9.240  -1.652  1.00 0.00 ? 328 PRO A HD2  12 
ATOM 9890  N N    . ARG A 1 38 ? -3.892  -12.988 -2.554  1.00 0.00 ? 329 ARG A N    12 
ATOM 9891  C CA   . ARG A 1 38 ? -4.002  -13.977 -3.619  1.00 0.00 ? 329 ARG A CA   12 
ATOM 9892  C C    . ARG A 1 38 ? -2.911  -15.034 -3.482  1.00 0.00 ? 329 ARG A C    12 
ATOM 9893  O O    . ARG A 1 38 ? -3.073  -16.171 -3.926  1.00 0.00 ? 329 ARG A O    12 
ATOM 9894  C CB   . ARG A 1 38 ? -3.902  -13.303 -4.989  1.00 0.00 ? 329 ARG A CB   12 
ATOM 9895  C CG   . ARG A 1 38 ? -4.730  -12.033 -5.110  1.00 0.00 ? 329 ARG A CG   12 
ATOM 9896  C CD   . ARG A 1 38 ? -4.661  -11.444 -6.513  1.00 0.00 ? 329 ARG A CD   12 
ATOM 9897  N NE   . ARG A 1 38 ? -3.345  -10.875 -6.814  1.00 0.00 ? 329 ARG A NE   12 
ATOM 9898  C CZ   . ARG A 1 38 ? -3.140  -9.809  -7.594  1.00 0.00 ? 329 ARG A CZ   12 
ATOM 9899  N NH1  . ARG A 1 38 ? -4.159  -9.174  -8.163  1.00 0.00 ? 329 ARG A NH1  12 
ATOM 9900  N NH2  . ARG A 1 38 ? -1.904  -9.381  -7.808  1.00 0.00 ? 329 ARG A NH2  12 
ATOM 9901  H H    . ARG A 1 38 ? -3.627  -12.072 -2.779  1.00 0.00 ? 329 ARG A H    12 
ATOM 9902  H HA   . ARG A 1 38 ? -4.966  -14.453 -3.529  1.00 0.00 ? 329 ARG A HA   12 
ATOM 9903  H HB2  . ARG A 1 38 ? -2.869  -13.054 -5.177  1.00 0.00 ? 329 ARG A HB2  12 
ATOM 9904  H HG2  . ARG A 1 38 ? -5.760  -12.267 -4.883  1.00 0.00 ? 329 ARG A HG2  12 
ATOM 9905  H HD2  . ARG A 1 38 ? -4.875  -12.225 -7.226  1.00 0.00 ? 329 ARG A HD2  12 
ATOM 9906  H HE   . ARG A 1 38 ? -2.564  -11.312 -6.417  1.00 0.00 ? 329 ARG A HE   12 
ATOM 9907  H HH11 . ARG A 1 38 ? -5.094  -9.487  -8.015  1.00 0.00 ? 329 ARG A HH11 12 
ATOM 9908  H HH12 . ARG A 1 38 ? -3.987  -8.378  -8.743  1.00 0.00 ? 329 ARG A HH12 12 
ATOM 9909  H HH21 . ARG A 1 38 ? -1.130  -9.854  -7.386  1.00 0.00 ? 329 ARG A HH21 12 
ATOM 9910  H HH22 . ARG A 1 38 ? -1.745  -8.585  -8.393  1.00 0.00 ? 329 ARG A HH22 12 
ATOM 9911  N N    . LEU A 1 39 ? -1.798  -14.649 -2.863  1.00 0.00 ? 330 LEU A N    12 
ATOM 9912  C CA   . LEU A 1 39 ? -0.676  -15.558 -2.665  1.00 0.00 ? 330 LEU A CA   12 
ATOM 9913  C C    . LEU A 1 39 ? -1.109  -16.804 -1.899  1.00 0.00 ? 330 LEU A C    12 
ATOM 9914  O O    . LEU A 1 39 ? -1.000  -17.923 -2.401  1.00 0.00 ? 330 LEU A O    12 
ATOM 9915  C CB   . LEU A 1 39 ? 0.451   -14.851 -1.911  1.00 0.00 ? 330 LEU A CB   12 
ATOM 9916  C CG   . LEU A 1 39 ? 1.375   -13.997 -2.780  1.00 0.00 ? 330 LEU A CG   12 
ATOM 9917  C CD1  . LEU A 1 39 ? 2.501   -13.408 -1.945  1.00 0.00 ? 330 LEU A CD1  12 
ATOM 9918  C CD2  . LEU A 1 39 ? 1.934   -14.820 -3.931  1.00 0.00 ? 330 LEU A CD2  12 
ATOM 9919  H H    . LEU A 1 39 ? -1.731  -13.729 -2.533  1.00 0.00 ? 330 LEU A H    12 
ATOM 9920  H HA   . LEU A 1 39 ? -0.314  -15.854 -3.637  1.00 0.00 ? 330 LEU A HA   12 
ATOM 9921  H HB2  . LEU A 1 39 ? 0.008   -14.215 -1.159  1.00 0.00 ? 330 LEU A HB2  12 
ATOM 9922  H HG   . LEU A 1 39 ? 0.808   -13.178 -3.198  1.00 0.00 ? 330 LEU A HG   12 
ATOM 9923  H HD11 . LEU A 1 39 ? 2.886   -12.524 -2.430  1.00 0.00 ? 330 LEU A HD11 12 
ATOM 9924  H HD12 . LEU A 1 39 ? 2.126   -13.148 -0.967  1.00 0.00 ? 330 LEU A HD12 12 
ATOM 9925  H HD13 . LEU A 1 39 ? 3.293   -14.137 -1.844  1.00 0.00 ? 330 LEU A HD13 12 
ATOM 9926  H HD21 . LEU A 1 39 ? 2.024   -15.851 -3.626  1.00 0.00 ? 330 LEU A HD21 12 
ATOM 9927  H HD22 . LEU A 1 39 ? 1.268   -14.752 -4.779  1.00 0.00 ? 330 LEU A HD22 12 
ATOM 9928  H HD23 . LEU A 1 39 ? 2.906   -14.439 -4.206  1.00 0.00 ? 330 LEU A HD23 12 
ATOM 9929  N N    . SER A 1 40 ? -1.602  -16.601 -0.681  1.00 0.00 ? 331 SER A N    12 
ATOM 9930  C CA   . SER A 1 40 ? -2.050  -17.708 0.157   1.00 0.00 ? 331 SER A CA   12 
ATOM 9931  C C    . SER A 1 40 ? -3.070  -17.232 1.186   1.00 0.00 ? 331 SER A C    12 
ATOM 9932  O O    . SER A 1 40 ? -2.726  -16.963 2.336   1.00 0.00 ? 331 SER A O    12 
ATOM 9933  C CB   . SER A 1 40 ? -0.856  -18.354 0.864   1.00 0.00 ? 331 SER A CB   12 
ATOM 9934  O OG   . SER A 1 40 ? 0.310   -18.285 0.063   1.00 0.00 ? 331 SER A OG   12 
ATOM 9935  H H    . SER A 1 40 ? -1.666  -15.686 -0.338  1.00 0.00 ? 331 SER A H    12 
ATOM 9936  H HA   . SER A 1 40 ? -2.516  -18.441 -0.485  1.00 0.00 ? 331 SER A HA   12 
ATOM 9937  H HB2  . SER A 1 40 ? -0.670  -17.838 1.795   1.00 0.00 ? 331 SER A HB2  12 
ATOM 9938  H HG   . SER A 1 40 ? 0.817   -17.506 0.301   1.00 0.00 ? 331 SER A HG   12 
ATOM 9939  N N    . ALA A 1 41 ? -4.324  -17.132 0.763   1.00 0.00 ? 332 ALA A N    12 
ATOM 9940  C CA   . ALA A 1 41 ? -5.395  -16.690 1.647   1.00 0.00 ? 332 ALA A CA   12 
ATOM 9941  C C    . ALA A 1 41 ? -5.490  -17.580 2.882   1.00 0.00 ? 332 ALA A C    12 
ATOM 9942  O O    . ALA A 1 41 ? -4.587  -18.370 3.161   1.00 0.00 ? 332 ALA A O    12 
ATOM 9943  C CB   . ALA A 1 41 ? -6.723  -16.679 0.900   1.00 0.00 ? 332 ALA A CB   12 
ATOM 9944  H H    . ALA A 1 41 ? -4.536  -17.362 -0.166  1.00 0.00 ? 332 ALA A H    12 
ATOM 9945  H HA   . ALA A 1 41 ? -5.173  -15.679 1.960   1.00 0.00 ? 332 ALA A HA   12 
ATOM 9946  H HB1  . ALA A 1 41 ? -7.034  -17.695 0.704   1.00 0.00 ? 332 ALA A HB1  12 
ATOM 9947  H HB2  . ALA A 1 41 ? -7.472  -16.182 1.499   1.00 0.00 ? 332 ALA A HB2  12 
ATOM 9948  H HB3  . ALA A 1 41 ? -6.605  -16.154 -0.037  1.00 0.00 ? 332 ALA A HB3  12 
ATOM 9949  N N    . ASN A 1 42 ? -6.587  -17.445 3.619   1.00 0.00 ? 333 ASN A N    12 
ATOM 9950  C CA   . ASN A 1 42 ? -6.800  -18.238 4.824   1.00 0.00 ? 333 ASN A CA   12 
ATOM 9951  C C    . ASN A 1 42 ? -7.577  -19.511 4.508   1.00 0.00 ? 333 ASN A C    12 
ATOM 9952  O O    . ASN A 1 42 ? -8.632  -19.412 3.846   1.00 0.00 ? 333 ASN A O    12 
ATOM 9953  C CB   . ASN A 1 42 ? -7.552  -17.416 5.873   1.00 0.00 ? 333 ASN A CB   12 
ATOM 9954  C CG   . ASN A 1 42 ? -6.830  -17.381 7.207   1.00 0.00 ? 333 ASN A CG   12 
ATOM 9955  O OD1  . ASN A 1 42 ? -7.158  -18.136 8.123   1.00 0.00 ? 333 ASN A OD1  12 
ATOM 9956  N ND2  . ASN A 1 42 ? -5.841  -16.501 7.321   1.00 0.00 ? 333 ASN A ND2  12 
ATOM 9957  O OXT  . ASN A 1 42 ? -7.122  -20.599 4.923   1.00 0.00 ? 333 ASN A OXT  12 
ATOM 9958  H H    . ASN A 1 42 ? -7.269  -16.797 3.347   1.00 0.00 ? 333 ASN A H    12 
ATOM 9959  H HA   . ASN A 1 42 ? -5.832  -18.509 5.219   1.00 0.00 ? 333 ASN A HA   12 
ATOM 9960  H HB2  . ASN A 1 42 ? -7.661  -16.403 5.518   1.00 0.00 ? 333 ASN A HB2  12 
ATOM 9961  H HD21 . ASN A 1 42 ? -5.637  -15.933 6.549   1.00 0.00 ? 333 ASN A HD21 12 
ATOM 9962  H HD22 . ASN A 1 42 ? -5.359  -16.457 8.172   1.00 0.00 ? 333 ASN A HD22 12 
ATOM 9963  N N    . GLY B 2 1  ? 9.982   -18.191 8.307   1.00 0.00 ? 198 GLY B N    12 
ATOM 9964  C CA   . GLY B 2 1  ? 9.543   -17.220 7.268   1.00 0.00 ? 198 GLY B CA   12 
ATOM 9965  C C    . GLY B 2 1  ? 10.708  -16.495 6.618   1.00 0.00 ? 198 GLY B C    12 
ATOM 9966  O O    . GLY B 2 1  ? 10.831  -15.277 6.749   1.00 0.00 ? 198 GLY B O    12 
ATOM 9967  H H1   . GLY B 2 1  ? 10.014  -19.151 7.908   1.00 0.00 ? 198 GLY B H1   12 
ATOM 9968  H H2   . GLY B 2 1  ? 9.318   -18.182 9.108   1.00 0.00 ? 198 GLY B H2   12 
ATOM 9969  H H3   . GLY B 2 1  ? 10.930  -17.940 8.654   1.00 0.00 ? 198 GLY B H3   12 
ATOM 9970  H HA2  . GLY B 2 1  ? 8.993   -17.750 6.504   1.00 0.00 ? 198 GLY B HA2  12 
ATOM 9971  H HA3  . GLY B 2 1  ? 8.891   -16.491 7.726   1.00 0.00 ? 198 GLY B HA3  12 
ATOM 9972  N N    . PRO B 2 2  ? 11.584  -17.224 5.906   1.00 0.00 ? 199 PRO B N    12 
ATOM 9973  C CA   . PRO B 2 2  ? 12.742  -16.633 5.238   1.00 0.00 ? 199 PRO B CA   12 
ATOM 9974  C C    . PRO B 2 2  ? 12.379  -16.004 3.898   1.00 0.00 ? 199 PRO B C    12 
ATOM 9975  O O    . PRO B 2 2  ? 12.924  -16.376 2.858   1.00 0.00 ? 199 PRO B O    12 
ATOM 9976  C CB   . PRO B 2 2  ? 13.662  -17.833 5.034   1.00 0.00 ? 199 PRO B CB   12 
ATOM 9977  C CG   . PRO B 2 2  ? 12.737  -18.990 4.869   1.00 0.00 ? 199 PRO B CG   12 
ATOM 9978  C CD   . PRO B 2 2  ? 11.513  -18.683 5.697   1.00 0.00 ? 199 PRO B CD   12 
ATOM 9979  H HA   . PRO B 2 2  ? 13.232  -15.900 5.862   1.00 0.00 ? 199 PRO B HA   12 
ATOM 9980  H HB2  . PRO B 2 2  ? 14.268  -17.681 4.153   1.00 0.00 ? 199 PRO B HB2  12 
ATOM 9981  H HG2  . PRO B 2 2  ? 12.467  -19.096 3.829   1.00 0.00 ? 199 PRO B HG2  12 
ATOM 9982  H HD2  . PRO B 2 2  ? 10.617  -18.949 5.156   1.00 0.00 ? 199 PRO B HD2  12 
ATOM 9983  N N    . LEU B 2 3  ? 11.455  -15.049 3.928   1.00 0.00 ? 200 LEU B N    12 
ATOM 9984  C CA   . LEU B 2 3  ? 11.018  -14.369 2.714   1.00 0.00 ? 200 LEU B CA   12 
ATOM 9985  C C    . LEU B 2 3  ? 11.858  -13.120 2.444   1.00 0.00 ? 200 LEU B C    12 
ATOM 9986  O O    . LEU B 2 3  ? 11.457  -12.250 1.671   1.00 0.00 ? 200 LEU B O    12 
ATOM 9987  C CB   . LEU B 2 3  ? 9.538   -13.992 2.820   1.00 0.00 ? 200 LEU B CB   12 
ATOM 9988  C CG   . LEU B 2 3  ? 9.241   -12.764 3.682   1.00 0.00 ? 200 LEU B CG   12 
ATOM 9989  C CD1  . LEU B 2 3  ? 8.740   -11.616 2.820   1.00 0.00 ? 200 LEU B CD1  12 
ATOM 9990  C CD2  . LEU B 2 3  ? 8.226   -13.104 4.765   1.00 0.00 ? 200 LEU B CD2  12 
ATOM 9991  H H    . LEU B 2 3  ? 11.057  -14.795 4.787   1.00 0.00 ? 200 LEU B H    12 
ATOM 9992  H HA   . LEU B 2 3  ? 11.145  -15.056 1.890   1.00 0.00 ? 200 LEU B HA   12 
ATOM 9993  H HB2  . LEU B 2 3  ? 9.164   -13.806 1.824   1.00 0.00 ? 200 LEU B HB2  12 
ATOM 9994  H HG   . LEU B 2 3  ? 10.152  -12.443 4.167   1.00 0.00 ? 200 LEU B HG   12 
ATOM 9995  H HD11 . LEU B 2 3  ? 8.116   -10.964 3.414   1.00 0.00 ? 200 LEU B HD11 12 
ATOM 9996  H HD12 . LEU B 2 3  ? 9.581   -11.058 2.439   1.00 0.00 ? 200 LEU B HD12 12 
ATOM 9997  H HD13 . LEU B 2 3  ? 8.165   -12.010 1.995   1.00 0.00 ? 200 LEU B HD13 12 
ATOM 9998  H HD21 . LEU B 2 3  ? 7.231   -13.077 4.347   1.00 0.00 ? 200 LEU B HD21 12 
ATOM 9999  H HD22 . LEU B 2 3  ? 8.429   -14.093 5.149   1.00 0.00 ? 200 LEU B HD22 12 
ATOM 10000 H HD23 . LEU B 2 3  ? 8.299   -12.385 5.567   1.00 0.00 ? 200 LEU B HD23 12 
ATOM 10001 N N    . GLY B 2 4  ? 13.023  -13.036 3.082   1.00 0.00 ? 201 GLY B N    12 
ATOM 10002 C CA   . GLY B 2 4  ? 13.889  -11.888 2.892   1.00 0.00 ? 201 GLY B CA   12 
ATOM 10003 C C    . GLY B 2 4  ? 13.805  -10.889 4.032   1.00 0.00 ? 201 GLY B C    12 
ATOM 10004 O O    . GLY B 2 4  ? 14.256  -9.751  3.900   1.00 0.00 ? 201 GLY B O    12 
ATOM 10005 H H    . GLY B 2 4  ? 13.296  -13.757 3.686   1.00 0.00 ? 201 GLY B H    12 
ATOM 10006 H HA2  . GLY B 2 4  ? 14.908  -12.233 2.808   1.00 0.00 ? 201 GLY B HA2  12 
ATOM 10007 H HA3  . GLY B 2 4  ? 13.612  -11.392 1.973   1.00 0.00 ? 201 GLY B HA3  12 
ATOM 10008 N N    . SER B 2 5  ? 13.226  -11.310 5.153   1.00 0.00 ? 202 SER B N    12 
ATOM 10009 C CA   . SER B 2 5  ? 13.093  -10.441 6.315   1.00 0.00 ? 202 SER B CA   12 
ATOM 10010 C C    . SER B 2 5  ? 12.254  -9.209  5.988   1.00 0.00 ? 202 SER B C    12 
ATOM 10011 O O    . SER B 2 5  ? 12.745  -8.251  5.389   1.00 0.00 ? 202 SER B O    12 
ATOM 10012 C CB   . SER B 2 5  ? 14.475  -10.011 6.812   1.00 0.00 ? 202 SER B CB   12 
ATOM 10013 O OG   . SER B 2 5  ? 14.575  -10.144 8.219   1.00 0.00 ? 202 SER B OG   12 
ATOM 10014 H H    . SER B 2 5  ? 12.882  -12.226 5.201   1.00 0.00 ? 202 SER B H    12 
ATOM 10015 H HA   . SER B 2 5  ? 12.599  -11.001 7.094   1.00 0.00 ? 202 SER B HA   12 
ATOM 10016 H HB2  . SER B 2 5  ? 15.229  -10.632 6.351   1.00 0.00 ? 202 SER B HB2  12 
ATOM 10017 H HG   . SER B 2 5  ? 15.370  -9.701  8.526   1.00 0.00 ? 202 SER B HG   12 
ATOM 10018 N N    . GLU B 2 6  ? 10.986  -9.239  6.386   1.00 0.00 ? 203 GLU B N    12 
ATOM 10019 C CA   . GLU B 2 6  ? 10.079  -8.122  6.140   1.00 0.00 ? 203 GLU B CA   12 
ATOM 10020 C C    . GLU B 2 6  ? 10.613  -6.844  6.781   1.00 0.00 ? 203 GLU B C    12 
ATOM 10021 O O    . GLU B 2 6  ? 11.348  -6.895  7.768   1.00 0.00 ? 203 GLU B O    12 
ATOM 10022 C CB   . GLU B 2 6  ? 8.686   -8.441  6.687   1.00 0.00 ? 203 GLU B CB   12 
ATOM 10023 C CG   . GLU B 2 6  ? 7.580   -7.597  6.075   1.00 0.00 ? 203 GLU B CG   12 
ATOM 10024 C CD   . GLU B 2 6  ? 6.283   -8.366  5.913   1.00 0.00 ? 203 GLU B CD   12 
ATOM 10025 O OE1  . GLU B 2 6  ? 5.586   -8.574  6.928   1.00 0.00 ? 203 GLU B OE1  12 
ATOM 10026 O OE2  . GLU B 2 6  ? 5.966   -8.761  4.771   1.00 0.00 ? 203 GLU B OE2  12 
ATOM 10027 H H    . GLU B 2 6  ? 10.651  -10.031 6.856   1.00 0.00 ? 203 GLU B H    12 
ATOM 10028 H HA   . GLU B 2 6  ? 10.015  -7.976  5.072   1.00 0.00 ? 203 GLU B HA   12 
ATOM 10029 H HB2  . GLU B 2 6  ? 8.466   -9.479  6.491   1.00 0.00 ? 203 GLU B HB2  12 
ATOM 10030 H HG2  . GLU B 2 6  ? 7.398   -6.746  6.715   1.00 0.00 ? 203 GLU B HG2  12 
ATOM 10031 N N    . LEU B 2 7  ? 10.241  -5.699  6.217   1.00 0.00 ? 204 LEU B N    12 
ATOM 10032 C CA   . LEU B 2 7  ? 10.689  -4.413  6.739   1.00 0.00 ? 204 LEU B CA   12 
ATOM 10033 C C    . LEU B 2 7  ? 9.846   -3.984  7.937   1.00 0.00 ? 204 LEU B C    12 
ATOM 10034 O O    . LEU B 2 7  ? 9.070   -4.773  8.477   1.00 0.00 ? 204 LEU B O    12 
ATOM 10035 C CB   . LEU B 2 7  ? 10.632  -3.338  5.646   1.00 0.00 ? 204 LEU B CB   12 
ATOM 10036 C CG   . LEU B 2 7  ? 11.065  -3.781  4.240   1.00 0.00 ? 204 LEU B CG   12 
ATOM 10037 C CD1  . LEU B 2 7  ? 12.176  -4.822  4.302   1.00 0.00 ? 204 LEU B CD1  12 
ATOM 10038 C CD2  . LEU B 2 7  ? 9.873   -4.316  3.460   1.00 0.00 ? 204 LEU B CD2  12 
ATOM 10039 H H    . LEU B 2 7  ? 9.652   -5.720  5.435   1.00 0.00 ? 204 LEU B H    12 
ATOM 10040 H HA   . LEU B 2 7  ? 11.713  -4.528  7.061   1.00 0.00 ? 204 LEU B HA   12 
ATOM 10041 H HB2  . LEU B 2 7  ? 9.617   -2.978  5.586   1.00 0.00 ? 204 LEU B HB2  12 
ATOM 10042 H HG   . LEU B 2 7  ? 11.449  -2.922  3.708   1.00 0.00 ? 204 LEU B HG   12 
ATOM 10043 H HD11 . LEU B 2 7  ? 11.766  -5.800  4.103   1.00 0.00 ? 204 LEU B HD11 12 
ATOM 10044 H HD12 . LEU B 2 7  ? 12.929  -4.590  3.561   1.00 0.00 ? 204 LEU B HD12 12 
ATOM 10045 H HD13 . LEU B 2 7  ? 12.625  -4.812  5.284   1.00 0.00 ? 204 LEU B HD13 12 
ATOM 10046 H HD21 . LEU B 2 7  ? 9.816   -3.819  2.503   1.00 0.00 ? 204 LEU B HD21 12 
ATOM 10047 H HD22 . LEU B 2 7  ? 9.991   -5.379  3.306   1.00 0.00 ? 204 LEU B HD22 12 
ATOM 10048 H HD23 . LEU B 2 7  ? 8.966   -4.130  4.016   1.00 0.00 ? 204 LEU B HD23 12 
ATOM 10049 N N    . GLU B 2 8  ? 10.004  -2.729  8.348   1.00 0.00 ? 205 GLU B N    12 
ATOM 10050 C CA   . GLU B 2 8  ? 9.262   -2.195  9.487   1.00 0.00 ? 205 GLU B CA   12 
ATOM 10051 C C    . GLU B 2 8  ? 7.848   -1.782  9.081   1.00 0.00 ? 205 GLU B C    12 
ATOM 10052 O O    . GLU B 2 8  ? 7.467   -0.618  9.207   1.00 0.00 ? 205 GLU B O    12 
ATOM 10053 C CB   . GLU B 2 8  ? 10.009  -1.004  10.094  1.00 0.00 ? 205 GLU B CB   12 
ATOM 10054 C CG   . GLU B 2 8  ? 10.695  -1.325  11.412  1.00 0.00 ? 205 GLU B CG   12 
ATOM 10055 C CD   . GLU B 2 8  ? 9.998   -0.690  12.600  1.00 0.00 ? 205 GLU B CD   12 
ATOM 10056 O OE1  . GLU B 2 8  ? 8.809   -1.000  12.826  1.00 0.00 ? 205 GLU B OE1  12 
ATOM 10057 O OE2  . GLU B 2 8  ? 10.641  0.116   13.304  1.00 0.00 ? 205 GLU B OE2  12 
ATOM 10058 H H    . GLU B 2 8  ? 10.634  -2.146  7.874   1.00 0.00 ? 205 GLU B H    12 
ATOM 10059 H HA   . GLU B 2 8  ? 9.193   -2.978  10.227  1.00 0.00 ? 205 GLU B HA   12 
ATOM 10060 H HB2  . GLU B 2 8  ? 10.762  -0.673  9.393   1.00 0.00 ? 205 GLU B HB2  12 
ATOM 10061 H HG2  . GLU B 2 8  ? 10.701  -2.397  11.549  1.00 0.00 ? 205 GLU B HG2  12 
ATOM 10062 N N    . SER B 2 9  ? 7.075   -2.744  8.589   1.00 0.00 ? 206 SER B N    12 
ATOM 10063 C CA   . SER B 2 9  ? 5.698   -2.494  8.168   1.00 0.00 ? 206 SER B CA   12 
ATOM 10064 C C    . SER B 2 9  ? 5.575   -1.191  7.378   1.00 0.00 ? 206 SER B C    12 
ATOM 10065 O O    . SER B 2 9  ? 4.912   -0.252  7.819   1.00 0.00 ? 206 SER B O    12 
ATOM 10066 C CB   . SER B 2 9  ? 4.774   -2.447  9.388   1.00 0.00 ? 206 SER B CB   12 
ATOM 10067 O OG   . SER B 2 9  ? 3.480   -1.994  9.030   1.00 0.00 ? 206 SER B OG   12 
ATOM 10068 H H    . SER B 2 9  ? 7.440   -3.651  8.507   1.00 0.00 ? 206 SER B H    12 
ATOM 10069 H HA   . SER B 2 9  ? 5.394   -3.313  7.534   1.00 0.00 ? 206 SER B HA   12 
ATOM 10070 H HB2  . SER B 2 9  ? 4.691   -3.437  9.812   1.00 0.00 ? 206 SER B HB2  12 
ATOM 10071 H HG   . SER B 2 9  ? 2.821   -2.575  9.414   1.00 0.00 ? 206 SER B HG   12 
ATOM 10072 N N    . PRO B 2 10 ? 6.214   -1.119  6.197   1.00 0.00 ? 207 PRO B N    12 
ATOM 10073 C CA   . PRO B 2 10 ? 6.167   0.067   5.341   1.00 0.00 ? 207 PRO B CA   12 
ATOM 10074 C C    . PRO B 2 10 ? 4.794   0.355   4.716   1.00 0.00 ? 207 PRO B C    12 
ATOM 10075 O O    . PRO B 2 10 ? 4.457   1.524   4.523   1.00 0.00 ? 207 PRO B O    12 
ATOM 10076 C CB   . PRO B 2 10 ? 7.203   -0.226  4.246   1.00 0.00 ? 207 PRO B CB   12 
ATOM 10077 C CG   . PRO B 2 10 ? 7.991   -1.389  4.744   1.00 0.00 ? 207 PRO B CG   12 
ATOM 10078 C CD   . PRO B 2 10 ? 7.054   -2.173  5.609   1.00 0.00 ? 207 PRO B CD   12 
ATOM 10079 H HA   . PRO B 2 10 ? 6.479   0.938   5.882   1.00 0.00 ? 207 PRO B HA   12 
ATOM 10080 H HB2  . PRO B 2 10 ? 6.696   -0.459  3.329   1.00 0.00 ? 207 PRO B HB2  12 
ATOM 10081 H HG2  . PRO B 2 10 ? 8.326   -1.989  3.910   1.00 0.00 ? 207 PRO B HG2  12 
ATOM 10082 H HD2  . PRO B 2 10 ? 6.468   -2.851  5.007   1.00 0.00 ? 207 PRO B HD2  12 
ATOM 10083 N N    . PRO B 2 11 ? 3.971   -0.672  4.379   1.00 0.00 ? 208 PRO B N    12 
ATOM 10084 C CA   . PRO B 2 11 ? 2.669   -0.443  3.765   1.00 0.00 ? 208 PRO B CA   12 
ATOM 10085 C C    . PRO B 2 11 ? 1.924   0.750   4.353   1.00 0.00 ? 208 PRO B C    12 
ATOM 10086 O O    . PRO B 2 11 ? 1.642   0.773   5.551   1.00 0.00 ? 208 PRO B O    12 
ATOM 10087 C CB   . PRO B 2 11 ? 1.889   -1.720  4.051   1.00 0.00 ? 208 PRO B CB   12 
ATOM 10088 C CG   . PRO B 2 11 ? 2.907   -2.781  4.296   1.00 0.00 ? 208 PRO B CG   12 
ATOM 10089 C CD   . PRO B 2 11 ? 4.238   -2.114  4.529   1.00 0.00 ? 208 PRO B CD   12 
ATOM 10090 H HA   . PRO B 2 11 ? 2.764   -0.325  2.708   1.00 0.00 ? 208 PRO B HA   12 
ATOM 10091 H HB2  . PRO B 2 11 ? 1.256   -1.569  4.911   1.00 0.00 ? 208 PRO B HB2  12 
ATOM 10092 H HG2  . PRO B 2 11 ? 2.628   -3.355  5.166   1.00 0.00 ? 208 PRO B HG2  12 
ATOM 10093 H HD2  . PRO B 2 11 ? 4.584   -2.347  5.515   1.00 0.00 ? 208 PRO B HD2  12 
ATOM 10094 N N    . PRO B 2 12 ? 1.645   1.780   3.527   1.00 0.00 ? 209 PRO B N    12 
ATOM 10095 C CA   . PRO B 2 12 ? 0.889   2.963   3.944   1.00 0.00 ? 209 PRO B CA   12 
ATOM 10096 C C    . PRO B 2 12 ? -0.373  2.592   4.727   1.00 0.00 ? 209 PRO B C    12 
ATOM 10097 O O    . PRO B 2 12 ? -0.569  1.434   5.079   1.00 0.00 ? 209 PRO B O    12 
ATOM 10098 C CB   . PRO B 2 12 ? 0.523   3.634   2.607   1.00 0.00 ? 209 PRO B CB   12 
ATOM 10099 C CG   . PRO B 2 12 ? 0.997   2.720   1.538   1.00 0.00 ? 209 PRO B CG   12 
ATOM 10100 C CD   . PRO B 2 12 ? 2.092   1.919   2.137   1.00 0.00 ? 209 PRO B CD   12 
ATOM 10101 H HA   . PRO B 2 12 ? 1.497   3.633   4.534   1.00 0.00 ? 209 PRO B HA   12 
ATOM 10102 H HB2  . PRO B 2 12 ? -0.539  3.749   2.548   1.00 0.00 ? 209 PRO B HB2  12 
ATOM 10103 H HG2  . PRO B 2 12 ? 0.193   2.073   1.241   1.00 0.00 ? 209 PRO B HG2  12 
ATOM 10104 H HD2  . PRO B 2 12 ? 2.165   0.969   1.638   1.00 0.00 ? 209 PRO B HD2  12 
ATOM 10105 N N    . PRO B 2 13 ? -1.270  3.555   4.988   1.00 0.00 ? 210 PRO B N    12 
ATOM 10106 C CA   . PRO B 2 13 ? -2.482  3.293   5.743   1.00 0.00 ? 210 PRO B CA   12 
ATOM 10107 C C    . PRO B 2 13 ? -3.615  2.782   4.868   1.00 0.00 ? 210 PRO B C    12 
ATOM 10108 O O    . PRO B 2 13 ? -3.481  2.697   3.647   1.00 0.00 ? 210 PRO B O    12 
ATOM 10109 C CB   . PRO B 2 13 ? -2.825  4.656   6.334   1.00 0.00 ? 210 PRO B CB   12 
ATOM 10110 C CG   . PRO B 2 13 ? -2.219  5.666   5.409   1.00 0.00 ? 210 PRO B CG   12 
ATOM 10111 C CD   . PRO B 2 13 ? -1.206  4.953   4.542   1.00 0.00 ? 210 PRO B CD   12 
ATOM 10112 H HA   . PRO B 2 13 ? -2.302  2.590   6.540   1.00 0.00 ? 210 PRO B HA   12 
ATOM 10113 H HB2  . PRO B 2 13 ? -3.898  4.761   6.380   1.00 0.00 ? 210 PRO B HB2  12 
ATOM 10114 H HG2  . PRO B 2 13 ? -2.991  6.095   4.790   1.00 0.00 ? 210 PRO B HG2  12 
ATOM 10115 H HD2  . PRO B 2 13 ? -1.493  5.032   3.502   1.00 0.00 ? 210 PRO B HD2  12 
ATOM 10116 N N    . TYR B 2 14 ? -4.732  2.444   5.499   1.00 0.00 ? 211 TYR B N    12 
ATOM 10117 C CA   . TYR B 2 14 ? -5.888  1.939   4.778   1.00 0.00 ? 211 TYR B CA   12 
ATOM 10118 C C    . TYR B 2 14 ? -6.488  3.041   3.913   1.00 0.00 ? 211 TYR B C    12 
ATOM 10119 O O    . TYR B 2 14 ? -6.303  3.059   2.698   1.00 0.00 ? 211 TYR B O    12 
ATOM 10120 C CB   . TYR B 2 14 ? -6.938  1.402   5.762   1.00 0.00 ? 211 TYR B CB   12 
ATOM 10121 C CG   . TYR B 2 14 ? -8.281  1.106   5.127   1.00 0.00 ? 211 TYR B CG   12 
ATOM 10122 C CD1  . TYR B 2 14 ? -8.355  0.553   3.859   1.00 0.00 ? 211 TYR B CD1  12 
ATOM 10123 C CD2  . TYR B 2 14 ? -9.468  1.387   5.792   1.00 0.00 ? 211 TYR B CD2  12 
ATOM 10124 C CE1  . TYR B 2 14 ? -9.574  0.284   3.266   1.00 0.00 ? 211 TYR B CE1  12 
ATOM 10125 C CE2  . TYR B 2 14 ? -10.693 1.120   5.206   1.00 0.00 ? 211 TYR B CE2  12 
ATOM 10126 C CZ   . TYR B 2 14 ? -10.740 0.569   3.943   1.00 0.00 ? 211 TYR B CZ   12 
ATOM 10127 O OH   . TYR B 2 14 ? -11.956 0.302   3.357   1.00 0.00 ? 211 TYR B OH   12 
ATOM 10128 H H    . TYR B 2 14 ? -4.781  2.544   6.471   1.00 0.00 ? 211 TYR B H    12 
ATOM 10129 H HA   . TYR B 2 14 ? -5.553  1.134   4.138   1.00 0.00 ? 211 TYR B HA   12 
ATOM 10130 H HB2  . TYR B 2 14 ? -6.573  0.487   6.201   1.00 0.00 ? 211 TYR B HB2  12 
ATOM 10131 H HD1  . TYR B 2 14 ? -7.442  0.330   3.336   1.00 0.00 ? 211 TYR B HD1  12 
ATOM 10132 H HD2  . TYR B 2 14 ? -9.429  1.817   6.781   1.00 0.00 ? 211 TYR B HD2  12 
ATOM 10133 H HE1  . TYR B 2 14 ? -9.609  -0.147  2.275   1.00 0.00 ? 211 TYR B HE1  12 
ATOM 10134 H HE2  . TYR B 2 14 ? -11.606 1.345   5.737   1.00 0.00 ? 211 TYR B HE2  12 
ATOM 10135 H HH   . TYR B 2 14 ? -12.128 0.947   2.668   1.00 0.00 ? 211 TYR B HH   12 
ATOM 10136 N N    . SER B 2 15 ? -7.200  3.961   4.556   1.00 0.00 ? 212 SER B N    12 
ATOM 10137 C CA   . SER B 2 15 ? -7.828  5.072   3.855   1.00 0.00 ? 212 SER B CA   12 
ATOM 10138 C C    . SER B 2 15 ? -8.638  4.571   2.658   1.00 0.00 ? 212 SER B C    12 
ATOM 10139 O O    . SER B 2 15 ? -9.824  4.274   2.794   1.00 0.00 ? 212 SER B O    12 
ATOM 10140 C CB   . SER B 2 15 ? -6.766  6.080   3.408   1.00 0.00 ? 212 SER B CB   12 
ATOM 10141 O OG   . SER B 2 15 ? -5.479  5.488   3.382   1.00 0.00 ? 212 SER B OG   12 
ATOM 10142 H H    . SER B 2 15 ? -7.305  3.890   5.527   1.00 0.00 ? 212 SER B H    12 
ATOM 10143 H HA   . SER B 2 15 ? -8.500  5.557   4.547   1.00 0.00 ? 212 SER B HA   12 
ATOM 10144 H HB2  . SER B 2 15 ? -7.004  6.434   2.419   1.00 0.00 ? 212 SER B HB2  12 
ATOM 10145 H HG   . SER B 2 15 ? -5.432  4.856   2.660   1.00 0.00 ? 212 SER B HG   12 
ATOM 10146 N N    . ARG B 2 16 ? -7.998  4.476   1.491   1.00 0.00 ? 213 ARG B N    12 
ATOM 10147 C CA   . ARG B 2 16 ? -8.663  4.004   0.275   1.00 0.00 ? 213 ARG B CA   12 
ATOM 10148 C C    . ARG B 2 16 ? -7.811  4.304   -0.956  1.00 0.00 ? 213 ARG B C    12 
ATOM 10149 O O    . ARG B 2 16 ? -7.711  3.485   -1.869  1.00 0.00 ? 213 ARG B O    12 
ATOM 10150 C CB   . ARG B 2 16 ? -10.046 4.646   0.121   1.00 0.00 ? 213 ARG B CB   12 
ATOM 10151 C CG   . ARG B 2 16 ? -11.189 3.751   0.581   1.00 0.00 ? 213 ARG B CG   12 
ATOM 10152 C CD   . ARG B 2 16 ? -11.942 3.149   -0.592  1.00 0.00 ? 213 ARG B CD   12 
ATOM 10153 N NE   . ARG B 2 16 ? -13.143 3.915   -0.920  1.00 0.00 ? 213 ARG B NE   12 
ATOM 10154 C CZ   . ARG B 2 16 ? -14.236 3.929   -0.164  1.00 0.00 ? 213 ARG B CZ   12 
ATOM 10155 N NH1  . ARG B 2 16 ? -14.281 3.216   0.953   1.00 0.00 ? 213 ARG B NH1  12 
ATOM 10156 N NH2  . ARG B 2 16 ? -15.285 4.656   -0.525  1.00 0.00 ? 213 ARG B NH2  12 
ATOM 10157 H H    . ARG B 2 16 ? -7.051  4.724   1.444   1.00 0.00 ? 213 ARG B H    12 
ATOM 10158 H HA   . ARG B 2 16 ? -8.781  2.933   0.360   1.00 0.00 ? 213 ARG B HA   12 
ATOM 10159 H HB2  . ARG B 2 16 ? -10.075 5.557   0.701   1.00 0.00 ? 213 ARG B HB2  12 
ATOM 10160 H HG2  . ARG B 2 16 ? -10.784 2.950   1.182   1.00 0.00 ? 213 ARG B HG2  12 
ATOM 10161 H HD2  . ARG B 2 16 ? -11.290 3.133   -1.453  1.00 0.00 ? 213 ARG B HD2  12 
ATOM 10162 H HE   . ARG B 2 16 ? -13.132 4.448   -1.743  1.00 0.00 ? 213 ARG B HE   12 
ATOM 10163 H HH11 . ARG B 2 16 ? -13.491 2.668   1.228   1.00 0.00 ? 213 ARG B HH11 12 
ATOM 10164 H HH12 . ARG B 2 16 ? -15.104 3.227   1.521   1.00 0.00 ? 213 ARG B HH12 12 
ATOM 10165 H HH21 . ARG B 2 16 ? -15.255 5.196   -1.366  1.00 0.00 ? 213 ARG B HH21 12 
ATOM 10166 H HH22 . ARG B 2 16 ? -16.107 4.665   0.044   1.00 0.00 ? 213 ARG B HH22 12 
ATOM 10167 N N    . TYR B 2 17 ? -7.199  5.485   -0.972  1.00 0.00 ? 214 TYR B N    12 
ATOM 10168 C CA   . TYR B 2 17 ? -6.352  5.899   -2.087  1.00 0.00 ? 214 TYR B CA   12 
ATOM 10169 C C    . TYR B 2 17 ? -4.896  5.505   -1.837  1.00 0.00 ? 214 TYR B C    12 
ATOM 10170 O O    . TYR B 2 17 ? -4.565  4.975   -0.776  1.00 0.00 ? 214 TYR B O    12 
ATOM 10171 C CB   . TYR B 2 17 ? -6.462  7.411   -2.300  1.00 0.00 ? 214 TYR B CB   12 
ATOM 10172 C CG   . TYR B 2 17 ? -7.841  7.961   -2.036  1.00 0.00 ? 214 TYR B CG   12 
ATOM 10173 C CD1  . TYR B 2 17 ? -8.969  7.189   -2.274  1.00 0.00 ? 214 TYR B CD1  12 
ATOM 10174 C CD2  . TYR B 2 17 ? -8.016  9.250   -1.555  1.00 0.00 ? 214 TYR B CD2  12 
ATOM 10175 C CE1  . TYR B 2 17 ? -10.234 7.686   -2.040  1.00 0.00 ? 214 TYR B CE1  12 
ATOM 10176 C CE2  . TYR B 2 17 ? -9.278  9.756   -1.318  1.00 0.00 ? 214 TYR B CE2  12 
ATOM 10177 C CZ   . TYR B 2 17 ? -10.385 8.971   -1.562  1.00 0.00 ? 214 TYR B CZ   12 
ATOM 10178 O OH   . TYR B 2 17 ? -11.645 9.472   -1.328  1.00 0.00 ? 214 TYR B OH   12 
ATOM 10179 H H    . TYR B 2 17 ? -7.322  6.096   -0.216  1.00 0.00 ? 214 TYR B H    12 
ATOM 10180 H HA   . TYR B 2 17 ? -6.702  5.392   -2.974  1.00 0.00 ? 214 TYR B HA   12 
ATOM 10181 H HB2  . TYR B 2 17 ? -5.772  7.915   -1.641  1.00 0.00 ? 214 TYR B HB2  12 
ATOM 10182 H HD1  . TYR B 2 17 ? -8.848  6.183   -2.647  1.00 0.00 ? 214 TYR B HD1  12 
ATOM 10183 H HD2  . TYR B 2 17 ? -7.147  9.863   -1.365  1.00 0.00 ? 214 TYR B HD2  12 
ATOM 10184 H HE1  . TYR B 2 17 ? -11.098 7.070   -2.232  1.00 0.00 ? 214 TYR B HE1  12 
ATOM 10185 H HE2  . TYR B 2 17 ? -9.393  10.762  -0.945  1.00 0.00 ? 214 TYR B HE2  12 
ATOM 10186 H HH   . TYR B 2 17 ? -11.748 10.308  -1.788  1.00 0.00 ? 214 TYR B HH   12 
ATOM 10187 N N    . PRO B 2 18 ? -4.006  5.760   -2.813  1.00 0.00 ? 215 PRO B N    12 
ATOM 10188 C CA   . PRO B 2 18 ? -2.592  5.428   -2.700  1.00 0.00 ? 215 PRO B CA   12 
ATOM 10189 C C    . PRO B 2 18 ? -1.779  6.539   -2.046  1.00 0.00 ? 215 PRO B C    12 
ATOM 10190 O O    . PRO B 2 18 ? -1.273  7.433   -2.723  1.00 0.00 ? 215 PRO B O    12 
ATOM 10191 C CB   . PRO B 2 18 ? -2.172  5.237   -4.157  1.00 0.00 ? 215 PRO B CB   12 
ATOM 10192 C CG   . PRO B 2 18 ? -3.098  6.097   -4.960  1.00 0.00 ? 215 PRO B CG   12 
ATOM 10193 C CD   . PRO B 2 18 ? -4.311  6.391   -4.106  1.00 0.00 ? 215 PRO B CD   12 
ATOM 10194 H HA   . PRO B 2 18 ? -2.446  4.508   -2.157  1.00 0.00 ? 215 PRO B HA   12 
ATOM 10195 H HB2  . PRO B 2 18 ? -1.143  5.548   -4.281  1.00 0.00 ? 215 PRO B HB2  12 
ATOM 10196 H HG2  . PRO B 2 18 ? -2.601  7.018   -5.224  1.00 0.00 ? 215 PRO B HG2  12 
ATOM 10197 H HD2  . PRO B 2 18 ? -4.433  7.458   -3.989  1.00 0.00 ? 215 PRO B HD2  12 
ATOM 10198 N N    . MET B 2 19 ? -1.659  6.476   -0.722  1.00 0.00 ? 216 MET B N    12 
ATOM 10199 C CA   . MET B 2 19 ? -0.904  7.477   0.020   1.00 0.00 ? 216 MET B CA   12 
ATOM 10200 C C    . MET B 2 19 ? 0.086   6.822   0.976   1.00 0.00 ? 216 MET B C    12 
ATOM 10201 O O    . MET B 2 19 ? -0.306  6.221   1.975   1.00 0.00 ? 216 MET B O    12 
ATOM 10202 C CB   . MET B 2 19 ? -1.853  8.399   0.791   1.00 0.00 ? 216 MET B CB   12 
ATOM 10203 C CG   . MET B 2 19 ? -2.497  7.745   2.006   1.00 0.00 ? 216 MET B CG   12 
ATOM 10204 S SD   . MET B 2 19 ? -4.227  8.215   2.214   1.00 0.00 ? 216 MET B SD   12 
ATOM 10205 C CE   . MET B 2 19 ? -5.008  7.213   0.951   1.00 0.00 ? 216 MET B CE   12 
ATOM 10206 H H    . MET B 2 19 ? -2.086  5.740   -0.236  1.00 0.00 ? 216 MET B H    12 
ATOM 10207 H HA   . MET B 2 19 ? -0.348  8.064   -0.695  1.00 0.00 ? 216 MET B HA   12 
ATOM 10208 H HB2  . MET B 2 19 ? -1.301  9.264   1.127   1.00 0.00 ? 216 MET B HB2  12 
ATOM 10209 H HG2  . MET B 2 19 ? -2.441  6.670   1.899   1.00 0.00 ? 216 MET B HG2  12 
ATOM 10210 H HE1  . MET B 2 19 ? -4.802  6.170   1.140   1.00 0.00 ? 216 MET B HE1  12 
ATOM 10211 H HE2  . MET B 2 19 ? -6.075  7.378   0.971   1.00 0.00 ? 216 MET B HE2  12 
ATOM 10212 H HE3  . MET B 2 19 ? -4.619  7.487   -0.018  1.00 0.00 ? 216 MET B HE3  12 
ATOM 10213 N N    . ASP B 2 20 ? 1.372   6.951   0.662   1.00 0.00 ? 217 ASP B N    12 
ATOM 10214 C CA   . ASP B 2 20 ? 2.430   6.375   1.486   1.00 0.00 ? 217 ASP B CA   12 
ATOM 10215 C C    . ASP B 2 20 ? 2.213   6.695   2.963   1.00 0.00 ? 217 ASP B C    12 
ATOM 10216 O O    . ASP B 2 20 ? 2.486   5.812   3.804   1.00 0.00 ? 217 ASP B O    12 
ATOM 10217 C CB   . ASP B 2 20 ? 3.794   6.901   1.036   1.00 0.00 ? 217 ASP B CB   12 
ATOM 10218 C CG   . ASP B 2 20 ? 3.802   8.406   0.853   1.00 0.00 ? 217 ASP B CG   12 
ATOM 10219 O OD1  . ASP B 2 20 ? 2.752   9.038   1.096   1.00 0.00 ? 217 ASP B OD1  12 
ATOM 10220 O OD2  . ASP B 2 20 ? 4.857   8.951   0.468   1.00 0.00 ? 217 ASP B OD2  12 
ATOM 10221 O OXT  . ASP B 2 20 ? 1.773   7.824   3.266   1.00 0.00 ? 217 ASP B OXT  12 
ATOM 10222 H H    . ASP B 2 20 ? 1.616   7.448   -0.147  1.00 0.00 ? 217 ASP B H    12 
ATOM 10223 H HA   . ASP B 2 20 ? 2.407   5.305   1.353   1.00 0.00 ? 217 ASP B HA   12 
ATOM 10224 H HB2  . ASP B 2 20 ? 4.536   6.643   1.777   1.00 0.00 ? 217 ASP B HB2  12 
ATOM 10225 N N    . GLY A 1 1  ? 8.791   -12.551 -7.286  1.00 0.00 ? 292 GLY A N    13 
ATOM 10226 C CA   . GLY A 1 1  ? 7.485   -12.020 -6.804  1.00 0.00 ? 292 GLY A CA   13 
ATOM 10227 C C    . GLY A 1 1  ? 6.397   -12.108 -7.858  1.00 0.00 ? 292 GLY A C    13 
ATOM 10228 O O    . GLY A 1 1  ? 6.261   -11.209 -8.687  1.00 0.00 ? 292 GLY A O    13 
ATOM 10229 H H1   . GLY A 1 1  ? 8.762   -13.590 -7.325  1.00 0.00 ? 292 GLY A H1   13 
ATOM 10230 H H2   . GLY A 1 1  ? 9.554   -12.259 -6.643  1.00 0.00 ? 292 GLY A H2   13 
ATOM 10231 H H3   . GLY A 1 1  ? 8.995   -12.185 -8.238  1.00 0.00 ? 292 GLY A H3   13 
ATOM 10232 H HA2  . GLY A 1 1  ? 7.178   -12.585 -5.936  1.00 0.00 ? 292 GLY A HA2  13 
ATOM 10233 H HA3  . GLY A 1 1  ? 7.613   -10.986 -6.520  1.00 0.00 ? 292 GLY A HA3  13 
ATOM 10234 N N    . PRO A 1 2  ? 5.602   -13.192 -7.851  1.00 0.00 ? 293 PRO A N    13 
ATOM 10235 C CA   . PRO A 1 2  ? 4.518   -13.385 -8.819  1.00 0.00 ? 293 PRO A CA   13 
ATOM 10236 C C    . PRO A 1 2  ? 3.526   -12.227 -8.819  1.00 0.00 ? 293 PRO A C    13 
ATOM 10237 O O    . PRO A 1 2  ? 2.792   -12.024 -9.786  1.00 0.00 ? 293 PRO A O    13 
ATOM 10238 C CB   . PRO A 1 2  ? 3.835   -14.673 -8.345  1.00 0.00 ? 293 PRO A CB   13 
ATOM 10239 C CG   . PRO A 1 2  ? 4.873   -15.385 -7.548  1.00 0.00 ? 293 PRO A CG   13 
ATOM 10240 C CD   . PRO A 1 2  ? 5.700   -14.314 -6.899  1.00 0.00 ? 293 PRO A CD   13 
ATOM 10241 H HA   . PRO A 1 2  ? 4.903   -13.526 -9.819  1.00 0.00 ? 293 PRO A HA   13 
ATOM 10242 H HB2  . PRO A 1 2  ? 2.975   -14.425 -7.741  1.00 0.00 ? 293 PRO A HB2  13 
ATOM 10243 H HG2  . PRO A 1 2  ? 4.401   -16.002 -6.798  1.00 0.00 ? 293 PRO A HG2  13 
ATOM 10244 H HD2  . PRO A 1 2  ? 5.283   -14.044 -5.940  1.00 0.00 ? 293 PRO A HD2  13 
ATOM 10245 N N    . LEU A 1 3  ? 3.507   -11.470 -7.725  1.00 0.00 ? 294 LEU A N    13 
ATOM 10246 C CA   . LEU A 1 3  ? 2.605   -10.330 -7.597  1.00 0.00 ? 294 LEU A CA   13 
ATOM 10247 C C    . LEU A 1 3  ? 1.164   -10.797 -7.412  1.00 0.00 ? 294 LEU A C    13 
ATOM 10248 O O    . LEU A 1 3  ? 0.581   -10.637 -6.340  1.00 0.00 ? 294 LEU A O    13 
ATOM 10249 C CB   . LEU A 1 3  ? 2.708   -9.425  -8.828  1.00 0.00 ? 294 LEU A CB   13 
ATOM 10250 C CG   . LEU A 1 3  ? 3.247   -8.020  -8.554  1.00 0.00 ? 294 LEU A CG   13 
ATOM 10251 C CD1  . LEU A 1 3  ? 2.403   -7.322  -7.500  1.00 0.00 ? 294 LEU A CD1  13 
ATOM 10252 C CD2  . LEU A 1 3  ? 4.703   -8.084  -8.118  1.00 0.00 ? 294 LEU A CD2  13 
ATOM 10253 H H    . LEU A 1 3  ? 4.116   -11.682 -6.988  1.00 0.00 ? 294 LEU A H    13 
ATOM 10254 H HA   . LEU A 1 3  ? 2.902   -9.770  -6.724  1.00 0.00 ? 294 LEU A HA   13 
ATOM 10255 H HB2  . LEU A 1 3  ? 3.356   -9.904  -9.547  1.00 0.00 ? 294 LEU A HB2  13 
ATOM 10256 H HG   . LEU A 1 3  ? 3.194   -7.439  -9.463  1.00 0.00 ? 294 LEU A HG   13 
ATOM 10257 H HD11 . LEU A 1 3  ? 2.956   -7.268  -6.574  1.00 0.00 ? 294 LEU A HD11 13 
ATOM 10258 H HD12 . LEU A 1 3  ? 2.161   -6.325  -7.835  1.00 0.00 ? 294 LEU A HD12 13 
ATOM 10259 H HD13 . LEU A 1 3  ? 1.492   -7.880  -7.342  1.00 0.00 ? 294 LEU A HD13 13 
ATOM 10260 H HD21 . LEU A 1 3  ? 4.926   -7.238  -7.484  1.00 0.00 ? 294 LEU A HD21 13 
ATOM 10261 H HD22 . LEU A 1 3  ? 4.876   -8.998  -7.571  1.00 0.00 ? 294 LEU A HD22 13 
ATOM 10262 H HD23 . LEU A 1 3  ? 5.342   -8.058  -8.989  1.00 0.00 ? 294 LEU A HD23 13 
ATOM 10263 N N    . GLY A 1 4  ? 0.595   -11.376 -8.464  1.00 0.00 ? 295 GLY A N    13 
ATOM 10264 C CA   . GLY A 1 4  ? -0.771  -11.857 -8.398  1.00 0.00 ? 295 GLY A CA   13 
ATOM 10265 C C    . GLY A 1 4  ? -1.297  -12.299 -9.749  1.00 0.00 ? 295 GLY A C    13 
ATOM 10266 O O    . GLY A 1 4  ? -1.283  -11.530 -10.710 1.00 0.00 ? 295 GLY A O    13 
ATOM 10267 H H    . GLY A 1 4  ? 1.109   -11.478 -9.293  1.00 0.00 ? 295 GLY A H    13 
ATOM 10268 H HA2  . GLY A 1 4  ? -0.814  -12.694 -7.716  1.00 0.00 ? 295 GLY A HA2  13 
ATOM 10269 H HA3  . GLY A 1 4  ? -1.401  -11.066 -8.020  1.00 0.00 ? 295 GLY A HA3  13 
ATOM 10270 N N    . SER A 1 5  ? -1.763  -13.541 -9.823  1.00 0.00 ? 296 SER A N    13 
ATOM 10271 C CA   . SER A 1 5  ? -2.298  -14.085 -11.066 1.00 0.00 ? 296 SER A CA   13 
ATOM 10272 C C    . SER A 1 5  ? -3.818  -13.974 -11.098 1.00 0.00 ? 296 SER A C    13 
ATOM 10273 O O    . SER A 1 5  ? -4.523  -14.979 -11.195 1.00 0.00 ? 296 SER A O    13 
ATOM 10274 C CB   . SER A 1 5  ? -1.879  -15.547 -11.229 1.00 0.00 ? 296 SER A CB   13 
ATOM 10275 O OG   . SER A 1 5  ? -2.111  -16.000 -12.552 1.00 0.00 ? 296 SER A OG   13 
ATOM 10276 H H    . SER A 1 5  ? -1.748  -14.107 -9.022  1.00 0.00 ? 296 SER A H    13 
ATOM 10277 H HA   . SER A 1 5  ? -1.889  -13.510 -11.883 1.00 0.00 ? 296 SER A HA   13 
ATOM 10278 H HB2  . SER A 1 5  ? -0.827  -15.645 -11.008 1.00 0.00 ? 296 SER A HB2  13 
ATOM 10279 H HG   . SER A 1 5  ? -1.468  -15.603 -13.144 1.00 0.00 ? 296 SER A HG   13 
ATOM 10280 N N    . GLY A 1 6  ? -4.317  -12.745 -11.018 1.00 0.00 ? 297 GLY A N    13 
ATOM 10281 C CA   . GLY A 1 6  ? -5.750  -12.522 -11.038 1.00 0.00 ? 297 GLY A CA   13 
ATOM 10282 C C    . GLY A 1 6  ? -6.162  -11.332 -10.193 1.00 0.00 ? 297 GLY A C    13 
ATOM 10283 O O    . GLY A 1 6  ? -5.433  -10.934 -9.284  1.00 0.00 ? 297 GLY A O    13 
ATOM 10284 H H    . GLY A 1 6  ? -3.706  -11.983 -10.943 1.00 0.00 ? 297 GLY A H    13 
ATOM 10285 H HA2  . GLY A 1 6  ? -6.062  -12.352 -12.057 1.00 0.00 ? 297 GLY A HA2  13 
ATOM 10286 H HA3  . GLY A 1 6  ? -6.246  -13.405 -10.662 1.00 0.00 ? 297 GLY A HA3  13 
ATOM 10287 N N    . PRO A 1 7  ? -7.335  -10.740 -10.471 1.00 0.00 ? 298 PRO A N    13 
ATOM 10288 C CA   . PRO A 1 7  ? -7.833  -9.582  -9.720  1.00 0.00 ? 298 PRO A CA   13 
ATOM 10289 C C    . PRO A 1 7  ? -7.960  -9.873  -8.230  1.00 0.00 ? 298 PRO A C    13 
ATOM 10290 O O    . PRO A 1 7  ? -8.301  -10.985 -7.831  1.00 0.00 ? 298 PRO A O    13 
ATOM 10291 C CB   . PRO A 1 7  ? -9.212  -9.316  -10.333 1.00 0.00 ? 298 PRO A CB   13 
ATOM 10292 C CG   . PRO A 1 7  ? -9.166  -9.955  -11.678 1.00 0.00 ? 298 PRO A CG   13 
ATOM 10293 C CD   . PRO A 1 7  ? -8.267  -11.149 -11.535 1.00 0.00 ? 298 PRO A CD   13 
ATOM 10294 H HA   . PRO A 1 7  ? -7.199  -8.718  -9.862  1.00 0.00 ? 298 PRO A HA   13 
ATOM 10295 H HB2  . PRO A 1 7  ? -9.976  -9.760  -9.711  1.00 0.00 ? 298 PRO A HB2  13 
ATOM 10296 H HG2  . PRO A 1 7  ? -10.158 -10.265 -11.972 1.00 0.00 ? 298 PRO A HG2  13 
ATOM 10297 H HD2  . PRO A 1 7  ? -8.836  -12.018 -11.237 1.00 0.00 ? 298 PRO A HD2  13 
ATOM 10298 N N    . LEU A 1 8  ? -7.684  -8.864  -7.412  1.00 0.00 ? 299 LEU A N    13 
ATOM 10299 C CA   . LEU A 1 8  ? -7.765  -9.010  -5.963  1.00 0.00 ? 299 LEU A CA   13 
ATOM 10300 C C    . LEU A 1 8  ? -9.177  -9.392  -5.529  1.00 0.00 ? 299 LEU A C    13 
ATOM 10301 O O    . LEU A 1 8  ? -10.144 -9.149  -6.252  1.00 0.00 ? 299 LEU A O    13 
ATOM 10302 C CB   . LEU A 1 8  ? -7.344  -7.709  -5.280  1.00 0.00 ? 299 LEU A CB   13 
ATOM 10303 C CG   . LEU A 1 8  ? -5.834  -7.502  -5.167  1.00 0.00 ? 299 LEU A CG   13 
ATOM 10304 C CD1  . LEU A 1 8  ? -5.526  -6.135  -4.574  1.00 0.00 ? 299 LEU A CD1  13 
ATOM 10305 C CD2  . LEU A 1 8  ? -5.211  -8.606  -4.329  1.00 0.00 ? 299 LEU A CD2  13 
ATOM 10306 H H    . LEU A 1 8  ? -7.418  -8.001  -7.790  1.00 0.00 ? 299 LEU A H    13 
ATOM 10307 H HA   . LEU A 1 8  ? -7.086  -9.795  -5.670  1.00 0.00 ? 299 LEU A HA   13 
ATOM 10308 H HB2  . LEU A 1 8  ? -7.761  -6.882  -5.839  1.00 0.00 ? 299 LEU A HB2  13 
ATOM 10309 H HG   . LEU A 1 8  ? -5.398  -7.543  -6.155  1.00 0.00 ? 299 LEU A HG   13 
ATOM 10310 H HD11 . LEU A 1 8  ? -6.126  -5.982  -3.691  1.00 0.00 ? 299 LEU A HD11 13 
ATOM 10311 H HD12 . LEU A 1 8  ? -4.479  -6.085  -4.313  1.00 0.00 ? 299 LEU A HD12 13 
ATOM 10312 H HD13 . LEU A 1 8  ? -5.753  -5.369  -5.302  1.00 0.00 ? 299 LEU A HD13 13 
ATOM 10313 H HD21 . LEU A 1 8  ? -4.866  -9.399  -4.976  1.00 0.00 ? 299 LEU A HD21 13 
ATOM 10314 H HD22 . LEU A 1 8  ? -4.375  -8.209  -3.773  1.00 0.00 ? 299 LEU A HD22 13 
ATOM 10315 H HD23 . LEU A 1 8  ? -5.947  -8.997  -3.642  1.00 0.00 ? 299 LEU A HD23 13 
ATOM 10316 N N    . PRO A 1 9  ? -9.313  -10.000 -4.337  1.00 0.00 ? 300 PRO A N    13 
ATOM 10317 C CA   . PRO A 1 9  ? -10.616 -10.415 -3.808  1.00 0.00 ? 300 PRO A CA   13 
ATOM 10318 C C    . PRO A 1 9  ? -11.601 -9.251  -3.731  1.00 0.00 ? 300 PRO A C    13 
ATOM 10319 O O    . PRO A 1 9  ? -11.234 -8.101  -3.977  1.00 0.00 ? 300 PRO A O    13 
ATOM 10320 C CB   . PRO A 1 9  ? -10.290 -10.934 -2.405  1.00 0.00 ? 300 PRO A CB   13 
ATOM 10321 C CG   . PRO A 1 9  ? -8.846  -11.296 -2.455  1.00 0.00 ? 300 PRO A CG   13 
ATOM 10322 C CD   . PRO A 1 9  ? -8.211  -10.332 -3.416  1.00 0.00 ? 300 PRO A CD   13 
ATOM 10323 H HA   . PRO A 1 9  ? -11.047 -11.210 -4.400  1.00 0.00 ? 300 PRO A HA   13 
ATOM 10324 H HB2  . PRO A 1 9  ? -10.479 -10.158 -1.679  1.00 0.00 ? 300 PRO A HB2  13 
ATOM 10325 H HG2  . PRO A 1 9  ? -8.407  -11.191 -1.473  1.00 0.00 ? 300 PRO A HG2  13 
ATOM 10326 H HD2  . PRO A 1 9  ? -7.865  -9.451  -2.896  1.00 0.00 ? 300 PRO A HD2  13 
ATOM 10327 N N    . PRO A 1 10 ? -12.869 -9.536  -3.387  1.00 0.00 ? 301 PRO A N    13 
ATOM 10328 C CA   . PRO A 1 10 ? -13.914 -8.512  -3.280  1.00 0.00 ? 301 PRO A CA   13 
ATOM 10329 C C    . PRO A 1 10 ? -13.730 -7.602  -2.066  1.00 0.00 ? 301 PRO A C    13 
ATOM 10330 O O    . PRO A 1 10 ? -14.628 -7.481  -1.232  1.00 0.00 ? 301 PRO A O    13 
ATOM 10331 C CB   . PRO A 1 10 ? -15.214 -9.325  -3.139  1.00 0.00 ? 301 PRO A CB   13 
ATOM 10332 C CG   . PRO A 1 10 ? -14.842 -10.740 -3.443  1.00 0.00 ? 301 PRO A CG   13 
ATOM 10333 C CD   . PRO A 1 10 ? -13.392 -10.874 -3.090  1.00 0.00 ? 301 PRO A CD   13 
ATOM 10334 H HA   . PRO A 1 10 ? -13.964 -7.907  -4.173  1.00 0.00 ? 301 PRO A HA   13 
ATOM 10335 H HB2  . PRO A 1 10 ? -15.592 -9.226  -2.133  1.00 0.00 ? 301 PRO A HB2  13 
ATOM 10336 H HG2  . PRO A 1 10 ? -15.438 -11.412 -2.843  1.00 0.00 ? 301 PRO A HG2  13 
ATOM 10337 H HD2  . PRO A 1 10 ? -13.276 -11.113 -2.043  1.00 0.00 ? 301 PRO A HD2  13 
ATOM 10338 N N    . GLY A 1 11 ? -12.568 -6.962  -1.970  1.00 0.00 ? 302 GLY A N    13 
ATOM 10339 C CA   . GLY A 1 11 ? -12.307 -6.069  -0.854  1.00 0.00 ? 302 GLY A CA   13 
ATOM 10340 C C    . GLY A 1 11 ? -10.919 -5.458  -0.895  1.00 0.00 ? 302 GLY A C    13 
ATOM 10341 O O    . GLY A 1 11 ? -10.714 -4.336  -0.434  1.00 0.00 ? 302 GLY A O    13 
ATOM 10342 H H    . GLY A 1 11 ? -11.883 -7.102  -2.653  1.00 0.00 ? 302 GLY A H    13 
ATOM 10343 H HA2  . GLY A 1 11 ? -13.035 -5.271  -0.869  1.00 0.00 ? 302 GLY A HA2  13 
ATOM 10344 H HA3  . GLY A 1 11 ? -12.417 -6.622  0.066   1.00 0.00 ? 302 GLY A HA3  13 
ATOM 10345 N N    . TRP A 1 12 ? -9.960  -6.192  -1.446  1.00 0.00 ? 303 TRP A N    13 
ATOM 10346 C CA   . TRP A 1 12 ? -8.589  -5.710  -1.527  1.00 0.00 ? 303 TRP A CA   13 
ATOM 10347 C C    . TRP A 1 12 ? -8.357  -4.850  -2.761  1.00 0.00 ? 303 TRP A C    13 
ATOM 10348 O O    . TRP A 1 12 ? -9.160  -4.845  -3.695  1.00 0.00 ? 303 TRP A O    13 
ATOM 10349 C CB   . TRP A 1 12 ? -7.625  -6.890  -1.535  1.00 0.00 ? 303 TRP A CB   13 
ATOM 10350 C CG   . TRP A 1 12 ? -7.663  -7.675  -0.268  1.00 0.00 ? 303 TRP A CG   13 
ATOM 10351 C CD1  . TRP A 1 12 ? -8.531  -8.676  0.049   1.00 0.00 ? 303 TRP A CD1  13 
ATOM 10352 C CD2  . TRP A 1 12 ? -6.799  -7.517  0.858   1.00 0.00 ? 303 TRP A CD2  13 
ATOM 10353 N NE1  . TRP A 1 12 ? -8.258  -9.156  1.304   1.00 0.00 ? 303 TRP A NE1  13 
ATOM 10354 C CE2  . TRP A 1 12 ? -7.194  -8.461  1.822   1.00 0.00 ? 303 TRP A CE2  13 
ATOM 10355 C CE3  . TRP A 1 12 ? -5.726  -6.670  1.138   1.00 0.00 ? 303 TRP A CE3  13 
ATOM 10356 C CZ2  . TRP A 1 12 ? -6.548  -8.580  3.051   1.00 0.00 ? 303 TRP A CZ2  13 
ATOM 10357 C CZ3  . TRP A 1 12 ? -5.087  -6.788  2.355   1.00 0.00 ? 303 TRP A CZ3  13 
ATOM 10358 C CH2  . TRP A 1 12 ? -5.497  -7.737  3.299   1.00 0.00 ? 303 TRP A CH2  13 
ATOM 10359 H H    . TRP A 1 12 ? -10.176 -7.079  -1.797  1.00 0.00 ? 303 TRP A H    13 
ATOM 10360 H HA   . TRP A 1 12 ? -8.396  -5.114  -0.648  1.00 0.00 ? 303 TRP A HA   13 
ATOM 10361 H HB2  . TRP A 1 12 ? -7.883  -7.553  -2.347  1.00 0.00 ? 303 TRP A HB2  13 
ATOM 10362 H HD1  . TRP A 1 12 ? -9.315  -9.029  -0.603  1.00 0.00 ? 303 TRP A HD1  13 
ATOM 10363 H HE1  . TRP A 1 12 ? -8.743  -9.878  1.751   1.00 0.00 ? 303 TRP A HE1  13 
ATOM 10364 H HE3  . TRP A 1 12 ? -5.395  -5.931  0.423   1.00 0.00 ? 303 TRP A HE3  13 
ATOM 10365 H HZ2  . TRP A 1 12 ? -6.852  -9.307  3.790   1.00 0.00 ? 303 TRP A HZ2  13 
ATOM 10366 H HZ3  . TRP A 1 12 ? -4.256  -6.140  2.588   1.00 0.00 ? 303 TRP A HZ3  13 
ATOM 10367 H HH2  . TRP A 1 12 ? -4.965  -7.793  4.235   1.00 0.00 ? 303 TRP A HH2  13 
ATOM 10368 N N    . GLU A 1 13 ? -7.246  -4.124  -2.749  1.00 0.00 ? 304 GLU A N    13 
ATOM 10369 C CA   . GLU A 1 13 ? -6.875  -3.256  -3.855  1.00 0.00 ? 304 GLU A CA   13 
ATOM 10370 C C    . GLU A 1 13 ? -5.391  -2.925  -3.799  1.00 0.00 ? 304 GLU A C    13 
ATOM 10371 O O    . GLU A 1 13 ? -4.865  -2.558  -2.748  1.00 0.00 ? 304 GLU A O    13 
ATOM 10372 C CB   . GLU A 1 13 ? -7.697  -1.972  -3.832  1.00 0.00 ? 304 GLU A CB   13 
ATOM 10373 C CG   . GLU A 1 13 ? -7.423  -1.078  -5.026  1.00 0.00 ? 304 GLU A CG   13 
ATOM 10374 C CD   . GLU A 1 13 ? -8.681  -0.721  -5.794  1.00 0.00 ? 304 GLU A CD   13 
ATOM 10375 O OE1  . GLU A 1 13 ? -9.561  -0.052  -5.212  1.00 0.00 ? 304 GLU A OE1  13 
ATOM 10376 O OE2  . GLU A 1 13 ? -8.784  -1.108  -6.977  1.00 0.00 ? 304 GLU A OE2  13 
ATOM 10377 H H    . GLU A 1 13 ? -6.656  -4.174  -1.967  1.00 0.00 ? 304 GLU A H    13 
ATOM 10378 H HA   . GLU A 1 13 ? -7.077  -3.780  -4.774  1.00 0.00 ? 304 GLU A HA   13 
ATOM 10379 H HB2  . GLU A 1 13 ? -8.747  -2.227  -3.828  1.00 0.00 ? 304 GLU A HB2  13 
ATOM 10380 H HG2  . GLU A 1 13 ? -6.962  -0.173  -4.677  1.00 0.00 ? 304 GLU A HG2  13 
ATOM 10381 N N    . ILE A 1 14 ? -4.718  -3.054  -4.935  1.00 0.00 ? 305 ILE A N    13 
ATOM 10382 C CA   . ILE A 1 14 ? -3.291  -2.770  -5.013  1.00 0.00 ? 305 ILE A CA   13 
ATOM 10383 C C    . ILE A 1 14 ? -3.041  -1.267  -5.075  1.00 0.00 ? 305 ILE A C    13 
ATOM 10384 O O    . ILE A 1 14 ? -3.771  -0.528  -5.733  1.00 0.00 ? 305 ILE A O    13 
ATOM 10385 C CB   . ILE A 1 14 ? -2.647  -3.444  -6.246  1.00 0.00 ? 305 ILE A CB   13 
ATOM 10386 C CG1  . ILE A 1 14 ? -2.816  -4.965  -6.175  1.00 0.00 ? 305 ILE A CG1  13 
ATOM 10387 C CG2  . ILE A 1 14 ? -1.171  -3.074  -6.352  1.00 0.00 ? 305 ILE A CG2  13 
ATOM 10388 C CD1  . ILE A 1 14 ? -2.045  -5.711  -7.243  1.00 0.00 ? 305 ILE A CD1  13 
ATOM 10389 H H    . ILE A 1 14 ? -5.195  -3.340  -5.743  1.00 0.00 ? 305 ILE A H    13 
ATOM 10390 H HA   . ILE A 1 14 ? -2.821  -3.169  -4.122  1.00 0.00 ? 305 ILE A HA   13 
ATOM 10391 H HB   . ILE A 1 14 ? -3.147  -3.075  -7.129  1.00 0.00 ? 305 ILE A HB   13 
ATOM 10392 H HG12 . ILE A 1 14 ? -2.471  -5.314  -5.214  1.00 0.00 ? 305 ILE A HG12 13 
ATOM 10393 H HG21 . ILE A 1 14 ? -0.885  -2.488  -5.491  1.00 0.00 ? 305 ILE A HG21 13 
ATOM 10394 H HG22 . ILE A 1 14 ? -0.575  -3.972  -6.390  1.00 0.00 ? 305 ILE A HG22 13 
ATOM 10395 H HG23 . ILE A 1 14 ? -1.009  -2.495  -7.249  1.00 0.00 ? 305 ILE A HG23 13 
ATOM 10396 H HD11 . ILE A 1 14 ? -0.986  -5.603  -7.064  1.00 0.00 ? 305 ILE A HD11 13 
ATOM 10397 H HD12 . ILE A 1 14 ? -2.310  -6.757  -7.214  1.00 0.00 ? 305 ILE A HD12 13 
ATOM 10398 H HD13 . ILE A 1 14 ? -2.289  -5.305  -8.214  1.00 0.00 ? 305 ILE A HD13 13 
ATOM 10399 N N    . ARG A 1 15 ? -1.999  -0.829  -4.381  1.00 0.00 ? 306 ARG A N    13 
ATOM 10400 C CA   . ARG A 1 15 ? -1.632  0.578   -4.349  1.00 0.00 ? 306 ARG A CA   13 
ATOM 10401 C C    . ARG A 1 15 ? -0.140  0.718   -4.089  1.00 0.00 ? 306 ARG A C    13 
ATOM 10402 O O    . ARG A 1 15 ? 0.477   -0.175  -3.521  1.00 0.00 ? 306 ARG A O    13 
ATOM 10403 C CB   . ARG A 1 15 ? -2.426  1.310   -3.268  1.00 0.00 ? 306 ARG A CB   13 
ATOM 10404 C CG   . ARG A 1 15 ? -3.891  1.501   -3.621  1.00 0.00 ? 306 ARG A CG   13 
ATOM 10405 C CD   . ARG A 1 15 ? -4.442  2.791   -3.041  1.00 0.00 ? 306 ARG A CD   13 
ATOM 10406 N NE   . ARG A 1 15 ? -5.721  3.160   -3.640  1.00 0.00 ? 306 ARG A NE   13 
ATOM 10407 C CZ   . ARG A 1 15 ? -5.838  3.691   -4.854  1.00 0.00 ? 306 ARG A CZ   13 
ATOM 10408 N NH1  . ARG A 1 15 ? -4.758  3.918   -5.588  1.00 0.00 ? 306 ARG A NH1  13 
ATOM 10409 N NH2  . ARG A 1 15 ? -7.037  3.996   -5.332  1.00 0.00 ? 306 ARG A NH2  13 
ATOM 10410 H H    . ARG A 1 15 ? -1.461  -1.473  -3.876  1.00 0.00 ? 306 ARG A H    13 
ATOM 10411 H HA   . ARG A 1 15 ? -1.863  1.006   -5.313  1.00 0.00 ? 306 ARG A HA   13 
ATOM 10412 H HB2  . ARG A 1 15 ? -2.370  0.744   -2.351  1.00 0.00 ? 306 ARG A HB2  13 
ATOM 10413 H HG2  . ARG A 1 15 ? -3.992  1.531   -4.696  1.00 0.00 ? 306 ARG A HG2  13 
ATOM 10414 H HD2  . ARG A 1 15 ? -4.577  2.663   -1.977  1.00 0.00 ? 306 ARG A HD2  13 
ATOM 10415 H HE   . ARG A 1 15 ? -6.532  3.002   -3.114  1.00 0.00 ? 306 ARG A HE   13 
ATOM 10416 H HH11 . ARG A 1 15 ? -3.852  3.690   -5.230  1.00 0.00 ? 306 ARG A HH11 13 
ATOM 10417 H HH12 . ARG A 1 15 ? -4.848  4.318   -6.501  1.00 0.00 ? 306 ARG A HH12 13 
ATOM 10418 H HH21 . ARG A 1 15 ? -7.854  3.825   -4.781  1.00 0.00 ? 306 ARG A HH21 13 
ATOM 10419 H HH22 . ARG A 1 15 ? -7.123  4.395   -6.244  1.00 0.00 ? 306 ARG A HH22 13 
ATOM 10420 N N    . ASN A 1 16 ? 0.439   1.834   -4.502  1.00 0.00 ? 307 ASN A N    13 
ATOM 10421 C CA   . ASN A 1 16 ? 1.864   2.055   -4.307  1.00 0.00 ? 307 ASN A CA   13 
ATOM 10422 C C    . ASN A 1 16 ? 2.115   3.183   -3.312  1.00 0.00 ? 307 ASN A C    13 
ATOM 10423 O O    . ASN A 1 16 ? 1.255   4.037   -3.096  1.00 0.00 ? 307 ASN A O    13 
ATOM 10424 C CB   . ASN A 1 16 ? 2.534   2.358   -5.644  1.00 0.00 ? 307 ASN A CB   13 
ATOM 10425 C CG   . ASN A 1 16 ? 2.400   1.211   -6.627  1.00 0.00 ? 307 ASN A CG   13 
ATOM 10426 O OD1  . ASN A 1 16 ? 1.342   0.592   -6.732  1.00 0.00 ? 307 ASN A OD1  13 
ATOM 10427 N ND2  . ASN A 1 16 ? 3.472   0.922   -7.353  1.00 0.00 ? 307 ASN A ND2  13 
ATOM 10428 H H    . ASN A 1 16 ? -0.101  2.522   -4.948  1.00 0.00 ? 307 ASN A H    13 
ATOM 10429 H HA   . ASN A 1 16 ? 2.283   1.145   -3.906  1.00 0.00 ? 307 ASN A HA   13 
ATOM 10430 H HB2  . ASN A 1 16 ? 2.074   3.230   -6.076  1.00 0.00 ? 307 ASN A HB2  13 
ATOM 10431 H HD21 . ASN A 1 16 ? 4.282   1.458   -7.217  1.00 0.00 ? 307 ASN A HD21 13 
ATOM 10432 H HD22 . ASN A 1 16 ? 3.411   0.182   -7.993  1.00 0.00 ? 307 ASN A HD22 13 
ATOM 10433 N N    . THR A 1 17 ? 3.300   3.177   -2.708  1.00 0.00 ? 308 THR A N    13 
ATOM 10434 C CA   . THR A 1 17 ? 3.664   4.192   -1.727  1.00 0.00 ? 308 THR A CA   13 
ATOM 10435 C C    . THR A 1 17 ? 4.347   5.392   -2.381  1.00 0.00 ? 308 THR A C    13 
ATOM 10436 O O    . THR A 1 17 ? 5.309   5.938   -1.840  1.00 0.00 ? 308 THR A O    13 
ATOM 10437 C CB   . THR A 1 17 ? 4.598   3.614   -0.647  1.00 0.00 ? 308 THR A CB   13 
ATOM 10438 O OG1  . THR A 1 17 ? 5.882   3.325   -1.212  1.00 0.00 ? 308 THR A OG1  13 
ATOM 10439 C CG2  . THR A 1 17 ? 4.007   2.347   -0.044  1.00 0.00 ? 308 THR A CG2  13 
ATOM 10440 H H    . THR A 1 17 ? 3.944   2.472   -2.929  1.00 0.00 ? 308 THR A H    13 
ATOM 10441 H HA   . THR A 1 17 ? 2.756   4.526   -1.245  1.00 0.00 ? 308 THR A HA   13 
ATOM 10442 H HB   . THR A 1 17 ? 4.714   4.347   0.137   1.00 0.00 ? 308 THR A HB   13 
ATOM 10443 H HG1  . THR A 1 17 ? 6.420   2.863   -0.565  1.00 0.00 ? 308 THR A HG1  13 
ATOM 10444 H HG21 . THR A 1 17 ? 4.226   1.507   -0.685  1.00 0.00 ? 308 THR A HG21 13 
ATOM 10445 H HG22 . THR A 1 17 ? 2.937   2.460   0.047   1.00 0.00 ? 308 THR A HG22 13 
ATOM 10446 H HG23 . THR A 1 17 ? 4.437   2.177   0.933   1.00 0.00 ? 308 THR A HG23 13 
ATOM 10447 N N    . ALA A 1 18 ? 3.848   5.799   -3.544  1.00 0.00 ? 309 ALA A N    13 
ATOM 10448 C CA   . ALA A 1 18 ? 4.411   6.939   -4.260  1.00 0.00 ? 309 ALA A CA   13 
ATOM 10449 C C    . ALA A 1 18 ? 5.807   6.633   -4.794  1.00 0.00 ? 309 ALA A C    13 
ATOM 10450 O O    . ALA A 1 18 ? 6.004   6.493   -6.001  1.00 0.00 ? 309 ALA A O    13 
ATOM 10451 C CB   . ALA A 1 18 ? 4.451   8.161   -3.354  1.00 0.00 ? 309 ALA A CB   13 
ATOM 10452 H H    . ALA A 1 18 ? 3.084   5.323   -3.929  1.00 0.00 ? 309 ALA A H    13 
ATOM 10453 H HA   . ALA A 1 18 ? 3.759   7.161   -5.094  1.00 0.00 ? 309 ALA A HA   13 
ATOM 10454 H HB1  . ALA A 1 18 ? 5.425   8.622   -3.415  1.00 0.00 ? 309 ALA A HB1  13 
ATOM 10455 H HB2  . ALA A 1 18 ? 3.698   8.868   -3.669  1.00 0.00 ? 309 ALA A HB2  13 
ATOM 10456 H HB3  . ALA A 1 18 ? 4.258   7.859   -2.335  1.00 0.00 ? 309 ALA A HB3  13 
ATOM 10457 N N    . THR A 1 19 ? 6.775   6.530   -3.884  1.00 0.00 ? 310 THR A N    13 
ATOM 10458 C CA   . THR A 1 19 ? 8.162   6.248   -4.257  1.00 0.00 ? 310 THR A CA   13 
ATOM 10459 C C    . THR A 1 19 ? 8.253   5.171   -5.335  1.00 0.00 ? 310 THR A C    13 
ATOM 10460 O O    . THR A 1 19 ? 9.098   5.244   -6.228  1.00 0.00 ? 310 THR A O    13 
ATOM 10461 C CB   . THR A 1 19 ? 8.989   5.800   -3.037  1.00 0.00 ? 310 THR A CB   13 
ATOM 10462 O OG1  . THR A 1 19 ? 8.207   4.935   -2.205  1.00 0.00 ? 310 THR A OG1  13 
ATOM 10463 C CG2  . THR A 1 19 ? 9.458   7.001   -2.230  1.00 0.00 ? 310 THR A CG2  13 
ATOM 10464 H H    . THR A 1 19 ? 6.552   6.646   -2.938  1.00 0.00 ? 310 THR A H    13 
ATOM 10465 H HA   . THR A 1 19 ? 8.594   7.160   -4.639  1.00 0.00 ? 310 THR A HA   13 
ATOM 10466 H HB   . THR A 1 19 ? 9.856   5.260   -3.388  1.00 0.00 ? 310 THR A HB   13 
ATOM 10467 H HG1  . THR A 1 19 ? 7.672   5.463   -1.607  1.00 0.00 ? 310 THR A HG1  13 
ATOM 10468 H HG21 . THR A 1 19 ? 9.860   7.749   -2.898  1.00 0.00 ? 310 THR A HG21 13 
ATOM 10469 H HG22 . THR A 1 19 ? 10.225  6.690   -1.535  1.00 0.00 ? 310 THR A HG22 13 
ATOM 10470 H HG23 . THR A 1 19 ? 8.624   7.416   -1.684  1.00 0.00 ? 310 THR A HG23 13 
ATOM 10471 N N    . GLY A 1 20 ? 7.381   4.174   -5.247  1.00 0.00 ? 311 GLY A N    13 
ATOM 10472 C CA   . GLY A 1 20 ? 7.385   3.100   -6.224  1.00 0.00 ? 311 GLY A CA   13 
ATOM 10473 C C    . GLY A 1 20 ? 6.912   1.784   -5.641  1.00 0.00 ? 311 GLY A C    13 
ATOM 10474 O O    . GLY A 1 20 ? 6.099   1.087   -6.248  1.00 0.00 ? 311 GLY A O    13 
ATOM 10475 H H    . GLY A 1 20 ? 6.729   4.166   -4.515  1.00 0.00 ? 311 GLY A H    13 
ATOM 10476 H HA2  . GLY A 1 20 ? 6.736   3.372   -7.043  1.00 0.00 ? 311 GLY A HA2  13 
ATOM 10477 H HA3  . GLY A 1 20 ? 8.389   2.974   -6.600  1.00 0.00 ? 311 GLY A HA3  13 
ATOM 10478 N N    . ARG A 1 21 ? 7.423   1.441   -4.461  1.00 0.00 ? 312 ARG A N    13 
ATOM 10479 C CA   . ARG A 1 21 ? 7.041   0.194   -3.794  1.00 0.00 ? 312 ARG A CA   13 
ATOM 10480 C C    . ARG A 1 21 ? 5.532   0.015   -3.806  1.00 0.00 ? 312 ARG A C    13 
ATOM 10481 O O    . ARG A 1 21 ? 4.782   0.974   -3.994  1.00 0.00 ? 312 ARG A O    13 
ATOM 10482 C CB   . ARG A 1 21 ? 7.561   0.159   -2.351  1.00 0.00 ? 312 ARG A CB   13 
ATOM 10483 C CG   . ARG A 1 21 ? 8.537   -0.976  -2.081  1.00 0.00 ? 312 ARG A CG   13 
ATOM 10484 C CD   . ARG A 1 21 ? 7.828   -2.206  -1.527  1.00 0.00 ? 312 ARG A CD   13 
ATOM 10485 N NE   . ARG A 1 21 ? 8.762   -3.283  -1.212  1.00 0.00 ? 312 ARG A NE   13 
ATOM 10486 C CZ   . ARG A 1 21 ? 8.384   -4.482  -0.782  1.00 0.00 ? 312 ARG A CZ   13 
ATOM 10487 N NH1  . ARG A 1 21 ? 7.096   -4.754  -0.619  1.00 0.00 ? 312 ARG A NH1  13 
ATOM 10488 N NH2  . ARG A 1 21 ? 9.292   -5.412  -0.518  1.00 0.00 ? 312 ARG A NH2  13 
ATOM 10489 H H    . ARG A 1 21 ? 8.073   2.035   -4.033  1.00 0.00 ? 312 ARG A H    13 
ATOM 10490 H HA   . ARG A 1 21 ? 7.477   -0.623  -4.347  1.00 0.00 ? 312 ARG A HA   13 
ATOM 10491 H HB2  . ARG A 1 21 ? 8.059   1.091   -2.132  1.00 0.00 ? 312 ARG A HB2  13 
ATOM 10492 H HG2  . ARG A 1 21 ? 9.032   -1.241  -3.005  1.00 0.00 ? 312 ARG A HG2  13 
ATOM 10493 H HD2  . ARG A 1 21 ? 7.303   -1.925  -0.627  1.00 0.00 ? 312 ARG A HD2  13 
ATOM 10494 H HE   . ARG A 1 21 ? 9.720   -3.103  -1.326  1.00 0.00 ? 312 ARG A HE   13 
ATOM 10495 H HH11 . ARG A 1 21 ? 6.409   -4.056  -0.820  1.00 0.00 ? 312 ARG A HH11 13 
ATOM 10496 H HH12 . ARG A 1 21 ? 6.813   -5.657  -0.295  1.00 0.00 ? 312 ARG A HH12 13 
ATOM 10497 H HH21 . ARG A 1 21 ? 10.263  -5.212  -0.640  1.00 0.00 ? 312 ARG A HH21 13 
ATOM 10498 H HH22 . ARG A 1 21 ? 9.004   -6.314  -0.195  1.00 0.00 ? 312 ARG A HH22 13 
ATOM 10499 N N    . VAL A 1 22 ? 5.092   -1.219  -3.607  1.00 0.00 ? 313 VAL A N    13 
ATOM 10500 C CA   . VAL A 1 22 ? 3.672   -1.524  -3.616  1.00 0.00 ? 313 VAL A CA   13 
ATOM 10501 C C    . VAL A 1 22 ? 3.144   -1.862  -2.245  1.00 0.00 ? 313 VAL A C    13 
ATOM 10502 O O    . VAL A 1 22 ? 3.872   -1.900  -1.253  1.00 0.00 ? 313 VAL A O    13 
ATOM 10503 C CB   . VAL A 1 22 ? 3.315   -2.728  -4.524  1.00 0.00 ? 313 VAL A CB   13 
ATOM 10504 C CG1  . VAL A 1 22 ? 2.213   -2.343  -5.474  1.00 0.00 ? 313 VAL A CG1  13 
ATOM 10505 C CG2  . VAL A 1 22 ? 4.518   -3.272  -5.269  1.00 0.00 ? 313 VAL A CG2  13 
ATOM 10506 H H    . VAL A 1 22 ? 5.734   -1.942  -3.456  1.00 0.00 ? 313 VAL A H    13 
ATOM 10507 H HA   . VAL A 1 22 ? 3.147   -0.658  -3.990  1.00 0.00 ? 313 VAL A HA   13 
ATOM 10508 H HB   . VAL A 1 22 ? 2.936   -3.525  -3.897  1.00 0.00 ? 313 VAL A HB   13 
ATOM 10509 H HG11 . VAL A 1 22 ? 1.271   -2.367  -4.942  1.00 0.00 ? 313 VAL A HG11 13 
ATOM 10510 H HG12 . VAL A 1 22 ? 2.397   -1.347  -5.847  1.00 0.00 ? 313 VAL A HG12 13 
ATOM 10511 H HG13 . VAL A 1 22 ? 2.185   -3.040  -6.296  1.00 0.00 ? 313 VAL A HG13 13 
ATOM 10512 H HG21 . VAL A 1 22 ? 4.218   -4.136  -5.842  1.00 0.00 ? 313 VAL A HG21 13 
ATOM 10513 H HG22 . VAL A 1 22 ? 4.910   -2.513  -5.928  1.00 0.00 ? 313 VAL A HG22 13 
ATOM 10514 H HG23 . VAL A 1 22 ? 5.274   -3.559  -4.553  1.00 0.00 ? 313 VAL A HG23 13 
ATOM 10515 N N    . TYR A 1 23 ? 1.849   -2.105  -2.228  1.00 0.00 ? 314 TYR A N    13 
ATOM 10516 C CA   . TYR A 1 23 ? 1.163   -2.522  -1.038  1.00 0.00 ? 314 TYR A CA   13 
ATOM 10517 C C    . TYR A 1 23 ? -0.287  -2.826  -1.338  1.00 0.00 ? 314 TYR A C    13 
ATOM 10518 O O    . TYR A 1 23 ? -0.816  -2.428  -2.377  1.00 0.00 ? 314 TYR A O    13 
ATOM 10519 C CB   . TYR A 1 23 ? 1.271   -1.496  0.087   1.00 0.00 ? 314 TYR A CB   13 
ATOM 10520 C CG   . TYR A 1 23 ? 0.371   -0.288  -0.063  1.00 0.00 ? 314 TYR A CG   13 
ATOM 10521 C CD1  . TYR A 1 23 ? 0.661   0.717   -0.977  1.00 0.00 ? 314 TYR A CD1  13 
ATOM 10522 C CD2  . TYR A 1 23 ? -0.767  -0.152  0.721   1.00 0.00 ? 314 TYR A CD2  13 
ATOM 10523 C CE1  . TYR A 1 23 ? -0.160  1.820   -1.108  1.00 0.00 ? 314 TYR A CE1  13 
ATOM 10524 C CE2  . TYR A 1 23 ? -1.593  0.951   0.595   1.00 0.00 ? 314 TYR A CE2  13 
ATOM 10525 C CZ   . TYR A 1 23 ? -1.287  1.931   -0.321  1.00 0.00 ? 314 TYR A CZ   13 
ATOM 10526 O OH   . TYR A 1 23 ? -2.108  3.026   -0.445  1.00 0.00 ? 314 TYR A OH   13 
ATOM 10527 H H    . TYR A 1 23 ? 1.333   -1.978  -3.052  1.00 0.00 ? 314 TYR A H    13 
ATOM 10528 H HA   . TYR A 1 23 ? 1.643   -3.433  -0.734  1.00 0.00 ? 314 TYR A HA   13 
ATOM 10529 H HB2  . TYR A 1 23 ? 1.003   -1.981  1.011   1.00 0.00 ? 314 TYR A HB2  13 
ATOM 10530 H HD1  . TYR A 1 23 ? 1.544   0.628   -1.592  1.00 0.00 ? 314 TYR A HD1  13 
ATOM 10531 H HD2  . TYR A 1 23 ? -1.003  -0.920  1.444   1.00 0.00 ? 314 TYR A HD2  13 
ATOM 10532 H HE1  . TYR A 1 23 ? 0.088   2.594   -1.818  1.00 0.00 ? 314 TYR A HE1  13 
ATOM 10533 H HE2  . TYR A 1 23 ? -2.471  1.043   1.215   1.00 0.00 ? 314 TYR A HE2  13 
ATOM 10534 H HH   . TYR A 1 23 ? -1.619  3.821   -0.221  1.00 0.00 ? 314 TYR A HH   13 
ATOM 10535 N N    . PHE A 1 24 ? -0.929  -3.534  -0.428  1.00 0.00 ? 315 PHE A N    13 
ATOM 10536 C CA   . PHE A 1 24 ? -2.311  -3.903  -0.616  1.00 0.00 ? 315 PHE A CA   13 
ATOM 10537 C C    . PHE A 1 24 ? -3.204  -3.288  0.447   1.00 0.00 ? 315 PHE A C    13 
ATOM 10538 O O    . PHE A 1 24 ? -2.860  -3.253  1.631   1.00 0.00 ? 315 PHE A O    13 
ATOM 10539 C CB   . PHE A 1 24 ? -2.438  -5.424  -0.641  1.00 0.00 ? 315 PHE A CB   13 
ATOM 10540 C CG   . PHE A 1 24 ? -1.811  -6.036  -1.863  1.00 0.00 ? 315 PHE A CG   13 
ATOM 10541 C CD1  . PHE A 1 24 ? -0.468  -5.829  -2.152  1.00 0.00 ? 315 PHE A CD1  13 
ATOM 10542 C CD2  . PHE A 1 24 ? -2.567  -6.802  -2.731  1.00 0.00 ? 315 PHE A CD2  13 
ATOM 10543 C CE1  . PHE A 1 24 ? 0.106   -6.377  -3.285  1.00 0.00 ? 315 PHE A CE1  13 
ATOM 10544 C CE2  . PHE A 1 24 ? -1.999  -7.355  -3.864  1.00 0.00 ? 315 PHE A CE2  13 
ATOM 10545 C CZ   . PHE A 1 24 ? -0.661  -7.142  -4.142  1.00 0.00 ? 315 PHE A CZ   13 
ATOM 10546 H H    . PHE A 1 24 ? -0.459  -3.820  0.383   1.00 0.00 ? 315 PHE A H    13 
ATOM 10547 H HA   . PHE A 1 24 ? -2.611  -3.513  -1.572  1.00 0.00 ? 315 PHE A HA   13 
ATOM 10548 H HB2  . PHE A 1 24 ? -1.949  -5.838  0.231   1.00 0.00 ? 315 PHE A HB2  13 
ATOM 10549 H HD1  . PHE A 1 24 ? 0.134   -5.236  -1.481  1.00 0.00 ? 315 PHE A HD1  13 
ATOM 10550 H HD2  . PHE A 1 24 ? -3.611  -6.966  -2.515  1.00 0.00 ? 315 PHE A HD2  13 
ATOM 10551 H HE1  . PHE A 1 24 ? 1.154   -6.204  -3.502  1.00 0.00 ? 315 PHE A HE1  13 
ATOM 10552 H HE2  . PHE A 1 24 ? -2.600  -7.953  -4.534  1.00 0.00 ? 315 PHE A HE2  13 
ATOM 10553 H HZ   . PHE A 1 24 ? -0.217  -7.572  -5.028  1.00 0.00 ? 315 PHE A HZ   13 
ATOM 10554 N N    . VAL A 1 25 ? -4.354  -2.798  0.000   1.00 0.00 ? 316 VAL A N    13 
ATOM 10555 C CA   . VAL A 1 25 ? -5.316  -2.157  0.880   1.00 0.00 ? 316 VAL A CA   13 
ATOM 10556 C C    . VAL A 1 25 ? -6.536  -3.044  1.102   1.00 0.00 ? 316 VAL A C    13 
ATOM 10557 O O    . VAL A 1 25 ? -7.206  -3.443  0.150   1.00 0.00 ? 316 VAL A O    13 
ATOM 10558 C CB   . VAL A 1 25 ? -5.777  -0.806  0.297   1.00 0.00 ? 316 VAL A CB   13 
ATOM 10559 C CG1  . VAL A 1 25 ? -6.433  0.045   1.367   1.00 0.00 ? 316 VAL A CG1  13 
ATOM 10560 C CG2  . VAL A 1 25 ? -4.607  -0.067  -0.338  1.00 0.00 ? 316 VAL A CG2  13 
ATOM 10561 H H    . VAL A 1 25 ? -4.562  -2.875  -0.955  1.00 0.00 ? 316 VAL A H    13 
ATOM 10562 H HA   . VAL A 1 25 ? -4.834  -1.974  1.829   1.00 0.00 ? 316 VAL A HA   13 
ATOM 10563 H HB   . VAL A 1 25 ? -6.509  -1.001  -0.473  1.00 0.00 ? 316 VAL A HB   13 
ATOM 10564 H HG11 . VAL A 1 25 ? -7.449  -0.291  1.519   1.00 0.00 ? 316 VAL A HG11 13 
ATOM 10565 H HG12 . VAL A 1 25 ? -5.880  -0.049  2.291   1.00 0.00 ? 316 VAL A HG12 13 
ATOM 10566 H HG13 . VAL A 1 25 ? -6.437  1.079   1.053   1.00 0.00 ? 316 VAL A HG13 13 
ATOM 10567 H HG21 . VAL A 1 25 ? -3.680  -0.443  0.069   1.00 0.00 ? 316 VAL A HG21 13 
ATOM 10568 H HG22 . VAL A 1 25 ? -4.621  -0.221  -1.407  1.00 0.00 ? 316 VAL A HG22 13 
ATOM 10569 H HG23 . VAL A 1 25 ? -4.691  0.989   -0.126  1.00 0.00 ? 316 VAL A HG23 13 
ATOM 10570 N N    . ASP A 1 26 ? -6.820  -3.349  2.364   1.00 0.00 ? 317 ASP A N    13 
ATOM 10571 C CA   . ASP A 1 26 ? -7.963  -4.188  2.705   1.00 0.00 ? 317 ASP A CA   13 
ATOM 10572 C C    . ASP A 1 26 ? -9.161  -3.334  3.100   1.00 0.00 ? 317 ASP A C    13 
ATOM 10573 O O    . ASP A 1 26 ? -9.146  -2.664  4.133   1.00 0.00 ? 317 ASP A O    13 
ATOM 10574 C CB   . ASP A 1 26 ? -7.606  -5.144  3.843   1.00 0.00 ? 317 ASP A CB   13 
ATOM 10575 C CG   . ASP A 1 26 ? -8.393  -6.437  3.774   1.00 0.00 ? 317 ASP A CG   13 
ATOM 10576 O OD1  . ASP A 1 26 ? -9.022  -6.694  2.726   1.00 0.00 ? 317 ASP A OD1  13 
ATOM 10577 O OD2  . ASP A 1 26 ? -8.379  -7.195  4.767   1.00 0.00 ? 317 ASP A OD2  13 
ATOM 10578 H H    . ASP A 1 26 ? -6.249  -3.003  3.081   1.00 0.00 ? 317 ASP A H    13 
ATOM 10579 H HA   . ASP A 1 26 ? -8.221  -4.765  1.830   1.00 0.00 ? 317 ASP A HA   13 
ATOM 10580 H HB2  . ASP A 1 26 ? -6.553  -5.381  3.790   1.00 0.00 ? 317 ASP A HB2  13 
ATOM 10581 N N    . HIS A 1 27 ? -10.198 -3.365  2.269   1.00 0.00 ? 318 HIS A N    13 
ATOM 10582 C CA   . HIS A 1 27 ? -11.408 -2.594  2.523   1.00 0.00 ? 318 HIS A CA   13 
ATOM 10583 C C    . HIS A 1 27 ? -12.360 -3.334  3.465   1.00 0.00 ? 318 HIS A C    13 
ATOM 10584 O O    . HIS A 1 27 ? -13.335 -2.758  3.946   1.00 0.00 ? 318 HIS A O    13 
ATOM 10585 C CB   . HIS A 1 27 ? -12.101 -2.268  1.203   1.00 0.00 ? 318 HIS A CB   13 
ATOM 10586 C CG   . HIS A 1 27 ? -11.334 -1.270  0.401   1.00 0.00 ? 318 HIS A CG   13 
ATOM 10587 N ND1  . HIS A 1 27 ? -11.214 0.026   0.825   1.00 0.00 ? 318 HIS A ND1  13 
ATOM 10588 C CD2  . HIS A 1 27 ? -10.622 -1.432  -0.741  1.00 0.00 ? 318 HIS A CD2  13 
ATOM 10589 C CE1  . HIS A 1 27 ? -10.433 0.622   -0.051  1.00 0.00 ? 318 HIS A CE1  13 
ATOM 10590 N NE2  . HIS A 1 27 ? -10.050 -0.220  -1.023  1.00 0.00 ? 318 HIS A NE2  13 
ATOM 10591 H H    . HIS A 1 27 ? -10.147 -3.921  1.463   1.00 0.00 ? 318 HIS A H    13 
ATOM 10592 H HA   . HIS A 1 27 ? -11.113 -1.665  2.991   1.00 0.00 ? 318 HIS A HA   13 
ATOM 10593 H HB2  . HIS A 1 27 ? -12.201 -3.167  0.618   1.00 0.00 ? 318 HIS A HB2  13 
ATOM 10594 H HD2  . HIS A 1 27 ? -10.517 -2.340  -1.316  1.00 0.00 ? 318 HIS A HD2  13 
ATOM 10595 H HE1  . HIS A 1 27 ? -10.130 1.652   0.019   1.00 0.00 ? 318 HIS A HE1  13 
ATOM 10596 H HE2  . HIS A 1 27 ? -9.341  -0.058  -1.680  1.00 0.00 ? 318 HIS A HE2  13 
ATOM 10597 N N    . ASN A 1 28 ? -12.076 -4.611  3.725   1.00 0.00 ? 319 ASN A N    13 
ATOM 10598 C CA   . ASN A 1 28 ? -12.905 -5.407  4.622   1.00 0.00 ? 319 ASN A CA   13 
ATOM 10599 C C    . ASN A 1 28 ? -12.467 -5.200  6.068   1.00 0.00 ? 319 ASN A C    13 
ATOM 10600 O O    . ASN A 1 28 ? -13.297 -5.096  6.972   1.00 0.00 ? 319 ASN A O    13 
ATOM 10601 C CB   . ASN A 1 28 ? -12.818 -6.892  4.257   1.00 0.00 ? 319 ASN A CB   13 
ATOM 10602 C CG   . ASN A 1 28 ? -12.837 -7.123  2.759   1.00 0.00 ? 319 ASN A CG   13 
ATOM 10603 O OD1  . ASN A 1 28 ? -13.736 -6.661  2.059   1.00 0.00 ? 319 ASN A OD1  13 
ATOM 10604 N ND2  . ASN A 1 28 ? -11.840 -7.845  2.261   1.00 0.00 ? 319 ASN A ND2  13 
ATOM 10605 H H    . ASN A 1 28 ? -11.297 -5.028  3.302   1.00 0.00 ? 319 ASN A H    13 
ATOM 10606 H HA   . ASN A 1 28 ? -13.926 -5.076  4.515   1.00 0.00 ? 319 ASN A HA   13 
ATOM 10607 H HB2  . ASN A 1 28 ? -11.901 -7.300  4.655   1.00 0.00 ? 319 ASN A HB2  13 
ATOM 10608 H HD21 . ASN A 1 28 ? -11.159 -8.184  2.880   1.00 0.00 ? 319 ASN A HD21 13 
ATOM 10609 H HD22 . ASN A 1 28 ? -11.825 -8.011  1.296   1.00 0.00 ? 319 ASN A HD22 13 
ATOM 10610 N N    . ASN A 1 29 ? -11.155 -5.142  6.276   1.00 0.00 ? 320 ASN A N    13 
ATOM 10611 C CA   . ASN A 1 29 ? -10.595 -4.938  7.607   1.00 0.00 ? 320 ASN A CA   13 
ATOM 10612 C C    . ASN A 1 29 ? -10.138 -3.492  7.789   1.00 0.00 ? 320 ASN A C    13 
ATOM 10613 O O    . ASN A 1 29 ? -10.004 -3.012  8.915   1.00 0.00 ? 320 ASN A O    13 
ATOM 10614 C CB   . ASN A 1 29 ? -9.417  -5.886  7.846   1.00 0.00 ? 320 ASN A CB   13 
ATOM 10615 C CG   . ASN A 1 29 ? -9.813  -7.342  7.728   1.00 0.00 ? 320 ASN A CG   13 
ATOM 10616 O OD1  . ASN A 1 29 ? -10.848 -7.761  8.247   1.00 0.00 ? 320 ASN A OD1  13 
ATOM 10617 N ND2  . ASN A 1 29 ? -8.989  -8.124  7.042   1.00 0.00 ? 320 ASN A ND2  13 
ATOM 10618 H H    . ASN A 1 29 ? -10.547 -5.239  5.514   1.00 0.00 ? 320 ASN A H    13 
ATOM 10619 H HA   . ASN A 1 29 ? -11.369 -5.151  8.329   1.00 0.00 ? 320 ASN A HA   13 
ATOM 10620 H HB2  . ASN A 1 29 ? -8.643  -5.684  7.118   1.00 0.00 ? 320 ASN A HB2  13 
ATOM 10621 H HD21 . ASN A 1 29 ? -8.182  -7.720  6.655   1.00 0.00 ? 320 ASN A HD21 13 
ATOM 10622 H HD22 . ASN A 1 29 ? -9.218  -9.070  6.950   1.00 0.00 ? 320 ASN A HD22 13 
ATOM 10623 N N    . ARG A 1 30 ? -9.901  -2.802  6.673   1.00 0.00 ? 321 ARG A N    13 
ATOM 10624 C CA   . ARG A 1 30 ? -9.459  -1.413  6.710   1.00 0.00 ? 321 ARG A CA   13 
ATOM 10625 C C    . ARG A 1 30 ? -8.008  -1.318  7.172   1.00 0.00 ? 321 ARG A C    13 
ATOM 10626 O O    . ARG A 1 30 ? -7.703  -0.649  8.159   1.00 0.00 ? 321 ARG A O    13 
ATOM 10627 C CB   . ARG A 1 30 ? -10.359 -0.588  7.634   1.00 0.00 ? 321 ARG A CB   13 
ATOM 10628 C CG   . ARG A 1 30 ? -11.843 -0.814  7.395   1.00 0.00 ? 321 ARG A CG   13 
ATOM 10629 C CD   . ARG A 1 30 ? -12.551 -1.276  8.660   1.00 0.00 ? 321 ARG A CD   13 
ATOM 10630 N NE   . ARG A 1 30 ? -13.695 -0.428  8.986   1.00 0.00 ? 321 ARG A NE   13 
ATOM 10631 C CZ   . ARG A 1 30 ? -14.412 -0.556  10.099  1.00 0.00 ? 321 ARG A CZ   13 
ATOM 10632 N NH1  . ARG A 1 30 ? -14.101 -1.491  10.986  1.00 0.00 ? 321 ARG A NH1  13 
ATOM 10633 N NH2  . ARG A 1 30 ? -15.441 0.251   10.324  1.00 0.00 ? 321 ARG A NH2  13 
ATOM 10634 H H    . ARG A 1 30 ? -10.023 -3.239  5.806   1.00 0.00 ? 321 ARG A H    13 
ATOM 10635 H HA   . ARG A 1 30 ? -9.530  -1.018  5.707   1.00 0.00 ? 321 ARG A HA   13 
ATOM 10636 H HB2  . ARG A 1 30 ? -10.136 -0.847  8.659   1.00 0.00 ? 321 ARG A HB2  13 
ATOM 10637 H HG2  . ARG A 1 30 ? -12.290 0.111   7.062   1.00 0.00 ? 321 ARG A HG2  13 
ATOM 10638 H HD2  . ARG A 1 30 ? -12.896 -2.288  8.514   1.00 0.00 ? 321 ARG A HD2  13 
ATOM 10639 H HE   . ARG A 1 30 ? -13.942 0.270   8.344   1.00 0.00 ? 321 ARG A HE   13 
ATOM 10640 H HH11 . ARG A 1 30 ? -13.327 -2.101  10.820  1.00 0.00 ? 321 ARG A HH11 13 
ATOM 10641 H HH12 . ARG A 1 30 ? -14.642 -1.586  11.822  1.00 0.00 ? 321 ARG A HH12 13 
ATOM 10642 H HH21 . ARG A 1 30 ? -15.678 0.957   9.657   1.00 0.00 ? 321 ARG A HH21 13 
ATOM 10643 H HH22 . ARG A 1 30 ? -15.979 0.152   11.161  1.00 0.00 ? 321 ARG A HH22 13 
ATOM 10644 N N    . THR A 1 31 ? -7.117  -1.991  6.450   1.00 0.00 ? 322 THR A N    13 
ATOM 10645 C CA   . THR A 1 31 ? -5.699  -1.983  6.790   1.00 0.00 ? 322 THR A CA   13 
ATOM 10646 C C    . THR A 1 31 ? -4.826  -2.040  5.540   1.00 0.00 ? 322 THR A C    13 
ATOM 10647 O O    . THR A 1 31 ? -5.298  -1.798  4.429   1.00 0.00 ? 322 THR A O    13 
ATOM 10648 C CB   . THR A 1 31 ? -5.335  -3.161  7.713   1.00 0.00 ? 322 THR A CB   13 
ATOM 10649 O OG1  . THR A 1 31 ? -3.970  -3.053  8.131   1.00 0.00 ? 322 THR A OG1  13 
ATOM 10650 C CG2  . THR A 1 31 ? -5.550  -4.493  7.009   1.00 0.00 ? 322 THR A CG2  13 
ATOM 10651 H H    . THR A 1 31 ? -7.421  -2.503  5.671   1.00 0.00 ? 322 THR A H    13 
ATOM 10652 H HA   . THR A 1 31 ? -5.489  -1.064  7.315   1.00 0.00 ? 322 THR A HA   13 
ATOM 10653 H HB   . THR A 1 31 ? -5.973  -3.125  8.585   1.00 0.00 ? 322 THR A HB   13 
ATOM 10654 H HG1  . THR A 1 31 ? -3.929  -3.030  9.089   1.00 0.00 ? 322 THR A HG1  13 
ATOM 10655 H HG21 . THR A 1 31 ? -6.544  -4.857  7.223   1.00 0.00 ? 322 THR A HG21 13 
ATOM 10656 H HG22 . THR A 1 31 ? -4.821  -5.208  7.362   1.00 0.00 ? 322 THR A HG22 13 
ATOM 10657 H HG23 . THR A 1 31 ? -5.437  -4.360  5.943   1.00 0.00 ? 322 THR A HG23 13 
ATOM 10658 N N    . THR A 1 32 ? -3.551  -2.361  5.733   1.00 0.00 ? 323 THR A N    13 
ATOM 10659 C CA   . THR A 1 32 ? -2.608  -2.445  4.624   1.00 0.00 ? 323 THR A CA   13 
ATOM 10660 C C    . THR A 1 32 ? -1.634  -3.600  4.818   1.00 0.00 ? 323 THR A C    13 
ATOM 10661 O O    . THR A 1 32 ? -1.591  -4.215  5.883   1.00 0.00 ? 323 THR A O    13 
ATOM 10662 C CB   . THR A 1 32 ? -1.809  -1.139  4.464   1.00 0.00 ? 323 THR A CB   13 
ATOM 10663 O OG1  . THR A 1 32 ? -1.355  -0.685  5.745   1.00 0.00 ? 323 THR A OG1  13 
ATOM 10664 C CG2  . THR A 1 32 ? -2.669  -0.063  3.813   1.00 0.00 ? 323 THR A CG2  13 
ATOM 10665 H H    . THR A 1 32 ? -3.239  -2.552  6.641   1.00 0.00 ? 323 THR A H    13 
ATOM 10666 H HA   . THR A 1 32 ? -3.174  -2.609  3.720   1.00 0.00 ? 323 THR A HA   13 
ATOM 10667 H HB   . THR A 1 32 ? -0.949  -1.331  3.830   1.00 0.00 ? 323 THR A HB   13 
ATOM 10668 H HG1  . THR A 1 32 ? -0.726  -1.316  6.105   1.00 0.00 ? 323 THR A HG1  13 
ATOM 10669 H HG21 . THR A 1 32 ? -3.703  -0.212  4.091   1.00 0.00 ? 323 THR A HG21 13 
ATOM 10670 H HG22 . THR A 1 32 ? -2.571  -0.128  2.741   1.00 0.00 ? 323 THR A HG22 13 
ATOM 10671 H HG23 . THR A 1 32 ? -2.344  0.912   4.148   1.00 0.00 ? 323 THR A HG23 13 
ATOM 10672 N N    . GLN A 1 33 ? -0.852  -3.891  3.783   1.00 0.00 ? 324 GLN A N    13 
ATOM 10673 C CA   . GLN A 1 33 ? 0.119   -4.978  3.849   1.00 0.00 ? 324 GLN A CA   13 
ATOM 10674 C C    . GLN A 1 33 ? 0.919   -5.090  2.558   1.00 0.00 ? 324 GLN A C    13 
ATOM 10675 O O    . GLN A 1 33 ? 0.354   -5.097  1.466   1.00 0.00 ? 324 GLN A O    13 
ATOM 10676 C CB   . GLN A 1 33 ? -0.587  -6.310  4.129   1.00 0.00 ? 324 GLN A CB   13 
ATOM 10677 C CG   . GLN A 1 33 ? -1.982  -6.412  3.524   1.00 0.00 ? 324 GLN A CG   13 
ATOM 10678 C CD   . GLN A 1 33 ? -2.140  -7.594  2.586   1.00 0.00 ? 324 GLN A CD   13 
ATOM 10679 O OE1  . GLN A 1 33 ? -2.659  -7.460  1.480   1.00 0.00 ? 324 GLN A OE1  13 
ATOM 10680 N NE2  . GLN A 1 33 ? -1.694  -8.758  3.024   1.00 0.00 ? 324 GLN A NE2  13 
ATOM 10681 H H    . GLN A 1 33 ? -0.936  -3.370  2.956   1.00 0.00 ? 324 GLN A H    13 
ATOM 10682 H HA   . GLN A 1 33 ? 0.798   -4.765  4.662   1.00 0.00 ? 324 GLN A HA   13 
ATOM 10683 H HB2  . GLN A 1 33 ? 0.015   -7.112  3.727   1.00 0.00 ? 324 GLN A HB2  13 
ATOM 10684 H HG2  . GLN A 1 33 ? -2.698  -6.512  4.325   1.00 0.00 ? 324 GLN A HG2  13 
ATOM 10685 H HE21 . GLN A 1 33 ? -1.292  -8.790  3.911   1.00 0.00 ? 324 GLN A HE21 13 
ATOM 10686 H HE22 . GLN A 1 33 ? -1.793  -9.541  2.445   1.00 0.00 ? 324 GLN A HE22 13 
ATOM 10687 N N    . PHE A 1 34 ? 2.238   -5.188  2.688   1.00 0.00 ? 325 PHE A N    13 
ATOM 10688 C CA   . PHE A 1 34 ? 3.114   -5.326  1.530   1.00 0.00 ? 325 PHE A CA   13 
ATOM 10689 C C    . PHE A 1 34 ? 3.037   -6.753  1.012   1.00 0.00 ? 325 PHE A C    13 
ATOM 10690 O O    . PHE A 1 34 ? 4.046   -7.457  0.953   1.00 0.00 ? 325 PHE A O    13 
ATOM 10691 C CB   . PHE A 1 34 ? 4.563   -5.011  1.907   1.00 0.00 ? 325 PHE A CB   13 
ATOM 10692 C CG   . PHE A 1 34 ? 4.964   -3.564  1.763   1.00 0.00 ? 325 PHE A CG   13 
ATOM 10693 C CD1  . PHE A 1 34 ? 4.026   -2.570  1.510   1.00 0.00 ? 325 PHE A CD1  13 
ATOM 10694 C CD2  . PHE A 1 34 ? 6.295   -3.201  1.885   1.00 0.00 ? 325 PHE A CD2  13 
ATOM 10695 C CE1  . PHE A 1 34 ? 4.417   -1.248  1.381   1.00 0.00 ? 325 PHE A CE1  13 
ATOM 10696 C CE2  . PHE A 1 34 ? 6.686   -1.884  1.757   1.00 0.00 ? 325 PHE A CE2  13 
ATOM 10697 C CZ   . PHE A 1 34 ? 5.745   -0.907  1.504   1.00 0.00 ? 325 PHE A CZ   13 
ATOM 10698 H H    . PHE A 1 34 ? 2.631   -5.171  3.585   1.00 0.00 ? 325 PHE A H    13 
ATOM 10699 H HA   . PHE A 1 34 ? 2.780   -4.647  0.760   1.00 0.00 ? 325 PHE A HA   13 
ATOM 10700 H HB2  . PHE A 1 34 ? 4.723   -5.297  2.935   1.00 0.00 ? 325 PHE A HB2  13 
ATOM 10701 H HD1  . PHE A 1 34 ? 2.985   -2.833  1.414   1.00 0.00 ? 325 PHE A HD1  13 
ATOM 10702 H HD2  . PHE A 1 34 ? 7.034   -3.962  2.084   1.00 0.00 ? 325 PHE A HD2  13 
ATOM 10703 H HE1  . PHE A 1 34 ? 3.682   -0.481  1.189   1.00 0.00 ? 325 PHE A HE1  13 
ATOM 10704 H HE2  . PHE A 1 34 ? 7.725   -1.618  1.856   1.00 0.00 ? 325 PHE A HE2  13 
ATOM 10705 H HZ   . PHE A 1 34 ? 6.052   0.124   1.402   1.00 0.00 ? 325 PHE A HZ   13 
ATOM 10706 N N    . THR A 1 35 ? 1.840   -7.180  0.636   1.00 0.00 ? 326 THR A N    13 
ATOM 10707 C CA   . THR A 1 35 ? 1.645   -8.537  0.164   1.00 0.00 ? 326 THR A CA   13 
ATOM 10708 C C    . THR A 1 35 ? 0.305   -8.702  -0.535  1.00 0.00 ? 326 THR A C    13 
ATOM 10709 O O    . THR A 1 35 ? -0.643  -7.960  -0.275  1.00 0.00 ? 326 THR A O    13 
ATOM 10710 C CB   . THR A 1 35 ? 1.711   -9.525  1.340   1.00 0.00 ? 326 THR A CB   13 
ATOM 10711 O OG1  . THR A 1 35 ? 2.339   -8.902  2.467   1.00 0.00 ? 326 THR A OG1  13 
ATOM 10712 C CG2  . THR A 1 35 ? 2.480   -10.775 0.956   1.00 0.00 ? 326 THR A CG2  13 
ATOM 10713 H H    . THR A 1 35 ? 1.077   -6.569  0.667   1.00 0.00 ? 326 THR A H    13 
ATOM 10714 H HA   . THR A 1 35 ? 2.440   -8.775  -0.526  1.00 0.00 ? 326 THR A HA   13 
ATOM 10715 H HB   . THR A 1 35 ? 0.703   -9.806  1.611   1.00 0.00 ? 326 THR A HB   13 
ATOM 10716 H HG1  . THR A 1 35 ? 2.155   -9.412  3.260   1.00 0.00 ? 326 THR A HG1  13 
ATOM 10717 H HG21 . THR A 1 35 ? 2.367   -11.518 1.730   1.00 0.00 ? 326 THR A HG21 13 
ATOM 10718 H HG22 . THR A 1 35 ? 3.527   -10.529 0.840   1.00 0.00 ? 326 THR A HG22 13 
ATOM 10719 H HG23 . THR A 1 35 ? 2.094   -11.161 0.024   1.00 0.00 ? 326 THR A HG23 13 
ATOM 10720 N N    . ASP A 1 36 ? 0.235   -9.684  -1.423  1.00 0.00 ? 327 ASP A N    13 
ATOM 10721 C CA   . ASP A 1 36 ? -0.990  -9.971  -2.148  1.00 0.00 ? 327 ASP A CA   13 
ATOM 10722 C C    . ASP A 1 36 ? -1.709  -11.153 -1.502  1.00 0.00 ? 327 ASP A C    13 
ATOM 10723 O O    . ASP A 1 36 ? -1.235  -12.285 -1.586  1.00 0.00 ? 327 ASP A O    13 
ATOM 10724 C CB   . ASP A 1 36 ? -0.679  -10.287 -3.612  1.00 0.00 ? 327 ASP A CB   13 
ATOM 10725 C CG   . ASP A 1 36 ? -1.932  -10.403 -4.458  1.00 0.00 ? 327 ASP A CG   13 
ATOM 10726 O OD1  . ASP A 1 36 ? -2.935  -10.956 -3.959  1.00 0.00 ? 327 ASP A OD1  13 
ATOM 10727 O OD2  . ASP A 1 36 ? -1.911  -9.938  -5.617  1.00 0.00 ? 327 ASP A OD2  13 
ATOM 10728 H H    . ASP A 1 36 ? 1.030   -10.228 -1.598  1.00 0.00 ? 327 ASP A H    13 
ATOM 10729 H HA   . ASP A 1 36 ? -1.615  -9.097  -2.099  1.00 0.00 ? 327 ASP A HA   13 
ATOM 10730 H HB2  . ASP A 1 36 ? -0.063  -9.500  -4.021  1.00 0.00 ? 327 ASP A HB2  13 
ATOM 10731 N N    . PRO A 1 37 ? -2.860  -10.919 -0.846  1.00 0.00 ? 328 PRO A N    13 
ATOM 10732 C CA   . PRO A 1 37 ? -3.615  -11.986 -0.188  1.00 0.00 ? 328 PRO A CA   13 
ATOM 10733 C C    . PRO A 1 37 ? -3.756  -13.205 -1.081  1.00 0.00 ? 328 PRO A C    13 
ATOM 10734 O O    . PRO A 1 37 ? -3.788  -14.340 -0.606  1.00 0.00 ? 328 PRO A O    13 
ATOM 10735 C CB   . PRO A 1 37 ? -4.989  -11.356 0.081   1.00 0.00 ? 328 PRO A CB   13 
ATOM 10736 C CG   . PRO A 1 37 ? -4.979  -10.059 -0.655  1.00 0.00 ? 328 PRO A CG   13 
ATOM 10737 C CD   . PRO A 1 37 ? -3.543  -9.629  -0.708  1.00 0.00 ? 328 PRO A CD   13 
ATOM 10738 H HA   . PRO A 1 37 ? -3.158  -12.275 0.747   1.00 0.00 ? 328 PRO A HA   13 
ATOM 10739 H HB2  . PRO A 1 37 ? -5.764  -12.012 -0.289  1.00 0.00 ? 328 PRO A HB2  13 
ATOM 10740 H HG2  . PRO A 1 37 ? -5.365  -10.199 -1.655  1.00 0.00 ? 328 PRO A HG2  13 
ATOM 10741 H HD2  . PRO A 1 37 ? -3.374  -8.990  -1.558  1.00 0.00 ? 328 PRO A HD2  13 
ATOM 10742 N N    . ARG A 1 38 ? -3.842  -12.960 -2.383  1.00 0.00 ? 329 ARG A N    13 
ATOM 10743 C CA   . ARG A 1 38 ? -3.975  -14.036 -3.349  1.00 0.00 ? 329 ARG A CA   13 
ATOM 10744 C C    . ARG A 1 38 ? -2.752  -14.946 -3.305  1.00 0.00 ? 329 ARG A C    13 
ATOM 10745 O O    . ARG A 1 38 ? -2.861  -16.162 -3.456  1.00 0.00 ? 329 ARG A O    13 
ATOM 10746 C CB   . ARG A 1 38 ? -4.153  -13.470 -4.758  1.00 0.00 ? 329 ARG A CB   13 
ATOM 10747 C CG   . ARG A 1 38 ? -5.305  -12.486 -4.880  1.00 0.00 ? 329 ARG A CG   13 
ATOM 10748 C CD   . ARG A 1 38 ? -5.453  -11.968 -6.303  1.00 0.00 ? 329 ARG A CD   13 
ATOM 10749 N NE   . ARG A 1 38 ? -5.149  -12.995 -7.298  1.00 0.00 ? 329 ARG A NE   13 
ATOM 10750 C CZ   . ARG A 1 38 ? -5.967  -14.000 -7.593  1.00 0.00 ? 329 ARG A CZ   13 
ATOM 10751 N NH1  . ARG A 1 38 ? -7.135  -14.110 -6.975  1.00 0.00 ? 329 ARG A NH1  13 
ATOM 10752 N NH2  . ARG A 1 38 ? -5.617  -14.895 -8.506  1.00 0.00 ? 329 ARG A NH2  13 
ATOM 10753 H H    . ARG A 1 38 ? -3.815  -12.033 -2.699  1.00 0.00 ? 329 ARG A H    13 
ATOM 10754 H HA   . ARG A 1 38 ? -4.851  -14.607 -3.084  1.00 0.00 ? 329 ARG A HA   13 
ATOM 10755 H HB2  . ARG A 1 38 ? -3.244  -12.963 -5.047  1.00 0.00 ? 329 ARG A HB2  13 
ATOM 10756 H HG2  . ARG A 1 38 ? -6.220  -12.980 -4.592  1.00 0.00 ? 329 ARG A HG2  13 
ATOM 10757 H HD2  . ARG A 1 38 ? -6.469  -11.633 -6.447  1.00 0.00 ? 329 ARG A HD2  13 
ATOM 10758 H HE   . ARG A 1 38 ? -4.289  -12.933 -7.768  1.00 0.00 ? 329 ARG A HE   13 
ATOM 10759 H HH11 . ARG A 1 38 ? -7.401  -13.435 -6.285  1.00 0.00 ? 329 ARG A HH11 13 
ATOM 10760 H HH12 . ARG A 1 38 ? -7.749  -14.866 -7.198  1.00 0.00 ? 329 ARG A HH12 13 
ATOM 10761 H HH21 . ARG A 1 38 ? -4.736  -14.815 -8.974  1.00 0.00 ? 329 ARG A HH21 13 
ATOM 10762 H HH22 . ARG A 1 38 ? -6.233  -15.650 -8.727  1.00 0.00 ? 329 ARG A HH22 13 
ATOM 10763 N N    . LEU A 1 39 ? -1.586  -14.341 -3.097  1.00 0.00 ? 330 LEU A N    13 
ATOM 10764 C CA   . LEU A 1 39 ? -0.335  -15.088 -3.030  1.00 0.00 ? 330 LEU A CA   13 
ATOM 10765 C C    . LEU A 1 39 ? -0.355  -16.076 -1.870  1.00 0.00 ? 330 LEU A C    13 
ATOM 10766 O O    . LEU A 1 39 ? -0.373  -17.290 -2.075  1.00 0.00 ? 330 LEU A O    13 
ATOM 10767 C CB   . LEU A 1 39 ? 0.848   -14.129 -2.878  1.00 0.00 ? 330 LEU A CB   13 
ATOM 10768 C CG   . LEU A 1 39 ? 1.305   -13.452 -4.172  1.00 0.00 ? 330 LEU A CG   13 
ATOM 10769 C CD1  . LEU A 1 39 ? 2.495   -12.544 -3.907  1.00 0.00 ? 330 LEU A CD1  13 
ATOM 10770 C CD2  . LEU A 1 39 ? 1.650   -14.494 -5.224  1.00 0.00 ? 330 LEU A CD2  13 
ATOM 10771 H H    . LEU A 1 39 ? -1.566  -13.367 -2.985  1.00 0.00 ? 330 LEU A H    13 
ATOM 10772 H HA   . LEU A 1 39 ? -0.227  -15.634 -3.953  1.00 0.00 ? 330 LEU A HA   13 
ATOM 10773 H HB2  . LEU A 1 39 ? 0.573   -13.361 -2.170  1.00 0.00 ? 330 LEU A HB2  13 
ATOM 10774 H HG   . LEU A 1 39 ? 0.499   -12.842 -4.555  1.00 0.00 ? 330 LEU A HG   13 
ATOM 10775 H HD11 . LEU A 1 39 ? 3.385   -12.982 -4.336  1.00 0.00 ? 330 LEU A HD11 13 
ATOM 10776 H HD12 . LEU A 1 39 ? 2.319   -11.578 -4.355  1.00 0.00 ? 330 LEU A HD12 13 
ATOM 10777 H HD13 . LEU A 1 39 ? 2.630   -12.427 -2.841  1.00 0.00 ? 330 LEU A HD13 13 
ATOM 10778 H HD21 . LEU A 1 39 ? 2.674   -14.359 -5.541  1.00 0.00 ? 330 LEU A HD21 13 
ATOM 10779 H HD22 . LEU A 1 39 ? 1.531   -15.482 -4.806  1.00 0.00 ? 330 LEU A HD22 13 
ATOM 10780 H HD23 . LEU A 1 39 ? 0.992   -14.380 -6.073  1.00 0.00 ? 330 LEU A HD23 13 
ATOM 10781 N N    . SER A 1 40 ? -0.352  -15.549 -0.651  1.00 0.00 ? 331 SER A N    13 
ATOM 10782 C CA   . SER A 1 40 ? -0.370  -16.384 0.545   1.00 0.00 ? 331 SER A CA   13 
ATOM 10783 C C    . SER A 1 40 ? -1.756  -16.390 1.180   1.00 0.00 ? 331 SER A C    13 
ATOM 10784 O O    . SER A 1 40 ? -2.221  -15.369 1.688   1.00 0.00 ? 331 SER A O    13 
ATOM 10785 C CB   . SER A 1 40 ? 0.665   -15.887 1.556   1.00 0.00 ? 331 SER A CB   13 
ATOM 10786 O OG   . SER A 1 40 ? 0.432   -16.442 2.839   1.00 0.00 ? 331 SER A OG   13 
ATOM 10787 H H    . SER A 1 40 ? -0.336  -14.573 -0.552  1.00 0.00 ? 331 SER A H    13 
ATOM 10788 H HA   . SER A 1 40 ? -0.118  -17.391 0.250   1.00 0.00 ? 331 SER A HA   13 
ATOM 10789 H HB2  . SER A 1 40 ? 1.653   -16.175 1.228   1.00 0.00 ? 331 SER A HB2  13 
ATOM 10790 H HG   . SER A 1 40 ? 1.160   -16.217 3.422   1.00 0.00 ? 331 SER A HG   13 
ATOM 10791 N N    . ALA A 1 41 ? -2.411  -17.546 1.150   1.00 0.00 ? 332 ALA A N    13 
ATOM 10792 C CA   . ALA A 1 41 ? -3.745  -17.681 1.722   1.00 0.00 ? 332 ALA A CA   13 
ATOM 10793 C C    . ALA A 1 41 ? -4.105  -19.149 1.929   1.00 0.00 ? 332 ALA A C    13 
ATOM 10794 O O    . ALA A 1 41 ? -3.293  -20.040 1.678   1.00 0.00 ? 332 ALA A O    13 
ATOM 10795 C CB   . ALA A 1 41 ? -4.774  -17.005 0.822   1.00 0.00 ? 332 ALA A CB   13 
ATOM 10796 H H    . ALA A 1 41 ? -1.987  -18.324 0.734   1.00 0.00 ? 332 ALA A H    13 
ATOM 10797 H HA   . ALA A 1 41 ? -3.750  -17.182 2.682   1.00 0.00 ? 332 ALA A HA   13 
ATOM 10798 H HB1  . ALA A 1 41 ? -5.430  -17.753 0.401   1.00 0.00 ? 332 ALA A HB1  13 
ATOM 10799 H HB2  . ALA A 1 41 ? -5.357  -16.299 1.398   1.00 0.00 ? 332 ALA A HB2  13 
ATOM 10800 H HB3  . ALA A 1 41 ? -4.265  -16.485 0.023   1.00 0.00 ? 332 ALA A HB3  13 
ATOM 10801 N N    . ASN A 1 42 ? -5.328  -19.394 2.388   1.00 0.00 ? 333 ASN A N    13 
ATOM 10802 C CA   . ASN A 1 42 ? -5.795  -20.756 2.626   1.00 0.00 ? 333 ASN A CA   13 
ATOM 10803 C C    . ASN A 1 42 ? -5.055  -21.386 3.801   1.00 0.00 ? 333 ASN A C    13 
ATOM 10804 O O    . ASN A 1 42 ? -5.004  -22.633 3.867   1.00 0.00 ? 333 ASN A O    13 
ATOM 10805 C CB   . ASN A 1 42 ? -5.605  -21.608 1.371   1.00 0.00 ? 333 ASN A CB   13 
ATOM 10806 C CG   . ASN A 1 42 ? -6.618  -22.734 1.278   1.00 0.00 ? 333 ASN A CG   13 
ATOM 10807 O OD1  . ASN A 1 42 ? -6.380  -23.839 1.764   1.00 0.00 ? 333 ASN A OD1  13 
ATOM 10808 N ND2  . ASN A 1 42 ? -7.754  -22.456 0.649   1.00 0.00 ? 333 ASN A ND2  13 
ATOM 10809 O OXT  . ASN A 1 42 ? -4.531  -20.629 4.644   1.00 0.00 ? 333 ASN A OXT  13 
ATOM 10810 H H    . ASN A 1 42 ? -5.930  -18.644 2.571   1.00 0.00 ? 333 ASN A H    13 
ATOM 10811 H HA   . ASN A 1 42 ? -6.847  -20.708 2.863   1.00 0.00 ? 333 ASN A HA   13 
ATOM 10812 H HB2  . ASN A 1 42 ? -5.711  -20.982 0.498   1.00 0.00 ? 333 ASN A HB2  13 
ATOM 10813 H HD21 . ASN A 1 42 ? -7.875  -21.554 0.286   1.00 0.00 ? 333 ASN A HD21 13 
ATOM 10814 H HD22 . ASN A 1 42 ? -8.427  -23.165 0.576   1.00 0.00 ? 333 ASN A HD22 13 
ATOM 10815 N N    . GLY B 2 1  ? 4.718   -22.014 10.254  1.00 0.00 ? 198 GLY B N    13 
ATOM 10816 C CA   . GLY B 2 1  ? 4.773   -20.941 9.223   1.00 0.00 ? 198 GLY B CA   13 
ATOM 10817 C C    . GLY B 2 1  ? 5.701   -19.807 9.614   1.00 0.00 ? 198 GLY B C    13 
ATOM 10818 O O    . GLY B 2 1  ? 5.269   -18.659 9.723   1.00 0.00 ? 198 GLY B O    13 
ATOM 10819 H H1   . GLY B 2 1  ? 3.730   -22.277 10.446  1.00 0.00 ? 198 GLY B H1   13 
ATOM 10820 H H2   . GLY B 2 1  ? 5.154   -21.683 11.139  1.00 0.00 ? 198 GLY B H2   13 
ATOM 10821 H H3   . GLY B 2 1  ? 5.231   -22.856 9.922   1.00 0.00 ? 198 GLY B H3   13 
ATOM 10822 H HA2  . GLY B 2 1  ? 5.116   -21.369 8.293   1.00 0.00 ? 198 GLY B HA2  13 
ATOM 10823 H HA3  . GLY B 2 1  ? 3.779   -20.545 9.080   1.00 0.00 ? 198 GLY B HA3  13 
ATOM 10824 N N    . PRO B 2 2  ? 6.994   -20.102 9.832   1.00 0.00 ? 199 PRO B N    13 
ATOM 10825 C CA   . PRO B 2 2  ? 7.982   -19.096 10.214  1.00 0.00 ? 199 PRO B CA   13 
ATOM 10826 C C    . PRO B 2 2  ? 8.559   -18.363 9.008   1.00 0.00 ? 199 PRO B C    13 
ATOM 10827 O O    . PRO B 2 2  ? 9.776   -18.245 8.864   1.00 0.00 ? 199 PRO B O    13 
ATOM 10828 C CB   . PRO B 2 2  ? 9.059   -19.933 10.897  1.00 0.00 ? 199 PRO B CB   13 
ATOM 10829 C CG   . PRO B 2 2  ? 9.019   -21.245 10.189  1.00 0.00 ? 199 PRO B CG   13 
ATOM 10830 C CD   . PRO B 2 2  ? 7.596   -21.444 9.723   1.00 0.00 ? 199 PRO B CD   13 
ATOM 10831 H HA   . PRO B 2 2  ? 7.576   -18.381 10.914  1.00 0.00 ? 199 PRO B HA   13 
ATOM 10832 H HB2  . PRO B 2 2  ? 10.019  -19.449 10.785  1.00 0.00 ? 199 PRO B HB2  13 
ATOM 10833 H HG2  . PRO B 2 2  ? 9.689   -21.223 9.341   1.00 0.00 ? 199 PRO B HG2  13 
ATOM 10834 H HD2  . PRO B 2 2  ? 7.581   -21.787 8.699   1.00 0.00 ? 199 PRO B HD2  13 
ATOM 10835 N N    . LEU B 2 3  ? 7.677   -17.871 8.145   1.00 0.00 ? 200 LEU B N    13 
ATOM 10836 C CA   . LEU B 2 3  ? 8.098   -17.150 6.949   1.00 0.00 ? 200 LEU B CA   13 
ATOM 10837 C C    . LEU B 2 3  ? 7.813   -15.658 7.083   1.00 0.00 ? 200 LEU B C    13 
ATOM 10838 O O    . LEU B 2 3  ? 6.826   -15.258 7.701   1.00 0.00 ? 200 LEU B O    13 
ATOM 10839 C CB   . LEU B 2 3  ? 7.386   -17.707 5.715   1.00 0.00 ? 200 LEU B CB   13 
ATOM 10840 C CG   . LEU B 2 3  ? 7.074   -19.203 5.767   1.00 0.00 ? 200 LEU B CG   13 
ATOM 10841 C CD1  . LEU B 2 3  ? 5.601   -19.432 6.067   1.00 0.00 ? 200 LEU B CD1  13 
ATOM 10842 C CD2  . LEU B 2 3  ? 7.464   -19.874 4.459   1.00 0.00 ? 200 LEU B CD2  13 
ATOM 10843 H H    . LEU B 2 3  ? 6.720   -17.995 8.315   1.00 0.00 ? 200 LEU B H    13 
ATOM 10844 H HA   . LEU B 2 3  ? 9.162   -17.294 6.835   1.00 0.00 ? 200 LEU B HA   13 
ATOM 10845 H HB2  . LEU B 2 3  ? 6.456   -17.171 5.590   1.00 0.00 ? 200 LEU B HB2  13 
ATOM 10846 H HG   . LEU B 2 3  ? 7.651   -19.657 6.560   1.00 0.00 ? 200 LEU B HG   13 
ATOM 10847 H HD11 . LEU B 2 3  ? 5.327   -18.885 6.958   1.00 0.00 ? 200 LEU B HD11 13 
ATOM 10848 H HD12 . LEU B 2 3  ? 5.007   -19.085 5.235   1.00 0.00 ? 200 LEU B HD12 13 
ATOM 10849 H HD13 . LEU B 2 3  ? 5.425   -20.486 6.223   1.00 0.00 ? 200 LEU B HD13 13 
ATOM 10850 H HD21 . LEU B 2 3  ? 7.517   -20.942 4.603   1.00 0.00 ? 200 LEU B HD21 13 
ATOM 10851 H HD22 . LEU B 2 3  ? 6.724   -19.649 3.704   1.00 0.00 ? 200 LEU B HD22 13 
ATOM 10852 H HD23 . LEU B 2 3  ? 8.428   -19.506 4.138   1.00 0.00 ? 200 LEU B HD23 13 
ATOM 10853 N N    . GLY B 2 4  ? 8.683   -14.839 6.501   1.00 0.00 ? 201 GLY B N    13 
ATOM 10854 C CA   . GLY B 2 4  ? 8.501   -13.401 6.566   1.00 0.00 ? 201 GLY B CA   13 
ATOM 10855 C C    . GLY B 2 4  ? 9.798   -12.655 6.810   1.00 0.00 ? 201 GLY B C    13 
ATOM 10856 O O    . GLY B 2 4  ? 10.590  -13.038 7.671   1.00 0.00 ? 201 GLY B O    13 
ATOM 10857 H H    . GLY B 2 4  ? 9.453   -15.213 6.023   1.00 0.00 ? 201 GLY B H    13 
ATOM 10858 H HA2  . GLY B 2 4  ? 8.076   -13.062 5.633   1.00 0.00 ? 201 GLY B HA2  13 
ATOM 10859 H HA3  . GLY B 2 4  ? 7.811   -13.173 7.366   1.00 0.00 ? 201 GLY B HA3  13 
ATOM 10860 N N    . SER B 2 5  ? 10.012  -11.586 6.050   1.00 0.00 ? 202 SER B N    13 
ATOM 10861 C CA   . SER B 2 5  ? 11.217  -10.776 6.185   1.00 0.00 ? 202 SER B CA   13 
ATOM 10862 C C    . SER B 2 5  ? 11.003  -9.386  5.593   1.00 0.00 ? 202 SER B C    13 
ATOM 10863 O O    . SER B 2 5  ? 11.850  -8.873  4.862   1.00 0.00 ? 202 SER B O    13 
ATOM 10864 C CB   . SER B 2 5  ? 12.398  -11.460 5.494   1.00 0.00 ? 202 SER B CB   13 
ATOM 10865 O OG   . SER B 2 5  ? 12.671  -12.723 6.077   1.00 0.00 ? 202 SER B OG   13 
ATOM 10866 H H    . SER B 2 5  ? 9.341   -11.335 5.382   1.00 0.00 ? 202 SER B H    13 
ATOM 10867 H HA   . SER B 2 5  ? 11.434  -10.677 7.238   1.00 0.00 ? 202 SER B HA   13 
ATOM 10868 H HB2  . SER B 2 5  ? 12.169  -11.602 4.449   1.00 0.00 ? 202 SER B HB2  13 
ATOM 10869 H HG   . SER B 2 5  ? 13.236  -12.606 6.844   1.00 0.00 ? 202 SER B HG   13 
ATOM 10870 N N    . GLU B 2 6  ? 9.862   -8.783  5.914   1.00 0.00 ? 203 GLU B N    13 
ATOM 10871 C CA   . GLU B 2 6  ? 9.532   -7.452  5.414   1.00 0.00 ? 203 GLU B CA   13 
ATOM 10872 C C    . GLU B 2 6  ? 10.364  -6.383  6.117   1.00 0.00 ? 203 GLU B C    13 
ATOM 10873 O O    . GLU B 2 6  ? 11.235  -6.696  6.929   1.00 0.00 ? 203 GLU B O    13 
ATOM 10874 C CB   . GLU B 2 6  ? 8.042   -7.166  5.610   1.00 0.00 ? 203 GLU B CB   13 
ATOM 10875 C CG   . GLU B 2 6  ? 7.152   -7.834  4.574   1.00 0.00 ? 203 GLU B CG   13 
ATOM 10876 C CD   . GLU B 2 6  ? 6.299   -8.940  5.164   1.00 0.00 ? 203 GLU B CD   13 
ATOM 10877 O OE1  . GLU B 2 6  ? 6.834   -9.744  5.956   1.00 0.00 ? 203 GLU B OE1  13 
ATOM 10878 O OE2  . GLU B 2 6  ? 5.096   -9.002  4.834   1.00 0.00 ? 203 GLU B OE2  13 
ATOM 10879 H H    . GLU B 2 6  ? 9.226   -9.243  6.501   1.00 0.00 ? 203 GLU B H    13 
ATOM 10880 H HA   . GLU B 2 6  ? 9.759   -7.429  4.358   1.00 0.00 ? 203 GLU B HA   13 
ATOM 10881 H HB2  . GLU B 2 6  ? 7.746   -7.518  6.587   1.00 0.00 ? 203 GLU B HB2  13 
ATOM 10882 H HG2  . GLU B 2 6  ? 6.499   -7.089  4.144   1.00 0.00 ? 203 GLU B HG2  13 
ATOM 10883 N N    . LEU B 2 7  ? 10.091  -5.123  5.800   1.00 0.00 ? 204 LEU B N    13 
ATOM 10884 C CA   . LEU B 2 7  ? 10.814  -4.008  6.402   1.00 0.00 ? 204 LEU B CA   13 
ATOM 10885 C C    . LEU B 2 7  ? 10.031  -3.419  7.570   1.00 0.00 ? 204 LEU B C    13 
ATOM 10886 O O    . LEU B 2 7  ? 9.633   -2.254  7.540   1.00 0.00 ? 204 LEU B O    13 
ATOM 10887 C CB   . LEU B 2 7  ? 11.089  -2.924  5.355   1.00 0.00 ? 204 LEU B CB   13 
ATOM 10888 C CG   . LEU B 2 7  ? 11.499  -3.436  3.970   1.00 0.00 ? 204 LEU B CG   13 
ATOM 10889 C CD1  . LEU B 2 7  ? 12.470  -4.603  4.088   1.00 0.00 ? 204 LEU B CD1  13 
ATOM 10890 C CD2  . LEU B 2 7  ? 10.272  -3.840  3.167   1.00 0.00 ? 204 LEU B CD2  13 
ATOM 10891 H H    . LEU B 2 7  ? 9.384   -4.936  5.148   1.00 0.00 ? 204 LEU B H    13 
ATOM 10892 H HA   . LEU B 2 7  ? 11.756  -4.386  6.770   1.00 0.00 ? 204 LEU B HA   13 
ATOM 10893 H HB2  . LEU B 2 7  ? 10.194  -2.328  5.244   1.00 0.00 ? 204 LEU B HB2  13 
ATOM 10894 H HG   . LEU B 2 7  ? 12.000  -2.641  3.436   1.00 0.00 ? 204 LEU B HG   13 
ATOM 10895 H HD11 . LEU B 2 7  ? 13.116  -4.622  3.223   1.00 0.00 ? 204 LEU B HD11 13 
ATOM 10896 H HD12 . LEU B 2 7  ? 13.066  -4.486  4.980   1.00 0.00 ? 204 LEU B HD12 13 
ATOM 10897 H HD13 . LEU B 2 7  ? 11.915  -5.528  4.144   1.00 0.00 ? 204 LEU B HD13 13 
ATOM 10898 H HD21 . LEU B 2 7  ? 10.113  -4.904  3.264   1.00 0.00 ? 204 LEU B HD21 13 
ATOM 10899 H HD22 . LEU B 2 7  ? 9.407   -3.311  3.539   1.00 0.00 ? 204 LEU B HD22 13 
ATOM 10900 H HD23 . LEU B 2 7  ? 10.425  -3.593  2.126   1.00 0.00 ? 204 LEU B HD23 13 
ATOM 10901 N N    . GLU B 2 8  ? 9.817   -4.231  8.600   1.00 0.00 ? 205 GLU B N    13 
ATOM 10902 C CA   . GLU B 2 8  ? 9.076   -3.796  9.781   1.00 0.00 ? 205 GLU B CA   13 
ATOM 10903 C C    . GLU B 2 8  ? 7.587   -3.664  9.466   1.00 0.00 ? 205 GLU B C    13 
ATOM 10904 O O    . GLU B 2 8  ? 6.775   -4.470  9.921   1.00 0.00 ? 205 GLU B O    13 
ATOM 10905 C CB   . GLU B 2 8  ? 9.629   -2.466  10.301  1.00 0.00 ? 205 GLU B CB   13 
ATOM 10906 C CG   . GLU B 2 8  ? 9.191   -2.141  11.719  1.00 0.00 ? 205 GLU B CG   13 
ATOM 10907 C CD   . GLU B 2 8  ? 8.227   -0.972  11.778  1.00 0.00 ? 205 GLU B CD   13 
ATOM 10908 O OE1  . GLU B 2 8  ? 8.419   -0.005  11.010  1.00 0.00 ? 205 GLU B OE1  13 
ATOM 10909 O OE2  . GLU B 2 8  ? 7.280   -1.024  12.591  1.00 0.00 ? 205 GLU B OE2  13 
ATOM 10910 H H    . GLU B 2 8  ? 10.168  -5.146  8.568   1.00 0.00 ? 205 GLU B H    13 
ATOM 10911 H HA   . GLU B 2 8  ? 9.201   -4.549  10.545  1.00 0.00 ? 205 GLU B HA   13 
ATOM 10912 H HB2  . GLU B 2 8  ? 10.708  -2.508  10.282  1.00 0.00 ? 205 GLU B HB2  13 
ATOM 10913 H HG2  . GLU B 2 8  ? 8.705   -3.009  12.140  1.00 0.00 ? 205 GLU B HG2  13 
ATOM 10914 N N    . SER B 2 9  ? 7.235   -2.645  8.686   1.00 0.00 ? 206 SER B N    13 
ATOM 10915 C CA   . SER B 2 9  ? 5.843   -2.417  8.306   1.00 0.00 ? 206 SER B CA   13 
ATOM 10916 C C    . SER B 2 9  ? 5.683   -1.091  7.564   1.00 0.00 ? 206 SER B C    13 
ATOM 10917 O O    . SER B 2 9  ? 4.998   -0.185  8.040   1.00 0.00 ? 206 SER B O    13 
ATOM 10918 C CB   . SER B 2 9  ? 4.943   -2.432  9.544   1.00 0.00 ? 206 SER B CB   13 
ATOM 10919 O OG   . SER B 2 9  ? 4.269   -3.674  9.669   1.00 0.00 ? 206 SER B OG   13 
ATOM 10920 H H    . SER B 2 9  ? 7.925   -2.034  8.356   1.00 0.00 ? 206 SER B H    13 
ATOM 10921 H HA   . SER B 2 9  ? 5.546   -3.220  7.648   1.00 0.00 ? 206 SER B HA   13 
ATOM 10922 H HB2  . SER B 2 9  ? 5.543   -2.274  10.427  1.00 0.00 ? 206 SER B HB2  13 
ATOM 10923 H HG   . SER B 2 9  ? 4.265   -3.945  10.591  1.00 0.00 ? 206 SER B HG   13 
ATOM 10924 N N    . PRO B 2 10 ? 6.315   -0.958  6.383   1.00 0.00 ? 207 PRO B N    13 
ATOM 10925 C CA   . PRO B 2 10 ? 6.235   0.259   5.572   1.00 0.00 ? 207 PRO B CA   13 
ATOM 10926 C C    . PRO B 2 10 ? 4.856   0.526   4.946   1.00 0.00 ? 207 PRO B C    13 
ATOM 10927 O O    . PRO B 2 10 ? 4.491   1.691   4.785   1.00 0.00 ? 207 PRO B O    13 
ATOM 10928 C CB   . PRO B 2 10 ? 7.284   0.038   4.472   1.00 0.00 ? 207 PRO B CB   13 
ATOM 10929 C CG   . PRO B 2 10 ? 8.100   -1.125  4.923   1.00 0.00 ? 207 PRO B CG   13 
ATOM 10930 C CD   . PRO B 2 10 ? 7.179   -1.968  5.749   1.00 0.00 ? 207 PRO B CD   13 
ATOM 10931 H HA   . PRO B 2 10 ? 6.517   1.122   6.150   1.00 0.00 ? 207 PRO B HA   13 
ATOM 10932 H HB2  . PRO B 2 10 ? 6.788   -0.168  3.539   1.00 0.00 ? 207 PRO B HB2  13 
ATOM 10933 H HG2  . PRO B 2 10 ? 8.453   -1.681  4.067   1.00 0.00 ? 207 PRO B HG2  13 
ATOM 10934 H HD2  . PRO B 2 10 ? 6.611   -2.633  5.117   1.00 0.00 ? 207 PRO B HD2  13 
ATOM 10935 N N    . PRO B 2 11 ? 4.062   -0.514  4.568   1.00 0.00 ? 208 PRO B N    13 
ATOM 10936 C CA   . PRO B 2 11 ? 2.756   -0.308  3.952   1.00 0.00 ? 208 PRO B CA   13 
ATOM 10937 C C    . PRO B 2 11 ? 1.988   0.873   4.530   1.00 0.00 ? 208 PRO B C    13 
ATOM 10938 O O    . PRO B 2 11 ? 1.671   0.883   5.720   1.00 0.00 ? 208 PRO B O    13 
ATOM 10939 C CB   . PRO B 2 11 ? 2.000   -1.599  4.243   1.00 0.00 ? 208 PRO B CB   13 
ATOM 10940 C CG   . PRO B 2 11 ? 3.040   -2.644  4.469   1.00 0.00 ? 208 PRO B CG   13 
ATOM 10941 C CD   . PRO B 2 11 ? 4.365   -1.953  4.671   1.00 0.00 ? 208 PRO B CD   13 
ATOM 10942 H HA   . PRO B 2 11 ? 2.849   -0.192  2.894   1.00 0.00 ? 208 PRO B HA   13 
ATOM 10943 H HB2  . PRO B 2 11 ? 1.380   -1.462  5.115   1.00 0.00 ? 208 PRO B HB2  13 
ATOM 10944 H HG2  . PRO B 2 11 ? 2.789   -3.217  5.349   1.00 0.00 ? 208 PRO B HG2  13 
ATOM 10945 H HD2  . PRO B 2 11 ? 4.747   -2.205  5.638   1.00 0.00 ? 208 PRO B HD2  13 
ATOM 10946 N N    . PRO B 2 12 ? 1.725   1.909   3.707   1.00 0.00 ? 209 PRO B N    13 
ATOM 10947 C CA   . PRO B 2 12 ? 0.952   3.081   4.119   1.00 0.00 ? 209 PRO B CA   13 
ATOM 10948 C C    . PRO B 2 12 ? -0.326  2.697   4.871   1.00 0.00 ? 209 PRO B C    13 
ATOM 10949 O O    . PRO B 2 12 ? -0.536  1.532   5.198   1.00 0.00 ? 209 PRO B O    13 
ATOM 10950 C CB   . PRO B 2 12 ? 0.610   3.767   2.782   1.00 0.00 ? 209 PRO B CB   13 
ATOM 10951 C CG   . PRO B 2 12 ? 1.111   2.863   1.714   1.00 0.00 ? 209 PRO B CG   13 
ATOM 10952 C CD   . PRO B 2 12 ? 2.203   2.066   2.327   1.00 0.00 ? 209 PRO B CD   13 
ATOM 10953 H HA   . PRO B 2 12 ? 1.541   3.750   4.730   1.00 0.00 ? 209 PRO B HA   13 
ATOM 10954 H HB2  . PRO B 2 12 ? -0.452  3.883   2.704   1.00 0.00 ? 209 PRO B HB2  13 
ATOM 10955 H HG2  . PRO B 2 12 ? 0.320   2.212   1.395   1.00 0.00 ? 209 PRO B HG2  13 
ATOM 10956 H HD2  . PRO B 2 12 ? 2.292   1.122   1.820   1.00 0.00 ? 209 PRO B HD2  13 
ATOM 10957 N N    . PRO B 2 13 ? -1.219  3.665   5.131   1.00 0.00 ? 210 PRO B N    13 
ATOM 10958 C CA   . PRO B 2 13 ? -2.449  3.414   5.856   1.00 0.00 ? 210 PRO B CA   13 
ATOM 10959 C C    . PRO B 2 13 ? -3.595  3.024   4.938   1.00 0.00 ? 210 PRO B C    13 
ATOM 10960 O O    . PRO B 2 13 ? -3.580  3.330   3.746   1.00 0.00 ? 210 PRO B O    13 
ATOM 10961 C CB   . PRO B 2 13 ? -2.723  4.758   6.520   1.00 0.00 ? 210 PRO B CB   13 
ATOM 10962 C CG   . PRO B 2 13 ? -2.112  5.782   5.613   1.00 0.00 ? 210 PRO B CG   13 
ATOM 10963 C CD   . PRO B 2 13 ? -1.131  5.068   4.711   1.00 0.00 ? 210 PRO B CD   13 
ATOM 10964 H HA   . PRO B 2 13 ? -2.317  2.656   6.611   1.00 0.00 ? 210 PRO B HA   13 
ATOM 10965 H HB2  . PRO B 2 13 ? -3.789  4.901   6.614   1.00 0.00 ? 210 PRO B HB2  13 
ATOM 10966 H HG2  . PRO B 2 13 ? -2.885  6.245   5.020   1.00 0.00 ? 210 PRO B HG2  13 
ATOM 10967 H HD2  . PRO B 2 13 ? -1.434  5.172   3.677   1.00 0.00 ? 210 PRO B HD2  13 
ATOM 10968 N N    . TYR B 2 14 ? -4.591  2.348   5.500   1.00 0.00 ? 211 TYR B N    13 
ATOM 10969 C CA   . TYR B 2 14 ? -5.749  1.920   4.728   1.00 0.00 ? 211 TYR B CA   13 
ATOM 10970 C C    . TYR B 2 14 ? -6.310  3.084   3.912   1.00 0.00 ? 211 TYR B C    13 
ATOM 10971 O O    . TYR B 2 14 ? -6.094  3.170   2.703   1.00 0.00 ? 211 TYR B O    13 
ATOM 10972 C CB   . TYR B 2 14 ? -6.831  1.354   5.663   1.00 0.00 ? 211 TYR B CB   13 
ATOM 10973 C CG   . TYR B 2 14 ? -8.184  1.199   5.003   1.00 0.00 ? 211 TYR B CG   13 
ATOM 10974 C CD1  . TYR B 2 14 ? -8.339  0.383   3.894   1.00 0.00 ? 211 TYR B CD1  13 
ATOM 10975 C CD2  . TYR B 2 14 ? -9.297  1.882   5.478   1.00 0.00 ? 211 TYR B CD2  13 
ATOM 10976 C CE1  . TYR B 2 14 ? -9.565  0.247   3.274   1.00 0.00 ? 211 TYR B CE1  13 
ATOM 10977 C CE2  . TYR B 2 14 ? -10.528 1.753   4.862   1.00 0.00 ? 211 TYR B CE2  13 
ATOM 10978 C CZ   . TYR B 2 14 ? -10.656 0.935   3.760   1.00 0.00 ? 211 TYR B CZ   13 
ATOM 10979 O OH   . TYR B 2 14 ? -11.881 0.802   3.142   1.00 0.00 ? 211 TYR B OH   13 
ATOM 10980 H H    . TYR B 2 14 ? -4.545  2.132   6.454   1.00 0.00 ? 211 TYR B H    13 
ATOM 10981 H HA   . TYR B 2 14 ? -5.425  1.143   4.051   1.00 0.00 ? 211 TYR B HA   13 
ATOM 10982 H HB2  . TYR B 2 14 ? -6.520  0.381   6.014   1.00 0.00 ? 211 TYR B HB2  13 
ATOM 10983 H HD1  . TYR B 2 14 ? -7.484  -0.158  3.518   1.00 0.00 ? 211 TYR B HD1  13 
ATOM 10984 H HD2  . TYR B 2 14 ? -9.191  2.522   6.342   1.00 0.00 ? 211 TYR B HD2  13 
ATOM 10985 H HE1  . TYR B 2 14 ? -9.663  -0.390  2.408   1.00 0.00 ? 211 TYR B HE1  13 
ATOM 10986 H HE2  . TYR B 2 14 ? -11.381 2.293   5.244   1.00 0.00 ? 211 TYR B HE2  13 
ATOM 10987 H HH   . TYR B 2 14 ? -12.459 1.519   3.415   1.00 0.00 ? 211 TYR B HH   13 
ATOM 10988 N N    . SER B 2 15 ? -7.027  3.975   4.587   1.00 0.00 ? 212 SER B N    13 
ATOM 10989 C CA   . SER B 2 15 ? -7.624  5.130   3.932   1.00 0.00 ? 212 SER B CA   13 
ATOM 10990 C C    . SER B 2 15 ? -8.489  4.698   2.751   1.00 0.00 ? 212 SER B C    13 
ATOM 10991 O O    . SER B 2 15 ? -9.691  4.482   2.903   1.00 0.00 ? 212 SER B O    13 
ATOM 10992 C CB   . SER B 2 15 ? -6.536  6.104   3.470   1.00 0.00 ? 212 SER B CB   13 
ATOM 10993 O OG   . SER B 2 15 ? -7.075  7.112   2.632   1.00 0.00 ? 212 SER B OG   13 
ATOM 10994 H H    . SER B 2 15 ? -7.157  3.851   5.550   1.00 0.00 ? 212 SER B H    13 
ATOM 10995 H HA   . SER B 2 15 ? -8.252  5.628   4.656   1.00 0.00 ? 212 SER B HA   13 
ATOM 10996 H HB2  . SER B 2 15 ? -6.086  6.573   4.332   1.00 0.00 ? 212 SER B HB2  13 
ATOM 10997 H HG   . SER B 2 15 ? -6.971  7.968   3.053   1.00 0.00 ? 212 SER B HG   13 
ATOM 10998 N N    . ARG B 2 16 ? -7.873  4.566   1.573   1.00 0.00 ? 213 ARG B N    13 
ATOM 10999 C CA   . ARG B 2 16 ? -8.589  4.160   0.361   1.00 0.00 ? 213 ARG B CA   13 
ATOM 11000 C C    . ARG B 2 16 ? -7.769  4.474   -0.884  1.00 0.00 ? 213 ARG B C    13 
ATOM 11001 O O    . ARG B 2 16 ? -7.861  3.779   -1.895  1.00 0.00 ? 213 ARG B O    13 
ATOM 11002 C CB   . ARG B 2 16 ? -9.944  4.849   0.273   1.00 0.00 ? 213 ARG B CB   13 
ATOM 11003 C CG   . ARG B 2 16 ? -11.084 3.927   0.659   1.00 0.00 ? 213 ARG B CG   13 
ATOM 11004 C CD   . ARG B 2 16 ? -11.692 3.254   -0.560  1.00 0.00 ? 213 ARG B CD   13 
ATOM 11005 N NE   . ARG B 2 16 ? -10.720 3.021   -1.630  1.00 0.00 ? 213 ARG B NE   13 
ATOM 11006 C CZ   . ARG B 2 16 ? -11.046 2.903   -2.915  1.00 0.00 ? 213 ARG B CZ   13 
ATOM 11007 N NH1  . ARG B 2 16 ? -12.315 2.982   -3.294  1.00 0.00 ? 213 ARG B NH1  13 
ATOM 11008 N NH2  . ARG B 2 16 ? -10.100 2.701   -3.822  1.00 0.00 ? 213 ARG B NH2  13 
ATOM 11009 H H    . ARG B 2 16 ? -6.911  4.740   1.517   1.00 0.00 ? 213 ARG B H    13 
ATOM 11010 H HA   . ARG B 2 16 ? -8.755  3.094   0.406   1.00 0.00 ? 213 ARG B HA   13 
ATOM 11011 H HB2  . ARG B 2 16 ? -9.950  5.704   0.933   1.00 0.00 ? 213 ARG B HB2  13 
ATOM 11012 H HG2  . ARG B 2 16 ? -10.709 3.164   1.329   1.00 0.00 ? 213 ARG B HG2  13 
ATOM 11013 H HD2  . ARG B 2 16 ? -12.121 2.311   -0.261  1.00 0.00 ? 213 ARG B HD2  13 
ATOM 11014 H HE   . ARG B 2 16 ? -9.776  2.953   -1.379  1.00 0.00 ? 213 ARG B HE   13 
ATOM 11015 H HH11 . ARG B 2 16 ? -13.032 3.131   -2.615  1.00 0.00 ? 213 ARG B HH11 13 
ATOM 11016 H HH12 . ARG B 2 16 ? -12.553 2.893   -4.261  1.00 0.00 ? 213 ARG B HH12 13 
ATOM 11017 H HH21 . ARG B 2 16 ? -9.142  2.638   -3.541  1.00 0.00 ? 213 ARG B HH21 13 
ATOM 11018 H HH22 . ARG B 2 16 ? -10.344 2.612   -4.787  1.00 0.00 ? 213 ARG B HH22 13 
ATOM 11019 N N    . TYR B 2 17 ? -6.966  5.528   -0.799  1.00 0.00 ? 214 TYR B N    13 
ATOM 11020 C CA   . TYR B 2 17 ? -6.125  5.941   -1.916  1.00 0.00 ? 214 TYR B CA   13 
ATOM 11021 C C    . TYR B 2 17 ? -4.668  5.565   -1.659  1.00 0.00 ? 214 TYR B C    13 
ATOM 11022 O O    . TYR B 2 17 ? -4.328  5.073   -0.583  1.00 0.00 ? 214 TYR B O    13 
ATOM 11023 C CB   . TYR B 2 17 ? -6.254  7.449   -2.141  1.00 0.00 ? 214 TYR B CB   13 
ATOM 11024 C CG   . TYR B 2 17 ? -7.650  7.975   -1.916  1.00 0.00 ? 214 TYR B CG   13 
ATOM 11025 C CD1  . TYR B 2 17 ? -8.759  7.175   -2.161  1.00 0.00 ? 214 TYR B CD1  13 
ATOM 11026 C CD2  . TYR B 2 17 ? -7.862  9.269   -1.463  1.00 0.00 ? 214 TYR B CD2  13 
ATOM 11027 C CE1  . TYR B 2 17 ? -10.038 7.651   -1.961  1.00 0.00 ? 214 TYR B CE1  13 
ATOM 11028 C CE2  . TYR B 2 17 ? -9.139  9.754   -1.261  1.00 0.00 ? 214 TYR B CE2  13 
ATOM 11029 C CZ   . TYR B 2 17 ? -10.224 8.941   -1.511  1.00 0.00 ? 214 TYR B CZ   13 
ATOM 11030 O OH   . TYR B 2 17 ? -11.499 9.420   -1.312  1.00 0.00 ? 214 TYR B OH   13 
ATOM 11031 H H    . TYR B 2 17 ? -6.936  6.041   0.036   1.00 0.00 ? 214 TYR B H    13 
ATOM 11032 H HA   . TYR B 2 17 ? -6.468  5.423   -2.798  1.00 0.00 ? 214 TYR B HA   13 
ATOM 11033 H HB2  . TYR B 2 17 ? -5.591  7.968   -1.466  1.00 0.00 ? 214 TYR B HB2  13 
ATOM 11034 H HD1  . TYR B 2 17 ? -8.609  6.166   -2.513  1.00 0.00 ? 214 TYR B HD1  13 
ATOM 11035 H HD2  . TYR B 2 17 ? -7.008  9.902   -1.268  1.00 0.00 ? 214 TYR B HD2  13 
ATOM 11036 H HE1  . TYR B 2 17 ? -10.885 7.013   -2.159  1.00 0.00 ? 214 TYR B HE1  13 
ATOM 11037 H HE2  . TYR B 2 17 ? -9.280  10.763  -0.910  1.00 0.00 ? 214 TYR B HE2  13 
ATOM 11038 H HH   . TYR B 2 17 ? -11.839 9.089   -0.477  1.00 0.00 ? 214 TYR B HH   13 
ATOM 11039 N N    . PRO B 2 18 ? -3.785  5.791   -2.646  1.00 0.00 ? 215 PRO B N    13 
ATOM 11040 C CA   . PRO B 2 18 ? -2.372  5.471   -2.525  1.00 0.00 ? 215 PRO B CA   13 
ATOM 11041 C C    . PRO B 2 18 ? -1.572  6.613   -1.913  1.00 0.00 ? 215 PRO B C    13 
ATOM 11042 O O    . PRO B 2 18 ? -1.062  7.480   -2.624  1.00 0.00 ? 215 PRO B O    13 
ATOM 11043 C CB   . PRO B 2 18 ? -1.962  5.222   -3.975  1.00 0.00 ? 215 PRO B CB   13 
ATOM 11044 C CG   . PRO B 2 18 ? -2.868  6.087   -4.795  1.00 0.00 ? 215 PRO B CG   13 
ATOM 11045 C CD   . PRO B 2 18 ? -4.095  6.383   -3.957  1.00 0.00 ? 215 PRO B CD   13 
ATOM 11046 H HA   . PRO B 2 18 ? -2.220  4.575   -1.944  1.00 0.00 ? 215 PRO B HA   13 
ATOM 11047 H HB2  . PRO B 2 18 ? -0.926  5.494   -4.112  1.00 0.00 ? 215 PRO B HB2  13 
ATOM 11048 H HG2  . PRO B 2 18 ? -2.362  7.007   -5.044  1.00 0.00 ? 215 PRO B HG2  13 
ATOM 11049 H HD2  . PRO B 2 18 ? -4.237  7.450   -3.871  1.00 0.00 ? 215 PRO B HD2  13 
ATOM 11050 N N    . MET B 2 19 ? -1.469  6.608   -0.587  1.00 0.00 ? 216 MET B N    13 
ATOM 11051 C CA   . MET B 2 19 ? -0.738  7.647   0.128   1.00 0.00 ? 216 MET B CA   13 
ATOM 11052 C C    . MET B 2 19 ? 0.277   7.043   1.090   1.00 0.00 ? 216 MET B C    13 
ATOM 11053 O O    . MET B 2 19 ? -0.090  6.409   2.076   1.00 0.00 ? 216 MET B O    13 
ATOM 11054 C CB   . MET B 2 19 ? -1.712  8.544   0.895   1.00 0.00 ? 216 MET B CB   13 
ATOM 11055 C CG   . MET B 2 19 ? -2.349  7.869   2.103   1.00 0.00 ? 216 MET B CG   13 
ATOM 11056 S SD   . MET B 2 19 ? -4.106  8.247   2.262   1.00 0.00 ? 216 MET B SD   13 
ATOM 11057 C CE   . MET B 2 19 ? -4.803  7.174   1.008   1.00 0.00 ? 216 MET B CE   13 
ATOM 11058 H H    . MET B 2 19 ? -1.896  5.888   -0.078  1.00 0.00 ? 216 MET B H    13 
ATOM 11059 H HA   . MET B 2 19 ? -0.210  8.241   -0.601  1.00 0.00 ? 216 MET B HA   13 
ATOM 11060 H HB2  . MET B 2 19 ? -1.181  9.420   1.238   1.00 0.00 ? 216 MET B HB2  13 
ATOM 11061 H HG2  . MET B 2 19 ? -2.234  6.798   2.008   1.00 0.00 ? 216 MET B HG2  13 
ATOM 11062 H HE1  . MET B 2 19 ? -4.223  7.256   0.101   1.00 0.00 ? 216 MET B HE1  13 
ATOM 11063 H HE2  . MET B 2 19 ? -4.783  6.152   1.357   1.00 0.00 ? 216 MET B HE2  13 
ATOM 11064 H HE3  . MET B 2 19 ? -5.824  7.467   0.811   1.00 0.00 ? 216 MET B HE3  13 
ATOM 11065 N N    . ASP B 2 20 ? 1.557   7.256   0.799   1.00 0.00 ? 217 ASP B N    13 
ATOM 11066 C CA   . ASP B 2 20 ? 2.631   6.734   1.637   1.00 0.00 ? 217 ASP B CA   13 
ATOM 11067 C C    . ASP B 2 20 ? 2.395   7.076   3.105   1.00 0.00 ? 217 ASP B C    13 
ATOM 11068 O O    . ASP B 2 20 ? 1.885   8.183   3.379   1.00 0.00 ? 217 ASP B O    13 
ATOM 11069 C CB   . ASP B 2 20 ? 3.980   7.296   1.183   1.00 0.00 ? 217 ASP B CB   13 
ATOM 11070 C CG   . ASP B 2 20 ? 4.042   8.808   1.291   1.00 0.00 ? 217 ASP B CG   13 
ATOM 11071 O OD1  . ASP B 2 20 ? 4.182   9.318   2.423   1.00 0.00 ? 217 ASP B OD1  13 
ATOM 11072 O OD2  . ASP B 2 20 ? 3.950   9.483   0.244   1.00 0.00 ? 217 ASP B OD2  13 
ATOM 11073 O OXT  . ASP B 2 20 ? 2.723   6.235   3.968   1.00 0.00 ? 217 ASP B OXT  13 
ATOM 11074 H H    . ASP B 2 20 ? 1.784   7.781   0.003   1.00 0.00 ? 217 ASP B H    13 
ATOM 11075 H HA   . ASP B 2 20 ? 2.644   5.660   1.527   1.00 0.00 ? 217 ASP B HA   13 
ATOM 11076 H HB2  . ASP B 2 20 ? 4.763   6.879   1.798   1.00 0.00 ? 217 ASP B HB2  13 
ATOM 11077 N N    . GLY A 1 1  ? 8.999   -10.408 -3.835  1.00 0.00 ? 292 GLY A N    14 
ATOM 11078 C CA   . GLY A 1 1  ? 9.732   -10.723 -5.093  1.00 0.00 ? 292 GLY A CA   14 
ATOM 11079 C C    . GLY A 1 1  ? 8.818   -11.267 -6.176  1.00 0.00 ? 292 GLY A C    14 
ATOM 11080 O O    . GLY A 1 1  ? 8.636   -10.628 -7.213  1.00 0.00 ? 292 GLY A O    14 
ATOM 11081 H H1   . GLY A 1 1  ? 9.110   -11.186 -3.154  1.00 0.00 ? 292 GLY A H1   14 
ATOM 11082 H H2   . GLY A 1 1  ? 7.988   -10.278 -4.034  1.00 0.00 ? 292 GLY A H2   14 
ATOM 11083 H H3   . GLY A 1 1  ? 9.374   -9.535  -3.413  1.00 0.00 ? 292 GLY A H3   14 
ATOM 11084 H HA2  . GLY A 1 1  ? 10.206  -9.823  -5.455  1.00 0.00 ? 292 GLY A HA2  14 
ATOM 11085 H HA3  . GLY A 1 1  ? 10.494  -11.458 -4.879  1.00 0.00 ? 292 GLY A HA3  14 
ATOM 11086 N N    . PRO A 1 2  ? 8.226   -12.453 -5.962  1.00 0.00 ? 293 PRO A N    14 
ATOM 11087 C CA   . PRO A 1 2  ? 7.326   -13.076 -6.936  1.00 0.00 ? 293 PRO A CA   14 
ATOM 11088 C C    . PRO A 1 2  ? 5.951   -12.417 -6.959  1.00 0.00 ? 293 PRO A C    14 
ATOM 11089 O O    . PRO A 1 2  ? 5.359   -12.230 -8.023  1.00 0.00 ? 293 PRO A O    14 
ATOM 11090 C CB   . PRO A 1 2  ? 7.219   -14.517 -6.437  1.00 0.00 ? 293 PRO A CB   14 
ATOM 11091 C CG   . PRO A 1 2  ? 7.429   -14.420 -4.965  1.00 0.00 ? 293 PRO A CG   14 
ATOM 11092 C CD   . PRO A 1 2  ? 8.392   -13.282 -4.752  1.00 0.00 ? 293 PRO A CD   14 
ATOM 11093 H HA   . PRO A 1 2  ? 7.748   -13.065 -7.930  1.00 0.00 ? 293 PRO A HA   14 
ATOM 11094 H HB2  . PRO A 1 2  ? 6.243   -14.913 -6.675  1.00 0.00 ? 293 PRO A HB2  14 
ATOM 11095 H HG2  . PRO A 1 2  ? 6.489   -14.212 -4.475  1.00 0.00 ? 293 PRO A HG2  14 
ATOM 11096 H HD2  . PRO A 1 2  ? 8.126   -12.726 -3.865  1.00 0.00 ? 293 PRO A HD2  14 
ATOM 11097 N N    . LEU A 1 3  ? 5.447   -12.068 -5.780  1.00 0.00 ? 294 LEU A N    14 
ATOM 11098 C CA   . LEU A 1 3  ? 4.140   -11.430 -5.665  1.00 0.00 ? 294 LEU A CA   14 
ATOM 11099 C C    . LEU A 1 3  ? 3.060   -12.289 -6.316  1.00 0.00 ? 294 LEU A C    14 
ATOM 11100 O O    . LEU A 1 3  ? 3.314   -13.426 -6.715  1.00 0.00 ? 294 LEU A O    14 
ATOM 11101 C CB   . LEU A 1 3  ? 4.167   -10.043 -6.314  1.00 0.00 ? 294 LEU A CB   14 
ATOM 11102 C CG   . LEU A 1 3  ? 4.039   -8.869  -5.340  1.00 0.00 ? 294 LEU A CG   14 
ATOM 11103 C CD1  . LEU A 1 3  ? 5.314   -8.705  -4.527  1.00 0.00 ? 294 LEU A CD1  14 
ATOM 11104 C CD2  . LEU A 1 3  ? 3.715   -7.587  -6.092  1.00 0.00 ? 294 LEU A CD2  14 
ATOM 11105 H H    . LEU A 1 3  ? 5.966   -12.242 -4.967  1.00 0.00 ? 294 LEU A H    14 
ATOM 11106 H HA   . LEU A 1 3  ? 3.915   -11.323 -4.615  1.00 0.00 ? 294 LEU A HA   14 
ATOM 11107 H HB2  . LEU A 1 3  ? 5.099   -9.939  -6.851  1.00 0.00 ? 294 LEU A HB2  14 
ATOM 11108 H HG   . LEU A 1 3  ? 3.230   -9.067  -4.652  1.00 0.00 ? 294 LEU A HG   14 
ATOM 11109 H HD11 . LEU A 1 3  ? 5.508   -7.655  -4.371  1.00 0.00 ? 294 LEU A HD11 14 
ATOM 11110 H HD12 . LEU A 1 3  ? 5.198   -9.197  -3.573  1.00 0.00 ? 294 LEU A HD12 14 
ATOM 11111 H HD13 . LEU A 1 3  ? 6.141   -9.148  -5.063  1.00 0.00 ? 294 LEU A HD13 14 
ATOM 11112 H HD21 . LEU A 1 3  ? 2.684   -7.608  -6.414  1.00 0.00 ? 294 LEU A HD21 14 
ATOM 11113 H HD22 . LEU A 1 3  ? 3.870   -6.738  -5.441  1.00 0.00 ? 294 LEU A HD22 14 
ATOM 11114 H HD23 . LEU A 1 3  ? 4.360   -7.502  -6.954  1.00 0.00 ? 294 LEU A HD23 14 
ATOM 11115 N N    . GLY A 1 4  ? 1.854   -11.741 -6.419  1.00 0.00 ? 295 GLY A N    14 
ATOM 11116 C CA   . GLY A 1 4  ? 0.757   -12.473 -7.024  1.00 0.00 ? 295 GLY A CA   14 
ATOM 11117 C C    . GLY A 1 4  ? 0.577   -12.137 -8.491  1.00 0.00 ? 295 GLY A C    14 
ATOM 11118 O O    . GLY A 1 4  ? 0.141   -12.977 -9.279  1.00 0.00 ? 295 GLY A O    14 
ATOM 11119 H H    . GLY A 1 4  ? 1.707   -10.832 -6.085  1.00 0.00 ? 295 GLY A H    14 
ATOM 11120 H HA2  . GLY A 1 4  ? 0.950   -13.532 -6.929  1.00 0.00 ? 295 GLY A HA2  14 
ATOM 11121 H HA3  . GLY A 1 4  ? -0.155  -12.235 -6.497  1.00 0.00 ? 295 GLY A HA3  14 
ATOM 11122 N N    . SER A 1 5  ? 0.914   -10.904 -8.858  1.00 0.00 ? 296 SER A N    14 
ATOM 11123 C CA   . SER A 1 5  ? 0.787   -10.455 -10.240 1.00 0.00 ? 296 SER A CA   14 
ATOM 11124 C C    . SER A 1 5  ? -0.596  -10.778 -10.794 1.00 0.00 ? 296 SER A C    14 
ATOM 11125 O O    . SER A 1 5  ? -0.723  -11.388 -11.856 1.00 0.00 ? 296 SER A O    14 
ATOM 11126 C CB   . SER A 1 5  ? 1.863   -11.108 -11.111 1.00 0.00 ? 296 SER A CB   14 
ATOM 11127 O OG   . SER A 1 5  ? 2.071   -10.370 -12.303 1.00 0.00 ? 296 SER A OG   14 
ATOM 11128 H H    . SER A 1 5  ? 1.254   -10.281 -8.182  1.00 0.00 ? 296 SER A H    14 
ATOM 11129 H HA   . SER A 1 5  ? 0.927   -9.385  -10.254 1.00 0.00 ? 296 SER A HA   14 
ATOM 11130 H HB2  . SER A 1 5  ? 2.792   -11.150 -10.562 1.00 0.00 ? 296 SER A HB2  14 
ATOM 11131 H HG   . SER A 1 5  ? 1.737   -10.869 -13.051 1.00 0.00 ? 296 SER A HG   14 
ATOM 11132 N N    . GLY A 1 6  ? -1.630  -10.365 -10.069 1.00 0.00 ? 297 GLY A N    14 
ATOM 11133 C CA   . GLY A 1 6  ? -2.988  -10.621 -10.507 1.00 0.00 ? 297 GLY A CA   14 
ATOM 11134 C C    . GLY A 1 6  ? -4.005  -9.753  -9.789  1.00 0.00 ? 297 GLY A C    14 
ATOM 11135 O O    . GLY A 1 6  ? -3.635  -8.885  -9.000  1.00 0.00 ? 297 GLY A O    14 
ATOM 11136 H H    . GLY A 1 6  ? -1.469  -9.882  -9.232  1.00 0.00 ? 297 GLY A H    14 
ATOM 11137 H HA2  . GLY A 1 6  ? -3.055  -10.432 -11.568 1.00 0.00 ? 297 GLY A HA2  14 
ATOM 11138 H HA3  . GLY A 1 6  ? -3.223  -11.660 -10.322 1.00 0.00 ? 297 GLY A HA3  14 
ATOM 11139 N N    . PRO A 1 7  ? -5.307  -9.969  -10.047 1.00 0.00 ? 298 PRO A N    14 
ATOM 11140 C CA   . PRO A 1 7  ? -6.379  -9.192  -9.414  1.00 0.00 ? 298 PRO A CA   14 
ATOM 11141 C C    . PRO A 1 7  ? -6.357  -9.309  -7.894  1.00 0.00 ? 298 PRO A C    14 
ATOM 11142 O O    . PRO A 1 7  ? -5.314  -9.577  -7.298  1.00 0.00 ? 298 PRO A O    14 
ATOM 11143 C CB   . PRO A 1 7  ? -7.661  -9.815  -9.979  1.00 0.00 ? 298 PRO A CB   14 
ATOM 11144 C CG   . PRO A 1 7  ? -7.238  -10.511 -11.226 1.00 0.00 ? 298 PRO A CG   14 
ATOM 11145 C CD   . PRO A 1 7  ? -5.834  -10.981 -10.976 1.00 0.00 ? 298 PRO A CD   14 
ATOM 11146 H HA   . PRO A 1 7  ? -6.328  -8.149  -9.691  1.00 0.00 ? 298 PRO A HA   14 
ATOM 11147 H HB2  . PRO A 1 7  ? -8.075  -10.508 -9.261  1.00 0.00 ? 298 PRO A HB2  14 
ATOM 11148 H HG2  . PRO A 1 7  ? -7.887  -11.352 -11.417 1.00 0.00 ? 298 PRO A HG2  14 
ATOM 11149 H HD2  . PRO A 1 7  ? -5.839  -11.961 -10.520 1.00 0.00 ? 298 PRO A HD2  14 
ATOM 11150 N N    . LEU A 1 8  ? -7.514  -9.104  -7.272  1.00 0.00 ? 299 LEU A N    14 
ATOM 11151 C CA   . LEU A 1 8  ? -7.625  -9.186  -5.821  1.00 0.00 ? 299 LEU A CA   14 
ATOM 11152 C C    . LEU A 1 8  ? -9.040  -9.577  -5.402  1.00 0.00 ? 299 LEU A C    14 
ATOM 11153 O O    . LEU A 1 8  ? -9.995  -9.380  -6.153  1.00 0.00 ? 299 LEU A O    14 
ATOM 11154 C CB   . LEU A 1 8  ? -7.255  -7.846  -5.185  1.00 0.00 ? 299 LEU A CB   14 
ATOM 11155 C CG   . LEU A 1 8  ? -5.757  -7.591  -5.030  1.00 0.00 ? 299 LEU A CG   14 
ATOM 11156 C CD1  . LEU A 1 8  ? -5.513  -6.172  -4.551  1.00 0.00 ? 299 LEU A CD1  14 
ATOM 11157 C CD2  . LEU A 1 8  ? -5.145  -8.597  -4.068  1.00 0.00 ? 299 LEU A CD2  14 
ATOM 11158 H H    . LEU A 1 8  ? -8.310  -8.890  -7.802  1.00 0.00 ? 299 LEU A H    14 
ATOM 11159 H HA   . LEU A 1 8  ? -6.937  -9.942  -5.475  1.00 0.00 ? 299 LEU A HA   14 
ATOM 11160 H HB2  . LEU A 1 8  ? -7.672  -7.057  -5.794  1.00 0.00 ? 299 LEU A HB2  14 
ATOM 11161 H HG   . LEU A 1 8  ? -5.275  -7.707  -5.990  1.00 0.00 ? 299 LEU A HG   14 
ATOM 11162 H HD11 . LEU A 1 8  ? -4.455  -6.003  -4.453  1.00 0.00 ? 299 LEU A HD11 14 
ATOM 11163 H HD12 . LEU A 1 8  ? -5.924  -5.475  -5.265  1.00 0.00 ? 299 LEU A HD12 14 
ATOM 11164 H HD13 . LEU A 1 8  ? -5.991  -6.029  -3.594  1.00 0.00 ? 299 LEU A HD13 14 
ATOM 11165 H HD21 . LEU A 1 8  ? -4.235  -8.994  -4.492  1.00 0.00 ? 299 LEU A HD21 14 
ATOM 11166 H HD22 . LEU A 1 8  ? -4.922  -8.108  -3.131  1.00 0.00 ? 299 LEU A HD22 14 
ATOM 11167 H HD23 . LEU A 1 8  ? -5.843  -9.402  -3.896  1.00 0.00 ? 299 LEU A HD23 14 
ATOM 11168 N N    . PRO A 1 9  ? -9.190  -10.138 -4.190  1.00 0.00 ? 300 PRO A N    14 
ATOM 11169 C CA   . PRO A 1 9  ? -10.496 -10.548 -3.668  1.00 0.00 ? 300 PRO A CA   14 
ATOM 11170 C C    . PRO A 1 9  ? -11.474 -9.379  -3.601  1.00 0.00 ? 300 PRO A C    14 
ATOM 11171 O O    . PRO A 1 9  ? -11.109 -8.239  -3.887  1.00 0.00 ? 300 PRO A O    14 
ATOM 11172 C CB   . PRO A 1 9  ? -10.182 -11.063 -2.259  1.00 0.00 ? 300 PRO A CB   14 
ATOM 11173 C CG   . PRO A 1 9  ? -8.730  -11.393 -2.283  1.00 0.00 ? 300 PRO A CG   14 
ATOM 11174 C CD   . PRO A 1 9  ? -8.102  -10.420 -3.237  1.00 0.00 ? 300 PRO A CD   14 
ATOM 11175 H HA   . PRO A 1 9  ? -10.927 -11.343 -4.261  1.00 0.00 ? 300 PRO A HA   14 
ATOM 11176 H HB2  . PRO A 1 9  ? -10.399 -10.291 -1.536  1.00 0.00 ? 300 PRO A HB2  14 
ATOM 11177 H HG2  . PRO A 1 9  ? -8.310  -11.274 -1.295  1.00 0.00 ? 300 PRO A HG2  14 
ATOM 11178 H HD2  . PRO A 1 9  ? -7.800  -9.521  -2.718  1.00 0.00 ? 300 PRO A HD2  14 
ATOM 11179 N N    . PRO A 1 10 ? -12.734 -9.647  -3.223  1.00 0.00 ? 301 PRO A N    14 
ATOM 11180 C CA   . PRO A 1 10 ? -13.762 -8.608  -3.121  1.00 0.00 ? 301 PRO A CA   14 
ATOM 11181 C C    . PRO A 1 10 ? -13.573 -7.710  -1.901  1.00 0.00 ? 301 PRO A C    14 
ATOM 11182 O O    . PRO A 1 10 ? -14.472 -7.579  -1.071  1.00 0.00 ? 301 PRO A O    14 
ATOM 11183 C CB   . PRO A 1 10 ? -15.059 -9.409  -2.999  1.00 0.00 ? 301 PRO A CB   14 
ATOM 11184 C CG   . PRO A 1 10 ? -14.649 -10.699 -2.374  1.00 0.00 ? 301 PRO A CG   14 
ATOM 11185 C CD   . PRO A 1 10 ? -13.257 -10.982 -2.875  1.00 0.00 ? 301 PRO A CD   14 
ATOM 11186 H HA   . PRO A 1 10 ? -13.794 -7.998  -4.010  1.00 0.00 ? 301 PRO A HA   14 
ATOM 11187 H HB2  . PRO A 1 10 ? -15.760 -8.872  -2.376  1.00 0.00 ? 301 PRO A HB2  14 
ATOM 11188 H HG2  . PRO A 1 10 ? -14.648 -10.601 -1.299  1.00 0.00 ? 301 PRO A HG2  14 
ATOM 11189 H HD2  . PRO A 1 10 ? -12.664 -11.438 -2.096  1.00 0.00 ? 301 PRO A HD2  14 
ATOM 11190 N N    . GLY A 1 11 ? -12.399 -7.093  -1.797  1.00 0.00 ? 302 GLY A N    14 
ATOM 11191 C CA   . GLY A 1 11 ? -12.123 -6.212  -0.679  1.00 0.00 ? 302 GLY A CA   14 
ATOM 11192 C C    . GLY A 1 11 ? -10.750 -5.574  -0.755  1.00 0.00 ? 302 GLY A C    14 
ATOM 11193 O O    . GLY A 1 11 ? -10.563 -4.436  -0.323  1.00 0.00 ? 302 GLY A O    14 
ATOM 11194 H H    . GLY A 1 11 ? -11.714 -7.242  -2.480  1.00 0.00 ? 302 GLY A H    14 
ATOM 11195 H HA2  . GLY A 1 11 ? -12.869 -5.430  -0.660  1.00 0.00 ? 302 GLY A HA2  14 
ATOM 11196 H HA3  . GLY A 1 11 ? -12.193 -6.779  0.237   1.00 0.00 ? 302 GLY A HA3  14 
ATOM 11197 N N    . TRP A 1 12 ? -9.784  -6.305  -1.305  1.00 0.00 ? 303 TRP A N    14 
ATOM 11198 C CA   . TRP A 1 12 ? -8.422  -5.800  -1.427  1.00 0.00 ? 303 TRP A CA   14 
ATOM 11199 C C    . TRP A 1 12 ? -8.231  -4.989  -2.698  1.00 0.00 ? 303 TRP A C    14 
ATOM 11200 O O    . TRP A 1 12 ? -9.053  -5.029  -3.613  1.00 0.00 ? 303 TRP A O    14 
ATOM 11201 C CB   . TRP A 1 12 ? -7.424  -6.957  -1.415  1.00 0.00 ? 303 TRP A CB   14 
ATOM 11202 C CG   . TRP A 1 12 ? -7.450  -7.737  -0.144  1.00 0.00 ? 303 TRP A CG   14 
ATOM 11203 C CD1  . TRP A 1 12 ? -8.280  -8.773  0.157   1.00 0.00 ? 303 TRP A CD1  14 
ATOM 11204 C CD2  . TRP A 1 12 ? -6.611  -7.543  0.998   1.00 0.00 ? 303 TRP A CD2  14 
ATOM 11205 N NE1  . TRP A 1 12 ? -8.019  -9.232  1.423   1.00 0.00 ? 303 TRP A NE1  14 
ATOM 11206 C CE2  . TRP A 1 12 ? -6.993  -8.495  1.960   1.00 0.00 ? 303 TRP A CE2  14 
ATOM 11207 C CE3  . TRP A 1 12 ? -5.575  -6.655  1.298   1.00 0.00 ? 303 TRP A CE3  14 
ATOM 11208 C CZ2  . TRP A 1 12 ? -6.373  -8.584  3.203   1.00 0.00 ? 303 TRP A CZ2  14 
ATOM 11209 C CZ3  . TRP A 1 12 ? -4.961  -6.743  2.532   1.00 0.00 ? 303 TRP A CZ3  14 
ATOM 11210 C CH2  . TRP A 1 12 ? -5.361  -7.702  3.472   1.00 0.00 ? 303 TRP A CH2  14 
ATOM 11211 H H    . TRP A 1 12 ? -9.991  -7.205  -1.631  1.00 0.00 ? 303 TRP A H    14 
ATOM 11212 H HA   . TRP A 1 12 ? -8.228  -5.165  -0.576  1.00 0.00 ? 303 TRP A HA   14 
ATOM 11213 H HB2  . TRP A 1 12 ? -7.654  -7.631  -2.226  1.00 0.00 ? 303 TRP A HB2  14 
ATOM 11214 H HD1  . TRP A 1 12 ? -9.033  -9.160  -0.511  1.00 0.00 ? 303 TRP A HD1  14 
ATOM 11215 H HE1  . TRP A 1 12 ? -8.486  -9.967  1.866   1.00 0.00 ? 303 TRP A HE1  14 
ATOM 11216 H HE3  . TRP A 1 12 ? -5.254  -5.909  0.585   1.00 0.00 ? 303 TRP A HE3  14 
ATOM 11217 H HZ2  . TRP A 1 12 ? -6.670  -9.317  3.939   1.00 0.00 ? 303 TRP A HZ2  14 
ATOM 11218 H HZ3  . TRP A 1 12 ? -4.158  -6.064  2.783   1.00 0.00 ? 303 TRP A HZ3  14 
ATOM 11219 H HH2  . TRP A 1 12 ? -4.855  -7.732  4.423   1.00 0.00 ? 303 TRP A HH2  14 
ATOM 11220 N N    . GLU A 1 13 ? -7.129  -4.253  -2.738  1.00 0.00 ? 304 GLU A N    14 
ATOM 11221 C CA   . GLU A 1 13 ? -6.785  -3.436  -3.889  1.00 0.00 ? 304 GLU A CA   14 
ATOM 11222 C C    . GLU A 1 13 ? -5.289  -3.172  -3.915  1.00 0.00 ? 304 GLU A C    14 
ATOM 11223 O O    . GLU A 1 13 ? -4.610  -3.291  -2.894  1.00 0.00 ? 304 GLU A O    14 
ATOM 11224 C CB   . GLU A 1 13 ? -7.536  -2.107  -3.858  1.00 0.00 ? 304 GLU A CB   14 
ATOM 11225 C CG   . GLU A 1 13 ? -7.850  -1.558  -5.238  1.00 0.00 ? 304 GLU A CG   14 
ATOM 11226 C CD   . GLU A 1 13 ? -9.048  -0.631  -5.239  1.00 0.00 ? 304 GLU A CD   14 
ATOM 11227 O OE1  . GLU A 1 13 ? -8.875  0.564   -4.918  1.00 0.00 ? 304 GLU A OE1  14 
ATOM 11228 O OE2  . GLU A 1 13 ? -10.161 -1.098  -5.561  1.00 0.00 ? 304 GLU A OE2  14 
ATOM 11229 H H    . GLU A 1 13 ? -6.529  -4.257  -1.962  1.00 0.00 ? 304 GLU A H    14 
ATOM 11230 H HA   . GLU A 1 13 ? -7.062  -3.978  -4.779  1.00 0.00 ? 304 GLU A HA   14 
ATOM 11231 H HB2  . GLU A 1 13 ? -8.465  -2.240  -3.322  1.00 0.00 ? 304 GLU A HB2  14 
ATOM 11232 H HG2  . GLU A 1 13 ? -6.990  -1.013  -5.596  1.00 0.00 ? 304 GLU A HG2  14 
ATOM 11233 N N    . ILE A 1 14 ? -4.776  -2.814  -5.081  1.00 0.00 ? 305 ILE A N    14 
ATOM 11234 C CA   . ILE A 1 14 ? -3.361  -2.529  -5.226  1.00 0.00 ? 305 ILE A CA   14 
ATOM 11235 C C    . ILE A 1 14 ? -3.115  -1.030  -5.204  1.00 0.00 ? 305 ILE A C    14 
ATOM 11236 O O    . ILE A 1 14 ? -3.913  -0.246  -5.719  1.00 0.00 ? 305 ILE A O    14 
ATOM 11237 C CB   . ILE A 1 14 ? -2.797  -3.114  -6.534  1.00 0.00 ? 305 ILE A CB   14 
ATOM 11238 C CG1  . ILE A 1 14 ? -2.979  -4.632  -6.550  1.00 0.00 ? 305 ILE A CG1  14 
ATOM 11239 C CG2  . ILE A 1 14 ? -1.327  -2.743  -6.692  1.00 0.00 ? 305 ILE A CG2  14 
ATOM 11240 C CD1  . ILE A 1 14 ? -3.980  -5.112  -7.576  1.00 0.00 ? 305 ILE A CD1  14 
ATOM 11241 H H    . ILE A 1 14 ? -5.362  -2.734  -5.859  1.00 0.00 ? 305 ILE A H    14 
ATOM 11242 H HA   . ILE A 1 14 ? -2.839  -2.987  -4.391  1.00 0.00 ? 305 ILE A HA   14 
ATOM 11243 H HB   . ILE A 1 14 ? -3.342  -2.684  -7.360  1.00 0.00 ? 305 ILE A HB   14 
ATOM 11244 H HG12 . ILE A 1 14 ? -2.036  -5.099  -6.768  1.00 0.00 ? 305 ILE A HG12 14 
ATOM 11245 H HG21 . ILE A 1 14 ? -0.974  -3.073  -7.658  1.00 0.00 ? 305 ILE A HG21 14 
ATOM 11246 H HG22 . ILE A 1 14 ? -1.218  -1.671  -6.615  1.00 0.00 ? 305 ILE A HG22 14 
ATOM 11247 H HG23 . ILE A 1 14 ? -0.749  -3.218  -5.913  1.00 0.00 ? 305 ILE A HG23 14 
ATOM 11248 H HD11 . ILE A 1 14 ? -3.695  -6.095  -7.921  1.00 0.00 ? 305 ILE A HD11 14 
ATOM 11249 H HD12 . ILE A 1 14 ? -4.961  -5.158  -7.128  1.00 0.00 ? 305 ILE A HD12 14 
ATOM 11250 H HD13 . ILE A 1 14 ? -3.996  -4.427  -8.410  1.00 0.00 ? 305 ILE A HD13 14 
ATOM 11251 N N    . ARG A 1 15 ? -2.001  -0.644  -4.610  1.00 0.00 ? 306 ARG A N    14 
ATOM 11252 C CA   . ARG A 1 15 ? -1.633  0.756   -4.507  1.00 0.00 ? 306 ARG A CA   14 
ATOM 11253 C C    . ARG A 1 15 ? -0.146  0.879   -4.220  1.00 0.00 ? 306 ARG A C    14 
ATOM 11254 O O    . ARG A 1 15 ? 0.429   0.021   -3.568  1.00 0.00 ? 306 ARG A O    14 
ATOM 11255 C CB   . ARG A 1 15 ? -2.443  1.420   -3.397  1.00 0.00 ? 306 ARG A CB   14 
ATOM 11256 C CG   . ARG A 1 15 ? -3.882  1.711   -3.787  1.00 0.00 ? 306 ARG A CG   14 
ATOM 11257 C CD   . ARG A 1 15 ? -4.571  2.589   -2.759  1.00 0.00 ? 306 ARG A CD   14 
ATOM 11258 N NE   . ARG A 1 15 ? -5.746  3.261   -3.308  1.00 0.00 ? 306 ARG A NE   14 
ATOM 11259 C CZ   . ARG A 1 15 ? -6.894  2.643   -3.567  1.00 0.00 ? 306 ARG A CZ   14 
ATOM 11260 N NH1  . ARG A 1 15 ? -7.023  1.347   -3.323  1.00 0.00 ? 306 ARG A NH1  14 
ATOM 11261 N NH2  . ARG A 1 15 ? -7.916  3.323   -4.068  1.00 0.00 ? 306 ARG A NH2  14 
ATOM 11262 H H    . ARG A 1 15 ? -1.406  -1.321  -4.226  1.00 0.00 ? 306 ARG A H    14 
ATOM 11263 H HA   . ARG A 1 15 ? -1.856  1.235   -5.448  1.00 0.00 ? 306 ARG A HA   14 
ATOM 11264 H HB2  . ARG A 1 15 ? -2.449  0.767   -2.539  1.00 0.00 ? 306 ARG A HB2  14 
ATOM 11265 H HG2  . ARG A 1 15 ? -3.893  2.216   -4.741  1.00 0.00 ? 306 ARG A HG2  14 
ATOM 11266 H HD2  . ARG A 1 15 ? -4.875  1.976   -1.925  1.00 0.00 ? 306 ARG A HD2  14 
ATOM 11267 H HE   . ARG A 1 15 ? -5.674  4.220   -3.495  1.00 0.00 ? 306 ARG A HE   14 
ATOM 11268 H HH11 . ARG A 1 15 ? -6.255  0.831   -2.943  1.00 0.00 ? 306 ARG A HH11 14 
ATOM 11269 H HH12 . ARG A 1 15 ? -7.888  0.885   -3.517  1.00 0.00 ? 306 ARG A HH12 14 
ATOM 11270 H HH21 . ARG A 1 15 ? -7.824  4.302   -4.251  1.00 0.00 ? 306 ARG A HH21 14 
ATOM 11271 H HH22 . ARG A 1 15 ? -8.779  2.857   -4.263  1.00 0.00 ? 306 ARG A HH22 14 
ATOM 11272 N N    . ASN A 1 16 ? 0.479   1.938   -4.710  1.00 0.00 ? 307 ASN A N    14 
ATOM 11273 C CA   . ASN A 1 16 ? 1.908   2.132   -4.485  1.00 0.00 ? 307 ASN A CA   14 
ATOM 11274 C C    . ASN A 1 16 ? 2.150   3.243   -3.471  1.00 0.00 ? 307 ASN A C    14 
ATOM 11275 O O    . ASN A 1 16 ? 1.317   4.134   -3.299  1.00 0.00 ? 307 ASN A O    14 
ATOM 11276 C CB   . ASN A 1 16 ? 2.640   2.444   -5.796  1.00 0.00 ? 307 ASN A CB   14 
ATOM 11277 C CG   . ASN A 1 16 ? 1.989   1.792   -7.003  1.00 0.00 ? 307 ASN A CG   14 
ATOM 11278 O OD1  . ASN A 1 16 ? 0.980   2.273   -7.516  1.00 0.00 ? 307 ASN A OD1  14 
ATOM 11279 N ND2  . ASN A 1 16 ? 2.569   0.688   -7.463  1.00 0.00 ? 307 ASN A ND2  14 
ATOM 11280 H H    . ASN A 1 16 ? -0.027  2.602   -5.222  1.00 0.00 ? 307 ASN A H    14 
ATOM 11281 H HA   . ASN A 1 16 ? 2.300   1.210   -4.080  1.00 0.00 ? 307 ASN A HA   14 
ATOM 11282 H HB2  . ASN A 1 16 ? 2.652   3.512   -5.949  1.00 0.00 ? 307 ASN A HB2  14 
ATOM 11283 H HD21 . ASN A 1 16 ? 3.371   0.362   -7.003  1.00 0.00 ? 307 ASN A HD21 14 
ATOM 11284 H HD22 . ASN A 1 16 ? 2.171   0.246   -8.241  1.00 0.00 ? 307 ASN A HD22 14 
ATOM 11285 N N    . THR A 1 17 ? 3.294   3.181   -2.799  1.00 0.00 ? 308 THR A N    14 
ATOM 11286 C CA   . THR A 1 17 ? 3.645   4.175   -1.793  1.00 0.00 ? 308 THR A CA   14 
ATOM 11287 C C    . THR A 1 17 ? 4.109   5.476   -2.439  1.00 0.00 ? 308 THR A C    14 
ATOM 11288 O O    . THR A 1 17 ? 3.389   6.474   -2.435  1.00 0.00 ? 308 THR A O    14 
ATOM 11289 C CB   . THR A 1 17 ? 4.748   3.652   -0.853  1.00 0.00 ? 308 THR A CB   14 
ATOM 11290 O OG1  . THR A 1 17 ? 5.875   3.206   -1.617  1.00 0.00 ? 308 THR A OG1  14 
ATOM 11291 C CG2  . THR A 1 17 ? 4.223   2.509   0.003   1.00 0.00 ? 308 THR A CG2  14 
ATOM 11292 H H    . THR A 1 17 ? 3.920   2.451   -2.988  1.00 0.00 ? 308 THR A H    14 
ATOM 11293 H HA   . THR A 1 17 ? 2.763   4.375   -1.201  1.00 0.00 ? 308 THR A HA   14 
ATOM 11294 H HB   . THR A 1 17 ? 5.058   4.457   -0.202  1.00 0.00 ? 308 THR A HB   14 
ATOM 11295 H HG1  . THR A 1 17 ? 5.673   2.358   -2.020  1.00 0.00 ? 308 THR A HG1  14 
ATOM 11296 H HG21 . THR A 1 17 ? 4.477   1.565   -0.457  1.00 0.00 ? 308 THR A HG21 14 
ATOM 11297 H HG22 . THR A 1 17 ? 3.149   2.592   0.084   1.00 0.00 ? 308 THR A HG22 14 
ATOM 11298 H HG23 . THR A 1 17 ? 4.667   2.559   0.988   1.00 0.00 ? 308 THR A HG23 14 
ATOM 11299 N N    . ALA A 1 18 ? 5.314   5.456   -2.995  1.00 0.00 ? 309 ALA A N    14 
ATOM 11300 C CA   . ALA A 1 18 ? 5.875   6.631   -3.646  1.00 0.00 ? 309 ALA A CA   14 
ATOM 11301 C C    . ALA A 1 18 ? 7.305   6.365   -4.100  1.00 0.00 ? 309 ALA A C    14 
ATOM 11302 O O    . ALA A 1 18 ? 8.202   7.180   -3.887  1.00 0.00 ? 309 ALA A O    14 
ATOM 11303 C CB   . ALA A 1 18 ? 5.824   7.827   -2.710  1.00 0.00 ? 309 ALA A CB   14 
ATOM 11304 H H    . ALA A 1 18 ? 5.839   4.629   -2.966  1.00 0.00 ? 309 ALA A H    14 
ATOM 11305 H HA   . ALA A 1 18 ? 5.269   6.855   -4.512  1.00 0.00 ? 309 ALA A HA   14 
ATOM 11306 H HB1  . ALA A 1 18 ? 6.819   8.053   -2.359  1.00 0.00 ? 309 ALA A HB1  14 
ATOM 11307 H HB2  . ALA A 1 18 ? 5.424   8.679   -3.239  1.00 0.00 ? 309 ALA A HB2  14 
ATOM 11308 H HB3  . ALA A 1 18 ? 5.188   7.596   -1.868  1.00 0.00 ? 309 ALA A HB3  14 
ATOM 11309 N N    . THR A 1 19 ? 7.501   5.213   -4.728  1.00 0.00 ? 310 THR A N    14 
ATOM 11310 C CA   . THR A 1 19 ? 8.810   4.812   -5.220  1.00 0.00 ? 310 THR A CA   14 
ATOM 11311 C C    . THR A 1 19 ? 8.694   3.545   -6.057  1.00 0.00 ? 310 THR A C    14 
ATOM 11312 O O    . THR A 1 19 ? 9.349   3.405   -7.090  1.00 0.00 ? 310 THR A O    14 
ATOM 11313 C CB   . THR A 1 19 ? 9.800   4.569   -4.064  1.00 0.00 ? 310 THR A CB   14 
ATOM 11314 O OG1  . THR A 1 19 ? 9.162   4.836   -2.809  1.00 0.00 ? 310 THR A OG1  14 
ATOM 11315 C CG2  . THR A 1 19 ? 11.032  5.452   -4.209  1.00 0.00 ? 310 THR A CG2  14 
ATOM 11316 H H    . THR A 1 19 ? 6.739   4.614   -4.865  1.00 0.00 ? 310 THR A H    14 
ATOM 11317 H HA   . THR A 1 19 ? 9.195   5.610   -5.839  1.00 0.00 ? 310 THR A HA   14 
ATOM 11318 H HB   . THR A 1 19 ? 10.112  3.534   -4.087  1.00 0.00 ? 310 THR A HB   14 
ATOM 11319 H HG1  . THR A 1 19 ? 9.179   5.781   -2.637  1.00 0.00 ? 310 THR A HG1  14 
ATOM 11320 H HG21 . THR A 1 19 ? 11.879  4.966   -3.749  1.00 0.00 ? 310 THR A HG21 14 
ATOM 11321 H HG22 . THR A 1 19 ? 10.853  6.400   -3.725  1.00 0.00 ? 310 THR A HG22 14 
ATOM 11322 H HG23 . THR A 1 19 ? 11.236  5.615   -5.257  1.00 0.00 ? 310 THR A HG23 14 
ATOM 11323 N N    . GLY A 1 20 ? 7.852   2.623   -5.600  1.00 0.00 ? 311 GLY A N    14 
ATOM 11324 C CA   . GLY A 1 20 ? 7.649   1.379   -6.314  1.00 0.00 ? 311 GLY A CA   14 
ATOM 11325 C C    . GLY A 1 20 ? 7.078   0.291   -5.428  1.00 0.00 ? 311 GLY A C    14 
ATOM 11326 O O    . GLY A 1 20 ? 6.288   -0.537  -5.883  1.00 0.00 ? 311 GLY A O    14 
ATOM 11327 H H    . GLY A 1 20 ? 7.367   2.789   -4.765  1.00 0.00 ? 311 GLY A H    14 
ATOM 11328 H HA2  . GLY A 1 20 ? 6.963   1.557   -7.130  1.00 0.00 ? 311 GLY A HA2  14 
ATOM 11329 H HA3  . GLY A 1 20 ? 8.594   1.045   -6.716  1.00 0.00 ? 311 GLY A HA3  14 
ATOM 11330 N N    . ARG A 1 21 ? 7.476   0.291   -4.161  1.00 0.00 ? 312 ARG A N    14 
ATOM 11331 C CA   . ARG A 1 21 ? 6.988   -0.706  -3.215  1.00 0.00 ? 312 ARG A CA   14 
ATOM 11332 C C    . ARG A 1 21 ? 5.477   -0.691  -3.153  1.00 0.00 ? 312 ARG A C    14 
ATOM 11333 O O    . ARG A 1 21 ? 4.870   0.050   -2.378  1.00 0.00 ? 312 ARG A O    14 
ATOM 11334 C CB   . ARG A 1 21 ? 7.579   -0.477  -1.824  1.00 0.00 ? 312 ARG A CB   14 
ATOM 11335 C CG   . ARG A 1 21 ? 8.776   -1.363  -1.521  1.00 0.00 ? 312 ARG A CG   14 
ATOM 11336 C CD   . ARG A 1 21 ? 9.302   -1.126  -0.112  1.00 0.00 ? 312 ARG A CD   14 
ATOM 11337 N NE   . ARG A 1 21 ? 10.363  -2.065  0.241   1.00 0.00 ? 312 ARG A NE   14 
ATOM 11338 C CZ   . ARG A 1 21 ? 11.581  -2.037  -0.291  1.00 0.00 ? 312 ARG A CZ   14 
ATOM 11339 N NH1  . ARG A 1 21 ? 11.892  -1.119  -1.197  1.00 0.00 ? 312 ARG A NH1  14 
ATOM 11340 N NH2  . ARG A 1 21 ? 12.490  -2.927  0.083   1.00 0.00 ? 312 ARG A NH2  14 
ATOM 11341 H H    . ARG A 1 21 ? 8.111   0.972   -3.858  1.00 0.00 ? 312 ARG A H    14 
ATOM 11342 H HA   . ARG A 1 21 ? 7.288   -1.679  -3.574  1.00 0.00 ? 312 ARG A HA   14 
ATOM 11343 H HB2  . ARG A 1 21 ? 7.889   0.554   -1.738  1.00 0.00 ? 312 ARG A HB2  14 
ATOM 11344 H HG2  . ARG A 1 21 ? 8.476   -2.397  -1.611  1.00 0.00 ? 312 ARG A HG2  14 
ATOM 11345 H HD2  . ARG A 1 21 ? 9.689   -0.118  -0.047  1.00 0.00 ? 312 ARG A HD2  14 
ATOM 11346 H HE   . ARG A 1 21 ? 10.156  -2.753  0.907   1.00 0.00 ? 312 ARG A HE   14 
ATOM 11347 H HH11 . ARG A 1 21 ? 11.211  -0.445  -1.480  1.00 0.00 ? 312 ARG A HH11 14 
ATOM 11348 H HH12 . ARG A 1 21 ? 12.809  -1.102  -1.595  1.00 0.00 ? 312 ARG A HH12 14 
ATOM 11349 H HH21 . ARG A 1 21 ? 12.259  -3.621  0.765   1.00 0.00 ? 312 ARG A HH21 14 
ATOM 11350 H HH22 . ARG A 1 21 ? 13.406  -2.905  -0.317  1.00 0.00 ? 312 ARG A HH22 14 
ATOM 11351 N N    . VAL A 1 22 ? 4.884   -1.524  -3.986  1.00 0.00 ? 313 VAL A N    14 
ATOM 11352 C CA   . VAL A 1 22 ? 3.445   -1.643  -4.063  1.00 0.00 ? 313 VAL A CA   14 
ATOM 11353 C C    . VAL A 1 22 ? 2.896   -2.420  -2.864  1.00 0.00 ? 313 VAL A C    14 
ATOM 11354 O O    . VAL A 1 22 ? 3.436   -3.457  -2.477  1.00 0.00 ? 313 VAL A O    14 
ATOM 11355 C CB   . VAL A 1 22 ? 3.031   -2.328  -5.383  1.00 0.00 ? 313 VAL A CB   14 
ATOM 11356 C CG1  . VAL A 1 22 ? 3.871   -3.567  -5.636  1.00 0.00 ? 313 VAL A CG1  14 
ATOM 11357 C CG2  . VAL A 1 22 ? 1.556   -2.672  -5.378  1.00 0.00 ? 313 VAL A CG2  14 
ATOM 11358 H H    . VAL A 1 22 ? 5.440   -2.077  -4.573  1.00 0.00 ? 313 VAL A H    14 
ATOM 11359 H HA   . VAL A 1 22 ? 3.027   -0.646  -4.053  1.00 0.00 ? 313 VAL A HA   14 
ATOM 11360 H HB   . VAL A 1 22 ? 3.209   -1.633  -6.192  1.00 0.00 ? 313 VAL A HB   14 
ATOM 11361 H HG11 . VAL A 1 22 ? 4.359   -3.863  -4.719  1.00 0.00 ? 313 VAL A HG11 14 
ATOM 11362 H HG12 . VAL A 1 22 ? 3.236   -4.369  -5.981  1.00 0.00 ? 313 VAL A HG12 14 
ATOM 11363 H HG13 . VAL A 1 22 ? 4.615   -3.347  -6.386  1.00 0.00 ? 313 VAL A HG13 14 
ATOM 11364 H HG21 . VAL A 1 22 ? 1.404   -3.567  -4.796  1.00 0.00 ? 313 VAL A HG21 14 
ATOM 11365 H HG22 . VAL A 1 22 ? 1.004   -1.856  -4.939  1.00 0.00 ? 313 VAL A HG22 14 
ATOM 11366 H HG23 . VAL A 1 22 ? 1.221   -2.833  -6.390  1.00 0.00 ? 313 VAL A HG23 14 
ATOM 11367 N N    . TYR A 1 23 ? 1.819   -1.900  -2.288  1.00 0.00 ? 314 TYR A N    14 
ATOM 11368 C CA   . TYR A 1 23 ? 1.173   -2.521  -1.140  1.00 0.00 ? 314 TYR A CA   14 
ATOM 11369 C C    . TYR A 1 23 ? -0.265  -2.881  -1.465  1.00 0.00 ? 314 TYR A C    14 
ATOM 11370 O O    . TYR A 1 23 ? -0.762  -2.581  -2.550  1.00 0.00 ? 314 TYR A O    14 
ATOM 11371 C CB   . TYR A 1 23 ? 1.196   -1.586  0.071   1.00 0.00 ? 314 TYR A CB   14 
ATOM 11372 C CG   . TYR A 1 23 ? 0.346   -0.345  -0.078  1.00 0.00 ? 314 TYR A CG   14 
ATOM 11373 C CD1  . TYR A 1 23 ? 0.688   0.651   -0.983  1.00 0.00 ? 314 TYR A CD1  14 
ATOM 11374 C CD2  . TYR A 1 23 ? -0.796  -0.165  0.693   1.00 0.00 ? 314 TYR A CD2  14 
ATOM 11375 C CE1  . TYR A 1 23 ? -0.085  1.786   -1.120  1.00 0.00 ? 314 TYR A CE1  14 
ATOM 11376 C CE2  . TYR A 1 23 ? -1.575  0.971   0.560   1.00 0.00 ? 314 TYR A CE2  14 
ATOM 11377 C CZ   . TYR A 1 23 ? -1.215  1.940   -0.348  1.00 0.00 ? 314 TYR A CZ   14 
ATOM 11378 O OH   . TYR A 1 23 ? -1.985  3.068   -0.478  1.00 0.00 ? 314 TYR A OH   14 
ATOM 11379 H H    . TYR A 1 23 ? 1.440   -1.077  -2.654  1.00 0.00 ? 314 TYR A H    14 
ATOM 11380 H HA   . TYR A 1 23 ? 1.715   -3.423  -0.900  1.00 0.00 ? 314 TYR A HA   14 
ATOM 11381 H HB2  . TYR A 1 23 ? 0.830   -2.126  0.929   1.00 0.00 ? 314 TYR A HB2  14 
ATOM 11382 H HD1  . TYR A 1 23 ? 1.574   0.530   -1.587  1.00 0.00 ? 314 TYR A HD1  14 
ATOM 11383 H HD2  . TYR A 1 23 ? -1.072  -0.926  1.409   1.00 0.00 ? 314 TYR A HD2  14 
ATOM 11384 H HE1  . TYR A 1 23 ? 0.203   2.549   -1.825  1.00 0.00 ? 314 TYR A HE1  14 
ATOM 11385 H HE2  . TYR A 1 23 ? -2.456  1.100   1.169   1.00 0.00 ? 314 TYR A HE2  14 
ATOM 11386 H HH   . TYR A 1 23 ? -2.315  3.330   0.385   1.00 0.00 ? 314 TYR A HH   14 
ATOM 11387 N N    . PHE A 1 24 ? -0.928  -3.527  -0.519  1.00 0.00 ? 315 PHE A N    14 
ATOM 11388 C CA   . PHE A 1 24 ? -2.311  -3.917  -0.702  1.00 0.00 ? 315 PHE A CA   14 
ATOM 11389 C C    . PHE A 1 24 ? -3.198  -3.275  0.352   1.00 0.00 ? 315 PHE A C    14 
ATOM 11390 O O    . PHE A 1 24 ? -2.840  -3.210  1.529   1.00 0.00 ? 315 PHE A O    14 
ATOM 11391 C CB   . PHE A 1 24 ? -2.442  -5.440  -0.658  1.00 0.00 ? 315 PHE A CB   14 
ATOM 11392 C CG   . PHE A 1 24 ? -1.870  -6.119  -1.868  1.00 0.00 ? 315 PHE A CG   14 
ATOM 11393 C CD1  . PHE A 1 24 ? -0.499  -6.239  -2.028  1.00 0.00 ? 315 PHE A CD1  14 
ATOM 11394 C CD2  . PHE A 1 24 ? -2.704  -6.633  -2.844  1.00 0.00 ? 315 PHE A CD2  14 
ATOM 11395 C CE1  . PHE A 1 24 ? 0.030   -6.860  -3.144  1.00 0.00 ? 315 PHE A CE1  14 
ATOM 11396 C CE2  . PHE A 1 24 ? -2.182  -7.256  -3.963  1.00 0.00 ? 315 PHE A CE2  14 
ATOM 11397 C CZ   . PHE A 1 24 ? -0.813  -7.369  -4.113  1.00 0.00 ? 315 PHE A CZ   14 
ATOM 11398 H H    . PHE A 1 24 ? -0.472  -3.759  0.316   1.00 0.00 ? 315 PHE A H    14 
ATOM 11399 H HA   . PHE A 1 24 ? -2.621  -3.559  -1.671  1.00 0.00 ? 315 PHE A HA   14 
ATOM 11400 H HB2  . PHE A 1 24 ? -1.922  -5.813  0.211   1.00 0.00 ? 315 PHE A HB2  14 
ATOM 11401 H HD1  . PHE A 1 24 ? 0.160   -5.842  -1.271  1.00 0.00 ? 315 PHE A HD1  14 
ATOM 11402 H HD2  . PHE A 1 24 ? -3.773  -6.546  -2.723  1.00 0.00 ? 315 PHE A HD2  14 
ATOM 11403 H HE1  . PHE A 1 24 ? 1.100   -6.947  -3.259  1.00 0.00 ? 315 PHE A HE1  14 
ATOM 11404 H HE2  . PHE A 1 24 ? -2.842  -7.653  -4.721  1.00 0.00 ? 315 PHE A HE2  14 
ATOM 11405 H HZ   . PHE A 1 24 ? -0.403  -7.855  -4.986  1.00 0.00 ? 315 PHE A HZ   14 
ATOM 11406 N N    . VAL A 1 25 ? -4.357  -2.803  -0.085  1.00 0.00 ? 316 VAL A N    14 
ATOM 11407 C CA   . VAL A 1 25 ? -5.304  -2.152  0.805   1.00 0.00 ? 316 VAL A CA   14 
ATOM 11408 C C    . VAL A 1 25 ? -6.564  -2.995  0.977   1.00 0.00 ? 316 VAL A C    14 
ATOM 11409 O O    . VAL A 1 25 ? -7.264  -3.288  0.008   1.00 0.00 ? 316 VAL A O    14 
ATOM 11410 C CB   . VAL A 1 25 ? -5.695  -0.757  0.275   1.00 0.00 ? 316 VAL A CB   14 
ATOM 11411 C CG1  . VAL A 1 25 ? -6.306  0.089   1.378   1.00 0.00 ? 316 VAL A CG1  14 
ATOM 11412 C CG2  . VAL A 1 25 ? -4.488  -0.055  -0.332  1.00 0.00 ? 316 VAL A CG2  14 
ATOM 11413 H H    . VAL A 1 25 ? -4.581  -2.893  -1.036  1.00 0.00 ? 316 VAL A H    14 
ATOM 11414 H HA   . VAL A 1 25 ? -4.827  -2.032  1.766   1.00 0.00 ? 316 VAL A HA   14 
ATOM 11415 H HB   . VAL A 1 25 ? -6.435  -0.885  -0.502  1.00 0.00 ? 316 VAL A HB   14 
ATOM 11416 H HG11 . VAL A 1 25 ? -7.369  -0.090  1.421   1.00 0.00 ? 316 VAL A HG11 14 
ATOM 11417 H HG12 . VAL A 1 25 ? -5.857  -0.170  2.325   1.00 0.00 ? 316 VAL A HG12 14 
ATOM 11418 H HG13 . VAL A 1 25 ? -6.125  1.134   1.170   1.00 0.00 ? 316 VAL A HG13 14 
ATOM 11419 H HG21 . VAL A 1 25 ? -3.582  -0.505  0.047   1.00 0.00 ? 316 VAL A HG21 14 
ATOM 11420 H HG22 . VAL A 1 25 ? -4.517  -0.151  -1.407  1.00 0.00 ? 316 VAL A HG22 14 
ATOM 11421 H HG23 . VAL A 1 25 ? -4.509  0.992   -0.064  1.00 0.00 ? 316 VAL A HG23 14 
ATOM 11422 N N    . ASP A 1 26 ? -6.842  -3.384  2.219   1.00 0.00 ? 317 ASP A N    14 
ATOM 11423 C CA   . ASP A 1 26 ? -8.016  -4.195  2.526   1.00 0.00 ? 317 ASP A CA   14 
ATOM 11424 C C    . ASP A 1 26 ? -9.188  -3.319  2.950   1.00 0.00 ? 317 ASP A C    14 
ATOM 11425 O O    . ASP A 1 26 ? -9.096  -2.589  3.929   1.00 0.00 ? 317 ASP A O    14 
ATOM 11426 C CB   . ASP A 1 26 ? -7.697  -5.187  3.644   1.00 0.00 ? 317 ASP A CB   14 
ATOM 11427 C CG   . ASP A 1 26 ? -8.455  -6.490  3.492   1.00 0.00 ? 317 ASP A CG   14 
ATOM 11428 O OD1  . ASP A 1 26 ? -9.111  -6.677  2.444   1.00 0.00 ? 317 ASP A OD1  14 
ATOM 11429 O OD2  . ASP A 1 26 ? -8.394  -7.324  4.419   1.00 0.00 ? 317 ASP A OD2  14 
ATOM 11430 H H    . ASP A 1 26 ? -6.242  -3.120  2.946   1.00 0.00 ? 317 ASP A H    14 
ATOM 11431 H HA   . ASP A 1 26 ? -8.289  -4.743  1.636   1.00 0.00 ? 317 ASP A HA   14 
ATOM 11432 H HB2  . ASP A 1 26 ? -6.641  -5.402  3.637   1.00 0.00 ? 317 ASP A HB2  14 
ATOM 11433 N N    . HIS A 1 27 ? -10.286 -3.396  2.208   1.00 0.00 ? 318 HIS A N    14 
ATOM 11434 C CA   . HIS A 1 27 ? -11.478 -2.613  2.521   1.00 0.00 ? 318 HIS A CA   14 
ATOM 11435 C C    . HIS A 1 27 ? -12.374 -3.364  3.500   1.00 0.00 ? 318 HIS A C    14 
ATOM 11436 O O    . HIS A 1 27 ? -13.180 -2.759  4.206   1.00 0.00 ? 318 HIS A O    14 
ATOM 11437 C CB   . HIS A 1 27 ? -12.241 -2.285  1.238   1.00 0.00 ? 318 HIS A CB   14 
ATOM 11438 C CG   . HIS A 1 27 ? -11.536 -1.281  0.378   1.00 0.00 ? 318 HIS A CG   14 
ATOM 11439 N ND1  . HIS A 1 27 ? -11.532 0.052   0.699   1.00 0.00 ? 318 HIS A ND1  14 
ATOM 11440 C CD2  . HIS A 1 27 ? -10.818 -1.467  -0.757  1.00 0.00 ? 318 HIS A CD2  14 
ATOM 11441 C CE1  . HIS A 1 27 ? -10.816 0.649   -0.236  1.00 0.00 ? 318 HIS A CE1  14 
ATOM 11442 N NE2  . HIS A 1 27 ? -10.364 -0.231  -1.143  1.00 0.00 ? 318 HIS A NE2  14 
ATOM 11443 H H    . HIS A 1 27 ? -10.297 -3.992  1.431   1.00 0.00 ? 318 HIS A H    14 
ATOM 11444 H HA   . HIS A 1 27 ? -11.160 -1.687  2.989   1.00 0.00 ? 318 HIS A HA   14 
ATOM 11445 H HB2  . HIS A 1 27 ? -12.370 -3.188  0.661   1.00 0.00 ? 318 HIS A HB2  14 
ATOM 11446 H HD2  . HIS A 1 27 ? -10.633 -2.403  -1.264  1.00 0.00 ? 318 HIS A HD2  14 
ATOM 11447 H HE1  . HIS A 1 27 ? -10.615 1.708   -0.263  1.00 0.00 ? 318 HIS A HE1  14 
ATOM 11448 H HE2  . HIS A 1 27 ? -9.962  -0.012  -2.009  1.00 0.00 ? 318 HIS A HE2  14 
ATOM 11449 N N    . ASN A 1 28 ? -12.231 -4.688  3.540   1.00 0.00 ? 319 ASN A N    14 
ATOM 11450 C CA   . ASN A 1 28 ? -13.018 -5.508  4.452   1.00 0.00 ? 319 ASN A CA   14 
ATOM 11451 C C    . ASN A 1 28 ? -12.520 -5.318  5.879   1.00 0.00 ? 319 ASN A C    14 
ATOM 11452 O O    . ASN A 1 28 ? -13.292 -5.383  6.836   1.00 0.00 ? 319 ASN A O    14 
ATOM 11453 C CB   . ASN A 1 28 ? -12.930 -6.985  4.061   1.00 0.00 ? 319 ASN A CB   14 
ATOM 11454 C CG   . ASN A 1 28 ? -13.064 -7.203  2.568   1.00 0.00 ? 319 ASN A CG   14 
ATOM 11455 O OD1  . ASN A 1 28 ? -13.667 -6.394  1.861   1.00 0.00 ? 319 ASN A OD1  14 
ATOM 11456 N ND2  . ASN A 1 28 ? -12.501 -8.301  2.080   1.00 0.00 ? 319 ASN A ND2  14 
ATOM 11457 H H    . ASN A 1 28 ? -11.586 -5.121  2.943   1.00 0.00 ? 319 ASN A H    14 
ATOM 11458 H HA   . ASN A 1 28 ? -14.046 -5.185  4.391   1.00 0.00 ? 319 ASN A HA   14 
ATOM 11459 H HB2  . ASN A 1 28 ? -11.974 -7.377  4.377   1.00 0.00 ? 319 ASN A HB2  14 
ATOM 11460 H HD21 . ASN A 1 28 ? -12.038 -8.899  2.703   1.00 0.00 ? 319 ASN A HD21 14 
ATOM 11461 H HD22 . ASN A 1 28 ? -12.574 -8.472  1.117   1.00 0.00 ? 319 ASN A HD22 14 
ATOM 11462 N N    . ASN A 1 29 ? -11.219 -5.081  6.007   1.00 0.00 ? 320 ASN A N    14 
ATOM 11463 C CA   . ASN A 1 29 ? -10.597 -4.867  7.307   1.00 0.00 ? 320 ASN A CA   14 
ATOM 11464 C C    . ASN A 1 29 ? -10.153 -3.416  7.453   1.00 0.00 ? 320 ASN A C    14 
ATOM 11465 O O    . ASN A 1 29 ? -10.041 -2.899  8.564   1.00 0.00 ? 320 ASN A O    14 
ATOM 11466 C CB   . ASN A 1 29 ? -9.399  -5.801  7.491   1.00 0.00 ? 320 ASN A CB   14 
ATOM 11467 C CG   . ASN A 1 29 ? -9.816  -7.247  7.654   1.00 0.00 ? 320 ASN A CG   14 
ATOM 11468 O OD1  . ASN A 1 29 ? -10.340 -7.642  8.696   1.00 0.00 ? 320 ASN A OD1  14 
ATOM 11469 N ND2  . ASN A 1 29 ? -9.584  -8.047  6.622   1.00 0.00 ? 320 ASN A ND2  14 
ATOM 11470 H H    . ASN A 1 29 ? -10.660 -5.047  5.203   1.00 0.00 ? 320 ASN A H    14 
ATOM 11471 H HA   . ASN A 1 29 ? -11.333 -5.084  8.068   1.00 0.00 ? 320 ASN A HA   14 
ATOM 11472 H HB2  . ASN A 1 29 ? -8.755  -5.727  6.627   1.00 0.00 ? 320 ASN A HB2  14 
ATOM 11473 H HD21 . ASN A 1 29 ? -9.164  -7.664  5.824   1.00 0.00 ? 320 ASN A HD21 14 
ATOM 11474 H HD22 . ASN A 1 29 ? -9.842  -8.988  6.699   1.00 0.00 ? 320 ASN A HD22 14 
ATOM 11475 N N    . ARG A 1 30 ? -9.896  -2.764  6.321   1.00 0.00 ? 321 ARG A N    14 
ATOM 11476 C CA   . ARG A 1 30 ? -9.467  -1.371  6.324   1.00 0.00 ? 321 ARG A CA   14 
ATOM 11477 C C    . ARG A 1 30 ? -8.047  -1.247  6.863   1.00 0.00 ? 321 ARG A C    14 
ATOM 11478 O O    . ARG A 1 30 ? -7.785  -0.501  7.806   1.00 0.00 ? 321 ARG A O    14 
ATOM 11479 C CB   . ARG A 1 30 ? -10.445 -0.530  7.144   1.00 0.00 ? 321 ARG A CB   14 
ATOM 11480 C CG   . ARG A 1 30 ? -11.904 -0.854  6.847   1.00 0.00 ? 321 ARG A CG   14 
ATOM 11481 C CD   . ARG A 1 30 ? -12.445 -0.021  5.697   1.00 0.00 ? 321 ARG A CD   14 
ATOM 11482 N NE   . ARG A 1 30 ? -13.807 0.443   5.950   1.00 0.00 ? 321 ARG A NE   14 
ATOM 11483 C CZ   . ARG A 1 30 ? -14.848 -0.370  6.098   1.00 0.00 ? 321 ARG A CZ   14 
ATOM 11484 N NH1  . ARG A 1 30 ? -14.684 -1.683  6.021   1.00 0.00 ? 321 ARG A NH1  14 
ATOM 11485 N NH2  . ARG A 1 30 ? -16.055 0.132   6.325   1.00 0.00 ? 321 ARG A NH2  14 
ATOM 11486 H H    . ARG A 1 30 ? -9.998  -3.230  5.465   1.00 0.00 ? 321 ARG A H    14 
ATOM 11487 H HA   . ARG A 1 30 ? -9.479  -1.015  5.306   1.00 0.00 ? 321 ARG A HA   14 
ATOM 11488 H HB2  . ARG A 1 30 ? -10.264 -0.705  8.195   1.00 0.00 ? 321 ARG A HB2  14 
ATOM 11489 H HG2  . ARG A 1 30 ? -11.984 -1.899  6.587   1.00 0.00 ? 321 ARG A HG2  14 
ATOM 11490 H HD2  . ARG A 1 30 ? -11.805 0.835   5.559   1.00 0.00 ? 321 ARG A HD2  14 
ATOM 11491 H HE   . ARG A 1 30 ? -13.951 1.410   6.011   1.00 0.00 ? 321 ARG A HE   14 
ATOM 11492 H HH11 . ARG A 1 30 ? -13.777 -2.064  5.850   1.00 0.00 ? 321 ARG A HH11 14 
ATOM 11493 H HH12 . ARG A 1 30 ? -15.469 -2.292  6.133   1.00 0.00 ? 321 ARG A HH12 14 
ATOM 11494 H HH21 . ARG A 1 30 ? -16.181 1.122   6.384   1.00 0.00 ? 321 ARG A HH21 14 
ATOM 11495 H HH22 . ARG A 1 30 ? -16.838 -0.480  6.436   1.00 0.00 ? 321 ARG A HH22 14 
ATOM 11496 N N    . THR A 1 31 ? -7.134  -1.995  6.245   1.00 0.00 ? 322 THR A N    14 
ATOM 11497 C CA   . THR A 1 31 ? -5.730  -1.992  6.638   1.00 0.00 ? 322 THR A CA   14 
ATOM 11498 C C    . THR A 1 31 ? -4.825  -2.055  5.413   1.00 0.00 ? 322 THR A C    14 
ATOM 11499 O O    . THR A 1 31 ? -5.265  -1.795  4.294   1.00 0.00 ? 322 THR A O    14 
ATOM 11500 C CB   . THR A 1 31 ? -5.404  -3.175  7.568   1.00 0.00 ? 322 THR A CB   14 
ATOM 11501 O OG1  . THR A 1 31 ? -4.044  -3.096  8.009   1.00 0.00 ? 322 THR A OG1  14 
ATOM 11502 C CG2  . THR A 1 31 ? -5.635  -4.501  6.857   1.00 0.00 ? 322 THR A CG2  14 
ATOM 11503 H H    . THR A 1 31 ? -7.416  -2.567  5.501   1.00 0.00 ? 322 THR A H    14 
ATOM 11504 H HA   . THR A 1 31 ? -5.532  -1.074  7.170   1.00 0.00 ? 322 THR A HA   14 
ATOM 11505 H HB   . THR A 1 31 ? -6.057  -3.128  8.428   1.00 0.00 ? 322 THR A HB   14 
ATOM 11506 H HG1  . THR A 1 31 ? -3.942  -3.585  8.828   1.00 0.00 ? 322 THR A HG1  14 
ATOM 11507 H HG21 . THR A 1 31 ? -6.677  -4.774  6.931   1.00 0.00 ? 322 THR A HG21 14 
ATOM 11508 H HG22 . THR A 1 31 ? -5.029  -5.268  7.318   1.00 0.00 ? 322 THR A HG22 14 
ATOM 11509 H HG23 . THR A 1 31 ? -5.361  -4.404  5.816   1.00 0.00 ? 322 THR A HG23 14 
ATOM 11510 N N    . THR A 1 32 ? -3.560  -2.405  5.627   1.00 0.00 ? 323 THR A N    14 
ATOM 11511 C CA   . THR A 1 32 ? -2.600  -2.490  4.531   1.00 0.00 ? 323 THR A CA   14 
ATOM 11512 C C    . THR A 1 32 ? -1.606  -3.625  4.736   1.00 0.00 ? 323 THR A C    14 
ATOM 11513 O O    . THR A 1 32 ? -1.547  -4.233  5.805   1.00 0.00 ? 323 THR A O    14 
ATOM 11514 C CB   . THR A 1 32 ? -1.812  -1.177  4.370   1.00 0.00 ? 323 THR A CB   14 
ATOM 11515 O OG1  . THR A 1 32 ? -1.385  -0.709  5.655   1.00 0.00 ? 323 THR A OG1  14 
ATOM 11516 C CG2  . THR A 1 32 ? -2.671  -0.113  3.695   1.00 0.00 ? 323 THR A CG2  14 
ATOM 11517 H H    . THR A 1 32 ? -3.268  -2.613  6.538   1.00 0.00 ? 323 THR A H    14 
ATOM 11518 H HA   . THR A 1 32 ? -3.154  -2.664  3.623   1.00 0.00 ? 323 THR A HA   14 
ATOM 11519 H HB   . THR A 1 32 ? -0.934  -1.368  3.753   1.00 0.00 ? 323 THR A HB   14 
ATOM 11520 H HG1  . THR A 1 32 ? -0.427  -0.739  5.705   1.00 0.00 ? 323 THR A HG1  14 
ATOM 11521 H HG21 . THR A 1 32 ? -3.717  -0.307  3.900   1.00 0.00 ? 323 THR A HG21 14 
ATOM 11522 H HG22 . THR A 1 32 ? -2.504  -0.142  2.631   1.00 0.00 ? 323 THR A HG22 14 
ATOM 11523 H HG23 . THR A 1 32 ? -2.405  0.864   4.078   1.00 0.00 ? 323 THR A HG23 14 
ATOM 11524 N N    . GLN A 1 33 ? -0.828  -3.905  3.695   1.00 0.00 ? 324 GLN A N    14 
ATOM 11525 C CA   . GLN A 1 33 ? 0.184   -4.954  3.749   1.00 0.00 ? 324 GLN A CA   14 
ATOM 11526 C C    . GLN A 1 33 ? 0.857   -5.131  2.392   1.00 0.00 ? 324 GLN A C    14 
ATOM 11527 O O    . GLN A 1 33 ? 0.189   -5.235  1.364   1.00 0.00 ? 324 GLN A O    14 
ATOM 11528 C CB   . GLN A 1 33 ? -0.427  -6.283  4.204   1.00 0.00 ? 324 GLN A CB   14 
ATOM 11529 C CG   . GLN A 1 33 ? -1.887  -6.459  3.822   1.00 0.00 ? 324 GLN A CG   14 
ATOM 11530 C CD   . GLN A 1 33 ? -2.318  -7.912  3.851   1.00 0.00 ? 324 GLN A CD   14 
ATOM 11531 O OE1  . GLN A 1 33 ? -2.826  -8.402  4.859   1.00 0.00 ? 324 GLN A OE1  14 
ATOM 11532 N NE2  . GLN A 1 33 ? -2.113  -8.612  2.741   1.00 0.00 ? 324 GLN A NE2  14 
ATOM 11533 H H    . GLN A 1 33 ? -0.941  -3.394  2.865   1.00 0.00 ? 324 GLN A H    14 
ATOM 11534 H HA   . GLN A 1 33 ? 0.932   -4.651  4.466   1.00 0.00 ? 324 GLN A HA   14 
ATOM 11535 H HB2  . GLN A 1 33 ? 0.135   -7.090  3.759   1.00 0.00 ? 324 GLN A HB2  14 
ATOM 11536 H HG2  . GLN A 1 33 ? -2.497  -5.904  4.519   1.00 0.00 ? 324 GLN A HG2  14 
ATOM 11537 H HE21 . GLN A 1 33 ? -1.701  -8.158  1.977   1.00 0.00 ? 324 GLN A HE21 14 
ATOM 11538 H HE22 . GLN A 1 33 ? -2.381  -9.554  2.731   1.00 0.00 ? 324 GLN A HE22 14 
ATOM 11539 N N    . PHE A 1 34 ? 2.186   -5.170  2.400   1.00 0.00 ? 325 PHE A N    14 
ATOM 11540 C CA   . PHE A 1 34 ? 2.956   -5.337  1.173   1.00 0.00 ? 325 PHE A CA   14 
ATOM 11541 C C    . PHE A 1 34 ? 2.724   -6.714  0.563   1.00 0.00 ? 325 PHE A C    14 
ATOM 11542 O O    . PHE A 1 34 ? 3.100   -6.965  -0.582  1.00 0.00 ? 325 PHE A O    14 
ATOM 11543 C CB   . PHE A 1 34 ? 4.451   -5.141  1.454   1.00 0.00 ? 325 PHE A CB   14 
ATOM 11544 C CG   . PHE A 1 34 ? 4.904   -3.697  1.523   1.00 0.00 ? 325 PHE A CG   14 
ATOM 11545 C CD1  . PHE A 1 34 ? 4.041   -2.649  1.221   1.00 0.00 ? 325 PHE A CD1  14 
ATOM 11546 C CD2  . PHE A 1 34 ? 6.209   -3.386  1.880   1.00 0.00 ? 325 PHE A CD2  14 
ATOM 11547 C CE1  . PHE A 1 34 ? 4.467   -1.335  1.270   1.00 0.00 ? 325 PHE A CE1  14 
ATOM 11548 C CE2  . PHE A 1 34 ? 6.637   -2.075  1.934   1.00 0.00 ? 325 PHE A CE2  14 
ATOM 11549 C CZ   . PHE A 1 34 ? 5.765   -1.050  1.626   1.00 0.00 ? 325 PHE A CZ   14 
ATOM 11550 H H    . PHE A 1 34 ? 2.658   -5.100  3.255   1.00 0.00 ? 325 PHE A H    14 
ATOM 11551 H HA   . PHE A 1 34 ? 2.627   -4.594  0.466   1.00 0.00 ? 325 PHE A HA   14 
ATOM 11552 H HB2  . PHE A 1 34 ? 4.690   -5.611  2.395   1.00 0.00 ? 325 PHE A HB2  14 
ATOM 11553 H HD1  . PHE A 1 34 ? 3.027   -2.865  0.951   1.00 0.00 ? 325 PHE A HD1  14 
ATOM 11554 H HD2  . PHE A 1 34 ? 6.893   -4.180  2.128   1.00 0.00 ? 325 PHE A HD2  14 
ATOM 11555 H HE1  . PHE A 1 34 ? 3.780   -0.529  1.037   1.00 0.00 ? 325 PHE A HE1  14 
ATOM 11556 H HE2  . PHE A 1 34 ? 7.654   -1.852  2.215   1.00 0.00 ? 325 PHE A HE2  14 
ATOM 11557 H HZ   . PHE A 1 34 ? 6.102   -0.024  1.664   1.00 0.00 ? 325 PHE A HZ   14 
ATOM 11558 N N    . THR A 1 35 ? 2.105   -7.604  1.329   1.00 0.00 ? 326 THR A N    14 
ATOM 11559 C CA   . THR A 1 35 ? 1.834   -8.948  0.857   1.00 0.00 ? 326 THR A CA   14 
ATOM 11560 C C    . THR A 1 35 ? 0.547   -9.010  0.048   1.00 0.00 ? 326 THR A C    14 
ATOM 11561 O O    . THR A 1 35 ? -0.392  -8.254  0.293   1.00 0.00 ? 326 THR A O    14 
ATOM 11562 C CB   . THR A 1 35 ? 1.728   -9.931  2.029   1.00 0.00 ? 326 THR A CB   14 
ATOM 11563 O OG1  . THR A 1 35 ? 2.344   -9.374  3.197   1.00 0.00 ? 326 THR A OG1  14 
ATOM 11564 C CG2  . THR A 1 35 ? 2.396   -11.240 1.673   1.00 0.00 ? 326 THR A CG2  14 
ATOM 11565 H H    . THR A 1 35 ? 1.830   -7.356  2.234   1.00 0.00 ? 326 THR A H    14 
ATOM 11566 H HA   . THR A 1 35 ? 2.659   -9.256  0.232   1.00 0.00 ? 326 THR A HA   14 
ATOM 11567 H HB   . THR A 1 35 ? 0.684   -10.118 2.233   1.00 0.00 ? 326 THR A HB   14 
ATOM 11568 H HG1  . THR A 1 35 ? 3.158   -8.929  2.949   1.00 0.00 ? 326 THR A HG1  14 
ATOM 11569 H HG21 . THR A 1 35 ? 1.810   -11.743 0.918   1.00 0.00 ? 326 THR A HG21 14 
ATOM 11570 H HG22 . THR A 1 35 ? 2.465   -11.861 2.552   1.00 0.00 ? 326 THR A HG22 14 
ATOM 11571 H HG23 . THR A 1 35 ? 3.386   -11.039 1.290   1.00 0.00 ? 326 THR A HG23 14 
ATOM 11572 N N    . ASP A 1 36 ? 0.512   -9.920  -0.920  1.00 0.00 ? 327 ASP A N    14 
ATOM 11573 C CA   . ASP A 1 36 ? -0.663  -10.092 -1.758  1.00 0.00 ? 327 ASP A CA   14 
ATOM 11574 C C    . ASP A 1 36 ? -1.538  -11.211 -1.197  1.00 0.00 ? 327 ASP A C    14 
ATOM 11575 O O    . ASP A 1 36 ? -1.122  -12.369 -1.172  1.00 0.00 ? 327 ASP A O    14 
ATOM 11576 C CB   . ASP A 1 36 ? -0.253  -10.418 -3.195  1.00 0.00 ? 327 ASP A CB   14 
ATOM 11577 C CG   . ASP A 1 36 ? -1.409  -10.297 -4.168  1.00 0.00 ? 327 ASP A CG   14 
ATOM 11578 O OD1  . ASP A 1 36 ? -2.566  -10.501 -3.743  1.00 0.00 ? 327 ASP A OD1  14 
ATOM 11579 O OD2  . ASP A 1 36 ? -1.159  -9.998  -5.354  1.00 0.00 ? 327 ASP A OD2  14 
ATOM 11580 H H    . ASP A 1 36 ? 1.295   -10.492 -1.070  1.00 0.00 ? 327 ASP A H    14 
ATOM 11581 H HA   . ASP A 1 36 ? -1.212  -9.167  -1.747  1.00 0.00 ? 327 ASP A HA   14 
ATOM 11582 H HB2  . ASP A 1 36 ? 0.525   -9.736  -3.504  1.00 0.00 ? 327 ASP A HB2  14 
ATOM 11583 N N    . PRO A 1 37 ? -2.763  -10.893 -0.741  1.00 0.00 ? 328 PRO A N    14 
ATOM 11584 C CA   . PRO A 1 37 ? -3.670  -11.891 -0.171  1.00 0.00 ? 328 PRO A CA   14 
ATOM 11585 C C    . PRO A 1 37 ? -3.775  -13.125 -1.050  1.00 0.00 ? 328 PRO A C    14 
ATOM 11586 O O    . PRO A 1 37 ? -3.984  -14.235 -0.560  1.00 0.00 ? 328 PRO A O    14 
ATOM 11587 C CB   . PRO A 1 37 ? -5.022  -11.169 -0.092  1.00 0.00 ? 328 PRO A CB   14 
ATOM 11588 C CG   . PRO A 1 37 ? -4.839  -9.898  -0.852  1.00 0.00 ? 328 PRO A CG   14 
ATOM 11589 C CD   . PRO A 1 37 ? -3.380  -9.561  -0.754  1.00 0.00 ? 328 PRO A CD   14 
ATOM 11590 H HA   . PRO A 1 37 ? -3.356  -12.185 0.820   1.00 0.00 ? 328 PRO A HA   14 
ATOM 11591 H HB2  . PRO A 1 37 ? -5.787  -11.787 -0.537  1.00 0.00 ? 328 PRO A HB2  14 
ATOM 11592 H HG2  . PRO A 1 37 ? -5.119  -10.047 -1.885  1.00 0.00 ? 328 PRO A HG2  14 
ATOM 11593 H HD2  . PRO A 1 37 ? -3.073  -8.987  -1.612  1.00 0.00 ? 328 PRO A HD2  14 
ATOM 11594 N N    . ARG A 1 38 ? -3.627  -12.925 -2.353  1.00 0.00 ? 329 ARG A N    14 
ATOM 11595 C CA   . ARG A 1 38 ? -3.697  -14.025 -3.298  1.00 0.00 ? 329 ARG A CA   14 
ATOM 11596 C C    . ARG A 1 38 ? -2.663  -15.092 -2.949  1.00 0.00 ? 329 ARG A C    14 
ATOM 11597 O O    . ARG A 1 38 ? -2.843  -16.271 -3.252  1.00 0.00 ? 329 ARG A O    14 
ATOM 11598 C CB   . ARG A 1 38 ? -3.466  -13.520 -4.723  1.00 0.00 ? 329 ARG A CB   14 
ATOM 11599 C CG   . ARG A 1 38 ? -4.498  -12.502 -5.183  1.00 0.00 ? 329 ARG A CG   14 
ATOM 11600 C CD   . ARG A 1 38 ? -4.326  -12.167 -6.655  1.00 0.00 ? 329 ARG A CD   14 
ATOM 11601 N NE   . ARG A 1 38 ? -3.989  -13.346 -7.446  1.00 0.00 ? 329 ARG A NE   14 
ATOM 11602 C CZ   . ARG A 1 38 ? -4.888  -14.228 -7.872  1.00 0.00 ? 329 ARG A CZ   14 
ATOM 11603 N NH1  . ARG A 1 38 ? -6.172  -14.059 -7.587  1.00 0.00 ? 329 ARG A NH1  14 
ATOM 11604 N NH2  . ARG A 1 38 ? -4.503  -15.279 -8.585  1.00 0.00 ? 329 ARG A NH2  14 
ATOM 11605 H H    . ARG A 1 38 ? -3.469  -12.017 -2.686  1.00 0.00 ? 329 ARG A H    14 
ATOM 11606 H HA   . ARG A 1 38 ? -4.685  -14.454 -3.229  1.00 0.00 ? 329 ARG A HA   14 
ATOM 11607 H HB2  . ARG A 1 38 ? -2.491  -13.060 -4.774  1.00 0.00 ? 329 ARG A HB2  14 
ATOM 11608 H HG2  . ARG A 1 38 ? -5.485  -12.910 -5.029  1.00 0.00 ? 329 ARG A HG2  14 
ATOM 11609 H HD2  . ARG A 1 38 ? -5.250  -11.748 -7.025  1.00 0.00 ? 329 ARG A HD2  14 
ATOM 11610 H HE   . ARG A 1 38 ? -3.045  -13.490 -7.668  1.00 0.00 ? 329 ARG A HE   14 
ATOM 11611 H HH11 . ARG A 1 38 ? -6.465  -13.268 -7.051  1.00 0.00 ? 329 ARG A HH11 14 
ATOM 11612 H HH12 . ARG A 1 38 ? -6.847  -14.723 -7.909  1.00 0.00 ? 329 ARG A HH12 14 
ATOM 11613 H HH21 . ARG A 1 38 ? -3.536  -15.408 -8.803  1.00 0.00 ? 329 ARG A HH21 14 
ATOM 11614 H HH22 . ARG A 1 38 ? -5.181  -15.941 -8.905  1.00 0.00 ? 329 ARG A HH22 14 
ATOM 11615 N N    . LEU A 1 39 ? -1.580  -14.662 -2.307  1.00 0.00 ? 330 LEU A N    14 
ATOM 11616 C CA   . LEU A 1 39 ? -0.511  -15.570 -1.908  1.00 0.00 ? 330 LEU A CA   14 
ATOM 11617 C C    . LEU A 1 39 ? -1.016  -16.596 -0.898  1.00 0.00 ? 330 LEU A C    14 
ATOM 11618 O O    . LEU A 1 39 ? -0.829  -17.800 -1.074  1.00 0.00 ? 330 LEU A O    14 
ATOM 11619 C CB   . LEU A 1 39 ? 0.657   -14.782 -1.313  1.00 0.00 ? 330 LEU A CB   14 
ATOM 11620 C CG   . LEU A 1 39 ? 1.507   -14.019 -2.329  1.00 0.00 ? 330 LEU A CG   14 
ATOM 11621 C CD1  . LEU A 1 39 ? 2.617   -13.251 -1.628  1.00 0.00 ? 330 LEU A CD1  14 
ATOM 11622 C CD2  . LEU A 1 39 ? 2.086   -14.973 -3.362  1.00 0.00 ? 330 LEU A CD2  14 
ATOM 11623 H H    . LEU A 1 39 ? -1.496  -13.709 -2.096  1.00 0.00 ? 330 LEU A H    14 
ATOM 11624 H HA   . LEU A 1 39 ? -0.169  -16.087 -2.792  1.00 0.00 ? 330 LEU A HA   14 
ATOM 11625 H HB2  . LEU A 1 39 ? 0.260   -14.073 -0.600  1.00 0.00 ? 330 LEU A HB2  14 
ATOM 11626 H HG   . LEU A 1 39 ? 0.882   -13.304 -2.846  1.00 0.00 ? 330 LEU A HG   14 
ATOM 11627 H HD11 . LEU A 1 39 ? 3.489   -13.882 -1.539  1.00 0.00 ? 330 LEU A HD11 14 
ATOM 11628 H HD12 . LEU A 1 39 ? 2.866   -12.372 -2.204  1.00 0.00 ? 330 LEU A HD12 14 
ATOM 11629 H HD13 . LEU A 1 39 ? 2.285   -12.955 -0.644  1.00 0.00 ? 330 LEU A HD13 14 
ATOM 11630 H HD21 . LEU A 1 39 ? 2.932   -14.509 -3.847  1.00 0.00 ? 330 LEU A HD21 14 
ATOM 11631 H HD22 . LEU A 1 39 ? 2.405   -15.882 -2.873  1.00 0.00 ? 330 LEU A HD22 14 
ATOM 11632 H HD23 . LEU A 1 39 ? 1.331   -15.207 -4.099  1.00 0.00 ? 330 LEU A HD23 14 
ATOM 11633 N N    . SER A 1 40 ? -1.658  -16.110 0.159   1.00 0.00 ? 331 SER A N    14 
ATOM 11634 C CA   . SER A 1 40 ? -2.191  -16.983 1.198   1.00 0.00 ? 331 SER A CA   14 
ATOM 11635 C C    . SER A 1 40 ? -3.645  -16.639 1.505   1.00 0.00 ? 331 SER A C    14 
ATOM 11636 O O    . SER A 1 40 ? -3.987  -15.475 1.715   1.00 0.00 ? 331 SER A O    14 
ATOM 11637 C CB   . SER A 1 40 ? -1.349  -16.870 2.471   1.00 0.00 ? 331 SER A CB   14 
ATOM 11638 O OG   . SER A 1 40 ? -0.766  -15.584 2.584   1.00 0.00 ? 331 SER A OG   14 
ATOM 11639 H H    . SER A 1 40 ? -1.776  -15.141 0.243   1.00 0.00 ? 331 SER A H    14 
ATOM 11640 H HA   . SER A 1 40 ? -2.143  -17.999 0.835   1.00 0.00 ? 331 SER A HA   14 
ATOM 11641 H HB2  . SER A 1 40 ? -1.978  -17.042 3.332   1.00 0.00 ? 331 SER A HB2  14 
ATOM 11642 H HG   . SER A 1 40 ? -1.376  -14.925 2.241   1.00 0.00 ? 331 SER A HG   14 
ATOM 11643 N N    . ALA A 1 41 ? -4.497  -17.658 1.528   1.00 0.00 ? 332 ALA A N    14 
ATOM 11644 C CA   . ALA A 1 41 ? -5.914  -17.466 1.807   1.00 0.00 ? 332 ALA A CA   14 
ATOM 11645 C C    . ALA A 1 41 ? -6.605  -18.799 2.068   1.00 0.00 ? 332 ALA A C    14 
ATOM 11646 O O    . ALA A 1 41 ? -5.968  -19.852 2.055   1.00 0.00 ? 332 ALA A O    14 
ATOM 11647 C CB   . ALA A 1 41 ? -6.586  -16.738 0.649   1.00 0.00 ? 332 ALA A CB   14 
ATOM 11648 H H    . ALA A 1 41 ? -4.163  -18.563 1.355   1.00 0.00 ? 332 ALA A H    14 
ATOM 11649 H HA   . ALA A 1 41 ? -5.998  -16.848 2.692   1.00 0.00 ? 332 ALA A HA   14 
ATOM 11650 H HB1  . ALA A 1 41 ? -6.404  -17.278 -0.267  1.00 0.00 ? 332 ALA A HB1  14 
ATOM 11651 H HB2  . ALA A 1 41 ? -7.651  -16.682 0.828   1.00 0.00 ? 332 ALA A HB2  14 
ATOM 11652 H HB3  . ALA A 1 41 ? -6.182  -15.740 0.565   1.00 0.00 ? 332 ALA A HB3  14 
ATOM 11653 N N    . ASN A 1 42 ? -7.911  -18.747 2.305   1.00 0.00 ? 333 ASN A N    14 
ATOM 11654 C CA   . ASN A 1 42 ? -8.687  -19.953 2.569   1.00 0.00 ? 333 ASN A CA   14 
ATOM 11655 C C    . ASN A 1 42 ? -8.640  -20.904 1.376   1.00 0.00 ? 333 ASN A C    14 
ATOM 11656 O O    . ASN A 1 42 ? -8.196  -22.057 1.558   1.00 0.00 ? 333 ASN A O    14 
ATOM 11657 C CB   . ASN A 1 42 ? -10.139 -19.591 2.890   1.00 0.00 ? 333 ASN A CB   14 
ATOM 11658 C CG   . ASN A 1 42 ? -10.680 -20.372 4.073   1.00 0.00 ? 333 ASN A CG   14 
ATOM 11659 O OD1  . ASN A 1 42 ? -10.265 -21.502 4.328   1.00 0.00 ? 333 ASN A OD1  14 
ATOM 11660 N ND2  . ASN A 1 42 ? -11.615 -19.770 4.801   1.00 0.00 ? 333 ASN A ND2  14 
ATOM 11661 O OXT  . ASN A 1 42 ? -9.046  -20.487 0.272   1.00 0.00 ? 333 ASN A OXT  14 
ATOM 11662 H H    . ASN A 1 42 ? -8.364  -17.878 2.302   1.00 0.00 ? 333 ASN A H    14 
ATOM 11663 H HA   . ASN A 1 42 ? -8.251  -20.447 3.424   1.00 0.00 ? 333 ASN A HA   14 
ATOM 11664 H HB2  . ASN A 1 42 ? -10.199 -18.538 3.121   1.00 0.00 ? 333 ASN A HB2  14 
ATOM 11665 H HD21 . ASN A 1 42 ? -11.898 -18.870 4.538   1.00 0.00 ? 333 ASN A HD21 14 
ATOM 11666 H HD22 . ASN A 1 42 ? -11.981 -20.252 5.571   1.00 0.00 ? 333 ASN A HD22 14 
ATOM 11667 N N    . GLY B 2 1  ? 16.612  4.563   5.173   1.00 0.00 ? 198 GLY B N    14 
ATOM 11668 C CA   . GLY B 2 1  ? 15.881  5.234   6.284   1.00 0.00 ? 198 GLY B CA   14 
ATOM 11669 C C    . GLY B 2 1  ? 15.178  4.245   7.195   1.00 0.00 ? 198 GLY B C    14 
ATOM 11670 O O    . GLY B 2 1  ? 15.471  4.183   8.389   1.00 0.00 ? 198 GLY B O    14 
ATOM 11671 H H1   . GLY B 2 1  ? 16.591  3.532   5.303   1.00 0.00 ? 198 GLY B H1   14 
ATOM 11672 H H2   . GLY B 2 1  ? 17.603  4.879   5.156   1.00 0.00 ? 198 GLY B H2   14 
ATOM 11673 H H3   . GLY B 2 1  ? 16.170  4.798   4.262   1.00 0.00 ? 198 GLY B H3   14 
ATOM 11674 H HA2  . GLY B 2 1  ? 16.585  5.807   6.869   1.00 0.00 ? 198 GLY B HA2  14 
ATOM 11675 H HA3  . GLY B 2 1  ? 15.147  5.906   5.865   1.00 0.00 ? 198 GLY B HA3  14 
ATOM 11676 N N    . PRO B 2 2  ? 14.237  3.454   6.654   1.00 0.00 ? 199 PRO B N    14 
ATOM 11677 C CA   . PRO B 2 2  ? 13.494  2.463   7.434   1.00 0.00 ? 199 PRO B CA   14 
ATOM 11678 C C    . PRO B 2 2  ? 14.305  1.195   7.678   1.00 0.00 ? 199 PRO B C    14 
ATOM 11679 O O    . PRO B 2 2  ? 13.963  0.122   7.182   1.00 0.00 ? 199 PRO B O    14 
ATOM 11680 C CB   . PRO B 2 2  ? 12.288  2.165   6.548   1.00 0.00 ? 199 PRO B CB   14 
ATOM 11681 C CG   . PRO B 2 2  ? 12.785  2.373   5.158   1.00 0.00 ? 199 PRO B CG   14 
ATOM 11682 C CD   . PRO B 2 2  ? 13.820  3.466   5.238   1.00 0.00 ? 199 PRO B CD   14 
ATOM 11683 H HA   . PRO B 2 2  ? 13.163  2.868   8.378   1.00 0.00 ? 199 PRO B HA   14 
ATOM 11684 H HB2  . PRO B 2 2  ? 11.965  1.147   6.706   1.00 0.00 ? 199 PRO B HB2  14 
ATOM 11685 H HG2  . PRO B 2 2  ? 13.230  1.461   4.789   1.00 0.00 ? 199 PRO B HG2  14 
ATOM 11686 H HD2  . PRO B 2 2  ? 14.656  3.240   4.592   1.00 0.00 ? 199 PRO B HD2  14 
ATOM 11687 N N    . LEU B 2 3  ? 15.379  1.327   8.448   1.00 0.00 ? 200 LEU B N    14 
ATOM 11688 C CA   . LEU B 2 3  ? 16.241  0.191   8.758   1.00 0.00 ? 200 LEU B CA   14 
ATOM 11689 C C    . LEU B 2 3  ? 15.420  -0.994  9.256   1.00 0.00 ? 200 LEU B C    14 
ATOM 11690 O O    . LEU B 2 3  ? 14.999  -1.030  10.412  1.00 0.00 ? 200 LEU B O    14 
ATOM 11691 C CB   . LEU B 2 3  ? 17.278  0.585   9.811   1.00 0.00 ? 200 LEU B CB   14 
ATOM 11692 C CG   . LEU B 2 3  ? 18.521  -0.304  9.858   1.00 0.00 ? 200 LEU B CG   14 
ATOM 11693 C CD1  . LEU B 2 3  ? 18.172  -1.677  10.410  1.00 0.00 ? 200 LEU B CD1  14 
ATOM 11694 C CD2  . LEU B 2 3  ? 19.141  -0.426  8.473   1.00 0.00 ? 200 LEU B CD2  14 
ATOM 11695 H H    . LEU B 2 3  ? 15.600  2.207   8.816   1.00 0.00 ? 200 LEU B H    14 
ATOM 11696 H HA   . LEU B 2 3  ? 16.751  -0.093  7.851   1.00 0.00 ? 200 LEU B HA   14 
ATOM 11697 H HB2  . LEU B 2 3  ? 17.592  1.599   9.614   1.00 0.00 ? 200 LEU B HB2  14 
ATOM 11698 H HG   . LEU B 2 3  ? 19.252  0.144   10.515  1.00 0.00 ? 200 LEU B HG   14 
ATOM 11699 H HD11 . LEU B 2 3  ? 19.062  -2.143  10.806  1.00 0.00 ? 200 LEU B HD11 14 
ATOM 11700 H HD12 . LEU B 2 3  ? 17.440  -1.573  11.198  1.00 0.00 ? 200 LEU B HD12 14 
ATOM 11701 H HD13 . LEU B 2 3  ? 17.766  -2.290  9.619   1.00 0.00 ? 200 LEU B HD13 14 
ATOM 11702 H HD21 . LEU B 2 3  ? 18.667  -1.235  7.937   1.00 0.00 ? 200 LEU B HD21 14 
ATOM 11703 H HD22 . LEU B 2 3  ? 18.998  0.498   7.932   1.00 0.00 ? 200 LEU B HD22 14 
ATOM 11704 H HD23 . LEU B 2 3  ? 20.198  -0.627  8.568   1.00 0.00 ? 200 LEU B HD23 14 
ATOM 11705 N N    . GLY B 2 4  ? 15.198  -1.963  8.374   1.00 0.00 ? 201 GLY B N    14 
ATOM 11706 C CA   . GLY B 2 4  ? 14.429  -3.137  8.740   1.00 0.00 ? 201 GLY B CA   14 
ATOM 11707 C C    . GLY B 2 4  ? 14.279  -4.112  7.589   1.00 0.00 ? 201 GLY B C    14 
ATOM 11708 O O    . GLY B 2 4  ? 14.522  -3.761  6.434   1.00 0.00 ? 201 GLY B O    14 
ATOM 11709 H H    . GLY B 2 4  ? 15.561  -1.881  7.468   1.00 0.00 ? 201 GLY B H    14 
ATOM 11710 H HA2  . GLY B 2 4  ? 14.924  -3.637  9.560   1.00 0.00 ? 201 GLY B HA2  14 
ATOM 11711 H HA3  . GLY B 2 4  ? 13.446  -2.824  9.063   1.00 0.00 ? 201 GLY B HA3  14 
ATOM 11712 N N    . SER B 2 5  ? 13.879  -5.339  7.905   1.00 0.00 ? 202 SER B N    14 
ATOM 11713 C CA   . SER B 2 5  ? 13.697  -6.368  6.887   1.00 0.00 ? 202 SER B CA   14 
ATOM 11714 C C    . SER B 2 5  ? 12.346  -7.057  7.046   1.00 0.00 ? 202 SER B C    14 
ATOM 11715 O O    . SER B 2 5  ? 12.245  -8.106  7.683   1.00 0.00 ? 202 SER B O    14 
ATOM 11716 C CB   . SER B 2 5  ? 14.821  -7.401  6.970   1.00 0.00 ? 202 SER B CB   14 
ATOM 11717 O OG   . SER B 2 5  ? 15.700  -7.289  5.863   1.00 0.00 ? 202 SER B OG   14 
ATOM 11718 H H    . SER B 2 5  ? 13.701  -5.558  8.842   1.00 0.00 ? 202 SER B H    14 
ATOM 11719 H HA   . SER B 2 5  ? 13.731  -5.889  5.920   1.00 0.00 ? 202 SER B HA   14 
ATOM 11720 H HB2  . SER B 2 5  ? 15.386  -7.244  7.877   1.00 0.00 ? 202 SER B HB2  14 
ATOM 11721 H HG   . SER B 2 5  ? 15.873  -8.161  5.502   1.00 0.00 ? 202 SER B HG   14 
ATOM 11722 N N    . GLU B 2 6  ? 11.311  -6.462  6.464   1.00 0.00 ? 203 GLU B N    14 
ATOM 11723 C CA   . GLU B 2 6  ? 9.966   -7.021  6.543   1.00 0.00 ? 203 GLU B CA   14 
ATOM 11724 C C    . GLU B 2 6  ? 9.058   -6.414  5.479   1.00 0.00 ? 203 GLU B C    14 
ATOM 11725 O O