data_2E1F
# 
_entry.id   2E1F 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2E1F         
RCSB  RCSB026105   
WWPDB D_1000026105 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2E1E 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2E1F 
_pdbx_database_status.recvd_initial_deposition_date   2006-10-25 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kitano, K.'    1 
'Yoshihara, N.' 2 
'Hakoshima, T.' 3 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of the HRDC domain of human Werner syndrome protein, WRN' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            282 
_citation.page_first                2717 
_citation.page_last                 2728 
_citation.year                      2007 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17148451 
_citation.pdbx_database_id_DOI      10.1074/jbc.M610142200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kitano, K.'    1 
primary 'Yoshihara, N.' 2 
primary 'Hakoshima, T.' 3 
# 
_cell.entry_id           2E1F 
_cell.length_a           61.664 
_cell.length_b           61.664 
_cell.length_c           136.683 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2E1F 
_symmetry.space_group_name_H-M             'P 62 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                180 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Werner syndrome ATP-dependent helicase' 11399.173 1  3.6.1.- ? 'HRDC domain' ? 
2 non-polymer syn 'CHLORIDE ION'                           35.453    1  ?       ? ?             ? 
3 water       nat water                                    18.015    52 ?       ? ?             ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GIQPVISAQEQETQIVLYGKLVEARQKHANKMDVPPAILATNKILVDMAKMRPTTVENVKRIDGVSEGKAAMLAPLLEVI
KHFCQTNSVQTDLFSSTKPQEEQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GIQPVISAQEQETQIVLYGKLVEARQKHANKMDVPPAILATNKILVDMAKMRPTTVENVKRIDGVSEGKAAMLAPLLEVI
KHFCQTNSVQTDLFSSTKPQEEQ
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ILE n 
1 3   GLN n 
1 4   PRO n 
1 5   VAL n 
1 6   ILE n 
1 7   SER n 
1 8   ALA n 
1 9   GLN n 
1 10  GLU n 
1 11  GLN n 
1 12  GLU n 
1 13  THR n 
1 14  GLN n 
1 15  ILE n 
1 16  VAL n 
1 17  LEU n 
1 18  TYR n 
1 19  GLY n 
1 20  LYS n 
1 21  LEU n 
1 22  VAL n 
1 23  GLU n 
1 24  ALA n 
1 25  ARG n 
1 26  GLN n 
1 27  LYS n 
1 28  HIS n 
1 29  ALA n 
1 30  ASN n 
1 31  LYS n 
1 32  MET n 
1 33  ASP n 
1 34  VAL n 
1 35  PRO n 
1 36  PRO n 
1 37  ALA n 
1 38  ILE n 
1 39  LEU n 
1 40  ALA n 
1 41  THR n 
1 42  ASN n 
1 43  LYS n 
1 44  ILE n 
1 45  LEU n 
1 46  VAL n 
1 47  ASP n 
1 48  MET n 
1 49  ALA n 
1 50  LYS n 
1 51  MET n 
1 52  ARG n 
1 53  PRO n 
1 54  THR n 
1 55  THR n 
1 56  VAL n 
1 57  GLU n 
1 58  ASN n 
1 59  VAL n 
1 60  LYS n 
1 61  ARG n 
1 62  ILE n 
1 63  ASP n 
1 64  GLY n 
1 65  VAL n 
1 66  SER n 
1 67  GLU n 
1 68  GLY n 
1 69  LYS n 
1 70  ALA n 
1 71  ALA n 
1 72  MET n 
1 73  LEU n 
1 74  ALA n 
1 75  PRO n 
1 76  LEU n 
1 77  LEU n 
1 78  GLU n 
1 79  VAL n 
1 80  ILE n 
1 81  LYS n 
1 82  HIS n 
1 83  PHE n 
1 84  CYS n 
1 85  GLN n 
1 86  THR n 
1 87  ASN n 
1 88  SER n 
1 89  VAL n 
1 90  GLN n 
1 91  THR n 
1 92  ASP n 
1 93  LEU n 
1 94  PHE n 
1 95  SER n 
1 96  SER n 
1 97  THR n 
1 98  LYS n 
1 99  PRO n 
1 100 GLN n 
1 101 GLU n 
1 102 GLU n 
1 103 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21-CodonPlus RIL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX-5X-1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    WRN_HUMAN 
_struct_ref.pdbx_db_accession          Q14191 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           1142 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2E1F 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 103 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q14191 
_struct_ref_seq.db_align_beg                  1142 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1242 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1142 
_struct_ref_seq.pdbx_auth_seq_align_end       1242 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2E1F GLY A 1 ? UNP Q14191 ? ? 'EXPRESSION TAG' 1140 1 
1 2E1F ILE A 2 ? UNP Q14191 ? ? 'EXPRESSION TAG' 1141 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'  ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2E1F 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.29 
_exptl_crystal.density_percent_sol   62.60 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pdbx_details    'pH 5.5, VAPOR DIFFUSION, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           90 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   RIGAKU 
_diffrn_detector.pdbx_collection_date   2006-05-20 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL38B1' 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
_diffrn_source.pdbx_synchrotron_beamline   BL38B1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.00 
# 
_reflns.entry_id                     2E1F 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.0 
_reflns.d_resolution_low             20 
_reflns.number_all                   ? 
_reflns.number_obs                   10934 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.07 
_reflns_shell.percent_possible_all   99.6 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2E1F 
_refine.ls_d_res_high                            2.0 
_refine.ls_d_res_low                             20 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     10934 
_refine.ls_number_reflns_R_free                  530 
_refine.ls_percent_reflns_obs                    99.7 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.248 
_refine.ls_R_factor_R_free                       0.255 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      2E1E 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  'the structure was refined also with REFMAC 5.' 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        724 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             52 
_refine_hist.number_atoms_total               777 
_refine_hist.d_res_high                       2.0 
_refine_hist.d_res_low                        20 
# 
_struct.entry_id                  2E1F 
_struct.title                     'Crystal structure of the HRDC Domain of Human Werner Syndrome Protein, WRN' 
_struct.pdbx_descriptor           'Werner syndrome ATP-dependent helicase (E.C.3.6.1.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2E1F 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HRDC domain, Hydrolase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 7  ? ASP A 33 ? SER A 1146 ASP A 1172 1 ? 27 
HELX_P HELX_P2 2 PRO A 35 ? ALA A 40 ? PRO A 1174 ALA A 1179 1 ? 6  
HELX_P HELX_P3 3 THR A 41 ? ARG A 52 ? THR A 1180 ARG A 1191 1 ? 12 
HELX_P HELX_P4 4 THR A 55 ? LYS A 60 ? THR A 1194 LYS A 1199 1 ? 6  
HELX_P HELX_P5 5 SER A 66 ? LEU A 73 ? SER A 1205 LEU A 1212 1 ? 8  
HELX_P HELX_P6 6 LEU A 73 ? ASN A 87 ? LEU A 1212 ASN A 1226 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE CL A 101' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 ILE A 15 ? ILE A 1154 . ? 1_555  ? 
2 AC1 4 ILE A 15 ? ILE A 1154 . ? 12_555 ? 
3 AC1 4 GLY A 19 ? GLY A 1158 . ? 12_555 ? 
4 AC1 4 GLY A 19 ? GLY A 1158 . ? 1_555  ? 
# 
_database_PDB_matrix.entry_id          2E1F 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2E1F 
_atom_sites.fract_transf_matrix[1][1]   0.016217 
_atom_sites.fract_transf_matrix[1][2]   0.009363 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018726 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007316 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N  N   . GLN A 1 3  ? 24.993 29.458 25.753 1.00 41.89 ? 1142 GLN A N   1 
ATOM   2   C  CA  . GLN A 1 3  ? 25.328 28.555 24.604 1.00 41.67 ? 1142 GLN A CA  1 
ATOM   3   C  C   . GLN A 1 3  ? 24.140 27.769 24.041 1.00 41.48 ? 1142 GLN A C   1 
ATOM   4   O  O   . GLN A 1 3  ? 23.956 27.745 22.823 1.00 41.81 ? 1142 GLN A O   1 
ATOM   5   C  CB  . GLN A 1 3  ? 26.497 27.620 24.945 1.00 41.72 ? 1142 GLN A CB  1 
ATOM   6   C  CG  . GLN A 1 3  ? 27.819 28.349 25.174 1.00 42.61 ? 1142 GLN A CG  1 
ATOM   7   C  CD  . GLN A 1 3  ? 29.038 27.452 25.021 1.00 43.18 ? 1142 GLN A CD  1 
ATOM   8   O  OE1 . GLN A 1 3  ? 28.991 26.424 24.341 1.00 43.64 ? 1142 GLN A OE1 1 
ATOM   9   N  NE2 . GLN A 1 3  ? 30.143 27.849 25.648 1.00 43.33 ? 1142 GLN A NE2 1 
ATOM   10  N  N   . PRO A 1 4  ? 23.337 27.104 24.905 1.00 41.13 ? 1143 PRO A N   1 
ATOM   11  C  CA  . PRO A 1 4  ? 22.235 26.330 24.327 1.00 40.51 ? 1143 PRO A CA  1 
ATOM   12  C  C   . PRO A 1 4  ? 21.146 27.247 23.783 1.00 39.98 ? 1143 PRO A C   1 
ATOM   13  O  O   . PRO A 1 4  ? 20.825 28.267 24.409 1.00 39.97 ? 1143 PRO A O   1 
ATOM   14  C  CB  . PRO A 1 4  ? 21.700 25.519 25.516 1.00 40.71 ? 1143 PRO A CB  1 
ATOM   15  C  CG  . PRO A 1 4  ? 22.705 25.684 26.608 1.00 40.77 ? 1143 PRO A CG  1 
ATOM   16  C  CD  . PRO A 1 4  ? 23.347 27.001 26.375 1.00 41.13 ? 1143 PRO A CD  1 
ATOM   17  N  N   . VAL A 1 5  ? 20.600 26.904 22.619 1.00 39.28 ? 1144 VAL A N   1 
ATOM   18  C  CA  . VAL A 1 5  ? 19.530 27.716 22.038 1.00 38.34 ? 1144 VAL A CA  1 
ATOM   19  C  C   . VAL A 1 5  ? 18.166 27.158 22.438 1.00 37.43 ? 1144 VAL A C   1 
ATOM   20  O  O   . VAL A 1 5  ? 17.225 27.913 22.643 1.00 37.08 ? 1144 VAL A O   1 
ATOM   21  C  CB  . VAL A 1 5  ? 19.658 27.928 20.484 1.00 38.08 ? 1144 VAL A CB  1 
ATOM   22  C  CG1 . VAL A 1 5  ? 21.073 28.341 20.102 1.00 38.04 ? 1144 VAL A CG1 1 
ATOM   23  C  CG2 . VAL A 1 5  ? 19.243 26.711 19.720 1.00 38.59 ? 1144 VAL A CG2 1 
ATOM   24  N  N   . ILE A 1 6  ? 18.075 25.840 22.576 1.00 36.69 ? 1145 ILE A N   1 
ATOM   25  C  CA  . ILE A 1 6  ? 16.812 25.207 22.960 1.00 36.34 ? 1145 ILE A CA  1 
ATOM   26  C  C   . ILE A 1 6  ? 16.677 25.026 24.473 1.00 36.01 ? 1145 ILE A C   1 
ATOM   27  O  O   . ILE A 1 6  ? 17.671 25.011 25.200 1.00 35.65 ? 1145 ILE A O   1 
ATOM   28  C  CB  . ILE A 1 6  ? 16.550 23.868 22.214 1.00 36.47 ? 1145 ILE A CB  1 
ATOM   29  C  CG1 . ILE A 1 6  ? 17.583 22.794 22.602 1.00 36.33 ? 1145 ILE A CG1 1 
ATOM   30  C  CG2 . ILE A 1 6  ? 16.465 24.113 20.697 1.00 37.00 ? 1145 ILE A CG2 1 
ATOM   31  C  CD1 . ILE A 1 6  ? 17.327 21.424 21.978 1.00 36.86 ? 1145 ILE A CD1 1 
ATOM   32  N  N   . SER A 1 7  ? 15.434 24.915 24.932 1.00 35.69 ? 1146 SER A N   1 
ATOM   33  C  CA  . SER A 1 7  ? 15.147 24.765 26.351 1.00 35.70 ? 1146 SER A CA  1 
ATOM   34  C  C   . SER A 1 7  ? 15.348 23.309 26.742 1.00 35.65 ? 1146 SER A C   1 
ATOM   35  O  O   . SER A 1 7  ? 15.409 22.433 25.881 1.00 34.32 ? 1146 SER A O   1 
ATOM   36  C  CB  . SER A 1 7  ? 13.710 25.188 26.650 1.00 35.71 ? 1146 SER A CB  1 
ATOM   37  O  OG  . SER A 1 7  ? 12.809 24.279 26.048 1.00 35.70 ? 1146 SER A OG  1 
ATOM   38  N  N   . ALA A 1 8  ? 15.457 23.063 28.045 1.00 36.06 ? 1147 ALA A N   1 
ATOM   39  C  CA  . ALA A 1 8  ? 15.554 21.706 28.574 1.00 36.65 ? 1147 ALA A CA  1 
ATOM   40  C  C   . ALA A 1 8  ? 14.369 20.843 28.146 1.00 37.19 ? 1147 ALA A C   1 
ATOM   41  O  O   . ALA A 1 8  ? 14.537 19.664 27.793 1.00 37.84 ? 1147 ALA A O   1 
ATOM   42  C  CB  . ALA A 1 8  ? 15.675 21.743 30.115 1.00 36.82 ? 1147 ALA A CB  1 
ATOM   43  N  N   . GLN A 1 9  ? 13.171 21.418 28.172 1.00 37.46 ? 1148 GLN A N   1 
ATOM   44  C  CA  . GLN A 1 9  ? 11.983 20.655 27.799 1.00 38.49 ? 1148 GLN A CA  1 
ATOM   45  C  C   . GLN A 1 9  ? 11.971 20.301 26.312 1.00 37.78 ? 1148 GLN A C   1 
ATOM   46  O  O   . GLN A 1 9  ? 11.604 19.188 25.948 1.00 37.45 ? 1148 GLN A O   1 
ATOM   47  C  CB  . GLN A 1 9  ? 10.690 21.364 28.221 1.00 38.95 ? 1148 GLN A CB  1 
ATOM   48  C  CG  . GLN A 1 9  ? 10.397 21.304 29.742 1.00 42.84 ? 1148 GLN A CG  1 
ATOM   49  C  CD  . GLN A 1 9  ? 10.079 19.890 30.294 1.00 47.76 ? 1148 GLN A CD  1 
ATOM   50  O  OE1 . GLN A 1 9  ? 10.475 18.857 29.729 1.00 49.44 ? 1148 GLN A OE1 1 
ATOM   51  N  NE2 . GLN A 1 9  ? 9.372  19.858 31.428 1.00 49.41 ? 1148 GLN A NE2 1 
ATOM   52  N  N   . GLU A 1 10 ? 12.385 21.247 25.466 1.00 37.61 ? 1149 GLU A N   1 
ATOM   53  C  CA  . GLU A 1 10 ? 12.512 20.999 24.022 1.00 37.30 ? 1149 GLU A CA  1 
ATOM   54  C  C   . GLU A 1 10 ? 13.540 19.900 23.739 1.00 37.51 ? 1149 GLU A C   1 
ATOM   55  O  O   . GLU A 1 10 ? 13.293 19.007 22.938 1.00 36.68 ? 1149 GLU A O   1 
ATOM   56  C  CB  . GLU A 1 10 ? 12.846 22.298 23.269 1.00 37.42 ? 1149 GLU A CB  1 
ATOM   57  C  CG  . GLU A 1 10 ? 13.324 22.127 21.811 1.00 37.54 ? 1149 GLU A CG  1 
ATOM   58  C  CD  . GLU A 1 10 ? 12.240 21.660 20.848 1.00 38.12 ? 1149 GLU A CD  1 
ATOM   59  O  OE1 . GLU A 1 10 ? 12.599 21.118 19.772 1.00 38.30 ? 1149 GLU A OE1 1 
ATOM   60  O  OE2 . GLU A 1 10 ? 11.040 21.841 21.147 1.00 36.36 ? 1149 GLU A OE2 1 
ATOM   61  N  N   . GLN A 1 11 ? 14.684 19.965 24.415 1.00 37.89 ? 1150 GLN A N   1 
ATOM   62  C  CA  . GLN A 1 11 ? 15.708 18.930 24.300 1.00 38.85 ? 1150 GLN A CA  1 
ATOM   63  C  C   . GLN A 1 11 ? 15.165 17.534 24.628 1.00 38.37 ? 1150 GLN A C   1 
ATOM   64  O  O   . GLN A 1 11 ? 15.423 16.580 23.902 1.00 38.13 ? 1150 GLN A O   1 
ATOM   65  C  CB  . GLN A 1 11 ? 16.899 19.275 25.199 1.00 39.33 ? 1150 GLN A CB  1 
ATOM   66  C  CG  . GLN A 1 11 ? 17.759 18.094 25.601 1.00 43.30 ? 1150 GLN A CG  1 
ATOM   67  C  CD  . GLN A 1 11 ? 19.096 18.028 24.888 1.00 48.14 ? 1150 GLN A CD  1 
ATOM   68  O  OE1 . GLN A 1 11 ? 20.155 18.083 25.532 1.00 50.28 ? 1150 GLN A OE1 1 
ATOM   69  N  NE2 . GLN A 1 11 ? 19.063 17.904 23.562 1.00 49.61 ? 1150 GLN A NE2 1 
ATOM   70  N  N   . GLU A 1 12 ? 14.413 17.418 25.721 1.00 38.36 ? 1151 GLU A N   1 
ATOM   71  C  CA  . GLU A 1 12 ? 13.834 16.128 26.102 1.00 38.12 ? 1151 GLU A CA  1 
ATOM   72  C  C   . GLU A 1 12 ? 12.785 15.666 25.088 1.00 38.14 ? 1151 GLU A C   1 
ATOM   73  O  O   . GLU A 1 12 ? 12.758 14.495 24.726 1.00 38.27 ? 1151 GLU A O   1 
ATOM   74  C  CB  . GLU A 1 12 ? 13.240 16.203 27.508 1.00 38.40 ? 1151 GLU A CB  1 
ATOM   75  C  CG  . GLU A 1 12 ? 12.607 14.902 27.992 1.00 37.71 ? 1151 GLU A CG  1 
ATOM   76  C  CD  . GLU A 1 12 ? 12.340 14.937 29.484 1.00 38.76 ? 1151 GLU A CD  1 
ATOM   77  O  OE1 . GLU A 1 12 ? 11.171 15.150 29.862 1.00 38.10 ? 1151 GLU A OE1 1 
ATOM   78  O  OE2 . GLU A 1 12 ? 13.302 14.768 30.267 1.00 37.02 ? 1151 GLU A OE2 1 
ATOM   79  N  N   . THR A 1 13 ? 11.942 16.592 24.628 1.00 38.21 ? 1152 THR A N   1 
ATOM   80  C  CA  . THR A 1 13 ? 10.951 16.305 23.581 1.00 38.54 ? 1152 THR A CA  1 
ATOM   81  C  C   . THR A 1 13 ? 11.631 15.739 22.328 1.00 38.47 ? 1152 THR A C   1 
ATOM   82  O  O   . THR A 1 13 ? 11.166 14.747 21.766 1.00 38.19 ? 1152 THR A O   1 
ATOM   83  C  CB  . THR A 1 13 ? 10.135 17.568 23.224 1.00 38.87 ? 1152 THR A CB  1 
ATOM   84  O  OG1 . THR A 1 13 ? 9.317  17.938 24.341 1.00 38.78 ? 1152 THR A OG1 1 
ATOM   85  C  CG2 . THR A 1 13 ? 9.231  17.344 21.991 1.00 38.77 ? 1152 THR A CG2 1 
ATOM   86  N  N   . GLN A 1 14 ? 12.736 16.356 21.905 1.00 38.51 ? 1153 GLN A N   1 
ATOM   87  C  CA  . GLN A 1 14 ? 13.451 15.891 20.712 1.00 38.62 ? 1153 GLN A CA  1 
ATOM   88  C  C   . GLN A 1 14 ? 14.012 14.491 20.915 1.00 38.93 ? 1153 GLN A C   1 
ATOM   89  O  O   . GLN A 1 14 ? 13.946 13.657 20.006 1.00 39.19 ? 1153 GLN A O   1 
ATOM   90  C  CB  . GLN A 1 14 ? 14.581 16.847 20.334 1.00 38.84 ? 1153 GLN A CB  1 
ATOM   91  C  CG  . GLN A 1 14 ? 14.114 18.189 19.755 1.00 39.35 ? 1153 GLN A CG  1 
ATOM   92  C  CD  . GLN A 1 14 ? 15.266 19.049 19.256 1.00 39.66 ? 1153 GLN A CD  1 
ATOM   93  O  OE1 . GLN A 1 14 ? 16.357 18.548 18.968 1.00 41.00 ? 1153 GLN A OE1 1 
ATOM   94  N  NE2 . GLN A 1 14 ? 15.024 20.354 19.143 1.00 40.08 ? 1153 GLN A NE2 1 
ATOM   95  N  N   . ILE A 1 15 ? 14.572 14.238 22.102 1.00 38.35 ? 1154 ILE A N   1 
ATOM   96  C  CA  . ILE A 1 15 ? 15.105 12.915 22.422 1.00 38.33 ? 1154 ILE A CA  1 
ATOM   97  C  C   . ILE A 1 15 ? 14.007 11.856 22.401 1.00 38.02 ? 1154 ILE A C   1 
ATOM   98  O  O   . ILE A 1 15 ? 14.186 10.798 21.788 1.00 37.76 ? 1154 ILE A O   1 
ATOM   99  C  CB  . ILE A 1 15 ? 15.856 12.885 23.774 1.00 38.49 ? 1154 ILE A CB  1 
ATOM   100 C  CG1 . ILE A 1 15 ? 17.144 13.718 23.698 1.00 38.20 ? 1154 ILE A CG1 1 
ATOM   101 C  CG2 . ILE A 1 15 ? 16.180 11.431 24.179 1.00 39.22 ? 1154 ILE A CG2 1 
ATOM   102 C  CD1 . ILE A 1 15 ? 17.792 13.974 25.084 1.00 38.95 ? 1154 ILE A CD1 1 
ATOM   103 N  N   . VAL A 1 16 ? 12.876 12.145 23.054 1.00 37.26 ? 1155 VAL A N   1 
ATOM   104 C  CA  . VAL A 1 16 ? 11.761 11.186 23.149 1.00 36.52 ? 1155 VAL A CA  1 
ATOM   105 C  C   . VAL A 1 16 ? 11.164 10.899 21.759 1.00 36.60 ? 1155 VAL A C   1 
ATOM   106 O  O   . VAL A 1 16 ? 10.946 9.738  21.391 1.00 35.95 ? 1155 VAL A O   1 
ATOM   107 C  CB  . VAL A 1 16 ? 10.662 11.667 24.155 1.00 36.25 ? 1155 VAL A CB  1 
ATOM   108 C  CG1 . VAL A 1 16 ? 9.443  10.748 24.117 1.00 36.33 ? 1155 VAL A CG1 1 
ATOM   109 C  CG2 . VAL A 1 16 ? 11.227 11.716 25.594 1.00 34.56 ? 1155 VAL A CG2 1 
ATOM   110 N  N   . LEU A 1 17 ? 10.906 11.961 20.999 1.00 36.94 ? 1156 LEU A N   1 
ATOM   111 C  CA  . LEU A 1 17 ? 10.350 11.822 19.655 1.00 37.68 ? 1156 LEU A CA  1 
ATOM   112 C  C   . LEU A 1 17 ? 11.315 11.075 18.739 1.00 37.55 ? 1156 LEU A C   1 
ATOM   113 O  O   . LEU A 1 17 ? 10.893 10.227 17.956 1.00 38.26 ? 1156 LEU A O   1 
ATOM   114 C  CB  . LEU A 1 17 ? 10.009 13.193 19.048 1.00 37.91 ? 1156 LEU A CB  1 
ATOM   115 C  CG  . LEU A 1 17 ? 8.823  13.328 18.060 1.00 40.02 ? 1156 LEU A CG  1 
ATOM   116 C  CD1 . LEU A 1 17 ? 9.100  14.402 17.012 1.00 39.95 ? 1156 LEU A CD1 1 
ATOM   117 C  CD2 . LEU A 1 17 ? 8.337  12.034 17.393 1.00 37.63 ? 1156 LEU A CD2 1 
ATOM   118 N  N   . TYR A 1 18 ? 12.604 11.380 18.835 1.00 37.96 ? 1157 TYR A N   1 
ATOM   119 C  CA  . TYR A 1 18 ? 13.618 10.685 18.025 1.00 37.81 ? 1157 TYR A CA  1 
ATOM   120 C  C   . TYR A 1 18 ? 13.570 9.166  18.208 1.00 37.97 ? 1157 TYR A C   1 
ATOM   121 O  O   . TYR A 1 18 ? 13.623 8.421  17.223 1.00 38.09 ? 1157 TYR A O   1 
ATOM   122 C  CB  . TYR A 1 18 ? 15.019 11.201 18.339 1.00 38.32 ? 1157 TYR A CB  1 
ATOM   123 C  CG  . TYR A 1 18 ? 16.115 10.528 17.550 1.00 38.36 ? 1157 TYR A CG  1 
ATOM   124 C  CD1 . TYR A 1 18 ? 16.419 10.945 16.248 1.00 38.07 ? 1157 TYR A CD1 1 
ATOM   125 C  CD2 . TYR A 1 18 ? 16.850 9.484  18.098 1.00 38.10 ? 1157 TYR A CD2 1 
ATOM   126 C  CE1 . TYR A 1 18 ? 17.435 10.329 15.512 1.00 38.09 ? 1157 TYR A CE1 1 
ATOM   127 C  CE2 . TYR A 1 18 ? 17.880 8.861  17.371 1.00 39.25 ? 1157 TYR A CE2 1 
ATOM   128 C  CZ  . TYR A 1 18 ? 18.159 9.290  16.074 1.00 38.77 ? 1157 TYR A CZ  1 
ATOM   129 O  OH  . TYR A 1 18 ? 19.181 8.683  15.358 1.00 38.19 ? 1157 TYR A OH  1 
ATOM   130 N  N   . GLY A 1 19 ? 13.471 8.710  19.462 1.00 37.47 ? 1158 GLY A N   1 
ATOM   131 C  CA  . GLY A 1 19 ? 13.321 7.279  19.747 1.00 36.51 ? 1158 GLY A CA  1 
ATOM   132 C  C   . GLY A 1 19 ? 12.092 6.634  19.133 1.00 36.42 ? 1158 GLY A C   1 
ATOM   133 O  O   . GLY A 1 19 ? 12.160 5.510  18.633 1.00 36.04 ? 1158 GLY A O   1 
ATOM   134 N  N   . LYS A 1 20 ? 10.959 7.330  19.179 1.00 35.99 ? 1159 LYS A N   1 
ATOM   135 C  CA  . LYS A 1 20 ? 9.745  6.848  18.513 1.00 35.81 ? 1159 LYS A CA  1 
ATOM   136 C  C   . LYS A 1 20 ? 9.933  6.761  16.996 1.00 36.22 ? 1159 LYS A C   1 
ATOM   137 O  O   . LYS A 1 20 ? 9.410  5.842  16.351 1.00 36.15 ? 1159 LYS A O   1 
ATOM   138 C  CB  . LYS A 1 20 ? 8.542  7.730  18.856 1.00 35.61 ? 1159 LYS A CB  1 
ATOM   139 C  CG  . LYS A 1 20 ? 8.148  7.674  20.334 1.00 35.11 ? 1159 LYS A CG  1 
ATOM   140 C  CD  . LYS A 1 20 ? 6.912  8.504  20.611 1.00 34.35 ? 1159 LYS A CD  1 
ATOM   141 C  CE  . LYS A 1 20 ? 6.617  8.561  22.101 1.00 36.48 ? 1159 LYS A CE  1 
ATOM   142 N  NZ  . LYS A 1 20 ? 6.188  7.262  22.674 1.00 35.27 ? 1159 LYS A NZ  1 
ATOM   143 N  N   . LEU A 1 21 ? 10.687 7.702  16.433 1.00 36.39 ? 1160 LEU A N   1 
ATOM   144 C  CA  . LEU A 1 21 ? 10.969 7.687  14.985 1.00 37.13 ? 1160 LEU A CA  1 
ATOM   145 C  C   . LEU A 1 21 ? 11.910 6.546  14.595 1.00 37.24 ? 1160 LEU A C   1 
ATOM   146 O  O   . LEU A 1 21 ? 11.758 5.942  13.531 1.00 37.79 ? 1160 LEU A O   1 
ATOM   147 C  CB  . LEU A 1 21 ? 11.534 9.029  14.521 1.00 36.95 ? 1160 LEU A CB  1 
ATOM   148 C  CG  . LEU A 1 21 ? 10.569 10.224 14.606 1.00 37.73 ? 1160 LEU A CG  1 
ATOM   149 C  CD1 . LEU A 1 21 ? 11.297 11.505 14.229 1.00 37.41 ? 1160 LEU A CD1 1 
ATOM   150 C  CD2 . LEU A 1 21 ? 9.304  10.022 13.739 1.00 37.28 ? 1160 LEU A CD2 1 
ATOM   151 N  N   . VAL A 1 22 ? 12.882 6.257  15.454 1.00 36.79 ? 1161 VAL A N   1 
ATOM   152 C  CA  . VAL A 1 22 ? 13.787 5.121  15.233 1.00 36.98 ? 1161 VAL A CA  1 
ATOM   153 C  C   . VAL A 1 22 ? 12.993 3.819  15.196 1.00 36.96 ? 1161 VAL A C   1 
ATOM   154 O  O   . VAL A 1 22 ? 13.180 2.997  14.296 1.00 36.26 ? 1161 VAL A O   1 
ATOM   155 C  CB  . VAL A 1 22 ? 14.907 5.048  16.318 1.00 37.20 ? 1161 VAL A CB  1 
ATOM   156 C  CG1 . VAL A 1 22 ? 15.601 3.685  16.303 1.00 37.76 ? 1161 VAL A CG1 1 
ATOM   157 C  CG2 . VAL A 1 22 ? 15.925 6.178  16.114 1.00 36.60 ? 1161 VAL A CG2 1 
ATOM   158 N  N   . GLU A 1 23 ? 12.097 3.630  16.168 1.00 37.10 ? 1162 GLU A N   1 
ATOM   159 C  CA  . GLU A 1 23 ? 11.278 2.409  16.195 1.00 37.29 ? 1162 GLU A CA  1 
ATOM   160 C  C   . GLU A 1 23 ? 10.321 2.300  14.997 1.00 37.57 ? 1162 GLU A C   1 
ATOM   161 O  O   . GLU A 1 23 ? 10.124 1.205  14.437 1.00 37.43 ? 1162 GLU A O   1 
ATOM   162 C  CB  . GLU A 1 23 ? 10.522 2.283  17.527 1.00 37.74 ? 1162 GLU A CB  1 
ATOM   163 C  CG  . GLU A 1 23 ? 11.449 1.982  18.700 1.00 37.12 ? 1162 GLU A CG  1 
ATOM   164 C  CD  . GLU A 1 23 ? 10.746 1.316  19.867 1.00 38.81 ? 1162 GLU A CD  1 
ATOM   165 O  OE1 . GLU A 1 23 ? 9.626  1.744  20.229 1.00 38.90 ? 1162 GLU A OE1 1 
ATOM   166 O  OE2 . GLU A 1 23 ? 11.325 0.364  20.429 1.00 38.72 ? 1162 GLU A OE2 1 
ATOM   167 N  N   . ALA A 1 24 ? 9.733  3.428  14.602 1.00 37.66 ? 1163 ALA A N   1 
ATOM   168 C  CA  . ALA A 1 24 ? 8.836  3.456  13.438 1.00 37.97 ? 1163 ALA A CA  1 
ATOM   169 C  C   . ALA A 1 24 ? 9.595  3.159  12.146 1.00 37.88 ? 1163 ALA A C   1 
ATOM   170 O  O   . ALA A 1 24 ? 9.099  2.428  11.283 1.00 38.13 ? 1163 ALA A O   1 
ATOM   171 C  CB  . ALA A 1 24 ? 8.100  4.796  13.350 1.00 38.17 ? 1163 ALA A CB  1 
ATOM   172 N  N   . ARG A 1 25 ? 10.804 3.705  12.028 1.00 37.69 ? 1164 ARG A N   1 
ATOM   173 C  CA  . ARG A 1 25 ? 11.672 3.415  10.889 1.00 38.13 ? 1164 ARG A CA  1 
ATOM   174 C  C   . ARG A 1 25 ? 12.021 1.927  10.818 1.00 38.47 ? 1164 ARG A C   1 
ATOM   175 O  O   . ARG A 1 25 ? 11.950 1.331  9.749  1.00 38.39 ? 1164 ARG A O   1 
ATOM   176 C  CB  . ARG A 1 25 ? 12.940 4.269  10.939 1.00 37.83 ? 1164 ARG A CB  1 
ATOM   177 C  CG  . ARG A 1 25 ? 13.906 4.031  9.784  1.00 37.63 ? 1164 ARG A CG  1 
ATOM   178 C  CD  . ARG A 1 25 ? 15.181 4.825  9.949  1.00 38.34 ? 1164 ARG A CD  1 
ATOM   179 N  NE  . ARG A 1 25 ? 15.918 4.443  11.155 1.00 37.59 ? 1164 ARG A NE  1 
ATOM   180 C  CZ  . ARG A 1 25 ? 17.074 4.985  11.521 1.00 39.22 ? 1164 ARG A CZ  1 
ATOM   181 N  NH1 . ARG A 1 25 ? 17.634 5.928  10.764 1.00 37.89 ? 1164 ARG A NH1 1 
ATOM   182 N  NH2 . ARG A 1 25 ? 17.668 4.597  12.650 1.00 40.32 ? 1164 ARG A NH2 1 
ATOM   183 N  N   . GLN A 1 26 ? 12.383 1.333  11.959 1.00 38.78 ? 1165 GLN A N   1 
ATOM   184 C  CA  . GLN A 1 26 ? 12.714 -0.091 12.003 1.00 39.53 ? 1165 GLN A CA  1 
ATOM   185 C  C   . GLN A 1 26 ? 11.531 -0.963 11.563 1.00 39.65 ? 1165 GLN A C   1 
ATOM   186 O  O   . GLN A 1 26 ? 11.704 -1.874 10.759 1.00 38.95 ? 1165 GLN A O   1 
ATOM   187 C  CB  . GLN A 1 26 ? 13.216 -0.517 13.388 1.00 39.53 ? 1165 GLN A CB  1 
ATOM   188 C  CG  . GLN A 1 26 ? 13.826 -1.945 13.418 1.00 41.44 ? 1165 GLN A CG  1 
ATOM   189 C  CD  . GLN A 1 26 ? 15.141 -2.050 12.658 1.00 44.56 ? 1165 GLN A CD  1 
ATOM   190 O  OE1 . GLN A 1 26 ? 15.251 -2.781 11.661 1.00 46.76 ? 1165 GLN A OE1 1 
ATOM   191 N  NE2 . GLN A 1 26 ? 16.144 -1.306 13.112 1.00 45.57 ? 1165 GLN A NE2 1 
ATOM   192 N  N   . LYS A 1 27 ? 10.344 -0.664 12.089 1.00 40.06 ? 1166 LYS A N   1 
ATOM   193 C  CA  . LYS A 1 27 ? 9.112  -1.386 11.750 1.00 40.98 ? 1166 LYS A CA  1 
ATOM   194 C  C   . LYS A 1 27 ? 8.823  -1.335 10.248 1.00 41.39 ? 1166 LYS A C   1 
ATOM   195 O  O   . LYS A 1 27 ? 8.583  -2.369 9.618  1.00 41.51 ? 1166 LYS A O   1 
ATOM   196 C  CB  . LYS A 1 27 ? 7.934  -0.806 12.547 1.00 40.65 ? 1166 LYS A CB  1 
ATOM   197 C  CG  . LYS A 1 27 ? 6.578  -1.507 12.358 1.00 41.13 ? 1166 LYS A CG  1 
ATOM   198 C  CD  . LYS A 1 27 ? 5.500  -0.831 13.205 1.00 41.46 ? 1166 LYS A CD  1 
ATOM   199 C  CE  . LYS A 1 27 ? 4.126  -1.452 12.987 1.00 43.92 ? 1166 LYS A CE  1 
ATOM   200 N  NZ  . LYS A 1 27 ? 3.139  -0.950 14.000 1.00 45.44 ? 1166 LYS A NZ  1 
ATOM   201 N  N   . HIS A 1 28 ? 8.862  -0.128 9.687  1.00 42.25 ? 1167 HIS A N   1 
ATOM   202 C  CA  . HIS A 1 28 ? 8.549  0.111  8.281  1.00 43.18 ? 1167 HIS A CA  1 
ATOM   203 C  C   . HIS A 1 28 ? 9.612  -0.453 7.328  1.00 43.43 ? 1167 HIS A C   1 
ATOM   204 O  O   . HIS A 1 28 ? 9.285  -0.943 6.236  1.00 43.07 ? 1167 HIS A O   1 
ATOM   205 C  CB  . HIS A 1 28 ? 8.330  1.607  8.037  1.00 43.67 ? 1167 HIS A CB  1 
ATOM   206 C  CG  . HIS A 1 28 ? 7.526  1.907  6.811  1.00 44.97 ? 1167 HIS A CG  1 
ATOM   207 N  ND1 . HIS A 1 28 ? 6.190  1.582  6.699  1.00 46.63 ? 1167 HIS A ND1 1 
ATOM   208 C  CD2 . HIS A 1 28 ? 7.868  2.498  5.641  1.00 46.49 ? 1167 HIS A CD2 1 
ATOM   209 C  CE1 . HIS A 1 28 ? 5.747  1.951  5.509  1.00 46.37 ? 1167 HIS A CE1 1 
ATOM   210 N  NE2 . HIS A 1 28 ? 6.743  2.515  4.850  1.00 45.53 ? 1167 HIS A NE2 1 
ATOM   211 N  N   . ALA A 1 29 ? 10.876 -0.387 7.744  1.00 43.52 ? 1168 ALA A N   1 
ATOM   212 C  CA  . ALA A 1 29 ? 11.970 -0.975 6.975  1.00 44.04 ? 1168 ALA A CA  1 
ATOM   213 C  C   . ALA A 1 29 ? 11.897 -2.505 6.976  1.00 44.65 ? 1168 ALA A C   1 
ATOM   214 O  O   . ALA A 1 29 ? 12.139 -3.141 5.937  1.00 44.13 ? 1168 ALA A O   1 
ATOM   215 C  CB  . ALA A 1 29 ? 13.323 -0.496 7.484  1.00 43.78 ? 1168 ALA A CB  1 
ATOM   216 N  N   . ASN A 1 30 ? 11.555 -3.086 8.129  1.00 45.00 ? 1169 ASN A N   1 
ATOM   217 C  CA  . ASN A 1 30 ? 11.344 -4.536 8.236  1.00 46.05 ? 1169 ASN A CA  1 
ATOM   218 C  C   . ASN A 1 30 ? 10.197 -5.021 7.347  1.00 46.50 ? 1169 ASN A C   1 
ATOM   219 O  O   . ASN A 1 30 ? 10.257 -6.125 6.793  1.00 46.63 ? 1169 ASN A O   1 
ATOM   220 C  CB  . ASN A 1 30 ? 11.096 -4.960 9.692  1.00 46.10 ? 1169 ASN A CB  1 
ATOM   221 C  CG  . ASN A 1 30 ? 12.368 -4.960 10.541 1.00 47.04 ? 1169 ASN A CG  1 
ATOM   222 O  OD1 . ASN A 1 30 ? 12.303 -5.082 11.765 1.00 49.78 ? 1169 ASN A OD1 1 
ATOM   223 N  ND2 . ASN A 1 30 ? 13.526 -4.817 9.900  1.00 47.79 ? 1169 ASN A ND2 1 
ATOM   224 N  N   . LYS A 1 31 ? 9.160  -4.193 7.219  1.00 46.92 ? 1170 LYS A N   1 
ATOM   225 C  CA  . LYS A 1 31 ? 8.022  -4.492 6.349  1.00 47.50 ? 1170 LYS A CA  1 
ATOM   226 C  C   . LYS A 1 31 ? 8.390  -4.435 4.858  1.00 47.49 ? 1170 LYS A C   1 
ATOM   227 O  O   . LYS A 1 31 ? 7.973  -5.296 4.077  1.00 47.88 ? 1170 LYS A O   1 
ATOM   228 C  CB  . LYS A 1 31 ? 6.855  -3.550 6.647  1.00 47.61 ? 1170 LYS A CB  1 
ATOM   229 C  CG  . LYS A 1 31 ? 6.092  -3.902 7.913  1.00 48.86 ? 1170 LYS A CG  1 
ATOM   230 C  CD  . LYS A 1 31 ? 4.886  -2.995 8.117  1.00 50.84 ? 1170 LYS A CD  1 
ATOM   231 C  CE  . LYS A 1 31 ? 4.131  -3.362 9.387  1.00 51.85 ? 1170 LYS A CE  1 
ATOM   232 N  NZ  . LYS A 1 31 ? 2.984  -2.443 9.644  1.00 52.76 ? 1170 LYS A NZ  1 
ATOM   233 N  N   . MET A 1 32 ? 9.162  -3.418 4.480  1.00 47.30 ? 1171 MET A N   1 
ATOM   234 C  CA  . MET A 1 32 ? 9.627  -3.236 3.108  1.00 48.01 ? 1171 MET A CA  1 
ATOM   235 C  C   . MET A 1 32 ? 10.805 -4.158 2.794  1.00 46.86 ? 1171 MET A C   1 
ATOM   236 O  O   . MET A 1 32 ? 11.244 -4.238 1.645  1.00 46.96 ? 1171 MET A O   1 
ATOM   237 C  CB  . MET A 1 32 ? 10.072 -1.787 2.879  1.00 47.62 ? 1171 MET A CB  1 
ATOM   238 C  CG  . MET A 1 32 ? 8.991  -0.727 2.940  1.00 47.95 ? 1171 MET A CG  1 
ATOM   239 S  SD  . MET A 1 32 ? 9.779  0.896  3.131  1.00 51.91 ? 1171 MET A SD  1 
ATOM   240 C  CE  . MET A 1 32 ? 10.264 1.209  1.427  1.00 50.97 ? 1171 MET A CE  1 
ATOM   241 N  N   . ASP A 1 33 ? 11.309 -4.844 3.822  1.00 45.95 ? 1172 ASP A N   1 
ATOM   242 C  CA  . ASP A 1 33 ? 12.548 -5.628 3.749  1.00 44.93 ? 1172 ASP A CA  1 
ATOM   243 C  C   . ASP A 1 33 ? 13.708 -4.800 3.180  1.00 44.27 ? 1172 ASP A C   1 
ATOM   244 O  O   . ASP A 1 33 ? 14.372 -5.203 2.216  1.00 43.40 ? 1172 ASP A O   1 
ATOM   245 C  CB  . ASP A 1 33 ? 12.346 -6.925 2.946  1.00 45.19 ? 1172 ASP A CB  1 
ATOM   246 C  CG  . ASP A 1 33 ? 13.540 -7.872 3.046  1.00 45.56 ? 1172 ASP A CG  1 
ATOM   247 O  OD1 . ASP A 1 33 ? 13.911 -8.479 2.013  1.00 45.48 ? 1172 ASP A OD1 1 
ATOM   248 O  OD2 . ASP A 1 33 ? 14.117 -7.996 4.152  1.00 45.21 ? 1172 ASP A OD2 1 
ATOM   249 N  N   . VAL A 1 34 ? 13.931 -3.626 3.766  1.00 43.12 ? 1173 VAL A N   1 
ATOM   250 C  CA  . VAL A 1 34 ? 15.053 -2.770 3.371  1.00 42.51 ? 1173 VAL A CA  1 
ATOM   251 C  C   . VAL A 1 34 ? 15.830 -2.374 4.627  1.00 41.90 ? 1173 VAL A C   1 
ATOM   252 O  O   . VAL A 1 34 ? 15.269 -2.394 5.723  1.00 41.83 ? 1173 VAL A O   1 
ATOM   253 C  CB  . VAL A 1 34 ? 14.587 -1.503 2.578  1.00 42.53 ? 1173 VAL A CB  1 
ATOM   254 C  CG1 . VAL A 1 34 ? 13.722 -1.891 1.375  1.00 43.39 ? 1173 VAL A CG1 1 
ATOM   255 C  CG2 . VAL A 1 34 ? 13.832 -0.517 3.475  1.00 43.26 ? 1173 VAL A CG2 1 
ATOM   256 N  N   . PRO A 1 35 ? 17.127 -2.048 4.486  1.00 41.41 ? 1174 PRO A N   1 
ATOM   257 C  CA  . PRO A 1 35 ? 17.853 -1.519 5.641  1.00 41.11 ? 1174 PRO A CA  1 
ATOM   258 C  C   . PRO A 1 35 ? 17.243 -0.192 6.118  1.00 40.78 ? 1174 PRO A C   1 
ATOM   259 O  O   . PRO A 1 35 ? 16.835 0.622  5.283  1.00 40.25 ? 1174 PRO A O   1 
ATOM   260 C  CB  . PRO A 1 35 ? 19.272 -1.310 5.101  1.00 41.00 ? 1174 PRO A CB  1 
ATOM   261 C  CG  . PRO A 1 35 ? 19.358 -2.183 3.873  1.00 41.15 ? 1174 PRO A CG  1 
ATOM   262 C  CD  . PRO A 1 35 ? 17.991 -2.172 3.294  1.00 41.38 ? 1174 PRO A CD  1 
ATOM   263 N  N   . PRO A 1 36 ? 17.148 0.016  7.453  1.00 40.67 ? 1175 PRO A N   1 
ATOM   264 C  CA  . PRO A 1 36 ? 16.558 1.248  7.995  1.00 40.39 ? 1175 PRO A CA  1 
ATOM   265 C  C   . PRO A 1 36 ? 17.070 2.531  7.341  1.00 40.15 ? 1175 PRO A C   1 
ATOM   266 O  O   . PRO A 1 36 ? 16.271 3.424  7.045  1.00 39.95 ? 1175 PRO A O   1 
ATOM   267 C  CB  . PRO A 1 36 ? 16.955 1.204  9.475  1.00 40.84 ? 1175 PRO A CB  1 
ATOM   268 C  CG  . PRO A 1 36 ? 17.045 -0.245 9.776  1.00 41.57 ? 1175 PRO A CG  1 
ATOM   269 C  CD  . PRO A 1 36 ? 17.566 -0.905 8.529  1.00 40.64 ? 1175 PRO A CD  1 
ATOM   270 N  N   . ALA A 1 37 ? 18.381 2.615  7.108  1.00 39.70 ? 1176 ALA A N   1 
ATOM   271 C  CA  . ALA A 1 37 ? 19.009 3.820  6.551  1.00 39.94 ? 1176 ALA A CA  1 
ATOM   272 C  C   . ALA A 1 37 ? 18.574 4.141  5.110  1.00 40.38 ? 1176 ALA A C   1 
ATOM   273 O  O   . ALA A 1 37 ? 18.696 5.285  4.659  1.00 40.53 ? 1176 ALA A O   1 
ATOM   274 C  CB  . ALA A 1 37 ? 20.523 3.700  6.626  1.00 40.27 ? 1176 ALA A CB  1 
ATOM   275 N  N   . ILE A 1 38 ? 18.074 3.132  4.398  1.00 40.07 ? 1177 ILE A N   1 
ATOM   276 C  CA  . ILE A 1 38 ? 17.526 3.315  3.046  1.00 40.60 ? 1177 ILE A CA  1 
ATOM   277 C  C   . ILE A 1 38 ? 16.200 4.086  3.102  1.00 40.17 ? 1177 ILE A C   1 
ATOM   278 O  O   . ILE A 1 38 ? 15.895 4.891  2.212  1.00 39.97 ? 1177 ILE A O   1 
ATOM   279 C  CB  . ILE A 1 38 ? 17.377 1.951  2.308  1.00 40.62 ? 1177 ILE A CB  1 
ATOM   280 C  CG1 . ILE A 1 38 ? 18.758 1.388  1.932  1.00 42.36 ? 1177 ILE A CG1 1 
ATOM   281 C  CG2 . ILE A 1 38 ? 16.487 2.064  1.060  1.00 41.64 ? 1177 ILE A CG2 1 
ATOM   282 C  CD1 . ILE A 1 38 ? 19.417 2.019  0.691  1.00 43.47 ? 1177 ILE A CD1 1 
ATOM   283 N  N   . LEU A 1 39 ? 15.427 3.849  4.162  1.00 39.73 ? 1178 LEU A N   1 
ATOM   284 C  CA  . LEU A 1 39 ? 14.203 4.606  4.406  1.00 39.76 ? 1178 LEU A CA  1 
ATOM   285 C  C   . LEU A 1 39 ? 14.486 6.032  4.887  1.00 39.34 ? 1178 LEU A C   1 
ATOM   286 O  O   . LEU A 1 39 ? 13.926 6.988  4.359  1.00 39.31 ? 1178 LEU A O   1 
ATOM   287 C  CB  . LEU A 1 39 ? 13.299 3.867  5.395  1.00 39.71 ? 1178 LEU A CB  1 
ATOM   288 C  CG  . LEU A 1 39 ? 12.014 4.547  5.878  1.00 40.71 ? 1178 LEU A CG  1 
ATOM   289 C  CD1 . LEU A 1 39 ? 11.128 4.978  4.722  1.00 41.99 ? 1178 LEU A CD1 1 
ATOM   290 C  CD2 . LEU A 1 39 ? 11.249 3.613  6.803  1.00 40.74 ? 1178 LEU A CD2 1 
ATOM   291 N  N   . ALA A 1 40 ? 15.338 6.164  5.899  1.00 38.92 ? 1179 ALA A N   1 
ATOM   292 C  CA  . ALA A 1 40 ? 15.747 7.460  6.411  1.00 38.93 ? 1179 ALA A CA  1 
ATOM   293 C  C   . ALA A 1 40 ? 17.037 7.298  7.186  1.00 39.08 ? 1179 ALA A C   1 
ATOM   294 O  O   . ALA A 1 40 ? 17.174 6.403  8.020  1.00 38.50 ? 1179 ALA A O   1 
ATOM   295 C  CB  . ALA A 1 40 ? 14.668 8.049  7.322  1.00 39.00 ? 1179 ALA A CB  1 
ATOM   296 N  N   . THR A 1 41 ? 17.985 8.178  6.920  1.00 38.99 ? 1180 THR A N   1 
ATOM   297 C  CA  . THR A 1 41 ? 19.222 8.186  7.680  1.00 39.27 ? 1180 THR A CA  1 
ATOM   298 C  C   . THR A 1 41 ? 18.971 8.733  9.081  1.00 39.16 ? 1180 THR A C   1 
ATOM   299 O  O   . THR A 1 41 ? 17.936 9.360  9.334  1.00 38.48 ? 1180 THR A O   1 
ATOM   300 C  CB  . THR A 1 41 ? 20.271 9.042  6.990  1.00 39.71 ? 1180 THR A CB  1 
ATOM   301 O  OG1 . THR A 1 41 ? 21.520 8.900  7.680  1.00 44.26 ? 1180 THR A OG1 1 
ATOM   302 C  CG2 . THR A 1 41 ? 19.858 10.482 7.003  1.00 37.67 ? 1180 THR A CG2 1 
ATOM   303 N  N   . ASN A 1 42 ? 19.909 8.496  9.994  1.00 38.88 ? 1181 ASN A N   1 
ATOM   304 C  CA  . ASN A 1 42 ? 19.796 9.065  11.333 1.00 38.85 ? 1181 ASN A CA  1 
ATOM   305 C  C   . ASN A 1 42 ? 19.690 10.591 11.268 1.00 38.92 ? 1181 ASN A C   1 
ATOM   306 O  O   . ASN A 1 42 ? 18.888 11.192 11.979 1.00 38.60 ? 1181 ASN A O   1 
ATOM   307 C  CB  . ASN A 1 42 ? 20.986 8.640  12.198 1.00 39.15 ? 1181 ASN A CB  1 
ATOM   308 C  CG  . ASN A 1 42 ? 20.958 7.158  12.559 1.00 38.61 ? 1181 ASN A CG  1 
ATOM   309 O  OD1 . ASN A 1 42 ? 19.957 6.467  12.352 1.00 36.74 ? 1181 ASN A OD1 1 
ATOM   310 N  ND2 . ASN A 1 42 ? 22.070 6.667  13.107 1.00 39.29 ? 1181 ASN A ND2 1 
ATOM   311 N  N   . LYS A 1 43 ? 20.472 11.199 10.373 1.00 39.00 ? 1182 LYS A N   1 
ATOM   312 C  CA  . LYS A 1 43 ? 20.446 12.653 10.151 1.00 39.26 ? 1182 LYS A CA  1 
ATOM   313 C  C   . LYS A 1 43 ? 19.051 13.175 9.780  1.00 38.73 ? 1182 LYS A C   1 
ATOM   314 O  O   . LYS A 1 43 ? 18.604 14.188 10.311 1.00 38.81 ? 1182 LYS A O   1 
ATOM   315 C  CB  . LYS A 1 43 ? 21.462 13.042 9.077  1.00 39.31 ? 1182 LYS A CB  1 
ATOM   316 C  CG  . LYS A 1 43 ? 21.748 14.535 8.969  1.00 40.18 ? 1182 LYS A CG  1 
ATOM   317 C  CD  . LYS A 1 43 ? 22.835 14.801 7.921  1.00 40.15 ? 1182 LYS A CD  1 
ATOM   318 C  CE  . LYS A 1 43 ? 22.269 14.910 6.507  1.00 41.86 ? 1182 LYS A CE  1 
ATOM   319 N  NZ  . LYS A 1 43 ? 21.730 16.273 6.235  1.00 42.67 ? 1182 LYS A NZ  1 
ATOM   320 N  N   . ILE A 1 44 ? 18.364 12.482 8.878  1.00 38.02 ? 1183 ILE A N   1 
ATOM   321 C  CA  . ILE A 1 44 ? 16.984 12.835 8.534  1.00 37.35 ? 1183 ILE A CA  1 
ATOM   322 C  C   . ILE A 1 44 ? 16.082 12.754 9.781  1.00 37.54 ? 1183 ILE A C   1 
ATOM   323 O  O   . ILE A 1 44 ? 15.304 13.665 10.046 1.00 36.93 ? 1183 ILE A O   1 
ATOM   324 C  CB  . ILE A 1 44 ? 16.462 11.975 7.347  1.00 37.52 ? 1183 ILE A CB  1 
ATOM   325 C  CG1 . ILE A 1 44 ? 17.056 12.502 6.031  1.00 36.67 ? 1183 ILE A CG1 1 
ATOM   326 C  CG2 . ILE A 1 44 ? 14.930 11.983 7.280  1.00 38.06 ? 1183 ILE A CG2 1 
ATOM   327 C  CD1 . ILE A 1 44 ? 17.005 11.519 4.854  1.00 36.88 ? 1183 ILE A CD1 1 
ATOM   328 N  N   . LEU A 1 45 ? 16.215 11.675 10.552 1.00 37.24 ? 1184 LEU A N   1 
ATOM   329 C  CA  . LEU A 1 45 ? 15.421 11.507 11.764 1.00 37.94 ? 1184 LEU A CA  1 
ATOM   330 C  C   . LEU A 1 45 ? 15.659 12.615 12.789 1.00 37.61 ? 1184 LEU A C   1 
ATOM   331 O  O   . LEU A 1 45 ? 14.707 13.104 13.386 1.00 37.36 ? 1184 LEU A O   1 
ATOM   332 C  CB  . LEU A 1 45 ? 15.682 10.136 12.395 1.00 38.19 ? 1184 LEU A CB  1 
ATOM   333 C  CG  . LEU A 1 45 ? 14.647 9.015  12.217 1.00 39.70 ? 1184 LEU A CG  1 
ATOM   334 C  CD1 . LEU A 1 45 ? 13.936 8.992  10.868 1.00 38.10 ? 1184 LEU A CD1 1 
ATOM   335 C  CD2 . LEU A 1 45 ? 15.224 7.651  12.572 1.00 37.74 ? 1184 LEU A CD2 1 
ATOM   336 N  N   . VAL A 1 46 ? 16.920 13.010 12.974 1.00 37.96 ? 1185 VAL A N   1 
ATOM   337 C  CA  . VAL A 1 46 ? 17.271 14.131 13.870 1.00 38.44 ? 1185 VAL A CA  1 
ATOM   338 C  C   . VAL A 1 46 ? 16.556 15.395 13.416 1.00 38.51 ? 1185 VAL A C   1 
ATOM   339 O  O   . VAL A 1 46 ? 15.986 16.126 14.228 1.00 38.30 ? 1185 VAL A O   1 
ATOM   340 C  CB  . VAL A 1 46 ? 18.808 14.375 13.910 1.00 38.79 ? 1185 VAL A CB  1 
ATOM   341 C  CG1 . VAL A 1 46 ? 19.151 15.728 14.553 1.00 39.69 ? 1185 VAL A CG1 1 
ATOM   342 C  CG2 . VAL A 1 46 ? 19.513 13.241 14.646 1.00 38.61 ? 1185 VAL A CG2 1 
ATOM   343 N  N   . ASP A 1 47 ? 16.577 15.644 12.107 1.00 38.28 ? 1186 ASP A N   1 
ATOM   344 C  CA  . ASP A 1 47 ? 15.906 16.804 11.551 1.00 38.44 ? 1186 ASP A CA  1 
ATOM   345 C  C   . ASP A 1 47 ? 14.400 16.728 11.751 1.00 38.16 ? 1186 ASP A C   1 
ATOM   346 O  O   . ASP A 1 47 ? 13.755 17.739 12.006 1.00 38.10 ? 1186 ASP A O   1 
ATOM   347 C  CB  . ASP A 1 47 ? 16.252 16.970 10.064 1.00 38.68 ? 1186 ASP A CB  1 
ATOM   348 C  CG  . ASP A 1 47 ? 17.641 17.553 9.850  1.00 39.41 ? 1186 ASP A CG  1 
ATOM   349 O  OD1 . ASP A 1 47 ? 18.325 17.860 10.854 1.00 41.30 ? 1186 ASP A OD1 1 
ATOM   350 O  OD2 . ASP A 1 47 ? 18.052 17.702 8.680  1.00 39.34 ? 1186 ASP A OD2 1 
ATOM   351 N  N   . MET A 1 48 ? 13.847 15.525 11.631 1.00 38.29 ? 1187 MET A N   1 
ATOM   352 C  CA  . MET A 1 48 ? 12.410 15.323 11.792 1.00 38.67 ? 1187 MET A CA  1 
ATOM   353 C  C   . MET A 1 48 ? 11.979 15.525 13.249 1.00 38.53 ? 1187 MET A C   1 
ATOM   354 O  O   . MET A 1 48 ? 10.885 16.021 13.507 1.00 38.77 ? 1187 MET A O   1 
ATOM   355 C  CB  . MET A 1 48 ? 11.995 13.938 11.283 1.00 38.32 ? 1187 MET A CB  1 
ATOM   356 C  CG  . MET A 1 48 ? 12.045 13.800 9.754  1.00 38.72 ? 1187 MET A CG  1 
ATOM   357 S  SD  . MET A 1 48 ? 11.647 12.144 9.167  1.00 39.58 ? 1187 MET A SD  1 
ATOM   358 C  CE  . MET A 1 48 ? 9.861  12.157 9.294  1.00 37.21 ? 1187 MET A CE  1 
ATOM   359 N  N   . ALA A 1 49 ? 12.843 15.137 14.190 1.00 38.71 ? 1188 ALA A N   1 
ATOM   360 C  CA  . ALA A 1 49 ? 12.577 15.343 15.622 1.00 39.10 ? 1188 ALA A CA  1 
ATOM   361 C  C   . ALA A 1 49 ? 12.658 16.818 16.036 1.00 39.49 ? 1188 ALA A C   1 
ATOM   362 O  O   . ALA A 1 49 ? 12.000 17.239 16.991 1.00 39.56 ? 1188 ALA A O   1 
ATOM   363 C  CB  . ALA A 1 49 ? 13.528 14.500 16.466 1.00 38.74 ? 1188 ALA A CB  1 
ATOM   364 N  N   . LYS A 1 50 ? 13.457 17.591 15.308 1.00 40.31 ? 1189 LYS A N   1 
ATOM   365 C  CA  . LYS A 1 50 ? 13.673 19.011 15.579 1.00 41.39 ? 1189 LYS A CA  1 
ATOM   366 C  C   . LYS A 1 50 ? 12.643 19.894 14.867 1.00 41.66 ? 1189 LYS A C   1 
ATOM   367 O  O   . LYS A 1 50 ? 12.074 20.810 15.467 1.00 41.53 ? 1189 LYS A O   1 
ATOM   368 C  CB  . LYS A 1 50 ? 15.092 19.378 15.139 1.00 41.27 ? 1189 LYS A CB  1 
ATOM   369 C  CG  . LYS A 1 50 ? 15.525 20.808 15.405 1.00 42.53 ? 1189 LYS A CG  1 
ATOM   370 C  CD  . LYS A 1 50 ? 16.814 21.156 14.636 1.00 43.03 ? 1189 LYS A CD  1 
ATOM   371 C  CE  . LYS A 1 50 ? 18.086 20.574 15.283 1.00 45.35 ? 1189 LYS A CE  1 
ATOM   372 N  NZ  . LYS A 1 50 ? 18.140 19.077 15.316 1.00 45.54 ? 1189 LYS A NZ  1 
ATOM   373 N  N   . MET A 1 51 ? 12.406 19.620 13.584 1.00 41.87 ? 1190 MET A N   1 
ATOM   374 C  CA  . MET A 1 51 ? 11.482 20.432 12.790 1.00 42.65 ? 1190 MET A CA  1 
ATOM   375 C  C   . MET A 1 51 ? 10.028 19.961 12.878 1.00 41.45 ? 1190 MET A C   1 
ATOM   376 O  O   . MET A 1 51 ? 9.109  20.751 12.676 1.00 41.42 ? 1190 MET A O   1 
ATOM   377 C  CB  . MET A 1 51 ? 11.961 20.546 11.336 1.00 42.65 ? 1190 MET A CB  1 
ATOM   378 C  CG  . MET A 1 51 ? 13.244 21.361 11.196 1.00 43.44 ? 1190 MET A CG  1 
ATOM   379 S  SD  . MET A 1 51 ? 14.165 21.109 9.659  1.00 46.94 ? 1190 MET A SD  1 
ATOM   380 C  CE  . MET A 1 51 ? 15.788 20.799 10.379 1.00 45.30 ? 1190 MET A CE  1 
ATOM   381 N  N   . ARG A 1 52 ? 9.833  18.685 13.208 1.00 40.86 ? 1191 ARG A N   1 
ATOM   382 C  CA  . ARG A 1 52 ? 8.498  18.089 13.382 1.00 40.36 ? 1191 ARG A CA  1 
ATOM   383 C  C   . ARG A 1 52 ? 7.522  18.361 12.234 1.00 40.00 ? 1191 ARG A C   1 
ATOM   384 O  O   . ARG A 1 52 ? 6.489  18.998 12.442 1.00 39.88 ? 1191 ARG A O   1 
ATOM   385 C  CB  . ARG A 1 52 ? 7.860  18.515 14.710 1.00 40.38 ? 1191 ARG A CB  1 
ATOM   386 C  CG  . ARG A 1 52 ? 8.084  17.542 15.847 1.00 40.52 ? 1191 ARG A CG  1 
ATOM   387 C  CD  . ARG A 1 52 ? 9.078  18.058 16.838 1.00 40.80 ? 1191 ARG A CD  1 
ATOM   388 N  NE  . ARG A 1 52 ? 8.624  19.242 17.576 1.00 39.02 ? 1191 ARG A NE  1 
ATOM   389 C  CZ  . ARG A 1 52 ? 9.384  19.882 18.459 1.00 40.03 ? 1191 ARG A CZ  1 
ATOM   390 N  NH1 . ARG A 1 52 ? 10.608 19.435 18.708 1.00 39.40 ? 1191 ARG A NH1 1 
ATOM   391 N  NH2 . ARG A 1 52 ? 8.928  20.951 19.100 1.00 39.50 ? 1191 ARG A NH2 1 
ATOM   392 N  N   . PRO A 1 53 ? 7.841  17.877 11.021 1.00 39.77 ? 1192 PRO A N   1 
ATOM   393 C  CA  . PRO A 1 53 ? 6.880  18.030 9.927  1.00 39.51 ? 1192 PRO A CA  1 
ATOM   394 C  C   . PRO A 1 53 ? 5.687  17.092 10.118 1.00 39.43 ? 1192 PRO A C   1 
ATOM   395 O  O   . PRO A 1 53 ? 5.865  15.939 10.520 1.00 39.23 ? 1192 PRO A O   1 
ATOM   396 C  CB  . PRO A 1 53 ? 7.692  17.621 8.700  1.00 39.68 ? 1192 PRO A CB  1 
ATOM   397 C  CG  . PRO A 1 53 ? 8.689  16.637 9.235  1.00 39.38 ? 1192 PRO A CG  1 
ATOM   398 C  CD  . PRO A 1 53 ? 9.065  17.178 10.584 1.00 39.64 ? 1192 PRO A CD  1 
ATOM   399 N  N   . THR A 1 54 ? 4.483  17.583 9.840  1.00 39.58 ? 1193 THR A N   1 
ATOM   400 C  CA  . THR A 1 54 ? 3.277  16.758 9.971  1.00 39.82 ? 1193 THR A CA  1 
ATOM   401 C  C   . THR A 1 54 ? 2.584  16.512 8.631  1.00 39.93 ? 1193 THR A C   1 
ATOM   402 O  O   . THR A 1 54 ? 1.652  15.707 8.540  1.00 40.13 ? 1193 THR A O   1 
ATOM   403 C  CB  . THR A 1 54 ? 2.273  17.363 10.967 1.00 39.69 ? 1193 THR A CB  1 
ATOM   404 O  OG1 . THR A 1 54 ? 1.941  18.698 10.561 1.00 40.13 ? 1193 THR A OG1 1 
ATOM   405 C  CG2 . THR A 1 54 ? 2.863  17.377 12.384 1.00 40.13 ? 1193 THR A CG2 1 
ATOM   406 N  N   . THR A 1 55 ? 3.041  17.215 7.599  1.00 39.73 ? 1194 THR A N   1 
ATOM   407 C  CA  . THR A 1 55 ? 2.497  17.059 6.256  1.00 39.49 ? 1194 THR A CA  1 
ATOM   408 C  C   . THR A 1 55 ? 3.562  16.506 5.315  1.00 39.64 ? 1194 THR A C   1 
ATOM   409 O  O   . THR A 1 55 ? 4.759  16.539 5.627  1.00 39.22 ? 1194 THR A O   1 
ATOM   410 C  CB  . THR A 1 55 ? 1.979  18.399 5.698  1.00 39.33 ? 1194 THR A CB  1 
ATOM   411 O  OG1 . THR A 1 55 ? 3.061  19.334 5.607  1.00 38.35 ? 1194 THR A OG1 1 
ATOM   412 C  CG2 . THR A 1 55 ? 0.884  18.973 6.590  1.00 39.69 ? 1194 THR A CG2 1 
ATOM   413 N  N   . VAL A 1 56 ? 3.121  15.994 4.167  1.00 39.84 ? 1195 VAL A N   1 
ATOM   414 C  CA  . VAL A 1 56 ? 4.037  15.532 3.130  1.00 40.26 ? 1195 VAL A CA  1 
ATOM   415 C  C   . VAL A 1 56 ? 4.828  16.707 2.553  1.00 40.24 ? 1195 VAL A C   1 
ATOM   416 O  O   . VAL A 1 56 ? 6.030  16.590 2.308  1.00 40.40 ? 1195 VAL A O   1 
ATOM   417 C  CB  . VAL A 1 56 ? 3.296  14.704 2.029  1.00 40.27 ? 1195 VAL A CB  1 
ATOM   418 C  CG1 . VAL A 1 56 ? 3.920  14.887 0.642  1.00 40.39 ? 1195 VAL A CG1 1 
ATOM   419 C  CG2 . VAL A 1 56 ? 3.283  13.230 2.420  1.00 41.17 ? 1195 VAL A CG2 1 
ATOM   420 N  N   . GLU A 1 57 ? 4.156  17.841 2.367  1.00 40.16 ? 1196 GLU A N   1 
ATOM   421 C  CA  . GLU A 1 57 ? 4.798  19.044 1.842  1.00 40.12 ? 1196 GLU A CA  1 
ATOM   422 C  C   . GLU A 1 57 ? 5.921  19.541 2.760  1.00 39.99 ? 1196 GLU A C   1 
ATOM   423 O  O   . GLU A 1 57 ? 6.950  20.025 2.286  1.00 39.99 ? 1196 GLU A O   1 
ATOM   424 C  CB  . GLU A 1 57 ? 3.761  20.149 1.602  1.00 40.19 ? 1196 GLU A CB  1 
ATOM   425 C  CG  . GLU A 1 57 ? 2.655  19.762 0.621  1.00 40.85 ? 1196 GLU A CG  1 
ATOM   426 C  CD  . GLU A 1 57 ? 3.191  19.460 -0.795 1.00 41.58 ? 1196 GLU A CD  1 
ATOM   427 O  OE1 . GLU A 1 57 ? 3.625  20.541 -1.479 1.00 43.08 ? 1196 GLU A OE1 1 
ATOM   428 O  OE2 . GLU A 1 57 ? 3.176  18.166 -1.233 1.00 41.57 ? 1196 GLU A OE2 1 
ATOM   429 N  N   . ASN A 1 58 ? 5.732  19.408 4.069  1.00 39.84 ? 1197 ASN A N   1 
ATOM   430 C  CA  . ASN A 1 58 ? 6.744  19.873 5.015  1.00 39.77 ? 1197 ASN A CA  1 
ATOM   431 C  C   . ASN A 1 58 ? 7.948  18.951 5.168  1.00 39.82 ? 1197 ASN A C   1 
ATOM   432 O  O   . ASN A 1 58 ? 9.078  19.431 5.284  1.00 39.96 ? 1197 ASN A O   1 
ATOM   433 C  CB  . ASN A 1 58 ? 6.128  20.229 6.375  1.00 39.75 ? 1197 ASN A CB  1 
ATOM   434 C  CG  . ASN A 1 58 ? 5.496  21.617 6.376  1.00 39.77 ? 1197 ASN A CG  1 
ATOM   435 O  OD1 . ASN A 1 58 ? 5.861  22.476 5.562  1.00 38.34 ? 1197 ASN A OD1 1 
ATOM   436 N  ND2 . ASN A 1 58 ? 4.551  21.840 7.292  1.00 39.58 ? 1197 ASN A ND2 1 
ATOM   437 N  N   . VAL A 1 59 ? 7.719  17.638 5.158  1.00 39.71 ? 1198 VAL A N   1 
ATOM   438 C  CA  . VAL A 1 59 ? 8.831  16.686 5.250  1.00 40.00 ? 1198 VAL A CA  1 
ATOM   439 C  C   . VAL A 1 59 ? 9.819  16.856 4.087  1.00 40.12 ? 1198 VAL A C   1 
ATOM   440 O  O   . VAL A 1 59 ? 11.025 16.708 4.273  1.00 40.07 ? 1198 VAL A O   1 
ATOM   441 C  CB  . VAL A 1 59 ? 8.357  15.208 5.424  1.00 39.76 ? 1198 VAL A CB  1 
ATOM   442 C  CG1 . VAL A 1 59 ? 7.826  14.617 4.122  1.00 40.92 ? 1198 VAL A CG1 1 
ATOM   443 C  CG2 . VAL A 1 59 ? 9.490  14.344 5.980  1.00 40.46 ? 1198 VAL A CG2 1 
ATOM   444 N  N   . LYS A 1 60 ? 9.296  17.208 2.911  1.00 40.41 ? 1199 LYS A N   1 
ATOM   445 C  CA  . LYS A 1 60 ? 10.098 17.403 1.695  1.00 40.88 ? 1199 LYS A CA  1 
ATOM   446 C  C   . LYS A 1 60 ? 11.111 18.550 1.795  1.00 41.27 ? 1199 LYS A C   1 
ATOM   447 O  O   . LYS A 1 60 ? 12.059 18.615 1.005  1.00 41.54 ? 1199 LYS A O   1 
ATOM   448 C  CB  . LYS A 1 60 ? 9.185  17.619 0.481  1.00 40.65 ? 1199 LYS A CB  1 
ATOM   449 C  CG  . LYS A 1 60 ? 8.410  16.378 0.047  1.00 40.72 ? 1199 LYS A CG  1 
ATOM   450 C  CD  . LYS A 1 60 ? 7.395  16.675 -1.065 1.00 40.69 ? 1199 LYS A CD  1 
ATOM   451 C  CE  . LYS A 1 60 ? 8.064  16.864 -2.423 1.00 40.82 ? 1199 LYS A CE  1 
ATOM   452 N  NZ  . LYS A 1 60 ? 7.071  17.008 -3.532 1.00 40.70 ? 1199 LYS A NZ  1 
ATOM   453 N  N   . ARG A 1 61 ? 10.896 19.447 2.757  1.00 41.62 ? 1200 ARG A N   1 
ATOM   454 C  CA  . ARG A 1 61 ? 11.781 20.589 3.006  1.00 42.16 ? 1200 ARG A CA  1 
ATOM   455 C  C   . ARG A 1 61 ? 13.032 20.180 3.792  1.00 42.31 ? 1200 ARG A C   1 
ATOM   456 O  O   . ARG A 1 61 ? 13.987 20.956 3.898  1.00 42.42 ? 1200 ARG A O   1 
ATOM   457 C  CB  . ARG A 1 61 ? 11.034 21.697 3.765  1.00 42.10 ? 1200 ARG A CB  1 
ATOM   458 C  CG  . ARG A 1 61 ? 9.757  22.199 3.092  1.00 42.46 ? 1200 ARG A CG  1 
ATOM   459 C  CD  . ARG A 1 61 ? 8.981  23.158 4.001  1.00 42.69 ? 1200 ARG A CD  1 
ATOM   460 N  NE  . ARG A 1 61 ? 9.511  24.523 3.964  1.00 43.79 ? 1200 ARG A NE  1 
ATOM   461 C  CZ  . ARG A 1 61 ? 9.093  25.521 4.743  1.00 44.72 ? 1200 ARG A CZ  1 
ATOM   462 N  NH1 . ARG A 1 61 ? 8.130  25.331 5.640  1.00 44.43 ? 1200 ARG A NH1 1 
ATOM   463 N  NH2 . ARG A 1 61 ? 9.643  26.722 4.625  1.00 45.34 ? 1200 ARG A NH2 1 
ATOM   464 N  N   . ILE A 1 62 ? 13.010 18.971 4.354  1.00 42.44 ? 1201 ILE A N   1 
ATOM   465 C  CA  . ILE A 1 62 ? 14.148 18.411 5.083  1.00 42.60 ? 1201 ILE A CA  1 
ATOM   466 C  C   . ILE A 1 62 ? 15.210 17.920 4.101  1.00 42.76 ? 1201 ILE A C   1 
ATOM   467 O  O   . ILE A 1 62 ? 14.883 17.264 3.105  1.00 42.54 ? 1201 ILE A O   1 
ATOM   468 C  CB  . ILE A 1 62 ? 13.687 17.281 6.039  1.00 42.56 ? 1201 ILE A CB  1 
ATOM   469 C  CG1 . ILE A 1 62 ? 12.915 17.900 7.214  1.00 42.86 ? 1201 ILE A CG1 1 
ATOM   470 C  CG2 . ILE A 1 62 ? 14.871 16.416 6.513  1.00 42.66 ? 1201 ILE A CG2 1 
ATOM   471 C  CD1 . ILE A 1 62 ? 12.195 16.909 8.107  1.00 42.95 ? 1201 ILE A CD1 1 
ATOM   472 N  N   . ASP A 1 63 ? 16.473 18.251 4.384  1.00 42.93 ? 1202 ASP A N   1 
ATOM   473 C  CA  . ASP A 1 63 ? 17.594 17.887 3.509  1.00 43.05 ? 1202 ASP A CA  1 
ATOM   474 C  C   . ASP A 1 63 ? 17.653 16.378 3.305  1.00 42.73 ? 1202 ASP A C   1 
ATOM   475 O  O   . ASP A 1 63 ? 17.810 15.616 4.267  1.00 42.22 ? 1202 ASP A O   1 
ATOM   476 C  CB  . ASP A 1 63 ? 18.932 18.366 4.087  1.00 43.63 ? 1202 ASP A CB  1 
ATOM   477 C  CG  . ASP A 1 63 ? 18.920 19.835 4.474  1.00 44.67 ? 1202 ASP A CG  1 
ATOM   478 O  OD1 . ASP A 1 63 ? 19.227 20.130 5.650  1.00 46.89 ? 1202 ASP A OD1 1 
ATOM   479 O  OD2 . ASP A 1 63 ? 18.606 20.688 3.617  1.00 45.45 ? 1202 ASP A OD2 1 
ATOM   480 N  N   . GLY A 1 64 ? 17.512 15.958 2.050  1.00 42.13 ? 1203 GLY A N   1 
ATOM   481 C  CA  . GLY A 1 64 ? 17.595 14.545 1.690  1.00 41.96 ? 1203 GLY A CA  1 
ATOM   482 C  C   . GLY A 1 64 ? 16.262 13.834 1.553  1.00 41.51 ? 1203 GLY A C   1 
ATOM   483 O  O   . GLY A 1 64 ? 16.224 12.630 1.305  1.00 41.52 ? 1203 GLY A O   1 
ATOM   484 N  N   . VAL A 1 65 ? 15.167 14.570 1.721  1.00 41.17 ? 1204 VAL A N   1 
ATOM   485 C  CA  . VAL A 1 65 ? 13.833 13.995 1.565  1.00 40.77 ? 1204 VAL A CA  1 
ATOM   486 C  C   . VAL A 1 65 ? 13.215 14.426 0.235  1.00 40.84 ? 1204 VAL A C   1 
ATOM   487 O  O   . VAL A 1 65 ? 12.856 15.593 0.046  1.00 40.82 ? 1204 VAL A O   1 
ATOM   488 C  CB  . VAL A 1 65 ? 12.897 14.331 2.760  1.00 40.78 ? 1204 VAL A CB  1 
ATOM   489 C  CG1 . VAL A 1 65 ? 11.504 13.756 2.532  1.00 40.70 ? 1204 VAL A CG1 1 
ATOM   490 C  CG2 . VAL A 1 65 ? 13.477 13.797 4.068  1.00 40.11 ? 1204 VAL A CG2 1 
ATOM   491 N  N   . SER A 1 66 ? 13.126 13.467 -0.686 1.00 40.57 ? 1205 SER A N   1 
ATOM   492 C  CA  . SER A 1 66 ? 12.493 13.659 -1.980 1.00 40.37 ? 1205 SER A CA  1 
ATOM   493 C  C   . SER A 1 66 ? 11.018 13.276 -1.906 1.00 40.33 ? 1205 SER A C   1 
ATOM   494 O  O   . SER A 1 66 ? 10.541 12.809 -0.873 1.00 39.77 ? 1205 SER A O   1 
ATOM   495 C  CB  . SER A 1 66 ? 13.190 12.785 -3.024 1.00 40.34 ? 1205 SER A CB  1 
ATOM   496 O  OG  . SER A 1 66 ? 13.140 11.422 -2.631 1.00 40.29 ? 1205 SER A OG  1 
ATOM   497 N  N   . GLU A 1 67 ? 10.308 13.474 -3.016 1.00 40.34 ? 1206 GLU A N   1 
ATOM   498 C  CA  . GLU A 1 67 ? 8.914  13.048 -3.166 1.00 40.67 ? 1206 GLU A CA  1 
ATOM   499 C  C   . GLU A 1 67 ? 8.739  11.560 -2.825 1.00 40.61 ? 1206 GLU A C   1 
ATOM   500 O  O   . GLU A 1 67 ? 7.835  11.188 -2.073 1.00 40.65 ? 1206 GLU A O   1 
ATOM   501 C  CB  . GLU A 1 67 ? 8.435  13.351 -4.593 1.00 40.66 ? 1206 GLU A CB  1 
ATOM   502 C  CG  . GLU A 1 67 ? 7.002  12.937 -4.911 1.00 41.24 ? 1206 GLU A CG  1 
ATOM   503 C  CD  . GLU A 1 67 ? 6.520  13.497 -6.238 1.00 41.16 ? 1206 GLU A CD  1 
ATOM   504 O  OE1 . GLU A 1 67 ? 6.249  14.716 -6.307 1.00 42.03 ? 1206 GLU A OE1 1 
ATOM   505 O  OE2 . GLU A 1 67 ? 6.402  12.722 -7.215 1.00 42.97 ? 1206 GLU A OE2 1 
ATOM   506 N  N   . GLY A 1 68 ? 9.620  10.722 -3.366 1.00 40.51 ? 1207 GLY A N   1 
ATOM   507 C  CA  . GLY A 1 68 ? 9.590  9.284  -3.104 1.00 40.31 ? 1207 GLY A CA  1 
ATOM   508 C  C   . GLY A 1 68 ? 9.823  8.910  -1.652 1.00 40.15 ? 1207 GLY A C   1 
ATOM   509 O  O   . GLY A 1 68 ? 9.082  8.096  -1.087 1.00 40.16 ? 1207 GLY A O   1 
ATOM   510 N  N   . LYS A 1 69 ? 10.858 9.485  -1.042 1.00 39.96 ? 1208 LYS A N   1 
ATOM   511 C  CA  . LYS A 1 69 ? 11.115 9.241  0.377  1.00 39.53 ? 1208 LYS A CA  1 
ATOM   512 C  C   . LYS A 1 69 ? 9.960  9.740  1.246  1.00 39.63 ? 1208 LYS A C   1 
ATOM   513 O  O   . LYS A 1 69 ? 9.553  9.058  2.183  1.00 39.68 ? 1208 LYS A O   1 
ATOM   514 C  CB  . LYS A 1 69 ? 12.442 9.858  0.838  1.00 39.71 ? 1208 LYS A CB  1 
ATOM   515 C  CG  . LYS A 1 69 ? 12.840 9.443  2.267  1.00 38.46 ? 1208 LYS A CG  1 
ATOM   516 C  CD  . LYS A 1 69 ? 14.269 9.841  2.634  1.00 38.87 ? 1208 LYS A CD  1 
ATOM   517 C  CE  . LYS A 1 69 ? 15.317 9.198  1.719  1.00 38.33 ? 1208 LYS A CE  1 
ATOM   518 N  NZ  . LYS A 1 69 ? 15.349 7.711  1.799  1.00 37.41 ? 1208 LYS A NZ  1 
ATOM   519 N  N   . ALA A 1 70 ? 9.438  10.921 0.921  1.00 39.67 ? 1209 ALA A N   1 
ATOM   520 C  CA  . ALA A 1 70 ? 8.307  11.517 1.647  1.00 39.83 ? 1209 ALA A CA  1 
ATOM   521 C  C   . ALA A 1 70 ? 7.136  10.540 1.772  1.00 39.95 ? 1209 ALA A C   1 
ATOM   522 O  O   . ALA A 1 70 ? 6.556  10.387 2.849  1.00 39.41 ? 1209 ALA A O   1 
ATOM   523 C  CB  . ALA A 1 70 ? 7.853  12.791 0.955  1.00 39.65 ? 1209 ALA A CB  1 
ATOM   524 N  N   . ALA A 1 71 ? 6.804  9.881  0.661  1.00 39.68 ? 1210 ALA A N   1 
ATOM   525 C  CA  . ALA A 1 71 ? 5.751  8.866  0.626  1.00 39.99 ? 1210 ALA A CA  1 
ATOM   526 C  C   . ALA A 1 71 ? 6.084  7.670  1.512  1.00 40.19 ? 1210 ALA A C   1 
ATOM   527 O  O   . ALA A 1 71 ? 5.206  7.118  2.182  1.00 40.38 ? 1210 ALA A O   1 
ATOM   528 C  CB  . ALA A 1 71 ? 5.497  8.412  -0.813 1.00 40.03 ? 1210 ALA A CB  1 
ATOM   529 N  N   . MET A 1 72 ? 7.358  7.280  1.523  1.00 40.04 ? 1211 MET A N   1 
ATOM   530 C  CA  . MET A 1 72 ? 7.819  6.199  2.379  1.00 40.26 ? 1211 MET A CA  1 
ATOM   531 C  C   . MET A 1 72 ? 7.780  6.604  3.853  1.00 39.78 ? 1211 MET A C   1 
ATOM   532 O  O   . MET A 1 72 ? 7.667  5.750  4.727  1.00 39.92 ? 1211 MET A O   1 
ATOM   533 C  CB  . MET A 1 72 ? 9.243  5.775  2.002  1.00 40.37 ? 1211 MET A CB  1 
ATOM   534 C  CG  . MET A 1 72 ? 9.402  5.197  0.607  1.00 42.03 ? 1211 MET A CG  1 
ATOM   535 S  SD  . MET A 1 72 ? 8.175  3.936  0.245  1.00 45.23 ? 1211 MET A SD  1 
ATOM   536 C  CE  . MET A 1 72 ? 6.980  4.848  -0.724 1.00 43.05 ? 1211 MET A CE  1 
ATOM   537 N  N   . LEU A 1 73 ? 7.879  7.905  4.114  1.00 39.59 ? 1212 LEU A N   1 
ATOM   538 C  CA  . LEU A 1 73 ? 7.939  8.429  5.487  1.00 39.37 ? 1212 LEU A CA  1 
ATOM   539 C  C   . LEU A 1 73 ? 6.564  8.748  6.085  1.00 39.56 ? 1212 LEU A C   1 
ATOM   540 O  O   . LEU A 1 73 ? 6.478  9.254  7.204  1.00 39.29 ? 1212 LEU A O   1 
ATOM   541 C  CB  . LEU A 1 73 ? 8.852  9.662  5.554  1.00 39.13 ? 1212 LEU A CB  1 
ATOM   542 C  CG  . LEU A 1 73 ? 10.366 9.438  5.424  1.00 39.46 ? 1212 LEU A CG  1 
ATOM   543 C  CD1 . LEU A 1 73 ? 11.111 10.768 5.320  1.00 39.31 ? 1212 LEU A CD1 1 
ATOM   544 C  CD2 . LEU A 1 73 ? 10.916 8.604  6.569  1.00 38.94 ? 1212 LEU A CD2 1 
ATOM   545 N  N   . ALA A 1 74 ? 5.500  8.434  5.346  1.00 39.66 ? 1213 ALA A N   1 
ATOM   546 C  CA  . ALA A 1 74 ? 4.123  8.672  5.798  1.00 39.95 ? 1213 ALA A CA  1 
ATOM   547 C  C   . ALA A 1 74 ? 3.829  8.130  7.212  1.00 40.11 ? 1213 ALA A C   1 
ATOM   548 O  O   . ALA A 1 74 ? 3.304  8.864  8.037  1.00 39.72 ? 1213 ALA A O   1 
ATOM   549 C  CB  . ALA A 1 74 ? 3.099  8.153  4.761  1.00 40.10 ? 1213 ALA A CB  1 
ATOM   550 N  N   . PRO A 1 75 ? 4.186  6.858  7.500  1.00 40.54 ? 1214 PRO A N   1 
ATOM   551 C  CA  . PRO A 1 75 ? 4.035  6.316  8.858  1.00 40.71 ? 1214 PRO A CA  1 
ATOM   552 C  C   . PRO A 1 75 ? 4.683  7.170  9.962  1.00 40.77 ? 1214 PRO A C   1 
ATOM   553 O  O   . PRO A 1 75 ? 4.117  7.296  11.049 1.00 40.75 ? 1214 PRO A O   1 
ATOM   554 C  CB  . PRO A 1 75 ? 4.762  4.973  8.787  1.00 40.75 ? 1214 PRO A CB  1 
ATOM   555 C  CG  . PRO A 1 75 ? 4.742  4.594  7.384  1.00 41.59 ? 1214 PRO A CG  1 
ATOM   556 C  CD  . PRO A 1 75 ? 4.722  5.848  6.569  1.00 40.97 ? 1214 PRO A CD  1 
ATOM   557 N  N   . LEU A 1 76 ? 5.855  7.736  9.678  1.00 40.64 ? 1215 LEU A N   1 
ATOM   558 C  CA  . LEU A 1 76 ? 6.596  8.539  10.652 1.00 40.57 ? 1215 LEU A CA  1 
ATOM   559 C  C   . LEU A 1 76 ? 5.968  9.915  10.847 1.00 40.63 ? 1215 LEU A C   1 
ATOM   560 O  O   . LEU A 1 76 ? 6.050  10.492 11.930 1.00 40.49 ? 1215 LEU A O   1 
ATOM   561 C  CB  . LEU A 1 76 ? 8.060  8.679  10.234 1.00 40.40 ? 1215 LEU A CB  1 
ATOM   562 C  CG  . LEU A 1 76 ? 8.985  7.505  10.578 1.00 40.11 ? 1215 LEU A CG  1 
ATOM   563 C  CD1 . LEU A 1 76 ? 8.712  6.303  9.683  1.00 39.32 ? 1215 LEU A CD1 1 
ATOM   564 C  CD2 . LEU A 1 76 ? 10.439 7.936  10.482 1.00 39.87 ? 1215 LEU A CD2 1 
ATOM   565 N  N   . LEU A 1 77 ? 5.366  10.441 9.785  1.00 40.38 ? 1216 LEU A N   1 
ATOM   566 C  CA  . LEU A 1 77 ? 4.612  11.692 9.854  1.00 40.64 ? 1216 LEU A CA  1 
ATOM   567 C  C   . LEU A 1 77 ? 3.415  11.552 10.795 1.00 40.59 ? 1216 LEU A C   1 
ATOM   568 O  O   . LEU A 1 77 ? 3.084  12.479 11.539 1.00 40.19 ? 1216 LEU A O   1 
ATOM   569 C  CB  . LEU A 1 77 ? 4.140  12.097 8.451  1.00 40.74 ? 1216 LEU A CB  1 
ATOM   570 C  CG  . LEU A 1 77 ? 4.876  13.214 7.697  1.00 41.26 ? 1216 LEU A CG  1 
ATOM   571 C  CD1 . LEU A 1 77 ? 6.379  13.220 7.928  1.00 41.72 ? 1216 LEU A CD1 1 
ATOM   572 C  CD2 . LEU A 1 77 ? 4.559  13.168 6.210  1.00 40.84 ? 1216 LEU A CD2 1 
ATOM   573 N  N   . GLU A 1 78 ? 2.782  10.381 10.739 1.00 40.62 ? 1217 GLU A N   1 
ATOM   574 C  CA  . GLU A 1 78 ? 1.699  9.996  11.641 1.00 40.78 ? 1217 GLU A CA  1 
ATOM   575 C  C   . GLU A 1 78 ? 2.169  9.946  13.105 1.00 40.43 ? 1217 GLU A C   1 
ATOM   576 O  O   . GLU A 1 78 ? 1.444  10.367 14.007 1.00 40.07 ? 1217 GLU A O   1 
ATOM   577 C  CB  . GLU A 1 78 ? 1.144  8.634  11.211 1.00 41.14 ? 1217 GLU A CB  1 
ATOM   578 C  CG  . GLU A 1 78 ? -0.306 8.381  11.580 1.00 43.01 ? 1217 GLU A CG  1 
ATOM   579 C  CD  . GLU A 1 78 ? -1.281 9.318  10.875 1.00 43.98 ? 1217 GLU A CD  1 
ATOM   580 O  OE1 . GLU A 1 78 ? -1.032 9.701  9.710  1.00 44.63 ? 1217 GLU A OE1 1 
ATOM   581 O  OE2 . GLU A 1 78 ? -2.302 9.668  11.493 1.00 45.11 ? 1217 GLU A OE2 1 
ATOM   582 N  N   . VAL A 1 79 ? 3.375  9.427  13.327 1.00 39.84 ? 1218 VAL A N   1 
ATOM   583 C  CA  . VAL A 1 79 ? 3.974  9.364  14.676 1.00 39.62 ? 1218 VAL A CA  1 
ATOM   584 C  C   . VAL A 1 79 ? 4.191  10.766 15.252 1.00 39.66 ? 1218 VAL A C   1 
ATOM   585 O  O   . VAL A 1 79 ? 3.850  11.033 16.417 1.00 40.02 ? 1218 VAL A O   1 
ATOM   586 C  CB  . VAL A 1 79 ? 5.322  8.570  14.676 1.00 39.65 ? 1218 VAL A CB  1 
ATOM   587 C  CG1 . VAL A 1 79 ? 6.056  8.711  16.022 1.00 38.91 ? 1218 VAL A CG1 1 
ATOM   588 C  CG2 . VAL A 1 79 ? 5.083  7.099  14.334 1.00 39.35 ? 1218 VAL A CG2 1 
ATOM   589 N  N   . ILE A 1 80 ? 4.756  11.649 14.429 1.00 39.60 ? 1219 ILE A N   1 
ATOM   590 C  CA  . ILE A 1 80 ? 5.024  13.036 14.808 1.00 39.73 ? 1219 ILE A CA  1 
ATOM   591 C  C   . ILE A 1 80 ? 3.730  13.780 15.146 1.00 39.91 ? 1219 ILE A C   1 
ATOM   592 O  O   . ILE A 1 80 ? 3.660  14.473 16.159 1.00 40.01 ? 1219 ILE A O   1 
ATOM   593 C  CB  . ILE A 1 80 ? 5.806  13.791 13.700 1.00 39.70 ? 1219 ILE A CB  1 
ATOM   594 C  CG1 . ILE A 1 80 ? 7.222  13.219 13.566 1.00 39.21 ? 1219 ILE A CG1 1 
ATOM   595 C  CG2 . ILE A 1 80 ? 5.838  15.296 13.976 1.00 39.66 ? 1219 ILE A CG2 1 
ATOM   596 C  CD1 . ILE A 1 80 ? 8.069  13.866 12.497 1.00 39.62 ? 1219 ILE A CD1 1 
ATOM   597 N  N   . LYS A 1 81 ? 2.704  13.623 14.317 1.00 40.29 ? 1220 LYS A N   1 
ATOM   598 C  CA  . LYS A 1 81 ? 1.429  14.301 14.571 1.00 40.66 ? 1220 LYS A CA  1 
ATOM   599 C  C   . LYS A 1 81 ? 0.712  13.765 15.822 1.00 40.86 ? 1220 LYS A C   1 
ATOM   600 O  O   . LYS A 1 81 ? 0.188  14.545 16.616 1.00 40.84 ? 1220 LYS A O   1 
ATOM   601 C  CB  . LYS A 1 81 ? 0.518  14.323 13.322 1.00 40.75 ? 1220 LYS A CB  1 
ATOM   602 C  CG  . LYS A 1 81 ? 0.000  12.972 12.846 1.00 40.86 ? 1220 LYS A CG  1 
ATOM   603 C  CD  . LYS A 1 81 ? -1.026 13.115 11.706 1.00 41.37 ? 1220 LYS A CD  1 
ATOM   604 C  CE  . LYS A 1 81 ? -0.352 13.206 10.338 1.00 42.14 ? 1220 LYS A CE  1 
ATOM   605 N  NZ  . LYS A 1 81 ? -1.341 13.334 9.234  1.00 43.23 ? 1220 LYS A NZ  1 
ATOM   606 N  N   . HIS A 1 82 ? 0.713  12.444 16.002 1.00 41.31 ? 1221 HIS A N   1 
ATOM   607 C  CA  . HIS A 1 82 ? 0.141  11.817 17.201 1.00 41.89 ? 1221 HIS A CA  1 
ATOM   608 C  C   . HIS A 1 82 ? 0.860  12.301 18.467 1.00 41.69 ? 1221 HIS A C   1 
ATOM   609 O  O   . HIS A 1 82 ? 0.225  12.751 19.431 1.00 41.47 ? 1221 HIS A O   1 
ATOM   610 C  CB  . HIS A 1 82 ? 0.235  10.288 17.106 1.00 42.33 ? 1221 HIS A CB  1 
ATOM   611 C  CG  . HIS A 1 82 ? -0.564 9.567  18.149 1.00 44.44 ? 1221 HIS A CG  1 
ATOM   612 N  ND1 . HIS A 1 82 ? -0.186 9.513  19.475 1.00 47.24 ? 1221 HIS A ND1 1 
ATOM   613 C  CD2 . HIS A 1 82 ? -1.724 8.874  18.061 1.00 46.47 ? 1221 HIS A CD2 1 
ATOM   614 C  CE1 . HIS A 1 82 ? -1.083 8.826  20.160 1.00 47.19 ? 1221 HIS A CE1 1 
ATOM   615 N  NE2 . HIS A 1 82 ? -2.027 8.427  19.325 1.00 47.85 ? 1221 HIS A NE2 1 
ATOM   616 N  N   . PHE A 1 83 ? 2.187  12.193 18.446 1.00 41.62 ? 1222 PHE A N   1 
ATOM   617 C  CA  . PHE A 1 83 ? 3.037  12.594 19.565 1.00 41.43 ? 1222 PHE A CA  1 
ATOM   618 C  C   . PHE A 1 83 ? 2.812  14.048 19.977 1.00 41.94 ? 1222 PHE A C   1 
ATOM   619 O  O   . PHE A 1 83 ? 2.592  14.335 21.153 1.00 41.51 ? 1222 PHE A O   1 
ATOM   620 C  CB  . PHE A 1 83 ? 4.515  12.369 19.224 1.00 41.30 ? 1222 PHE A CB  1 
ATOM   621 C  CG  . PHE A 1 83 ? 5.460  12.809 20.313 1.00 40.50 ? 1222 PHE A CG  1 
ATOM   622 C  CD1 . PHE A 1 83 ? 6.035  14.073 20.285 1.00 39.95 ? 1222 PHE A CD1 1 
ATOM   623 C  CD2 . PHE A 1 83 ? 5.760  11.960 21.369 1.00 39.96 ? 1222 PHE A CD2 1 
ATOM   624 C  CE1 . PHE A 1 83 ? 6.906  14.482 21.295 1.00 40.45 ? 1222 PHE A CE1 1 
ATOM   625 C  CE2 . PHE A 1 83 ? 6.631  12.362 22.388 1.00 40.53 ? 1222 PHE A CE2 1 
ATOM   626 C  CZ  . PHE A 1 83 ? 7.197  13.621 22.347 1.00 40.54 ? 1222 PHE A CZ  1 
ATOM   627 N  N   . CYS A 1 84 ? 2.868  14.954 19.003 1.00 42.53 ? 1223 CYS A N   1 
ATOM   628 C  CA  . CYS A 1 84 ? 2.779  16.387 19.260 1.00 43.46 ? 1223 CYS A CA  1 
ATOM   629 C  C   . CYS A 1 84 ? 1.374  16.832 19.666 1.00 44.10 ? 1223 CYS A C   1 
ATOM   630 O  O   . CYS A 1 84 ? 1.190  17.942 20.185 1.00 43.99 ? 1223 CYS A O   1 
ATOM   631 C  CB  . CYS A 1 84 ? 3.267  17.174 18.048 1.00 43.44 ? 1223 CYS A CB  1 
ATOM   632 S  SG  . CYS A 1 84 ? 5.031  17.017 17.718 1.00 44.48 ? 1223 CYS A SG  1 
ATOM   633 N  N   . GLN A 1 85 ? 0.396  15.957 19.438 1.00 44.66 ? 1224 GLN A N   1 
ATOM   634 C  CA  . GLN A 1 85 ? -0.972 16.154 19.916 1.00 45.31 ? 1224 GLN A CA  1 
ATOM   635 C  C   . GLN A 1 85 ? -1.106 15.720 21.382 1.00 45.37 ? 1224 GLN A C   1 
ATOM   636 O  O   . GLN A 1 85 ? -1.591 16.492 22.218 1.00 45.22 ? 1224 GLN A O   1 
ATOM   637 C  CB  . GLN A 1 85 ? -1.948 15.385 19.020 1.00 45.18 ? 1224 GLN A CB  1 
ATOM   638 C  CG  . GLN A 1 85 ? -3.411 15.457 19.416 1.00 45.95 ? 1224 GLN A CG  1 
ATOM   639 C  CD  . GLN A 1 85 ? -4.302 14.647 18.484 1.00 46.08 ? 1224 GLN A CD  1 
ATOM   640 O  OE1 . GLN A 1 85 ? -3.823 14.010 17.537 1.00 47.37 ? 1224 GLN A OE1 1 
ATOM   641 N  NE2 . GLN A 1 85 ? -5.603 14.667 18.748 1.00 47.29 ? 1224 GLN A NE2 1 
ATOM   642 N  N   . THR A 1 86 ? -0.671 14.493 21.686 1.00 45.55 ? 1225 THR A N   1 
ATOM   643 C  CA  . THR A 1 86 ? -0.743 13.937 23.047 1.00 45.89 ? 1225 THR A CA  1 
ATOM   644 C  C   . THR A 1 86 ? 0.086  14.779 24.007 1.00 45.80 ? 1225 THR A C   1 
ATOM   645 O  O   . THR A 1 86 ? -0.358 15.129 25.093 1.00 45.86 ? 1225 THR A O   1 
ATOM   646 C  CB  . THR A 1 86 ? -0.260 12.469 23.100 1.00 45.92 ? 1225 THR A CB  1 
ATOM   647 O  OG1 . THR A 1 86 ? -0.957 11.699 22.115 1.00 46.22 ? 1225 THR A OG1 1 
ATOM   648 C  CG2 . THR A 1 86 ? -0.521 11.867 24.484 1.00 46.31 ? 1225 THR A CG2 1 
ATOM   649 N  N   . ASN A 1 87 ? 1.309  15.076 23.593 1.00 45.91 ? 1226 ASN A N   1 
ATOM   650 C  CA  . ASN A 1 87 ? 2.133  16.066 24.258 1.00 45.90 ? 1226 ASN A CA  1 
ATOM   651 C  C   . ASN A 1 87 ? 1.830  17.370 23.547 1.00 46.09 ? 1226 ASN A C   1 
ATOM   652 O  O   . ASN A 1 87 ? 1.476  17.349 22.372 1.00 47.12 ? 1226 ASN A O   1 
ATOM   653 C  CB  . ASN A 1 87 ? 3.603  15.682 24.115 1.00 45.41 ? 1226 ASN A CB  1 
ATOM   654 C  CG  . ASN A 1 87 ? 3.851  14.238 24.485 1.00 44.63 ? 1226 ASN A CG  1 
ATOM   655 O  OD1 . ASN A 1 87 ? 4.156  13.924 25.633 1.00 43.61 ? 1226 ASN A OD1 1 
ATOM   656 N  ND2 . ASN A 1 87 ? 3.686  13.341 23.518 1.00 43.28 ? 1226 ASN A ND2 1 
ATOM   657 N  N   . SER A 1 88 ? 1.959  18.495 24.230 1.00 45.70 ? 1227 SER A N   1 
ATOM   658 C  CA  . SER A 1 88 ? 1.514  19.765 23.656 1.00 45.11 ? 1227 SER A CA  1 
ATOM   659 C  C   . SER A 1 88 ? 2.695  20.604 23.172 1.00 45.07 ? 1227 SER A C   1 
ATOM   660 O  O   . SER A 1 88 ? 3.024  21.641 23.758 1.00 45.03 ? 1227 SER A O   1 
ATOM   661 C  CB  . SER A 1 88 ? 0.663  20.527 24.676 1.00 45.08 ? 1227 SER A CB  1 
ATOM   662 O  OG  . SER A 1 88 ? -0.391 19.705 25.145 1.00 44.24 ? 1227 SER A OG  1 
ATOM   663 N  N   . VAL A 1 89 ? 3.329  20.136 22.098 1.00 44.85 ? 1228 VAL A N   1 
ATOM   664 C  CA  . VAL A 1 89 ? 4.546  20.754 21.567 1.00 44.67 ? 1228 VAL A CA  1 
ATOM   665 C  C   . VAL A 1 89 ? 4.335  21.323 20.165 1.00 44.67 ? 1228 VAL A C   1 
ATOM   666 O  O   . VAL A 1 89 ? 3.436  20.888 19.441 1.00 44.38 ? 1228 VAL A O   1 
ATOM   667 C  CB  . VAL A 1 89 ? 5.739  19.764 21.547 1.00 44.70 ? 1228 VAL A CB  1 
ATOM   668 C  CG1 . VAL A 1 89 ? 6.095  19.334 22.951 1.00 44.44 ? 1228 VAL A CG1 1 
ATOM   669 C  CG2 . VAL A 1 89 ? 5.424  18.558 20.702 1.00 44.49 ? 1228 VAL A CG2 1 
ATOM   670 N  N   . GLN A 1 90 ? 5.180  22.285 19.797 1.00 44.74 ? 1229 GLN A N   1 
ATOM   671 C  CA  . GLN A 1 90 ? 5.097  22.963 18.504 1.00 45.17 ? 1229 GLN A CA  1 
ATOM   672 C  C   . GLN A 1 90 ? 5.515  22.020 17.372 1.00 45.11 ? 1229 GLN A C   1 
ATOM   673 O  O   . GLN A 1 90 ? 6.418  21.196 17.541 1.00 44.71 ? 1229 GLN A O   1 
ATOM   674 C  CB  . GLN A 1 90 ? 5.974  24.225 18.494 1.00 45.26 ? 1229 GLN A CB  1 
ATOM   675 C  CG  . GLN A 1 90 ? 5.751  25.192 19.669 1.00 45.16 ? 1229 GLN A CG  1 
ATOM   676 C  CD  . GLN A 1 90 ? 6.444  26.544 19.485 1.00 45.60 ? 1229 GLN A CD  1 
ATOM   677 O  OE1 . GLN A 1 90 ? 6.651  27.010 18.361 1.00 45.92 ? 1229 GLN A OE1 1 
ATOM   678 N  NE2 . GLN A 1 90 ? 6.789  27.185 20.599 1.00 45.73 ? 1229 GLN A NE2 1 
ATOM   679 N  N   . THR A 1 91 ? 4.841  22.139 16.230 1.00 45.29 ? 1230 THR A N   1 
ATOM   680 C  CA  . THR A 1 91 ? 5.167  21.347 15.040 1.00 45.39 ? 1230 THR A CA  1 
ATOM   681 C  C   . THR A 1 91 ? 5.583  22.265 13.895 1.00 45.58 ? 1230 THR A C   1 
ATOM   682 O  O   . THR A 1 91 ? 5.373  23.478 13.961 1.00 45.40 ? 1230 THR A O   1 
ATOM   683 C  CB  . THR A 1 91 ? 3.967  20.493 14.554 1.00 45.50 ? 1230 THR A CB  1 
ATOM   684 O  OG1 . THR A 1 91 ? 2.951  21.346 14.014 1.00 44.94 ? 1230 THR A OG1 1 
ATOM   685 C  CG2 . THR A 1 91 ? 3.384  19.662 15.679 1.00 45.67 ? 1230 THR A CG2 1 
ATOM   686 N  N   . ASP A 1 92 ? 6.173  21.671 12.857 1.00 45.81 ? 1231 ASP A N   1 
ATOM   687 C  CA  . ASP A 1 92 ? 6.503  22.353 11.604 1.00 45.90 ? 1231 ASP A CA  1 
ATOM   688 C  C   . ASP A 1 92 ? 7.354  23.612 11.803 1.00 46.43 ? 1231 ASP A C   1 
ATOM   689 O  O   . ASP A 1 92 ? 6.978  24.705 11.382 1.00 46.27 ? 1231 ASP A O   1 
ATOM   690 C  CB  . ASP A 1 92 ? 5.221  22.641 10.813 1.00 45.91 ? 1231 ASP A CB  1 
ATOM   691 C  CG  . ASP A 1 92 ? 4.391  21.390 10.579 1.00 45.22 ? 1231 ASP A CG  1 
ATOM   692 O  OD1 . ASP A 1 92 ? 4.718  20.620 9.653  1.00 44.85 ? 1231 ASP A OD1 1 
ATOM   693 O  OD2 . ASP A 1 92 ? 3.413  21.175 11.322 1.00 44.35 ? 1231 ASP A OD2 1 
ATOM   694 N  N   . LEU A 1 93 ? 8.504  23.437 12.448 1.00 47.18 ? 1232 LEU A N   1 
ATOM   695 C  CA  . LEU A 1 93 ? 9.406  24.536 12.798 1.00 48.10 ? 1232 LEU A CA  1 
ATOM   696 C  C   . LEU A 1 93 ? 10.454 24.784 11.724 1.00 48.48 ? 1232 LEU A C   1 
ATOM   697 O  O   . LEU A 1 93 ? 11.574 24.273 11.809 1.00 48.82 ? 1232 LEU A O   1 
ATOM   698 C  CB  . LEU A 1 93 ? 10.124 24.235 14.117 1.00 48.04 ? 1232 LEU A CB  1 
ATOM   699 C  CG  . LEU A 1 93 ? 9.482  24.495 15.477 1.00 48.65 ? 1232 LEU A CG  1 
ATOM   700 C  CD1 . LEU A 1 93 ? 8.305  23.573 15.727 1.00 49.37 ? 1232 LEU A CD1 1 
ATOM   701 C  CD2 . LEU A 1 93 ? 10.546 24.262 16.532 1.00 48.47 ? 1232 LEU A CD2 1 
ATOM   702 N  N   . PHE A 1 94 ? 10.101 25.579 10.724 1.00 49.09 ? 1233 PHE A N   1 
ATOM   703 C  CA  . PHE A 1 94 ? 11.019 25.869 9.627  1.00 49.74 ? 1233 PHE A CA  1 
ATOM   704 C  C   . PHE A 1 94 ? 11.420 27.341 9.614  1.00 50.25 ? 1233 PHE A C   1 
ATOM   705 O  O   . PHE A 1 94 ? 10.599 28.222 9.889  1.00 50.35 ? 1233 PHE A O   1 
ATOM   706 C  CB  . PHE A 1 94 ? 10.425 25.400 8.287  1.00 49.53 ? 1233 PHE A CB  1 
ATOM   707 C  CG  . PHE A 1 94 ? 10.085 23.932 8.274  1.00 49.59 ? 1233 PHE A CG  1 
ATOM   708 C  CD1 . PHE A 1 94 ? 8.792  23.498 8.559  1.00 49.46 ? 1233 PHE A CD1 1 
ATOM   709 C  CD2 . PHE A 1 94 ? 11.071 22.976 8.027  1.00 49.65 ? 1233 PHE A CD2 1 
ATOM   710 C  CE1 . PHE A 1 94 ? 8.482  22.133 8.578  1.00 49.19 ? 1233 PHE A CE1 1 
ATOM   711 C  CE2 . PHE A 1 94 ? 10.770 21.608 8.044  1.00 49.24 ? 1233 PHE A CE2 1 
ATOM   712 C  CZ  . PHE A 1 94 ? 9.473  21.189 8.320  1.00 49.09 ? 1233 PHE A CZ  1 
ATOM   713 N  N   . SER A 1 95 ? 12.695 27.590 9.320  1.00 50.83 ? 1234 SER A N   1 
ATOM   714 C  CA  . SER A 1 95 ? 13.257 28.944 9.337  1.00 51.31 ? 1234 SER A CA  1 
ATOM   715 C  C   . SER A 1 95 ? 12.850 29.779 8.120  1.00 51.36 ? 1234 SER A C   1 
ATOM   716 O  O   . SER A 1 95 ? 12.445 30.932 8.268  1.00 51.51 ? 1234 SER A O   1 
ATOM   717 C  CB  . SER A 1 95 ? 14.783 28.898 9.487  1.00 51.41 ? 1234 SER A CB  1 
ATOM   718 O  OG  . SER A 1 95 ? 15.368 28.021 8.540  1.00 51.92 ? 1234 SER A OG  1 
ATOM   719 N  N   . SER A 1 96 ? 12.959 29.200 6.926  1.00 51.51 ? 1235 SER A N   1 
ATOM   720 C  CA  . SER A 1 96 ? 12.546 29.891 5.703  1.00 51.48 ? 1235 SER A CA  1 
ATOM   721 C  C   . SER A 1 96 ? 11.028 29.843 5.532  1.00 51.50 ? 1235 SER A C   1 
ATOM   722 O  O   . SER A 1 96 ? 10.348 29.001 6.124  1.00 51.42 ? 1235 SER A O   1 
ATOM   723 C  CB  . SER A 1 96 ? 13.245 29.299 4.474  1.00 51.57 ? 1235 SER A CB  1 
ATOM   724 O  OG  . SER A 1 96 ? 12.970 30.064 3.310  1.00 51.44 ? 1235 SER A OG  1 
HETATM 725 CL CL  . CL  B 2 .  ? 14.149 8.144  22.772 0.50 52.86 ? 101  CL  A CL  1 
HETATM 726 O  O   . HOH C 3 .  ? 15.661 14.048 29.116 1.00 35.33 ? 1    HOH A O   1 
HETATM 727 O  O   . HOH C 3 .  ? 15.465 2.327  12.916 1.00 32.10 ? 2    HOH A O   1 
HETATM 728 O  O   . HOH C 3 .  ? 22.178 6.655  9.125  1.00 43.79 ? 3    HOH A O   1 
HETATM 729 O  O   . HOH C 3 .  ? 17.625 7.622  3.594  1.00 43.53 ? 4    HOH A O   1 
HETATM 730 O  O   . HOH C 3 .  ? 23.037 10.018 9.250  1.00 43.43 ? 5    HOH A O   1 
HETATM 731 O  O   . HOH C 3 .  ? 10.928 7.727  23.117 1.00 36.59 ? 6    HOH A O   1 
HETATM 732 O  O   . HOH C 3 .  ? 10.280 14.884 32.310 1.00 43.63 ? 7    HOH A O   1 
HETATM 733 O  O   . HOH C 3 .  ? 7.323  4.433  17.245 1.00 38.37 ? 8    HOH A O   1 
HETATM 734 O  O   . HOH C 3 .  ? 8.110  3.649  19.737 1.00 40.61 ? 9    HOH A O   1 
HETATM 735 O  O   . HOH C 3 .  ? 16.117 -0.891 15.760 1.00 43.46 ? 10   HOH A O   1 
HETATM 736 O  O   . HOH C 3 .  ? 13.725 -0.568 19.375 1.00 42.80 ? 11   HOH A O   1 
HETATM 737 O  O   . HOH C 3 .  ? 15.468 25.413 29.757 1.00 45.64 ? 12   HOH A O   1 
HETATM 738 O  O   . HOH C 3 .  ? 16.511 0.254  19.835 1.00 40.41 ? 13   HOH A O   1 
HETATM 739 O  O   . HOH C 3 .  ? 12.326 23.929 29.608 1.00 51.50 ? 14   HOH A O   1 
HETATM 740 O  O   . HOH C 3 .  ? 15.153 -4.343 7.738  1.00 52.36 ? 15   HOH A O   1 
HETATM 741 O  O   . HOH C 3 .  ? 9.293  15.203 28.116 1.00 40.64 ? 16   HOH A O   1 
HETATM 742 O  O   . HOH C 3 .  ? 8.636  6.333  23.666 1.00 43.84 ? 17   HOH A O   1 
HETATM 743 O  O   . HOH C 3 .  ? 20.923 24.173 21.500 1.00 56.15 ? 18   HOH A O   1 
HETATM 744 O  O   . HOH C 3 .  ? 11.097 -2.050 21.491 1.00 51.24 ? 19   HOH A O   1 
HETATM 745 O  O   . HOH C 3 .  ? 9.439  17.988 27.434 1.00 45.71 ? 20   HOH A O   1 
HETATM 746 O  O   . HOH C 3 .  ? 7.275  16.189 24.847 1.00 41.62 ? 21   HOH A O   1 
HETATM 747 O  O   . HOH C 3 .  ? 13.063 22.472 17.498 1.00 45.75 ? 22   HOH A O   1 
HETATM 748 O  O   . HOH C 3 .  ? 17.074 15.973 28.163 1.00 48.44 ? 23   HOH A O   1 
HETATM 749 O  O   . HOH C 3 .  ? 13.439 -0.342 16.849 1.00 44.08 ? 24   HOH A O   1 
HETATM 750 O  O   . HOH C 3 .  ? 23.844 10.715 6.749  1.00 61.80 ? 25   HOH A O   1 
HETATM 751 O  O   . HOH C 3 .  ? 28.585 28.248 21.925 1.00 72.22 ? 26   HOH A O   1 
HETATM 752 O  O   . HOH C 3 .  ? 19.034 19.281 19.104 1.00 57.60 ? 27   HOH A O   1 
HETATM 753 O  O   . HOH C 3 .  ? 12.856 -5.445 -0.590 1.00 55.21 ? 28   HOH A O   1 
HETATM 754 O  O   . HOH C 3 .  ? 3.354  8.666  18.405 1.00 57.73 ? 29   HOH A O   1 
HETATM 755 O  O   . HOH C 3 .  ? 6.368  2.307  15.726 1.00 54.87 ? 30   HOH A O   1 
HETATM 756 O  O   . HOH C 3 .  ? 11.274 16.545 34.293 1.00 56.64 ? 31   HOH A O   1 
HETATM 757 O  O   . HOH C 3 .  ? 14.624 17.808 0.332  1.00 66.65 ? 32   HOH A O   1 
HETATM 758 O  O   . HOH C 3 .  ? 16.130 18.124 29.173 1.00 46.02 ? 33   HOH A O   1 
HETATM 759 O  O   . HOH C 3 .  ? 20.946 12.151 4.945  1.00 59.21 ? 34   HOH A O   1 
HETATM 760 O  O   . HOH C 3 .  ? 5.144  0.692  9.073  1.00 65.16 ? 35   HOH A O   1 
HETATM 761 O  O   . HOH C 3 .  ? 18.380 22.091 18.474 1.00 57.69 ? 36   HOH A O   1 
HETATM 762 O  O   . HOH C 3 .  ? 9.490  22.458 23.076 1.00 51.48 ? 37   HOH A O   1 
HETATM 763 O  O   . HOH C 3 .  ? 12.218 24.655 4.881  1.00 78.22 ? 38   HOH A O   1 
HETATM 764 O  O   . HOH C 3 .  ? 13.970 16.839 31.821 1.00 52.94 ? 39   HOH A O   1 
HETATM 765 O  O   . HOH C 3 .  ? 24.907 4.319  12.028 1.00 57.74 ? 40   HOH A O   1 
HETATM 766 O  O   . HOH C 3 .  ? 20.866 3.897  10.592 1.00 52.80 ? 41   HOH A O   1 
HETATM 767 O  O   . HOH C 3 .  ? 24.185 32.603 26.414 1.00 66.03 ? 42   HOH A O   1 
HETATM 768 O  O   . HOH C 3 .  ? 8.384  23.559 28.315 1.00 66.73 ? 43   HOH A O   1 
HETATM 769 O  O   . HOH C 3 .  ? 1.747  0.792  9.789  1.00 78.33 ? 44   HOH A O   1 
HETATM 770 O  O   . HOH C 3 .  ? 0.473  2.302  11.771 1.00 78.61 ? 45   HOH A O   1 
HETATM 771 O  O   . HOH C 3 .  ? 18.778 15.214 20.885 1.00 69.74 ? 46   HOH A O   1 
HETATM 772 O  O   . HOH C 3 .  ? 21.254 15.214 18.202 1.00 51.87 ? 47   HOH A O   1 
HETATM 773 O  O   . HOH C 3 .  ? 11.050 -1.438 16.124 1.00 48.85 ? 48   HOH A O   1 
HETATM 774 O  O   . HOH C 3 .  ? 21.536 11.698 23.836 1.00 57.02 ? 49   HOH A O   1 
HETATM 775 O  O   . HOH C 3 .  ? 25.572 6.910  11.478 1.00 59.18 ? 50   HOH A O   1 
HETATM 776 O  O   . HOH C 3 .  ? 7.255  -7.779 5.017  1.00 76.79 ? 51   HOH A O   1 
HETATM 777 O  O   . HOH C 3 .  ? 16.507 -9.125 1.488  1.00 69.69 ? 52   HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   1140 ?    ?   ?   A . n 
A 1 2   ILE 2   1141 ?    ?   ?   A . n 
A 1 3   GLN 3   1142 1142 GLN GLN A . n 
A 1 4   PRO 4   1143 1143 PRO PRO A . n 
A 1 5   VAL 5   1144 1144 VAL VAL A . n 
A 1 6   ILE 6   1145 1145 ILE ILE A . n 
A 1 7   SER 7   1146 1146 SER SER A . n 
A 1 8   ALA 8   1147 1147 ALA ALA A . n 
A 1 9   GLN 9   1148 1148 GLN GLN A . n 
A 1 10  GLU 10  1149 1149 GLU GLU A . n 
A 1 11  GLN 11  1150 1150 GLN GLN A . n 
A 1 12  GLU 12  1151 1151 GLU GLU A . n 
A 1 13  THR 13  1152 1152 THR THR A . n 
A 1 14  GLN 14  1153 1153 GLN GLN A . n 
A 1 15  ILE 15  1154 1154 ILE ILE A . n 
A 1 16  VAL 16  1155 1155 VAL VAL A . n 
A 1 17  LEU 17  1156 1156 LEU LEU A . n 
A 1 18  TYR 18  1157 1157 TYR TYR A . n 
A 1 19  GLY 19  1158 1158 GLY GLY A . n 
A 1 20  LYS 20  1159 1159 LYS LYS A . n 
A 1 21  LEU 21  1160 1160 LEU LEU A . n 
A 1 22  VAL 22  1161 1161 VAL VAL A . n 
A 1 23  GLU 23  1162 1162 GLU GLU A . n 
A 1 24  ALA 24  1163 1163 ALA ALA A . n 
A 1 25  ARG 25  1164 1164 ARG ARG A . n 
A 1 26  GLN 26  1165 1165 GLN GLN A . n 
A 1 27  LYS 27  1166 1166 LYS LYS A . n 
A 1 28  HIS 28  1167 1167 HIS HIS A . n 
A 1 29  ALA 29  1168 1168 ALA ALA A . n 
A 1 30  ASN 30  1169 1169 ASN ASN A . n 
A 1 31  LYS 31  1170 1170 LYS LYS A . n 
A 1 32  MET 32  1171 1171 MET MET A . n 
A 1 33  ASP 33  1172 1172 ASP ASP A . n 
A 1 34  VAL 34  1173 1173 VAL VAL A . n 
A 1 35  PRO 35  1174 1174 PRO PRO A . n 
A 1 36  PRO 36  1175 1175 PRO PRO A . n 
A 1 37  ALA 37  1176 1176 ALA ALA A . n 
A 1 38  ILE 38  1177 1177 ILE ILE A . n 
A 1 39  LEU 39  1178 1178 LEU LEU A . n 
A 1 40  ALA 40  1179 1179 ALA ALA A . n 
A 1 41  THR 41  1180 1180 THR THR A . n 
A 1 42  ASN 42  1181 1181 ASN ASN A . n 
A 1 43  LYS 43  1182 1182 LYS LYS A . n 
A 1 44  ILE 44  1183 1183 ILE ILE A . n 
A 1 45  LEU 45  1184 1184 LEU LEU A . n 
A 1 46  VAL 46  1185 1185 VAL VAL A . n 
A 1 47  ASP 47  1186 1186 ASP ASP A . n 
A 1 48  MET 48  1187 1187 MET MET A . n 
A 1 49  ALA 49  1188 1188 ALA ALA A . n 
A 1 50  LYS 50  1189 1189 LYS LYS A . n 
A 1 51  MET 51  1190 1190 MET MET A . n 
A 1 52  ARG 52  1191 1191 ARG ARG A . n 
A 1 53  PRO 53  1192 1192 PRO PRO A . n 
A 1 54  THR 54  1193 1193 THR THR A . n 
A 1 55  THR 55  1194 1194 THR THR A . n 
A 1 56  VAL 56  1195 1195 VAL VAL A . n 
A 1 57  GLU 57  1196 1196 GLU GLU A . n 
A 1 58  ASN 58  1197 1197 ASN ASN A . n 
A 1 59  VAL 59  1198 1198 VAL VAL A . n 
A 1 60  LYS 60  1199 1199 LYS LYS A . n 
A 1 61  ARG 61  1200 1200 ARG ARG A . n 
A 1 62  ILE 62  1201 1201 ILE ILE A . n 
A 1 63  ASP 63  1202 1202 ASP ASP A . n 
A 1 64  GLY 64  1203 1203 GLY GLY A . n 
A 1 65  VAL 65  1204 1204 VAL VAL A . n 
A 1 66  SER 66  1205 1205 SER SER A . n 
A 1 67  GLU 67  1206 1206 GLU GLU A . n 
A 1 68  GLY 68  1207 1207 GLY GLY A . n 
A 1 69  LYS 69  1208 1208 LYS LYS A . n 
A 1 70  ALA 70  1209 1209 ALA ALA A . n 
A 1 71  ALA 71  1210 1210 ALA ALA A . n 
A 1 72  MET 72  1211 1211 MET MET A . n 
A 1 73  LEU 73  1212 1212 LEU LEU A . n 
A 1 74  ALA 74  1213 1213 ALA ALA A . n 
A 1 75  PRO 75  1214 1214 PRO PRO A . n 
A 1 76  LEU 76  1215 1215 LEU LEU A . n 
A 1 77  LEU 77  1216 1216 LEU LEU A . n 
A 1 78  GLU 78  1217 1217 GLU GLU A . n 
A 1 79  VAL 79  1218 1218 VAL VAL A . n 
A 1 80  ILE 80  1219 1219 ILE ILE A . n 
A 1 81  LYS 81  1220 1220 LYS LYS A . n 
A 1 82  HIS 82  1221 1221 HIS HIS A . n 
A 1 83  PHE 83  1222 1222 PHE PHE A . n 
A 1 84  CYS 84  1223 1223 CYS CYS A . n 
A 1 85  GLN 85  1224 1224 GLN GLN A . n 
A 1 86  THR 86  1225 1225 THR THR A . n 
A 1 87  ASN 87  1226 1226 ASN ASN A . n 
A 1 88  SER 88  1227 1227 SER SER A . n 
A 1 89  VAL 89  1228 1228 VAL VAL A . n 
A 1 90  GLN 90  1229 1229 GLN GLN A . n 
A 1 91  THR 91  1230 1230 THR THR A . n 
A 1 92  ASP 92  1231 1231 ASP ASP A . n 
A 1 93  LEU 93  1232 1232 LEU LEU A . n 
A 1 94  PHE 94  1233 1233 PHE PHE A . n 
A 1 95  SER 95  1234 1234 SER SER A . n 
A 1 96  SER 96  1235 1235 SER SER A . n 
A 1 97  THR 97  1236 ?    ?   ?   A . n 
A 1 98  LYS 98  1237 ?    ?   ?   A . n 
A 1 99  PRO 99  1238 ?    ?   ?   A . n 
A 1 100 GLN 100 1239 ?    ?   ?   A . n 
A 1 101 GLU 101 1240 ?    ?   ?   A . n 
A 1 102 GLU 102 1241 ?    ?   ?   A . n 
A 1 103 GLN 103 1242 ?    ?   ?   A . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PQS  monomeric 1 
2 software_defined_assembly            PISA dimeric   2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,C 
2 1,2 A,B,C 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
2 'ABSA (A^2)' 1070  ? 
2 MORE         -19   ? 
2 'SSA (A^2)'  10800 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z        1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 12_555 x,x-y,-z+1/3 0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 45.5610000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    CL 
_pdbx_struct_special_symmetry.auth_seq_id     101 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   B 
_pdbx_struct_special_symmetry.label_comp_id   CL 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-12-12 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' . ? 1 
PHASER   phasing           . ? 2 
CNS      refinement        . ? 3 
HKL-2000 'data reduction'  . ? 4 
HKL-2000 'data scaling'    . ? 5 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CD A GLU 1196 ? ? OE1 A GLU 1196 ? ? 1.351 1.252 0.099 0.011 N 
2 1 CD A GLU 1196 ? ? OE2 A GLU 1196 ? ? 1.366 1.252 0.114 0.011 N 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    SER 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     1227 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -103.97 
_pdbx_validate_torsion.psi             69.73 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY 1140 ? A GLY 1   
2 1 Y 1 A ILE 1141 ? A ILE 2   
3 1 Y 1 A THR 1236 ? A THR 97  
4 1 Y 1 A LYS 1237 ? A LYS 98  
5 1 Y 1 A PRO 1238 ? A PRO 99  
6 1 Y 1 A GLN 1239 ? A GLN 100 
7 1 Y 1 A GLU 1240 ? A GLU 101 
8 1 Y 1 A GLU 1241 ? A GLU 102 
9 1 Y 1 A GLN 1242 ? A GLN 103 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CHLORIDE ION' CL  
3 water          HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CL  1  101 101 CL  CL  A . 
C 3 HOH 1  1   1   HOH HOH A . 
C 3 HOH 2  2   2   HOH HOH A . 
C 3 HOH 3  3   3   HOH HOH A . 
C 3 HOH 4  4   4   HOH HOH A . 
C 3 HOH 5  5   5   HOH HOH A . 
C 3 HOH 6  6   6   HOH HOH A . 
C 3 HOH 7  7   7   HOH HOH A . 
C 3 HOH 8  8   8   HOH HOH A . 
C 3 HOH 9  9   9   HOH HOH A . 
C 3 HOH 10 10  10  HOH HOH A . 
C 3 HOH 11 11  11  HOH HOH A . 
C 3 HOH 12 12  12  HOH HOH A . 
C 3 HOH 13 13  13  HOH HOH A . 
C 3 HOH 14 14  14  HOH HOH A . 
C 3 HOH 15 15  15  HOH HOH A . 
C 3 HOH 16 16  16  HOH HOH A . 
C 3 HOH 17 17  17  HOH HOH A . 
C 3 HOH 18 18  18  HOH HOH A . 
C 3 HOH 19 19  19  HOH HOH A . 
C 3 HOH 20 20  20  HOH HOH A . 
C 3 HOH 21 21  21  HOH HOH A . 
C 3 HOH 22 22  22  HOH HOH A . 
C 3 HOH 23 23  23  HOH HOH A . 
C 3 HOH 24 24  24  HOH HOH A . 
C 3 HOH 25 25  25  HOH HOH A . 
C 3 HOH 26 26  26  HOH HOH A . 
C 3 HOH 27 27  27  HOH HOH A . 
C 3 HOH 28 28  28  HOH HOH A . 
C 3 HOH 29 29  29  HOH HOH A . 
C 3 HOH 30 30  30  HOH HOH A . 
C 3 HOH 31 31  31  HOH HOH A . 
C 3 HOH 32 32  32  HOH HOH A . 
C 3 HOH 33 33  33  HOH HOH A . 
C 3 HOH 34 34  34  HOH HOH A . 
C 3 HOH 35 35  35  HOH HOH A . 
C 3 HOH 36 36  36  HOH HOH A . 
C 3 HOH 37 37  37  HOH HOH A . 
C 3 HOH 38 38  38  HOH HOH A . 
C 3 HOH 39 39  39  HOH HOH A . 
C 3 HOH 40 40  40  HOH HOH A . 
C 3 HOH 41 41  41  HOH HOH A . 
C 3 HOH 42 42  42  HOH HOH A . 
C 3 HOH 43 43  43  HOH HOH A . 
C 3 HOH 44 44  44  HOH HOH A . 
C 3 HOH 45 45  45  HOH HOH A . 
C 3 HOH 46 46  46  HOH HOH A . 
C 3 HOH 47 47  47  HOH HOH A . 
C 3 HOH 48 48  48  HOH HOH A . 
C 3 HOH 49 49  49  HOH HOH A . 
C 3 HOH 50 50  50  HOH HOH A . 
C 3 HOH 51 51  51  HOH HOH A . 
C 3 HOH 52 52  52  HOH HOH A . 
#