data_2E3M
# 
_entry.id   2E3M 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2E3M         
RCSB  RCSB026182   
WWPDB D_1000026182 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2E3N . unspecified 
PDB 2E3O . unspecified 
PDB 2E3P . unspecified 
PDB 2E3Q . unspecified 
PDB 2E3R . unspecified 
PDB 2E3S . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2E3M 
_pdbx_database_status.recvd_initial_deposition_date   2006-11-28 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kudo, N.'      1 
'Kumagai, K.'   2 
'Wakatsuki, S.' 3 
'Nishijima, M.' 4 
'Hanada, K.'    5 
'Kato, R.'      6 
# 
_citation.id                        primary 
_citation.title                     
'Structural basis for specific lipid recognition by CERT responsible for nonvesicular trafficking of ceramide.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.Usa 
_citation.journal_volume            105 
_citation.page_first                488 
_citation.page_last                 493 
_citation.year                      2008 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18184806 
_citation.pdbx_database_id_DOI      10.1073/pnas.0709191105 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kudo, N.'      1 
primary 'Kumagai, K.'   2 
primary 'Tomishige, N.' 3 
primary 'Yamaji, T.'    4 
primary 'Wakatsuki, S.' 5 
primary 'Nishijima, M.' 6 
primary 'Hanada, K.'    7 
primary 'Kato, R.'      8 
# 
_cell.entry_id           2E3M 
_cell.length_a           40.969 
_cell.length_b           75.434 
_cell.length_c           42.364 
_cell.angle_alpha        90.00 
_cell.angle_beta         108.52 
_cell.angle_gamma        90.00 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2E3M 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Lipid-transfer protein CERT' 28931.764 1  ? ? 'CERT START DOMAIN (RESIDUES 347-598)' ? 
2 water   nat water                         18.015    25 ? ? ?                                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Goodpasture-antigen binding protein, GPBP, CDNA FLJ34532 fis, clone HLUNG2008235, highly similar to Homo sapiens goodpasture antigen-binding protein (COL4A3BP)mRNA
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SNSLHWPTSLPSGDAFSSVGTHRFVQKVEEMVQNHMTYSLQDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHA
VKGVTGHEVCNYFWNVDVRNDWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKIPALTENDPETWIVC
NFSVDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRF
TSYVQEKTAGKPILF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SNSLHWPTSLPSGDAFSSVGTHRFVQKVEEMVQNHMTYSLQDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHA
VKGVTGHEVCNYFWNVDVRNDWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKIPALTENDPETWIVC
NFSVDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRF
TSYVQEKTAGKPILF
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ASN n 
1 3   SER n 
1 4   LEU n 
1 5   HIS n 
1 6   TRP n 
1 7   PRO n 
1 8   THR n 
1 9   SER n 
1 10  LEU n 
1 11  PRO n 
1 12  SER n 
1 13  GLY n 
1 14  ASP n 
1 15  ALA n 
1 16  PHE n 
1 17  SER n 
1 18  SER n 
1 19  VAL n 
1 20  GLY n 
1 21  THR n 
1 22  HIS n 
1 23  ARG n 
1 24  PHE n 
1 25  VAL n 
1 26  GLN n 
1 27  LYS n 
1 28  VAL n 
1 29  GLU n 
1 30  GLU n 
1 31  MET n 
1 32  VAL n 
1 33  GLN n 
1 34  ASN n 
1 35  HIS n 
1 36  MET n 
1 37  THR n 
1 38  TYR n 
1 39  SER n 
1 40  LEU n 
1 41  GLN n 
1 42  ASP n 
1 43  VAL n 
1 44  GLY n 
1 45  GLY n 
1 46  ASP n 
1 47  ALA n 
1 48  ASN n 
1 49  TRP n 
1 50  GLN n 
1 51  LEU n 
1 52  VAL n 
1 53  VAL n 
1 54  GLU n 
1 55  GLU n 
1 56  GLY n 
1 57  GLU n 
1 58  MET n 
1 59  LYS n 
1 60  VAL n 
1 61  TYR n 
1 62  ARG n 
1 63  ARG n 
1 64  GLU n 
1 65  VAL n 
1 66  GLU n 
1 67  GLU n 
1 68  ASN n 
1 69  GLY n 
1 70  ILE n 
1 71  VAL n 
1 72  LEU n 
1 73  ASP n 
1 74  PRO n 
1 75  LEU n 
1 76  LYS n 
1 77  ALA n 
1 78  THR n 
1 79  HIS n 
1 80  ALA n 
1 81  VAL n 
1 82  LYS n 
1 83  GLY n 
1 84  VAL n 
1 85  THR n 
1 86  GLY n 
1 87  HIS n 
1 88  GLU n 
1 89  VAL n 
1 90  CYS n 
1 91  ASN n 
1 92  TYR n 
1 93  PHE n 
1 94  TRP n 
1 95  ASN n 
1 96  VAL n 
1 97  ASP n 
1 98  VAL n 
1 99  ARG n 
1 100 ASN n 
1 101 ASP n 
1 102 TRP n 
1 103 GLU n 
1 104 THR n 
1 105 THR n 
1 106 ILE n 
1 107 GLU n 
1 108 ASN n 
1 109 PHE n 
1 110 HIS n 
1 111 VAL n 
1 112 VAL n 
1 113 GLU n 
1 114 THR n 
1 115 LEU n 
1 116 ALA n 
1 117 ASP n 
1 118 ASN n 
1 119 ALA n 
1 120 ILE n 
1 121 ILE n 
1 122 ILE n 
1 123 TYR n 
1 124 GLN n 
1 125 THR n 
1 126 HIS n 
1 127 LYS n 
1 128 ARG n 
1 129 VAL n 
1 130 TRP n 
1 131 PRO n 
1 132 ALA n 
1 133 SER n 
1 134 GLN n 
1 135 ARG n 
1 136 ASP n 
1 137 VAL n 
1 138 LEU n 
1 139 TYR n 
1 140 LEU n 
1 141 SER n 
1 142 VAL n 
1 143 ILE n 
1 144 ARG n 
1 145 LYS n 
1 146 ILE n 
1 147 PRO n 
1 148 ALA n 
1 149 LEU n 
1 150 THR n 
1 151 GLU n 
1 152 ASN n 
1 153 ASP n 
1 154 PRO n 
1 155 GLU n 
1 156 THR n 
1 157 TRP n 
1 158 ILE n 
1 159 VAL n 
1 160 CYS n 
1 161 ASN n 
1 162 PHE n 
1 163 SER n 
1 164 VAL n 
1 165 ASP n 
1 166 HIS n 
1 167 ASP n 
1 168 SER n 
1 169 ALA n 
1 170 PRO n 
1 171 LEU n 
1 172 ASN n 
1 173 ASN n 
1 174 ARG n 
1 175 CYS n 
1 176 VAL n 
1 177 ARG n 
1 178 ALA n 
1 179 LYS n 
1 180 ILE n 
1 181 ASN n 
1 182 VAL n 
1 183 ALA n 
1 184 MET n 
1 185 ILE n 
1 186 CYS n 
1 187 GLN n 
1 188 THR n 
1 189 LEU n 
1 190 VAL n 
1 191 SER n 
1 192 PRO n 
1 193 PRO n 
1 194 GLU n 
1 195 GLY n 
1 196 ASN n 
1 197 GLN n 
1 198 GLU n 
1 199 ILE n 
1 200 SER n 
1 201 ARG n 
1 202 ASP n 
1 203 ASN n 
1 204 ILE n 
1 205 LEU n 
1 206 CYS n 
1 207 LYS n 
1 208 ILE n 
1 209 THR n 
1 210 TYR n 
1 211 VAL n 
1 212 ALA n 
1 213 ASN n 
1 214 VAL n 
1 215 ASN n 
1 216 PRO n 
1 217 GLY n 
1 218 GLY n 
1 219 TRP n 
1 220 ALA n 
1 221 PRO n 
1 222 ALA n 
1 223 SER n 
1 224 VAL n 
1 225 LEU n 
1 226 ARG n 
1 227 ALA n 
1 228 VAL n 
1 229 ALA n 
1 230 LYS n 
1 231 ARG n 
1 232 GLU n 
1 233 TYR n 
1 234 PRO n 
1 235 LYS n 
1 236 PHE n 
1 237 LEU n 
1 238 LYS n 
1 239 ARG n 
1 240 PHE n 
1 241 THR n 
1 242 SER n 
1 243 TYR n 
1 244 VAL n 
1 245 GLN n 
1 246 GLU n 
1 247 LYS n 
1 248 THR n 
1 249 ALA n 
1 250 GLY n 
1 251 LYS n 
1 252 PRO n 
1 253 ILE n 
1 254 LEU n 
1 255 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 CERT 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               DH5alpha 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pGEX-5X1 (MODIFIED)' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q53YV2_HUMAN 
_struct_ref.pdbx_db_accession          Q53YV2 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;LHWPTSLPSGDAFSSVGTHRFVQKVEEMVQNHMTYSLQDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKG
VTGHEVCNYFWNVDVRNDWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKIPALTENDPETWIVCNFS
VDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSY
VQEKTAGKPILF
;
_struct_ref.pdbx_align_begin           347 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2E3M 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 4 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 255 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q53YV2 
_struct_ref_seq.db_align_beg                  347 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  598 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       347 
_struct_ref_seq.pdbx_auth_seq_align_end       598 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2E3M SER A 1 ? UNP Q53YV2 ? ? 'EXPRESSION TAG' 344 1 
1 2E3M ASN A 2 ? UNP Q53YV2 ? ? 'EXPRESSION TAG' 345 2 
1 2E3M SER A 3 ? UNP Q53YV2 ? ? 'EXPRESSION TAG' 346 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2E3M 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.14 
_exptl_crystal.density_percent_sol   42.64 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_details    'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2005-02-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.000  1.0 
2 1.0000 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE AR-NW12A' 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
_diffrn_source.pdbx_synchrotron_beamline   AR-NW12A 
_diffrn_source.pdbx_wavelength             1.000 
_diffrn_source.pdbx_wavelength_list        1.0000 
# 
_reflns.entry_id                     2E3M 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            2.150 
_reflns.number_obs                   13045 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         93.4 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.15 
_reflns_shell.d_res_low              2.23 
_reflns_shell.percent_possible_all   93.0 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2E3M 
_refine.ls_number_reflns_obs                     11630 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             40.16 
_refine.ls_d_res_high                            2.20 
_refine.ls_percent_reflns_obs                    98.2 
_refine.ls_R_factor_obs                          0.232 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.229 
_refine.ls_R_factor_R_free                       0.286 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  621 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.936 
_refine.correlation_coeff_Fo_to_Fc_free          0.894 
_refine.B_iso_mean                               39.31 
_refine.aniso_B[1][1]                            1.33000 
_refine.aniso_B[2][2]                            -1.16000 
_refine.aniso_B[3][3]                            -0.25000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            -0.13000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.362 
_refine.pdbx_overall_ESU_R_Free                  0.262 
_refine.overall_SU_ML                            0.206 
_refine.overall_SU_B                             7.935 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1904 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             25 
_refine_hist.number_atoms_total               1929 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        40.16 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.016  0.022  ? 1948 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.593  1.931  ? 2654 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       7.563  5.000  ? 236  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       35.213 24.375 ? 96   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       19.540 15.000 ? 327  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       22.622 15.000 ? 13   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.099  0.200  ? 298  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.006  0.020  ? 1492 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.228  0.200  ? 771  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.310  0.200  ? 1288 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.165  0.200  ? 71   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.244  0.200  ? 63   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.214  0.200  ? 2    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.020  1.500  ? 1219 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.812  2.000  ? 1937 'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.152  3.000  ? 840  'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.354  4.500  ? 717  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.20 
_refine_ls_shell.d_res_low                        2.26 
_refine_ls_shell.number_reflns_R_work             769 
_refine_ls_shell.R_factor_R_work                  0.259 
_refine_ls_shell.percent_reflns_obs               89.66 
_refine_ls_shell.R_factor_R_free                  0.298 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             46 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2E3M 
_struct.title                     'Crystal structure of CERT START domain' 
_struct.pdbx_descriptor           'Lipid-transfer protein CERT' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2E3M 
_struct_keywords.pdbx_keywords   'LIPID TRANSPORT' 
_struct_keywords.text            'LIPID TRANSFER PROTEIN, CERT, CERAMIDE TRANSFER, LIPID TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PHE A 24  ? SER A 39  ? PHE A 367 SER A 382 1 ? 16 
HELX_P HELX_P2 2 THR A 85  ? ASN A 95  ? THR A 428 ASN A 438 1 ? 11 
HELX_P HELX_P3 3 VAL A 96  ? TRP A 102 ? VAL A 439 TRP A 445 5 ? 7  
HELX_P HELX_P4 4 SER A 200 ? ASP A 202 ? SER A 543 ASP A 545 5 ? 3  
HELX_P HELX_P5 5 PRO A 221 ? ALA A 249 ? PRO A 564 ALA A 592 1 ? 29 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TRP 130 A . ? TRP 473 A PRO 131 A ? PRO 474 A 1 1.68  
2 GLY 195 A . ? GLY 538 A ASN 196 A ? ASN 539 A 1 -1.58 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 9 ? 
B ? 8 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
A 7 8 ? anti-parallel 
A 8 9 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
B 7 8 ? parallel      
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 50  ? GLU A 55  ? GLN A 393 GLU A 398 
A 2 MET A 58  ? ARG A 62  ? MET A 401 ARG A 405 
A 3 LEU A 75  ? LYS A 82  ? LEU A 418 LYS A 425 
A 4 ILE A 204 ? ASN A 215 ? ILE A 547 ASN A 558 
A 5 LYS A 179 ? VAL A 190 ? LYS A 522 VAL A 533 
A 6 THR A 156 ? SER A 163 ? THR A 499 SER A 506 
A 7 ARG A 135 ? ILE A 146 ? ARG A 478 ILE A 489 
A 8 ALA A 119 ? HIS A 126 ? ALA A 462 HIS A 469 
A 9 ILE A 106 ? ALA A 116 ? ILE A 449 ALA A 459 
B 1 GLN A 50  ? GLU A 55  ? GLN A 393 GLU A 398 
B 2 MET A 58  ? ARG A 62  ? MET A 401 ARG A 405 
B 3 LEU A 75  ? LYS A 82  ? LEU A 418 LYS A 425 
B 4 ILE A 204 ? ASN A 215 ? ILE A 547 ASN A 558 
B 5 LYS A 179 ? VAL A 190 ? LYS A 522 VAL A 533 
B 6 THR A 156 ? SER A 163 ? THR A 499 SER A 506 
B 7 ARG A 135 ? ILE A 146 ? ARG A 478 ILE A 489 
B 8 VAL A 176 ? ARG A 177 ? VAL A 519 ARG A 520 
C 1 GLU A 66  ? GLU A 67  ? GLU A 409 GLU A 410 
C 2 ILE A 70  ? VAL A 71  ? ILE A 413 VAL A 414 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLN A 50  ? N GLN A 393 O ARG A 62  ? O ARG A 405 
A 2 3 N TYR A 61  ? N TYR A 404 O LYS A 76  ? O LYS A 419 
A 3 4 N HIS A 79  ? N HIS A 422 O ILE A 208 ? O ILE A 551 
A 4 5 O THR A 209 ? O THR A 552 N ILE A 185 ? N ILE A 528 
A 5 6 O VAL A 182 ? O VAL A 525 N ASN A 161 ? N ASN A 504 
A 6 7 O THR A 156 ? O THR A 499 N ILE A 146 ? N ILE A 489 
A 7 8 O SER A 141 ? O SER A 484 N ILE A 120 ? N ILE A 463 
A 8 9 O ILE A 121 ? O ILE A 464 N VAL A 112 ? N VAL A 455 
B 1 2 N GLN A 50  ? N GLN A 393 O ARG A 62  ? O ARG A 405 
B 2 3 N TYR A 61  ? N TYR A 404 O LYS A 76  ? O LYS A 419 
B 3 4 N HIS A 79  ? N HIS A 422 O ILE A 208 ? O ILE A 551 
B 4 5 O THR A 209 ? O THR A 552 N ILE A 185 ? N ILE A 528 
B 5 6 O VAL A 182 ? O VAL A 525 N ASN A 161 ? N ASN A 504 
B 6 7 O THR A 156 ? O THR A 499 N ILE A 146 ? N ILE A 489 
B 7 8 N ASP A 136 ? N ASP A 479 O VAL A 176 ? O VAL A 519 
C 1 2 N GLU A 67  ? N GLU A 410 O ILE A 70  ? O ILE A 413 
# 
_database_PDB_matrix.entry_id          2E3M 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2E3M 
_atom_sites.fract_transf_matrix[1][1]   0.024409 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.008175 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013257 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.024894 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . VAL A 1 19  ? -11.481 20.051 2.609   1.00 53.53 ? 362 VAL A N   1 
ATOM   2    C CA  . VAL A 1 19  ? -11.240 19.608 4.027   1.00 53.67 ? 362 VAL A CA  1 
ATOM   3    C C   . VAL A 1 19  ? -10.446 18.295 3.982   1.00 53.20 ? 362 VAL A C   1 
ATOM   4    O O   . VAL A 1 19  ? -10.850 17.326 3.293   1.00 54.21 ? 362 VAL A O   1 
ATOM   5    C CB  . VAL A 1 19  ? -12.565 19.475 4.833   1.00 53.90 ? 362 VAL A CB  1 
ATOM   6    C CG1 . VAL A 1 19  ? -12.317 18.970 6.289   1.00 54.27 ? 362 VAL A CG1 1 
ATOM   7    C CG2 . VAL A 1 19  ? -13.300 20.795 4.840   1.00 54.32 ? 362 VAL A CG2 1 
ATOM   8    N N   . GLY A 1 20  ? -9.324  18.280 4.705   1.00 51.93 ? 363 GLY A N   1 
ATOM   9    C CA  . GLY A 1 20  ? -8.186  17.412 4.391   1.00 49.91 ? 363 GLY A CA  1 
ATOM   10   C C   . GLY A 1 20  ? -8.232  15.978 4.872   1.00 48.57 ? 363 GLY A C   1 
ATOM   11   O O   . GLY A 1 20  ? -9.290  15.461 5.256   1.00 48.73 ? 363 GLY A O   1 
ATOM   12   N N   . THR A 1 21  ? -7.058  15.345 4.850   1.00 46.89 ? 364 THR A N   1 
ATOM   13   C CA  . THR A 1 21  ? -6.889  13.932 5.203   1.00 44.96 ? 364 THR A CA  1 
ATOM   14   C C   . THR A 1 21  ? -5.627  13.670 6.029   1.00 43.08 ? 364 THR A C   1 
ATOM   15   O O   . THR A 1 21  ? -5.374  12.519 6.389   1.00 42.88 ? 364 THR A O   1 
ATOM   16   C CB  . THR A 1 21  ? -6.709  13.071 3.952   1.00 45.12 ? 364 THR A CB  1 
ATOM   17   O OG1 . THR A 1 21  ? -5.732  13.701 3.117   1.00 44.91 ? 364 THR A OG1 1 
ATOM   18   C CG2 . THR A 1 21  ? -8.045  12.876 3.205   1.00 46.00 ? 364 THR A CG2 1 
ATOM   19   N N   . HIS A 1 22  ? -4.818  14.711 6.282   1.00 40.39 ? 365 HIS A N   1 
ATOM   20   C CA  . HIS A 1 22  ? -3.594  14.571 7.116   1.00 37.69 ? 365 HIS A CA  1 
ATOM   21   C C   . HIS A 1 22  ? -3.927  14.078 8.543   1.00 35.58 ? 365 HIS A C   1 
ATOM   22   O O   . HIS A 1 22  ? -5.088  13.999 8.926   1.00 34.57 ? 365 HIS A O   1 
ATOM   23   C CB  . HIS A 1 22  ? -2.795  15.875 7.161   1.00 36.98 ? 365 HIS A CB  1 
ATOM   24   C CG  . HIS A 1 22  ? -3.537  17.000 7.807   1.00 35.84 ? 365 HIS A CG  1 
ATOM   25   N ND1 . HIS A 1 22  ? -3.514  17.227 9.168   1.00 33.79 ? 365 HIS A ND1 1 
ATOM   26   C CD2 . HIS A 1 22  ? -4.334  17.959 7.278   1.00 35.51 ? 365 HIS A CD2 1 
ATOM   27   C CE1 . HIS A 1 22  ? -4.263  18.280 9.450   1.00 34.01 ? 365 HIS A CE1 1 
ATOM   28   N NE2 . HIS A 1 22  ? -4.772  18.743 8.322   1.00 35.36 ? 365 HIS A NE2 1 
ATOM   29   N N   . ARG A 1 23  ? -2.908  13.721 9.307   1.00 34.26 ? 366 ARG A N   1 
ATOM   30   C CA  . ARG A 1 23  ? -3.134  13.059 10.605  1.00 33.61 ? 366 ARG A CA  1 
ATOM   31   C C   . ARG A 1 23  ? -3.895  13.938 11.635  1.00 33.24 ? 366 ARG A C   1 
ATOM   32   O O   . ARG A 1 23  ? -4.622  13.415 12.477  1.00 33.17 ? 366 ARG A O   1 
ATOM   33   C CB  . ARG A 1 23  ? -1.805  12.511 11.158  1.00 33.57 ? 366 ARG A CB  1 
ATOM   34   C CG  . ARG A 1 23  ? -1.107  13.437 12.071  1.00 33.18 ? 366 ARG A CG  1 
ATOM   35   C CD  . ARG A 1 23  ? 0.339   13.124 12.279  1.00 32.93 ? 366 ARG A CD  1 
ATOM   36   N NE  . ARG A 1 23  ? 1.066   13.703 11.188  1.00 37.59 ? 366 ARG A NE  1 
ATOM   37   C CZ  . ARG A 1 23  ? 2.062   14.570 11.281  1.00 35.09 ? 366 ARG A CZ  1 
ATOM   38   N NH1 . ARG A 1 23  ? 2.564   14.977 12.444  1.00 31.29 ? 366 ARG A NH1 1 
ATOM   39   N NH2 . ARG A 1 23  ? 2.569   15.005 10.162  1.00 36.15 ? 366 ARG A NH2 1 
ATOM   40   N N   . PHE A 1 24  ? -3.776  15.268 11.525  1.00 32.43 ? 367 PHE A N   1 
ATOM   41   C CA  . PHE A 1 24  ? -4.399  16.207 12.484  1.00 31.52 ? 367 PHE A CA  1 
ATOM   42   C C   . PHE A 1 24  ? -5.759  16.725 12.063  1.00 32.68 ? 367 PHE A C   1 
ATOM   43   O O   . PHE A 1 24  ? -6.226  17.770 12.568  1.00 32.04 ? 367 PHE A O   1 
ATOM   44   C CB  . PHE A 1 24  ? -3.481  17.410 12.695  1.00 30.43 ? 367 PHE A CB  1 
ATOM   45   C CG  . PHE A 1 24  ? -2.333  17.150 13.623  1.00 28.61 ? 367 PHE A CG  1 
ATOM   46   C CD1 . PHE A 1 24  ? -2.542  17.056 14.997  1.00 28.44 ? 367 PHE A CD1 1 
ATOM   47   C CD2 . PHE A 1 24  ? -1.066  16.991 13.140  1.00 25.82 ? 367 PHE A CD2 1 
ATOM   48   C CE1 . PHE A 1 24  ? -1.459  16.809 15.886  1.00 26.33 ? 367 PHE A CE1 1 
ATOM   49   C CE2 . PHE A 1 24  ? 0.007   16.750 14.015  1.00 26.36 ? 367 PHE A CE2 1 
ATOM   50   C CZ  . PHE A 1 24  ? -0.206  16.672 15.391  1.00 26.67 ? 367 PHE A CZ  1 
ATOM   51   N N   . VAL A 1 25  ? -6.407  16.018 11.130  1.00 33.28 ? 368 VAL A N   1 
ATOM   52   C CA  . VAL A 1 25  ? -7.608  16.570 10.504  1.00 33.38 ? 368 VAL A CA  1 
ATOM   53   C C   . VAL A 1 25  ? -8.805  16.678 11.470  1.00 33.44 ? 368 VAL A C   1 
ATOM   54   O O   . VAL A 1 25  ? -9.578  17.640 11.409  1.00 34.07 ? 368 VAL A O   1 
ATOM   55   C CB  . VAL A 1 25  ? -7.942  15.799 9.211   1.00 33.32 ? 368 VAL A CB  1 
ATOM   56   C CG1 . VAL A 1 25  ? -9.229  15.003 9.344   1.00 34.74 ? 368 VAL A CG1 1 
ATOM   57   C CG2 . VAL A 1 25  ? -8.073  16.721 8.092   1.00 32.62 ? 368 VAL A CG2 1 
ATOM   58   N N   . GLN A 1 26  ? -8.971  15.693 12.352  1.00 32.96 ? 369 GLN A N   1 
ATOM   59   C CA  . GLN A 1 26  ? -10.139 15.651 13.244  1.00 33.06 ? 369 GLN A CA  1 
ATOM   60   C C   . GLN A 1 26  ? -10.018 16.681 14.370  1.00 31.83 ? 369 GLN A C   1 
ATOM   61   O O   . GLN A 1 26  ? -11.008 17.229 14.823  1.00 31.85 ? 369 GLN A O   1 
ATOM   62   C CB  . GLN A 1 26  ? -10.340 14.240 13.855  1.00 32.66 ? 369 GLN A CB  1 
ATOM   63   C CG  . GLN A 1 26  ? -10.550 13.106 12.820  1.00 34.62 ? 369 GLN A CG  1 
ATOM   64   C CD  . GLN A 1 26  ? -10.732 11.701 13.453  1.00 35.14 ? 369 GLN A CD  1 
ATOM   65   O OE1 . GLN A 1 26  ? -10.386 11.455 14.622  1.00 37.28 ? 369 GLN A OE1 1 
ATOM   66   N NE2 . GLN A 1 26  ? -11.278 10.791 12.677  1.00 36.84 ? 369 GLN A NE2 1 
ATOM   67   N N   . LYS A 1 27  ? -8.811  16.891 14.863  1.00 31.85 ? 370 LYS A N   1 
ATOM   68   C CA  . LYS A 1 27  ? -8.619  17.875 15.906  1.00 31.99 ? 370 LYS A CA  1 
ATOM   69   C C   . LYS A 1 27  ? -8.652  19.299 15.338  1.00 31.07 ? 370 LYS A C   1 
ATOM   70   O O   . LYS A 1 27  ? -9.069  20.196 16.025  1.00 31.08 ? 370 LYS A O   1 
ATOM   71   C CB  . LYS A 1 27  ? -7.351  17.649 16.714  1.00 32.54 ? 370 LYS A CB  1 
ATOM   72   C CG  . LYS A 1 27  ? -7.459  18.368 18.087  1.00 32.23 ? 370 LYS A CG  1 
ATOM   73   C CD  . LYS A 1 27  ? -6.134  18.879 18.574  1.00 35.46 ? 370 LYS A CD  1 
ATOM   74   C CE  . LYS A 1 27  ? -6.313  19.692 19.887  1.00 35.09 ? 370 LYS A CE  1 
ATOM   75   N NZ  . LYS A 1 27  ? -7.473  19.219 20.732  1.00 35.80 ? 370 LYS A NZ  1 
ATOM   76   N N   . VAL A 1 28  ? -8.264  19.479 14.080  1.00 31.23 ? 371 VAL A N   1 
ATOM   77   C CA  . VAL A 1 28  ? -8.434  20.768 13.401  1.00 30.67 ? 371 VAL A CA  1 
ATOM   78   C C   . VAL A 1 28  ? -9.905  21.142 13.350  1.00 31.43 ? 371 VAL A C   1 
ATOM   79   O O   . VAL A 1 28  ? -10.286 22.259 13.713  1.00 32.13 ? 371 VAL A O   1 
ATOM   80   C CB  . VAL A 1 28  ? -7.800  20.773 12.002  1.00 30.11 ? 371 VAL A CB  1 
ATOM   81   C CG1 . VAL A 1 28  ? -8.365  21.900 11.137  1.00 28.87 ? 371 VAL A CG1 1 
ATOM   82   C CG2 . VAL A 1 28  ? -6.341  20.950 12.150  1.00 27.85 ? 371 VAL A CG2 1 
ATOM   83   N N   . GLU A 1 29  ? -10.735 20.185 12.966  1.00 31.82 ? 372 GLU A N   1 
ATOM   84   C CA  . GLU A 1 29  ? -12.160 20.431 12.774  1.00 32.35 ? 372 GLU A CA  1 
ATOM   85   C C   . GLU A 1 29  ? -12.828 20.622 14.106  1.00 32.04 ? 372 GLU A C   1 
ATOM   86   O O   . GLU A 1 29  ? -13.807 21.352 14.213  1.00 31.28 ? 372 GLU A O   1 
ATOM   87   C CB  . GLU A 1 29  ? -12.834 19.254 12.043  1.00 33.07 ? 372 GLU A CB  1 
ATOM   88   C CG  . GLU A 1 29  ? -12.748 19.304 10.506  1.00 35.35 ? 372 GLU A CG  1 
ATOM   89   C CD  . GLU A 1 29  ? -13.093 20.683 9.951   1.00 40.43 ? 372 GLU A CD  1 
ATOM   90   O OE1 . GLU A 1 29  ? -14.311 21.032 9.943   1.00 39.11 ? 372 GLU A OE1 1 
ATOM   91   O OE2 . GLU A 1 29  ? -12.129 21.412 9.539   1.00 40.32 ? 372 GLU A OE2 1 
ATOM   92   N N   . GLU A 1 30  ? -12.322 19.930 15.122  1.00 31.89 ? 373 GLU A N   1 
ATOM   93   C CA  . GLU A 1 30  ? -12.890 20.086 16.452  1.00 32.41 ? 373 GLU A CA  1 
ATOM   94   C C   . GLU A 1 30  ? -12.505 21.434 17.038  1.00 30.92 ? 373 GLU A C   1 
ATOM   95   O O   . GLU A 1 30  ? -13.334 22.092 17.581  1.00 31.27 ? 373 GLU A O   1 
ATOM   96   C CB  . GLU A 1 30  ? -12.462 18.968 17.394  1.00 32.96 ? 373 GLU A CB  1 
ATOM   97   C CG  . GLU A 1 30  ? -13.350 18.919 18.618  1.00 37.60 ? 373 GLU A CG  1 
ATOM   98   C CD  . GLU A 1 30  ? -12.832 17.967 19.702  1.00 43.94 ? 373 GLU A CD  1 
ATOM   99   O OE1 . GLU A 1 30  ? -13.645 17.120 20.165  1.00 46.67 ? 373 GLU A OE1 1 
ATOM   100  O OE2 . GLU A 1 30  ? -11.632 18.084 20.086  1.00 45.49 ? 373 GLU A OE2 1 
ATOM   101  N N   . MET A 1 31  ? -11.245 21.837 16.940  1.00 31.02 ? 374 MET A N   1 
ATOM   102  C CA  . MET A 1 31  ? -10.862 23.197 17.337  1.00 30.79 ? 374 MET A CA  1 
ATOM   103  C C   . MET A 1 31  ? -11.668 24.265 16.590  1.00 30.35 ? 374 MET A C   1 
ATOM   104  O O   . MET A 1 31  ? -12.236 25.146 17.211  1.00 30.60 ? 374 MET A O   1 
ATOM   105  C CB  . MET A 1 31  ? -9.374  23.406 17.089  1.00 31.17 ? 374 MET A CB  1 
ATOM   106  C CG  . MET A 1 31  ? -8.477  22.429 17.897  1.00 33.40 ? 374 MET A CG  1 
ATOM   107  S SD  . MET A 1 31  ? -8.542  22.712 19.679  1.00 36.65 ? 374 MET A SD  1 
ATOM   108  C CE  . MET A 1 31  ? -8.099  24.438 19.771  1.00 35.25 ? 374 MET A CE  1 
ATOM   109  N N   . VAL A 1 32  ? -11.748 24.144 15.261  1.00 30.17 ? 375 VAL A N   1 
ATOM   110  C CA  . VAL A 1 32  ? -12.502 25.063 14.423  1.00 30.85 ? 375 VAL A CA  1 
ATOM   111  C C   . VAL A 1 32  ? -13.944 25.168 14.849  1.00 31.75 ? 375 VAL A C   1 
ATOM   112  O O   . VAL A 1 32  ? -14.482 26.274 14.959  1.00 31.34 ? 375 VAL A O   1 
ATOM   113  C CB  . VAL A 1 32  ? -12.380 24.718 12.881  1.00 30.38 ? 375 VAL A CB  1 
ATOM   114  C CG1 . VAL A 1 32  ? -13.475 25.380 12.090  1.00 29.29 ? 375 VAL A CG1 1 
ATOM   115  C CG2 . VAL A 1 32  ? -11.064 25.171 12.376  1.00 30.24 ? 375 VAL A CG2 1 
ATOM   116  N N   . GLN A 1 33  ? -14.542 24.019 15.156  1.00 32.62 ? 376 GLN A N   1 
ATOM   117  C CA  . GLN A 1 33  ? -15.940 23.955 15.562  1.00 33.83 ? 376 GLN A CA  1 
ATOM   118  C C   . GLN A 1 33  ? -16.174 24.523 16.961  1.00 33.70 ? 376 GLN A C   1 
ATOM   119  O O   . GLN A 1 33  ? -17.223 25.125 17.240  1.00 34.56 ? 376 GLN A O   1 
ATOM   120  C CB  . GLN A 1 33  ? -16.444 22.505 15.483  1.00 34.54 ? 376 GLN A CB  1 
ATOM   121  C CG  . GLN A 1 33  ? -17.923 22.335 15.758  1.00 38.79 ? 376 GLN A CG  1 
ATOM   122  C CD  . GLN A 1 33  ? -18.762 23.060 14.722  1.00 44.68 ? 376 GLN A CD  1 
ATOM   123  O OE1 . GLN A 1 33  ? -18.400 23.108 13.543  1.00 50.28 ? 376 GLN A OE1 1 
ATOM   124  N NE2 . GLN A 1 33  ? -19.874 23.647 15.155  1.00 44.15 ? 376 GLN A NE2 1 
ATOM   125  N N   . ASN A 1 34  ? -15.226 24.313 17.858  1.00 33.20 ? 377 ASN A N   1 
ATOM   126  C CA  . ASN A 1 34  ? -15.367 24.865 19.193  1.00 33.22 ? 377 ASN A CA  1 
ATOM   127  C C   . ASN A 1 34  ? -15.308 26.388 19.112  1.00 32.18 ? 377 ASN A C   1 
ATOM   128  O O   . ASN A 1 34  ? -16.130 27.048 19.705  1.00 32.26 ? 377 ASN A O   1 
ATOM   129  C CB  . ASN A 1 34  ? -14.310 24.308 20.147  1.00 33.84 ? 377 ASN A CB  1 
ATOM   130  C CG  . ASN A 1 34  ? -14.633 22.874 20.624  1.00 38.40 ? 377 ASN A CG  1 
ATOM   131  O OD1 . ASN A 1 34  ? -15.669 22.294 20.281  1.00 41.07 ? 377 ASN A OD1 1 
ATOM   132  N ND2 . ASN A 1 34  ? -13.719 22.299 21.409  1.00 42.41 ? 377 ASN A ND2 1 
ATOM   133  N N   . HIS A 1 35  ? -14.368 26.922 18.332  1.00 31.51 ? 378 HIS A N   1 
ATOM   134  C CA  . HIS A 1 35  ? -14.296 28.379 18.062  1.00 31.52 ? 378 HIS A CA  1 
ATOM   135  C C   . HIS A 1 35  ? -15.565 28.939 17.416  1.00 32.29 ? 378 HIS A C   1 
ATOM   136  O O   . HIS A 1 35  ? -16.152 29.893 17.936  1.00 32.51 ? 378 HIS A O   1 
ATOM   137  C CB  . HIS A 1 35  ? -13.042 28.744 17.239  1.00 30.01 ? 378 HIS A CB  1 
ATOM   138  C CG  . HIS A 1 35  ? -11.753 28.642 18.002  1.00 29.22 ? 378 HIS A CG  1 
ATOM   139  N ND1 . HIS A 1 35  ? -11.491 29.386 19.137  1.00 30.42 ? 378 HIS A ND1 1 
ATOM   140  C CD2 . HIS A 1 35  ? -10.644 27.889 17.788  1.00 28.95 ? 378 HIS A CD2 1 
ATOM   141  C CE1 . HIS A 1 35  ? -10.273 29.116 19.569  1.00 28.25 ? 378 HIS A CE1 1 
ATOM   142  N NE2 . HIS A 1 35  ? -9.742  28.200 18.777  1.00 26.19 ? 378 HIS A NE2 1 
ATOM   143  N N   . MET A 1 36  ? -16.009 28.363 16.290  1.00 33.55 ? 379 MET A N   1 
ATOM   144  C CA  . MET A 1 36  ? -17.320 28.755 15.709  1.00 34.60 ? 379 MET A CA  1 
ATOM   145  C C   . MET A 1 36  ? -18.458 28.812 16.740  1.00 35.92 ? 379 MET A C   1 
ATOM   146  O O   . MET A 1 36  ? -19.263 29.767 16.747  1.00 36.47 ? 379 MET A O   1 
ATOM   147  C CB  . MET A 1 36  ? -17.722 27.862 14.513  1.00 34.21 ? 379 MET A CB  1 
ATOM   148  C CG  . MET A 1 36  ? -16.778 28.003 13.314  1.00 34.14 ? 379 MET A CG  1 
ATOM   149  S SD  . MET A 1 36  ? -16.418 29.757 12.936  1.00 35.70 ? 379 MET A SD  1 
ATOM   150  C CE  . MET A 1 36  ? -18.010 30.315 12.360  1.00 38.74 ? 379 MET A CE  1 
ATOM   151  N N   . THR A 1 37  ? -18.537 27.798 17.602  1.00 37.01 ? 380 THR A N   1 
ATOM   152  C CA  . THR A 1 37  ? -19.654 27.702 18.557  1.00 38.72 ? 380 THR A CA  1 
ATOM   153  C C   . THR A 1 37  ? -19.479 28.553 19.837  1.00 38.39 ? 380 THR A C   1 
ATOM   154  O O   . THR A 1 37  ? -20.454 29.146 20.282  1.00 38.51 ? 380 THR A O   1 
ATOM   155  C CB  . THR A 1 37  ? -20.002 26.205 18.931  1.00 39.37 ? 380 THR A CB  1 
ATOM   156  O OG1 . THR A 1 37  ? -19.850 25.345 17.779  1.00 42.53 ? 380 THR A OG1 1 
ATOM   157  C CG2 . THR A 1 37  ? -21.428 26.092 19.448  1.00 41.09 ? 380 THR A CG2 1 
ATOM   158  N N   . TYR A 1 38  ? -18.264 28.605 20.412  1.00 38.57 ? 381 TYR A N   1 
ATOM   159  C CA  . TYR A 1 38  ? -17.980 29.297 21.704  1.00 38.96 ? 381 TYR A CA  1 
ATOM   160  C C   . TYR A 1 38  ? -17.348 30.701 21.601  1.00 38.47 ? 381 TYR A C   1 
ATOM   161  O O   . TYR A 1 38  ? -17.638 31.573 22.410  1.00 37.49 ? 381 TYR A O   1 
ATOM   162  C CB  . TYR A 1 38  ? -17.077 28.432 22.611  1.00 40.42 ? 381 TYR A CB  1 
ATOM   163  C CG  . TYR A 1 38  ? -17.721 27.128 23.060  1.00 41.87 ? 381 TYR A CG  1 
ATOM   164  C CD1 . TYR A 1 38  ? -18.515 27.091 24.200  1.00 43.18 ? 381 TYR A CD1 1 
ATOM   165  C CD2 . TYR A 1 38  ? -17.555 25.947 22.331  1.00 43.35 ? 381 TYR A CD2 1 
ATOM   166  C CE1 . TYR A 1 38  ? -19.119 25.921 24.618  1.00 43.87 ? 381 TYR A CE1 1 
ATOM   167  C CE2 . TYR A 1 38  ? -18.164 24.766 22.733  1.00 43.96 ? 381 TYR A CE2 1 
ATOM   168  C CZ  . TYR A 1 38  ? -18.953 24.764 23.887  1.00 44.36 ? 381 TYR A CZ  1 
ATOM   169  O OH  . TYR A 1 38  ? -19.576 23.606 24.339  1.00 44.32 ? 381 TYR A OH  1 
ATOM   170  N N   . SER A 1 39  ? -16.457 30.902 20.628  1.00 37.93 ? 382 SER A N   1 
ATOM   171  C CA  . SER A 1 39  ? -15.649 32.121 20.569  1.00 37.49 ? 382 SER A CA  1 
ATOM   172  C C   . SER A 1 39  ? -16.397 33.291 19.950  1.00 37.89 ? 382 SER A C   1 
ATOM   173  O O   . SER A 1 39  ? -15.954 34.427 20.064  1.00 37.33 ? 382 SER A O   1 
ATOM   174  C CB  . SER A 1 39  ? -14.359 31.874 19.799  1.00 36.91 ? 382 SER A CB  1 
ATOM   175  O OG  . SER A 1 39  ? -13.688 30.779 20.370  1.00 36.13 ? 382 SER A OG  1 
ATOM   176  N N   . LEU A 1 40  ? -17.521 33.008 19.300  1.00 37.98 ? 383 LEU A N   1 
ATOM   177  C CA  . LEU A 1 40  ? -18.274 34.048 18.628  1.00 39.78 ? 383 LEU A CA  1 
ATOM   178  C C   . LEU A 1 40  ? -19.364 34.631 19.519  1.00 40.72 ? 383 LEU A C   1 
ATOM   179  O O   . LEU A 1 40  ? -19.899 35.684 19.215  1.00 40.96 ? 383 LEU A O   1 
ATOM   180  C CB  . LEU A 1 40  ? -18.843 33.552 17.290  1.00 38.98 ? 383 LEU A CB  1 
ATOM   181  C CG  . LEU A 1 40  ? -17.814 33.233 16.204  1.00 37.48 ? 383 LEU A CG  1 
ATOM   182  C CD1 . LEU A 1 40  ? -18.526 32.898 14.895  1.00 36.52 ? 383 LEU A CD1 1 
ATOM   183  C CD2 . LEU A 1 40  ? -16.907 34.402 16.013  1.00 36.48 ? 383 LEU A CD2 1 
ATOM   184  N N   . GLN A 1 41  ? -19.669 33.944 20.617  1.00 42.55 ? 384 GLN A N   1 
ATOM   185  C CA  . GLN A 1 41  ? -20.571 34.444 21.664  1.00 44.35 ? 384 GLN A CA  1 
ATOM   186  C C   . GLN A 1 41  ? -20.213 35.868 22.081  1.00 44.98 ? 384 GLN A C   1 
ATOM   187  O O   . GLN A 1 41  ? -19.042 36.164 22.277  1.00 44.70 ? 384 GLN A O   1 
ATOM   188  C CB  . GLN A 1 41  ? -20.463 33.548 22.899  1.00 44.99 ? 384 GLN A CB  1 
ATOM   189  C CG  . GLN A 1 41  ? -21.711 32.795 23.230  1.00 46.90 ? 384 GLN A CG  1 
ATOM   190  C CD  . GLN A 1 41  ? -21.735 31.401 22.651  1.00 51.74 ? 384 GLN A CD  1 
ATOM   191  O OE1 . GLN A 1 41  ? -21.350 30.423 23.329  1.00 51.33 ? 384 GLN A OE1 1 
ATOM   192  N NE2 . GLN A 1 41  ? -22.194 31.287 21.388  1.00 53.14 ? 384 GLN A NE2 1 
ATOM   193  N N   . ASP A 1 42  ? -21.217 36.739 22.205  1.00 46.68 ? 385 ASP A N   1 
ATOM   194  C CA  . ASP A 1 42  ? -21.007 38.112 22.688  1.00 48.02 ? 385 ASP A CA  1 
ATOM   195  C C   . ASP A 1 42  ? -20.643 38.138 24.177  1.00 48.46 ? 385 ASP A C   1 
ATOM   196  O O   . ASP A 1 42  ? -21.349 37.558 25.012  1.00 48.70 ? 385 ASP A O   1 
ATOM   197  C CB  . ASP A 1 42  ? -22.233 39.000 22.419  1.00 48.52 ? 385 ASP A CB  1 
ATOM   198  C CG  . ASP A 1 42  ? -22.238 40.287 23.272  1.00 49.35 ? 385 ASP A CG  1 
ATOM   199  O OD1 . ASP A 1 42  ? -21.161 40.838 23.594  1.00 48.38 ? 385 ASP A OD1 1 
ATOM   200  O OD2 . ASP A 1 42  ? -23.337 40.755 23.619  1.00 52.51 ? 385 ASP A OD2 1 
ATOM   201  N N   . VAL A 1 43  ? -19.532 38.803 24.493  1.00 49.10 ? 386 VAL A N   1 
ATOM   202  C CA  . VAL A 1 43  ? -19.042 38.924 25.877  1.00 49.37 ? 386 VAL A CA  1 
ATOM   203  C C   . VAL A 1 43  ? -19.172 40.352 26.404  1.00 49.91 ? 386 VAL A C   1 
ATOM   204  O O   . VAL A 1 43  ? -19.632 41.250 25.689  1.00 50.45 ? 386 VAL A O   1 
ATOM   205  C CB  . VAL A 1 43  ? -17.568 38.456 26.022  1.00 49.07 ? 386 VAL A CB  1 
ATOM   206  C CG1 . VAL A 1 43  ? -17.436 36.970 25.676  1.00 50.11 ? 386 VAL A CG1 1 
ATOM   207  C CG2 . VAL A 1 43  ? -16.642 39.306 25.175  1.00 48.28 ? 386 VAL A CG2 1 
ATOM   208  N N   . GLY A 1 44  ? -18.757 40.573 27.647  1.00 50.29 ? 387 GLY A N   1 
ATOM   209  C CA  . GLY A 1 44  ? -18.802 41.923 28.229  1.00 51.34 ? 387 GLY A CA  1 
ATOM   210  C C   . GLY A 1 44  ? -20.240 42.212 28.602  1.00 51.92 ? 387 GLY A C   1 
ATOM   211  O O   . GLY A 1 44  ? -20.536 42.438 29.783  1.00 52.73 ? 387 GLY A O   1 
ATOM   212  N N   . GLY A 1 45  ? -21.148 42.174 27.614  1.00 51.13 ? 388 GLY A N   1 
ATOM   213  C CA  . GLY A 1 45  ? -22.550 41.910 27.930  1.00 50.00 ? 388 GLY A CA  1 
ATOM   214  C C   . GLY A 1 45  ? -22.660 40.627 28.751  1.00 49.23 ? 388 GLY A C   1 
ATOM   215  O O   . GLY A 1 45  ? -23.767 40.131 29.004  1.00 49.68 ? 388 GLY A O   1 
ATOM   216  N N   . ASP A 1 46  ? -21.490 40.090 29.133  1.00 47.91 ? 389 ASP A N   1 
ATOM   217  C CA  . ASP A 1 46  ? -21.305 38.874 29.930  1.00 46.03 ? 389 ASP A CA  1 
ATOM   218  C C   . ASP A 1 46  ? -20.456 39.264 31.134  1.00 44.97 ? 389 ASP A C   1 
ATOM   219  O O   . ASP A 1 46  ? -19.391 39.882 30.988  1.00 44.61 ? 389 ASP A O   1 
ATOM   220  C CB  . ASP A 1 46  ? -20.596 37.783 29.111  1.00 45.99 ? 389 ASP A CB  1 
ATOM   221  C CG  . ASP A 1 46  ? -20.419 36.470 29.891  1.00 46.56 ? 389 ASP A CG  1 
ATOM   222  O OD1 . ASP A 1 46  ? -20.472 35.405 29.256  1.00 46.10 ? 389 ASP A OD1 1 
ATOM   223  O OD2 . ASP A 1 46  ? -20.247 36.491 31.132  1.00 46.80 ? 389 ASP A OD2 1 
ATOM   224  N N   . ALA A 1 47  ? -20.922 38.895 32.326  1.00 43.42 ? 390 ALA A N   1 
ATOM   225  C CA  . ALA A 1 47  ? -20.417 39.510 33.544  1.00 41.72 ? 390 ALA A CA  1 
ATOM   226  C C   . ALA A 1 47  ? -19.161 38.864 34.059  1.00 40.81 ? 390 ALA A C   1 
ATOM   227  O O   . ALA A 1 47  ? -18.477 39.429 34.915  1.00 41.05 ? 390 ALA A O   1 
ATOM   228  C CB  . ALA A 1 47  ? -21.488 39.549 34.609  1.00 42.53 ? 390 ALA A CB  1 
ATOM   229  N N   . ASN A 1 48  ? -18.834 37.696 33.512  1.00 39.29 ? 391 ASN A N   1 
ATOM   230  C CA  . ASN A 1 48  ? -17.571 37.042 33.821  1.00 37.64 ? 391 ASN A CA  1 
ATOM   231  C C   . ASN A 1 48  ? -16.397 37.570 33.007  1.00 36.67 ? 391 ASN A C   1 
ATOM   232  O O   . ASN A 1 48  ? -15.237 37.318 33.342  1.00 37.52 ? 391 ASN A O   1 
ATOM   233  C CB  . ASN A 1 48  ? -17.712 35.544 33.644  1.00 38.31 ? 391 ASN A CB  1 
ATOM   234  C CG  . ASN A 1 48  ? -18.657 34.926 34.664  1.00 39.42 ? 391 ASN A CG  1 
ATOM   235  O OD1 . ASN A 1 48  ? -18.392 34.948 35.878  1.00 38.77 ? 391 ASN A OD1 1 
ATOM   236  N ND2 . ASN A 1 48  ? -19.767 34.382 34.177  1.00 38.21 ? 391 ASN A ND2 1 
ATOM   237  N N   . TRP A 1 49  ? -16.687 38.313 31.954  1.00 33.89 ? 392 TRP A N   1 
ATOM   238  C CA  . TRP A 1 49  ? -15.626 38.976 31.209  1.00 33.29 ? 392 TRP A CA  1 
ATOM   239  C C   . TRP A 1 49  ? -15.494 40.463 31.556  1.00 32.27 ? 392 TRP A C   1 
ATOM   240  O O   . TRP A 1 49  ? -16.475 41.128 31.828  1.00 32.05 ? 392 TRP A O   1 
ATOM   241  C CB  . TRP A 1 49  ? -15.890 38.852 29.714  1.00 32.54 ? 392 TRP A CB  1 
ATOM   242  C CG  . TRP A 1 49  ? -15.776 37.490 29.206  1.00 31.21 ? 392 TRP A CG  1 
ATOM   243  C CD1 . TRP A 1 49  ? -16.698 36.489 29.320  1.00 31.41 ? 392 TRP A CD1 1 
ATOM   244  C CD2 . TRP A 1 49  ? -14.669 36.945 28.483  1.00 32.24 ? 392 TRP A CD2 1 
ATOM   245  N NE1 . TRP A 1 49  ? -16.235 35.343 28.692  1.00 32.59 ? 392 TRP A NE1 1 
ATOM   246  C CE2 . TRP A 1 49  ? -14.991 35.599 28.170  1.00 33.78 ? 392 TRP A CE2 1 
ATOM   247  C CE3 . TRP A 1 49  ? -13.438 37.458 28.064  1.00 29.55 ? 392 TRP A CE3 1 
ATOM   248  C CZ2 . TRP A 1 49  ? -14.109 34.759 27.468  1.00 34.02 ? 392 TRP A CZ2 1 
ATOM   249  C CZ3 . TRP A 1 49  ? -12.575 36.629 27.362  1.00 32.98 ? 392 TRP A CZ3 1 
ATOM   250  C CH2 . TRP A 1 49  ? -12.911 35.294 27.065  1.00 30.95 ? 392 TRP A CH2 1 
ATOM   251  N N   . GLN A 1 50  ? -14.295 41.009 31.503  1.00 32.14 ? 393 GLN A N   1 
ATOM   252  C CA  . GLN A 1 50  ? -14.251 42.462 31.536  1.00 32.16 ? 393 GLN A CA  1 
ATOM   253  C C   . GLN A 1 50  ? -13.504 43.114 30.402  1.00 31.00 ? 393 GLN A C   1 
ATOM   254  O O   . GLN A 1 50  ? -12.483 42.612 29.939  1.00 30.12 ? 393 GLN A O   1 
ATOM   255  C CB  . GLN A 1 50  ? -13.786 42.996 32.882  1.00 33.00 ? 393 GLN A CB  1 
ATOM   256  C CG  . GLN A 1 50  ? -12.385 42.672 33.289  1.00 37.02 ? 393 GLN A CG  1 
ATOM   257  C CD  . GLN A 1 50  ? -12.095 43.234 34.674  1.00 42.38 ? 393 GLN A CD  1 
ATOM   258  O OE1 . GLN A 1 50  ? -11.933 44.453 34.860  1.00 42.30 ? 393 GLN A OE1 1 
ATOM   259  N NE2 . GLN A 1 50  ? -12.058 42.348 35.660  1.00 43.95 ? 393 GLN A NE2 1 
ATOM   260  N N   . LEU A 1 51  ? -14.078 44.226 29.950  1.00 30.51 ? 394 LEU A N   1 
ATOM   261  C CA  . LEU A 1 51  ? -13.496 45.096 28.948  1.00 29.66 ? 394 LEU A CA  1 
ATOM   262  C C   . LEU A 1 51  ? -12.311 45.821 29.550  1.00 30.18 ? 394 LEU A C   1 
ATOM   263  O O   . LEU A 1 51  ? -12.492 46.722 30.351  1.00 31.01 ? 394 LEU A O   1 
ATOM   264  C CB  . LEU A 1 51  ? -14.547 46.112 28.496  1.00 29.14 ? 394 LEU A CB  1 
ATOM   265  C CG  . LEU A 1 51  ? -14.193 47.098 27.366  1.00 27.00 ? 394 LEU A CG  1 
ATOM   266  C CD1 . LEU A 1 51  ? -13.514 46.437 26.121  1.00 22.99 ? 394 LEU A CD1 1 
ATOM   267  C CD2 . LEU A 1 51  ? -15.491 47.758 26.968  1.00 26.48 ? 394 LEU A CD2 1 
ATOM   268  N N   . VAL A 1 52  ? -11.108 45.432 29.171  1.00 29.99 ? 395 VAL A N   1 
ATOM   269  C CA  . VAL A 1 52  ? -9.916  45.946 29.787  1.00 30.11 ? 395 VAL A CA  1 
ATOM   270  C C   . VAL A 1 52  ? -9.155  46.967 28.916  1.00 31.48 ? 395 VAL A C   1 
ATOM   271  O O   . VAL A 1 52  ? -8.332  47.739 29.438  1.00 31.36 ? 395 VAL A O   1 
ATOM   272  C CB  . VAL A 1 52  ? -8.952  44.815 30.224  1.00 29.66 ? 395 VAL A CB  1 
ATOM   273  C CG1 . VAL A 1 52  ? -9.588  43.926 31.326  1.00 29.81 ? 395 VAL A CG1 1 
ATOM   274  C CG2 . VAL A 1 52  ? -8.425  44.020 29.035  1.00 27.71 ? 395 VAL A CG2 1 
ATOM   275  N N   . VAL A 1 53  ? -9.429  46.976 27.604  1.00 31.72 ? 396 VAL A N   1 
ATOM   276  C CA  . VAL A 1 53  ? -8.866  47.991 26.698  1.00 31.56 ? 396 VAL A CA  1 
ATOM   277  C C   . VAL A 1 53  ? -9.820  48.317 25.547  1.00 32.07 ? 396 VAL A C   1 
ATOM   278  O O   . VAL A 1 53  ? -10.452 47.422 24.974  1.00 30.84 ? 396 VAL A O   1 
ATOM   279  C CB  . VAL A 1 53  ? -7.501  47.571 26.096  1.00 32.48 ? 396 VAL A CB  1 
ATOM   280  C CG1 . VAL A 1 53  ? -6.972  48.657 25.107  1.00 30.63 ? 396 VAL A CG1 1 
ATOM   281  C CG2 . VAL A 1 53  ? -6.470  47.298 27.177  1.00 30.48 ? 396 VAL A CG2 1 
ATOM   282  N N   . GLU A 1 54  ? -9.938  49.613 25.239  1.00 32.33 ? 397 GLU A N   1 
ATOM   283  C CA  . GLU A 1 54  ? -10.698 50.076 24.074  1.00 32.10 ? 397 GLU A CA  1 
ATOM   284  C C   . GLU A 1 54  ? -9.942  51.192 23.368  1.00 33.68 ? 397 GLU A C   1 
ATOM   285  O O   . GLU A 1 54  ? -9.341  52.073 24.006  1.00 33.02 ? 397 GLU A O   1 
ATOM   286  C CB  . GLU A 1 54  ? -12.110 50.525 24.430  1.00 31.91 ? 397 GLU A CB  1 
ATOM   287  C CG  . GLU A 1 54  ? -12.969 50.923 23.229  1.00 29.88 ? 397 GLU A CG  1 
ATOM   288  C CD  . GLU A 1 54  ? -14.394 51.328 23.596  1.00 31.99 ? 397 GLU A CD  1 
ATOM   289  O OE1 . GLU A 1 54  ? -14.870 50.987 24.708  1.00 32.09 ? 397 GLU A OE1 1 
ATOM   290  O OE2 . GLU A 1 54  ? -15.063 51.963 22.752  1.00 30.00 ? 397 GLU A OE2 1 
ATOM   291  N N   . GLU A 1 55  ? -9.976  51.119 22.035  1.00 34.49 ? 398 GLU A N   1 
ATOM   292  C CA  . GLU A 1 55  ? -9.292  52.032 21.174  1.00 35.18 ? 398 GLU A CA  1 
ATOM   293  C C   . GLU A 1 55  ? -9.899  51.948 19.813  1.00 35.34 ? 398 GLU A C   1 
ATOM   294  O O   . GLU A 1 55  ? -9.893  50.878 19.183  1.00 35.76 ? 398 GLU A O   1 
ATOM   295  C CB  . GLU A 1 55  ? -7.842  51.643 21.061  1.00 35.75 ? 398 GLU A CB  1 
ATOM   296  C CG  . GLU A 1 55  ? -7.009  52.719 20.372  1.00 39.56 ? 398 GLU A CG  1 
ATOM   297  C CD  . GLU A 1 55  ? -5.561  52.517 20.637  1.00 44.62 ? 398 GLU A CD  1 
ATOM   298  O OE1 . GLU A 1 55  ? -4.772  53.438 20.368  1.00 46.66 ? 398 GLU A OE1 1 
ATOM   299  O OE2 . GLU A 1 55  ? -5.211  51.416 21.124  1.00 49.30 ? 398 GLU A OE2 1 
ATOM   300  N N   . GLY A 1 56  ? -10.401 53.086 19.340  1.00 35.16 ? 399 GLY A N   1 
ATOM   301  C CA  . GLY A 1 56  ? -11.146 53.132 18.099  1.00 33.04 ? 399 GLY A CA  1 
ATOM   302  C C   . GLY A 1 56  ? -12.185 52.040 18.155  1.00 32.42 ? 399 GLY A C   1 
ATOM   303  O O   . GLY A 1 56  ? -13.048 52.057 19.017  1.00 31.52 ? 399 GLY A O   1 
ATOM   304  N N   . GLU A 1 57  ? -12.072 51.078 17.241  1.00 31.08 ? 400 GLU A N   1 
ATOM   305  C CA  . GLU A 1 57  ? -13.090 50.044 17.059  1.00 30.68 ? 400 GLU A CA  1 
ATOM   306  C C   . GLU A 1 57  ? -12.716 48.761 17.780  1.00 28.94 ? 400 GLU A C   1 
ATOM   307  O O   . GLU A 1 57  ? -13.496 47.797 17.756  1.00 28.66 ? 400 GLU A O   1 
ATOM   308  C CB  . GLU A 1 57  ? -13.223 49.703 15.561  1.00 31.33 ? 400 GLU A CB  1 
ATOM   309  C CG  . GLU A 1 57  ? -13.513 50.885 14.652  1.00 35.73 ? 400 GLU A CG  1 
ATOM   310  C CD  . GLU A 1 57  ? -14.756 51.592 15.051  1.00 41.76 ? 400 GLU A CD  1 
ATOM   311  O OE1 . GLU A 1 57  ? -15.839 50.942 15.002  1.00 44.12 ? 400 GLU A OE1 1 
ATOM   312  O OE2 . GLU A 1 57  ? -14.632 52.791 15.442  1.00 45.65 ? 400 GLU A OE2 1 
ATOM   313  N N   . MET A 1 58  ? -11.513 48.746 18.353  1.00 26.79 ? 401 MET A N   1 
ATOM   314  C CA  . MET A 1 58  ? -10.999 47.614 19.059  1.00 27.63 ? 401 MET A CA  1 
ATOM   315  C C   . MET A 1 58  ? -11.445 47.651 20.510  1.00 28.08 ? 401 MET A C   1 
ATOM   316  O O   . MET A 1 58  ? -11.360 48.692 21.162  1.00 28.03 ? 401 MET A O   1 
ATOM   317  C CB  . MET A 1 58  ? -9.486  47.556 18.944  1.00 27.68 ? 401 MET A CB  1 
ATOM   318  C CG  . MET A 1 58  ? -8.835  46.379 19.627  1.00 24.33 ? 401 MET A CG  1 
ATOM   319  S SD  . MET A 1 58  ? -7.077  46.426 19.410  1.00 28.87 ? 401 MET A SD  1 
ATOM   320  C CE  . MET A 1 58  ? -6.651  48.031 20.147  1.00 32.73 ? 401 MET A CE  1 
ATOM   321  N N   . LYS A 1 59  ? -11.978 46.507 20.963  1.00 28.16 ? 402 LYS A N   1 
ATOM   322  C CA  . LYS A 1 59  ? -12.427 46.250 22.319  1.00 27.69 ? 402 LYS A CA  1 
ATOM   323  C C   . LYS A 1 59  ? -11.702 44.972 22.744  1.00 28.76 ? 402 LYS A C   1 
ATOM   324  O O   . LYS A 1 59  ? -11.816 43.931 22.058  1.00 27.94 ? 402 LYS A O   1 
ATOM   325  C CB  . LYS A 1 59  ? -13.933 45.968 22.307  1.00 28.16 ? 402 LYS A CB  1 
ATOM   326  C CG  . LYS A 1 59  ? -14.816 47.201 22.364  1.00 28.26 ? 402 LYS A CG  1 
ATOM   327  C CD  . LYS A 1 59  ? -16.163 46.852 22.871  1.00 30.84 ? 402 LYS A CD  1 
ATOM   328  C CE  . LYS A 1 59  ? -16.946 48.117 23.215  1.00 31.09 ? 402 LYS A CE  1 
ATOM   329  N NZ  . LYS A 1 59  ? -17.699 48.483 22.002  1.00 31.73 ? 402 LYS A NZ  1 
ATOM   330  N N   . VAL A 1 60  ? -10.916 45.042 23.825  1.00 28.10 ? 403 VAL A N   1 
ATOM   331  C CA  . VAL A 1 60  ? -10.201 43.868 24.332  1.00 27.93 ? 403 VAL A CA  1 
ATOM   332  C C   . VAL A 1 60  ? -10.805 43.464 25.673  1.00 28.37 ? 403 VAL A C   1 
ATOM   333  O O   . VAL A 1 60  ? -10.830 44.276 26.633  1.00 27.28 ? 403 VAL A O   1 
ATOM   334  C CB  . VAL A 1 60  ? -8.677  44.101 24.521  1.00 28.53 ? 403 VAL A CB  1 
ATOM   335  C CG1 . VAL A 1 60  ? -7.997  42.792 24.965  1.00 28.28 ? 403 VAL A CG1 1 
ATOM   336  C CG2 . VAL A 1 60  ? -7.993  44.661 23.242  1.00 27.70 ? 403 VAL A CG2 1 
ATOM   337  N N   . TYR A 1 61  ? -11.294 42.227 25.731  1.00 27.10 ? 404 TYR A N   1 
ATOM   338  C CA  . TYR A 1 61  ? -11.879 41.679 26.947  1.00 27.19 ? 404 TYR A CA  1 
ATOM   339  C C   . TYR A 1 61  ? -11.002 40.600 27.544  1.00 28.51 ? 404 TYR A C   1 
ATOM   340  O O   . TYR A 1 61  ? -10.350 39.860 26.819  1.00 27.08 ? 404 TYR A O   1 
ATOM   341  C CB  . TYR A 1 61  ? -13.246 41.049 26.702  1.00 25.78 ? 404 TYR A CB  1 
ATOM   342  C CG  . TYR A 1 61  ? -14.275 41.953 26.080  1.00 26.26 ? 404 TYR A CG  1 
ATOM   343  C CD1 . TYR A 1 61  ? -15.329 42.486 26.843  1.00 25.82 ? 404 TYR A CD1 1 
ATOM   344  C CD2 . TYR A 1 61  ? -14.211 42.263 24.711  1.00 25.31 ? 404 TYR A CD2 1 
ATOM   345  C CE1 . TYR A 1 61  ? -16.283 43.300 26.257  1.00 24.05 ? 404 TYR A CE1 1 
ATOM   346  C CE2 . TYR A 1 61  ? -15.150 43.052 24.135  1.00 26.04 ? 404 TYR A CE2 1 
ATOM   347  C CZ  . TYR A 1 61  ? -16.178 43.569 24.891  1.00 23.50 ? 404 TYR A CZ  1 
ATOM   348  O OH  . TYR A 1 61  ? -17.096 44.367 24.261  1.00 24.02 ? 404 TYR A OH  1 
ATOM   349  N N   . ARG A 1 62  ? -11.043 40.488 28.880  1.00 29.90 ? 405 ARG A N   1 
ATOM   350  C CA  . ARG A 1 62  ? -10.388 39.401 29.584  1.00 32.08 ? 405 ARG A CA  1 
ATOM   351  C C   . ARG A 1 62  ? -11.344 38.744 30.608  1.00 33.59 ? 405 ARG A C   1 
ATOM   352  O O   . ARG A 1 62  ? -12.274 39.381 31.148  1.00 33.05 ? 405 ARG A O   1 
ATOM   353  C CB  . ARG A 1 62  ? -9.112  39.923 30.247  1.00 33.07 ? 405 ARG A CB  1 
ATOM   354  C CG  . ARG A 1 62  ? -8.994  39.651 31.759  1.00 32.85 ? 405 ARG A CG  1 
ATOM   355  C CD  . ARG A 1 62  ? -8.044  40.628 32.460  1.00 31.91 ? 405 ARG A CD  1 
ATOM   356  N NE  . ARG A 1 62  ? -6.755  40.591 31.802  1.00 31.22 ? 405 ARG A NE  1 
ATOM   357  C CZ  . ARG A 1 62  ? -5.754  41.443 32.009  1.00 30.15 ? 405 ARG A CZ  1 
ATOM   358  N NH1 . ARG A 1 62  ? -5.862  42.451 32.903  1.00 27.78 ? 405 ARG A NH1 1 
ATOM   359  N NH2 . ARG A 1 62  ? -4.643  41.278 31.299  1.00 24.41 ? 405 ARG A NH2 1 
ATOM   360  N N   . ARG A 1 63  ? -11.129 37.455 30.825  1.00 34.79 ? 406 ARG A N   1 
ATOM   361  C CA  . ARG A 1 63  ? -11.832 36.702 31.859  1.00 36.90 ? 406 ARG A CA  1 
ATOM   362  C C   . ARG A 1 63  ? -10.756 36.203 32.830  1.00 37.51 ? 406 ARG A C   1 
ATOM   363  O O   . ARG A 1 63  ? -9.795  35.592 32.408  1.00 37.90 ? 406 ARG A O   1 
ATOM   364  C CB  . ARG A 1 63  ? -12.618 35.566 31.208  1.00 37.24 ? 406 ARG A CB  1 
ATOM   365  C CG  . ARG A 1 63  ? -13.278 34.606 32.124  1.00 38.79 ? 406 ARG A CG  1 
ATOM   366  C CD  . ARG A 1 63  ? -14.048 33.587 31.327  1.00 41.69 ? 406 ARG A CD  1 
ATOM   367  N NE  . ARG A 1 63  ? -15.116 33.059 32.160  1.00 47.03 ? 406 ARG A NE  1 
ATOM   368  C CZ  . ARG A 1 63  ? -14.929 32.182 33.142  1.00 50.90 ? 406 ARG A CZ  1 
ATOM   369  N NH1 . ARG A 1 63  ? -15.964 31.777 33.882  1.00 49.58 ? 406 ARG A NH1 1 
ATOM   370  N NH2 . ARG A 1 63  ? -13.700 31.703 33.373  1.00 53.01 ? 406 ARG A NH2 1 
ATOM   371  N N   . GLU A 1 64  ? -10.869 36.525 34.112  1.00 38.82 ? 407 GLU A N   1 
ATOM   372  C CA  . GLU A 1 64  ? -9.767  36.228 35.025  1.00 40.75 ? 407 GLU A CA  1 
ATOM   373  C C   . GLU A 1 64  ? -9.820  34.804 35.596  1.00 41.31 ? 407 GLU A C   1 
ATOM   374  O O   . GLU A 1 64  ? -10.795 34.396 36.207  1.00 41.36 ? 407 GLU A O   1 
ATOM   375  C CB  . GLU A 1 64  ? -9.641  37.292 36.123  1.00 40.88 ? 407 GLU A CB  1 
ATOM   376  C CG  . GLU A 1 64  ? -8.794  38.480 35.697  1.00 43.00 ? 407 GLU A CG  1 
ATOM   377  C CD  . GLU A 1 64  ? -8.426  39.386 36.853  1.00 47.50 ? 407 GLU A CD  1 
ATOM   378  O OE1 . GLU A 1 64  ? -8.709  39.028 38.020  1.00 46.35 ? 407 GLU A OE1 1 
ATOM   379  O OE2 . GLU A 1 64  ? -7.838  40.460 36.584  1.00 49.08 ? 407 GLU A OE2 1 
ATOM   380  N N   . VAL A 1 65  ? -8.775  34.037 35.332  1.00 42.92 ? 408 VAL A N   1 
ATOM   381  C CA  . VAL A 1 65  ? -8.734  32.642 35.764  1.00 44.52 ? 408 VAL A CA  1 
ATOM   382  C C   . VAL A 1 65  ? -7.322  32.165 36.034  1.00 45.81 ? 408 VAL A C   1 
ATOM   383  O O   . VAL A 1 65  ? -6.375  32.507 35.318  1.00 45.89 ? 408 VAL A O   1 
ATOM   384  C CB  . VAL A 1 65  ? -9.605  31.620 34.887  1.00 44.27 ? 408 VAL A CB  1 
ATOM   385  C CG1 . VAL A 1 65  ? -10.248 32.265 33.661  1.00 44.56 ? 408 VAL A CG1 1 
ATOM   386  C CG2 . VAL A 1 65  ? -8.831  30.349 34.519  1.00 43.89 ? 408 VAL A CG2 1 
ATOM   387  N N   . GLU A 1 66  ? -7.196  31.430 37.136  1.00 47.63 ? 409 GLU A N   1 
ATOM   388  C CA  . GLU A 1 66  ? -6.008  30.630 37.407  1.00 49.65 ? 409 GLU A CA  1 
ATOM   389  C C   . GLU A 1 66  ? -6.391  29.184 37.710  1.00 50.06 ? 409 GLU A C   1 
ATOM   390  O O   . GLU A 1 66  ? -7.490  28.900 38.192  1.00 49.23 ? 409 GLU A O   1 
ATOM   391  C CB  . GLU A 1 66  ? -5.157  31.233 38.518  1.00 49.74 ? 409 GLU A CB  1 
ATOM   392  C CG  . GLU A 1 66  ? -5.777  32.405 39.186  1.00 52.65 ? 409 GLU A CG  1 
ATOM   393  C CD  . GLU A 1 66  ? -4.822  33.083 40.113  1.00 55.43 ? 409 GLU A CD  1 
ATOM   394  O OE1 . GLU A 1 66  ? -4.537  34.296 39.899  1.00 55.52 ? 409 GLU A OE1 1 
ATOM   395  O OE2 . GLU A 1 66  ? -4.360  32.385 41.048  1.00 57.02 ? 409 GLU A OE2 1 
ATOM   396  N N   . GLU A 1 67  ? -5.495  28.274 37.357  1.00 51.07 ? 410 GLU A N   1 
ATOM   397  C CA  . GLU A 1 67  ? -5.691  26.862 37.642  1.00 52.52 ? 410 GLU A CA  1 
ATOM   398  C C   . GLU A 1 67  ? -4.397  26.339 38.251  1.00 53.04 ? 410 GLU A C   1 
ATOM   399  O O   . GLU A 1 67  ? -3.326  26.366 37.618  1.00 53.20 ? 410 GLU A O   1 
ATOM   400  C CB  . GLU A 1 67  ? -6.159  26.087 36.395  1.00 52.17 ? 410 GLU A CB  1 
ATOM   401  C CG  . GLU A 1 67  ? -7.602  26.495 35.953  1.00 53.38 ? 410 GLU A CG  1 
ATOM   402  C CD  . GLU A 1 67  ? -8.124  25.805 34.681  1.00 53.72 ? 410 GLU A CD  1 
ATOM   403  O OE1 . GLU A 1 67  ? -7.798  24.622 34.429  1.00 55.65 ? 410 GLU A OE1 1 
ATOM   404  O OE2 . GLU A 1 67  ? -8.903  26.448 33.943  1.00 54.87 ? 410 GLU A OE2 1 
ATOM   405  N N   . ASN A 1 68  ? -4.514  25.909 39.512  1.00 53.90 ? 411 ASN A N   1 
ATOM   406  C CA  . ASN A 1 68  ? -3.375  25.472 40.344  1.00 54.02 ? 411 ASN A CA  1 
ATOM   407  C C   . ASN A 1 68  ? -2.303  26.549 40.480  1.00 53.40 ? 411 ASN A C   1 
ATOM   408  O O   . ASN A 1 68  ? -1.101  26.304 40.290  1.00 53.25 ? 411 ASN A O   1 
ATOM   409  C CB  . ASN A 1 68  ? -2.800  24.132 39.859  1.00 54.59 ? 411 ASN A CB  1 
ATOM   410  C CG  . ASN A 1 68  ? -3.798  22.995 39.996  1.00 56.74 ? 411 ASN A CG  1 
ATOM   411  O OD1 . ASN A 1 68  ? -3.578  22.060 40.772  1.00 59.52 ? 411 ASN A OD1 1 
ATOM   412  N ND2 . ASN A 1 68  ? -4.921  23.081 39.263  1.00 58.01 ? 411 ASN A ND2 1 
ATOM   413  N N   . GLY A 1 69  ? -2.769  27.754 40.798  1.00 52.68 ? 412 GLY A N   1 
ATOM   414  C CA  . GLY A 1 69  ? -1.883  28.899 40.997  1.00 52.04 ? 412 GLY A CA  1 
ATOM   415  C C   . GLY A 1 69  ? -1.406  29.598 39.742  1.00 51.31 ? 412 GLY A C   1 
ATOM   416  O O   . GLY A 1 69  ? -0.725  30.609 39.834  1.00 52.03 ? 412 GLY A O   1 
ATOM   417  N N   . ILE A 1 70  ? -1.758  29.072 38.571  1.00 49.96 ? 413 ILE A N   1 
ATOM   418  C CA  . ILE A 1 70  ? -1.225  29.600 37.306  1.00 48.72 ? 413 ILE A CA  1 
ATOM   419  C C   . ILE A 1 70  ? -2.260  30.437 36.494  1.00 47.13 ? 413 ILE A C   1 
ATOM   420  O O   . ILE A 1 70  ? -3.424  30.053 36.387  1.00 47.19 ? 413 ILE A O   1 
ATOM   421  C CB  . ILE A 1 70  ? -0.493  28.486 36.496  1.00 48.94 ? 413 ILE A CB  1 
ATOM   422  C CG1 . ILE A 1 70  ? 1.024   28.602 36.738  1.00 49.99 ? 413 ILE A CG1 1 
ATOM   423  C CG2 . ILE A 1 70  ? -0.798  28.567 35.022  1.00 48.77 ? 413 ILE A CG2 1 
ATOM   424  C CD1 . ILE A 1 70  ? 1.800   27.333 36.473  1.00 49.17 ? 413 ILE A CD1 1 
ATOM   425  N N   . VAL A 1 71  ? -1.815  31.585 35.972  1.00 45.29 ? 414 VAL A N   1 
ATOM   426  C CA  . VAL A 1 71  ? -2.655  32.568 35.250  1.00 43.11 ? 414 VAL A CA  1 
ATOM   427  C C   . VAL A 1 71  ? -2.978  32.102 33.812  1.00 41.89 ? 414 VAL A C   1 
ATOM   428  O O   . VAL A 1 71  ? -2.086  32.019 32.961  1.00 41.08 ? 414 VAL A O   1 
ATOM   429  C CB  . VAL A 1 71  ? -1.946  33.961 35.220  1.00 43.46 ? 414 VAL A CB  1 
ATOM   430  C CG1 . VAL A 1 71  ? -2.695  34.986 34.328  1.00 41.58 ? 414 VAL A CG1 1 
ATOM   431  C CG2 . VAL A 1 71  ? -1.732  34.496 36.665  1.00 42.36 ? 414 VAL A CG2 1 
ATOM   432  N N   . LEU A 1 72  ? -4.249  31.793 33.564  1.00 40.36 ? 415 LEU A N   1 
ATOM   433  C CA  . LEU A 1 72  ? -4.695  31.315 32.246  1.00 39.15 ? 415 LEU A CA  1 
ATOM   434  C C   . LEU A 1 72  ? -5.658  32.282 31.524  1.00 37.48 ? 415 LEU A C   1 
ATOM   435  O O   . LEU A 1 72  ? -6.058  32.018 30.383  1.00 38.54 ? 415 LEU A O   1 
ATOM   436  C CB  . LEU A 1 72  ? -5.297  29.909 32.347  1.00 39.09 ? 415 LEU A CB  1 
ATOM   437  C CG  . LEU A 1 72  ? -4.359  28.745 32.793  1.00 40.80 ? 415 LEU A CG  1 
ATOM   438  C CD1 . LEU A 1 72  ? -4.940  27.368 32.483  1.00 38.33 ? 415 LEU A CD1 1 
ATOM   439  C CD2 . LEU A 1 72  ? -2.955  28.853 32.209  1.00 38.02 ? 415 LEU A CD2 1 
ATOM   440  N N   . ASP A 1 73  ? -6.005  33.385 32.181  1.00 34.11 ? 416 ASP A N   1 
ATOM   441  C CA  . ASP A 1 73  ? -6.908  34.410 31.644  1.00 31.54 ? 416 ASP A CA  1 
ATOM   442  C C   . ASP A 1 73  ? -7.194  34.269 30.124  1.00 29.85 ? 416 ASP A C   1 
ATOM   443  O O   . ASP A 1 73  ? -6.399  34.692 29.293  1.00 29.34 ? 416 ASP A O   1 
ATOM   444  C CB  . ASP A 1 73  ? -6.335  35.812 31.881  1.00 31.12 ? 416 ASP A CB  1 
ATOM   445  C CG  . ASP A 1 73  ? -6.231  36.193 33.364  1.00 32.36 ? 416 ASP A CG  1 
ATOM   446  O OD1 . ASP A 1 73  ? -5.907  37.387 33.576  1.00 29.73 ? 416 ASP A OD1 1 
ATOM   447  O OD2 . ASP A 1 73  ? -6.467  35.339 34.285  1.00 27.31 ? 416 ASP A OD2 1 
ATOM   448  N N   . PRO A 1 74  ? -8.321  33.663 29.769  1.00 28.01 ? 417 PRO A N   1 
ATOM   449  C CA  . PRO A 1 74  ? -8.762  33.767 28.373  1.00 27.29 ? 417 PRO A CA  1 
ATOM   450  C C   . PRO A 1 74  ? -8.888  35.242 27.957  1.00 26.50 ? 417 PRO A C   1 
ATOM   451  O O   . PRO A 1 74  ? -9.401  36.064 28.739  1.00 26.45 ? 417 PRO A O   1 
ATOM   452  C CB  . PRO A 1 74  ? -10.147 33.149 28.402  1.00 26.46 ? 417 PRO A CB  1 
ATOM   453  C CG  . PRO A 1 74  ? -10.071 32.127 29.526  1.00 28.21 ? 417 PRO A CG  1 
ATOM   454  C CD  . PRO A 1 74  ? -9.233  32.846 30.592  1.00 27.84 ? 417 PRO A CD  1 
ATOM   455  N N   . LEU A 1 75  ? -8.400  35.544 26.764  1.00 24.40 ? 418 LEU A N   1 
ATOM   456  C CA  . LEU A 1 75  ? -8.526  36.868 26.160  1.00 25.21 ? 418 LEU A CA  1 
ATOM   457  C C   . LEU A 1 75  ? -9.410  36.859 24.903  1.00 25.16 ? 418 LEU A C   1 
ATOM   458  O O   . LEU A 1 75  ? -9.335  35.933 24.055  1.00 25.06 ? 418 LEU A O   1 
ATOM   459  C CB  . LEU A 1 75  ? -7.139  37.396 25.776  1.00 25.33 ? 418 LEU A CB  1 
ATOM   460  C CG  . LEU A 1 75  ? -7.172  38.836 25.293  1.00 27.68 ? 418 LEU A CG  1 
ATOM   461  C CD1 . LEU A 1 75  ? -6.144  39.584 26.044  1.00 27.48 ? 418 LEU A CD1 1 
ATOM   462  C CD2 . LEU A 1 75  ? -7.015  38.954 23.697  1.00 27.94 ? 418 LEU A CD2 1 
ATOM   463  N N   . LYS A 1 76  ? -10.248 37.869 24.770  1.00 24.20 ? 419 LYS A N   1 
ATOM   464  C CA  . LYS A 1 76  ? -11.068 37.963 23.597  1.00 24.28 ? 419 LYS A CA  1 
ATOM   465  C C   . LYS A 1 76  ? -11.097 39.414 23.121  1.00 25.31 ? 419 LYS A C   1 
ATOM   466  O O   . LYS A 1 76  ? -11.272 40.323 23.937  1.00 23.05 ? 419 LYS A O   1 
ATOM   467  C CB  . LYS A 1 76  ? -12.477 37.428 23.853  1.00 25.13 ? 419 LYS A CB  1 
ATOM   468  C CG  . LYS A 1 76  ? -13.448 37.560 22.643  1.00 27.07 ? 419 LYS A CG  1 
ATOM   469  C CD  . LYS A 1 76  ? -14.759 36.866 23.047  1.00 32.62 ? 419 LYS A CD  1 
ATOM   470  C CE  . LYS A 1 76  ? -15.643 36.402 21.871  1.00 36.09 ? 419 LYS A CE  1 
ATOM   471  N NZ  . LYS A 1 76  ? -16.101 37.427 20.934  1.00 39.83 ? 419 LYS A NZ  1 
ATOM   472  N N   . ALA A 1 77  ? -10.919 39.618 21.808  1.00 24.56 ? 420 ALA A N   1 
ATOM   473  C CA  . ALA A 1 77  ? -10.944 40.966 21.250  1.00 26.31 ? 420 ALA A CA  1 
ATOM   474  C C   . ALA A 1 77  ? -11.845 41.019 20.043  1.00 27.71 ? 420 ALA A C   1 
ATOM   475  O O   . ALA A 1 77  ? -11.934 40.027 19.275  1.00 27.69 ? 420 ALA A O   1 
ATOM   476  C CB  . ALA A 1 77  ? -9.485  41.464 20.900  1.00 25.22 ? 420 ALA A CB  1 
ATOM   477  N N   . THR A 1 78  ? -12.578 42.136 19.916  1.00 28.46 ? 421 THR A N   1 
ATOM   478  C CA  . THR A 1 78  ? -13.391 42.388 18.744  1.00 28.84 ? 421 THR A CA  1 
ATOM   479  C C   . THR A 1 78  ? -12.828 43.614 18.069  1.00 29.45 ? 421 THR A C   1 
ATOM   480  O O   . THR A 1 78  ? -12.181 44.455 18.713  1.00 30.01 ? 421 THR A O   1 
ATOM   481  C CB  . THR A 1 78  ? -14.930 42.512 19.008  1.00 28.72 ? 421 THR A CB  1 
ATOM   482  O OG1 . THR A 1 78  ? -15.231 43.481 20.028  1.00 29.70 ? 421 THR A OG1 1 
ATOM   483  C CG2 . THR A 1 78  ? -15.570 41.175 19.359  1.00 29.33 ? 421 THR A CG2 1 
ATOM   484  N N   . HIS A 1 79  ? -13.061 43.710 16.761  1.00 29.44 ? 422 HIS A N   1 
ATOM   485  C CA  . HIS A 1 79  ? -12.528 44.779 15.972  1.00 29.28 ? 422 HIS A CA  1 
ATOM   486  C C   . HIS A 1 79  ? -13.347 44.888 14.685  1.00 30.65 ? 422 HIS A C   1 
ATOM   487  O O   . HIS A 1 79  ? -13.957 43.917 14.245  1.00 30.20 ? 422 HIS A O   1 
ATOM   488  C CB  . HIS A 1 79  ? -11.053 44.498 15.674  1.00 29.81 ? 422 HIS A CB  1 
ATOM   489  C CG  . HIS A 1 79  ? -10.222 45.730 15.474  1.00 28.94 ? 422 HIS A CG  1 
ATOM   490  N ND1 . HIS A 1 79  ? -10.762 46.948 15.125  1.00 29.91 ? 422 HIS A ND1 1 
ATOM   491  C CD2 . HIS A 1 79  ? -8.891  45.916 15.533  1.00 28.68 ? 422 HIS A CD2 1 
ATOM   492  C CE1 . HIS A 1 79  ? -9.796  47.836 14.999  1.00 27.60 ? 422 HIS A CE1 1 
ATOM   493  N NE2 . HIS A 1 79  ? -8.652  47.233 15.221  1.00 29.72 ? 422 HIS A NE2 1 
ATOM   494  N N   . ALA A 1 80  ? -13.388 46.089 14.117  1.00 30.53 ? 423 ALA A N   1 
ATOM   495  C CA  . ALA A 1 80  ? -14.048 46.330 12.838  1.00 31.38 ? 423 ALA A CA  1 
ATOM   496  C C   . ALA A 1 80  ? -13.075 47.139 11.970  1.00 31.73 ? 423 ALA A C   1 
ATOM   497  O O   . ALA A 1 80  ? -12.518 48.180 12.404  1.00 31.50 ? 423 ALA A O   1 
ATOM   498  C CB  . ALA A 1 80  ? -15.354 47.059 13.054  1.00 31.14 ? 423 ALA A CB  1 
ATOM   499  N N   . VAL A 1 81  ? -12.779 46.604 10.790  1.00 32.01 ? 424 VAL A N   1 
ATOM   500  C CA  . VAL A 1 81  ? -11.700 47.149 9.939   1.00 31.87 ? 424 VAL A CA  1 
ATOM   501  C C   . VAL A 1 81  ? -12.253 47.422 8.544   1.00 32.00 ? 424 VAL A C   1 
ATOM   502  O O   . VAL A 1 81  ? -12.628 46.499 7.808   1.00 30.67 ? 424 VAL A O   1 
ATOM   503  C CB  . VAL A 1 81  ? -10.470 46.210 9.913   1.00 32.30 ? 424 VAL A CB  1 
ATOM   504  C CG1 . VAL A 1 81  ? -9.339  46.809 9.088   1.00 32.85 ? 424 VAL A CG1 1 
ATOM   505  C CG2 . VAL A 1 81  ? -9.977  45.969 11.330  1.00 31.93 ? 424 VAL A CG2 1 
ATOM   506  N N   . LYS A 1 82  ? -12.304 48.708 8.191   1.00 32.15 ? 425 LYS A N   1 
ATOM   507  C CA  . LYS A 1 82  ? -12.928 49.140 6.953   1.00 32.64 ? 425 LYS A CA  1 
ATOM   508  C C   . LYS A 1 82  ? -12.028 48.798 5.780   1.00 32.14 ? 425 LYS A C   1 
ATOM   509  O O   . LYS A 1 82  ? -10.805 48.928 5.880   1.00 30.01 ? 425 LYS A O   1 
ATOM   510  C CB  . LYS A 1 82  ? -13.259 50.662 6.997   1.00 33.35 ? 425 LYS A CB  1 
ATOM   511  C CG  . LYS A 1 82  ? -14.661 50.937 7.596   1.00 37.08 ? 425 LYS A CG  1 
ATOM   512  C CD  . LYS A 1 82  ? -14.732 52.230 8.449   1.00 40.95 ? 425 LYS A CD  1 
ATOM   513  C CE  . LYS A 1 82  ? -16.000 52.264 9.331   1.00 42.17 ? 425 LYS A CE  1 
ATOM   514  N NZ  . LYS A 1 82  ? -15.881 51.476 10.620  1.00 45.85 ? 425 LYS A NZ  1 
ATOM   515  N N   . GLY A 1 83  ? -12.641 48.354 4.675   1.00 32.87 ? 426 GLY A N   1 
ATOM   516  C CA  . GLY A 1 83  ? -11.909 48.234 3.386   1.00 32.84 ? 426 GLY A CA  1 
ATOM   517  C C   . GLY A 1 83  ? -10.948 47.062 3.234   1.00 33.05 ? 426 GLY A C   1 
ATOM   518  O O   . GLY A 1 83  ? -9.997  47.104 2.406   1.00 33.83 ? 426 GLY A O   1 
ATOM   519  N N   . VAL A 1 84  ? -11.183 46.014 4.026   1.00 32.04 ? 427 VAL A N   1 
ATOM   520  C CA  . VAL A 1 84  ? -10.471 44.737 3.857   1.00 31.15 ? 427 VAL A CA  1 
ATOM   521  C C   . VAL A 1 84  ? -11.485 43.628 4.030   1.00 30.01 ? 427 VAL A C   1 
ATOM   522  O O   . VAL A 1 84  ? -12.548 43.871 4.576   1.00 31.09 ? 427 VAL A O   1 
ATOM   523  C CB  . VAL A 1 84  ? -9.306  44.574 4.868   1.00 31.51 ? 427 VAL A CB  1 
ATOM   524  C CG1 . VAL A 1 84  ? -8.342  45.769 4.761   1.00 30.79 ? 427 VAL A CG1 1 
ATOM   525  C CG2 . VAL A 1 84  ? -9.844  44.401 6.322   1.00 31.08 ? 427 VAL A CG2 1 
ATOM   526  N N   . THR A 1 85  ? -11.166 42.430 3.552   1.00 28.02 ? 428 THR A N   1 
ATOM   527  C CA  . THR A 1 85  ? -12.033 41.284 3.706   1.00 27.25 ? 428 THR A CA  1 
ATOM   528  C C   . THR A 1 85  ? -11.442 40.328 4.749   1.00 26.33 ? 428 THR A C   1 
ATOM   529  O O   . THR A 1 85  ? -10.282 40.464 5.111   1.00 26.05 ? 428 THR A O   1 
ATOM   530  C CB  . THR A 1 85  ? -12.244 40.537 2.355   1.00 26.68 ? 428 THR A CB  1 
ATOM   531  O OG1 . THR A 1 85  ? -11.027 39.916 1.977   1.00 28.67 ? 428 THR A OG1 1 
ATOM   532  C CG2 . THR A 1 85  ? -12.655 41.522 1.247   1.00 26.47 ? 428 THR A CG2 1 
ATOM   533  N N   . GLY A 1 86  ? -12.268 39.403 5.236   1.00 26.43 ? 429 GLY A N   1 
ATOM   534  C CA  . GLY A 1 86  ? -11.854 38.318 6.151   1.00 26.95 ? 429 GLY A CA  1 
ATOM   535  C C   . GLY A 1 86  ? -10.825 37.381 5.539   1.00 27.17 ? 429 GLY A C   1 
ATOM   536  O O   . GLY A 1 86  ? -9.907  36.946 6.219   1.00 27.92 ? 429 GLY A O   1 
ATOM   537  N N   . HIS A 1 87  ? -10.940 37.120 4.238   1.00 27.04 ? 430 HIS A N   1 
ATOM   538  C CA  . HIS A 1 87  ? -9.929  36.369 3.478   1.00 26.74 ? 430 HIS A CA  1 
ATOM   539  C C   . HIS A 1 87  ? -8.576  37.054 3.510   1.00 26.85 ? 430 HIS A C   1 
ATOM   540  O O   . HIS A 1 87  ? -7.521  36.436 3.813   1.00 26.94 ? 430 HIS A O   1 
ATOM   541  C CB  . HIS A 1 87  ? -10.403 36.245 2.030   1.00 27.05 ? 430 HIS A CB  1 
ATOM   542  C CG  . HIS A 1 87  ? -9.676  35.214 1.232   1.00 27.02 ? 430 HIS A CG  1 
ATOM   543  N ND1 . HIS A 1 87  ? -10.065 34.855 -0.042  1.00 29.04 ? 430 HIS A ND1 1 
ATOM   544  C CD2 . HIS A 1 87  ? -8.613  34.434 1.533   1.00 28.98 ? 430 HIS A CD2 1 
ATOM   545  C CE1 . HIS A 1 87  ? -9.246  33.925 -0.504  1.00 28.61 ? 430 HIS A CE1 1 
ATOM   546  N NE2 . HIS A 1 87  ? -8.364  33.645 0.434   1.00 29.35 ? 430 HIS A NE2 1 
ATOM   547  N N   . GLU A 1 88  ? -8.581  38.347 3.176   1.00 26.17 ? 431 GLU A N   1 
ATOM   548  C CA  . GLU A 1 88  ? -7.348  39.106 3.239   1.00 24.72 ? 431 GLU A CA  1 
ATOM   549  C C   . GLU A 1 88  ? -6.737  39.102 4.637   1.00 23.84 ? 431 GLU A C   1 
ATOM   550  O O   . GLU A 1 88  ? -5.536  38.903 4.789   1.00 22.89 ? 431 GLU A O   1 
ATOM   551  C CB  . GLU A 1 88  ? -7.571  40.554 2.763   1.00 25.27 ? 431 GLU A CB  1 
ATOM   552  C CG  . GLU A 1 88  ? -7.746  40.661 1.267   1.00 25.62 ? 431 GLU A CG  1 
ATOM   553  C CD  . GLU A 1 88  ? -8.252  42.029 0.834   1.00 29.95 ? 431 GLU A CD  1 
ATOM   554  O OE1 . GLU A 1 88  ? -8.766  42.778 1.688   1.00 29.48 ? 431 GLU A OE1 1 
ATOM   555  O OE2 . GLU A 1 88  ? -8.139  42.344 -0.366  1.00 28.72 ? 431 GLU A OE2 1 
ATOM   556  N N   . VAL A 1 89  ? -7.547  39.372 5.647   1.00 24.43 ? 432 VAL A N   1 
ATOM   557  C CA  . VAL A 1 89  ? -7.039  39.401 7.046   1.00 25.12 ? 432 VAL A CA  1 
ATOM   558  C C   . VAL A 1 89  ? -6.463  38.013 7.438   1.00 25.46 ? 432 VAL A C   1 
ATOM   559  O O   . VAL A 1 89  ? -5.341  37.884 7.910   1.00 26.39 ? 432 VAL A O   1 
ATOM   560  C CB  . VAL A 1 89  ? -8.152  39.907 8.012   1.00 24.49 ? 432 VAL A CB  1 
ATOM   561  C CG1 . VAL A 1 89  ? -7.724  39.786 9.499   1.00 23.64 ? 432 VAL A CG1 1 
ATOM   562  C CG2 . VAL A 1 89  ? -8.490  41.381 7.658   1.00 24.39 ? 432 VAL A CG2 1 
ATOM   563  N N   . CYS A 1 90  ? -7.203  36.964 7.157   1.00 26.49 ? 433 CYS A N   1 
ATOM   564  C CA  . CYS A 1 90  ? -6.725  35.626 7.504   1.00 27.61 ? 433 CYS A CA  1 
ATOM   565  C C   . CYS A 1 90  ? -5.488  35.198 6.722   1.00 28.34 ? 433 CYS A C   1 
ATOM   566  O O   . CYS A 1 90  ? -4.546  34.684 7.331   1.00 28.48 ? 433 CYS A O   1 
ATOM   567  C CB  . CYS A 1 90  ? -7.860  34.626 7.393   1.00 27.51 ? 433 CYS A CB  1 
ATOM   568  S SG  . CYS A 1 90  ? -8.986  34.878 8.704   1.00 27.72 ? 433 CYS A SG  1 
ATOM   569  N N   . ASN A 1 91  ? -5.451  35.465 5.405   1.00 28.81 ? 434 ASN A N   1 
ATOM   570  C CA  . ASN A 1 91  ? -4.213  35.269 4.621   1.00 29.55 ? 434 ASN A CA  1 
ATOM   571  C C   . ASN A 1 91  ? -2.971  35.869 5.244   1.00 28.92 ? 434 ASN A C   1 
ATOM   572  O O   . ASN A 1 91  ? -1.952  35.205 5.334   1.00 28.68 ? 434 ASN A O   1 
ATOM   573  C CB  . ASN A 1 91  ? -4.294  35.877 3.203   1.00 30.01 ? 434 ASN A CB  1 
ATOM   574  C CG  . ASN A 1 91  ? -4.978  35.002 2.226   1.00 33.38 ? 434 ASN A CG  1 
ATOM   575  O OD1 . ASN A 1 91  ? -5.205  35.432 1.095   1.00 36.48 ? 434 ASN A OD1 1 
ATOM   576  N ND2 . ASN A 1 91  ? -5.337  33.765 2.629   1.00 32.13 ? 434 ASN A ND2 1 
ATOM   577  N N   . TYR A 1 92  ? -3.038  37.152 5.601   1.00 29.11 ? 435 TYR A N   1 
ATOM   578  C CA  . TYR A 1 92  ? -1.877  37.854 6.152   1.00 29.39 ? 435 TYR A CA  1 
ATOM   579  C C   . TYR A 1 92  ? -1.455  37.353 7.516   1.00 27.90 ? 435 TYR A C   1 
ATOM   580  O O   . TYR A 1 92  ? -0.278  37.357 7.802   1.00 27.78 ? 435 TYR A O   1 
ATOM   581  C CB  . TYR A 1 92  ? -2.099  39.372 6.214   1.00 31.04 ? 435 TYR A CB  1 
ATOM   582  C CG  . TYR A 1 92  ? -1.906  40.023 4.870   1.00 34.46 ? 435 TYR A CG  1 
ATOM   583  C CD1 . TYR A 1 92  ? -0.622  40.390 4.413   1.00 36.54 ? 435 TYR A CD1 1 
ATOM   584  C CD2 . TYR A 1 92  ? -2.990  40.249 4.041   1.00 33.32 ? 435 TYR A CD2 1 
ATOM   585  C CE1 . TYR A 1 92  ? -0.458  40.970 3.148   1.00 36.06 ? 435 TYR A CE1 1 
ATOM   586  C CE2 . TYR A 1 92  ? -2.827  40.819 2.813   1.00 35.62 ? 435 TYR A CE2 1 
ATOM   587  C CZ  . TYR A 1 92  ? -1.577  41.170 2.369   1.00 35.29 ? 435 TYR A CZ  1 
ATOM   588  O OH  . TYR A 1 92  ? -1.480  41.733 1.122   1.00 37.20 ? 435 TYR A OH  1 
ATOM   589  N N   . PHE A 1 93  ? -2.425  36.971 8.353   1.00 27.16 ? 436 PHE A N   1 
ATOM   590  C CA  . PHE A 1 93  ? -2.166  36.463 9.695   1.00 26.31 ? 436 PHE A CA  1 
ATOM   591  C C   . PHE A 1 93  ? -1.496  35.095 9.621   1.00 26.79 ? 436 PHE A C   1 
ATOM   592  O O   . PHE A 1 93  ? -0.575  34.827 10.374  1.00 26.72 ? 436 PHE A O   1 
ATOM   593  C CB  . PHE A 1 93  ? -3.482  36.360 10.489  1.00 25.65 ? 436 PHE A CB  1 
ATOM   594  C CG  . PHE A 1 93  ? -3.293  35.936 11.928  1.00 26.10 ? 436 PHE A CG  1 
ATOM   595  C CD1 . PHE A 1 93  ? -2.531  36.715 12.809  1.00 25.35 ? 436 PHE A CD1 1 
ATOM   596  C CD2 . PHE A 1 93  ? -3.903  34.789 12.412  1.00 25.48 ? 436 PHE A CD2 1 
ATOM   597  C CE1 . PHE A 1 93  ? -2.372  36.357 14.136  1.00 25.97 ? 436 PHE A CE1 1 
ATOM   598  C CE2 . PHE A 1 93  ? -3.720  34.400 13.729  1.00 28.31 ? 436 PHE A CE2 1 
ATOM   599  C CZ  . PHE A 1 93  ? -2.941  35.184 14.595  1.00 26.52 ? 436 PHE A CZ  1 
ATOM   600  N N   . TRP A 1 94  ? -1.992  34.248 8.713   1.00 27.47 ? 437 TRP A N   1 
ATOM   601  C CA  . TRP A 1 94  ? -1.545  32.851 8.522   1.00 28.20 ? 437 TRP A CA  1 
ATOM   602  C C   . TRP A 1 94  ? -0.255  32.786 7.718   1.00 29.02 ? 437 TRP A C   1 
ATOM   603  O O   . TRP A 1 94  ? 0.680   32.039 8.040   1.00 27.55 ? 437 TRP A O   1 
ATOM   604  C CB  . TRP A 1 94  ? -2.639  32.013 7.823   1.00 28.23 ? 437 TRP A CB  1 
ATOM   605  C CG  . TRP A 1 94  ? -2.225  30.573 7.615   1.00 28.88 ? 437 TRP A CG  1 
ATOM   606  C CD1 . TRP A 1 94  ? -2.189  29.578 8.578   1.00 27.67 ? 437 TRP A CD1 1 
ATOM   607  C CD2 . TRP A 1 94  ? -1.724  29.980 6.406   1.00 27.59 ? 437 TRP A CD2 1 
ATOM   608  N NE1 . TRP A 1 94  ? -1.718  28.420 8.037   1.00 28.78 ? 437 TRP A NE1 1 
ATOM   609  C CE2 . TRP A 1 94  ? -1.429  28.624 6.704   1.00 28.98 ? 437 TRP A CE2 1 
ATOM   610  C CE3 . TRP A 1 94  ? -1.503  30.456 5.103   1.00 28.18 ? 437 TRP A CE3 1 
ATOM   611  C CZ2 . TRP A 1 94  ? -0.917  27.742 5.751   1.00 26.15 ? 437 TRP A CZ2 1 
ATOM   612  C CZ3 . TRP A 1 94  ? -1.008  29.574 4.143   1.00 30.39 ? 437 TRP A CZ3 1 
ATOM   613  C CH2 . TRP A 1 94  ? -0.722  28.217 4.482   1.00 29.47 ? 437 TRP A CH2 1 
ATOM   614  N N   . ASN A 1 95  ? -0.176  33.631 6.698   1.00 30.99 ? 438 ASN A N   1 
ATOM   615  C CA  . ASN A 1 95  ? 0.935   33.539 5.728   1.00 33.31 ? 438 ASN A CA  1 
ATOM   616  C C   . ASN A 1 95  ? 2.312   33.824 6.340   1.00 33.61 ? 438 ASN A C   1 
ATOM   617  O O   . ASN A 1 95  ? 2.653   34.948 6.649   1.00 33.07 ? 438 ASN A O   1 
ATOM   618  C CB  . ASN A 1 95  ? 0.670   34.356 4.438   1.00 33.49 ? 438 ASN A CB  1 
ATOM   619  C CG  . ASN A 1 95  ? 1.754   34.149 3.393   1.00 37.53 ? 438 ASN A CG  1 
ATOM   620  O OD1 . ASN A 1 95  ? 2.512   33.165 3.443   1.00 40.28 ? 438 ASN A OD1 1 
ATOM   621  N ND2 . ASN A 1 95  ? 1.863   35.096 2.457   1.00 39.58 ? 438 ASN A ND2 1 
ATOM   622  N N   . VAL A 1 96  ? 3.068   32.743 6.513   1.00 34.96 ? 439 VAL A N   1 
ATOM   623  C CA  . VAL A 1 96  ? 4.430   32.708 7.041   1.00 35.86 ? 439 VAL A CA  1 
ATOM   624  C C   . VAL A 1 96  ? 5.428   33.585 6.196   1.00 37.27 ? 439 VAL A C   1 
ATOM   625  O O   . VAL A 1 96  ? 6.301   34.279 6.735   1.00 37.02 ? 439 VAL A O   1 
ATOM   626  C CB  . VAL A 1 96  ? 4.805   31.161 7.209   1.00 36.16 ? 439 VAL A CB  1 
ATOM   627  C CG1 . VAL A 1 96  ? 5.962   30.701 6.329   1.00 34.66 ? 439 VAL A CG1 1 
ATOM   628  C CG2 . VAL A 1 96  ? 4.929   30.734 8.701   1.00 34.51 ? 439 VAL A CG2 1 
ATOM   629  N N   . ASP A 1 97  ? 5.236   33.600 4.876   1.00 38.73 ? 440 ASP A N   1 
ATOM   630  C CA  . ASP A 1 97  ? 6.006   34.467 3.983   1.00 41.05 ? 440 ASP A CA  1 
ATOM   631  C C   . ASP A 1 97  ? 6.005   35.935 4.386   1.00 41.47 ? 440 ASP A C   1 
ATOM   632  O O   . ASP A 1 97  ? 6.988   36.620 4.122   1.00 42.26 ? 440 ASP A O   1 
ATOM   633  C CB  . ASP A 1 97  ? 5.536   34.318 2.521   1.00 41.01 ? 440 ASP A CB  1 
ATOM   634  C CG  . ASP A 1 97  ? 5.463   32.851 2.084   1.00 44.41 ? 440 ASP A CG  1 
ATOM   635  O OD1 . ASP A 1 97  ? 6.220   32.032 2.659   1.00 45.01 ? 440 ASP A OD1 1 
ATOM   636  O OD2 . ASP A 1 97  ? 4.648   32.510 1.178   1.00 47.78 ? 440 ASP A OD2 1 
ATOM   637  N N   . VAL A 1 98  ? 4.933   36.424 5.018   1.00 42.31 ? 441 VAL A N   1 
ATOM   638  C CA  . VAL A 1 98  ? 4.851   37.858 5.388   1.00 43.53 ? 441 VAL A CA  1 
ATOM   639  C C   . VAL A 1 98  ? 4.899   38.182 6.889   1.00 43.78 ? 441 VAL A C   1 
ATOM   640  O O   . VAL A 1 98  ? 4.512   39.267 7.294   1.00 43.95 ? 441 VAL A O   1 
ATOM   641  C CB  . VAL A 1 98  ? 3.620   38.605 4.733   1.00 43.45 ? 441 VAL A CB  1 
ATOM   642  C CG1 . VAL A 1 98  ? 3.706   38.599 3.209   1.00 43.78 ? 441 VAL A CG1 1 
ATOM   643  C CG2 . VAL A 1 98  ? 2.308   38.028 5.210   1.00 43.85 ? 441 VAL A CG2 1 
ATOM   644  N N   . ARG A 1 99  ? 5.416   37.264 7.694   1.00 44.94 ? 442 ARG A N   1 
ATOM   645  C CA  . ARG A 1 99  ? 5.345   37.363 9.171   1.00 45.68 ? 442 ARG A CA  1 
ATOM   646  C C   . ARG A 1 99  ? 6.206   38.446 9.775   1.00 46.35 ? 442 ARG A C   1 
ATOM   647  O O   . ARG A 1 99  ? 5.780   39.136 10.689  1.00 46.23 ? 442 ARG A O   1 
ATOM   648  C CB  . ARG A 1 99  ? 5.784   36.044 9.794   1.00 45.92 ? 442 ARG A CB  1 
ATOM   649  C CG  . ARG A 1 99  ? 4.683   35.148 10.181  1.00 45.26 ? 442 ARG A CG  1 
ATOM   650  C CD  . ARG A 1 99  ? 4.468   35.212 11.674  1.00 44.12 ? 442 ARG A CD  1 
ATOM   651  N NE  . ARG A 1 99  ? 3.961   33.948 12.185  1.00 43.28 ? 442 ARG A NE  1 
ATOM   652  C CZ  . ARG A 1 99  ? 2.824   33.382 11.807  1.00 44.12 ? 442 ARG A CZ  1 
ATOM   653  N NH1 . ARG A 1 99  ? 2.472   32.213 12.335  1.00 44.52 ? 442 ARG A NH1 1 
ATOM   654  N NH2 . ARG A 1 99  ? 2.047   33.960 10.885  1.00 43.25 ? 442 ARG A NH2 1 
ATOM   655  N N   . ASN A 1 100 ? 7.435   38.565 9.265   1.00 47.75 ? 443 ASN A N   1 
ATOM   656  C CA  . ASN A 1 100 ? 8.417   39.555 9.743   1.00 48.14 ? 443 ASN A CA  1 
ATOM   657  C C   . ASN A 1 100 ? 7.905   41.001 9.683   1.00 47.75 ? 443 ASN A C   1 
ATOM   658  O O   . ASN A 1 100 ? 8.279   41.837 10.515  1.00 47.22 ? 443 ASN A O   1 
ATOM   659  C CB  . ASN A 1 100 ? 9.733   39.402 8.968   1.00 48.60 ? 443 ASN A CB  1 
ATOM   660  C CG  . ASN A 1 100 ? 10.274  37.940 8.976   1.00 50.97 ? 443 ASN A CG  1 
ATOM   661  O OD1 . ASN A 1 100 ? 10.684  37.394 7.925   1.00 51.27 ? 443 ASN A OD1 1 
ATOM   662  N ND2 . ASN A 1 100 ? 10.281  37.313 10.164  1.00 50.78 ? 443 ASN A ND2 1 
ATOM   663  N N   . ASP A 1 101 ? 7.014   41.272 8.725   1.00 47.70 ? 444 ASP A N   1 
ATOM   664  C CA  . ASP A 1 101 ? 6.493   42.634 8.480   1.00 47.31 ? 444 ASP A CA  1 
ATOM   665  C C   . ASP A 1 101 ? 5.569   43.158 9.558   1.00 46.81 ? 444 ASP A C   1 
ATOM   666  O O   . ASP A 1 101 ? 5.412   44.381 9.710   1.00 47.48 ? 444 ASP A O   1 
ATOM   667  C CB  . ASP A 1 101 ? 5.752   42.719 7.151   1.00 47.16 ? 444 ASP A CB  1 
ATOM   668  C CG  . ASP A 1 101 ? 6.532   42.145 6.012   1.00 48.59 ? 444 ASP A CG  1 
ATOM   669  O OD1 . ASP A 1 101 ? 7.741   41.849 6.185   1.00 50.84 ? 444 ASP A OD1 1 
ATOM   670  O OD2 . ASP A 1 101 ? 5.921   41.966 4.939   1.00 50.12 ? 444 ASP A OD2 1 
ATOM   671  N N   . TRP A 1 102 ? 4.922   42.271 10.292  1.00 45.21 ? 445 TRP A N   1 
ATOM   672  C CA  . TRP A 1 102 ? 4.008   42.773 11.298  1.00 44.97 ? 445 TRP A CA  1 
ATOM   673  C C   . TRP A 1 102 ? 4.282   42.253 12.708  1.00 45.55 ? 445 TRP A C   1 
ATOM   674  O O   . TRP A 1 102 ? 3.947   42.937 13.687  1.00 45.38 ? 445 TRP A O   1 
ATOM   675  C CB  . TRP A 1 102 ? 2.551   42.546 10.883  1.00 44.18 ? 445 TRP A CB  1 
ATOM   676  C CG  . TRP A 1 102 ? 2.212   41.118 10.675  1.00 42.40 ? 445 TRP A CG  1 
ATOM   677  C CD1 . TRP A 1 102 ? 2.253   40.432 9.501   1.00 41.29 ? 445 TRP A CD1 1 
ATOM   678  C CD2 . TRP A 1 102 ? 1.784   40.192 11.672  1.00 42.02 ? 445 TRP A CD2 1 
ATOM   679  N NE1 . TRP A 1 102 ? 1.862   39.132 9.696   1.00 41.35 ? 445 TRP A NE1 1 
ATOM   680  C CE2 . TRP A 1 102 ? 1.559   38.959 11.023  1.00 42.65 ? 445 TRP A CE2 1 
ATOM   681  C CE3 . TRP A 1 102 ? 1.534   40.288 13.050  1.00 41.08 ? 445 TRP A CE3 1 
ATOM   682  C CZ2 . TRP A 1 102 ? 1.133   37.817 11.715  1.00 41.99 ? 445 TRP A CZ2 1 
ATOM   683  C CZ3 . TRP A 1 102 ? 1.106   39.155 13.727  1.00 41.45 ? 445 TRP A CZ3 1 
ATOM   684  C CH2 . TRP A 1 102 ? 0.907   37.941 13.057  1.00 42.07 ? 445 TRP A CH2 1 
ATOM   685  N N   . GLU A 1 103 ? 4.886   41.057 12.784  1.00 45.56 ? 446 GLU A N   1 
ATOM   686  C CA  . GLU A 1 103 ? 5.205   40.386 14.035  1.00 46.41 ? 446 GLU A CA  1 
ATOM   687  C C   . GLU A 1 103 ? 6.349   41.066 14.749  1.00 46.69 ? 446 GLU A C   1 
ATOM   688  O O   . GLU A 1 103 ? 7.388   41.304 14.134  1.00 46.33 ? 446 GLU A O   1 
ATOM   689  C CB  . GLU A 1 103 ? 5.618   38.936 13.772  1.00 46.40 ? 446 GLU A CB  1 
ATOM   690  C CG  . GLU A 1 103 ? 4.507   37.934 13.914  1.00 47.43 ? 446 GLU A CG  1 
ATOM   691  C CD  . GLU A 1 103 ? 4.183   37.574 15.354  1.00 49.22 ? 446 GLU A CD  1 
ATOM   692  O OE1 . GLU A 1 103 ? 3.259   36.738 15.536  1.00 50.54 ? 446 GLU A OE1 1 
ATOM   693  O OE2 . GLU A 1 103 ? 4.833   38.108 16.295  1.00 49.80 ? 446 GLU A OE2 1 
ATOM   694  N N   . THR A 1 104 ? 6.171   41.340 16.044  1.00 47.28 ? 447 THR A N   1 
ATOM   695  C CA  . THR A 1 104 ? 7.204   42.040 16.829  1.00 48.10 ? 447 THR A CA  1 
ATOM   696  C C   . THR A 1 104 ? 7.757   41.264 18.030  1.00 48.43 ? 447 THR A C   1 
ATOM   697  O O   . THR A 1 104 ? 8.771   41.660 18.590  1.00 48.58 ? 447 THR A O   1 
ATOM   698  C CB  . THR A 1 104 ? 6.723   43.449 17.329  1.00 48.37 ? 447 THR A CB  1 
ATOM   699  O OG1 . THR A 1 104 ? 5.806   43.298 18.422  1.00 46.90 ? 447 THR A OG1 1 
ATOM   700  C CG2 . THR A 1 104 ? 6.065   44.249 16.200  1.00 48.86 ? 447 THR A CG2 1 
ATOM   701  N N   . THR A 1 105 ? 7.100   40.170 18.422  1.00 49.04 ? 448 THR A N   1 
ATOM   702  C CA  . THR A 1 105 ? 7.432   39.469 19.674  1.00 49.08 ? 448 THR A CA  1 
ATOM   703  C C   . THR A 1 105 ? 8.172   38.163 19.433  1.00 49.26 ? 448 THR A C   1 
ATOM   704  O O   . THR A 1 105 ? 8.395   37.397 20.360  1.00 48.54 ? 448 THR A O   1 
ATOM   705  C CB  . THR A 1 105 ? 6.177   39.157 20.527  1.00 49.24 ? 448 THR A CB  1 
ATOM   706  O OG1 . THR A 1 105 ? 5.598   37.907 20.112  1.00 50.40 ? 448 THR A OG1 1 
ATOM   707  C CG2 . THR A 1 105 ? 5.146   40.260 20.425  1.00 49.10 ? 448 THR A CG2 1 
ATOM   708  N N   . ILE A 1 106 ? 8.546   37.930 18.179  1.00 50.11 ? 449 ILE A N   1 
ATOM   709  C CA  . ILE A 1 106 ? 9.132   36.673 17.726  1.00 50.79 ? 449 ILE A CA  1 
ATOM   710  C C   . ILE A 1 106 ? 10.656  36.769 17.530  1.00 51.25 ? 449 ILE A C   1 
ATOM   711  O O   . ILE A 1 106 ? 11.130  37.545 16.686  1.00 51.63 ? 449 ILE A O   1 
ATOM   712  C CB  . ILE A 1 106 ? 8.406   36.185 16.435  1.00 50.52 ? 449 ILE A CB  1 
ATOM   713  C CG1 . ILE A 1 106 ? 7.114   35.457 16.820  1.00 51.33 ? 449 ILE A CG1 1 
ATOM   714  C CG2 . ILE A 1 106 ? 9.284   35.272 15.581  1.00 51.67 ? 449 ILE A CG2 1 
ATOM   715  C CD1 . ILE A 1 106 ? 6.323   34.915 15.639  1.00 50.69 ? 449 ILE A CD1 1 
ATOM   716  N N   . GLU A 1 107 ? 11.416  35.990 18.316  1.00 51.45 ? 450 GLU A N   1 
ATOM   717  C CA  . GLU A 1 107 ? 12.882  35.870 18.128  1.00 51.48 ? 450 GLU A CA  1 
ATOM   718  C C   . GLU A 1 107 ? 13.147  35.184 16.792  1.00 50.79 ? 450 GLU A C   1 
ATOM   719  O O   . GLU A 1 107 ? 13.588  35.824 15.840  1.00 51.03 ? 450 GLU A O   1 
ATOM   720  C CB  . GLU A 1 107 ? 13.542  35.099 19.281  1.00 51.22 ? 450 GLU A CB  1 
ATOM   721  C CG  . GLU A 1 107 ? 15.069  35.289 19.416  1.00 52.86 ? 450 GLU A CG  1 
ATOM   722  C CD  . GLU A 1 107 ? 15.727  34.272 20.371  1.00 53.44 ? 450 GLU A CD  1 
ATOM   723  O OE1 . GLU A 1 107 ? 15.749  33.058 20.046  1.00 55.60 ? 450 GLU A OE1 1 
ATOM   724  O OE2 . GLU A 1 107 ? 16.224  34.682 21.450  1.00 55.06 ? 450 GLU A OE2 1 
ATOM   725  N N   . ASN A 1 108 ? 12.848  33.887 16.724  1.00 50.13 ? 451 ASN A N   1 
ATOM   726  C CA  . ASN A 1 108 ? 12.947  33.100 15.488  1.00 49.03 ? 451 ASN A CA  1 
ATOM   727  C C   . ASN A 1 108 ? 11.768  32.151 15.339  1.00 47.69 ? 451 ASN A C   1 
ATOM   728  O O   . ASN A 1 108 ? 10.988  32.009 16.274  1.00 47.23 ? 451 ASN A O   1 
ATOM   729  C CB  . ASN A 1 108 ? 14.237  32.289 15.457  1.00 49.27 ? 451 ASN A CB  1 
ATOM   730  C CG  . ASN A 1 108 ? 15.318  32.968 14.664  1.00 51.77 ? 451 ASN A CG  1 
ATOM   731  O OD1 . ASN A 1 108 ? 15.702  32.499 13.589  1.00 52.58 ? 451 ASN A OD1 1 
ATOM   732  N ND2 . ASN A 1 108 ? 15.809  34.095 15.176  1.00 52.36 ? 451 ASN A ND2 1 
ATOM   733  N N   . PHE A 1 109 ? 11.652  31.523 14.163  1.00 45.96 ? 452 PHE A N   1 
ATOM   734  C CA  . PHE A 1 109 ? 10.621  30.519 13.889  1.00 45.15 ? 452 PHE A CA  1 
ATOM   735  C C   . PHE A 1 109 ? 10.926  29.746 12.625  1.00 44.46 ? 452 PHE A C   1 
ATOM   736  O O   . PHE A 1 109 ? 11.665  30.215 11.763  1.00 45.06 ? 452 PHE A O   1 
ATOM   737  C CB  . PHE A 1 109 ? 9.193   31.134 13.781  1.00 45.24 ? 452 PHE A CB  1 
ATOM   738  C CG  . PHE A 1 109 ? 8.878   31.764 12.441  1.00 44.46 ? 452 PHE A CG  1 
ATOM   739  C CD1 . PHE A 1 109 ? 9.099   33.124 12.229  1.00 45.72 ? 452 PHE A CD1 1 
ATOM   740  C CD2 . PHE A 1 109 ? 8.342   31.007 11.409  1.00 44.98 ? 452 PHE A CD2 1 
ATOM   741  C CE1 . PHE A 1 109 ? 8.802   33.714 10.989  1.00 46.59 ? 452 PHE A CE1 1 
ATOM   742  C CE2 . PHE A 1 109 ? 8.035   31.579 10.173  1.00 46.18 ? 452 PHE A CE2 1 
ATOM   743  C CZ  . PHE A 1 109 ? 8.257   32.939 9.963   1.00 45.97 ? 452 PHE A CZ  1 
ATOM   744  N N   . HIS A 1 110 ? 10.324  28.577 12.488  1.00 43.00 ? 453 HIS A N   1 
ATOM   745  C CA  . HIS A 1 110 ? 10.385  27.894 11.214  1.00 42.30 ? 453 HIS A CA  1 
ATOM   746  C C   . HIS A 1 110 ? 9.222   26.931 11.078  1.00 41.13 ? 453 HIS A C   1 
ATOM   747  O O   . HIS A 1 110 ? 8.644   26.528 12.065  1.00 41.29 ? 453 HIS A O   1 
ATOM   748  C CB  . HIS A 1 110 ? 11.745  27.185 11.035  1.00 42.42 ? 453 HIS A CB  1 
ATOM   749  C CG  . HIS A 1 110 ? 11.942  26.006 11.943  1.00 41.97 ? 453 HIS A CG  1 
ATOM   750  N ND1 . HIS A 1 110 ? 12.454  26.124 13.217  1.00 40.58 ? 453 HIS A ND1 1 
ATOM   751  C CD2 . HIS A 1 110 ? 11.697  24.687 11.753  1.00 40.69 ? 453 HIS A CD2 1 
ATOM   752  C CE1 . HIS A 1 110 ? 12.508  24.930 13.776  1.00 41.39 ? 453 HIS A CE1 1 
ATOM   753  N NE2 . HIS A 1 110 ? 12.049  24.042 12.911  1.00 42.46 ? 453 HIS A NE2 1 
ATOM   754  N N   . VAL A 1 111 ? 8.896   26.588 9.839   1.00 40.77 ? 454 VAL A N   1 
ATOM   755  C CA  . VAL A 1 111 ? 7.900   25.601 9.499   1.00 39.79 ? 454 VAL A CA  1 
ATOM   756  C C   . VAL A 1 111 ? 8.519   24.190 9.638   1.00 40.25 ? 454 VAL A C   1 
ATOM   757  O O   . VAL A 1 111 ? 9.429   23.794 8.887   1.00 40.03 ? 454 VAL A O   1 
ATOM   758  C CB  . VAL A 1 111 ? 7.352   25.863 8.070   1.00 40.09 ? 454 VAL A CB  1 
ATOM   759  C CG1 . VAL A 1 111 ? 6.378   24.762 7.629   1.00 39.85 ? 454 VAL A CG1 1 
ATOM   760  C CG2 . VAL A 1 111 ? 6.696   27.236 7.990   1.00 37.82 ? 454 VAL A CG2 1 
ATOM   761  N N   . VAL A 1 112 ? 8.016   23.454 10.633  1.00 39.37 ? 455 VAL A N   1 
ATOM   762  C CA  . VAL A 1 112 ? 8.500   22.132 10.994  1.00 38.57 ? 455 VAL A CA  1 
ATOM   763  C C   . VAL A 1 112 ? 7.970   21.068 10.024  1.00 38.16 ? 455 VAL A C   1 
ATOM   764  O O   . VAL A 1 112 ? 8.648   20.071 9.719   1.00 37.52 ? 455 VAL A O   1 
ATOM   765  C CB  . VAL A 1 112 ? 8.087   21.819 12.442  1.00 39.31 ? 455 VAL A CB  1 
ATOM   766  C CG1 . VAL A 1 112 ? 8.044   20.316 12.715  1.00 39.56 ? 455 VAL A CG1 1 
ATOM   767  C CG2 . VAL A 1 112 ? 9.016   22.517 13.406  1.00 38.83 ? 455 VAL A CG2 1 
ATOM   768  N N   . GLU A 1 113 ? 6.765   21.293 9.512   1.00 37.08 ? 456 GLU A N   1 
ATOM   769  C CA  . GLU A 1 113 ? 6.195   20.372 8.578   1.00 35.91 ? 456 GLU A CA  1 
ATOM   770  C C   . GLU A 1 113 ? 5.045   21.029 7.884   1.00 35.80 ? 456 GLU A C   1 
ATOM   771  O O   . GLU A 1 113 ? 4.330   21.836 8.472   1.00 36.91 ? 456 GLU A O   1 
ATOM   772  C CB  . GLU A 1 113 ? 5.719   19.116 9.312   1.00 36.06 ? 456 GLU A CB  1 
ATOM   773  C CG  . GLU A 1 113 ? 4.932   18.108 8.460   1.00 34.74 ? 456 GLU A CG  1 
ATOM   774  C CD  . GLU A 1 113 ? 4.444   16.926 9.271   1.00 34.82 ? 456 GLU A CD  1 
ATOM   775  O OE1 . GLU A 1 113 ? 4.826   16.832 10.444  1.00 32.19 ? 456 GLU A OE1 1 
ATOM   776  O OE2 . GLU A 1 113 ? 3.659   16.100 8.746   1.00 34.10 ? 456 GLU A OE2 1 
ATOM   777  N N   . THR A 1 114 ? 4.856   20.670 6.626   1.00 35.15 ? 457 THR A N   1 
ATOM   778  C CA  . THR A 1 114 ? 3.660   21.073 5.912   1.00 34.34 ? 457 THR A CA  1 
ATOM   779  C C   . THR A 1 114 ? 2.740   19.870 5.865   1.00 34.06 ? 457 THR A C   1 
ATOM   780  O O   . THR A 1 114 ? 3.118   18.809 5.349   1.00 33.51 ? 457 THR A O   1 
ATOM   781  C CB  . THR A 1 114 ? 4.014   21.640 4.505   1.00 34.45 ? 457 THR A CB  1 
ATOM   782  O OG1 . THR A 1 114 ? 4.658   22.907 4.668   1.00 35.49 ? 457 THR A OG1 1 
ATOM   783  C CG2 . THR A 1 114 ? 2.785   21.815 3.628   1.00 33.17 ? 457 THR A CG2 1 
ATOM   784  N N   . LEU A 1 115 ? 1.545   20.048 6.421   1.00 33.67 ? 458 LEU A N   1 
ATOM   785  C CA  . LEU A 1 115 ? 0.532   19.011 6.497   1.00 33.46 ? 458 LEU A CA  1 
ATOM   786  C C   . LEU A 1 115 ? -0.405  19.113 5.318   1.00 33.61 ? 458 LEU A C   1 
ATOM   787  O O   . LEU A 1 115 ? -0.979  18.115 4.877   1.00 32.99 ? 458 LEU A O   1 
ATOM   788  C CB  . LEU A 1 115 ? -0.297  19.196 7.771   1.00 33.07 ? 458 LEU A CB  1 
ATOM   789  C CG  . LEU A 1 115 ? 0.352   18.822 9.107   1.00 33.90 ? 458 LEU A CG  1 
ATOM   790  C CD1 . LEU A 1 115 ? -0.337  19.567 10.223  1.00 29.85 ? 458 LEU A CD1 1 
ATOM   791  C CD2 . LEU A 1 115 ? 0.250   17.276 9.320   1.00 33.79 ? 458 LEU A CD2 1 
ATOM   792  N N   . ALA A 1 116 ? -0.617  20.348 4.853   1.00 33.75 ? 459 ALA A N   1 
ATOM   793  C CA  . ALA A 1 116 ? -1.476  20.609 3.691   1.00 33.06 ? 459 ALA A CA  1 
ATOM   794  C C   . ALA A 1 116 ? -1.254  22.029 3.198   1.00 33.94 ? 459 ALA A C   1 
ATOM   795  O O   . ALA A 1 116 ? -0.432  22.802 3.756   1.00 34.34 ? 459 ALA A O   1 
ATOM   796  C CB  . ALA A 1 116 ? -2.956  20.361 4.019   1.00 32.58 ? 459 ALA A CB  1 
ATOM   797  N N   . ASP A 1 117 ? -1.968  22.385 2.135   1.00 34.54 ? 460 ASP A N   1 
ATOM   798  C CA  . ASP A 1 117 ? -1.794  23.703 1.537   1.00 35.33 ? 460 ASP A CA  1 
ATOM   799  C C   . ASP A 1 117 ? -2.195  24.796 2.545   1.00 34.53 ? 460 ASP A C   1 
ATOM   800  O O   . ASP A 1 117 ? -1.592  25.849 2.587   1.00 35.52 ? 460 ASP A O   1 
ATOM   801  C CB  . ASP A 1 117 ? -2.622  23.802 0.256   1.00 35.58 ? 460 ASP A CB  1 
ATOM   802  C CG  . ASP A 1 117 ? -2.030  22.971 -0.910  1.00 39.42 ? 460 ASP A CG  1 
ATOM   803  O OD1 . ASP A 1 117 ? -0.857  22.518 -0.861  1.00 40.98 ? 460 ASP A OD1 1 
ATOM   804  O OD2 . ASP A 1 117 ? -2.754  22.786 -1.908  1.00 42.69 ? 460 ASP A OD2 1 
ATOM   805  N N   . ASN A 1 118 ? -3.213  24.505 3.351   1.00 34.16 ? 461 ASN A N   1 
ATOM   806  C CA  . ASN A 1 118 ? -3.755  25.404 4.363   1.00 33.05 ? 461 ASN A CA  1 
ATOM   807  C C   . ASN A 1 118 ? -3.339  25.045 5.818   1.00 32.56 ? 461 ASN A C   1 
ATOM   808  O O   . ASN A 1 118 ? -3.934  25.555 6.742   1.00 31.28 ? 461 ASN A O   1 
ATOM   809  C CB  . ASN A 1 118 ? -5.284  25.415 4.257   1.00 32.17 ? 461 ASN A CB  1 
ATOM   810  C CG  . ASN A 1 118 ? -5.906  24.108 4.695   1.00 33.58 ? 461 ASN A CG  1 
ATOM   811  O OD1 . ASN A 1 118 ? -5.293  23.054 4.572   1.00 36.81 ? 461 ASN A OD1 1 
ATOM   812  N ND2 . ASN A 1 118 ? -7.125  24.164 5.205   1.00 30.52 ? 461 ASN A ND2 1 
ATOM   813  N N   . ALA A 1 119 ? -2.333  24.177 6.003   1.00 32.36 ? 462 ALA A N   1 
ATOM   814  C CA  . ALA A 1 119 ? -1.973  23.663 7.357   1.00 31.26 ? 462 ALA A CA  1 
ATOM   815  C C   . ALA A 1 119 ? -0.496  23.336 7.505   1.00 31.13 ? 462 ALA A C   1 
ATOM   816  O O   . ALA A 1 119 ? 0.073   22.551 6.737   1.00 30.53 ? 462 ALA A O   1 
ATOM   817  C CB  . ALA A 1 119 ? -2.838  22.445 7.745   1.00 30.66 ? 462 ALA A CB  1 
ATOM   818  N N   . ILE A 1 120 ? 0.112   23.978 8.499   1.00 30.64 ? 463 ILE A N   1 
ATOM   819  C CA  . ILE A 1 120 ? 1.536   23.875 8.790   1.00 30.17 ? 463 ILE A CA  1 
ATOM   820  C C   . ILE A 1 120 ? 1.755   23.770 10.305  1.00 30.54 ? 463 ILE A C   1 
ATOM   821  O O   . ILE A 1 120 ? 0.881   24.142 11.095  1.00 30.33 ? 463 ILE A O   1 
ATOM   822  C CB  . ILE A 1 120 ? 2.335   25.092 8.235   1.00 30.07 ? 463 ILE A CB  1 
ATOM   823  C CG1 . ILE A 1 120 ? 1.759   26.419 8.758   1.00 28.90 ? 463 ILE A CG1 1 
ATOM   824  C CG2 . ILE A 1 120 ? 2.397   25.060 6.636   1.00 29.81 ? 463 ILE A CG2 1 
ATOM   825  C CD1 . ILE A 1 120 ? 2.577   27.655 8.322   1.00 28.49 ? 463 ILE A CD1 1 
ATOM   826  N N   . ILE A 1 121 ? 2.917   23.247 10.693  1.00 30.31 ? 464 ILE A N   1 
ATOM   827  C CA  . ILE A 1 121 ? 3.340   23.207 12.088  1.00 30.31 ? 464 ILE A CA  1 
ATOM   828  C C   . ILE A 1 121 ? 4.557   24.121 12.226  1.00 31.04 ? 464 ILE A C   1 
ATOM   829  O O   . ILE A 1 121 ? 5.529   23.977 11.502  1.00 31.15 ? 464 ILE A O   1 
ATOM   830  C CB  . ILE A 1 121 ? 3.660   21.744 12.544  1.00 30.52 ? 464 ILE A CB  1 
ATOM   831  C CG1 . ILE A 1 121 ? 2.404   20.858 12.377  1.00 28.51 ? 464 ILE A CG1 1 
ATOM   832  C CG2 . ILE A 1 121 ? 4.256   21.712 13.983  1.00 29.47 ? 464 ILE A CG2 1 
ATOM   833  C CD1 . ILE A 1 121 ? 2.636   19.396 12.649  1.00 29.84 ? 464 ILE A CD1 1 
ATOM   834  N N   . ILE A 1 122 ? 4.487   25.056 13.159  1.00 32.31 ? 465 ILE A N   1 
ATOM   835  C CA  . ILE A 1 122 ? 5.485   26.104 13.279  1.00 33.33 ? 465 ILE A CA  1 
ATOM   836  C C   . ILE A 1 122 ? 6.160   25.998 14.638  1.00 34.75 ? 465 ILE A C   1 
ATOM   837  O O   . ILE A 1 122 ? 5.497   25.918 15.681  1.00 35.27 ? 465 ILE A O   1 
ATOM   838  C CB  . ILE A 1 122 ? 4.845   27.512 13.145  1.00 32.16 ? 465 ILE A CB  1 
ATOM   839  C CG1 . ILE A 1 122 ? 4.225   27.700 11.765  1.00 33.00 ? 465 ILE A CG1 1 
ATOM   840  C CG2 . ILE A 1 122 ? 5.878   28.635 13.379  1.00 32.93 ? 465 ILE A CG2 1 
ATOM   841  C CD1 . ILE A 1 122 ? 3.268   28.874 11.698  1.00 27.08 ? 465 ILE A CD1 1 
ATOM   842  N N   . TYR A 1 123 ? 7.478   26.000 14.626  1.00 36.01 ? 466 TYR A N   1 
ATOM   843  C CA  . TYR A 1 123 ? 8.195   26.163 15.858  1.00 37.80 ? 466 TYR A CA  1 
ATOM   844  C C   . TYR A 1 123 ? 8.671   27.607 15.945  1.00 38.44 ? 466 TYR A C   1 
ATOM   845  O O   . TYR A 1 123 ? 9.154   28.161 14.972  1.00 38.48 ? 466 TYR A O   1 
ATOM   846  C CB  . TYR A 1 123 ? 9.364   25.166 15.969  1.00 38.21 ? 466 TYR A CB  1 
ATOM   847  C CG  . TYR A 1 123 ? 10.179  25.418 17.210  1.00 39.12 ? 466 TYR A CG  1 
ATOM   848  C CD1 . TYR A 1 123 ? 9.789   24.889 18.428  1.00 39.52 ? 466 TYR A CD1 1 
ATOM   849  C CD2 . TYR A 1 123 ? 11.309  26.237 17.170  1.00 40.17 ? 466 TYR A CD2 1 
ATOM   850  C CE1 . TYR A 1 123 ? 10.508  25.133 19.568  1.00 41.32 ? 466 TYR A CE1 1 
ATOM   851  C CE2 . TYR A 1 123 ? 12.046  26.496 18.320  1.00 41.79 ? 466 TYR A CE2 1 
ATOM   852  C CZ  . TYR A 1 123 ? 11.631  25.936 19.510  1.00 40.84 ? 466 TYR A CZ  1 
ATOM   853  O OH  . TYR A 1 123 ? 12.322  26.176 20.656  1.00 41.85 ? 466 TYR A OH  1 
ATOM   854  N N   . GLN A 1 124 ? 8.533   28.217 17.112  1.00 39.46 ? 467 GLN A N   1 
ATOM   855  C CA  . GLN A 1 124 ? 9.032   29.563 17.285  1.00 41.09 ? 467 GLN A CA  1 
ATOM   856  C C   . GLN A 1 124 ? 9.478   29.862 18.709  1.00 42.82 ? 467 GLN A C   1 
ATOM   857  O O   . GLN A 1 124 ? 8.952   29.341 19.698  1.00 41.78 ? 467 GLN A O   1 
ATOM   858  C CB  . GLN A 1 124 ? 8.002   30.626 16.812  1.00 40.78 ? 467 GLN A CB  1 
ATOM   859  C CG  . GLN A 1 124 ? 6.826   30.847 17.733  1.00 40.92 ? 467 GLN A CG  1 
ATOM   860  C CD  . GLN A 1 124 ? 5.697   31.696 17.123  1.00 40.94 ? 467 GLN A CD  1 
ATOM   861  O OE1 . GLN A 1 124 ? 5.500   31.732 15.915  1.00 41.05 ? 467 GLN A OE1 1 
ATOM   862  N NE2 . GLN A 1 124 ? 4.938   32.334 17.972  1.00 36.73 ? 467 GLN A NE2 1 
ATOM   863  N N   . THR A 1 125 ? 10.441  30.759 18.786  1.00 45.55 ? 468 THR A N   1 
ATOM   864  C CA  . THR A 1 125 ? 10.853  31.320 20.044  1.00 48.26 ? 468 THR A CA  1 
ATOM   865  C C   . THR A 1 125 ? 10.457  32.781 20.096  1.00 49.54 ? 468 THR A C   1 
ATOM   866  O O   . THR A 1 125 ? 10.454  33.477 19.078  1.00 49.22 ? 468 THR A O   1 
ATOM   867  C CB  . THR A 1 125 ? 12.358  31.212 20.234  1.00 48.13 ? 468 THR A CB  1 
ATOM   868  O OG1 . THR A 1 125 ? 12.770  29.875 19.936  1.00 49.50 ? 468 THR A OG1 1 
ATOM   869  C CG2 . THR A 1 125 ? 12.694  31.511 21.670  1.00 48.86 ? 468 THR A CG2 1 
ATOM   870  N N   . HIS A 1 126 ? 10.136  33.228 21.302  1.00 51.85 ? 469 HIS A N   1 
ATOM   871  C CA  . HIS A 1 126 ? 9.751   34.603 21.525  1.00 54.35 ? 469 HIS A CA  1 
ATOM   872  C C   . HIS A 1 126 ? 10.868  35.420 22.159  1.00 56.03 ? 469 HIS A C   1 
ATOM   873  O O   . HIS A 1 126 ? 11.823  34.872 22.719  1.00 55.90 ? 469 HIS A O   1 
ATOM   874  C CB  . HIS A 1 126 ? 8.484   34.662 22.375  1.00 54.29 ? 469 HIS A CB  1 
ATOM   875  C CG  . HIS A 1 126 ? 7.267   34.171 21.662  1.00 54.41 ? 469 HIS A CG  1 
ATOM   876  N ND1 . HIS A 1 126 ? 6.596   34.931 20.726  1.00 54.86 ? 469 HIS A ND1 1 
ATOM   877  C CD2 . HIS A 1 126 ? 6.608   32.993 21.735  1.00 53.62 ? 469 HIS A CD2 1 
ATOM   878  C CE1 . HIS A 1 126 ? 5.572   34.241 20.256  1.00 54.45 ? 469 HIS A CE1 1 
ATOM   879  N NE2 . HIS A 1 126 ? 5.559   33.061 20.850  1.00 53.95 ? 469 HIS A NE2 1 
ATOM   880  N N   . LYS A 1 127 ? 10.736  36.737 22.045  1.00 58.29 ? 470 LYS A N   1 
ATOM   881  C CA  . LYS A 1 127 ? 11.652  37.662 22.695  1.00 60.88 ? 470 LYS A CA  1 
ATOM   882  C C   . LYS A 1 127 ? 11.437  37.626 24.209  1.00 62.80 ? 470 LYS A C   1 
ATOM   883  O O   . LYS A 1 127 ? 10.367  37.223 24.684  1.00 63.04 ? 470 LYS A O   1 
ATOM   884  C CB  . LYS A 1 127 ? 11.467  39.086 22.159  1.00 60.58 ? 470 LYS A CB  1 
ATOM   885  C CG  . LYS A 1 127 ? 11.810  39.238 20.702  1.00 59.77 ? 470 LYS A CG  1 
ATOM   886  C CD  . LYS A 1 127 ? 11.637  40.669 20.244  1.00 58.55 ? 470 LYS A CD  1 
ATOM   887  C CE  . LYS A 1 127 ? 11.896  40.802 18.749  1.00 57.41 ? 470 LYS A CE  1 
ATOM   888  N NZ  . LYS A 1 127 ? 13.048  39.975 18.322  1.00 56.99 ? 470 LYS A NZ  1 
ATOM   889  N N   . ARG A 1 128 ? 12.453  38.056 24.955  1.00 65.10 ? 471 ARG A N   1 
ATOM   890  C CA  . ARG A 1 128 ? 12.441  37.910 26.405  1.00 67.26 ? 471 ARG A CA  1 
ATOM   891  C C   . ARG A 1 128 ? 11.581  38.968 27.081  1.00 68.21 ? 471 ARG A C   1 
ATOM   892  O O   . ARG A 1 128 ? 11.911  40.157 27.089  1.00 68.97 ? 471 ARG A O   1 
ATOM   893  C CB  . ARG A 1 128 ? 13.863  37.872 26.976  1.00 67.39 ? 471 ARG A CB  1 
ATOM   894  C CG  . ARG A 1 128 ? 13.996  36.945 28.178  1.00 69.39 ? 471 ARG A CG  1 
ATOM   895  C CD  . ARG A 1 128 ? 15.354  36.234 28.258  1.00 72.28 ? 471 ARG A CD  1 
ATOM   896  N NE  . ARG A 1 128 ? 15.547  35.261 27.176  1.00 74.25 ? 471 ARG A NE  1 
ATOM   897  C CZ  . ARG A 1 128 ? 16.501  35.345 26.244  1.00 75.46 ? 471 ARG A CZ  1 
ATOM   898  N NH1 . ARG A 1 128 ? 17.371  36.353 26.261  1.00 74.99 ? 471 ARG A NH1 1 
ATOM   899  N NH2 . ARG A 1 128 ? 16.597  34.413 25.296  1.00 75.17 ? 471 ARG A NH2 1 
ATOM   900  N N   . VAL A 1 129 ? 10.451  38.521 27.615  1.00 69.27 ? 472 VAL A N   1 
ATOM   901  C CA  . VAL A 1 129 ? 9.596   39.364 28.432  1.00 70.05 ? 472 VAL A CA  1 
ATOM   902  C C   . VAL A 1 129 ? 9.881   39.014 29.897  1.00 70.92 ? 472 VAL A C   1 
ATOM   903  O O   . VAL A 1 129 ? 9.570   37.910 30.370  1.00 70.91 ? 472 VAL A O   1 
ATOM   904  C CB  . VAL A 1 129 ? 8.085   39.206 28.068  1.00 69.97 ? 472 VAL A CB  1 
ATOM   905  C CG1 . VAL A 1 129 ? 7.194   39.894 29.105  1.00 69.73 ? 472 VAL A CG1 1 
ATOM   906  C CG2 . VAL A 1 129 ? 7.796   39.740 26.659  1.00 69.07 ? 472 VAL A CG2 1 
ATOM   907  N N   . TRP A 1 130 ? 10.514  39.960 30.586  1.00 71.81 ? 473 TRP A N   1 
ATOM   908  C CA  . TRP A 1 130 ? 10.826  39.853 32.012  1.00 72.78 ? 473 TRP A CA  1 
ATOM   909  C C   . TRP A 1 130 ? 9.520   39.744 32.823  1.00 72.59 ? 473 TRP A C   1 
ATOM   910  O O   . TRP A 1 130 ? 8.501   40.337 32.435  1.00 72.19 ? 473 TRP A O   1 
ATOM   911  C CB  . TRP A 1 130 ? 11.634  41.077 32.481  1.00 73.71 ? 473 TRP A CB  1 
ATOM   912  C CG  . TRP A 1 130 ? 12.530  41.728 31.424  1.00 75.06 ? 473 TRP A CG  1 
ATOM   913  C CD1 . TRP A 1 130 ? 12.247  41.916 30.080  1.00 76.16 ? 473 TRP A CD1 1 
ATOM   914  C CD2 . TRP A 1 130 ? 13.824  42.316 31.639  1.00 76.41 ? 473 TRP A CD2 1 
ATOM   915  N NE1 . TRP A 1 130 ? 13.298  42.558 29.454  1.00 76.56 ? 473 TRP A NE1 1 
ATOM   916  C CE2 . TRP A 1 130 ? 14.275  42.820 30.382  1.00 76.66 ? 473 TRP A CE2 1 
ATOM   917  C CE3 . TRP A 1 130 ? 14.650  42.463 32.764  1.00 76.05 ? 473 TRP A CE3 1 
ATOM   918  C CZ2 . TRP A 1 130 ? 15.517  43.460 30.227  1.00 75.80 ? 473 TRP A CZ2 1 
ATOM   919  C CZ3 . TRP A 1 130 ? 15.886  43.106 32.606  1.00 75.88 ? 473 TRP A CZ3 1 
ATOM   920  C CH2 . TRP A 1 130 ? 16.302  43.594 31.345  1.00 75.36 ? 473 TRP A CH2 1 
ATOM   921  N N   . PRO A 1 131 ? 9.537   38.987 33.947  1.00 72.41 ? 474 PRO A N   1 
ATOM   922  C CA  . PRO A 1 131 ? 10.635  38.246 34.572  1.00 71.97 ? 474 PRO A CA  1 
ATOM   923  C C   . PRO A 1 131 ? 10.677  36.771 34.156  1.00 71.60 ? 474 PRO A C   1 
ATOM   924  O O   . PRO A 1 131 ? 10.238  35.901 34.924  1.00 71.81 ? 474 PRO A O   1 
ATOM   925  C CB  . PRO A 1 131 ? 10.293  38.335 36.059  1.00 72.00 ? 474 PRO A CB  1 
ATOM   926  C CG  . PRO A 1 131 ? 8.821   38.564 36.130  1.00 72.41 ? 474 PRO A CG  1 
ATOM   927  C CD  . PRO A 1 131 ? 8.304   38.835 34.735  1.00 72.46 ? 474 PRO A CD  1 
ATOM   928  N N   . ALA A 1 132 ? 11.207  36.494 32.962  1.00 70.67 ? 475 ALA A N   1 
ATOM   929  C CA  . ALA A 1 132 ? 11.197  35.136 32.417  1.00 69.42 ? 475 ALA A CA  1 
ATOM   930  C C   . ALA A 1 132 ? 12.271  34.915 31.364  1.00 68.57 ? 475 ALA A C   1 
ATOM   931  O O   . ALA A 1 132 ? 12.645  35.848 30.637  1.00 68.37 ? 475 ALA A O   1 
ATOM   932  C CB  . ALA A 1 132 ? 9.827   34.823 31.832  1.00 69.72 ? 475 ALA A CB  1 
ATOM   933  N N   . SER A 1 133 ? 12.765  33.676 31.289  1.00 67.20 ? 476 SER A N   1 
ATOM   934  C CA  . SER A 1 133 ? 13.563  33.231 30.142  1.00 65.91 ? 476 SER A CA  1 
ATOM   935  C C   . SER A 1 133 ? 12.598  33.126 28.961  1.00 64.63 ? 476 SER A C   1 
ATOM   936  O O   . SER A 1 133 ? 11.414  33.475 29.094  1.00 64.59 ? 476 SER A O   1 
ATOM   937  C CB  . SER A 1 133 ? 14.291  31.896 30.412  1.00 66.11 ? 476 SER A CB  1 
ATOM   938  O OG  . SER A 1 133 ? 13.393  30.848 30.764  1.00 66.64 ? 476 SER A OG  1 
ATOM   939  N N   . GLN A 1 134 ? 13.078  32.692 27.803  1.00 62.66 ? 477 GLN A N   1 
ATOM   940  C CA  . GLN A 1 134 ? 12.194  32.693 26.655  1.00 60.86 ? 477 GLN A CA  1 
ATOM   941  C C   . GLN A 1 134 ? 11.196  31.559 26.727  1.00 58.88 ? 477 GLN A C   1 
ATOM   942  O O   . GLN A 1 134 ? 11.466  30.499 27.292  1.00 58.47 ? 477 GLN A O   1 
ATOM   943  C CB  . GLN A 1 134 ? 12.947  32.700 25.323  1.00 61.05 ? 477 GLN A CB  1 
ATOM   944  C CG  . GLN A 1 134 ? 14.199  31.847 25.283  1.00 62.15 ? 477 GLN A CG  1 
ATOM   945  C CD  . GLN A 1 134 ? 15.017  32.055 24.017  1.00 61.80 ? 477 GLN A CD  1 
ATOM   946  O OE1 . GLN A 1 134 ? 16.074  31.446 23.844  1.00 64.56 ? 477 GLN A OE1 1 
ATOM   947  N NE2 . GLN A 1 134 ? 14.534  32.921 23.127  1.00 62.06 ? 477 GLN A NE2 1 
ATOM   948  N N   . ARG A 1 135 ? 10.014  31.822 26.184  1.00 56.90 ? 478 ARG A N   1 
ATOM   949  C CA  . ARG A 1 135 ? 9.059   30.769 25.900  1.00 54.11 ? 478 ARG A CA  1 
ATOM   950  C C   . ARG A 1 135 ? 9.294   30.343 24.484  1.00 51.47 ? 478 ARG A C   1 
ATOM   951  O O   . ARG A 1 135 ? 9.534   31.178 23.606  1.00 51.25 ? 478 ARG A O   1 
ATOM   952  C CB  . ARG A 1 135 ? 7.622   31.268 26.045  1.00 54.60 ? 478 ARG A CB  1 
ATOM   953  C CG  . ARG A 1 135 ? 7.030   31.029 27.419  1.00 56.98 ? 478 ARG A CG  1 
ATOM   954  C CD  . ARG A 1 135 ? 7.412   32.135 28.406  1.00 61.15 ? 478 ARG A CD  1 
ATOM   955  N NE  . ARG A 1 135 ? 7.939   31.568 29.645  1.00 63.07 ? 478 ARG A NE  1 
ATOM   956  C CZ  . ARG A 1 135 ? 7.775   32.095 30.853  1.00 65.83 ? 478 ARG A CZ  1 
ATOM   957  N NH1 . ARG A 1 135 ? 7.077   33.220 31.018  1.00 67.74 ? 478 ARG A NH1 1 
ATOM   958  N NH2 . ARG A 1 135 ? 8.306   31.486 31.907  1.00 67.14 ? 478 ARG A NH2 1 
ATOM   959  N N   . ASP A 1 136 ? 9.241   29.043 24.247  1.00 48.06 ? 479 ASP A N   1 
ATOM   960  C CA  . ASP A 1 136 ? 9.008   28.614 22.882  1.00 44.34 ? 479 ASP A CA  1 
ATOM   961  C C   . ASP A 1 136 ? 7.593   28.089 22.746  1.00 41.83 ? 479 ASP A C   1 
ATOM   962  O O   . ASP A 1 136 ? 6.885   27.913 23.722  1.00 40.30 ? 479 ASP A O   1 
ATOM   963  C CB  . ASP A 1 136 ? 10.072  27.650 22.364  1.00 44.04 ? 479 ASP A CB  1 
ATOM   964  C CG  . ASP A 1 136 ? 10.117  26.358 23.124  1.00 44.67 ? 479 ASP A CG  1 
ATOM   965  O OD1 . ASP A 1 136 ? 9.344   26.193 24.084  1.00 43.66 ? 479 ASP A OD1 1 
ATOM   966  O OD2 . ASP A 1 136 ? 10.941  25.490 22.753  1.00 46.81 ? 479 ASP A OD2 1 
ATOM   967  N N   . VAL A 1 137 ? 7.192   27.852 21.511  1.00 39.63 ? 480 VAL A N   1 
ATOM   968  C CA  . VAL A 1 137 ? 5.877   27.353 21.222  1.00 37.39 ? 480 VAL A CA  1 
ATOM   969  C C   . VAL A 1 137 ? 5.995   26.532 19.952  1.00 36.20 ? 480 VAL A C   1 
ATOM   970  O O   . VAL A 1 137 ? 6.856   26.790 19.086  1.00 36.71 ? 480 VAL A O   1 
ATOM   971  C CB  . VAL A 1 137 ? 4.787   28.497 21.195  1.00 37.44 ? 480 VAL A CB  1 
ATOM   972  C CG1 . VAL A 1 137 ? 5.085   29.513 20.122  1.00 37.90 ? 480 VAL A CG1 1 
ATOM   973  C CG2 . VAL A 1 137 ? 3.343   27.944 21.094  1.00 34.90 ? 480 VAL A CG2 1 
ATOM   974  N N   . LEU A 1 138 ? 5.171   25.498 19.904  1.00 33.35 ? 481 LEU A N   1 
ATOM   975  C CA  . LEU A 1 138 ? 5.164   24.539 18.839  1.00 31.90 ? 481 LEU A CA  1 
ATOM   976  C C   . LEU A 1 138 ? 3.672   24.277 18.538  1.00 29.87 ? 481 LEU A C   1 
ATOM   977  O O   . LEU A 1 138 ? 2.947   23.670 19.352  1.00 29.17 ? 481 LEU A O   1 
ATOM   978  C CB  . LEU A 1 138 ? 5.914   23.247 19.276  1.00 31.57 ? 481 LEU A CB  1 
ATOM   979  C CG  . LEU A 1 138 ? 5.768   21.983 18.404  1.00 32.56 ? 481 LEU A CG  1 
ATOM   980  C CD1 . LEU A 1 138 ? 6.401   22.216 17.036  1.00 33.83 ? 481 LEU A CD1 1 
ATOM   981  C CD2 . LEU A 1 138 ? 6.307   20.672 19.058  1.00 31.65 ? 481 LEU A CD2 1 
ATOM   982  N N   . TYR A 1 139 ? 3.219   24.756 17.375  1.00 28.30 ? 482 TYR A N   1 
ATOM   983  C CA  . TYR A 1 139 ? 1.796   24.793 17.065  1.00 27.17 ? 482 TYR A CA  1 
ATOM   984  C C   . TYR A 1 139 ? 1.417   24.487 15.644  1.00 26.95 ? 482 TYR A C   1 
ATOM   985  O O   . TYR A 1 139 ? 2.137   24.779 14.714  1.00 26.99 ? 482 TYR A O   1 
ATOM   986  C CB  . TYR A 1 139 ? 1.157   26.132 17.473  1.00 27.96 ? 482 TYR A CB  1 
ATOM   987  C CG  . TYR A 1 139 ? 1.687   27.358 16.762  1.00 29.07 ? 482 TYR A CG  1 
ATOM   988  C CD1 . TYR A 1 139 ? 0.983   27.962 15.720  1.00 27.67 ? 482 TYR A CD1 1 
ATOM   989  C CD2 . TYR A 1 139 ? 2.891   27.938 17.164  1.00 30.80 ? 482 TYR A CD2 1 
ATOM   990  C CE1 . TYR A 1 139 ? 1.487   29.116 15.093  1.00 27.48 ? 482 TYR A CE1 1 
ATOM   991  C CE2 . TYR A 1 139 ? 3.382   29.054 16.554  1.00 28.16 ? 482 TYR A CE2 1 
ATOM   992  C CZ  . TYR A 1 139 ? 2.688   29.641 15.517  1.00 28.64 ? 482 TYR A CZ  1 
ATOM   993  O OH  . TYR A 1 139 ? 3.242   30.779 14.940  1.00 28.04 ? 482 TYR A OH  1 
ATOM   994  N N   . LEU A 1 140 ? 0.230   23.928 15.502  1.00 27.85 ? 483 LEU A N   1 
ATOM   995  C CA  . LEU A 1 140 ? -0.387  23.757 14.210  1.00 27.52 ? 483 LEU A CA  1 
ATOM   996  C C   . LEU A 1 140 ? -1.149  25.051 13.869  1.00 26.77 ? 483 LEU A C   1 
ATOM   997  O O   . LEU A 1 140 ? -1.936  25.548 14.677  1.00 26.26 ? 483 LEU A O   1 
ATOM   998  C CB  . LEU A 1 140 ? -1.315  22.525 14.216  1.00 27.77 ? 483 LEU A CB  1 
ATOM   999  C CG  . LEU A 1 140 ? -1.933  22.016 12.883  1.00 28.48 ? 483 LEU A CG  1 
ATOM   1000 C CD1 . LEU A 1 140 ? -2.270  20.578 12.986  1.00 28.72 ? 483 LEU A CD1 1 
ATOM   1001 C CD2 . LEU A 1 140 ? -3.206  22.735 12.524  1.00 28.28 ? 483 LEU A CD2 1 
ATOM   1002 N N   . SER A 1 141 ? -0.879  25.579 12.681  1.00 25.73 ? 484 SER A N   1 
ATOM   1003 C CA  . SER A 1 141 ? -1.502  26.786 12.169  1.00 26.48 ? 484 SER A CA  1 
ATOM   1004 C C   . SER A 1 141 ? -2.284  26.473 10.909  1.00 25.97 ? 484 SER A C   1 
ATOM   1005 O O   . SER A 1 141 ? -1.703  26.059 9.911   1.00 25.66 ? 484 SER A O   1 
ATOM   1006 C CB  . SER A 1 141 ? -0.439  27.830 11.826  1.00 26.45 ? 484 SER A CB  1 
ATOM   1007 O OG  . SER A 1 141 ? -1.076  29.025 11.430  1.00 29.03 ? 484 SER A OG  1 
ATOM   1008 N N   . VAL A 1 142 ? -3.603  26.636 10.962  1.00 25.64 ? 485 VAL A N   1 
ATOM   1009 C CA  . VAL A 1 142 ? -4.438  26.287 9.824   1.00 25.31 ? 485 VAL A CA  1 
ATOM   1010 C C   . VAL A 1 142 ? -5.321  27.464 9.439   1.00 25.08 ? 485 VAL A C   1 
ATOM   1011 O O   . VAL A 1 142 ? -5.798  28.203 10.310  1.00 23.41 ? 485 VAL A O   1 
ATOM   1012 C CB  . VAL A 1 142 ? -5.262  24.977 10.097  1.00 25.58 ? 485 VAL A CB  1 
ATOM   1013 C CG1 . VAL A 1 142 ? -6.053  25.100 11.348  1.00 25.14 ? 485 VAL A CG1 1 
ATOM   1014 C CG2 . VAL A 1 142 ? -6.169  24.555 8.889   1.00 25.07 ? 485 VAL A CG2 1 
ATOM   1015 N N   . ILE A 1 143 ? -5.511  27.628 8.130   1.00 24.63 ? 486 ILE A N   1 
ATOM   1016 C CA  . ILE A 1 143 ? -6.439  28.622 7.586   1.00 25.63 ? 486 ILE A CA  1 
ATOM   1017 C C   . ILE A 1 143 ? -7.668  27.946 6.941   1.00 26.14 ? 486 ILE A C   1 
ATOM   1018 O O   . ILE A 1 143 ? -7.521  27.120 6.052   1.00 25.70 ? 486 ILE A O   1 
ATOM   1019 C CB  . ILE A 1 143 ? -5.750  29.653 6.601   1.00 25.43 ? 486 ILE A CB  1 
ATOM   1020 C CG1 . ILE A 1 143 ? -6.804  30.613 6.036   1.00 24.64 ? 486 ILE A CG1 1 
ATOM   1021 C CG2 . ILE A 1 143 ? -4.917  28.919 5.455   1.00 25.24 ? 486 ILE A CG2 1 
ATOM   1022 C CD1 . ILE A 1 143 ? -6.269  31.943 5.584   1.00 25.51 ? 486 ILE A CD1 1 
ATOM   1023 N N   . ARG A 1 144 ? -8.871  28.277 7.401   1.00 26.38 ? 487 ARG A N   1 
ATOM   1024 C CA  . ARG A 1 144 ? -10.071 27.646 6.852   1.00 29.47 ? 487 ARG A CA  1 
ATOM   1025 C C   . ARG A 1 144 ? -11.116 28.672 6.444   1.00 30.52 ? 487 ARG A C   1 
ATOM   1026 O O   . ARG A 1 144 ? -11.231 29.735 7.049   1.00 30.61 ? 487 ARG A O   1 
ATOM   1027 C CB  . ARG A 1 144 ? -10.739 26.638 7.833   1.00 29.72 ? 487 ARG A CB  1 
ATOM   1028 C CG  . ARG A 1 144 ? -9.945  25.348 8.149   1.00 33.25 ? 487 ARG A CG  1 
ATOM   1029 C CD  . ARG A 1 144 ? -10.245 24.146 7.236   1.00 37.03 ? 487 ARG A CD  1 
ATOM   1030 N NE  . ARG A 1 144 ? -11.494 23.467 7.608   1.00 41.66 ? 487 ARG A NE  1 
ATOM   1031 C CZ  . ARG A 1 144 ? -12.660 23.569 6.957   1.00 43.32 ? 487 ARG A CZ  1 
ATOM   1032 N NH1 . ARG A 1 144 ? -13.719 22.906 7.407   1.00 44.01 ? 487 ARG A NH1 1 
ATOM   1033 N NH2 . ARG A 1 144 ? -12.784 24.318 5.852   1.00 44.41 ? 487 ARG A NH2 1 
ATOM   1034 N N   . LYS A 1 145 ? -11.875 28.323 5.411   1.00 31.87 ? 488 LYS A N   1 
ATOM   1035 C CA  . LYS A 1 145 ? -13.115 29.026 5.069   1.00 33.78 ? 488 LYS A CA  1 
ATOM   1036 C C   . LYS A 1 145 ? -14.304 28.166 5.462   1.00 33.82 ? 488 LYS A C   1 
ATOM   1037 O O   . LYS A 1 145 ? -14.414 26.997 5.060   1.00 33.78 ? 488 LYS A O   1 
ATOM   1038 C CB  . LYS A 1 145 ? -13.172 29.436 3.584   1.00 32.71 ? 488 LYS A CB  1 
ATOM   1039 C CG  . LYS A 1 145 ? -14.483 30.144 3.235   1.00 35.16 ? 488 LYS A CG  1 
ATOM   1040 C CD  . LYS A 1 145 ? -14.591 30.620 1.777   1.00 36.94 ? 488 LYS A CD  1 
ATOM   1041 C CE  . LYS A 1 145 ? -14.922 29.503 0.778   1.00 42.61 ? 488 LYS A CE  1 
ATOM   1042 N NZ  . LYS A 1 145 ? -16.076 28.669 1.220   1.00 44.74 ? 488 LYS A NZ  1 
ATOM   1043 N N   . ILE A 1 146 ? -15.156 28.750 6.301   1.00 34.98 ? 489 ILE A N   1 
ATOM   1044 C CA  . ILE A 1 146 ? -16.383 28.136 6.764   1.00 36.01 ? 489 ILE A CA  1 
ATOM   1045 C C   . ILE A 1 146 ? -17.505 28.741 5.889   1.00 37.27 ? 489 ILE A C   1 
ATOM   1046 O O   . ILE A 1 146 ? -17.801 29.948 5.989   1.00 34.94 ? 489 ILE A O   1 
ATOM   1047 C CB  . ILE A 1 146 ? -16.632 28.408 8.299   1.00 35.66 ? 489 ILE A CB  1 
ATOM   1048 C CG1 . ILE A 1 146 ? -15.473 27.909 9.186   1.00 37.12 ? 489 ILE A CG1 1 
ATOM   1049 C CG2 . ILE A 1 146 ? -17.957 27.832 8.754   1.00 35.72 ? 489 ILE A CG2 1 
ATOM   1050 C CD1 . ILE A 1 146 ? -14.727 26.591 8.718   1.00 36.18 ? 489 ILE A CD1 1 
ATOM   1051 N N   . PRO A 1 147 ? -18.088 27.914 4.991   1.00 38.88 ? 490 PRO A N   1 
ATOM   1052 C CA  . PRO A 1 147 ? -19.198 28.361 4.156   1.00 40.25 ? 490 PRO A CA  1 
ATOM   1053 C C   . PRO A 1 147 ? -20.310 28.982 4.983   1.00 41.81 ? 490 PRO A C   1 
ATOM   1054 O O   . PRO A 1 147 ? -20.484 28.632 6.163   1.00 42.12 ? 490 PRO A O   1 
ATOM   1055 C CB  . PRO A 1 147 ? -19.719 27.070 3.502   1.00 40.45 ? 490 PRO A CB  1 
ATOM   1056 C CG  . PRO A 1 147 ? -18.970 25.899 4.155   1.00 40.49 ? 490 PRO A CG  1 
ATOM   1057 C CD  . PRO A 1 147 ? -17.699 26.513 4.711   1.00 39.87 ? 490 PRO A CD  1 
ATOM   1058 N N   . ALA A 1 148 ? -21.051 29.900 4.371   1.00 43.33 ? 491 ALA A N   1 
ATOM   1059 C CA  . ALA A 1 148 ? -22.307 30.377 4.940   1.00 44.91 ? 491 ALA A CA  1 
ATOM   1060 C C   . ALA A 1 148 ? -23.390 29.318 4.731   1.00 46.20 ? 491 ALA A C   1 
ATOM   1061 O O   . ALA A 1 148 ? -23.451 28.685 3.662   1.00 46.60 ? 491 ALA A O   1 
ATOM   1062 C CB  . ALA A 1 148 ? -22.712 31.692 4.290   1.00 44.83 ? 491 ALA A CB  1 
ATOM   1063 N N   . LEU A 1 149 ? -24.226 29.111 5.751   1.00 47.59 ? 492 LEU A N   1 
ATOM   1064 C CA  . LEU A 1 149 ? -25.372 28.190 5.647   1.00 49.16 ? 492 LEU A CA  1 
ATOM   1065 C C   . LEU A 1 149 ? -26.414 28.662 4.616   1.00 49.66 ? 492 LEU A C   1 
ATOM   1066 O O   . LEU A 1 149 ? -27.128 27.851 3.996   1.00 49.42 ? 492 LEU A O   1 
ATOM   1067 C CB  . LEU A 1 149 ? -26.015 27.977 7.026   1.00 49.26 ? 492 LEU A CB  1 
ATOM   1068 C CG  . LEU A 1 149 ? -25.819 26.622 7.741   1.00 50.01 ? 492 LEU A CG  1 
ATOM   1069 C CD1 . LEU A 1 149 ? -24.477 25.926 7.446   1.00 49.13 ? 492 LEU A CD1 1 
ATOM   1070 C CD2 . LEU A 1 149 ? -26.029 26.783 9.240   1.00 49.32 ? 492 LEU A CD2 1 
ATOM   1071 N N   . THR A 1 150 ? -26.497 29.983 4.459   1.00 50.32 ? 493 THR A N   1 
ATOM   1072 C CA  . THR A 1 150 ? -27.273 30.589 3.393   1.00 51.05 ? 493 THR A CA  1 
ATOM   1073 C C   . THR A 1 150 ? -26.539 31.800 2.880   1.00 51.13 ? 493 THR A C   1 
ATOM   1074 O O   . THR A 1 150 ? -25.770 32.431 3.615   1.00 51.02 ? 493 THR A O   1 
ATOM   1075 C CB  . THR A 1 150 ? -28.632 31.106 3.866   1.00 51.23 ? 493 THR A CB  1 
ATOM   1076 O OG1 . THR A 1 150 ? -28.431 32.134 4.849   1.00 52.17 ? 493 THR A OG1 1 
ATOM   1077 C CG2 . THR A 1 150 ? -29.522 29.964 4.411   1.00 52.35 ? 493 THR A CG2 1 
ATOM   1078 N N   . GLU A 1 151 ? -26.834 32.144 1.627   1.00 50.99 ? 494 GLU A N   1 
ATOM   1079 C CA  . GLU A 1 151 ? -26.353 33.369 0.989   1.00 50.83 ? 494 GLU A CA  1 
ATOM   1080 C C   . GLU A 1 151 ? -26.856 34.642 1.690   1.00 50.46 ? 494 GLU A C   1 
ATOM   1081 O O   . GLU A 1 151 ? -26.427 35.744 1.364   1.00 50.21 ? 494 GLU A O   1 
ATOM   1082 C CB  . GLU A 1 151 ? -26.702 33.350 -0.505  1.00 50.82 ? 494 GLU A CB  1 
ATOM   1083 C CG  . GLU A 1 151 ? -26.281 32.034 -1.196  1.00 51.02 ? 494 GLU A CG  1 
ATOM   1084 C CD  . GLU A 1 151 ? -26.039 32.184 -2.683  1.00 51.40 ? 494 GLU A CD  1 
ATOM   1085 O OE1 . GLU A 1 151 ? -27.011 32.230 -3.454  1.00 53.82 ? 494 GLU A OE1 1 
ATOM   1086 O OE2 . GLU A 1 151 ? -24.871 32.235 -3.092  1.00 51.51 ? 494 GLU A OE2 1 
ATOM   1087 N N   . ASN A 1 152 ? -27.757 34.461 2.656   1.00 50.60 ? 495 ASN A N   1 
ATOM   1088 C CA  . ASN A 1 152 ? -28.251 35.526 3.537   1.00 50.68 ? 495 ASN A CA  1 
ATOM   1089 C C   . ASN A 1 152 ? -27.305 35.814 4.715   1.00 50.43 ? 495 ASN A C   1 
ATOM   1090 O O   . ASN A 1 152 ? -27.583 36.689 5.547   1.00 50.68 ? 495 ASN A O   1 
ATOM   1091 C CB  . ASN A 1 152 ? -29.639 35.140 4.085   1.00 50.93 ? 495 ASN A CB  1 
ATOM   1092 C CG  . ASN A 1 152 ? -30.552 34.481 3.020   1.00 51.85 ? 495 ASN A CG  1 
ATOM   1093 O OD1 . ASN A 1 152 ? -30.535 34.849 1.842   1.00 51.84 ? 495 ASN A OD1 1 
ATOM   1094 N ND2 . ASN A 1 152 ? -31.352 33.505 3.451   1.00 51.70 ? 495 ASN A ND2 1 
ATOM   1095 N N   . ASP A 1 153 ? -26.189 35.076 4.769   1.00 50.22 ? 496 ASP A N   1 
ATOM   1096 C CA  . ASP A 1 153 ? -25.253 35.068 5.910   1.00 49.51 ? 496 ASP A CA  1 
ATOM   1097 C C   . ASP A 1 153 ? -23.816 35.322 5.475   1.00 48.38 ? 496 ASP A C   1 
ATOM   1098 O O   . ASP A 1 153 ? -23.465 35.081 4.313   1.00 48.94 ? 496 ASP A O   1 
ATOM   1099 C CB  . ASP A 1 153 ? -25.321 33.718 6.639   1.00 50.08 ? 496 ASP A CB  1 
ATOM   1100 C CG  . ASP A 1 153 ? -26.458 33.651 7.627   1.00 51.85 ? 496 ASP A CG  1 
ATOM   1101 O OD1 . ASP A 1 153 ? -27.268 34.593 7.637   1.00 53.71 ? 496 ASP A OD1 1 
ATOM   1102 O OD2 . ASP A 1 153 ? -26.537 32.670 8.401   1.00 53.33 ? 496 ASP A OD2 1 
ATOM   1103 N N   . PRO A 1 154 ? -22.958 35.792 6.403   1.00 47.21 ? 497 PRO A N   1 
ATOM   1104 C CA  . PRO A 1 154 ? -21.564 35.971 5.966   1.00 45.20 ? 497 PRO A CA  1 
ATOM   1105 C C   . PRO A 1 154 ? -20.834 34.629 5.968   1.00 42.62 ? 497 PRO A C   1 
ATOM   1106 O O   . PRO A 1 154 ? -21.195 33.754 6.758   1.00 42.32 ? 497 PRO A O   1 
ATOM   1107 C CB  . PRO A 1 154 ? -20.975 36.901 7.035   1.00 45.32 ? 497 PRO A CB  1 
ATOM   1108 C CG  . PRO A 1 154 ? -21.796 36.668 8.260   1.00 46.22 ? 497 PRO A CG  1 
ATOM   1109 C CD  . PRO A 1 154 ? -23.153 36.150 7.826   1.00 47.19 ? 497 PRO A CD  1 
ATOM   1110 N N   . GLU A 1 155 ? -19.856 34.460 5.077   1.00 39.75 ? 498 GLU A N   1 
ATOM   1111 C CA  . GLU A 1 155 ? -18.878 33.367 5.214   1.00 38.12 ? 498 GLU A CA  1 
ATOM   1112 C C   . GLU A 1 155 ? -17.849 33.749 6.264   1.00 35.89 ? 498 GLU A C   1 
ATOM   1113 O O   . GLU A 1 155 ? -17.548 34.921 6.457   1.00 33.98 ? 498 GLU A O   1 
ATOM   1114 C CB  . GLU A 1 155 ? -18.126 33.070 3.905   1.00 37.47 ? 498 GLU A CB  1 
ATOM   1115 C CG  . GLU A 1 155 ? -19.037 32.539 2.786   1.00 40.36 ? 498 GLU A CG  1 
ATOM   1116 C CD  . GLU A 1 155 ? -18.272 32.173 1.541   1.00 39.14 ? 498 GLU A CD  1 
ATOM   1117 O OE1 . GLU A 1 155 ? -18.641 31.151 0.934   1.00 39.58 ? 498 GLU A OE1 1 
ATOM   1118 O OE2 . GLU A 1 155 ? -17.297 32.890 1.208   1.00 39.93 ? 498 GLU A OE2 1 
ATOM   1119 N N   . THR A 1 156 ? -17.275 32.745 6.901   1.00 33.96 ? 499 THR A N   1 
ATOM   1120 C CA  . THR A 1 156 ? -16.268 33.016 7.909   1.00 32.97 ? 499 THR A CA  1 
ATOM   1121 C C   . THR A 1 156 ? -14.947 32.486 7.421   1.00 31.34 ? 499 THR A C   1 
ATOM   1122 O O   . THR A 1 156 ? -14.901 31.395 6.864   1.00 32.02 ? 499 THR A O   1 
ATOM   1123 C CB  . THR A 1 156 ? -16.668 32.367 9.242   1.00 32.94 ? 499 THR A CB  1 
ATOM   1124 O OG1 . THR A 1 156 ? -17.964 32.834 9.582   1.00 34.61 ? 499 THR A OG1 1 
ATOM   1125 C CG2 . THR A 1 156 ? -15.695 32.721 10.367  1.00 31.92 ? 499 THR A CG2 1 
ATOM   1126 N N   . TRP A 1 157 ? -13.901 33.287 7.578   1.00 29.83 ? 500 TRP A N   1 
ATOM   1127 C CA  . TRP A 1 157 ? -12.555 32.805 7.519   1.00 28.40 ? 500 TRP A CA  1 
ATOM   1128 C C   . TRP A 1 157 ? -12.017 32.719 8.937   1.00 28.05 ? 500 TRP A C   1 
ATOM   1129 O O   . TRP A 1 157 ? -12.325 33.570 9.772   1.00 28.33 ? 500 TRP A O   1 
ATOM   1130 C CB  . TRP A 1 157 ? -11.697 33.725 6.677   1.00 28.72 ? 500 TRP A CB  1 
ATOM   1131 C CG  . TRP A 1 157 ? -11.968 33.560 5.220   1.00 28.27 ? 500 TRP A CG  1 
ATOM   1132 C CD1 . TRP A 1 157 ? -12.978 34.145 4.497   1.00 28.41 ? 500 TRP A CD1 1 
ATOM   1133 C CD2 . TRP A 1 157 ? -11.242 32.735 4.309   1.00 27.14 ? 500 TRP A CD2 1 
ATOM   1134 N NE1 . TRP A 1 157 ? -12.926 33.728 3.183   1.00 27.52 ? 500 TRP A NE1 1 
ATOM   1135 C CE2 . TRP A 1 157 ? -11.864 32.870 3.037   1.00 26.74 ? 500 TRP A CE2 1 
ATOM   1136 C CE3 . TRP A 1 157 ? -10.121 31.907 4.434   1.00 27.23 ? 500 TRP A CE3 1 
ATOM   1137 C CZ2 . TRP A 1 157 ? -11.402 32.219 1.918   1.00 26.10 ? 500 TRP A CZ2 1 
ATOM   1138 C CZ3 . TRP A 1 157 ? -9.662  31.232 3.313   1.00 28.37 ? 500 TRP A CZ3 1 
ATOM   1139 C CH2 . TRP A 1 157 ? -10.308 31.383 2.070   1.00 30.25 ? 500 TRP A CH2 1 
ATOM   1140 N N   . ILE A 1 158 ? -11.220 31.690 9.200   1.00 27.23 ? 501 ILE A N   1 
ATOM   1141 C CA  . ILE A 1 158 ? -10.614 31.468 10.506  1.00 26.14 ? 501 ILE A CA  1 
ATOM   1142 C C   . ILE A 1 158 ? -9.181  30.925 10.343  1.00 26.41 ? 501 ILE A C   1 
ATOM   1143 O O   . ILE A 1 158 ? -8.927  30.058 9.496   1.00 26.69 ? 501 ILE A O   1 
ATOM   1144 C CB  . ILE A 1 158 ? -11.501 30.551 11.364  1.00 26.39 ? 501 ILE A CB  1 
ATOM   1145 C CG1 . ILE A 1 158 ? -10.902 30.365 12.769  1.00 25.76 ? 501 ILE A CG1 1 
ATOM   1146 C CG2 . ILE A 1 158 ? -11.792 29.188 10.629  1.00 26.03 ? 501 ILE A CG2 1 
ATOM   1147 C CD1 . ILE A 1 158 ? -11.781 29.605 13.753  1.00 26.34 ? 501 ILE A CD1 1 
ATOM   1148 N N   . VAL A 1 159 ? -8.236  31.497 11.101  1.00 24.57 ? 502 VAL A N   1 
ATOM   1149 C CA  . VAL A 1 159 ? -6.927  30.930 11.327  1.00 23.48 ? 502 VAL A CA  1 
ATOM   1150 C C   . VAL A 1 159 ? -6.917  30.360 12.775  1.00 25.32 ? 502 VAL A C   1 
ATOM   1151 O O   . VAL A 1 159 ? -7.197  31.077 13.755  1.00 24.03 ? 502 VAL A O   1 
ATOM   1152 C CB  . VAL A 1 159 ? -5.776  31.944 11.170  1.00 23.23 ? 502 VAL A CB  1 
ATOM   1153 C CG1 . VAL A 1 159 ? -4.412  31.280 11.402  1.00 21.13 ? 502 VAL A CG1 1 
ATOM   1154 C CG2 . VAL A 1 159 ? -5.805  32.650 9.796   1.00 22.77 ? 502 VAL A CG2 1 
ATOM   1155 N N   . CYS A 1 160 ? -6.628  29.065 12.893  1.00 25.59 ? 503 CYS A N   1 
ATOM   1156 C CA  . CYS A 1 160 ? -6.549  28.417 14.215  1.00 27.58 ? 503 CYS A CA  1 
ATOM   1157 C C   . CYS A 1 160 ? -5.112  28.068 14.456  1.00 26.95 ? 503 CYS A C   1 
ATOM   1158 O O   . CYS A 1 160 ? -4.507  27.430 13.600  1.00 25.74 ? 503 CYS A O   1 
ATOM   1159 C CB  . CYS A 1 160 ? -7.327  27.124 14.215  1.00 28.79 ? 503 CYS A CB  1 
ATOM   1160 S SG  . CYS A 1 160 ? -9.057  27.345 14.299  1.00 36.29 ? 503 CYS A SG  1 
ATOM   1161 N N   . ASN A 1 161 ? -4.561  28.549 15.577  1.00 26.11 ? 504 ASN A N   1 
ATOM   1162 C CA  . ASN A 1 161 ? -3.197  28.237 16.006  1.00 25.79 ? 504 ASN A CA  1 
ATOM   1163 C C   . ASN A 1 161 ? -3.286  27.580 17.358  1.00 26.19 ? 504 ASN A C   1 
ATOM   1164 O O   . ASN A 1 161 ? -3.702  28.229 18.344  1.00 25.39 ? 504 ASN A O   1 
ATOM   1165 C CB  . ASN A 1 161 ? -2.344  29.492 16.148  1.00 26.14 ? 504 ASN A CB  1 
ATOM   1166 C CG  . ASN A 1 161 ? -2.165  30.252 14.817  1.00 27.52 ? 504 ASN A CG  1 
ATOM   1167 O OD1 . ASN A 1 161 ? -2.324  29.692 13.729  1.00 32.24 ? 504 ASN A OD1 1 
ATOM   1168 N ND2 . ASN A 1 161 ? -1.833  31.511 14.916  1.00 19.93 ? 504 ASN A ND2 1 
ATOM   1169 N N   . PHE A 1 162 ? -2.918  26.295 17.401  1.00 25.65 ? 505 PHE A N   1 
ATOM   1170 C CA  . PHE A 1 162 ? -3.036  25.485 18.624  1.00 25.04 ? 505 PHE A CA  1 
ATOM   1171 C C   . PHE A 1 162 ? -1.858  24.522 18.794  1.00 24.80 ? 505 PHE A C   1 
ATOM   1172 O O   . PHE A 1 162 ? -1.331  23.928 17.825  1.00 24.73 ? 505 PHE A O   1 
ATOM   1173 C CB  . PHE A 1 162 ? -4.408  24.760 18.701  1.00 24.68 ? 505 PHE A CB  1 
ATOM   1174 C CG  . PHE A 1 162 ? -4.655  23.754 17.574  1.00 25.69 ? 505 PHE A CG  1 
ATOM   1175 C CD1 . PHE A 1 162 ? -4.166  22.439 17.673  1.00 24.59 ? 505 PHE A CD1 1 
ATOM   1176 C CD2 . PHE A 1 162 ? -5.383  24.123 16.428  1.00 20.28 ? 505 PHE A CD2 1 
ATOM   1177 C CE1 . PHE A 1 162 ? -4.412  21.497 16.619  1.00 27.22 ? 505 PHE A CE1 1 
ATOM   1178 C CE2 . PHE A 1 162 ? -5.627  23.207 15.386  1.00 23.47 ? 505 PHE A CE2 1 
ATOM   1179 C CZ  . PHE A 1 162 ? -5.137  21.886 15.477  1.00 23.49 ? 505 PHE A CZ  1 
ATOM   1180 N N   . SER A 1 163 ? -1.417  24.409 20.031  1.00 23.91 ? 506 SER A N   1 
ATOM   1181 C CA  . SER A 1 163 ? -0.257  23.600 20.349  1.00 25.58 ? 506 SER A CA  1 
ATOM   1182 C C   . SER A 1 163 ? -0.409  22.140 19.952  1.00 24.25 ? 506 SER A C   1 
ATOM   1183 O O   . SER A 1 163 ? -1.421  21.551 20.198  1.00 23.84 ? 506 SER A O   1 
ATOM   1184 C CB  . SER A 1 163 ? 0.090   23.720 21.848  1.00 25.21 ? 506 SER A CB  1 
ATOM   1185 O OG  . SER A 1 163 ? 0.592   25.035 22.073  1.00 26.76 ? 506 SER A OG  1 
ATOM   1186 N N   . VAL A 1 164 ? 0.621   21.594 19.304  1.00 25.95 ? 507 VAL A N   1 
ATOM   1187 C CA  . VAL A 1 164 ? 0.702   20.162 19.040  1.00 26.20 ? 507 VAL A CA  1 
ATOM   1188 C C   . VAL A 1 164 ? 2.093   19.648 19.408  1.00 27.30 ? 507 VAL A C   1 
ATOM   1189 O O   . VAL A 1 164 ? 2.987   20.456 19.656  1.00 27.23 ? 507 VAL A O   1 
ATOM   1190 C CB  . VAL A 1 164 ? 0.350   19.797 17.557  1.00 26.63 ? 507 VAL A CB  1 
ATOM   1191 C CG1 . VAL A 1 164 ? -1.087  20.221 17.202  1.00 24.62 ? 507 VAL A CG1 1 
ATOM   1192 C CG2 . VAL A 1 164 ? 1.399   20.325 16.582  1.00 24.47 ? 507 VAL A CG2 1 
ATOM   1193 N N   . ASP A 1 165 ? 2.254   18.322 19.516  1.00 28.16 ? 508 ASP A N   1 
ATOM   1194 C CA  . ASP A 1 165 ? 3.591   17.718 19.639  1.00 30.80 ? 508 ASP A CA  1 
ATOM   1195 C C   . ASP A 1 165 ? 4.133   17.357 18.273  1.00 31.63 ? 508 ASP A C   1 
ATOM   1196 O O   . ASP A 1 165 ? 3.382   17.064 17.327  1.00 31.07 ? 508 ASP A O   1 
ATOM   1197 C CB  . ASP A 1 165 ? 3.612   16.432 20.524  1.00 31.32 ? 508 ASP A CB  1 
ATOM   1198 C CG  . ASP A 1 165 ? 2.999   16.644 21.902  1.00 33.31 ? 508 ASP A CG  1 
ATOM   1199 O OD1 . ASP A 1 165 ? 3.122   17.751 22.455  1.00 34.80 ? 508 ASP A OD1 1 
ATOM   1200 O OD2 . ASP A 1 165 ? 2.360   15.700 22.422  1.00 37.28 ? 508 ASP A OD2 1 
ATOM   1201 N N   . HIS A 1 166 ? 5.456   17.367 18.190  1.00 33.61 ? 509 HIS A N   1 
ATOM   1202 C CA  . HIS A 1 166 ? 6.147   16.890 17.017  1.00 35.46 ? 509 HIS A CA  1 
ATOM   1203 C C   . HIS A 1 166 ? 7.483   16.395 17.485  1.00 36.68 ? 509 HIS A C   1 
ATOM   1204 O O   . HIS A 1 166 ? 8.141   17.074 18.288  1.00 37.19 ? 509 HIS A O   1 
ATOM   1205 C CB  . HIS A 1 166 ? 6.307   17.990 15.977  1.00 34.64 ? 509 HIS A CB  1 
ATOM   1206 C CG  . HIS A 1 166 ? 6.495   17.474 14.584  1.00 35.63 ? 509 HIS A CG  1 
ATOM   1207 N ND1 . HIS A 1 166 ? 7.702   17.005 14.121  1.00 35.13 ? 509 HIS A ND1 1 
ATOM   1208 C CD2 . HIS A 1 166 ? 5.639   17.400 13.538  1.00 37.77 ? 509 HIS A CD2 1 
ATOM   1209 C CE1 . HIS A 1 166 ? 7.581   16.636 12.861  1.00 37.24 ? 509 HIS A CE1 1 
ATOM   1210 N NE2 . HIS A 1 166 ? 6.341   16.879 12.475  1.00 39.50 ? 509 HIS A NE2 1 
ATOM   1211 N N   . ASP A 1 167 ? 7.850   15.199 17.012  1.00 38.64 ? 510 ASP A N   1 
ATOM   1212 C CA  . ASP A 1 167 ? 9.109   14.506 17.374  1.00 40.88 ? 510 ASP A CA  1 
ATOM   1213 C C   . ASP A 1 167 ? 10.360  15.282 17.051  1.00 42.36 ? 510 ASP A C   1 
ATOM   1214 O O   . ASP A 1 167 ? 11.368  15.148 17.731  1.00 43.05 ? 510 ASP A O   1 
ATOM   1215 C CB  . ASP A 1 167 ? 9.193   13.147 16.661  1.00 41.31 ? 510 ASP A CB  1 
ATOM   1216 C CG  . ASP A 1 167 ? 8.325   12.094 17.320  1.00 42.67 ? 510 ASP A CG  1 
ATOM   1217 O OD1 . ASP A 1 167 ? 7.878   12.321 18.461  1.00 43.06 ? 510 ASP A OD1 1 
ATOM   1218 O OD2 . ASP A 1 167 ? 8.076   11.039 16.701  1.00 47.57 ? 510 ASP A OD2 1 
ATOM   1219 N N   . SER A 1 168 ? 10.294  16.096 15.998  1.00 44.16 ? 511 SER A N   1 
ATOM   1220 C CA  . SER A 1 168 ? 11.415  16.930 15.610  1.00 45.32 ? 511 SER A CA  1 
ATOM   1221 C C   . SER A 1 168 ? 11.532  18.136 16.536  1.00 46.23 ? 511 SER A C   1 
ATOM   1222 O O   . SER A 1 168 ? 12.498  18.885 16.471  1.00 46.99 ? 511 SER A O   1 
ATOM   1223 C CB  . SER A 1 168 ? 11.241  17.358 14.153  1.00 45.78 ? 511 SER A CB  1 
ATOM   1224 O OG  . SER A 1 168 ? 11.097  16.197 13.353  1.00 45.13 ? 511 SER A OG  1 
ATOM   1225 N N   . ALA A 1 169 ? 10.548  18.326 17.411  1.00 47.11 ? 512 ALA A N   1 
ATOM   1226 C CA  . ALA A 1 169 ? 10.595  19.448 18.332  1.00 47.48 ? 512 ALA A CA  1 
ATOM   1227 C C   . ALA A 1 169 ? 10.291  19.026 19.775  1.00 48.23 ? 512 ALA A C   1 
ATOM   1228 O O   . ALA A 1 169 ? 9.190   19.299 20.298  1.00 47.98 ? 512 ALA A O   1 
ATOM   1229 C CB  . ALA A 1 169 ? 9.697   20.596 17.851  1.00 47.07 ? 512 ALA A CB  1 
ATOM   1230 N N   . PRO A 1 170 ? 11.280  18.364 20.433  1.00 48.72 ? 513 PRO A N   1 
ATOM   1231 C CA  . PRO A 1 170 ? 11.119  18.002 21.841  1.00 49.28 ? 513 PRO A CA  1 
ATOM   1232 C C   . PRO A 1 170 ? 11.166  19.257 22.705  1.00 49.69 ? 513 PRO A C   1 
ATOM   1233 O O   . PRO A 1 170 ? 11.631  20.301 22.236  1.00 48.44 ? 513 PRO A O   1 
ATOM   1234 C CB  . PRO A 1 170 ? 12.373  17.154 22.125  1.00 49.51 ? 513 PRO A CB  1 
ATOM   1235 C CG  . PRO A 1 170 ? 13.411  17.678 21.167  1.00 48.92 ? 513 PRO A CG  1 
ATOM   1236 C CD  . PRO A 1 170 ? 12.608  17.962 19.915  1.00 48.61 ? 513 PRO A CD  1 
ATOM   1237 N N   . LEU A 1 171 ? 10.701  19.152 23.951  1.00 50.95 ? 514 LEU A N   1 
ATOM   1238 C CA  . LEU A 1 171 ? 11.008  20.182 24.938  1.00 53.07 ? 514 LEU A CA  1 
ATOM   1239 C C   . LEU A 1 171 ? 12.526  20.293 24.974  1.00 54.31 ? 514 LEU A C   1 
ATOM   1240 O O   . LEU A 1 171 ? 13.235  19.278 24.963  1.00 54.78 ? 514 LEU A O   1 
ATOM   1241 C CB  . LEU A 1 171 ? 10.483  19.814 26.333  1.00 53.05 ? 514 LEU A CB  1 
ATOM   1242 C CG  . LEU A 1 171 ? 9.028   19.354 26.499  1.00 53.95 ? 514 LEU A CG  1 
ATOM   1243 C CD1 . LEU A 1 171 ? 8.798   18.766 27.876  1.00 54.04 ? 514 LEU A CD1 1 
ATOM   1244 C CD2 . LEU A 1 171 ? 8.029   20.477 26.208  1.00 53.58 ? 514 LEU A CD2 1 
ATOM   1245 N N   . ASN A 1 172 ? 13.029  21.516 24.946  1.00 55.94 ? 515 ASN A N   1 
ATOM   1246 C CA  . ASN A 1 172 ? 14.443  21.741 25.184  1.00 57.30 ? 515 ASN A CA  1 
ATOM   1247 C C   . ASN A 1 172 ? 14.596  22.472 26.504  1.00 58.17 ? 515 ASN A C   1 
ATOM   1248 O O   . ASN A 1 172 ? 13.617  23.000 27.033  1.00 58.75 ? 515 ASN A O   1 
ATOM   1249 C CB  . ASN A 1 172 ? 15.094  22.507 24.030  1.00 57.53 ? 515 ASN A CB  1 
ATOM   1250 C CG  . ASN A 1 172 ? 14.410  23.829 23.739  1.00 58.47 ? 515 ASN A CG  1 
ATOM   1251 O OD1 . ASN A 1 172 ? 14.119  24.609 24.649  1.00 59.76 ? 515 ASN A OD1 1 
ATOM   1252 N ND2 . ASN A 1 172 ? 14.165  24.098 22.457  1.00 58.26 ? 515 ASN A ND2 1 
ATOM   1253 N N   . ASN A 1 173 ? 15.811  22.500 27.043  1.00 59.09 ? 516 ASN A N   1 
ATOM   1254 C CA  . ASN A 1 173 ? 16.035  23.055 28.377  1.00 59.93 ? 516 ASN A CA  1 
ATOM   1255 C C   . ASN A 1 173 ? 16.456  24.527 28.345  1.00 59.92 ? 516 ASN A C   1 
ATOM   1256 O O   . ASN A 1 173 ? 16.802  25.108 29.369  1.00 60.25 ? 516 ASN A O   1 
ATOM   1257 C CB  . ASN A 1 173 ? 17.034  22.178 29.153  1.00 60.59 ? 516 ASN A CB  1 
ATOM   1258 C CG  . ASN A 1 173 ? 16.560  20.725 29.292  1.00 62.04 ? 516 ASN A CG  1 
ATOM   1259 O OD1 . ASN A 1 173 ? 16.251  20.057 28.295  1.00 62.94 ? 516 ASN A OD1 1 
ATOM   1260 N ND2 . ASN A 1 173 ? 16.515  20.227 30.537  1.00 63.79 ? 516 ASN A ND2 1 
ATOM   1261 N N   . ARG A 1 174 ? 16.392  25.123 27.155  1.00 60.01 ? 517 ARG A N   1 
ATOM   1262 C CA  . ARG A 1 174 ? 16.699  26.535 26.939  1.00 59.56 ? 517 ARG A CA  1 
ATOM   1263 C C   . ARG A 1 174 ? 15.415  27.400 26.983  1.00 58.59 ? 517 ARG A C   1 
ATOM   1264 O O   . ARG A 1 174 ? 15.443  28.596 27.302  1.00 58.75 ? 517 ARG A O   1 
ATOM   1265 C CB  . ARG A 1 174 ? 17.415  26.702 25.586  1.00 60.20 ? 517 ARG A CB  1 
ATOM   1266 C CG  . ARG A 1 174 ? 18.740  27.510 25.629  1.00 62.45 ? 517 ARG A CG  1 
ATOM   1267 C CD  . ARG A 1 174 ? 18.554  28.984 26.064  1.00 65.51 ? 517 ARG A CD  1 
ATOM   1268 N NE  . ARG A 1 174 ? 18.312  29.125 27.502  1.00 67.02 ? 517 ARG A NE  1 
ATOM   1269 C CZ  . ARG A 1 174 ? 17.525  30.045 28.063  1.00 68.52 ? 517 ARG A CZ  1 
ATOM   1270 N NH1 . ARG A 1 174 ? 16.856  30.926 27.307  1.00 67.68 ? 517 ARG A NH1 1 
ATOM   1271 N NH2 . ARG A 1 174 ? 17.383  30.064 29.392  1.00 68.95 ? 517 ARG A NH2 1 
ATOM   1272 N N   . CYS A 1 175 ? 14.282  26.786 26.672  1.00 56.78 ? 518 CYS A N   1 
ATOM   1273 C CA  . CYS A 1 175 ? 13.031  27.521 26.620  1.00 54.49 ? 518 CYS A CA  1 
ATOM   1274 C C   . CYS A 1 175 ? 11.952  26.904 27.506  1.00 52.98 ? 518 CYS A C   1 
ATOM   1275 O O   . CYS A 1 175 ? 12.003  25.721 27.856  1.00 52.96 ? 518 CYS A O   1 
ATOM   1276 C CB  . CYS A 1 175 ? 12.565  27.647 25.166  1.00 54.39 ? 518 CYS A CB  1 
ATOM   1277 S SG  . CYS A 1 175 ? 13.476  28.915 24.212  1.00 54.36 ? 518 CYS A SG  1 
ATOM   1278 N N   . VAL A 1 176 ? 10.990  27.729 27.893  1.00 50.95 ? 519 VAL A N   1 
ATOM   1279 C CA  . VAL A 1 176 ? 9.783   27.244 28.559  1.00 48.97 ? 519 VAL A CA  1 
ATOM   1280 C C   . VAL A 1 176 ? 8.709   27.049 27.467  1.00 47.16 ? 519 VAL A C   1 
ATOM   1281 O O   . VAL A 1 176 ? 8.439   27.963 26.685  1.00 46.84 ? 519 VAL A O   1 
ATOM   1282 C CB  . VAL A 1 176 ? 9.324   28.240 29.639  1.00 49.08 ? 519 VAL A CB  1 
ATOM   1283 C CG1 . VAL A 1 176 ? 8.084   27.734 30.381  1.00 48.95 ? 519 VAL A CG1 1 
ATOM   1284 C CG2 . VAL A 1 176 ? 10.471  28.511 30.609  1.00 49.18 ? 519 VAL A CG2 1 
ATOM   1285 N N   . ARG A 1 177 ? 8.118   25.857 27.406  1.00 44.62 ? 520 ARG A N   1 
ATOM   1286 C CA  . ARG A 1 177 ? 7.116   25.554 26.387  1.00 42.03 ? 520 ARG A CA  1 
ATOM   1287 C C   . ARG A 1 177 ? 5.706   26.081 26.756  1.00 40.33 ? 520 ARG A C   1 
ATOM   1288 O O   . ARG A 1 177 ? 5.014   25.541 27.616  1.00 39.74 ? 520 ARG A O   1 
ATOM   1289 C CB  . ARG A 1 177 ? 7.130   24.051 26.116  1.00 42.41 ? 520 ARG A CB  1 
ATOM   1290 C CG  . ARG A 1 177 ? 6.234   23.533 24.988  1.00 42.54 ? 520 ARG A CG  1 
ATOM   1291 C CD  . ARG A 1 177 ? 6.663   23.958 23.609  1.00 40.73 ? 520 ARG A CD  1 
ATOM   1292 N NE  . ARG A 1 177 ? 8.089   23.787 23.324  1.00 43.25 ? 520 ARG A NE  1 
ATOM   1293 C CZ  . ARG A 1 177 ? 8.644   22.731 22.713  1.00 40.36 ? 520 ARG A CZ  1 
ATOM   1294 N NH1 . ARG A 1 177 ? 7.911   21.701 22.316  1.00 40.46 ? 520 ARG A NH1 1 
ATOM   1295 N NH2 . ARG A 1 177 ? 9.944   22.715 22.488  1.00 37.49 ? 520 ARG A NH2 1 
ATOM   1296 N N   . ALA A 1 178 ? 5.296   27.168 26.108  1.00 38.76 ? 521 ALA A N   1 
ATOM   1297 C CA  . ALA A 1 178 ? 3.905   27.668 26.215  1.00 36.93 ? 521 ALA A CA  1 
ATOM   1298 C C   . ALA A 1 178 ? 2.927   26.732 25.491  1.00 35.60 ? 521 ALA A C   1 
ATOM   1299 O O   . ALA A 1 178 ? 3.301   26.078 24.521  1.00 34.74 ? 521 ALA A O   1 
ATOM   1300 C CB  . ALA A 1 178 ? 3.802   29.101 25.649  1.00 36.35 ? 521 ALA A CB  1 
ATOM   1301 N N   . LYS A 1 179 ? 1.693   26.656 25.990  1.00 34.59 ? 522 LYS A N   1 
ATOM   1302 C CA  . LYS A 1 179 ? 0.629   25.939 25.324  1.00 34.43 ? 522 LYS A CA  1 
ATOM   1303 C C   . LYS A 1 179 ? -0.457  26.937 24.884  1.00 33.33 ? 522 LYS A C   1 
ATOM   1304 O O   . LYS A 1 179 ? -1.068  27.570 25.716  1.00 32.62 ? 522 LYS A O   1 
ATOM   1305 C CB  . LYS A 1 179 ? 0.035   24.836 26.223  1.00 35.20 ? 522 LYS A CB  1 
ATOM   1306 C CG  . LYS A 1 179 ? 0.990   23.619 26.516  1.00 38.04 ? 522 LYS A CG  1 
ATOM   1307 C CD  . LYS A 1 179 ? 1.582   22.963 25.240  1.00 40.60 ? 522 LYS A CD  1 
ATOM   1308 C CE  . LYS A 1 179 ? 1.693   21.429 25.329  1.00 43.35 ? 522 LYS A CE  1 
ATOM   1309 N NZ  . LYS A 1 179 ? 0.536   20.746 24.611  1.00 45.75 ? 522 LYS A NZ  1 
ATOM   1310 N N   . ILE A 1 180 ? -0.693  27.043 23.573  1.00 31.83 ? 523 ILE A N   1 
ATOM   1311 C CA  . ILE A 1 180 ? -1.620  28.041 23.025  1.00 29.89 ? 523 ILE A CA  1 
ATOM   1312 C C   . ILE A 1 180 ? -2.849  27.467 22.341  1.00 29.47 ? 523 ILE A C   1 
ATOM   1313 O O   . ILE A 1 180 ? -2.821  26.378 21.771  1.00 30.05 ? 523 ILE A O   1 
ATOM   1314 C CB  . ILE A 1 180 ? -0.910  29.010 22.042  1.00 29.77 ? 523 ILE A CB  1 
ATOM   1315 C CG1 . ILE A 1 180 ? -0.431  28.298 20.763  1.00 28.85 ? 523 ILE A CG1 1 
ATOM   1316 C CG2 . ILE A 1 180 ? 0.230   29.732 22.717  1.00 28.13 ? 523 ILE A CG2 1 
ATOM   1317 C CD1 . ILE A 1 180 ? -0.057  29.274 19.650  1.00 29.52 ? 523 ILE A CD1 1 
ATOM   1318 N N   . ASN A 1 181 ? -3.947  28.196 22.419  1.00 27.81 ? 524 ASN A N   1 
ATOM   1319 C CA  . ASN A 1 181 ? -5.071  27.946 21.542  1.00 27.53 ? 524 ASN A CA  1 
ATOM   1320 C C   . ASN A 1 181 ? -5.580  29.322 21.126  1.00 26.51 ? 524 ASN A C   1 
ATOM   1321 O O   . ASN A 1 181 ? -6.192  30.012 21.929  1.00 26.40 ? 524 ASN A O   1 
ATOM   1322 C CB  . ASN A 1 181 ? -6.147  27.098 22.225  1.00 27.22 ? 524 ASN A CB  1 
ATOM   1323 C CG  . ASN A 1 181 ? -7.462  27.041 21.436  1.00 28.98 ? 524 ASN A CG  1 
ATOM   1324 O OD1 . ASN A 1 181 ? -7.534  27.421 20.265  1.00 30.89 ? 524 ASN A OD1 1 
ATOM   1325 N ND2 . ASN A 1 181 ? -8.522  26.583 22.101  1.00 27.64 ? 524 ASN A ND2 1 
ATOM   1326 N N   . VAL A 1 182 ? -5.265  29.715 19.893  1.00 25.08 ? 525 VAL A N   1 
ATOM   1327 C CA  . VAL A 1 182 ? -5.539  31.068 19.382  1.00 24.45 ? 525 VAL A CA  1 
ATOM   1328 C C   . VAL A 1 182 ? -6.408  30.985 18.106  1.00 24.60 ? 525 VAL A C   1 
ATOM   1329 O O   . VAL A 1 182 ? -6.217  30.125 17.273  1.00 25.31 ? 525 VAL A O   1 
ATOM   1330 C CB  . VAL A 1 182 ? -4.177  31.844 19.109  1.00 23.65 ? 525 VAL A CB  1 
ATOM   1331 C CG1 . VAL A 1 182 ? -4.346  32.971 18.084  1.00 22.57 ? 525 VAL A CG1 1 
ATOM   1332 C CG2 . VAL A 1 182 ? -3.531  32.398 20.418  1.00 22.46 ? 525 VAL A CG2 1 
ATOM   1333 N N   . ALA A 1 183 ? -7.369  31.878 17.952  1.00 25.26 ? 526 ALA A N   1 
ATOM   1334 C CA  . ALA A 1 183 ? -8.135  31.958 16.691  1.00 24.91 ? 526 ALA A CA  1 
ATOM   1335 C C   . ALA A 1 183 ? -8.298  33.417 16.307  1.00 25.37 ? 526 ALA A C   1 
ATOM   1336 O O   . ALA A 1 183 ? -8.494  34.272 17.184  1.00 24.17 ? 526 ALA A O   1 
ATOM   1337 C CB  . ALA A 1 183 ? -9.506  31.319 16.838  1.00 24.34 ? 526 ALA A CB  1 
ATOM   1338 N N   . MET A 1 184 ? -8.219  33.671 15.000  1.00 24.58 ? 527 MET A N   1 
ATOM   1339 C CA  . MET A 1 184 ? -8.508  34.952 14.381  1.00 24.40 ? 527 MET A CA  1 
ATOM   1340 C C   . MET A 1 184 ? -9.705  34.667 13.459  1.00 24.42 ? 527 MET A C   1 
ATOM   1341 O O   . MET A 1 184 ? -9.572  33.944 12.474  1.00 24.68 ? 527 MET A O   1 
ATOM   1342 C CB  . MET A 1 184 ? -7.267  35.398 13.597  1.00 23.97 ? 527 MET A CB  1 
ATOM   1343 C CG  . MET A 1 184 ? -7.409  36.563 12.657  1.00 27.37 ? 527 MET A CG  1 
ATOM   1344 S SD  . MET A 1 184 ? -7.139  38.174 13.408  1.00 36.58 ? 527 MET A SD  1 
ATOM   1345 C CE  . MET A 1 184 ? -5.402  38.142 13.742  1.00 28.62 ? 527 MET A CE  1 
ATOM   1346 N N   . ILE A 1 185 ? -10.871 35.193 13.799  1.00 23.30 ? 528 ILE A N   1 
ATOM   1347 C CA  . ILE A 1 185 ? -12.094 34.829 13.127  1.00 24.03 ? 528 ILE A CA  1 
ATOM   1348 C C   . ILE A 1 185 ? -12.686 36.059 12.429  1.00 25.26 ? 528 ILE A C   1 
ATOM   1349 O O   . ILE A 1 185 ? -12.993 37.082 13.083  1.00 24.01 ? 528 ILE A O   1 
ATOM   1350 C CB  . ILE A 1 185 ? -13.166 34.249 14.087  1.00 23.99 ? 528 ILE A CB  1 
ATOM   1351 C CG1 . ILE A 1 185 ? -12.616 33.146 15.002  1.00 23.86 ? 528 ILE A CG1 1 
ATOM   1352 C CG2 . ILE A 1 185 ? -14.348 33.660 13.289  1.00 23.52 ? 528 ILE A CG2 1 
ATOM   1353 C CD1 . ILE A 1 185 ? -13.586 32.785 16.152  1.00 24.44 ? 528 ILE A CD1 1 
ATOM   1354 N N   . CYS A 1 186 ? -12.842 35.961 11.106  1.00 25.22 ? 529 CYS A N   1 
ATOM   1355 C CA  . CYS A 1 186 ? -13.231 37.142 10.332  1.00 27.29 ? 529 CYS A CA  1 
ATOM   1356 C C   . CYS A 1 186 ? -14.429 36.915 9.436   1.00 28.39 ? 529 CYS A C   1 
ATOM   1357 O O   . CYS A 1 186 ? -14.527 35.879 8.744   1.00 28.69 ? 529 CYS A O   1 
ATOM   1358 C CB  . CYS A 1 186 ? -12.094 37.623 9.488   1.00 25.90 ? 529 CYS A CB  1 
ATOM   1359 S SG  . CYS A 1 186 ? -10.621 37.935 10.306  1.00 28.72 ? 529 CYS A SG  1 
ATOM   1360 N N   . GLN A 1 187 ? -15.348 37.871 9.487   1.00 29.42 ? 530 GLN A N   1 
ATOM   1361 C CA  . GLN A 1 187 ? -16.511 37.891 8.594   1.00 30.95 ? 530 GLN A CA  1 
ATOM   1362 C C   . GLN A 1 187 ? -16.546 39.239 7.901   1.00 31.92 ? 530 GLN A C   1 
ATOM   1363 O O   . GLN A 1 187 ? -16.242 40.268 8.510   1.00 31.86 ? 530 GLN A O   1 
ATOM   1364 C CB  . GLN A 1 187 ? -17.795 37.593 9.338   1.00 30.50 ? 530 GLN A CB  1 
ATOM   1365 C CG  . GLN A 1 187 ? -17.899 36.114 9.699   1.00 31.60 ? 530 GLN A CG  1 
ATOM   1366 C CD  . GLN A 1 187 ? -18.996 35.822 10.677  1.00 34.33 ? 530 GLN A CD  1 
ATOM   1367 O OE1 . GLN A 1 187 ? -19.572 36.740 11.261  1.00 38.53 ? 530 GLN A OE1 1 
ATOM   1368 N NE2 . GLN A 1 187 ? -19.304 34.543 10.868  1.00 31.60 ? 530 GLN A NE2 1 
ATOM   1369 N N   . THR A 1 188 ? -16.853 39.196 6.608   1.00 33.31 ? 531 THR A N   1 
ATOM   1370 C CA  . THR A 1 188 ? -16.845 40.348 5.737   1.00 34.72 ? 531 THR A CA  1 
ATOM   1371 C C   . THR A 1 188 ? -18.295 40.776 5.451   1.00 36.21 ? 531 THR A C   1 
ATOM   1372 O O   . THR A 1 188 ? -19.119 39.976 5.008   1.00 35.24 ? 531 THR A O   1 
ATOM   1373 C CB  . THR A 1 188 ? -16.074 40.071 4.444   1.00 34.65 ? 531 THR A CB  1 
ATOM   1374 O OG1 . THR A 1 188 ? -14.739 39.662 4.773   1.00 35.09 ? 531 THR A OG1 1 
ATOM   1375 C CG2 . THR A 1 188 ? -16.007 41.328 3.559   1.00 34.43 ? 531 THR A CG2 1 
ATOM   1376 N N   . LEU A 1 189 ? -18.580 42.034 5.769   1.00 37.98 ? 532 LEU A N   1 
ATOM   1377 C CA  . LEU A 1 189 ? -19.851 42.672 5.475   1.00 40.99 ? 532 LEU A CA  1 
ATOM   1378 C C   . LEU A 1 189 ? -19.620 43.525 4.246   1.00 42.75 ? 532 LEU A C   1 
ATOM   1379 O O   . LEU A 1 189 ? -18.726 44.357 4.239   1.00 42.74 ? 532 LEU A O   1 
ATOM   1380 C CB  . LEU A 1 189 ? -20.305 43.560 6.656   1.00 40.85 ? 532 LEU A CB  1 
ATOM   1381 C CG  . LEU A 1 189 ? -21.013 42.927 7.875   1.00 41.50 ? 532 LEU A CG  1 
ATOM   1382 C CD1 . LEU A 1 189 ? -20.413 41.588 8.326   1.00 41.40 ? 532 LEU A CD1 1 
ATOM   1383 C CD2 . LEU A 1 189 ? -21.064 43.879 9.062   1.00 41.63 ? 532 LEU A CD2 1 
ATOM   1384 N N   . VAL A 1 190 ? -20.400 43.292 3.195   1.00 45.84 ? 533 VAL A N   1 
ATOM   1385 C CA  . VAL A 1 190 ? -20.304 44.108 1.976   1.00 48.52 ? 533 VAL A CA  1 
ATOM   1386 C C   . VAL A 1 190 ? -21.613 44.869 1.744   1.00 50.62 ? 533 VAL A C   1 
ATOM   1387 O O   . VAL A 1 190 ? -22.719 44.332 1.939   1.00 50.97 ? 533 VAL A O   1 
ATOM   1388 C CB  . VAL A 1 190 ? -19.906 43.272 0.734   1.00 48.47 ? 533 VAL A CB  1 
ATOM   1389 C CG1 . VAL A 1 190 ? -19.855 44.143 -0.538  1.00 49.14 ? 533 VAL A CG1 1 
ATOM   1390 C CG2 . VAL A 1 190 ? -18.559 42.608 0.953   1.00 49.18 ? 533 VAL A CG2 1 
ATOM   1391 N N   . SER A 1 191 ? -21.473 46.125 1.350   1.00 52.75 ? 534 SER A N   1 
ATOM   1392 C CA  . SER A 1 191 ? -22.618 46.987 1.099   1.00 55.17 ? 534 SER A CA  1 
ATOM   1393 C C   . SER A 1 191 ? -23.043 47.023 -0.393  1.00 56.89 ? 534 SER A C   1 
ATOM   1394 O O   . SER A 1 191 ? -23.336 45.975 -0.965  1.00 56.85 ? 534 SER A O   1 
ATOM   1395 C CB  . SER A 1 191 ? -22.372 48.380 1.682   1.00 54.85 ? 534 SER A CB  1 
ATOM   1396 O OG  . SER A 1 191 ? -23.594 48.918 2.139   1.00 54.70 ? 534 SER A OG  1 
ATOM   1397 N N   . PRO A 1 192 ? -23.139 48.221 -1.012  1.00 59.23 ? 535 PRO A N   1 
ATOM   1398 C CA  . PRO A 1 192 ? -23.844 48.252 -2.305  1.00 60.52 ? 535 PRO A CA  1 
ATOM   1399 C C   . PRO A 1 192 ? -23.043 48.526 -3.588  1.00 62.04 ? 535 PRO A C   1 
ATOM   1400 O O   . PRO A 1 192 ? -22.259 49.486 -3.658  1.00 62.02 ? 535 PRO A O   1 
ATOM   1401 C CB  . PRO A 1 192 ? -24.807 49.415 -2.094  1.00 60.52 ? 535 PRO A CB  1 
ATOM   1402 C CG  . PRO A 1 192 ? -24.008 50.386 -1.123  1.00 60.09 ? 535 PRO A CG  1 
ATOM   1403 C CD  . PRO A 1 192 ? -22.800 49.593 -0.601  1.00 59.51 ? 535 PRO A CD  1 
ATOM   1404 N N   . PRO A 1 193 ? -23.250 47.701 -4.633  1.00 64.00 ? 536 PRO A N   1 
ATOM   1405 C CA  . PRO A 1 193 ? -23.103 48.444 -5.887  1.00 65.11 ? 536 PRO A CA  1 
ATOM   1406 C C   . PRO A 1 193 ? -24.094 49.628 -5.814  1.00 66.26 ? 536 PRO A C   1 
ATOM   1407 O O   . PRO A 1 193 ? -25.325 49.418 -5.758  1.00 66.30 ? 536 PRO A O   1 
ATOM   1408 C CB  . PRO A 1 193 ? -23.497 47.420 -6.959  1.00 65.05 ? 536 PRO A CB  1 
ATOM   1409 C CG  . PRO A 1 193 ? -23.203 46.077 -6.316  1.00 64.75 ? 536 PRO A CG  1 
ATOM   1410 C CD  . PRO A 1 193 ? -23.543 46.267 -4.849  1.00 63.79 ? 536 PRO A CD  1 
ATOM   1411 N N   . GLU A 1 194 ? -23.547 50.846 -5.739  1.00 67.22 ? 537 GLU A N   1 
ATOM   1412 C CA  . GLU A 1 194 ? -24.350 52.070 -5.648  1.00 68.18 ? 537 GLU A CA  1 
ATOM   1413 C C   . GLU A 1 194 ? -24.512 52.712 -7.041  1.00 68.56 ? 537 GLU A C   1 
ATOM   1414 O O   . GLU A 1 194 ? -23.596 53.383 -7.536  1.00 68.75 ? 537 GLU A O   1 
ATOM   1415 C CB  . GLU A 1 194 ? -23.719 53.035 -4.628  1.00 68.36 ? 537 GLU A CB  1 
ATOM   1416 C CG  . GLU A 1 194 ? -24.526 54.317 -4.335  1.00 68.92 ? 537 GLU A CG  1 
ATOM   1417 C CD  . GLU A 1 194 ? -23.993 55.557 -5.064  1.00 69.91 ? 537 GLU A CD  1 
ATOM   1418 O OE1 . GLU A 1 194 ? -24.396 56.688 -4.689  1.00 69.65 ? 537 GLU A OE1 1 
ATOM   1419 O OE2 . GLU A 1 194 ? -23.170 55.410 -5.998  1.00 69.62 ? 537 GLU A OE2 1 
ATOM   1420 N N   . GLY A 1 195 ? -25.665 52.481 -7.675  1.00 68.82 ? 538 GLY A N   1 
ATOM   1421 C CA  . GLY A 1 195 ? -25.907 52.985 -9.033  1.00 69.23 ? 538 GLY A CA  1 
ATOM   1422 C C   . GLY A 1 195 ? -27.144 52.472 -9.776  1.00 69.36 ? 538 GLY A C   1 
ATOM   1423 O O   . GLY A 1 195 ? -28.078 53.250 -10.020 1.00 69.67 ? 538 GLY A O   1 
ATOM   1424 N N   . ASN A 1 196 ? -27.175 51.195 -10.182 1.00 69.08 ? 539 ASN A N   1 
ATOM   1425 C CA  . ASN A 1 196 ? -26.102 50.201 -10.016 1.00 68.56 ? 539 ASN A CA  1 
ATOM   1426 C C   . ASN A 1 196 ? -24.783 50.628 -10.712 1.00 68.09 ? 539 ASN A C   1 
ATOM   1427 O O   . ASN A 1 196 ? -24.815 51.285 -11.768 1.00 67.96 ? 539 ASN A O   1 
ATOM   1428 C CB  . ASN A 1 196 ? -26.559 48.814 -10.543 1.00 68.63 ? 539 ASN A CB  1 
ATOM   1429 C CG  . ASN A 1 196 ? -27.863 48.292 -9.885  1.00 68.28 ? 539 ASN A CG  1 
ATOM   1430 O OD1 . ASN A 1 196 ? -27.886 47.208 -9.274  1.00 66.94 ? 539 ASN A OD1 1 
ATOM   1431 N ND2 . ASN A 1 196 ? -28.947 49.040 -10.043 1.00 67.13 ? 539 ASN A ND2 1 
ATOM   1432 N N   . GLN A 1 197 ? -23.637 50.255 -10.121 1.00 67.21 ? 540 GLN A N   1 
ATOM   1433 C CA  . GLN A 1 197 ? -22.322 50.721 -10.605 1.00 65.77 ? 540 GLN A CA  1 
ATOM   1434 C C   . GLN A 1 197 ? -21.175 49.718 -10.355 1.00 65.55 ? 540 GLN A C   1 
ATOM   1435 O O   . GLN A 1 197 ? -20.846 48.952 -11.272 1.00 65.86 ? 540 GLN A O   1 
ATOM   1436 C CB  . GLN A 1 197 ? -21.985 52.096 -10.013 1.00 66.35 ? 540 GLN A CB  1 
ATOM   1437 C CG  . GLN A 1 197 ? -21.345 53.078 -10.997 1.00 66.07 ? 540 GLN A CG  1 
ATOM   1438 C CD  . GLN A 1 197 ? -20.660 54.265 -10.308 1.00 66.00 ? 540 GLN A CD  1 
ATOM   1439 O OE1 . GLN A 1 197 ? -20.565 55.355 -10.878 1.00 65.70 ? 540 GLN A OE1 1 
ATOM   1440 N NE2 . GLN A 1 197 ? -20.166 54.049 -9.091  1.00 65.51 ? 540 GLN A NE2 1 
ATOM   1441 N N   . GLU A 1 198 ? -20.561 49.747 -9.156  1.00 64.03 ? 541 GLU A N   1 
ATOM   1442 C CA  . GLU A 1 198 ? -19.468 48.805 -8.749  1.00 63.17 ? 541 GLU A CA  1 
ATOM   1443 C C   . GLU A 1 198 ? -18.946 48.893 -7.292  1.00 60.76 ? 541 GLU A C   1 
ATOM   1444 O O   . GLU A 1 198 ? -18.774 49.982 -6.739  1.00 60.75 ? 541 GLU A O   1 
ATOM   1445 C CB  . GLU A 1 198 ? -18.266 48.855 -9.707  1.00 62.84 ? 541 GLU A CB  1 
ATOM   1446 C CG  . GLU A 1 198 ? -18.034 47.523 -10.418 1.00 64.08 ? 541 GLU A CG  1 
ATOM   1447 C CD  . GLU A 1 198 ? -17.159 47.619 -11.665 1.00 64.26 ? 541 GLU A CD  1 
ATOM   1448 O OE1 . GLU A 1 198 ? -17.118 48.693 -12.319 1.00 65.06 ? 541 GLU A OE1 1 
ATOM   1449 O OE2 . GLU A 1 198 ? -16.515 46.595 -11.997 1.00 65.26 ? 541 GLU A OE2 1 
ATOM   1450 N N   . ILE A 1 199 ? -18.654 47.733 -6.708  1.00 58.14 ? 542 ILE A N   1 
ATOM   1451 C CA  . ILE A 1 199 ? -18.114 47.633 -5.340  1.00 55.64 ? 542 ILE A CA  1 
ATOM   1452 C C   . ILE A 1 199 ? -16.638 48.035 -5.231  1.00 53.32 ? 542 ILE A C   1 
ATOM   1453 O O   . ILE A 1 199 ? -15.796 47.472 -5.926  1.00 53.55 ? 542 ILE A O   1 
ATOM   1454 C CB  . ILE A 1 199 ? -18.285 46.199 -4.771  1.00 55.74 ? 542 ILE A CB  1 
ATOM   1455 C CG1 . ILE A 1 199 ? -19.726 45.721 -4.973  1.00 55.80 ? 542 ILE A CG1 1 
ATOM   1456 C CG2 . ILE A 1 199 ? -17.890 46.156 -3.291  1.00 55.66 ? 542 ILE A CG2 1 
ATOM   1457 C CD1 . ILE A 1 199 ? -19.956 44.260 -4.626  1.00 56.24 ? 542 ILE A CD1 1 
ATOM   1458 N N   . SER A 1 200 ? -16.340 49.015 -4.374  1.00 50.28 ? 543 SER A N   1 
ATOM   1459 C CA  . SER A 1 200 ? -14.959 49.350 -3.998  1.00 47.54 ? 543 SER A CA  1 
ATOM   1460 C C   . SER A 1 200 ? -14.671 48.937 -2.546  1.00 45.29 ? 543 SER A C   1 
ATOM   1461 O O   . SER A 1 200 ? -15.504 48.314 -1.896  1.00 44.39 ? 543 SER A O   1 
ATOM   1462 C CB  . SER A 1 200 ? -14.670 50.844 -4.185  1.00 47.66 ? 543 SER A CB  1 
ATOM   1463 O OG  . SER A 1 200 ? -15.402 51.636 -3.268  1.00 46.93 ? 543 SER A OG  1 
ATOM   1464 N N   . ARG A 1 201 ? -13.498 49.313 -2.048  1.00 43.48 ? 544 ARG A N   1 
ATOM   1465 C CA  . ARG A 1 201 ? -13.087 48.999 -0.676  1.00 41.61 ? 544 ARG A CA  1 
ATOM   1466 C C   . ARG A 1 201 ? -13.898 49.831 0.313   1.00 41.64 ? 544 ARG A C   1 
ATOM   1467 O O   . ARG A 1 201 ? -13.822 49.624 1.540   1.00 40.83 ? 544 ARG A O   1 
ATOM   1468 C CB  . ARG A 1 201 ? -11.566 49.164 -0.490  1.00 41.11 ? 544 ARG A CB  1 
ATOM   1469 C CG  . ARG A 1 201 ? -10.746 48.068 -1.223  1.00 40.28 ? 544 ARG A CG  1 
ATOM   1470 C CD  . ARG A 1 201 ? -9.269  47.986 -0.811  1.00 39.97 ? 544 ARG A CD  1 
ATOM   1471 N NE  . ARG A 1 201 ? -8.588  46.860 -1.463  1.00 39.22 ? 544 ARG A NE  1 
ATOM   1472 C CZ  . ARG A 1 201 ? -8.540  45.602 -0.997  1.00 37.91 ? 544 ARG A CZ  1 
ATOM   1473 N NH1 . ARG A 1 201 ? -9.117  45.306 0.154   1.00 32.85 ? 544 ARG A NH1 1 
ATOM   1474 N NH2 . ARG A 1 201 ? -7.906  44.634 -1.681  1.00 33.80 ? 544 ARG A NH2 1 
ATOM   1475 N N   . ASP A 1 202 ? -14.700 50.746 -0.243  1.00 40.34 ? 545 ASP A N   1 
ATOM   1476 C CA  . ASP A 1 202 ? -15.578 51.616 0.517   1.00 40.06 ? 545 ASP A CA  1 
ATOM   1477 C C   . ASP A 1 202 ? -16.811 50.886 0.971   1.00 38.97 ? 545 ASP A C   1 
ATOM   1478 O O   . ASP A 1 202 ? -17.439 51.253 1.951   1.00 38.70 ? 545 ASP A O   1 
ATOM   1479 C CB  . ASP A 1 202 ? -16.030 52.801 -0.355  1.00 40.98 ? 545 ASP A CB  1 
ATOM   1480 C CG  . ASP A 1 202 ? -15.131 54.011 -0.207  1.00 43.85 ? 545 ASP A CG  1 
ATOM   1481 O OD1 . ASP A 1 202 ? -14.148 53.942 0.573   1.00 45.00 ? 545 ASP A OD1 1 
ATOM   1482 O OD2 . ASP A 1 202 ? -15.428 55.040 -0.861  1.00 48.96 ? 545 ASP A OD2 1 
ATOM   1483 N N   . ASN A 1 203 ? -17.193 49.869 0.220   1.00 37.97 ? 546 ASN A N   1 
ATOM   1484 C CA  . ASN A 1 203 ? -18.400 49.143 0.522   1.00 37.23 ? 546 ASN A CA  1 
ATOM   1485 C C   . ASN A 1 203 ? -18.172 47.927 1.441   1.00 35.82 ? 546 ASN A C   1 
ATOM   1486 O O   . ASN A 1 203 ? -19.111 47.182 1.722   1.00 35.80 ? 546 ASN A O   1 
ATOM   1487 C CB  . ASN A 1 203 ? -19.074 48.759 -0.801  1.00 38.08 ? 546 ASN A CB  1 
ATOM   1488 C CG  . ASN A 1 203 ? -19.230 49.969 -1.720  1.00 41.20 ? 546 ASN A CG  1 
ATOM   1489 O OD1 . ASN A 1 203 ? -19.852 50.967 -1.335  1.00 43.85 ? 546 ASN A OD1 1 
ATOM   1490 N ND2 . ASN A 1 203 ? -18.619 49.917 -2.902  1.00 41.44 ? 546 ASN A ND2 1 
ATOM   1491 N N   . ILE A 1 204 ? -16.944 47.750 1.918   1.00 33.92 ? 547 ILE A N   1 
ATOM   1492 C CA  . ILE A 1 204 ? -16.611 46.555 2.736   1.00 33.56 ? 547 ILE A CA  1 
ATOM   1493 C C   . ILE A 1 204 ? -15.999 46.800 4.133   1.00 32.21 ? 547 ILE A C   1 
ATOM   1494 O O   . ILE A 1 204 ? -15.147 47.667 4.331   1.00 30.68 ? 547 ILE A O   1 
ATOM   1495 C CB  . ILE A 1 204 ? -15.726 45.551 1.955   1.00 33.05 ? 547 ILE A CB  1 
ATOM   1496 C CG1 . ILE A 1 204 ? -14.264 45.993 1.969   1.00 32.01 ? 547 ILE A CG1 1 
ATOM   1497 C CG2 . ILE A 1 204 ? -16.248 45.388 0.492   1.00 35.78 ? 547 ILE A CG2 1 
ATOM   1498 C CD1 . ILE A 1 204 ? -13.292 45.044 1.211   1.00 33.23 ? 547 ILE A CD1 1 
ATOM   1499 N N   . LEU A 1 205 ? -16.433 45.978 5.079   1.00 32.14 ? 548 LEU A N   1 
ATOM   1500 C CA  . LEU A 1 205 ? -15.921 46.023 6.446   1.00 32.47 ? 548 LEU A CA  1 
ATOM   1501 C C   . LEU A 1 205 ? -15.681 44.592 6.958   1.00 31.56 ? 548 LEU A C   1 
ATOM   1502 O O   . LEU A 1 205 ? -16.545 43.740 6.868   1.00 32.42 ? 548 LEU A O   1 
ATOM   1503 C CB  . LEU A 1 205 ? -16.938 46.739 7.348   1.00 32.78 ? 548 LEU A CB  1 
ATOM   1504 C CG  . LEU A 1 205 ? -16.654 46.724 8.855   1.00 32.88 ? 548 LEU A CG  1 
ATOM   1505 C CD1 . LEU A 1 205 ? -15.784 47.923 9.275   1.00 33.03 ? 548 LEU A CD1 1 
ATOM   1506 C CD2 . LEU A 1 205 ? -17.993 46.742 9.550   1.00 35.79 ? 548 LEU A CD2 1 
ATOM   1507 N N   . CYS A 1 206 ? -14.486 44.331 7.442   1.00 31.14 ? 549 CYS A N   1 
ATOM   1508 C CA  . CYS A 1 206 ? -14.166 43.063 8.114   1.00 30.34 ? 549 CYS A CA  1 
ATOM   1509 C C   . CYS A 1 206 ? -14.460 43.121 9.641   1.00 29.43 ? 549 CYS A C   1 
ATOM   1510 O O   . CYS A 1 206 ? -13.880 43.934 10.355  1.00 28.58 ? 549 CYS A O   1 
ATOM   1511 C CB  . CYS A 1 206 ? -12.690 42.752 7.899   1.00 29.20 ? 549 CYS A CB  1 
ATOM   1512 S SG  . CYS A 1 206 ? -12.250 41.101 8.467   1.00 31.07 ? 549 CYS A SG  1 
ATOM   1513 N N   . LYS A 1 207 ? -15.348 42.248 10.112  1.00 28.82 ? 550 LYS A N   1 
ATOM   1514 C CA  . LYS A 1 207 ? -15.608 42.068 11.529  1.00 28.91 ? 550 LYS A CA  1 
ATOM   1515 C C   . LYS A 1 207 ? -14.660 41.005 12.075  1.00 28.54 ? 550 LYS A C   1 
ATOM   1516 O O   . LYS A 1 207 ? -14.676 39.837 11.623  1.00 28.47 ? 550 LYS A O   1 
ATOM   1517 C CB  . LYS A 1 207 ? -17.052 41.640 11.780  1.00 29.05 ? 550 LYS A CB  1 
ATOM   1518 C CG  . LYS A 1 207 ? -18.111 42.582 11.210  1.00 31.62 ? 550 LYS A CG  1 
ATOM   1519 C CD  . LYS A 1 207 ? -18.290 43.795 12.071  1.00 38.72 ? 550 LYS A CD  1 
ATOM   1520 C CE  . LYS A 1 207 ? -19.343 43.541 13.148  1.00 40.41 ? 550 LYS A CE  1 
ATOM   1521 N NZ  . LYS A 1 207 ? -18.907 44.253 14.366  1.00 44.40 ? 550 LYS A NZ  1 
ATOM   1522 N N   . ILE A 1 208 ? -13.824 41.401 13.025  1.00 25.84 ? 551 ILE A N   1 
ATOM   1523 C CA  . ILE A 1 208 ? -12.822 40.481 13.526  1.00 24.30 ? 551 ILE A CA  1 
ATOM   1524 C C   . ILE A 1 208 ? -13.188 40.091 14.956  1.00 24.99 ? 551 ILE A C   1 
ATOM   1525 O O   . ILE A 1 208 ? -13.584 40.950 15.760  1.00 24.50 ? 551 ILE A O   1 
ATOM   1526 C CB  . ILE A 1 208 ? -11.396 41.101 13.520  1.00 24.49 ? 551 ILE A CB  1 
ATOM   1527 C CG1 . ILE A 1 208 ? -10.924 41.462 12.101  1.00 23.27 ? 551 ILE A CG1 1 
ATOM   1528 C CG2 . ILE A 1 208 ? -10.390 40.192 14.215  1.00 22.47 ? 551 ILE A CG2 1 
ATOM   1529 C CD1 . ILE A 1 208 ? -9.598  42.264 12.066  1.00 22.45 ? 551 ILE A CD1 1 
ATOM   1530 N N   . THR A 1 209 ? -13.108 38.787 15.238  1.00 25.14 ? 552 THR A N   1 
ATOM   1531 C CA  . THR A 1 209 ? -13.022 38.263 16.610  1.00 24.29 ? 552 THR A CA  1 
ATOM   1532 C C   . THR A 1 209 ? -11.706 37.495 16.733  1.00 24.49 ? 552 THR A C   1 
ATOM   1533 O O   . THR A 1 209 ? -11.399 36.598 15.939  1.00 24.59 ? 552 THR A O   1 
ATOM   1534 C CB  . THR A 1 209 ? -14.205 37.363 16.945  1.00 23.86 ? 552 THR A CB  1 
ATOM   1535 O OG1 . THR A 1 209 ? -15.392 38.132 16.930  1.00 23.29 ? 552 THR A OG1 1 
ATOM   1536 C CG2 . THR A 1 209 ? -14.063 36.718 18.333  1.00 23.76 ? 552 THR A CG2 1 
ATOM   1537 N N   . TYR A 1 210 ? -10.914 37.878 17.717  1.00 23.85 ? 553 TYR A N   1 
ATOM   1538 C CA  . TYR A 1 210 ? -9.635  37.272 17.973  1.00 23.01 ? 553 TYR A CA  1 
ATOM   1539 C C   . TYR A 1 210 ? -9.654  36.712 19.413  1.00 24.06 ? 553 TYR A C   1 
ATOM   1540 O O   . TYR A 1 210 ? -9.929  37.447 20.404  1.00 23.74 ? 553 TYR A O   1 
ATOM   1541 C CB  . TYR A 1 210 ? -8.507  38.298 17.820  1.00 22.96 ? 553 TYR A CB  1 
ATOM   1542 C CG  . TYR A 1 210 ? -7.185  37.800 18.364  1.00 22.01 ? 553 TYR A CG  1 
ATOM   1543 C CD1 . TYR A 1 210 ? -6.290  37.154 17.561  1.00 20.57 ? 553 TYR A CD1 1 
ATOM   1544 C CD2 . TYR A 1 210 ? -6.852  37.973 19.727  1.00 26.67 ? 553 TYR A CD2 1 
ATOM   1545 C CE1 . TYR A 1 210 ? -5.121  36.646 18.074  1.00 23.98 ? 553 TYR A CE1 1 
ATOM   1546 C CE2 . TYR A 1 210 ? -5.660  37.486 20.254  1.00 22.21 ? 553 TYR A CE2 1 
ATOM   1547 C CZ  . TYR A 1 210 ? -4.810  36.808 19.428  1.00 23.59 ? 553 TYR A CZ  1 
ATOM   1548 O OH  . TYR A 1 210 ? -3.602  36.355 19.928  1.00 23.23 ? 553 TYR A OH  1 
ATOM   1549 N N   . VAL A 1 211 ? -9.358  35.420 19.540  1.00 23.16 ? 554 VAL A N   1 
ATOM   1550 C CA  . VAL A 1 211 ? -9.367  34.765 20.862  1.00 22.61 ? 554 VAL A CA  1 
ATOM   1551 C C   . VAL A 1 211 ? -7.966  34.210 21.168  1.00 22.71 ? 554 VAL A C   1 
ATOM   1552 O O   . VAL A 1 211 ? -7.297  33.763 20.264  1.00 21.23 ? 554 VAL A O   1 
ATOM   1553 C CB  . VAL A 1 211 ? -10.539 33.709 21.060  1.00 23.35 ? 554 VAL A CB  1 
ATOM   1554 C CG1 . VAL A 1 211 ? -11.858 34.403 21.243  1.00 22.67 ? 554 VAL A CG1 1 
ATOM   1555 C CG2 . VAL A 1 211 ? -10.683 32.730 19.881  1.00 23.07 ? 554 VAL A CG2 1 
ATOM   1556 N N   . ALA A 1 212 ? -7.525  34.292 22.432  1.00 22.53 ? 555 ALA A N   1 
ATOM   1557 C CA  . ALA A 1 212 ? -6.241  33.735 22.868  1.00 24.09 ? 555 ALA A CA  1 
ATOM   1558 C C   . ALA A 1 212 ? -6.364  33.049 24.244  1.00 25.23 ? 555 ALA A C   1 
ATOM   1559 O O   . ALA A 1 212 ? -6.780  33.670 25.226  1.00 24.10 ? 555 ALA A O   1 
ATOM   1560 C CB  . ALA A 1 212 ? -5.171  34.832 22.942  1.00 23.23 ? 555 ALA A CB  1 
ATOM   1561 N N   . ASN A 1 213 ? -5.980  31.776 24.280  1.00 26.85 ? 556 ASN A N   1 
ATOM   1562 C CA  . ASN A 1 213 ? -5.932  30.975 25.498  1.00 29.33 ? 556 ASN A CA  1 
ATOM   1563 C C   . ASN A 1 213 ? -4.524  30.416 25.565  1.00 29.74 ? 556 ASN A C   1 
ATOM   1564 O O   . ASN A 1 213 ? -4.170  29.493 24.819  1.00 29.76 ? 556 ASN A O   1 
ATOM   1565 C CB  . ASN A 1 213 ? -6.985  29.866 25.454  1.00 29.17 ? 556 ASN A CB  1 
ATOM   1566 C CG  . ASN A 1 213 ? -8.384  30.405 25.258  1.00 32.80 ? 556 ASN A CG  1 
ATOM   1567 O OD1 . ASN A 1 213 ? -9.074  30.706 26.224  1.00 35.81 ? 556 ASN A OD1 1 
ATOM   1568 N ND2 . ASN A 1 213 ? -8.836  30.495 23.983  1.00 36.29 ? 556 ASN A ND2 1 
ATOM   1569 N N   . VAL A 1 214 ? -3.704  31.019 26.420  1.00 30.86 ? 557 VAL A N   1 
ATOM   1570 C CA  . VAL A 1 214 ? -2.280  30.720 26.465  1.00 31.95 ? 557 VAL A CA  1 
ATOM   1571 C C   . VAL A 1 214 ? -1.919  30.255 27.888  1.00 33.71 ? 557 VAL A C   1 
ATOM   1572 O O   . VAL A 1 214 ? -2.299  30.899 28.870  1.00 33.67 ? 557 VAL A O   1 
ATOM   1573 C CB  . VAL A 1 214 ? -1.431  31.957 26.059  1.00 31.89 ? 557 VAL A CB  1 
ATOM   1574 C CG1 . VAL A 1 214 ? 0.029   31.698 26.277  1.00 33.11 ? 557 VAL A CG1 1 
ATOM   1575 C CG2 . VAL A 1 214 ? -1.702  32.399 24.579  1.00 30.28 ? 557 VAL A CG2 1 
ATOM   1576 N N   . ASN A 1 215 ? -1.273  29.097 27.988  1.00 35.18 ? 558 ASN A N   1 
ATOM   1577 C CA  . ASN A 1 215 ? -0.528  28.733 29.184  1.00 37.24 ? 558 ASN A CA  1 
ATOM   1578 C C   . ASN A 1 215 ? 0.926   29.045 28.964  1.00 38.73 ? 558 ASN A C   1 
ATOM   1579 O O   . ASN A 1 215 ? 1.560   28.369 28.163  1.00 39.32 ? 558 ASN A O   1 
ATOM   1580 C CB  . ASN A 1 215 ? -0.624  27.255 29.502  1.00 37.50 ? 558 ASN A CB  1 
ATOM   1581 C CG  . ASN A 1 215 ? -0.075  26.933 30.909  1.00 38.55 ? 558 ASN A CG  1 
ATOM   1582 O OD1 . ASN A 1 215 ? 0.876   27.585 31.401  1.00 37.08 ? 558 ASN A OD1 1 
ATOM   1583 N ND2 . ASN A 1 215 ? -0.705  25.970 31.571  1.00 36.76 ? 558 ASN A ND2 1 
ATOM   1584 N N   . PRO A 1 216 ? 1.460   30.067 29.668  1.00 40.44 ? 559 PRO A N   1 
ATOM   1585 C CA  . PRO A 1 216 ? 2.881   30.460 29.686  1.00 41.52 ? 559 PRO A CA  1 
ATOM   1586 C C   . PRO A 1 216 ? 3.834   29.298 30.018  1.00 42.62 ? 559 PRO A C   1 
ATOM   1587 O O   . PRO A 1 216 ? 4.949   29.277 29.518  1.00 43.31 ? 559 PRO A O   1 
ATOM   1588 C CB  . PRO A 1 216 ? 2.935   31.509 30.821  1.00 41.54 ? 559 PRO A CB  1 
ATOM   1589 C CG  . PRO A 1 216 ? 1.574   32.119 30.824  1.00 41.42 ? 559 PRO A CG  1 
ATOM   1590 C CD  . PRO A 1 216 ? 0.649   30.939 30.549  1.00 40.86 ? 559 PRO A CD  1 
ATOM   1591 N N   . GLY A 1 217 ? 3.405   28.378 30.887  1.00 44.00 ? 560 GLY A N   1 
ATOM   1592 C CA  . GLY A 1 217 ? 4.118   27.118 31.139  1.00 45.86 ? 560 GLY A CA  1 
ATOM   1593 C C   . GLY A 1 217 ? 5.170   27.059 32.236  1.00 47.27 ? 560 GLY A C   1 
ATOM   1594 O O   . GLY A 1 217 ? 5.786   26.001 32.445  1.00 47.52 ? 560 GLY A O   1 
ATOM   1595 N N   . GLY A 1 218 ? 5.384   28.180 32.932  1.00 47.51 ? 561 GLY A N   1 
ATOM   1596 C CA  . GLY A 1 218 ? 6.350   28.254 34.039  1.00 47.52 ? 561 GLY A CA  1 
ATOM   1597 C C   . GLY A 1 218 ? 5.738   28.931 35.264  1.00 47.39 ? 561 GLY A C   1 
ATOM   1598 O O   . GLY A 1 218 ? 4.770   28.427 35.830  1.00 48.02 ? 561 GLY A O   1 
ATOM   1599 N N   . TRP A 1 219 ? 6.311   30.060 35.675  1.00 46.61 ? 562 TRP A N   1 
ATOM   1600 C CA  . TRP A 1 219 ? 5.762   30.885 36.759  1.00 45.84 ? 562 TRP A CA  1 
ATOM   1601 C C   . TRP A 1 219 ? 6.236   32.319 36.594  1.00 44.99 ? 562 TRP A C   1 
ATOM   1602 O O   . TRP A 1 219 ? 7.414   32.553 36.327  1.00 44.91 ? 562 TRP A O   1 
ATOM   1603 C CB  . TRP A 1 219 ? 6.181   30.361 38.146  1.00 45.74 ? 562 TRP A CB  1 
ATOM   1604 C CG  . TRP A 1 219 ? 5.546   31.125 39.298  1.00 45.37 ? 562 TRP A CG  1 
ATOM   1605 C CD1 . TRP A 1 219 ? 4.436   30.764 40.003  1.00 44.58 ? 562 TRP A CD1 1 
ATOM   1606 C CD2 . TRP A 1 219 ? 5.982   32.382 39.858  1.00 44.63 ? 562 TRP A CD2 1 
ATOM   1607 N NE1 . TRP A 1 219 ? 4.149   31.709 40.958  1.00 45.42 ? 562 TRP A NE1 1 
ATOM   1608 C CE2 . TRP A 1 219 ? 5.080   32.711 40.893  1.00 44.66 ? 562 TRP A CE2 1 
ATOM   1609 C CE3 . TRP A 1 219 ? 7.046   33.251 39.588  1.00 43.60 ? 562 TRP A CE3 1 
ATOM   1610 C CZ2 . TRP A 1 219 ? 5.210   33.871 41.662  1.00 45.82 ? 562 TRP A CZ2 1 
ATOM   1611 C CZ3 . TRP A 1 219 ? 7.174   34.409 40.348  1.00 45.23 ? 562 TRP A CZ3 1 
ATOM   1612 C CH2 . TRP A 1 219 ? 6.258   34.712 41.372  1.00 45.05 ? 562 TRP A CH2 1 
ATOM   1613 N N   . ALA A 1 220 ? 5.316   33.268 36.738  1.00 44.11 ? 563 ALA A N   1 
ATOM   1614 C CA  . ALA A 1 220 ? 5.663   34.684 36.922  1.00 43.80 ? 563 ALA A CA  1 
ATOM   1615 C C   . ALA A 1 220 ? 4.576   35.323 37.767  1.00 43.30 ? 563 ALA A C   1 
ATOM   1616 O O   . ALA A 1 220 ? 3.504   34.744 37.901  1.00 42.98 ? 563 ALA A O   1 
ATOM   1617 C CB  . ALA A 1 220 ? 5.815   35.394 35.589  1.00 44.35 ? 563 ALA A CB  1 
ATOM   1618 N N   . PRO A 1 221 ? 4.852   36.496 38.383  1.00 43.59 ? 564 PRO A N   1 
ATOM   1619 C CA  . PRO A 1 221 ? 3.802   37.141 39.203  1.00 43.22 ? 564 PRO A CA  1 
ATOM   1620 C C   . PRO A 1 221 ? 2.524   37.481 38.410  1.00 43.57 ? 564 PRO A C   1 
ATOM   1621 O O   . PRO A 1 221 ? 2.612   38.070 37.331  1.00 43.78 ? 564 PRO A O   1 
ATOM   1622 C CB  . PRO A 1 221 ? 4.459   38.415 39.729  1.00 43.32 ? 564 PRO A CB  1 
ATOM   1623 C CG  . PRO A 1 221 ? 5.841   38.455 39.173  1.00 43.63 ? 564 PRO A CG  1 
ATOM   1624 C CD  . PRO A 1 221 ? 6.131   37.236 38.381  1.00 42.98 ? 564 PRO A CD  1 
ATOM   1625 N N   . ALA A 1 222 ? 1.359   37.085 38.945  1.00 42.98 ? 565 ALA A N   1 
ATOM   1626 C CA  . ALA A 1 222 ? 0.070   37.297 38.298  1.00 42.42 ? 565 ALA A CA  1 
ATOM   1627 C C   . ALA A 1 222 ? -0.074  38.729 37.798  1.00 43.14 ? 565 ALA A C   1 
ATOM   1628 O O   . ALA A 1 222 ? -0.619  38.964 36.701  1.00 43.37 ? 565 ALA A O   1 
ATOM   1629 C CB  . ALA A 1 222 ? -1.039  36.979 39.235  1.00 41.87 ? 565 ALA A CB  1 
ATOM   1630 N N   . SER A 1 223 ? 0.458   39.669 38.590  1.00 42.83 ? 566 SER A N   1 
ATOM   1631 C CA  . SER A 1 223 ? 0.299   41.089 38.368  1.00 42.23 ? 566 SER A CA  1 
ATOM   1632 C C   . SER A 1 223 ? 0.980   41.588 37.082  1.00 41.88 ? 566 SER A C   1 
ATOM   1633 O O   . SER A 1 223 ? 0.381   42.354 36.315  1.00 42.27 ? 566 SER A O   1 
ATOM   1634 C CB  . SER A 1 223 ? 0.824   41.862 39.580  1.00 42.46 ? 566 SER A CB  1 
ATOM   1635 O OG  . SER A 1 223 ? 2.151   42.279 39.347  1.00 43.35 ? 566 SER A OG  1 
ATOM   1636 N N   . VAL A 1 224 ? 2.212   41.158 36.844  1.00 40.85 ? 567 VAL A N   1 
ATOM   1637 C CA  . VAL A 1 224 ? 2.928   41.570 35.655  1.00 40.71 ? 567 VAL A CA  1 
ATOM   1638 C C   . VAL A 1 224 ? 2.458   40.844 34.396  1.00 40.38 ? 567 VAL A C   1 
ATOM   1639 O O   . VAL A 1 224 ? 2.507   41.420 33.315  1.00 40.42 ? 567 VAL A O   1 
ATOM   1640 C CB  . VAL A 1 224 ? 4.480   41.452 35.772  1.00 41.09 ? 567 VAL A CB  1 
ATOM   1641 C CG1 . VAL A 1 224 ? 5.005   42.195 37.009  1.00 41.18 ? 567 VAL A CG1 1 
ATOM   1642 C CG2 . VAL A 1 224 ? 4.931   39.989 35.760  1.00 41.89 ? 567 VAL A CG2 1 
ATOM   1643 N N   . LEU A 1 225 ? 2.029   39.586 34.546  1.00 39.69 ? 568 LEU A N   1 
ATOM   1644 C CA  . LEU A 1 225 ? 1.565   38.781 33.431  1.00 38.87 ? 568 LEU A CA  1 
ATOM   1645 C C   . LEU A 1 225 ? 0.306   39.422 32.872  1.00 38.10 ? 568 LEU A C   1 
ATOM   1646 O O   . LEU A 1 225 ? 0.135   39.505 31.661  1.00 38.47 ? 568 LEU A O   1 
ATOM   1647 C CB  . LEU A 1 225 ? 1.296   37.314 33.865  1.00 39.37 ? 568 LEU A CB  1 
ATOM   1648 C CG  . LEU A 1 225 ? 2.496   36.351 34.046  1.00 38.99 ? 568 LEU A CG  1 
ATOM   1649 C CD1 . LEU A 1 225 ? 2.040   35.046 34.603  1.00 38.73 ? 568 LEU A CD1 1 
ATOM   1650 C CD2 . LEU A 1 225 ? 3.281   36.077 32.763  1.00 38.55 ? 568 LEU A CD2 1 
ATOM   1651 N N   . ARG A 1 226 ? -0.559  39.904 33.764  1.00 37.15 ? 569 ARG A N   1 
ATOM   1652 C CA  . ARG A 1 226 ? -1.779  40.582 33.359  1.00 35.89 ? 569 ARG A CA  1 
ATOM   1653 C C   . ARG A 1 226 ? -1.496  41.970 32.724  1.00 35.95 ? 569 ARG A C   1 
ATOM   1654 O O   . ARG A 1 226 ? -2.180  42.382 31.751  1.00 34.87 ? 569 ARG A O   1 
ATOM   1655 C CB  . ARG A 1 226 ? -2.752  40.655 34.524  1.00 36.26 ? 569 ARG A CB  1 
ATOM   1656 C CG  . ARG A 1 226 ? -3.465  39.348 34.718  1.00 35.22 ? 569 ARG A CG  1 
ATOM   1657 C CD  . ARG A 1 226 ? -4.192  39.215 36.035  1.00 35.93 ? 569 ARG A CD  1 
ATOM   1658 N NE  . ARG A 1 226 ? -4.925  37.950 35.996  1.00 34.15 ? 569 ARG A NE  1 
ATOM   1659 C CZ  . ARG A 1 226 ? -5.208  37.170 37.040  1.00 34.87 ? 569 ARG A CZ  1 
ATOM   1660 N NH1 . ARG A 1 226 ? -4.862  37.530 38.294  1.00 34.81 ? 569 ARG A NH1 1 
ATOM   1661 N NH2 . ARG A 1 226 ? -5.855  36.027 36.827  1.00 28.11 ? 569 ARG A NH2 1 
ATOM   1662 N N   . ALA A 1 227 ? -0.467  42.643 33.243  1.00 34.97 ? 570 ALA A N   1 
ATOM   1663 C CA  . ALA A 1 227 ? -0.016  43.919 32.705  1.00 34.84 ? 570 ALA A CA  1 
ATOM   1664 C C   . ALA A 1 227 ? 0.636   43.780 31.349  1.00 34.24 ? 570 ALA A C   1 
ATOM   1665 O O   . ALA A 1 227 ? 0.402   44.620 30.492  1.00 34.64 ? 570 ALA A O   1 
ATOM   1666 C CB  . ALA A 1 227 ? 0.922   44.660 33.681  1.00 34.63 ? 570 ALA A CB  1 
ATOM   1667 N N   . VAL A 1 228 ? 1.467   42.756 31.153  1.00 33.82 ? 571 VAL A N   1 
ATOM   1668 C CA  . VAL A 1 228 ? 2.064   42.528 29.838  1.00 33.37 ? 571 VAL A CA  1 
ATOM   1669 C C   . VAL A 1 228 ? 1.000   42.174 28.750  1.00 33.41 ? 571 VAL A C   1 
ATOM   1670 O O   . VAL A 1 228 ? 1.136   42.595 27.613  1.00 32.94 ? 571 VAL A O   1 
ATOM   1671 C CB  . VAL A 1 228 ? 3.148   41.423 29.811  1.00 33.84 ? 571 VAL A CB  1 
ATOM   1672 C CG1 . VAL A 1 228 ? 3.586   41.172 28.345  1.00 33.95 ? 571 VAL A CG1 1 
ATOM   1673 C CG2 . VAL A 1 228 ? 4.394   41.763 30.667  1.00 34.02 ? 571 VAL A CG2 1 
ATOM   1674 N N   . ALA A 1 229 ? -0.022  41.391 29.111  1.00 33.60 ? 572 ALA A N   1 
ATOM   1675 C CA  . ALA A 1 229 ? -1.039  40.930 28.160  1.00 34.45 ? 572 ALA A CA  1 
ATOM   1676 C C   . ALA A 1 229 ? -1.881  42.117 27.716  1.00 34.92 ? 572 ALA A C   1 
ATOM   1677 O O   . ALA A 1 229 ? -2.111  42.300 26.527  1.00 34.33 ? 572 ALA A O   1 
ATOM   1678 C CB  . ALA A 1 229 ? -1.907  39.878 28.787  1.00 34.08 ? 572 ALA A CB  1 
ATOM   1679 N N   . LYS A 1 230 ? -2.290  42.928 28.697  1.00 35.74 ? 573 LYS A N   1 
ATOM   1680 C CA  . LYS A 1 230 ? -3.004  44.193 28.502  1.00 36.60 ? 573 LYS A CA  1 
ATOM   1681 C C   . LYS A 1 230 ? -2.328  45.185 27.512  1.00 36.76 ? 573 LYS A C   1 
ATOM   1682 O O   . LYS A 1 230 ? -3.033  45.937 26.842  1.00 35.60 ? 573 LYS A O   1 
ATOM   1683 C CB  . LYS A 1 230 ? -3.271  44.857 29.855  1.00 36.83 ? 573 LYS A CB  1 
ATOM   1684 C CG  . LYS A 1 230 ? -4.455  45.793 29.880  1.00 39.54 ? 573 LYS A CG  1 
ATOM   1685 C CD  . LYS A 1 230 ? -5.312  45.617 31.156  1.00 43.65 ? 573 LYS A CD  1 
ATOM   1686 C CE  . LYS A 1 230 ? -5.113  46.775 32.125  1.00 46.17 ? 573 LYS A CE  1 
ATOM   1687 N NZ  . LYS A 1 230 ? -6.367  47.153 32.889  1.00 48.79 ? 573 LYS A NZ  1 
ATOM   1688 N N   . ARG A 1 231 ? -0.994  45.161 27.401  1.00 37.21 ? 574 ARG A N   1 
ATOM   1689 C CA  . ARG A 1 231 ? -0.296  45.999 26.422  1.00 38.86 ? 574 ARG A CA  1 
ATOM   1690 C C   . ARG A 1 231 ? -0.057  45.276 25.107  1.00 37.66 ? 574 ARG A C   1 
ATOM   1691 O O   . ARG A 1 231 ? -0.280  45.846 24.053  1.00 38.06 ? 574 ARG A O   1 
ATOM   1692 C CB  . ARG A 1 231 ? 1.070   46.492 26.944  1.00 38.82 ? 574 ARG A CB  1 
ATOM   1693 C CG  . ARG A 1 231 ? 1.829   47.357 25.915  1.00 42.05 ? 574 ARG A CG  1 
ATOM   1694 C CD  . ARG A 1 231 ? 3.256   47.754 26.323  1.00 43.15 ? 574 ARG A CD  1 
ATOM   1695 N NE  . ARG A 1 231 ? 4.088   46.587 26.616  1.00 50.30 ? 574 ARG A NE  1 
ATOM   1696 C CZ  . ARG A 1 231 ? 4.341   46.125 27.843  1.00 52.77 ? 574 ARG A CZ  1 
ATOM   1697 N NH1 . ARG A 1 231 ? 3.829   46.730 28.925  1.00 53.88 ? 574 ARG A NH1 1 
ATOM   1698 N NH2 . ARG A 1 231 ? 5.104   45.047 27.984  1.00 52.82 ? 574 ARG A NH2 1 
ATOM   1699 N N   . GLU A 1 232 ? 0.460   44.049 25.186  1.00 37.12 ? 575 GLU A N   1 
ATOM   1700 C CA  . GLU A 1 232 ? 0.860   43.296 24.004  1.00 36.94 ? 575 GLU A CA  1 
ATOM   1701 C C   . GLU A 1 232 ? -0.290  42.980 23.050  1.00 35.27 ? 575 GLU A C   1 
ATOM   1702 O O   . GLU A 1 232 ? -0.154  43.210 21.862  1.00 35.96 ? 575 GLU A O   1 
ATOM   1703 C CB  . GLU A 1 232 ? 1.702   42.051 24.355  1.00 37.46 ? 575 GLU A CB  1 
ATOM   1704 C CG  . GLU A 1 232 ? 3.160   42.374 24.806  1.00 41.08 ? 575 GLU A CG  1 
ATOM   1705 C CD  . GLU A 1 232 ? 3.842   43.504 23.974  1.00 46.76 ? 575 GLU A CD  1 
ATOM   1706 O OE1 . GLU A 1 232 ? 4.252   43.238 22.817  1.00 47.37 ? 575 GLU A OE1 1 
ATOM   1707 O OE2 . GLU A 1 232 ? 3.973   44.655 24.486  1.00 47.73 ? 575 GLU A OE2 1 
ATOM   1708 N N   . TYR A 1 233 ? -1.410  42.481 23.545  1.00 33.45 ? 576 TYR A N   1 
ATOM   1709 C CA  . TYR A 1 233 ? -2.524  42.157 22.645  1.00 33.06 ? 576 TYR A CA  1 
ATOM   1710 C C   . TYR A 1 233 ? -3.114  43.324 21.835  1.00 32.68 ? 576 TYR A C   1 
ATOM   1711 O O   . TYR A 1 233 ? -3.206  43.224 20.598  1.00 31.92 ? 576 TYR A O   1 
ATOM   1712 C CB  . TYR A 1 233 ? -3.604  41.369 23.376  1.00 33.62 ? 576 TYR A CB  1 
ATOM   1713 C CG  . TYR A 1 233 ? -3.153  39.940 23.672  1.00 33.49 ? 576 TYR A CG  1 
ATOM   1714 C CD1 . TYR A 1 233 ? -3.255  38.949 22.696  1.00 33.46 ? 576 TYR A CD1 1 
ATOM   1715 C CD2 . TYR A 1 233 ? -2.597  39.596 24.910  1.00 33.25 ? 576 TYR A CD2 1 
ATOM   1716 C CE1 . TYR A 1 233 ? -2.849  37.656 22.939  1.00 33.59 ? 576 TYR A CE1 1 
ATOM   1717 C CE2 . TYR A 1 233 ? -2.169  38.278 25.171  1.00 35.38 ? 576 TYR A CE2 1 
ATOM   1718 C CZ  . TYR A 1 233 ? -2.327  37.309 24.178  1.00 35.09 ? 576 TYR A CZ  1 
ATOM   1719 O OH  . TYR A 1 233 ? -1.938  36.009 24.387  1.00 33.97 ? 576 TYR A OH  1 
ATOM   1720 N N   . PRO A 1 234 ? -3.506  44.436 22.513  1.00 32.72 ? 577 PRO A N   1 
ATOM   1721 C CA  . PRO A 1 234 ? -3.970  45.621 21.763  1.00 32.93 ? 577 PRO A CA  1 
ATOM   1722 C C   . PRO A 1 234 ? -2.920  46.128 20.792  1.00 32.12 ? 577 PRO A C   1 
ATOM   1723 O O   . PRO A 1 234 ? -3.240  46.480 19.668  1.00 31.90 ? 577 PRO A O   1 
ATOM   1724 C CB  . PRO A 1 234 ? -4.224  46.675 22.869  1.00 32.73 ? 577 PRO A CB  1 
ATOM   1725 C CG  . PRO A 1 234 ? -4.470  45.876 24.064  1.00 32.99 ? 577 PRO A CG  1 
ATOM   1726 C CD  . PRO A 1 234 ? -3.551  44.691 23.965  1.00 31.93 ? 577 PRO A CD  1 
ATOM   1727 N N   . LYS A 1 235 ? -1.667  46.110 21.205  1.00 32.55 ? 578 LYS A N   1 
ATOM   1728 C CA  . LYS A 1 235 ? -0.594  46.567 20.335  1.00 33.36 ? 578 LYS A CA  1 
ATOM   1729 C C   . LYS A 1 235 ? -0.444  45.669 19.095  1.00 32.44 ? 578 LYS A C   1 
ATOM   1730 O O   . LYS A 1 235 ? -0.278  46.175 17.966  1.00 31.86 ? 578 LYS A O   1 
ATOM   1731 C CB  . LYS A 1 235 ? 0.706   46.644 21.125  1.00 34.20 ? 578 LYS A CB  1 
ATOM   1732 C CG  . LYS A 1 235 ? 1.961   46.836 20.266  1.00 39.16 ? 578 LYS A CG  1 
ATOM   1733 C CD  . LYS A 1 235 ? 3.008   47.707 20.952  1.00 42.70 ? 578 LYS A CD  1 
ATOM   1734 C CE  . LYS A 1 235 ? 3.710   48.556 19.880  1.00 47.82 ? 578 LYS A CE  1 
ATOM   1735 N NZ  . LYS A 1 235 ? 4.451   47.713 18.851  1.00 50.57 ? 578 LYS A NZ  1 
ATOM   1736 N N   . PHE A 1 236 ? -0.501  44.349 19.308  1.00 30.89 ? 579 PHE A N   1 
ATOM   1737 C CA  . PHE A 1 236 ? -0.461  43.413 18.199  1.00 30.52 ? 579 PHE A CA  1 
ATOM   1738 C C   . PHE A 1 236 ? -1.643  43.647 17.270  1.00 29.26 ? 579 PHE A C   1 
ATOM   1739 O O   . PHE A 1 236 ? -1.442  43.718 16.070  1.00 29.50 ? 579 PHE A O   1 
ATOM   1740 C CB  . PHE A 1 236 ? -0.337  41.926 18.634  1.00 30.24 ? 579 PHE A CB  1 
ATOM   1741 C CG  . PHE A 1 236 ? -1.196  40.991 17.823  1.00 30.71 ? 579 PHE A CG  1 
ATOM   1742 C CD1 . PHE A 1 236 ? -0.981  40.825 16.432  1.00 29.26 ? 579 PHE A CD1 1 
ATOM   1743 C CD2 . PHE A 1 236 ? -2.238  40.301 18.418  1.00 27.17 ? 579 PHE A CD2 1 
ATOM   1744 C CE1 . PHE A 1 236 ? -1.792  39.988 15.685  1.00 28.77 ? 579 PHE A CE1 1 
ATOM   1745 C CE2 . PHE A 1 236 ? -3.032  39.421 17.657  1.00 30.00 ? 579 PHE A CE2 1 
ATOM   1746 C CZ  . PHE A 1 236 ? -2.809  39.274 16.288  1.00 27.81 ? 579 PHE A CZ  1 
ATOM   1747 N N   . LEU A 1 237 ? -2.851  43.807 17.820  1.00 30.01 ? 580 LEU A N   1 
ATOM   1748 C CA  . LEU A 1 237 ? -4.076  43.919 16.982  1.00 30.28 ? 580 LEU A CA  1 
ATOM   1749 C C   . LEU A 1 237 ? -4.157  45.160 16.111  1.00 30.12 ? 580 LEU A C   1 
ATOM   1750 O O   . LEU A 1 237 ? -4.663  45.105 14.984  1.00 28.09 ? 580 LEU A O   1 
ATOM   1751 C CB  . LEU A 1 237 ? -5.344  43.797 17.806  1.00 30.39 ? 580 LEU A CB  1 
ATOM   1752 C CG  . LEU A 1 237 ? -5.709  42.359 18.162  1.00 33.69 ? 580 LEU A CG  1 
ATOM   1753 C CD1 . LEU A 1 237 ? -6.543  42.382 19.434  1.00 34.15 ? 580 LEU A CD1 1 
ATOM   1754 C CD2 . LEU A 1 237 ? -6.422  41.605 16.970  1.00 36.69 ? 580 LEU A CD2 1 
ATOM   1755 N N   . LYS A 1 238 ? -3.666  46.274 16.652  1.00 30.51 ? 581 LYS A N   1 
ATOM   1756 C CA  . LYS A 1 238 ? -3.596  47.525 15.920  1.00 31.76 ? 581 LYS A CA  1 
ATOM   1757 C C   . LYS A 1 238 ? -2.494  47.538 14.878  1.00 30.91 ? 581 LYS A C   1 
ATOM   1758 O O   . LYS A 1 238 ? -2.687  48.053 13.774  1.00 31.18 ? 581 LYS A O   1 
ATOM   1759 C CB  . LYS A 1 238 ? -3.461  48.711 16.885  1.00 32.50 ? 581 LYS A CB  1 
ATOM   1760 C CG  . LYS A 1 238 ? -4.845  49.182 17.350  1.00 36.25 ? 581 LYS A CG  1 
ATOM   1761 C CD  . LYS A 1 238 ? -5.690  49.709 16.141  1.00 39.30 ? 581 LYS A CD  1 
ATOM   1762 C CE  . LYS A 1 238 ? -7.202  49.723 16.397  1.00 37.05 ? 581 LYS A CE  1 
ATOM   1763 N NZ  . LYS A 1 238 ? -7.745  50.913 17.142  1.00 39.04 ? 581 LYS A NZ  1 
ATOM   1764 N N   . ARG A 1 239 ? -1.334  46.985 15.199  1.00 31.31 ? 582 ARG A N   1 
ATOM   1765 C CA  . ARG A 1 239 ? -0.290  46.927 14.189  1.00 32.24 ? 582 ARG A CA  1 
ATOM   1766 C C   . ARG A 1 239 ? -0.727  45.994 13.061  1.00 31.58 ? 582 ARG A C   1 
ATOM   1767 O O   . ARG A 1 239 ? -0.650  46.375 11.898  1.00 31.17 ? 582 ARG A O   1 
ATOM   1768 C CB  . ARG A 1 239 ? 1.063   46.490 14.746  1.00 33.21 ? 582 ARG A CB  1 
ATOM   1769 C CG  . ARG A 1 239 ? 2.258   47.299 14.169  1.00 39.10 ? 582 ARG A CG  1 
ATOM   1770 C CD  . ARG A 1 239 ? 2.123   48.859 14.530  1.00 45.69 ? 582 ARG A CD  1 
ATOM   1771 N NE  . ARG A 1 239 ? 3.394   49.556 14.821  1.00 49.05 ? 582 ARG A NE  1 
ATOM   1772 C CZ  . ARG A 1 239 ? 3.474   50.824 15.254  1.00 52.95 ? 582 ARG A CZ  1 
ATOM   1773 N NH1 . ARG A 1 239 ? 4.651   51.393 15.500  1.00 53.12 ? 582 ARG A NH1 1 
ATOM   1774 N NH2 . ARG A 1 239 ? 2.371   51.543 15.450  1.00 54.31 ? 582 ARG A NH2 1 
ATOM   1775 N N   . PHE A 1 240 ? -1.184  44.786 13.417  1.00 30.76 ? 583 PHE A N   1 
ATOM   1776 C CA  . PHE A 1 240 ? -1.527  43.790 12.409  1.00 30.23 ? 583 PHE A CA  1 
ATOM   1777 C C   . PHE A 1 240 ? -2.645  44.293 11.504  1.00 30.24 ? 583 PHE A C   1 
ATOM   1778 O O   . PHE A 1 240 ? -2.533  44.203 10.289  1.00 31.15 ? 583 PHE A O   1 
ATOM   1779 C CB  . PHE A 1 240 ? -1.861  42.386 12.991  1.00 29.13 ? 583 PHE A CB  1 
ATOM   1780 C CG  . PHE A 1 240 ? -2.469  41.456 11.967  1.00 27.67 ? 583 PHE A CG  1 
ATOM   1781 C CD1 . PHE A 1 240 ? -1.682  40.886 10.978  1.00 25.56 ? 583 PHE A CD1 1 
ATOM   1782 C CD2 . PHE A 1 240 ? -3.851  41.200 11.956  1.00 26.66 ? 583 PHE A CD2 1 
ATOM   1783 C CE1 . PHE A 1 240 ? -2.248  40.062 9.978   1.00 24.07 ? 583 PHE A CE1 1 
ATOM   1784 C CE2 . PHE A 1 240 ? -4.419  40.388 10.973  1.00 24.63 ? 583 PHE A CE2 1 
ATOM   1785 C CZ  . PHE A 1 240 ? -3.614  39.822 9.978   1.00 25.79 ? 583 PHE A CZ  1 
ATOM   1786 N N   . THR A 1 241 ? -3.717  44.824 12.071  1.00 29.82 ? 584 THR A N   1 
ATOM   1787 C CA  . THR A 1 241 ? -4.836  45.232 11.236  1.00 29.37 ? 584 THR A CA  1 
ATOM   1788 C C   . THR A 1 241 ? -4.511  46.474 10.368  1.00 30.88 ? 584 THR A C   1 
ATOM   1789 O O   . THR A 1 241 ? -5.053  46.641 9.286   1.00 30.00 ? 584 THR A O   1 
ATOM   1790 C CB  . THR A 1 241 ? -6.121  45.489 12.066  1.00 29.08 ? 584 THR A CB  1 
ATOM   1791 O OG1 . THR A 1 241 ? -5.838  46.471 13.081  1.00 26.52 ? 584 THR A OG1 1 
ATOM   1792 C CG2 . THR A 1 241 ? -6.659  44.161 12.714  1.00 26.25 ? 584 THR A CG2 1 
ATOM   1793 N N   . SER A 1 242 ? -3.636  47.348 10.838  1.00 32.02 ? 585 SER A N   1 
ATOM   1794 C CA  . SER A 1 242 ? -3.392  48.566 10.090  1.00 34.23 ? 585 SER A CA  1 
ATOM   1795 C C   . SER A 1 242 ? -2.398  48.209 8.984   1.00 34.81 ? 585 SER A C   1 
ATOM   1796 O O   . SER A 1 242 ? -2.414  48.778 7.901   1.00 34.48 ? 585 SER A O   1 
ATOM   1797 C CB  . SER A 1 242 ? -2.981  49.733 11.019  1.00 33.12 ? 585 SER A CB  1 
ATOM   1798 O OG  . SER A 1 242 ? -1.601  49.900 11.039  1.00 35.78 ? 585 SER A OG  1 
ATOM   1799 N N   . TYR A 1 243 ? -1.597  47.190 9.251   1.00 36.39 ? 586 TYR A N   1 
ATOM   1800 C CA  . TYR A 1 243 ? -0.735  46.598 8.247   1.00 37.58 ? 586 TYR A CA  1 
ATOM   1801 C C   . TYR A 1 243 ? -1.522  45.969 7.094   1.00 38.10 ? 586 TYR A C   1 
ATOM   1802 O O   . TYR A 1 243 ? -1.126  46.107 5.910   1.00 37.96 ? 586 TYR A O   1 
ATOM   1803 C CB  . TYR A 1 243 ? 0.155   45.554 8.898   1.00 38.71 ? 586 TYR A CB  1 
ATOM   1804 C CG  . TYR A 1 243 ? 0.829   44.612 7.934   1.00 40.04 ? 586 TYR A CG  1 
ATOM   1805 C CD1 . TYR A 1 243 ? 2.037   44.947 7.326   1.00 41.30 ? 586 TYR A CD1 1 
ATOM   1806 C CD2 . TYR A 1 243 ? 0.271   43.365 7.649   1.00 42.72 ? 586 TYR A CD2 1 
ATOM   1807 C CE1 . TYR A 1 243 ? 2.661   44.068 6.431   1.00 41.28 ? 586 TYR A CE1 1 
ATOM   1808 C CE2 . TYR A 1 243 ? 0.891   42.468 6.759   1.00 41.50 ? 586 TYR A CE2 1 
ATOM   1809 C CZ  . TYR A 1 243 ? 2.071   42.835 6.160   1.00 41.82 ? 586 TYR A CZ  1 
ATOM   1810 O OH  . TYR A 1 243 ? 2.684   41.952 5.308   1.00 43.67 ? 586 TYR A OH  1 
ATOM   1811 N N   . VAL A 1 244 ? -2.614  45.266 7.423   1.00 37.70 ? 587 VAL A N   1 
ATOM   1812 C CA  . VAL A 1 244 ? -3.468  44.684 6.384   1.00 37.36 ? 587 VAL A CA  1 
ATOM   1813 C C   . VAL A 1 244 ? -4.088  45.795 5.537   1.00 37.63 ? 587 VAL A C   1 
ATOM   1814 O O   . VAL A 1 244 ? -4.228  45.659 4.305   1.00 36.79 ? 587 VAL A O   1 
ATOM   1815 C CB  . VAL A 1 244 ? -4.593  43.826 6.955   1.00 37.37 ? 587 VAL A CB  1 
ATOM   1816 C CG1 . VAL A 1 244 ? -5.588  43.458 5.859   1.00 37.82 ? 587 VAL A CG1 1 
ATOM   1817 C CG2 . VAL A 1 244 ? -4.034  42.559 7.616   1.00 36.95 ? 587 VAL A CG2 1 
ATOM   1818 N N   . GLN A 1 245 ? -4.454  46.894 6.192   1.00 37.46 ? 588 GLN A N   1 
ATOM   1819 C CA  . GLN A 1 245 ? -5.080  47.999 5.479   1.00 38.70 ? 588 GLN A CA  1 
ATOM   1820 C C   . GLN A 1 245 ? -4.168  48.627 4.430   1.00 38.96 ? 588 GLN A C   1 
ATOM   1821 O O   . GLN A 1 245 ? -4.634  48.947 3.323   1.00 38.78 ? 588 GLN A O   1 
ATOM   1822 C CB  . GLN A 1 245 ? -5.599  49.058 6.436   1.00 38.97 ? 588 GLN A CB  1 
ATOM   1823 C CG  . GLN A 1 245 ? -6.921  48.734 7.022   1.00 39.26 ? 588 GLN A CG  1 
ATOM   1824 C CD  . GLN A 1 245 ? -7.374  49.792 8.006   1.00 43.32 ? 588 GLN A CD  1 
ATOM   1825 O OE1 . GLN A 1 245 ? -6.612  50.208 8.890   1.00 43.54 ? 588 GLN A OE1 1 
ATOM   1826 N NE2 . GLN A 1 245 ? -8.618  50.237 7.858   1.00 40.50 ? 588 GLN A NE2 1 
ATOM   1827 N N   . GLU A 1 246 ? -2.887  48.776 4.757   1.00 39.40 ? 589 GLU A N   1 
ATOM   1828 C CA  . GLU A 1 246 ? -1.952  49.409 3.832   1.00 41.14 ? 589 GLU A CA  1 
ATOM   1829 C C   . GLU A 1 246 ? -1.387  48.469 2.792   1.00 41.09 ? 589 GLU A C   1 
ATOM   1830 O O   . GLU A 1 246 ? -0.985  48.916 1.702   1.00 41.26 ? 589 GLU A O   1 
ATOM   1831 C CB  . GLU A 1 246 ? -0.816  50.135 4.545   1.00 42.36 ? 589 GLU A CB  1 
ATOM   1832 C CG  . GLU A 1 246 ? -0.256  49.447 5.772   1.00 45.23 ? 589 GLU A CG  1 
ATOM   1833 C CD  . GLU A 1 246 ? 0.519   50.405 6.646   1.00 51.07 ? 589 GLU A CD  1 
ATOM   1834 O OE1 . GLU A 1 246 ? 0.436   50.258 7.894   1.00 52.67 ? 589 GLU A OE1 1 
ATOM   1835 O OE2 . GLU A 1 246 ? 1.194   51.322 6.082   1.00 53.89 ? 589 GLU A OE2 1 
ATOM   1836 N N   . LYS A 1 247 ? -1.366  47.177 3.110   1.00 39.84 ? 590 LYS A N   1 
ATOM   1837 C CA  . LYS A 1 247 ? -0.984  46.186 2.121   1.00 39.09 ? 590 LYS A CA  1 
ATOM   1838 C C   . LYS A 1 247 ? -2.006  46.018 1.017   1.00 38.14 ? 590 LYS A C   1 
ATOM   1839 O O   . LYS A 1 247 ? -1.647  45.631 -0.091  1.00 38.69 ? 590 LYS A O   1 
ATOM   1840 C CB  . LYS A 1 247 ? -0.684  44.839 2.764   1.00 39.24 ? 590 LYS A CB  1 
ATOM   1841 C CG  . LYS A 1 247 ? 0.785   44.659 3.122   1.00 41.01 ? 590 LYS A CG  1 
ATOM   1842 C CD  . LYS A 1 247 ? 1.700   44.900 1.907   1.00 45.07 ? 590 LYS A CD  1 
ATOM   1843 C CE  . LYS A 1 247 ? 2.915   43.955 1.903   1.00 46.20 ? 590 LYS A CE  1 
ATOM   1844 N NZ  . LYS A 1 247 ? 2.550   42.567 1.436   1.00 45.34 ? 590 LYS A NZ  1 
ATOM   1845 N N   . THR A 1 248 ? -3.269  46.284 1.324   1.00 36.50 ? 591 THR A N   1 
ATOM   1846 C CA  . THR A 1 248 ? -4.347  46.035 0.386   1.00 35.64 ? 591 THR A CA  1 
ATOM   1847 C C   . THR A 1 248 ? -4.891  47.305 -0.294  1.00 35.98 ? 591 THR A C   1 
ATOM   1848 O O   . THR A 1 248 ? -5.590  47.202 -1.312  1.00 35.85 ? 591 THR A O   1 
ATOM   1849 C CB  . THR A 1 248 ? -5.521  45.297 1.037   1.00 34.64 ? 591 THR A CB  1 
ATOM   1850 O OG1 . THR A 1 248 ? -5.985  46.061 2.144   1.00 33.68 ? 591 THR A OG1 1 
ATOM   1851 C CG2 . THR A 1 248 ? -5.124  43.869 1.469   1.00 32.72 ? 591 THR A CG2 1 
ATOM   1852 N N   . ALA A 1 249 ? -4.549  48.474 0.258   1.00 36.20 ? 592 ALA A N   1 
ATOM   1853 C CA  . ALA A 1 249 ? -5.050  49.780 -0.228  1.00 37.06 ? 592 ALA A CA  1 
ATOM   1854 C C   . ALA A 1 249 ? -4.787  49.949 -1.712  1.00 37.08 ? 592 ALA A C   1 
ATOM   1855 O O   . ALA A 1 249 ? -3.648  49.890 -2.145  1.00 37.90 ? 592 ALA A O   1 
ATOM   1856 C CB  . ALA A 1 249 ? -4.430  50.954 0.560   1.00 36.26 ? 592 ALA A CB  1 
ATOM   1857 N N   . GLY A 1 250 ? -5.848  50.130 -2.481  1.00 37.53 ? 593 GLY A N   1 
ATOM   1858 C CA  . GLY A 1 250 ? -5.705  50.469 -3.894  1.00 38.91 ? 593 GLY A CA  1 
ATOM   1859 C C   . GLY A 1 250 ? -5.649  49.241 -4.792  1.00 39.84 ? 593 GLY A C   1 
ATOM   1860 O O   . GLY A 1 250 ? -5.435  49.367 -6.008  1.00 40.46 ? 593 GLY A O   1 
ATOM   1861 N N   . LYS A 1 251 ? -5.853  48.066 -4.200  1.00 39.16 ? 594 LYS A N   1 
ATOM   1862 C CA  . LYS A 1 251 ? -5.698  46.815 -4.919  1.00 38.79 ? 594 LYS A CA  1 
ATOM   1863 C C   . LYS A 1 251 ? -7.062  46.173 -5.092  1.00 38.44 ? 594 LYS A C   1 
ATOM   1864 O O   . LYS A 1 251 ? -8.021  46.531 -4.374  1.00 37.96 ? 594 LYS A O   1 
ATOM   1865 C CB  . LYS A 1 251 ? -4.729  45.867 -4.205  1.00 38.50 ? 594 LYS A CB  1 
ATOM   1866 C CG  . LYS A 1 251 ? -3.434  46.544 -3.733  1.00 41.47 ? 594 LYS A CG  1 
ATOM   1867 C CD  . LYS A 1 251 ? -2.171  45.663 -3.885  1.00 41.88 ? 594 LYS A CD  1 
ATOM   1868 C CE  . LYS A 1 251 ? -2.265  44.350 -3.108  1.00 42.34 ? 594 LYS A CE  1 
ATOM   1869 N NZ  . LYS A 1 251 ? -0.911  43.693 -2.881  1.00 43.06 ? 594 LYS A NZ  1 
ATOM   1870 N N   . PRO A 1 252 ? -7.172  45.244 -6.079  1.00 38.14 ? 595 PRO A N   1 
ATOM   1871 C CA  . PRO A 1 252 ? -8.422  44.520 -6.266  1.00 37.34 ? 595 PRO A CA  1 
ATOM   1872 C C   . PRO A 1 252 ? -8.760  43.722 -4.997  1.00 36.22 ? 595 PRO A C   1 
ATOM   1873 O O   . PRO A 1 252 ? -7.871  43.291 -4.241  1.00 36.06 ? 595 PRO A O   1 
ATOM   1874 C CB  . PRO A 1 252 ? -8.143  43.607 -7.475  1.00 37.56 ? 595 PRO A CB  1 
ATOM   1875 C CG  . PRO A 1 252 ? -6.671  43.559 -7.614  1.00 38.20 ? 595 PRO A CG  1 
ATOM   1876 C CD  . PRO A 1 252 ? -6.125  44.822 -7.033  1.00 38.22 ? 595 PRO A CD  1 
ATOM   1877 N N   . ILE A 1 253 ? -10.041 43.575 -4.730  1.00 35.50 ? 596 ILE A N   1 
ATOM   1878 C CA  . ILE A 1 253 ? -10.453 42.978 -3.474  1.00 34.84 ? 596 ILE A CA  1 
ATOM   1879 C C   . ILE A 1 253 ? -10.405 41.449 -3.590  1.00 35.41 ? 596 ILE A C   1 
ATOM   1880 O O   . ILE A 1 253 ? -11.025 40.873 -4.483  1.00 34.65 ? 596 ILE A O   1 
ATOM   1881 C CB  . ILE A 1 253 ? -11.864 43.463 -3.095  1.00 35.24 ? 596 ILE A CB  1 
ATOM   1882 C CG1 . ILE A 1 253 ? -11.902 45.009 -2.995  1.00 33.61 ? 596 ILE A CG1 1 
ATOM   1883 C CG2 . ILE A 1 253 ? -12.376 42.728 -1.844  1.00 33.18 ? 596 ILE A CG2 1 
ATOM   1884 C CD1 . ILE A 1 253 ? -13.281 45.589 -2.671  1.00 33.71 ? 596 ILE A CD1 1 
ATOM   1885 N N   . LEU A 1 254 ? -9.646  40.809 -2.705  1.00 36.17 ? 597 LEU A N   1 
ATOM   1886 C CA  . LEU A 1 254 ? -9.716  39.358 -2.547  1.00 36.85 ? 597 LEU A CA  1 
ATOM   1887 C C   . LEU A 1 254 ? -10.797 38.951 -1.542  1.00 37.60 ? 597 LEU A C   1 
ATOM   1888 O O   . LEU A 1 254 ? -10.591 39.019 -0.317  1.00 36.91 ? 597 LEU A O   1 
ATOM   1889 C CB  . LEU A 1 254 ? -8.355  38.771 -2.160  1.00 37.02 ? 597 LEU A CB  1 
ATOM   1890 C CG  . LEU A 1 254 ? -8.208  37.248 -2.015  1.00 37.05 ? 597 LEU A CG  1 
ATOM   1891 C CD1 . LEU A 1 254 ? -8.489  36.481 -3.339  1.00 39.80 ? 597 LEU A CD1 1 
ATOM   1892 C CD2 . LEU A 1 254 ? -6.830  36.947 -1.490  1.00 37.33 ? 597 LEU A CD2 1 
ATOM   1893 N N   . PHE A 1 255 ? -11.939 38.515 -2.074  1.00 37.58 ? 598 PHE A N   1 
ATOM   1894 C CA  . PHE A 1 255 ? -13.043 38.085 -1.252  1.00 38.96 ? 598 PHE A CA  1 
ATOM   1895 C C   . PHE A 1 255 ? -12.870 36.647 -0.774  1.00 39.15 ? 598 PHE A C   1 
ATOM   1896 O O   . PHE A 1 255 ? -12.097 35.820 -1.306  1.00 38.94 ? 598 PHE A O   1 
ATOM   1897 C CB  . PHE A 1 255 ? -14.373 38.218 -1.999  1.00 40.11 ? 598 PHE A CB  1 
ATOM   1898 C CG  . PHE A 1 255 ? -14.880 39.637 -2.116  1.00 42.27 ? 598 PHE A CG  1 
ATOM   1899 C CD1 . PHE A 1 255 ? -14.821 40.308 -3.341  1.00 44.73 ? 598 PHE A CD1 1 
ATOM   1900 C CD2 . PHE A 1 255 ? -15.436 40.293 -1.007  1.00 43.77 ? 598 PHE A CD2 1 
ATOM   1901 C CE1 . PHE A 1 255 ? -15.304 41.626 -3.471  1.00 46.91 ? 598 PHE A CE1 1 
ATOM   1902 C CE2 . PHE A 1 255 ? -15.907 41.597 -1.117  1.00 44.67 ? 598 PHE A CE2 1 
ATOM   1903 C CZ  . PHE A 1 255 ? -15.845 42.275 -2.353  1.00 45.47 ? 598 PHE A CZ  1 
ATOM   1904 O OXT . PHE A 1 255 ? -13.556 36.270 0.183   1.00 39.33 ? 598 PHE A OXT 1 
HETATM 1905 O O   . HOH B 2 .   ? -0.401  32.829 17.098  1.00 29.71 ? 599 HOH A O   1 
HETATM 1906 O O   . HOH B 2 .   ? -16.529 38.437 13.937  1.00 27.24 ? 600 HOH A O   1 
HETATM 1907 O O   . HOH B 2 .   ? -3.454  19.900 0.301   1.00 33.55 ? 601 HOH A O   1 
HETATM 1908 O O   . HOH B 2 .   ? -4.729  33.789 27.546  1.00 26.83 ? 602 HOH A O   1 
HETATM 1909 O O   . HOH B 2 .   ? -1.460  35.710 17.881  1.00 33.29 ? 603 HOH A O   1 
HETATM 1910 O O   . HOH B 2 .   ? 0.545   30.978 10.438  1.00 24.37 ? 604 HOH A O   1 
HETATM 1911 O O   . HOH B 2 .   ? 3.490   21.916 22.097  1.00 22.51 ? 605 HOH A O   1 
HETATM 1912 O O   . HOH B 2 .   ? -10.788 33.294 24.970  1.00 33.92 ? 606 HOH A O   1 
HETATM 1913 O O   . HOH B 2 .   ? -7.247  27.125 17.299  1.00 35.78 ? 607 HOH A O   1 
HETATM 1914 O O   . HOH B 2 .   ? 3.349   24.579 22.009  1.00 33.29 ? 608 HOH A O   1 
HETATM 1915 O O   . HOH B 2 .   ? -4.513  36.828 28.911  1.00 31.04 ? 609 HOH A O   1 
HETATM 1916 O O   . HOH B 2 .   ? -18.710 45.724 25.670  1.00 39.89 ? 610 HOH A O   1 
HETATM 1917 O O   . HOH B 2 .   ? -3.240  35.387 26.957  1.00 37.23 ? 611 HOH A O   1 
HETATM 1918 O O   . HOH B 2 .   ? -15.398 46.214 18.941  1.00 30.50 ? 612 HOH A O   1 
HETATM 1919 O O   . HOH B 2 .   ? -3.823  44.515 34.301  1.00 30.73 ? 613 HOH A O   1 
HETATM 1920 O O   . HOH B 2 .   ? 12.482  41.058 8.446   1.00 61.94 ? 614 HOH A O   1 
HETATM 1921 O O   . HOH B 2 .   ? -7.219  49.251 11.775  1.00 32.64 ? 615 HOH A O   1 
HETATM 1922 O O   . HOH B 2 .   ? -13.540 30.052 22.769  1.00 42.38 ? 616 HOH A O   1 
HETATM 1923 O O   . HOH B 2 .   ? -6.163  29.934 28.993  1.00 33.69 ? 617 HOH A O   1 
HETATM 1924 O O   . HOH B 2 .   ? -17.789 40.065 22.154  1.00 32.32 ? 618 HOH A O   1 
HETATM 1925 O O   . HOH B 2 .   ? -10.333 26.191 3.313   1.00 34.99 ? 619 HOH A O   1 
HETATM 1926 O O   . HOH B 2 .   ? 1.130   33.782 14.905  1.00 42.01 ? 620 HOH A O   1 
HETATM 1927 O O   . HOH B 2 .   ? 5.841   13.506 14.628  1.00 29.37 ? 621 HOH A O   1 
HETATM 1928 O O   . HOH B 2 .   ? -12.870 38.130 35.281  1.00 42.85 ? 622 HOH A O   1 
HETATM 1929 O O   . HOH B 2 .   ? -4.529  27.056 0.743   1.00 47.34 ? 623 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   344 ?   ?   ?   A . n 
A 1 2   ASN 2   345 ?   ?   ?   A . n 
A 1 3   SER 3   346 ?   ?   ?   A . n 
A 1 4   LEU 4   347 ?   ?   ?   A . n 
A 1 5   HIS 5   348 ?   ?   ?   A . n 
A 1 6   TRP 6   349 ?   ?   ?   A . n 
A 1 7   PRO 7   350 ?   ?   ?   A . n 
A 1 8   THR 8   351 ?   ?   ?   A . n 
A 1 9   SER 9   352 ?   ?   ?   A . n 
A 1 10  LEU 10  353 ?   ?   ?   A . n 
A 1 11  PRO 11  354 ?   ?   ?   A . n 
A 1 12  SER 12  355 ?   ?   ?   A . n 
A 1 13  GLY 13  356 ?   ?   ?   A . n 
A 1 14  ASP 14  357 ?   ?   ?   A . n 
A 1 15  ALA 15  358 ?   ?   ?   A . n 
A 1 16  PHE 16  359 ?   ?   ?   A . n 
A 1 17  SER 17  360 ?   ?   ?   A . n 
A 1 18  SER 18  361 ?   ?   ?   A . n 
A 1 19  VAL 19  362 362 VAL VAL A . n 
A 1 20  GLY 20  363 363 GLY GLY A . n 
A 1 21  THR 21  364 364 THR THR A . n 
A 1 22  HIS 22  365 365 HIS HIS A . n 
A 1 23  ARG 23  366 366 ARG ARG A . n 
A 1 24  PHE 24  367 367 PHE PHE A . n 
A 1 25  VAL 25  368 368 VAL VAL A . n 
A 1 26  GLN 26  369 369 GLN GLN A . n 
A 1 27  LYS 27  370 370 LYS LYS A . n 
A 1 28  VAL 28  371 371 VAL VAL A . n 
A 1 29  GLU 29  372 372 GLU GLU A . n 
A 1 30  GLU 30  373 373 GLU GLU A . n 
A 1 31  MET 31  374 374 MET MET A . n 
A 1 32  VAL 32  375 375 VAL VAL A . n 
A 1 33  GLN 33  376 376 GLN GLN A . n 
A 1 34  ASN 34  377 377 ASN ASN A . n 
A 1 35  HIS 35  378 378 HIS HIS A . n 
A 1 36  MET 36  379 379 MET MET A . n 
A 1 37  THR 37  380 380 THR THR A . n 
A 1 38  TYR 38  381 381 TYR TYR A . n 
A 1 39  SER 39  382 382 SER SER A . n 
A 1 40  LEU 40  383 383 LEU LEU A . n 
A 1 41  GLN 41  384 384 GLN GLN A . n 
A 1 42  ASP 42  385 385 ASP ASP A . n 
A 1 43  VAL 43  386 386 VAL VAL A . n 
A 1 44  GLY 44  387 387 GLY GLY A . n 
A 1 45  GLY 45  388 388 GLY GLY A . n 
A 1 46  ASP 46  389 389 ASP ASP A . n 
A 1 47  ALA 47  390 390 ALA ALA A . n 
A 1 48  ASN 48  391 391 ASN ASN A . n 
A 1 49  TRP 49  392 392 TRP TRP A . n 
A 1 50  GLN 50  393 393 GLN GLN A . n 
A 1 51  LEU 51  394 394 LEU LEU A . n 
A 1 52  VAL 52  395 395 VAL VAL A . n 
A 1 53  VAL 53  396 396 VAL VAL A . n 
A 1 54  GLU 54  397 397 GLU GLU A . n 
A 1 55  GLU 55  398 398 GLU GLU A . n 
A 1 56  GLY 56  399 399 GLY GLY A . n 
A 1 57  GLU 57  400 400 GLU GLU A . n 
A 1 58  MET 58  401 401 MET MET A . n 
A 1 59  LYS 59  402 402 LYS LYS A . n 
A 1 60  VAL 60  403 403 VAL VAL A . n 
A 1 61  TYR 61  404 404 TYR TYR A . n 
A 1 62  ARG 62  405 405 ARG ARG A . n 
A 1 63  ARG 63  406 406 ARG ARG A . n 
A 1 64  GLU 64  407 407 GLU GLU A . n 
A 1 65  VAL 65  408 408 VAL VAL A . n 
A 1 66  GLU 66  409 409 GLU GLU A . n 
A 1 67  GLU 67  410 410 GLU GLU A . n 
A 1 68  ASN 68  411 411 ASN ASN A . n 
A 1 69  GLY 69  412 412 GLY GLY A . n 
A 1 70  ILE 70  413 413 ILE ILE A . n 
A 1 71  VAL 71  414 414 VAL VAL A . n 
A 1 72  LEU 72  415 415 LEU LEU A . n 
A 1 73  ASP 73  416 416 ASP ASP A . n 
A 1 74  PRO 74  417 417 PRO PRO A . n 
A 1 75  LEU 75  418 418 LEU LEU A . n 
A 1 76  LYS 76  419 419 LYS LYS A . n 
A 1 77  ALA 77  420 420 ALA ALA A . n 
A 1 78  THR 78  421 421 THR THR A . n 
A 1 79  HIS 79  422 422 HIS HIS A . n 
A 1 80  ALA 80  423 423 ALA ALA A . n 
A 1 81  VAL 81  424 424 VAL VAL A . n 
A 1 82  LYS 82  425 425 LYS LYS A . n 
A 1 83  GLY 83  426 426 GLY GLY A . n 
A 1 84  VAL 84  427 427 VAL VAL A . n 
A 1 85  THR 85  428 428 THR THR A . n 
A 1 86  GLY 86  429 429 GLY GLY A . n 
A 1 87  HIS 87  430 430 HIS HIS A . n 
A 1 88  GLU 88  431 431 GLU GLU A . n 
A 1 89  VAL 89  432 432 VAL VAL A . n 
A 1 90  CYS 90  433 433 CYS CYS A . n 
A 1 91  ASN 91  434 434 ASN ASN A . n 
A 1 92  TYR 92  435 435 TYR TYR A . n 
A 1 93  PHE 93  436 436 PHE PHE A . n 
A 1 94  TRP 94  437 437 TRP TRP A . n 
A 1 95  ASN 95  438 438 ASN ASN A . n 
A 1 96  VAL 96  439 439 VAL VAL A . n 
A 1 97  ASP 97  440 440 ASP ASP A . n 
A 1 98  VAL 98  441 441 VAL VAL A . n 
A 1 99  ARG 99  442 442 ARG ARG A . n 
A 1 100 ASN 100 443 443 ASN ASN A . n 
A 1 101 ASP 101 444 444 ASP ASP A . n 
A 1 102 TRP 102 445 445 TRP TRP A . n 
A 1 103 GLU 103 446 446 GLU GLU A . n 
A 1 104 THR 104 447 447 THR THR A . n 
A 1 105 THR 105 448 448 THR THR A . n 
A 1 106 ILE 106 449 449 ILE ILE A . n 
A 1 107 GLU 107 450 450 GLU GLU A . n 
A 1 108 ASN 108 451 451 ASN ASN A . n 
A 1 109 PHE 109 452 452 PHE PHE A . n 
A 1 110 HIS 110 453 453 HIS HIS A . n 
A 1 111 VAL 111 454 454 VAL VAL A . n 
A 1 112 VAL 112 455 455 VAL VAL A . n 
A 1 113 GLU 113 456 456 GLU GLU A . n 
A 1 114 THR 114 457 457 THR THR A . n 
A 1 115 LEU 115 458 458 LEU LEU A . n 
A 1 116 ALA 116 459 459 ALA ALA A . n 
A 1 117 ASP 117 460 460 ASP ASP A . n 
A 1 118 ASN 118 461 461 ASN ASN A . n 
A 1 119 ALA 119 462 462 ALA ALA A . n 
A 1 120 ILE 120 463 463 ILE ILE A . n 
A 1 121 ILE 121 464 464 ILE ILE A . n 
A 1 122 ILE 122 465 465 ILE ILE A . n 
A 1 123 TYR 123 466 466 TYR TYR A . n 
A 1 124 GLN 124 467 467 GLN GLN A . n 
A 1 125 THR 125 468 468 THR THR A . n 
A 1 126 HIS 126 469 469 HIS HIS A . n 
A 1 127 LYS 127 470 470 LYS LYS A . n 
A 1 128 ARG 128 471 471 ARG ARG A . n 
A 1 129 VAL 129 472 472 VAL VAL A . n 
A 1 130 TRP 130 473 473 TRP TRP A . n 
A 1 131 PRO 131 474 474 PRO PRO A . n 
A 1 132 ALA 132 475 475 ALA ALA A . n 
A 1 133 SER 133 476 476 SER SER A . n 
A 1 134 GLN 134 477 477 GLN GLN A . n 
A 1 135 ARG 135 478 478 ARG ARG A . n 
A 1 136 ASP 136 479 479 ASP ASP A . n 
A 1 137 VAL 137 480 480 VAL VAL A . n 
A 1 138 LEU 138 481 481 LEU LEU A . n 
A 1 139 TYR 139 482 482 TYR TYR A . n 
A 1 140 LEU 140 483 483 LEU LEU A . n 
A 1 141 SER 141 484 484 SER SER A . n 
A 1 142 VAL 142 485 485 VAL VAL A . n 
A 1 143 ILE 143 486 486 ILE ILE A . n 
A 1 144 ARG 144 487 487 ARG ARG A . n 
A 1 145 LYS 145 488 488 LYS LYS A . n 
A 1 146 ILE 146 489 489 ILE ILE A . n 
A 1 147 PRO 147 490 490 PRO PRO A . n 
A 1 148 ALA 148 491 491 ALA ALA A . n 
A 1 149 LEU 149 492 492 LEU LEU A . n 
A 1 150 THR 150 493 493 THR THR A . n 
A 1 151 GLU 151 494 494 GLU GLU A . n 
A 1 152 ASN 152 495 495 ASN ASN A . n 
A 1 153 ASP 153 496 496 ASP ASP A . n 
A 1 154 PRO 154 497 497 PRO PRO A . n 
A 1 155 GLU 155 498 498 GLU GLU A . n 
A 1 156 THR 156 499 499 THR THR A . n 
A 1 157 TRP 157 500 500 TRP TRP A . n 
A 1 158 ILE 158 501 501 ILE ILE A . n 
A 1 159 VAL 159 502 502 VAL VAL A . n 
A 1 160 CYS 160 503 503 CYS CYS A . n 
A 1 161 ASN 161 504 504 ASN ASN A . n 
A 1 162 PHE 162 505 505 PHE PHE A . n 
A 1 163 SER 163 506 506 SER SER A . n 
A 1 164 VAL 164 507 507 VAL VAL A . n 
A 1 165 ASP 165 508 508 ASP ASP A . n 
A 1 166 HIS 166 509 509 HIS HIS A . n 
A 1 167 ASP 167 510 510 ASP ASP A . n 
A 1 168 SER 168 511 511 SER SER A . n 
A 1 169 ALA 169 512 512 ALA ALA A . n 
A 1 170 PRO 170 513 513 PRO PRO A . n 
A 1 171 LEU 171 514 514 LEU LEU A . n 
A 1 172 ASN 172 515 515 ASN ASN A . n 
A 1 173 ASN 173 516 516 ASN ASN A . n 
A 1 174 ARG 174 517 517 ARG ARG A . n 
A 1 175 CYS 175 518 518 CYS CYS A . n 
A 1 176 VAL 176 519 519 VAL VAL A . n 
A 1 177 ARG 177 520 520 ARG ARG A . n 
A 1 178 ALA 178 521 521 ALA ALA A . n 
A 1 179 LYS 179 522 522 LYS LYS A . n 
A 1 180 ILE 180 523 523 ILE ILE A . n 
A 1 181 ASN 181 524 524 ASN ASN A . n 
A 1 182 VAL 182 525 525 VAL VAL A . n 
A 1 183 ALA 183 526 526 ALA ALA A . n 
A 1 184 MET 184 527 527 MET MET A . n 
A 1 185 ILE 185 528 528 ILE ILE A . n 
A 1 186 CYS 186 529 529 CYS CYS A . n 
A 1 187 GLN 187 530 530 GLN GLN A . n 
A 1 188 THR 188 531 531 THR THR A . n 
A 1 189 LEU 189 532 532 LEU LEU A . n 
A 1 190 VAL 190 533 533 VAL VAL A . n 
A 1 191 SER 191 534 534 SER SER A . n 
A 1 192 PRO 192 535 535 PRO PRO A . n 
A 1 193 PRO 193 536 536 PRO PRO A . n 
A 1 194 GLU 194 537 537 GLU GLU A . n 
A 1 195 GLY 195 538 538 GLY GLY A . n 
A 1 196 ASN 196 539 539 ASN ASN A . n 
A 1 197 GLN 197 540 540 GLN GLN A . n 
A 1 198 GLU 198 541 541 GLU GLU A . n 
A 1 199 ILE 199 542 542 ILE ILE A . n 
A 1 200 SER 200 543 543 SER SER A . n 
A 1 201 ARG 201 544 544 ARG ARG A . n 
A 1 202 ASP 202 545 545 ASP ASP A . n 
A 1 203 ASN 203 546 546 ASN ASN A . n 
A 1 204 ILE 204 547 547 ILE ILE A . n 
A 1 205 LEU 205 548 548 LEU LEU A . n 
A 1 206 CYS 206 549 549 CYS CYS A . n 
A 1 207 LYS 207 550 550 LYS LYS A . n 
A 1 208 ILE 208 551 551 ILE ILE A . n 
A 1 209 THR 209 552 552 THR THR A . n 
A 1 210 TYR 210 553 553 TYR TYR A . n 
A 1 211 VAL 211 554 554 VAL VAL A . n 
A 1 212 ALA 212 555 555 ALA ALA A . n 
A 1 213 ASN 213 556 556 ASN ASN A . n 
A 1 214 VAL 214 557 557 VAL VAL A . n 
A 1 215 ASN 215 558 558 ASN ASN A . n 
A 1 216 PRO 216 559 559 PRO PRO A . n 
A 1 217 GLY 217 560 560 GLY GLY A . n 
A 1 218 GLY 218 561 561 GLY GLY A . n 
A 1 219 TRP 219 562 562 TRP TRP A . n 
A 1 220 ALA 220 563 563 ALA ALA A . n 
A 1 221 PRO 221 564 564 PRO PRO A . n 
A 1 222 ALA 222 565 565 ALA ALA A . n 
A 1 223 SER 223 566 566 SER SER A . n 
A 1 224 VAL 224 567 567 VAL VAL A . n 
A 1 225 LEU 225 568 568 LEU LEU A . n 
A 1 226 ARG 226 569 569 ARG ARG A . n 
A 1 227 ALA 227 570 570 ALA ALA A . n 
A 1 228 VAL 228 571 571 VAL VAL A . n 
A 1 229 ALA 229 572 572 ALA ALA A . n 
A 1 230 LYS 230 573 573 LYS LYS A . n 
A 1 231 ARG 231 574 574 ARG ARG A . n 
A 1 232 GLU 232 575 575 GLU GLU A . n 
A 1 233 TYR 233 576 576 TYR TYR A . n 
A 1 234 PRO 234 577 577 PRO PRO A . n 
A 1 235 LYS 235 578 578 LYS LYS A . n 
A 1 236 PHE 236 579 579 PHE PHE A . n 
A 1 237 LEU 237 580 580 LEU LEU A . n 
A 1 238 LYS 238 581 581 LYS LYS A . n 
A 1 239 ARG 239 582 582 ARG ARG A . n 
A 1 240 PHE 240 583 583 PHE PHE A . n 
A 1 241 THR 241 584 584 THR THR A . n 
A 1 242 SER 242 585 585 SER SER A . n 
A 1 243 TYR 243 586 586 TYR TYR A . n 
A 1 244 VAL 244 587 587 VAL VAL A . n 
A 1 245 GLN 245 588 588 GLN GLN A . n 
A 1 246 GLU 246 589 589 GLU GLU A . n 
A 1 247 LYS 247 590 590 LYS LYS A . n 
A 1 248 THR 248 591 591 THR THR A . n 
A 1 249 ALA 249 592 592 ALA ALA A . n 
A 1 250 GLY 250 593 593 GLY GLY A . n 
A 1 251 LYS 251 594 594 LYS LYS A . n 
A 1 252 PRO 252 595 595 PRO PRO A . n 
A 1 253 ILE 253 596 596 ILE ILE A . n 
A 1 254 LEU 254 597 597 LEU LEU A . n 
A 1 255 PHE 255 598 598 PHE PHE A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-12-18 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MOLREP    phasing           .        ? 1 
REFMAC    refinement        5.2.0005 ? 2 
HKL-2000  'data collection' .        ? 3 
HKL-2000  'data reduction'  .        ? 4 
SCALEPACK 'data scaling'    .        ? 5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   NH2 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   ARG 
_pdbx_validate_close_contact.auth_seq_id_1    366 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   OE2 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   GLU 
_pdbx_validate_close_contact.auth_seq_id_2    456 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.10 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CB 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            CYS 
_pdbx_validate_rmsd_bond.auth_seq_id_1             529 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            SG 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            CYS 
_pdbx_validate_rmsd_bond.auth_seq_id_2             529 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.714 
_pdbx_validate_rmsd_bond.bond_target_value         1.812 
_pdbx_validate_rmsd_bond.bond_deviation            -0.098 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.016 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 366 ? ? CZ A ARG 366 ? ? NH2 A ARG 366 ? ? 116.81 120.30 -3.49 0.50 N 
2 1 C  A PRO 535 ? ? N  A PRO 536 ? ? CA  A PRO 536 ? ? 109.75 119.30 -9.55 1.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 416 ? ? -12.62  98.07   
2 1 GLU A 450 ? ? -66.22  -70.88  
3 1 SER A 534 ? ? -95.13  -125.69 
4 1 GLN A 540 ? ? -150.01 -85.16  
5 1 GLU A 541 ? ? -175.01 141.52  
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   PRO 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    535 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   PRO 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    536 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            147.09 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 344 ? A SER 1  
2  1 Y 1 A ASN 345 ? A ASN 2  
3  1 Y 1 A SER 346 ? A SER 3  
4  1 Y 1 A LEU 347 ? A LEU 4  
5  1 Y 1 A HIS 348 ? A HIS 5  
6  1 Y 1 A TRP 349 ? A TRP 6  
7  1 Y 1 A PRO 350 ? A PRO 7  
8  1 Y 1 A THR 351 ? A THR 8  
9  1 Y 1 A SER 352 ? A SER 9  
10 1 Y 1 A LEU 353 ? A LEU 10 
11 1 Y 1 A PRO 354 ? A PRO 11 
12 1 Y 1 A SER 355 ? A SER 12 
13 1 Y 1 A GLY 356 ? A GLY 13 
14 1 Y 1 A ASP 357 ? A ASP 14 
15 1 Y 1 A ALA 358 ? A ALA 15 
16 1 Y 1 A PHE 359 ? A PHE 16 
17 1 Y 1 A SER 360 ? A SER 17 
18 1 Y 1 A SER 361 ? A SER 18 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  599 599 HOH HOH A . 
B 2 HOH 2  600 600 HOH HOH A . 
B 2 HOH 3  601 601 HOH HOH A . 
B 2 HOH 4  602 602 HOH HOH A . 
B 2 HOH 5  603 603 HOH HOH A . 
B 2 HOH 6  604 604 HOH HOH A . 
B 2 HOH 7  605 605 HOH HOH A . 
B 2 HOH 8  606 606 HOH HOH A . 
B 2 HOH 9  607 607 HOH HOH A . 
B 2 HOH 10 608 608 HOH HOH A . 
B 2 HOH 11 609 609 HOH HOH A . 
B 2 HOH 12 610 610 HOH HOH A . 
B 2 HOH 13 611 611 HOH HOH A . 
B 2 HOH 14 612 612 HOH HOH A . 
B 2 HOH 15 613 613 HOH HOH A . 
B 2 HOH 16 614 614 HOH HOH A . 
B 2 HOH 17 615 615 HOH HOH A . 
B 2 HOH 18 616 616 HOH HOH A . 
B 2 HOH 19 617 617 HOH HOH A . 
B 2 HOH 20 618 618 HOH HOH A . 
B 2 HOH 21 619 619 HOH HOH A . 
B 2 HOH 22 620 620 HOH HOH A . 
B 2 HOH 23 621 621 HOH HOH A . 
B 2 HOH 24 622 622 HOH HOH A . 
B 2 HOH 25 623 623 HOH HOH A . 
#