data_2E3H
# 
_entry.id   2E3H 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2E3H         
RCSB  RCSB026177   
WWPDB D_1000026177 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2E3I 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2E3H 
_pdbx_database_status.recvd_initial_deposition_date   2006-11-26 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Maesaki, R.'   1 
'Hakoshima, T.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.Usa 
_citation.journal_volume            104 
_citation.page_first                10346 
_citation.page_last                 10351 
_citation.year                      2007 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17563362 
_citation.pdbx_database_id_DOI      10.1073/pnas.0703876104 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Mishima, M.'   1 
primary 'Maesaki, R.'   2 
primary 'Kasa, M.'      3 
primary 'Watanabe, T.'  4 
primary 'Fukata, M.'    5 
primary 'Kaibuchi, K.'  6 
primary 'Hakoshima, T.' 7 
# 
_cell.entry_id           2E3H 
_cell.length_a           54.937 
_cell.length_b           54.937 
_cell.length_c           57.270 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2E3H 
_symmetry.space_group_name_H-M             'P 32 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                154 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man Restin 9681.208 1   ? ? 'CAP-Gly domain 2' ? 
2 water   nat water  18.015   119 ? ? ?                  ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;CLIP-170, Cytoplasmic linker protein 170 alpha-2, Reed- Sternberg intermediate filament-associated protein, Cytoplasmic linker protein 1
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ELKIGDRVLVGGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPSTTPAK
AKANAVRRVM
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ELKIGDRVLVGGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPSTTPAK
AKANAVRRVM
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLU n 
1 2  LEU n 
1 3  LYS n 
1 4  ILE n 
1 5  GLY n 
1 6  ASP n 
1 7  ARG n 
1 8  VAL n 
1 9  LEU n 
1 10 VAL n 
1 11 GLY n 
1 12 GLY n 
1 13 THR n 
1 14 LYS n 
1 15 ALA n 
1 16 GLY n 
1 17 VAL n 
1 18 VAL n 
1 19 ARG n 
1 20 PHE n 
1 21 LEU n 
1 22 GLY n 
1 23 GLU n 
1 24 THR n 
1 25 ASP n 
1 26 PHE n 
1 27 ALA n 
1 28 LYS n 
1 29 GLY n 
1 30 GLU n 
1 31 TRP n 
1 32 CYS n 
1 33 GLY n 
1 34 VAL n 
1 35 GLU n 
1 36 LEU n 
1 37 ASP n 
1 38 GLU n 
1 39 PRO n 
1 40 LEU n 
1 41 GLY n 
1 42 LYS n 
1 43 ASN n 
1 44 ASP n 
1 45 GLY n 
1 46 ALA n 
1 47 VAL n 
1 48 ALA n 
1 49 GLY n 
1 50 THR n 
1 51 ARG n 
1 52 TYR n 
1 53 PHE n 
1 54 GLN n 
1 55 CYS n 
1 56 GLN n 
1 57 PRO n 
1 58 LYS n 
1 59 TYR n 
1 60 GLY n 
1 61 LEU n 
1 62 PHE n 
1 63 ALA n 
1 64 PRO n 
1 65 VAL n 
1 66 HIS n 
1 67 LYS n 
1 68 VAL n 
1 69 THR n 
1 70 LYS n 
1 71 ILE n 
1 72 GLY n 
1 73 PHE n 
1 74 PRO n 
1 75 SER n 
1 76 THR n 
1 77 THR n 
1 78 PRO n 
1 79 ALA n 
1 80 LYS n 
1 81 ALA n 
1 82 LYS n 
1 83 ALA n 
1 84 ASN n 
1 85 ALA n 
1 86 VAL n 
1 87 ARG n 
1 88 ARG n 
1 89 VAL n 
1 90 MET n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 CLIP-170 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX4T 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    REST_HUMAN 
_struct_ref.pdbx_db_accession          P30622 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;ELKIGDRVLVGGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPSTTPAK
AKANAVRRVM
;
_struct_ref.pdbx_align_begin           211 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2E3H 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 90 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P30622 
_struct_ref_seq.db_align_beg                  211 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  300 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       211 
_struct_ref_seq.pdbx_auth_seq_align_end       300 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2E3H 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.58 
_exptl_crystal.density_percent_sol   52.24 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    'pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAC Science DIP-2040' 
_diffrn_detector.pdbx_collection_date   2004-02-08 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL44XU' 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
_diffrn_source.pdbx_synchrotron_beamline   BL44XU 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9 
# 
_reflns.entry_id                     2E3H 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            1.45 
_reflns.d_resolution_low             50.0 
_reflns.number_all                   ? 
_reflns.number_obs                   17953 
_reflns.percent_possible_obs         98.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.042 
_reflns.pdbx_netI_over_sigmaI        44.3 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.45 
_reflns_shell.d_res_low              1.56 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.107 
_reflns_shell.meanI_over_sigI_obs    11.5 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2E3H 
_refine.ls_number_reflns_obs                     17032 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             47.67 
_refine.ls_d_res_high                            1.45 
_refine.ls_percent_reflns_obs                    98.97 
_refine.ls_R_factor_obs                          0.19281 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19168 
_refine.ls_R_factor_R_free                       0.21483 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  915 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.961 
_refine.correlation_coeff_Fo_to_Fc_free          0.951 
_refine.B_iso_mean                               22.472 
_refine.aniso_B[1][1]                            -0.22 
_refine.aniso_B[2][2]                            -0.22 
_refine.aniso_B[3][3]                            0.33 
_refine.aniso_B[1][2]                            -0.11 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      1LPL 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.067 
_refine.pdbx_overall_ESU_R_Free                  0.068 
_refine.overall_SU_ML                            0.037 
_refine.overall_SU_B                             0.922 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        651 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             119 
_refine_hist.number_atoms_total               770 
_refine_hist.d_res_high                       1.45 
_refine_hist.d_res_low                        47.67 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.011  0.022  ? 663 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.356  1.969  ? 891 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.281  5.000  ? 79  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       28.725 22.759 ? 29  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.253 15.000 ? 124 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       17.419 15.000 ? 6   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.092  0.200  ? 100 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.006  0.020  ? 485 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.199  0.200  ? 275 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.310  0.200  ? 437 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.157  0.200  ? 97  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.173  0.200  ? 48  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.125  0.200  ? 18  'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.221  1.500  ? 413 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.849  2.000  ? 652 'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.464  3.000  ? 279 'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.574  4.500  ? 239 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?   'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.451 
_refine_ls_shell.d_res_low                        1.488 
_refine_ls_shell.number_reflns_R_work             1262 
_refine_ls_shell.R_factor_R_work                  0.199 
_refine_ls_shell.percent_reflns_obs               99.92 
_refine_ls_shell.R_factor_R_free                  0.245 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             68 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2E3H 
_struct.title                     'Crystal structure of the CLIP-170 CAP-Gly domain 2' 
_struct.pdbx_descriptor           Restin 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2E3H 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN' 
_struct_keywords.text            'CAP-Gly, Cytoplasmic linker, tubulin binding, STRUCTURAL PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY A 60 ? PRO A 64 ? GLY A 270 PRO A 274 
A 2 GLU A 30 ? LEU A 36 ? GLU A 240 LEU A 246 
A 3 LYS A 14 ? GLU A 23 ? LYS A 224 GLU A 233 
A 4 ARG A 7  ? VAL A 10 ? ARG A 217 VAL A 220 
A 5 VAL A 68 ? LYS A 70 ? VAL A 278 LYS A 280 
B 1 ALA A 46 ? VAL A 47 ? ALA A 256 VAL A 257 
B 2 THR A 50 ? ARG A 51 ? THR A 260 ARG A 261 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LEU A 61 ? O LEU A 271 N VAL A 34 ? N VAL A 244 
A 2 3 O GLY A 33 ? O GLY A 243 N ARG A 19 ? N ARG A 229 
A 3 4 O GLY A 16 ? O GLY A 226 N VAL A 8  ? N VAL A 218 
A 4 5 N LEU A 9  ? N LEU A 219 O THR A 69 ? O THR A 279 
B 1 2 N VAL A 47 ? N VAL A 257 O THR A 50 ? O THR A 260 
# 
_database_PDB_matrix.entry_id          2E3H 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2E3H 
_atom_sites.fract_transf_matrix[1][1]   0.018203 
_atom_sites.fract_transf_matrix[1][2]   0.010509 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.021019 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.017461 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N N   . GLU A 1 1  ? 13.270 12.109 4.924  1.00 34.50 ? 211 GLU A N   1 
ATOM   2   C CA  . GLU A 1 1  ? 13.360 11.941 6.403  1.00 34.11 ? 211 GLU A CA  1 
ATOM   3   C C   . GLU A 1 1  ? 14.254 10.754 6.748  1.00 32.11 ? 211 GLU A C   1 
ATOM   4   O O   . GLU A 1 1  ? 14.383 9.809  5.960  1.00 32.73 ? 211 GLU A O   1 
ATOM   5   C CB  . GLU A 1 1  ? 11.971 11.745 7.026  1.00 34.32 ? 211 GLU A CB  1 
ATOM   6   C CG  . GLU A 1 1  ? 11.283 10.438 6.645  1.00 36.68 ? 211 GLU A CG  1 
ATOM   7   C CD  . GLU A 1 1  ? 10.085 10.112 7.522  1.00 36.86 ? 211 GLU A CD  1 
ATOM   8   O OE1 . GLU A 1 1  ? 9.735  10.928 8.408  1.00 41.40 ? 211 GLU A OE1 1 
ATOM   9   O OE2 . GLU A 1 1  ? 9.491  9.028  7.326  1.00 41.21 ? 211 GLU A OE2 1 
ATOM   10  N N   . LEU A 1 2  ? 14.854 10.804 7.934  1.00 29.72 ? 212 LEU A N   1 
ATOM   11  C CA  . LEU A 1 2  ? 15.775 9.762  8.354  1.00 27.15 ? 212 LEU A CA  1 
ATOM   12  C C   . LEU A 1 2  ? 15.052 8.472  8.694  1.00 25.48 ? 212 LEU A C   1 
ATOM   13  O O   . LEU A 1 2  ? 13.973 8.475  9.297  1.00 25.03 ? 212 LEU A O   1 
ATOM   14  C CB  . LEU A 1 2  ? 16.622 10.212 9.553  1.00 27.18 ? 212 LEU A CB  1 
ATOM   15  C CG  . LEU A 1 2  ? 17.523 11.440 9.419  1.00 27.93 ? 212 LEU A CG  1 
ATOM   16  C CD1 . LEU A 1 2  ? 18.042 11.823 10.788 1.00 29.51 ? 212 LEU A CD1 1 
ATOM   17  C CD2 . LEU A 1 2  ? 18.682 11.195 8.471  1.00 28.71 ? 212 LEU A CD2 1 
ATOM   18  N N   . LYS A 1 3  ? 15.692 7.373  8.320  1.00 23.42 ? 213 LYS A N   1 
ATOM   19  C CA  . LYS A 1 3  ? 15.206 6.023  8.574  1.00 22.66 ? 213 LYS A CA  1 
ATOM   20  C C   . LYS A 1 3  ? 16.327 5.201  9.195  1.00 21.07 ? 213 LYS A C   1 
ATOM   21  O O   . LYS A 1 3  ? 17.503 5.425  8.911  1.00 19.43 ? 213 LYS A O   1 
ATOM   22  C CB  . LYS A 1 3  ? 14.789 5.336  7.263  1.00 23.35 ? 213 LYS A CB  1 
ATOM   23  C CG  . LYS A 1 3  ? 13.546 5.892  6.602  1.00 27.10 ? 213 LYS A CG  1 
ATOM   24  C CD  . LYS A 1 3  ? 13.351 5.232  5.254  1.00 31.78 ? 213 LYS A CD  1 
ATOM   25  C CE  . LYS A 1 3  ? 12.024 5.613  4.624  1.00 35.22 ? 213 LYS A CE  1 
ATOM   26  N NZ  . LYS A 1 3  ? 11.980 5.242  3.182  1.00 38.17 ? 213 LYS A NZ  1 
ATOM   27  N N   . ILE A 1 4  ? 15.959 4.229  10.022 1.00 19.71 ? 214 ILE A N   1 
ATOM   28  C CA  . ILE A 1 4  ? 16.925 3.232  10.460 1.00 18.87 ? 214 ILE A CA  1 
ATOM   29  C C   . ILE A 1 4  ? 17.573 2.629  9.204  1.00 18.38 ? 214 ILE A C   1 
ATOM   30  O O   . ILE A 1 4  ? 16.915 2.374  8.186  1.00 18.33 ? 214 ILE A O   1 
ATOM   31  C CB  . ILE A 1 4  ? 16.298 2.183  11.411 1.00 19.51 ? 214 ILE A CB  1 
ATOM   32  C CG1 . ILE A 1 4  ? 15.980 2.845  12.774 1.00 21.74 ? 214 ILE A CG1 1 
ATOM   33  C CG2 . ILE A 1 4  ? 17.222 0.971  11.578 1.00 19.76 ? 214 ILE A CG2 1 
ATOM   34  C CD1 . ILE A 1 4  ? 14.915 2.135  13.591 1.00 25.88 ? 214 ILE A CD1 1 
ATOM   35  N N   . GLY A 1 5  ? 18.884 2.447  9.273  1.00 15.88 ? 215 GLY A N   1 
ATOM   36  C CA  . GLY A 1 5  ? 19.644 1.936  8.143  1.00 16.59 ? 215 GLY A CA  1 
ATOM   37  C C   . GLY A 1 5  ? 20.276 2.970  7.237  1.00 16.34 ? 215 GLY A C   1 
ATOM   38  O O   . GLY A 1 5  ? 21.088 2.626  6.369  1.00 16.90 ? 215 GLY A O   1 
ATOM   39  N N   . ASP A 1 6  ? 19.917 4.242  7.401  1.00 15.98 ? 216 ASP A N   1 
ATOM   40  C CA  . ASP A 1 6  ? 20.479 5.270  6.549  1.00 15.92 ? 216 ASP A CA  1 
ATOM   41  C C   . ASP A 1 6  ? 21.931 5.577  6.874  1.00 14.77 ? 216 ASP A C   1 
ATOM   42  O O   . ASP A 1 6  ? 22.322 5.572  8.061  1.00 15.17 ? 216 ASP A O   1 
ATOM   43  C CB  . ASP A 1 6  ? 19.663 6.562  6.673  1.00 16.47 ? 216 ASP A CB  1 
ATOM   44  C CG  . ASP A 1 6  ? 18.303 6.486  5.982  1.00 19.75 ? 216 ASP A CG  1 
ATOM   45  O OD1 . ASP A 1 6  ? 18.005 5.541  5.212  1.00 21.40 ? 216 ASP A OD1 1 
ATOM   46  O OD2 . ASP A 1 6  ? 17.530 7.426  6.221  1.00 21.04 ? 216 ASP A OD2 1 
ATOM   47  N N   . ARG A 1 7  ? 22.723 5.863  5.845  0.50 11.87 ? 217 ARG A N   1 
ATOM   48  C CA  . ARG A 1 7  ? 24.100 6.331  5.993  0.50 12.33 ? 217 ARG A CA  1 
ATOM   49  C C   . ARG A 1 7  ? 24.081 7.817  6.248  0.50 11.84 ? 217 ARG A C   1 
ATOM   50  O O   . ARG A 1 7  ? 23.470 8.570  5.497  0.50 11.09 ? 217 ARG A O   1 
ATOM   51  C CB  A ARG A 1 7  ? 24.900 6.006  4.737  0.50 13.30 ? 217 ARG A CB  1 
ATOM   52  C CB  B ARG A 1 7  ? 24.942 6.075  4.730  0.50 14.23 ? 217 ARG A CB  1 
ATOM   53  C CG  A ARG A 1 7  ? 25.093 4.498  4.568  0.50 10.84 ? 217 ARG A CG  1 
ATOM   54  C CG  B ARG A 1 7  ? 25.688 4.737  4.733  0.50 17.91 ? 217 ARG A CG  1 
ATOM   55  C CD  A ARG A 1 7  ? 26.166 3.954  5.558  0.50 10.37 ? 217 ARG A CD  1 
ATOM   56  C CD  B ARG A 1 7  ? 27.189 4.925  4.426  0.50 22.25 ? 217 ARG A CD  1 
ATOM   57  N NE  A ARG A 1 7  ? 27.480 4.583  5.384  0.50 9.87  ? 217 ARG A NE  1 
ATOM   58  N NE  B ARG A 1 7  ? 27.456 5.032  2.991  0.50 25.42 ? 217 ARG A NE  1 
ATOM   59  C CZ  A ARG A 1 7  ? 28.494 4.502  6.242  0.50 9.58  ? 217 ARG A CZ  1 
ATOM   60  C CZ  B ARG A 1 7  ? 28.527 5.612  2.451  0.50 25.17 ? 217 ARG A CZ  1 
ATOM   61  N NH1 A ARG A 1 7  ? 28.378 3.808  7.354  0.50 10.28 ? 217 ARG A NH1 1 
ATOM   62  N NH1 B ARG A 1 7  ? 29.461 6.171  3.197  0.50 26.88 ? 217 ARG A NH1 1 
ATOM   63  N NH2 A ARG A 1 7  ? 29.631 5.129  5.991  0.50 10.56 ? 217 ARG A NH2 1 
ATOM   64  N NH2 B ARG A 1 7  ? 28.654 5.632  1.139  0.50 27.89 ? 217 ARG A NH2 1 
ATOM   65  N N   . VAL A 1 8  ? 24.781 8.244  7.296  1.00 13.85 ? 218 VAL A N   1 
ATOM   66  C CA  . VAL A 1 8  ? 24.690 9.615  7.779  1.00 14.67 ? 218 VAL A CA  1 
ATOM   67  C C   . VAL A 1 8  ? 26.032 10.159 8.237  1.00 14.73 ? 218 VAL A C   1 
ATOM   68  O O   . VAL A 1 8  ? 26.971 9.398  8.518  1.00 14.89 ? 218 VAL A O   1 
ATOM   69  C CB  . VAL A 1 8  ? 23.681 9.749  8.961  1.00 14.52 ? 218 VAL A CB  1 
ATOM   70  C CG1 . VAL A 1 8  ? 22.267 9.420  8.508  1.00 16.36 ? 218 VAL A CG1 1 
ATOM   71  C CG2 . VAL A 1 8  ? 24.115 8.885  10.152 1.00 14.75 ? 218 VAL A CG2 1 
ATOM   72  N N   . LEU A 1 9  ? 26.089 11.488 8.361  1.00 15.30 ? 219 LEU A N   1 
ATOM   73  C CA  . LEU A 1 9  ? 27.116 12.179 9.119  1.00 15.89 ? 219 LEU A CA  1 
ATOM   74  C C   . LEU A 1 9  ? 26.488 12.752 10.379 1.00 16.11 ? 219 LEU A C   1 
ATOM   75  O O   . LEU A 1 9  ? 25.348 13.253 10.349 1.00 17.05 ? 219 LEU A O   1 
ATOM   76  C CB  . LEU A 1 9  ? 27.698 13.340 8.308  1.00 17.16 ? 219 LEU A CB  1 
ATOM   77  C CG  . LEU A 1 9  ? 28.425 12.989 7.017  1.00 18.42 ? 219 LEU A CG  1 
ATOM   78  C CD1 . LEU A 1 9  ? 28.886 14.254 6.331  1.00 20.53 ? 219 LEU A CD1 1 
ATOM   79  C CD2 . LEU A 1 9  ? 29.601 12.092 7.296  1.00 22.41 ? 219 LEU A CD2 1 
ATOM   80  N N   . VAL A 1 10 ? 27.232 12.664 11.475 1.00 16.17 ? 220 VAL A N   1 
ATOM   81  C CA  . VAL A 1 10 ? 26.849 13.330 12.718 1.00 16.88 ? 220 VAL A CA  1 
ATOM   82  C C   . VAL A 1 10 ? 27.687 14.609 12.864 1.00 16.71 ? 220 VAL A C   1 
ATOM   83  O O   . VAL A 1 10 ? 28.907 14.555 12.818 1.00 17.54 ? 220 VAL A O   1 
ATOM   84  C CB  . VAL A 1 10 ? 27.056 12.422 13.939 1.00 16.58 ? 220 VAL A CB  1 
ATOM   85  C CG1 . VAL A 1 10 ? 26.592 13.126 15.202 1.00 18.23 ? 220 VAL A CG1 1 
ATOM   86  C CG2 . VAL A 1 10 ? 26.318 11.077 13.744 1.00 18.53 ? 220 VAL A CG2 1 
ATOM   87  N N   . GLY A 1 11 ? 27.008 15.751 12.984 1.00 17.48 ? 221 GLY A N   1 
ATOM   88  C CA  . GLY A 1 11 ? 27.695 17.031 13.114 1.00 18.15 ? 221 GLY A CA  1 
ATOM   89  C C   . GLY A 1 11 ? 28.530 17.375 11.887 1.00 17.63 ? 221 GLY A C   1 
ATOM   90  O O   . GLY A 1 11 ? 29.448 18.188 11.966 1.00 18.59 ? 221 GLY A O   1 
ATOM   91  N N   . GLY A 1 12 ? 28.212 16.749 10.757 1.00 17.38 ? 222 GLY A N   1 
ATOM   92  C CA  . GLY A 1 12 ? 29.000 16.922 9.545  1.00 17.73 ? 222 GLY A CA  1 
ATOM   93  C C   . GLY A 1 12 ? 30.402 16.319 9.584  1.00 16.98 ? 222 GLY A C   1 
ATOM   94  O O   . GLY A 1 12 ? 31.150 16.516 8.646  1.00 17.73 ? 222 GLY A O   1 
ATOM   95  N N   . THR A 1 13 ? 30.786 15.606 10.648 1.00 16.30 ? 223 THR A N   1 
ATOM   96  C CA  . THR A 1 13 ? 32.181 15.192 10.817 1.00 16.55 ? 223 THR A CA  1 
ATOM   97  C C   . THR A 1 13 ? 32.445 13.689 10.947 1.00 16.61 ? 223 THR A C   1 
ATOM   98  O O   . THR A 1 13 ? 33.583 13.271 10.765 1.00 17.73 ? 223 THR A O   1 
ATOM   99  C CB  . THR A 1 13 ? 32.835 15.871 12.036 1.00 17.54 ? 223 THR A CB  1 
ATOM   100 O OG1 . THR A 1 13 ? 32.104 15.533 13.214 1.00 20.16 ? 223 THR A OG1 1 
ATOM   101 C CG2 . THR A 1 13 ? 32.859 17.370 11.864 1.00 17.52 ? 223 THR A CG2 1 
ATOM   102 N N   . LYS A 1 14 ? 31.425 12.899 11.281 0.50 13.85 ? 224 LYS A N   1 
ATOM   103 C CA  . LYS A 1 14 ? 31.623 11.483 11.643 0.50 14.67 ? 224 LYS A CA  1 
ATOM   104 C C   . LYS A 1 14 ? 30.590 10.642 10.888 0.50 13.12 ? 224 LYS A C   1 
ATOM   105 O O   . LYS A 1 14 ? 29.399 10.866 11.053 0.50 11.98 ? 224 LYS A O   1 
ATOM   106 C CB  A LYS A 1 14 ? 31.434 11.277 13.153 0.50 15.34 ? 224 LYS A CB  1 
ATOM   107 C CB  B LYS A 1 14 ? 31.484 11.284 13.157 0.50 15.51 ? 224 LYS A CB  1 
ATOM   108 C CG  A LYS A 1 14 ? 32.332 12.124 14.057 0.50 16.02 ? 224 LYS A CG  1 
ATOM   109 C CG  B LYS A 1 14 ? 32.606 11.911 13.995 0.50 17.20 ? 224 LYS A CG  1 
ATOM   110 C CD  A LYS A 1 14 ? 31.944 11.977 15.527 0.50 15.96 ? 224 LYS A CD  1 
ATOM   111 C CD  B LYS A 1 14 ? 32.275 11.900 15.489 0.50 17.61 ? 224 LYS A CD  1 
ATOM   112 C CE  A LYS A 1 14 ? 32.928 12.696 16.425 0.50 16.30 ? 224 LYS A CE  1 
ATOM   113 C CE  B LYS A 1 14 ? 31.744 13.247 15.981 0.50 22.87 ? 224 LYS A CE  1 
ATOM   114 N NZ  A LYS A 1 14 ? 32.809 14.158 16.204 0.50 16.59 ? 224 LYS A NZ  1 
ATOM   115 N NZ  B LYS A 1 14 ? 30.504 13.759 15.315 0.50 25.65 ? 224 LYS A NZ  1 
ATOM   116 N N   . ALA A 1 15 ? 31.036 9.705  10.051 1.00 14.75 ? 225 ALA A N   1 
ATOM   117 C CA  . ALA A 1 15 ? 30.101 8.885  9.268  1.00 14.08 ? 225 ALA A CA  1 
ATOM   118 C C   . ALA A 1 15 ? 29.644 7.637  10.017 1.00 14.27 ? 225 ALA A C   1 
ATOM   119 O O   . ALA A 1 15 ? 30.409 7.027  10.764 1.00 14.26 ? 225 ALA A O   1 
ATOM   120 C CB  . ALA A 1 15 ? 30.726 8.473  7.932  1.00 15.69 ? 225 ALA A CB  1 
ATOM   121 N N   . GLY A 1 16 ? 28.410 7.242  9.772  1.00 13.16 ? 226 GLY A N   1 
ATOM   122 C CA  . GLY A 1 16 ? 27.901 6.024  10.372 1.00 13.59 ? 226 GLY A CA  1 
ATOM   123 C C   . GLY A 1 16 ? 26.550 5.648  9.800  1.00 13.38 ? 226 GLY A C   1 
ATOM   124 O O   . GLY A 1 16 ? 26.129 6.171  8.752  1.00 13.50 ? 226 GLY A O   1 
ATOM   125 N N   . VAL A 1 17 ? 25.875 4.741  10.503 1.00 12.73 ? 227 VAL A N   1 
ATOM   126 C CA  . VAL A 1 17 ? 24.566 4.238  10.100 1.00 13.04 ? 227 VAL A CA  1 
ATOM   127 C C   . VAL A 1 17 ? 23.551 4.432  11.233 1.00 13.19 ? 227 VAL A C   1 
ATOM   128 O O   . VAL A 1 17 ? 23.893 4.259  12.420 1.00 13.38 ? 227 VAL A O   1 
ATOM   129 C CB  . VAL A 1 17 ? 24.633 2.746  9.674  1.00 13.12 ? 227 VAL A CB  1 
ATOM   130 C CG1 . VAL A 1 17 ? 25.059 1.856  10.798 1.00 13.77 ? 227 VAL A CG1 1 
ATOM   131 C CG2 . VAL A 1 17 ? 23.302 2.271  9.070  1.00 15.31 ? 227 VAL A CG2 1 
ATOM   132 N N   . VAL A 1 18 ? 22.323 4.798  10.878 1.00 13.95 ? 228 VAL A N   1 
ATOM   133 C CA  . VAL A 1 18 ? 21.282 4.967  11.874 1.00 14.06 ? 228 VAL A CA  1 
ATOM   134 C C   . VAL A 1 18 ? 20.866 3.585  12.382 1.00 13.81 ? 228 VAL A C   1 
ATOM   135 O O   . VAL A 1 18 ? 20.410 2.733  11.602 1.00 14.67 ? 228 VAL A O   1 
ATOM   136 C CB  . VAL A 1 18 ? 20.070 5.713  11.295 1.00 14.00 ? 228 VAL A CB  1 
ATOM   137 C CG1 . VAL A 1 18 ? 18.981 5.833  12.365 1.00 15.66 ? 228 VAL A CG1 1 
ATOM   138 C CG2 . VAL A 1 18 ? 20.499 7.094  10.795 1.00 14.86 ? 228 VAL A CG2 1 
ATOM   139 N N   . ARG A 1 19 ? 21.011 3.376  13.685 1.00 14.14 ? 229 ARG A N   1 
ATOM   140 C CA  . ARG A 1 19 ? 20.611 2.126  14.317 1.00 14.49 ? 229 ARG A CA  1 
ATOM   141 C C   . ARG A 1 19 ? 19.334 2.267  15.129 1.00 15.16 ? 229 ARG A C   1 
ATOM   142 O O   . ARG A 1 19 ? 18.694 1.262  15.451 1.00 15.73 ? 229 ARG A O   1 
ATOM   143 C CB  . ARG A 1 19 ? 21.696 1.638  15.269 1.00 15.62 ? 229 ARG A CB  1 
ATOM   144 C CG  . ARG A 1 19 ? 23.086 1.432  14.655 1.00 15.48 ? 229 ARG A CG  1 
ATOM   145 C CD  . ARG A 1 19 ? 23.195 0.187  13.729 1.00 15.13 ? 229 ARG A CD  1 
ATOM   146 N NE  . ARG A 1 19 ? 22.526 -0.958 14.346 1.00 15.98 ? 229 ARG A NE  1 
ATOM   147 C CZ  . ARG A 1 19 ? 22.972 -1.652 15.394 1.00 15.64 ? 229 ARG A CZ  1 
ATOM   148 N NH1 . ARG A 1 19 ? 24.169 -1.448 15.928 1.00 15.62 ? 229 ARG A NH1 1 
ATOM   149 N NH2 . ARG A 1 19 ? 22.196 -2.587 15.915 1.00 18.17 ? 229 ARG A NH2 1 
ATOM   150 N N   . PHE A 1 20 ? 18.962 3.506  15.448 1.00 14.34 ? 230 PHE A N   1 
ATOM   151 C CA  . PHE A 1 20 ? 17.856 3.791  16.385 1.00 14.65 ? 230 PHE A CA  1 
ATOM   152 C C   . PHE A 1 20 ? 17.311 5.168  16.074 1.00 15.07 ? 230 PHE A C   1 
ATOM   153 O O   . PHE A 1 20 ? 18.071 6.099  15.788 1.00 14.60 ? 230 PHE A O   1 
ATOM   154 C CB  . PHE A 1 20 ? 18.359 3.715  17.833 1.00 15.31 ? 230 PHE A CB  1 
ATOM   155 C CG  . PHE A 1 20 ? 17.403 4.284  18.856 1.00 15.43 ? 230 PHE A CG  1 
ATOM   156 C CD1 . PHE A 1 20 ? 16.408 3.488  19.432 1.00 16.84 ? 230 PHE A CD1 1 
ATOM   157 C CD2 . PHE A 1 20 ? 17.504 5.619  19.245 1.00 15.02 ? 230 PHE A CD2 1 
ATOM   158 C CE1 . PHE A 1 20 ? 15.505 4.031  20.386 1.00 16.83 ? 230 PHE A CE1 1 
ATOM   159 C CE2 . PHE A 1 20 ? 16.609 6.177  20.200 1.00 15.81 ? 230 PHE A CE2 1 
ATOM   160 C CZ  . PHE A 1 20 ? 15.627 5.382  20.760 1.00 16.61 ? 230 PHE A CZ  1 
ATOM   161 N N   . LEU A 1 21 ? 15.988 5.303  16.139 1.00 15.32 ? 231 LEU A N   1 
ATOM   162 C CA  . LEU A 1 21 ? 15.316 6.590  16.001 1.00 17.22 ? 231 LEU A CA  1 
ATOM   163 C C   . LEU A 1 21 ? 14.124 6.576  16.923 1.00 17.21 ? 231 LEU A C   1 
ATOM   164 O O   . LEU A 1 21 ? 13.194 5.819  16.711 1.00 18.80 ? 231 LEU A O   1 
ATOM   165 C CB  . LEU A 1 21 ? 14.801 6.773  14.583 1.00 19.19 ? 231 LEU A CB  1 
ATOM   166 C CG  . LEU A 1 21 ? 15.721 7.323  13.517 1.00 22.87 ? 231 LEU A CG  1 
ATOM   167 C CD1 . LEU A 1 21 ? 15.057 7.100  12.166 1.00 25.35 ? 231 LEU A CD1 1 
ATOM   168 C CD2 . LEU A 1 21 ? 15.984 8.809  13.717 1.00 24.96 ? 231 LEU A CD2 1 
ATOM   169 N N   . GLY A 1 22 ? 14.143 7.393  17.962 1.00 16.41 ? 232 GLY A N   1 
ATOM   170 C CA  . GLY A 1 22 ? 13.028 7.385  18.902 1.00 17.72 ? 232 GLY A CA  1 
ATOM   171 C C   . GLY A 1 22 ? 13.248 8.216  20.139 1.00 18.12 ? 232 GLY A C   1 
ATOM   172 O O   . GLY A 1 22 ? 14.238 8.949  20.281 1.00 17.60 ? 232 GLY A O   1 
ATOM   173 N N   . GLU A 1 23 ? 12.294 8.094  21.034 1.00 18.35 ? 233 GLU A N   1 
ATOM   174 C CA  . GLU A 1 23 ? 12.367 8.788  22.312 1.00 19.72 ? 233 GLU A CA  1 
ATOM   175 C C   . GLU A 1 23 ? 13.380 8.119  23.228 1.00 17.83 ? 233 GLU A C   1 
ATOM   176 O O   . GLU A 1 23 ? 13.672 6.920  23.101 1.00 18.22 ? 233 GLU A O   1 
ATOM   177 C CB  . GLU A 1 23 ? 10.971 8.856  22.949 1.00 20.23 ? 233 GLU A CB  1 
ATOM   178 C CG  . GLU A 1 23 ? 10.026 9.785  22.168 1.00 24.17 ? 233 GLU A CG  1 
ATOM   179 C CD  . GLU A 1 23 ? 8.730  10.099 22.895 1.00 25.56 ? 233 GLU A CD  1 
ATOM   180 O OE1 . GLU A 1 23 ? 7.713  10.313 22.201 1.00 33.97 ? 233 GLU A OE1 1 
ATOM   181 O OE2 . GLU A 1 23 ? 8.728  10.141 24.145 1.00 33.57 ? 233 GLU A OE2 1 
ATOM   182 N N   . THR A 1 24 ? 13.937 8.899  24.154 1.00 17.30 ? 234 THR A N   1 
ATOM   183 C CA  . THR A 1 24 ? 14.916 8.388  25.097 1.00 16.54 ? 234 THR A CA  1 
ATOM   184 C C   . THR A 1 24 ? 14.601 8.837  26.520 1.00 16.67 ? 234 THR A C   1 
ATOM   185 O O   . THR A 1 24 ? 13.727 9.698  26.747 1.00 17.60 ? 234 THR A O   1 
ATOM   186 C CB  . THR A 1 24 ? 16.360 8.867  24.754 1.00 16.28 ? 234 THR A CB  1 
ATOM   187 O OG1 . THR A 1 24 ? 16.481 10.265 25.090 1.00 16.49 ? 234 THR A OG1 1 
ATOM   188 C CG2 . THR A 1 24 ? 16.702 8.626  23.276 1.00 18.06 ? 234 THR A CG2 1 
ATOM   189 N N   . ASP A 1 25 ? 15.342 8.272  27.463 1.00 15.72 ? 235 ASP A N   1 
ATOM   190 C CA  . ASP A 1 25 ? 15.184 8.627  28.880 1.00 16.37 ? 235 ASP A CA  1 
ATOM   191 C C   . ASP A 1 25 ? 16.101 9.751  29.318 1.00 16.76 ? 235 ASP A C   1 
ATOM   192 O O   . ASP A 1 25 ? 16.032 10.166 30.461 1.00 17.81 ? 235 ASP A O   1 
ATOM   193 C CB  . ASP A 1 25 ? 15.463 7.401  29.765 1.00 17.68 ? 235 ASP A CB  1 
ATOM   194 C CG  . ASP A 1 25 ? 14.408 6.320  29.621 1.00 19.48 ? 235 ASP A CG  1 
ATOM   195 O OD1 . ASP A 1 25 ? 14.753 5.137  29.824 1.00 24.59 ? 235 ASP A OD1 1 
ATOM   196 O OD2 . ASP A 1 25 ? 13.246 6.631  29.309 1.00 24.06 ? 235 ASP A OD2 1 
ATOM   197 N N   . PHE A 1 26 ? 16.977 10.228 28.433 1.00 15.66 ? 236 PHE A N   1 
ATOM   198 C CA  . PHE A 1 26 ? 17.957 11.248 28.795 1.00 15.08 ? 236 PHE A CA  1 
ATOM   199 C C   . PHE A 1 26 ? 17.640 12.644 28.244 1.00 14.62 ? 236 PHE A C   1 
ATOM   200 O O   . PHE A 1 26 ? 18.292 13.606 28.643 1.00 14.31 ? 236 PHE A O   1 
ATOM   201 C CB  . PHE A 1 26 ? 19.388 10.812 28.395 1.00 14.43 ? 236 PHE A CB  1 
ATOM   202 C CG  . PHE A 1 26 ? 19.584 10.582 26.907 1.00 14.42 ? 236 PHE A CG  1 
ATOM   203 C CD1 . PHE A 1 26 ? 19.731 11.652 26.020 1.00 14.52 ? 236 PHE A CD1 1 
ATOM   204 C CD2 . PHE A 1 26 ? 19.635 9.282  26.389 1.00 15.51 ? 236 PHE A CD2 1 
ATOM   205 C CE1 . PHE A 1 26 ? 19.901 11.437 24.649 1.00 14.65 ? 236 PHE A CE1 1 
ATOM   206 C CE2 . PHE A 1 26 ? 19.834 9.073  25.008 1.00 15.36 ? 236 PHE A CE2 1 
ATOM   207 C CZ  . PHE A 1 26 ? 19.960 10.138 24.157 1.00 15.43 ? 236 PHE A CZ  1 
ATOM   208 N N   . ALA A 1 27 ? 16.643 12.757 27.363 1.00 14.84 ? 237 ALA A N   1 
ATOM   209 C CA  . ALA A 1 27 ? 16.344 14.048 26.732 1.00 15.96 ? 237 ALA A CA  1 
ATOM   210 C C   . ALA A 1 27 ? 14.932 13.996 26.176 1.00 16.87 ? 237 ALA A C   1 
ATOM   211 O O   . ALA A 1 27 ? 14.337 12.920 26.085 1.00 18.25 ? 237 ALA A O   1 
ATOM   212 C CB  . ALA A 1 27 ? 17.347 14.337 25.620 1.00 16.97 ? 237 ALA A CB  1 
ATOM   213 N N   . LYS A 1 28 ? 14.438 15.167 25.779 1.00 17.86 ? 238 LYS A N   1 
ATOM   214 C CA  . LYS A 1 28 ? 13.141 15.308 25.112 1.00 18.70 ? 238 LYS A CA  1 
ATOM   215 C C   . LYS A 1 28 ? 13.226 15.020 23.611 1.00 19.14 ? 238 LYS A C   1 
ATOM   216 O O   . LYS A 1 28 ? 14.288 15.163 22.973 1.00 19.49 ? 238 LYS A O   1 
ATOM   217 C CB  . LYS A 1 28 ? 12.623 16.743 25.296 1.00 18.55 ? 238 LYS A CB  1 
ATOM   218 C CG  . LYS A 1 28 ? 13.384 17.739 24.435 1.00 19.85 ? 238 LYS A CG  1 
ATOM   219 C CD  . LYS A 1 28 ? 13.368 19.152 24.992 1.00 22.06 ? 238 LYS A CD  1 
ATOM   220 C CE  . LYS A 1 28 ? 12.015 19.769 24.809 1.00 22.29 ? 238 LYS A CE  1 
ATOM   221 N NZ  . LYS A 1 28 ? 11.943 21.114 25.503 1.00 21.02 ? 238 LYS A NZ  1 
ATOM   222 N N   . GLY A 1 29 ? 12.081 14.668 23.035 1.00 19.10 ? 239 GLY A N   1 
ATOM   223 C CA  . GLY A 1 29 ? 11.950 14.558 21.581 1.00 19.20 ? 239 GLY A CA  1 
ATOM   224 C C   . GLY A 1 29 ? 12.606 13.315 20.989 1.00 18.89 ? 239 GLY A C   1 
ATOM   225 O O   . GLY A 1 29 ? 12.908 12.371 21.711 1.00 20.59 ? 239 GLY A O   1 
ATOM   226 N N   . GLU A 1 30 ? 12.818 13.342 19.687 0.50 17.89 ? 240 GLU A N   1 
ATOM   227 C CA  . GLU A 1 30 ? 13.370 12.197 18.987 0.50 18.29 ? 240 GLU A CA  1 
ATOM   228 C C   . GLU A 1 30 ? 14.865 12.319 18.817 0.50 16.81 ? 240 GLU A C   1 
ATOM   229 O O   . GLU A 1 30 ? 15.378 13.348 18.394 0.50 15.90 ? 240 GLU A O   1 
ATOM   230 C CB  A GLU A 1 30 ? 12.717 12.102 17.607 0.50 19.00 ? 240 GLU A CB  1 
ATOM   231 C CB  B GLU A 1 30 ? 12.669 11.951 17.656 0.50 19.56 ? 240 GLU A CB  1 
ATOM   232 C CG  A GLU A 1 30 ? 13.236 10.982 16.727 0.50 19.47 ? 240 GLU A CG  1 
ATOM   233 C CG  B GLU A 1 30 ? 11.266 11.399 17.834 0.50 22.78 ? 240 GLU A CG  1 
ATOM   234 C CD  A GLU A 1 30 ? 12.528 10.908 15.388 0.50 20.15 ? 240 GLU A CD  1 
ATOM   235 C CD  B GLU A 1 30 ? 10.982 10.212 16.935 0.50 26.09 ? 240 GLU A CD  1 
ATOM   236 O OE1 A GLU A 1 30 ? 12.031 9.816  15.049 0.50 23.82 ? 240 GLU A OE1 1 
ATOM   237 O OE1 B GLU A 1 30 ? 11.247 10.290 15.715 0.50 28.18 ? 240 GLU A OE1 1 
ATOM   238 O OE2 A GLU A 1 30 ? 12.468 11.933 14.678 0.50 22.94 ? 240 GLU A OE2 1 
ATOM   239 O OE2 B GLU A 1 30 ? 10.480 9.190  17.447 0.50 29.21 ? 240 GLU A OE2 1 
ATOM   240 N N   . TRP A 1 31 ? 15.546 11.232 19.164 1.00 16.78 ? 241 TRP A N   1 
ATOM   241 C CA  . TRP A 1 31 ? 16.994 11.135 19.018 1.00 15.86 ? 241 TRP A CA  1 
ATOM   242 C C   . TRP A 1 31 ? 17.389 10.048 18.045 1.00 15.89 ? 241 TRP A C   1 
ATOM   243 O O   . TRP A 1 31 ? 16.722 9.036  17.913 1.00 16.89 ? 241 TRP A O   1 
ATOM   244 C CB  . TRP A 1 31 ? 17.655 10.905 20.385 1.00 16.73 ? 241 TRP A CB  1 
ATOM   245 C CG  . TRP A 1 31 ? 17.635 12.154 21.189 1.00 15.90 ? 241 TRP A CG  1 
ATOM   246 C CD1 . TRP A 1 31 ? 16.520 12.775 21.721 1.00 18.93 ? 241 TRP A CD1 1 
ATOM   247 C CD2 . TRP A 1 31 ? 18.739 12.990 21.492 1.00 15.00 ? 241 TRP A CD2 1 
ATOM   248 N NE1 . TRP A 1 31 ? 16.896 13.928 22.351 1.00 18.05 ? 241 TRP A NE1 1 
ATOM   249 C CE2 . TRP A 1 31 ? 18.247 14.102 22.219 1.00 17.54 ? 241 TRP A CE2 1 
ATOM   250 C CE3 . TRP A 1 31 ? 20.112 12.895 21.260 1.00 17.18 ? 241 TRP A CE3 1 
ATOM   251 C CZ2 . TRP A 1 31 ? 19.092 15.112 22.699 1.00 16.41 ? 241 TRP A CZ2 1 
ATOM   252 C CZ3 . TRP A 1 31 ? 20.943 13.900 21.723 1.00 16.51 ? 241 TRP A CZ3 1 
ATOM   253 C CH2 . TRP A 1 31 ? 20.433 14.993 22.454 1.00 18.15 ? 241 TRP A CH2 1 
ATOM   254 N N   . CYS A 1 32 ? 18.493 10.288 17.361 0.50 12.48 ? 242 CYS A N   1 
ATOM   255 C CA  . CYS A 1 32 ? 19.073 9.358  16.428 0.50 13.23 ? 242 CYS A CA  1 
ATOM   256 C C   . CYS A 1 32 ? 20.247 8.649  17.087 0.50 11.75 ? 242 CYS A C   1 
ATOM   257 O O   . CYS A 1 32 ? 21.189 9.304  17.534 0.50 10.57 ? 242 CYS A O   1 
ATOM   258 C CB  A CYS A 1 32 ? 19.463 10.143 15.187 0.50 13.86 ? 242 CYS A CB  1 
ATOM   259 C CB  B CYS A 1 32 ? 19.716 10.120 15.287 0.50 15.55 ? 242 CYS A CB  1 
ATOM   260 S SG  A CYS A 1 32 ? 20.044 9.145  13.861 0.50 12.49 ? 242 CYS A SG  1 
ATOM   261 S SG  B CYS A 1 32 ? 18.624 10.824 14.143 0.50 25.14 ? 242 CYS A SG  1 
ATOM   262 N N   . GLY A 1 33 ? 20.196 7.327  17.165 1.00 13.45 ? 243 GLY A N   1 
ATOM   263 C CA  . GLY A 1 33 ? 21.344 6.554  17.628 1.00 13.50 ? 243 GLY A CA  1 
ATOM   264 C C   . GLY A 1 33 ? 22.103 6.040  16.422 1.00 12.63 ? 243 GLY A C   1 
ATOM   265 O O   . GLY A 1 33 ? 21.540 5.347  15.558 1.00 13.42 ? 243 GLY A O   1 
ATOM   266 N N   . VAL A 1 34 ? 23.357 6.442  16.335 1.00 13.40 ? 244 VAL A N   1 
ATOM   267 C CA  . VAL A 1 34 ? 24.202 6.161  15.172 1.00 13.13 ? 244 VAL A CA  1 
ATOM   268 C C   . VAL A 1 34 ? 25.355 5.253  15.597 1.00 13.51 ? 244 VAL A C   1 
ATOM   269 O O   . VAL A 1 34 ? 25.962 5.443  16.661 1.00 13.03 ? 244 VAL A O   1 
ATOM   270 C CB  . VAL A 1 34 ? 24.757 7.467  14.566 1.00 13.52 ? 244 VAL A CB  1 
ATOM   271 C CG1 . VAL A 1 34 ? 25.737 7.186  13.412 1.00 14.77 ? 244 VAL A CG1 1 
ATOM   272 C CG2 . VAL A 1 34 ? 23.594 8.374  14.127 1.00 14.47 ? 244 VAL A CG2 1 
ATOM   273 N N   . GLU A 1 35 ? 25.633 4.231  14.794 1.00 12.96 ? 245 GLU A N   1 
ATOM   274 C CA  . GLU A 1 35 ? 26.859 3.451  14.952 1.00 13.16 ? 245 GLU A CA  1 
ATOM   275 C C   . GLU A 1 35 ? 27.847 3.964  13.914 1.00 12.78 ? 245 GLU A C   1 
ATOM   276 O O   . GLU A 1 35 ? 27.588 3.875  12.704 1.00 12.89 ? 245 GLU A O   1 
ATOM   277 C CB  . GLU A 1 35 ? 26.601 1.962  14.724 1.00 13.64 ? 245 GLU A CB  1 
ATOM   278 C CG  . GLU A 1 35 ? 27.859 1.165  14.820 1.00 14.89 ? 245 GLU A CG  1 
ATOM   279 C CD  . GLU A 1 35 ? 27.653 -0.273 14.479 1.00 18.60 ? 245 GLU A CD  1 
ATOM   280 O OE1 . GLU A 1 35 ? 26.502 -0.742 14.450 1.00 18.63 ? 245 GLU A OE1 1 
ATOM   281 O OE2 . GLU A 1 35 ? 28.673 -0.923 14.189 1.00 20.54 ? 245 GLU A OE2 1 
ATOM   282 N N   . LEU A 1 36 ? 28.953 4.516  14.398 1.00 13.51 ? 246 LEU A N   1 
ATOM   283 C CA  . LEU A 1 36 ? 29.969 5.123  13.546 1.00 13.29 ? 246 LEU A CA  1 
ATOM   284 C C   . LEU A 1 36 ? 30.837 4.064  12.870 1.00 13.80 ? 246 LEU A C   1 
ATOM   285 O O   . LEU A 1 36 ? 30.992 2.947  13.372 1.00 14.17 ? 246 LEU A O   1 
ATOM   286 C CB  . LEU A 1 36 ? 30.841 6.023  14.413 1.00 13.58 ? 246 LEU A CB  1 
ATOM   287 C CG  . LEU A 1 36 ? 30.100 7.181  15.087 1.00 13.99 ? 246 LEU A CG  1 
ATOM   288 C CD1 . LEU A 1 36 ? 31.090 7.902  15.984 1.00 17.38 ? 246 LEU A CD1 1 
ATOM   289 C CD2 . LEU A 1 36 ? 29.472 8.132  14.081 1.00 15.98 ? 246 LEU A CD2 1 
ATOM   290 N N   . ASP A 1 37 ? 31.456 4.449  11.760 1.00 14.03 ? 247 ASP A N   1 
ATOM   291 C CA  . ASP A 1 37 ? 32.458 3.607  11.106 1.00 15.33 ? 247 ASP A CA  1 
ATOM   292 C C   . ASP A 1 37 ? 33.724 3.497  11.925 1.00 15.40 ? 247 ASP A C   1 
ATOM   293 O O   . ASP A 1 37 ? 34.382 2.458  11.923 1.00 16.61 ? 247 ASP A O   1 
ATOM   294 C CB  . ASP A 1 37 ? 32.843 4.206  9.760  1.00 16.29 ? 247 ASP A CB  1 
ATOM   295 C CG  . ASP A 1 37 ? 31.707 4.208  8.761  1.00 16.31 ? 247 ASP A CG  1 
ATOM   296 O OD1 . ASP A 1 37 ? 30.668 3.535  8.986  1.00 16.98 ? 247 ASP A OD1 1 
ATOM   297 O OD2 . ASP A 1 37 ? 31.859 4.891  7.720  1.00 16.34 ? 247 ASP A OD2 1 
ATOM   298 N N   . GLU A 1 38 ? 34.073 4.586  12.605 1.00 15.36 ? 248 GLU A N   1 
ATOM   299 C CA  . GLU A 1 38 ? 35.343 4.708  13.325 1.00 16.68 ? 248 GLU A CA  1 
ATOM   300 C C   . GLU A 1 38 ? 35.035 4.891  14.804 1.00 15.96 ? 248 GLU A C   1 
ATOM   301 O O   . GLU A 1 38 ? 33.956 5.351  15.145 1.00 15.69 ? 248 GLU A O   1 
ATOM   302 C CB  . GLU A 1 38 ? 36.116 5.924  12.813 1.00 18.49 ? 248 GLU A CB  1 
ATOM   303 C CG  . GLU A 1 38 ? 36.507 5.869  11.333 1.00 22.31 ? 248 GLU A CG  1 
ATOM   304 C CD  . GLU A 1 38 ? 37.304 4.641  10.988 1.00 28.97 ? 248 GLU A CD  1 
ATOM   305 O OE1 . GLU A 1 38 ? 36.961 3.996  9.970  1.00 33.88 ? 248 GLU A OE1 1 
ATOM   306 O OE2 . GLU A 1 38 ? 38.254 4.309  11.732 1.00 31.64 ? 248 GLU A OE2 1 
ATOM   307 N N   . PRO A 1 39 ? 35.974 4.531  15.701 1.00 16.61 ? 249 PRO A N   1 
ATOM   308 C CA  . PRO A 1 39 ? 35.719 4.579  17.152 1.00 16.88 ? 249 PRO A CA  1 
ATOM   309 C C   . PRO A 1 39 ? 35.783 5.998  17.746 1.00 16.83 ? 249 PRO A C   1 
ATOM   310 O O   . PRO A 1 39 ? 36.561 6.284  18.673 1.00 17.97 ? 249 PRO A O   1 
ATOM   311 C CB  . PRO A 1 39 ? 36.802 3.660  17.722 1.00 17.13 ? 249 PRO A CB  1 
ATOM   312 C CG  . PRO A 1 39 ? 37.936 3.770  16.757 1.00 17.38 ? 249 PRO A CG  1 
ATOM   313 C CD  . PRO A 1 39 ? 37.308 3.969  15.387 1.00 16.67 ? 249 PRO A CD  1 
ATOM   314 N N   . LEU A 1 40 ? 34.911 6.865  17.235 1.00 16.17 ? 250 LEU A N   1 
ATOM   315 C CA  . LEU A 1 40 ? 34.899 8.293  17.579 1.00 17.08 ? 250 LEU A CA  1 
ATOM   316 C C   . LEU A 1 40 ? 33.680 8.619  18.429 1.00 16.98 ? 250 LEU A C   1 
ATOM   317 O O   . LEU A 1 40 ? 33.352 9.798  18.619 1.00 18.41 ? 250 LEU A O   1 
ATOM   318 C CB  . LEU A 1 40 ? 34.905 9.129  16.286 1.00 17.77 ? 250 LEU A CB  1 
ATOM   319 C CG  . LEU A 1 40 ? 36.037 8.843  15.291 1.00 18.93 ? 250 LEU A CG  1 
ATOM   320 C CD1 . LEU A 1 40 ? 35.808 9.575  13.945 1.00 21.43 ? 250 LEU A CD1 1 
ATOM   321 C CD2 . LEU A 1 40 ? 37.371 9.225  15.915 1.00 22.72 ? 250 LEU A CD2 1 
ATOM   322 N N   . GLY A 1 41 ? 33.022 7.572  18.930 1.00 16.51 ? 251 GLY A N   1 
ATOM   323 C CA  . GLY A 1 41 ? 31.794 7.750  19.699 1.00 17.33 ? 251 GLY A CA  1 
ATOM   324 C C   . GLY A 1 41 ? 32.033 7.655  21.188 1.00 18.00 ? 251 GLY A C   1 
ATOM   325 O O   . GLY A 1 41 ? 33.182 7.627  21.653 1.00 19.56 ? 251 GLY A O   1 
ATOM   326 N N   . LYS A 1 42 ? 30.938 7.583  21.932 1.00 17.56 ? 252 LYS A N   1 
ATOM   327 C CA  . LYS A 1 42 ? 30.976 7.685  23.397 1.00 18.19 ? 252 LYS A CA  1 
ATOM   328 C C   . LYS A 1 42 ? 30.179 6.624  24.132 1.00 17.20 ? 252 LYS A C   1 
ATOM   329 O O   . LYS A 1 42 ? 30.124 6.628  25.370 1.00 17.95 ? 252 LYS A O   1 
ATOM   330 C CB  . LYS A 1 42 ? 30.448 9.062  23.820 1.00 19.87 ? 252 LYS A CB  1 
ATOM   331 C CG  . LYS A 1 42 ? 31.266 10.242 23.306 1.00 23.70 ? 252 LYS A CG  1 
ATOM   332 C CD  . LYS A 1 42 ? 32.619 10.286 23.980 1.00 28.12 ? 252 LYS A CD  1 
ATOM   333 C CE  . LYS A 1 42 ? 33.289 11.632 23.790 1.00 30.34 ? 252 LYS A CE  1 
ATOM   334 N NZ  . LYS A 1 42 ? 34.064 11.651 22.523 1.00 34.16 ? 252 LYS A NZ  1 
ATOM   335 N N   . ASN A 1 43 ? 29.550 5.713  23.404 1.00 15.05 ? 253 ASN A N   1 
ATOM   336 C CA  . ASN A 1 43 ? 28.728 4.674  24.018 1.00 15.36 ? 253 ASN A CA  1 
ATOM   337 C C   . ASN A 1 43 ? 28.679 3.434  23.111 1.00 15.50 ? 253 ASN A C   1 
ATOM   338 O O   . ASN A 1 43 ? 29.258 3.435  22.008 1.00 15.34 ? 253 ASN A O   1 
ATOM   339 C CB  . ASN A 1 43 ? 27.314 5.229  24.337 1.00 16.18 ? 253 ASN A CB  1 
ATOM   340 C CG  . ASN A 1 43 ? 26.561 5.623  23.087 1.00 14.64 ? 253 ASN A CG  1 
ATOM   341 O OD1 . ASN A 1 43 ? 26.216 4.766  22.271 1.00 15.05 ? 253 ASN A OD1 1 
ATOM   342 N ND2 . ASN A 1 43 ? 26.315 6.938  22.919 1.00 16.59 ? 253 ASN A ND2 1 
ATOM   343 N N   . ASP A 1 44 ? 27.995 2.402  23.580 1.00 15.57 ? 254 ASP A N   1 
ATOM   344 C CA  . ASP A 1 44 ? 27.788 1.178  22.817 1.00 16.13 ? 254 ASP A CA  1 
ATOM   345 C C   . ASP A 1 44 ? 26.294 0.977  22.532 1.00 16.03 ? 254 ASP A C   1 
ATOM   346 O O   . ASP A 1 44 ? 25.840 -0.148 22.320 1.00 16.10 ? 254 ASP A O   1 
ATOM   347 C CB  . ASP A 1 44 ? 28.333 -0.015 23.616 1.00 16.77 ? 254 ASP A CB  1 
ATOM   348 C CG  . ASP A 1 44 ? 27.481 -0.327 24.832 1.00 19.61 ? 254 ASP A CG  1 
ATOM   349 O OD1 . ASP A 1 44 ? 26.703 0.546  25.273 1.00 18.97 ? 254 ASP A OD1 1 
ATOM   350 O OD2 . ASP A 1 44 ? 27.571 -1.471 25.345 1.00 22.14 ? 254 ASP A OD2 1 
ATOM   351 N N   . GLY A 1 45 ? 25.529 2.074  22.546 1.00 15.05 ? 255 GLY A N   1 
ATOM   352 C CA  . GLY A 1 45 ? 24.088 2.014  22.279 1.00 15.33 ? 255 GLY A CA  1 
ATOM   353 C C   . GLY A 1 45 ? 23.217 2.167  23.510 1.00 14.56 ? 255 GLY A C   1 
ATOM   354 O O   . GLY A 1 45 ? 21.992 2.234  23.400 1.00 15.31 ? 255 GLY A O   1 
ATOM   355 N N   . ALA A 1 46 ? 23.861 2.245  24.676 1.00 15.45 ? 256 ALA A N   1 
ATOM   356 C CA  . ALA A 1 46 ? 23.151 2.455  25.943 1.00 16.56 ? 256 ALA A CA  1 
ATOM   357 C C   . ALA A 1 46 ? 23.654 3.728  26.609 1.00 17.44 ? 256 ALA A C   1 
ATOM   358 O O   . ALA A 1 46 ? 24.814 4.122  26.424 1.00 17.86 ? 256 ALA A O   1 
ATOM   359 C CB  . ALA A 1 46 ? 23.347 1.230  26.886 1.00 16.64 ? 256 ALA A CB  1 
ATOM   360 N N   . VAL A 1 47 ? 22.767 4.371  27.374 1.00 17.68 ? 257 VAL A N   1 
ATOM   361 C CA  . VAL A 1 47 ? 23.129 5.527  28.211 1.00 19.16 ? 257 VAL A CA  1 
ATOM   362 C C   . VAL A 1 47 ? 22.429 5.347  29.544 1.00 19.43 ? 257 VAL A C   1 
ATOM   363 O O   . VAL A 1 47 ? 21.231 5.088  29.572 1.00 19.32 ? 257 VAL A O   1 
ATOM   364 C CB  . VAL A 1 47 ? 22.642 6.890  27.624 1.00 18.91 ? 257 VAL A CB  1 
ATOM   365 C CG1 . VAL A 1 47 ? 22.942 8.046  28.596 1.00 22.02 ? 257 VAL A CG1 1 
ATOM   366 C CG2 . VAL A 1 47 ? 23.242 7.144  26.261 1.00 20.53 ? 257 VAL A CG2 1 
ATOM   367 N N   . ALA A 1 48 ? 23.180 5.496  30.635 1.00 20.90 ? 258 ALA A N   1 
ATOM   368 C CA  . ALA A 1 48 ? 22.602 5.461  31.993 1.00 23.39 ? 258 ALA A CA  1 
ATOM   369 C C   . ALA A 1 48 ? 21.719 4.252  32.304 1.00 25.10 ? 258 ALA A C   1 
ATOM   370 O O   . ALA A 1 48 ? 20.667 4.392  32.934 1.00 27.44 ? 258 ALA A O   1 
ATOM   371 C CB  . ALA A 1 48 ? 21.826 6.754  32.264 1.00 24.09 ? 258 ALA A CB  1 
ATOM   372 N N   . GLY A 1 49 ? 22.116 3.064  31.882 1.00 25.83 ? 259 GLY A N   1 
ATOM   373 C CA  . GLY A 1 49 ? 21.249 1.903  32.153 1.00 26.08 ? 259 GLY A CA  1 
ATOM   374 C C   . GLY A 1 49 ? 19.904 1.819  31.429 1.00 25.34 ? 259 GLY A C   1 
ATOM   375 O O   . GLY A 1 49 ? 19.010 1.073  31.843 1.00 27.00 ? 259 GLY A O   1 
ATOM   376 N N   . THR A 1 50 ? 19.738 2.577  30.342 1.00 23.19 ? 260 THR A N   1 
ATOM   377 C CA  . THR A 1 50 ? 18.750 2.220  29.325 1.00 21.59 ? 260 THR A CA  1 
ATOM   378 C C   . THR A 1 50 ? 19.514 1.899  28.051 1.00 19.90 ? 260 THR A C   1 
ATOM   379 O O   . THR A 1 50 ? 20.374 2.681  27.623 1.00 19.47 ? 260 THR A O   1 
ATOM   380 C CB  . THR A 1 50 ? 17.733 3.348  29.021 1.00 21.78 ? 260 THR A CB  1 
ATOM   381 O OG1 . THR A 1 50 ? 17.040 3.691  30.226 1.00 23.04 ? 260 THR A OG1 1 
ATOM   382 C CG2 . THR A 1 50 ? 16.716 2.919  27.973 1.00 22.33 ? 260 THR A CG2 1 
ATOM   383 N N   . ARG A 1 51 ? 19.201 0.747  27.466 1.00 19.04 ? 261 ARG A N   1 
ATOM   384 C CA  . ARG A 1 51 ? 19.783 0.378  26.179 1.00 18.26 ? 261 ARG A CA  1 
ATOM   385 C C   . ARG A 1 51 ? 18.820 0.694  25.042 1.00 18.48 ? 261 ARG A C   1 
ATOM   386 O O   . ARG A 1 51 ? 17.663 0.274  25.050 1.00 19.05 ? 261 ARG A O   1 
ATOM   387 C CB  . ARG A 1 51 ? 20.195 -1.100 26.149 1.00 18.68 ? 261 ARG A CB  1 
ATOM   388 C CG  . ARG A 1 51 ? 20.837 -1.455 24.816 1.00 18.35 ? 261 ARG A CG  1 
ATOM   389 C CD  . ARG A 1 51 ? 21.663 -2.748 24.864 1.00 19.39 ? 261 ARG A CD  1 
ATOM   390 N NE  . ARG A 1 51 ? 22.801 -2.648 25.771 1.00 17.95 ? 261 ARG A NE  1 
ATOM   391 C CZ  . ARG A 1 51 ? 23.951 -2.025 25.512 1.00 17.70 ? 261 ARG A CZ  1 
ATOM   392 N NH1 . ARG A 1 51 ? 24.123 -1.375 24.361 1.00 16.24 ? 261 ARG A NH1 1 
ATOM   393 N NH2 . ARG A 1 51 ? 24.931 -2.014 26.406 1.00 19.76 ? 261 ARG A NH2 1 
ATOM   394 N N   . TYR A 1 52 ? 19.328 1.406  24.036 1.00 16.23 ? 262 TYR A N   1 
ATOM   395 C CA  . TYR A 1 52 ? 18.543 1.767  22.857 1.00 16.47 ? 262 TYR A CA  1 
ATOM   396 C C   . TYR A 1 52 ? 18.868 0.898  21.645 1.00 15.97 ? 262 TYR A C   1 
ATOM   397 O O   . TYR A 1 52 ? 18.001 0.594  20.831 1.00 17.15 ? 262 TYR A O   1 
ATOM   398 C CB  . TYR A 1 52 ? 18.752 3.269  22.555 1.00 16.11 ? 262 TYR A CB  1 
ATOM   399 C CG  . TYR A 1 52 ? 18.385 4.103  23.763 1.00 16.07 ? 262 TYR A CG  1 
ATOM   400 C CD1 . TYR A 1 52 ? 19.362 4.574  24.631 1.00 15.92 ? 262 TYR A CD1 1 
ATOM   401 C CD2 . TYR A 1 52 ? 17.056 4.378  24.040 1.00 17.33 ? 262 TYR A CD2 1 
ATOM   402 C CE1 . TYR A 1 52 ? 19.018 5.311  25.779 1.00 15.66 ? 262 TYR A CE1 1 
ATOM   403 C CE2 . TYR A 1 52 ? 16.698 5.109  25.159 1.00 16.40 ? 262 TYR A CE2 1 
ATOM   404 C CZ  . TYR A 1 52 ? 17.683 5.583  26.010 1.00 16.14 ? 262 TYR A CZ  1 
ATOM   405 O OH  . TYR A 1 52 ? 17.323 6.307  27.131 1.00 18.13 ? 262 TYR A OH  1 
ATOM   406 N N   . PHE A 1 53 ? 20.145 0.538  21.527 1.00 15.15 ? 263 PHE A N   1 
ATOM   407 C CA  . PHE A 1 53 ? 20.616 -0.445 20.528 1.00 15.30 ? 263 PHE A CA  1 
ATOM   408 C C   . PHE A 1 53 ? 21.913 -1.016 21.059 1.00 14.79 ? 263 PHE A C   1 
ATOM   409 O O   . PHE A 1 53 ? 22.374 -0.622 22.120 1.00 14.94 ? 263 PHE A O   1 
ATOM   410 C CB  . PHE A 1 53 ? 20.779 0.179  19.123 1.00 15.18 ? 263 PHE A CB  1 
ATOM   411 C CG  . PHE A 1 53 ? 21.843 1.263  19.019 1.00 14.39 ? 263 PHE A CG  1 
ATOM   412 C CD1 . PHE A 1 53 ? 23.102 0.966  18.488 1.00 14.91 ? 263 PHE A CD1 1 
ATOM   413 C CD2 . PHE A 1 53 ? 21.585 2.598  19.395 1.00 13.92 ? 263 PHE A CD2 1 
ATOM   414 C CE1 . PHE A 1 53 ? 24.079 1.959  18.350 1.00 14.25 ? 263 PHE A CE1 1 
ATOM   415 C CE2 . PHE A 1 53 ? 22.576 3.581  19.252 1.00 13.55 ? 263 PHE A CE2 1 
ATOM   416 C CZ  . PHE A 1 53 ? 23.816 3.271  18.732 1.00 14.51 ? 263 PHE A CZ  1 
ATOM   417 N N   . GLN A 1 54 ? 22.500 -1.972 20.330 1.00 15.01 ? 264 GLN A N   1 
ATOM   418 C CA  . GLN A 1 54 ? 23.814 -2.491 20.712 1.00 15.80 ? 264 GLN A CA  1 
ATOM   419 C C   . GLN A 1 54 ? 24.812 -2.366 19.576 1.00 15.77 ? 264 GLN A C   1 
ATOM   420 O O   . GLN A 1 54 ? 24.521 -2.766 18.436 1.00 16.47 ? 264 GLN A O   1 
ATOM   421 C CB  . GLN A 1 54 ? 23.706 -3.975 21.111 1.00 15.55 ? 264 GLN A CB  1 
ATOM   422 C CG  . GLN A 1 54 ? 25.053 -4.600 21.520 1.00 16.47 ? 264 GLN A CG  1 
ATOM   423 C CD  . GLN A 1 54 ? 25.493 -4.162 22.901 1.00 16.48 ? 264 GLN A CD  1 
ATOM   424 O OE1 . GLN A 1 54 ? 24.849 -4.508 23.903 1.00 18.95 ? 264 GLN A OE1 1 
ATOM   425 N NE2 . GLN A 1 54 ? 26.591 -3.411 22.985 1.00 16.78 ? 264 GLN A NE2 1 
ATOM   426 N N   . CYS A 1 55 ? 25.964 -1.778 19.885 1.00 15.59 ? 265 CYS A N   1 
ATOM   427 C CA  . CYS A 1 55 ? 27.093 -1.793 18.952 1.00 15.85 ? 265 CYS A CA  1 
ATOM   428 C C   . CYS A 1 55 ? 28.382 -2.002 19.743 1.00 15.52 ? 265 CYS A C   1 
ATOM   429 O O   . CYS A 1 55 ? 28.359 -2.159 20.974 1.00 16.86 ? 265 CYS A O   1 
ATOM   430 C CB  . CYS A 1 55 ? 27.150 -0.511 18.096 1.00 15.38 ? 265 CYS A CB  1 
ATOM   431 S SG  . CYS A 1 55 ? 27.499 1.014  19.013 1.00 15.50 ? 265 CYS A SG  1 
ATOM   432 N N   . GLN A 1 56 ? 29.495 -1.970 19.027 0.50 14.28 ? 266 GLN A N   1 
ATOM   433 C CA  . GLN A 1 56 ? 30.794 -2.037 19.654 0.50 15.59 ? 266 GLN A CA  1 
ATOM   434 C C   . GLN A 1 56 ? 31.052 -0.785 20.510 0.50 15.62 ? 266 GLN A C   1 
ATOM   435 O O   . GLN A 1 56 ? 30.632 0.314  20.154 0.50 12.71 ? 266 GLN A O   1 
ATOM   436 C CB  A GLN A 1 56 ? 31.876 -2.215 18.582 0.50 16.45 ? 266 GLN A CB  1 
ATOM   437 C CB  B GLN A 1 56 ? 31.880 -2.193 18.600 0.50 16.87 ? 266 GLN A CB  1 
ATOM   438 C CG  A GLN A 1 56 ? 31.863 -3.602 17.911 0.50 16.77 ? 266 GLN A CG  1 
ATOM   439 C CG  B GLN A 1 56 ? 31.951 -3.594 18.033 0.50 18.99 ? 266 GLN A CG  1 
ATOM   440 C CD  A GLN A 1 56 ? 32.451 -4.681 18.806 0.50 16.87 ? 266 GLN A CD  1 
ATOM   441 C CD  B GLN A 1 56 ? 33.342 -4.172 18.140 0.50 21.98 ? 266 GLN A CD  1 
ATOM   442 O OE1 A GLN A 1 56 ? 31.947 -4.942 19.888 0.50 19.71 ? 266 GLN A OE1 1 
ATOM   443 O OE1 B GLN A 1 56 ? 34.265 -3.532 18.646 0.50 23.35 ? 266 GLN A OE1 1 
ATOM   444 N NE2 A GLN A 1 56 ? 33.519 -5.318 18.346 0.50 17.45 ? 266 GLN A NE2 1 
ATOM   445 N NE2 B GLN A 1 56 ? 33.500 -5.395 17.673 0.50 23.15 ? 266 GLN A NE2 1 
ATOM   446 N N   . PRO A 1 57 ? 31.718 -0.945 21.665 1.00 17.98 ? 267 PRO A N   1 
ATOM   447 C CA  . PRO A 1 57 ? 32.049 0.202  22.495 1.00 18.55 ? 267 PRO A CA  1 
ATOM   448 C C   . PRO A 1 57 ? 32.855 1.236  21.707 1.00 18.07 ? 267 PRO A C   1 
ATOM   449 O O   . PRO A 1 57 ? 33.694 0.884  20.868 1.00 18.47 ? 267 PRO A O   1 
ATOM   450 C CB  . PRO A 1 57 ? 32.900 -0.391 23.640 1.00 20.31 ? 267 PRO A CB  1 
ATOM   451 C CG  . PRO A 1 57 ? 33.205 -1.778 23.227 1.00 21.35 ? 267 PRO A CG  1 
ATOM   452 C CD  . PRO A 1 57 ? 32.175 -2.218 22.258 1.00 18.87 ? 267 PRO A CD  1 
ATOM   453 N N   . LYS A 1 58 ? 32.576 2.510  21.985 1.00 18.03 ? 268 LYS A N   1 
ATOM   454 C CA  . LYS A 1 58 ? 33.233 3.638  21.321 1.00 19.57 ? 268 LYS A CA  1 
ATOM   455 C C   . LYS A 1 58 ? 32.707 3.929  19.916 1.00 17.14 ? 268 LYS A C   1 
ATOM   456 O O   . LYS A 1 58 ? 33.167 4.891  19.292 1.00 18.69 ? 268 LYS A O   1 
ATOM   457 C CB  . LYS A 1 58 ? 34.765 3.476  21.278 1.00 20.07 ? 268 LYS A CB  1 
ATOM   458 C CG  . LYS A 1 58 ? 35.447 3.488  22.657 1.00 23.85 ? 268 LYS A CG  1 
ATOM   459 C CD  . LYS A 1 58 ? 36.964 3.393  22.526 1.00 24.76 ? 268 LYS A CD  1 
ATOM   460 C CE  . LYS A 1 58 ? 37.521 4.440  21.556 1.00 31.27 ? 268 LYS A CE  1 
ATOM   461 N NZ  . LYS A 1 58 ? 38.994 4.275  21.350 1.00 34.81 ? 268 LYS A NZ  1 
ATOM   462 N N   . TYR A 1 59 ? 31.746 3.148  19.418 1.00 15.84 ? 269 TYR A N   1 
ATOM   463 C CA  . TYR A 1 59 ? 31.226 3.405  18.085 1.00 14.62 ? 269 TYR A CA  1 
ATOM   464 C C   . TYR A 1 59 ? 29.837 4.032  18.109 1.00 15.08 ? 269 TYR A C   1 
ATOM   465 O O   . TYR A 1 59 ? 29.339 4.465  17.078 1.00 15.61 ? 269 TYR A O   1 
ATOM   466 C CB  . TYR A 1 59 ? 31.205 2.128  17.235 1.00 15.25 ? 269 TYR A CB  1 
ATOM   467 C CG  . TYR A 1 59 ? 32.582 1.628  16.825 1.00 14.35 ? 269 TYR A CG  1 
ATOM   468 C CD1 . TYR A 1 59 ? 33.324 0.819  17.685 1.00 14.44 ? 269 TYR A CD1 1 
ATOM   469 C CD2 . TYR A 1 59 ? 33.145 1.993  15.609 1.00 15.45 ? 269 TYR A CD2 1 
ATOM   470 C CE1 . TYR A 1 59 ? 34.572 0.324  17.310 1.00 15.82 ? 269 TYR A CE1 1 
ATOM   471 C CE2 . TYR A 1 59 ? 34.408 1.513  15.228 1.00 15.77 ? 269 TYR A CE2 1 
ATOM   472 C CZ  . TYR A 1 59 ? 35.105 0.690  16.091 1.00 15.90 ? 269 TYR A CZ  1 
ATOM   473 O OH  . TYR A 1 59 ? 36.357 0.229  15.730 1.00 18.31 ? 269 TYR A OH  1 
ATOM   474 N N   . GLY A 1 60 ? 29.209 4.107  19.272 1.00 14.08 ? 270 GLY A N   1 
ATOM   475 C CA  . GLY A 1 60 ? 27.843 4.657  19.359 1.00 14.37 ? 270 GLY A CA  1 
ATOM   476 C C   . GLY A 1 60 ? 27.810 6.140  19.722 1.00 14.50 ? 270 GLY A C   1 
ATOM   477 O O   . GLY A 1 60 ? 28.634 6.628  20.514 1.00 14.20 ? 270 GLY A O   1 
ATOM   478 N N   . LEU A 1 61 ? 26.865 6.856  19.116 1.00 14.34 ? 271 LEU A N   1 
ATOM   479 C CA  . LEU A 1 61 ? 26.603 8.268  19.440 1.00 15.67 ? 271 LEU A CA  1 
ATOM   480 C C   . LEU A 1 61 ? 25.115 8.487  19.333 1.00 15.83 ? 271 LEU A C   1 
ATOM   481 O O   . LEU A 1 61 ? 24.445 7.872  18.481 1.00 16.82 ? 271 LEU A O   1 
ATOM   482 C CB  . LEU A 1 61 ? 27.281 9.185  18.417 1.00 17.89 ? 271 LEU A CB  1 
ATOM   483 C CG  . LEU A 1 61 ? 28.709 9.663  18.603 1.00 21.14 ? 271 LEU A CG  1 
ATOM   484 C CD1 . LEU A 1 61 ? 29.029 10.703 17.531 1.00 21.39 ? 271 LEU A CD1 1 
ATOM   485 C CD2 . LEU A 1 61 ? 28.930 10.266 19.969 1.00 21.56 ? 271 LEU A CD2 1 
ATOM   486 N N   . PHE A 1 62 ? 24.566 9.354  20.181 1.00 14.77 ? 272 PHE A N   1 
ATOM   487 C CA  . PHE A 1 62 ? 23.201 9.824  19.988 1.00 14.40 ? 272 PHE A CA  1 
ATOM   488 C C   . PHE A 1 62 ? 23.241 11.283 19.639 1.00 15.19 ? 272 PHE A C   1 
ATOM   489 O O   . PHE A 1 62 ? 24.075 12.027 20.154 1.00 16.75 ? 272 PHE A O   1 
ATOM   490 C CB  . PHE A 1 62 ? 22.357 9.616  21.255 1.00 14.76 ? 272 PHE A CB  1 
ATOM   491 C CG  . PHE A 1 62 ? 22.120 8.168  21.577 1.00 13.93 ? 272 PHE A CG  1 
ATOM   492 C CD1 . PHE A 1 62 ? 23.029 7.477  22.374 1.00 16.33 ? 272 PHE A CD1 1 
ATOM   493 C CD2 . PHE A 1 62 ? 21.008 7.496  21.067 1.00 14.73 ? 272 PHE A CD2 1 
ATOM   494 C CE1 . PHE A 1 62 ? 22.828 6.129  22.661 1.00 14.99 ? 272 PHE A CE1 1 
ATOM   495 C CE2 . PHE A 1 62 ? 20.804 6.149  21.333 1.00 15.09 ? 272 PHE A CE2 1 
ATOM   496 C CZ  . PHE A 1 62 ? 21.726 5.468  22.131 1.00 15.84 ? 272 PHE A CZ  1 
ATOM   497 N N   . ALA A 1 63 ? 22.333 11.701 18.778 1.00 14.82 ? 273 ALA A N   1 
ATOM   498 C CA  . ALA A 1 63 ? 22.261 13.104 18.370 1.00 15.47 ? 273 ALA A CA  1 
ATOM   499 C C   . ALA A 1 63 ? 20.818 13.442 18.042 1.00 15.83 ? 273 ALA A C   1 
ATOM   500 O O   . ALA A 1 63 ? 20.084 12.584 17.561 1.00 15.43 ? 273 ALA A O   1 
ATOM   501 C CB  . ALA A 1 63 ? 23.130 13.341 17.148 1.00 16.46 ? 273 ALA A CB  1 
ATOM   502 N N   . PRO A 1 64 ? 20.414 14.714 18.223 1.00 15.85 ? 274 PRO A N   1 
ATOM   503 C CA  . PRO A 1 64 ? 19.098 15.120 17.702 1.00 17.34 ? 274 PRO A CA  1 
ATOM   504 C C   . PRO A 1 64 ? 19.126 15.060 16.187 1.00 18.35 ? 274 PRO A C   1 
ATOM   505 O O   . PRO A 1 64 ? 20.193 15.184 15.574 1.00 17.66 ? 274 PRO A O   1 
ATOM   506 C CB  . PRO A 1 64 ? 18.942 16.577 18.172 1.00 18.01 ? 274 PRO A CB  1 
ATOM   507 C CG  . PRO A 1 64 ? 20.187 16.945 18.831 1.00 18.09 ? 274 PRO A CG  1 
ATOM   508 C CD  . PRO A 1 64 ? 21.169 15.821 18.830 1.00 16.84 ? 274 PRO A CD  1 
ATOM   509 N N   . VAL A 1 65 ? 17.965 14.872 15.573 1.00 20.57 ? 275 VAL A N   1 
ATOM   510 C CA  . VAL A 1 65 ? 17.919 14.740 14.121 1.00 21.84 ? 275 VAL A CA  1 
ATOM   511 C C   . VAL A 1 65 ? 18.501 15.947 13.395 1.00 21.72 ? 275 VAL A C   1 
ATOM   512 O O   . VAL A 1 65 ? 19.062 15.802 12.311 1.00 23.00 ? 275 VAL A O   1 
ATOM   513 C CB  . VAL A 1 65 ? 16.507 14.367 13.575 1.00 21.99 ? 275 VAL A CB  1 
ATOM   514 C CG1 . VAL A 1 65 ? 15.980 13.115 14.243 1.00 23.55 ? 275 VAL A CG1 1 
ATOM   515 C CG2 . VAL A 1 65 ? 15.529 15.555 13.682 1.00 25.80 ? 275 VAL A CG2 1 
ATOM   516 N N   . HIS A 1 66 ? 18.407 17.139 13.995 1.00 22.08 ? 276 HIS A N   1 
ATOM   517 C CA  . HIS A 1 66 ? 18.987 18.323 13.383 1.00 22.03 ? 276 HIS A CA  1 
ATOM   518 C C   . HIS A 1 66 ? 20.525 18.320 13.292 1.00 22.39 ? 276 HIS A C   1 
ATOM   519 O O   . HIS A 1 66 ? 21.134 19.168 12.644 1.00 23.59 ? 276 HIS A O   1 
ATOM   520 C CB  . HIS A 1 66 ? 18.431 19.616 14.022 1.00 22.30 ? 276 HIS A CB  1 
ATOM   521 C CG  . HIS A 1 66 ? 18.822 19.818 15.451 1.00 20.90 ? 276 HIS A CG  1 
ATOM   522 N ND1 . HIS A 1 66 ? 17.938 19.658 16.496 1.00 25.42 ? 276 HIS A ND1 1 
ATOM   523 C CD2 . HIS A 1 66 ? 19.996 20.192 16.005 1.00 20.78 ? 276 HIS A CD2 1 
ATOM   524 C CE1 . HIS A 1 66 ? 18.554 19.930 17.632 1.00 22.19 ? 276 HIS A CE1 1 
ATOM   525 N NE2 . HIS A 1 66 ? 19.805 20.248 17.364 1.00 24.11 ? 276 HIS A NE2 1 
ATOM   526 N N   . LYS A 1 67 ? 21.162 17.354 13.951 1.00 20.11 ? 277 LYS A N   1 
ATOM   527 C CA  . LYS A 1 67 ? 22.611 17.212 13.880 1.00 20.16 ? 277 LYS A CA  1 
ATOM   528 C C   . LYS A 1 67 ? 23.027 16.020 13.012 1.00 19.58 ? 277 LYS A C   1 
ATOM   529 O O   . LYS A 1 67 ? 24.208 15.686 12.969 1.00 20.74 ? 277 LYS A O   1 
ATOM   530 C CB  . LYS A 1 67 ? 23.206 17.054 15.288 1.00 20.98 ? 277 LYS A CB  1 
ATOM   531 C CG  . LYS A 1 67 ? 23.250 18.346 16.096 1.00 22.70 ? 277 LYS A CG  1 
ATOM   532 C CD  . LYS A 1 67 ? 24.192 19.380 15.450 1.00 25.80 ? 277 LYS A CD  1 
ATOM   533 C CE  . LYS A 1 67 ? 24.381 20.648 16.286 1.00 28.91 ? 277 LYS A CE  1 
ATOM   534 N NZ  . LYS A 1 67 ? 23.108 21.326 16.658 1.00 32.85 ? 277 LYS A NZ  1 
ATOM   535 N N   . VAL A 1 68 ? 22.049 15.396 12.357 1.00 18.49 ? 278 VAL A N   1 
ATOM   536 C CA  . VAL A 1 68 ? 22.292 14.170 11.559 1.00 19.20 ? 278 VAL A CA  1 
ATOM   537 C C   . VAL A 1 68 ? 21.801 14.395 10.142 1.00 19.27 ? 278 VAL A C   1 
ATOM   538 O O   . VAL A 1 68 ? 20.638 14.765 9.930  1.00 20.85 ? 278 VAL A O   1 
ATOM   539 C CB  . VAL A 1 68 ? 21.590 12.926 12.184 1.00 18.94 ? 278 VAL A CB  1 
ATOM   540 C CG1 . VAL A 1 68 ? 21.832 11.677 11.346 1.00 20.75 ? 278 VAL A CG1 1 
ATOM   541 C CG2 . VAL A 1 68 ? 22.082 12.665 13.611 1.00 18.90 ? 278 VAL A CG2 1 
ATOM   542 N N   . THR A 1 69 ? 22.676 14.159 9.172  0.50 17.68 ? 279 THR A N   1 
ATOM   543 C CA  . THR A 1 69 ? 22.334 14.409 7.785  0.50 18.26 ? 279 THR A CA  1 
ATOM   544 C C   . THR A 1 69 ? 22.755 13.227 6.940  0.50 17.19 ? 279 THR A C   1 
ATOM   545 O O   . THR A 1 69 ? 23.810 12.623 7.157  0.50 14.24 ? 279 THR A O   1 
ATOM   546 C CB  A THR A 1 69 ? 23.114 15.618 7.263  0.50 19.17 ? 279 THR A CB  1 
ATOM   547 C CB  B THR A 1 69 ? 22.927 15.720 7.256  0.50 19.16 ? 279 THR A CB  1 
ATOM   548 O OG1 A THR A 1 69 ? 22.749 15.890 5.900  0.50 21.55 ? 279 THR A OG1 1 
ATOM   549 O OG1 B THR A 1 69 ? 24.306 15.808 7.612  0.50 19.85 ? 279 THR A OG1 1 
ATOM   550 C CG2 A THR A 1 69 ? 24.590 15.335 7.330  0.50 19.76 ? 279 THR A CG2 1 
ATOM   551 C CG2 B THR A 1 69 ? 22.194 16.905 7.857  0.50 18.91 ? 279 THR A CG2 1 
ATOM   552 N N   . LYS A 1 70 ? 21.936 12.920 5.949  1.00 19.25 ? 280 LYS A N   1 
ATOM   553 C CA  . LYS A 1 70 ? 22.212 11.813 5.052  1.00 21.28 ? 280 LYS A CA  1 
ATOM   554 C C   . LYS A 1 70 ? 23.474 12.094 4.239  1.00 21.39 ? 280 LYS A C   1 
ATOM   555 O O   . LYS A 1 70 ? 23.704 13.225 3.799  1.00 21.00 ? 280 LYS A O   1 
ATOM   556 C CB  . LYS A 1 70 ? 20.995 11.569 4.151  1.00 21.09 ? 280 LYS A CB  1 
ATOM   557 C CG  . LYS A 1 70 ? 19.844 10.906 4.905  1.00 23.66 ? 280 LYS A CG  1 
ATOM   558 C CD  . LYS A 1 70 ? 18.591 10.663 4.058  1.00 25.73 ? 280 LYS A CD  1 
ATOM   559 C CE  . LYS A 1 70 ? 18.718 9.424  3.201  1.00 31.16 ? 280 LYS A CE  1 
ATOM   560 N NZ  . LYS A 1 70 ? 19.638 9.620  2.039  1.00 35.51 ? 280 LYS A NZ  1 
ATOM   561 N N   . ILE A 1 71 ? 24.317 11.076 4.075  1.00 21.60 ? 281 ILE A N   1 
ATOM   562 C CA  . ILE A 1 71 ? 25.534 11.242 3.278  1.00 23.87 ? 281 ILE A CA  1 
ATOM   563 C C   . ILE A 1 71 ? 25.162 11.661 1.861  1.00 25.55 ? 281 ILE A C   1 
ATOM   564 O O   . ILE A 1 71 ? 24.250 11.096 1.258  1.00 25.97 ? 281 ILE A O   1 
ATOM   565 C CB  . ILE A 1 71 ? 26.462 10.003 3.326  1.00 23.75 ? 281 ILE A CB  1 
ATOM   566 C CG1 . ILE A 1 71 ? 27.136 9.938  4.698  1.00 23.96 ? 281 ILE A CG1 1 
ATOM   567 C CG2 . ILE A 1 71 ? 27.557 10.104 2.252  1.00 24.12 ? 281 ILE A CG2 1 
ATOM   568 C CD1 . ILE A 1 71 ? 28.015 8.733  4.943  1.00 24.37 ? 281 ILE A CD1 1 
ATOM   569 N N   . GLY A 1 72 ? 25.845 12.692 1.373  1.00 27.20 ? 282 GLY A N   1 
ATOM   570 C CA  . GLY A 1 72 ? 25.601 13.232 0.030  1.00 29.11 ? 282 GLY A CA  1 
ATOM   571 C C   . GLY A 1 72 ? 24.921 14.587 0.043  1.00 30.72 ? 282 GLY A C   1 
ATOM   572 O O   . GLY A 1 72 ? 24.838 15.261 -0.987 1.00 31.38 ? 282 GLY A O   1 
ATOM   573 N N   . PHE A 1 73 ? 24.444 14.992 1.215  1.00 31.35 ? 283 PHE A N   1 
ATOM   574 C CA  . PHE A 1 73 ? 23.713 16.243 1.372  1.00 32.43 ? 283 PHE A CA  1 
ATOM   575 C C   . PHE A 1 73 ? 24.505 17.186 2.275  1.00 32.47 ? 283 PHE A C   1 
ATOM   576 O O   . PHE A 1 73 ? 25.318 16.724 3.082  1.00 31.81 ? 283 PHE A O   1 
ATOM   577 C CB  . PHE A 1 73 ? 22.326 15.964 1.962  1.00 32.80 ? 283 PHE A CB  1 
ATOM   578 C CG  . PHE A 1 73 ? 21.445 15.117 1.081  1.00 35.22 ? 283 PHE A CG  1 
ATOM   579 C CD1 . PHE A 1 73 ? 20.520 15.712 0.228  1.00 38.52 ? 283 PHE A CD1 1 
ATOM   580 C CD2 . PHE A 1 73 ? 21.532 13.726 1.109  1.00 37.47 ? 283 PHE A CD2 1 
ATOM   581 C CE1 . PHE A 1 73 ? 19.695 14.934 -0.591 1.00 39.48 ? 283 PHE A CE1 1 
ATOM   582 C CE2 . PHE A 1 73 ? 20.717 12.937 0.296  1.00 38.87 ? 283 PHE A CE2 1 
ATOM   583 C CZ  . PHE A 1 73 ? 19.795 13.540 -0.555 1.00 40.00 ? 283 PHE A CZ  1 
ATOM   584 N N   . PRO A 1 74 ? 24.283 18.512 2.151  1.00 32.67 ? 284 PRO A N   1 
ATOM   585 C CA  . PRO A 1 74 ? 25.006 19.450 3.017  1.00 32.87 ? 284 PRO A CA  1 
ATOM   586 C C   . PRO A 1 74 ? 24.537 19.319 4.468  1.00 33.17 ? 284 PRO A C   1 
ATOM   587 O O   . PRO A 1 74 ? 23.340 19.153 4.720  1.00 33.31 ? 284 PRO A O   1 
ATOM   588 C CB  . PRO A 1 74 ? 24.618 20.821 2.448  1.00 32.94 ? 284 PRO A CB  1 
ATOM   589 C CG  . PRO A 1 74 ? 23.261 20.590 1.839  1.00 33.22 ? 284 PRO A CG  1 
ATOM   590 C CD  . PRO A 1 74 ? 23.367 19.214 1.228  1.00 32.99 ? 284 PRO A CD  1 
ATOM   591 N N   . SER A 1 75 ? 25.475 19.377 5.406  1.00 33.06 ? 285 SER A N   1 
ATOM   592 C CA  . SER A 1 75 ? 25.143 19.205 6.817  1.00 33.59 ? 285 SER A CA  1 
ATOM   593 C C   . SER A 1 75 ? 24.650 20.497 7.469  1.00 35.15 ? 285 SER A C   1 
ATOM   594 O O   . SER A 1 75 ? 23.996 20.452 8.512  1.00 35.55 ? 285 SER A O   1 
ATOM   595 C CB  . SER A 1 75 ? 26.331 18.632 7.588  1.00 32.94 ? 285 SER A CB  1 
ATOM   596 O OG  . SER A 1 75 ? 27.410 19.543 7.618  1.00 29.62 ? 285 SER A OG  1 
ATOM   597 N N   . THR A 1 76 ? 24.990 21.634 6.860  1.00 36.35 ? 286 THR A N   1 
ATOM   598 C CA  . THR A 1 76 ? 24.522 22.954 7.296  1.00 37.91 ? 286 THR A CA  1 
ATOM   599 C C   . THR A 1 76 ? 24.279 23.852 6.085  1.00 38.14 ? 286 THR A C   1 
ATOM   600 O O   . THR A 1 76 ? 25.008 23.789 5.091  1.00 38.65 ? 286 THR A O   1 
ATOM   601 C CB  . THR A 1 76 ? 25.519 23.662 8.251  1.00 38.06 ? 286 THR A CB  1 
ATOM   602 O OG1 . THR A 1 76 ? 26.870 23.416 7.832  1.00 39.99 ? 286 THR A OG1 1 
ATOM   603 C CG2 . THR A 1 76 ? 25.338 23.180 9.685  1.00 39.13 ? 286 THR A CG2 1 
ATOM   604 N N   . VAL A 1 86 ? 33.905 24.999 12.659 1.00 30.37 ? 296 VAL A N   1 
ATOM   605 C CA  . VAL A 1 86 ? 34.386 23.621 12.672 1.00 29.77 ? 296 VAL A CA  1 
ATOM   606 C C   . VAL A 1 86 ? 34.355 23.072 11.248 1.00 27.96 ? 296 VAL A C   1 
ATOM   607 O O   . VAL A 1 86 ? 33.320 23.139 10.572 1.00 28.30 ? 296 VAL A O   1 
ATOM   608 C CB  . VAL A 1 86 ? 33.545 22.726 13.624 1.00 30.46 ? 296 VAL A CB  1 
ATOM   609 C CG1 . VAL A 1 86 ? 34.000 21.268 13.572 1.00 31.90 ? 296 VAL A CG1 1 
ATOM   610 C CG2 . VAL A 1 86 ? 33.619 23.243 15.061 1.00 31.80 ? 296 VAL A CG2 1 
ATOM   611 N N   . ARG A 1 87 ? 35.501 22.569 10.796 1.00 26.17 ? 297 ARG A N   1 
ATOM   612 C CA  . ARG A 1 87 ? 35.621 21.939 9.475  1.00 23.85 ? 297 ARG A CA  1 
ATOM   613 C C   . ARG A 1 87 ? 34.714 20.702 9.417  1.00 22.55 ? 297 ARG A C   1 
ATOM   614 O O   . ARG A 1 87 ? 34.722 19.853 10.329 1.00 23.42 ? 297 ARG A O   1 
ATOM   615 C CB  . ARG A 1 87 ? 37.059 21.508 9.211  1.00 24.51 ? 297 ARG A CB  1 
ATOM   616 C CG  . ARG A 1 87 ? 38.051 22.629 9.000  1.00 25.76 ? 297 ARG A CG  1 
ATOM   617 C CD  . ARG A 1 87 ? 39.461 22.102 9.254  1.00 27.58 ? 297 ARG A CD  1 
ATOM   618 N NE  . ARG A 1 87 ? 40.508 23.044 8.856  1.00 29.11 ? 297 ARG A NE  1 
ATOM   619 C CZ  . ARG A 1 87 ? 41.093 23.911 9.676  1.00 31.90 ? 297 ARG A CZ  1 
ATOM   620 N NH1 . ARG A 1 87 ? 40.728 23.989 10.955 1.00 33.65 ? 297 ARG A NH1 1 
ATOM   621 N NH2 . ARG A 1 87 ? 42.038 24.717 9.214  1.00 32.30 ? 297 ARG A NH2 1 
ATOM   622 N N   . ARG A 1 88 ? 33.934 20.601 8.350  1.00 19.57 ? 298 ARG A N   1 
ATOM   623 C CA  . ARG A 1 88 ? 33.039 19.462 8.158  1.00 18.68 ? 298 ARG A CA  1 
ATOM   624 C C   . ARG A 1 88 ? 33.384 18.736 6.880  1.00 17.56 ? 298 ARG A C   1 
ATOM   625 O O   . ARG A 1 88 ? 33.923 19.329 5.938  1.00 18.10 ? 298 ARG A O   1 
ATOM   626 C CB  . ARG A 1 88 ? 31.581 19.913 8.088  1.00 18.24 ? 298 ARG A CB  1 
ATOM   627 C CG  . ARG A 1 88 ? 31.084 20.529 9.405  1.00 19.29 ? 298 ARG A CG  1 
ATOM   628 C CD  . ARG A 1 88 ? 29.751 21.204 9.226  1.00 23.68 ? 298 ARG A CD  1 
ATOM   629 N NE  . ARG A 1 88 ? 29.159 21.501 10.533 1.00 27.82 ? 298 ARG A NE  1 
ATOM   630 C CZ  . ARG A 1 88 ? 28.032 20.958 11.001 1.00 28.46 ? 298 ARG A CZ  1 
ATOM   631 N NH1 . ARG A 1 88 ? 27.319 20.105 10.271 1.00 29.11 ? 298 ARG A NH1 1 
ATOM   632 N NH2 . ARG A 1 88 ? 27.597 21.293 12.212 1.00 29.95 ? 298 ARG A NH2 1 
ATOM   633 N N   . VAL A 1 89 ? 33.036 17.456 6.839  1.00 17.07 ? 299 VAL A N   1 
ATOM   634 C CA  . VAL A 1 89 ? 33.208 16.623 5.652  1.00 16.55 ? 299 VAL A CA  1 
ATOM   635 C C   . VAL A 1 89 ? 32.402 17.182 4.501  1.00 17.65 ? 299 VAL A C   1 
ATOM   636 O O   . VAL A 1 89 ? 32.930 17.385 3.392  1.00 16.49 ? 299 VAL A O   1 
ATOM   637 C CB  . VAL A 1 89 ? 32.735 15.171 5.982  1.00 15.85 ? 299 VAL A CB  1 
ATOM   638 C CG1 . VAL A 1 89 ? 32.619 14.271 4.740  1.00 16.64 ? 299 VAL A CG1 1 
ATOM   639 C CG2 . VAL A 1 89 ? 33.638 14.529 7.031  1.00 16.55 ? 299 VAL A CG2 1 
ATOM   640 N N   . MET A 1 90 ? 31.126 17.433 4.782  0.50 16.66 ? 300 MET A N   1 
ATOM   641 C CA  . MET A 1 90 ? 30.200 18.060 3.857  0.50 19.56 ? 300 MET A CA  1 
ATOM   642 C C   . MET A 1 90 ? 29.037 18.607 4.666  0.50 18.02 ? 300 MET A C   1 
ATOM   643 O O   . MET A 1 90 ? 29.037 18.458 5.890  0.50 14.84 ? 300 MET A O   1 
ATOM   644 C CB  A MET A 1 90 ? 29.760 17.088 2.748  0.50 19.61 ? 300 MET A CB  1 
ATOM   645 C CB  B MET A 1 90 ? 29.672 17.005 2.908  0.50 19.28 ? 300 MET A CB  1 
ATOM   646 C CG  A MET A 1 90 ? 28.622 16.144 3.086  0.50 21.60 ? 300 MET A CG  1 
ATOM   647 C CG  B MET A 1 90 ? 28.775 15.993 3.588  0.50 21.10 ? 300 MET A CG  1 
ATOM   648 S SD  A MET A 1 90 ? 28.231 15.058 1.697  0.50 26.72 ? 300 MET A SD  1 
ATOM   649 S SD  B MET A 1 90 ? 28.073 14.828 2.418  0.50 24.21 ? 300 MET A SD  1 
ATOM   650 C CE  A MET A 1 90 ? 29.479 13.778 1.881  0.50 19.31 ? 300 MET A CE  1 
ATOM   651 C CE  B MET A 1 90 ? 27.863 15.976 1.006  0.50 15.40 ? 300 MET A CE  1 
HETATM 652 O O   . HOH B 2 .  ? 19.138 6.772  28.941 1.00 18.13 ? 1   HOH A O   1 
HETATM 653 O O   . HOH B 2 .  ? 33.012 7.386  11.779 1.00 16.22 ? 2   HOH A O   1 
HETATM 654 O O   . HOH B 2 .  ? 19.350 -1.457 15.228 1.00 18.28 ? 3   HOH A O   1 
HETATM 655 O O   . HOH B 2 .  ? 18.759 8.517  31.024 1.00 19.22 ? 4   HOH A O   1 
HETATM 656 O O   . HOH B 2 .  ? 14.512 2.717  16.754 1.00 22.33 ? 5   HOH A O   1 
HETATM 657 O O   . HOH B 2 .  ? 29.003 2.220  10.805 1.00 16.64 ? 6   HOH A O   1 
HETATM 658 O O   . HOH B 2 .  ? 35.732 13.078 12.489 1.00 23.84 ? 7   HOH A O   1 
HETATM 659 O O   . HOH B 2 .  ? 20.912 -3.569 18.610 1.00 21.06 ? 8   HOH A O   1 
HETATM 660 O O   . HOH B 2 .  ? 26.624 1.473  7.425  1.00 19.34 ? 9   HOH A O   1 
HETATM 661 O O   . HOH B 2 .  ? 29.228 -2.542 16.220 1.00 21.46 ? 10  HOH A O   1 
HETATM 662 O O   . HOH B 2 .  ? 25.500 16.096 10.079 1.00 22.01 ? 11  HOH A O   1 
HETATM 663 O O   . HOH B 2 .  ? 31.443 2.887  24.665 1.00 25.06 ? 12  HOH A O   1 
HETATM 664 O O   . HOH B 2 .  ? 17.448 2.806  5.527  1.00 18.67 ? 13  HOH A O   1 
HETATM 665 O O   . HOH B 2 .  ? 36.384 19.099 12.185 1.00 23.97 ? 14  HOH A O   1 
HETATM 666 O O   . HOH B 2 .  ? 16.340 0.410  16.663 1.00 21.01 ? 15  HOH A O   1 
HETATM 667 O O   . HOH B 2 .  ? 12.708 11.554 24.265 1.00 20.89 ? 16  HOH A O   1 
HETATM 668 O O   . HOH B 2 .  ? 35.069 14.641 14.625 1.00 27.48 ? 17  HOH A O   1 
HETATM 669 O O   . HOH B 2 .  ? 27.760 -0.002 9.554  0.50 18.11 ? 18  HOH A O   1 
HETATM 670 O O   . HOH B 2 .  ? 18.653 -2.744 17.534 1.00 21.43 ? 19  HOH A O   1 
HETATM 671 O O   . HOH B 2 .  ? 12.440 11.593 26.953 1.00 22.51 ? 20  HOH A O   1 
HETATM 672 O O   . HOH B 2 .  ? 18.112 4.667  32.589 1.00 30.99 ? 21  HOH A O   1 
HETATM 673 O O   . HOH B 2 .  ? 17.026 -0.954 18.923 1.00 23.20 ? 22  HOH A O   1 
HETATM 674 O O   . HOH B 2 .  ? 24.611 18.587 11.158 1.00 28.67 ? 23  HOH A O   1 
HETATM 675 O O   . HOH B 2 .  ? 21.712 5.789  3.095  1.00 30.07 ? 24  HOH A O   1 
HETATM 676 O O   . HOH B 2 .  ? 12.991 4.106  10.447 1.00 31.68 ? 25  HOH A O   1 
HETATM 677 O O   . HOH B 2 .  ? 12.326 20.352 28.268 0.50 18.49 ? 26  HOH A O   1 
HETATM 678 O O   . HOH B 2 .  ? 25.778 14.734 4.840  1.00 32.55 ? 27  HOH A O   1 
HETATM 679 O O   . HOH B 2 .  ? 31.667 -5.308 22.280 1.00 40.13 ? 28  HOH A O   1 
HETATM 680 O O   . HOH B 2 .  ? 10.087 6.179  20.481 1.00 29.46 ? 29  HOH A O   1 
HETATM 681 O O   . HOH B 2 .  ? 22.790 -6.143 23.960 1.00 31.00 ? 30  HOH A O   1 
HETATM 682 O O   . HOH B 2 .  ? 12.602 4.555  22.598 1.00 32.35 ? 31  HOH A O   1 
HETATM 683 O O   . HOH B 2 .  ? 17.157 -1.026 28.542 1.00 31.22 ? 32  HOH A O   1 
HETATM 684 O O   . HOH B 2 .  ? 35.476 -2.580 20.369 1.00 35.27 ? 33  HOH A O   1 
HETATM 685 O O   . HOH B 2 .  ? 13.913 9.816  32.169 1.00 27.77 ? 34  HOH A O   1 
HETATM 686 O O   . HOH B 2 .  ? 36.218 -0.074 20.673 1.00 29.82 ? 35  HOH A O   1 
HETATM 687 O O   . HOH B 2 .  ? 15.497 1.771  3.819  1.00 28.03 ? 36  HOH A O   1 
HETATM 688 O O   . HOH B 2 .  ? 35.870 7.745  20.979 1.00 28.82 ? 37  HOH A O   1 
HETATM 689 O O   . HOH B 2 .  ? 13.985 2.199  23.239 1.00 32.97 ? 38  HOH A O   1 
HETATM 690 O O   . HOH B 2 .  ? 15.273 0.538  21.419 1.00 28.33 ? 39  HOH A O   1 
HETATM 691 O O   . HOH B 2 .  ? 11.567 8.832  30.035 1.00 33.98 ? 40  HOH A O   1 
HETATM 692 O O   . HOH B 2 .  ? 18.743 16.011 9.944  1.00 24.00 ? 41  HOH A O   1 
HETATM 693 O O   . HOH B 2 .  ? 25.712 -5.402 26.349 1.00 32.83 ? 42  HOH A O   1 
HETATM 694 O O   . HOH B 2 .  ? 14.206 1.490  8.113  1.00 31.26 ? 43  HOH A O   1 
HETATM 695 O O   . HOH B 2 .  ? 30.035 19.638 14.193 1.00 32.50 ? 44  HOH A O   1 
HETATM 696 O O   . HOH B 2 .  ? 15.435 15.123 16.762 1.00 27.78 ? 45  HOH A O   1 
HETATM 697 O O   . HOH B 2 .  ? 17.639 7.198  33.105 1.00 33.98 ? 46  HOH A O   1 
HETATM 698 O O   . HOH B 2 .  ? 35.507 17.512 14.440 1.00 31.02 ? 47  HOH A O   1 
HETATM 699 O O   . HOH B 2 .  ? 37.894 -0.028 18.186 1.00 40.18 ? 48  HOH A O   1 
HETATM 700 O O   . HOH B 2 .  ? 21.760 8.235  3.328  1.00 37.20 ? 49  HOH A O   1 
HETATM 701 O O   . HOH B 2 .  ? 32.062 7.738  27.124 1.00 33.94 ? 50  HOH A O   1 
HETATM 702 O O   . HOH B 2 .  ? 18.942 -3.114 21.901 1.00 37.16 ? 51  HOH A O   1 
HETATM 703 O O   . HOH B 2 .  ? 18.994 5.232  2.794  1.00 36.45 ? 52  HOH A O   1 
HETATM 704 O O   . HOH B 2 .  ? 24.494 -5.714 17.913 1.00 35.31 ? 53  HOH A O   1 
HETATM 705 O O   . HOH B 2 .  ? 15.189 7.378  33.909 1.00 43.20 ? 54  HOH A O   1 
HETATM 706 O O   . HOH B 2 .  ? 13.111 14.727 15.604 1.00 39.53 ? 55  HOH A O   1 
HETATM 707 O O   . HOH B 2 .  ? 13.266 1.093  5.360  1.00 36.59 ? 56  HOH A O   1 
HETATM 708 O O   . HOH B 2 .  ? 24.260 14.223 -3.421 1.00 36.41 ? 57  HOH A O   1 
HETATM 709 O O   . HOH B 2 .  ? 30.993 13.218 20.633 1.00 35.50 ? 58  HOH A O   1 
HETATM 710 O O   . HOH B 2 .  ? 30.461 1.052  26.578 1.00 41.89 ? 59  HOH A O   1 
HETATM 711 O O   . HOH B 2 .  ? 15.685 8.015  4.510  1.00 38.49 ? 60  HOH A O   1 
HETATM 712 O O   . HOH B 2 .  ? 19.738 14.747 5.437  1.00 28.79 ? 61  HOH A O   1 
HETATM 713 O O   . HOH B 2 .  ? 22.570 -4.103 28.350 1.00 45.47 ? 62  HOH A O   1 
HETATM 714 O O   . HOH B 2 .  ? 17.077 -2.240 23.743 1.00 38.19 ? 63  HOH A O   1 
HETATM 715 O O   . HOH B 2 .  ? 10.484 11.521 25.501 1.00 31.91 ? 64  HOH A O   1 
HETATM 716 O O   . HOH B 2 .  ? 10.029 13.802 24.714 1.00 36.72 ? 65  HOH A O   1 
HETATM 717 O O   . HOH B 2 .  ? 15.029 1.187  25.415 1.00 45.08 ? 66  HOH A O   1 
HETATM 718 O O   . HOH B 2 .  ? 36.805 0.928  12.847 1.00 34.25 ? 67  HOH A O   1 
HETATM 719 O O   . HOH B 2 .  ? 11.818 7.219  10.239 1.00 37.76 ? 68  HOH A O   1 
HETATM 720 O O   . HOH B 2 .  ? 20.861 -6.212 19.894 1.00 35.31 ? 69  HOH A O   1 
HETATM 721 O O   . HOH B 2 .  ? 19.561 18.548 9.785  1.00 43.77 ? 70  HOH A O   1 
HETATM 722 O O   . HOH B 2 .  ? 32.886 11.707 20.235 1.00 38.65 ? 71  HOH A O   1 
HETATM 723 O O   . HOH B 2 .  ? 28.975 15.264 17.052 1.00 52.92 ? 72  HOH A O   1 
HETATM 724 O O   . HOH B 2 .  ? 13.139 2.924  29.453 1.00 34.65 ? 73  HOH A O   1 
HETATM 725 O O   . HOH B 2 .  ? 17.607 20.825 10.635 1.00 41.49 ? 74  HOH A O   1 
HETATM 726 O O   . HOH B 2 .  ? 37.871 23.213 12.264 1.00 42.57 ? 75  HOH A O   1 
HETATM 727 O O   . HOH B 2 .  ? 37.475 10.207 20.227 1.00 47.81 ? 76  HOH A O   1 
HETATM 728 O O   . HOH B 2 .  ? 29.553 -3.088 25.766 1.00 47.72 ? 77  HOH A O   1 
HETATM 729 O O   . HOH B 2 .  ? 8.261  7.483  24.438 1.00 59.21 ? 78  HOH A O   1 
HETATM 730 O O   . HOH B 2 .  ? 33.783 0.536  9.886  0.50 22.84 ? 79  HOH A O   1 
HETATM 731 O O   . HOH B 2 .  ? 35.966 1.783  8.902  1.00 43.61 ? 80  HOH A O   1 
HETATM 732 O O   . HOH B 2 .  ? 22.207 23.731 18.504 1.00 41.81 ? 81  HOH A O   1 
HETATM 733 O O   . HOH B 2 .  ? 14.262 12.208 2.143  1.00 52.43 ? 82  HOH A O   1 
HETATM 734 O O   . HOH B 2 .  ? 38.128 20.840 13.105 1.00 44.98 ? 83  HOH A O   1 
HETATM 735 O O   . HOH B 2 .  ? 10.962 9.227  26.475 1.00 41.04 ? 84  HOH A O   1 
HETATM 736 O O   . HOH B 2 .  ? 21.893 21.560 14.165 1.00 44.03 ? 85  HOH A O   1 
HETATM 737 O O   . HOH B 2 .  ? 20.363 -5.413 22.620 1.00 43.17 ? 86  HOH A O   1 
HETATM 738 O O   . HOH B 2 .  ? 18.206 15.038 7.795  1.00 44.26 ? 87  HOH A O   1 
HETATM 739 O O   . HOH B 2 .  ? 13.496 1.486  19.099 1.00 37.84 ? 88  HOH A O   1 
HETATM 740 O O   . HOH B 2 .  ? 39.071 12.663 16.329 1.00 42.11 ? 89  HOH A O   1 
HETATM 741 O O   . HOH B 2 .  ? 31.601 5.690  4.046  1.00 45.26 ? 90  HOH A O   1 
HETATM 742 O O   . HOH B 2 .  ? 24.555 2.580  30.643 1.00 40.66 ? 91  HOH A O   1 
HETATM 743 O O   . HOH B 2 .  ? 30.696 23.797 11.361 1.00 44.15 ? 92  HOH A O   1 
HETATM 744 O O   . HOH B 2 .  ? 11.895 3.355  20.147 1.00 47.92 ? 93  HOH A O   1 
HETATM 745 O O   . HOH B 2 .  ? 39.212 6.066  19.208 1.00 43.85 ? 94  HOH A O   1 
HETATM 746 O O   . HOH B 2 .  ? 13.439 9.341  34.826 1.00 53.18 ? 95  HOH A O   1 
HETATM 747 O O   . HOH B 2 .  ? 12.305 4.651  13.876 1.00 56.20 ? 96  HOH A O   1 
HETATM 748 O O   . HOH B 2 .  ? 26.993 14.877 -2.697 1.00 53.63 ? 97  HOH A O   1 
HETATM 749 O O   . HOH B 2 .  ? 18.379 -3.722 28.272 1.00 48.21 ? 98  HOH A O   1 
HETATM 750 O O   . HOH B 2 .  ? 31.463 17.350 15.082 1.00 52.45 ? 99  HOH A O   1 
HETATM 751 O O   . HOH B 2 .  ? 35.642 11.547 18.844 1.00 41.38 ? 100 HOH A O   1 
HETATM 752 O O   . HOH B 2 .  ? 14.983 -2.147 22.166 1.00 42.07 ? 101 HOH A O   1 
HETATM 753 O O   . HOH B 2 .  ? 15.897 1.595  31.772 1.00 46.64 ? 102 HOH A O   1 
HETATM 754 O O   . HOH B 2 .  ? 30.758 14.773 18.830 1.00 65.34 ? 103 HOH A O   1 
HETATM 755 O O   . HOH B 2 .  ? 12.427 10.337 10.393 1.00 47.20 ? 104 HOH A O   1 
HETATM 756 O O   . HOH B 2 .  ? 18.516 6.970  0.797  1.00 51.83 ? 105 HOH A O   1 
HETATM 757 O O   . HOH B 2 .  ? 17.034 17.886 10.112 1.00 54.23 ? 106 HOH A O   1 
HETATM 758 O O   . HOH B 2 .  ? 22.124 9.654  1.125  1.00 51.47 ? 107 HOH A O   1 
HETATM 759 O O   . HOH B 2 .  ? 19.879 -2.386 30.113 1.00 62.24 ? 108 HOH A O   1 
HETATM 760 O O   . HOH B 2 .  ? 36.603 13.293 16.582 1.00 43.80 ? 109 HOH A O   1 
HETATM 761 O O   . HOH B 2 .  ? 13.569 12.322 11.758 1.00 52.61 ? 110 HOH A O   1 
HETATM 762 O O   . HOH B 2 .  ? 20.194 8.942  -0.589 1.00 58.53 ? 111 HOH A O   1 
HETATM 763 O O   . HOH B 2 .  ? 23.389 24.026 16.219 1.00 66.99 ? 112 HOH A O   1 
HETATM 764 O O   . HOH B 2 .  ? 33.407 18.555 16.592 1.00 55.36 ? 113 HOH A O   1 
HETATM 765 O O   . HOH B 2 .  ? 15.530 3.784  1.784  1.00 46.75 ? 114 HOH A O   1 
HETATM 766 O O   . HOH B 2 .  ? 20.674 5.113  35.874 1.00 44.54 ? 115 HOH A O   1 
HETATM 767 O O   . HOH B 2 .  ? 33.223 4.731  25.550 1.00 65.18 ? 116 HOH A O   1 
HETATM 768 O O   . HOH B 2 .  ? 23.021 -0.495 30.231 1.00 53.53 ? 117 HOH A O   1 
HETATM 769 O O   . HOH B 2 .  ? 26.253 13.489 18.471 1.00 53.03 ? 118 HOH A O   1 
HETATM 770 O O   . HOH B 2 .  ? 15.746 14.129 7.171  1.00 49.77 ? 119 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLU 1  211 211 GLU GLU A . n 
A 1 2  LEU 2  212 212 LEU LEU A . n 
A 1 3  LYS 3  213 213 LYS LYS A . n 
A 1 4  ILE 4  214 214 ILE ILE A . n 
A 1 5  GLY 5  215 215 GLY GLY A . n 
A 1 6  ASP 6  216 216 ASP ASP A . n 
A 1 7  ARG 7  217 217 ARG ARG A . n 
A 1 8  VAL 8  218 218 VAL VAL A . n 
A 1 9  LEU 9  219 219 LEU LEU A . n 
A 1 10 VAL 10 220 220 VAL VAL A . n 
A 1 11 GLY 11 221 221 GLY GLY A . n 
A 1 12 GLY 12 222 222 GLY GLY A . n 
A 1 13 THR 13 223 223 THR THR A . n 
A 1 14 LYS 14 224 224 LYS LYS A . n 
A 1 15 ALA 15 225 225 ALA ALA A . n 
A 1 16 GLY 16 226 226 GLY GLY A . n 
A 1 17 VAL 17 227 227 VAL VAL A . n 
A 1 18 VAL 18 228 228 VAL VAL A . n 
A 1 19 ARG 19 229 229 ARG ARG A . n 
A 1 20 PHE 20 230 230 PHE PHE A . n 
A 1 21 LEU 21 231 231 LEU LEU A . n 
A 1 22 GLY 22 232 232 GLY GLY A . n 
A 1 23 GLU 23 233 233 GLU GLU A . n 
A 1 24 THR 24 234 234 THR THR A . n 
A 1 25 ASP 25 235 235 ASP ASP A . n 
A 1 26 PHE 26 236 236 PHE PHE A . n 
A 1 27 ALA 27 237 237 ALA ALA A . n 
A 1 28 LYS 28 238 238 LYS LYS A . n 
A 1 29 GLY 29 239 239 GLY GLY A . n 
A 1 30 GLU 30 240 240 GLU GLU A . n 
A 1 31 TRP 31 241 241 TRP TRP A . n 
A 1 32 CYS 32 242 242 CYS CYS A . n 
A 1 33 GLY 33 243 243 GLY GLY A . n 
A 1 34 VAL 34 244 244 VAL VAL A . n 
A 1 35 GLU 35 245 245 GLU GLU A . n 
A 1 36 LEU 36 246 246 LEU LEU A . n 
A 1 37 ASP 37 247 247 ASP ASP A . n 
A 1 38 GLU 38 248 248 GLU GLU A . n 
A 1 39 PRO 39 249 249 PRO PRO A . n 
A 1 40 LEU 40 250 250 LEU LEU A . n 
A 1 41 GLY 41 251 251 GLY GLY A . n 
A 1 42 LYS 42 252 252 LYS LYS A . n 
A 1 43 ASN 43 253 253 ASN ASN A . n 
A 1 44 ASP 44 254 254 ASP ASP A . n 
A 1 45 GLY 45 255 255 GLY GLY A . n 
A 1 46 ALA 46 256 256 ALA ALA A . n 
A 1 47 VAL 47 257 257 VAL VAL A . n 
A 1 48 ALA 48 258 258 ALA ALA A . n 
A 1 49 GLY 49 259 259 GLY GLY A . n 
A 1 50 THR 50 260 260 THR THR A . n 
A 1 51 ARG 51 261 261 ARG ARG A . n 
A 1 52 TYR 52 262 262 TYR TYR A . n 
A 1 53 PHE 53 263 263 PHE PHE A . n 
A 1 54 GLN 54 264 264 GLN GLN A . n 
A 1 55 CYS 55 265 265 CYS CYS A . n 
A 1 56 GLN 56 266 266 GLN GLN A . n 
A 1 57 PRO 57 267 267 PRO PRO A . n 
A 1 58 LYS 58 268 268 LYS LYS A . n 
A 1 59 TYR 59 269 269 TYR TYR A . n 
A 1 60 GLY 60 270 270 GLY GLY A . n 
A 1 61 LEU 61 271 271 LEU LEU A . n 
A 1 62 PHE 62 272 272 PHE PHE A . n 
A 1 63 ALA 63 273 273 ALA ALA A . n 
A 1 64 PRO 64 274 274 PRO PRO A . n 
A 1 65 VAL 65 275 275 VAL VAL A . n 
A 1 66 HIS 66 276 276 HIS HIS A . n 
A 1 67 LYS 67 277 277 LYS LYS A . n 
A 1 68 VAL 68 278 278 VAL VAL A . n 
A 1 69 THR 69 279 279 THR THR A . n 
A 1 70 LYS 70 280 280 LYS LYS A . n 
A 1 71 ILE 71 281 281 ILE ILE A . n 
A 1 72 GLY 72 282 282 GLY GLY A . n 
A 1 73 PHE 73 283 283 PHE PHE A . n 
A 1 74 PRO 74 284 284 PRO PRO A . n 
A 1 75 SER 75 285 285 SER SER A . n 
A 1 76 THR 76 286 286 THR THR A . n 
A 1 77 THR 77 287 ?   ?   ?   A . n 
A 1 78 PRO 78 288 ?   ?   ?   A . n 
A 1 79 ALA 79 289 ?   ?   ?   A . n 
A 1 80 LYS 80 290 ?   ?   ?   A . n 
A 1 81 ALA 81 291 ?   ?   ?   A . n 
A 1 82 LYS 82 292 ?   ?   ?   A . n 
A 1 83 ALA 83 293 ?   ?   ?   A . n 
A 1 84 ASN 84 294 ?   ?   ?   A . n 
A 1 85 ALA 85 295 ?   ?   ?   A . n 
A 1 86 VAL 86 296 296 VAL VAL A . n 
A 1 87 ARG 87 297 297 ARG ARG A . n 
A 1 88 ARG 88 298 298 ARG ARG A . n 
A 1 89 VAL 89 299 299 VAL VAL A . n 
A 1 90 MET 90 300 300 MET MET A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   1   1   HOH HOH A . 
B 2 HOH 2   2   2   HOH HOH A . 
B 2 HOH 3   3   3   HOH HOH A . 
B 2 HOH 4   4   4   HOH HOH A . 
B 2 HOH 5   5   5   HOH HOH A . 
B 2 HOH 6   6   6   HOH HOH A . 
B 2 HOH 7   7   7   HOH HOH A . 
B 2 HOH 8   8   8   HOH HOH A . 
B 2 HOH 9   9   9   HOH HOH A . 
B 2 HOH 10  10  10  HOH HOH A . 
B 2 HOH 11  11  11  HOH HOH A . 
B 2 HOH 12  12  12  HOH HOH A . 
B 2 HOH 13  13  13  HOH HOH A . 
B 2 HOH 14  14  14  HOH HOH A . 
B 2 HOH 15  15  15  HOH HOH A . 
B 2 HOH 16  16  16  HOH HOH A . 
B 2 HOH 17  17  17  HOH HOH A . 
B 2 HOH 18  18  18  HOH HOH A . 
B 2 HOH 19  19  19  HOH HOH A . 
B 2 HOH 20  20  20  HOH HOH A . 
B 2 HOH 21  21  21  HOH HOH A . 
B 2 HOH 22  22  22  HOH HOH A . 
B 2 HOH 23  23  23  HOH HOH A . 
B 2 HOH 24  24  24  HOH HOH A . 
B 2 HOH 25  25  25  HOH HOH A . 
B 2 HOH 26  26  26  HOH HOH A . 
B 2 HOH 27  27  27  HOH HOH A . 
B 2 HOH 28  28  28  HOH HOH A . 
B 2 HOH 29  29  29  HOH HOH A . 
B 2 HOH 30  30  30  HOH HOH A . 
B 2 HOH 31  31  31  HOH HOH A . 
B 2 HOH 32  32  32  HOH HOH A . 
B 2 HOH 33  33  33  HOH HOH A . 
B 2 HOH 34  34  34  HOH HOH A . 
B 2 HOH 35  35  35  HOH HOH A . 
B 2 HOH 36  36  36  HOH HOH A . 
B 2 HOH 37  37  37  HOH HOH A . 
B 2 HOH 38  38  38  HOH HOH A . 
B 2 HOH 39  39  39  HOH HOH A . 
B 2 HOH 40  40  40  HOH HOH A . 
B 2 HOH 41  41  41  HOH HOH A . 
B 2 HOH 42  42  42  HOH HOH A . 
B 2 HOH 43  43  43  HOH HOH A . 
B 2 HOH 44  44  44  HOH HOH A . 
B 2 HOH 45  45  45  HOH HOH A . 
B 2 HOH 46  46  46  HOH HOH A . 
B 2 HOH 47  47  47  HOH HOH A . 
B 2 HOH 48  48  48  HOH HOH A . 
B 2 HOH 49  49  49  HOH HOH A . 
B 2 HOH 50  50  50  HOH HOH A . 
B 2 HOH 51  51  51  HOH HOH A . 
B 2 HOH 52  52  52  HOH HOH A . 
B 2 HOH 53  53  53  HOH HOH A . 
B 2 HOH 54  54  54  HOH HOH A . 
B 2 HOH 55  55  55  HOH HOH A . 
B 2 HOH 56  56  56  HOH HOH A . 
B 2 HOH 57  57  57  HOH HOH A . 
B 2 HOH 58  58  58  HOH HOH A . 
B 2 HOH 59  59  59  HOH HOH A . 
B 2 HOH 60  60  60  HOH HOH A . 
B 2 HOH 61  61  61  HOH HOH A . 
B 2 HOH 62  62  62  HOH HOH A . 
B 2 HOH 63  63  63  HOH HOH A . 
B 2 HOH 64  64  64  HOH HOH A . 
B 2 HOH 65  65  65  HOH HOH A . 
B 2 HOH 66  66  66  HOH HOH A . 
B 2 HOH 67  67  67  HOH HOH A . 
B 2 HOH 68  68  68  HOH HOH A . 
B 2 HOH 69  69  69  HOH HOH A . 
B 2 HOH 70  70  70  HOH HOH A . 
B 2 HOH 71  71  71  HOH HOH A . 
B 2 HOH 72  72  72  HOH HOH A . 
B 2 HOH 73  73  73  HOH HOH A . 
B 2 HOH 74  74  74  HOH HOH A . 
B 2 HOH 75  75  75  HOH HOH A . 
B 2 HOH 76  76  76  HOH HOH A . 
B 2 HOH 77  77  77  HOH HOH A . 
B 2 HOH 78  78  78  HOH HOH A . 
B 2 HOH 79  79  79  HOH HOH A . 
B 2 HOH 80  80  80  HOH HOH A . 
B 2 HOH 81  81  81  HOH HOH A . 
B 2 HOH 82  82  82  HOH HOH A . 
B 2 HOH 83  83  83  HOH HOH A . 
B 2 HOH 84  84  84  HOH HOH A . 
B 2 HOH 85  85  85  HOH HOH A . 
B 2 HOH 86  86  86  HOH HOH A . 
B 2 HOH 87  87  87  HOH HOH A . 
B 2 HOH 88  88  88  HOH HOH A . 
B 2 HOH 89  89  89  HOH HOH A . 
B 2 HOH 90  90  90  HOH HOH A . 
B 2 HOH 91  91  91  HOH HOH A . 
B 2 HOH 92  92  92  HOH HOH A . 
B 2 HOH 93  93  93  HOH HOH A . 
B 2 HOH 94  94  94  HOH HOH A . 
B 2 HOH 95  95  95  HOH HOH A . 
B 2 HOH 96  96  96  HOH HOH A . 
B 2 HOH 97  97  97  HOH HOH A . 
B 2 HOH 98  98  98  HOH HOH A . 
B 2 HOH 99  99  99  HOH HOH A . 
B 2 HOH 100 100 100 HOH HOH A . 
B 2 HOH 101 101 101 HOH HOH A . 
B 2 HOH 102 102 102 HOH HOH A . 
B 2 HOH 103 103 103 HOH HOH A . 
B 2 HOH 104 104 104 HOH HOH A . 
B 2 HOH 105 105 105 HOH HOH A . 
B 2 HOH 106 106 106 HOH HOH A . 
B 2 HOH 107 107 107 HOH HOH A . 
B 2 HOH 108 108 108 HOH HOH A . 
B 2 HOH 109 109 109 HOH HOH A . 
B 2 HOH 110 110 110 HOH HOH A . 
B 2 HOH 111 111 111 HOH HOH A . 
B 2 HOH 112 112 112 HOH HOH A . 
B 2 HOH 113 113 113 HOH HOH A . 
B 2 HOH 114 114 114 HOH HOH A . 
B 2 HOH 115 115 115 HOH HOH A . 
B 2 HOH 116 116 116 HOH HOH A . 
B 2 HOH 117 117 117 HOH HOH A . 
B 2 HOH 118 118 118 HOH HOH A . 
B 2 HOH 119 119 119 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     18 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   B 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-08-28 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC   refinement        5.2.0019 ? 1 
HKL-2000 'data collection' .        ? 2 
HKL-2000 'data reduction'  .        ? 3 
HKL-2000 'data scaling'    .        ? 4 
AMoRE    phasing           .        ? 5 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    LYS 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     268 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             77.78 
_pdbx_validate_torsion.psi             -1.13 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A THR 287 ? A THR 77 
2 1 Y 1 A PRO 288 ? A PRO 78 
3 1 Y 1 A ALA 289 ? A ALA 79 
4 1 Y 1 A LYS 290 ? A LYS 80 
5 1 Y 1 A ALA 291 ? A ALA 81 
6 1 Y 1 A LYS 292 ? A LYS 82 
7 1 Y 1 A ALA 293 ? A ALA 83 
8 1 Y 1 A ASN 294 ? A ASN 84 
9 1 Y 1 A ALA 295 ? A ALA 85 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#