data_2E7G
# 
_entry.id   2E7G 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2E7G         
RCSB  RCSB026320   
WWPDB D_1000026320 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hss001000556.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2E7G 
_pdbx_database_status.recvd_initial_deposition_date   2007-01-09 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Furue, M.'                                              1 
'Suzuki, S.'                                             2 
'Muto, Y.'                                               3 
'Inoue, M.'                                              4 
'Kigawa, T.'                                             5 
'Terada, T.'                                             6 
'Shirouzu, M.'                                           7 
'Yokoyama, S.'                                           8 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 9 
# 
_citation.id                        primary 
_citation.title                     
'Solution structure of putative ribosome-binding factor A (RbfA) from human mutochondrial precursor' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Furue, M.'    1 
primary 'Suzuki, S.'   2 
primary 'Muto, Y.'     3 
primary 'Inoue, M.'    4 
primary 'Kigawa, T.'   5 
primary 'Terada, T.'   6 
primary 'Shirouzu, M.' 7 
primary 'Yokoyama, S.' 8 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Putative ribosome-binding factor A' 
_entity.formula_weight             14009.806 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'KH FOLD' 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGRKEDHARLRALNGLLYKALTDLLCTPEVSQELYDLNVELSKVSLTPDFSACRAYWKTTLSAEQNAHMEAVLQR
SAAHMRHLLMSQQTLRNVPPIVFVQDKGNAALAELDQLLAVADSGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGRKEDHARLRALNGLLYKALTDLLCTPEVSQELYDLNVELSKVSLTPDFSACRAYWKTTLSAEQNAHMEAVLQR
SAAHMRHLLMSQQTLRNVPPIVFVQDKGNAALAELDQLLAVADSGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hss001000556.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   ARG n 
1 9   LYS n 
1 10  GLU n 
1 11  ASP n 
1 12  HIS n 
1 13  ALA n 
1 14  ARG n 
1 15  LEU n 
1 16  ARG n 
1 17  ALA n 
1 18  LEU n 
1 19  ASN n 
1 20  GLY n 
1 21  LEU n 
1 22  LEU n 
1 23  TYR n 
1 24  LYS n 
1 25  ALA n 
1 26  LEU n 
1 27  THR n 
1 28  ASP n 
1 29  LEU n 
1 30  LEU n 
1 31  CYS n 
1 32  THR n 
1 33  PRO n 
1 34  GLU n 
1 35  VAL n 
1 36  SER n 
1 37  GLN n 
1 38  GLU n 
1 39  LEU n 
1 40  TYR n 
1 41  ASP n 
1 42  LEU n 
1 43  ASN n 
1 44  VAL n 
1 45  GLU n 
1 46  LEU n 
1 47  SER n 
1 48  LYS n 
1 49  VAL n 
1 50  SER n 
1 51  LEU n 
1 52  THR n 
1 53  PRO n 
1 54  ASP n 
1 55  PHE n 
1 56  SER n 
1 57  ALA n 
1 58  CYS n 
1 59  ARG n 
1 60  ALA n 
1 61  TYR n 
1 62  TRP n 
1 63  LYS n 
1 64  THR n 
1 65  THR n 
1 66  LEU n 
1 67  SER n 
1 68  ALA n 
1 69  GLU n 
1 70  GLN n 
1 71  ASN n 
1 72  ALA n 
1 73  HIS n 
1 74  MET n 
1 75  GLU n 
1 76  ALA n 
1 77  VAL n 
1 78  LEU n 
1 79  GLN n 
1 80  ARG n 
1 81  SER n 
1 82  ALA n 
1 83  ALA n 
1 84  HIS n 
1 85  MET n 
1 86  ARG n 
1 87  HIS n 
1 88  LEU n 
1 89  LEU n 
1 90  MET n 
1 91  SER n 
1 92  GLN n 
1 93  GLN n 
1 94  THR n 
1 95  LEU n 
1 96  ARG n 
1 97  ASN n 
1 98  VAL n 
1 99  PRO n 
1 100 PRO n 
1 101 ILE n 
1 102 VAL n 
1 103 PHE n 
1 104 VAL n 
1 105 GLN n 
1 106 ASP n 
1 107 LYS n 
1 108 GLY n 
1 109 ASN n 
1 110 ALA n 
1 111 ALA n 
1 112 LEU n 
1 113 ALA n 
1 114 GLU n 
1 115 LEU n 
1 116 ASP n 
1 117 GLN n 
1 118 LEU n 
1 119 LEU n 
1 120 ALA n 
1 121 VAL n 
1 122 ALA n 
1 123 ASP n 
1 124 SER n 
1 125 GLY n 
1 126 PRO n 
1 127 SER n 
1 128 SER n 
1 129 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 C18orf22 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P050905-10 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RBFAL_HUMAN 
_struct_ref.pdbx_db_accession          Q8N0V3 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;RKEDHARLRALNGLLYKALTDLLCTPEVSQELYDLNMELSKVSLTPDFSACRAYWKTTLSAEQNAHMEAVLQRSAAHMRH
LLMSQQTLRNVPPIVFVQDKGNAALAELDQLLAVAD
;
_struct_ref.pdbx_align_begin           86 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2E7G 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 123 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q8N0V3 
_struct_ref_seq.db_align_beg                  86 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  201 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       86 
_struct_ref_seq.pdbx_auth_seq_align_end       201 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2E7G GLY A 1   ? UNP Q8N0V3 ?   ?   'CLONING ARTIFACT' 79  1  
1 2E7G SER A 2   ? UNP Q8N0V3 ?   ?   'CLONING ARTIFACT' 80  2  
1 2E7G SER A 3   ? UNP Q8N0V3 ?   ?   'CLONING ARTIFACT' 81  3  
1 2E7G GLY A 4   ? UNP Q8N0V3 ?   ?   'CLONING ARTIFACT' 82  4  
1 2E7G SER A 5   ? UNP Q8N0V3 ?   ?   'CLONING ARTIFACT' 83  5  
1 2E7G SER A 6   ? UNP Q8N0V3 ?   ?   'CLONING ARTIFACT' 84  6  
1 2E7G GLY A 7   ? UNP Q8N0V3 ?   ?   'CLONING ARTIFACT' 85  7  
1 2E7G VAL A 44  ? UNP Q8N0V3 MET 122 'SEE REMARK 999'   122 8  
1 2E7G SER A 124 ? UNP Q8N0V3 ?   ?   'CLONING ARTIFACT' 202 9  
1 2E7G GLY A 125 ? UNP Q8N0V3 ?   ?   'CLONING ARTIFACT' 203 10 
1 2E7G PRO A 126 ? UNP Q8N0V3 ?   ?   'CLONING ARTIFACT' 204 11 
1 2E7G SER A 127 ? UNP Q8N0V3 ?   ?   'CLONING ARTIFACT' 205 12 
1 2E7G SER A 128 ? UNP Q8N0V3 ?   ?   'CLONING ARTIFACT' 206 13 
1 2E7G GLY A 129 ? UNP Q8N0V3 ?   ?   'CLONING ARTIFACT' 207 14 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY 1 
2 1 3D_13C-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'0.79mM 13C-15N PROTEIN; 20mM d-Tris-HCl(ph7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           2E7G 
_pdbx_nmr_refine.method             'torsion angle dyanamics, restrainted molecular dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2E7G 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'structures with the least restraint violations, structures with the lowest energy, target function' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2E7G 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           XWINNMR 3.5      Bruker          1 
processing           NMRPipe 20031121 'Delaglio, F.'  2 
'data analysis'      NMRview 5.0.4    'Johnson, B.A.' 3 
'data analysis'      Kujira  0.9748   'Kobayashi, N.' 4 
'structure solution' CYANA   2.0.17   'Guntert, P.'   5 
'data analysis'      Oliva   1.10.5   'Yokochi, M.'   6 
refinement           CYANA   2.0.17   'Guntert, P.'   7 
# 
_exptl.entry_id          2E7G 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2E7G 
_struct.title                     
'Solution structure of putative ribosome-binding factor A (RbfA) from human mutochondrial precursor' 
_struct.pdbx_descriptor           'Putative ribosome-binding factor A' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2E7G 
_struct_keywords.pdbx_keywords   'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' 
_struct_keywords.text            
;RbfA, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ARG A 14 ? LEU A 29 ? ARG A 92  LEU A 107 1 ? 16 
HELX_P HELX_P2 2 GLN A 37 ? LEU A 42 ? GLN A 115 LEU A 120 1 ? 6  
HELX_P HELX_P3 3 ALA A 68 ? ARG A 80 ? ALA A 146 ARG A 158 1 ? 13 
HELX_P HELX_P4 4 ALA A 82 ? MET A 90 ? ALA A 160 MET A 168 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   3 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 46  ? THR A 52  ? LEU A 124 THR A 130 
A 2 CYS A 58  ? TYR A 61  ? CYS A 136 TYR A 139 
A 3 ILE A 101 ? GLN A 105 ? ILE A 179 GLN A 183 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LYS A 48 ? N LYS A 126 O TYR A 61  ? O TYR A 139 
A 2 3 N CYS A 58 ? N CYS A 136 O VAL A 102 ? O VAL A 180 
# 
_database_PDB_matrix.entry_id          2E7G 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2E7G 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? 3.230   -15.256 -9.102  1.00 0.00 ? 79  GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? 2.416   -16.330 -8.563  1.00 0.00 ? 79  GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? 2.949   -16.856 -7.244  1.00 0.00 ? 79  GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? 2.513   -16.428 -6.176  1.00 0.00 ? 79  GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? 4.124   -15.091 -8.737  1.00 0.00 ? 79  GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? 1.411   -15.965 -8.413  1.00 0.00 ? 79  GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? 2.391   -17.141 -9.276  1.00 0.00 ? 79  GLY A HA3  1  
ATOM 8     N N    . SER A 1 2   ? 3.894   -17.787 -7.319  1.00 0.00 ? 80  SER A N    1  
ATOM 9     C CA   . SER A 1 2   ? 4.484   -18.376 -6.122  1.00 0.00 ? 80  SER A CA   1  
ATOM 10    C C    . SER A 1 2   ? 5.787   -19.095 -6.456  1.00 0.00 ? 80  SER A C    1  
ATOM 11    O O    . SER A 1 2   ? 6.158   -19.221 -7.623  1.00 0.00 ? 80  SER A O    1  
ATOM 12    C CB   . SER A 1 2   ? 3.502   -19.352 -5.472  1.00 0.00 ? 80  SER A CB   1  
ATOM 13    O OG   . SER A 1 2   ? 2.591   -18.671 -4.626  1.00 0.00 ? 80  SER A OG   1  
ATOM 14    H H    . SER A 1 2   ? 4.201   -18.087 -8.201  1.00 0.00 ? 80  SER A H    1  
ATOM 15    H HA   . SER A 1 2   ? 4.695   -17.575 -5.429  1.00 0.00 ? 80  SER A HA   1  
ATOM 16    H HB2  . SER A 1 2   ? 2.945   -19.865 -6.241  1.00 0.00 ? 80  SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2   ? 4.051   -20.072 -4.884  1.00 0.00 ? 80  SER A HB3  1  
ATOM 18    H HG   . SER A 1 2   ? 3.065   -18.296 -3.880  1.00 0.00 ? 80  SER A HG   1  
ATOM 19    N N    . SER A 1 3   ? 6.479   -19.564 -5.422  1.00 0.00 ? 81  SER A N    1  
ATOM 20    C CA   . SER A 1 3   ? 7.743   -20.267 -5.604  1.00 0.00 ? 81  SER A CA   1  
ATOM 21    C C    . SER A 1 3   ? 7.639   -21.708 -5.113  1.00 0.00 ? 81  SER A C    1  
ATOM 22    O O    . SER A 1 3   ? 8.049   -22.641 -5.801  1.00 0.00 ? 81  SER A O    1  
ATOM 23    C CB   . SER A 1 3   ? 8.865   -19.542 -4.859  1.00 0.00 ? 81  SER A CB   1  
ATOM 24    O OG   . SER A 1 3   ? 10.138  -20.001 -5.282  1.00 0.00 ? 81  SER A OG   1  
ATOM 25    H H    . SER A 1 3   ? 6.131   -19.431 -4.515  1.00 0.00 ? 81  SER A H    1  
ATOM 26    H HA   . SER A 1 3   ? 7.969   -20.274 -6.659  1.00 0.00 ? 81  SER A HA   1  
ATOM 27    H HB2  . SER A 1 3   ? 8.796   -18.483 -5.051  1.00 0.00 ? 81  SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3   ? 8.765   -19.723 -3.798  1.00 0.00 ? 81  SER A HB3  1  
ATOM 29    H HG   . SER A 1 3   ? 10.202  -19.932 -6.237  1.00 0.00 ? 81  SER A HG   1  
ATOM 30    N N    . GLY A 1 4   ? 7.086   -21.880 -3.916  1.00 0.00 ? 82  GLY A N    1  
ATOM 31    C CA   . GLY A 1 4   ? 6.937   -23.209 -3.351  1.00 0.00 ? 82  GLY A CA   1  
ATOM 32    C C    . GLY A 1 4   ? 7.664   -23.362 -2.030  1.00 0.00 ? 82  GLY A C    1  
ATOM 33    O O    . GLY A 1 4   ? 7.258   -22.785 -1.021  1.00 0.00 ? 82  GLY A O    1  
ATOM 34    H H    . GLY A 1 4   ? 6.777   -21.098 -3.411  1.00 0.00 ? 82  GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4   ? 5.887   -23.408 -3.199  1.00 0.00 ? 82  GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4   ? 7.332   -23.931 -4.051  1.00 0.00 ? 82  GLY A HA3  1  
ATOM 37    N N    . SER A 1 5   ? 8.739   -24.143 -2.034  1.00 0.00 ? 83  SER A N    1  
ATOM 38    C CA   . SER A 1 5   ? 9.521   -24.375 -0.825  1.00 0.00 ? 83  SER A CA   1  
ATOM 39    C C    . SER A 1 5   ? 10.220  -23.096 -0.376  1.00 0.00 ? 83  SER A C    1  
ATOM 40    O O    . SER A 1 5   ? 10.222  -22.093 -1.090  1.00 0.00 ? 83  SER A O    1  
ATOM 41    C CB   . SER A 1 5   ? 10.554  -25.477 -1.064  1.00 0.00 ? 83  SER A CB   1  
ATOM 42    O OG   . SER A 1 5   ? 10.856  -26.163 0.138   1.00 0.00 ? 83  SER A OG   1  
ATOM 43    H H    . SER A 1 5   ? 9.012   -24.575 -2.871  1.00 0.00 ? 83  SER A H    1  
ATOM 44    H HA   . SER A 1 5   ? 8.842   -24.693 -0.048  1.00 0.00 ? 83  SER A HA   1  
ATOM 45    H HB2  . SER A 1 5   ? 10.163  -26.185 -1.780  1.00 0.00 ? 83  SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5   ? 11.462  -25.038 -1.452  1.00 0.00 ? 83  SER A HB3  1  
ATOM 47    H HG   . SER A 1 5   ? 10.112  -26.095 0.741   1.00 0.00 ? 83  SER A HG   1  
ATOM 48    N N    . SER A 1 6   ? 10.811  -23.138 0.813   1.00 0.00 ? 84  SER A N    1  
ATOM 49    C CA   . SER A 1 6   ? 11.511  -21.982 1.361   1.00 0.00 ? 84  SER A CA   1  
ATOM 50    C C    . SER A 1 6   ? 12.887  -21.826 0.721   1.00 0.00 ? 84  SER A C    1  
ATOM 51    O O    . SER A 1 6   ? 13.178  -20.811 0.089   1.00 0.00 ? 84  SER A O    1  
ATOM 52    C CB   . SER A 1 6   ? 11.654  -22.118 2.878   1.00 0.00 ? 84  SER A CB   1  
ATOM 53    O OG   . SER A 1 6   ? 10.414  -21.901 3.529   1.00 0.00 ? 84  SER A OG   1  
ATOM 54    H H    . SER A 1 6   ? 10.774  -23.967 1.336   1.00 0.00 ? 84  SER A H    1  
ATOM 55    H HA   . SER A 1 6   ? 10.922  -21.104 1.141   1.00 0.00 ? 84  SER A HA   1  
ATOM 56    H HB2  . SER A 1 6   ? 12.003  -23.111 3.117   1.00 0.00 ? 84  SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6   ? 12.368  -21.389 3.236   1.00 0.00 ? 84  SER A HB3  1  
ATOM 58    H HG   . SER A 1 6   ? 10.446  -21.071 4.011   1.00 0.00 ? 84  SER A HG   1  
ATOM 59    N N    . GLY A 1 7   ? 13.730  -22.840 0.889   1.00 0.00 ? 85  GLY A N    1  
ATOM 60    C CA   . GLY A 1 7   ? 15.065  -22.797 0.323   1.00 0.00 ? 85  GLY A CA   1  
ATOM 61    C C    . GLY A 1 7   ? 16.083  -22.213 1.282   1.00 0.00 ? 85  GLY A C    1  
ATOM 62    O O    . GLY A 1 7   ? 16.177  -22.639 2.433   1.00 0.00 ? 85  GLY A O    1  
ATOM 63    H H    . GLY A 1 7   ? 13.442  -23.624 1.403   1.00 0.00 ? 85  GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7   ? 15.366  -23.801 0.062   1.00 0.00 ? 85  GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7   ? 15.044  -22.194 -0.573  1.00 0.00 ? 85  GLY A HA3  1  
ATOM 66    N N    . ARG A 1 8   ? 16.848  -21.236 0.807   1.00 0.00 ? 86  ARG A N    1  
ATOM 67    C CA   . ARG A 1 8   ? 17.867  -20.594 1.630   1.00 0.00 ? 86  ARG A CA   1  
ATOM 68    C C    . ARG A 1 8   ? 17.301  -20.211 2.994   1.00 0.00 ? 86  ARG A C    1  
ATOM 69    O O    . ARG A 1 8   ? 16.100  -20.328 3.236   1.00 0.00 ? 86  ARG A O    1  
ATOM 70    C CB   . ARG A 1 8   ? 18.414  -19.351 0.925   1.00 0.00 ? 86  ARG A CB   1  
ATOM 71    C CG   . ARG A 1 8   ? 19.271  -19.668 -0.289  1.00 0.00 ? 86  ARG A CG   1  
ATOM 72    C CD   . ARG A 1 8   ? 19.566  -18.418 -1.104  1.00 0.00 ? 86  ARG A CD   1  
ATOM 73    N NE   . ARG A 1 8   ? 20.077  -18.739 -2.434  1.00 0.00 ? 86  ARG A NE   1  
ATOM 74    C CZ   . ARG A 1 8   ? 19.328  -19.246 -3.407  1.00 0.00 ? 86  ARG A CZ   1  
ATOM 75    N NH1  . ARG A 1 8   ? 18.041  -19.487 -3.200  1.00 0.00 ? 86  ARG A NH1  1  
ATOM 76    N NH2  . ARG A 1 8   ? 19.866  -19.512 -4.590  1.00 0.00 ? 86  ARG A NH2  1  
ATOM 77    H H    . ARG A 1 8   ? 16.726  -20.940 -0.119  1.00 0.00 ? 86  ARG A H    1  
ATOM 78    H HA   . ARG A 1 8   ? 18.672  -21.300 1.772   1.00 0.00 ? 86  ARG A HA   1  
ATOM 79    H HB2  . ARG A 1 8   ? 17.584  -18.740 0.603   1.00 0.00 ? 86  ARG A HB2  1  
ATOM 80    H HB3  . ARG A 1 8   ? 19.013  -18.790 1.626   1.00 0.00 ? 86  ARG A HB3  1  
ATOM 81    H HG2  . ARG A 1 8   ? 20.206  -20.096 0.043   1.00 0.00 ? 86  ARG A HG2  1  
ATOM 82    H HG3  . ARG A 1 8   ? 18.749  -20.378 -0.912  1.00 0.00 ? 86  ARG A HG3  1  
ATOM 83    H HD2  . ARG A 1 8   ? 18.654  -17.849 -1.208  1.00 0.00 ? 86  ARG A HD2  1  
ATOM 84    H HD3  . ARG A 1 8   ? 20.301  -17.827 -0.579  1.00 0.00 ? 86  ARG A HD3  1  
ATOM 85    H HE   . ARG A 1 8   ? 21.026  -18.569 -2.608  1.00 0.00 ? 86  ARG A HE   1  
ATOM 86    H HH11 . ARG A 1 8   ? 17.633  -19.287 -2.309  1.00 0.00 ? 86  ARG A HH11 1  
ATOM 87    H HH12 . ARG A 1 8   ? 17.479  -19.868 -3.934  1.00 0.00 ? 86  ARG A HH12 1  
ATOM 88    H HH21 . ARG A 1 8   ? 20.836  -19.331 -4.750  1.00 0.00 ? 86  ARG A HH21 1  
ATOM 89    H HH22 . ARG A 1 8   ? 19.302  -19.893 -5.321  1.00 0.00 ? 86  ARG A HH22 1  
ATOM 90    N N    . LYS A 1 9   ? 18.176  -19.753 3.884   1.00 0.00 ? 87  LYS A N    1  
ATOM 91    C CA   . LYS A 1 9   ? 17.765  -19.352 5.224   1.00 0.00 ? 87  LYS A CA   1  
ATOM 92    C C    . LYS A 1 9   ? 17.325  -17.891 5.244   1.00 0.00 ? 87  LYS A C    1  
ATOM 93    O O    . LYS A 1 9   ? 16.281  -17.556 5.802   1.00 0.00 ? 87  LYS A O    1  
ATOM 94    C CB   . LYS A 1 9   ? 18.911  -19.563 6.216   1.00 0.00 ? 87  LYS A CB   1  
ATOM 95    C CG   . LYS A 1 9   ? 20.161  -18.767 5.880   1.00 0.00 ? 87  LYS A CG   1  
ATOM 96    C CD   . LYS A 1 9   ? 21.244  -18.962 6.927   1.00 0.00 ? 87  LYS A CD   1  
ATOM 97    C CE   . LYS A 1 9   ? 22.598  -18.484 6.424   1.00 0.00 ? 87  LYS A CE   1  
ATOM 98    N NZ   . LYS A 1 9   ? 23.718  -19.047 7.228   1.00 0.00 ? 87  LYS A NZ   1  
ATOM 99    H H    . LYS A 1 9   ? 19.121  -19.683 3.632   1.00 0.00 ? 87  LYS A H    1  
ATOM 100   H HA   . LYS A 1 9   ? 16.930  -19.971 5.515   1.00 0.00 ? 87  LYS A HA   1  
ATOM 101   H HB2  . LYS A 1 9   ? 18.578  -19.271 7.201   1.00 0.00 ? 87  LYS A HB2  1  
ATOM 102   H HB3  . LYS A 1 9   ? 19.171  -20.612 6.229   1.00 0.00 ? 87  LYS A HB3  1  
ATOM 103   H HG2  . LYS A 1 9   ? 20.538  -19.094 4.922   1.00 0.00 ? 87  LYS A HG2  1  
ATOM 104   H HG3  . LYS A 1 9   ? 19.906  -17.718 5.830   1.00 0.00 ? 87  LYS A HG3  1  
ATOM 105   H HD2  . LYS A 1 9   ? 20.983  -18.401 7.812   1.00 0.00 ? 87  LYS A HD2  1  
ATOM 106   H HD3  . LYS A 1 9   ? 21.311  -20.013 7.172   1.00 0.00 ? 87  LYS A HD3  1  
ATOM 107   H HE2  . LYS A 1 9   ? 22.714  -18.791 5.396   1.00 0.00 ? 87  LYS A HE2  1  
ATOM 108   H HE3  . LYS A 1 9   ? 22.629  -17.406 6.484   1.00 0.00 ? 87  LYS A HE3  1  
ATOM 109   H HZ1  . LYS A 1 9   ? 23.811  -20.067 7.047   1.00 0.00 ? 87  LYS A HZ1  1  
ATOM 110   H HZ2  . LYS A 1 9   ? 23.539  -18.901 8.242   1.00 0.00 ? 87  LYS A HZ2  1  
ATOM 111   H HZ3  . LYS A 1 9   ? 24.611  -18.578 6.974   1.00 0.00 ? 87  LYS A HZ3  1  
ATOM 112   N N    . GLU A 1 10  ? 18.128  -17.027 4.630   1.00 0.00 ? 88  GLU A N    1  
ATOM 113   C CA   . GLU A 1 10  ? 17.819  -15.603 4.577   1.00 0.00 ? 88  GLU A CA   1  
ATOM 114   C C    . GLU A 1 10  ? 16.369  -15.376 4.158   1.00 0.00 ? 88  GLU A C    1  
ATOM 115   O O    . GLU A 1 10  ? 15.697  -14.481 4.670   1.00 0.00 ? 88  GLU A O    1  
ATOM 116   C CB   . GLU A 1 10  ? 18.760  -14.890 3.604   1.00 0.00 ? 88  GLU A CB   1  
ATOM 117   C CG   . GLU A 1 10  ? 18.267  -13.519 3.174   1.00 0.00 ? 88  GLU A CG   1  
ATOM 118   C CD   . GLU A 1 10  ? 18.090  -12.570 4.344   1.00 0.00 ? 88  GLU A CD   1  
ATOM 119   O OE1  . GLU A 1 10  ? 18.838  -12.705 5.335   1.00 0.00 ? 88  GLU A OE1  1  
ATOM 120   O OE2  . GLU A 1 10  ? 17.204  -11.693 4.268   1.00 0.00 ? 88  GLU A OE2  1  
ATOM 121   H H    . GLU A 1 10  ? 18.946  -17.356 4.203   1.00 0.00 ? 88  GLU A H    1  
ATOM 122   H HA   . GLU A 1 10  ? 17.963  -15.196 5.566   1.00 0.00 ? 88  GLU A HA   1  
ATOM 123   H HB2  . GLU A 1 10  ? 19.725  -14.772 4.076   1.00 0.00 ? 88  GLU A HB2  1  
ATOM 124   H HB3  . GLU A 1 10  ? 18.875  -15.501 2.721   1.00 0.00 ? 88  GLU A HB3  1  
ATOM 125   H HG2  . GLU A 1 10  ? 18.983  -13.091 2.489   1.00 0.00 ? 88  GLU A HG2  1  
ATOM 126   H HG3  . GLU A 1 10  ? 17.316  -13.633 2.675   1.00 0.00 ? 88  GLU A HG3  1  
ATOM 127   N N    . ASP A 1 11  ? 15.895  -16.192 3.224   1.00 0.00 ? 89  ASP A N    1  
ATOM 128   C CA   . ASP A 1 11  ? 14.525  -16.082 2.735   1.00 0.00 ? 89  ASP A CA   1  
ATOM 129   C C    . ASP A 1 11  ? 13.577  -15.684 3.862   1.00 0.00 ? 89  ASP A C    1  
ATOM 130   O O    . ASP A 1 11  ? 12.899  -14.659 3.784   1.00 0.00 ? 89  ASP A O    1  
ATOM 131   C CB   . ASP A 1 11  ? 14.074  -17.405 2.115   1.00 0.00 ? 89  ASP A CB   1  
ATOM 132   C CG   . ASP A 1 11  ? 12.843  -17.246 1.244   1.00 0.00 ? 89  ASP A CG   1  
ATOM 133   O OD1  . ASP A 1 11  ? 12.674  -16.161 0.648   1.00 0.00 ? 89  ASP A OD1  1  
ATOM 134   O OD2  . ASP A 1 11  ? 12.050  -18.206 1.158   1.00 0.00 ? 89  ASP A OD2  1  
ATOM 135   H H    . ASP A 1 11  ? 16.480  -16.887 2.854   1.00 0.00 ? 89  ASP A H    1  
ATOM 136   H HA   . ASP A 1 11  ? 14.505  -15.314 1.977   1.00 0.00 ? 89  ASP A HA   1  
ATOM 137   H HB2  . ASP A 1 11  ? 14.874  -17.801 1.507   1.00 0.00 ? 89  ASP A HB2  1  
ATOM 138   H HB3  . ASP A 1 11  ? 13.846  -18.106 2.905   1.00 0.00 ? 89  ASP A HB3  1  
ATOM 139   N N    . HIS A 1 12  ? 13.534  -16.502 4.909   1.00 0.00 ? 90  HIS A N    1  
ATOM 140   C CA   . HIS A 1 12  ? 12.668  -16.236 6.052   1.00 0.00 ? 90  HIS A CA   1  
ATOM 141   C C    . HIS A 1 12  ? 13.107  -14.970 6.783   1.00 0.00 ? 90  HIS A C    1  
ATOM 142   O O    . HIS A 1 12  ? 12.281  -14.241 7.332   1.00 0.00 ? 90  HIS A O    1  
ATOM 143   C CB   . HIS A 1 12  ? 12.679  -17.424 7.014   1.00 0.00 ? 90  HIS A CB   1  
ATOM 144   C CG   . HIS A 1 12  ? 11.568  -17.391 8.019   1.00 0.00 ? 90  HIS A CG   1  
ATOM 145   N ND1  . HIS A 1 12  ? 11.758  -17.649 9.360   1.00 0.00 ? 90  HIS A ND1  1  
ATOM 146   C CD2  . HIS A 1 12  ? 10.249  -17.127 7.871   1.00 0.00 ? 90  HIS A CD2  1  
ATOM 147   C CE1  . HIS A 1 12  ? 10.604  -17.547 9.994   1.00 0.00 ? 90  HIS A CE1  1  
ATOM 148   N NE2  . HIS A 1 12  ? 9.672   -17.230 9.113   1.00 0.00 ? 90  HIS A NE2  1  
ATOM 149   H H    . HIS A 1 12  ? 14.098  -17.303 4.913   1.00 0.00 ? 90  HIS A H    1  
ATOM 150   H HA   . HIS A 1 12  ? 11.665  -16.093 5.682   1.00 0.00 ? 90  HIS A HA   1  
ATOM 151   H HB2  . HIS A 1 12  ? 12.586  -18.339 6.447   1.00 0.00 ? 90  HIS A HB2  1  
ATOM 152   H HB3  . HIS A 1 12  ? 13.615  -17.434 7.554   1.00 0.00 ? 90  HIS A HB3  1  
ATOM 153   H HD2  . HIS A 1 12  ? 9.743   -16.881 6.948   1.00 0.00 ? 90  HIS A HD2  1  
ATOM 154   H HE1  . HIS A 1 12  ? 10.448  -17.696 11.052  1.00 0.00 ? 90  HIS A HE1  1  
ATOM 155   H HE2  . HIS A 1 12  ? 8.712   -17.177 9.302   1.00 0.00 ? 90  HIS A HE2  1  
ATOM 156   N N    . ALA A 1 13  ? 14.412  -14.717 6.787   1.00 0.00 ? 91  ALA A N    1  
ATOM 157   C CA   . ALA A 1 13  ? 14.959  -13.540 7.449   1.00 0.00 ? 91  ALA A CA   1  
ATOM 158   C C    . ALA A 1 13  ? 14.426  -12.258 6.819   1.00 0.00 ? 91  ALA A C    1  
ATOM 159   O O    . ALA A 1 13  ? 14.048  -11.320 7.522   1.00 0.00 ? 91  ALA A O    1  
ATOM 160   C CB   . ALA A 1 13  ? 16.480  -13.564 7.395   1.00 0.00 ? 91  ALA A CB   1  
ATOM 161   H H    . ALA A 1 13  ? 15.020  -15.336 6.332   1.00 0.00 ? 91  ALA A H    1  
ATOM 162   H HA   . ALA A 1 13  ? 14.660  -13.571 8.487   1.00 0.00 ? 91  ALA A HA   1  
ATOM 163   H HB1  . ALA A 1 13  ? 16.870  -12.692 7.900   1.00 0.00 ? 91  ALA A HB1  1  
ATOM 164   H HB2  . ALA A 1 13  ? 16.843  -14.456 7.883   1.00 0.00 ? 91  ALA A HB2  1  
ATOM 165   H HB3  . ALA A 1 13  ? 16.803  -13.559 6.365   1.00 0.00 ? 91  ALA A HB3  1  
ATOM 166   N N    . ARG A 1 14  ? 14.399  -12.223 5.490   1.00 0.00 ? 92  ARG A N    1  
ATOM 167   C CA   . ARG A 1 14  ? 13.913  -11.055 4.766   1.00 0.00 ? 92  ARG A CA   1  
ATOM 168   C C    . ARG A 1 14  ? 12.398  -10.925 4.897   1.00 0.00 ? 92  ARG A C    1  
ATOM 169   O O    . ARG A 1 14  ? 11.865  -9.819  4.996   1.00 0.00 ? 92  ARG A O    1  
ATOM 170   C CB   . ARG A 1 14  ? 14.303  -11.146 3.290   1.00 0.00 ? 92  ARG A CB   1  
ATOM 171   C CG   . ARG A 1 14  ? 14.367  -9.796  2.593   1.00 0.00 ? 92  ARG A CG   1  
ATOM 172   C CD   . ARG A 1 14  ? 15.275  -9.842  1.374   1.00 0.00 ? 92  ARG A CD   1  
ATOM 173   N NE   . ARG A 1 14  ? 14.658  -10.553 0.258   1.00 0.00 ? 92  ARG A NE   1  
ATOM 174   C CZ   . ARG A 1 14  ? 15.300  -10.859 -0.864  1.00 0.00 ? 92  ARG A CZ   1  
ATOM 175   N NH1  . ARG A 1 14  ? 16.571  -10.516 -1.019  1.00 0.00 ? 92  ARG A NH1  1  
ATOM 176   N NH2  . ARG A 1 14  ? 14.669  -11.508 -1.835  1.00 0.00 ? 92  ARG A NH2  1  
ATOM 177   H H    . ARG A 1 14  ? 14.713  -13.002 4.985   1.00 0.00 ? 92  ARG A H    1  
ATOM 178   H HA   . ARG A 1 14  ? 14.376  -10.181 5.198   1.00 0.00 ? 92  ARG A HA   1  
ATOM 179   H HB2  . ARG A 1 14  ? 15.274  -11.612 3.213   1.00 0.00 ? 92  ARG A HB2  1  
ATOM 180   H HB3  . ARG A 1 14  ? 13.577  -11.758 2.776   1.00 0.00 ? 92  ARG A HB3  1  
ATOM 181   H HG2  . ARG A 1 14  ? 13.373  -9.517  2.277   1.00 0.00 ? 92  ARG A HG2  1  
ATOM 182   H HG3  . ARG A 1 14  ? 14.747  -9.061  3.287   1.00 0.00 ? 92  ARG A HG3  1  
ATOM 183   H HD2  . ARG A 1 14  ? 15.493  -8.830  1.066   1.00 0.00 ? 92  ARG A HD2  1  
ATOM 184   H HD3  . ARG A 1 14  ? 16.193  -10.342 1.644   1.00 0.00 ? 92  ARG A HD3  1  
ATOM 185   H HE   . ARG A 1 14  ? 13.719  -10.816 0.351   1.00 0.00 ? 92  ARG A HE   1  
ATOM 186   H HH11 . ARG A 1 14  ? 17.049  -10.028 -0.289  1.00 0.00 ? 92  ARG A HH11 1  
ATOM 187   H HH12 . ARG A 1 14  ? 17.053  -10.748 -1.864  1.00 0.00 ? 92  ARG A HH12 1  
ATOM 188   H HH21 . ARG A 1 14  ? 13.711  -11.768 -1.722  1.00 0.00 ? 92  ARG A HH21 1  
ATOM 189   H HH22 . ARG A 1 14  ? 15.153  -11.737 -2.679  1.00 0.00 ? 92  ARG A HH22 1  
ATOM 190   N N    . LEU A 1 15  ? 11.710  -12.061 4.896   1.00 0.00 ? 93  LEU A N    1  
ATOM 191   C CA   . LEU A 1 15  ? 10.256  -12.075 5.014   1.00 0.00 ? 93  LEU A CA   1  
ATOM 192   C C    . LEU A 1 15  ? 9.816   -11.558 6.379   1.00 0.00 ? 93  LEU A C    1  
ATOM 193   O O    . LEU A 1 15  ? 8.891   -10.751 6.480   1.00 0.00 ? 93  LEU A O    1  
ATOM 194   C CB   . LEU A 1 15  ? 9.721   -13.491 4.796   1.00 0.00 ? 93  LEU A CB   1  
ATOM 195   C CG   . LEU A 1 15  ? 9.608   -13.950 3.341   1.00 0.00 ? 93  LEU A CG   1  
ATOM 196   C CD1  . LEU A 1 15  ? 9.257   -15.428 3.273   1.00 0.00 ? 93  LEU A CD1  1  
ATOM 197   C CD2  . LEU A 1 15  ? 8.570   -13.119 2.600   1.00 0.00 ? 93  LEU A CD2  1  
ATOM 198   H H    . LEU A 1 15  ? 12.190  -12.911 4.814   1.00 0.00 ? 93  LEU A H    1  
ATOM 199   H HA   . LEU A 1 15  ? 9.856   -11.426 4.250   1.00 0.00 ? 93  LEU A HA   1  
ATOM 200   H HB2  . LEU A 1 15  ? 10.379  -14.176 5.308   1.00 0.00 ? 93  LEU A HB2  1  
ATOM 201   H HB3  . LEU A 1 15  ? 8.736   -13.544 5.238   1.00 0.00 ? 93  LEU A HB3  1  
ATOM 202   H HG   . LEU A 1 15  ? 10.561  -13.810 2.851   1.00 0.00 ? 93  LEU A HG   1  
ATOM 203   H HD11 . LEU A 1 15  ? 10.072  -16.010 3.677   1.00 0.00 ? 93  LEU A HD11 1  
ATOM 204   H HD12 . LEU A 1 15  ? 9.088   -15.711 2.244   1.00 0.00 ? 93  LEU A HD12 1  
ATOM 205   H HD13 . LEU A 1 15  ? 8.362   -15.612 3.848   1.00 0.00 ? 93  LEU A HD13 1  
ATOM 206   H HD21 . LEU A 1 15  ? 7.720   -13.739 2.356   1.00 0.00 ? 93  LEU A HD21 1  
ATOM 207   H HD22 . LEU A 1 15  ? 9.004   -12.730 1.690   1.00 0.00 ? 93  LEU A HD22 1  
ATOM 208   H HD23 . LEU A 1 15  ? 8.251   -12.300 3.226   1.00 0.00 ? 93  LEU A HD23 1  
ATOM 209   N N    . ARG A 1 16  ? 10.485  -12.026 7.428   1.00 0.00 ? 94  ARG A N    1  
ATOM 210   C CA   . ARG A 1 16  ? 10.163  -11.609 8.788   1.00 0.00 ? 94  ARG A CA   1  
ATOM 211   C C    . ARG A 1 16  ? 10.606  -10.170 9.035   1.00 0.00 ? 94  ARG A C    1  
ATOM 212   O O    . ARG A 1 16  ? 9.870   -9.376  9.620   1.00 0.00 ? 94  ARG A O    1  
ATOM 213   C CB   . ARG A 1 16  ? 10.831  -12.541 9.801   1.00 0.00 ? 94  ARG A CB   1  
ATOM 214   C CG   . ARG A 1 16  ? 10.545  -12.172 11.247  1.00 0.00 ? 94  ARG A CG   1  
ATOM 215   C CD   . ARG A 1 16  ? 11.336  -13.043 12.211  1.00 0.00 ? 94  ARG A CD   1  
ATOM 216   N NE   . ARG A 1 16  ? 10.726  -14.358 12.386  1.00 0.00 ? 94  ARG A NE   1  
ATOM 217   C CZ   . ARG A 1 16  ? 11.027  -15.180 13.386  1.00 0.00 ? 94  ARG A CZ   1  
ATOM 218   N NH1  . ARG A 1 16  ? 11.924  -14.825 14.294  1.00 0.00 ? 94  ARG A NH1  1  
ATOM 219   N NH2  . ARG A 1 16  ? 10.428  -16.361 13.478  1.00 0.00 ? 94  ARG A NH2  1  
ATOM 220   H H    . ARG A 1 16  ? 11.211  -12.667 7.284   1.00 0.00 ? 94  ARG A H    1  
ATOM 221   H HA   . ARG A 1 16  ? 9.091   -11.670 8.908   1.00 0.00 ? 94  ARG A HA   1  
ATOM 222   H HB2  . ARG A 1 16  ? 10.478  -13.548 9.633   1.00 0.00 ? 94  ARG A HB2  1  
ATOM 223   H HB3  . ARG A 1 16  ? 11.899  -12.512 9.648   1.00 0.00 ? 94  ARG A HB3  1  
ATOM 224   H HG2  . ARG A 1 16  ? 10.819  -11.139 11.407  1.00 0.00 ? 94  ARG A HG2  1  
ATOM 225   H HG3  . ARG A 1 16  ? 9.491   -12.302 11.441  1.00 0.00 ? 94  ARG A HG3  1  
ATOM 226   H HD2  . ARG A 1 16  ? 12.336  -13.170 11.823  1.00 0.00 ? 94  ARG A HD2  1  
ATOM 227   H HD3  . ARG A 1 16  ? 11.383  -12.547 13.168  1.00 0.00 ? 94  ARG A HD3  1  
ATOM 228   H HE   . ARG A 1 16  ? 10.060  -14.642 11.726  1.00 0.00 ? 94  ARG A HE   1  
ATOM 229   H HH11 . ARG A 1 16  ? 12.376  -13.935 14.228  1.00 0.00 ? 94  ARG A HH11 1  
ATOM 230   H HH12 . ARG A 1 16  ? 12.148  -15.445 15.046  1.00 0.00 ? 94  ARG A HH12 1  
ATOM 231   H HH21 . ARG A 1 16  ? 9.751   -16.633 12.795  1.00 0.00 ? 94  ARG A HH21 1  
ATOM 232   H HH22 . ARG A 1 16  ? 10.655  -16.979 14.230  1.00 0.00 ? 94  ARG A HH22 1  
ATOM 233   N N    . ALA A 1 17  ? 11.812  -9.842  8.584   1.00 0.00 ? 95  ALA A N    1  
ATOM 234   C CA   . ALA A 1 17  ? 12.352  -8.499  8.755   1.00 0.00 ? 95  ALA A CA   1  
ATOM 235   C C    . ALA A 1 17  ? 11.534  -7.475  7.976   1.00 0.00 ? 95  ALA A C    1  
ATOM 236   O O    . ALA A 1 17  ? 11.194  -6.411  8.496   1.00 0.00 ? 95  ALA A O    1  
ATOM 237   C CB   . ALA A 1 17  ? 13.809  -8.457  8.317   1.00 0.00 ? 95  ALA A CB   1  
ATOM 238   H H    . ALA A 1 17  ? 12.351  -10.520 8.125   1.00 0.00 ? 95  ALA A H    1  
ATOM 239   H HA   . ALA A 1 17  ? 12.311  -8.254  9.807   1.00 0.00 ? 95  ALA A HA   1  
ATOM 240   H HB1  . ALA A 1 17  ? 14.334  -9.305  8.733   1.00 0.00 ? 95  ALA A HB1  1  
ATOM 241   H HB2  . ALA A 1 17  ? 13.862  -8.494  7.239   1.00 0.00 ? 95  ALA A HB2  1  
ATOM 242   H HB3  . ALA A 1 17  ? 14.264  -7.543  8.669   1.00 0.00 ? 95  ALA A HB3  1  
ATOM 243   N N    . LEU A 1 18  ? 11.220  -7.802  6.728   1.00 0.00 ? 96  LEU A N    1  
ATOM 244   C CA   . LEU A 1 18  ? 10.441  -6.910  5.876   1.00 0.00 ? 96  LEU A CA   1  
ATOM 245   C C    . LEU A 1 18  ? 9.020   -6.751  6.409   1.00 0.00 ? 96  LEU A C    1  
ATOM 246   O O    . LEU A 1 18  ? 8.501   -5.639  6.498   1.00 0.00 ? 96  LEU A O    1  
ATOM 247   C CB   . LEU A 1 18  ? 10.403  -7.444  4.443   1.00 0.00 ? 96  LEU A CB   1  
ATOM 248   C CG   . LEU A 1 18  ? 10.018  -6.435  3.361   1.00 0.00 ? 96  LEU A CG   1  
ATOM 249   C CD1  . LEU A 1 18  ? 10.293  -7.005  1.978   1.00 0.00 ? 96  LEU A CD1  1  
ATOM 250   C CD2  . LEU A 1 18  ? 8.554   -6.041  3.496   1.00 0.00 ? 96  LEU A CD2  1  
ATOM 251   H H    . LEU A 1 18  ? 11.518  -8.663  6.369   1.00 0.00 ? 96  LEU A H    1  
ATOM 252   H HA   . LEU A 1 18  ? 10.924  -5.944  5.879   1.00 0.00 ? 96  LEU A HA   1  
ATOM 253   H HB2  . LEU A 1 18  ? 11.385  -7.824  4.206   1.00 0.00 ? 96  LEU A HB2  1  
ATOM 254   H HB3  . LEU A 1 18  ? 9.688   -8.254  4.412   1.00 0.00 ? 96  LEU A HB3  1  
ATOM 255   H HG   . LEU A 1 18  ? 10.617  -5.543  3.479   1.00 0.00 ? 96  LEU A HG   1  
ATOM 256   H HD11 . LEU A 1 18  ? 10.441  -8.071  2.051   1.00 0.00 ? 96  LEU A HD11 1  
ATOM 257   H HD12 . LEU A 1 18  ? 11.181  -6.545  1.570   1.00 0.00 ? 96  LEU A HD12 1  
ATOM 258   H HD13 . LEU A 1 18  ? 9.453   -6.800  1.331   1.00 0.00 ? 96  LEU A HD13 1  
ATOM 259   H HD21 . LEU A 1 18  ? 8.220   -5.581  2.577   1.00 0.00 ? 96  LEU A HD21 1  
ATOM 260   H HD22 . LEU A 1 18  ? 8.444   -5.340  4.310   1.00 0.00 ? 96  LEU A HD22 1  
ATOM 261   H HD23 . LEU A 1 18  ? 7.961   -6.921  3.694   1.00 0.00 ? 96  LEU A HD23 1  
ATOM 262   N N    . ASN A 1 19  ? 8.399   -7.870  6.765   1.00 0.00 ? 97  ASN A N    1  
ATOM 263   C CA   . ASN A 1 19  ? 7.039   -7.855  7.291   1.00 0.00 ? 97  ASN A CA   1  
ATOM 264   C C    . ASN A 1 19  ? 6.967   -7.058  8.590   1.00 0.00 ? 97  ASN A C    1  
ATOM 265   O O    . ASN A 1 19  ? 6.086   -6.218  8.767   1.00 0.00 ? 97  ASN A O    1  
ATOM 266   C CB   . ASN A 1 19  ? 6.546   -9.284  7.529   1.00 0.00 ? 97  ASN A CB   1  
ATOM 267   C CG   . ASN A 1 19  ? 5.480   -9.356  8.605   1.00 0.00 ? 97  ASN A CG   1  
ATOM 268   O OD1  . ASN A 1 19  ? 4.414   -8.753  8.480   1.00 0.00 ? 97  ASN A OD1  1  
ATOM 269   N ND2  . ASN A 1 19  ? 5.764   -10.097 9.670   1.00 0.00 ? 97  ASN A ND2  1  
ATOM 270   H H    . ASN A 1 19  ? 8.865   -8.727  6.671   1.00 0.00 ? 97  ASN A H    1  
ATOM 271   H HA   . ASN A 1 19  ? 6.404   -7.383  6.556   1.00 0.00 ? 97  ASN A HA   1  
ATOM 272   H HB2  . ASN A 1 19  ? 6.129   -9.672  6.611   1.00 0.00 ? 97  ASN A HB2  1  
ATOM 273   H HB3  . ASN A 1 19  ? 7.379   -9.901  7.830   1.00 0.00 ? 97  ASN A HB3  1  
ATOM 274   H HD21 . ASN A 1 19  ? 6.633   -10.548 9.702   1.00 0.00 ? 97  ASN A HD21 1  
ATOM 275   H HD22 . ASN A 1 19  ? 5.092   -10.161 10.381  1.00 0.00 ? 97  ASN A HD22 1  
ATOM 276   N N    . GLY A 1 20  ? 7.901   -7.328  9.496   1.00 0.00 ? 98  GLY A N    1  
ATOM 277   C CA   . GLY A 1 20  ? 7.927   -6.627  10.767  1.00 0.00 ? 98  GLY A CA   1  
ATOM 278   C C    . GLY A 1 20  ? 8.371   -5.185  10.625  1.00 0.00 ? 98  GLY A C    1  
ATOM 279   O O    . GLY A 1 20  ? 7.845   -4.296  11.296  1.00 0.00 ? 98  GLY A O    1  
ATOM 280   H H    . GLY A 1 20  ? 8.579   -8.008  9.300   1.00 0.00 ? 98  GLY A H    1  
ATOM 281   H HA2  . GLY A 1 20  ? 6.936   -6.647  11.197  1.00 0.00 ? 98  GLY A HA2  1  
ATOM 282   H HA3  . GLY A 1 20  ? 8.608   -7.137  11.432  1.00 0.00 ? 98  GLY A HA3  1  
ATOM 283   N N    . LEU A 1 21  ? 9.343   -4.950  9.750   1.00 0.00 ? 99  LEU A N    1  
ATOM 284   C CA   . LEU A 1 21  ? 9.859   -3.605  9.523   1.00 0.00 ? 99  LEU A CA   1  
ATOM 285   C C    . LEU A 1 21  ? 8.760   -2.679  9.011   1.00 0.00 ? 99  LEU A C    1  
ATOM 286   O O    . LEU A 1 21  ? 8.575   -1.574  9.525   1.00 0.00 ? 99  LEU A O    1  
ATOM 287   C CB   . LEU A 1 21  ? 11.016  -3.643  8.523   1.00 0.00 ? 99  LEU A CB   1  
ATOM 288   C CG   . LEU A 1 21  ? 12.373  -4.071  9.083   1.00 0.00 ? 99  LEU A CG   1  
ATOM 289   C CD1  . LEU A 1 21  ? 13.298  -4.515  7.961   1.00 0.00 ? 99  LEU A CD1  1  
ATOM 290   C CD2  . LEU A 1 21  ? 13.003  -2.937  9.879   1.00 0.00 ? 99  LEU A CD2  1  
ATOM 291   H H    . LEU A 1 21  ? 9.722   -5.698  9.245   1.00 0.00 ? 99  LEU A H    1  
ATOM 292   H HA   . LEU A 1 21  ? 10.222  -3.226  10.467  1.00 0.00 ? 99  LEU A HA   1  
ATOM 293   H HB2  . LEU A 1 21  ? 10.751  -4.334  7.737   1.00 0.00 ? 99  LEU A HB2  1  
ATOM 294   H HB3  . LEU A 1 21  ? 11.126  -2.652  8.107   1.00 0.00 ? 99  LEU A HB3  1  
ATOM 295   H HG   . LEU A 1 21  ? 12.232  -4.910  9.750   1.00 0.00 ? 99  LEU A HG   1  
ATOM 296   H HD11 . LEU A 1 21  ? 13.519  -5.566  8.071   1.00 0.00 ? 99  LEU A HD11 1  
ATOM 297   H HD12 . LEU A 1 21  ? 14.216  -3.947  8.005   1.00 0.00 ? 99  LEU A HD12 1  
ATOM 298   H HD13 . LEU A 1 21  ? 12.816  -4.345  7.009   1.00 0.00 ? 99  LEU A HD13 1  
ATOM 299   H HD21 . LEU A 1 21  ? 12.246  -2.206  10.124  1.00 0.00 ? 99  LEU A HD21 1  
ATOM 300   H HD22 . LEU A 1 21  ? 13.776  -2.468  9.287   1.00 0.00 ? 99  LEU A HD22 1  
ATOM 301   H HD23 . LEU A 1 21  ? 13.433  -3.330  10.788  1.00 0.00 ? 99  LEU A HD23 1  
ATOM 302   N N    . LEU A 1 22  ? 8.033   -3.136  7.998   1.00 0.00 ? 100 LEU A N    1  
ATOM 303   C CA   . LEU A 1 22  ? 6.950   -2.350  7.418   1.00 0.00 ? 100 LEU A CA   1  
ATOM 304   C C    . LEU A 1 22  ? 5.810   -2.172  8.416   1.00 0.00 ? 100 LEU A C    1  
ATOM 305   O O    . LEU A 1 22  ? 5.196   -1.108  8.489   1.00 0.00 ? 100 LEU A O    1  
ATOM 306   C CB   . LEU A 1 22  ? 6.429   -3.023  6.147   1.00 0.00 ? 100 LEU A CB   1  
ATOM 307   C CG   . LEU A 1 22  ? 7.260   -2.804  4.882   1.00 0.00 ? 100 LEU A CG   1  
ATOM 308   C CD1  . LEU A 1 22  ? 6.764   -3.697  3.756   1.00 0.00 ? 100 LEU A CD1  1  
ATOM 309   C CD2  . LEU A 1 22  ? 7.217   -1.341  4.463   1.00 0.00 ? 100 LEU A CD2  1  
ATOM 310   H H    . LEU A 1 22  ? 8.227   -4.023  7.632   1.00 0.00 ? 100 LEU A H    1  
ATOM 311   H HA   . LEU A 1 22  ? 7.345   -1.378  7.165   1.00 0.00 ? 100 LEU A HA   1  
ATOM 312   H HB2  . LEU A 1 22  ? 6.382   -4.085  6.331   1.00 0.00 ? 100 LEU A HB2  1  
ATOM 313   H HB3  . LEU A 1 22  ? 5.433   -2.648  5.959   1.00 0.00 ? 100 LEU A HB3  1  
ATOM 314   H HG   . LEU A 1 22  ? 8.289   -3.064  5.086   1.00 0.00 ? 100 LEU A HG   1  
ATOM 315   H HD11 . LEU A 1 22  ? 7.517   -3.755  2.985   1.00 0.00 ? 100 LEU A HD11 1  
ATOM 316   H HD12 . LEU A 1 22  ? 5.856   -3.285  3.343   1.00 0.00 ? 100 LEU A HD12 1  
ATOM 317   H HD13 . LEU A 1 22  ? 6.567   -4.687  4.142   1.00 0.00 ? 100 LEU A HD13 1  
ATOM 318   H HD21 . LEU A 1 22  ? 8.188   -1.045  4.094   1.00 0.00 ? 100 LEU A HD21 1  
ATOM 319   H HD22 . LEU A 1 22  ? 6.954   -0.731  5.315   1.00 0.00 ? 100 LEU A HD22 1  
ATOM 320   H HD23 . LEU A 1 22  ? 6.481   -1.211  3.685   1.00 0.00 ? 100 LEU A HD23 1  
ATOM 321   N N    . TYR A 1 23  ? 5.535   -3.220  9.185   1.00 0.00 ? 101 TYR A N    1  
ATOM 322   C CA   . TYR A 1 23  ? 4.470   -3.180  10.179  1.00 0.00 ? 101 TYR A CA   1  
ATOM 323   C C    . TYR A 1 23  ? 4.805   -2.197  11.297  1.00 0.00 ? 101 TYR A C    1  
ATOM 324   O O    . TYR A 1 23  ? 3.948   -1.439  11.751  1.00 0.00 ? 101 TYR A O    1  
ATOM 325   C CB   . TYR A 1 23  ? 4.236   -4.574  10.764  1.00 0.00 ? 101 TYR A CB   1  
ATOM 326   C CG   . TYR A 1 23  ? 3.266   -4.590  11.923  1.00 0.00 ? 101 TYR A CG   1  
ATOM 327   C CD1  . TYR A 1 23  ? 1.919   -4.308  11.731  1.00 0.00 ? 101 TYR A CD1  1  
ATOM 328   C CD2  . TYR A 1 23  ? 3.696   -4.885  13.211  1.00 0.00 ? 101 TYR A CD2  1  
ATOM 329   C CE1  . TYR A 1 23  ? 1.028   -4.321  12.787  1.00 0.00 ? 101 TYR A CE1  1  
ATOM 330   C CE2  . TYR A 1 23  ? 2.813   -4.901  14.273  1.00 0.00 ? 101 TYR A CE2  1  
ATOM 331   C CZ   . TYR A 1 23  ? 1.480   -4.618  14.056  1.00 0.00 ? 101 TYR A CZ   1  
ATOM 332   O OH   . TYR A 1 23  ? 0.597   -4.632  15.112  1.00 0.00 ? 101 TYR A OH   1  
ATOM 333   H H    . TYR A 1 23  ? 6.060   -4.041  9.080   1.00 0.00 ? 101 TYR A H    1  
ATOM 334   H HA   . TYR A 1 23  ? 3.567   -2.852  9.685   1.00 0.00 ? 101 TYR A HA   1  
ATOM 335   H HB2  . TYR A 1 23  ? 3.842   -5.218  9.993   1.00 0.00 ? 101 TYR A HB2  1  
ATOM 336   H HB3  . TYR A 1 23  ? 5.177   -4.973  11.113  1.00 0.00 ? 101 TYR A HB3  1  
ATOM 337   H HD1  . TYR A 1 23  ? 1.568   -4.076  10.736  1.00 0.00 ? 101 TYR A HD1  1  
ATOM 338   H HD2  . TYR A 1 23  ? 4.741   -5.105  13.377  1.00 0.00 ? 101 TYR A HD2  1  
ATOM 339   H HE1  . TYR A 1 23  ? -0.015  -4.100  12.618  1.00 0.00 ? 101 TYR A HE1  1  
ATOM 340   H HE2  . TYR A 1 23  ? 3.166   -5.133  15.267  1.00 0.00 ? 101 TYR A HE2  1  
ATOM 341   H HH   . TYR A 1 23  ? -0.179  -5.144  14.873  1.00 0.00 ? 101 TYR A HH   1  
ATOM 342   N N    . LYS A 1 24  ? 6.058   -2.216  11.737  1.00 0.00 ? 102 LYS A N    1  
ATOM 343   C CA   . LYS A 1 24  ? 6.510   -1.327  12.800  1.00 0.00 ? 102 LYS A CA   1  
ATOM 344   C C    . LYS A 1 24  ? 6.656   0.103   12.289  1.00 0.00 ? 102 LYS A C    1  
ATOM 345   O O    . LYS A 1 24  ? 6.288   1.057   12.973  1.00 0.00 ? 102 LYS A O    1  
ATOM 346   C CB   . LYS A 1 24  ? 7.845   -1.815  13.368  1.00 0.00 ? 102 LYS A CB   1  
ATOM 347   C CG   . LYS A 1 24  ? 8.181   -1.223  14.726  1.00 0.00 ? 102 LYS A CG   1  
ATOM 348   C CD   . LYS A 1 24  ? 8.931   0.091   14.592  1.00 0.00 ? 102 LYS A CD   1  
ATOM 349   C CE   . LYS A 1 24  ? 10.403  -0.136  14.285  1.00 0.00 ? 102 LYS A CE   1  
ATOM 350   N NZ   . LYS A 1 24  ? 11.181  -0.465  15.511  1.00 0.00 ? 102 LYS A NZ   1  
ATOM 351   H H    . LYS A 1 24  ? 6.696   -2.844  11.335  1.00 0.00 ? 102 LYS A H    1  
ATOM 352   H HA   . LYS A 1 24  ? 5.768   -1.342  13.584  1.00 0.00 ? 102 LYS A HA   1  
ATOM 353   H HB2  . LYS A 1 24  ? 7.810   -2.890  13.466  1.00 0.00 ? 102 LYS A HB2  1  
ATOM 354   H HB3  . LYS A 1 24  ? 8.634   -1.550  12.679  1.00 0.00 ? 102 LYS A HB3  1  
ATOM 355   H HG2  . LYS A 1 24  ? 7.264   -1.048  15.269  1.00 0.00 ? 102 LYS A HG2  1  
ATOM 356   H HG3  . LYS A 1 24  ? 8.796   -1.925  15.272  1.00 0.00 ? 102 LYS A HG3  1  
ATOM 357   H HD2  . LYS A 1 24  ? 8.493   0.666   13.790  1.00 0.00 ? 102 LYS A HD2  1  
ATOM 358   H HD3  . LYS A 1 24  ? 8.846   0.640   15.519  1.00 0.00 ? 102 LYS A HD3  1  
ATOM 359   H HE2  . LYS A 1 24  ? 10.489  -0.953  13.585  1.00 0.00 ? 102 LYS A HE2  1  
ATOM 360   H HE3  . LYS A 1 24  ? 10.808  0.762   13.842  1.00 0.00 ? 102 LYS A HE3  1  
ATOM 361   H HZ1  . LYS A 1 24  ? 10.940  0.198   16.275  1.00 0.00 ? 102 LYS A HZ1  1  
ATOM 362   H HZ2  . LYS A 1 24  ? 12.201  -0.396  15.317  1.00 0.00 ? 102 LYS A HZ2  1  
ATOM 363   H HZ3  . LYS A 1 24  ? 10.964  -1.433  15.824  1.00 0.00 ? 102 LYS A HZ3  1  
ATOM 364   N N    . ALA A 1 25  ? 7.193   0.243   11.081  1.00 0.00 ? 103 ALA A N    1  
ATOM 365   C CA   . ALA A 1 25  ? 7.383   1.556   10.477  1.00 0.00 ? 103 ALA A CA   1  
ATOM 366   C C    . ALA A 1 25  ? 6.046   2.185   10.100  1.00 0.00 ? 103 ALA A C    1  
ATOM 367   O O    . ALA A 1 25  ? 5.827   3.378   10.318  1.00 0.00 ? 103 ALA A O    1  
ATOM 368   C CB   . ALA A 1 25  ? 8.282   1.449   9.254   1.00 0.00 ? 103 ALA A CB   1  
ATOM 369   H H    . ALA A 1 25  ? 7.466   -0.556  10.584  1.00 0.00 ? 103 ALA A H    1  
ATOM 370   H HA   . ALA A 1 25  ? 7.876   2.188   11.201  1.00 0.00 ? 103 ALA A HA   1  
ATOM 371   H HB1  . ALA A 1 25  ? 7.698   1.115   8.408   1.00 0.00 ? 103 ALA A HB1  1  
ATOM 372   H HB2  . ALA A 1 25  ? 8.711   2.415   9.037   1.00 0.00 ? 103 ALA A HB2  1  
ATOM 373   H HB3  . ALA A 1 25  ? 9.071   0.739   9.449   1.00 0.00 ? 103 ALA A HB3  1  
ATOM 374   N N    . LEU A 1 26  ? 5.156   1.378   9.534   1.00 0.00 ? 104 LEU A N    1  
ATOM 375   C CA   . LEU A 1 26  ? 3.840   1.857   9.126   1.00 0.00 ? 104 LEU A CA   1  
ATOM 376   C C    . LEU A 1 26  ? 3.041   2.345   10.330  1.00 0.00 ? 104 LEU A C    1  
ATOM 377   O O    . LEU A 1 26  ? 2.496   3.450   10.322  1.00 0.00 ? 104 LEU A O    1  
ATOM 378   C CB   . LEU A 1 26  ? 3.073   0.747   8.405   1.00 0.00 ? 104 LEU A CB   1  
ATOM 379   C CG   . LEU A 1 26  ? 3.497   0.464   6.964   1.00 0.00 ? 104 LEU A CG   1  
ATOM 380   C CD1  . LEU A 1 26  ? 3.022   -0.913  6.528   1.00 0.00 ? 104 LEU A CD1  1  
ATOM 381   C CD2  . LEU A 1 26  ? 2.959   1.537   6.029   1.00 0.00 ? 104 LEU A CD2  1  
ATOM 382   H H    . LEU A 1 26  ? 5.389   0.438   9.386   1.00 0.00 ? 104 LEU A H    1  
ATOM 383   H HA   . LEU A 1 26  ? 3.984   2.684   8.446   1.00 0.00 ? 104 LEU A HA   1  
ATOM 384   H HB2  . LEU A 1 26  ? 3.198   -0.163  8.972   1.00 0.00 ? 104 LEU A HB2  1  
ATOM 385   H HB3  . LEU A 1 26  ? 2.027   1.022   8.396   1.00 0.00 ? 104 LEU A HB3  1  
ATOM 386   H HG   . LEU A 1 26  ? 4.577   0.478   6.904   1.00 0.00 ? 104 LEU A HG   1  
ATOM 387   H HD11 . LEU A 1 26  ? 3.430   -1.661  7.190   1.00 0.00 ? 104 LEU A HD11 1  
ATOM 388   H HD12 . LEU A 1 26  ? 3.353   -1.106  5.519   1.00 0.00 ? 104 LEU A HD12 1  
ATOM 389   H HD13 . LEU A 1 26  ? 1.943   -0.949  6.565   1.00 0.00 ? 104 LEU A HD13 1  
ATOM 390   H HD21 . LEU A 1 26  ? 1.902   1.381   5.874   1.00 0.00 ? 104 LEU A HD21 1  
ATOM 391   H HD22 . LEU A 1 26  ? 3.474   1.479   5.080   1.00 0.00 ? 104 LEU A HD22 1  
ATOM 392   H HD23 . LEU A 1 26  ? 3.120   2.510   6.467   1.00 0.00 ? 104 LEU A HD23 1  
ATOM 393   N N    . THR A 1 27  ? 2.976   1.515   11.366  1.00 0.00 ? 105 THR A N    1  
ATOM 394   C CA   . THR A 1 27  ? 2.245   1.862   12.578  1.00 0.00 ? 105 THR A CA   1  
ATOM 395   C C    . THR A 1 27  ? 2.881   3.054   13.283  1.00 0.00 ? 105 THR A C    1  
ATOM 396   O O    . THR A 1 27  ? 2.196   3.838   13.940  1.00 0.00 ? 105 THR A O    1  
ATOM 397   C CB   . THR A 1 27  ? 2.185   0.674   13.557  1.00 0.00 ? 105 THR A CB   1  
ATOM 398   O OG1  . THR A 1 27  ? 1.452   1.043   14.731  1.00 0.00 ? 105 THR A OG1  1  
ATOM 399   C CG2  . THR A 1 27  ? 3.584   0.224   13.948  1.00 0.00 ? 105 THR A CG2  1  
ATOM 400   H H    . THR A 1 27  ? 3.431   0.649   11.313  1.00 0.00 ? 105 THR A H    1  
ATOM 401   H HA   . THR A 1 27  ? 1.234   2.120   12.296  1.00 0.00 ? 105 THR A HA   1  
ATOM 402   H HB   . THR A 1 27  ? 1.681   -0.149  13.071  1.00 0.00 ? 105 THR A HB   1  
ATOM 403   H HG1  . THR A 1 27  ? 0.850   0.333   14.968  1.00 0.00 ? 105 THR A HG1  1  
ATOM 404   H HG21 . THR A 1 27  ? 3.549   -0.795  14.304  1.00 0.00 ? 105 THR A HG21 1  
ATOM 405   H HG22 . THR A 1 27  ? 3.964   0.865   14.730  1.00 0.00 ? 105 THR A HG22 1  
ATOM 406   H HG23 . THR A 1 27  ? 4.234   0.282   13.088  1.00 0.00 ? 105 THR A HG23 1  
ATOM 407   N N    . ASP A 1 28  ? 4.196   3.187   13.141  1.00 0.00 ? 106 ASP A N    1  
ATOM 408   C CA   . ASP A 1 28  ? 4.925   4.286   13.762  1.00 0.00 ? 106 ASP A CA   1  
ATOM 409   C C    . ASP A 1 28  ? 4.507   5.624   13.160  1.00 0.00 ? 106 ASP A C    1  
ATOM 410   O O    . ASP A 1 28  ? 4.336   6.612   13.876  1.00 0.00 ? 106 ASP A O    1  
ATOM 411   C CB   . ASP A 1 28  ? 6.432   4.085   13.595  1.00 0.00 ? 106 ASP A CB   1  
ATOM 412   C CG   . ASP A 1 28  ? 7.037   3.273   14.723  1.00 0.00 ? 106 ASP A CG   1  
ATOM 413   O OD1  . ASP A 1 28  ? 6.348   2.366   15.237  1.00 0.00 ? 106 ASP A OD1  1  
ATOM 414   O OD2  . ASP A 1 28  ? 8.199   3.544   15.092  1.00 0.00 ? 106 ASP A OD2  1  
ATOM 415   H H    . ASP A 1 28  ? 4.687   2.529   12.604  1.00 0.00 ? 106 ASP A H    1  
ATOM 416   H HA   . ASP A 1 28  ? 4.686   4.289   14.815  1.00 0.00 ? 106 ASP A HA   1  
ATOM 417   H HB2  . ASP A 1 28  ? 6.619   3.569   12.665  1.00 0.00 ? 106 ASP A HB2  1  
ATOM 418   H HB3  . ASP A 1 28  ? 6.916   5.050   13.570  1.00 0.00 ? 106 ASP A HB3  1  
ATOM 419   N N    . LEU A 1 29  ? 4.346   5.649   11.842  1.00 0.00 ? 107 LEU A N    1  
ATOM 420   C CA   . LEU A 1 29  ? 3.950   6.867   11.143  1.00 0.00 ? 107 LEU A CA   1  
ATOM 421   C C    . LEU A 1 29  ? 2.544   7.296   11.552  1.00 0.00 ? 107 LEU A C    1  
ATOM 422   O O    . LEU A 1 29  ? 2.248   8.489   11.636  1.00 0.00 ? 107 LEU A O    1  
ATOM 423   C CB   . LEU A 1 29  ? 4.010   6.652   9.630   1.00 0.00 ? 107 LEU A CB   1  
ATOM 424   C CG   . LEU A 1 29  ? 5.404   6.672   9.004   1.00 0.00 ? 107 LEU A CG   1  
ATOM 425   C CD1  . LEU A 1 29  ? 5.349   6.192   7.562   1.00 0.00 ? 107 LEU A CD1  1  
ATOM 426   C CD2  . LEU A 1 29  ? 6.003   8.070   9.080   1.00 0.00 ? 107 LEU A CD2  1  
ATOM 427   H H    . LEU A 1 29  ? 4.497   4.831   11.326  1.00 0.00 ? 107 LEU A H    1  
ATOM 428   H HA   . LEU A 1 29  ? 4.645   7.647   11.416  1.00 0.00 ? 107 LEU A HA   1  
ATOM 429   H HB2  . LEU A 1 29  ? 3.565   5.693   9.414   1.00 0.00 ? 107 LEU A HB2  1  
ATOM 430   H HB3  . LEU A 1 29  ? 3.425   7.432   9.163   1.00 0.00 ? 107 LEU A HB3  1  
ATOM 431   H HG   . LEU A 1 29  ? 6.049   6.001   9.554   1.00 0.00 ? 107 LEU A HG   1  
ATOM 432   H HD11 . LEU A 1 29  ? 6.292   6.397   7.078   1.00 0.00 ? 107 LEU A HD11 1  
ATOM 433   H HD12 . LEU A 1 29  ? 4.557   6.709   7.040   1.00 0.00 ? 107 LEU A HD12 1  
ATOM 434   H HD13 . LEU A 1 29  ? 5.158   5.129   7.544   1.00 0.00 ? 107 LEU A HD13 1  
ATOM 435   H HD21 . LEU A 1 29  ? 6.141   8.346   10.115  1.00 0.00 ? 107 LEU A HD21 1  
ATOM 436   H HD22 . LEU A 1 29  ? 5.334   8.774   8.606   1.00 0.00 ? 107 LEU A HD22 1  
ATOM 437   H HD23 . LEU A 1 29  ? 6.957   8.081   8.574   1.00 0.00 ? 107 LEU A HD23 1  
ATOM 438   N N    . LEU A 1 30  ? 1.683   6.318   11.808  1.00 0.00 ? 108 LEU A N    1  
ATOM 439   C CA   . LEU A 1 30  ? 0.309   6.594   12.211  1.00 0.00 ? 108 LEU A CA   1  
ATOM 440   C C    . LEU A 1 30  ? 0.249   7.051   13.665  1.00 0.00 ? 108 LEU A C    1  
ATOM 441   O O    . LEU A 1 30  ? -0.831  7.281   14.209  1.00 0.00 ? 108 LEU A O    1  
ATOM 442   C CB   . LEU A 1 30  ? -0.560  5.349   12.019  1.00 0.00 ? 108 LEU A CB   1  
ATOM 443   C CG   . LEU A 1 30  ? -1.051  5.086   10.595  1.00 0.00 ? 108 LEU A CG   1  
ATOM 444   C CD1  . LEU A 1 30  ? 0.044   5.395   9.587   1.00 0.00 ? 108 LEU A CD1  1  
ATOM 445   C CD2  . LEU A 1 30  ? -1.521  3.646   10.451  1.00 0.00 ? 108 LEU A CD2  1  
ATOM 446   H H    . LEU A 1 30  ? 1.978   5.387   11.724  1.00 0.00 ? 108 LEU A H    1  
ATOM 447   H HA   . LEU A 1 30  ? -0.068  7.386   11.581  1.00 0.00 ? 108 LEU A HA   1  
ATOM 448   H HB2  . LEU A 1 30  ? 0.017   4.493   12.333  1.00 0.00 ? 108 LEU A HB2  1  
ATOM 449   H HB3  . LEU A 1 30  ? -1.427  5.451   12.656  1.00 0.00 ? 108 LEU A HB3  1  
ATOM 450   H HG   . LEU A 1 30  ? -1.890  5.735   10.385  1.00 0.00 ? 108 LEU A HG   1  
ATOM 451   H HD11 . LEU A 1 30  ? -0.387  5.478   8.601   1.00 0.00 ? 108 LEU A HD11 1  
ATOM 452   H HD12 . LEU A 1 30  ? 0.775   4.600   9.594   1.00 0.00 ? 108 LEU A HD12 1  
ATOM 453   H HD13 . LEU A 1 30  ? 0.524   6.326   9.851   1.00 0.00 ? 108 LEU A HD13 1  
ATOM 454   H HD21 . LEU A 1 30  ? -0.684  3.021   10.178  1.00 0.00 ? 108 LEU A HD21 1  
ATOM 455   H HD22 . LEU A 1 30  ? -2.278  3.590   9.682   1.00 0.00 ? 108 LEU A HD22 1  
ATOM 456   H HD23 . LEU A 1 30  ? -1.934  3.306   11.389  1.00 0.00 ? 108 LEU A HD23 1  
ATOM 457   N N    . CYS A 1 31  ? 1.415   7.182   14.286  1.00 0.00 ? 109 CYS A N    1  
ATOM 458   C CA   . CYS A 1 31  ? 1.496   7.613   15.677  1.00 0.00 ? 109 CYS A CA   1  
ATOM 459   C C    . CYS A 1 31  ? 1.661   9.127   15.769  1.00 0.00 ? 109 CYS A C    1  
ATOM 460   O O    . CYS A 1 31  ? 1.208   9.756   16.726  1.00 0.00 ? 109 CYS A O    1  
ATOM 461   C CB   . CYS A 1 31  ? 2.662   6.918   16.382  1.00 0.00 ? 109 CYS A CB   1  
ATOM 462   S SG   . CYS A 1 31  ? 2.519   5.117   16.442  1.00 0.00 ? 109 CYS A SG   1  
ATOM 463   H H    . CYS A 1 31  ? 2.243   6.984   13.799  1.00 0.00 ? 109 CYS A H    1  
ATOM 464   H HA   . CYS A 1 31  ? 0.574   7.334   16.164  1.00 0.00 ? 109 CYS A HA   1  
ATOM 465   H HB2  . CYS A 1 31  ? 3.580   7.157   15.865  1.00 0.00 ? 109 CYS A HB2  1  
ATOM 466   H HB3  . CYS A 1 31  ? 2.725   7.278   17.398  1.00 0.00 ? 109 CYS A HB3  1  
ATOM 467   H HG   . CYS A 1 31  ? 1.283   4.793   16.095  1.00 0.00 ? 109 CYS A HG   1  
ATOM 468   N N    . THR A 1 32  ? 2.314   9.708   14.767  1.00 0.00 ? 110 THR A N    1  
ATOM 469   C CA   . THR A 1 32  ? 2.542   11.147  14.735  1.00 0.00 ? 110 THR A CA   1  
ATOM 470   C C    . THR A 1 32  ? 1.780   11.799  13.586  1.00 0.00 ? 110 THR A C    1  
ATOM 471   O O    . THR A 1 32  ? 2.016   11.513  12.412  1.00 0.00 ? 110 THR A O    1  
ATOM 472   C CB   . THR A 1 32  ? 4.040   11.476  14.594  1.00 0.00 ? 110 THR A CB   1  
ATOM 473   O OG1  . THR A 1 32  ? 4.818   10.559  15.372  1.00 0.00 ? 110 THR A OG1  1  
ATOM 474   C CG2  . THR A 1 32  ? 4.326   12.900  15.044  1.00 0.00 ? 110 THR A CG2  1  
ATOM 475   H H    . THR A 1 32  ? 2.651   9.153   14.032  1.00 0.00 ? 110 THR A H    1  
ATOM 476   H HA   . THR A 1 32  ? 2.189   11.561  15.668  1.00 0.00 ? 110 THR A HA   1  
ATOM 477   H HB   . THR A 1 32  ? 4.318   11.380  13.554  1.00 0.00 ? 110 THR A HB   1  
ATOM 478   H HG1  . THR A 1 32  ? 5.715   10.890  15.455  1.00 0.00 ? 110 THR A HG1  1  
ATOM 479   H HG21 . THR A 1 32  ? 4.720   12.888  16.050  1.00 0.00 ? 110 THR A HG21 1  
ATOM 480   H HG22 . THR A 1 32  ? 3.411   13.475  15.023  1.00 0.00 ? 110 THR A HG22 1  
ATOM 481   H HG23 . THR A 1 32  ? 5.048   13.349  14.380  1.00 0.00 ? 110 THR A HG23 1  
ATOM 482   N N    . PRO A 1 33  ? 0.845   12.697  13.930  1.00 0.00 ? 111 PRO A N    1  
ATOM 483   C CA   . PRO A 1 33  ? 0.030   13.409  12.940  1.00 0.00 ? 111 PRO A CA   1  
ATOM 484   C C    . PRO A 1 33  ? 0.844   14.418  12.137  1.00 0.00 ? 111 PRO A C    1  
ATOM 485   O O    . PRO A 1 33  ? 0.303   15.140  11.301  1.00 0.00 ? 111 PRO A O    1  
ATOM 486   C CB   . PRO A 1 33  ? -1.018  14.126  13.794  1.00 0.00 ? 111 PRO A CB   1  
ATOM 487   C CG   . PRO A 1 33  ? -0.374  14.289  15.128  1.00 0.00 ? 111 PRO A CG   1  
ATOM 488   C CD   . PRO A 1 33  ? 0.511   13.086  15.310  1.00 0.00 ? 111 PRO A CD   1  
ATOM 489   H HA   . PRO A 1 33  ? -0.461  12.724  12.264  1.00 0.00 ? 111 PRO A HA   1  
ATOM 490   H HB2  . PRO A 1 33  ? -1.255  15.082  13.350  1.00 0.00 ? 111 PRO A HB2  1  
ATOM 491   H HB3  . PRO A 1 33  ? -1.910  13.522  13.859  1.00 0.00 ? 111 PRO A HB3  1  
ATOM 492   H HG2  . PRO A 1 33  ? 0.215   15.193  15.143  1.00 0.00 ? 111 PRO A HG2  1  
ATOM 493   H HG3  . PRO A 1 33  ? -1.129  14.318  15.899  1.00 0.00 ? 111 PRO A HG3  1  
ATOM 494   H HD2  . PRO A 1 33  ? 1.400   13.352  15.861  1.00 0.00 ? 111 PRO A HD2  1  
ATOM 495   H HD3  . PRO A 1 33  ? -0.026  12.296  15.814  1.00 0.00 ? 111 PRO A HD3  1  
ATOM 496   N N    . GLU A 1 34  ? 2.147   14.461  12.397  1.00 0.00 ? 112 GLU A N    1  
ATOM 497   C CA   . GLU A 1 34  ? 3.035   15.382  11.698  1.00 0.00 ? 112 GLU A CA   1  
ATOM 498   C C    . GLU A 1 34  ? 2.890   15.235  10.186  1.00 0.00 ? 112 GLU A C    1  
ATOM 499   O O    . GLU A 1 34  ? 2.674   16.215  9.473   1.00 0.00 ? 112 GLU A O    1  
ATOM 500   C CB   . GLU A 1 34  ? 4.488   15.137  12.109  1.00 0.00 ? 112 GLU A CB   1  
ATOM 501   C CG   . GLU A 1 34  ? 4.888   15.851  13.389  1.00 0.00 ? 112 GLU A CG   1  
ATOM 502   C CD   . GLU A 1 34  ? 4.798   17.360  13.268  1.00 0.00 ? 112 GLU A CD   1  
ATOM 503   O OE1  . GLU A 1 34  ? 3.673   17.896  13.354  1.00 0.00 ? 112 GLU A OE1  1  
ATOM 504   O OE2  . GLU A 1 34  ? 5.852   18.004  13.087  1.00 0.00 ? 112 GLU A OE2  1  
ATOM 505   H H    . GLU A 1 34  ? 2.520   13.859  13.075  1.00 0.00 ? 112 GLU A H    1  
ATOM 506   H HA   . GLU A 1 34  ? 2.757   16.387  11.977  1.00 0.00 ? 112 GLU A HA   1  
ATOM 507   H HB2  . GLU A 1 34  ? 4.635   14.076  12.251  1.00 0.00 ? 112 GLU A HB2  1  
ATOM 508   H HB3  . GLU A 1 34  ? 5.136   15.477  11.315  1.00 0.00 ? 112 GLU A HB3  1  
ATOM 509   H HG2  . GLU A 1 34  ? 4.233   15.529  14.185  1.00 0.00 ? 112 GLU A HG2  1  
ATOM 510   H HG3  . GLU A 1 34  ? 5.906   15.584  13.632  1.00 0.00 ? 112 GLU A HG3  1  
ATOM 511   N N    . VAL A 1 35  ? 3.013   14.002  9.703   1.00 0.00 ? 113 VAL A N    1  
ATOM 512   C CA   . VAL A 1 35  ? 2.896   13.725  8.277   1.00 0.00 ? 113 VAL A CA   1  
ATOM 513   C C    . VAL A 1 35  ? 1.462   13.368  7.902   1.00 0.00 ? 113 VAL A C    1  
ATOM 514   O O    . VAL A 1 35  ? 0.863   13.996  7.029   1.00 0.00 ? 113 VAL A O    1  
ATOM 515   C CB   . VAL A 1 35  ? 3.828   12.575  7.850   1.00 0.00 ? 113 VAL A CB   1  
ATOM 516   C CG1  . VAL A 1 35  ? 3.475   11.297  8.597   1.00 0.00 ? 113 VAL A CG1  1  
ATOM 517   C CG2  . VAL A 1 35  ? 3.754   12.360  6.346   1.00 0.00 ? 113 VAL A CG2  1  
ATOM 518   H H    . VAL A 1 35  ? 3.186   13.262  10.321  1.00 0.00 ? 113 VAL A H    1  
ATOM 519   H HA   . VAL A 1 35  ? 3.188   14.615  7.738   1.00 0.00 ? 113 VAL A HA   1  
ATOM 520   H HB   . VAL A 1 35  ? 4.841   12.846  8.105   1.00 0.00 ? 113 VAL A HB   1  
ATOM 521   H HG11 . VAL A 1 35  ? 4.302   10.604  8.533   1.00 0.00 ? 113 VAL A HG11 1  
ATOM 522   H HG12 . VAL A 1 35  ? 3.277   11.529  9.633   1.00 0.00 ? 113 VAL A HG12 1  
ATOM 523   H HG13 . VAL A 1 35  ? 2.598   10.851  8.153   1.00 0.00 ? 113 VAL A HG13 1  
ATOM 524   H HG21 . VAL A 1 35  ? 3.030   11.589  6.128   1.00 0.00 ? 113 VAL A HG21 1  
ATOM 525   H HG22 . VAL A 1 35  ? 3.455   13.280  5.865   1.00 0.00 ? 113 VAL A HG22 1  
ATOM 526   H HG23 . VAL A 1 35  ? 4.723   12.059  5.977   1.00 0.00 ? 113 VAL A HG23 1  
ATOM 527   N N    . SER A 1 36  ? 0.916   12.355  8.569   1.00 0.00 ? 114 SER A N    1  
ATOM 528   C CA   . SER A 1 36  ? -0.447  11.912  8.304   1.00 0.00 ? 114 SER A CA   1  
ATOM 529   C C    . SER A 1 36  ? -1.437  12.620  9.224   1.00 0.00 ? 114 SER A C    1  
ATOM 530   O O    . SER A 1 36  ? -2.012  12.007  10.122  1.00 0.00 ? 114 SER A O    1  
ATOM 531   C CB   . SER A 1 36  ? -0.558  10.397  8.485   1.00 0.00 ? 114 SER A CB   1  
ATOM 532   O OG   . SER A 1 36  ? -0.592  10.050  9.859   1.00 0.00 ? 114 SER A OG   1  
ATOM 533   H H    . SER A 1 36  ? 1.445   11.894  9.253   1.00 0.00 ? 114 SER A H    1  
ATOM 534   H HA   . SER A 1 36  ? -0.684  12.162  7.280   1.00 0.00 ? 114 SER A HA   1  
ATOM 535   H HB2  . SER A 1 36  ? -1.464  10.046  8.015   1.00 0.00 ? 114 SER A HB2  1  
ATOM 536   H HB3  . SER A 1 36  ? 0.295   9.919   8.026   1.00 0.00 ? 114 SER A HB3  1  
ATOM 537   H HG   . SER A 1 36  ? 0.303   9.908   10.176  1.00 0.00 ? 114 SER A HG   1  
ATOM 538   N N    . GLN A 1 37  ? -1.629  13.915  8.992   1.00 0.00 ? 115 GLN A N    1  
ATOM 539   C CA   . GLN A 1 37  ? -2.549  14.707  9.801   1.00 0.00 ? 115 GLN A CA   1  
ATOM 540   C C    . GLN A 1 37  ? -3.968  14.156  9.708   1.00 0.00 ? 115 GLN A C    1  
ATOM 541   O O    . GLN A 1 37  ? -4.642  13.978  10.723  1.00 0.00 ? 115 GLN A O    1  
ATOM 542   C CB   . GLN A 1 37  ? -2.527  16.169  9.351   1.00 0.00 ? 115 GLN A CB   1  
ATOM 543   C CG   . GLN A 1 37  ? -2.890  16.361  7.888   1.00 0.00 ? 115 GLN A CG   1  
ATOM 544   C CD   . GLN A 1 37  ? -2.666  17.783  7.413   1.00 0.00 ? 115 GLN A CD   1  
ATOM 545   O OE1  . GLN A 1 37  ? -1.925  18.022  6.459   1.00 0.00 ? 115 GLN A OE1  1  
ATOM 546   N NE2  . GLN A 1 37  ? -3.308  18.737  8.077   1.00 0.00 ? 115 GLN A NE2  1  
ATOM 547   H H    . GLN A 1 37  ? -1.142  14.347  8.261   1.00 0.00 ? 115 GLN A H    1  
ATOM 548   H HA   . GLN A 1 37  ? -2.220  14.650  10.827  1.00 0.00 ? 115 GLN A HA   1  
ATOM 549   H HB2  . GLN A 1 37  ? -3.229  16.728  9.951   1.00 0.00 ? 115 GLN A HB2  1  
ATOM 550   H HB3  . GLN A 1 37  ? -1.535  16.566  9.509   1.00 0.00 ? 115 GLN A HB3  1  
ATOM 551   H HG2  . GLN A 1 37  ? -2.282  15.699  7.289   1.00 0.00 ? 115 GLN A HG2  1  
ATOM 552   H HG3  . GLN A 1 37  ? -3.932  16.112  7.753   1.00 0.00 ? 115 GLN A HG3  1  
ATOM 553   H HE21 . GLN A 1 37  ? -3.881  18.473  8.828   1.00 0.00 ? 115 GLN A HE21 1  
ATOM 554   H HE22 . GLN A 1 37  ? -3.181  19.665  7.792   1.00 0.00 ? 115 GLN A HE22 1  
ATOM 555   N N    . GLU A 1 38  ? -4.415  13.887  8.486   1.00 0.00 ? 116 GLU A N    1  
ATOM 556   C CA   . GLU A 1 38  ? -5.755  13.357  8.262   1.00 0.00 ? 116 GLU A CA   1  
ATOM 557   C C    . GLU A 1 38  ? -5.885  11.948  8.833   1.00 0.00 ? 116 GLU A C    1  
ATOM 558   O O    . GLU A 1 38  ? -6.893  11.607  9.453   1.00 0.00 ? 116 GLU A O    1  
ATOM 559   C CB   . GLU A 1 38  ? -6.080  13.346  6.767   1.00 0.00 ? 116 GLU A CB   1  
ATOM 560   C CG   . GLU A 1 38  ? -7.568  13.428  6.467   1.00 0.00 ? 116 GLU A CG   1  
ATOM 561   C CD   . GLU A 1 38  ? -8.100  14.846  6.542   1.00 0.00 ? 116 GLU A CD   1  
ATOM 562   O OE1  . GLU A 1 38  ? -8.155  15.402  7.659   1.00 0.00 ? 116 GLU A OE1  1  
ATOM 563   O OE2  . GLU A 1 38  ? -8.463  15.399  5.482   1.00 0.00 ? 116 GLU A OE2  1  
ATOM 564   H H    . GLU A 1 38  ? -3.830  14.049  7.716   1.00 0.00 ? 116 GLU A H    1  
ATOM 565   H HA   . GLU A 1 38  ? -6.456  14.003  8.769   1.00 0.00 ? 116 GLU A HA   1  
ATOM 566   H HB2  . GLU A 1 38  ? -5.592  14.187  6.298   1.00 0.00 ? 116 GLU A HB2  1  
ATOM 567   H HB3  . GLU A 1 38  ? -5.698  12.433  6.335   1.00 0.00 ? 116 GLU A HB3  1  
ATOM 568   H HG2  . GLU A 1 38  ? -7.743  13.046  5.473   1.00 0.00 ? 116 GLU A HG2  1  
ATOM 569   H HG3  . GLU A 1 38  ? -8.101  12.821  7.184   1.00 0.00 ? 116 GLU A HG3  1  
ATOM 570   N N    . LEU A 1 39  ? -4.858  11.132  8.618   1.00 0.00 ? 117 LEU A N    1  
ATOM 571   C CA   . LEU A 1 39  ? -4.857  9.759   9.110   1.00 0.00 ? 117 LEU A CA   1  
ATOM 572   C C    . LEU A 1 39  ? -4.994  9.724   10.629  1.00 0.00 ? 117 LEU A C    1  
ATOM 573   O O    . LEU A 1 39  ? -5.840  9.011   11.170  1.00 0.00 ? 117 LEU A O    1  
ATOM 574   C CB   . LEU A 1 39  ? -3.571  9.047   8.687   1.00 0.00 ? 117 LEU A CB   1  
ATOM 575   C CG   . LEU A 1 39  ? -3.604  7.518   8.732   1.00 0.00 ? 117 LEU A CG   1  
ATOM 576   C CD1  . LEU A 1 39  ? -4.758  6.985   7.898   1.00 0.00 ? 117 LEU A CD1  1  
ATOM 577   C CD2  . LEU A 1 39  ? -2.282  6.942   8.248   1.00 0.00 ? 117 LEU A CD2  1  
ATOM 578   H H    . LEU A 1 39  ? -4.083  11.460  8.118   1.00 0.00 ? 117 LEU A H    1  
ATOM 579   H HA   . LEU A 1 39  ? -5.702  9.249   8.673   1.00 0.00 ? 117 LEU A HA   1  
ATOM 580   H HB2  . LEU A 1 39  ? -3.347  9.342   7.674   1.00 0.00 ? 117 LEU A HB2  1  
ATOM 581   H HB3  . LEU A 1 39  ? -2.778  9.381   9.341   1.00 0.00 ? 117 LEU A HB3  1  
ATOM 582   H HG   . LEU A 1 39  ? -3.756  7.198   9.754   1.00 0.00 ? 117 LEU A HG   1  
ATOM 583   H HD11 . LEU A 1 39  ? -5.675  7.059   8.462   1.00 0.00 ? 117 LEU A HD11 1  
ATOM 584   H HD12 . LEU A 1 39  ? -4.573  5.951   7.647   1.00 0.00 ? 117 LEU A HD12 1  
ATOM 585   H HD13 . LEU A 1 39  ? -4.845  7.565   6.991   1.00 0.00 ? 117 LEU A HD13 1  
ATOM 586   H HD21 . LEU A 1 39  ? -2.391  5.880   8.084   1.00 0.00 ? 117 LEU A HD21 1  
ATOM 587   H HD22 . LEU A 1 39  ? -1.519  7.114   8.994   1.00 0.00 ? 117 LEU A HD22 1  
ATOM 588   H HD23 . LEU A 1 39  ? -1.997  7.421   7.324   1.00 0.00 ? 117 LEU A HD23 1  
ATOM 589   N N    . TYR A 1 40  ? -4.159  10.500  11.311  1.00 0.00 ? 118 TYR A N    1  
ATOM 590   C CA   . TYR A 1 40  ? -4.188  10.558  12.768  1.00 0.00 ? 118 TYR A CA   1  
ATOM 591   C C    . TYR A 1 40  ? -5.581  10.925  13.272  1.00 0.00 ? 118 TYR A C    1  
ATOM 592   O O    . TYR A 1 40  ? -6.154  10.226  14.108  1.00 0.00 ? 118 TYR A O    1  
ATOM 593   C CB   . TYR A 1 40  ? -3.165  11.575  13.279  1.00 0.00 ? 118 TYR A CB   1  
ATOM 594   C CG   . TYR A 1 40  ? -2.985  11.550  14.780  1.00 0.00 ? 118 TYR A CG   1  
ATOM 595   C CD1  . TYR A 1 40  ? -2.188  10.588  15.388  1.00 0.00 ? 118 TYR A CD1  1  
ATOM 596   C CD2  . TYR A 1 40  ? -3.612  12.489  15.590  1.00 0.00 ? 118 TYR A CD2  1  
ATOM 597   C CE1  . TYR A 1 40  ? -2.021  10.561  16.759  1.00 0.00 ? 118 TYR A CE1  1  
ATOM 598   C CE2  . TYR A 1 40  ? -3.449  12.470  16.962  1.00 0.00 ? 118 TYR A CE2  1  
ATOM 599   C CZ   . TYR A 1 40  ? -2.653  11.505  17.541  1.00 0.00 ? 118 TYR A CZ   1  
ATOM 600   O OH   . TYR A 1 40  ? -2.490  11.483  18.907  1.00 0.00 ? 118 TYR A OH   1  
ATOM 601   H H    . TYR A 1 40  ? -3.507  11.046  10.824  1.00 0.00 ? 118 TYR A H    1  
ATOM 602   H HA   . TYR A 1 40  ? -3.927  9.580   13.144  1.00 0.00 ? 118 TYR A HA   1  
ATOM 603   H HB2  . TYR A 1 40  ? -2.207  11.369  12.827  1.00 0.00 ? 118 TYR A HB2  1  
ATOM 604   H HB3  . TYR A 1 40  ? -3.484  12.568  12.998  1.00 0.00 ? 118 TYR A HB3  1  
ATOM 605   H HD1  . TYR A 1 40  ? -1.694  9.850   14.772  1.00 0.00 ? 118 TYR A HD1  1  
ATOM 606   H HD2  . TYR A 1 40  ? -4.235  13.243  15.132  1.00 0.00 ? 118 TYR A HD2  1  
ATOM 607   H HE1  . TYR A 1 40  ? -1.397  9.806   17.213  1.00 0.00 ? 118 TYR A HE1  1  
ATOM 608   H HE2  . TYR A 1 40  ? -3.945  13.209  17.574  1.00 0.00 ? 118 TYR A HE2  1  
ATOM 609   H HH   . TYR A 1 40  ? -1.958  12.235  19.178  1.00 0.00 ? 118 TYR A HH   1  
ATOM 610   N N    . ASP A 1 41  ? -6.118  12.024  12.756  1.00 0.00 ? 119 ASP A N    1  
ATOM 611   C CA   . ASP A 1 41  ? -7.445  12.484  13.151  1.00 0.00 ? 119 ASP A CA   1  
ATOM 612   C C    . ASP A 1 41  ? -8.430  11.320  13.204  1.00 0.00 ? 119 ASP A C    1  
ATOM 613   O O    . ASP A 1 41  ? -9.377  11.330  13.992  1.00 0.00 ? 119 ASP A O    1  
ATOM 614   C CB   . ASP A 1 41  ? -7.949  13.551  12.177  1.00 0.00 ? 119 ASP A CB   1  
ATOM 615   C CG   . ASP A 1 41  ? -9.351  14.023  12.510  1.00 0.00 ? 119 ASP A CG   1  
ATOM 616   O OD1  . ASP A 1 41  ? -9.496  14.832  13.450  1.00 0.00 ? 119 ASP A OD1  1  
ATOM 617   O OD2  . ASP A 1 41  ? -10.302 13.581  11.833  1.00 0.00 ? 119 ASP A OD2  1  
ATOM 618   H H    . ASP A 1 41  ? -5.612  12.539  12.093  1.00 0.00 ? 119 ASP A H    1  
ATOM 619   H HA   . ASP A 1 41  ? -7.366  12.918  14.136  1.00 0.00 ? 119 ASP A HA   1  
ATOM 620   H HB2  . ASP A 1 41  ? -7.285  14.402  12.211  1.00 0.00 ? 119 ASP A HB2  1  
ATOM 621   H HB3  . ASP A 1 41  ? -7.954  13.143  11.177  1.00 0.00 ? 119 ASP A HB3  1  
ATOM 622   N N    . LEU A 1 42  ? -8.202  10.320  12.361  1.00 0.00 ? 120 LEU A N    1  
ATOM 623   C CA   . LEU A 1 42  ? -9.070  9.148   12.311  1.00 0.00 ? 120 LEU A CA   1  
ATOM 624   C C    . LEU A 1 42  ? -8.762  8.193   13.460  1.00 0.00 ? 120 LEU A C    1  
ATOM 625   O O    . LEU A 1 42  ? -9.652  7.516   13.972  1.00 0.00 ? 120 LEU A O    1  
ATOM 626   C CB   . LEU A 1 42  ? -8.906  8.424   10.973  1.00 0.00 ? 120 LEU A CB   1  
ATOM 627   C CG   . LEU A 1 42  ? -9.058  9.287   9.720   1.00 0.00 ? 120 LEU A CG   1  
ATOM 628   C CD1  . LEU A 1 42  ? -8.408  8.610   8.524   1.00 0.00 ? 120 LEU A CD1  1  
ATOM 629   C CD2  . LEU A 1 42  ? -10.527 9.570   9.442   1.00 0.00 ? 120 LEU A CD2  1  
ATOM 630   H H    . LEU A 1 42  ? -7.432  10.369  11.757  1.00 0.00 ? 120 LEU A H    1  
ATOM 631   H HA   . LEU A 1 42  ? -10.090 9.488   12.404  1.00 0.00 ? 120 LEU A HA   1  
ATOM 632   H HB2  . LEU A 1 42  ? -7.920  7.984   10.954  1.00 0.00 ? 120 LEU A HB2  1  
ATOM 633   H HB3  . LEU A 1 42  ? -9.649  7.641   10.929  1.00 0.00 ? 120 LEU A HB3  1  
ATOM 634   H HG   . LEU A 1 42  ? -8.559  10.233  9.879   1.00 0.00 ? 120 LEU A HG   1  
ATOM 635   H HD11 . LEU A 1 42  ? -7.832  9.335   7.969   1.00 0.00 ? 120 LEU A HD11 1  
ATOM 636   H HD12 . LEU A 1 42  ? -9.173  8.193   7.886   1.00 0.00 ? 120 LEU A HD12 1  
ATOM 637   H HD13 . LEU A 1 42  ? -7.757  7.819   8.867   1.00 0.00 ? 120 LEU A HD13 1  
ATOM 638   H HD21 . LEU A 1 42  ? -10.643 9.897   8.419   1.00 0.00 ? 120 LEU A HD21 1  
ATOM 639   H HD22 . LEU A 1 42  ? -10.877 10.344  10.109  1.00 0.00 ? 120 LEU A HD22 1  
ATOM 640   H HD23 . LEU A 1 42  ? -11.103 8.670   9.600   1.00 0.00 ? 120 LEU A HD23 1  
ATOM 641   N N    . ASN A 1 43  ? -7.496  8.146   13.860  1.00 0.00 ? 121 ASN A N    1  
ATOM 642   C CA   . ASN A 1 43  ? -7.071  7.275   14.950  1.00 0.00 ? 121 ASN A CA   1  
ATOM 643   C C    . ASN A 1 43  ? -7.053  5.816   14.506  1.00 0.00 ? 121 ASN A C    1  
ATOM 644   O O    . ASN A 1 43  ? -7.576  4.939   15.195  1.00 0.00 ? 121 ASN A O    1  
ATOM 645   C CB   . ASN A 1 43  ? -7.999  7.442   16.155  1.00 0.00 ? 121 ASN A CB   1  
ATOM 646   C CG   . ASN A 1 43  ? -7.398  6.879   17.429  1.00 0.00 ? 121 ASN A CG   1  
ATOM 647   O OD1  . ASN A 1 43  ? -6.197  6.622   17.502  1.00 0.00 ? 121 ASN A OD1  1  
ATOM 648   N ND2  . ASN A 1 43  ? -8.235  6.686   18.442  1.00 0.00 ? 121 ASN A ND2  1  
ATOM 649   H H    . ASN A 1 43  ? -6.831  8.710   13.412  1.00 0.00 ? 121 ASN A H    1  
ATOM 650   H HA   . ASN A 1 43  ? -6.070  7.565   15.235  1.00 0.00 ? 121 ASN A HA   1  
ATOM 651   H HB2  . ASN A 1 43  ? -8.196  8.493   16.307  1.00 0.00 ? 121 ASN A HB2  1  
ATOM 652   H HB3  . ASN A 1 43  ? -8.929  6.930   15.960  1.00 0.00 ? 121 ASN A HB3  1  
ATOM 653   H HD21 . ASN A 1 43  ? -9.180  6.914   18.313  1.00 0.00 ? 121 ASN A HD21 1  
ATOM 654   H HD22 . ASN A 1 43  ? -7.874  6.324   19.278  1.00 0.00 ? 121 ASN A HD22 1  
ATOM 655   N N    . VAL A 1 44  ? -6.449  5.562   13.349  1.00 0.00 ? 122 VAL A N    1  
ATOM 656   C CA   . VAL A 1 44  ? -6.361  4.210   12.813  1.00 0.00 ? 122 VAL A CA   1  
ATOM 657   C C    . VAL A 1 44  ? -5.229  3.429   13.471  1.00 0.00 ? 122 VAL A C    1  
ATOM 658   O O    . VAL A 1 44  ? -4.242  4.010   13.921  1.00 0.00 ? 122 VAL A O    1  
ATOM 659   C CB   . VAL A 1 44  ? -6.142  4.223   11.288  1.00 0.00 ? 122 VAL A CB   1  
ATOM 660   C CG1  . VAL A 1 44  ? -4.792  4.835   10.949  1.00 0.00 ? 122 VAL A CG1  1  
ATOM 661   C CG2  . VAL A 1 44  ? -6.257  2.817   10.721  1.00 0.00 ? 122 VAL A CG2  1  
ATOM 662   H H    . VAL A 1 44  ? -6.051  6.303   12.846  1.00 0.00 ? 122 VAL A H    1  
ATOM 663   H HA   . VAL A 1 44  ? -7.296  3.708   13.016  1.00 0.00 ? 122 VAL A HA   1  
ATOM 664   H HB   . VAL A 1 44  ? -6.912  4.834   10.840  1.00 0.00 ? 122 VAL A HB   1  
ATOM 665   H HG11 . VAL A 1 44  ? -4.433  5.407   11.792  1.00 0.00 ? 122 VAL A HG11 1  
ATOM 666   H HG12 . VAL A 1 44  ? -4.087  4.049   10.720  1.00 0.00 ? 122 VAL A HG12 1  
ATOM 667   H HG13 . VAL A 1 44  ? -4.897  5.486   10.093  1.00 0.00 ? 122 VAL A HG13 1  
ATOM 668   H HG21 . VAL A 1 44  ? -6.196  2.858   9.644   1.00 0.00 ? 122 VAL A HG21 1  
ATOM 669   H HG22 . VAL A 1 44  ? -5.452  2.207   11.104  1.00 0.00 ? 122 VAL A HG22 1  
ATOM 670   H HG23 . VAL A 1 44  ? -7.204  2.387   11.013  1.00 0.00 ? 122 VAL A HG23 1  
ATOM 671   N N    . GLU A 1 45  ? -5.379  2.110   13.523  1.00 0.00 ? 123 GLU A N    1  
ATOM 672   C CA   . GLU A 1 45  ? -4.368  1.250   14.127  1.00 0.00 ? 123 GLU A CA   1  
ATOM 673   C C    . GLU A 1 45  ? -4.263  -0.076  13.378  1.00 0.00 ? 123 GLU A C    1  
ATOM 674   O O    . GLU A 1 45  ? -5.224  -0.843  13.312  1.00 0.00 ? 123 GLU A O    1  
ATOM 675   C CB   . GLU A 1 45  ? -4.699  0.991   15.598  1.00 0.00 ? 123 GLU A CB   1  
ATOM 676   C CG   . GLU A 1 45  ? -3.485  0.647   16.444  1.00 0.00 ? 123 GLU A CG   1  
ATOM 677   C CD   . GLU A 1 45  ? -3.711  0.903   17.921  1.00 0.00 ? 123 GLU A CD   1  
ATOM 678   O OE1  . GLU A 1 45  ? -4.829  0.631   18.406  1.00 0.00 ? 123 GLU A OE1  1  
ATOM 679   O OE2  . GLU A 1 45  ? -2.770  1.376   18.593  1.00 0.00 ? 123 GLU A OE2  1  
ATOM 680   H H    . GLU A 1 45  ? -6.188  1.705   13.147  1.00 0.00 ? 123 GLU A H    1  
ATOM 681   H HA   . GLU A 1 45  ? -3.419  1.760   14.066  1.00 0.00 ? 123 GLU A HA   1  
ATOM 682   H HB2  . GLU A 1 45  ? -5.161  1.876   16.012  1.00 0.00 ? 123 GLU A HB2  1  
ATOM 683   H HB3  . GLU A 1 45  ? -5.398  0.170   15.658  1.00 0.00 ? 123 GLU A HB3  1  
ATOM 684   H HG2  . GLU A 1 45  ? -3.252  -0.399  16.308  1.00 0.00 ? 123 GLU A HG2  1  
ATOM 685   H HG3  . GLU A 1 45  ? -2.650  1.246   16.113  1.00 0.00 ? 123 GLU A HG3  1  
ATOM 686   N N    . LEU A 1 46  ? -3.089  -0.337  12.813  1.00 0.00 ? 124 LEU A N    1  
ATOM 687   C CA   . LEU A 1 46  ? -2.857  -1.569  12.067  1.00 0.00 ? 124 LEU A CA   1  
ATOM 688   C C    . LEU A 1 46  ? -3.114  -2.792  12.942  1.00 0.00 ? 124 LEU A C    1  
ATOM 689   O O    . LEU A 1 46  ? -3.063  -2.712  14.169  1.00 0.00 ? 124 LEU A O    1  
ATOM 690   C CB   . LEU A 1 46  ? -1.424  -1.603  11.533  1.00 0.00 ? 124 LEU A CB   1  
ATOM 691   C CG   . LEU A 1 46  ? -1.163  -0.795  10.261  1.00 0.00 ? 124 LEU A CG   1  
ATOM 692   C CD1  . LEU A 1 46  ? 0.322   -0.504  10.109  1.00 0.00 ? 124 LEU A CD1  1  
ATOM 693   C CD2  . LEU A 1 46  ? -1.691  -1.535  9.041   1.00 0.00 ? 124 LEU A CD2  1  
ATOM 694   H H    . LEU A 1 46  ? -2.361  0.312   12.899  1.00 0.00 ? 124 LEU A H    1  
ATOM 695   H HA   . LEU A 1 46  ? -3.543  -1.587  11.234  1.00 0.00 ? 124 LEU A HA   1  
ATOM 696   H HB2  . LEU A 1 46  ? -0.774  -1.222  12.305  1.00 0.00 ? 124 LEU A HB2  1  
ATOM 697   H HB3  . LEU A 1 46  ? -1.172  -2.634  11.329  1.00 0.00 ? 124 LEU A HB3  1  
ATOM 698   H HG   . LEU A 1 46  ? -1.682  0.151   10.330  1.00 0.00 ? 124 LEU A HG   1  
ATOM 699   H HD11 . LEU A 1 46  ? 0.818   -1.370  9.697   1.00 0.00 ? 124 LEU A HD11 1  
ATOM 700   H HD12 . LEU A 1 46  ? 0.745   -0.273  11.076  1.00 0.00 ? 124 LEU A HD12 1  
ATOM 701   H HD13 . LEU A 1 46  ? 0.458   0.338   9.446   1.00 0.00 ? 124 LEU A HD13 1  
ATOM 702   H HD21 . LEU A 1 46  ? -1.158  -2.468  8.928   1.00 0.00 ? 124 LEU A HD21 1  
ATOM 703   H HD22 . LEU A 1 46  ? -1.544  -0.928  8.160   1.00 0.00 ? 124 LEU A HD22 1  
ATOM 704   H HD23 . LEU A 1 46  ? -2.744  -1.735  9.169   1.00 0.00 ? 124 LEU A HD23 1  
ATOM 705   N N    . SER A 1 47  ? -3.388  -3.924  12.302  1.00 0.00 ? 125 SER A N    1  
ATOM 706   C CA   . SER A 1 47  ? -3.655  -5.164  13.021  1.00 0.00 ? 125 SER A CA   1  
ATOM 707   C C    . SER A 1 47  ? -2.789  -6.300  12.485  1.00 0.00 ? 125 SER A C    1  
ATOM 708   O O    . SER A 1 47  ? -2.276  -7.119  13.248  1.00 0.00 ? 125 SER A O    1  
ATOM 709   C CB   . SER A 1 47  ? -5.134  -5.537  12.907  1.00 0.00 ? 125 SER A CB   1  
ATOM 710   O OG   . SER A 1 47  ? -5.447  -5.988  11.600  1.00 0.00 ? 125 SER A OG   1  
ATOM 711   H H    . SER A 1 47  ? -3.414  -3.925  11.322  1.00 0.00 ? 125 SER A H    1  
ATOM 712   H HA   . SER A 1 47  ? -3.413  -5.003  14.061  1.00 0.00 ? 125 SER A HA   1  
ATOM 713   H HB2  . SER A 1 47  ? -5.360  -6.324  13.610  1.00 0.00 ? 125 SER A HB2  1  
ATOM 714   H HB3  . SER A 1 47  ? -5.739  -4.670  13.130  1.00 0.00 ? 125 SER A HB3  1  
ATOM 715   H HG   . SER A 1 47  ? -5.051  -5.398  10.954  1.00 0.00 ? 125 SER A HG   1  
ATOM 716   N N    . LYS A 1 48  ? -2.632  -6.344  11.167  1.00 0.00 ? 126 LYS A N    1  
ATOM 717   C CA   . LYS A 1 48  ? -1.828  -7.378  10.525  1.00 0.00 ? 126 LYS A CA   1  
ATOM 718   C C    . LYS A 1 48  ? -1.412  -6.951  9.121   1.00 0.00 ? 126 LYS A C    1  
ATOM 719   O O    . LYS A 1 48  ? -2.135  -6.221  8.443   1.00 0.00 ? 126 LYS A O    1  
ATOM 720   C CB   . LYS A 1 48  ? -2.609  -8.692  10.460  1.00 0.00 ? 126 LYS A CB   1  
ATOM 721   C CG   . LYS A 1 48  ? -1.898  -9.784  9.678   1.00 0.00 ? 126 LYS A CG   1  
ATOM 722   C CD   . LYS A 1 48  ? -2.271  -9.749  8.206   1.00 0.00 ? 126 LYS A CD   1  
ATOM 723   C CE   . LYS A 1 48  ? -3.606  -10.432 7.953   1.00 0.00 ? 126 LYS A CE   1  
ATOM 724   N NZ   . LYS A 1 48  ? -3.473  -11.915 7.921   1.00 0.00 ? 126 LYS A NZ   1  
ATOM 725   H H    . LYS A 1 48  ? -3.066  -5.663  10.611  1.00 0.00 ? 126 LYS A H    1  
ATOM 726   H HA   . LYS A 1 48  ? -0.940  -7.525  11.122  1.00 0.00 ? 126 LYS A HA   1  
ATOM 727   H HB2  . LYS A 1 48  ? -2.775  -9.049  11.465  1.00 0.00 ? 126 LYS A HB2  1  
ATOM 728   H HB3  . LYS A 1 48  ? -3.564  -8.506  9.990   1.00 0.00 ? 126 LYS A HB3  1  
ATOM 729   H HG2  . LYS A 1 48  ? -0.831  -9.644  9.771   1.00 0.00 ? 126 LYS A HG2  1  
ATOM 730   H HG3  . LYS A 1 48  ? -2.174  -10.745 10.088  1.00 0.00 ? 126 LYS A HG3  1  
ATOM 731   H HD2  . LYS A 1 48  ? -2.340  -8.720  7.885   1.00 0.00 ? 126 LYS A HD2  1  
ATOM 732   H HD3  . LYS A 1 48  ? -1.504  -10.255 7.637   1.00 0.00 ? 126 LYS A HD3  1  
ATOM 733   H HE2  . LYS A 1 48  ? -4.291  -10.158 8.740   1.00 0.00 ? 126 LYS A HE2  1  
ATOM 734   H HE3  . LYS A 1 48  ? -3.995  -10.094 7.004   1.00 0.00 ? 126 LYS A HE3  1  
ATOM 735   H HZ1  . LYS A 1 48  ? -3.905  -12.294 7.054   1.00 0.00 ? 126 LYS A HZ1  1  
ATOM 736   H HZ2  . LYS A 1 48  ? -3.950  -12.334 8.744   1.00 0.00 ? 126 LYS A HZ2  1  
ATOM 737   H HZ3  . LYS A 1 48  ? -2.469  -12.184 7.942   1.00 0.00 ? 126 LYS A HZ3  1  
ATOM 738   N N    . VAL A 1 49  ? -0.241  -7.411  8.690   1.00 0.00 ? 127 VAL A N    1  
ATOM 739   C CA   . VAL A 1 49  ? 0.270   -7.079  7.366   1.00 0.00 ? 127 VAL A CA   1  
ATOM 740   C C    . VAL A 1 49  ? 0.505   -8.336  6.536   1.00 0.00 ? 127 VAL A C    1  
ATOM 741   O O    . VAL A 1 49  ? 1.177   -9.267  6.978   1.00 0.00 ? 127 VAL A O    1  
ATOM 742   C CB   . VAL A 1 49  ? 1.585   -6.283  7.455   1.00 0.00 ? 127 VAL A CB   1  
ATOM 743   C CG1  . VAL A 1 49  ? 2.148   -6.024  6.066   1.00 0.00 ? 127 VAL A CG1  1  
ATOM 744   C CG2  . VAL A 1 49  ? 1.367   -4.976  8.203   1.00 0.00 ? 127 VAL A CG2  1  
ATOM 745   H H    . VAL A 1 49  ? 0.290   -7.988  9.277   1.00 0.00 ? 127 VAL A H    1  
ATOM 746   H HA   . VAL A 1 49  ? -0.466  -6.463  6.869   1.00 0.00 ? 127 VAL A HA   1  
ATOM 747   H HB   . VAL A 1 49  ? 2.303   -6.873  8.006   1.00 0.00 ? 127 VAL A HB   1  
ATOM 748   H HG11 . VAL A 1 49  ? 3.210   -6.226  6.065   1.00 0.00 ? 127 VAL A HG11 1  
ATOM 749   H HG12 . VAL A 1 49  ? 1.657   -6.668  5.352   1.00 0.00 ? 127 VAL A HG12 1  
ATOM 750   H HG13 . VAL A 1 49  ? 1.979   -4.991  5.796   1.00 0.00 ? 127 VAL A HG13 1  
ATOM 751   H HG21 . VAL A 1 49  ? 0.378   -4.971  8.637   1.00 0.00 ? 127 VAL A HG21 1  
ATOM 752   H HG22 . VAL A 1 49  ? 2.104   -4.882  8.988   1.00 0.00 ? 127 VAL A HG22 1  
ATOM 753   H HG23 . VAL A 1 49  ? 1.464   -4.148  7.518   1.00 0.00 ? 127 VAL A HG23 1  
ATOM 754   N N    . SER A 1 50  ? -0.054  -8.355  5.330   1.00 0.00 ? 128 SER A N    1  
ATOM 755   C CA   . SER A 1 50  ? 0.092   -9.500  4.438   1.00 0.00 ? 128 SER A CA   1  
ATOM 756   C C    . SER A 1 50  ? 1.051   -9.179  3.296   1.00 0.00 ? 128 SER A C    1  
ATOM 757   O O    . SER A 1 50  ? 0.759   -8.343  2.440   1.00 0.00 ? 128 SER A O    1  
ATOM 758   C CB   . SER A 1 50  ? -1.270  -9.912  3.876   1.00 0.00 ? 128 SER A CB   1  
ATOM 759   O OG   . SER A 1 50  ? -1.144  -11.010 2.990   1.00 0.00 ? 128 SER A OG   1  
ATOM 760   H H    . SER A 1 50  ? -0.578  -7.582  5.034   1.00 0.00 ? 128 SER A H    1  
ATOM 761   H HA   . SER A 1 50  ? 0.497   -10.319 5.014   1.00 0.00 ? 128 SER A HA   1  
ATOM 762   H HB2  . SER A 1 50  ? -1.922  -10.193 4.689   1.00 0.00 ? 128 SER A HB2  1  
ATOM 763   H HB3  . SER A 1 50  ? -1.701  -9.079  3.340   1.00 0.00 ? 128 SER A HB3  1  
ATOM 764   H HG   . SER A 1 50  ? -1.884  -11.609 3.114   1.00 0.00 ? 128 SER A HG   1  
ATOM 765   N N    . LEU A 1 51  ? 2.198   -9.850  3.288   1.00 0.00 ? 129 LEU A N    1  
ATOM 766   C CA   . LEU A 1 51  ? 3.201   -9.639  2.251   1.00 0.00 ? 129 LEU A CA   1  
ATOM 767   C C    . LEU A 1 51  ? 3.281   -10.842 1.317   1.00 0.00 ? 129 LEU A C    1  
ATOM 768   O O    . LEU A 1 51  ? 3.197   -11.989 1.755   1.00 0.00 ? 129 LEU A O    1  
ATOM 769   C CB   . LEU A 1 51  ? 4.570   -9.379  2.884   1.00 0.00 ? 129 LEU A CB   1  
ATOM 770   C CG   . LEU A 1 51  ? 5.738   -9.214  1.912   1.00 0.00 ? 129 LEU A CG   1  
ATOM 771   C CD1  . LEU A 1 51  ? 5.753   -7.809  1.329   1.00 0.00 ? 129 LEU A CD1  1  
ATOM 772   C CD2  . LEU A 1 51  ? 7.057   -9.519  2.606   1.00 0.00 ? 129 LEU A CD2  1  
ATOM 773   H H    . LEU A 1 51  ? 2.374   -10.504 3.997   1.00 0.00 ? 129 LEU A H    1  
ATOM 774   H HA   . LEU A 1 51  ? 2.908   -8.772  1.679   1.00 0.00 ? 129 LEU A HA   1  
ATOM 775   H HB2  . LEU A 1 51  ? 4.497   -8.476  3.470   1.00 0.00 ? 129 LEU A HB2  1  
ATOM 776   H HB3  . LEU A 1 51  ? 4.795   -10.211 3.536   1.00 0.00 ? 129 LEU A HB3  1  
ATOM 777   H HG   . LEU A 1 51  ? 5.620   -9.912  1.095   1.00 0.00 ? 129 LEU A HG   1  
ATOM 778   H HD11 . LEU A 1 51  ? 4.926   -7.695  0.644   1.00 0.00 ? 129 LEU A HD11 1  
ATOM 779   H HD12 . LEU A 1 51  ? 6.682   -7.648  0.802   1.00 0.00 ? 129 LEU A HD12 1  
ATOM 780   H HD13 . LEU A 1 51  ? 5.663   -7.087  2.127   1.00 0.00 ? 129 LEU A HD13 1  
ATOM 781   H HD21 . LEU A 1 51  ? 6.862   -9.889  3.602   1.00 0.00 ? 129 LEU A HD21 1  
ATOM 782   H HD22 . LEU A 1 51  ? 7.649   -8.617  2.668   1.00 0.00 ? 129 LEU A HD22 1  
ATOM 783   H HD23 . LEU A 1 51  ? 7.596   -10.266 2.043   1.00 0.00 ? 129 LEU A HD23 1  
ATOM 784   N N    . THR A 1 52  ? 3.444   -10.571 0.025   1.00 0.00 ? 130 THR A N    1  
ATOM 785   C CA   . THR A 1 52  ? 3.536   -11.631 -0.972  1.00 0.00 ? 130 THR A CA   1  
ATOM 786   C C    . THR A 1 52  ? 4.844   -12.402 -0.836  1.00 0.00 ? 130 THR A C    1  
ATOM 787   O O    . THR A 1 52  ? 5.856   -11.878 -0.368  1.00 0.00 ? 130 THR A O    1  
ATOM 788   C CB   . THR A 1 52  ? 3.432   -11.067 -2.401  1.00 0.00 ? 130 THR A CB   1  
ATOM 789   O OG1  . THR A 1 52  ? 4.464   -10.100 -2.623  1.00 0.00 ? 130 THR A OG1  1  
ATOM 790   C CG2  . THR A 1 52  ? 2.071   -10.427 -2.633  1.00 0.00 ? 130 THR A CG2  1  
ATOM 791   H H    . THR A 1 52  ? 3.504   -9.637  -0.262  1.00 0.00 ? 130 THR A H    1  
ATOM 792   H HA   . THR A 1 52  ? 2.711   -12.310 -0.813  1.00 0.00 ? 130 THR A HA   1  
ATOM 793   H HB   . THR A 1 52  ? 3.554   -11.880 -3.102  1.00 0.00 ? 130 THR A HB   1  
ATOM 794   H HG1  . THR A 1 52  ? 4.541   -9.924  -3.564  1.00 0.00 ? 130 THR A HG1  1  
ATOM 795   H HG21 . THR A 1 52  ? 2.202   -9.465  -3.106  1.00 0.00 ? 130 THR A HG21 1  
ATOM 796   H HG22 . THR A 1 52  ? 1.569   -10.298 -1.686  1.00 0.00 ? 130 THR A HG22 1  
ATOM 797   H HG23 . THR A 1 52  ? 1.478   -11.064 -3.271  1.00 0.00 ? 130 THR A HG23 1  
ATOM 798   N N    . PRO A 1 53  ? 4.827   -13.676 -1.254  1.00 0.00 ? 131 PRO A N    1  
ATOM 799   C CA   . PRO A 1 53  ? 6.005   -14.546 -1.190  1.00 0.00 ? 131 PRO A CA   1  
ATOM 800   C C    . PRO A 1 53  ? 7.087   -14.131 -2.182  1.00 0.00 ? 131 PRO A C    1  
ATOM 801   O O    . PRO A 1 53  ? 8.273   -14.369 -1.957  1.00 0.00 ? 131 PRO A O    1  
ATOM 802   C CB   . PRO A 1 53  ? 5.448   -15.925 -1.552  1.00 0.00 ? 131 PRO A CB   1  
ATOM 803   C CG   . PRO A 1 53  ? 4.235   -15.641 -2.369  1.00 0.00 ? 131 PRO A CG   1  
ATOM 804   C CD   . PRO A 1 53  ? 3.657   -14.365 -1.823  1.00 0.00 ? 131 PRO A CD   1  
ATOM 805   H HA   . PRO A 1 53  ? 6.424   -14.574 -0.195  1.00 0.00 ? 131 PRO A HA   1  
ATOM 806   H HB2  . PRO A 1 53  ? 6.186   -16.477 -2.116  1.00 0.00 ? 131 PRO A HB2  1  
ATOM 807   H HB3  . PRO A 1 53  ? 5.199   -16.464 -0.650  1.00 0.00 ? 131 PRO A HB3  1  
ATOM 808   H HG2  . PRO A 1 53  ? 4.512   -15.514 -3.405  1.00 0.00 ? 131 PRO A HG2  1  
ATOM 809   H HG3  . PRO A 1 53  ? 3.526   -16.448 -2.265  1.00 0.00 ? 131 PRO A HG3  1  
ATOM 810   H HD2  . PRO A 1 53  ? 3.213   -13.782 -2.616  1.00 0.00 ? 131 PRO A HD2  1  
ATOM 811   H HD3  . PRO A 1 53  ? 2.927   -14.580 -1.056  1.00 0.00 ? 131 PRO A HD3  1  
ATOM 812   N N    . ASP A 1 54  ? 6.669   -13.511 -3.281  1.00 0.00 ? 132 ASP A N    1  
ATOM 813   C CA   . ASP A 1 54  ? 7.602   -13.062 -4.307  1.00 0.00 ? 132 ASP A CA   1  
ATOM 814   C C    . ASP A 1 54  ? 8.231   -11.726 -3.923  1.00 0.00 ? 132 ASP A C    1  
ATOM 815   O O    . ASP A 1 54  ? 9.072   -11.193 -4.647  1.00 0.00 ? 132 ASP A O    1  
ATOM 816   C CB   . ASP A 1 54  ? 6.890   -12.936 -5.655  1.00 0.00 ? 132 ASP A CB   1  
ATOM 817   C CG   . ASP A 1 54  ? 6.664   -14.281 -6.318  1.00 0.00 ? 132 ASP A CG   1  
ATOM 818   O OD1  . ASP A 1 54  ? 7.620   -15.081 -6.379  1.00 0.00 ? 132 ASP A OD1  1  
ATOM 819   O OD2  . ASP A 1 54  ? 5.529   -14.533 -6.775  1.00 0.00 ? 132 ASP A OD2  1  
ATOM 820   H H    . ASP A 1 54  ? 5.710   -13.351 -3.403  1.00 0.00 ? 132 ASP A H    1  
ATOM 821   H HA   . ASP A 1 54  ? 8.384   -13.802 -4.391  1.00 0.00 ? 132 ASP A HA   1  
ATOM 822   H HB2  . ASP A 1 54  ? 5.930   -12.464 -5.504  1.00 0.00 ? 132 ASP A HB2  1  
ATOM 823   H HB3  . ASP A 1 54  ? 7.488   -12.325 -6.315  1.00 0.00 ? 132 ASP A HB3  1  
ATOM 824   N N    . PHE A 1 55  ? 7.816   -11.190 -2.780  1.00 0.00 ? 133 PHE A N    1  
ATOM 825   C CA   . PHE A 1 55  ? 8.337   -9.915  -2.301  1.00 0.00 ? 133 PHE A CA   1  
ATOM 826   C C    . PHE A 1 55  ? 7.996   -8.788  -3.272  1.00 0.00 ? 133 PHE A C    1  
ATOM 827   O O    . PHE A 1 55  ? 8.692   -7.775  -3.334  1.00 0.00 ? 133 PHE A O    1  
ATOM 828   C CB   . PHE A 1 55  ? 9.853   -9.998  -2.111  1.00 0.00 ? 133 PHE A CB   1  
ATOM 829   C CG   . PHE A 1 55  ? 10.260  -10.529 -0.766  1.00 0.00 ? 133 PHE A CG   1  
ATOM 830   C CD1  . PHE A 1 55  ? 9.809   -9.925  0.397   1.00 0.00 ? 133 PHE A CD1  1  
ATOM 831   C CD2  . PHE A 1 55  ? 11.094  -11.631 -0.665  1.00 0.00 ? 133 PHE A CD2  1  
ATOM 832   C CE1  . PHE A 1 55  ? 10.183  -10.411 1.636   1.00 0.00 ? 133 PHE A CE1  1  
ATOM 833   C CE2  . PHE A 1 55  ? 11.471  -12.121 0.571   1.00 0.00 ? 133 PHE A CE2  1  
ATOM 834   C CZ   . PHE A 1 55  ? 11.014  -11.511 1.723   1.00 0.00 ? 133 PHE A CZ   1  
ATOM 835   H H    . PHE A 1 55  ? 7.143   -11.663 -2.247  1.00 0.00 ? 133 PHE A H    1  
ATOM 836   H HA   . PHE A 1 55  ? 7.874   -9.706  -1.349  1.00 0.00 ? 133 PHE A HA   1  
ATOM 837   H HB2  . PHE A 1 55  ? 10.268  -10.651 -2.864  1.00 0.00 ? 133 PHE A HB2  1  
ATOM 838   H HB3  . PHE A 1 55  ? 10.277  -9.011  -2.222  1.00 0.00 ? 133 PHE A HB3  1  
ATOM 839   H HD1  . PHE A 1 55  ? 9.159   -9.066  0.331   1.00 0.00 ? 133 PHE A HD1  1  
ATOM 840   H HD2  . PHE A 1 55  ? 11.452  -12.109 -1.566  1.00 0.00 ? 133 PHE A HD2  1  
ATOM 841   H HE1  . PHE A 1 55  ? 9.825   -9.933  2.535   1.00 0.00 ? 133 PHE A HE1  1  
ATOM 842   H HE2  . PHE A 1 55  ? 12.121  -12.982 0.635   1.00 0.00 ? 133 PHE A HE2  1  
ATOM 843   H HZ   . PHE A 1 55  ? 11.308  -11.892 2.689   1.00 0.00 ? 133 PHE A HZ   1  
ATOM 844   N N    . SER A 1 56  ? 6.919   -8.974  -4.029  1.00 0.00 ? 134 SER A N    1  
ATOM 845   C CA   . SER A 1 56  ? 6.487   -7.976  -5.001  1.00 0.00 ? 134 SER A CA   1  
ATOM 846   C C    . SER A 1 56  ? 5.518   -6.983  -4.366  1.00 0.00 ? 134 SER A C    1  
ATOM 847   O O    . SER A 1 56  ? 5.888   -5.853  -4.052  1.00 0.00 ? 134 SER A O    1  
ATOM 848   C CB   . SER A 1 56  ? 5.826   -8.655  -6.201  1.00 0.00 ? 134 SER A CB   1  
ATOM 849   O OG   . SER A 1 56  ? 5.204   -7.704  -7.048  1.00 0.00 ? 134 SER A OG   1  
ATOM 850   H H    . SER A 1 56  ? 6.405   -9.803  -3.934  1.00 0.00 ? 134 SER A H    1  
ATOM 851   H HA   . SER A 1 56  ? 7.362   -7.441  -5.338  1.00 0.00 ? 134 SER A HA   1  
ATOM 852   H HB2  . SER A 1 56  ? 6.574   -9.188  -6.768  1.00 0.00 ? 134 SER A HB2  1  
ATOM 853   H HB3  . SER A 1 56  ? 5.077   -9.351  -5.850  1.00 0.00 ? 134 SER A HB3  1  
ATOM 854   H HG   . SER A 1 56  ? 4.274   -7.633  -6.822  1.00 0.00 ? 134 SER A HG   1  
ATOM 855   N N    . ALA A 1 57  ? 4.275   -7.416  -4.181  1.00 0.00 ? 135 ALA A N    1  
ATOM 856   C CA   . ALA A 1 57  ? 3.252   -6.567  -3.582  1.00 0.00 ? 135 ALA A CA   1  
ATOM 857   C C    . ALA A 1 57  ? 3.215   -6.738  -2.067  1.00 0.00 ? 135 ALA A C    1  
ATOM 858   O O    . ALA A 1 57  ? 3.477   -7.825  -1.549  1.00 0.00 ? 135 ALA A O    1  
ATOM 859   C CB   . ALA A 1 57  ? 1.890   -6.878  -4.184  1.00 0.00 ? 135 ALA A CB   1  
ATOM 860   H H    . ALA A 1 57  ? 4.041   -8.328  -4.452  1.00 0.00 ? 135 ALA A H    1  
ATOM 861   H HA   . ALA A 1 57  ? 3.494   -5.540  -3.812  1.00 0.00 ? 135 ALA A HA   1  
ATOM 862   H HB1  . ALA A 1 57  ? 1.252   -6.010  -4.096  1.00 0.00 ? 135 ALA A HB1  1  
ATOM 863   H HB2  . ALA A 1 57  ? 2.007   -7.135  -5.226  1.00 0.00 ? 135 ALA A HB2  1  
ATOM 864   H HB3  . ALA A 1 57  ? 1.444   -7.708  -3.656  1.00 0.00 ? 135 ALA A HB3  1  
ATOM 865   N N    . CYS A 1 58  ? 2.889   -5.661  -1.363  1.00 0.00 ? 136 CYS A N    1  
ATOM 866   C CA   . CYS A 1 58  ? 2.819   -5.691  0.094   1.00 0.00 ? 136 CYS A CA   1  
ATOM 867   C C    . CYS A 1 58  ? 1.445   -5.244  0.582   1.00 0.00 ? 136 CYS A C    1  
ATOM 868   O O    . CYS A 1 58  ? 1.144   -4.050  0.612   1.00 0.00 ? 136 CYS A O    1  
ATOM 869   C CB   . CYS A 1 58  ? 3.904   -4.797  0.697   1.00 0.00 ? 136 CYS A CB   1  
ATOM 870   S SG   . CYS A 1 58  ? 3.773   -4.583  2.487   1.00 0.00 ? 136 CYS A SG   1  
ATOM 871   H H    . CYS A 1 58  ? 2.691   -4.824  -1.832  1.00 0.00 ? 136 CYS A H    1  
ATOM 872   H HA   . CYS A 1 58  ? 2.986   -6.709  0.411   1.00 0.00 ? 136 CYS A HA   1  
ATOM 873   H HB2  . CYS A 1 58  ? 4.872   -5.228  0.488   1.00 0.00 ? 136 CYS A HB2  1  
ATOM 874   H HB3  . CYS A 1 58  ? 3.847   -3.820  0.242   1.00 0.00 ? 136 CYS A HB3  1  
ATOM 875   H HG   . CYS A 1 58  ? 2.674   -5.200  2.893   1.00 0.00 ? 136 CYS A HG   1  
ATOM 876   N N    . ARG A 1 59  ? 0.614   -6.209  0.961   1.00 0.00 ? 137 ARG A N    1  
ATOM 877   C CA   . ARG A 1 59  ? -0.729  -5.915  1.445   1.00 0.00 ? 137 ARG A CA   1  
ATOM 878   C C    . ARG A 1 59  ? -0.722  -5.661  2.950   1.00 0.00 ? 137 ARG A C    1  
ATOM 879   O O    . ARG A 1 59  ? 0.002   -6.319  3.697   1.00 0.00 ? 137 ARG A O    1  
ATOM 880   C CB   . ARG A 1 59  ? -1.677  -7.070  1.117   1.00 0.00 ? 137 ARG A CB   1  
ATOM 881   C CG   . ARG A 1 59  ? -2.280  -6.985  -0.276  1.00 0.00 ? 137 ARG A CG   1  
ATOM 882   C CD   . ARG A 1 59  ? -1.305  -7.473  -1.336  1.00 0.00 ? 137 ARG A CD   1  
ATOM 883   N NE   . ARG A 1 59  ? -1.976  -7.781  -2.596  1.00 0.00 ? 137 ARG A NE   1  
ATOM 884   C CZ   . ARG A 1 59  ? -2.580  -8.938  -2.842  1.00 0.00 ? 137 ARG A CZ   1  
ATOM 885   N NH1  . ARG A 1 59  ? -2.599  -9.890  -1.920  1.00 0.00 ? 137 ARG A NH1  1  
ATOM 886   N NH2  . ARG A 1 59  ? -3.169  -9.144  -4.014  1.00 0.00 ? 137 ARG A NH2  1  
ATOM 887   H H    . ARG A 1 59  ? 0.911   -7.142  0.914   1.00 0.00 ? 137 ARG A H    1  
ATOM 888   H HA   . ARG A 1 59  ? -1.075  -5.023  0.943   1.00 0.00 ? 137 ARG A HA   1  
ATOM 889   H HB2  . ARG A 1 59  ? -1.133  -8.000  1.193   1.00 0.00 ? 137 ARG A HB2  1  
ATOM 890   H HB3  . ARG A 1 59  ? -2.483  -7.073  1.835   1.00 0.00 ? 137 ARG A HB3  1  
ATOM 891   H HG2  . ARG A 1 59  ? -3.169  -7.598  -0.311  1.00 0.00 ? 137 ARG A HG2  1  
ATOM 892   H HG3  . ARG A 1 59  ? -2.541  -5.958  -0.483  1.00 0.00 ? 137 ARG A HG3  1  
ATOM 893   H HD2  . ARG A 1 59  ? -0.569  -6.702  -1.511  1.00 0.00 ? 137 ARG A HD2  1  
ATOM 894   H HD3  . ARG A 1 59  ? -0.814  -8.363  -0.972  1.00 0.00 ? 137 ARG A HD3  1  
ATOM 895   H HE   . ARG A 1 59  ? -1.974  -7.092  -3.292  1.00 0.00 ? 137 ARG A HE   1  
ATOM 896   H HH11 . ARG A 1 59  ? -2.157  -9.737  -1.036  1.00 0.00 ? 137 ARG A HH11 1  
ATOM 897   H HH12 . ARG A 1 59  ? -3.056  -10.760 -2.107  1.00 0.00 ? 137 ARG A HH12 1  
ATOM 898   H HH21 . ARG A 1 59  ? -3.157  -8.429  -4.712  1.00 0.00 ? 137 ARG A HH21 1  
ATOM 899   H HH22 . ARG A 1 59  ? -3.623  -10.015 -4.198  1.00 0.00 ? 137 ARG A HH22 1  
ATOM 900   N N    . ALA A 1 60  ? -1.532  -4.702  3.387   1.00 0.00 ? 138 ALA A N    1  
ATOM 901   C CA   . ALA A 1 60  ? -1.620  -4.363  4.802   1.00 0.00 ? 138 ALA A CA   1  
ATOM 902   C C    . ALA A 1 60  ? -3.073  -4.257  5.252   1.00 0.00 ? 138 ALA A C    1  
ATOM 903   O O    . ALA A 1 60  ? -3.882  -3.580  4.616   1.00 0.00 ? 138 ALA A O    1  
ATOM 904   C CB   . ALA A 1 60  ? -0.883  -3.061  5.078   1.00 0.00 ? 138 ALA A CB   1  
ATOM 905   H H    . ALA A 1 60  ? -2.085  -4.213  2.743   1.00 0.00 ? 138 ALA A H    1  
ATOM 906   H HA   . ALA A 1 60  ? -1.136  -5.148  5.364   1.00 0.00 ? 138 ALA A HA   1  
ATOM 907   H HB1  . ALA A 1 60  ? -1.545  -2.375  5.589   1.00 0.00 ? 138 ALA A HB1  1  
ATOM 908   H HB2  . ALA A 1 60  ? -0.022  -3.259  5.699   1.00 0.00 ? 138 ALA A HB2  1  
ATOM 909   H HB3  . ALA A 1 60  ? -0.562  -2.623  4.145   1.00 0.00 ? 138 ALA A HB3  1  
ATOM 910   N N    . TYR A 1 61  ? -3.398  -4.930  6.350   1.00 0.00 ? 139 TYR A N    1  
ATOM 911   C CA   . TYR A 1 61  ? -4.755  -4.914  6.882   1.00 0.00 ? 139 TYR A CA   1  
ATOM 912   C C    . TYR A 1 61  ? -4.866  -3.953  8.063   1.00 0.00 ? 139 TYR A C    1  
ATOM 913   O O    . TYR A 1 61  ? -4.037  -3.974  8.973   1.00 0.00 ? 139 TYR A O    1  
ATOM 914   C CB   . TYR A 1 61  ? -5.173  -6.320  7.314   1.00 0.00 ? 139 TYR A CB   1  
ATOM 915   C CG   . TYR A 1 61  ? -5.384  -7.271  6.158   1.00 0.00 ? 139 TYR A CG   1  
ATOM 916   C CD1  . TYR A 1 61  ? -4.307  -7.754  5.424   1.00 0.00 ? 139 TYR A CD1  1  
ATOM 917   C CD2  . TYR A 1 61  ? -6.660  -7.686  5.798   1.00 0.00 ? 139 TYR A CD2  1  
ATOM 918   C CE1  . TYR A 1 61  ? -4.495  -8.622  4.366   1.00 0.00 ? 139 TYR A CE1  1  
ATOM 919   C CE2  . TYR A 1 61  ? -6.857  -8.555  4.742   1.00 0.00 ? 139 TYR A CE2  1  
ATOM 920   C CZ   . TYR A 1 61  ? -5.772  -9.020  4.030   1.00 0.00 ? 139 TYR A CZ   1  
ATOM 921   O OH   . TYR A 1 61  ? -5.964  -9.885  2.977   1.00 0.00 ? 139 TYR A OH   1  
ATOM 922   H H    . TYR A 1 61  ? -2.710  -5.452  6.812   1.00 0.00 ? 139 TYR A H    1  
ATOM 923   H HA   . TYR A 1 61  ? -5.416  -4.578  6.097   1.00 0.00 ? 139 TYR A HA   1  
ATOM 924   H HB2  . TYR A 1 61  ? -4.407  -6.737  7.949   1.00 0.00 ? 139 TYR A HB2  1  
ATOM 925   H HB3  . TYR A 1 61  ? -6.099  -6.260  7.867   1.00 0.00 ? 139 TYR A HB3  1  
ATOM 926   H HD1  . TYR A 1 61  ? -3.308  -7.440  5.690   1.00 0.00 ? 139 TYR A HD1  1  
ATOM 927   H HD2  . TYR A 1 61  ? -7.508  -7.320  6.358   1.00 0.00 ? 139 TYR A HD2  1  
ATOM 928   H HE1  . TYR A 1 61  ? -3.645  -8.987  3.808   1.00 0.00 ? 139 TYR A HE1  1  
ATOM 929   H HE2  . TYR A 1 61  ? -7.857  -8.867  4.478   1.00 0.00 ? 139 TYR A HE2  1  
ATOM 930   H HH   . TYR A 1 61  ? -5.936  -10.790 3.297   1.00 0.00 ? 139 TYR A HH   1  
ATOM 931   N N    . TRP A 1 62  ? -5.895  -3.115  8.040   1.00 0.00 ? 140 TRP A N    1  
ATOM 932   C CA   . TRP A 1 62  ? -6.115  -2.146  9.108   1.00 0.00 ? 140 TRP A CA   1  
ATOM 933   C C    . TRP A 1 62  ? -7.525  -2.273  9.675   1.00 0.00 ? 140 TRP A C    1  
ATOM 934   O O    . TRP A 1 62  ? -8.480  -2.528  8.941   1.00 0.00 ? 140 TRP A O    1  
ATOM 935   C CB   . TRP A 1 62  ? -5.886  -0.725  8.591   1.00 0.00 ? 140 TRP A CB   1  
ATOM 936   C CG   . TRP A 1 62  ? -6.742  -0.377  7.411   1.00 0.00 ? 140 TRP A CG   1  
ATOM 937   C CD1  . TRP A 1 62  ? -6.586  -0.815  6.127   1.00 0.00 ? 140 TRP A CD1  1  
ATOM 938   C CD2  . TRP A 1 62  ? -7.886  0.484   7.407   1.00 0.00 ? 140 TRP A CD2  1  
ATOM 939   N NE1  . TRP A 1 62  ? -7.564  -0.278  5.325   1.00 0.00 ? 140 TRP A NE1  1  
ATOM 940   C CE2  . TRP A 1 62  ? -8.375  0.522   6.086   1.00 0.00 ? 140 TRP A CE2  1  
ATOM 941   C CE3  . TRP A 1 62  ? -8.547  1.226   8.391   1.00 0.00 ? 140 TRP A CE3  1  
ATOM 942   C CZ2  . TRP A 1 62  ? -9.491  1.272   5.727   1.00 0.00 ? 140 TRP A CZ2  1  
ATOM 943   C CZ3  . TRP A 1 62  ? -9.655  1.970   8.032   1.00 0.00 ? 140 TRP A CZ3  1  
ATOM 944   C CH2  . TRP A 1 62  ? -10.118 1.988   6.710   1.00 0.00 ? 140 TRP A CH2  1  
ATOM 945   H H    . TRP A 1 62  ? -6.522  -3.147  7.287   1.00 0.00 ? 140 TRP A H    1  
ATOM 946   H HA   . TRP A 1 62  ? -5.404  -2.353  9.894   1.00 0.00 ? 140 TRP A HA   1  
ATOM 947   H HB2  . TRP A 1 62  ? -6.105  -0.022  9.381   1.00 0.00 ? 140 TRP A HB2  1  
ATOM 948   H HB3  . TRP A 1 62  ? -4.852  -0.620  8.296   1.00 0.00 ? 140 TRP A HB3  1  
ATOM 949   H HD1  . TRP A 1 62  ? -5.803  -1.483  5.804   1.00 0.00 ? 140 TRP A HD1  1  
ATOM 950   H HE1  . TRP A 1 62  ? -7.665  -0.443  4.364   1.00 0.00 ? 140 TRP A HE1  1  
ATOM 951   H HE3  . TRP A 1 62  ? -8.205  1.224   9.415   1.00 0.00 ? 140 TRP A HE3  1  
ATOM 952   H HZ2  . TRP A 1 62  ? -9.861  1.296   4.712   1.00 0.00 ? 140 TRP A HZ2  1  
ATOM 953   H HZ3  . TRP A 1 62  ? -10.178 2.550   8.778   1.00 0.00 ? 140 TRP A HZ3  1  
ATOM 954   H HH2  . TRP A 1 62  ? -10.987 2.584   6.475   1.00 0.00 ? 140 TRP A HH2  1  
ATOM 955   N N    . LYS A 1 63  ? -7.649  -2.093  10.986  1.00 0.00 ? 141 LYS A N    1  
ATOM 956   C CA   . LYS A 1 63  ? -8.943  -2.186  11.652  1.00 0.00 ? 141 LYS A CA   1  
ATOM 957   C C    . LYS A 1 63  ? -9.954  -1.241  11.011  1.00 0.00 ? 141 LYS A C    1  
ATOM 958   O O    . LYS A 1 63  ? -9.799  -0.021  11.061  1.00 0.00 ? 141 LYS A O    1  
ATOM 959   C CB   . LYS A 1 63  ? -8.798  -1.860  13.140  1.00 0.00 ? 141 LYS A CB   1  
ATOM 960   C CG   . LYS A 1 63  ? -8.146  -2.971  13.945  1.00 0.00 ? 141 LYS A CG   1  
ATOM 961   C CD   . LYS A 1 63  ? -9.172  -3.978  14.438  1.00 0.00 ? 141 LYS A CD   1  
ATOM 962   C CE   . LYS A 1 63  ? -8.680  -4.715  15.675  1.00 0.00 ? 141 LYS A CE   1  
ATOM 963   N NZ   . LYS A 1 63  ? -9.517  -5.909  15.978  1.00 0.00 ? 141 LYS A NZ   1  
ATOM 964   H H    . LYS A 1 63  ? -6.851  -1.892  11.518  1.00 0.00 ? 141 LYS A H    1  
ATOM 965   H HA   . LYS A 1 63  ? -9.298  -3.200  11.547  1.00 0.00 ? 141 LYS A HA   1  
ATOM 966   H HB2  . LYS A 1 63  ? -8.197  -0.969  13.244  1.00 0.00 ? 141 LYS A HB2  1  
ATOM 967   H HB3  . LYS A 1 63  ? -9.779  -1.673  13.553  1.00 0.00 ? 141 LYS A HB3  1  
ATOM 968   H HG2  . LYS A 1 63  ? -7.427  -3.482  13.322  1.00 0.00 ? 141 LYS A HG2  1  
ATOM 969   H HG3  . LYS A 1 63  ? -7.642  -2.538  14.798  1.00 0.00 ? 141 LYS A HG3  1  
ATOM 970   H HD2  . LYS A 1 63  ? -10.086 -3.458  14.683  1.00 0.00 ? 141 LYS A HD2  1  
ATOM 971   H HD3  . LYS A 1 63  ? -9.364  -4.696  13.654  1.00 0.00 ? 141 LYS A HD3  1  
ATOM 972   H HE2  . LYS A 1 63  ? -7.662  -5.033  15.507  1.00 0.00 ? 141 LYS A HE2  1  
ATOM 973   H HE3  . LYS A 1 63  ? -8.712  -4.039  16.517  1.00 0.00 ? 141 LYS A HE3  1  
ATOM 974   H HZ1  . LYS A 1 63  ? -10.524 -5.649  15.974  1.00 0.00 ? 141 LYS A HZ1  1  
ATOM 975   H HZ2  . LYS A 1 63  ? -9.272  -6.287  16.915  1.00 0.00 ? 141 LYS A HZ2  1  
ATOM 976   H HZ3  . LYS A 1 63  ? -9.358  -6.648  15.265  1.00 0.00 ? 141 LYS A HZ3  1  
ATOM 977   N N    . THR A 1 64  ? -10.992 -1.813  10.408  1.00 0.00 ? 142 THR A N    1  
ATOM 978   C CA   . THR A 1 64  ? -12.029 -1.022  9.757   1.00 0.00 ? 142 THR A CA   1  
ATOM 979   C C    . THR A 1 64  ? -13.318 -1.029  10.572  1.00 0.00 ? 142 THR A C    1  
ATOM 980   O O    . THR A 1 64  ? -13.488 -1.845  11.478  1.00 0.00 ? 142 THR A O    1  
ATOM 981   C CB   . THR A 1 64  ? -12.328 -1.546  8.340   1.00 0.00 ? 142 THR A CB   1  
ATOM 982   O OG1  . THR A 1 64  ? -12.323 -2.978  8.336   1.00 0.00 ? 142 THR A OG1  1  
ATOM 983   C CG2  . THR A 1 64  ? -11.302 -1.027  7.344   1.00 0.00 ? 142 THR A CG2  1  
ATOM 984   H H    . THR A 1 64  ? -11.060 -2.791  10.402  1.00 0.00 ? 142 THR A H    1  
ATOM 985   H HA   . THR A 1 64  ? -11.671 -0.006  9.675   1.00 0.00 ? 142 THR A HA   1  
ATOM 986   H HB   . THR A 1 64  ? -13.306 -1.196  8.042   1.00 0.00 ? 142 THR A HB   1  
ATOM 987   H HG1  . THR A 1 64  ? -12.916 -3.298  7.651   1.00 0.00 ? 142 THR A HG1  1  
ATOM 988   H HG21 . THR A 1 64  ? -10.364 -1.540  7.494   1.00 0.00 ? 142 THR A HG21 1  
ATOM 989   H HG22 . THR A 1 64  ? -11.162 0.033   7.491   1.00 0.00 ? 142 THR A HG22 1  
ATOM 990   H HG23 . THR A 1 64  ? -11.654 -1.208  6.339   1.00 0.00 ? 142 THR A HG23 1  
ATOM 991   N N    . THR A 1 65  ? -14.225 -0.114  10.243  1.00 0.00 ? 143 THR A N    1  
ATOM 992   C CA   . THR A 1 65  ? -15.498 -0.013  10.944  1.00 0.00 ? 143 THR A CA   1  
ATOM 993   C C    . THR A 1 65  ? -16.553 -0.904  10.298  1.00 0.00 ? 143 THR A C    1  
ATOM 994   O O    . THR A 1 65  ? -16.271 -1.622  9.338   1.00 0.00 ? 143 THR A O    1  
ATOM 995   C CB   . THR A 1 65  ? -16.013 1.438   10.969  1.00 0.00 ? 143 THR A CB   1  
ATOM 996   O OG1  . THR A 1 65  ? -16.698 1.736   9.747   1.00 0.00 ? 143 THR A OG1  1  
ATOM 997   C CG2  . THR A 1 65  ? -14.865 2.416   11.165  1.00 0.00 ? 143 THR A CG2  1  
ATOM 998   H H    . THR A 1 65  ? -14.030 0.509   9.511   1.00 0.00 ? 143 THR A H    1  
ATOM 999   H HA   . THR A 1 65  ? -15.344 -0.336  11.963  1.00 0.00 ? 143 THR A HA   1  
ATOM 1000  H HB   . THR A 1 65  ? -16.702 1.545   11.795  1.00 0.00 ? 143 THR A HB   1  
ATOM 1001  H HG1  . THR A 1 65  ? -17.646 1.678   9.889   1.00 0.00 ? 143 THR A HG1  1  
ATOM 1002  H HG21 . THR A 1 65  ? -14.305 2.143   12.047  1.00 0.00 ? 143 THR A HG21 1  
ATOM 1003  H HG22 . THR A 1 65  ? -15.258 3.415   11.283  1.00 0.00 ? 143 THR A HG22 1  
ATOM 1004  H HG23 . THR A 1 65  ? -14.215 2.385   10.303  1.00 0.00 ? 143 THR A HG23 1  
ATOM 1005  N N    . LEU A 1 66  ? -17.770 -0.852  10.828  1.00 0.00 ? 144 LEU A N    1  
ATOM 1006  C CA   . LEU A 1 66  ? -18.869 -1.654  10.302  1.00 0.00 ? 144 LEU A CA   1  
ATOM 1007  C C    . LEU A 1 66  ? -19.760 -0.821  9.386   1.00 0.00 ? 144 LEU A C    1  
ATOM 1008  O O    . LEU A 1 66  ? -20.973 -1.027  9.328   1.00 0.00 ? 144 LEU A O    1  
ATOM 1009  C CB   . LEU A 1 66  ? -19.698 -2.234  11.449  1.00 0.00 ? 144 LEU A CB   1  
ATOM 1010  C CG   . LEU A 1 66  ? -18.958 -2.449  12.770  1.00 0.00 ? 144 LEU A CG   1  
ATOM 1011  C CD1  . LEU A 1 66  ? -19.932 -2.421  13.938  1.00 0.00 ? 144 LEU A CD1  1  
ATOM 1012  C CD2  . LEU A 1 66  ? -18.192 -3.763  12.744  1.00 0.00 ? 144 LEU A CD2  1  
ATOM 1013  H H    . LEU A 1 66  ? -17.934 -0.261  11.592  1.00 0.00 ? 144 LEU A H    1  
ATOM 1014  H HA   . LEU A 1 66  ? -18.443 -2.465  9.730   1.00 0.00 ? 144 LEU A HA   1  
ATOM 1015  H HB2  . LEU A 1 66  ? -20.520 -1.561  11.636  1.00 0.00 ? 144 LEU A HB2  1  
ATOM 1016  H HB3  . LEU A 1 66  ? -20.085 -3.190  11.125  1.00 0.00 ? 144 LEU A HB3  1  
ATOM 1017  H HG   . LEU A 1 66  ? -18.246 -1.648  12.910  1.00 0.00 ? 144 LEU A HG   1  
ATOM 1018  H HD11 . LEU A 1 66  ? -19.388 -2.257  14.855  1.00 0.00 ? 144 LEU A HD11 1  
ATOM 1019  H HD12 . LEU A 1 66  ? -20.456 -3.364  13.992  1.00 0.00 ? 144 LEU A HD12 1  
ATOM 1020  H HD13 . LEU A 1 66  ? -20.644 -1.622  13.793  1.00 0.00 ? 144 LEU A HD13 1  
ATOM 1021  H HD21 . LEU A 1 66  ? -17.256 -3.644  13.270  1.00 0.00 ? 144 LEU A HD21 1  
ATOM 1022  H HD22 . LEU A 1 66  ? -17.995 -4.045  11.719  1.00 0.00 ? 144 LEU A HD22 1  
ATOM 1023  H HD23 . LEU A 1 66  ? -18.779 -4.532  13.222  1.00 0.00 ? 144 LEU A HD23 1  
ATOM 1024  N N    . SER A 1 67  ? -19.151 0.118   8.670   1.00 0.00 ? 145 SER A N    1  
ATOM 1025  C CA   . SER A 1 67  ? -19.890 0.983   7.757   1.00 0.00 ? 145 SER A CA   1  
ATOM 1026  C C    . SER A 1 67  ? -19.088 1.240   6.484   1.00 0.00 ? 145 SER A C    1  
ATOM 1027  O O    . SER A 1 67  ? -17.975 1.762   6.533   1.00 0.00 ? 145 SER A O    1  
ATOM 1028  C CB   . SER A 1 67  ? -20.225 2.311   8.438   1.00 0.00 ? 145 SER A CB   1  
ATOM 1029  O OG   . SER A 1 67  ? -21.375 2.188   9.257   1.00 0.00 ? 145 SER A OG   1  
ATOM 1030  H H    . SER A 1 67  ? -18.182 0.234   8.760   1.00 0.00 ? 145 SER A H    1  
ATOM 1031  H HA   . SER A 1 67  ? -20.809 0.481   7.495   1.00 0.00 ? 145 SER A HA   1  
ATOM 1032  H HB2  . SER A 1 67  ? -19.392 2.618   9.052   1.00 0.00 ? 145 SER A HB2  1  
ATOM 1033  H HB3  . SER A 1 67  ? -20.413 3.062   7.684   1.00 0.00 ? 145 SER A HB3  1  
ATOM 1034  H HG   . SER A 1 67  ? -21.473 1.275   9.536   1.00 0.00 ? 145 SER A HG   1  
ATOM 1035  N N    . ALA A 1 68  ? -19.664 0.869   5.345   1.00 0.00 ? 146 ALA A N    1  
ATOM 1036  C CA   . ALA A 1 68  ? -19.006 1.060   4.059   1.00 0.00 ? 146 ALA A CA   1  
ATOM 1037  C C    . ALA A 1 68  ? -18.632 2.523   3.846   1.00 0.00 ? 146 ALA A C    1  
ATOM 1038  O O    . ALA A 1 68  ? -17.549 2.829   3.347   1.00 0.00 ? 146 ALA A O    1  
ATOM 1039  C CB   . ALA A 1 68  ? -19.902 0.572   2.930   1.00 0.00 ? 146 ALA A CB   1  
ATOM 1040  H H    . ALA A 1 68  ? -20.553 0.458   5.371   1.00 0.00 ? 146 ALA A H    1  
ATOM 1041  H HA   . ALA A 1 68  ? -18.105 0.464   4.053   1.00 0.00 ? 146 ALA A HA   1  
ATOM 1042  H HB1  . ALA A 1 68  ? -19.342 -0.092  2.288   1.00 0.00 ? 146 ALA A HB1  1  
ATOM 1043  H HB2  . ALA A 1 68  ? -20.748 0.045   3.344   1.00 0.00 ? 146 ALA A HB2  1  
ATOM 1044  H HB3  . ALA A 1 68  ? -20.251 1.418   2.357   1.00 0.00 ? 146 ALA A HB3  1  
ATOM 1045  N N    . GLU A 1 69  ? -19.535 3.421   4.226   1.00 0.00 ? 147 GLU A N    1  
ATOM 1046  C CA   . GLU A 1 69  ? -19.299 4.852   4.074   1.00 0.00 ? 147 GLU A CA   1  
ATOM 1047  C C    . GLU A 1 69  ? -18.066 5.287   4.862   1.00 0.00 ? 147 GLU A C    1  
ATOM 1048  O O    . GLU A 1 69  ? -17.224 6.027   4.356   1.00 0.00 ? 147 GLU A O    1  
ATOM 1049  C CB   . GLU A 1 69  ? -20.521 5.646   4.539   1.00 0.00 ? 147 GLU A CB   1  
ATOM 1050  C CG   . GLU A 1 69  ? -21.784 5.334   3.754   1.00 0.00 ? 147 GLU A CG   1  
ATOM 1051  C CD   . GLU A 1 69  ? -21.849 6.077   2.434   1.00 0.00 ? 147 GLU A CD   1  
ATOM 1052  O OE1  . GLU A 1 69  ? -21.586 7.298   2.426   1.00 0.00 ? 147 GLU A OE1  1  
ATOM 1053  O OE2  . GLU A 1 69  ? -22.163 5.437   1.408   1.00 0.00 ? 147 GLU A OE2  1  
ATOM 1054  H H    . GLU A 1 69  ? -20.380 3.115   4.616   1.00 0.00 ? 147 GLU A H    1  
ATOM 1055  H HA   . GLU A 1 69  ? -19.129 5.051   3.026   1.00 0.00 ? 147 GLU A HA   1  
ATOM 1056  H HB2  . GLU A 1 69  ? -20.705 5.424   5.580   1.00 0.00 ? 147 GLU A HB2  1  
ATOM 1057  H HB3  . GLU A 1 69  ? -20.311 6.700   4.437   1.00 0.00 ? 147 GLU A HB3  1  
ATOM 1058  H HG2  . GLU A 1 69  ? -21.816 4.273   3.554   1.00 0.00 ? 147 GLU A HG2  1  
ATOM 1059  H HG3  . GLU A 1 69  ? -22.641 5.612   4.350   1.00 0.00 ? 147 GLU A HG3  1  
ATOM 1060  N N    . GLN A 1 70  ? -17.970 4.821   6.103   1.00 0.00 ? 148 GLN A N    1  
ATOM 1061  C CA   . GLN A 1 70  ? -16.843 5.162   6.962   1.00 0.00 ? 148 GLN A CA   1  
ATOM 1062  C C    . GLN A 1 70  ? -15.551 4.548   6.433   1.00 0.00 ? 148 GLN A C    1  
ATOM 1063  O O    . GLN A 1 70  ? -14.515 5.210   6.376   1.00 0.00 ? 148 GLN A O    1  
ATOM 1064  C CB   . GLN A 1 70  ? -17.100 4.685   8.392   1.00 0.00 ? 148 GLN A CB   1  
ATOM 1065  C CG   . GLN A 1 70  ? -16.303 5.445   9.440   1.00 0.00 ? 148 GLN A CG   1  
ATOM 1066  C CD   . GLN A 1 70  ? -14.858 5.657   9.033   1.00 0.00 ? 148 GLN A CD   1  
ATOM 1067  O OE1  . GLN A 1 70  ? -14.389 6.791   8.932   1.00 0.00 ? 148 GLN A OE1  1  
ATOM 1068  N NE2  . GLN A 1 70  ? -14.143 4.563   8.798   1.00 0.00 ? 148 GLN A NE2  1  
ATOM 1069  H H    . GLN A 1 70  ? -18.675 4.235   6.449   1.00 0.00 ? 148 GLN A H    1  
ATOM 1070  H HA   . GLN A 1 70  ? -16.741 6.237   6.963   1.00 0.00 ? 148 GLN A HA   1  
ATOM 1071  H HB2  . GLN A 1 70  ? -18.150 4.803   8.614   1.00 0.00 ? 148 GLN A HB2  1  
ATOM 1072  H HB3  . GLN A 1 70  ? -16.841 3.639   8.462   1.00 0.00 ? 148 GLN A HB3  1  
ATOM 1073  H HG2  . GLN A 1 70  ? -16.762 6.410   9.593   1.00 0.00 ? 148 GLN A HG2  1  
ATOM 1074  H HG3  . GLN A 1 70  ? -16.324 4.887   10.364  1.00 0.00 ? 148 GLN A HG3  1  
ATOM 1075  H HE21 . GLN A 1 70  ? -14.583 3.693   8.897   1.00 0.00 ? 148 GLN A HE21 1  
ATOM 1076  H HE22 . GLN A 1 70  ? -13.206 4.671   8.533   1.00 0.00 ? 148 GLN A HE22 1  
ATOM 1077  N N    . ASN A 1 71  ? -15.620 3.278   6.048   1.00 0.00 ? 149 ASN A N    1  
ATOM 1078  C CA   . ASN A 1 71  ? -14.455 2.573   5.525   1.00 0.00 ? 149 ASN A CA   1  
ATOM 1079  C C    . ASN A 1 71  ? -13.974 3.208   4.224   1.00 0.00 ? 149 ASN A C    1  
ATOM 1080  O O    . ASN A 1 71  ? -12.773 3.296   3.971   1.00 0.00 ? 149 ASN A O    1  
ATOM 1081  C CB   . ASN A 1 71  ? -14.786 1.098   5.294   1.00 0.00 ? 149 ASN A CB   1  
ATOM 1082  C CG   . ASN A 1 71  ? -15.053 0.355   6.589   1.00 0.00 ? 149 ASN A CG   1  
ATOM 1083  O OD1  . ASN A 1 71  ? -14.531 0.717   7.644   1.00 0.00 ? 149 ASN A OD1  1  
ATOM 1084  N ND2  . ASN A 1 71  ? -15.868 -0.690  6.514   1.00 0.00 ? 149 ASN A ND2  1  
ATOM 1085  H H    . ASN A 1 71  ? -16.474 2.802   6.118   1.00 0.00 ? 149 ASN A H    1  
ATOM 1086  H HA   . ASN A 1 71  ? -13.667 2.645   6.260   1.00 0.00 ? 149 ASN A HA   1  
ATOM 1087  H HB2  . ASN A 1 71  ? -15.667 1.026   4.673   1.00 0.00 ? 149 ASN A HB2  1  
ATOM 1088  H HB3  . ASN A 1 71  ? -13.957 0.622   4.791   1.00 0.00 ? 149 ASN A HB3  1  
ATOM 1089  H HD21 . ASN A 1 71  ? -16.247 -0.921  5.640   1.00 0.00 ? 149 ASN A HD21 1  
ATOM 1090  H HD22 . ASN A 1 71  ? -16.058 -1.188  7.337   1.00 0.00 ? 149 ASN A HD22 1  
ATOM 1091  N N    . ALA A 1 72  ? -14.921 3.650   3.402   1.00 0.00 ? 150 ALA A N    1  
ATOM 1092  C CA   . ALA A 1 72  ? -14.595 4.279   2.129   1.00 0.00 ? 150 ALA A CA   1  
ATOM 1093  C C    . ALA A 1 72  ? -13.803 5.565   2.339   1.00 0.00 ? 150 ALA A C    1  
ATOM 1094  O O    . ALA A 1 72  ? -12.758 5.771   1.720   1.00 0.00 ? 150 ALA A O    1  
ATOM 1095  C CB   . ALA A 1 72  ? -15.864 4.562   1.339   1.00 0.00 ? 150 ALA A CB   1  
ATOM 1096  H H    . ALA A 1 72  ? -15.861 3.551   3.660   1.00 0.00 ? 150 ALA A H    1  
ATOM 1097  H HA   . ALA A 1 72  ? -13.992 3.586   1.559   1.00 0.00 ? 150 ALA A HA   1  
ATOM 1098  H HB1  . ALA A 1 72  ? -16.725 4.341   1.953   1.00 0.00 ? 150 ALA A HB1  1  
ATOM 1099  H HB2  . ALA A 1 72  ? -15.884 5.602   1.051   1.00 0.00 ? 150 ALA A HB2  1  
ATOM 1100  H HB3  . ALA A 1 72  ? -15.883 3.942   0.455   1.00 0.00 ? 150 ALA A HB3  1  
ATOM 1101  N N    . HIS A 1 73  ? -14.307 6.429   3.214   1.00 0.00 ? 151 HIS A N    1  
ATOM 1102  C CA   . HIS A 1 73  ? -13.646 7.696   3.505   1.00 0.00 ? 151 HIS A CA   1  
ATOM 1103  C C    . HIS A 1 73  ? -12.248 7.463   4.069   1.00 0.00 ? 151 HIS A C    1  
ATOM 1104  O O    . HIS A 1 73  ? -11.275 8.061   3.611   1.00 0.00 ? 151 HIS A O    1  
ATOM 1105  C CB   . HIS A 1 73  ? -14.477 8.514   4.494   1.00 0.00 ? 151 HIS A CB   1  
ATOM 1106  C CG   . HIS A 1 73  ? -13.699 9.593   5.182   1.00 0.00 ? 151 HIS A CG   1  
ATOM 1107  N ND1  . HIS A 1 73  ? -13.675 10.900  4.744   1.00 0.00 ? 151 HIS A ND1  1  
ATOM 1108  C CD2  . HIS A 1 73  ? -12.915 9.553   6.285   1.00 0.00 ? 151 HIS A CD2  1  
ATOM 1109  C CE1  . HIS A 1 73  ? -12.909 11.617  5.546   1.00 0.00 ? 151 HIS A CE1  1  
ATOM 1110  N NE2  . HIS A 1 73  ? -12.436 10.824  6.490   1.00 0.00 ? 151 HIS A NE2  1  
ATOM 1111  H H    . HIS A 1 73  ? -15.143 6.209   3.675   1.00 0.00 ? 151 HIS A H    1  
ATOM 1112  H HA   . HIS A 1 73  ? -13.560 8.246   2.580   1.00 0.00 ? 151 HIS A HA   1  
ATOM 1113  H HB2  . HIS A 1 73  ? -15.296 8.981   3.966   1.00 0.00 ? 151 HIS A HB2  1  
ATOM 1114  H HB3  . HIS A 1 73  ? -14.874 7.855   5.253   1.00 0.00 ? 151 HIS A HB3  1  
ATOM 1115  H HD2  . HIS A 1 73  ? -12.705 8.684   6.892   1.00 0.00 ? 151 HIS A HD2  1  
ATOM 1116  H HE1  . HIS A 1 73  ? -12.704 12.673  5.448   1.00 0.00 ? 151 HIS A HE1  1  
ATOM 1117  H HE2  . HIS A 1 73  ? -11.774 11.081  7.164   1.00 0.00 ? 151 HIS A HE2  1  
ATOM 1118  N N    . MET A 1 74  ? -12.156 6.590   5.067   1.00 0.00 ? 152 MET A N    1  
ATOM 1119  C CA   . MET A 1 74  ? -10.876 6.277   5.693   1.00 0.00 ? 152 MET A CA   1  
ATOM 1120  C C    . MET A 1 74  ? -9.919  5.646   4.688   1.00 0.00 ? 152 MET A C    1  
ATOM 1121  O O    . MET A 1 74  ? -8.745  6.009   4.622   1.00 0.00 ? 152 MET A O    1  
ATOM 1122  C CB   . MET A 1 74  ? -11.082 5.335   6.881   1.00 0.00 ? 152 MET A CB   1  
ATOM 1123  C CG   . MET A 1 74  ? -11.317 6.058   8.197   1.00 0.00 ? 152 MET A CG   1  
ATOM 1124  S SD   . MET A 1 74  ? -10.985 5.016   9.631   1.00 0.00 ? 152 MET A SD   1  
ATOM 1125  C CE   . MET A 1 74  ? -9.197  4.921   9.574   1.00 0.00 ? 152 MET A CE   1  
ATOM 1126  H H    . MET A 1 74  ? -12.967 6.144   5.390   1.00 0.00 ? 152 MET A H    1  
ATOM 1127  H HA   . MET A 1 74  ? -10.447 7.202   6.049   1.00 0.00 ? 152 MET A HA   1  
ATOM 1128  H HB2  . MET A 1 74  ? -11.937 4.706   6.682   1.00 0.00 ? 152 MET A HB2  1  
ATOM 1129  H HB3  . MET A 1 74  ? -10.205 4.713   6.988   1.00 0.00 ? 152 MET A HB3  1  
ATOM 1130  H HG2  . MET A 1 74  ? -10.669 6.921   8.240   1.00 0.00 ? 152 MET A HG2  1  
ATOM 1131  H HG3  . MET A 1 74  ? -12.346 6.381   8.234   1.00 0.00 ? 152 MET A HG3  1  
ATOM 1132  H HE1  . MET A 1 74  ? -8.839  5.408   8.678   1.00 0.00 ? 152 MET A HE1  1  
ATOM 1133  H HE2  . MET A 1 74  ? -8.783  5.414   10.441  1.00 0.00 ? 152 MET A HE2  1  
ATOM 1134  H HE3  . MET A 1 74  ? -8.892  3.885   9.567   1.00 0.00 ? 152 MET A HE3  1  
ATOM 1135  N N    . GLU A 1 75  ? -10.428 4.698   3.906   1.00 0.00 ? 153 GLU A N    1  
ATOM 1136  C CA   . GLU A 1 75  ? -9.616  4.017   2.905   1.00 0.00 ? 153 GLU A CA   1  
ATOM 1137  C C    . GLU A 1 75  ? -9.107  5.000   1.856   1.00 0.00 ? 153 GLU A C    1  
ATOM 1138  O O    . GLU A 1 75  ? -7.970  4.901   1.397   1.00 0.00 ? 153 GLU A O    1  
ATOM 1139  C CB   . GLU A 1 75  ? -10.425 2.907   2.230   1.00 0.00 ? 153 GLU A CB   1  
ATOM 1140  C CG   . GLU A 1 75  ? -9.661  2.174   1.140   1.00 0.00 ? 153 GLU A CG   1  
ATOM 1141  C CD   . GLU A 1 75  ? -8.756  1.090   1.692   1.00 0.00 ? 153 GLU A CD   1  
ATOM 1142  O OE1  . GLU A 1 75  ? -7.911  1.404   2.556   1.00 0.00 ? 153 GLU A OE1  1  
ATOM 1143  O OE2  . GLU A 1 75  ? -8.892  -0.074  1.258   1.00 0.00 ? 153 GLU A OE2  1  
ATOM 1144  H H    . GLU A 1 75  ? -11.371 4.452   4.006   1.00 0.00 ? 153 GLU A H    1  
ATOM 1145  H HA   . GLU A 1 75  ? -8.769  3.576   3.409   1.00 0.00 ? 153 GLU A HA   1  
ATOM 1146  H HB2  . GLU A 1 75  ? -10.723 2.188   2.979   1.00 0.00 ? 153 GLU A HB2  1  
ATOM 1147  H HB3  . GLU A 1 75  ? -11.311 3.341   1.789   1.00 0.00 ? 153 GLU A HB3  1  
ATOM 1148  H HG2  . GLU A 1 75  ? -10.370 1.719   0.464   1.00 0.00 ? 153 GLU A HG2  1  
ATOM 1149  H HG3  . GLU A 1 75  ? -9.057  2.887   0.600   1.00 0.00 ? 153 GLU A HG3  1  
ATOM 1150  N N    . ALA A 1 76  ? -9.958  5.949   1.480   1.00 0.00 ? 154 ALA A N    1  
ATOM 1151  C CA   . ALA A 1 76  ? -9.595  6.952   0.487   1.00 0.00 ? 154 ALA A CA   1  
ATOM 1152  C C    . ALA A 1 76  ? -8.464  7.841   0.992   1.00 0.00 ? 154 ALA A C    1  
ATOM 1153  O O    . ALA A 1 76  ? -7.513  8.128   0.264   1.00 0.00 ? 154 ALA A O    1  
ATOM 1154  C CB   . ALA A 1 76  ? -10.807 7.795   0.119   1.00 0.00 ? 154 ALA A CB   1  
ATOM 1155  H H    . ALA A 1 76  ? -10.851 5.977   1.882   1.00 0.00 ? 154 ALA A H    1  
ATOM 1156  H HA   . ALA A 1 76  ? -9.263  6.436   -0.403  1.00 0.00 ? 154 ALA A HA   1  
ATOM 1157  H HB1  . ALA A 1 76  ? -10.906 7.832   -0.956  1.00 0.00 ? 154 ALA A HB1  1  
ATOM 1158  H HB2  . ALA A 1 76  ? -11.695 7.354   0.548   1.00 0.00 ? 154 ALA A HB2  1  
ATOM 1159  H HB3  . ALA A 1 76  ? -10.680 8.796   0.504   1.00 0.00 ? 154 ALA A HB3  1  
ATOM 1160  N N    . VAL A 1 77  ? -8.573  8.276   2.244   1.00 0.00 ? 155 VAL A N    1  
ATOM 1161  C CA   . VAL A 1 77  ? -7.559  9.132   2.847   1.00 0.00 ? 155 VAL A CA   1  
ATOM 1162  C C    . VAL A 1 77  ? -6.276  8.356   3.120   1.00 0.00 ? 155 VAL A C    1  
ATOM 1163  O O    . VAL A 1 77  ? -5.174  8.847   2.870   1.00 0.00 ? 155 VAL A O    1  
ATOM 1164  C CB   . VAL A 1 77  ? -8.060  9.754   4.164   1.00 0.00 ? 155 VAL A CB   1  
ATOM 1165  C CG1  . VAL A 1 77  ? -8.535  8.670   5.119   1.00 0.00 ? 155 VAL A CG1  1  
ATOM 1166  C CG2  . VAL A 1 77  ? -6.969  10.599  4.803   1.00 0.00 ? 155 VAL A CG2  1  
ATOM 1167  H H    . VAL A 1 77  ? -9.354  8.013   2.774   1.00 0.00 ? 155 VAL A H    1  
ATOM 1168  H HA   . VAL A 1 77  ? -7.343  9.933   2.154   1.00 0.00 ? 155 VAL A HA   1  
ATOM 1169  H HB   . VAL A 1 77  ? -8.899  10.397  3.939   1.00 0.00 ? 155 VAL A HB   1  
ATOM 1170  H HG11 . VAL A 1 77  ? -7.719  7.995   5.332   1.00 0.00 ? 155 VAL A HG11 1  
ATOM 1171  H HG12 . VAL A 1 77  ? -8.877  9.124   6.038   1.00 0.00 ? 155 VAL A HG12 1  
ATOM 1172  H HG13 . VAL A 1 77  ? -9.346  8.120   4.665   1.00 0.00 ? 155 VAL A HG13 1  
ATOM 1173  H HG21 . VAL A 1 77  ? -7.346  11.045  5.711   1.00 0.00 ? 155 VAL A HG21 1  
ATOM 1174  H HG22 . VAL A 1 77  ? -6.118  9.975   5.035   1.00 0.00 ? 155 VAL A HG22 1  
ATOM 1175  H HG23 . VAL A 1 77  ? -6.667  11.377  4.117   1.00 0.00 ? 155 VAL A HG23 1  
ATOM 1176  N N    . LEU A 1 78  ? -6.425  7.141   3.635   1.00 0.00 ? 156 LEU A N    1  
ATOM 1177  C CA   . LEU A 1 78  ? -5.277  6.294   3.943   1.00 0.00 ? 156 LEU A CA   1  
ATOM 1178  C C    . LEU A 1 78  ? -4.563  5.860   2.667   1.00 0.00 ? 156 LEU A C    1  
ATOM 1179  O O    . LEU A 1 78  ? -3.334  5.818   2.616   1.00 0.00 ? 156 LEU A O    1  
ATOM 1180  C CB   . LEU A 1 78  ? -5.723  5.064   4.735   1.00 0.00 ? 156 LEU A CB   1  
ATOM 1181  C CG   . LEU A 1 78  ? -4.664  3.982   4.948   1.00 0.00 ? 156 LEU A CG   1  
ATOM 1182  C CD1  . LEU A 1 78  ? -3.620  4.448   5.952   1.00 0.00 ? 156 LEU A CD1  1  
ATOM 1183  C CD2  . LEU A 1 78  ? -5.311  2.686   5.412   1.00 0.00 ? 156 LEU A CD2  1  
ATOM 1184  H H    . LEU A 1 78  ? -7.327  6.803   3.813   1.00 0.00 ? 156 LEU A H    1  
ATOM 1185  H HA   . LEU A 1 78  ? -4.592  6.871   4.546   1.00 0.00 ? 156 LEU A HA   1  
ATOM 1186  H HB2  . LEU A 1 78  ? -6.054  5.398   5.706   1.00 0.00 ? 156 LEU A HB2  1  
ATOM 1187  H HB3  . LEU A 1 78  ? -6.554  4.616   4.208   1.00 0.00 ? 156 LEU A HB3  1  
ATOM 1188  H HG   . LEU A 1 78  ? -4.161  3.789   4.010   1.00 0.00 ? 156 LEU A HG   1  
ATOM 1189  H HD11 . LEU A 1 78  ? -3.584  5.527   5.959   1.00 0.00 ? 156 LEU A HD11 1  
ATOM 1190  H HD12 . LEU A 1 78  ? -2.653  4.057   5.673   1.00 0.00 ? 156 LEU A HD12 1  
ATOM 1191  H HD13 . LEU A 1 78  ? -3.883  4.090   6.936   1.00 0.00 ? 156 LEU A HD13 1  
ATOM 1192  H HD21 . LEU A 1 78  ? -6.250  2.548   4.896   1.00 0.00 ? 156 LEU A HD21 1  
ATOM 1193  H HD22 . LEU A 1 78  ? -5.490  2.734   6.477   1.00 0.00 ? 156 LEU A HD22 1  
ATOM 1194  H HD23 . LEU A 1 78  ? -4.654  1.857   5.194   1.00 0.00 ? 156 LEU A HD23 1  
ATOM 1195  N N    . GLN A 1 79  ? -5.342  5.540   1.638   1.00 0.00 ? 157 GLN A N    1  
ATOM 1196  C CA   . GLN A 1 79  ? -4.783  5.111   0.362   1.00 0.00 ? 157 GLN A CA   1  
ATOM 1197  C C    . GLN A 1 79  ? -3.925  6.211   -0.254  1.00 0.00 ? 157 GLN A C    1  
ATOM 1198  O O    . GLN A 1 79  ? -2.774  5.979   -0.624  1.00 0.00 ? 157 GLN A O    1  
ATOM 1199  C CB   . GLN A 1 79  ? -5.904  4.721   -0.604  1.00 0.00 ? 157 GLN A CB   1  
ATOM 1200  C CG   . GLN A 1 79  ? -6.330  3.266   -0.486  1.00 0.00 ? 157 GLN A CG   1  
ATOM 1201  C CD   . GLN A 1 79  ? -6.845  2.701   -1.794  1.00 0.00 ? 157 GLN A CD   1  
ATOM 1202  O OE1  . GLN A 1 79  ? -6.294  2.973   -2.861  1.00 0.00 ? 157 GLN A OE1  1  
ATOM 1203  N NE2  . GLN A 1 79  ? -7.908  1.908   -1.719  1.00 0.00 ? 157 GLN A NE2  1  
ATOM 1204  H H    . GLN A 1 79  ? -6.315  5.594   1.741   1.00 0.00 ? 157 GLN A H    1  
ATOM 1205  H HA   . GLN A 1 79  ? -4.162  4.247   0.546   1.00 0.00 ? 157 GLN A HA   1  
ATOM 1206  H HB2  . GLN A 1 79  ? -6.764  5.343   -0.408  1.00 0.00 ? 157 GLN A HB2  1  
ATOM 1207  H HB3  . GLN A 1 79  ? -5.567  4.893   -1.615  1.00 0.00 ? 157 GLN A HB3  1  
ATOM 1208  H HG2  . GLN A 1 79  ? -5.480  2.680   -0.168  1.00 0.00 ? 157 GLN A HG2  1  
ATOM 1209  H HG3  . GLN A 1 79  ? -7.113  3.193   0.255   1.00 0.00 ? 157 GLN A HG3  1  
ATOM 1210  H HE21 . GLN A 1 79  ? -8.295  1.736   -0.835  1.00 0.00 ? 157 GLN A HE21 1  
ATOM 1211  H HE22 . GLN A 1 79  ? -8.263  1.530   -2.550  1.00 0.00 ? 157 GLN A HE22 1  
ATOM 1212  N N    . ARG A 1 80  ? -4.493  7.407   -0.362  1.00 0.00 ? 158 ARG A N    1  
ATOM 1213  C CA   . ARG A 1 80  ? -3.780  8.543   -0.935  1.00 0.00 ? 158 ARG A CA   1  
ATOM 1214  C C    . ARG A 1 80  ? -2.606  8.950   -0.050  1.00 0.00 ? 158 ARG A C    1  
ATOM 1215  O O    . ARG A 1 80  ? -1.694  9.648   -0.493  1.00 0.00 ? 158 ARG A O    1  
ATOM 1216  C CB   . ARG A 1 80  ? -4.730  9.728   -1.119  1.00 0.00 ? 158 ARG A CB   1  
ATOM 1217  C CG   . ARG A 1 80  ? -5.079  10.436  0.179   1.00 0.00 ? 158 ARG A CG   1  
ATOM 1218  C CD   . ARG A 1 80  ? -5.418  11.899  -0.058  1.00 0.00 ? 158 ARG A CD   1  
ATOM 1219  N NE   . ARG A 1 80  ? -6.843  12.098  -0.307  1.00 0.00 ? 158 ARG A NE   1  
ATOM 1220  C CZ   . ARG A 1 80  ? -7.744  12.246  0.657   1.00 0.00 ? 158 ARG A CZ   1  
ATOM 1221  N NH1  . ARG A 1 80  ? -7.370  12.220  1.929   1.00 0.00 ? 158 ARG A NH1  1  
ATOM 1222  N NH2  . ARG A 1 80  ? -9.023  12.423  0.351   1.00 0.00 ? 158 ARG A NH2  1  
ATOM 1223  H H    . ARG A 1 80  ? -5.414  7.529   -0.050  1.00 0.00 ? 158 ARG A H    1  
ATOM 1224  H HA   . ARG A 1 80  ? -3.401  8.243   -1.901  1.00 0.00 ? 158 ARG A HA   1  
ATOM 1225  H HB2  . ARG A 1 80  ? -4.267  10.445  -1.781  1.00 0.00 ? 158 ARG A HB2  1  
ATOM 1226  H HB3  . ARG A 1 80  ? -5.645  9.374   -1.568  1.00 0.00 ? 158 ARG A HB3  1  
ATOM 1227  H HG2  . ARG A 1 80  ? -5.933  9.948   0.626   1.00 0.00 ? 158 ARG A HG2  1  
ATOM 1228  H HG3  . ARG A 1 80  ? -4.235  10.375  0.850   1.00 0.00 ? 158 ARG A HG3  1  
ATOM 1229  H HD2  . ARG A 1 80  ? -5.133  12.467  0.815   1.00 0.00 ? 158 ARG A HD2  1  
ATOM 1230  H HD3  . ARG A 1 80  ? -4.860  12.250  -0.913  1.00 0.00 ? 158 ARG A HD3  1  
ATOM 1231  H HE   . ARG A 1 80  ? -7.142  12.120  -1.240  1.00 0.00 ? 158 ARG A HE   1  
ATOM 1232  H HH11 . ARG A 1 80  ? -6.407  12.088  2.163   1.00 0.00 ? 158 ARG A HH11 1  
ATOM 1233  H HH12 . ARG A 1 80  ? -8.050  12.334  2.653   1.00 0.00 ? 158 ARG A HH12 1  
ATOM 1234  H HH21 . ARG A 1 80  ? -9.309  12.443  -0.607  1.00 0.00 ? 158 ARG A HH21 1  
ATOM 1235  H HH22 . ARG A 1 80  ? -9.701  12.535  1.077   1.00 0.00 ? 158 ARG A HH22 1  
ATOM 1236  N N    . SER A 1 81  ? -2.637  8.511   1.204   1.00 0.00 ? 159 SER A N    1  
ATOM 1237  C CA   . SER A 1 81  ? -1.578  8.833   2.153   1.00 0.00 ? 159 SER A CA   1  
ATOM 1238  C C    . SER A 1 81  ? -0.554  7.705   2.229   1.00 0.00 ? 159 SER A C    1  
ATOM 1239  O O    . SER A 1 81  ? 0.256   7.648   3.154   1.00 0.00 ? 159 SER A O    1  
ATOM 1240  C CB   . SER A 1 81  ? -2.169  9.095   3.540   1.00 0.00 ? 159 SER A CB   1  
ATOM 1241  O OG   . SER A 1 81  ? -2.504  10.462  3.702   1.00 0.00 ? 159 SER A OG   1  
ATOM 1242  H H    . SER A 1 81  ? -3.391  7.958   1.499   1.00 0.00 ? 159 SER A H    1  
ATOM 1243  H HA   . SER A 1 81  ? -1.084  9.729   1.807   1.00 0.00 ? 159 SER A HA   1  
ATOM 1244  H HB2  . SER A 1 81  ? -3.061  8.501   3.666   1.00 0.00 ? 159 SER A HB2  1  
ATOM 1245  H HB3  . SER A 1 81  ? -1.445  8.822   4.294   1.00 0.00 ? 159 SER A HB3  1  
ATOM 1246  H HG   . SER A 1 81  ? -1.741  10.942  4.035   1.00 0.00 ? 159 SER A HG   1  
ATOM 1247  N N    . ALA A 1 82  ? -0.597  6.808   1.249   1.00 0.00 ? 160 ALA A N    1  
ATOM 1248  C CA   . ALA A 1 82  ? 0.327   5.682   1.203   1.00 0.00 ? 160 ALA A CA   1  
ATOM 1249  C C    . ALA A 1 82  ? 1.610   6.055   0.468   1.00 0.00 ? 160 ALA A C    1  
ATOM 1250  O O    . ALA A 1 82  ? 2.709   5.888   0.996   1.00 0.00 ? 160 ALA A O    1  
ATOM 1251  C CB   . ALA A 1 82  ? -0.335  4.483   0.539   1.00 0.00 ? 160 ALA A CB   1  
ATOM 1252  H H    . ALA A 1 82  ? -1.266  6.907   0.540   1.00 0.00 ? 160 ALA A H    1  
ATOM 1253  H HA   . ALA A 1 82  ? 0.572   5.409   2.219   1.00 0.00 ? 160 ALA A HA   1  
ATOM 1254  H HB1  . ALA A 1 82  ? -0.445  4.675   -0.519  1.00 0.00 ? 160 ALA A HB1  1  
ATOM 1255  H HB2  . ALA A 1 82  ? 0.279   3.607   0.684   1.00 0.00 ? 160 ALA A HB2  1  
ATOM 1256  H HB3  . ALA A 1 82  ? -1.307  4.320   0.978   1.00 0.00 ? 160 ALA A HB3  1  
ATOM 1257  N N    . ALA A 1 83  ? 1.463   6.560   -0.752  1.00 0.00 ? 161 ALA A N    1  
ATOM 1258  C CA   . ALA A 1 83  ? 2.610   6.957   -1.558  1.00 0.00 ? 161 ALA A CA   1  
ATOM 1259  C C    . ALA A 1 83  ? 3.649   7.686   -0.713  1.00 0.00 ? 161 ALA A C    1  
ATOM 1260  O O    . ALA A 1 83  ? 4.802   7.263   -0.627  1.00 0.00 ? 161 ALA A O    1  
ATOM 1261  C CB   . ALA A 1 83  ? 2.162   7.834   -2.718  1.00 0.00 ? 161 ALA A CB   1  
ATOM 1262  H H    . ALA A 1 83  ? 0.560   6.669   -1.118  1.00 0.00 ? 161 ALA A H    1  
ATOM 1263  H HA   . ALA A 1 83  ? 3.057   6.062   -1.967  1.00 0.00 ? 161 ALA A HA   1  
ATOM 1264  H HB1  . ALA A 1 83  ? 3.028   8.177   -3.264  1.00 0.00 ? 161 ALA A HB1  1  
ATOM 1265  H HB2  . ALA A 1 83  ? 1.525   7.261   -3.376  1.00 0.00 ? 161 ALA A HB2  1  
ATOM 1266  H HB3  . ALA A 1 83  ? 1.616   8.683   -2.337  1.00 0.00 ? 161 ALA A HB3  1  
ATOM 1267  N N    . HIS A 1 84  ? 3.233   8.784   -0.089  1.00 0.00 ? 162 HIS A N    1  
ATOM 1268  C CA   . HIS A 1 84  ? 4.129   9.572   0.750   1.00 0.00 ? 162 HIS A CA   1  
ATOM 1269  C C    . HIS A 1 84  ? 4.731   8.713   1.857   1.00 0.00 ? 162 HIS A C    1  
ATOM 1270  O O    . HIS A 1 84  ? 5.929   8.789   2.132   1.00 0.00 ? 162 HIS A O    1  
ATOM 1271  C CB   . HIS A 1 84  ? 3.379   10.758  1.359   1.00 0.00 ? 162 HIS A CB   1  
ATOM 1272  C CG   . HIS A 1 84  ? 4.280   11.856  1.833   1.00 0.00 ? 162 HIS A CG   1  
ATOM 1273  N ND1  . HIS A 1 84  ? 5.084   12.590  0.985   1.00 0.00 ? 162 HIS A ND1  1  
ATOM 1274  C CD2  . HIS A 1 84  ? 4.502   12.345  3.076   1.00 0.00 ? 162 HIS A CD2  1  
ATOM 1275  C CE1  . HIS A 1 84  ? 5.761   13.482  1.686   1.00 0.00 ? 162 HIS A CE1  1  
ATOM 1276  N NE2  . HIS A 1 84  ? 5.425   13.354  2.957   1.00 0.00 ? 162 HIS A NE2  1  
ATOM 1277  H H    . HIS A 1 84  ? 2.302   9.071   -0.196  1.00 0.00 ? 162 HIS A H    1  
ATOM 1278  H HA   . HIS A 1 84  ? 4.927   9.944   0.125   1.00 0.00 ? 162 HIS A HA   1  
ATOM 1279  H HB2  . HIS A 1 84  ? 2.713   11.173  0.617   1.00 0.00 ? 162 HIS A HB2  1  
ATOM 1280  H HB3  . HIS A 1 84  ? 2.800   10.414  2.204   1.00 0.00 ? 162 HIS A HB3  1  
ATOM 1281  H HD2  . HIS A 1 84  ? 4.038   12.005  3.991   1.00 0.00 ? 162 HIS A HD2  1  
ATOM 1282  H HE1  . HIS A 1 84  ? 6.468   14.194  1.288   1.00 0.00 ? 162 HIS A HE1  1  
ATOM 1283  H HE2  . HIS A 1 84  ? 5.843   13.835  3.702   1.00 0.00 ? 162 HIS A HE2  1  
ATOM 1284  N N    . MET A 1 85  ? 3.893   7.899   2.490   1.00 0.00 ? 163 MET A N    1  
ATOM 1285  C CA   . MET A 1 85  ? 4.345   7.025   3.567   1.00 0.00 ? 163 MET A CA   1  
ATOM 1286  C C    . MET A 1 85  ? 5.468   6.110   3.091   1.00 0.00 ? 163 MET A C    1  
ATOM 1287  O O    . MET A 1 85  ? 6.454   5.903   3.798   1.00 0.00 ? 163 MET A O    1  
ATOM 1288  C CB   . MET A 1 85  ? 3.178   6.189   4.097   1.00 0.00 ? 163 MET A CB   1  
ATOM 1289  C CG   . MET A 1 85  ? 2.417   6.856   5.231   1.00 0.00 ? 163 MET A CG   1  
ATOM 1290  S SD   . MET A 1 85  ? 1.544   5.671   6.272   1.00 0.00 ? 163 MET A SD   1  
ATOM 1291  C CE   . MET A 1 85  ? -0.155  6.000   5.809   1.00 0.00 ? 163 MET A CE   1  
ATOM 1292  H H    . MET A 1 85  ? 2.950   7.883   2.226   1.00 0.00 ? 163 MET A H    1  
ATOM 1293  H HA   . MET A 1 85  ? 4.719   7.650   4.365   1.00 0.00 ? 163 MET A HA   1  
ATOM 1294  H HB2  . MET A 1 85  ? 2.488   6.003   3.288   1.00 0.00 ? 163 MET A HB2  1  
ATOM 1295  H HB3  . MET A 1 85  ? 3.561   5.245   4.456   1.00 0.00 ? 163 MET A HB3  1  
ATOM 1296  H HG2  . MET A 1 85  ? 3.117   7.404   5.843   1.00 0.00 ? 163 MET A HG2  1  
ATOM 1297  H HG3  . MET A 1 85  ? 1.698   7.542   4.808   1.00 0.00 ? 163 MET A HG3  1  
ATOM 1298  H HE1  . MET A 1 85  ? -0.281  5.820   4.752   1.00 0.00 ? 163 MET A HE1  1  
ATOM 1299  H HE2  . MET A 1 85  ? -0.812  5.350   6.367   1.00 0.00 ? 163 MET A HE2  1  
ATOM 1300  H HE3  . MET A 1 85  ? -0.394  7.031   6.030   1.00 0.00 ? 163 MET A HE3  1  
ATOM 1301  N N    . ARG A 1 86  ? 5.311   5.564   1.889   1.00 0.00 ? 164 ARG A N    1  
ATOM 1302  C CA   . ARG A 1 86  ? 6.311   4.669   1.320   1.00 0.00 ? 164 ARG A CA   1  
ATOM 1303  C C    . ARG A 1 86  ? 7.680   5.343   1.275   1.00 0.00 ? 164 ARG A C    1  
ATOM 1304  O O    . ARG A 1 86  ? 8.694   4.734   1.616   1.00 0.00 ? 164 ARG A O    1  
ATOM 1305  C CB   . ARG A 1 86  ? 5.897   4.237   -0.088  1.00 0.00 ? 164 ARG A CB   1  
ATOM 1306  C CG   . ARG A 1 86  ? 6.394   2.852   -0.470  1.00 0.00 ? 164 ARG A CG   1  
ATOM 1307  C CD   . ARG A 1 86  ? 6.123   2.548   -1.935  1.00 0.00 ? 164 ARG A CD   1  
ATOM 1308  N NE   . ARG A 1 86  ? 6.779   3.503   -2.823  1.00 0.00 ? 164 ARG A NE   1  
ATOM 1309  C CZ   . ARG A 1 86  ? 6.242   4.664   -3.180  1.00 0.00 ? 164 ARG A CZ   1  
ATOM 1310  N NH1  . ARG A 1 86  ? 5.045   5.012   -2.727  1.00 0.00 ? 164 ARG A NH1  1  
ATOM 1311  N NH2  . ARG A 1 86  ? 6.901   5.480   -3.993  1.00 0.00 ? 164 ARG A NH2  1  
ATOM 1312  H H    . ARG A 1 86  ? 4.502   5.767   1.374   1.00 0.00 ? 164 ARG A H    1  
ATOM 1313  H HA   . ARG A 1 86  ? 6.373   3.796   1.952   1.00 0.00 ? 164 ARG A HA   1  
ATOM 1314  H HB2  . ARG A 1 86  ? 4.819   4.238   -0.150  1.00 0.00 ? 164 ARG A HB2  1  
ATOM 1315  H HB3  . ARG A 1 86  ? 6.291   4.946   -0.800  1.00 0.00 ? 164 ARG A HB3  1  
ATOM 1316  H HG2  . ARG A 1 86  ? 7.458   2.800   -0.295  1.00 0.00 ? 164 ARG A HG2  1  
ATOM 1317  H HG3  . ARG A 1 86  ? 5.890   2.118   0.141   1.00 0.00 ? 164 ARG A HG3  1  
ATOM 1318  H HD2  . ARG A 1 86  ? 6.487   1.556   -2.157  1.00 0.00 ? 164 ARG A HD2  1  
ATOM 1319  H HD3  . ARG A 1 86  ? 5.057   2.586   -2.105  1.00 0.00 ? 164 ARG A HD3  1  
ATOM 1320  H HE   . ARG A 1 86  ? 7.664   3.266   -3.170  1.00 0.00 ? 164 ARG A HE   1  
ATOM 1321  H HH11 . ARG A 1 86  ? 4.547   4.400   -2.114  1.00 0.00 ? 164 ARG A HH11 1  
ATOM 1322  H HH12 . ARG A 1 86  ? 4.643   5.887   -2.996  1.00 0.00 ? 164 ARG A HH12 1  
ATOM 1323  H HH21 . ARG A 1 86  ? 7.803   5.222   -4.336  1.00 0.00 ? 164 ARG A HH21 1  
ATOM 1324  H HH22 . ARG A 1 86  ? 6.496   6.354   -4.261  1.00 0.00 ? 164 ARG A HH22 1  
ATOM 1325  N N    . HIS A 1 87  ? 7.700   6.603   0.852   1.00 0.00 ? 165 HIS A N    1  
ATOM 1326  C CA   . HIS A 1 87  ? 8.944   7.359   0.762   1.00 0.00 ? 165 HIS A CA   1  
ATOM 1327  C C    . HIS A 1 87  ? 9.538   7.594   2.147   1.00 0.00 ? 165 HIS A C    1  
ATOM 1328  O O    . HIS A 1 87  ? 10.748  7.472   2.345   1.00 0.00 ? 165 HIS A O    1  
ATOM 1329  C CB   . HIS A 1 87  ? 8.703   8.698   0.064   1.00 0.00 ? 165 HIS A CB   1  
ATOM 1330  C CG   . HIS A 1 87  ? 9.960   9.367   -0.399  1.00 0.00 ? 165 HIS A CG   1  
ATOM 1331  N ND1  . HIS A 1 87  ? 10.668  8.955   -1.508  1.00 0.00 ? 165 HIS A ND1  1  
ATOM 1332  C CD2  . HIS A 1 87  ? 10.635  10.428  0.104   1.00 0.00 ? 165 HIS A CD2  1  
ATOM 1333  C CE1  . HIS A 1 87  ? 11.724  9.732   -1.667  1.00 0.00 ? 165 HIS A CE1  1  
ATOM 1334  N NE2  . HIS A 1 87  ? 11.727  10.634  -0.702  1.00 0.00 ? 165 HIS A NE2  1  
ATOM 1335  H H    . HIS A 1 87  ? 6.859   7.034   0.594   1.00 0.00 ? 165 HIS A H    1  
ATOM 1336  H HA   . HIS A 1 87  ? 9.643   6.779   0.178   1.00 0.00 ? 165 HIS A HA   1  
ATOM 1337  H HB2  . HIS A 1 87  ? 8.075   8.537   -0.800  1.00 0.00 ? 165 HIS A HB2  1  
ATOM 1338  H HB3  . HIS A 1 87  ? 8.201   9.367   0.748   1.00 0.00 ? 165 HIS A HB3  1  
ATOM 1339  H HD2  . HIS A 1 87  ? 10.365  11.005  0.977   1.00 0.00 ? 165 HIS A HD2  1  
ATOM 1340  H HE1  . HIS A 1 87  ? 12.461  9.645   -2.452  1.00 0.00 ? 165 HIS A HE1  1  
ATOM 1341  H HE2  . HIS A 1 87  ? 12.445  11.279  -0.535  1.00 0.00 ? 165 HIS A HE2  1  
ATOM 1342  N N    . LEU A 1 88  ? 8.681   7.932   3.104   1.00 0.00 ? 166 LEU A N    1  
ATOM 1343  C CA   . LEU A 1 88  ? 9.121   8.185   4.472   1.00 0.00 ? 166 LEU A CA   1  
ATOM 1344  C C    . LEU A 1 88  ? 9.859   6.976   5.039   1.00 0.00 ? 166 LEU A C    1  
ATOM 1345  O O    . LEU A 1 88  ? 10.810  7.121   5.808   1.00 0.00 ? 166 LEU A O    1  
ATOM 1346  C CB   . LEU A 1 88  ? 7.923   8.527   5.358   1.00 0.00 ? 166 LEU A CB   1  
ATOM 1347  C CG   . LEU A 1 88  ? 7.364   9.944   5.214   1.00 0.00 ? 166 LEU A CG   1  
ATOM 1348  C CD1  . LEU A 1 88  ? 6.197   10.157  6.167   1.00 0.00 ? 166 LEU A CD1  1  
ATOM 1349  C CD2  . LEU A 1 88  ? 8.454   10.975  5.465   1.00 0.00 ? 166 LEU A CD2  1  
ATOM 1350  H H    . LEU A 1 88  ? 7.729   8.014   2.886   1.00 0.00 ? 166 LEU A H    1  
ATOM 1351  H HA   . LEU A 1 88  ? 9.796   9.027   4.452   1.00 0.00 ? 166 LEU A HA   1  
ATOM 1352  H HB2  . LEU A 1 88  ? 7.129   7.834   5.125   1.00 0.00 ? 166 LEU A HB2  1  
ATOM 1353  H HB3  . LEU A 1 88  ? 8.225   8.393   6.388   1.00 0.00 ? 166 LEU A HB3  1  
ATOM 1354  H HG   . LEU A 1 88  ? 6.999   10.079  4.205   1.00 0.00 ? 166 LEU A HG   1  
ATOM 1355  H HD11 . LEU A 1 88  ? 6.165   9.350   6.883   1.00 0.00 ? 166 LEU A HD11 1  
ATOM 1356  H HD12 . LEU A 1 88  ? 5.274   10.177  5.606   1.00 0.00 ? 166 LEU A HD12 1  
ATOM 1357  H HD13 . LEU A 1 88  ? 6.324   11.095  6.686   1.00 0.00 ? 166 LEU A HD13 1  
ATOM 1358  H HD21 . LEU A 1 88  ? 9.061   10.661  6.302   1.00 0.00 ? 166 LEU A HD21 1  
ATOM 1359  H HD22 . LEU A 1 88  ? 8.001   11.931  5.686   1.00 0.00 ? 166 LEU A HD22 1  
ATOM 1360  H HD23 . LEU A 1 88  ? 9.073   11.065  4.585   1.00 0.00 ? 166 LEU A HD23 1  
ATOM 1361  N N    . LEU A 1 89  ? 9.416   5.785   4.653   1.00 0.00 ? 167 LEU A N    1  
ATOM 1362  C CA   . LEU A 1 89  ? 10.035  4.550   5.120   1.00 0.00 ? 167 LEU A CA   1  
ATOM 1363  C C    . LEU A 1 89  ? 11.363  4.304   4.411   1.00 0.00 ? 167 LEU A C    1  
ATOM 1364  O O    . LEU A 1 89  ? 12.322  3.826   5.016   1.00 0.00 ? 167 LEU A O    1  
ATOM 1365  C CB   . LEU A 1 89  ? 9.095   3.366   4.892   1.00 0.00 ? 167 LEU A CB   1  
ATOM 1366  C CG   . LEU A 1 89  ? 7.726   3.456   5.567   1.00 0.00 ? 167 LEU A CG   1  
ATOM 1367  C CD1  . LEU A 1 89  ? 7.043   2.097   5.573   1.00 0.00 ? 167 LEU A CD1  1  
ATOM 1368  C CD2  . LEU A 1 89  ? 7.864   3.991   6.985   1.00 0.00 ? 167 LEU A CD2  1  
ATOM 1369  H H    . LEU A 1 89  ? 8.654   5.733   4.038   1.00 0.00 ? 167 LEU A H    1  
ATOM 1370  H HA   . LEU A 1 89  ? 10.221  4.653   6.179   1.00 0.00 ? 167 LEU A HA   1  
ATOM 1371  H HB2  . LEU A 1 89  ? 8.933   3.272   3.829   1.00 0.00 ? 167 LEU A HB2  1  
ATOM 1372  H HB3  . LEU A 1 89  ? 9.588   2.477   5.259   1.00 0.00 ? 167 LEU A HB3  1  
ATOM 1373  H HG   . LEU A 1 89  ? 7.101   4.140   5.010   1.00 0.00 ? 167 LEU A HG   1  
ATOM 1374  H HD11 . LEU A 1 89  ? 7.084   1.669   4.583   1.00 0.00 ? 167 LEU A HD11 1  
ATOM 1375  H HD12 . LEU A 1 89  ? 6.012   2.213   5.873   1.00 0.00 ? 167 LEU A HD12 1  
ATOM 1376  H HD13 . LEU A 1 89  ? 7.548   1.443   6.270   1.00 0.00 ? 167 LEU A HD13 1  
ATOM 1377  H HD21 . LEU A 1 89  ? 8.769   3.602   7.429   1.00 0.00 ? 167 LEU A HD21 1  
ATOM 1378  H HD22 . LEU A 1 89  ? 7.012   3.680   7.572   1.00 0.00 ? 167 LEU A HD22 1  
ATOM 1379  H HD23 . LEU A 1 89  ? 7.910   5.070   6.959   1.00 0.00 ? 167 LEU A HD23 1  
ATOM 1380  N N    . MET A 1 90  ? 11.411  4.636   3.125   1.00 0.00 ? 168 MET A N    1  
ATOM 1381  C CA   . MET A 1 90  ? 12.622  4.454   2.334   1.00 0.00 ? 168 MET A CA   1  
ATOM 1382  C C    . MET A 1 90  ? 13.851  4.923   3.106   1.00 0.00 ? 168 MET A C    1  
ATOM 1383  O O    . MET A 1 90  ? 14.908  4.293   3.052   1.00 0.00 ? 168 MET A O    1  
ATOM 1384  C CB   . MET A 1 90  ? 12.514  5.218   1.012   1.00 0.00 ? 168 MET A CB   1  
ATOM 1385  C CG   . MET A 1 90  ? 11.576  4.566   0.009   1.00 0.00 ? 168 MET A CG   1  
ATOM 1386  S SD   . MET A 1 90  ? 11.541  5.431   -1.572  1.00 0.00 ? 168 MET A SD   1  
ATOM 1387  C CE   . MET A 1 90  ? 11.477  4.050   -2.712  1.00 0.00 ? 168 MET A CE   1  
ATOM 1388  H H    . MET A 1 90  ? 10.614  5.013   2.697   1.00 0.00 ? 168 MET A H    1  
ATOM 1389  H HA   . MET A 1 90  ? 12.725  3.400   2.123   1.00 0.00 ? 168 MET A HA   1  
ATOM 1390  H HB2  . MET A 1 90  ? 12.153  6.215   1.215   1.00 0.00 ? 168 MET A HB2  1  
ATOM 1391  H HB3  . MET A 1 90  ? 13.495  5.282   0.566   1.00 0.00 ? 168 MET A HB3  1  
ATOM 1392  H HG2  . MET A 1 90  ? 11.900  3.550   -0.160  1.00 0.00 ? 168 MET A HG2  1  
ATOM 1393  H HG3  . MET A 1 90  ? 10.578  4.559   0.423   1.00 0.00 ? 168 MET A HG3  1  
ATOM 1394  H HE1  . MET A 1 90  ? 11.048  4.375   -3.648  1.00 0.00 ? 168 MET A HE1  1  
ATOM 1395  H HE2  . MET A 1 90  ? 12.477  3.679   -2.884  1.00 0.00 ? 168 MET A HE2  1  
ATOM 1396  H HE3  . MET A 1 90  ? 10.869  3.263   -2.290  1.00 0.00 ? 168 MET A HE3  1  
ATOM 1397  N N    . SER A 1 91  ? 13.706  6.033   3.823   1.00 0.00 ? 169 SER A N    1  
ATOM 1398  C CA   . SER A 1 91  ? 14.806  6.588   4.603   1.00 0.00 ? 169 SER A CA   1  
ATOM 1399  C C    . SER A 1 91  ? 15.648  5.477   5.223   1.00 0.00 ? 169 SER A C    1  
ATOM 1400  O O    . SER A 1 91  ? 16.877  5.511   5.168   1.00 0.00 ? 169 SER A O    1  
ATOM 1401  C CB   . SER A 1 91  ? 14.268  7.509   5.700   1.00 0.00 ? 169 SER A CB   1  
ATOM 1402  O OG   . SER A 1 91  ? 15.324  8.173   6.372   1.00 0.00 ? 169 SER A OG   1  
ATOM 1403  H H    . SER A 1 91  ? 12.839  6.490   3.826   1.00 0.00 ? 169 SER A H    1  
ATOM 1404  H HA   . SER A 1 91  ? 15.429  7.164   3.935   1.00 0.00 ? 169 SER A HA   1  
ATOM 1405  H HB2  . SER A 1 91  ? 13.616  8.247   5.259   1.00 0.00 ? 169 SER A HB2  1  
ATOM 1406  H HB3  . SER A 1 91  ? 13.713  6.922   6.418   1.00 0.00 ? 169 SER A HB3  1  
ATOM 1407  H HG   . SER A 1 91  ? 14.966  8.693   7.096   1.00 0.00 ? 169 SER A HG   1  
ATOM 1408  N N    . GLN A 1 92  ? 14.976  4.494   5.814   1.00 0.00 ? 170 GLN A N    1  
ATOM 1409  C CA   . GLN A 1 92  ? 15.661  3.373   6.445   1.00 0.00 ? 170 GLN A CA   1  
ATOM 1410  C C    . GLN A 1 92  ? 16.429  2.553   5.414   1.00 0.00 ? 170 GLN A C    1  
ATOM 1411  O O    . GLN A 1 92  ? 15.874  1.653   4.784   1.00 0.00 ? 170 GLN A O    1  
ATOM 1412  C CB   . GLN A 1 92  ? 14.657  2.481   7.177   1.00 0.00 ? 170 GLN A CB   1  
ATOM 1413  C CG   . GLN A 1 92  ? 14.110  3.100   8.453   1.00 0.00 ? 170 GLN A CG   1  
ATOM 1414  C CD   . GLN A 1 92  ? 12.983  2.287   9.060   1.00 0.00 ? 170 GLN A CD   1  
ATOM 1415  O OE1  . GLN A 1 92  ? 12.855  1.091   8.799   1.00 0.00 ? 170 GLN A OE1  1  
ATOM 1416  N NE2  . GLN A 1 92  ? 12.160  2.934   9.877   1.00 0.00 ? 170 GLN A NE2  1  
ATOM 1417  H H    . GLN A 1 92  ? 13.997  4.524   5.825   1.00 0.00 ? 170 GLN A H    1  
ATOM 1418  H HA   . GLN A 1 92  ? 16.361  3.774   7.162   1.00 0.00 ? 170 GLN A HA   1  
ATOM 1419  H HB2  . GLN A 1 92  ? 13.827  2.276   6.517   1.00 0.00 ? 170 GLN A HB2  1  
ATOM 1420  H HB3  . GLN A 1 92  ? 15.141  1.550   7.434   1.00 0.00 ? 170 GLN A HB3  1  
ATOM 1421  H HG2  . GLN A 1 92  ? 14.910  3.173   9.175   1.00 0.00 ? 170 GLN A HG2  1  
ATOM 1422  H HG3  . GLN A 1 92  ? 13.739  4.089   8.227   1.00 0.00 ? 170 GLN A HG3  1  
ATOM 1423  H HE21 . GLN A 1 92  ? 12.323  3.887   10.039  1.00 0.00 ? 170 GLN A HE21 1  
ATOM 1424  H HE22 . GLN A 1 92  ? 11.423  2.433   10.283  1.00 0.00 ? 170 GLN A HE22 1  
ATOM 1425  N N    . GLN A 1 93  ? 17.709  2.872   5.246   1.00 0.00 ? 171 GLN A N    1  
ATOM 1426  C CA   . GLN A 1 93  ? 18.553  2.165   4.290   1.00 0.00 ? 171 GLN A CA   1  
ATOM 1427  C C    . GLN A 1 93  ? 18.507  0.660   4.532   1.00 0.00 ? 171 GLN A C    1  
ATOM 1428  O O    . GLN A 1 93  ? 18.471  -0.131  3.589   1.00 0.00 ? 171 GLN A O    1  
ATOM 1429  C CB   . GLN A 1 93  ? 19.995  2.665   4.383   1.00 0.00 ? 171 GLN A CB   1  
ATOM 1430  C CG   . GLN A 1 93  ? 20.149  4.142   4.057   1.00 0.00 ? 171 GLN A CG   1  
ATOM 1431  C CD   . GLN A 1 93  ? 21.594  4.543   3.835   1.00 0.00 ? 171 GLN A CD   1  
ATOM 1432  O OE1  . GLN A 1 93  ? 22.329  4.810   4.786   1.00 0.00 ? 171 GLN A OE1  1  
ATOM 1433  N NE2  . GLN A 1 93  ? 22.010  4.588   2.575   1.00 0.00 ? 171 GLN A NE2  1  
ATOM 1434  H H    . GLN A 1 93  ? 18.094  3.599   5.778   1.00 0.00 ? 171 GLN A H    1  
ATOM 1435  H HA   . GLN A 1 93  ? 18.174  2.369   3.300   1.00 0.00 ? 171 GLN A HA   1  
ATOM 1436  H HB2  . GLN A 1 93  ? 20.357  2.500   5.387   1.00 0.00 ? 171 GLN A HB2  1  
ATOM 1437  H HB3  . GLN A 1 93  ? 20.604  2.101   3.692   1.00 0.00 ? 171 GLN A HB3  1  
ATOM 1438  H HG2  . GLN A 1 93  ? 19.590  4.360   3.159   1.00 0.00 ? 171 GLN A HG2  1  
ATOM 1439  H HG3  . GLN A 1 93  ? 19.751  4.722   4.877   1.00 0.00 ? 171 GLN A HG3  1  
ATOM 1440  H HE21 . GLN A 1 93  ? 21.368  4.364   1.868   1.00 0.00 ? 171 GLN A HE21 1  
ATOM 1441  H HE22 . GLN A 1 93  ? 22.938  4.845   2.403   1.00 0.00 ? 171 GLN A HE22 1  
ATOM 1442  N N    . THR A 1 94  ? 18.510  0.269   5.803   1.00 0.00 ? 172 THR A N    1  
ATOM 1443  C CA   . THR A 1 94  ? 18.471  -1.140  6.170   1.00 0.00 ? 172 THR A CA   1  
ATOM 1444  C C    . THR A 1 94  ? 17.572  -1.930  5.224   1.00 0.00 ? 172 THR A C    1  
ATOM 1445  O O    . THR A 1 94  ? 17.907  -3.043  4.818   1.00 0.00 ? 172 THR A O    1  
ATOM 1446  C CB   . THR A 1 94  ? 17.970  -1.332  7.614   1.00 0.00 ? 172 THR A CB   1  
ATOM 1447  O OG1  . THR A 1 94  ? 18.862  -0.688  8.531   1.00 0.00 ? 172 THR A OG1  1  
ATOM 1448  C CG2  . THR A 1 94  ? 17.861  -2.810  7.957   1.00 0.00 ? 172 THR A CG2  1  
ATOM 1449  H H    . THR A 1 94  ? 18.539  0.947   6.510   1.00 0.00 ? 172 THR A H    1  
ATOM 1450  H HA   . THR A 1 94  ? 19.476  -1.530  6.105   1.00 0.00 ? 172 THR A HA   1  
ATOM 1451  H HB   . THR A 1 94  ? 16.991  -0.884  7.702   1.00 0.00 ? 172 THR A HB   1  
ATOM 1452  H HG1  . THR A 1 94  ? 18.778  -1.093  9.397   1.00 0.00 ? 172 THR A HG1  1  
ATOM 1453  H HG21 . THR A 1 94  ? 16.820  -3.090  8.014   1.00 0.00 ? 172 THR A HG21 1  
ATOM 1454  H HG22 . THR A 1 94  ? 18.336  -2.994  8.909   1.00 0.00 ? 172 THR A HG22 1  
ATOM 1455  H HG23 . THR A 1 94  ? 18.349  -3.394  7.192   1.00 0.00 ? 172 THR A HG23 1  
ATOM 1456  N N    . LEU A 1 95  ? 16.431  -1.347  4.876   1.00 0.00 ? 173 LEU A N    1  
ATOM 1457  C CA   . LEU A 1 95  ? 15.484  -1.996  3.976   1.00 0.00 ? 173 LEU A CA   1  
ATOM 1458  C C    . LEU A 1 95  ? 16.064  -2.120  2.571   1.00 0.00 ? 173 LEU A C    1  
ATOM 1459  O O    . LEU A 1 95  ? 16.408  -1.120  1.940   1.00 0.00 ? 173 LEU A O    1  
ATOM 1460  C CB   . LEU A 1 95  ? 14.172  -1.209  3.930   1.00 0.00 ? 173 LEU A CB   1  
ATOM 1461  C CG   . LEU A 1 95  ? 13.113  -1.610  4.958   1.00 0.00 ? 173 LEU A CG   1  
ATOM 1462  C CD1  . LEU A 1 95  ? 12.554  -2.988  4.639   1.00 0.00 ? 173 LEU A CD1  1  
ATOM 1463  C CD2  . LEU A 1 95  ? 13.696  -1.582  6.363   1.00 0.00 ? 173 LEU A CD2  1  
ATOM 1464  H H    . LEU A 1 95  ? 16.219  -0.459  5.231   1.00 0.00 ? 173 LEU A H    1  
ATOM 1465  H HA   . LEU A 1 95  ? 15.287  -2.986  4.360   1.00 0.00 ? 173 LEU A HA   1  
ATOM 1466  H HB2  . LEU A 1 95  ? 14.406  -0.167  4.086   1.00 0.00 ? 173 LEU A HB2  1  
ATOM 1467  H HB3  . LEU A 1 95  ? 13.745  -1.337  2.946   1.00 0.00 ? 173 LEU A HB3  1  
ATOM 1468  H HG   . LEU A 1 95  ? 12.297  -0.902  4.919   1.00 0.00 ? 173 LEU A HG   1  
ATOM 1469  H HD11 . LEU A 1 95  ? 11.707  -3.189  5.276   1.00 0.00 ? 173 LEU A HD11 1  
ATOM 1470  H HD12 . LEU A 1 95  ? 13.317  -3.734  4.807   1.00 0.00 ? 173 LEU A HD12 1  
ATOM 1471  H HD13 . LEU A 1 95  ? 12.243  -3.019  3.605   1.00 0.00 ? 173 LEU A HD13 1  
ATOM 1472  H HD21 . LEU A 1 95  ? 13.531  -0.608  6.801   1.00 0.00 ? 173 LEU A HD21 1  
ATOM 1473  H HD22 . LEU A 1 95  ? 14.757  -1.780  6.317   1.00 0.00 ? 173 LEU A HD22 1  
ATOM 1474  H HD23 . LEU A 1 95  ? 13.215  -2.336  6.968   1.00 0.00 ? 173 LEU A HD23 1  
ATOM 1475  N N    . ARG A 1 96  ? 16.169  -3.353  2.086   1.00 0.00 ? 174 ARG A N    1  
ATOM 1476  C CA   . ARG A 1 96  ? 16.707  -3.607  0.755   1.00 0.00 ? 174 ARG A CA   1  
ATOM 1477  C C    . ARG A 1 96  ? 15.747  -3.114  -0.323  1.00 0.00 ? 174 ARG A C    1  
ATOM 1478  O O    . ARG A 1 96  ? 16.019  -2.128  -1.006  1.00 0.00 ? 174 ARG A O    1  
ATOM 1479  C CB   . ARG A 1 96  ? 16.978  -5.101  0.568   1.00 0.00 ? 174 ARG A CB   1  
ATOM 1480  C CG   . ARG A 1 96  ? 17.791  -5.422  -0.675  1.00 0.00 ? 174 ARG A CG   1  
ATOM 1481  C CD   . ARG A 1 96  ? 19.283  -5.405  -0.384  1.00 0.00 ? 174 ARG A CD   1  
ATOM 1482  N NE   . ARG A 1 96  ? 20.076  -5.237  -1.600  1.00 0.00 ? 174 ARG A NE   1  
ATOM 1483  C CZ   . ARG A 1 96  ? 21.381  -5.475  -1.664  1.00 0.00 ? 174 ARG A CZ   1  
ATOM 1484  N NH1  . ARG A 1 96  ? 22.037  -5.888  -0.589  1.00 0.00 ? 174 ARG A NH1  1  
ATOM 1485  N NH2  . ARG A 1 96  ? 22.033  -5.299  -2.807  1.00 0.00 ? 174 ARG A NH2  1  
ATOM 1486  H H    . ARG A 1 96  ? 15.879  -4.109  2.637   1.00 0.00 ? 174 ARG A H    1  
ATOM 1487  H HA   . ARG A 1 96  ? 17.638  -3.068  0.665   1.00 0.00 ? 174 ARG A HA   1  
ATOM 1488  H HB2  . ARG A 1 96  ? 17.517  -5.468  1.429   1.00 0.00 ? 174 ARG A HB2  1  
ATOM 1489  H HB3  . ARG A 1 96  ? 16.033  -5.619  0.498   1.00 0.00 ? 174 ARG A HB3  1  
ATOM 1490  H HG2  . ARG A 1 96  ? 17.516  -6.405  -1.030  1.00 0.00 ? 174 ARG A HG2  1  
ATOM 1491  H HG3  . ARG A 1 96  ? 17.572  -4.688  -1.436  1.00 0.00 ? 174 ARG A HG3  1  
ATOM 1492  H HD2  . ARG A 1 96  ? 19.496  -4.588  0.288   1.00 0.00 ? 174 ARG A HD2  1  
ATOM 1493  H HD3  . ARG A 1 96  ? 19.555  -6.338  0.086   1.00 0.00 ? 174 ARG A HD3  1  
ATOM 1494  H HE   . ARG A 1 96  ? 19.611  -4.932  -2.406  1.00 0.00 ? 174 ARG A HE   1  
ATOM 1495  H HH11 . ARG A 1 96  ? 21.548  -6.023  0.273   1.00 0.00 ? 174 ARG A HH11 1  
ATOM 1496  H HH12 . ARG A 1 96  ? 23.020  -6.067  -0.641  1.00 0.00 ? 174 ARG A HH12 1  
ATOM 1497  H HH21 . ARG A 1 96  ? 21.541  -4.987  -3.620  1.00 0.00 ? 174 ARG A HH21 1  
ATOM 1498  H HH22 . ARG A 1 96  ? 23.015  -5.477  -2.854  1.00 0.00 ? 174 ARG A HH22 1  
ATOM 1499  N N    . ASN A 1 97  ? 14.623  -3.809  -0.470  1.00 0.00 ? 175 ASN A N    1  
ATOM 1500  C CA   . ASN A 1 97  ? 13.623  -3.442  -1.465  1.00 0.00 ? 175 ASN A CA   1  
ATOM 1501  C C    . ASN A 1 97  ? 12.270  -3.184  -0.808  1.00 0.00 ? 175 ASN A C    1  
ATOM 1502  O O    . ASN A 1 97  ? 11.705  -4.064  -0.159  1.00 0.00 ? 175 ASN A O    1  
ATOM 1503  C CB   . ASN A 1 97  ? 13.489  -4.547  -2.515  1.00 0.00 ? 175 ASN A CB   1  
ATOM 1504  C CG   . ASN A 1 97  ? 12.104  -4.596  -3.130  1.00 0.00 ? 175 ASN A CG   1  
ATOM 1505  O OD1  . ASN A 1 97  ? 11.247  -5.366  -2.696  1.00 0.00 ? 175 ASN A OD1  1  
ATOM 1506  N ND2  . ASN A 1 97  ? 11.879  -3.772  -4.147  1.00 0.00 ? 175 ASN A ND2  1  
ATOM 1507  H H    . ASN A 1 97  ? 14.463  -4.586  0.105   1.00 0.00 ? 175 ASN A H    1  
ATOM 1508  H HA   . ASN A 1 97  ? 13.954  -2.536  -1.950  1.00 0.00 ? 175 ASN A HA   1  
ATOM 1509  H HB2  . ASN A 1 97  ? 14.206  -4.374  -3.305  1.00 0.00 ? 175 ASN A HB2  1  
ATOM 1510  H HB3  . ASN A 1 97  ? 13.692  -5.501  -2.053  1.00 0.00 ? 175 ASN A HB3  1  
ATOM 1511  H HD21 . ASN A 1 97  ? 12.608  -3.187  -4.439  1.00 0.00 ? 175 ASN A HD21 1  
ATOM 1512  H HD22 . ASN A 1 97  ? 10.991  -3.783  -4.563  1.00 0.00 ? 175 ASN A HD22 1  
ATOM 1513  N N    . VAL A 1 98  ? 11.757  -1.970  -0.982  1.00 0.00 ? 176 VAL A N    1  
ATOM 1514  C CA   . VAL A 1 98  ? 10.470  -1.595  -0.407  1.00 0.00 ? 176 VAL A CA   1  
ATOM 1515  C C    . VAL A 1 98  ? 9.370   -1.615  -1.463  1.00 0.00 ? 176 VAL A C    1  
ATOM 1516  O O    . VAL A 1 98  ? 9.211   -0.679  -2.247  1.00 0.00 ? 176 VAL A O    1  
ATOM 1517  C CB   . VAL A 1 98  ? 10.527  -0.195  0.232   1.00 0.00 ? 176 VAL A CB   1  
ATOM 1518  C CG1  . VAL A 1 98  ? 9.164   0.198   0.780   1.00 0.00 ? 176 VAL A CG1  1  
ATOM 1519  C CG2  . VAL A 1 98  ? 11.583  -0.153  1.327   1.00 0.00 ? 176 VAL A CG2  1  
ATOM 1520  H H    . VAL A 1 98  ? 12.255  -1.311  -1.509  1.00 0.00 ? 176 VAL A H    1  
ATOM 1521  H HA   . VAL A 1 98  ? 10.227  -2.311  0.365   1.00 0.00 ? 176 VAL A HA   1  
ATOM 1522  H HB   . VAL A 1 98  ? 10.802  0.517   -0.532  1.00 0.00 ? 176 VAL A HB   1  
ATOM 1523  H HG11 . VAL A 1 98  ? 9.263   1.083   1.391   1.00 0.00 ? 176 VAL A HG11 1  
ATOM 1524  H HG12 . VAL A 1 98  ? 8.490   0.399   -0.040  1.00 0.00 ? 176 VAL A HG12 1  
ATOM 1525  H HG13 . VAL A 1 98  ? 8.770   -0.610  1.379   1.00 0.00 ? 176 VAL A HG13 1  
ATOM 1526  H HG21 . VAL A 1 98  ? 11.107  -0.273  2.289   1.00 0.00 ? 176 VAL A HG21 1  
ATOM 1527  H HG22 . VAL A 1 98  ? 12.293  -0.953  1.174   1.00 0.00 ? 176 VAL A HG22 1  
ATOM 1528  H HG23 . VAL A 1 98  ? 12.097  0.796   1.295   1.00 0.00 ? 176 VAL A HG23 1  
ATOM 1529  N N    . PRO A 1 99  ? 8.592   -2.707  -1.486  1.00 0.00 ? 177 PRO A N    1  
ATOM 1530  C CA   . PRO A 1 99  ? 7.492   -2.875  -2.441  1.00 0.00 ? 177 PRO A CA   1  
ATOM 1531  C C    . PRO A 1 99  ? 6.328   -1.931  -2.156  1.00 0.00 ? 177 PRO A C    1  
ATOM 1532  O O    . PRO A 1 99  ? 6.275   -1.267  -1.121  1.00 0.00 ? 177 PRO A O    1  
ATOM 1533  C CB   . PRO A 1 99  ? 7.063   -4.330  -2.235  1.00 0.00 ? 177 PRO A CB   1  
ATOM 1534  C CG   . PRO A 1 99  ? 7.472   -4.652  -0.839  1.00 0.00 ? 177 PRO A CG   1  
ATOM 1535  C CD   . PRO A 1 99  ? 8.725   -3.861  -0.582  1.00 0.00 ? 177 PRO A CD   1  
ATOM 1536  H HA   . PRO A 1 99  ? 7.825   -2.737  -3.459  1.00 0.00 ? 177 PRO A HA   1  
ATOM 1537  H HB2  . PRO A 1 99  ? 5.993   -4.414  -2.364  1.00 0.00 ? 177 PRO A HB2  1  
ATOM 1538  H HB3  . PRO A 1 99  ? 7.568   -4.962  -2.949  1.00 0.00 ? 177 PRO A HB3  1  
ATOM 1539  H HG2  . PRO A 1 99  ? 6.694   -4.356  -0.151  1.00 0.00 ? 177 PRO A HG2  1  
ATOM 1540  H HG3  . PRO A 1 99  ? 7.671   -5.709  -0.750  1.00 0.00 ? 177 PRO A HG3  1  
ATOM 1541  H HD2  . PRO A 1 99  ? 8.764   -3.541  0.449   1.00 0.00 ? 177 PRO A HD2  1  
ATOM 1542  H HD3  . PRO A 1 99  ? 9.598   -4.447  -0.830  1.00 0.00 ? 177 PRO A HD3  1  
ATOM 1543  N N    . PRO A 1 100 ? 5.372   -1.870  -3.095  1.00 0.00 ? 178 PRO A N    1  
ATOM 1544  C CA   . PRO A 1 100 ? 4.191   -1.011  -2.967  1.00 0.00 ? 178 PRO A CA   1  
ATOM 1545  C C    . PRO A 1 100 ? 3.234   -1.499  -1.884  1.00 0.00 ? 178 PRO A C    1  
ATOM 1546  O O    . PRO A 1 100 ? 2.927   -2.689  -1.805  1.00 0.00 ? 178 PRO A O    1  
ATOM 1547  C CB   . PRO A 1 100 ? 3.532   -1.106  -4.345  1.00 0.00 ? 178 PRO A CB   1  
ATOM 1548  C CG   . PRO A 1 100 ? 3.983   -2.417  -4.891  1.00 0.00 ? 178 PRO A CG   1  
ATOM 1549  C CD   . PRO A 1 100 ? 5.370   -2.635  -4.353  1.00 0.00 ? 178 PRO A CD   1  
ATOM 1550  H HA   . PRO A 1 100 ? 4.466   0.014   -2.767  1.00 0.00 ? 178 PRO A HA   1  
ATOM 1551  H HB2  . PRO A 1 100 ? 2.457   -1.071  -4.237  1.00 0.00 ? 178 PRO A HB2  1  
ATOM 1552  H HB3  . PRO A 1 100 ? 3.864   -0.286  -4.964  1.00 0.00 ? 178 PRO A HB3  1  
ATOM 1553  H HG2  . PRO A 1 100 ? 3.323   -3.202  -4.554  1.00 0.00 ? 178 PRO A HG2  1  
ATOM 1554  H HG3  . PRO A 1 100 ? 4.002   -2.378  -5.970  1.00 0.00 ? 178 PRO A HG3  1  
ATOM 1555  H HD2  . PRO A 1 100 ? 5.542   -3.684  -4.167  1.00 0.00 ? 178 PRO A HD2  1  
ATOM 1556  H HD3  . PRO A 1 100 ? 6.107   -2.246  -5.041  1.00 0.00 ? 178 PRO A HD3  1  
ATOM 1557  N N    . ILE A 1 101 ? 2.766   -0.574  -1.054  1.00 0.00 ? 179 ILE A N    1  
ATOM 1558  C CA   . ILE A 1 101 ? 1.843   -0.911  0.023   1.00 0.00 ? 179 ILE A CA   1  
ATOM 1559  C C    . ILE A 1 101 ? 0.394   -0.765  -0.430  1.00 0.00 ? 179 ILE A C    1  
ATOM 1560  O O    . ILE A 1 101 ? 0.008   0.260   -0.992  1.00 0.00 ? 179 ILE A O    1  
ATOM 1561  C CB   . ILE A 1 101 ? 2.074   -0.025  1.261   1.00 0.00 ? 179 ILE A CB   1  
ATOM 1562  C CG1  . ILE A 1 101 ? 3.480   -0.250  1.821   1.00 0.00 ? 179 ILE A CG1  1  
ATOM 1563  C CG2  . ILE A 1 101 ? 1.023   -0.313  2.322   1.00 0.00 ? 179 ILE A CG2  1  
ATOM 1564  C CD1  . ILE A 1 101 ? 3.965   0.875   2.707   1.00 0.00 ? 179 ILE A CD1  1  
ATOM 1565  H H    . ILE A 1 101 ? 3.048   0.357   -1.168  1.00 0.00 ? 179 ILE A H    1  
ATOM 1566  H HA   . ILE A 1 101 ? 2.019   -1.940  0.303   1.00 0.00 ? 179 ILE A HA   1  
ATOM 1567  H HB   . ILE A 1 101 ? 1.975   1.007   0.961   1.00 0.00 ? 179 ILE A HB   1  
ATOM 1568  H HG12 . ILE A 1 101 ? 3.487   -1.157  2.405   1.00 0.00 ? 179 ILE A HG12 1  
ATOM 1569  H HG13 . ILE A 1 101 ? 4.175   -0.350  1.000   1.00 0.00 ? 179 ILE A HG13 1  
ATOM 1570  H HG21 . ILE A 1 101 ? 1.484   -0.821  3.157   1.00 0.00 ? 179 ILE A HG21 1  
ATOM 1571  H HG22 . ILE A 1 101 ? 0.590   0.616   2.661   1.00 0.00 ? 179 ILE A HG22 1  
ATOM 1572  H HG23 . ILE A 1 101 ? 0.249   -0.939  1.903   1.00 0.00 ? 179 ILE A HG23 1  
ATOM 1573  H HD11 . ILE A 1 101 ? 3.117   1.407   3.112   1.00 0.00 ? 179 ILE A HD11 1  
ATOM 1574  H HD12 . ILE A 1 101 ? 4.556   0.470   3.515   1.00 0.00 ? 179 ILE A HD12 1  
ATOM 1575  H HD13 . ILE A 1 101 ? 4.571   1.556   2.125   1.00 0.00 ? 179 ILE A HD13 1  
ATOM 1576  N N    . VAL A 1 102 ? -0.406  -1.797  -0.179  1.00 0.00 ? 180 VAL A N    1  
ATOM 1577  C CA   . VAL A 1 102 ? -1.814  -1.782  -0.558  1.00 0.00 ? 180 VAL A CA   1  
ATOM 1578  C C    . VAL A 1 102 ? -2.704  -2.153  0.623   1.00 0.00 ? 180 VAL A C    1  
ATOM 1579  O O    . VAL A 1 102 ? -2.610  -3.255  1.163   1.00 0.00 ? 180 VAL A O    1  
ATOM 1580  C CB   . VAL A 1 102 ? -2.092  -2.753  -1.721  1.00 0.00 ? 180 VAL A CB   1  
ATOM 1581  C CG1  . VAL A 1 102 ? -3.557  -2.697  -2.125  1.00 0.00 ? 180 VAL A CG1  1  
ATOM 1582  C CG2  . VAL A 1 102 ? -1.191  -2.436  -2.906  1.00 0.00 ? 180 VAL A CG2  1  
ATOM 1583  H H    . VAL A 1 102 ? -0.040  -2.586  0.272   1.00 0.00 ? 180 VAL A H    1  
ATOM 1584  H HA   . VAL A 1 102 ? -2.062  -0.783  -0.884  1.00 0.00 ? 180 VAL A HA   1  
ATOM 1585  H HB   . VAL A 1 102 ? -1.872  -3.756  -1.387  1.00 0.00 ? 180 VAL A HB   1  
ATOM 1586  H HG11 . VAL A 1 102 ? -4.176  -2.755  -1.242  1.00 0.00 ? 180 VAL A HG11 1  
ATOM 1587  H HG12 . VAL A 1 102 ? -3.753  -1.769  -2.643  1.00 0.00 ? 180 VAL A HG12 1  
ATOM 1588  H HG13 . VAL A 1 102 ? -3.783  -3.528  -2.777  1.00 0.00 ? 180 VAL A HG13 1  
ATOM 1589  H HG21 . VAL A 1 102 ? -0.560  -1.594  -2.662  1.00 0.00 ? 180 VAL A HG21 1  
ATOM 1590  H HG22 . VAL A 1 102 ? -0.574  -3.295  -3.129  1.00 0.00 ? 180 VAL A HG22 1  
ATOM 1591  H HG23 . VAL A 1 102 ? -1.798  -2.196  -3.766  1.00 0.00 ? 180 VAL A HG23 1  
ATOM 1592  N N    . PHE A 1 103 ? -3.569  -1.225  1.018   1.00 0.00 ? 181 PHE A N    1  
ATOM 1593  C CA   . PHE A 1 103 ? -4.477  -1.453  2.136   1.00 0.00 ? 181 PHE A CA   1  
ATOM 1594  C C    . PHE A 1 103 ? -5.705  -2.241  1.687   1.00 0.00 ? 181 PHE A C    1  
ATOM 1595  O O    . PHE A 1 103 ? -6.336  -1.910  0.683   1.00 0.00 ? 181 PHE A O    1  
ATOM 1596  C CB   . PHE A 1 103 ? -4.909  -0.120  2.750   1.00 0.00 ? 181 PHE A CB   1  
ATOM 1597  C CG   . PHE A 1 103 ? -3.766  0.689   3.292   1.00 0.00 ? 181 PHE A CG   1  
ATOM 1598  C CD1  . PHE A 1 103 ? -3.088  0.280   4.429   1.00 0.00 ? 181 PHE A CD1  1  
ATOM 1599  C CD2  . PHE A 1 103 ? -3.368  1.858   2.664   1.00 0.00 ? 181 PHE A CD2  1  
ATOM 1600  C CE1  . PHE A 1 103 ? -2.036  1.023   4.930   1.00 0.00 ? 181 PHE A CE1  1  
ATOM 1601  C CE2  . PHE A 1 103 ? -2.316  2.605   3.160   1.00 0.00 ? 181 PHE A CE2  1  
ATOM 1602  C CZ   . PHE A 1 103 ? -1.649  2.186   4.294   1.00 0.00 ? 181 PHE A CZ   1  
ATOM 1603  H H    . PHE A 1 103 ? -3.597  -0.365  0.547   1.00 0.00 ? 181 PHE A H    1  
ATOM 1604  H HA   . PHE A 1 103 ? -3.948  -2.028  2.880   1.00 0.00 ? 181 PHE A HA   1  
ATOM 1605  H HB2  . PHE A 1 103 ? -5.406  0.472   1.996   1.00 0.00 ? 181 PHE A HB2  1  
ATOM 1606  H HB3  . PHE A 1 103 ? -5.596  -0.312  3.561   1.00 0.00 ? 181 PHE A HB3  1  
ATOM 1607  H HD1  . PHE A 1 103 ? -3.389  -0.631  4.927   1.00 0.00 ? 181 PHE A HD1  1  
ATOM 1608  H HD2  . PHE A 1 103 ? -3.890  2.186   1.776   1.00 0.00 ? 181 PHE A HD2  1  
ATOM 1609  H HE1  . PHE A 1 103 ? -1.515  0.693   5.817   1.00 0.00 ? 181 PHE A HE1  1  
ATOM 1610  H HE2  . PHE A 1 103 ? -2.016  3.514   2.660   1.00 0.00 ? 181 PHE A HE2  1  
ATOM 1611  H HZ   . PHE A 1 103 ? -0.827  2.768   4.684   1.00 0.00 ? 181 PHE A HZ   1  
ATOM 1612  N N    . VAL A 1 104 ? -6.037  -3.286  2.438   1.00 0.00 ? 182 VAL A N    1  
ATOM 1613  C CA   . VAL A 1 104 ? -7.189  -4.122  2.119   1.00 0.00 ? 182 VAL A CA   1  
ATOM 1614  C C    . VAL A 1 104 ? -8.142  -4.219  3.305   1.00 0.00 ? 182 VAL A C    1  
ATOM 1615  O O    . VAL A 1 104 ? -7.711  -4.307  4.454   1.00 0.00 ? 182 VAL A O    1  
ATOM 1616  C CB   . VAL A 1 104 ? -6.755  -5.541  1.705   1.00 0.00 ? 182 VAL A CB   1  
ATOM 1617  C CG1  . VAL A 1 104 ? -7.970  -6.435  1.511   1.00 0.00 ? 182 VAL A CG1  1  
ATOM 1618  C CG2  . VAL A 1 104 ? -5.912  -5.492  0.440   1.00 0.00 ? 182 VAL A CG2  1  
ATOM 1619  H H    . VAL A 1 104 ? -5.495  -3.500  3.226   1.00 0.00 ? 182 VAL A H    1  
ATOM 1620  H HA   . VAL A 1 104 ? -7.709  -3.670  1.287   1.00 0.00 ? 182 VAL A HA   1  
ATOM 1621  H HB   . VAL A 1 104 ? -6.152  -5.957  2.499   1.00 0.00 ? 182 VAL A HB   1  
ATOM 1622  H HG11 . VAL A 1 104 ? -7.687  -7.309  0.943   1.00 0.00 ? 182 VAL A HG11 1  
ATOM 1623  H HG12 . VAL A 1 104 ? -8.351  -6.739  2.475   1.00 0.00 ? 182 VAL A HG12 1  
ATOM 1624  H HG13 . VAL A 1 104 ? -8.735  -5.891  0.976   1.00 0.00 ? 182 VAL A HG13 1  
ATOM 1625  H HG21 . VAL A 1 104 ? -5.014  -6.074  0.585   1.00 0.00 ? 182 VAL A HG21 1  
ATOM 1626  H HG22 . VAL A 1 104 ? -6.476  -5.900  -0.386  1.00 0.00 ? 182 VAL A HG22 1  
ATOM 1627  H HG23 . VAL A 1 104 ? -5.646  -4.468  0.223   1.00 0.00 ? 182 VAL A HG23 1  
ATOM 1628  N N    . GLN A 1 105 ? -9.440  -4.203  3.016   1.00 0.00 ? 183 GLN A N    1  
ATOM 1629  C CA   . GLN A 1 105 ? -10.455 -4.289  4.060   1.00 0.00 ? 183 GLN A CA   1  
ATOM 1630  C C    . GLN A 1 105 ? -10.496 -5.689  4.665   1.00 0.00 ? 183 GLN A C    1  
ATOM 1631  O O    . GLN A 1 105 ? -10.582 -6.684  3.946   1.00 0.00 ? 183 GLN A O    1  
ATOM 1632  C CB   . GLN A 1 105 ? -11.829 -3.924  3.495   1.00 0.00 ? 183 GLN A CB   1  
ATOM 1633  C CG   . GLN A 1 105 ? -11.978 -2.448  3.166   1.00 0.00 ? 183 GLN A CG   1  
ATOM 1634  C CD   . GLN A 1 105 ? -13.067 -2.186  2.143   1.00 0.00 ? 183 GLN A CD   1  
ATOM 1635  O OE1  . GLN A 1 105 ? -13.070 -2.771  1.060   1.00 0.00 ? 183 GLN A OE1  1  
ATOM 1636  N NE2  . GLN A 1 105 ? -13.998 -1.302  2.483   1.00 0.00 ? 183 GLN A NE2  1  
ATOM 1637  H H    . GLN A 1 105 ? -9.720  -4.131  2.081   1.00 0.00 ? 183 GLN A H    1  
ATOM 1638  H HA   . GLN A 1 105 ? -10.195 -3.584  4.834   1.00 0.00 ? 183 GLN A HA   1  
ATOM 1639  H HB2  . GLN A 1 105 ? -11.996 -4.492  2.592   1.00 0.00 ? 183 GLN A HB2  1  
ATOM 1640  H HB3  . GLN A 1 105 ? -12.584 -4.187  4.221   1.00 0.00 ? 183 GLN A HB3  1  
ATOM 1641  H HG2  . GLN A 1 105 ? -12.221 -1.913  4.072   1.00 0.00 ? 183 GLN A HG2  1  
ATOM 1642  H HG3  . GLN A 1 105 ? -11.041 -2.083  2.774   1.00 0.00 ? 183 GLN A HG3  1  
ATOM 1643  H HE21 . GLN A 1 105 ? -13.930 -0.874  3.363   1.00 0.00 ? 183 GLN A HE21 1  
ATOM 1644  H HE22 . GLN A 1 105 ? -14.712 -1.113  1.841   1.00 0.00 ? 183 GLN A HE22 1  
ATOM 1645  N N    . ASP A 1 106 ? -10.433 -5.757  5.990   1.00 0.00 ? 184 ASP A N    1  
ATOM 1646  C CA   . ASP A 1 106 ? -10.464 -7.034  6.692   1.00 0.00 ? 184 ASP A CA   1  
ATOM 1647  C C    . ASP A 1 106 ? -11.788 -7.753  6.456   1.00 0.00 ? 184 ASP A C    1  
ATOM 1648  O O    . ASP A 1 106 ? -11.815 -8.894  5.995   1.00 0.00 ? 184 ASP A O    1  
ATOM 1649  C CB   . ASP A 1 106 ? -10.245 -6.822  8.191   1.00 0.00 ? 184 ASP A CB   1  
ATOM 1650  C CG   . ASP A 1 106 ? -9.581  -8.013  8.854   1.00 0.00 ? 184 ASP A CG   1  
ATOM 1651  O OD1  . ASP A 1 106 ? -10.269 -9.033  9.067   1.00 0.00 ? 184 ASP A OD1  1  
ATOM 1652  O OD2  . ASP A 1 106 ? -8.373  -7.925  9.159   1.00 0.00 ? 184 ASP A OD2  1  
ATOM 1653  H H    . ASP A 1 106 ? -10.365 -4.928  6.508   1.00 0.00 ? 184 ASP A H    1  
ATOM 1654  H HA   . ASP A 1 106 ? -9.663  -7.646  6.304   1.00 0.00 ? 184 ASP A HA   1  
ATOM 1655  H HB2  . ASP A 1 106 ? -9.616  -5.956  8.338   1.00 0.00 ? 184 ASP A HB2  1  
ATOM 1656  H HB3  . ASP A 1 106 ? -11.199 -6.654  8.667   1.00 0.00 ? 184 ASP A HB3  1  
ATOM 1657  N N    . LYS A 1 107 ? -12.887 -7.077  6.775   1.00 0.00 ? 185 LYS A N    1  
ATOM 1658  C CA   . LYS A 1 107 ? -14.216 -7.650  6.597   1.00 0.00 ? 185 LYS A CA   1  
ATOM 1659  C C    . LYS A 1 107 ? -14.727 -7.410  5.180   1.00 0.00 ? 185 LYS A C    1  
ATOM 1660  O O    . LYS A 1 107 ? -15.908 -7.136  4.974   1.00 0.00 ? 185 LYS A O    1  
ATOM 1661  C CB   . LYS A 1 107 ? -15.193 -7.048  7.611   1.00 0.00 ? 185 LYS A CB   1  
ATOM 1662  C CG   . LYS A 1 107 ? -14.908 -7.457  9.046   1.00 0.00 ? 185 LYS A CG   1  
ATOM 1663  C CD   . LYS A 1 107 ? -15.871 -6.793  10.016  1.00 0.00 ? 185 LYS A CD   1  
ATOM 1664  C CE   . LYS A 1 107 ? -16.065 -7.632  11.270  1.00 0.00 ? 185 LYS A CE   1  
ATOM 1665  N NZ   . LYS A 1 107 ? -17.253 -7.193  12.053  1.00 0.00 ? 185 LYS A NZ   1  
ATOM 1666  H H    . LYS A 1 107 ? -12.802 -6.170  7.138   1.00 0.00 ? 185 LYS A H    1  
ATOM 1667  H HA   . LYS A 1 107 ? -14.145 -8.713  6.766   1.00 0.00 ? 185 LYS A HA   1  
ATOM 1668  H HB2  . LYS A 1 107 ? -15.140 -5.971  7.548   1.00 0.00 ? 185 LYS A HB2  1  
ATOM 1669  H HB3  . LYS A 1 107 ? -16.194 -7.366  7.360   1.00 0.00 ? 185 LYS A HB3  1  
ATOM 1670  H HG2  . LYS A 1 107 ? -15.008 -8.528  9.132   1.00 0.00 ? 185 LYS A HG2  1  
ATOM 1671  H HG3  . LYS A 1 107 ? -13.898 -7.166  9.300   1.00 0.00 ? 185 LYS A HG3  1  
ATOM 1672  H HD2  . LYS A 1 107 ? -15.476 -5.829  10.299  1.00 0.00 ? 185 LYS A HD2  1  
ATOM 1673  H HD3  . LYS A 1 107 ? -16.827 -6.664  9.529   1.00 0.00 ? 185 LYS A HD3  1  
ATOM 1674  H HE2  . LYS A 1 107 ? -16.196 -8.663  10.981  1.00 0.00 ? 185 LYS A HE2  1  
ATOM 1675  H HE3  . LYS A 1 107 ? -15.183 -7.541  11.888  1.00 0.00 ? 185 LYS A HE3  1  
ATOM 1676  H HZ1  . LYS A 1 107 ? -17.958 -6.764  11.420  1.00 0.00 ? 185 LYS A HZ1  1  
ATOM 1677  H HZ2  . LYS A 1 107 ? -16.971 -6.491  12.766  1.00 0.00 ? 185 LYS A HZ2  1  
ATOM 1678  H HZ3  . LYS A 1 107 ? -17.685 -8.007  12.535  1.00 0.00 ? 185 LYS A HZ3  1  
ATOM 1679  N N    . GLY A 1 108 ? -13.829 -7.518  4.206   1.00 0.00 ? 186 GLY A N    1  
ATOM 1680  C CA   . GLY A 1 108 ? -14.208 -7.311  2.820   1.00 0.00 ? 186 GLY A CA   1  
ATOM 1681  C C    . GLY A 1 108 ? -15.479 -8.051  2.451   1.00 0.00 ? 186 GLY A C    1  
ATOM 1682  O O    . GLY A 1 108 ? -15.446 -9.245  2.155   1.00 0.00 ? 186 GLY A O    1  
ATOM 1683  H H    . GLY A 1 108 ? -12.900 -7.739  4.430   1.00 0.00 ? 186 GLY A H    1  
ATOM 1684  H HA2  . GLY A 1 108 ? -14.357 -6.255  2.653   1.00 0.00 ? 186 GLY A HA2  1  
ATOM 1685  H HA3  . GLY A 1 108 ? -13.407 -7.657  2.184   1.00 0.00 ? 186 GLY A HA3  1  
ATOM 1686  N N    . ASN A 1 109 ? -16.602 -7.341  2.469   1.00 0.00 ? 187 ASN A N    1  
ATOM 1687  C CA   . ASN A 1 109 ? -17.890 -7.938  2.136   1.00 0.00 ? 187 ASN A CA   1  
ATOM 1688  C C    . ASN A 1 109 ? -17.805 -8.720  0.829   1.00 0.00 ? 187 ASN A C    1  
ATOM 1689  O O    . ASN A 1 109 ? -17.951 -8.155  -0.255  1.00 0.00 ? 187 ASN A O    1  
ATOM 1690  C CB   . ASN A 1 109 ? -18.965 -6.855  2.026   1.00 0.00 ? 187 ASN A CB   1  
ATOM 1691  C CG   . ASN A 1 109 ? -19.090 -6.035  3.296   1.00 0.00 ? 187 ASN A CG   1  
ATOM 1692  O OD1  . ASN A 1 109 ? -18.182 -5.287  3.657   1.00 0.00 ? 187 ASN A OD1  1  
ATOM 1693  N ND2  . ASN A 1 109 ? -20.220 -6.172  3.980   1.00 0.00 ? 187 ASN A ND2  1  
ATOM 1694  H H    . ASN A 1 109 ? -16.564 -6.392  2.713   1.00 0.00 ? 187 ASN A H    1  
ATOM 1695  H HA   . ASN A 1 109 ? -18.156 -8.618  2.932   1.00 0.00 ? 187 ASN A HA   1  
ATOM 1696  H HB2  . ASN A 1 109 ? -18.715 -6.189  1.214   1.00 0.00 ? 187 ASN A HB2  1  
ATOM 1697  H HB3  . ASN A 1 109 ? -19.918 -7.321  1.825   1.00 0.00 ? 187 ASN A HB3  1  
ATOM 1698  H HD21 . ASN A 1 109 ? -20.901 -6.786  3.632   1.00 0.00 ? 187 ASN A HD21 1  
ATOM 1699  H HD22 . ASN A 1 109 ? -20.328 -5.653  4.804   1.00 0.00 ? 187 ASN A HD22 1  
ATOM 1700  N N    . ALA A 1 110 ? -17.567 -10.023 0.939   1.00 0.00 ? 188 ALA A N    1  
ATOM 1701  C CA   . ALA A 1 110 ? -17.465 -10.883 -0.234  1.00 0.00 ? 188 ALA A CA   1  
ATOM 1702  C C    . ALA A 1 110 ? -18.536 -11.968 -0.214  1.00 0.00 ? 188 ALA A C    1  
ATOM 1703  O O    . ALA A 1 110 ? -18.459 -12.915 0.567   1.00 0.00 ? 188 ALA A O    1  
ATOM 1704  C CB   . ALA A 1 110 ? -16.080 -11.507 -0.311  1.00 0.00 ? 188 ALA A CB   1  
ATOM 1705  H H    . ALA A 1 110 ? -17.459 -10.415 1.830   1.00 0.00 ? 188 ALA A H    1  
ATOM 1706  H HA   . ALA A 1 110 ? -17.605 -10.268 -1.112  1.00 0.00 ? 188 ALA A HA   1  
ATOM 1707  H HB1  . ALA A 1 110 ? -15.467 -10.939 -0.997  1.00 0.00 ? 188 ALA A HB1  1  
ATOM 1708  H HB2  . ALA A 1 110 ? -15.626 -11.499 0.669   1.00 0.00 ? 188 ALA A HB2  1  
ATOM 1709  H HB3  . ALA A 1 110 ? -16.163 -12.525 -0.661  1.00 0.00 ? 188 ALA A HB3  1  
ATOM 1710  N N    . ALA A 1 111 ? -19.536 -11.822 -1.078  1.00 0.00 ? 189 ALA A N    1  
ATOM 1711  C CA   . ALA A 1 111 ? -20.622 -12.790 -1.160  1.00 0.00 ? 189 ALA A CA   1  
ATOM 1712  C C    . ALA A 1 111 ? -20.712 -13.397 -2.556  1.00 0.00 ? 189 ALA A C    1  
ATOM 1713  O O    . ALA A 1 111 ? -21.343 -12.833 -3.450  1.00 0.00 ? 189 ALA A O    1  
ATOM 1714  C CB   . ALA A 1 111 ? -21.942 -12.136 -0.781  1.00 0.00 ? 189 ALA A CB   1  
ATOM 1715  H H    . ALA A 1 111 ? -19.542 -11.045 -1.675  1.00 0.00 ? 189 ALA A H    1  
ATOM 1716  H HA   . ALA A 1 111 ? -20.421 -13.578 -0.447  1.00 0.00 ? 189 ALA A HA   1  
ATOM 1717  H HB1  . ALA A 1 111 ? -21.985 -11.142 -1.204  1.00 0.00 ? 189 ALA A HB1  1  
ATOM 1718  H HB2  . ALA A 1 111 ? -22.760 -12.727 -1.165  1.00 0.00 ? 189 ALA A HB2  1  
ATOM 1719  H HB3  . ALA A 1 111 ? -22.017 -12.073 0.295   1.00 0.00 ? 189 ALA A HB3  1  
ATOM 1720  N N    . LEU A 1 112 ? -20.076 -14.550 -2.736  1.00 0.00 ? 190 LEU A N    1  
ATOM 1721  C CA   . LEU A 1 112 ? -20.084 -15.234 -4.024  1.00 0.00 ? 190 LEU A CA   1  
ATOM 1722  C C    . LEU A 1 112 ? -20.526 -16.686 -3.868  1.00 0.00 ? 190 LEU A C    1  
ATOM 1723  O O    . LEU A 1 112 ? -19.721 -17.559 -3.547  1.00 0.00 ? 190 LEU A O    1  
ATOM 1724  C CB   . LEU A 1 112 ? -18.695 -15.178 -4.662  1.00 0.00 ? 190 LEU A CB   1  
ATOM 1725  C CG   . LEU A 1 112 ? -18.643 -15.375 -6.178  1.00 0.00 ? 190 LEU A CG   1  
ATOM 1726  C CD1  . LEU A 1 112 ? -19.262 -16.710 -6.564  1.00 0.00 ? 190 LEU A CD1  1  
ATOM 1727  C CD2  . LEU A 1 112 ? -19.352 -14.231 -6.888  1.00 0.00 ? 190 LEU A CD2  1  
ATOM 1728  H H    . LEU A 1 112 ? -19.591 -14.951 -1.986  1.00 0.00 ? 190 LEU A H    1  
ATOM 1729  H HA   . LEU A 1 112 ? -20.787 -14.724 -4.666  1.00 0.00 ? 190 LEU A HA   1  
ATOM 1730  H HB2  . LEU A 1 112 ? -18.268 -14.212 -4.440  1.00 0.00 ? 190 LEU A HB2  1  
ATOM 1731  H HB3  . LEU A 1 112 ? -18.091 -15.950 -4.206  1.00 0.00 ? 190 LEU A HB3  1  
ATOM 1732  H HG   . LEU A 1 112 ? -17.611 -15.381 -6.499  1.00 0.00 ? 190 LEU A HG   1  
ATOM 1733  H HD11 . LEU A 1 112 ? -18.939 -16.982 -7.557  1.00 0.00 ? 190 LEU A HD11 1  
ATOM 1734  H HD12 . LEU A 1 112 ? -20.338 -16.626 -6.545  1.00 0.00 ? 190 LEU A HD12 1  
ATOM 1735  H HD13 . LEU A 1 112 ? -18.948 -17.468 -5.862  1.00 0.00 ? 190 LEU A HD13 1  
ATOM 1736  H HD21 . LEU A 1 112 ? -18.933 -13.291 -6.562  1.00 0.00 ? 190 LEU A HD21 1  
ATOM 1737  H HD22 . LEU A 1 112 ? -20.406 -14.257 -6.650  1.00 0.00 ? 190 LEU A HD22 1  
ATOM 1738  H HD23 . LEU A 1 112 ? -19.221 -14.334 -7.955  1.00 0.00 ? 190 LEU A HD23 1  
ATOM 1739  N N    . ALA A 1 113 ? -21.811 -16.936 -4.098  1.00 0.00 ? 191 ALA A N    1  
ATOM 1740  C CA   . ALA A 1 113 ? -22.359 -18.282 -3.987  1.00 0.00 ? 191 ALA A CA   1  
ATOM 1741  C C    . ALA A 1 113 ? -21.920 -19.152 -5.159  1.00 0.00 ? 191 ALA A C    1  
ATOM 1742  O O    . ALA A 1 113 ? -21.803 -18.676 -6.288  1.00 0.00 ? 191 ALA A O    1  
ATOM 1743  C CB   . ALA A 1 113 ? -23.877 -18.228 -3.907  1.00 0.00 ? 191 ALA A CB   1  
ATOM 1744  H H    . ALA A 1 113 ? -22.404 -16.198 -4.351  1.00 0.00 ? 191 ALA A H    1  
ATOM 1745  H HA   . ALA A 1 113 ? -21.990 -18.718 -3.070  1.00 0.00 ? 191 ALA A HA   1  
ATOM 1746  H HB1  . ALA A 1 113 ? -24.174 -17.410 -3.267  1.00 0.00 ? 191 ALA A HB1  1  
ATOM 1747  H HB2  . ALA A 1 113 ? -24.285 -18.079 -4.895  1.00 0.00 ? 191 ALA A HB2  1  
ATOM 1748  H HB3  . ALA A 1 113 ? -24.249 -19.157 -3.500  1.00 0.00 ? 191 ALA A HB3  1  
ATOM 1749  N N    . GLU A 1 114 ? -21.677 -20.430 -4.884  1.00 0.00 ? 192 GLU A N    1  
ATOM 1750  C CA   . GLU A 1 114 ? -21.249 -21.366 -5.917  1.00 0.00 ? 192 GLU A CA   1  
ATOM 1751  C C    . GLU A 1 114 ? -22.398 -22.279 -6.334  1.00 0.00 ? 192 GLU A C    1  
ATOM 1752  O O    . GLU A 1 114 ? -22.204 -23.473 -6.566  1.00 0.00 ? 192 GLU A O    1  
ATOM 1753  C CB   . GLU A 1 114 ? -20.071 -22.205 -5.420  1.00 0.00 ? 192 GLU A CB   1  
ATOM 1754  C CG   . GLU A 1 114 ? -20.387 -23.025 -4.180  1.00 0.00 ? 192 GLU A CG   1  
ATOM 1755  C CD   . GLU A 1 114 ? -20.924 -24.403 -4.514  1.00 0.00 ? 192 GLU A CD   1  
ATOM 1756  O OE1  . GLU A 1 114 ? -20.239 -25.143 -5.251  1.00 0.00 ? 192 GLU A OE1  1  
ATOM 1757  O OE2  . GLU A 1 114 ? -22.028 -24.741 -4.040  1.00 0.00 ? 192 GLU A OE2  1  
ATOM 1758  H H    . GLU A 1 114 ? -21.789 -20.751 -3.965  1.00 0.00 ? 192 GLU A H    1  
ATOM 1759  H HA   . GLU A 1 114 ? -20.934 -20.791 -6.775  1.00 0.00 ? 192 GLU A HA   1  
ATOM 1760  H HB2  . GLU A 1 114 ? -19.768 -22.880 -6.206  1.00 0.00 ? 192 GLU A HB2  1  
ATOM 1761  H HB3  . GLU A 1 114 ? -19.247 -21.545 -5.188  1.00 0.00 ? 192 GLU A HB3  1  
ATOM 1762  H HG2  . GLU A 1 114 ? -19.484 -23.138 -3.599  1.00 0.00 ? 192 GLU A HG2  1  
ATOM 1763  H HG3  . GLU A 1 114 ? -21.127 -22.499 -3.595  1.00 0.00 ? 192 GLU A HG3  1  
ATOM 1764  N N    . LEU A 1 115 ? -23.595 -21.710 -6.426  1.00 0.00 ? 193 LEU A N    1  
ATOM 1765  C CA   . LEU A 1 115 ? -24.777 -22.473 -6.813  1.00 0.00 ? 193 LEU A CA   1  
ATOM 1766  C C    . LEU A 1 115 ? -25.013 -22.383 -8.318  1.00 0.00 ? 193 LEU A C    1  
ATOM 1767  O O    . LEU A 1 115 ? -25.311 -21.312 -8.846  1.00 0.00 ? 193 LEU A O    1  
ATOM 1768  C CB   . LEU A 1 115 ? -26.007 -21.962 -6.061  1.00 0.00 ? 193 LEU A CB   1  
ATOM 1769  C CG   . LEU A 1 115 ? -26.063 -22.287 -4.568  1.00 0.00 ? 193 LEU A CG   1  
ATOM 1770  C CD1  . LEU A 1 115 ? -27.219 -21.554 -3.905  1.00 0.00 ? 193 LEU A CD1  1  
ATOM 1771  C CD2  . LEU A 1 115 ? -26.187 -23.788 -4.353  1.00 0.00 ? 193 LEU A CD2  1  
ATOM 1772  H H    . LEU A 1 115 ? -23.687 -20.755 -6.228  1.00 0.00 ? 193 LEU A H    1  
ATOM 1773  H HA   . LEU A 1 115 ? -24.606 -23.505 -6.549  1.00 0.00 ? 193 LEU A HA   1  
ATOM 1774  H HB2  . LEU A 1 115 ? -26.037 -20.888 -6.167  1.00 0.00 ? 193 LEU A HB2  1  
ATOM 1775  H HB3  . LEU A 1 115 ? -26.882 -22.393 -6.527  1.00 0.00 ? 193 LEU A HB3  1  
ATOM 1776  H HG   . LEU A 1 115 ? -25.146 -21.955 -4.099  1.00 0.00 ? 193 LEU A HG   1  
ATOM 1777  H HD11 . LEU A 1 115 ? -27.635 -22.170 -3.122  1.00 0.00 ? 193 LEU A HD11 1  
ATOM 1778  H HD12 . LEU A 1 115 ? -27.981 -21.344 -4.641  1.00 0.00 ? 193 LEU A HD12 1  
ATOM 1779  H HD13 . LEU A 1 115 ? -26.862 -20.626 -3.483  1.00 0.00 ? 193 LEU A HD13 1  
ATOM 1780  H HD21 . LEU A 1 115 ? -26.107 -24.295 -5.303  1.00 0.00 ? 193 LEU A HD21 1  
ATOM 1781  H HD22 . LEU A 1 115 ? -27.146 -24.009 -3.907  1.00 0.00 ? 193 LEU A HD22 1  
ATOM 1782  H HD23 . LEU A 1 115 ? -25.398 -24.124 -3.697  1.00 0.00 ? 193 LEU A HD23 1  
ATOM 1783  N N    . ASP A 1 116 ? -24.881 -23.514 -9.001  1.00 0.00 ? 194 ASP A N    1  
ATOM 1784  C CA   . ASP A 1 116 ? -25.083 -23.565 -10.444 1.00 0.00 ? 194 ASP A CA   1  
ATOM 1785  C C    . ASP A 1 116 ? -26.346 -24.348 -10.789 1.00 0.00 ? 194 ASP A C    1  
ATOM 1786  O O    . ASP A 1 116 ? -27.196 -23.873 -11.540 1.00 0.00 ? 194 ASP A O    1  
ATOM 1787  C CB   . ASP A 1 116 ? -23.871 -24.199 -11.129 1.00 0.00 ? 194 ASP A CB   1  
ATOM 1788  C CG   . ASP A 1 116 ? -22.613 -23.369 -10.963 1.00 0.00 ? 194 ASP A CG   1  
ATOM 1789  O OD1  . ASP A 1 116 ? -22.467 -22.716 -9.908  1.00 0.00 ? 194 ASP A OD1  1  
ATOM 1790  O OD2  . ASP A 1 116 ? -21.774 -23.374 -11.887 1.00 0.00 ? 194 ASP A OD2  1  
ATOM 1791  H H    . ASP A 1 116 ? -24.642 -24.336 -8.522  1.00 0.00 ? 194 ASP A H    1  
ATOM 1792  H HA   . ASP A 1 116 ? -25.196 -22.551 -10.798 1.00 0.00 ? 194 ASP A HA   1  
ATOM 1793  H HB2  . ASP A 1 116 ? -23.695 -25.175 -10.702 1.00 0.00 ? 194 ASP A HB2  1  
ATOM 1794  H HB3  . ASP A 1 116 ? -24.076 -24.303 -12.184 1.00 0.00 ? 194 ASP A HB3  1  
ATOM 1795  N N    . GLN A 1 117 ? -26.459 -25.551 -10.235 1.00 0.00 ? 195 GLN A N    1  
ATOM 1796  C CA   . GLN A 1 117 ? -27.617 -26.401 -10.486 1.00 0.00 ? 195 GLN A CA   1  
ATOM 1797  C C    . GLN A 1 117 ? -28.672 -26.219 -9.400  1.00 0.00 ? 195 GLN A C    1  
ATOM 1798  O O    . GLN A 1 117 ? -28.368 -26.284 -8.208  1.00 0.00 ? 195 GLN A O    1  
ATOM 1799  C CB   . GLN A 1 117 ? -27.192 -27.869 -10.559 1.00 0.00 ? 195 GLN A CB   1  
ATOM 1800  C CG   . GLN A 1 117 ? -28.229 -28.771 -11.209 1.00 0.00 ? 195 GLN A CG   1  
ATOM 1801  C CD   . GLN A 1 117 ? -27.875 -30.241 -11.100 1.00 0.00 ? 195 GLN A CD   1  
ATOM 1802  O OE1  . GLN A 1 117 ? -26.719 -30.627 -11.274 1.00 0.00 ? 195 GLN A OE1  1  
ATOM 1803  N NE2  . GLN A 1 117 ? -28.871 -31.070 -10.810 1.00 0.00 ? 195 GLN A NE2  1  
ATOM 1804  H H    . GLN A 1 117 ? -25.747 -25.875 -9.645  1.00 0.00 ? 195 GLN A H    1  
ATOM 1805  H HA   . GLN A 1 117 ? -28.041 -26.111 -11.435 1.00 0.00 ? 195 GLN A HA   1  
ATOM 1806  H HB2  . GLN A 1 117 ? -26.278 -27.939 -11.129 1.00 0.00 ? 195 GLN A HB2  1  
ATOM 1807  H HB3  . GLN A 1 117 ? -27.011 -28.230 -9.558  1.00 0.00 ? 195 GLN A HB3  1  
ATOM 1808  H HG2  . GLN A 1 117 ? -29.181 -28.609 -10.726 1.00 0.00 ? 195 GLN A HG2  1  
ATOM 1809  H HG3  . GLN A 1 117 ? -28.309 -28.511 -12.255 1.00 0.00 ? 195 GLN A HG3  1  
ATOM 1810  H HE21 . GLN A 1 117 ? -29.767 -30.691 -10.686 1.00 0.00 ? 195 GLN A HE21 1  
ATOM 1811  H HE22 . GLN A 1 117 ? -28.671 -32.025 -10.735 1.00 0.00 ? 195 GLN A HE22 1  
ATOM 1812  N N    . LEU A 1 118 ? -29.911 -25.989 -9.819  1.00 0.00 ? 196 LEU A N    1  
ATOM 1813  C CA   . LEU A 1 118 ? -31.012 -25.797 -8.881  1.00 0.00 ? 196 LEU A CA   1  
ATOM 1814  C C    . LEU A 1 118 ? -32.106 -26.836 -9.105  1.00 0.00 ? 196 LEU A C    1  
ATOM 1815  O O    . LEU A 1 118 ? -33.084 -26.582 -9.810  1.00 0.00 ? 196 LEU A O    1  
ATOM 1816  C CB   . LEU A 1 118 ? -31.593 -24.389 -9.028  1.00 0.00 ? 196 LEU A CB   1  
ATOM 1817  C CG   . LEU A 1 118 ? -30.658 -23.236 -8.661  1.00 0.00 ? 196 LEU A CG   1  
ATOM 1818  C CD1  . LEU A 1 118 ? -31.161 -21.930 -9.257  1.00 0.00 ? 196 LEU A CD1  1  
ATOM 1819  C CD2  . LEU A 1 118 ? -30.525 -23.118 -7.150  1.00 0.00 ? 196 LEU A CD2  1  
ATOM 1820  H H    . LEU A 1 118 ? -30.091 -25.948 -10.781 1.00 0.00 ? 196 LEU A H    1  
ATOM 1821  H HA   . LEU A 1 118 ? -30.620 -25.913 -7.882  1.00 0.00 ? 196 LEU A HA   1  
ATOM 1822  H HB2  . LEU A 1 118 ? -31.889 -24.259 -10.058 1.00 0.00 ? 196 LEU A HB2  1  
ATOM 1823  H HB3  . LEU A 1 118 ? -32.465 -24.324 -8.393  1.00 0.00 ? 196 LEU A HB3  1  
ATOM 1824  H HG   . LEU A 1 118 ? -29.676 -23.432 -9.070  1.00 0.00 ? 196 LEU A HG   1  
ATOM 1825  H HD11 . LEU A 1 118 ? -30.320 -21.300 -9.503  1.00 0.00 ? 196 LEU A HD11 1  
ATOM 1826  H HD12 . LEU A 1 118 ? -31.791 -21.426 -8.539  1.00 0.00 ? 196 LEU A HD12 1  
ATOM 1827  H HD13 . LEU A 1 118 ? -31.730 -22.139 -10.151 1.00 0.00 ? 196 LEU A HD13 1  
ATOM 1828  H HD21 . LEU A 1 118 ? -30.168 -22.130 -6.896  1.00 0.00 ? 196 LEU A HD21 1  
ATOM 1829  H HD22 . LEU A 1 118 ? -29.822 -23.857 -6.791  1.00 0.00 ? 196 LEU A HD22 1  
ATOM 1830  H HD23 . LEU A 1 118 ? -31.487 -23.282 -6.689  1.00 0.00 ? 196 LEU A HD23 1  
ATOM 1831  N N    . LEU A 1 119 ? -31.936 -28.006 -8.500  1.00 0.00 ? 197 LEU A N    1  
ATOM 1832  C CA   . LEU A 1 119 ? -32.910 -29.084 -8.630  1.00 0.00 ? 197 LEU A CA   1  
ATOM 1833  C C    . LEU A 1 119 ? -32.578 -30.235 -7.686  1.00 0.00 ? 197 LEU A C    1  
ATOM 1834  O O    . LEU A 1 119 ? -31.528 -30.865 -7.805  1.00 0.00 ? 197 LEU A O    1  
ATOM 1835  C CB   . LEU A 1 119 ? -32.950 -29.589 -10.074 1.00 0.00 ? 197 LEU A CB   1  
ATOM 1836  C CG   . LEU A 1 119 ? -34.207 -30.358 -10.481 1.00 0.00 ? 197 LEU A CG   1  
ATOM 1837  C CD1  . LEU A 1 119 ? -35.354 -29.398 -10.758 1.00 0.00 ? 197 LEU A CD1  1  
ATOM 1838  C CD2  . LEU A 1 119 ? -33.930 -31.227 -11.699 1.00 0.00 ? 197 LEU A CD2  1  
ATOM 1839  H H    . LEU A 1 119 ? -31.137 -28.149 -7.951  1.00 0.00 ? 197 LEU A H    1  
ATOM 1840  H HA   . LEU A 1 119 ? -33.880 -28.688 -8.369  1.00 0.00 ? 197 LEU A HA   1  
ATOM 1841  H HB2  . LEU A 1 119 ? -32.860 -28.734 -10.726 1.00 0.00 ? 197 LEU A HB2  1  
ATOM 1842  H HB3  . LEU A 1 119 ? -32.100 -30.241 -10.219 1.00 0.00 ? 197 LEU A HB3  1  
ATOM 1843  H HG   . LEU A 1 119 ? -34.504 -31.006 -9.668  1.00 0.00 ? 197 LEU A HG   1  
ATOM 1844  H HD11 . LEU A 1 119 ? -35.011 -28.604 -11.404 1.00 0.00 ? 197 LEU A HD11 1  
ATOM 1845  H HD12 . LEU A 1 119 ? -35.705 -28.979 -9.827  1.00 0.00 ? 197 LEU A HD12 1  
ATOM 1846  H HD13 . LEU A 1 119 ? -36.161 -29.931 -11.239 1.00 0.00 ? 197 LEU A HD13 1  
ATOM 1847  H HD21 . LEU A 1 119 ? -33.696 -32.231 -11.379 1.00 0.00 ? 197 LEU A HD21 1  
ATOM 1848  H HD22 . LEU A 1 119 ? -33.093 -30.820 -12.248 1.00 0.00 ? 197 LEU A HD22 1  
ATOM 1849  H HD23 . LEU A 1 119 ? -34.803 -31.245 -12.334 1.00 0.00 ? 197 LEU A HD23 1  
ATOM 1850  N N    . ALA A 1 120 ? -33.482 -30.505 -6.750  1.00 0.00 ? 198 ALA A N    1  
ATOM 1851  C CA   . ALA A 1 120 ? -33.288 -31.583 -5.789  1.00 0.00 ? 198 ALA A CA   1  
ATOM 1852  C C    . ALA A 1 120 ? -33.216 -32.936 -6.488  1.00 0.00 ? 198 ALA A C    1  
ATOM 1853  O O    . ALA A 1 120 ? -34.236 -33.593 -6.697  1.00 0.00 ? 198 ALA A O    1  
ATOM 1854  C CB   . ALA A 1 120 ? -34.406 -31.578 -4.757  1.00 0.00 ? 198 ALA A CB   1  
ATOM 1855  H H    . ALA A 1 120 ? -34.300 -29.967 -6.706  1.00 0.00 ? 198 ALA A H    1  
ATOM 1856  H HA   . ALA A 1 120 ? -32.355 -31.406 -5.273  1.00 0.00 ? 198 ALA A HA   1  
ATOM 1857  H HB1  . ALA A 1 120 ? -34.069 -31.070 -3.865  1.00 0.00 ? 198 ALA A HB1  1  
ATOM 1858  H HB2  . ALA A 1 120 ? -35.266 -31.066 -5.161  1.00 0.00 ? 198 ALA A HB2  1  
ATOM 1859  H HB3  . ALA A 1 120 ? -34.674 -32.595 -4.512  1.00 0.00 ? 198 ALA A HB3  1  
ATOM 1860  N N    . VAL A 1 121 ? -32.005 -33.348 -6.848  1.00 0.00 ? 199 VAL A N    1  
ATOM 1861  C CA   . VAL A 1 121 ? -31.800 -34.624 -7.524  1.00 0.00 ? 199 VAL A CA   1  
ATOM 1862  C C    . VAL A 1 121 ? -30.953 -35.566 -6.675  1.00 0.00 ? 199 VAL A C    1  
ATOM 1863  O O    . VAL A 1 121 ? -29.864 -35.205 -6.229  1.00 0.00 ? 199 VAL A O    1  
ATOM 1864  C CB   . VAL A 1 121 ? -31.120 -34.431 -8.892  1.00 0.00 ? 199 VAL A CB   1  
ATOM 1865  C CG1  . VAL A 1 121 ? -29.699 -33.917 -8.715  1.00 0.00 ? 199 VAL A CG1  1  
ATOM 1866  C CG2  . VAL A 1 121 ? -31.130 -35.733 -9.679  1.00 0.00 ? 199 VAL A CG2  1  
ATOM 1867  H H    . VAL A 1 121 ? -31.230 -32.781 -6.654  1.00 0.00 ? 199 VAL A H    1  
ATOM 1868  H HA   . VAL A 1 121 ? -32.768 -35.074 -7.686  1.00 0.00 ? 199 VAL A HA   1  
ATOM 1869  H HB   . VAL A 1 121 ? -31.679 -33.694 -9.449  1.00 0.00 ? 199 VAL A HB   1  
ATOM 1870  H HG11 . VAL A 1 121 ? -29.532 -33.086 -9.385  1.00 0.00 ? 199 VAL A HG11 1  
ATOM 1871  H HG12 . VAL A 1 121 ? -29.558 -33.593 -7.694  1.00 0.00 ? 199 VAL A HG12 1  
ATOM 1872  H HG13 . VAL A 1 121 ? -29.000 -34.708 -8.942  1.00 0.00 ? 199 VAL A HG13 1  
ATOM 1873  H HG21 . VAL A 1 121 ? -32.044 -35.799 -10.252 1.00 0.00 ? 199 VAL A HG21 1  
ATOM 1874  H HG22 . VAL A 1 121 ? -30.283 -35.756 -10.350 1.00 0.00 ? 199 VAL A HG22 1  
ATOM 1875  H HG23 . VAL A 1 121 ? -31.071 -36.568 -8.997  1.00 0.00 ? 199 VAL A HG23 1  
ATOM 1876  N N    . ALA A 1 122 ? -31.461 -36.774 -6.456  1.00 0.00 ? 200 ALA A N    1  
ATOM 1877  C CA   . ALA A 1 122 ? -30.749 -37.769 -5.663  1.00 0.00 ? 200 ALA A CA   1  
ATOM 1878  C C    . ALA A 1 122 ? -31.437 -39.128 -5.743  1.00 0.00 ? 200 ALA A C    1  
ATOM 1879  O O    . ALA A 1 122 ? -32.662 -39.211 -5.829  1.00 0.00 ? 200 ALA A O    1  
ATOM 1880  C CB   . ALA A 1 122 ? -30.644 -37.313 -4.216  1.00 0.00 ? 200 ALA A CB   1  
ATOM 1881  H H    . ALA A 1 122 ? -32.333 -37.002 -6.838  1.00 0.00 ? 200 ALA A H    1  
ATOM 1882  H HA   . ALA A 1 122 ? -29.748 -37.859 -6.061  1.00 0.00 ? 200 ALA A HA   1  
ATOM 1883  H HB1  . ALA A 1 122 ? -30.604 -36.234 -4.181  1.00 0.00 ? 200 ALA A HB1  1  
ATOM 1884  H HB2  . ALA A 1 122 ? -31.506 -37.660 -3.666  1.00 0.00 ? 200 ALA A HB2  1  
ATOM 1885  H HB3  . ALA A 1 122 ? -29.747 -37.721 -3.775  1.00 0.00 ? 200 ALA A HB3  1  
ATOM 1886  N N    . ASP A 1 123 ? -30.640 -40.191 -5.716  1.00 0.00 ? 201 ASP A N    1  
ATOM 1887  C CA   . ASP A 1 123 ? -31.172 -41.547 -5.785  1.00 0.00 ? 201 ASP A CA   1  
ATOM 1888  C C    . ASP A 1 123 ? -31.272 -42.163 -4.393  1.00 0.00 ? 201 ASP A C    1  
ATOM 1889  O O    . ASP A 1 123 ? -30.278 -42.258 -3.673  1.00 0.00 ? 201 ASP A O    1  
ATOM 1890  C CB   . ASP A 1 123 ? -30.290 -42.419 -6.680  1.00 0.00 ? 201 ASP A CB   1  
ATOM 1891  C CG   . ASP A 1 123 ? -28.833 -42.386 -6.265  1.00 0.00 ? 201 ASP A CG   1  
ATOM 1892  O OD1  . ASP A 1 123 ? -28.483 -43.060 -5.274  1.00 0.00 ? 201 ASP A OD1  1  
ATOM 1893  O OD2  . ASP A 1 123 ? -28.041 -41.686 -6.931  1.00 0.00 ? 201 ASP A OD2  1  
ATOM 1894  H H    . ASP A 1 123 ? -29.671 -40.060 -5.646  1.00 0.00 ? 201 ASP A H    1  
ATOM 1895  H HA   . ASP A 1 123 ? -32.162 -41.494 -6.212  1.00 0.00 ? 201 ASP A HA   1  
ATOM 1896  H HB2  . ASP A 1 123 ? -30.637 -43.441 -6.630  1.00 0.00 ? 201 ASP A HB2  1  
ATOM 1897  H HB3  . ASP A 1 123 ? -30.364 -42.067 -7.699  1.00 0.00 ? 201 ASP A HB3  1  
ATOM 1898  N N    . SER A 1 124 ? -32.478 -42.580 -4.020  1.00 0.00 ? 202 SER A N    1  
ATOM 1899  C CA   . SER A 1 124 ? -32.708 -43.182 -2.712  1.00 0.00 ? 202 SER A CA   1  
ATOM 1900  C C    . SER A 1 124 ? -34.029 -43.945 -2.691  1.00 0.00 ? 202 SER A C    1  
ATOM 1901  O O    . SER A 1 124 ? -34.996 -43.553 -3.343  1.00 0.00 ? 202 SER A O    1  
ATOM 1902  C CB   . SER A 1 124 ? -32.709 -42.106 -1.625  1.00 0.00 ? 202 SER A CB   1  
ATOM 1903  O OG   . SER A 1 124 ? -32.374 -42.657 -0.362  1.00 0.00 ? 202 SER A OG   1  
ATOM 1904  H H    . SER A 1 124 ? -33.231 -42.477 -4.639  1.00 0.00 ? 202 SER A H    1  
ATOM 1905  H HA   . SER A 1 124 ? -31.903 -43.875 -2.520  1.00 0.00 ? 202 SER A HA   1  
ATOM 1906  H HB2  . SER A 1 124 ? -31.987 -41.344 -1.875  1.00 0.00 ? 202 SER A HB2  1  
ATOM 1907  H HB3  . SER A 1 124 ? -33.693 -41.664 -1.561  1.00 0.00 ? 202 SER A HB3  1  
ATOM 1908  H HG   . SER A 1 124 ? -31.500 -43.051 -0.407  1.00 0.00 ? 202 SER A HG   1  
ATOM 1909  N N    . GLY A 1 125 ? -34.062 -45.039 -1.935  1.00 0.00 ? 203 GLY A N    1  
ATOM 1910  C CA   . GLY A 1 125 ? -35.268 -45.840 -1.842  1.00 0.00 ? 203 GLY A CA   1  
ATOM 1911  C C    . GLY A 1 125 ? -35.425 -46.497 -0.485  1.00 0.00 ? 203 GLY A C    1  
ATOM 1912  O O    . GLY A 1 125 ? -34.986 -47.626 -0.263  1.00 0.00 ? 203 GLY A O    1  
ATOM 1913  H H    . GLY A 1 125 ? -33.260 -45.303 -1.437  1.00 0.00 ? 203 GLY A H    1  
ATOM 1914  H HA2  . GLY A 1 125 ? -36.123 -45.207 -2.025  1.00 0.00 ? 203 GLY A HA2  1  
ATOM 1915  H HA3  . GLY A 1 125 ? -35.235 -46.610 -2.599  1.00 0.00 ? 203 GLY A HA3  1  
ATOM 1916  N N    . PRO A 1 126 ? -36.062 -45.780 0.453   1.00 0.00 ? 204 PRO A N    1  
ATOM 1917  C CA   . PRO A 1 126 ? -36.288 -46.280 1.813   1.00 0.00 ? 204 PRO A CA   1  
ATOM 1918  C C    . PRO A 1 126 ? -37.304 -47.417 1.851   1.00 0.00 ? 204 PRO A C    1  
ATOM 1919  O O    . PRO A 1 126 ? -37.565 -47.994 2.906   1.00 0.00 ? 204 PRO A O    1  
ATOM 1920  C CB   . PRO A 1 126 ? -36.828 -45.055 2.556   1.00 0.00 ? 204 PRO A CB   1  
ATOM 1921  C CG   . PRO A 1 126 ? -37.440 -44.208 1.494   1.00 0.00 ? 204 PRO A CG   1  
ATOM 1922  C CD   . PRO A 1 126 ? -36.610 -44.428 0.259   1.00 0.00 ? 204 PRO A CD   1  
ATOM 1923  H HA   . PRO A 1 126 ? -35.368 -46.606 2.274   1.00 0.00 ? 204 PRO A HA   1  
ATOM 1924  H HB2  . PRO A 1 126 ? -37.562 -45.368 3.285   1.00 0.00 ? 204 PRO A HB2  1  
ATOM 1925  H HB3  . PRO A 1 126 ? -36.016 -44.544 3.050   1.00 0.00 ? 204 PRO A HB3  1  
ATOM 1926  H HG2  . PRO A 1 126 ? -38.460 -44.515 1.321   1.00 0.00 ? 204 PRO A HG2  1  
ATOM 1927  H HG3  . PRO A 1 126 ? -37.404 -43.169 1.789   1.00 0.00 ? 204 PRO A HG3  1  
ATOM 1928  H HD2  . PRO A 1 126 ? -37.230 -44.386 -0.624  1.00 0.00 ? 204 PRO A HD2  1  
ATOM 1929  H HD3  . PRO A 1 126 ? -35.818 -43.696 0.201   1.00 0.00 ? 204 PRO A HD3  1  
ATOM 1930  N N    . SER A 1 127 ? -37.876 -47.732 0.693   1.00 0.00 ? 205 SER A N    1  
ATOM 1931  C CA   . SER A 1 127 ? -38.866 -48.798 0.595   1.00 0.00 ? 205 SER A CA   1  
ATOM 1932  C C    . SER A 1 127 ? -38.248 -50.148 0.946   1.00 0.00 ? 205 SER A C    1  
ATOM 1933  O O    . SER A 1 127 ? -37.441 -50.689 0.192   1.00 0.00 ? 205 SER A O    1  
ATOM 1934  C CB   . SER A 1 127 ? -39.456 -48.847 -0.816  1.00 0.00 ? 205 SER A CB   1  
ATOM 1935  O OG   . SER A 1 127 ? -40.350 -47.768 -1.033  1.00 0.00 ? 205 SER A OG   1  
ATOM 1936  H H    . SER A 1 127 ? -37.627 -47.235 -0.114  1.00 0.00 ? 205 SER A H    1  
ATOM 1937  H HA   . SER A 1 127 ? -39.656 -48.582 1.299   1.00 0.00 ? 205 SER A HA   1  
ATOM 1938  H HB2  . SER A 1 127 ? -38.658 -48.787 -1.540  1.00 0.00 ? 205 SER A HB2  1  
ATOM 1939  H HB3  . SER A 1 127 ? -39.992 -49.775 -0.947  1.00 0.00 ? 205 SER A HB3  1  
ATOM 1940  H HG   . SER A 1 127 ? -39.853 -46.984 -1.276  1.00 0.00 ? 205 SER A HG   1  
ATOM 1941  N N    . SER A 1 128 ? -38.635 -50.686 2.099   1.00 0.00 ? 206 SER A N    1  
ATOM 1942  C CA   . SER A 1 128 ? -38.117 -51.971 2.554   1.00 0.00 ? 206 SER A CA   1  
ATOM 1943  C C    . SER A 1 128 ? -38.329 -53.048 1.495   1.00 0.00 ? 206 SER A C    1  
ATOM 1944  O O    . SER A 1 128 ? -37.407 -53.787 1.151   1.00 0.00 ? 206 SER A O    1  
ATOM 1945  C CB   . SER A 1 128 ? -38.797 -52.385 3.861   1.00 0.00 ? 206 SER A CB   1  
ATOM 1946  O OG   . SER A 1 128 ? -40.197 -52.515 3.688   1.00 0.00 ? 206 SER A OG   1  
ATOM 1947  H H    . SER A 1 128 ? -39.282 -50.206 2.657   1.00 0.00 ? 206 SER A H    1  
ATOM 1948  H HA   . SER A 1 128 ? -37.058 -51.858 2.729   1.00 0.00 ? 206 SER A HA   1  
ATOM 1949  H HB2  . SER A 1 128 ? -38.396 -53.332 4.188   1.00 0.00 ? 206 SER A HB2  1  
ATOM 1950  H HB3  . SER A 1 128 ? -38.607 -51.634 4.615   1.00 0.00 ? 206 SER A HB3  1  
ATOM 1951  H HG   . SER A 1 128 ? -40.404 -53.411 3.411   1.00 0.00 ? 206 SER A HG   1  
ATOM 1952  N N    . GLY A 1 129 ? -39.552 -53.132 0.980   1.00 0.00 ? 207 GLY A N    1  
ATOM 1953  C CA   . GLY A 1 129 ? -39.864 -54.121 -0.035  1.00 0.00 ? 207 GLY A CA   1  
ATOM 1954  C C    . GLY A 1 129 ? -41.355 -54.364 -0.169  1.00 0.00 ? 207 GLY A C    1  
ATOM 1955  O O    . GLY A 1 129 ? -41.914 -54.248 -1.259  1.00 0.00 ? 207 GLY A O    1  
ATOM 1956  H H    . GLY A 1 129 ? -40.248 -52.516 1.293   1.00 0.00 ? 207 GLY A H    1  
ATOM 1957  H HA2  . GLY A 1 129 ? -39.479 -53.781 -0.984  1.00 0.00 ? 207 GLY A HA2  1  
ATOM 1958  H HA3  . GLY A 1 129 ? -39.382 -55.052 0.226   1.00 0.00 ? 207 GLY A HA3  1  
ATOM 1959  N N    . GLY A 1 1   ? -3.139  -27.864 8.112   1.00 0.00 ? 79  GLY A N    2  
ATOM 1960  C CA   . GLY A 1 1   ? -2.348  -27.579 6.929   1.00 0.00 ? 79  GLY A CA   2  
ATOM 1961  C C    . GLY A 1 1   ? -1.548  -26.298 7.061   1.00 0.00 ? 79  GLY A C    2  
ATOM 1962  O O    . GLY A 1 1   ? -0.577  -26.239 7.815   1.00 0.00 ? 79  GLY A O    2  
ATOM 1963  H H1   . GLY A 1 1   ? -4.096  -27.654 8.121   1.00 0.00 ? 79  GLY A H1   2  
ATOM 1964  H HA2  . GLY A 1 1   ? -1.668  -28.399 6.757   1.00 0.00 ? 79  GLY A HA2  2  
ATOM 1965  H HA3  . GLY A 1 1   ? -3.010  -27.490 6.080   1.00 0.00 ? 79  GLY A HA3  2  
ATOM 1966  N N    . SER A 1 2   ? -1.957  -25.268 6.326   1.00 0.00 ? 80  SER A N    2  
ATOM 1967  C CA   . SER A 1 2   ? -1.268  -23.984 6.360   1.00 0.00 ? 80  SER A CA   2  
ATOM 1968  C C    . SER A 1 2   ? 0.233   -24.177 6.551   1.00 0.00 ? 80  SER A C    2  
ATOM 1969  O O    . SER A 1 2   ? 0.872   -23.450 7.312   1.00 0.00 ? 80  SER A O    2  
ATOM 1970  C CB   . SER A 1 2   ? -1.829  -23.111 7.485   1.00 0.00 ? 80  SER A CB   2  
ATOM 1971  O OG   . SER A 1 2   ? -1.551  -23.675 8.755   1.00 0.00 ? 80  SER A OG   2  
ATOM 1972  H H    . SER A 1 2   ? -2.739  -25.377 5.744   1.00 0.00 ? 80  SER A H    2  
ATOM 1973  H HA   . SER A 1 2   ? -1.439  -23.491 5.415   1.00 0.00 ? 80  SER A HA   2  
ATOM 1974  H HB2  . SER A 1 2   ? -1.380  -22.130 7.434   1.00 0.00 ? 80  SER A HB2  2  
ATOM 1975  H HB3  . SER A 1 2   ? -2.899  -23.023 7.369   1.00 0.00 ? 80  SER A HB3  2  
ATOM 1976  H HG   . SER A 1 2   ? -2.210  -24.342 8.960   1.00 0.00 ? 80  SER A HG   2  
ATOM 1977  N N    . SER A 1 3   ? 0.790   -25.162 5.854   1.00 0.00 ? 81  SER A N    2  
ATOM 1978  C CA   . SER A 1 3   ? 2.215   -25.455 5.948   1.00 0.00 ? 81  SER A CA   2  
ATOM 1979  C C    . SER A 1 3   ? 3.037   -24.169 5.919   1.00 0.00 ? 81  SER A C    2  
ATOM 1980  O O    . SER A 1 3   ? 3.987   -24.009 6.684   1.00 0.00 ? 81  SER A O    2  
ATOM 1981  C CB   . SER A 1 3   ? 2.646   -26.374 4.804   1.00 0.00 ? 81  SER A CB   2  
ATOM 1982  O OG   . SER A 1 3   ? 3.777   -27.146 5.168   1.00 0.00 ? 81  SER A OG   2  
ATOM 1983  H H    . SER A 1 3   ? 0.228   -25.707 5.264   1.00 0.00 ? 81  SER A H    2  
ATOM 1984  H HA   . SER A 1 3   ? 2.389   -25.958 6.888   1.00 0.00 ? 81  SER A HA   2  
ATOM 1985  H HB2  . SER A 1 3   ? 1.834   -27.041 4.557   1.00 0.00 ? 81  SER A HB2  2  
ATOM 1986  H HB3  . SER A 1 3   ? 2.896   -25.776 3.940   1.00 0.00 ? 81  SER A HB3  2  
ATOM 1987  H HG   . SER A 1 3   ? 4.283   -26.677 5.835   1.00 0.00 ? 81  SER A HG   2  
ATOM 1988  N N    . GLY A 1 4   ? 2.662   -23.255 5.030   1.00 0.00 ? 82  GLY A N    2  
ATOM 1989  C CA   . GLY A 1 4   ? 3.374   -21.995 4.917   1.00 0.00 ? 82  GLY A CA   2  
ATOM 1990  C C    . GLY A 1 4   ? 4.165   -21.890 3.628   1.00 0.00 ? 82  GLY A C    2  
ATOM 1991  O O    . GLY A 1 4   ? 3.617   -22.064 2.539   1.00 0.00 ? 82  GLY A O    2  
ATOM 1992  H H    . GLY A 1 4   ? 1.896   -23.437 4.446   1.00 0.00 ? 82  GLY A H    2  
ATOM 1993  H HA2  . GLY A 1 4   ? 2.660   -21.186 4.956   1.00 0.00 ? 82  GLY A HA2  2  
ATOM 1994  H HA3  . GLY A 1 4   ? 4.053   -21.902 5.751   1.00 0.00 ? 82  GLY A HA3  2  
ATOM 1995  N N    . SER A 1 5   ? 5.457   -21.603 3.750   1.00 0.00 ? 83  SER A N    2  
ATOM 1996  C CA   . SER A 1 5   ? 6.323   -21.469 2.585   1.00 0.00 ? 83  SER A CA   2  
ATOM 1997  C C    . SER A 1 5   ? 7.622   -22.244 2.783   1.00 0.00 ? 83  SER A C    2  
ATOM 1998  O O    . SER A 1 5   ? 8.466   -21.867 3.596   1.00 0.00 ? 83  SER A O    2  
ATOM 1999  C CB   . SER A 1 5   ? 6.632   -19.994 2.320   1.00 0.00 ? 83  SER A CB   2  
ATOM 2000  O OG   . SER A 1 5   ? 5.622   -19.397 1.525   1.00 0.00 ? 83  SER A OG   2  
ATOM 2001  H H    . SER A 1 5   ? 5.835   -21.475 4.645   1.00 0.00 ? 83  SER A H    2  
ATOM 2002  H HA   . SER A 1 5   ? 5.800   -21.877 1.734   1.00 0.00 ? 83  SER A HA   2  
ATOM 2003  H HB2  . SER A 1 5   ? 6.693   -19.467 3.259   1.00 0.00 ? 83  SER A HB2  2  
ATOM 2004  H HB3  . SER A 1 5   ? 7.576   -19.915 1.801   1.00 0.00 ? 83  SER A HB3  2  
ATOM 2005  H HG   . SER A 1 5   ? 5.058   -18.852 2.079   1.00 0.00 ? 83  SER A HG   2  
ATOM 2006  N N    . SER A 1 6   ? 7.775   -23.331 2.032   1.00 0.00 ? 84  SER A N    2  
ATOM 2007  C CA   . SER A 1 6   ? 8.969   -24.163 2.126   1.00 0.00 ? 84  SER A CA   2  
ATOM 2008  C C    . SER A 1 6   ? 9.889   -23.930 0.932   1.00 0.00 ? 84  SER A C    2  
ATOM 2009  O O    . SER A 1 6   ? 9.658   -24.455 -0.156  1.00 0.00 ? 84  SER A O    2  
ATOM 2010  C CB   . SER A 1 6   ? 8.581   -25.641 2.206   1.00 0.00 ? 84  SER A CB   2  
ATOM 2011  O OG   . SER A 1 6   ? 9.544   -26.382 2.934   1.00 0.00 ? 84  SER A OG   2  
ATOM 2012  H H    . SER A 1 6   ? 7.067   -23.580 1.402   1.00 0.00 ? 84  SER A H    2  
ATOM 2013  H HA   . SER A 1 6   ? 9.494   -23.888 3.029   1.00 0.00 ? 84  SER A HA   2  
ATOM 2014  H HB2  . SER A 1 6   ? 7.625   -25.733 2.698   1.00 0.00 ? 84  SER A HB2  2  
ATOM 2015  H HB3  . SER A 1 6   ? 8.513   -26.046 1.206   1.00 0.00 ? 84  SER A HB3  2  
ATOM 2016  H HG   . SER A 1 6   ? 9.324   -26.362 3.868   1.00 0.00 ? 84  SER A HG   2  
ATOM 2017  N N    . GLY A 1 7   ? 10.936  -23.137 1.144   1.00 0.00 ? 85  GLY A N    2  
ATOM 2018  C CA   . GLY A 1 7   ? 11.875  -22.848 0.077   1.00 0.00 ? 85  GLY A CA   2  
ATOM 2019  C C    . GLY A 1 7   ? 13.258  -22.509 0.598   1.00 0.00 ? 85  GLY A C    2  
ATOM 2020  O O    . GLY A 1 7   ? 13.933  -23.357 1.182   1.00 0.00 ? 85  GLY A O    2  
ATOM 2021  H H    . GLY A 1 7   ? 11.070  -22.746 2.033   1.00 0.00 ? 85  GLY A H    2  
ATOM 2022  H HA2  . GLY A 1 7   ? 11.947  -23.710 -0.569  1.00 0.00 ? 85  GLY A HA2  2  
ATOM 2023  H HA3  . GLY A 1 7   ? 11.505  -22.011 -0.496  1.00 0.00 ? 85  GLY A HA3  2  
ATOM 2024  N N    . ARG A 1 8   ? 13.681  -21.268 0.386   1.00 0.00 ? 86  ARG A N    2  
ATOM 2025  C CA   . ARG A 1 8   ? 14.994  -20.820 0.836   1.00 0.00 ? 86  ARG A CA   2  
ATOM 2026  C C    . ARG A 1 8   ? 14.955  -20.414 2.307   1.00 0.00 ? 86  ARG A C    2  
ATOM 2027  O O    . ARG A 1 8   ? 13.893  -20.107 2.850   1.00 0.00 ? 86  ARG A O    2  
ATOM 2028  C CB   . ARG A 1 8   ? 15.475  -19.645 -0.016  1.00 0.00 ? 86  ARG A CB   2  
ATOM 2029  C CG   . ARG A 1 8   ? 15.890  -20.042 -1.423  1.00 0.00 ? 86  ARG A CG   2  
ATOM 2030  C CD   . ARG A 1 8   ? 14.706  -20.028 -2.378  1.00 0.00 ? 86  ARG A CD   2  
ATOM 2031  N NE   . ARG A 1 8   ? 15.004  -20.718 -3.630  1.00 0.00 ? 86  ARG A NE   2  
ATOM 2032  C CZ   . ARG A 1 8   ? 14.174  -20.752 -4.666  1.00 0.00 ? 86  ARG A CZ   2  
ATOM 2033  N NH1  . ARG A 1 8   ? 13.001  -20.137 -4.600  1.00 0.00 ? 86  ARG A NH1  2  
ATOM 2034  N NH2  . ARG A 1 8   ? 14.516  -21.401 -5.771  1.00 0.00 ? 86  ARG A NH2  2  
ATOM 2035  H H    . ARG A 1 8   ? 13.097  -20.637 -0.085  1.00 0.00 ? 86  ARG A H    2  
ATOM 2036  H HA   . ARG A 1 8   ? 15.683  -21.643 0.721   1.00 0.00 ? 86  ARG A HA   2  
ATOM 2037  H HB2  . ARG A 1 8   ? 14.679  -18.919 -0.091  1.00 0.00 ? 86  ARG A HB2  2  
ATOM 2038  H HB3  . ARG A 1 8   ? 16.324  -19.187 0.470   1.00 0.00 ? 86  ARG A HB3  2  
ATOM 2039  H HG2  . ARG A 1 8   ? 16.634  -19.345 -1.780  1.00 0.00 ? 86  ARG A HG2  2  
ATOM 2040  H HG3  . ARG A 1 8   ? 16.309  -21.037 -1.397  1.00 0.00 ? 86  ARG A HG3  2  
ATOM 2041  H HD2  . ARG A 1 8   ? 13.869  -20.515 -1.900  1.00 0.00 ? 86  ARG A HD2  2  
ATOM 2042  H HD3  . ARG A 1 8   ? 14.449  -19.002 -2.595  1.00 0.00 ? 86  ARG A HD3  2  
ATOM 2043  H HE   . ARG A 1 8   ? 15.865  -21.179 -3.700  1.00 0.00 ? 86  ARG A HE   2  
ATOM 2044  H HH11 . ARG A 1 8   ? 12.740  -19.646 -3.769  1.00 0.00 ? 86  ARG A HH11 2  
ATOM 2045  H HH12 . ARG A 1 8   ? 12.378  -20.163 -5.383  1.00 0.00 ? 86  ARG A HH12 2  
ATOM 2046  H HH21 . ARG A 1 8   ? 15.400  -21.865 -5.825  1.00 0.00 ? 86  ARG A HH21 2  
ATOM 2047  H HH22 . ARG A 1 8   ? 13.891  -21.426 -6.551  1.00 0.00 ? 86  ARG A HH22 2  
ATOM 2048  N N    . LYS A 1 9   ? 16.119  -20.415 2.946   1.00 0.00 ? 87  LYS A N    2  
ATOM 2049  C CA   . LYS A 1 9   ? 16.220  -20.046 4.353   1.00 0.00 ? 87  LYS A CA   2  
ATOM 2050  C C    . LYS A 1 9   ? 16.163  -18.531 4.524   1.00 0.00 ? 87  LYS A C    2  
ATOM 2051  O O    . LYS A 1 9   ? 15.463  -18.023 5.399   1.00 0.00 ? 87  LYS A O    2  
ATOM 2052  C CB   . LYS A 1 9   ? 17.520  -20.589 4.952   1.00 0.00 ? 87  LYS A CB   2  
ATOM 2053  C CG   . LYS A 1 9   ? 18.771  -20.034 4.293   1.00 0.00 ? 87  LYS A CG   2  
ATOM 2054  C CD   . LYS A 1 9   ? 20.021  -20.750 4.779   1.00 0.00 ? 87  LYS A CD   2  
ATOM 2055  C CE   . LYS A 1 9   ? 21.251  -20.317 3.995   1.00 0.00 ? 87  LYS A CE   2  
ATOM 2056  N NZ   . LYS A 1 9   ? 21.873  -19.093 4.571   1.00 0.00 ? 87  LYS A NZ   2  
ATOM 2057  H H    . LYS A 1 9   ? 16.932  -20.669 2.459   1.00 0.00 ? 87  LYS A H    2  
ATOM 2058  H HA   . LYS A 1 9   ? 15.383  -20.487 4.873   1.00 0.00 ? 87  LYS A HA   2  
ATOM 2059  H HB2  . LYS A 1 9   ? 17.550  -20.339 6.002   1.00 0.00 ? 87  LYS A HB2  2  
ATOM 2060  H HB3  . LYS A 1 9   ? 17.529  -21.664 4.846   1.00 0.00 ? 87  LYS A HB3  2  
ATOM 2061  H HG2  . LYS A 1 9   ? 18.690  -20.160 3.224   1.00 0.00 ? 87  LYS A HG2  2  
ATOM 2062  H HG3  . LYS A 1 9   ? 18.855  -18.983 4.529   1.00 0.00 ? 87  LYS A HG3  2  
ATOM 2063  H HD2  . LYS A 1 9   ? 20.174  -20.520 5.823   1.00 0.00 ? 87  LYS A HD2  2  
ATOM 2064  H HD3  . LYS A 1 9   ? 19.884  -21.815 4.659   1.00 0.00 ? 87  LYS A HD3  2  
ATOM 2065  H HE2  . LYS A 1 9   ? 21.972  -21.120 4.012   1.00 0.00 ? 87  LYS A HE2  2  
ATOM 2066  H HE3  . LYS A 1 9   ? 20.959  -20.117 2.975   1.00 0.00 ? 87  LYS A HE3  2  
ATOM 2067  H HZ1  . LYS A 1 9   ? 21.174  -18.569 5.135   1.00 0.00 ? 87  LYS A HZ1  2  
ATOM 2068  H HZ2  . LYS A 1 9   ? 22.220  -18.477 3.809   1.00 0.00 ? 87  LYS A HZ2  2  
ATOM 2069  H HZ3  . LYS A 1 9   ? 22.672  -19.353 5.184   1.00 0.00 ? 87  LYS A HZ3  2  
ATOM 2070  N N    . GLU A 1 10  ? 16.903  -17.817 3.682   1.00 0.00 ? 88  GLU A N    2  
ATOM 2071  C CA   . GLU A 1 10  ? 16.935  -16.360 3.741   1.00 0.00 ? 88  GLU A CA   2  
ATOM 2072  C C    . GLU A 1 10  ? 15.532  -15.779 3.590   1.00 0.00 ? 88  GLU A C    2  
ATOM 2073  O O    . GLU A 1 10  ? 15.113  -14.929 4.376   1.00 0.00 ? 88  GLU A O    2  
ATOM 2074  C CB   . GLU A 1 10  ? 17.850  -15.803 2.649   1.00 0.00 ? 88  GLU A CB   2  
ATOM 2075  C CG   . GLU A 1 10  ? 17.406  -16.163 1.241   1.00 0.00 ? 88  GLU A CG   2  
ATOM 2076  C CD   . GLU A 1 10  ? 18.493  -15.932 0.209   1.00 0.00 ? 88  GLU A CD   2  
ATOM 2077  O OE1  . GLU A 1 10  ? 19.522  -16.638 0.266   1.00 0.00 ? 88  GLU A OE1  2  
ATOM 2078  O OE2  . GLU A 1 10  ? 18.315  -15.048 -0.654  1.00 0.00 ? 88  GLU A OE2  2  
ATOM 2079  H H    . GLU A 1 10  ? 17.441  -18.280 3.006   1.00 0.00 ? 88  GLU A H    2  
ATOM 2080  H HA   . GLU A 1 10  ? 17.328  -16.076 4.706   1.00 0.00 ? 88  GLU A HA   2  
ATOM 2081  H HB2  . GLU A 1 10  ? 17.877  -14.727 2.732   1.00 0.00 ? 88  GLU A HB2  2  
ATOM 2082  H HB3  . GLU A 1 10  ? 18.847  -16.191 2.799   1.00 0.00 ? 88  GLU A HB3  2  
ATOM 2083  H HG2  . GLU A 1 10  ? 17.127  -17.205 1.220   1.00 0.00 ? 88  GLU A HG2  2  
ATOM 2084  H HG3  . GLU A 1 10  ? 16.550  -15.557 0.981   1.00 0.00 ? 88  GLU A HG3  2  
ATOM 2085  N N    . ASP A 1 11  ? 14.813  -16.242 2.574   1.00 0.00 ? 89  ASP A N    2  
ATOM 2086  C CA   . ASP A 1 11  ? 13.457  -15.769 2.320   1.00 0.00 ? 89  ASP A CA   2  
ATOM 2087  C C    . ASP A 1 11  ? 12.722  -15.495 3.628   1.00 0.00 ? 89  ASP A C    2  
ATOM 2088  O O    . ASP A 1 11  ? 12.104  -14.444 3.796   1.00 0.00 ? 89  ASP A O    2  
ATOM 2089  C CB   . ASP A 1 11  ? 12.683  -16.796 1.491   1.00 0.00 ? 89  ASP A CB   2  
ATOM 2090  C CG   . ASP A 1 11  ? 12.857  -16.586 0.000   1.00 0.00 ? 89  ASP A CG   2  
ATOM 2091  O OD1  . ASP A 1 11  ? 14.006  -16.371 -0.439  1.00 0.00 ? 89  ASP A OD1  2  
ATOM 2092  O OD2  . ASP A 1 11  ? 11.844  -16.638 -0.729  1.00 0.00 ? 89  ASP A OD2  2  
ATOM 2093  H H    . ASP A 1 11  ? 15.202  -16.919 1.982   1.00 0.00 ? 89  ASP A H    2  
ATOM 2094  H HA   . ASP A 1 11  ? 13.526  -14.848 1.761   1.00 0.00 ? 89  ASP A HA   2  
ATOM 2095  H HB2  . ASP A 1 11  ? 13.034  -17.787 1.739   1.00 0.00 ? 89  ASP A HB2  2  
ATOM 2096  H HB3  . ASP A 1 11  ? 11.632  -16.721 1.727   1.00 0.00 ? 89  ASP A HB3  2  
ATOM 2097  N N    . HIS A 1 12  ? 12.793  -16.449 4.552   1.00 0.00 ? 90  HIS A N    2  
ATOM 2098  C CA   . HIS A 1 12  ? 12.134  -16.310 5.845   1.00 0.00 ? 90  HIS A CA   2  
ATOM 2099  C C    . HIS A 1 12  ? 12.712  -15.135 6.627   1.00 0.00 ? 90  HIS A C    2  
ATOM 2100  O O    . HIS A 1 12  ? 11.978  -14.370 7.252   1.00 0.00 ? 90  HIS A O    2  
ATOM 2101  C CB   . HIS A 1 12  ? 12.279  -17.598 6.656   1.00 0.00 ? 90  HIS A CB   2  
ATOM 2102  C CG   . HIS A 1 12  ? 11.139  -17.847 7.595   1.00 0.00 ? 90  HIS A CG   2  
ATOM 2103  N ND1  . HIS A 1 12  ? 11.267  -18.578 8.757   1.00 0.00 ? 90  HIS A ND1  2  
ATOM 2104  C CD2  . HIS A 1 12  ? 9.845   -17.456 7.539   1.00 0.00 ? 90  HIS A CD2  2  
ATOM 2105  C CE1  . HIS A 1 12  ? 10.101  -18.627 9.375   1.00 0.00 ? 90  HIS A CE1  2  
ATOM 2106  N NE2  . HIS A 1 12  ? 9.220   -17.954 8.656   1.00 0.00 ? 90  HIS A NE2  2  
ATOM 2107  H H    . HIS A 1 12  ? 13.300  -17.264 4.359   1.00 0.00 ? 90  HIS A H    2  
ATOM 2108  H HA   . HIS A 1 12  ? 11.085  -16.125 5.665   1.00 0.00 ? 90  HIS A HA   2  
ATOM 2109  H HB2  . HIS A 1 12  ? 12.340  -18.437 5.979   1.00 0.00 ? 90  HIS A HB2  2  
ATOM 2110  H HB3  . HIS A 1 12  ? 13.187  -17.547 7.241   1.00 0.00 ? 90  HIS A HB3  2  
ATOM 2111  H HD2  . HIS A 1 12  ? 9.387   -16.863 6.760   1.00 0.00 ? 90  HIS A HD2  2  
ATOM 2112  H HE1  . HIS A 1 12  ? 9.900   -19.132 10.308  1.00 0.00 ? 90  HIS A HE1  2  
ATOM 2113  H HE2  . HIS A 1 12  ? 8.260   -17.904 8.843   1.00 0.00 ? 90  HIS A HE2  2  
ATOM 2114  N N    . ALA A 1 13  ? 14.034  -14.998 6.588   1.00 0.00 ? 91  ALA A N    2  
ATOM 2115  C CA   . ALA A 1 13  ? 14.711  -13.915 7.291   1.00 0.00 ? 91  ALA A CA   2  
ATOM 2116  C C    . ALA A 1 13  ? 14.330  -12.559 6.708   1.00 0.00 ? 91  ALA A C    2  
ATOM 2117  O O    . ALA A 1 13  ? 14.000  -11.627 7.442   1.00 0.00 ? 91  ALA A O    2  
ATOM 2118  C CB   . ALA A 1 13  ? 16.218  -14.111 7.235   1.00 0.00 ? 91  ALA A CB   2  
ATOM 2119  H H    . ALA A 1 13  ? 14.566  -15.639 6.072   1.00 0.00 ? 91  ALA A H    2  
ATOM 2120  H HA   . ALA A 1 13  ? 14.406  -13.948 8.327   1.00 0.00 ? 91  ALA A HA   2  
ATOM 2121  H HB1  . ALA A 1 13  ? 16.536  -14.166 6.204   1.00 0.00 ? 91  ALA A HB1  2  
ATOM 2122  H HB2  . ALA A 1 13  ? 16.708  -13.279 7.719   1.00 0.00 ? 91  ALA A HB2  2  
ATOM 2123  H HB3  . ALA A 1 13  ? 16.481  -15.028 7.742   1.00 0.00 ? 91  ALA A HB3  2  
ATOM 2124  N N    . ARG A 1 14  ? 14.378  -12.455 5.384   1.00 0.00 ? 92  ARG A N    2  
ATOM 2125  C CA   . ARG A 1 14  ? 14.040  -11.211 4.702   1.00 0.00 ? 92  ARG A CA   2  
ATOM 2126  C C    . ARG A 1 14  ? 12.546  -10.922 4.808   1.00 0.00 ? 92  ARG A C    2  
ATOM 2127  O O    . ARG A 1 14  ? 12.131  -9.766  4.898   1.00 0.00 ? 92  ARG A O    2  
ATOM 2128  C CB   . ARG A 1 14  ? 14.454  -11.282 3.231   1.00 0.00 ? 92  ARG A CB   2  
ATOM 2129  C CG   . ARG A 1 14  ? 14.908  -9.948  2.661   1.00 0.00 ? 92  ARG A CG   2  
ATOM 2130  C CD   . ARG A 1 14  ? 16.411  -9.764  2.800   1.00 0.00 ? 92  ARG A CD   2  
ATOM 2131  N NE   . ARG A 1 14  ? 16.778  -8.361  2.967   1.00 0.00 ? 92  ARG A NE   2  
ATOM 2132  C CZ   . ARG A 1 14  ? 16.796  -7.740  4.141   1.00 0.00 ? 92  ARG A CZ   2  
ATOM 2133  N NH1  . ARG A 1 14  ? 16.469  -8.395  5.246   1.00 0.00 ? 92  ARG A NH1  2  
ATOM 2134  N NH2  . ARG A 1 14  ? 17.141  -6.461  4.212   1.00 0.00 ? 92  ARG A NH2  2  
ATOM 2135  H H    . ARG A 1 14  ? 14.649  -13.232 4.852   1.00 0.00 ? 92  ARG A H    2  
ATOM 2136  H HA   . ARG A 1 14  ? 14.584  -10.411 5.182   1.00 0.00 ? 92  ARG A HA   2  
ATOM 2137  H HB2  . ARG A 1 14  ? 15.267  -11.986 3.131   1.00 0.00 ? 92  ARG A HB2  2  
ATOM 2138  H HB3  . ARG A 1 14  ? 13.614  -11.630 2.650   1.00 0.00 ? 92  ARG A HB3  2  
ATOM 2139  H HG2  . ARG A 1 14  ? 14.647  -9.907  1.614   1.00 0.00 ? 92  ARG A HG2  2  
ATOM 2140  H HG3  . ARG A 1 14  ? 14.406  -9.151  3.191   1.00 0.00 ? 92  ARG A HG3  2  
ATOM 2141  H HD2  . ARG A 1 14  ? 16.749  -10.320 3.663   1.00 0.00 ? 92  ARG A HD2  2  
ATOM 2142  H HD3  . ARG A 1 14  ? 16.890  -10.150 1.913   1.00 0.00 ? 92  ARG A HD3  2  
ATOM 2143  H HE   . ARG A 1 14  ? 17.023  -7.857  2.163   1.00 0.00 ? 92  ARG A HE   2  
ATOM 2144  H HH11 . ARG A 1 14  ? 16.209  -9.360  5.196   1.00 0.00 ? 92  ARG A HH11 2  
ATOM 2145  H HH12 . ARG A 1 14  ? 16.484  -7.926  6.130   1.00 0.00 ? 92  ARG A HH12 2  
ATOM 2146  H HH21 . ARG A 1 14  ? 17.388  -5.963  3.381   1.00 0.00 ? 92  ARG A HH21 2  
ATOM 2147  H HH22 . ARG A 1 14  ? 17.154  -5.994  5.095   1.00 0.00 ? 92  ARG A HH22 2  
ATOM 2148  N N    . LEU A 1 15  ? 11.742  -11.979 4.796   1.00 0.00 ? 93  LEU A N    2  
ATOM 2149  C CA   . LEU A 1 15  ? 10.293  -11.840 4.890   1.00 0.00 ? 93  LEU A CA   2  
ATOM 2150  C C    . LEU A 1 15  ? 9.886   -11.291 6.254   1.00 0.00 ? 93  LEU A C    2  
ATOM 2151  O O    . LEU A 1 15  ? 9.049   -10.393 6.348   1.00 0.00 ? 93  LEU A O    2  
ATOM 2152  C CB   . LEU A 1 15  ? 9.614   -13.190 4.648   1.00 0.00 ? 93  LEU A CB   2  
ATOM 2153  C CG   . LEU A 1 15  ? 9.471   -13.616 3.187   1.00 0.00 ? 93  LEU A CG   2  
ATOM 2154  C CD1  . LEU A 1 15  ? 9.250   -15.117 3.088   1.00 0.00 ? 93  LEU A CD1  2  
ATOM 2155  C CD2  . LEU A 1 15  ? 8.329   -12.862 2.521   1.00 0.00 ? 93  LEU A CD2  2  
ATOM 2156  H H    . LEU A 1 15  ? 12.131  -12.876 4.722   1.00 0.00 ? 93  LEU A H    2  
ATOM 2157  H HA   . LEU A 1 15  ? 9.977   -11.145 4.127   1.00 0.00 ? 93  LEU A HA   2  
ATOM 2158  H HB2  . LEU A 1 15  ? 10.191  -13.946 5.158   1.00 0.00 ? 93  LEU A HB2  2  
ATOM 2159  H HB3  . LEU A 1 15  ? 8.624   -13.143 5.079   1.00 0.00 ? 93  LEU A HB3  2  
ATOM 2160  H HG   . LEU A 1 15  ? 10.383  -13.378 2.657   1.00 0.00 ? 93  LEU A HG   2  
ATOM 2161  H HD11 . LEU A 1 15  ? 9.262   -15.549 4.077   1.00 0.00 ? 93  LEU A HD11 2  
ATOM 2162  H HD12 . LEU A 1 15  ? 10.035  -15.558 2.493   1.00 0.00 ? 93  LEU A HD12 2  
ATOM 2163  H HD13 . LEU A 1 15  ? 8.294   -15.311 2.622   1.00 0.00 ? 93  LEU A HD13 2  
ATOM 2164  H HD21 . LEU A 1 15  ? 7.649   -12.498 3.277   1.00 0.00 ? 93  LEU A HD21 2  
ATOM 2165  H HD22 . LEU A 1 15  ? 7.800   -13.526 1.852   1.00 0.00 ? 93  LEU A HD22 2  
ATOM 2166  H HD23 . LEU A 1 15  ? 8.726   -12.028 1.961   1.00 0.00 ? 93  LEU A HD23 2  
ATOM 2167  N N    . ARG A 1 16  ? 10.485  -11.835 7.308   1.00 0.00 ? 94  ARG A N    2  
ATOM 2168  C CA   . ARG A 1 16  ? 10.186  -11.399 8.666   1.00 0.00 ? 94  ARG A CA   2  
ATOM 2169  C C    . ARG A 1 16  ? 10.711  -9.987  8.912   1.00 0.00 ? 94  ARG A C    2  
ATOM 2170  O O    . ARG A 1 16  ? 10.017  -9.147  9.485   1.00 0.00 ? 94  ARG A O    2  
ATOM 2171  C CB   . ARG A 1 16  ? 10.798  -12.366 9.682   1.00 0.00 ? 94  ARG A CB   2  
ATOM 2172  C CG   . ARG A 1 16  ? 10.310  -12.145 11.104  1.00 0.00 ? 94  ARG A CG   2  
ATOM 2173  C CD   . ARG A 1 16  ? 11.057  -11.005 11.779  1.00 0.00 ? 94  ARG A CD   2  
ATOM 2174  N NE   . ARG A 1 16  ? 11.155  -11.195 13.224  1.00 0.00 ? 94  ARG A NE   2  
ATOM 2175  C CZ   . ARG A 1 16  ? 11.491  -10.228 14.070  1.00 0.00 ? 94  ARG A CZ   2  
ATOM 2176  N NH1  . ARG A 1 16  ? 11.760  -9.011  13.619  1.00 0.00 ? 94  ARG A NH1  2  
ATOM 2177  N NH2  . ARG A 1 16  ? 11.559  -10.478 15.372  1.00 0.00 ? 94  ARG A NH2  2  
ATOM 2178  H H    . ARG A 1 16  ? 11.144  -12.547 7.169   1.00 0.00 ? 94  ARG A H    2  
ATOM 2179  H HA   . ARG A 1 16  ? 9.113   -11.397 8.786   1.00 0.00 ? 94  ARG A HA   2  
ATOM 2180  H HB2  . ARG A 1 16  ? 10.551  -13.377 9.393   1.00 0.00 ? 94  ARG A HB2  2  
ATOM 2181  H HB3  . ARG A 1 16  ? 11.871  -12.249 9.670   1.00 0.00 ? 94  ARG A HB3  2  
ATOM 2182  H HG2  . ARG A 1 16  ? 9.257   -11.906 11.080  1.00 0.00 ? 94  ARG A HG2  2  
ATOM 2183  H HG3  . ARG A 1 16  ? 10.463  -13.051 11.672  1.00 0.00 ? 94  ARG A HG3  2  
ATOM 2184  H HD2  . ARG A 1 16  ? 12.053  -10.950 11.365  1.00 0.00 ? 94  ARG A HD2  2  
ATOM 2185  H HD3  . ARG A 1 16  ? 10.534  -10.082 11.580  1.00 0.00 ? 94  ARG A HD3  2  
ATOM 2186  H HE   . ARG A 1 16  ? 10.960  -12.087 13.579  1.00 0.00 ? 94  ARG A HE   2  
ATOM 2187  H HH11 . ARG A 1 16  ? 11.709  -8.819  12.639  1.00 0.00 ? 94  ARG A HH11 2  
ATOM 2188  H HH12 . ARG A 1 16  ? 12.012  -8.284  14.259  1.00 0.00 ? 94  ARG A HH12 2  
ATOM 2189  H HH21 . ARG A 1 16  ? 11.356  -11.394 15.716  1.00 0.00 ? 94  ARG A HH21 2  
ATOM 2190  H HH22 . ARG A 1 16  ? 11.812  -9.750  16.008  1.00 0.00 ? 94  ARG A HH22 2  
ATOM 2191  N N    . ALA A 1 17  ? 11.940  -9.734  8.475   1.00 0.00 ? 95  ALA A N    2  
ATOM 2192  C CA   . ALA A 1 17  ? 12.557  -8.425  8.647   1.00 0.00 ? 95  ALA A CA   2  
ATOM 2193  C C    . ALA A 1 17  ? 11.819  -7.361  7.841   1.00 0.00 ? 95  ALA A C    2  
ATOM 2194  O O    . ALA A 1 17  ? 11.567  -6.259  8.332   1.00 0.00 ? 95  ALA A O    2  
ATOM 2195  C CB   . ALA A 1 17  ? 14.023  -8.475  8.240   1.00 0.00 ? 95  ALA A CB   2  
ATOM 2196  H H    . ALA A 1 17  ? 12.444  -10.445 8.026   1.00 0.00 ? 95  ALA A H    2  
ATOM 2197  H HA   . ALA A 1 17  ? 12.508  -8.167  9.695   1.00 0.00 ? 95  ALA A HA   2  
ATOM 2198  H HB1  . ALA A 1 17  ? 14.638  -8.561  9.125   1.00 0.00 ? 95  ALA A HB1  2  
ATOM 2199  H HB2  . ALA A 1 17  ? 14.190  -9.328  7.600   1.00 0.00 ? 95  ALA A HB2  2  
ATOM 2200  H HB3  . ALA A 1 17  ? 14.280  -7.570  7.710   1.00 0.00 ? 95  ALA A HB3  2  
ATOM 2201  N N    . LEU A 1 18  ? 11.475  -7.695  6.603   1.00 0.00 ? 96  LEU A N    2  
ATOM 2202  C CA   . LEU A 1 18  ? 10.766  -6.768  5.728   1.00 0.00 ? 96  LEU A CA   2  
ATOM 2203  C C    . LEU A 1 18  ? 9.339   -6.541  6.218   1.00 0.00 ? 96  LEU A C    2  
ATOM 2204  O O    . LEU A 1 18  ? 8.865   -5.407  6.275   1.00 0.00 ? 96  LEU A O    2  
ATOM 2205  C CB   . LEU A 1 18  ? 10.746  -7.301  4.295   1.00 0.00 ? 96  LEU A CB   2  
ATOM 2206  C CG   . LEU A 1 18  ? 10.481  -6.269  3.198   1.00 0.00 ? 96  LEU A CG   2  
ATOM 2207  C CD1  . LEU A 1 18  ? 10.779  -6.857  1.828   1.00 0.00 ? 96  LEU A CD1  2  
ATOM 2208  C CD2  . LEU A 1 18  ? 9.043   -5.776  3.268   1.00 0.00 ? 96  LEU A CD2  2  
ATOM 2209  H H    . LEU A 1 18  ? 11.703  -8.587  6.267   1.00 0.00 ? 96  LEU A H    2  
ATOM 2210  H HA   . LEU A 1 18  ? 11.294  -5.826  5.746   1.00 0.00 ? 96  LEU A HA   2  
ATOM 2211  H HB2  . LEU A 1 18  ? 11.706  -7.753  4.097   1.00 0.00 ? 96  LEU A HB2  2  
ATOM 2212  H HB3  . LEU A 1 18  ? 9.975   -8.056  4.234   1.00 0.00 ? 96  LEU A HB3  2  
ATOM 2213  H HG   . LEU A 1 18  ? 11.134  -5.420  3.346   1.00 0.00 ? 96  LEU A HG   2  
ATOM 2214  H HD11 . LEU A 1 18  ? 9.893   -6.804  1.213   1.00 0.00 ? 96  LEU A HD11 2  
ATOM 2215  H HD12 . LEU A 1 18  ? 11.081  -7.888  1.937   1.00 0.00 ? 96  LEU A HD12 2  
ATOM 2216  H HD13 . LEU A 1 18  ? 11.576  -6.297  1.362   1.00 0.00 ? 96  LEU A HD13 2  
ATOM 2217  H HD21 . LEU A 1 18  ? 8.793   -5.265  2.349   1.00 0.00 ? 96  LEU A HD21 2  
ATOM 2218  H HD22 . LEU A 1 18  ? 8.936   -5.093  4.099   1.00 0.00 ? 96  LEU A HD22 2  
ATOM 2219  H HD23 . LEU A 1 18  ? 8.380   -6.617  3.404   1.00 0.00 ? 96  LEU A HD23 2  
ATOM 2220  N N    . ASN A 1 19  ? 8.661   -7.627  6.573   1.00 0.00 ? 97  ASN A N    2  
ATOM 2221  C CA   . ASN A 1 19  ? 7.289   -7.546  7.060   1.00 0.00 ? 97  ASN A CA   2  
ATOM 2222  C C    . ASN A 1 19  ? 7.226   -6.802  8.390   1.00 0.00 ? 97  ASN A C    2  
ATOM 2223  O O    . ASN A 1 19  ? 6.402   -5.907  8.575   1.00 0.00 ? 97  ASN A O    2  
ATOM 2224  C CB   . ASN A 1 19  ? 6.698   -8.949  7.219   1.00 0.00 ? 97  ASN A CB   2  
ATOM 2225  C CG   . ASN A 1 19  ? 5.489   -8.967  8.134   1.00 0.00 ? 97  ASN A CG   2  
ATOM 2226  O OD1  . ASN A 1 19  ? 4.392   -8.571  7.740   1.00 0.00 ? 97  ASN A OD1  2  
ATOM 2227  N ND2  . ASN A 1 19  ? 5.685   -9.428  9.364   1.00 0.00 ? 97  ASN A ND2  2  
ATOM 2228  H H    . ASN A 1 19  ? 9.093   -8.504  6.505   1.00 0.00 ? 97  ASN A H    2  
ATOM 2229  H HA   . ASN A 1 19  ? 6.709   -7.003  6.329   1.00 0.00 ? 97  ASN A HA   2  
ATOM 2230  H HB2  . ASN A 1 19  ? 6.397   -9.319  6.250   1.00 0.00 ? 97  ASN A HB2  2  
ATOM 2231  H HB3  . ASN A 1 19  ? 7.450   -9.605  7.632   1.00 0.00 ? 97  ASN A HB3  2  
ATOM 2232  H HD21 . ASN A 1 19  ? 6.586   -9.727  9.609   1.00 0.00 ? 97  ASN A HD21 2  
ATOM 2233  H HD22 . ASN A 1 19  ? 4.920   -9.451  9.976   1.00 0.00 ? 97  ASN A HD22 2  
ATOM 2234  N N    . GLY A 1 20  ? 8.105   -7.179  9.314   1.00 0.00 ? 98  GLY A N    2  
ATOM 2235  C CA   . GLY A 1 20  ? 8.133   -6.537  10.616  1.00 0.00 ? 98  GLY A CA   2  
ATOM 2236  C C    . GLY A 1 20  ? 8.560   -5.084  10.536  1.00 0.00 ? 98  GLY A C    2  
ATOM 2237  O O    . GLY A 1 20  ? 8.049   -4.238  11.271  1.00 0.00 ? 98  GLY A O    2  
ATOM 2238  H H    . GLY A 1 20  ? 8.738   -7.898  9.111   1.00 0.00 ? 98  GLY A H    2  
ATOM 2239  H HA2  . GLY A 1 20  ? 7.147   -6.588  11.052  1.00 0.00 ? 98  GLY A HA2  2  
ATOM 2240  H HA3  . GLY A 1 20  ? 8.825   -7.069  11.252  1.00 0.00 ? 98  GLY A HA3  2  
ATOM 2241  N N    . LEU A 1 21  ? 9.501   -4.794  9.644   1.00 0.00 ? 99  LEU A N    2  
ATOM 2242  C CA   . LEU A 1 21  ? 9.999   -3.433  9.472   1.00 0.00 ? 99  LEU A CA   2  
ATOM 2243  C C    . LEU A 1 21  ? 8.893   -2.508  8.975   1.00 0.00 ? 99  LEU A C    2  
ATOM 2244  O O    . LEU A 1 21  ? 8.682   -1.425  9.523   1.00 0.00 ? 99  LEU A O    2  
ATOM 2245  C CB   . LEU A 1 21  ? 11.172  -3.418  8.491   1.00 0.00 ? 99  LEU A CB   2  
ATOM 2246  C CG   . LEU A 1 21  ? 12.526  -3.849  9.056   1.00 0.00 ? 99  LEU A CG   2  
ATOM 2247  C CD1  . LEU A 1 21  ? 13.465  -4.263  7.934   1.00 0.00 ? 99  LEU A CD1  2  
ATOM 2248  C CD2  . LEU A 1 21  ? 13.139  -2.728  9.882   1.00 0.00 ? 99  LEU A CD2  2  
ATOM 2249  H H    . LEU A 1 21  ? 9.870   -5.510  9.087   1.00 0.00 ? 99  LEU A H    2  
ATOM 2250  H HA   . LEU A 1 21  ? 10.340  -3.082  10.434  1.00 0.00 ? 99  LEU A HA   2  
ATOM 2251  H HB2  . LEU A 1 21  ? 10.928  -4.082  7.675   1.00 0.00 ? 99  LEU A HB2  2  
ATOM 2252  H HB3  . LEU A 1 21  ? 11.274  -2.410  8.115   1.00 0.00 ? 99  LEU A HB3  2  
ATOM 2253  H HG   . LEU A 1 21  ? 12.383  -4.703  9.704   1.00 0.00 ? 99  LEU A HG   2  
ATOM 2254  H HD11 . LEU A 1 21  ? 13.518  -5.340  7.888   1.00 0.00 ? 99  LEU A HD11 2  
ATOM 2255  H HD12 . LEU A 1 21  ? 14.450  -3.861  8.123   1.00 0.00 ? 99  LEU A HD12 2  
ATOM 2256  H HD13 . LEU A 1 21  ? 13.095  -3.880  6.995   1.00 0.00 ? 99  LEU A HD13 2  
ATOM 2257  H HD21 . LEU A 1 21  ? 12.362  -2.048  10.199  1.00 0.00 ? 99  LEU A HD21 2  
ATOM 2258  H HD22 . LEU A 1 21  ? 13.862  -2.194  9.283   1.00 0.00 ? 99  LEU A HD22 2  
ATOM 2259  H HD23 . LEU A 1 21  ? 13.628  -3.146  10.749  1.00 0.00 ? 99  LEU A HD23 2  
ATOM 2260  N N    . LEU A 1 22  ? 8.188   -2.942  7.936   1.00 0.00 ? 100 LEU A N    2  
ATOM 2261  C CA   . LEU A 1 22  ? 7.101   -2.153  7.366   1.00 0.00 ? 100 LEU A CA   2  
ATOM 2262  C C    . LEU A 1 22  ? 5.957   -2.002  8.363   1.00 0.00 ? 100 LEU A C    2  
ATOM 2263  O O    . LEU A 1 22  ? 5.307   -0.958  8.424   1.00 0.00 ? 100 LEU A O    2  
ATOM 2264  C CB   . LEU A 1 22  ? 6.590   -2.807  6.081   1.00 0.00 ? 100 LEU A CB   2  
ATOM 2265  C CG   . LEU A 1 22  ? 7.520   -2.724  4.870   1.00 0.00 ? 100 LEU A CG   2  
ATOM 2266  C CD1  . LEU A 1 22  ? 6.867   -3.356  3.651   1.00 0.00 ? 100 LEU A CD1  2  
ATOM 2267  C CD2  . LEU A 1 22  ? 7.899   -1.278  4.586   1.00 0.00 ? 100 LEU A CD2  2  
ATOM 2268  H H    . LEU A 1 22  ? 8.403   -3.813  7.542   1.00 0.00 ? 100 LEU A H    2  
ATOM 2269  H HA   . LEU A 1 22  ? 7.490   -1.174  7.132   1.00 0.00 ? 100 LEU A HA   2  
ATOM 2270  H HB2  . LEU A 1 22  ? 6.412   -3.851  6.289   1.00 0.00 ? 100 LEU A HB2  2  
ATOM 2271  H HB3  . LEU A 1 22  ? 5.658   -2.330  5.816   1.00 0.00 ? 100 LEU A HB3  2  
ATOM 2272  H HG   . LEU A 1 22  ? 8.428   -3.272  5.083   1.00 0.00 ? 100 LEU A HG   2  
ATOM 2273  H HD11 . LEU A 1 22  ? 7.106   -4.408  3.619   1.00 0.00 ? 100 LEU A HD11 2  
ATOM 2274  H HD12 . LEU A 1 22  ? 7.235   -2.876  2.756   1.00 0.00 ? 100 LEU A HD12 2  
ATOM 2275  H HD13 . LEU A 1 22  ? 5.796   -3.231  3.711   1.00 0.00 ? 100 LEU A HD13 2  
ATOM 2276  H HD21 . LEU A 1 22  ? 8.884   -1.080  4.980   1.00 0.00 ? 100 LEU A HD21 2  
ATOM 2277  H HD22 . LEU A 1 22  ? 7.183   -0.620  5.058   1.00 0.00 ? 100 LEU A HD22 2  
ATOM 2278  H HD23 . LEU A 1 22  ? 7.896   -1.108  3.519   1.00 0.00 ? 100 LEU A HD23 2  
ATOM 2279  N N    . TYR A 1 23  ? 5.717   -3.050  9.143   1.00 0.00 ? 101 TYR A N    2  
ATOM 2280  C CA   . TYR A 1 23  ? 4.651   -3.034  10.138  1.00 0.00 ? 101 TYR A CA   2  
ATOM 2281  C C    . TYR A 1 23  ? 4.946   -2.018  11.236  1.00 0.00 ? 101 TYR A C    2  
ATOM 2282  O O    . TYR A 1 23  ? 4.066   -1.265  11.655  1.00 0.00 ? 101 TYR A O    2  
ATOM 2283  C CB   . TYR A 1 23  ? 4.474   -4.425  10.748  1.00 0.00 ? 101 TYR A CB   2  
ATOM 2284  C CG   . TYR A 1 23  ? 3.545   -4.449  11.941  1.00 0.00 ? 101 TYR A CG   2  
ATOM 2285  C CD1  . TYR A 1 23  ? 2.210   -4.086  11.814  1.00 0.00 ? 101 TYR A CD1  2  
ATOM 2286  C CD2  . TYR A 1 23  ? 4.003   -4.834  13.196  1.00 0.00 ? 101 TYR A CD2  2  
ATOM 2287  C CE1  . TYR A 1 23  ? 1.358   -4.105  12.901  1.00 0.00 ? 101 TYR A CE1  2  
ATOM 2288  C CE2  . TYR A 1 23  ? 3.157   -4.858  14.288  1.00 0.00 ? 101 TYR A CE2  2  
ATOM 2289  C CZ   . TYR A 1 23  ? 1.836   -4.493  14.136  1.00 0.00 ? 101 TYR A CZ   2  
ATOM 2290  O OH   . TYR A 1 23  ? 0.991   -4.514  15.222  1.00 0.00 ? 101 TYR A OH   2  
ATOM 2291  H H    . TYR A 1 23  ? 6.268   -3.854  9.047   1.00 0.00 ? 101 TYR A H    2  
ATOM 2292  H HA   . TYR A 1 23  ? 3.735   -2.752  9.638   1.00 0.00 ? 101 TYR A HA   2  
ATOM 2293  H HB2  . TYR A 1 23  ? 4.070   -5.091  10.001  1.00 0.00 ? 101 TYR A HB2  2  
ATOM 2294  H HB3  . TYR A 1 23  ? 5.437   -4.795  11.070  1.00 0.00 ? 101 TYR A HB3  2  
ATOM 2295  H HD1  . TYR A 1 23  ? 1.838   -3.783  10.846  1.00 0.00 ? 101 TYR A HD1  2  
ATOM 2296  H HD2  . TYR A 1 23  ? 5.038   -5.119  13.311  1.00 0.00 ? 101 TYR A HD2  2  
ATOM 2297  H HE1  . TYR A 1 23  ? 0.323   -3.820  12.783  1.00 0.00 ? 101 TYR A HE1  2  
ATOM 2298  H HE2  . TYR A 1 23  ? 3.532   -5.161  15.255  1.00 0.00 ? 101 TYR A HE2  2  
ATOM 2299  H HH   . TYR A 1 23  ? 0.680   -5.410  15.368  1.00 0.00 ? 101 TYR A HH   2  
ATOM 2300  N N    . LYS A 1 24  ? 6.191   -2.002  11.700  1.00 0.00 ? 102 LYS A N    2  
ATOM 2301  C CA   . LYS A 1 24  ? 6.606   -1.078  12.748  1.00 0.00 ? 102 LYS A CA   2  
ATOM 2302  C C    . LYS A 1 24  ? 6.668   0.352   12.220  1.00 0.00 ? 102 LYS A C    2  
ATOM 2303  O O    . LYS A 1 24  ? 6.236   1.290   12.890  1.00 0.00 ? 102 LYS A O    2  
ATOM 2304  C CB   . LYS A 1 24  ? 7.971   -1.486  13.306  1.00 0.00 ? 102 LYS A CB   2  
ATOM 2305  C CG   . LYS A 1 24  ? 8.168   -1.115  14.765  1.00 0.00 ? 102 LYS A CG   2  
ATOM 2306  C CD   . LYS A 1 24  ? 8.636   0.323   14.916  1.00 0.00 ? 102 LYS A CD   2  
ATOM 2307  C CE   . LYS A 1 24  ? 8.631   0.761   16.373  1.00 0.00 ? 102 LYS A CE   2  
ATOM 2308  N NZ   . LYS A 1 24  ? 9.788   0.200   17.124  1.00 0.00 ? 102 LYS A NZ   2  
ATOM 2309  H H    . LYS A 1 24  ? 6.848   -2.627  11.326  1.00 0.00 ? 102 LYS A H    2  
ATOM 2310  H HA   . LYS A 1 24  ? 5.874   -1.125  13.540  1.00 0.00 ? 102 LYS A HA   2  
ATOM 2311  H HB2  . LYS A 1 24  ? 8.080   -2.556  13.210  1.00 0.00 ? 102 LYS A HB2  2  
ATOM 2312  H HB3  . LYS A 1 24  ? 8.743   -1.001  12.725  1.00 0.00 ? 102 LYS A HB3  2  
ATOM 2313  H HG2  . LYS A 1 24  ? 7.231   -1.234  15.287  1.00 0.00 ? 102 LYS A HG2  2  
ATOM 2314  H HG3  . LYS A 1 24  ? 8.909   -1.772  15.197  1.00 0.00 ? 102 LYS A HG3  2  
ATOM 2315  H HD2  . LYS A 1 24  ? 9.640   0.409   14.530  1.00 0.00 ? 102 LYS A HD2  2  
ATOM 2316  H HD3  . LYS A 1 24  ? 7.975   0.968   14.354  1.00 0.00 ? 102 LYS A HD3  2  
ATOM 2317  H HE2  . LYS A 1 24  ? 8.676   1.838   16.412  1.00 0.00 ? 102 LYS A HE2  2  
ATOM 2318  H HE3  . LYS A 1 24  ? 7.715   0.422   16.834  1.00 0.00 ? 102 LYS A HE3  2  
ATOM 2319  H HZ1  . LYS A 1 24  ? 10.466  -0.233  16.465  1.00 0.00 ? 102 LYS A HZ1  2  
ATOM 2320  H HZ2  . LYS A 1 24  ? 9.461   -0.527  17.793  1.00 0.00 ? 102 LYS A HZ2  2  
ATOM 2321  H HZ3  . LYS A 1 24  ? 10.269  0.953   17.655  1.00 0.00 ? 102 LYS A HZ3  2  
ATOM 2322  N N    . ALA A 1 25  ? 7.206   0.511   11.016  1.00 0.00 ? 103 ALA A N    2  
ATOM 2323  C CA   . ALA A 1 25  ? 7.321   1.825   10.397  1.00 0.00 ? 103 ALA A CA   2  
ATOM 2324  C C    . ALA A 1 25  ? 5.952   2.364   9.994   1.00 0.00 ? 103 ALA A C    2  
ATOM 2325  O O    . ALA A 1 25  ? 5.678   3.557   10.131  1.00 0.00 ? 103 ALA A O    2  
ATOM 2326  C CB   . ALA A 1 25  ? 8.241   1.761   9.187   1.00 0.00 ? 103 ALA A CB   2  
ATOM 2327  H H    . ALA A 1 25  ? 7.532   -0.276  10.531  1.00 0.00 ? 103 ALA A H    2  
ATOM 2328  H HA   . ALA A 1 25  ? 7.762   2.497   11.119  1.00 0.00 ? 103 ALA A HA   2  
ATOM 2329  H HB1  . ALA A 1 25  ? 8.975   0.982   9.336   1.00 0.00 ? 103 ALA A HB1  2  
ATOM 2330  H HB2  . ALA A 1 25  ? 7.660   1.545   8.304   1.00 0.00 ? 103 ALA A HB2  2  
ATOM 2331  H HB3  . ALA A 1 25  ? 8.742   2.710   9.066   1.00 0.00 ? 103 ALA A HB3  2  
ATOM 2332  N N    . LEU A 1 26  ? 5.096   1.478   9.497   1.00 0.00 ? 104 LEU A N    2  
ATOM 2333  C CA   . LEU A 1 26  ? 3.754   1.865   9.073   1.00 0.00 ? 104 LEU A CA   2  
ATOM 2334  C C    . LEU A 1 26  ? 2.917   2.318   10.265  1.00 0.00 ? 104 LEU A C    2  
ATOM 2335  O O    . LEU A 1 26  ? 2.300   3.384   10.235  1.00 0.00 ? 104 LEU A O    2  
ATOM 2336  C CB   . LEU A 1 26  ? 3.065   0.697   8.366   1.00 0.00 ? 104 LEU A CB   2  
ATOM 2337  C CG   . LEU A 1 26  ? 3.467   0.463   6.909   1.00 0.00 ? 104 LEU A CG   2  
ATOM 2338  C CD1  . LEU A 1 26  ? 3.017   -0.914  6.445   1.00 0.00 ? 104 LEU A CD1  2  
ATOM 2339  C CD2  . LEU A 1 26  ? 2.883   1.547   6.014   1.00 0.00 ? 104 LEU A CD2  2  
ATOM 2340  H H    . LEU A 1 26  ? 5.371   0.542   9.412   1.00 0.00 ? 104 LEU A H    2  
ATOM 2341  H HA   . LEU A 1 26  ? 3.850   2.688   8.381   1.00 0.00 ? 104 LEU A HA   2  
ATOM 2342  H HB2  . LEU A 1 26  ? 3.289   -0.203  8.918   1.00 0.00 ? 104 LEU A HB2  2  
ATOM 2343  H HB3  . LEU A 1 26  ? 2.000   0.878   8.391   1.00 0.00 ? 104 LEU A HB3  2  
ATOM 2344  H HG   . LEU A 1 26  ? 4.545   0.506   6.828   1.00 0.00 ? 104 LEU A HG   2  
ATOM 2345  H HD11 . LEU A 1 26  ? 2.747   -0.871  5.401   1.00 0.00 ? 104 LEU A HD11 2  
ATOM 2346  H HD12 . LEU A 1 26  ? 2.162   -1.227  7.026   1.00 0.00 ? 104 LEU A HD12 2  
ATOM 2347  H HD13 . LEU A 1 26  ? 3.822   -1.620  6.581   1.00 0.00 ? 104 LEU A HD13 2  
ATOM 2348  H HD21 . LEU A 1 26  ? 3.514   1.675   5.147   1.00 0.00 ? 104 LEU A HD21 2  
ATOM 2349  H HD22 . LEU A 1 26  ? 2.832   2.477   6.562   1.00 0.00 ? 104 LEU A HD22 2  
ATOM 2350  H HD23 . LEU A 1 26  ? 1.891   1.258   5.700   1.00 0.00 ? 104 LEU A HD23 2  
ATOM 2351  N N    . THR A 1 27  ? 2.901   1.503   11.315  1.00 0.00 ? 105 THR A N    2  
ATOM 2352  C CA   . THR A 1 27  ? 2.140   1.821   12.517  1.00 0.00 ? 105 THR A CA   2  
ATOM 2353  C C    . THR A 1 27  ? 2.766   2.987   13.272  1.00 0.00 ? 105 THR A C    2  
ATOM 2354  O O    . THR A 1 27  ? 2.084   3.701   14.008  1.00 0.00 ? 105 THR A O    2  
ATOM 2355  C CB   . THR A 1 27  ? 2.046   0.606   13.459  1.00 0.00 ? 105 THR A CB   2  
ATOM 2356  O OG1  . THR A 1 27  ? 1.135   0.884   14.528  1.00 0.00 ? 105 THR A OG1  2  
ATOM 2357  C CG2  . THR A 1 27  ? 3.413   0.256   14.029  1.00 0.00 ? 105 THR A CG2  2  
ATOM 2358  H H    . THR A 1 27  ? 3.413   0.668   11.278  1.00 0.00 ? 105 THR A H    2  
ATOM 2359  H HA   . THR A 1 27  ? 1.139   2.094   12.216  1.00 0.00 ? 105 THR A HA   2  
ATOM 2360  H HB   . THR A 1 27  ? 1.680   -0.241  12.896  1.00 0.00 ? 105 THR A HB   2  
ATOM 2361  H HG1  . THR A 1 27  ? 0.704   0.071   14.802  1.00 0.00 ? 105 THR A HG1  2  
ATOM 2362  H HG21 . THR A 1 27  ? 3.551   -0.815  14.001  1.00 0.00 ? 105 THR A HG21 2  
ATOM 2363  H HG22 . THR A 1 27  ? 3.476   0.601   15.050  1.00 0.00 ? 105 THR A HG22 2  
ATOM 2364  H HG23 . THR A 1 27  ? 4.181   0.733   13.439  1.00 0.00 ? 105 THR A HG23 2  
ATOM 2365  N N    . ASP A 1 28  ? 4.068   3.177   13.084  1.00 0.00 ? 106 ASP A N    2  
ATOM 2366  C CA   . ASP A 1 28  ? 4.786   4.260   13.746  1.00 0.00 ? 106 ASP A CA   2  
ATOM 2367  C C    . ASP A 1 28  ? 4.360   5.615   13.189  1.00 0.00 ? 106 ASP A C    2  
ATOM 2368  O O    . ASP A 1 28  ? 4.158   6.571   13.940  1.00 0.00 ? 106 ASP A O    2  
ATOM 2369  C CB   . ASP A 1 28  ? 6.295   4.077   13.578  1.00 0.00 ? 106 ASP A CB   2  
ATOM 2370  C CG   . ASP A 1 28  ? 7.046   5.393   13.617  1.00 0.00 ? 106 ASP A CG   2  
ATOM 2371  O OD1  . ASP A 1 28  ? 7.007   6.068   14.667  1.00 0.00 ? 106 ASP A OD1  2  
ATOM 2372  O OD2  . ASP A 1 28  ? 7.673   5.749   12.597  1.00 0.00 ? 106 ASP A OD2  2  
ATOM 2373  H H    . ASP A 1 28  ? 4.557   2.575   12.485  1.00 0.00 ? 106 ASP A H    2  
ATOM 2374  H HA   . ASP A 1 28  ? 4.543   4.224   14.798  1.00 0.00 ? 106 ASP A HA   2  
ATOM 2375  H HB2  . ASP A 1 28  ? 6.666   3.449   14.376  1.00 0.00 ? 106 ASP A HB2  2  
ATOM 2376  H HB3  . ASP A 1 28  ? 6.490   3.599   12.629  1.00 0.00 ? 106 ASP A HB3  2  
ATOM 2377  N N    . LEU A 1 29  ? 4.227   5.691   11.870  1.00 0.00 ? 107 LEU A N    2  
ATOM 2378  C CA   . LEU A 1 29  ? 3.826   6.929   11.212  1.00 0.00 ? 107 LEU A CA   2  
ATOM 2379  C C    . LEU A 1 29  ? 2.439   7.367   11.672  1.00 0.00 ? 107 LEU A C    2  
ATOM 2380  O O    . LEU A 1 29  ? 2.163   8.560   11.798  1.00 0.00 ? 107 LEU A O    2  
ATOM 2381  C CB   . LEU A 1 29  ? 3.839   6.750   9.693   1.00 0.00 ? 107 LEU A CB   2  
ATOM 2382  C CG   . LEU A 1 29  ? 5.218   6.712   9.033   1.00 0.00 ? 107 LEU A CG   2  
ATOM 2383  C CD1  . LEU A 1 29  ? 5.089   6.431   7.544   1.00 0.00 ? 107 LEU A CD1  2  
ATOM 2384  C CD2  . LEU A 1 29  ? 5.958   8.020   9.269   1.00 0.00 ? 107 LEU A CD2  2  
ATOM 2385  H H    . LEU A 1 29  ? 4.402   4.896   11.325  1.00 0.00 ? 107 LEU A H    2  
ATOM 2386  H HA   . LEU A 1 29  ? 4.539   7.694   11.482  1.00 0.00 ? 107 LEU A HA   2  
ATOM 2387  H HB2  . LEU A 1 29  ? 3.338   5.821   9.465   1.00 0.00 ? 107 LEU A HB2  2  
ATOM 2388  H HB3  . LEU A 1 29  ? 3.286   7.571   9.259   1.00 0.00 ? 107 LEU A HB3  2  
ATOM 2389  H HG   . LEU A 1 29  ? 5.799   5.913   9.474   1.00 0.00 ? 107 LEU A HG   2  
ATOM 2390  H HD11 . LEU A 1 29  ? 5.069   5.364   7.379   1.00 0.00 ? 107 LEU A HD11 2  
ATOM 2391  H HD12 . LEU A 1 29  ? 5.933   6.859   7.023   1.00 0.00 ? 107 LEU A HD12 2  
ATOM 2392  H HD13 . LEU A 1 29  ? 4.176   6.871   7.172   1.00 0.00 ? 107 LEU A HD13 2  
ATOM 2393  H HD21 . LEU A 1 29  ? 6.216   8.463   8.318   1.00 0.00 ? 107 LEU A HD21 2  
ATOM 2394  H HD22 . LEU A 1 29  ? 6.860   7.827   9.832   1.00 0.00 ? 107 LEU A HD22 2  
ATOM 2395  H HD23 . LEU A 1 29  ? 5.325   8.697   9.822   1.00 0.00 ? 107 LEU A HD23 2  
ATOM 2396  N N    . LEU A 1 30  ? 1.571   6.393   11.923  1.00 0.00 ? 108 LEU A N    2  
ATOM 2397  C CA   . LEU A 1 30  ? 0.212   6.677   12.372  1.00 0.00 ? 108 LEU A CA   2  
ATOM 2398  C C    . LEU A 1 30  ? 0.211   7.214   13.799  1.00 0.00 ? 108 LEU A C    2  
ATOM 2399  O O    . LEU A 1 30  ? -0.834  7.593   14.330  1.00 0.00 ? 108 LEU A O    2  
ATOM 2400  C CB   . LEU A 1 30  ? -0.647  5.414   12.290  1.00 0.00 ? 108 LEU A CB   2  
ATOM 2401  C CG   . LEU A 1 30  ? -1.178  5.052   10.902  1.00 0.00 ? 108 LEU A CG   2  
ATOM 2402  C CD1  . LEU A 1 30  ? -0.116  5.302   9.843   1.00 0.00 ? 108 LEU A CD1  2  
ATOM 2403  C CD2  . LEU A 1 30  ? -1.636  3.601   10.868  1.00 0.00 ? 108 LEU A CD2  2  
ATOM 2404  H H    . LEU A 1 30  ? 1.849   5.461   11.804  1.00 0.00 ? 108 LEU A H    2  
ATOM 2405  H HA   . LEU A 1 30  ? -0.203  7.428   11.717  1.00 0.00 ? 108 LEU A HA   2  
ATOM 2406  H HB2  . LEU A 1 30  ? -0.052  4.586   12.643  1.00 0.00 ? 108 LEU A HB2  2  
ATOM 2407  H HB3  . LEU A 1 30  ? -1.497  5.550   12.944  1.00 0.00 ? 108 LEU A HB3  2  
ATOM 2408  H HG   . LEU A 1 30  ? -2.029  5.678   10.674  1.00 0.00 ? 108 LEU A HG   2  
ATOM 2409  H HD11 . LEU A 1 30  ? -0.324  4.698   8.973   1.00 0.00 ? 108 LEU A HD11 2  
ATOM 2410  H HD12 . LEU A 1 30  ? 0.855   5.042   10.238  1.00 0.00 ? 108 LEU A HD12 2  
ATOM 2411  H HD13 . LEU A 1 30  ? -0.123  6.347   9.566   1.00 0.00 ? 108 LEU A HD13 2  
ATOM 2412  H HD21 . LEU A 1 30  ? -2.444  3.463   11.571  1.00 0.00 ? 108 LEU A HD21 2  
ATOM 2413  H HD22 . LEU A 1 30  ? -0.811  2.957   11.137  1.00 0.00 ? 108 LEU A HD22 2  
ATOM 2414  H HD23 . LEU A 1 30  ? -1.977  3.355   9.873   1.00 0.00 ? 108 LEU A HD23 2  
ATOM 2415  N N    . CYS A 1 31  ? 1.388   7.246   14.414  1.00 0.00 ? 109 CYS A N    2  
ATOM 2416  C CA   . CYS A 1 31  ? 1.524   7.739   15.780  1.00 0.00 ? 109 CYS A CA   2  
ATOM 2417  C C    . CYS A 1 31  ? 1.797   9.240   15.792  1.00 0.00 ? 109 CYS A C    2  
ATOM 2418  O O    . CYS A 1 31  ? 1.557   9.918   16.792  1.00 0.00 ? 109 CYS A O    2  
ATOM 2419  C CB   . CYS A 1 31  ? 2.650   6.998   16.503  1.00 0.00 ? 109 CYS A CB   2  
ATOM 2420  S SG   . CYS A 1 31  ? 2.436   5.203   16.557  1.00 0.00 ? 109 CYS A SG   2  
ATOM 2421  H H    . CYS A 1 31  ? 2.185   6.931   13.939  1.00 0.00 ? 109 CYS A H    2  
ATOM 2422  H HA   . CYS A 1 31  ? 0.593   7.551   16.294  1.00 0.00 ? 109 CYS A HA   2  
ATOM 2423  H HB2  . CYS A 1 31  ? 3.584   7.201   16.001  1.00 0.00 ? 109 CYS A HB2  2  
ATOM 2424  H HB3  . CYS A 1 31  ? 2.710   7.354   17.520  1.00 0.00 ? 109 CYS A HB3  2  
ATOM 2425  H HG   . CYS A 1 31  ? 1.259   4.916   16.021  1.00 0.00 ? 109 CYS A HG   2  
ATOM 2426  N N    . THR A 1 32  ? 2.303   9.753   14.675  1.00 0.00 ? 110 THR A N    2  
ATOM 2427  C CA   . THR A 1 32  ? 2.612   11.172  14.558  1.00 0.00 ? 110 THR A CA   2  
ATOM 2428  C C    . THR A 1 32  ? 1.797   11.822  13.445  1.00 0.00 ? 110 THR A C    2  
ATOM 2429  O O    . THR A 1 32  ? 1.983   11.540  12.261  1.00 0.00 ? 110 THR A O    2  
ATOM 2430  C CB   . THR A 1 32  ? 4.110   11.400  14.282  1.00 0.00 ? 110 THR A CB   2  
ATOM 2431  O OG1  . THR A 1 32  ? 4.880   10.333  14.846  1.00 0.00 ? 110 THR A OG1  2  
ATOM 2432  C CG2  . THR A 1 32  ? 4.572   12.728  14.863  1.00 0.00 ? 110 THR A CG2  2  
ATOM 2433  H H    . THR A 1 32  ? 2.473   9.161   13.913  1.00 0.00 ? 110 THR A H    2  
ATOM 2434  H HA   . THR A 1 32  ? 2.364   11.646  15.496  1.00 0.00 ? 110 THR A HA   2  
ATOM 2435  H HB   . THR A 1 32  ? 4.265   11.419  13.212  1.00 0.00 ? 110 THR A HB   2  
ATOM 2436  H HG1  . THR A 1 32  ? 5.238   10.610  15.694  1.00 0.00 ? 110 THR A HG1  2  
ATOM 2437  H HG21 . THR A 1 32  ? 5.580   12.627  15.237  1.00 0.00 ? 110 THR A HG21 2  
ATOM 2438  H HG22 . THR A 1 32  ? 3.915   13.015  15.671  1.00 0.00 ? 110 THR A HG22 2  
ATOM 2439  H HG23 . THR A 1 32  ? 4.548   13.485  14.093  1.00 0.00 ? 110 THR A HG23 2  
ATOM 2440  N N    . PRO A 1 33  ? 0.873   12.714  13.831  1.00 0.00 ? 111 PRO A N    2  
ATOM 2441  C CA   . PRO A 1 33  ? 0.012   13.423  12.880  1.00 0.00 ? 111 PRO A CA   2  
ATOM 2442  C C    . PRO A 1 33  ? 0.784   14.439  12.045  1.00 0.00 ? 111 PRO A C    2  
ATOM 2443  O O    . PRO A 1 33  ? 0.224   15.076  11.153  1.00 0.00 ? 111 PRO A O    2  
ATOM 2444  C CB   . PRO A 1 33  ? -1.002  14.133  13.781  1.00 0.00 ? 111 PRO A CB   2  
ATOM 2445  C CG   . PRO A 1 33  ? -0.301  14.296  15.085  1.00 0.00 ? 111 PRO A CG   2  
ATOM 2446  C CD   . PRO A 1 33  ? 0.597   13.099  15.226  1.00 0.00 ? 111 PRO A CD   2  
ATOM 2447  H HA   . PRO A 1 33  ? -0.504  12.738  12.225  1.00 0.00 ? 111 PRO A HA   2  
ATOM 2448  H HB2  . PRO A 1 33  ? -1.264  15.089  13.350  1.00 0.00 ? 111 PRO A HB2  2  
ATOM 2449  H HB3  . PRO A 1 33  ? -1.887  13.523  13.883  1.00 0.00 ? 111 PRO A HB3  2  
ATOM 2450  H HG2  . PRO A 1 33  ? 0.282   15.204  15.077  1.00 0.00 ? 111 PRO A HG2  2  
ATOM 2451  H HG3  . PRO A 1 33  ? -1.022  14.319  15.889  1.00 0.00 ? 111 PRO A HG3  2  
ATOM 2452  H HD2  . PRO A 1 33  ? 1.508   13.368  15.739  1.00 0.00 ? 111 PRO A HD2  2  
ATOM 2453  H HD3  . PRO A 1 33  ? 0.088   12.304  15.750  1.00 0.00 ? 111 PRO A HD3  2  
ATOM 2454  N N    . GLU A 1 34  ? 2.072   14.584  12.340  1.00 0.00 ? 112 GLU A N    2  
ATOM 2455  C CA   . GLU A 1 34  ? 2.920   15.523  11.615  1.00 0.00 ? 112 GLU A CA   2  
ATOM 2456  C C    . GLU A 1 34  ? 2.762   15.347  10.107  1.00 0.00 ? 112 GLU A C    2  
ATOM 2457  O O    . GLU A 1 34  ? 2.505   16.308  9.383   1.00 0.00 ? 112 GLU A O    2  
ATOM 2458  C CB   . GLU A 1 34  ? 4.386   15.331  12.011  1.00 0.00 ? 112 GLU A CB   2  
ATOM 2459  C CG   . GLU A 1 34  ? 4.814   16.183  13.193  1.00 0.00 ? 112 GLU A CG   2  
ATOM 2460  C CD   . GLU A 1 34  ? 6.299   16.082  13.479  1.00 0.00 ? 112 GLU A CD   2  
ATOM 2461  O OE1  . GLU A 1 34  ? 7.097   16.585  12.660  1.00 0.00 ? 112 GLU A OE1  2  
ATOM 2462  O OE2  . GLU A 1 34  ? 6.664   15.499  14.521  1.00 0.00 ? 112 GLU A OE2  2  
ATOM 2463  H H    . GLU A 1 34  ? 2.461   14.047  13.062  1.00 0.00 ? 112 GLU A H    2  
ATOM 2464  H HA   . GLU A 1 34  ? 2.613   16.522  11.883  1.00 0.00 ? 112 GLU A HA   2  
ATOM 2465  H HB2  . GLU A 1 34  ? 4.545   14.293  12.264  1.00 0.00 ? 112 GLU A HB2  2  
ATOM 2466  H HB3  . GLU A 1 34  ? 5.010   15.585  11.166  1.00 0.00 ? 112 GLU A HB3  2  
ATOM 2467  H HG2  . GLU A 1 34  ? 4.573   17.215  12.983  1.00 0.00 ? 112 GLU A HG2  2  
ATOM 2468  H HG3  . GLU A 1 34  ? 4.271   15.859  14.069  1.00 0.00 ? 112 GLU A HG3  2  
ATOM 2469  N N    . VAL A 1 35  ? 2.918   14.111  9.642   1.00 0.00 ? 113 VAL A N    2  
ATOM 2470  C CA   . VAL A 1 35  ? 2.792   13.808  8.221   1.00 0.00 ? 113 VAL A CA   2  
ATOM 2471  C C    . VAL A 1 35  ? 1.365   13.402  7.871   1.00 0.00 ? 113 VAL A C    2  
ATOM 2472  O O    . VAL A 1 35  ? 0.740   13.991  6.988   1.00 0.00 ? 113 VAL A O    2  
ATOM 2473  C CB   . VAL A 1 35  ? 3.753   12.680  7.801   1.00 0.00 ? 113 VAL A CB   2  
ATOM 2474  C CG1  . VAL A 1 35  ? 3.442   11.401  8.563   1.00 0.00 ? 113 VAL A CG1  2  
ATOM 2475  C CG2  . VAL A 1 35  ? 3.677   12.448  6.300   1.00 0.00 ? 113 VAL A CG2  2  
ATOM 2476  H H    . VAL A 1 35  ? 3.122   13.387  10.269  1.00 0.00 ? 113 VAL A H    2  
ATOM 2477  H HA   . VAL A 1 35  ? 3.050   14.698  7.666   1.00 0.00 ? 113 VAL A HA   2  
ATOM 2478  H HB   . VAL A 1 35  ? 4.760   12.983  8.047   1.00 0.00 ? 113 VAL A HB   2  
ATOM 2479  H HG11 . VAL A 1 35  ? 2.571   10.929  8.132   1.00 0.00 ? 113 VAL A HG11 2  
ATOM 2480  H HG12 . VAL A 1 35  ? 4.285   10.730  8.499   1.00 0.00 ? 113 VAL A HG12 2  
ATOM 2481  H HG13 . VAL A 1 35  ? 3.247   11.638  9.599   1.00 0.00 ? 113 VAL A HG13 2  
ATOM 2482  H HG21 . VAL A 1 35  ? 3.442   11.412  6.108   1.00 0.00 ? 113 VAL A HG21 2  
ATOM 2483  H HG22 . VAL A 1 35  ? 2.906   13.076  5.876   1.00 0.00 ? 113 VAL A HG22 2  
ATOM 2484  H HG23 . VAL A 1 35  ? 4.627   12.692  5.848   1.00 0.00 ? 113 VAL A HG23 2  
ATOM 2485  N N    . SER A 1 36  ? 0.855   12.392  8.568   1.00 0.00 ? 114 SER A N    2  
ATOM 2486  C CA   . SER A 1 36  ? -0.498  11.904  8.328   1.00 0.00 ? 114 SER A CA   2  
ATOM 2487  C C    . SER A 1 36  ? -1.499  12.609  9.239   1.00 0.00 ? 114 SER A C    2  
ATOM 2488  O O    . SER A 1 36  ? -2.103  11.988  10.113  1.00 0.00 ? 114 SER A O    2  
ATOM 2489  C CB   . SER A 1 36  ? -0.565  10.392  8.552   1.00 0.00 ? 114 SER A CB   2  
ATOM 2490  O OG   . SER A 1 36  ? -0.389  10.071  9.921   1.00 0.00 ? 114 SER A OG   2  
ATOM 2491  H H    . SER A 1 36  ? 1.403   11.963  9.258   1.00 0.00 ? 114 SER A H    2  
ATOM 2492  H HA   . SER A 1 36  ? -0.751  12.119  7.300   1.00 0.00 ? 114 SER A HA   2  
ATOM 2493  H HB2  . SER A 1 36  ? -1.528  10.025  8.229   1.00 0.00 ? 114 SER A HB2  2  
ATOM 2494  H HB3  . SER A 1 36  ? 0.214   9.911   7.978   1.00 0.00 ? 114 SER A HB3  2  
ATOM 2495  H HG   . SER A 1 36  ? -1.248  9.977   10.340  1.00 0.00 ? 114 SER A HG   2  
ATOM 2496  N N    . GLN A 1 37  ? -1.670  13.910  9.026   1.00 0.00 ? 115 GLN A N    2  
ATOM 2497  C CA   . GLN A 1 37  ? -2.597  14.700  9.827   1.00 0.00 ? 115 GLN A CA   2  
ATOM 2498  C C    . GLN A 1 37  ? -4.020  14.168  9.696   1.00 0.00 ? 115 GLN A C    2  
ATOM 2499  O O    . GLN A 1 37  ? -4.723  13.997  10.691  1.00 0.00 ? 115 GLN A O    2  
ATOM 2500  C CB   . GLN A 1 37  ? -2.547  16.169  9.403   1.00 0.00 ? 115 GLN A CB   2  
ATOM 2501  C CG   . GLN A 1 37  ? -2.875  17.138  10.527  1.00 0.00 ? 115 GLN A CG   2  
ATOM 2502  C CD   . GLN A 1 37  ? -3.003  18.569  10.044  1.00 0.00 ? 115 GLN A CD   2  
ATOM 2503  O OE1  . GLN A 1 37  ? -4.093  19.142  10.044  1.00 0.00 ? 115 GLN A OE1  2  
ATOM 2504  N NE2  . GLN A 1 37  ? -1.886  19.156  9.630   1.00 0.00 ? 115 GLN A NE2  2  
ATOM 2505  H H    . GLN A 1 37  ? -1.160  14.348  8.314   1.00 0.00 ? 115 GLN A H    2  
ATOM 2506  H HA   . GLN A 1 37  ? -2.291  14.622  10.860  1.00 0.00 ? 115 GLN A HA   2  
ATOM 2507  H HB2  . GLN A 1 37  ? -1.555  16.393  9.041   1.00 0.00 ? 115 GLN A HB2  2  
ATOM 2508  H HB3  . GLN A 1 37  ? -3.257  16.324  8.604   1.00 0.00 ? 115 GLN A HB3  2  
ATOM 2509  H HG2  . GLN A 1 37  ? -3.811  16.842  10.978  1.00 0.00 ? 115 GLN A HG2  2  
ATOM 2510  H HG3  . GLN A 1 37  ? -2.090  17.091  11.266  1.00 0.00 ? 115 GLN A HG3  2  
ATOM 2511  H HE21 . GLN A 1 37  ? -1.054  18.639  9.658   1.00 0.00 ? 115 GLN A HE21 2  
ATOM 2512  H HE22 . GLN A 1 37  ? -1.940  20.081  9.312   1.00 0.00 ? 115 GLN A HE22 2  
ATOM 2513  N N    . GLU A 1 38  ? -4.438  13.908  8.461   1.00 0.00 ? 116 GLU A N    2  
ATOM 2514  C CA   . GLU A 1 38  ? -5.778  13.397  8.200   1.00 0.00 ? 116 GLU A CA   2  
ATOM 2515  C C    . GLU A 1 38  ? -5.955  12.004  8.798   1.00 0.00 ? 116 GLU A C    2  
ATOM 2516  O O    . GLU A 1 38  ? -6.991  11.696  9.388   1.00 0.00 ? 116 GLU A O    2  
ATOM 2517  C CB   . GLU A 1 38  ? -6.049  13.356  6.695   1.00 0.00 ? 116 GLU A CB   2  
ATOM 2518  C CG   . GLU A 1 38  ? -6.281  14.727  6.081   1.00 0.00 ? 116 GLU A CG   2  
ATOM 2519  C CD   . GLU A 1 38  ? -7.577  15.362  6.545   1.00 0.00 ? 116 GLU A CD   2  
ATOM 2520  O OE1  . GLU A 1 38  ? -8.642  15.005  6.000   1.00 0.00 ? 116 GLU A OE1  2  
ATOM 2521  O OE2  . GLU A 1 38  ? -7.526  16.217  7.454   1.00 0.00 ? 116 GLU A OE2  2  
ATOM 2522  H H    . GLU A 1 38  ? -3.831  14.065  7.708   1.00 0.00 ? 116 GLU A H    2  
ATOM 2523  H HA   . GLU A 1 38  ? -6.485  14.067  8.666   1.00 0.00 ? 116 GLU A HA   2  
ATOM 2524  H HB2  . GLU A 1 38  ? -5.203  12.901  6.201   1.00 0.00 ? 116 GLU A HB2  2  
ATOM 2525  H HB3  . GLU A 1 38  ? -6.926  12.752  6.516   1.00 0.00 ? 116 GLU A HB3  2  
ATOM 2526  H HG2  . GLU A 1 38  ? -5.462  15.374  6.357   1.00 0.00 ? 116 GLU A HG2  2  
ATOM 2527  H HG3  . GLU A 1 38  ? -6.311  14.625  5.006   1.00 0.00 ? 116 GLU A HG3  2  
ATOM 2528  N N    . LEU A 1 39  ? -4.936  11.166  8.639   1.00 0.00 ? 117 LEU A N    2  
ATOM 2529  C CA   . LEU A 1 39  ? -4.978  9.804   9.162   1.00 0.00 ? 117 LEU A CA   2  
ATOM 2530  C C    . LEU A 1 39  ? -5.139  9.808   10.679  1.00 0.00 ? 117 LEU A C    2  
ATOM 2531  O O    . LEU A 1 39  ? -6.016  9.136   11.222  1.00 0.00 ? 117 LEU A O    2  
ATOM 2532  C CB   . LEU A 1 39  ? -3.705  9.049   8.775   1.00 0.00 ? 117 LEU A CB   2  
ATOM 2533  C CG   . LEU A 1 39  ? -3.793  7.523   8.810   1.00 0.00 ? 117 LEU A CG   2  
ATOM 2534  C CD1  . LEU A 1 39  ? -5.099  7.049   8.190   1.00 0.00 ? 117 LEU A CD1  2  
ATOM 2535  C CD2  . LEU A 1 39  ? -2.604  6.904   8.090   1.00 0.00 ? 117 LEU A CD2  2  
ATOM 2536  H H    . LEU A 1 39  ? -4.138  11.468  8.160   1.00 0.00 ? 117 LEU A H    2  
ATOM 2537  H HA   . LEU A 1 39  ? -5.830  9.307   8.723   1.00 0.00 ? 117 LEU A HA   2  
ATOM 2538  H HB2  . LEU A 1 39  ? -3.440  9.342   7.771   1.00 0.00 ? 117 LEU A HB2  2  
ATOM 2539  H HB3  . LEU A 1 39  ? -2.922  9.352   9.455   1.00 0.00 ? 117 LEU A HB3  2  
ATOM 2540  H HG   . LEU A 1 39  ? -3.773  7.191   9.839   1.00 0.00 ? 117 LEU A HG   2  
ATOM 2541  H HD11 . LEU A 1 39  ? -5.059  5.981   8.041   1.00 0.00 ? 117 LEU A HD11 2  
ATOM 2542  H HD12 . LEU A 1 39  ? -5.246  7.541   7.240   1.00 0.00 ? 117 LEU A HD12 2  
ATOM 2543  H HD13 . LEU A 1 39  ? -5.919  7.291   8.851   1.00 0.00 ? 117 LEU A HD13 2  
ATOM 2544  H HD21 . LEU A 1 39  ? -1.991  6.371   8.802   1.00 0.00 ? 117 LEU A HD21 2  
ATOM 2545  H HD22 . LEU A 1 39  ? -2.019  7.684   7.624   1.00 0.00 ? 117 LEU A HD22 2  
ATOM 2546  H HD23 . LEU A 1 39  ? -2.957  6.218   7.335   1.00 0.00 ? 117 LEU A HD23 2  
ATOM 2547  N N    . TYR A 1 40  ? -4.288  10.571  11.357  1.00 0.00 ? 118 TYR A N    2  
ATOM 2548  C CA   . TYR A 1 40  ? -4.335  10.662  12.811  1.00 0.00 ? 118 TYR A CA   2  
ATOM 2549  C C    . TYR A 1 40  ? -5.735  11.038  13.288  1.00 0.00 ? 118 TYR A C    2  
ATOM 2550  O O    . TYR A 1 40  ? -6.317  10.360  14.135  1.00 0.00 ? 118 TYR A O    2  
ATOM 2551  C CB   . TYR A 1 40  ? -3.320  11.691  13.312  1.00 0.00 ? 118 TYR A CB   2  
ATOM 2552  C CG   . TYR A 1 40  ? -3.132  11.676  14.812  1.00 0.00 ? 118 TYR A CG   2  
ATOM 2553  C CD1  . TYR A 1 40  ? -2.297  10.744  15.417  1.00 0.00 ? 118 TYR A CD1  2  
ATOM 2554  C CD2  . TYR A 1 40  ? -3.789  12.591  15.624  1.00 0.00 ? 118 TYR A CD2  2  
ATOM 2555  C CE1  . TYR A 1 40  ? -2.122  10.725  16.787  1.00 0.00 ? 118 TYR A CE1  2  
ATOM 2556  C CE2  . TYR A 1 40  ? -3.618  12.581  16.995  1.00 0.00 ? 118 TYR A CE2  2  
ATOM 2557  C CZ   . TYR A 1 40  ? -2.784  11.646  17.572  1.00 0.00 ? 118 TYR A CZ   2  
ATOM 2558  O OH   . TYR A 1 40  ? -2.613  11.631  18.937  1.00 0.00 ? 118 TYR A OH   2  
ATOM 2559  H H    . TYR A 1 40  ? -3.611  11.083  10.868  1.00 0.00 ? 118 TYR A H    2  
ATOM 2560  H HA   . TYR A 1 40  ? -4.078  9.693   13.213  1.00 0.00 ? 118 TYR A HA   2  
ATOM 2561  H HB2  . TYR A 1 40  ? -2.363  11.494  12.856  1.00 0.00 ? 118 TYR A HB2  2  
ATOM 2562  H HB3  . TYR A 1 40  ? -3.651  12.680  13.029  1.00 0.00 ? 118 TYR A HB3  2  
ATOM 2563  H HD1  . TYR A 1 40  ? -1.779  10.024  14.800  1.00 0.00 ? 118 TYR A HD1  2  
ATOM 2564  H HD2  . TYR A 1 40  ? -4.442  13.322  15.169  1.00 0.00 ? 118 TYR A HD2  2  
ATOM 2565  H HE1  . TYR A 1 40  ? -1.468  9.994   17.239  1.00 0.00 ? 118 TYR A HE1  2  
ATOM 2566  H HE2  . TYR A 1 40  ? -4.137  13.301  17.610  1.00 0.00 ? 118 TYR A HE2  2  
ATOM 2567  H HH   . TYR A 1 40  ? -3.407  11.290  19.355  1.00 0.00 ? 118 TYR A HH   2  
ATOM 2568  N N    . ASP A 1 41  ? -6.268  12.123  12.738  1.00 0.00 ? 119 ASP A N    2  
ATOM 2569  C CA   . ASP A 1 41  ? -7.600  12.590  13.105  1.00 0.00 ? 119 ASP A CA   2  
ATOM 2570  C C    . ASP A 1 41  ? -8.565  11.417  13.256  1.00 0.00 ? 119 ASP A C    2  
ATOM 2571  O O    . ASP A 1 41  ? -9.471  11.448  14.090  1.00 0.00 ? 119 ASP A O    2  
ATOM 2572  C CB   . ASP A 1 41  ? -8.128  13.568  12.055  1.00 0.00 ? 119 ASP A CB   2  
ATOM 2573  C CG   . ASP A 1 41  ? -9.551  14.010  12.337  1.00 0.00 ? 119 ASP A CG   2  
ATOM 2574  O OD1  . ASP A 1 41  ? -9.742  14.858  13.233  1.00 0.00 ? 119 ASP A OD1  2  
ATOM 2575  O OD2  . ASP A 1 41  ? -10.474 13.506  11.663  1.00 0.00 ? 119 ASP A OD2  2  
ATOM 2576  H H    . ASP A 1 41  ? -5.754  12.622  12.069  1.00 0.00 ? 119 ASP A H    2  
ATOM 2577  H HA   . ASP A 1 41  ? -7.524  13.101  14.053  1.00 0.00 ? 119 ASP A HA   2  
ATOM 2578  H HB2  . ASP A 1 41  ? -7.496  14.445  12.038  1.00 0.00 ? 119 ASP A HB2  2  
ATOM 2579  H HB3  . ASP A 1 41  ? -8.103  13.094  11.085  1.00 0.00 ? 119 ASP A HB3  2  
ATOM 2580  N N    . LEU A 1 42  ? -8.365  10.386  12.443  1.00 0.00 ? 120 LEU A N    2  
ATOM 2581  C CA   . LEU A 1 42  ? -9.217  9.203   12.485  1.00 0.00 ? 120 LEU A CA   2  
ATOM 2582  C C    . LEU A 1 42  ? -8.802  8.272   13.620  1.00 0.00 ? 120 LEU A C    2  
ATOM 2583  O O    . LEU A 1 42  ? -9.642  7.631   14.249  1.00 0.00 ? 120 LEU A O    2  
ATOM 2584  C CB   . LEU A 1 42  ? -9.155  8.457   11.151  1.00 0.00 ? 120 LEU A CB   2  
ATOM 2585  C CG   . LEU A 1 42  ? -9.466  9.286   9.904   1.00 0.00 ? 120 LEU A CG   2  
ATOM 2586  C CD1  . LEU A 1 42  ? -8.917  8.605   8.660   1.00 0.00 ? 120 LEU A CD1  2  
ATOM 2587  C CD2  . LEU A 1 42  ? -10.965 9.511   9.773   1.00 0.00 ? 120 LEU A CD2  2  
ATOM 2588  H H    . LEU A 1 42  ? -7.627  10.419  11.800  1.00 0.00 ? 120 LEU A H    2  
ATOM 2589  H HA   . LEU A 1 42  ? -10.231 9.531   12.658  1.00 0.00 ? 120 LEU A HA   2  
ATOM 2590  H HB2  . LEU A 1 42  ? -8.159  8.057   11.042  1.00 0.00 ? 120 LEU A HB2  2  
ATOM 2591  H HB3  . LEU A 1 42  ? -9.865  7.644   11.194  1.00 0.00 ? 120 LEU A HB3  2  
ATOM 2592  H HG   . LEU A 1 42  ? -8.988  10.252  9.993   1.00 0.00 ? 120 LEU A HG   2  
ATOM 2593  H HD11 . LEU A 1 42  ? -8.899  7.537   8.812   1.00 0.00 ? 120 LEU A HD11 2  
ATOM 2594  H HD12 . LEU A 1 42  ? -7.914  8.959   8.469   1.00 0.00 ? 120 LEU A HD12 2  
ATOM 2595  H HD13 . LEU A 1 42  ? -9.547  8.839   7.814   1.00 0.00 ? 120 LEU A HD13 2  
ATOM 2596  H HD21 . LEU A 1 42  ? -11.491 8.624   10.095  1.00 0.00 ? 120 LEU A HD21 2  
ATOM 2597  H HD22 . LEU A 1 42  ? -11.209 9.720   8.741   1.00 0.00 ? 120 LEU A HD22 2  
ATOM 2598  H HD23 . LEU A 1 42  ? -11.259 10.347  10.390  1.00 0.00 ? 120 LEU A HD23 2  
ATOM 2599  N N    . ASN A 1 43  ? -7.500  8.206   13.878  1.00 0.00 ? 121 ASN A N    2  
ATOM 2600  C CA   . ASN A 1 43  ? -6.973  7.355   14.938  1.00 0.00 ? 121 ASN A CA   2  
ATOM 2601  C C    . ASN A 1 43  ? -7.006  5.887   14.525  1.00 0.00 ? 121 ASN A C    2  
ATOM 2602  O O    . ASN A 1 43  ? -7.557  5.044   15.233  1.00 0.00 ? 121 ASN A O    2  
ATOM 2603  C CB   . ASN A 1 43  ? -7.776  7.552   16.225  1.00 0.00 ? 121 ASN A CB   2  
ATOM 2604  C CG   . ASN A 1 43  ? -6.959  7.256   17.468  1.00 0.00 ? 121 ASN A CG   2  
ATOM 2605  O OD1  . ASN A 1 43  ? -6.030  7.992   17.804  1.00 0.00 ? 121 ASN A OD1  2  
ATOM 2606  N ND2  . ASN A 1 43  ? -7.301  6.174   18.158  1.00 0.00 ? 121 ASN A ND2  2  
ATOM 2607  H H    . ASN A 1 43  ? -6.878  8.741   13.341  1.00 0.00 ? 121 ASN A H    2  
ATOM 2608  H HA   . ASN A 1 43  ? -5.948  7.644   15.116  1.00 0.00 ? 121 ASN A HA   2  
ATOM 2609  H HB2  . ASN A 1 43  ? -8.115  8.577   16.277  1.00 0.00 ? 121 ASN A HB2  2  
ATOM 2610  H HB3  . ASN A 1 43  ? -8.631  6.894   16.214  1.00 0.00 ? 121 ASN A HB3  2  
ATOM 2611  H HD21 . ASN A 1 43  ? -8.052  5.635   17.831  1.00 0.00 ? 121 ASN A HD21 2  
ATOM 2612  H HD22 . ASN A 1 43  ? -6.790  5.960   18.966  1.00 0.00 ? 121 ASN A HD22 2  
ATOM 2613  N N    . VAL A 1 44  ? -6.411  5.588   13.374  1.00 0.00 ? 122 VAL A N    2  
ATOM 2614  C CA   . VAL A 1 44  ? -6.371  4.222   12.867  1.00 0.00 ? 122 VAL A CA   2  
ATOM 2615  C C    . VAL A 1 44  ? -5.253  3.423   13.528  1.00 0.00 ? 122 VAL A C    2  
ATOM 2616  O O    . VAL A 1 44  ? -4.220  3.977   13.904  1.00 0.00 ? 122 VAL A O    2  
ATOM 2617  C CB   . VAL A 1 44  ? -6.172  4.196   11.340  1.00 0.00 ? 122 VAL A CB   2  
ATOM 2618  C CG1  . VAL A 1 44  ? -4.964  5.032   10.944  1.00 0.00 ? 122 VAL A CG1  2  
ATOM 2619  C CG2  . VAL A 1 44  ? -6.024  2.764   10.847  1.00 0.00 ? 122 VAL A CG2  2  
ATOM 2620  H H    . VAL A 1 44  ? -5.989  6.303   12.855  1.00 0.00 ? 122 VAL A H    2  
ATOM 2621  H HA   . VAL A 1 44  ? -7.317  3.753   13.094  1.00 0.00 ? 122 VAL A HA   2  
ATOM 2622  H HB   . VAL A 1 44  ? -7.047  4.626   10.876  1.00 0.00 ? 122 VAL A HB   2  
ATOM 2623  H HG11 . VAL A 1 44  ? -5.260  5.764   10.207  1.00 0.00 ? 122 VAL A HG11 2  
ATOM 2624  H HG12 . VAL A 1 44  ? -4.573  5.535   11.816  1.00 0.00 ? 122 VAL A HG12 2  
ATOM 2625  H HG13 . VAL A 1 44  ? -4.203  4.389   10.527  1.00 0.00 ? 122 VAL A HG13 2  
ATOM 2626  H HG21 . VAL A 1 44  ? -5.236  2.274   11.398  1.00 0.00 ? 122 VAL A HG21 2  
ATOM 2627  H HG22 . VAL A 1 44  ? -6.953  2.233   10.998  1.00 0.00 ? 122 VAL A HG22 2  
ATOM 2628  H HG23 . VAL A 1 44  ? -5.780  2.769   9.795   1.00 0.00 ? 122 VAL A HG23 2  
ATOM 2629  N N    . GLU A 1 45  ? -5.467  2.118   13.665  1.00 0.00 ? 123 GLU A N    2  
ATOM 2630  C CA   . GLU A 1 45  ? -4.476  1.243   14.281  1.00 0.00 ? 123 GLU A CA   2  
ATOM 2631  C C    . GLU A 1 45  ? -4.330  -0.054  13.492  1.00 0.00 ? 123 GLU A C    2  
ATOM 2632  O O    . GLU A 1 45  ? -5.294  -0.803  13.321  1.00 0.00 ? 123 GLU A O    2  
ATOM 2633  C CB   . GLU A 1 45  ? -4.868  0.931   15.727  1.00 0.00 ? 123 GLU A CB   2  
ATOM 2634  C CG   . GLU A 1 45  ? -3.681  0.635   16.629  1.00 0.00 ? 123 GLU A CG   2  
ATOM 2635  C CD   . GLU A 1 45  ? -3.248  -0.816  16.566  1.00 0.00 ? 123 GLU A CD   2  
ATOM 2636  O OE1  . GLU A 1 45  ? -4.086  -1.699  16.843  1.00 0.00 ? 123 GLU A OE1  2  
ATOM 2637  O OE2  . GLU A 1 45  ? -2.069  -1.069  16.238  1.00 0.00 ? 123 GLU A OE2  2  
ATOM 2638  H H    . GLU A 1 45  ? -6.310  1.735   13.346  1.00 0.00 ? 123 GLU A H    2  
ATOM 2639  H HA   . GLU A 1 45  ? -3.529  1.761   14.279  1.00 0.00 ? 123 GLU A HA   2  
ATOM 2640  H HB2  . GLU A 1 45  ? -5.401  1.778   16.134  1.00 0.00 ? 123 GLU A HB2  2  
ATOM 2641  H HB3  . GLU A 1 45  ? -5.520  0.071   15.733  1.00 0.00 ? 123 GLU A HB3  2  
ATOM 2642  H HG2  . GLU A 1 45  ? -2.851  1.256   16.326  1.00 0.00 ? 123 GLU A HG2  2  
ATOM 2643  H HG3  . GLU A 1 45  ? -3.952  0.871   17.648  1.00 0.00 ? 123 GLU A HG3  2  
ATOM 2644  N N    . LEU A 1 46  ? -3.119  -0.314  13.012  1.00 0.00 ? 124 LEU A N    2  
ATOM 2645  C CA   . LEU A 1 46  ? -2.845  -1.521  12.239  1.00 0.00 ? 124 LEU A CA   2  
ATOM 2646  C C    . LEU A 1 46  ? -3.116  -2.772  13.068  1.00 0.00 ? 124 LEU A C    2  
ATOM 2647  O O    . LEU A 1 46  ? -3.124  -2.724  14.298  1.00 0.00 ? 124 LEU A O    2  
ATOM 2648  C CB   . LEU A 1 46  ? -1.394  -1.521  11.753  1.00 0.00 ? 124 LEU A CB   2  
ATOM 2649  C CG   . LEU A 1 46  ? -1.101  -0.673  10.515  1.00 0.00 ? 124 LEU A CG   2  
ATOM 2650  C CD1  . LEU A 1 46  ? 0.383   -0.355  10.426  1.00 0.00 ? 124 LEU A CD1  2  
ATOM 2651  C CD2  . LEU A 1 46  ? -1.572  -1.387  9.256   1.00 0.00 ? 124 LEU A CD2  2  
ATOM 2652  H H    . LEU A 1 46  ? -2.391  0.319   13.180  1.00 0.00 ? 124 LEU A H    2  
ATOM 2653  H HA   . LEU A 1 46  ? -3.503  -1.522  11.383  1.00 0.00 ? 124 LEU A HA   2  
ATOM 2654  H HB2  . LEU A 1 46  ? -0.776  -1.155  12.559  1.00 0.00 ? 124 LEU A HB2  2  
ATOM 2655  H HB3  . LEU A 1 46  ? -1.122  -2.543  11.528  1.00 0.00 ? 124 LEU A HB3  2  
ATOM 2656  H HG   . LEU A 1 46  ? -1.638  0.262   10.592  1.00 0.00 ? 124 LEU A HG   2  
ATOM 2657  H HD11 . LEU A 1 46  ? 0.660   -0.218  9.391   1.00 0.00 ? 124 LEU A HD11 2  
ATOM 2658  H HD12 . LEU A 1 46  ? 0.952   -1.171  10.846  1.00 0.00 ? 124 LEU A HD12 2  
ATOM 2659  H HD13 . LEU A 1 46  ? 0.591   0.550   10.978  1.00 0.00 ? 124 LEU A HD13 2  
ATOM 2660  H HD21 . LEU A 1 46  ? -1.048  -2.325  9.158   1.00 0.00 ? 124 LEU A HD21 2  
ATOM 2661  H HD22 . LEU A 1 46  ? -1.368  -0.768  8.394   1.00 0.00 ? 124 LEU A HD22 2  
ATOM 2662  H HD23 . LEU A 1 46  ? -2.634  -1.572  9.324   1.00 0.00 ? 124 LEU A HD23 2  
ATOM 2663  N N    . SER A 1 47  ? -3.334  -3.892  12.387  1.00 0.00 ? 125 SER A N    2  
ATOM 2664  C CA   . SER A 1 47  ? -3.606  -5.156  13.061  1.00 0.00 ? 125 SER A CA   2  
ATOM 2665  C C    . SER A 1 47  ? -2.676  -6.254  12.554  1.00 0.00 ? 125 SER A C    2  
ATOM 2666  O O    . SER A 1 47  ? -2.208  -7.093  13.324  1.00 0.00 ? 125 SER A O    2  
ATOM 2667  C CB   . SER A 1 47  ? -5.064  -5.569  12.847  1.00 0.00 ? 125 SER A CB   2  
ATOM 2668  O OG   . SER A 1 47  ? -5.261  -6.934  13.174  1.00 0.00 ? 125 SER A OG   2  
ATOM 2669  H H    . SER A 1 47  ? -3.314  -3.867  11.407  1.00 0.00 ? 125 SER A H    2  
ATOM 2670  H HA   . SER A 1 47  ? -3.433  -5.013  14.117  1.00 0.00 ? 125 SER A HA   2  
ATOM 2671  H HB2  . SER A 1 47  ? -5.702  -4.966  13.474  1.00 0.00 ? 125 SER A HB2  2  
ATOM 2672  H HB3  . SER A 1 47  ? -5.330  -5.417  11.811  1.00 0.00 ? 125 SER A HB3  2  
ATOM 2673  H HG   . SER A 1 47  ? -5.567  -7.005  14.081  1.00 0.00 ? 125 SER A HG   2  
ATOM 2674  N N    . LYS A 1 48  ? -2.411  -6.241  11.252  1.00 0.00 ? 126 LYS A N    2  
ATOM 2675  C CA   . LYS A 1 48  ? -1.535  -7.233  10.639  1.00 0.00 ? 126 LYS A CA   2  
ATOM 2676  C C    . LYS A 1 48  ? -1.152  -6.820  9.222   1.00 0.00 ? 126 LYS A C    2  
ATOM 2677  O O    . LYS A 1 48  ? -1.872  -6.064  8.569   1.00 0.00 ? 126 LYS A O    2  
ATOM 2678  C CB   . LYS A 1 48  ? -2.220  -8.602  10.615  1.00 0.00 ? 126 LYS A CB   2  
ATOM 2679  C CG   . LYS A 1 48  ? -3.422  -8.665  9.689   1.00 0.00 ? 126 LYS A CG   2  
ATOM 2680  C CD   . LYS A 1 48  ? -3.795  -10.099 9.356   1.00 0.00 ? 126 LYS A CD   2  
ATOM 2681  C CE   . LYS A 1 48  ? -4.622  -10.732 10.465  1.00 0.00 ? 126 LYS A CE   2  
ATOM 2682  N NZ   . LYS A 1 48  ? -3.765  -11.394 11.487  1.00 0.00 ? 126 LYS A NZ   2  
ATOM 2683  H H    . LYS A 1 48  ? -2.814  -5.547  10.689  1.00 0.00 ? 126 LYS A H    2  
ATOM 2684  H HA   . LYS A 1 48  ? -0.639  -7.299  11.237  1.00 0.00 ? 126 LYS A HA   2  
ATOM 2685  H HB2  . LYS A 1 48  ? -1.504  -9.343  10.292  1.00 0.00 ? 126 LYS A HB2  2  
ATOM 2686  H HB3  . LYS A 1 48  ? -2.549  -8.844  11.615  1.00 0.00 ? 126 LYS A HB3  2  
ATOM 2687  H HG2  . LYS A 1 48  ? -4.262  -8.189  10.172  1.00 0.00 ? 126 LYS A HG2  2  
ATOM 2688  H HG3  . LYS A 1 48  ? -3.187  -8.141  8.773   1.00 0.00 ? 126 LYS A HG3  2  
ATOM 2689  H HD2  . LYS A 1 48  ? -4.371  -10.110 8.442   1.00 0.00 ? 126 LYS A HD2  2  
ATOM 2690  H HD3  . LYS A 1 48  ? -2.890  -10.675 9.220   1.00 0.00 ? 126 LYS A HD3  2  
ATOM 2691  H HE2  . LYS A 1 48  ? -5.208  -9.962  10.943  1.00 0.00 ? 126 LYS A HE2  2  
ATOM 2692  H HE3  . LYS A 1 48  ? -5.281  -11.468 10.029  1.00 0.00 ? 126 LYS A HE3  2  
ATOM 2693  H HZ1  . LYS A 1 48  ? -3.005  -10.750 11.787  1.00 0.00 ? 126 LYS A HZ1  2  
ATOM 2694  H HZ2  . LYS A 1 48  ? -3.336  -12.255 11.090  1.00 0.00 ? 126 LYS A HZ2  2  
ATOM 2695  H HZ3  . LYS A 1 48  ? -4.334  -11.654 12.317  1.00 0.00 ? 126 LYS A HZ3  2  
ATOM 2696  N N    . VAL A 1 49  ? -0.014  -7.320  8.751   1.00 0.00 ? 127 VAL A N    2  
ATOM 2697  C CA   . VAL A 1 49  ? 0.463   -7.005  7.410   1.00 0.00 ? 127 VAL A CA   2  
ATOM 2698  C C    . VAL A 1 49  ? 0.713   -8.274  6.603   1.00 0.00 ? 127 VAL A C    2  
ATOM 2699  O O    . VAL A 1 49  ? 1.356   -9.208  7.081   1.00 0.00 ? 127 VAL A O    2  
ATOM 2700  C CB   . VAL A 1 49  ? 1.760   -6.175  7.457   1.00 0.00 ? 127 VAL A CB   2  
ATOM 2701  C CG1  . VAL A 1 49  ? 2.323   -5.985  6.057   1.00 0.00 ? 127 VAL A CG1  2  
ATOM 2702  C CG2  . VAL A 1 49  ? 1.508   -4.832  8.126   1.00 0.00 ? 127 VAL A CG2  2  
ATOM 2703  H H    . VAL A 1 49  ? 0.516   -7.917  9.319   1.00 0.00 ? 127 VAL A H    2  
ATOM 2704  H HA   . VAL A 1 49  ? -0.297  -6.419  6.914   1.00 0.00 ? 127 VAL A HA   2  
ATOM 2705  H HB   . VAL A 1 49  ? 2.488   -6.715  8.044   1.00 0.00 ? 127 VAL A HB   2  
ATOM 2706  H HG11 . VAL A 1 49  ? 3.354   -6.308  6.037   1.00 0.00 ? 127 VAL A HG11 2  
ATOM 2707  H HG12 . VAL A 1 49  ? 1.747   -6.570  5.354   1.00 0.00 ? 127 VAL A HG12 2  
ATOM 2708  H HG13 . VAL A 1 49  ? 2.269   -4.941  5.786   1.00 0.00 ? 127 VAL A HG13 2  
ATOM 2709  H HG21 . VAL A 1 49  ? 0.453   -4.604  8.089   1.00 0.00 ? 127 VAL A HG21 2  
ATOM 2710  H HG22 . VAL A 1 49  ? 1.831   -4.876  9.156   1.00 0.00 ? 127 VAL A HG22 2  
ATOM 2711  H HG23 . VAL A 1 49  ? 2.061   -4.062  7.608   1.00 0.00 ? 127 VAL A HG23 2  
ATOM 2712  N N    . SER A 1 50  ? 0.202   -8.299  5.377   1.00 0.00 ? 128 SER A N    2  
ATOM 2713  C CA   . SER A 1 50  ? 0.367   -9.455  4.503   1.00 0.00 ? 128 SER A CA   2  
ATOM 2714  C C    . SER A 1 50  ? 1.294   -9.127  3.337   1.00 0.00 ? 128 SER A C    2  
ATOM 2715  O O    . SER A 1 50  ? 0.950   -8.333  2.459   1.00 0.00 ? 128 SER A O    2  
ATOM 2716  C CB   . SER A 1 50  ? -0.992  -9.920  3.975   1.00 0.00 ? 128 SER A CB   2  
ATOM 2717  O OG   . SER A 1 50  ? -0.882  -11.171 3.318   1.00 0.00 ? 128 SER A OG   2  
ATOM 2718  H H    . SER A 1 50  ? -0.301  -7.523  5.053   1.00 0.00 ? 128 SER A H    2  
ATOM 2719  H HA   . SER A 1 50  ? 0.808   -10.250 5.086   1.00 0.00 ? 128 SER A HA   2  
ATOM 2720  H HB2  . SER A 1 50  ? -1.681  -10.019 4.799   1.00 0.00 ? 128 SER A HB2  2  
ATOM 2721  H HB3  . SER A 1 50  ? -1.371  -9.190  3.274   1.00 0.00 ? 128 SER A HB3  2  
ATOM 2722  H HG   . SER A 1 50  ? -1.496  -11.199 2.580   1.00 0.00 ? 128 SER A HG   2  
ATOM 2723  N N    . LEU A 1 51  ? 2.471   -9.742  3.334   1.00 0.00 ? 129 LEU A N    2  
ATOM 2724  C CA   . LEU A 1 51  ? 3.450   -9.516  2.276   1.00 0.00 ? 129 LEU A CA   2  
ATOM 2725  C C    . LEU A 1 51  ? 3.534   -10.722 1.345   1.00 0.00 ? 129 LEU A C    2  
ATOM 2726  O O    . LEU A 1 51  ? 3.465   -11.869 1.789   1.00 0.00 ? 129 LEU A O    2  
ATOM 2727  C CB   . LEU A 1 51  ? 4.825   -9.226  2.879   1.00 0.00 ? 129 LEU A CB   2  
ATOM 2728  C CG   . LEU A 1 51  ? 5.979   -9.089  1.885   1.00 0.00 ? 129 LEU A CG   2  
ATOM 2729  C CD1  . LEU A 1 51  ? 5.979   -7.705  1.255   1.00 0.00 ? 129 LEU A CD1  2  
ATOM 2730  C CD2  . LEU A 1 51  ? 7.309   -9.365  2.571   1.00 0.00 ? 129 LEU A CD2  2  
ATOM 2731  H H    . LEU A 1 51  ? 2.689   -10.363 4.060   1.00 0.00 ? 129 LEU A H    2  
ATOM 2732  H HA   . LEU A 1 51  ? 3.128   -8.658  1.705   1.00 0.00 ? 129 LEU A HA   2  
ATOM 2733  H HB2  . LEU A 1 51  ? 4.755   -8.303  3.434   1.00 0.00 ? 129 LEU A HB2  2  
ATOM 2734  H HB3  . LEU A 1 51  ? 5.065   -10.034 3.557   1.00 0.00 ? 129 LEU A HB3  2  
ATOM 2735  H HG   . LEU A 1 51  ? 5.852   -9.815  1.094   1.00 0.00 ? 129 LEU A HG   2  
ATOM 2736  H HD11 . LEU A 1 51  ? 6.666   -7.688  0.423   1.00 0.00 ? 129 LEU A HD11 2  
ATOM 2737  H HD12 . LEU A 1 51  ? 6.285   -6.975  1.990   1.00 0.00 ? 129 LEU A HD12 2  
ATOM 2738  H HD13 . LEU A 1 51  ? 4.984   -7.468  0.907   1.00 0.00 ? 129 LEU A HD13 2  
ATOM 2739  H HD21 . LEU A 1 51  ? 7.686   -8.451  3.005   1.00 0.00 ? 129 LEU A HD21 2  
ATOM 2740  H HD22 . LEU A 1 51  ? 8.018   -9.737  1.845   1.00 0.00 ? 129 LEU A HD22 2  
ATOM 2741  H HD23 . LEU A 1 51  ? 7.168   -10.101 3.348   1.00 0.00 ? 129 LEU A HD23 2  
ATOM 2742  N N    . THR A 1 52  ? 3.685   -10.455 0.052   1.00 0.00 ? 130 THR A N    2  
ATOM 2743  C CA   . THR A 1 52  ? 3.779   -11.518 -0.941  1.00 0.00 ? 130 THR A CA   2  
ATOM 2744  C C    . THR A 1 52  ? 5.092   -12.282 -0.806  1.00 0.00 ? 130 THR A C    2  
ATOM 2745  O O    . THR A 1 52  ? 6.107   -11.745 -0.361  1.00 0.00 ? 130 THR A O    2  
ATOM 2746  C CB   . THR A 1 52  ? 3.668   -10.960 -2.373  1.00 0.00 ? 130 THR A CB   2  
ATOM 2747  O OG1  . THR A 1 52  ? 4.567   -9.858  -2.540  1.00 0.00 ? 130 THR A OG1  2  
ATOM 2748  C CG2  . THR A 1 52  ? 2.246   -10.511 -2.670  1.00 0.00 ? 130 THR A CG2  2  
ATOM 2749  H H    . THR A 1 52  ? 3.732   -9.521  -0.240  1.00 0.00 ? 130 THR A H    2  
ATOM 2750  H HA   . THR A 1 52  ? 2.958   -12.201 -0.779  1.00 0.00 ? 130 THR A HA   2  
ATOM 2751  H HB   . THR A 1 52  ? 3.936   -11.742 -3.069  1.00 0.00 ? 130 THR A HB   2  
ATOM 2752  H HG1  . THR A 1 52  ? 5.429   -10.091 -2.187  1.00 0.00 ? 130 THR A HG1  2  
ATOM 2753  H HG21 . THR A 1 52  ? 2.269   -9.612  -3.268  1.00 0.00 ? 130 THR A HG21 2  
ATOM 2754  H HG22 . THR A 1 52  ? 1.730   -10.313 -1.742  1.00 0.00 ? 130 THR A HG22 2  
ATOM 2755  H HG23 . THR A 1 52  ? 1.728   -11.289 -3.211  1.00 0.00 ? 130 THR A HG23 2  
ATOM 2756  N N    . PRO A 1 53  ? 5.074   -13.564 -1.199  1.00 0.00 ? 131 PRO A N    2  
ATOM 2757  C CA   . PRO A 1 53  ? 6.256   -14.429 -1.132  1.00 0.00 ? 131 PRO A CA   2  
ATOM 2758  C C    . PRO A 1 53  ? 7.323   -14.031 -2.145  1.00 0.00 ? 131 PRO A C    2  
ATOM 2759  O O    . PRO A 1 53  ? 8.501   -14.351 -1.979  1.00 0.00 ? 131 PRO A O    2  
ATOM 2760  C CB   . PRO A 1 53  ? 5.699   -15.817 -1.459  1.00 0.00 ? 131 PRO A CB   2  
ATOM 2761  C CG   . PRO A 1 53  ? 4.476   -15.553 -2.267  1.00 0.00 ? 131 PRO A CG   2  
ATOM 2762  C CD   . PRO A 1 53  ? 3.899   -14.269 -1.739  1.00 0.00 ? 131 PRO A CD   2  
ATOM 2763  H HA   . PRO A 1 53  ? 6.687   -14.436 -0.141  1.00 0.00 ? 131 PRO A HA   2  
ATOM 2764  H HB2  . PRO A 1 53  ? 6.432   -16.378 -2.021  1.00 0.00 ? 131 PRO A HB2  2  
ATOM 2765  H HB3  . PRO A 1 53  ? 5.463   -16.338 -0.543  1.00 0.00 ? 131 PRO A HB3  2  
ATOM 2766  H HG2  . PRO A 1 53  ? 4.739   -15.446 -3.308  1.00 0.00 ? 131 PRO A HG2  2  
ATOM 2767  H HG3  . PRO A 1 53  ? 3.770   -16.361 -2.138  1.00 0.00 ? 131 PRO A HG3  2  
ATOM 2768  H HD2  . PRO A 1 53  ? 3.444   -13.703 -2.538  1.00 0.00 ? 131 PRO A HD2  2  
ATOM 2769  H HD3  . PRO A 1 53  ? 3.179   -14.470 -0.959  1.00 0.00 ? 131 PRO A HD3  2  
ATOM 2770  N N    . ASP A 1 54  ? 6.905   -13.332 -3.195  1.00 0.00 ? 132 ASP A N    2  
ATOM 2771  C CA   . ASP A 1 54  ? 7.826   -12.889 -4.235  1.00 0.00 ? 132 ASP A CA   2  
ATOM 2772  C C    . ASP A 1 54  ? 8.396   -11.512 -3.906  1.00 0.00 ? 132 ASP A C    2  
ATOM 2773  O O    . ASP A 1 54  ? 9.151   -10.938 -4.690  1.00 0.00 ? 132 ASP A O    2  
ATOM 2774  C CB   . ASP A 1 54  ? 7.118   -12.851 -5.590  1.00 0.00 ? 132 ASP A CB   2  
ATOM 2775  C CG   . ASP A 1 54  ? 6.621   -14.216 -6.022  1.00 0.00 ? 132 ASP A CG   2  
ATOM 2776  O OD1  . ASP A 1 54  ? 7.464   -15.101 -6.280  1.00 0.00 ? 132 ASP A OD1  2  
ATOM 2777  O OD2  . ASP A 1 54  ? 5.388   -14.401 -6.101  1.00 0.00 ? 132 ASP A OD2  2  
ATOM 2778  H H    . ASP A 1 54  ? 5.954   -13.107 -3.271  1.00 0.00 ? 132 ASP A H    2  
ATOM 2779  H HA   . ASP A 1 54  ? 8.638   -13.598 -4.283  1.00 0.00 ? 132 ASP A HA   2  
ATOM 2780  H HB2  . ASP A 1 54  ? 6.271   -12.183 -5.528  1.00 0.00 ? 132 ASP A HB2  2  
ATOM 2781  H HB3  . ASP A 1 54  ? 7.806   -12.485 -6.338  1.00 0.00 ? 132 ASP A HB3  2  
ATOM 2782  N N    . PHE A 1 55  ? 8.028   -10.988 -2.742  1.00 0.00 ? 133 PHE A N    2  
ATOM 2783  C CA   . PHE A 1 55  ? 8.500   -9.678  -2.310  1.00 0.00 ? 133 PHE A CA   2  
ATOM 2784  C C    . PHE A 1 55  ? 8.110   -8.600  -3.317  1.00 0.00 ? 133 PHE A C    2  
ATOM 2785  O O    . PHE A 1 55  ? 8.769   -7.565  -3.421  1.00 0.00 ? 133 PHE A O    2  
ATOM 2786  C CB   . PHE A 1 55  ? 10.019  -9.695  -2.127  1.00 0.00 ? 133 PHE A CB   2  
ATOM 2787  C CG   . PHE A 1 55  ? 10.458  -10.274 -0.812  1.00 0.00 ? 133 PHE A CG   2  
ATOM 2788  C CD1  . PHE A 1 55  ? 9.917   -9.814  0.378   1.00 0.00 ? 133 PHE A CD1  2  
ATOM 2789  C CD2  . PHE A 1 55  ? 11.411  -11.279 -0.767  1.00 0.00 ? 133 PHE A CD2  2  
ATOM 2790  C CE1  . PHE A 1 55  ? 10.320  -10.345 1.588   1.00 0.00 ? 133 PHE A CE1  2  
ATOM 2791  C CE2  . PHE A 1 55  ? 11.818  -11.813 0.441   1.00 0.00 ? 133 PHE A CE2  2  
ATOM 2792  C CZ   . PHE A 1 55  ? 11.271  -11.346 1.620   1.00 0.00 ? 133 PHE A CZ   2  
ATOM 2793  H H    . PHE A 1 55  ? 7.423   -11.494 -2.159  1.00 0.00 ? 133 PHE A H    2  
ATOM 2794  H HA   . PHE A 1 55  ? 8.035   -9.454  -1.362  1.00 0.00 ? 133 PHE A HA   2  
ATOM 2795  H HB2  . PHE A 1 55  ? 10.463  -10.286 -2.914  1.00 0.00 ? 133 PHE A HB2  2  
ATOM 2796  H HB3  . PHE A 1 55  ? 10.393  -8.684  -2.187  1.00 0.00 ? 133 PHE A HB3  2  
ATOM 2797  H HD1  . PHE A 1 55  ? 9.173   -9.032  0.354   1.00 0.00 ? 133 PHE A HD1  2  
ATOM 2798  H HD2  . PHE A 1 55  ? 11.840  -11.645 -1.689  1.00 0.00 ? 133 PHE A HD2  2  
ATOM 2799  H HE1  . PHE A 1 55  ? 9.891   -9.978  2.509   1.00 0.00 ? 133 PHE A HE1  2  
ATOM 2800  H HE2  . PHE A 1 55  ? 12.561  -12.596 0.463   1.00 0.00 ? 133 PHE A HE2  2  
ATOM 2801  H HZ   . PHE A 1 55  ? 11.587  -11.762 2.565   1.00 0.00 ? 133 PHE A HZ   2  
ATOM 2802  N N    . SER A 1 56  ? 7.034   -8.851  -4.056  1.00 0.00 ? 134 SER A N    2  
ATOM 2803  C CA   . SER A 1 56  ? 6.558   -7.904  -5.058  1.00 0.00 ? 134 SER A CA   2  
ATOM 2804  C C    . SER A 1 56  ? 5.555   -6.928  -4.450  1.00 0.00 ? 134 SER A C    2  
ATOM 2805  O O    . SER A 1 56  ? 5.880   -5.771  -4.186  1.00 0.00 ? 134 SER A O    2  
ATOM 2806  C CB   . SER A 1 56  ? 5.916   -8.650  -6.229  1.00 0.00 ? 134 SER A CB   2  
ATOM 2807  O OG   . SER A 1 56  ? 4.806   -9.418  -5.798  1.00 0.00 ? 134 SER A OG   2  
ATOM 2808  H H    . SER A 1 56  ? 6.551   -9.694  -3.926  1.00 0.00 ? 134 SER A H    2  
ATOM 2809  H HA   . SER A 1 56  ? 7.410   -7.348  -5.420  1.00 0.00 ? 134 SER A HA   2  
ATOM 2810  H HB2  . SER A 1 56  ? 5.579   -7.936  -6.966  1.00 0.00 ? 134 SER A HB2  2  
ATOM 2811  H HB3  . SER A 1 56  ? 6.645   -9.311  -6.675  1.00 0.00 ? 134 SER A HB3  2  
ATOM 2812  H HG   . SER A 1 56  ? 5.118   -10.201 -5.338  1.00 0.00 ? 134 SER A HG   2  
ATOM 2813  N N    . ALA A 1 57  ? 4.334   -7.404  -4.232  1.00 0.00 ? 135 ALA A N    2  
ATOM 2814  C CA   . ALA A 1 57  ? 3.283   -6.576  -3.653  1.00 0.00 ? 135 ALA A CA   2  
ATOM 2815  C C    . ALA A 1 57  ? 3.273   -6.684  -2.132  1.00 0.00 ? 135 ALA A C    2  
ATOM 2816  O O    . ALA A 1 57  ? 3.547   -7.748  -1.575  1.00 0.00 ? 135 ALA A O    2  
ATOM 2817  C CB   . ALA A 1 57  ? 1.928   -6.970  -4.221  1.00 0.00 ? 135 ALA A CB   2  
ATOM 2818  H H    . ALA A 1 57  ? 4.135   -8.335  -4.464  1.00 0.00 ? 135 ALA A H    2  
ATOM 2819  H HA   . ALA A 1 57  ? 3.477   -5.550  -3.930  1.00 0.00 ? 135 ALA A HA   2  
ATOM 2820  H HB1  . ALA A 1 57  ? 1.319   -6.086  -4.344  1.00 0.00 ? 135 ALA A HB1  2  
ATOM 2821  H HB2  . ALA A 1 57  ? 2.064   -7.449  -5.179  1.00 0.00 ? 135 ALA A HB2  2  
ATOM 2822  H HB3  . ALA A 1 57  ? 1.438   -7.653  -3.543  1.00 0.00 ? 135 ALA A HB3  2  
ATOM 2823  N N    . CYS A 1 58  ? 2.957   -5.579  -1.468  1.00 0.00 ? 136 CYS A N    2  
ATOM 2824  C CA   . CYS A 1 58  ? 2.913   -5.549  -0.010  1.00 0.00 ? 136 CYS A CA   2  
ATOM 2825  C C    . CYS A 1 58  ? 1.543   -5.095  0.484   1.00 0.00 ? 136 CYS A C    2  
ATOM 2826  O O    . CYS A 1 58  ? 1.233   -3.903  0.475   1.00 0.00 ? 136 CYS A O    2  
ATOM 2827  C CB   . CYS A 1 58  ? 3.999   -4.621  0.535   1.00 0.00 ? 136 CYS A CB   2  
ATOM 2828  S SG   . CYS A 1 58  ? 3.904   -4.342  2.319   1.00 0.00 ? 136 CYS A SG   2  
ATOM 2829  H H    . CYS A 1 58  ? 2.748   -4.762  -1.968  1.00 0.00 ? 136 CYS A H    2  
ATOM 2830  H HA   . CYS A 1 58  ? 3.096   -6.552  0.347   1.00 0.00 ? 136 CYS A HA   2  
ATOM 2831  H HB2  . CYS A 1 58  ? 4.968   -5.048  0.321   1.00 0.00 ? 136 CYS A HB2  2  
ATOM 2832  H HB3  . CYS A 1 58  ? 3.920   -3.661  0.046   1.00 0.00 ? 136 CYS A HB3  2  
ATOM 2833  H HG   . CYS A 1 58  ? 2.702   -3.859  2.594   1.00 0.00 ? 136 CYS A HG   2  
ATOM 2834  N N    . ARG A 1 59  ? 0.727   -6.052  0.913   1.00 0.00 ? 137 ARG A N    2  
ATOM 2835  C CA   . ARG A 1 59  ? -0.611  -5.750  1.407   1.00 0.00 ? 137 ARG A CA   2  
ATOM 2836  C C    . ARG A 1 59  ? -0.620  -5.657  2.930   1.00 0.00 ? 137 ARG A C    2  
ATOM 2837  O O    . ARG A 1 59  ? 0.048   -6.434  3.613   1.00 0.00 ? 137 ARG A O    2  
ATOM 2838  C CB   . ARG A 1 59  ? -1.602  -6.820  0.945   1.00 0.00 ? 137 ARG A CB   2  
ATOM 2839  C CG   . ARG A 1 59  ? -1.859  -6.805  -0.553  1.00 0.00 ? 137 ARG A CG   2  
ATOM 2840  C CD   . ARG A 1 59  ? -2.109  -8.206  -1.089  1.00 0.00 ? 137 ARG A CD   2  
ATOM 2841  N NE   . ARG A 1 59  ? -3.252  -8.844  -0.441  1.00 0.00 ? 137 ARG A NE   2  
ATOM 2842  C CZ   . ARG A 1 59  ? -3.616  -10.102 -0.667  1.00 0.00 ? 137 ARG A CZ   2  
ATOM 2843  N NH1  . ARG A 1 59  ? -2.931  -10.851 -1.519  1.00 0.00 ? 137 ARG A NH1  2  
ATOM 2844  N NH2  . ARG A 1 59  ? -4.668  -10.612 -0.038  1.00 0.00 ? 137 ARG A NH2  2  
ATOM 2845  H H    . ARG A 1 59  ? 1.031   -6.983  0.895   1.00 0.00 ? 137 ARG A H    2  
ATOM 2846  H HA   . ARG A 1 59  ? -0.908  -4.796  0.999   1.00 0.00 ? 137 ARG A HA   2  
ATOM 2847  H HB2  . ARG A 1 59  ? -1.215  -7.792  1.212   1.00 0.00 ? 137 ARG A HB2  2  
ATOM 2848  H HB3  . ARG A 1 59  ? -2.543  -6.664  1.451   1.00 0.00 ? 137 ARG A HB3  2  
ATOM 2849  H HG2  . ARG A 1 59  ? -2.728  -6.195  -0.754  1.00 0.00 ? 137 ARG A HG2  2  
ATOM 2850  H HG3  . ARG A 1 59  ? -0.999  -6.385  -1.052  1.00 0.00 ? 137 ARG A HG3  2  
ATOM 2851  H HD2  . ARG A 1 59  ? -2.299  -8.142  -2.150  1.00 0.00 ? 137 ARG A HD2  2  
ATOM 2852  H HD3  . ARG A 1 59  ? -1.228  -8.805  -0.916  1.00 0.00 ? 137 ARG A HD3  2  
ATOM 2853  H HE   . ARG A 1 59  ? -3.772  -8.308  0.193   1.00 0.00 ? 137 ARG A HE   2  
ATOM 2854  H HH11 . ARG A 1 59  ? -2.138  -10.470 -1.993  1.00 0.00 ? 137 ARG A HH11 2  
ATOM 2855  H HH12 . ARG A 1 59  ? -3.207  -11.798 -1.686  1.00 0.00 ? 137 ARG A HH12 2  
ATOM 2856  H HH21 . ARG A 1 59  ? -5.186  -10.049 0.605   1.00 0.00 ? 137 ARG A HH21 2  
ATOM 2857  H HH22 . ARG A 1 59  ? -4.941  -11.558 -0.208  1.00 0.00 ? 137 ARG A HH22 2  
ATOM 2858  N N    . ALA A 1 60  ? -1.380  -4.702  3.456   1.00 0.00 ? 138 ALA A N    2  
ATOM 2859  C CA   . ALA A 1 60  ? -1.476  -4.509  4.897   1.00 0.00 ? 138 ALA A CA   2  
ATOM 2860  C C    . ALA A 1 60  ? -2.928  -4.340  5.332   1.00 0.00 ? 138 ALA A C    2  
ATOM 2861  O O    . ALA A 1 60  ? -3.696  -3.617  4.697   1.00 0.00 ? 138 ALA A O    2  
ATOM 2862  C CB   . ALA A 1 60  ? -0.651  -3.304  5.325   1.00 0.00 ? 138 ALA A CB   2  
ATOM 2863  H H    . ALA A 1 60  ? -1.888  -4.114  2.860   1.00 0.00 ? 138 ALA A H    2  
ATOM 2864  H HA   . ALA A 1 60  ? -1.066  -5.385  5.379   1.00 0.00 ? 138 ALA A HA   2  
ATOM 2865  H HB1  . ALA A 1 60  ? 0.394   -3.497  5.129   1.00 0.00 ? 138 ALA A HB1  2  
ATOM 2866  H HB2  . ALA A 1 60  ? -0.968  -2.435  4.768   1.00 0.00 ? 138 ALA A HB2  2  
ATOM 2867  H HB3  . ALA A 1 60  ? -0.793  -3.127  6.380   1.00 0.00 ? 138 ALA A HB3  2  
ATOM 2868  N N    . TYR A 1 61  ? -3.297  -5.011  6.418   1.00 0.00 ? 139 TYR A N    2  
ATOM 2869  C CA   . TYR A 1 61  ? -4.658  -4.937  6.936   1.00 0.00 ? 139 TYR A CA   2  
ATOM 2870  C C    . TYR A 1 61  ? -4.737  -3.985  8.125   1.00 0.00 ? 139 TYR A C    2  
ATOM 2871  O O    . TYR A 1 61  ? -3.927  -4.059  9.049   1.00 0.00 ? 139 TYR A O    2  
ATOM 2872  C CB   . TYR A 1 61  ? -5.145  -6.327  7.347   1.00 0.00 ? 139 TYR A CB   2  
ATOM 2873  C CG   . TYR A 1 61  ? -5.323  -7.276  6.183   1.00 0.00 ? 139 TYR A CG   2  
ATOM 2874  C CD1  . TYR A 1 61  ? -4.229  -7.718  5.449   1.00 0.00 ? 139 TYR A CD1  2  
ATOM 2875  C CD2  . TYR A 1 61  ? -6.583  -7.730  5.817   1.00 0.00 ? 139 TYR A CD2  2  
ATOM 2876  C CE1  . TYR A 1 61  ? -4.386  -8.584  4.385   1.00 0.00 ? 139 TYR A CE1  2  
ATOM 2877  C CE2  . TYR A 1 61  ? -6.750  -8.597  4.755   1.00 0.00 ? 139 TYR A CE2  2  
ATOM 2878  C CZ   . TYR A 1 61  ? -5.648  -9.021  4.042   1.00 0.00 ? 139 TYR A CZ   2  
ATOM 2879  O OH   . TYR A 1 61  ? -5.809  -9.884  2.982   1.00 0.00 ? 139 TYR A OH   2  
ATOM 2880  H H    . TYR A 1 61  ? -2.639  -5.570  6.881   1.00 0.00 ? 139 TYR A H    2  
ATOM 2881  H HA   . TYR A 1 61  ? -5.293  -4.563  6.147   1.00 0.00 ? 139 TYR A HA   2  
ATOM 2882  H HB2  . TYR A 1 61  ? -4.430  -6.766  8.026   1.00 0.00 ? 139 TYR A HB2  2  
ATOM 2883  H HB3  . TYR A 1 61  ? -6.098  -6.234  7.847   1.00 0.00 ? 139 TYR A HB3  2  
ATOM 2884  H HD1  . TYR A 1 61  ? -3.241  -7.373  5.720   1.00 0.00 ? 139 TYR A HD1  2  
ATOM 2885  H HD2  . TYR A 1 61  ? -7.444  -7.395  6.378   1.00 0.00 ? 139 TYR A HD2  2  
ATOM 2886  H HE1  . TYR A 1 61  ? -3.523  -8.916  3.826   1.00 0.00 ? 139 TYR A HE1  2  
ATOM 2887  H HE2  . TYR A 1 61  ? -7.738  -8.939  4.486   1.00 0.00 ? 139 TYR A HE2  2  
ATOM 2888  H HH   . TYR A 1 61  ? -6.003  -9.382  2.187   1.00 0.00 ? 139 TYR A HH   2  
ATOM 2889  N N    . TRP A 1 62  ? -5.720  -3.092  8.095   1.00 0.00 ? 140 TRP A N    2  
ATOM 2890  C CA   . TRP A 1 62  ? -5.907  -2.125  9.171   1.00 0.00 ? 140 TRP A CA   2  
ATOM 2891  C C    . TRP A 1 62  ? -7.297  -2.254  9.784   1.00 0.00 ? 140 TRP A C    2  
ATOM 2892  O O    . TRP A 1 62  ? -8.275  -2.506  9.080   1.00 0.00 ? 140 TRP A O    2  
ATOM 2893  C CB   . TRP A 1 62  ? -5.696  -0.703  8.649   1.00 0.00 ? 140 TRP A CB   2  
ATOM 2894  C CG   . TRP A 1 62  ? -6.529  -0.383  7.445   1.00 0.00 ? 140 TRP A CG   2  
ATOM 2895  C CD1  . TRP A 1 62  ? -6.345  -0.847  6.174   1.00 0.00 ? 140 TRP A CD1  2  
ATOM 2896  C CD2  . TRP A 1 62  ? -7.676  0.473   7.399   1.00 0.00 ? 140 TRP A CD2  2  
ATOM 2897  N NE1  . TRP A 1 62  ? -7.309  -0.332  5.341   1.00 0.00 ? 140 TRP A NE1  2  
ATOM 2898  C CE2  . TRP A 1 62  ? -8.137  0.480   6.069   1.00 0.00 ? 140 TRP A CE2  2  
ATOM 2899  C CE3  . TRP A 1 62  ? -8.359  1.232   8.353   1.00 0.00 ? 140 TRP A CE3  2  
ATOM 2900  C CZ2  . TRP A 1 62  ? -9.249  1.219   5.671   1.00 0.00 ? 140 TRP A CZ2  2  
ATOM 2901  C CZ3  . TRP A 1 62  ? -9.462  1.964   7.957   1.00 0.00 ? 140 TRP A CZ3  2  
ATOM 2902  C CH2  . TRP A 1 62  ? -9.899  1.953   6.626   1.00 0.00 ? 140 TRP A CH2  2  
ATOM 2903  H H    . TRP A 1 62  ? -6.334  -3.083  7.332   1.00 0.00 ? 140 TRP A H    2  
ATOM 2904  H HA   . TRP A 1 62  ? -5.170  -2.332  9.933   1.00 0.00 ? 140 TRP A HA   2  
ATOM 2905  H HB2  . TRP A 1 62  ? -5.950  0.001   9.427   1.00 0.00 ? 140 TRP A HB2  2  
ATOM 2906  H HB3  . TRP A 1 62  ? -4.657  -0.577  8.379   1.00 0.00 ? 140 TRP A HB3  2  
ATOM 2907  H HD1  . TRP A 1 62  ? -5.553  -1.519  5.881   1.00 0.00 ? 140 TRP A HD1  2  
ATOM 2908  H HE1  . TRP A 1 62  ? -7.389  -0.517  4.381   1.00 0.00 ? 140 TRP A HE1  2  
ATOM 2909  H HE3  . TRP A 1 62  ? -8.038  1.253   9.384   1.00 0.00 ? 140 TRP A HE3  2  
ATOM 2910  H HZ2  . TRP A 1 62  ? -9.599  1.220   4.649   1.00 0.00 ? 140 TRP A HZ2  2  
ATOM 2911  H HZ3  . TRP A 1 62  ? -10.002 2.557   8.680   1.00 0.00 ? 140 TRP A HZ3  2  
ATOM 2912  H HH2  . TRP A 1 62  ? -10.764 2.540   6.361   1.00 0.00 ? 140 TRP A HH2  2  
ATOM 2913  N N    . LYS A 1 63  ? -7.378  -2.080  11.098  1.00 0.00 ? 141 LYS A N    2  
ATOM 2914  C CA   . LYS A 1 63  ? -8.649  -2.176  11.806  1.00 0.00 ? 141 LYS A CA   2  
ATOM 2915  C C    . LYS A 1 63  ? -9.688  -1.245  11.187  1.00 0.00 ? 141 LYS A C    2  
ATOM 2916  O O    . LYS A 1 63  ? -9.496  -0.030  11.136  1.00 0.00 ? 141 LYS A O    2  
ATOM 2917  C CB   . LYS A 1 63  ? -8.459  -1.833  13.286  1.00 0.00 ? 141 LYS A CB   2  
ATOM 2918  C CG   . LYS A 1 63  ? -7.870  -2.970  14.103  1.00 0.00 ? 141 LYS A CG   2  
ATOM 2919  C CD   . LYS A 1 63  ? -8.950  -3.909  14.612  1.00 0.00 ? 141 LYS A CD   2  
ATOM 2920  C CE   . LYS A 1 63  ? -8.428  -5.329  14.766  1.00 0.00 ? 141 LYS A CE   2  
ATOM 2921  N NZ   . LYS A 1 63  ? -8.494  -6.086  13.486  1.00 0.00 ? 141 LYS A NZ   2  
ATOM 2922  H H    . LYS A 1 63  ? -6.562  -1.882  11.605  1.00 0.00 ? 141 LYS A H    2  
ATOM 2923  H HA   . LYS A 1 63  ? -9.000  -3.193  11.723  1.00 0.00 ? 141 LYS A HA   2  
ATOM 2924  H HB2  . LYS A 1 63  ? -7.800  -0.981  13.364  1.00 0.00 ? 141 LYS A HB2  2  
ATOM 2925  H HB3  . LYS A 1 63  ? -9.419  -1.574  13.709  1.00 0.00 ? 141 LYS A HB3  2  
ATOM 2926  H HG2  . LYS A 1 63  ? -7.185  -3.529  13.483  1.00 0.00 ? 141 LYS A HG2  2  
ATOM 2927  H HG3  . LYS A 1 63  ? -7.338  -2.556  14.947  1.00 0.00 ? 141 LYS A HG3  2  
ATOM 2928  H HD2  . LYS A 1 63  ? -9.296  -3.558  15.574  1.00 0.00 ? 141 LYS A HD2  2  
ATOM 2929  H HD3  . LYS A 1 63  ? -9.773  -3.911  13.911  1.00 0.00 ? 141 LYS A HD3  2  
ATOM 2930  H HE2  . LYS A 1 63  ? -7.401  -5.287  15.097  1.00 0.00 ? 141 LYS A HE2  2  
ATOM 2931  H HE3  . LYS A 1 63  ? -9.024  -5.839  15.508  1.00 0.00 ? 141 LYS A HE3  2  
ATOM 2932  H HZ1  . LYS A 1 63  ? -9.456  -6.454  13.338  1.00 0.00 ? 141 LYS A HZ1  2  
ATOM 2933  H HZ2  . LYS A 1 63  ? -7.830  -6.886  13.509  1.00 0.00 ? 141 LYS A HZ2  2  
ATOM 2934  H HZ3  . LYS A 1 63  ? -8.245  -5.465  12.690  1.00 0.00 ? 141 LYS A HZ3  2  
ATOM 2935  N N    . THR A 1 64  ? -10.789 -1.824  10.719  1.00 0.00 ? 142 THR A N    2  
ATOM 2936  C CA   . THR A 1 64  ? -11.858 -1.047  10.104  1.00 0.00 ? 142 THR A CA   2  
ATOM 2937  C C    . THR A 1 64  ? -13.176 -1.244  10.844  1.00 0.00 ? 142 THR A C    2  
ATOM 2938  O O    . THR A 1 64  ? -13.282 -2.090  11.733  1.00 0.00 ? 142 THR A O    2  
ATOM 2939  C CB   . THR A 1 64  ? -12.051 -1.430  8.625   1.00 0.00 ? 142 THR A CB   2  
ATOM 2940  O OG1  . THR A 1 64  ? -12.330 -2.830  8.513   1.00 0.00 ? 142 THR A OG1  2  
ATOM 2941  C CG2  . THR A 1 64  ? -10.812 -1.087  7.811   1.00 0.00 ? 142 THR A CG2  2  
ATOM 2942  H H    . THR A 1 64  ? -10.884 -2.797  10.789  1.00 0.00 ? 142 THR A H    2  
ATOM 2943  H HA   . THR A 1 64  ? -11.582 -0.004  10.152  1.00 0.00 ? 142 THR A HA   2  
ATOM 2944  H HB   . THR A 1 64  ? -12.888 -0.871  8.230   1.00 0.00 ? 142 THR A HB   2  
ATOM 2945  H HG1  . THR A 1 64  ? -11.940 -3.294  9.258   1.00 0.00 ? 142 THR A HG1  2  
ATOM 2946  H HG21 . THR A 1 64  ? -11.092 -0.915  6.783   1.00 0.00 ? 142 THR A HG21 2  
ATOM 2947  H HG22 . THR A 1 64  ? -10.111 -1.907  7.861   1.00 0.00 ? 142 THR A HG22 2  
ATOM 2948  H HG23 . THR A 1 64  ? -10.353 -0.196  8.213   1.00 0.00 ? 142 THR A HG23 2  
ATOM 2949  N N    . THR A 1 65  ? -14.182 -0.457  10.472  1.00 0.00 ? 143 THR A N    2  
ATOM 2950  C CA   . THR A 1 65  ? -15.493 -0.544  11.101  1.00 0.00 ? 143 THR A CA   2  
ATOM 2951  C C    . THR A 1 65  ? -16.471 -1.322  10.228  1.00 0.00 ? 143 THR A C    2  
ATOM 2952  O O    . THR A 1 65  ? -16.134 -1.737  9.118   1.00 0.00 ? 143 THR A O    2  
ATOM 2953  C CB   . THR A 1 65  ? -16.075 0.854   11.384  1.00 0.00 ? 143 THR A CB   2  
ATOM 2954  O OG1  . THR A 1 65  ? -16.509 1.460   10.161  1.00 0.00 ? 143 THR A OG1  2  
ATOM 2955  C CG2  . THR A 1 65  ? -15.042 1.744   12.058  1.00 0.00 ? 143 THR A CG2  2  
ATOM 2956  H H    . THR A 1 65  ? -14.035 0.198   9.758   1.00 0.00 ? 143 THR A H    2  
ATOM 2957  H HA   . THR A 1 65  ? -15.378 -1.060  12.043  1.00 0.00 ? 143 THR A HA   2  
ATOM 2958  H HB   . THR A 1 65  ? -16.924 0.747   12.045  1.00 0.00 ? 143 THR A HB   2  
ATOM 2959  H HG1  . THR A 1 65  ? -17.245 2.050   10.340  1.00 0.00 ? 143 THR A HG1  2  
ATOM 2960  H HG21 . THR A 1 65  ? -15.291 2.780   11.884  1.00 0.00 ? 143 THR A HG21 2  
ATOM 2961  H HG22 . THR A 1 65  ? -14.065 1.534   11.650  1.00 0.00 ? 143 THR A HG22 2  
ATOM 2962  H HG23 . THR A 1 65  ? -15.039 1.549   13.120  1.00 0.00 ? 143 THR A HG23 2  
ATOM 2963  N N    . LEU A 1 66  ? -17.684 -1.516  10.734  1.00 0.00 ? 144 LEU A N    2  
ATOM 2964  C CA   . LEU A 1 66  ? -18.712 -2.244  9.998   1.00 0.00 ? 144 LEU A CA   2  
ATOM 2965  C C    . LEU A 1 66  ? -19.545 -1.295  9.142   1.00 0.00 ? 144 LEU A C    2  
ATOM 2966  O O    . LEU A 1 66  ? -20.667 -1.617  8.752   1.00 0.00 ? 144 LEU A O    2  
ATOM 2967  C CB   . LEU A 1 66  ? -19.620 -3.003  10.968  1.00 0.00 ? 144 LEU A CB   2  
ATOM 2968  C CG   . LEU A 1 66  ? -20.411 -4.169  10.374  1.00 0.00 ? 144 LEU A CG   2  
ATOM 2969  C CD1  . LEU A 1 66  ? -19.495 -5.353  10.105  1.00 0.00 ? 144 LEU A CD1  2  
ATOM 2970  C CD2  . LEU A 1 66  ? -21.546 -4.571  11.304  1.00 0.00 ? 144 LEU A CD2  2  
ATOM 2971  H H    . LEU A 1 66  ? -17.894 -1.161  11.622  1.00 0.00 ? 144 LEU A H    2  
ATOM 2972  H HA   . LEU A 1 66  ? -18.218 -2.953  9.351   1.00 0.00 ? 144 LEU A HA   2  
ATOM 2973  H HB2  . LEU A 1 66  ? -19.002 -3.393  11.762  1.00 0.00 ? 144 LEU A HB2  2  
ATOM 2974  H HB3  . LEU A 1 66  ? -20.328 -2.296  11.379  1.00 0.00 ? 144 LEU A HB3  2  
ATOM 2975  H HG   . LEU A 1 66  ? -20.842 -3.860  9.432   1.00 0.00 ? 144 LEU A HG   2  
ATOM 2976  H HD11 . LEU A 1 66  ? -19.911 -6.240  10.557  1.00 0.00 ? 144 LEU A HD11 2  
ATOM 2977  H HD12 . LEU A 1 66  ? -18.520 -5.157  10.527  1.00 0.00 ? 144 LEU A HD12 2  
ATOM 2978  H HD13 . LEU A 1 66  ? -19.402 -5.500  9.039   1.00 0.00 ? 144 LEU A HD13 2  
ATOM 2979  H HD21 . LEU A 1 66  ? -21.147 -5.132  12.137  1.00 0.00 ? 144 LEU A HD21 2  
ATOM 2980  H HD22 . LEU A 1 66  ? -22.254 -5.184  10.764  1.00 0.00 ? 144 LEU A HD22 2  
ATOM 2981  H HD23 . LEU A 1 66  ? -22.043 -3.685  11.671  1.00 0.00 ? 144 LEU A HD23 2  
ATOM 2982  N N    . SER A 1 67  ? -18.986 -0.124  8.851   1.00 0.00 ? 145 SER A N    2  
ATOM 2983  C CA   . SER A 1 67  ? -19.677 0.873   8.042   1.00 0.00 ? 145 SER A CA   2  
ATOM 2984  C C    . SER A 1 67  ? -18.903 1.163   6.760   1.00 0.00 ? 145 SER A C    2  
ATOM 2985  O O    . SER A 1 67  ? -17.717 1.488   6.798   1.00 0.00 ? 145 SER A O    2  
ATOM 2986  C CB   . SER A 1 67  ? -19.868 2.164   8.840   1.00 0.00 ? 145 SER A CB   2  
ATOM 2987  O OG   . SER A 1 67  ? -20.637 1.933   10.008  1.00 0.00 ? 145 SER A OG   2  
ATOM 2988  H H    . SER A 1 67  ? -18.088 0.074   9.192   1.00 0.00 ? 145 SER A H    2  
ATOM 2989  H HA   . SER A 1 67  ? -20.646 0.474   7.781   1.00 0.00 ? 145 SER A HA   2  
ATOM 2990  H HB2  . SER A 1 67  ? -18.903 2.552   9.130   1.00 0.00 ? 145 SER A HB2  2  
ATOM 2991  H HB3  . SER A 1 67  ? -20.378 2.892   8.225   1.00 0.00 ? 145 SER A HB3  2  
ATOM 2992  H HG   . SER A 1 67  ? -21.468 2.409   9.943   1.00 0.00 ? 145 SER A HG   2  
ATOM 2993  N N    . ALA A 1 68  ? -19.584 1.044   5.625   1.00 0.00 ? 146 ALA A N    2  
ATOM 2994  C CA   . ALA A 1 68  ? -18.962 1.295   4.331   1.00 0.00 ? 146 ALA A CA   2  
ATOM 2995  C C    . ALA A 1 68  ? -18.603 2.769   4.172   1.00 0.00 ? 146 ALA A C    2  
ATOM 2996  O O    . ALA A 1 68  ? -17.605 3.108   3.535   1.00 0.00 ? 146 ALA A O    2  
ATOM 2997  C CB   . ALA A 1 68  ? -19.886 0.851   3.207   1.00 0.00 ? 146 ALA A CB   2  
ATOM 2998  H H    . ALA A 1 68  ? -20.528 0.782   5.659   1.00 0.00 ? 146 ALA A H    2  
ATOM 2999  H HA   . ALA A 1 68  ? -18.058 0.706   4.275   1.00 0.00 ? 146 ALA A HA   2  
ATOM 3000  H HB1  . ALA A 1 68  ? -19.755 -0.207  3.031   1.00 0.00 ? 146 ALA A HB1  2  
ATOM 3001  H HB2  . ALA A 1 68  ? -20.911 1.046   3.485   1.00 0.00 ? 146 ALA A HB2  2  
ATOM 3002  H HB3  . ALA A 1 68  ? -19.647 1.398   2.307   1.00 0.00 ? 146 ALA A HB3  2  
ATOM 3003  N N    . GLU A 1 69  ? -19.422 3.640   4.753   1.00 0.00 ? 147 GLU A N    2  
ATOM 3004  C CA   . GLU A 1 69  ? -19.189 5.077   4.674   1.00 0.00 ? 147 GLU A CA   2  
ATOM 3005  C C    . GLU A 1 69  ? -17.829 5.441   5.262   1.00 0.00 ? 147 GLU A C    2  
ATOM 3006  O O    . GLU A 1 69  ? -17.059 6.185   4.656   1.00 0.00 ? 147 GLU A O    2  
ATOM 3007  C CB   . GLU A 1 69  ? -20.295 5.836   5.408   1.00 0.00 ? 147 GLU A CB   2  
ATOM 3008  C CG   . GLU A 1 69  ? -20.367 5.522   6.893   1.00 0.00 ? 147 GLU A CG   2  
ATOM 3009  C CD   . GLU A 1 69  ? -21.742 5.780   7.479   1.00 0.00 ? 147 GLU A CD   2  
ATOM 3010  O OE1  . GLU A 1 69  ? -22.629 4.917   7.311   1.00 0.00 ? 147 GLU A OE1  2  
ATOM 3011  O OE2  . GLU A 1 69  ? -21.931 6.844   8.103   1.00 0.00 ? 147 GLU A OE2  2  
ATOM 3012  H H    . GLU A 1 69  ? -20.200 3.308   5.247   1.00 0.00 ? 147 GLU A H    2  
ATOM 3013  H HA   . GLU A 1 69  ? -19.203 5.358   3.631   1.00 0.00 ? 147 GLU A HA   2  
ATOM 3014  H HB2  . GLU A 1 69  ? -20.125 6.897   5.294   1.00 0.00 ? 147 GLU A HB2  2  
ATOM 3015  H HB3  . GLU A 1 69  ? -21.246 5.584   4.962   1.00 0.00 ? 147 GLU A HB3  2  
ATOM 3016  H HG2  . GLU A 1 69  ? -20.120 4.481   7.040   1.00 0.00 ? 147 GLU A HG2  2  
ATOM 3017  H HG3  . GLU A 1 69  ? -19.649 6.138   7.414   1.00 0.00 ? 147 GLU A HG3  2  
ATOM 3018  N N    . GLN A 1 70  ? -17.543 4.912   6.448   1.00 0.00 ? 148 GLN A N    2  
ATOM 3019  C CA   . GLN A 1 70  ? -16.277 5.183   7.119   1.00 0.00 ? 148 GLN A CA   2  
ATOM 3020  C C    . GLN A 1 70  ? -15.122 4.491   6.402   1.00 0.00 ? 148 GLN A C    2  
ATOM 3021  O O    . GLN A 1 70  ? -14.045 5.064   6.246   1.00 0.00 ? 148 GLN A O    2  
ATOM 3022  C CB   . GLN A 1 70  ? -16.339 4.721   8.576   1.00 0.00 ? 148 GLN A CB   2  
ATOM 3023  C CG   . GLN A 1 70  ? -15.504 5.571   9.520   1.00 0.00 ? 148 GLN A CG   2  
ATOM 3024  C CD   . GLN A 1 70  ? -14.955 4.776   10.689  1.00 0.00 ? 148 GLN A CD   2  
ATOM 3025  O OE1  . GLN A 1 70  ? -15.371 4.965   11.832  1.00 0.00 ? 148 GLN A OE1  2  
ATOM 3026  N NE2  . GLN A 1 70  ? -14.016 3.881   10.408  1.00 0.00 ? 148 GLN A NE2  2  
ATOM 3027  H H    . GLN A 1 70  ? -18.198 4.328   6.881   1.00 0.00 ? 148 GLN A H    2  
ATOM 3028  H HA   . GLN A 1 70  ? -16.111 6.250   7.096   1.00 0.00 ? 148 GLN A HA   2  
ATOM 3029  H HB2  . GLN A 1 70  ? -17.366 4.755   8.908   1.00 0.00 ? 148 GLN A HB2  2  
ATOM 3030  H HB3  . GLN A 1 70  ? -15.984 3.703   8.633   1.00 0.00 ? 148 GLN A HB3  2  
ATOM 3031  H HG2  . GLN A 1 70  ? -14.675 5.989   8.969   1.00 0.00 ? 148 GLN A HG2  2  
ATOM 3032  H HG3  . GLN A 1 70  ? -16.120 6.370   9.904   1.00 0.00 ? 148 GLN A HG3  2  
ATOM 3033  H HE21 . GLN A 1 70  ? -13.732 3.786   9.474   1.00 0.00 ? 148 GLN A HE21 2  
ATOM 3034  H HE22 . GLN A 1 70  ? -13.643 3.354   11.144  1.00 0.00 ? 148 GLN A HE22 2  
ATOM 3035  N N    . ASN A 1 71  ? -15.355 3.256   5.970   1.00 0.00 ? 149 ASN A N    2  
ATOM 3036  C CA   . ASN A 1 71  ? -14.333 2.486   5.270   1.00 0.00 ? 149 ASN A CA   2  
ATOM 3037  C C    . ASN A 1 71  ? -13.990 3.129   3.930   1.00 0.00 ? 149 ASN A C    2  
ATOM 3038  O O    . ASN A 1 71  ? -12.836 3.114   3.501   1.00 0.00 ? 149 ASN A O    2  
ATOM 3039  C CB   . ASN A 1 71  ? -14.810 1.048   5.052   1.00 0.00 ? 149 ASN A CB   2  
ATOM 3040  C CG   . ASN A 1 71  ? -14.918 0.272   6.350   1.00 0.00 ? 149 ASN A CG   2  
ATOM 3041  O OD1  . ASN A 1 71  ? -14.462 0.727   7.399   1.00 0.00 ? 149 ASN A OD1  2  
ATOM 3042  N ND2  . ASN A 1 71  ? -15.525 -0.907  6.285   1.00 0.00 ? 149 ASN A ND2  2  
ATOM 3043  H H    . ASN A 1 71  ? -16.235 2.853   6.125   1.00 0.00 ? 149 ASN A H    2  
ATOM 3044  H HA   . ASN A 1 71  ? -13.448 2.473   5.888   1.00 0.00 ? 149 ASN A HA   2  
ATOM 3045  H HB2  . ASN A 1 71  ? -15.783 1.065   4.583   1.00 0.00 ? 149 ASN A HB2  2  
ATOM 3046  H HB3  . ASN A 1 71  ? -14.111 0.538   4.406   1.00 0.00 ? 149 ASN A HB3  2  
ATOM 3047  H HD21 . ASN A 1 71  ? -15.864 -1.206  5.415   1.00 0.00 ? 149 ASN A HD21 2  
ATOM 3048  H HD22 . ASN A 1 71  ? -15.610 -1.430  7.109   1.00 0.00 ? 149 ASN A HD22 2  
ATOM 3049  N N    . ALA A 1 72  ? -14.999 3.693   3.275   1.00 0.00 ? 150 ALA A N    2  
ATOM 3050  C CA   . ALA A 1 72  ? -14.803 4.344   1.985   1.00 0.00 ? 150 ALA A CA   2  
ATOM 3051  C C    . ALA A 1 72  ? -13.979 5.618   2.132   1.00 0.00 ? 150 ALA A C    2  
ATOM 3052  O O    . ALA A 1 72  ? -13.029 5.846   1.382   1.00 0.00 ? 150 ALA A O    2  
ATOM 3053  C CB   . ALA A 1 72  ? -16.146 4.653   1.341   1.00 0.00 ? 150 ALA A CB   2  
ATOM 3054  H H    . ALA A 1 72  ? -15.895 3.673   3.669   1.00 0.00 ? 150 ALA A H    2  
ATOM 3055  H HA   . ALA A 1 72  ? -14.273 3.656   1.342   1.00 0.00 ? 150 ALA A HA   2  
ATOM 3056  H HB1  . ALA A 1 72  ? -16.698 5.336   1.971   1.00 0.00 ? 150 ALA A HB1  2  
ATOM 3057  H HB2  . ALA A 1 72  ? -15.986 5.106   0.374   1.00 0.00 ? 150 ALA A HB2  2  
ATOM 3058  H HB3  . ALA A 1 72  ? -16.708 3.739   1.223   1.00 0.00 ? 150 ALA A HB3  2  
ATOM 3059  N N    . HIS A 1 73  ? -14.348 6.448   3.104   1.00 0.00 ? 151 HIS A N    2  
ATOM 3060  C CA   . HIS A 1 73  ? -13.642 7.700   3.349   1.00 0.00 ? 151 HIS A CA   2  
ATOM 3061  C C    . HIS A 1 73  ? -12.245 7.437   3.903   1.00 0.00 ? 151 HIS A C    2  
ATOM 3062  O O    . HIS A 1 73  ? -11.259 7.986   3.413   1.00 0.00 ? 151 HIS A O    2  
ATOM 3063  C CB   . HIS A 1 73  ? -14.434 8.574   4.322   1.00 0.00 ? 151 HIS A CB   2  
ATOM 3064  C CG   . HIS A 1 73  ? -13.617 9.660   4.952   1.00 0.00 ? 151 HIS A CG   2  
ATOM 3065  N ND1  . HIS A 1 73  ? -13.836 11.000  4.714   1.00 0.00 ? 151 HIS A ND1  2  
ATOM 3066  C CD2  . HIS A 1 73  ? -12.578 9.598   5.818   1.00 0.00 ? 151 HIS A CD2  2  
ATOM 3067  C CE1  . HIS A 1 73  ? -12.965 11.716  5.404   1.00 0.00 ? 151 HIS A CE1  2  
ATOM 3068  N NE2  . HIS A 1 73  ? -12.191 10.888  6.083   1.00 0.00 ? 151 HIS A NE2  2  
ATOM 3069  H H    . HIS A 1 73  ? -15.113 6.211   3.668   1.00 0.00 ? 151 HIS A H    2  
ATOM 3070  H HA   . HIS A 1 73  ? -13.550 8.219   2.407   1.00 0.00 ? 151 HIS A HA   2  
ATOM 3071  H HB2  . HIS A 1 73  ? -15.252 9.039   3.794   1.00 0.00 ? 151 HIS A HB2  2  
ATOM 3072  H HB3  . HIS A 1 73  ? -14.829 7.953   5.114   1.00 0.00 ? 151 HIS A HB3  2  
ATOM 3073  H HD2  . HIS A 1 73  ? -12.135 8.700   6.225   1.00 0.00 ? 151 HIS A HD2  2  
ATOM 3074  H HE1  . HIS A 1 73  ? -12.898 12.793  5.412   1.00 0.00 ? 151 HIS A HE1  2  
ATOM 3075  H HE2  . HIS A 1 73  ? -11.408 11.152  6.609   1.00 0.00 ? 151 HIS A HE2  2  
ATOM 3076  N N    . MET A 1 74  ? -12.170 6.594   4.928   1.00 0.00 ? 152 MET A N    2  
ATOM 3077  C CA   . MET A 1 74  ? -10.893 6.258   5.548   1.00 0.00 ? 152 MET A CA   2  
ATOM 3078  C C    . MET A 1 74  ? -9.951  5.611   4.538   1.00 0.00 ? 152 MET A C    2  
ATOM 3079  O O    . MET A 1 74  ? -8.772  5.956   4.468   1.00 0.00 ? 152 MET A O    2  
ATOM 3080  C CB   . MET A 1 74  ? -11.111 5.317   6.735   1.00 0.00 ? 152 MET A CB   2  
ATOM 3081  C CG   . MET A 1 74  ? -11.484 6.037   8.021   1.00 0.00 ? 152 MET A CG   2  
ATOM 3082  S SD   . MET A 1 74  ? -11.274 5.002   9.483   1.00 0.00 ? 152 MET A SD   2  
ATOM 3083  C CE   . MET A 1 74  ? -9.488  4.940   9.600   1.00 0.00 ? 152 MET A CE   2  
ATOM 3084  H H    . MET A 1 74  ? -12.991 6.187   5.275   1.00 0.00 ? 152 MET A H    2  
ATOM 3085  H HA   . MET A 1 74  ? -10.447 7.174   5.904   1.00 0.00 ? 152 MET A HA   2  
ATOM 3086  H HB2  . MET A 1 74  ? -11.904 4.627   6.492   1.00 0.00 ? 152 MET A HB2  2  
ATOM 3087  H HB3  . MET A 1 74  ? -10.202 4.762   6.911   1.00 0.00 ? 152 MET A HB3  2  
ATOM 3088  H HG2  . MET A 1 74  ? -10.857 6.911   8.124   1.00 0.00 ? 152 MET A HG2  2  
ATOM 3089  H HG3  . MET A 1 74  ? -12.517 6.344   7.958   1.00 0.00 ? 152 MET A HG3  2  
ATOM 3090  H HE1  . MET A 1 74  ? -9.058  5.081   8.620   1.00 0.00 ? 152 MET A HE1  2  
ATOM 3091  H HE2  . MET A 1 74  ? -9.144  5.721   10.261  1.00 0.00 ? 152 MET A HE2  2  
ATOM 3092  H HE3  . MET A 1 74  ? -9.187  3.978   9.990   1.00 0.00 ? 152 MET A HE3  2  
ATOM 3093  N N    . GLU A 1 75  ? -10.480 4.673   3.758   1.00 0.00 ? 153 GLU A N    2  
ATOM 3094  C CA   . GLU A 1 75  ? -9.684  3.979   2.753   1.00 0.00 ? 153 GLU A CA   2  
ATOM 3095  C C    . GLU A 1 75  ? -9.164  4.955   1.702   1.00 0.00 ? 153 GLU A C    2  
ATOM 3096  O O    . GLU A 1 75  ? -8.028  4.840   1.241   1.00 0.00 ? 153 GLU A O    2  
ATOM 3097  C CB   . GLU A 1 75  ? -10.515 2.883   2.081   1.00 0.00 ? 153 GLU A CB   2  
ATOM 3098  C CG   . GLU A 1 75  ? -9.798  2.195   0.931   1.00 0.00 ? 153 GLU A CG   2  
ATOM 3099  C CD   . GLU A 1 75  ? -8.972  1.008   1.386   1.00 0.00 ? 153 GLU A CD   2  
ATOM 3100  O OE1  . GLU A 1 75  ? -7.931  1.224   2.041   1.00 0.00 ? 153 GLU A OE1  2  
ATOM 3101  O OE2  . GLU A 1 75  ? -9.367  -0.138  1.086   1.00 0.00 ? 153 GLU A OE2  2  
ATOM 3102  H H    . GLU A 1 75  ? -11.427 4.443   3.862   1.00 0.00 ? 153 GLU A H    2  
ATOM 3103  H HA   . GLU A 1 75  ? -8.843  3.524   3.253   1.00 0.00 ? 153 GLU A HA   2  
ATOM 3104  H HB2  . GLU A 1 75  ? -10.768 2.136   2.819   1.00 0.00 ? 153 GLU A HB2  2  
ATOM 3105  H HB3  . GLU A 1 75  ? -11.425 3.322   1.699   1.00 0.00 ? 153 GLU A HB3  2  
ATOM 3106  H HG2  . GLU A 1 75  ? -10.534 1.851   0.220   1.00 0.00 ? 153 GLU A HG2  2  
ATOM 3107  H HG3  . GLU A 1 75  ? -9.143  2.909   0.453   1.00 0.00 ? 153 GLU A HG3  2  
ATOM 3108  N N    . ALA A 1 76  ? -10.003 5.915   1.327   1.00 0.00 ? 154 ALA A N    2  
ATOM 3109  C CA   . ALA A 1 76  ? -9.628  6.911   0.332   1.00 0.00 ? 154 ALA A CA   2  
ATOM 3110  C C    . ALA A 1 76  ? -8.493  7.794   0.840   1.00 0.00 ? 154 ALA A C    2  
ATOM 3111  O O    . ALA A 1 76  ? -7.535  8.069   0.116   1.00 0.00 ? 154 ALA A O    2  
ATOM 3112  C CB   . ALA A 1 76  ? -10.833 7.761   -0.044  1.00 0.00 ? 154 ALA A CB   2  
ATOM 3113  H H    . ALA A 1 76  ? -10.895 5.954   1.731   1.00 0.00 ? 154 ALA A H    2  
ATOM 3114  H HA   . ALA A 1 76  ? -9.296  6.390   -0.554  1.00 0.00 ? 154 ALA A HA   2  
ATOM 3115  H HB1  . ALA A 1 76  ? -11.564 7.718   0.750   1.00 0.00 ? 154 ALA A HB1  2  
ATOM 3116  H HB2  . ALA A 1 76  ? -10.520 8.784   -0.191  1.00 0.00 ? 154 ALA A HB2  2  
ATOM 3117  H HB3  . ALA A 1 76  ? -11.269 7.383   -0.957  1.00 0.00 ? 154 ALA A HB3  2  
ATOM 3118  N N    . VAL A 1 77  ? -8.607  8.237   2.088   1.00 0.00 ? 155 VAL A N    2  
ATOM 3119  C CA   . VAL A 1 77  ? -7.590  9.089   2.693   1.00 0.00 ? 155 VAL A CA   2  
ATOM 3120  C C    . VAL A 1 77  ? -6.316  8.302   2.984   1.00 0.00 ? 155 VAL A C    2  
ATOM 3121  O O    . VAL A 1 77  ? -5.207  8.793   2.768   1.00 0.00 ? 155 VAL A O    2  
ATOM 3122  C CB   . VAL A 1 77  ? -8.096  9.726   4.000   1.00 0.00 ? 155 VAL A CB   2  
ATOM 3123  C CG1  . VAL A 1 77  ? -8.571  8.653   4.969   1.00 0.00 ? 155 VAL A CG1  2  
ATOM 3124  C CG2  . VAL A 1 77  ? -7.009  10.582  4.631   1.00 0.00 ? 155 VAL A CG2  2  
ATOM 3125  H H    . VAL A 1 77  ? -9.393  7.983   2.615   1.00 0.00 ? 155 VAL A H    2  
ATOM 3126  H HA   . VAL A 1 77  ? -7.360  9.881   1.996   1.00 0.00 ? 155 VAL A HA   2  
ATOM 3127  H HB   . VAL A 1 77  ? -8.936  10.363  3.764   1.00 0.00 ? 155 VAL A HB   2  
ATOM 3128  H HG11 . VAL A 1 77  ? -8.950  9.120   5.865   1.00 0.00 ? 155 VAL A HG11 2  
ATOM 3129  H HG12 . VAL A 1 77  ? -9.354  8.071   4.506   1.00 0.00 ? 155 VAL A HG12 2  
ATOM 3130  H HG13 . VAL A 1 77  ? -7.744  8.007   5.223   1.00 0.00 ? 155 VAL A HG13 2  
ATOM 3131  H HG21 . VAL A 1 77  ? -7.419  11.121  5.473   1.00 0.00 ? 155 VAL A HG21 2  
ATOM 3132  H HG22 . VAL A 1 77  ? -6.202  9.948   4.969   1.00 0.00 ? 155 VAL A HG22 2  
ATOM 3133  H HG23 . VAL A 1 77  ? -6.634  11.284  3.902   1.00 0.00 ? 155 VAL A HG23 2  
ATOM 3134  N N    . LEU A 1 78  ? -6.482  7.079   3.475   1.00 0.00 ? 156 LEU A N    2  
ATOM 3135  C CA   . LEU A 1 78  ? -5.345  6.223   3.795   1.00 0.00 ? 156 LEU A CA   2  
ATOM 3136  C C    . LEU A 1 78  ? -4.617  5.787   2.528   1.00 0.00 ? 156 LEU A C    2  
ATOM 3137  O O    . LEU A 1 78  ? -3.389  5.816   2.466   1.00 0.00 ? 156 LEU A O    2  
ATOM 3138  C CB   . LEU A 1 78  ? -5.812  4.994   4.577   1.00 0.00 ? 156 LEU A CB   2  
ATOM 3139  C CG   . LEU A 1 78  ? -4.754  3.920   4.834   1.00 0.00 ? 156 LEU A CG   2  
ATOM 3140  C CD1  . LEU A 1 78  ? -3.608  4.485   5.659   1.00 0.00 ? 156 LEU A CD1  2  
ATOM 3141  C CD2  . LEU A 1 78  ? -5.373  2.717   5.531   1.00 0.00 ? 156 LEU A CD2  2  
ATOM 3142  H H    . LEU A 1 78  ? -7.390  6.743   3.625   1.00 0.00 ? 156 LEU A H    2  
ATOM 3143  H HA   . LEU A 1 78  ? -4.664  6.793   4.409   1.00 0.00 ? 156 LEU A HA   2  
ATOM 3144  H HB2  . LEU A 1 78  ? -6.179  5.331   5.534   1.00 0.00 ? 156 LEU A HB2  2  
ATOM 3145  H HB3  . LEU A 1 78  ? -6.621  4.538   4.024   1.00 0.00 ? 156 LEU A HB3  2  
ATOM 3146  H HG   . LEU A 1 78  ? -4.351  3.587   3.887   1.00 0.00 ? 156 LEU A HG   2  
ATOM 3147  H HD11 . LEU A 1 78  ? -3.587  5.560   5.556   1.00 0.00 ? 156 LEU A HD11 2  
ATOM 3148  H HD12 . LEU A 1 78  ? -2.675  4.071   5.309   1.00 0.00 ? 156 LEU A HD12 2  
ATOM 3149  H HD13 . LEU A 1 78  ? -3.750  4.225   6.698   1.00 0.00 ? 156 LEU A HD13 2  
ATOM 3150  H HD21 . LEU A 1 78  ? -4.675  1.894   5.515   1.00 0.00 ? 156 LEU A HD21 2  
ATOM 3151  H HD22 . LEU A 1 78  ? -6.280  2.431   5.018   1.00 0.00 ? 156 LEU A HD22 2  
ATOM 3152  H HD23 . LEU A 1 78  ? -5.604  2.974   6.554   1.00 0.00 ? 156 LEU A HD23 2  
ATOM 3153  N N    . GLN A 1 79  ? -5.385  5.385   1.519   1.00 0.00 ? 157 GLN A N    2  
ATOM 3154  C CA   . GLN A 1 79  ? -4.812  4.945   0.253   1.00 0.00 ? 157 GLN A CA   2  
ATOM 3155  C C    . GLN A 1 79  ? -4.020  6.069   -0.407  1.00 0.00 ? 157 GLN A C    2  
ATOM 3156  O O    . GLN A 1 79  ? -2.861  5.889   -0.779  1.00 0.00 ? 157 GLN A O    2  
ATOM 3157  C CB   . GLN A 1 79  ? -5.916  4.462   -0.690  1.00 0.00 ? 157 GLN A CB   2  
ATOM 3158  C CG   . GLN A 1 79  ? -6.349  3.027   -0.434  1.00 0.00 ? 157 GLN A CG   2  
ATOM 3159  C CD   . GLN A 1 79  ? -5.521  2.021   -1.208  1.00 0.00 ? 157 GLN A CD   2  
ATOM 3160  O OE1  . GLN A 1 79  ? -4.316  1.891   -0.988  1.00 0.00 ? 157 GLN A OE1  2  
ATOM 3161  N NE2  . GLN A 1 79  ? -6.163  1.301   -2.120  1.00 0.00 ? 157 GLN A NE2  2  
ATOM 3162  H H    . GLN A 1 79  ? -6.358  5.385   1.630   1.00 0.00 ? 157 GLN A H    2  
ATOM 3163  H HA   . GLN A 1 79  ? -4.143  4.123   0.459   1.00 0.00 ? 157 GLN A HA   2  
ATOM 3164  H HB2  . GLN A 1 79  ? -6.778  5.102   -0.574  1.00 0.00 ? 157 GLN A HB2  2  
ATOM 3165  H HB3  . GLN A 1 79  ? -5.560  4.532   -1.707  1.00 0.00 ? 157 GLN A HB3  2  
ATOM 3166  H HG2  . GLN A 1 79  ? -6.250  2.817   0.620   1.00 0.00 ? 157 GLN A HG2  2  
ATOM 3167  H HG3  . GLN A 1 79  ? -7.384  2.920   -0.726  1.00 0.00 ? 157 GLN A HG3  2  
ATOM 3168  H HE21 . GLN A 1 79  ? -7.123  1.459   -2.242  1.00 0.00 ? 157 GLN A HE21 2  
ATOM 3169  H HE22 . GLN A 1 79  ? -5.652  0.644   -2.635  1.00 0.00 ? 157 GLN A HE22 2  
ATOM 3170  N N    . ARG A 1 80  ? -4.654  7.228   -0.549  1.00 0.00 ? 158 ARG A N    2  
ATOM 3171  C CA   . ARG A 1 80  ? -4.009  8.381   -1.165  1.00 0.00 ? 158 ARG A CA   2  
ATOM 3172  C C    . ARG A 1 80  ? -2.843  8.873   -0.311  1.00 0.00 ? 158 ARG A C    2  
ATOM 3173  O O    . ARG A 1 80  ? -1.984  9.616   -0.785  1.00 0.00 ? 158 ARG A O    2  
ATOM 3174  C CB   . ARG A 1 80  ? -5.020  9.512   -1.366  1.00 0.00 ? 158 ARG A CB   2  
ATOM 3175  C CG   . ARG A 1 80  ? -5.285  10.322  -0.108  1.00 0.00 ? 158 ARG A CG   2  
ATOM 3176  C CD   . ARG A 1 80  ? -4.309  11.480  0.025   1.00 0.00 ? 158 ARG A CD   2  
ATOM 3177  N NE   . ARG A 1 80  ? -4.749  12.456  1.019   1.00 0.00 ? 158 ARG A NE   2  
ATOM 3178  C CZ   . ARG A 1 80  ? -4.324  13.714  1.051   1.00 0.00 ? 158 ARG A CZ   2  
ATOM 3179  N NH1  . ARG A 1 80  ? -3.454  14.147  0.149   1.00 0.00 ? 158 ARG A NH1  2  
ATOM 3180  N NH2  . ARG A 1 80  ? -4.771  14.543  1.987   1.00 0.00 ? 158 ARG A NH2  2  
ATOM 3181  H H    . ARG A 1 80  ? -5.578  7.310   -0.232  1.00 0.00 ? 158 ARG A H    2  
ATOM 3182  H HA   . ARG A 1 80  ? -3.629  8.074   -2.128  1.00 0.00 ? 158 ARG A HA   2  
ATOM 3183  H HB2  . ARG A 1 80  ? -4.647  10.181  -2.127  1.00 0.00 ? 158 ARG A HB2  2  
ATOM 3184  H HB3  . ARG A 1 80  ? -5.955  9.087   -1.698  1.00 0.00 ? 158 ARG A HB3  2  
ATOM 3185  H HG2  . ARG A 1 80  ? -6.290  10.716  -0.150  1.00 0.00 ? 158 ARG A HG2  2  
ATOM 3186  H HG3  . ARG A 1 80  ? -5.185  9.677   0.752   1.00 0.00 ? 158 ARG A HG3  2  
ATOM 3187  H HD2  . ARG A 1 80  ? -3.346  11.090  0.320   1.00 0.00 ? 158 ARG A HD2  2  
ATOM 3188  H HD3  . ARG A 1 80  ? -4.220  11.970  -0.933  1.00 0.00 ? 158 ARG A HD3  2  
ATOM 3189  H HE   . ARG A 1 80  ? -5.392  12.157  1.694   1.00 0.00 ? 158 ARG A HE   2  
ATOM 3190  H HH11 . ARG A 1 80  ? -3.116  13.526  -0.557  1.00 0.00 ? 158 ARG A HH11 2  
ATOM 3191  H HH12 . ARG A 1 80  ? -3.137  15.096  0.176   1.00 0.00 ? 158 ARG A HH12 2  
ATOM 3192  H HH21 . ARG A 1 80  ? -5.427  14.220  2.668   1.00 0.00 ? 158 ARG A HH21 2  
ATOM 3193  H HH22 . ARG A 1 80  ? -4.451  15.489  2.010   1.00 0.00 ? 158 ARG A HH22 2  
ATOM 3194  N N    . SER A 1 81  ? -2.822  8.453   0.950   1.00 0.00 ? 159 SER A N    2  
ATOM 3195  C CA   . SER A 1 81  ? -1.765  8.854   1.871   1.00 0.00 ? 159 SER A CA   2  
ATOM 3196  C C    . SER A 1 81  ? -0.689  7.776   1.966   1.00 0.00 ? 159 SER A C    2  
ATOM 3197  O O    . SER A 1 81  ? 0.195   7.839   2.820   1.00 0.00 ? 159 SER A O    2  
ATOM 3198  C CB   . SER A 1 81  ? -2.347  9.133   3.258   1.00 0.00 ? 159 SER A CB   2  
ATOM 3199  O OG   . SER A 1 81  ? -2.865  10.450  3.338   1.00 0.00 ? 159 SER A OG   2  
ATOM 3200  H H    . SER A 1 81  ? -3.536  7.862   1.269   1.00 0.00 ? 159 SER A H    2  
ATOM 3201  H HA   . SER A 1 81  ? -1.318  9.759   1.489   1.00 0.00 ? 159 SER A HA   2  
ATOM 3202  H HB2  . SER A 1 81  ? -3.143  8.433   3.459   1.00 0.00 ? 159 SER A HB2  2  
ATOM 3203  H HB3  . SER A 1 81  ? -1.571  9.019   4.001   1.00 0.00 ? 159 SER A HB3  2  
ATOM 3204  H HG   . SER A 1 81  ? -3.216  10.603  4.218   1.00 0.00 ? 159 SER A HG   2  
ATOM 3205  N N    . ALA A 1 82  ? -0.772  6.787   1.082   1.00 0.00 ? 160 ALA A N    2  
ATOM 3206  C CA   . ALA A 1 82  ? 0.194   5.696   1.064   1.00 0.00 ? 160 ALA A CA   2  
ATOM 3207  C C    . ALA A 1 82  ? 1.451   6.088   0.295   1.00 0.00 ? 160 ALA A C    2  
ATOM 3208  O O    . ALA A 1 82  ? 2.568   5.906   0.778   1.00 0.00 ? 160 ALA A O    2  
ATOM 3209  C CB   . ALA A 1 82  ? -0.431  4.448   0.457   1.00 0.00 ? 160 ALA A CB   2  
ATOM 3210  H H    . ALA A 1 82  ? -1.500  6.792   0.426   1.00 0.00 ? 160 ALA A H    2  
ATOM 3211  H HA   . ALA A 1 82  ? 0.464   5.472   2.086   1.00 0.00 ? 160 ALA A HA   2  
ATOM 3212  H HB1  . ALA A 1 82  ? -1.338  4.204   0.991   1.00 0.00 ? 160 ALA A HB1  2  
ATOM 3213  H HB2  . ALA A 1 82  ? -0.662  4.630   -0.582  1.00 0.00 ? 160 ALA A HB2  2  
ATOM 3214  H HB3  . ALA A 1 82  ? 0.264   3.625   0.533   1.00 0.00 ? 160 ALA A HB3  2  
ATOM 3215  N N    . ALA A 1 83  ? 1.261   6.627   -0.905  1.00 0.00 ? 161 ALA A N    2  
ATOM 3216  C CA   . ALA A 1 83  ? 2.379   7.047   -1.740  1.00 0.00 ? 161 ALA A CA   2  
ATOM 3217  C C    . ALA A 1 83  ? 3.449   7.751   -0.912  1.00 0.00 ? 161 ALA A C    2  
ATOM 3218  O O    . ALA A 1 83  ? 4.589   7.293   -0.832  1.00 0.00 ? 161 ALA A O    2  
ATOM 3219  C CB   . ALA A 1 83  ? 1.891   7.955   -2.858  1.00 0.00 ? 161 ALA A CB   2  
ATOM 3220  H H    . ALA A 1 83  ? 0.346   6.747   -1.235  1.00 0.00 ? 161 ALA A H    2  
ATOM 3221  H HA   . ALA A 1 83  ? 2.810   6.163   -2.189  1.00 0.00 ? 161 ALA A HA   2  
ATOM 3222  H HB1  . ALA A 1 83  ? 1.434   8.836   -2.432  1.00 0.00 ? 161 ALA A HB1  2  
ATOM 3223  H HB2  . ALA A 1 83  ? 2.728   8.246   -3.476  1.00 0.00 ? 161 ALA A HB2  2  
ATOM 3224  H HB3  . ALA A 1 83  ? 1.166   7.428   -3.459  1.00 0.00 ? 161 ALA A HB3  2  
ATOM 3225  N N    . HIS A 1 84  ? 3.074   8.868   -0.297  1.00 0.00 ? 162 HIS A N    2  
ATOM 3226  C CA   . HIS A 1 84  ? 4.001   9.637   0.526   1.00 0.00 ? 162 HIS A CA   2  
ATOM 3227  C C    . HIS A 1 84  ? 4.589   8.771   1.636   1.00 0.00 ? 162 HIS A C    2  
ATOM 3228  O O    . HIS A 1 84  ? 5.788   8.823   1.909   1.00 0.00 ? 162 HIS A O    2  
ATOM 3229  C CB   . HIS A 1 84  ? 3.295   10.851  1.130   1.00 0.00 ? 162 HIS A CB   2  
ATOM 3230  C CG   . HIS A 1 84  ? 4.236   11.910  1.617   1.00 0.00 ? 162 HIS A CG   2  
ATOM 3231  N ND1  . HIS A 1 84  ? 4.923   12.753  0.770   1.00 0.00 ? 162 HIS A ND1  2  
ATOM 3232  C CD2  . HIS A 1 84  ? 4.600   12.261  2.872   1.00 0.00 ? 162 HIS A CD2  2  
ATOM 3233  C CE1  . HIS A 1 84  ? 5.671   13.576  1.483   1.00 0.00 ? 162 HIS A CE1  2  
ATOM 3234  N NE2  . HIS A 1 84  ? 5.493   13.299  2.762   1.00 0.00 ? 162 HIS A NE2  2  
ATOM 3235  H H    . HIS A 1 84  ? 2.151   9.183   -0.398  1.00 0.00 ? 162 HIS A H    2  
ATOM 3236  H HA   . HIS A 1 84  ? 4.804   9.978   -0.110  1.00 0.00 ? 162 HIS A HA   2  
ATOM 3237  H HB2  . HIS A 1 84  ? 2.655   11.295  0.382   1.00 0.00 ? 162 HIS A HB2  2  
ATOM 3238  H HB3  . HIS A 1 84  ? 2.693   10.530  1.968   1.00 0.00 ? 162 HIS A HB3  2  
ATOM 3239  H HD2  . HIS A 1 84  ? 4.254   11.809  3.791   1.00 0.00 ? 162 HIS A HD2  2  
ATOM 3240  H HE1  . HIS A 1 84  ? 6.318   14.345  1.089   1.00 0.00 ? 162 HIS A HE1  2  
ATOM 3241  H HE2  . HIS A 1 84  ? 5.992   13.702  3.502   1.00 0.00 ? 162 HIS A HE2  2  
ATOM 3242  N N    . MET A 1 85  ? 3.736   7.975   2.273   1.00 0.00 ? 163 MET A N    2  
ATOM 3243  C CA   . MET A 1 85  ? 4.171   7.098   3.354   1.00 0.00 ? 163 MET A CA   2  
ATOM 3244  C C    . MET A 1 85  ? 5.278   6.161   2.881   1.00 0.00 ? 163 MET A C    2  
ATOM 3245  O O    . MET A 1 85  ? 6.250   5.922   3.598   1.00 0.00 ? 163 MET A O    2  
ATOM 3246  C CB   . MET A 1 85  ? 2.990   6.283   3.885   1.00 0.00 ? 163 MET A CB   2  
ATOM 3247  C CG   . MET A 1 85  ? 2.246   6.963   5.024   1.00 0.00 ? 163 MET A CG   2  
ATOM 3248  S SD   . MET A 1 85  ? 1.462   5.785   6.142   1.00 0.00 ? 163 MET A SD   2  
ATOM 3249  C CE   . MET A 1 85  ? -0.268  6.080   5.786   1.00 0.00 ? 163 MET A CE   2  
ATOM 3250  H H    . MET A 1 85  ? 2.791   7.978   2.011   1.00 0.00 ? 163 MET A H    2  
ATOM 3251  H HA   . MET A 1 85  ? 4.555   7.718   4.149   1.00 0.00 ? 163 MET A HA   2  
ATOM 3252  H HB2  . MET A 1 85  ? 2.292   6.114   3.078   1.00 0.00 ? 163 MET A HB2  2  
ATOM 3253  H HB3  . MET A 1 85  ? 3.355   5.331   4.240   1.00 0.00 ? 163 MET A HB3  2  
ATOM 3254  H HG2  . MET A 1 85  ? 2.946   7.561   5.588   1.00 0.00 ? 163 MET A HG2  2  
ATOM 3255  H HG3  . MET A 1 85  ? 1.484   7.603   4.605   1.00 0.00 ? 163 MET A HG3  2  
ATOM 3256  H HE1  . MET A 1 85  ? -0.504  7.116   5.980   1.00 0.00 ? 163 MET A HE1  2  
ATOM 3257  H HE2  . MET A 1 85  ? -0.465  5.854   4.748   1.00 0.00 ? 163 MET A HE2  2  
ATOM 3258  H HE3  . MET A 1 85  ? -0.878  5.448   6.415   1.00 0.00 ? 163 MET A HE3  2  
ATOM 3259  N N    . ARG A 1 86  ? 5.124   5.634   1.671   1.00 0.00 ? 164 ARG A N    2  
ATOM 3260  C CA   . ARG A 1 86  ? 6.110   4.722   1.104   1.00 0.00 ? 164 ARG A CA   2  
ATOM 3261  C C    . ARG A 1 86  ? 7.495   5.362   1.086   1.00 0.00 ? 164 ARG A C    2  
ATOM 3262  O O    . ARG A 1 86  ? 8.484   4.737   1.469   1.00 0.00 ? 164 ARG A O    2  
ATOM 3263  C CB   . ARG A 1 86  ? 5.705   4.317   -0.315  1.00 0.00 ? 164 ARG A CB   2  
ATOM 3264  C CG   . ARG A 1 86  ? 6.198   2.937   -0.719  1.00 0.00 ? 164 ARG A CG   2  
ATOM 3265  C CD   . ARG A 1 86  ? 5.892   2.642   -2.179  1.00 0.00 ? 164 ARG A CD   2  
ATOM 3266  N NE   . ARG A 1 86  ? 4.457   2.534   -2.426  1.00 0.00 ? 164 ARG A NE   2  
ATOM 3267  C CZ   . ARG A 1 86  ? 3.913   2.591   -3.637  1.00 0.00 ? 164 ARG A CZ   2  
ATOM 3268  N NH1  . ARG A 1 86  ? 4.682   2.752   -4.705  1.00 0.00 ? 164 ARG A NH1  2  
ATOM 3269  N NH2  . ARG A 1 86  ? 2.599   2.485   -3.781  1.00 0.00 ? 164 ARG A NH2  2  
ATOM 3270  H H    . ARG A 1 86  ? 4.327   5.862   1.147   1.00 0.00 ? 164 ARG A H    2  
ATOM 3271  H HA   . ARG A 1 86  ? 6.142   3.839   1.725   1.00 0.00 ? 164 ARG A HA   2  
ATOM 3272  H HB2  . ARG A 1 86  ? 4.627   4.325   -0.386  1.00 0.00 ? 164 ARG A HB2  2  
ATOM 3273  H HB3  . ARG A 1 86  ? 6.109   5.038   -1.011  1.00 0.00 ? 164 ARG A HB3  2  
ATOM 3274  H HG2  . ARG A 1 86  ? 7.267   2.889   -0.570  1.00 0.00 ? 164 ARG A HG2  2  
ATOM 3275  H HG3  . ARG A 1 86  ? 5.713   2.197   -0.101  1.00 0.00 ? 164 ARG A HG3  2  
ATOM 3276  H HD2  . ARG A 1 86  ? 6.293   3.439   -2.786  1.00 0.00 ? 164 ARG A HD2  2  
ATOM 3277  H HD3  . ARG A 1 86  ? 6.365   1.710   -2.450  1.00 0.00 ? 164 ARG A HD3  2  
ATOM 3278  H HE   . ARG A 1 86  ? 3.870   2.415   -1.651  1.00 0.00 ? 164 ARG A HE   2  
ATOM 3279  H HH11 . ARG A 1 86  ? 5.673   2.830   -4.600  1.00 0.00 ? 164 ARG A HH11 2  
ATOM 3280  H HH12 . ARG A 1 86  ? 4.270   2.793   -5.616  1.00 0.00 ? 164 ARG A HH12 2  
ATOM 3281  H HH21 . ARG A 1 86  ? 2.016   2.364   -2.978  1.00 0.00 ? 164 ARG A HH21 2  
ATOM 3282  H HH22 . ARG A 1 86  ? 2.191   2.528   -4.693  1.00 0.00 ? 164 ARG A HH22 2  
ATOM 3283  N N    . HIS A 1 87  ? 7.558   6.612   0.638   1.00 0.00 ? 165 HIS A N    2  
ATOM 3284  C CA   . HIS A 1 87  ? 8.822   7.337   0.570   1.00 0.00 ? 165 HIS A CA   2  
ATOM 3285  C C    . HIS A 1 87  ? 9.379   7.589   1.968   1.00 0.00 ? 165 HIS A C    2  
ATOM 3286  O O    . HIS A 1 87  ? 10.579  7.439   2.206   1.00 0.00 ? 165 HIS A O    2  
ATOM 3287  C CB   . HIS A 1 87  ? 8.634   8.665   -0.164  1.00 0.00 ? 165 HIS A CB   2  
ATOM 3288  C CG   . HIS A 1 87  ? 9.917   9.390   -0.428  1.00 0.00 ? 165 HIS A CG   2  
ATOM 3289  N ND1  . HIS A 1 87  ? 10.706  9.146   -1.532  1.00 0.00 ? 165 HIS A ND1  2  
ATOM 3290  C CD2  . HIS A 1 87  ? 10.547  10.360  0.276   1.00 0.00 ? 165 HIS A CD2  2  
ATOM 3291  C CE1  . HIS A 1 87  ? 11.767  9.933   -1.495  1.00 0.00 ? 165 HIS A CE1  2  
ATOM 3292  N NE2  . HIS A 1 87  ? 11.694  10.680  -0.408  1.00 0.00 ? 165 HIS A NE2  2  
ATOM 3293  H H    . HIS A 1 87  ? 6.736   7.057   0.346   1.00 0.00 ? 165 HIS A H    2  
ATOM 3294  H HA   . HIS A 1 87  ? 9.524   6.728   0.021   1.00 0.00 ? 165 HIS A HA   2  
ATOM 3295  H HB2  . HIS A 1 87  ? 8.157   8.478   -1.115  1.00 0.00 ? 165 HIS A HB2  2  
ATOM 3296  H HB3  . HIS A 1 87  ? 8.003   9.310   0.430   1.00 0.00 ? 165 HIS A HB3  2  
ATOM 3297  H HD2  . HIS A 1 87  ? 10.211  10.800  1.204   1.00 0.00 ? 165 HIS A HD2  2  
ATOM 3298  H HE1  . HIS A 1 87  ? 12.559  9.962   -2.229  1.00 0.00 ? 165 HIS A HE1  2  
ATOM 3299  H HE2  . HIS A 1 87  ? 12.394  11.288  -0.094  1.00 0.00 ? 165 HIS A HE2  2  
ATOM 3300  N N    . LEU A 1 88  ? 8.502   7.973   2.889   1.00 0.00 ? 166 LEU A N    2  
ATOM 3301  C CA   . LEU A 1 88  ? 8.907   8.247   4.263   1.00 0.00 ? 166 LEU A CA   2  
ATOM 3302  C C    . LEU A 1 88  ? 9.623   7.044   4.870   1.00 0.00 ? 166 LEU A C    2  
ATOM 3303  O O    . LEU A 1 88  ? 10.553  7.197   5.663   1.00 0.00 ? 166 LEU A O    2  
ATOM 3304  C CB   . LEU A 1 88  ? 7.687   8.609   5.112   1.00 0.00 ? 166 LEU A CB   2  
ATOM 3305  C CG   . LEU A 1 88  ? 7.142   10.027  4.933   1.00 0.00 ? 166 LEU A CG   2  
ATOM 3306  C CD1  . LEU A 1 88  ? 5.938   10.253  5.834   1.00 0.00 ? 166 LEU A CD1  2  
ATOM 3307  C CD2  . LEU A 1 88  ? 8.226   11.055  5.221   1.00 0.00 ? 166 LEU A CD2  2  
ATOM 3308  H H    . LEU A 1 88  ? 7.560   8.074   2.639   1.00 0.00 ? 166 LEU A H    2  
ATOM 3309  H HA   . LEU A 1 88  ? 9.586   9.085   4.248   1.00 0.00 ? 166 LEU A HA   2  
ATOM 3310  H HB2  . LEU A 1 88  ? 6.895   7.918   4.866   1.00 0.00 ? 166 LEU A HB2  2  
ATOM 3311  H HB3  . LEU A 1 88  ? 7.959   8.487   6.151   1.00 0.00 ? 166 LEU A HB3  2  
ATOM 3312  H HG   . LEU A 1 88  ? 6.821   10.156  3.909   1.00 0.00 ? 166 LEU A HG   2  
ATOM 3313  H HD11 . LEU A 1 88  ? 5.946   9.530   6.635   1.00 0.00 ? 166 LEU A HD11 2  
ATOM 3314  H HD12 . LEU A 1 88  ? 5.031   10.142  5.258   1.00 0.00 ? 166 LEU A HD12 2  
ATOM 3315  H HD13 . LEU A 1 88  ? 5.981   11.250  6.248   1.00 0.00 ? 166 LEU A HD13 2  
ATOM 3316  H HD21 . LEU A 1 88  ? 8.995   10.605  5.832   1.00 0.00 ? 166 LEU A HD21 2  
ATOM 3317  H HD22 . LEU A 1 88  ? 7.795   11.895  5.745   1.00 0.00 ? 166 LEU A HD22 2  
ATOM 3318  H HD23 . LEU A 1 88  ? 8.658   11.393  4.290   1.00 0.00 ? 166 LEU A HD23 2  
ATOM 3319  N N    . LEU A 1 89  ? 9.186   5.849   4.491   1.00 0.00 ? 167 LEU A N    2  
ATOM 3320  C CA   . LEU A 1 89  ? 9.787   4.619   4.996   1.00 0.00 ? 167 LEU A CA   2  
ATOM 3321  C C    . LEU A 1 89  ? 11.136  4.360   4.332   1.00 0.00 ? 167 LEU A C    2  
ATOM 3322  O O    . LEU A 1 89  ? 12.093  3.951   4.989   1.00 0.00 ? 167 LEU A O    2  
ATOM 3323  C CB   . LEU A 1 89  ? 8.851   3.434   4.754   1.00 0.00 ? 167 LEU A CB   2  
ATOM 3324  C CG   . LEU A 1 89  ? 7.461   3.536   5.384   1.00 0.00 ? 167 LEU A CG   2  
ATOM 3325  C CD1  . LEU A 1 89  ? 6.827   2.159   5.503   1.00 0.00 ? 167 LEU A CD1  2  
ATOM 3326  C CD2  . LEU A 1 89  ? 7.542   4.208   6.747   1.00 0.00 ? 167 LEU A CD2  2  
ATOM 3327  H H    . LEU A 1 89  ? 8.441   5.790   3.857   1.00 0.00 ? 167 LEU A H    2  
ATOM 3328  H HA   . LEU A 1 89  ? 9.939   4.736   6.058   1.00 0.00 ? 167 LEU A HA   2  
ATOM 3329  H HB2  . LEU A 1 89  ? 8.723   3.326   3.688   1.00 0.00 ? 167 LEU A HB2  2  
ATOM 3330  H HB3  . LEU A 1 89  ? 9.330   2.549   5.148   1.00 0.00 ? 167 LEU A HB3  2  
ATOM 3331  H HG   . LEU A 1 89  ? 6.829   4.141   4.749   1.00 0.00 ? 167 LEU A HG   2  
ATOM 3332  H HD11 . LEU A 1 89  ? 7.286   1.621   6.318   1.00 0.00 ? 167 LEU A HD11 2  
ATOM 3333  H HD12 . LEU A 1 89  ? 6.974   1.614   4.583   1.00 0.00 ? 167 LEU A HD12 2  
ATOM 3334  H HD13 . LEU A 1 89  ? 5.768   2.266   5.692   1.00 0.00 ? 167 LEU A HD13 2  
ATOM 3335  H HD21 . LEU A 1 89  ? 7.477   5.279   6.624   1.00 0.00 ? 167 LEU A HD21 2  
ATOM 3336  H HD22 . LEU A 1 89  ? 8.482   3.956   7.217   1.00 0.00 ? 167 LEU A HD22 2  
ATOM 3337  H HD23 . LEU A 1 89  ? 6.726   3.866   7.366   1.00 0.00 ? 167 LEU A HD23 2  
ATOM 3338  N N    . MET A 1 90  ? 11.204  4.603   3.027   1.00 0.00 ? 168 MET A N    2  
ATOM 3339  C CA   . MET A 1 90  ? 12.437  4.399   2.276   1.00 0.00 ? 168 MET A CA   2  
ATOM 3340  C C    . MET A 1 90  ? 13.651  4.810   3.102   1.00 0.00 ? 168 MET A C    2  
ATOM 3341  O O    . MET A 1 90  ? 14.746  4.277   2.922   1.00 0.00 ? 168 MET A O    2  
ATOM 3342  C CB   . MET A 1 90  ? 12.401  5.195   0.970   1.00 0.00 ? 168 MET A CB   2  
ATOM 3343  C CG   . MET A 1 90  ? 11.464  4.609   -0.073  1.00 0.00 ? 168 MET A CG   2  
ATOM 3344  S SD   . MET A 1 90  ? 11.515  5.508   -1.636  1.00 0.00 ? 168 MET A SD   2  
ATOM 3345  C CE   . MET A 1 90  ? 11.358  4.162   -2.806  1.00 0.00 ? 168 MET A CE   2  
ATOM 3346  H H    . MET A 1 90  ? 10.407  4.928   2.558   1.00 0.00 ? 168 MET A H    2  
ATOM 3347  H HA   . MET A 1 90  ? 12.513  3.347   2.044   1.00 0.00 ? 168 MET A HA   2  
ATOM 3348  H HB2  . MET A 1 90  ? 12.080  6.203   1.186   1.00 0.00 ? 168 MET A HB2  2  
ATOM 3349  H HB3  . MET A 1 90  ? 13.396  5.225   0.552   1.00 0.00 ? 168 MET A HB3  2  
ATOM 3350  H HG2  . MET A 1 90  ? 11.746  3.583   -0.256  1.00 0.00 ? 168 MET A HG2  2  
ATOM 3351  H HG3  . MET A 1 90  ? 10.455  4.639   0.312   1.00 0.00 ? 168 MET A HG3  2  
ATOM 3352  H HE1  . MET A 1 90  ? 11.763  4.465   -3.761  1.00 0.00 ? 168 MET A HE1  2  
ATOM 3353  H HE2  . MET A 1 90  ? 11.902  3.303   -2.441  1.00 0.00 ? 168 MET A HE2  2  
ATOM 3354  H HE3  . MET A 1 90  ? 10.315  3.906   -2.922  1.00 0.00 ? 168 MET A HE3  2  
ATOM 3355  N N    . SER A 1 91  ? 13.451  5.761   4.009   1.00 0.00 ? 169 SER A N    2  
ATOM 3356  C CA   . SER A 1 91  ? 14.531  6.246   4.860   1.00 0.00 ? 169 SER A CA   2  
ATOM 3357  C C    . SER A 1 91  ? 15.320  5.083   5.453   1.00 0.00 ? 169 SER A C    2  
ATOM 3358  O O    . SER A 1 91  ? 16.546  5.042   5.363   1.00 0.00 ? 169 SER A O    2  
ATOM 3359  C CB   . SER A 1 91  ? 13.970  7.121   5.983   1.00 0.00 ? 169 SER A CB   2  
ATOM 3360  O OG   . SER A 1 91  ? 13.348  8.283   5.462   1.00 0.00 ? 169 SER A OG   2  
ATOM 3361  H H    . SER A 1 91  ? 12.555  6.148   4.105   1.00 0.00 ? 169 SER A H    2  
ATOM 3362  H HA   . SER A 1 91  ? 15.193  6.841   4.249   1.00 0.00 ? 169 SER A HA   2  
ATOM 3363  H HB2  . SER A 1 91  ? 13.240  6.558   6.544   1.00 0.00 ? 169 SER A HB2  2  
ATOM 3364  H HB3  . SER A 1 91  ? 14.775  7.421   6.638   1.00 0.00 ? 169 SER A HB3  2  
ATOM 3365  H HG   . SER A 1 91  ? 13.929  8.696   4.819   1.00 0.00 ? 169 SER A HG   2  
ATOM 3366  N N    . GLN A 1 92  ? 14.606  4.139   6.058   1.00 0.00 ? 170 GLN A N    2  
ATOM 3367  C CA   . GLN A 1 92  ? 15.239  2.975   6.666   1.00 0.00 ? 170 GLN A CA   2  
ATOM 3368  C C    . GLN A 1 92  ? 16.417  2.494   5.825   1.00 0.00 ? 170 GLN A C    2  
ATOM 3369  O O    . GLN A 1 92  ? 16.321  2.406   4.601   1.00 0.00 ? 170 GLN A O    2  
ATOM 3370  C CB   . GLN A 1 92  ? 14.222  1.844   6.834   1.00 0.00 ? 170 GLN A CB   2  
ATOM 3371  C CG   . GLN A 1 92  ? 13.078  2.190   7.773   1.00 0.00 ? 170 GLN A CG   2  
ATOM 3372  C CD   . GLN A 1 92  ? 13.551  2.495   9.181   1.00 0.00 ? 170 GLN A CD   2  
ATOM 3373  O OE1  . GLN A 1 92  ? 14.258  3.476   9.412   1.00 0.00 ? 170 GLN A OE1  2  
ATOM 3374  N NE2  . GLN A 1 92  ? 13.162  1.653   10.132  1.00 0.00 ? 170 GLN A NE2  2  
ATOM 3375  H H    . GLN A 1 92  ? 13.631  4.228   6.096   1.00 0.00 ? 170 GLN A H    2  
ATOM 3376  H HA   . GLN A 1 92  ? 15.603  3.266   7.639   1.00 0.00 ? 170 GLN A HA   2  
ATOM 3377  H HB2  . GLN A 1 92  ? 13.805  1.604   5.867   1.00 0.00 ? 170 GLN A HB2  2  
ATOM 3378  H HB3  . GLN A 1 92  ? 14.729  0.975   7.225   1.00 0.00 ? 170 GLN A HB3  2  
ATOM 3379  H HG2  . GLN A 1 92  ? 12.562  3.057   7.388   1.00 0.00 ? 170 GLN A HG2  2  
ATOM 3380  H HG3  . GLN A 1 92  ? 12.395  1.354   7.811   1.00 0.00 ? 170 GLN A HG3  2  
ATOM 3381  H HE21 . GLN A 1 92  ? 12.600  0.892   9.874   1.00 0.00 ? 170 GLN A HE21 2  
ATOM 3382  H HE22 . GLN A 1 92  ? 13.453  1.825   11.050  1.00 0.00 ? 170 GLN A HE22 2  
ATOM 3383  N N    . GLN A 1 93  ? 17.525  2.185   6.490   1.00 0.00 ? 171 GLN A N    2  
ATOM 3384  C CA   . GLN A 1 93  ? 18.722  1.714   5.802   1.00 0.00 ? 171 GLN A CA   2  
ATOM 3385  C C    . GLN A 1 93  ? 19.079  0.298   6.239   1.00 0.00 ? 171 GLN A C    2  
ATOM 3386  O O    . GLN A 1 93  ? 20.252  -0.031  6.421   1.00 0.00 ? 171 GLN A O    2  
ATOM 3387  C CB   . GLN A 1 93  ? 19.896  2.656   6.074   1.00 0.00 ? 171 GLN A CB   2  
ATOM 3388  C CG   . GLN A 1 93  ? 20.211  2.825   7.551   1.00 0.00 ? 171 GLN A CG   2  
ATOM 3389  C CD   . GLN A 1 93  ? 21.165  3.972   7.818   1.00 0.00 ? 171 GLN A CD   2  
ATOM 3390  O OE1  . GLN A 1 93  ? 21.081  5.024   7.184   1.00 0.00 ? 171 GLN A OE1  2  
ATOM 3391  N NE2  . GLN A 1 93  ? 22.081  3.775   8.759   1.00 0.00 ? 171 GLN A NE2  2  
ATOM 3392  H H    . GLN A 1 93  ? 17.539  2.276   7.465   1.00 0.00 ? 171 GLN A H    2  
ATOM 3393  H HA   . GLN A 1 93  ? 18.514  1.709   4.742   1.00 0.00 ? 171 GLN A HA   2  
ATOM 3394  H HB2  . GLN A 1 93  ? 20.775  2.268   5.582   1.00 0.00 ? 171 GLN A HB2  2  
ATOM 3395  H HB3  . GLN A 1 93  ? 19.664  3.629   5.665   1.00 0.00 ? 171 GLN A HB3  2  
ATOM 3396  H HG2  . GLN A 1 93  ? 19.291  3.012   8.084   1.00 0.00 ? 171 GLN A HG2  2  
ATOM 3397  H HG3  . GLN A 1 93  ? 20.658  1.912   7.917   1.00 0.00 ? 171 GLN A HG3  2  
ATOM 3398  H HE21 . GLN A 1 93  ? 22.089  2.911   9.222   1.00 0.00 ? 171 GLN A HE21 2  
ATOM 3399  H HE22 . GLN A 1 93  ? 22.710  4.500   8.951   1.00 0.00 ? 171 GLN A HE22 2  
ATOM 3400  N N    . THR A 1 94  ? 18.060  -0.539  6.408   1.00 0.00 ? 172 THR A N    2  
ATOM 3401  C CA   . THR A 1 94  ? 18.266  -1.920  6.826   1.00 0.00 ? 172 THR A CA   2  
ATOM 3402  C C    . THR A 1 94  ? 17.715  -2.896  5.792   1.00 0.00 ? 172 THR A C    2  
ATOM 3403  O O    . THR A 1 94  ? 18.420  -3.797  5.336   1.00 0.00 ? 172 THR A O    2  
ATOM 3404  C CB   . THR A 1 94  ? 17.601  -2.201  8.186   1.00 0.00 ? 172 THR A CB   2  
ATOM 3405  O OG1  . THR A 1 94  ? 18.093  -1.286  9.171   1.00 0.00 ? 172 THR A OG1  2  
ATOM 3406  C CG2  . THR A 1 94  ? 17.869  -3.630  8.635   1.00 0.00 ? 172 THR A CG2  2  
ATOM 3407  H H    . THR A 1 94  ? 17.148  -0.219  6.248   1.00 0.00 ? 172 THR A H    2  
ATOM 3408  H HA   . THR A 1 94  ? 19.330  -2.082  6.928   1.00 0.00 ? 172 THR A HA   2  
ATOM 3409  H HB   . THR A 1 94  ? 16.533  -2.067  8.082   1.00 0.00 ? 172 THR A HB   2  
ATOM 3410  H HG1  . THR A 1 94  ? 18.951  -1.583  9.484   1.00 0.00 ? 172 THR A HG1  2  
ATOM 3411  H HG21 . THR A 1 94  ? 18.747  -3.651  9.263   1.00 0.00 ? 172 THR A HG21 2  
ATOM 3412  H HG22 . THR A 1 94  ? 18.030  -4.255  7.769   1.00 0.00 ? 172 THR A HG22 2  
ATOM 3413  H HG23 . THR A 1 94  ? 17.020  -3.997  9.191   1.00 0.00 ? 172 THR A HG23 2  
ATOM 3414  N N    . LEU A 1 95  ? 16.452  -2.710  5.425   1.00 0.00 ? 173 LEU A N    2  
ATOM 3415  C CA   . LEU A 1 95  ? 15.806  -3.574  4.443   1.00 0.00 ? 173 LEU A CA   2  
ATOM 3416  C C    . LEU A 1 95  ? 16.463  -3.429  3.074   1.00 0.00 ? 173 LEU A C    2  
ATOM 3417  O O    . LEU A 1 95  ? 17.288  -2.540  2.861   1.00 0.00 ? 173 LEU A O    2  
ATOM 3418  C CB   . LEU A 1 95  ? 14.316  -3.242  4.344   1.00 0.00 ? 173 LEU A CB   2  
ATOM 3419  C CG   . LEU A 1 95  ? 13.960  -1.984  3.551   1.00 0.00 ? 173 LEU A CG   2  
ATOM 3420  C CD1  . LEU A 1 95  ? 13.782  -2.314  2.077   1.00 0.00 ? 173 LEU A CD1  2  
ATOM 3421  C CD2  . LEU A 1 95  ? 12.700  -1.339  4.111   1.00 0.00 ? 173 LEU A CD2  2  
ATOM 3422  H H    . LEU A 1 95  ? 15.941  -1.975  5.823   1.00 0.00 ? 173 LEU A H    2  
ATOM 3423  H HA   . LEU A 1 95  ? 15.918  -4.595  4.776   1.00 0.00 ? 173 LEU A HA   2  
ATOM 3424  H HB2  . LEU A 1 95  ? 13.821  -4.079  3.876   1.00 0.00 ? 173 LEU A HB2  2  
ATOM 3425  H HB3  . LEU A 1 95  ? 13.938  -3.119  5.349   1.00 0.00 ? 173 LEU A HB3  2  
ATOM 3426  H HG   . LEU A 1 95  ? 14.768  -1.271  3.638   1.00 0.00 ? 173 LEU A HG   2  
ATOM 3427  H HD11 . LEU A 1 95  ? 13.808  -3.385  1.943   1.00 0.00 ? 173 LEU A HD11 2  
ATOM 3428  H HD12 . LEU A 1 95  ? 14.580  -1.861  1.508   1.00 0.00 ? 173 LEU A HD12 2  
ATOM 3429  H HD13 . LEU A 1 95  ? 12.833  -1.930  1.734   1.00 0.00 ? 173 LEU A HD13 2  
ATOM 3430  H HD21 . LEU A 1 95  ? 11.851  -1.630  3.511   1.00 0.00 ? 173 LEU A HD21 2  
ATOM 3431  H HD22 . LEU A 1 95  ? 12.805  -0.264  4.089   1.00 0.00 ? 173 LEU A HD22 2  
ATOM 3432  H HD23 . LEU A 1 95  ? 12.551  -1.666  5.129   1.00 0.00 ? 173 LEU A HD23 2  
ATOM 3433  N N    . ARG A 1 96  ? 16.089  -4.306  2.148   1.00 0.00 ? 174 ARG A N    2  
ATOM 3434  C CA   . ARG A 1 96  ? 16.641  -4.274  0.799   1.00 0.00 ? 174 ARG A CA   2  
ATOM 3435  C C    . ARG A 1 96  ? 15.795  -3.392  -0.114  1.00 0.00 ? 174 ARG A C    2  
ATOM 3436  O O    . ARG A 1 96  ? 16.184  -2.274  -0.447  1.00 0.00 ? 174 ARG A O    2  
ATOM 3437  C CB   . ARG A 1 96  ? 16.723  -5.690  0.225   1.00 0.00 ? 174 ARG A CB   2  
ATOM 3438  C CG   . ARG A 1 96  ? 17.359  -5.753  -1.154  1.00 0.00 ? 174 ARG A CG   2  
ATOM 3439  C CD   . ARG A 1 96  ? 18.871  -5.893  -1.064  1.00 0.00 ? 174 ARG A CD   2  
ATOM 3440  N NE   . ARG A 1 96  ? 19.519  -5.658  -2.351  1.00 0.00 ? 174 ARG A NE   2  
ATOM 3441  C CZ   . ARG A 1 96  ? 20.742  -6.085  -2.647  1.00 0.00 ? 174 ARG A CZ   2  
ATOM 3442  N NH1  . ARG A 1 96  ? 21.444  -6.766  -1.752  1.00 0.00 ? 174 ARG A NH1  2  
ATOM 3443  N NH2  . ARG A 1 96  ? 21.264  -5.832  -3.841  1.00 0.00 ? 174 ARG A NH2  2  
ATOM 3444  H H    . ARG A 1 96  ? 15.427  -4.991  2.378   1.00 0.00 ? 174 ARG A H    2  
ATOM 3445  H HA   . ARG A 1 96  ? 17.637  -3.861  0.857   1.00 0.00 ? 174 ARG A HA   2  
ATOM 3446  H HB2  . ARG A 1 96  ? 17.307  -6.305  0.895   1.00 0.00 ? 174 ARG A HB2  2  
ATOM 3447  H HB3  . ARG A 1 96  ? 15.725  -6.096  0.156   1.00 0.00 ? 174 ARG A HB3  2  
ATOM 3448  H HG2  . ARG A 1 96  ? 16.961  -6.605  -1.685  1.00 0.00 ? 174 ARG A HG2  2  
ATOM 3449  H HG3  . ARG A 1 96  ? 17.121  -4.847  -1.691  1.00 0.00 ? 174 ARG A HG3  2  
ATOM 3450  H HD2  . ARG A 1 96  ? 19.243  -5.176  -0.348  1.00 0.00 ? 174 ARG A HD2  2  
ATOM 3451  H HD3  . ARG A 1 96  ? 19.107  -6.892  -0.729  1.00 0.00 ? 174 ARG A HD3  2  
ATOM 3452  H HE   . ARG A 1 96  ? 19.018  -5.157  -3.027  1.00 0.00 ? 174 ARG A HE   2  
ATOM 3453  H HH11 . ARG A 1 96  ? 21.053  -6.959  -0.853  1.00 0.00 ? 174 ARG A HH11 2  
ATOM 3454  H HH12 . ARG A 1 96  ? 22.364  -7.088  -1.978  1.00 0.00 ? 174 ARG A HH12 2  
ATOM 3455  H HH21 . ARG A 1 96  ? 20.737  -5.319  -4.518  1.00 0.00 ? 174 ARG A HH21 2  
ATOM 3456  H HH22 . ARG A 1 96  ? 22.184  -6.154  -4.062  1.00 0.00 ? 174 ARG A HH22 2  
ATOM 3457  N N    . ASN A 1 97  ? 14.637  -3.905  -0.516  1.00 0.00 ? 175 ASN A N    2  
ATOM 3458  C CA   . ASN A 1 97  ? 13.736  -3.164  -1.392  1.00 0.00 ? 175 ASN A CA   2  
ATOM 3459  C C    . ASN A 1 97  ? 12.413  -2.873  -0.691  1.00 0.00 ? 175 ASN A C    2  
ATOM 3460  O O    . ASN A 1 97  ? 12.020  -3.581  0.237   1.00 0.00 ? 175 ASN A O    2  
ATOM 3461  C CB   . ASN A 1 97  ? 13.481  -3.951  -2.679  1.00 0.00 ? 175 ASN A CB   2  
ATOM 3462  C CG   . ASN A 1 97  ? 12.219  -3.503  -3.391  1.00 0.00 ? 175 ASN A CG   2  
ATOM 3463  O OD1  . ASN A 1 97  ? 12.118  -2.361  -3.840  1.00 0.00 ? 175 ASN A OD1  2  
ATOM 3464  N ND2  . ASN A 1 97  ? 11.248  -4.403  -3.496  1.00 0.00 ? 175 ASN A ND2  2  
ATOM 3465  H H    . ASN A 1 97  ? 14.381  -4.803  -0.217  1.00 0.00 ? 175 ASN A H    2  
ATOM 3466  H HA   . ASN A 1 97  ? 14.212  -2.228  -1.641  1.00 0.00 ? 175 ASN A HA   2  
ATOM 3467  H HB2  . ASN A 1 97  ? 14.317  -3.813  -3.350  1.00 0.00 ? 175 ASN A HB2  2  
ATOM 3468  H HB3  . ASN A 1 97  ? 13.386  -4.999  -2.441  1.00 0.00 ? 175 ASN A HB3  2  
ATOM 3469  H HD21 . ASN A 1 97  ? 11.399  -5.293  -3.115  1.00 0.00 ? 175 ASN A HD21 2  
ATOM 3470  H HD22 . ASN A 1 97  ? 10.422  -4.140  -3.952  1.00 0.00 ? 175 ASN A HD22 2  
ATOM 3471  N N    . VAL A 1 98  ? 11.728  -1.826  -1.141  1.00 0.00 ? 176 VAL A N    2  
ATOM 3472  C CA   . VAL A 1 98  ? 10.448  -1.441  -0.558  1.00 0.00 ? 176 VAL A CA   2  
ATOM 3473  C C    . VAL A 1 98  ? 9.336   -1.482  -1.600  1.00 0.00 ? 176 VAL A C    2  
ATOM 3474  O O    . VAL A 1 98  ? 9.157   -0.555  -2.390  1.00 0.00 ? 176 VAL A O    2  
ATOM 3475  C CB   . VAL A 1 98  ? 10.512  -0.029  0.053   1.00 0.00 ? 176 VAL A CB   2  
ATOM 3476  C CG1  . VAL A 1 98  ? 9.195   0.319   0.731   1.00 0.00 ? 176 VAL A CG1  2  
ATOM 3477  C CG2  . VAL A 1 98  ? 11.670  0.075   1.035   1.00 0.00 ? 176 VAL A CG2  2  
ATOM 3478  H H    . VAL A 1 98  ? 12.093  -1.300  -1.883  1.00 0.00 ? 176 VAL A H    2  
ATOM 3479  H HA   . VAL A 1 98  ? 10.216  -2.142  0.230   1.00 0.00 ? 176 VAL A HA   2  
ATOM 3480  H HB   . VAL A 1 98  ? 10.679  0.680   -0.744  1.00 0.00 ? 176 VAL A HB   2  
ATOM 3481  H HG11 . VAL A 1 98  ? 9.196   -0.068  1.739   1.00 0.00 ? 176 VAL A HG11 2  
ATOM 3482  H HG12 . VAL A 1 98  ? 9.076   1.392   0.756   1.00 0.00 ? 176 VAL A HG12 2  
ATOM 3483  H HG13 . VAL A 1 98  ? 8.379   -0.122  0.178   1.00 0.00 ? 176 VAL A HG13 2  
ATOM 3484  H HG21 . VAL A 1 98  ? 11.438  -0.492  1.924   1.00 0.00 ? 176 VAL A HG21 2  
ATOM 3485  H HG22 . VAL A 1 98  ? 12.565  -0.322  0.579   1.00 0.00 ? 176 VAL A HG22 2  
ATOM 3486  H HG23 . VAL A 1 98  ? 11.828  1.110   1.297   1.00 0.00 ? 176 VAL A HG23 2  
ATOM 3487  N N    . PRO A 1 99  ? 8.569   -2.583  -1.603  1.00 0.00 ? 177 PRO A N    2  
ATOM 3488  C CA   . PRO A 1 99  ? 7.459   -2.772  -2.542  1.00 0.00 ? 177 PRO A CA   2  
ATOM 3489  C C    . PRO A 1 99  ? 6.289   -1.838  -2.252  1.00 0.00 ? 177 PRO A C    2  
ATOM 3490  O O    . PRO A 1 99  ? 6.243   -1.163  -1.223  1.00 0.00 ? 177 PRO A O    2  
ATOM 3491  C CB   . PRO A 1 99  ? 7.049   -4.229  -2.318  1.00 0.00 ? 177 PRO A CB   2  
ATOM 3492  C CG   . PRO A 1 99  ? 7.478   -4.534  -0.924  1.00 0.00 ? 177 PRO A CG   2  
ATOM 3493  C CD   . PRO A 1 99  ? 8.726   -3.727  -0.690  1.00 0.00 ? 177 PRO A CD   2  
ATOM 3494  H HA   . PRO A 1 99  ? 7.779   -2.639  -3.566  1.00 0.00 ? 177 PRO A HA   2  
ATOM 3495  H HB2  . PRO A 1 99  ? 5.978   -4.326  -2.433  1.00 0.00 ? 177 PRO A HB2  2  
ATOM 3496  H HB3  . PRO A 1 99  ? 7.552   -4.863  -3.033  1.00 0.00 ? 177 PRO A HB3  2  
ATOM 3497  H HG2  . PRO A 1 99  ? 6.706   -4.240  -0.230  1.00 0.00 ? 177 PRO A HG2  2  
ATOM 3498  H HG3  . PRO A 1 99  ? 7.691   -5.588  -0.828  1.00 0.00 ? 177 PRO A HG3  2  
ATOM 3499  H HD2  . PRO A 1 99  ? 8.775   -3.398  0.337   1.00 0.00 ? 177 PRO A HD2  2  
ATOM 3500  H HD3  . PRO A 1 99  ? 9.602   -4.306  -0.945  1.00 0.00 ? 177 PRO A HD3  2  
ATOM 3501  N N    . PRO A 1 100 ? 5.320   -1.797  -3.178  1.00 0.00 ? 178 PRO A N    2  
ATOM 3502  C CA   . PRO A 1 100 ? 4.131   -0.950  -3.043  1.00 0.00 ? 178 PRO A CA   2  
ATOM 3503  C C    . PRO A 1 100 ? 3.194   -1.438  -1.943  1.00 0.00 ? 178 PRO A C    2  
ATOM 3504  O O    . PRO A 1 100 ? 2.907   -2.631  -1.843  1.00 0.00 ? 178 PRO A O    2  
ATOM 3505  C CB   . PRO A 1 100 ? 3.455   -1.066  -4.411  1.00 0.00 ? 178 PRO A CB   2  
ATOM 3506  C CG   . PRO A 1 100 ? 3.913   -2.378  -4.950  1.00 0.00 ? 178 PRO A CG   2  
ATOM 3507  C CD   . PRO A 1 100 ? 5.310   -2.575  -4.429  1.00 0.00 ? 178 PRO A CD   2  
ATOM 3508  H HA   . PRO A 1 100 ? 4.397   0.080   -2.857  1.00 0.00 ? 178 PRO A HA   2  
ATOM 3509  H HB2  . PRO A 1 100 ? 2.382   -1.042  -4.288  1.00 0.00 ? 178 PRO A HB2  2  
ATOM 3510  H HB3  . PRO A 1 100 ? 3.770   -0.249  -5.043  1.00 0.00 ? 178 PRO A HB3  2  
ATOM 3511  H HG2  . PRO A 1 100 ? 3.266   -3.166  -4.596  1.00 0.00 ? 178 PRO A HG2  2  
ATOM 3512  H HG3  . PRO A 1 100 ? 3.917   -2.350  -6.029  1.00 0.00 ? 178 PRO A HG3  2  
ATOM 3513  H HD2  . PRO A 1 100 ? 5.496   -3.620  -4.234  1.00 0.00 ? 178 PRO A HD2  2  
ATOM 3514  H HD3  . PRO A 1 100 ? 6.033   -2.185  -5.130  1.00 0.00 ? 178 PRO A HD3  2  
ATOM 3515  N N    . ILE A 1 101 ? 2.721   -0.508  -1.120  1.00 0.00 ? 179 ILE A N    2  
ATOM 3516  C CA   . ILE A 1 101 ? 1.816   -0.844  -0.028  1.00 0.00 ? 179 ILE A CA   2  
ATOM 3517  C C    . ILE A 1 101 ? 0.360   -0.729  -0.467  1.00 0.00 ? 179 ILE A C    2  
ATOM 3518  O O    . ILE A 1 101 ? -0.063  0.301   -0.991  1.00 0.00 ? 179 ILE A O    2  
ATOM 3519  C CB   . ILE A 1 101 ? 2.045   0.066   1.193   1.00 0.00 ? 179 ILE A CB   2  
ATOM 3520  C CG1  . ILE A 1 101 ? 3.442   -0.165  1.773   1.00 0.00 ? 179 ILE A CG1  2  
ATOM 3521  C CG2  . ILE A 1 101 ? 0.979   -0.187  2.249   1.00 0.00 ? 179 ILE A CG2  2  
ATOM 3522  C CD1  . ILE A 1 101 ? 3.935   0.977   2.634   1.00 0.00 ? 179 ILE A CD1  2  
ATOM 3523  H H    . ILE A 1 101 ? 2.987   0.426   -1.251  1.00 0.00 ? 179 ILE A H    2  
ATOM 3524  H HA   . ILE A 1 101 ? 2.013   -1.864  0.266   1.00 0.00 ? 179 ILE A HA   2  
ATOM 3525  H HB   . ILE A 1 101 ? 1.961   1.092   0.871   1.00 0.00 ? 179 ILE A HB   2  
ATOM 3526  H HG12 . ILE A 1 101 ? 3.430   -1.056  2.380   1.00 0.00 ? 179 ILE A HG12 2  
ATOM 3527  H HG13 . ILE A 1 101 ? 4.143   -0.296  0.961   1.00 0.00 ? 179 ILE A HG13 2  
ATOM 3528  H HG21 . ILE A 1 101 ? 0.249   -0.883  1.864   1.00 0.00 ? 179 ILE A HG21 2  
ATOM 3529  H HG22 . ILE A 1 101 ? 1.439   -0.602  3.133   1.00 0.00 ? 179 ILE A HG22 2  
ATOM 3530  H HG23 . ILE A 1 101 ? 0.492   0.743   2.499   1.00 0.00 ? 179 ILE A HG23 2  
ATOM 3531  H HD11 . ILE A 1 101 ? 3.100   1.602   2.916   1.00 0.00 ? 179 ILE A HD11 2  
ATOM 3532  H HD12 . ILE A 1 101 ? 4.407   0.583   3.521   1.00 0.00 ? 179 ILE A HD12 2  
ATOM 3533  H HD13 . ILE A 1 101 ? 4.650   1.565   2.077   1.00 0.00 ? 179 ILE A HD13 2  
ATOM 3534  N N    . VAL A 1 102 ? -0.404  -1.795  -0.248  1.00 0.00 ? 180 VAL A N    2  
ATOM 3535  C CA   . VAL A 1 102 ? -1.814  -1.814  -0.618  1.00 0.00 ? 180 VAL A CA   2  
ATOM 3536  C C    . VAL A 1 102 ? -2.695  -2.121  0.588   1.00 0.00 ? 180 VAL A C    2  
ATOM 3537  O O    . VAL A 1 102 ? -2.620  -3.207  1.165   1.00 0.00 ? 180 VAL A O    2  
ATOM 3538  C CB   . VAL A 1 102 ? -2.092  -2.853  -1.720  1.00 0.00 ? 180 VAL A CB   2  
ATOM 3539  C CG1  . VAL A 1 102 ? -3.559  -2.829  -2.121  1.00 0.00 ? 180 VAL A CG1  2  
ATOM 3540  C CG2  . VAL A 1 102 ? -1.197  -2.602  -2.925  1.00 0.00 ? 180 VAL A CG2  2  
ATOM 3541  H H    . VAL A 1 102 ? -0.010  -2.587  0.173   1.00 0.00 ? 180 VAL A H    2  
ATOM 3542  H HA   . VAL A 1 102 ? -2.073  -0.837  -1.000  1.00 0.00 ? 180 VAL A HA   2  
ATOM 3543  H HB   . VAL A 1 102 ? -1.865  -3.833  -1.328  1.00 0.00 ? 180 VAL A HB   2  
ATOM 3544  H HG11 . VAL A 1 102 ? -4.130  -2.316  -1.361  1.00 0.00 ? 180 VAL A HG11 2  
ATOM 3545  H HG12 . VAL A 1 102 ? -3.667  -2.312  -3.063  1.00 0.00 ? 180 VAL A HG12 2  
ATOM 3546  H HG13 . VAL A 1 102 ? -3.921  -3.841  -2.221  1.00 0.00 ? 180 VAL A HG13 2  
ATOM 3547  H HG21 . VAL A 1 102 ? -1.810  -2.451  -3.802  1.00 0.00 ? 180 VAL A HG21 2  
ATOM 3548  H HG22 . VAL A 1 102 ? -0.596  -1.722  -2.751  1.00 0.00 ? 180 VAL A HG22 2  
ATOM 3549  H HG23 . VAL A 1 102 ? -0.552  -3.454  -3.079  1.00 0.00 ? 180 VAL A HG23 2  
ATOM 3550  N N    . PHE A 1 103 ? -3.530  -1.159  0.965   1.00 0.00 ? 181 PHE A N    2  
ATOM 3551  C CA   . PHE A 1 103 ? -4.426  -1.326  2.104   1.00 0.00 ? 181 PHE A CA   2  
ATOM 3552  C C    . PHE A 1 103 ? -5.678  -2.099  1.701   1.00 0.00 ? 181 PHE A C    2  
ATOM 3553  O O    . PHE A 1 103 ? -6.307  -1.799  0.686   1.00 0.00 ? 181 PHE A O    2  
ATOM 3554  C CB   . PHE A 1 103 ? -4.816  0.037   2.677   1.00 0.00 ? 181 PHE A CB   2  
ATOM 3555  C CG   . PHE A 1 103 ? -3.667  0.776   3.302   1.00 0.00 ? 181 PHE A CG   2  
ATOM 3556  C CD1  . PHE A 1 103 ? -3.086  0.317   4.473   1.00 0.00 ? 181 PHE A CD1  2  
ATOM 3557  C CD2  . PHE A 1 103 ? -3.168  1.929   2.718   1.00 0.00 ? 181 PHE A CD2  2  
ATOM 3558  C CE1  . PHE A 1 103 ? -2.029  0.996   5.051   1.00 0.00 ? 181 PHE A CE1  2  
ATOM 3559  C CE2  . PHE A 1 103 ? -2.111  2.611   3.290   1.00 0.00 ? 181 PHE A CE2  2  
ATOM 3560  C CZ   . PHE A 1 103 ? -1.540  2.143   4.458   1.00 0.00 ? 181 PHE A CZ   2  
ATOM 3561  H H    . PHE A 1 103 ? -3.544  -0.315  0.466   1.00 0.00 ? 181 PHE A H    2  
ATOM 3562  H HA   . PHE A 1 103 ? -3.898  -1.888  2.859   1.00 0.00 ? 181 PHE A HA   2  
ATOM 3563  H HB2  . PHE A 1 103 ? -5.214  0.653   1.885   1.00 0.00 ? 181 PHE A HB2  2  
ATOM 3564  H HB3  . PHE A 1 103 ? -5.573  -0.102  3.434   1.00 0.00 ? 181 PHE A HB3  2  
ATOM 3565  H HD1  . PHE A 1 103 ? -3.467  -0.581  4.938   1.00 0.00 ? 181 PHE A HD1  2  
ATOM 3566  H HD2  . PHE A 1 103 ? -3.613  2.296   1.804   1.00 0.00 ? 181 PHE A HD2  2  
ATOM 3567  H HE1  . PHE A 1 103 ? -1.585  0.627   5.963   1.00 0.00 ? 181 PHE A HE1  2  
ATOM 3568  H HE2  . PHE A 1 103 ? -1.731  3.508   2.824   1.00 0.00 ? 181 PHE A HE2  2  
ATOM 3569  H HZ   . PHE A 1 103 ? -0.715  2.675   4.907   1.00 0.00 ? 181 PHE A HZ   2  
ATOM 3570  N N    . VAL A 1 104 ? -6.035  -3.096  2.505   1.00 0.00 ? 182 VAL A N    2  
ATOM 3571  C CA   . VAL A 1 104 ? -7.213  -3.912  2.234   1.00 0.00 ? 182 VAL A CA   2  
ATOM 3572  C C    . VAL A 1 104 ? -8.128  -3.977  3.451   1.00 0.00 ? 182 VAL A C    2  
ATOM 3573  O O    . VAL A 1 104 ? -7.661  -4.016  4.589   1.00 0.00 ? 182 VAL A O    2  
ATOM 3574  C CB   . VAL A 1 104 ? -6.821  -5.343  1.823   1.00 0.00 ? 182 VAL A CB   2  
ATOM 3575  C CG1  . VAL A 1 104 ? -8.061  -6.208  1.653   1.00 0.00 ? 182 VAL A CG1  2  
ATOM 3576  C CG2  . VAL A 1 104 ? -5.995  -5.324  0.546   1.00 0.00 ? 182 VAL A CG2  2  
ATOM 3577  H H    . VAL A 1 104 ? -5.494  -3.286  3.299   1.00 0.00 ? 182 VAL A H    2  
ATOM 3578  H HA   . VAL A 1 104 ? -7.752  -3.459  1.414   1.00 0.00 ? 182 VAL A HA   2  
ATOM 3579  H HB   . VAL A 1 104 ? -6.217  -5.770  2.611   1.00 0.00 ? 182 VAL A HB   2  
ATOM 3580  H HG11 . VAL A 1 104 ? -7.801  -7.107  1.112   1.00 0.00 ? 182 VAL A HG11 2  
ATOM 3581  H HG12 . VAL A 1 104 ? -8.452  -6.472  2.625   1.00 0.00 ? 182 VAL A HG12 2  
ATOM 3582  H HG13 . VAL A 1 104 ? -8.809  -5.660  1.100   1.00 0.00 ? 182 VAL A HG13 2  
ATOM 3583  H HG21 . VAL A 1 104 ? -4.945  -5.308  0.797   1.00 0.00 ? 182 VAL A HG21 2  
ATOM 3584  H HG22 . VAL A 1 104 ? -6.212  -6.207  -0.038  1.00 0.00 ? 182 VAL A HG22 2  
ATOM 3585  H HG23 . VAL A 1 104 ? -6.242  -4.443  -0.029  1.00 0.00 ? 182 VAL A HG23 2  
ATOM 3586  N N    . GLN A 1 105 ? -9.434  -3.989  3.203   1.00 0.00 ? 183 GLN A N    2  
ATOM 3587  C CA   . GLN A 1 105 ? -10.415 -4.049  4.280   1.00 0.00 ? 183 GLN A CA   2  
ATOM 3588  C C    . GLN A 1 105 ? -10.443 -5.436  4.914   1.00 0.00 ? 183 GLN A C    2  
ATOM 3589  O O    . GLN A 1 105 ? -10.562 -6.445  4.219   1.00 0.00 ? 183 GLN A O    2  
ATOM 3590  C CB   . GLN A 1 105 ? -11.805 -3.688  3.753   1.00 0.00 ? 183 GLN A CB   2  
ATOM 3591  C CG   . GLN A 1 105 ? -12.003 -2.197  3.529   1.00 0.00 ? 183 GLN A CG   2  
ATOM 3592  C CD   . GLN A 1 105 ? -13.183 -1.894  2.627   1.00 0.00 ? 183 GLN A CD   2  
ATOM 3593  O OE1  . GLN A 1 105 ? -14.095 -1.158  3.005   1.00 0.00 ? 183 GLN A OE1  2  
ATOM 3594  N NE2  . GLN A 1 105 ? -13.172 -2.461  1.426   1.00 0.00 ? 183 GLN A NE2  2  
ATOM 3595  H H    . GLN A 1 105 ? -9.744  -3.956  2.275   1.00 0.00 ? 183 GLN A H    2  
ATOM 3596  H HA   . GLN A 1 105 ? -10.127 -3.329  5.031   1.00 0.00 ? 183 GLN A HA   2  
ATOM 3597  H HB2  . GLN A 1 105 ? -11.964 -4.196  2.813   1.00 0.00 ? 183 GLN A HB2  2  
ATOM 3598  H HB3  . GLN A 1 105 ? -12.545 -4.024  4.464   1.00 0.00 ? 183 GLN A HB3  2  
ATOM 3599  H HG2  . GLN A 1 105 ? -12.168 -1.722  4.484   1.00 0.00 ? 183 GLN A HG2  2  
ATOM 3600  H HG3  . GLN A 1 105 ? -11.109 -1.793  3.077   1.00 0.00 ? 183 GLN A HG3  2  
ATOM 3601  H HE21 . GLN A 1 105 ? -12.413 -3.037  1.194   1.00 0.00 ? 183 GLN A HE21 2  
ATOM 3602  H HE22 . GLN A 1 105 ? -13.922 -2.283  0.823   1.00 0.00 ? 183 GLN A HE22 2  
ATOM 3603  N N    . ASP A 1 106 ? -10.333 -5.478  6.237   1.00 0.00 ? 184 ASP A N    2  
ATOM 3604  C CA   . ASP A 1 106 ? -10.347 -6.741  6.966   1.00 0.00 ? 184 ASP A CA   2  
ATOM 3605  C C    . ASP A 1 106 ? -11.408 -7.682  6.403   1.00 0.00 ? 184 ASP A C    2  
ATOM 3606  O O    . ASP A 1 106 ? -11.092 -8.752  5.882   1.00 0.00 ? 184 ASP A O    2  
ATOM 3607  C CB   . ASP A 1 106 ? -10.604 -6.494  8.453   1.00 0.00 ? 184 ASP A CB   2  
ATOM 3608  C CG   . ASP A 1 106 ? -10.787 -7.783  9.231   1.00 0.00 ? 184 ASP A CG   2  
ATOM 3609  O OD1  . ASP A 1 106 ? -10.221 -8.814  8.812   1.00 0.00 ? 184 ASP A OD1  2  
ATOM 3610  O OD2  . ASP A 1 106 ? -11.496 -7.759  10.259  1.00 0.00 ? 184 ASP A OD2  2  
ATOM 3611  H H    . ASP A 1 106 ? -10.242 -4.639  6.736   1.00 0.00 ? 184 ASP A H    2  
ATOM 3612  H HA   . ASP A 1 106 ? -9.378  -7.202  6.849   1.00 0.00 ? 184 ASP A HA   2  
ATOM 3613  H HB2  . ASP A 1 106 ? -9.764  -5.959  8.873   1.00 0.00 ? 184 ASP A HB2  2  
ATOM 3614  H HB3  . ASP A 1 106 ? -11.497 -5.898  8.563   1.00 0.00 ? 184 ASP A HB3  2  
ATOM 3615  N N    . LYS A 1 107 ? -12.669 -7.276  6.512   1.00 0.00 ? 185 LYS A N    2  
ATOM 3616  C CA   . LYS A 1 107 ? -13.778 -8.081  6.014   1.00 0.00 ? 185 LYS A CA   2  
ATOM 3617  C C    . LYS A 1 107 ? -14.011 -7.826  4.528   1.00 0.00 ? 185 LYS A C    2  
ATOM 3618  O O    . LYS A 1 107 ? -13.740 -6.737  4.025   1.00 0.00 ? 185 LYS A O    2  
ATOM 3619  C CB   . LYS A 1 107 ? -15.053 -7.772  6.802   1.00 0.00 ? 185 LYS A CB   2  
ATOM 3620  C CG   . LYS A 1 107 ? -14.934 -8.059  8.288   1.00 0.00 ? 185 LYS A CG   2  
ATOM 3621  C CD   . LYS A 1 107 ? -16.285 -7.982  8.981   1.00 0.00 ? 185 LYS A CD   2  
ATOM 3622  C CE   . LYS A 1 107 ? -17.097 -9.249  8.760   1.00 0.00 ? 185 LYS A CE   2  
ATOM 3623  N NZ   . LYS A 1 107 ? -18.559 -9.003  8.903   1.00 0.00 ? 185 LYS A NZ   2  
ATOM 3624  H H    . LYS A 1 107 ? -12.858 -6.412  6.937   1.00 0.00 ? 185 LYS A H    2  
ATOM 3625  H HA   . LYS A 1 107 ? -13.522 -9.120  6.153   1.00 0.00 ? 185 LYS A HA   2  
ATOM 3626  H HB2  . LYS A 1 107 ? -15.295 -6.727  6.676   1.00 0.00 ? 185 LYS A HB2  2  
ATOM 3627  H HB3  . LYS A 1 107 ? -15.861 -8.369  6.404   1.00 0.00 ? 185 LYS A HB3  2  
ATOM 3628  H HG2  . LYS A 1 107 ? -14.529 -9.051  8.423   1.00 0.00 ? 185 LYS A HG2  2  
ATOM 3629  H HG3  . LYS A 1 107 ? -14.269 -7.333  8.734   1.00 0.00 ? 185 LYS A HG3  2  
ATOM 3630  H HD2  . LYS A 1 107 ? -16.129 -7.848  10.041  1.00 0.00 ? 185 LYS A HD2  2  
ATOM 3631  H HD3  . LYS A 1 107 ? -16.834 -7.139  8.586   1.00 0.00 ? 185 LYS A HD3  2  
ATOM 3632  H HE2  . LYS A 1 107 ? -16.899 -9.620  7.767   1.00 0.00 ? 185 LYS A HE2  2  
ATOM 3633  H HE3  . LYS A 1 107 ? -16.792 -9.987  9.488   1.00 0.00 ? 185 LYS A HE3  2  
ATOM 3634  H HZ1  . LYS A 1 107 ? -18.830 -9.039  9.907   1.00 0.00 ? 185 LYS A HZ1  2  
ATOM 3635  H HZ2  . LYS A 1 107 ? -19.095 -9.726  8.384   1.00 0.00 ? 185 LYS A HZ2  2  
ATOM 3636  H HZ3  . LYS A 1 107 ? -18.802 -8.066  8.523   1.00 0.00 ? 185 LYS A HZ3  2  
ATOM 3637  N N    . GLY A 1 108 ? -14.517 -8.839  3.831   1.00 0.00 ? 186 GLY A N    2  
ATOM 3638  C CA   . GLY A 1 108 ? -14.780 -8.704  2.410   1.00 0.00 ? 186 GLY A CA   2  
ATOM 3639  C C    . GLY A 1 108 ? -16.259 -8.583  2.103   1.00 0.00 ? 186 GLY A C    2  
ATOM 3640  O O    . GLY A 1 108 ? -16.995 -9.567  2.164   1.00 0.00 ? 186 GLY A O    2  
ATOM 3641  H H    . GLY A 1 108 ? -14.714 -9.685  4.285   1.00 0.00 ? 186 GLY A H    2  
ATOM 3642  H HA2  . GLY A 1 108 ? -14.273 -7.823  2.044   1.00 0.00 ? 186 GLY A HA2  2  
ATOM 3643  H HA3  . GLY A 1 108 ? -14.387 -9.571  1.899   1.00 0.00 ? 186 GLY A HA3  2  
ATOM 3644  N N    . ASN A 1 109 ? -16.696 -7.373  1.772   1.00 0.00 ? 187 ASN A N    2  
ATOM 3645  C CA   . ASN A 1 109 ? -18.099 -7.126  1.457   1.00 0.00 ? 187 ASN A CA   2  
ATOM 3646  C C    . ASN A 1 109 ? -18.492 -7.816  0.154   1.00 0.00 ? 187 ASN A C    2  
ATOM 3647  O O    . ASN A 1 109 ? -18.302 -7.268  -0.932  1.00 0.00 ? 187 ASN A O    2  
ATOM 3648  C CB   . ASN A 1 109 ? -18.363 -5.623  1.351   1.00 0.00 ? 187 ASN A CB   2  
ATOM 3649  C CG   . ASN A 1 109 ? -19.843 -5.294  1.362   1.00 0.00 ? 187 ASN A CG   2  
ATOM 3650  O OD1  . ASN A 1 109 ? -20.496 -5.356  2.404   1.00 0.00 ? 187 ASN A OD1  2  
ATOM 3651  N ND2  . ASN A 1 109 ? -20.380 -4.942  0.200   1.00 0.00 ? 187 ASN A ND2  2  
ATOM 3652  H H    . ASN A 1 109 ? -16.061 -6.627  1.740   1.00 0.00 ? 187 ASN A H    2  
ATOM 3653  H HA   . ASN A 1 109 ? -18.695 -7.532  2.259   1.00 0.00 ? 187 ASN A HA   2  
ATOM 3654  H HB2  . ASN A 1 109 ? -17.896 -5.122  2.187   1.00 0.00 ? 187 ASN A HB2  2  
ATOM 3655  H HB3  . ASN A 1 109 ? -17.937 -5.252  0.431   1.00 0.00 ? 187 ASN A HB3  2  
ATOM 3656  H HD21 . ASN A 1 109 ? -19.799 -4.914  -0.589  1.00 0.00 ? 187 ASN A HD21 2  
ATOM 3657  H HD22 . ASN A 1 109 ? -21.335 -4.723  0.179   1.00 0.00 ? 187 ASN A HD22 2  
ATOM 3658  N N    . ALA A 1 110 ? -19.042 -9.020  0.270   1.00 0.00 ? 188 ALA A N    2  
ATOM 3659  C CA   . ALA A 1 110 ? -19.465 -9.783  -0.897  1.00 0.00 ? 188 ALA A CA   2  
ATOM 3660  C C    . ALA A 1 110 ? -20.983 -9.770  -1.042  1.00 0.00 ? 188 ALA A C    2  
ATOM 3661  O O    . ALA A 1 110 ? -21.706 -10.160 -0.126  1.00 0.00 ? 188 ALA A O    2  
ATOM 3662  C CB   . ALA A 1 110 ? -18.954 -11.213 -0.806  1.00 0.00 ? 188 ALA A CB   2  
ATOM 3663  H H    . ALA A 1 110 ? -19.168 -9.403  1.163   1.00 0.00 ? 188 ALA A H    2  
ATOM 3664  H HA   . ALA A 1 110 ? -19.026 -9.325  -1.772  1.00 0.00 ? 188 ALA A HA   2  
ATOM 3665  H HB1  . ALA A 1 110 ? -17.890 -11.227 -0.994  1.00 0.00 ? 188 ALA A HB1  2  
ATOM 3666  H HB2  . ALA A 1 110 ? -19.151 -11.603 0.181   1.00 0.00 ? 188 ALA A HB2  2  
ATOM 3667  H HB3  . ALA A 1 110 ? -19.457 -11.822 -1.542  1.00 0.00 ? 188 ALA A HB3  2  
ATOM 3668  N N    . ALA A 1 111 ? -21.459 -9.317  -2.197  1.00 0.00 ? 189 ALA A N    2  
ATOM 3669  C CA   . ALA A 1 111 ? -22.891 -9.255  -2.461  1.00 0.00 ? 189 ALA A CA   2  
ATOM 3670  C C    . ALA A 1 111 ? -23.225 -9.857  -3.822  1.00 0.00 ? 189 ALA A C    2  
ATOM 3671  O O    . ALA A 1 111 ? -24.091 -9.353  -4.539  1.00 0.00 ? 189 ALA A O    2  
ATOM 3672  C CB   . ALA A 1 111 ? -23.379 -7.816  -2.384  1.00 0.00 ? 189 ALA A CB   2  
ATOM 3673  H H    . ALA A 1 111 ? -20.832 -9.020  -2.889  1.00 0.00 ? 189 ALA A H    2  
ATOM 3674  H HA   . ALA A 1 111 ? -23.397 -9.822  -1.694  1.00 0.00 ? 189 ALA A HA   2  
ATOM 3675  H HB1  . ALA A 1 111 ? -22.722 -7.247  -1.742  1.00 0.00 ? 189 ALA A HB1  2  
ATOM 3676  H HB2  . ALA A 1 111 ? -23.381 -7.383  -3.373  1.00 0.00 ? 189 ALA A HB2  2  
ATOM 3677  H HB3  . ALA A 1 111 ? -24.381 -7.797  -1.981  1.00 0.00 ? 189 ALA A HB3  2  
ATOM 3678  N N    . LEU A 1 112 ? -22.534 -10.936 -4.172  1.00 0.00 ? 190 LEU A N    2  
ATOM 3679  C CA   . LEU A 1 112 ? -22.757 -11.606 -5.448  1.00 0.00 ? 190 LEU A CA   2  
ATOM 3680  C C    . LEU A 1 112 ? -24.212 -12.041 -5.587  1.00 0.00 ? 190 LEU A C    2  
ATOM 3681  O O    . LEU A 1 112 ? -24.861 -12.398 -4.604  1.00 0.00 ? 190 LEU A O    2  
ATOM 3682  C CB   . LEU A 1 112 ? -21.835 -12.821 -5.576  1.00 0.00 ? 190 LEU A CB   2  
ATOM 3683  C CG   . LEU A 1 112 ? -22.105 -13.973 -4.609  1.00 0.00 ? 190 LEU A CG   2  
ATOM 3684  C CD1  . LEU A 1 112 ? -21.474 -15.259 -5.121  1.00 0.00 ? 190 LEU A CD1  2  
ATOM 3685  C CD2  . LEU A 1 112 ? -21.583 -13.637 -3.220  1.00 0.00 ? 190 LEU A CD2  2  
ATOM 3686  H H    . LEU A 1 112 ? -21.858 -11.291 -3.559  1.00 0.00 ? 190 LEU A H    2  
ATOM 3687  H HA   . LEU A 1 112 ? -22.527 -10.905 -6.236  1.00 0.00 ? 190 LEU A HA   2  
ATOM 3688  H HB2  . LEU A 1 112 ? -21.931 -13.203 -6.581  1.00 0.00 ? 190 LEU A HB2  2  
ATOM 3689  H HB3  . LEU A 1 112 ? -20.821 -12.483 -5.416  1.00 0.00 ? 190 LEU A HB3  2  
ATOM 3690  H HG   . LEU A 1 112 ? -23.172 -14.132 -4.536  1.00 0.00 ? 190 LEU A HG   2  
ATOM 3691  H HD11 . LEU A 1 112 ? -20.844 -15.681 -4.353  1.00 0.00 ? 190 LEU A HD11 2  
ATOM 3692  H HD12 . LEU A 1 112 ? -20.880 -15.044 -5.997  1.00 0.00 ? 190 LEU A HD12 2  
ATOM 3693  H HD13 . LEU A 1 112 ? -22.251 -15.964 -5.378  1.00 0.00 ? 190 LEU A HD13 2  
ATOM 3694  H HD21 . LEU A 1 112 ? -22.333 -13.079 -2.679  1.00 0.00 ? 190 LEU A HD21 2  
ATOM 3695  H HD22 . LEU A 1 112 ? -20.685 -13.042 -3.307  1.00 0.00 ? 190 LEU A HD22 2  
ATOM 3696  H HD23 . LEU A 1 112 ? -21.360 -14.550 -2.688  1.00 0.00 ? 190 LEU A HD23 2  
ATOM 3697  N N    . ALA A 1 113 ? -24.718 -12.011 -6.816  1.00 0.00 ? 191 ALA A N    2  
ATOM 3698  C CA   . ALA A 1 113 ? -26.096 -12.407 -7.085  1.00 0.00 ? 191 ALA A CA   2  
ATOM 3699  C C    . ALA A 1 113 ? -26.175 -13.329 -8.296  1.00 0.00 ? 191 ALA A C    2  
ATOM 3700  O O    . ALA A 1 113 ? -27.083 -13.211 -9.119  1.00 0.00 ? 191 ALA A O    2  
ATOM 3701  C CB   . ALA A 1 113 ? -26.966 -11.177 -7.297  1.00 0.00 ? 191 ALA A CB   2  
ATOM 3702  H H    . ALA A 1 113 ? -24.152 -11.718 -7.559  1.00 0.00 ? 191 ALA A H    2  
ATOM 3703  H HA   . ALA A 1 113 ? -26.467 -12.934 -6.218  1.00 0.00 ? 191 ALA A HA   2  
ATOM 3704  H HB1  . ALA A 1 113 ? -28.007 -11.460 -7.243  1.00 0.00 ? 191 ALA A HB1  2  
ATOM 3705  H HB2  . ALA A 1 113 ? -26.751 -10.447 -6.531  1.00 0.00 ? 191 ALA A HB2  2  
ATOM 3706  H HB3  . ALA A 1 113 ? -26.758 -10.752 -8.268  1.00 0.00 ? 191 ALA A HB3  2  
ATOM 3707  N N    . GLU A 1 114 ? -25.219 -14.247 -8.399  1.00 0.00 ? 192 GLU A N    2  
ATOM 3708  C CA   . GLU A 1 114 ? -25.182 -15.189 -9.512  1.00 0.00 ? 192 GLU A CA   2  
ATOM 3709  C C    . GLU A 1 114 ? -25.540 -16.597 -9.046  1.00 0.00 ? 192 GLU A C    2  
ATOM 3710  O O    . GLU A 1 114 ? -24.670 -17.368 -8.638  1.00 0.00 ? 192 GLU A O    2  
ATOM 3711  C CB   . GLU A 1 114 ? -23.796 -15.191 -10.161 1.00 0.00 ? 192 GLU A CB   2  
ATOM 3712  C CG   . GLU A 1 114 ? -23.582 -14.053 -11.144 1.00 0.00 ? 192 GLU A CG   2  
ATOM 3713  C CD   . GLU A 1 114 ? -24.484 -14.154 -12.359 1.00 0.00 ? 192 GLU A CD   2  
ATOM 3714  O OE1  . GLU A 1 114 ? -24.402 -15.173 -13.076 1.00 0.00 ? 192 GLU A OE1  2  
ATOM 3715  O OE2  . GLU A 1 114 ? -25.271 -13.213 -12.593 1.00 0.00 ? 192 GLU A OE2  2  
ATOM 3716  H H    . GLU A 1 114 ? -24.523 -14.292 -7.712  1.00 0.00 ? 192 GLU A H    2  
ATOM 3717  H HA   . GLU A 1 114 ? -25.910 -14.868 -10.242 1.00 0.00 ? 192 GLU A HA   2  
ATOM 3718  H HB2  . GLU A 1 114 ? -23.049 -15.115 -9.385  1.00 0.00 ? 192 GLU A HB2  2  
ATOM 3719  H HB3  . GLU A 1 114 ? -23.661 -16.124 -10.688 1.00 0.00 ? 192 GLU A HB3  2  
ATOM 3720  H HG2  . GLU A 1 114 ? -23.784 -13.118 -10.643 1.00 0.00 ? 192 GLU A HG2  2  
ATOM 3721  H HG3  . GLU A 1 114 ? -22.554 -14.068 -11.475 1.00 0.00 ? 192 GLU A HG3  2  
ATOM 3722  N N    . LEU A 1 115 ? -26.826 -16.925 -9.109  1.00 0.00 ? 193 LEU A N    2  
ATOM 3723  C CA   . LEU A 1 115 ? -27.301 -18.240 -8.693  1.00 0.00 ? 193 LEU A CA   2  
ATOM 3724  C C    . LEU A 1 115 ? -27.412 -19.182 -9.887  1.00 0.00 ? 193 LEU A C    2  
ATOM 3725  O O    . LEU A 1 115 ? -27.885 -18.792 -10.955 1.00 0.00 ? 193 LEU A O    2  
ATOM 3726  C CB   . LEU A 1 115 ? -28.657 -18.118 -7.997  1.00 0.00 ? 193 LEU A CB   2  
ATOM 3727  C CG   . LEU A 1 115 ? -28.632 -17.574 -6.568  1.00 0.00 ? 193 LEU A CG   2  
ATOM 3728  C CD1  . LEU A 1 115 ? -30.032 -17.183 -6.121  1.00 0.00 ? 193 LEU A CD1  2  
ATOM 3729  C CD2  . LEU A 1 115 ? -28.034 -18.600 -5.617  1.00 0.00 ? 193 LEU A CD2  2  
ATOM 3730  H H    . LEU A 1 115 ? -27.472 -16.269 -9.442  1.00 0.00 ? 193 LEU A H    2  
ATOM 3731  H HA   . LEU A 1 115 ? -26.583 -18.646 -7.995  1.00 0.00 ? 193 LEU A HA   2  
ATOM 3732  H HB2  . LEU A 1 115 ? -29.275 -17.461 -8.590  1.00 0.00 ? 193 LEU A HB2  2  
ATOM 3733  H HB3  . LEU A 1 115 ? -29.104 -19.102 -7.970  1.00 0.00 ? 193 LEU A HB3  2  
ATOM 3734  H HG   . LEU A 1 115 ? -28.013 -16.687 -6.538  1.00 0.00 ? 193 LEU A HG   2  
ATOM 3735  H HD11 . LEU A 1 115 ? -29.966 -16.473 -5.310  1.00 0.00 ? 193 LEU A HD11 2  
ATOM 3736  H HD12 . LEU A 1 115 ? -30.562 -18.062 -5.787  1.00 0.00 ? 193 LEU A HD12 2  
ATOM 3737  H HD13 . LEU A 1 115 ? -30.563 -16.736 -6.949  1.00 0.00 ? 193 LEU A HD13 2  
ATOM 3738  H HD21 . LEU A 1 115 ? -27.734 -18.110 -4.702  1.00 0.00 ? 193 LEU A HD21 2  
ATOM 3739  H HD22 . LEU A 1 115 ? -27.172 -19.059 -6.079  1.00 0.00 ? 193 LEU A HD22 2  
ATOM 3740  H HD23 . LEU A 1 115 ? -28.770 -19.357 -5.395  1.00 0.00 ? 193 LEU A HD23 2  
ATOM 3741  N N    . ASP A 1 116 ? -26.976 -20.422 -9.699  1.00 0.00 ? 194 ASP A N    2  
ATOM 3742  C CA   . ASP A 1 116 ? -27.030 -21.421 -10.760 1.00 0.00 ? 194 ASP A CA   2  
ATOM 3743  C C    . ASP A 1 116 ? -27.457 -22.778 -10.208 1.00 0.00 ? 194 ASP A C    2  
ATOM 3744  O O    . ASP A 1 116 ? -26.679 -23.458 -9.538  1.00 0.00 ? 194 ASP A O    2  
ATOM 3745  C CB   . ASP A 1 116 ? -25.669 -21.541 -11.446 1.00 0.00 ? 194 ASP A CB   2  
ATOM 3746  C CG   . ASP A 1 116 ? -24.977 -20.201 -11.599 1.00 0.00 ? 194 ASP A CG   2  
ATOM 3747  O OD1  . ASP A 1 116 ? -25.677 -19.199 -11.858 1.00 0.00 ? 194 ASP A OD1  2  
ATOM 3748  O OD2  . ASP A 1 116 ? -23.737 -20.153 -11.460 1.00 0.00 ? 194 ASP A OD2  2  
ATOM 3749  H H    . ASP A 1 116 ? -26.610 -20.673 -8.824  1.00 0.00 ? 194 ASP A H    2  
ATOM 3750  H HA   . ASP A 1 116 ? -27.761 -21.096 -11.485 1.00 0.00 ? 194 ASP A HA   2  
ATOM 3751  H HB2  . ASP A 1 116 ? -25.033 -22.188 -10.860 1.00 0.00 ? 194 ASP A HB2  2  
ATOM 3752  H HB3  . ASP A 1 116 ? -25.805 -21.970 -12.428 1.00 0.00 ? 194 ASP A HB3  2  
ATOM 3753  N N    . GLN A 1 117 ? -28.696 -23.164 -10.493 1.00 0.00 ? 195 GLN A N    2  
ATOM 3754  C CA   . GLN A 1 117 ? -29.226 -24.439 -10.023 1.00 0.00 ? 195 GLN A CA   2  
ATOM 3755  C C    . GLN A 1 117 ? -29.769 -25.264 -11.185 1.00 0.00 ? 195 GLN A C    2  
ATOM 3756  O O    . GLN A 1 117 ? -30.816 -24.947 -11.750 1.00 0.00 ? 195 GLN A O    2  
ATOM 3757  C CB   . GLN A 1 117 ? -30.328 -24.207 -8.988  1.00 0.00 ? 195 GLN A CB   2  
ATOM 3758  C CG   . GLN A 1 117 ? -29.800 -23.928 -7.590  1.00 0.00 ? 195 GLN A CG   2  
ATOM 3759  C CD   . GLN A 1 117 ? -30.856 -24.118 -6.519  1.00 0.00 ? 195 GLN A CD   2  
ATOM 3760  O OE1  . GLN A 1 117 ? -31.937 -24.644 -6.784  1.00 0.00 ? 195 GLN A OE1  2  
ATOM 3761  N NE2  . GLN A 1 117 ? -30.547 -23.690 -5.300  1.00 0.00 ? 195 GLN A NE2  2  
ATOM 3762  H H    . GLN A 1 117 ? -29.267 -22.579 -11.031 1.00 0.00 ? 195 GLN A H    2  
ATOM 3763  H HA   . GLN A 1 117 ? -28.417 -24.983 -9.559  1.00 0.00 ? 195 GLN A HA   2  
ATOM 3764  H HB2  . GLN A 1 117 ? -30.926 -23.364 -9.299  1.00 0.00 ? 195 GLN A HB2  2  
ATOM 3765  H HB3  . GLN A 1 117 ? -30.954 -25.086 -8.944  1.00 0.00 ? 195 GLN A HB3  2  
ATOM 3766  H HG2  . GLN A 1 117 ? -28.979 -24.600 -7.388  1.00 0.00 ? 195 GLN A HG2  2  
ATOM 3767  H HG3  . GLN A 1 117 ? -29.447 -22.908 -7.550  1.00 0.00 ? 195 GLN A HG3  2  
ATOM 3768  H HE21 . GLN A 1 117 ? -29.667 -23.280 -5.163  1.00 0.00 ? 195 GLN A HE21 2  
ATOM 3769  H HE22 . GLN A 1 117 ? -31.211 -23.800 -4.589  1.00 0.00 ? 195 GLN A HE22 2  
ATOM 3770  N N    . LEU A 1 118 ? -29.050 -26.325 -11.537 1.00 0.00 ? 196 LEU A N    2  
ATOM 3771  C CA   . LEU A 1 118 ? -29.460 -27.197 -12.633 1.00 0.00 ? 196 LEU A CA   2  
ATOM 3772  C C    . LEU A 1 118 ? -29.449 -28.659 -12.198 1.00 0.00 ? 196 LEU A C    2  
ATOM 3773  O O    . LEU A 1 118 ? -28.670 -29.054 -11.330 1.00 0.00 ? 196 LEU A O    2  
ATOM 3774  C CB   . LEU A 1 118 ? -28.536 -27.004 -13.837 1.00 0.00 ? 196 LEU A CB   2  
ATOM 3775  C CG   . LEU A 1 118 ? -27.063 -27.351 -13.615 1.00 0.00 ? 196 LEU A CG   2  
ATOM 3776  C CD1  . LEU A 1 118 ? -26.804 -28.812 -13.945 1.00 0.00 ? 196 LEU A CD1  2  
ATOM 3777  C CD2  . LEU A 1 118 ? -26.171 -26.446 -14.453 1.00 0.00 ? 196 LEU A CD2  2  
ATOM 3778  H H    . LEU A 1 118 ? -28.225 -26.527 -11.050 1.00 0.00 ? 196 LEU A H    2  
ATOM 3779  H HA   . LEU A 1 118 ? -30.466 -26.925 -12.914 1.00 0.00 ? 196 LEU A HA   2  
ATOM 3780  H HB2  . LEU A 1 118 ? -28.904 -27.625 -14.639 1.00 0.00 ? 196 LEU A HB2  2  
ATOM 3781  H HB3  . LEU A 1 118 ? -28.592 -25.966 -14.132 1.00 0.00 ? 196 LEU A HB3  2  
ATOM 3782  H HG   . LEU A 1 118 ? -26.816 -27.195 -12.574 1.00 0.00 ? 196 LEU A HG   2  
ATOM 3783  H HD11 . LEU A 1 118 ? -26.244 -29.268 -13.142 1.00 0.00 ? 196 LEU A HD11 2  
ATOM 3784  H HD12 . LEU A 1 118 ? -26.237 -28.879 -14.862 1.00 0.00 ? 196 LEU A HD12 2  
ATOM 3785  H HD13 . LEU A 1 118 ? -27.746 -29.327 -14.066 1.00 0.00 ? 196 LEU A HD13 2  
ATOM 3786  H HD21 . LEU A 1 118 ? -25.960 -25.540 -13.904 1.00 0.00 ? 196 LEU A HD21 2  
ATOM 3787  H HD22 . LEU A 1 118 ? -26.674 -26.199 -15.376 1.00 0.00 ? 196 LEU A HD22 2  
ATOM 3788  H HD23 . LEU A 1 118 ? -25.245 -26.958 -14.672 1.00 0.00 ? 196 LEU A HD23 2  
ATOM 3789  N N    . LEU A 1 119 ? -30.317 -29.458 -12.809 1.00 0.00 ? 197 LEU A N    2  
ATOM 3790  C CA   . LEU A 1 119 ? -30.407 -30.878 -12.487 1.00 0.00 ? 197 LEU A CA   2  
ATOM 3791  C C    . LEU A 1 119 ? -31.243 -31.620 -13.525 1.00 0.00 ? 197 LEU A C    2  
ATOM 3792  O O    . LEU A 1 119 ? -32.381 -31.244 -13.802 1.00 0.00 ? 197 LEU A O    2  
ATOM 3793  C CB   . LEU A 1 119 ? -31.013 -31.069 -11.095 1.00 0.00 ? 197 LEU A CB   2  
ATOM 3794  C CG   . LEU A 1 119 ? -30.980 -32.492 -10.538 1.00 0.00 ? 197 LEU A CG   2  
ATOM 3795  C CD1  . LEU A 1 119 ? -30.907 -32.469 -9.019  1.00 0.00 ? 197 LEU A CD1  2  
ATOM 3796  C CD2  . LEU A 1 119 ? -32.198 -33.276 -11.004 1.00 0.00 ? 197 LEU A CD2  2  
ATOM 3797  H H    . LEU A 1 119 ? -30.912 -29.086 -13.492 1.00 0.00 ? 197 LEU A H    2  
ATOM 3798  H HA   . LEU A 1 119 ? -29.405 -31.283 -12.493 1.00 0.00 ? 197 LEU A HA   2  
ATOM 3799  H HB2  . LEU A 1 119 ? -30.474 -30.433 -10.410 1.00 0.00 ? 197 LEU A HB2  2  
ATOM 3800  H HB3  . LEU A 1 119 ? -32.046 -30.754 -11.140 1.00 0.00 ? 197 LEU A HB3  2  
ATOM 3801  H HG   . LEU A 1 119 ? -30.096 -32.996 -10.906 1.00 0.00 ? 197 LEU A HG   2  
ATOM 3802  H HD11 . LEU A 1 119 ? -31.894 -32.309 -8.614  1.00 0.00 ? 197 LEU A HD11 2  
ATOM 3803  H HD12 . LEU A 1 119 ? -30.253 -31.670 -8.702  1.00 0.00 ? 197 LEU A HD12 2  
ATOM 3804  H HD13 . LEU A 1 119 ? -30.520 -33.413 -8.663  1.00 0.00 ? 197 LEU A HD13 2  
ATOM 3805  H HD21 . LEU A 1 119 ? -32.052 -33.595 -12.025 1.00 0.00 ? 197 LEU A HD21 2  
ATOM 3806  H HD22 . LEU A 1 119 ? -33.075 -32.646 -10.946 1.00 0.00 ? 197 LEU A HD22 2  
ATOM 3807  H HD23 . LEU A 1 119 ? -32.333 -34.141 -10.371 1.00 0.00 ? 197 LEU A HD23 2  
ATOM 3808  N N    . ALA A 1 120 ? -30.671 -32.676 -14.093 1.00 0.00 ? 198 ALA A N    2  
ATOM 3809  C CA   . ALA A 1 120 ? -31.365 -33.474 -15.096 1.00 0.00 ? 198 ALA A CA   2  
ATOM 3810  C C    . ALA A 1 120 ? -30.870 -34.916 -15.090 1.00 0.00 ? 198 ALA A C    2  
ATOM 3811  O O    . ALA A 1 120 ? -29.669 -35.171 -15.001 1.00 0.00 ? 198 ALA A O    2  
ATOM 3812  C CB   . ALA A 1 120 ? -31.185 -32.858 -16.476 1.00 0.00 ? 198 ALA A CB   2  
ATOM 3813  H H    . ALA A 1 120 ? -29.761 -32.926 -13.830 1.00 0.00 ? 198 ALA A H    2  
ATOM 3814  H HA   . ALA A 1 120 ? -32.419 -33.464 -14.860 1.00 0.00 ? 198 ALA A HA   2  
ATOM 3815  H HB1  . ALA A 1 120 ? -31.870 -32.031 -16.592 1.00 0.00 ? 198 ALA A HB1  2  
ATOM 3816  H HB2  . ALA A 1 120 ? -30.170 -32.504 -16.583 1.00 0.00 ? 198 ALA A HB2  2  
ATOM 3817  H HB3  . ALA A 1 120 ? -31.388 -33.603 -17.231 1.00 0.00 ? 198 ALA A HB3  2  
ATOM 3818  N N    . VAL A 1 121 ? -31.804 -35.857 -15.183 1.00 0.00 ? 199 VAL A N    2  
ATOM 3819  C CA   . VAL A 1 121 ? -31.463 -37.275 -15.188 1.00 0.00 ? 199 VAL A CA   2  
ATOM 3820  C C    . VAL A 1 121 ? -31.519 -37.848 -16.600 1.00 0.00 ? 199 VAL A C    2  
ATOM 3821  O O    . VAL A 1 121 ? -32.435 -37.552 -17.366 1.00 0.00 ? 199 VAL A O    2  
ATOM 3822  C CB   . VAL A 1 121 ? -32.409 -38.083 -14.280 1.00 0.00 ? 199 VAL A CB   2  
ATOM 3823  C CG1  . VAL A 1 121 ? -31.938 -38.029 -12.835 1.00 0.00 ? 199 VAL A CG1  2  
ATOM 3824  C CG2  . VAL A 1 121 ? -33.835 -37.568 -14.404 1.00 0.00 ? 199 VAL A CG2  2  
ATOM 3825  H H    . VAL A 1 121 ? -32.745 -35.592 -15.251 1.00 0.00 ? 199 VAL A H    2  
ATOM 3826  H HA   . VAL A 1 121 ? -30.458 -37.378 -14.807 1.00 0.00 ? 199 VAL A HA   2  
ATOM 3827  H HB   . VAL A 1 121 ? -32.392 -39.114 -14.603 1.00 0.00 ? 199 VAL A HB   2  
ATOM 3828  H HG11 . VAL A 1 121 ? -31.254 -38.845 -12.649 1.00 0.00 ? 199 VAL A HG11 2  
ATOM 3829  H HG12 . VAL A 1 121 ? -31.437 -37.089 -12.654 1.00 0.00 ? 199 VAL A HG12 2  
ATOM 3830  H HG13 . VAL A 1 121 ? -32.789 -38.117 -12.176 1.00 0.00 ? 199 VAL A HG13 2  
ATOM 3831  H HG21 . VAL A 1 121 ? -33.971 -37.116 -15.375 1.00 0.00 ? 199 VAL A HG21 2  
ATOM 3832  H HG22 . VAL A 1 121 ? -34.527 -38.390 -14.290 1.00 0.00 ? 199 VAL A HG22 2  
ATOM 3833  H HG23 . VAL A 1 121 ? -34.021 -36.833 -13.635 1.00 0.00 ? 199 VAL A HG23 2  
ATOM 3834  N N    . ALA A 1 122 ? -30.532 -38.672 -16.937 1.00 0.00 ? 200 ALA A N    2  
ATOM 3835  C CA   . ALA A 1 122 ? -30.469 -39.290 -18.256 1.00 0.00 ? 200 ALA A CA   2  
ATOM 3836  C C    . ALA A 1 122 ? -30.695 -40.795 -18.168 1.00 0.00 ? 200 ALA A C    2  
ATOM 3837  O O    . ALA A 1 122 ? -29.743 -41.570 -18.070 1.00 0.00 ? 200 ALA A O    2  
ATOM 3838  C CB   . ALA A 1 122 ? -29.130 -38.992 -18.915 1.00 0.00 ? 200 ALA A CB   2  
ATOM 3839  H H    . ALA A 1 122 ? -29.830 -38.870 -16.283 1.00 0.00 ? 200 ALA A H    2  
ATOM 3840  H HA   . ALA A 1 122 ? -31.248 -38.854 -18.866 1.00 0.00 ? 200 ALA A HA   2  
ATOM 3841  H HB1  . ALA A 1 122 ? -29.091 -39.474 -19.881 1.00 0.00 ? 200 ALA A HB1  2  
ATOM 3842  H HB2  . ALA A 1 122 ? -29.020 -37.925 -19.039 1.00 0.00 ? 200 ALA A HB2  2  
ATOM 3843  H HB3  . ALA A 1 122 ? -28.332 -39.368 -18.293 1.00 0.00 ? 200 ALA A HB3  2  
ATOM 3844  N N    . ASP A 1 123 ? -31.959 -41.202 -18.203 1.00 0.00 ? 201 ASP A N    2  
ATOM 3845  C CA   . ASP A 1 123 ? -32.309 -42.616 -18.128 1.00 0.00 ? 201 ASP A CA   2  
ATOM 3846  C C    . ASP A 1 123 ? -33.086 -43.050 -19.368 1.00 0.00 ? 201 ASP A C    2  
ATOM 3847  O O    . ASP A 1 123 ? -34.317 -43.043 -19.375 1.00 0.00 ? 201 ASP A O    2  
ATOM 3848  C CB   . ASP A 1 123 ? -33.135 -42.892 -16.871 1.00 0.00 ? 201 ASP A CB   2  
ATOM 3849  C CG   . ASP A 1 123 ? -33.137 -44.360 -16.491 1.00 0.00 ? 201 ASP A CG   2  
ATOM 3850  O OD1  . ASP A 1 123 ? -32.087 -44.854 -16.031 1.00 0.00 ? 201 ASP A OD1  2  
ATOM 3851  O OD2  . ASP A 1 123 ? -34.189 -45.014 -16.653 1.00 0.00 ? 201 ASP A OD2  2  
ATOM 3852  H H    . ASP A 1 123 ? -32.673 -40.536 -18.283 1.00 0.00 ? 201 ASP A H    2  
ATOM 3853  H HA   . ASP A 1 123 ? -31.392 -43.183 -18.077 1.00 0.00 ? 201 ASP A HA   2  
ATOM 3854  H HB2  . ASP A 1 123 ? -32.725 -42.327 -16.047 1.00 0.00 ? 201 ASP A HB2  2  
ATOM 3855  H HB3  . ASP A 1 123 ? -34.155 -42.582 -17.043 1.00 0.00 ? 201 ASP A HB3  2  
ATOM 3856  N N    . SER A 1 124 ? -32.358 -43.426 -20.414 1.00 0.00 ? 202 SER A N    2  
ATOM 3857  C CA   . SER A 1 124 ? -32.978 -43.858 -21.661 1.00 0.00 ? 202 SER A CA   2  
ATOM 3858  C C    . SER A 1 124 ? -31.933 -44.416 -22.623 1.00 0.00 ? 202 SER A C    2  
ATOM 3859  O O    . SER A 1 124 ? -31.109 -43.677 -23.159 1.00 0.00 ? 202 SER A O    2  
ATOM 3860  C CB   . SER A 1 124 ? -33.720 -42.693 -22.317 1.00 0.00 ? 202 SER A CB   2  
ATOM 3861  O OG   . SER A 1 124 ? -32.820 -41.673 -22.713 1.00 0.00 ? 202 SER A OG   2  
ATOM 3862  H H    . SER A 1 124 ? -31.380 -43.410 -20.347 1.00 0.00 ? 202 SER A H    2  
ATOM 3863  H HA   . SER A 1 124 ? -33.686 -44.638 -21.426 1.00 0.00 ? 202 SER A HA   2  
ATOM 3864  H HB2  . SER A 1 124 ? -34.247 -43.049 -23.189 1.00 0.00 ? 202 SER A HB2  2  
ATOM 3865  H HB3  . SER A 1 124 ? -34.428 -42.279 -21.613 1.00 0.00 ? 202 SER A HB3  2  
ATOM 3866  H HG   . SER A 1 124 ? -31.953 -42.053 -22.869 1.00 0.00 ? 202 SER A HG   2  
ATOM 3867  N N    . GLY A 1 125 ? -31.974 -45.728 -22.836 1.00 0.00 ? 203 GLY A N    2  
ATOM 3868  C CA   . GLY A 1 125 ? -31.027 -46.364 -23.732 1.00 0.00 ? 203 GLY A CA   2  
ATOM 3869  C C    . GLY A 1 125 ? -31.497 -47.726 -24.202 1.00 0.00 ? 203 GLY A C    2  
ATOM 3870  O O    . GLY A 1 125 ? -31.171 -48.757 -23.613 1.00 0.00 ? 203 GLY A O    2  
ATOM 3871  H H    . GLY A 1 125 ? -32.654 -46.268 -22.381 1.00 0.00 ? 203 GLY A H    2  
ATOM 3872  H HA2  . GLY A 1 125 ? -30.880 -45.729 -24.593 1.00 0.00 ? 203 GLY A HA2  2  
ATOM 3873  H HA3  . GLY A 1 125 ? -30.084 -46.480 -23.218 1.00 0.00 ? 203 GLY A HA3  2  
ATOM 3874  N N    . PRO A 1 126 ? -32.286 -47.742 -25.287 1.00 0.00 ? 204 PRO A N    2  
ATOM 3875  C CA   . PRO A 1 126 ? -32.820 -48.982 -25.859 1.00 0.00 ? 204 PRO A CA   2  
ATOM 3876  C C    . PRO A 1 126 ? -31.737 -49.833 -26.513 1.00 0.00 ? 204 PRO A C    2  
ATOM 3877  O O    . PRO A 1 126 ? -30.676 -49.329 -26.881 1.00 0.00 ? 204 PRO A O    2  
ATOM 3878  C CB   . PRO A 1 126 ? -33.818 -48.487 -26.909 1.00 0.00 ? 204 PRO A CB   2  
ATOM 3879  C CG   . PRO A 1 126 ? -33.330 -47.130 -27.285 1.00 0.00 ? 204 PRO A CG   2  
ATOM 3880  C CD   . PRO A 1 126 ? -32.715 -46.552 -26.040 1.00 0.00 ? 204 PRO A CD   2  
ATOM 3881  H HA   . PRO A 1 126 ? -33.339 -49.570 -25.116 1.00 0.00 ? 204 PRO A HA   2  
ATOM 3882  H HB2  . PRO A 1 126 ? -33.814 -49.157 -27.757 1.00 0.00 ? 204 PRO A HB2  2  
ATOM 3883  H HB3  . PRO A 1 126 ? -34.807 -48.446 -26.480 1.00 0.00 ? 204 PRO A HB3  2  
ATOM 3884  H HG2  . PRO A 1 126 ? -32.591 -47.209 -28.067 1.00 0.00 ? 204 PRO A HG2  2  
ATOM 3885  H HG3  . PRO A 1 126 ? -34.160 -46.520 -27.611 1.00 0.00 ? 204 PRO A HG3  2  
ATOM 3886  H HD2  . PRO A 1 126 ? -31.870 -45.929 -26.291 1.00 0.00 ? 204 PRO A HD2  2  
ATOM 3887  H HD3  . PRO A 1 126 ? -33.450 -45.989 -25.483 1.00 0.00 ? 204 PRO A HD3  2  
ATOM 3888  N N    . SER A 1 127 ? -32.011 -51.126 -26.653 1.00 0.00 ? 205 SER A N    2  
ATOM 3889  C CA   . SER A 1 127 ? -31.058 -52.048 -27.260 1.00 0.00 ? 205 SER A CA   2  
ATOM 3890  C C    . SER A 1 127 ? -31.449 -52.364 -28.700 1.00 0.00 ? 205 SER A C    2  
ATOM 3891  O O    . SER A 1 127 ? -32.598 -52.174 -29.099 1.00 0.00 ? 205 SER A O    2  
ATOM 3892  C CB   . SER A 1 127 ? -30.978 -53.341 -26.445 1.00 0.00 ? 205 SER A CB   2  
ATOM 3893  O OG   . SER A 1 127 ? -32.255 -53.940 -26.313 1.00 0.00 ? 205 SER A OG   2  
ATOM 3894  H H    . SER A 1 127 ? -32.874 -51.468 -26.339 1.00 0.00 ? 205 SER A H    2  
ATOM 3895  H HA   . SER A 1 127 ? -30.089 -51.571 -27.259 1.00 0.00 ? 205 SER A HA   2  
ATOM 3896  H HB2  . SER A 1 127 ? -30.317 -54.035 -26.941 1.00 0.00 ? 205 SER A HB2  2  
ATOM 3897  H HB3  . SER A 1 127 ? -30.593 -53.119 -25.460 1.00 0.00 ? 205 SER A HB3  2  
ATOM 3898  H HG   . SER A 1 127 ? -32.163 -54.896 -26.323 1.00 0.00 ? 205 SER A HG   2  
ATOM 3899  N N    . SER A 1 128 ? -30.484 -52.848 -29.476 1.00 0.00 ? 206 SER A N    2  
ATOM 3900  C CA   . SER A 1 128 ? -30.726 -53.188 -30.873 1.00 0.00 ? 206 SER A CA   2  
ATOM 3901  C C    . SER A 1 128 ? -29.893 -54.396 -31.290 1.00 0.00 ? 206 SER A C    2  
ATOM 3902  O O    . SER A 1 128 ? -29.024 -54.851 -30.548 1.00 0.00 ? 206 SER A O    2  
ATOM 3903  C CB   . SER A 1 128 ? -30.400 -51.995 -31.774 1.00 0.00 ? 206 SER A CB   2  
ATOM 3904  O OG   . SER A 1 128 ? -29.034 -51.632 -31.665 1.00 0.00 ? 206 SER A OG   2  
ATOM 3905  H H    . SER A 1 128 ? -29.588 -52.977 -29.100 1.00 0.00 ? 206 SER A H    2  
ATOM 3906  H HA   . SER A 1 128 ? -31.772 -53.432 -30.979 1.00 0.00 ? 206 SER A HA   2  
ATOM 3907  H HB2  . SER A 1 128 ? -30.610 -52.253 -32.800 1.00 0.00 ? 206 SER A HB2  2  
ATOM 3908  H HB3  . SER A 1 128 ? -31.009 -51.151 -31.483 1.00 0.00 ? 206 SER A HB3  2  
ATOM 3909  H HG   . SER A 1 128 ? -28.703 -51.886 -30.800 1.00 0.00 ? 206 SER A HG   2  
ATOM 3910  N N    . GLY A 1 129 ? -30.166 -54.912 -32.485 1.00 0.00 ? 207 GLY A N    2  
ATOM 3911  C CA   . GLY A 1 129 ? -29.435 -56.063 -32.981 1.00 0.00 ? 207 GLY A CA   2  
ATOM 3912  C C    . GLY A 1 129 ? -29.956 -57.369 -32.415 1.00 0.00 ? 207 GLY A C    2  
ATOM 3913  O O    . GLY A 1 129 ? -29.498 -57.826 -31.368 1.00 0.00 ? 207 GLY A O    2  
ATOM 3914  H H    . GLY A 1 129 ? -30.871 -54.507 -33.034 1.00 0.00 ? 207 GLY A H    2  
ATOM 3915  H HA2  . GLY A 1 129 ? -29.517 -56.091 -34.057 1.00 0.00 ? 207 GLY A HA2  2  
ATOM 3916  H HA3  . GLY A 1 129 ? -28.394 -55.957 -32.712 1.00 0.00 ? 207 GLY A HA3  2  
ATOM 3917  N N    . GLY A 1 1   ? 3.781   -22.433 -5.512  1.00 0.00 ? 79  GLY A N    3  
ATOM 3918  C CA   . GLY A 1 1   ? 2.389   -22.795 -5.317  1.00 0.00 ? 79  GLY A CA   3  
ATOM 3919  C C    . GLY A 1 1   ? 2.139   -23.429 -3.963  1.00 0.00 ? 79  GLY A C    3  
ATOM 3920  O O    . GLY A 1 1   ? 2.544   -22.890 -2.933  1.00 0.00 ? 79  GLY A O    3  
ATOM 3921  H H1   . GLY A 1 1   ? 4.124   -22.280 -6.418  1.00 0.00 ? 79  GLY A H1   3  
ATOM 3922  H HA2  . GLY A 1 1   ? 1.782   -21.907 -5.405  1.00 0.00 ? 79  GLY A HA2  3  
ATOM 3923  H HA3  . GLY A 1 1   ? 2.100   -23.495 -6.088  1.00 0.00 ? 79  GLY A HA3  3  
ATOM 3924  N N    . SER A 1 2   ? 1.469   -24.577 -3.964  1.00 0.00 ? 80  SER A N    3  
ATOM 3925  C CA   . SER A 1 2   ? 1.161   -25.283 -2.725  1.00 0.00 ? 80  SER A CA   3  
ATOM 3926  C C    . SER A 1 2   ? 2.380   -26.046 -2.217  1.00 0.00 ? 80  SER A C    3  
ATOM 3927  O O    . SER A 1 2   ? 2.656   -26.069 -1.018  1.00 0.00 ? 80  SER A O    3  
ATOM 3928  C CB   . SER A 1 2   ? -0.006  -26.248 -2.941  1.00 0.00 ? 80  SER A CB   3  
ATOM 3929  O OG   . SER A 1 2   ? 0.356   -27.299 -3.820  1.00 0.00 ? 80  SER A OG   3  
ATOM 3930  H H    . SER A 1 2   ? 1.173   -24.957 -4.817  1.00 0.00 ? 80  SER A H    3  
ATOM 3931  H HA   . SER A 1 2   ? 0.877   -24.548 -1.987  1.00 0.00 ? 80  SER A HA   3  
ATOM 3932  H HB2  . SER A 1 2   ? -0.298  -26.673 -1.993  1.00 0.00 ? 80  SER A HB2  3  
ATOM 3933  H HB3  . SER A 1 2   ? -0.841  -25.710 -3.367  1.00 0.00 ? 80  SER A HB3  3  
ATOM 3934  H HG   . SER A 1 2   ? 0.949   -26.961 -4.496  1.00 0.00 ? 80  SER A HG   3  
ATOM 3935  N N    . SER A 1 3   ? 3.106   -26.671 -3.139  1.00 0.00 ? 81  SER A N    3  
ATOM 3936  C CA   . SER A 1 3   ? 4.294   -27.439 -2.785  1.00 0.00 ? 81  SER A CA   3  
ATOM 3937  C C    . SER A 1 3   ? 5.538   -26.556 -2.807  1.00 0.00 ? 81  SER A C    3  
ATOM 3938  O O    . SER A 1 3   ? 6.148   -26.351 -3.855  1.00 0.00 ? 81  SER A O    3  
ATOM 3939  C CB   . SER A 1 3   ? 4.472   -28.615 -3.748  1.00 0.00 ? 81  SER A CB   3  
ATOM 3940  O OG   . SER A 1 3   ? 5.558   -29.436 -3.355  1.00 0.00 ? 81  SER A OG   3  
ATOM 3941  H H    . SER A 1 3   ? 2.834   -26.615 -4.079  1.00 0.00 ? 81  SER A H    3  
ATOM 3942  H HA   . SER A 1 3   ? 4.155   -27.822 -1.785  1.00 0.00 ? 81  SER A HA   3  
ATOM 3943  H HB2  . SER A 1 3   ? 3.571   -29.210 -3.756  1.00 0.00 ? 81  SER A HB2  3  
ATOM 3944  H HB3  . SER A 1 3   ? 4.662   -28.237 -4.742  1.00 0.00 ? 81  SER A HB3  3  
ATOM 3945  H HG   . SER A 1 3   ? 6.384   -29.011 -3.597  1.00 0.00 ? 81  SER A HG   3  
ATOM 3946  N N    . GLY A 1 4   ? 5.908   -26.037 -1.640  1.00 0.00 ? 82  GLY A N    3  
ATOM 3947  C CA   . GLY A 1 4   ? 7.077   -25.182 -1.546  1.00 0.00 ? 82  GLY A CA   3  
ATOM 3948  C C    . GLY A 1 4   ? 6.717   -23.711 -1.492  1.00 0.00 ? 82  GLY A C    3  
ATOM 3949  O O    . GLY A 1 4   ? 6.448   -23.093 -2.522  1.00 0.00 ? 82  GLY A O    3  
ATOM 3950  H H    . GLY A 1 4   ? 5.382   -26.236 -0.837  1.00 0.00 ? 82  GLY A H    3  
ATOM 3951  H HA2  . GLY A 1 4   ? 7.627   -25.440 -0.653  1.00 0.00 ? 82  GLY A HA2  3  
ATOM 3952  H HA3  . GLY A 1 4   ? 7.705   -25.356 -2.407  1.00 0.00 ? 82  GLY A HA3  3  
ATOM 3953  N N    . SER A 1 5   ? 6.709   -23.149 -0.288  1.00 0.00 ? 83  SER A N    3  
ATOM 3954  C CA   . SER A 1 5   ? 6.373   -21.742 -0.103  1.00 0.00 ? 83  SER A CA   3  
ATOM 3955  C C    . SER A 1 5   ? 7.574   -20.852 -0.409  1.00 0.00 ? 83  SER A C    3  
ATOM 3956  O O    . SER A 1 5   ? 7.455   -19.851 -1.115  1.00 0.00 ? 83  SER A O    3  
ATOM 3957  C CB   . SER A 1 5   ? 5.891   -21.494 1.328   1.00 0.00 ? 83  SER A CB   3  
ATOM 3958  O OG   . SER A 1 5   ? 6.864   -21.908 2.272   1.00 0.00 ? 83  SER A OG   3  
ATOM 3959  H H    . SER A 1 5   ? 6.932   -23.694 0.495   1.00 0.00 ? 83  SER A H    3  
ATOM 3960  H HA   . SER A 1 5   ? 5.576   -21.498 -0.790  1.00 0.00 ? 83  SER A HA   3  
ATOM 3961  H HB2  . SER A 1 5   ? 5.701   -20.440 1.463   1.00 0.00 ? 83  SER A HB2  3  
ATOM 3962  H HB3  . SER A 1 5   ? 4.981   -22.049 1.499   1.00 0.00 ? 83  SER A HB3  3  
ATOM 3963  H HG   . SER A 1 5   ? 6.425   -22.262 3.049   1.00 0.00 ? 83  SER A HG   3  
ATOM 3964  N N    . SER A 1 6   ? 8.731   -21.225 0.129   1.00 0.00 ? 84  SER A N    3  
ATOM 3965  C CA   . SER A 1 6   ? 9.954   -20.460 -0.083  1.00 0.00 ? 84  SER A CA   3  
ATOM 3966  C C    . SER A 1 6   ? 11.130  -21.386 -0.377  1.00 0.00 ? 84  SER A C    3  
ATOM 3967  O O    . SER A 1 6   ? 11.081  -22.581 -0.091  1.00 0.00 ? 84  SER A O    3  
ATOM 3968  C CB   . SER A 1 6   ? 10.262  -19.601 1.145   1.00 0.00 ? 84  SER A CB   3  
ATOM 3969  O OG   . SER A 1 6   ? 9.459   -18.433 1.165   1.00 0.00 ? 84  SER A OG   3  
ATOM 3970  H H    . SER A 1 6   ? 8.762   -22.033 0.682   1.00 0.00 ? 84  SER A H    3  
ATOM 3971  H HA   . SER A 1 6   ? 9.798   -19.814 -0.934  1.00 0.00 ? 84  SER A HA   3  
ATOM 3972  H HB2  . SER A 1 6   ? 10.066  -20.172 2.040   1.00 0.00 ? 84  SER A HB2  3  
ATOM 3973  H HB3  . SER A 1 6   ? 11.302  -19.308 1.125   1.00 0.00 ? 84  SER A HB3  3  
ATOM 3974  H HG   . SER A 1 6   ? 8.992   -18.379 2.002   1.00 0.00 ? 84  SER A HG   3  
ATOM 3975  N N    . GLY A 1 7   ? 12.189  -20.823 -0.952  1.00 0.00 ? 85  GLY A N    3  
ATOM 3976  C CA   . GLY A 1 7   ? 13.364  -21.612 -1.277  1.00 0.00 ? 85  GLY A CA   3  
ATOM 3977  C C    . GLY A 1 7   ? 14.520  -21.344 -0.334  1.00 0.00 ? 85  GLY A C    3  
ATOM 3978  O O    . GLY A 1 7   ? 14.676  -22.028 0.678   1.00 0.00 ? 85  GLY A O    3  
ATOM 3979  H H    . GLY A 1 7   ? 12.173  -19.865 -1.158  1.00 0.00 ? 85  GLY A H    3  
ATOM 3980  H HA2  . GLY A 1 7   ? 13.106  -22.659 -1.226  1.00 0.00 ? 85  GLY A HA2  3  
ATOM 3981  H HA3  . GLY A 1 7   ? 13.674  -21.376 -2.284  1.00 0.00 ? 85  GLY A HA3  3  
ATOM 3982  N N    . ARG A 1 8   ? 15.334  -20.347 -0.666  1.00 0.00 ? 86  ARG A N    3  
ATOM 3983  C CA   . ARG A 1 8   ? 16.484  -19.993 0.157   1.00 0.00 ? 86  ARG A CA   3  
ATOM 3984  C C    . ARG A 1 8   ? 16.042  -19.560 1.552   1.00 0.00 ? 86  ARG A C    3  
ATOM 3985  O O    . ARG A 1 8   ? 15.051  -18.846 1.707   1.00 0.00 ? 86  ARG A O    3  
ATOM 3986  C CB   . ARG A 1 8   ? 17.287  -18.872 -0.506  1.00 0.00 ? 86  ARG A CB   3  
ATOM 3987  C CG   . ARG A 1 8   ? 16.432  -17.704 -0.970  1.00 0.00 ? 86  ARG A CG   3  
ATOM 3988  C CD   . ARG A 1 8   ? 17.288  -16.508 -1.357  1.00 0.00 ? 86  ARG A CD   3  
ATOM 3989  N NE   . ARG A 1 8   ? 16.478  -15.372 -1.789  1.00 0.00 ? 86  ARG A NE   3  
ATOM 3990  C CZ   . ARG A 1 8   ? 16.926  -14.122 -1.829  1.00 0.00 ? 86  ARG A CZ   3  
ATOM 3991  N NH1  . ARG A 1 8   ? 18.171  -13.849 -1.465  1.00 0.00 ? 86  ARG A NH1  3  
ATOM 3992  N NH2  . ARG A 1 8   ? 16.128  -13.143 -2.234  1.00 0.00 ? 86  ARG A NH2  3  
ATOM 3993  H H    . ARG A 1 8   ? 15.157  -19.838 -1.485  1.00 0.00 ? 86  ARG A H    3  
ATOM 3994  H HA   . ARG A 1 8   ? 17.110  -20.868 0.246   1.00 0.00 ? 86  ARG A HA   3  
ATOM 3995  H HB2  . ARG A 1 8   ? 18.014  -18.500 0.200   1.00 0.00 ? 86  ARG A HB2  3  
ATOM 3996  H HB3  . ARG A 1 8   ? 17.803  -19.275 -1.364  1.00 0.00 ? 86  ARG A HB3  3  
ATOM 3997  H HG2  . ARG A 1 8   ? 15.853  -18.011 -1.828  1.00 0.00 ? 86  ARG A HG2  3  
ATOM 3998  H HG3  . ARG A 1 8   ? 15.768  -17.416 -0.169  1.00 0.00 ? 86  ARG A HG3  3  
ATOM 3999  H HD2  . ARG A 1 8   ? 17.878  -16.212 -0.503  1.00 0.00 ? 86  ARG A HD2  3  
ATOM 4000  H HD3  . ARG A 1 8   ? 17.944  -16.798 -2.164  1.00 0.00 ? 86  ARG A HD3  3  
ATOM 4001  H HE   . ARG A 1 8   ? 15.554  -15.551 -2.063  1.00 0.00 ? 86  ARG A HE   3  
ATOM 4002  H HH11 . ARG A 1 8   ? 18.775  -14.586 -1.161  1.00 0.00 ? 86  ARG A HH11 3  
ATOM 4003  H HH12 . ARG A 1 8   ? 18.507  -12.907 -1.497  1.00 0.00 ? 86  ARG A HH12 3  
ATOM 4004  H HH21 . ARG A 1 8   ? 15.188  -13.345 -2.510  1.00 0.00 ? 86  ARG A HH21 3  
ATOM 4005  H HH22 . ARG A 1 8   ? 16.466  -12.202 -2.264  1.00 0.00 ? 86  ARG A HH22 3  
ATOM 4006  N N    . LYS A 1 9   ? 16.782  -19.998 2.564   1.00 0.00 ? 87  LYS A N    3  
ATOM 4007  C CA   . LYS A 1 9   ? 16.468  -19.656 3.946   1.00 0.00 ? 87  LYS A CA   3  
ATOM 4008  C C    . LYS A 1 9   ? 16.380  -18.144 4.126   1.00 0.00 ? 87  LYS A C    3  
ATOM 4009  O O    . LYS A 1 9   ? 15.485  -17.643 4.807   1.00 0.00 ? 87  LYS A O    3  
ATOM 4010  C CB   . LYS A 1 9   ? 17.528  -20.232 4.889   1.00 0.00 ? 87  LYS A CB   3  
ATOM 4011  C CG   . LYS A 1 9   ? 18.936  -19.749 4.587   1.00 0.00 ? 87  LYS A CG   3  
ATOM 4012  C CD   . LYS A 1 9   ? 19.983  -20.688 5.165   1.00 0.00 ? 87  LYS A CD   3  
ATOM 4013  C CE   . LYS A 1 9   ? 20.104  -21.961 4.341   1.00 0.00 ? 87  LYS A CE   3  
ATOM 4014  N NZ   . LYS A 1 9   ? 20.890  -23.007 5.051   1.00 0.00 ? 87  LYS A NZ   3  
ATOM 4015  H H    . LYS A 1 9   ? 17.560  -20.565 2.377   1.00 0.00 ? 87  LYS A H    3  
ATOM 4016  H HA   . LYS A 1 9   ? 15.511  -20.092 4.186   1.00 0.00 ? 87  LYS A HA   3  
ATOM 4017  H HB2  . LYS A 1 9   ? 17.282  -19.950 5.902   1.00 0.00 ? 87  LYS A HB2  3  
ATOM 4018  H HB3  . LYS A 1 9   ? 17.515  -21.309 4.811   1.00 0.00 ? 87  LYS A HB3  3  
ATOM 4019  H HG2  . LYS A 1 9   ? 19.068  -19.696 3.517   1.00 0.00 ? 87  LYS A HG2  3  
ATOM 4020  H HG3  . LYS A 1 9   ? 19.070  -18.767 5.018   1.00 0.00 ? 87  LYS A HG3  3  
ATOM 4021  H HD2  . LYS A 1 9   ? 20.939  -20.185 5.173   1.00 0.00 ? 87  LYS A HD2  3  
ATOM 4022  H HD3  . LYS A 1 9   ? 19.702  -20.948 6.175   1.00 0.00 ? 87  LYS A HD3  3  
ATOM 4023  H HE2  . LYS A 1 9   ? 19.114  -22.340 4.141   1.00 0.00 ? 87  LYS A HE2  3  
ATOM 4024  H HE3  . LYS A 1 9   ? 20.595  -21.725 3.408   1.00 0.00 ? 87  LYS A HE3  3  
ATOM 4025  H HZ1  . LYS A 1 9   ? 20.300  -23.470 5.771   1.00 0.00 ? 87  LYS A HZ1  3  
ATOM 4026  H HZ2  . LYS A 1 9   ? 21.715  -22.579 5.519   1.00 0.00 ? 87  LYS A HZ2  3  
ATOM 4027  H HZ3  . LYS A 1 9   ? 21.222  -23.725 4.376   1.00 0.00 ? 87  LYS A HZ3  3  
ATOM 4028  N N    . GLU A 1 10  ? 17.312  -17.424 3.511   1.00 0.00 ? 88  GLU A N    3  
ATOM 4029  C CA   . GLU A 1 10  ? 17.338  -15.969 3.604   1.00 0.00 ? 88  GLU A CA   3  
ATOM 4030  C C    . GLU A 1 10  ? 15.933  -15.390 3.462   1.00 0.00 ? 88  GLU A C    3  
ATOM 4031  O O    . GLU A 1 10  ? 15.530  -14.516 4.230   1.00 0.00 ? 88  GLU A O    3  
ATOM 4032  C CB   . GLU A 1 10  ? 18.253  -15.383 2.527   1.00 0.00 ? 88  GLU A CB   3  
ATOM 4033  C CG   . GLU A 1 10  ? 19.699  -15.835 2.645   1.00 0.00 ? 88  GLU A CG   3  
ATOM 4034  C CD   . GLU A 1 10  ? 20.460  -15.084 3.720   1.00 0.00 ? 88  GLU A CD   3  
ATOM 4035  O OE1  . GLU A 1 10  ? 20.065  -15.179 4.901   1.00 0.00 ? 88  GLU A OE1  3  
ATOM 4036  O OE2  . GLU A 1 10  ? 21.448  -14.401 3.381   1.00 0.00 ? 88  GLU A OE2  3  
ATOM 4037  H H    . GLU A 1 10  ? 17.999  -17.882 2.983   1.00 0.00 ? 88  GLU A H    3  
ATOM 4038  H HA   . GLU A 1 10  ? 17.726  -15.705 4.576   1.00 0.00 ? 88  GLU A HA   3  
ATOM 4039  H HB2  . GLU A 1 10  ? 17.883  -15.678 1.556   1.00 0.00 ? 88  GLU A HB2  3  
ATOM 4040  H HB3  . GLU A 1 10  ? 18.229  -14.305 2.598   1.00 0.00 ? 88  GLU A HB3  3  
ATOM 4041  H HG2  . GLU A 1 10  ? 19.715  -16.888 2.884   1.00 0.00 ? 88  GLU A HG2  3  
ATOM 4042  H HG3  . GLU A 1 10  ? 20.191  -15.675 1.697   1.00 0.00 ? 88  GLU A HG3  3  
ATOM 4043  N N    . ASP A 1 11  ? 15.193  -15.884 2.476   1.00 0.00 ? 89  ASP A N    3  
ATOM 4044  C CA   . ASP A 1 11  ? 13.833  -15.417 2.233   1.00 0.00 ? 89  ASP A CA   3  
ATOM 4045  C C    . ASP A 1 11  ? 13.094  -15.187 3.548   1.00 0.00 ? 89  ASP A C    3  
ATOM 4046  O O    . ASP A 1 11  ? 12.413  -14.175 3.720   1.00 0.00 ? 89  ASP A O    3  
ATOM 4047  C CB   . ASP A 1 11  ? 13.069  -16.428 1.375   1.00 0.00 ? 89  ASP A CB   3  
ATOM 4048  C CG   . ASP A 1 11  ? 13.362  -16.270 -0.104  1.00 0.00 ? 89  ASP A CG   3  
ATOM 4049  O OD1  . ASP A 1 11  ? 13.363  -15.119 -0.589  1.00 0.00 ? 89  ASP A OD1  3  
ATOM 4050  O OD2  . ASP A 1 11  ? 13.590  -17.297 -0.777  1.00 0.00 ? 89  ASP A OD2  3  
ATOM 4051  H H    . ASP A 1 11  ? 15.570  -16.580 1.897   1.00 0.00 ? 89  ASP A H    3  
ATOM 4052  H HA   . ASP A 1 11  ? 13.894  -14.480 1.700   1.00 0.00 ? 89  ASP A HA   3  
ATOM 4053  H HB2  . ASP A 1 11  ? 13.349  -17.428 1.674   1.00 0.00 ? 89  ASP A HB2  3  
ATOM 4054  H HB3  . ASP A 1 11  ? 12.009  -16.294 1.530   1.00 0.00 ? 89  ASP A HB3  3  
ATOM 4055  N N    . HIS A 1 12  ? 13.233  -16.132 4.472   1.00 0.00 ? 90  HIS A N    3  
ATOM 4056  C CA   . HIS A 1 12  ? 12.579  -16.032 5.772   1.00 0.00 ? 90  HIS A CA   3  
ATOM 4057  C C    . HIS A 1 12  ? 13.097  -14.826 6.550   1.00 0.00 ? 90  HIS A C    3  
ATOM 4058  O O    . HIS A 1 12  ? 12.336  -14.143 7.233   1.00 0.00 ? 90  HIS A O    3  
ATOM 4059  C CB   . HIS A 1 12  ? 12.805  -17.311 6.579   1.00 0.00 ? 90  HIS A CB   3  
ATOM 4060  C CG   . HIS A 1 12  ? 11.985  -17.381 7.831   1.00 0.00 ? 90  HIS A CG   3  
ATOM 4061  N ND1  . HIS A 1 12  ? 12.525  -17.253 9.093   1.00 0.00 ? 90  HIS A ND1  3  
ATOM 4062  C CD2  . HIS A 1 12  ? 10.656  -17.566 8.009   1.00 0.00 ? 90  HIS A CD2  3  
ATOM 4063  C CE1  . HIS A 1 12  ? 11.565  -17.358 9.994   1.00 0.00 ? 90  HIS A CE1  3  
ATOM 4064  N NE2  . HIS A 1 12  ? 10.420  -17.547 9.362   1.00 0.00 ? 90  HIS A NE2  3  
ATOM 4065  H H    . HIS A 1 12  ? 13.789  -16.914 4.275   1.00 0.00 ? 90  HIS A H    3  
ATOM 4066  H HA   . HIS A 1 12  ? 11.520  -15.907 5.601   1.00 0.00 ? 90  HIS A HA   3  
ATOM 4067  H HB2  . HIS A 1 12  ? 12.550  -18.164 5.969   1.00 0.00 ? 90  HIS A HB2  3  
ATOM 4068  H HB3  . HIS A 1 12  ? 13.846  -17.372 6.860   1.00 0.00 ? 90  HIS A HB3  3  
ATOM 4069  H HD2  . HIS A 1 12  ? 9.917   -17.702 7.232   1.00 0.00 ? 90  HIS A HD2  3  
ATOM 4070  H HE1  . HIS A 1 12  ? 11.692  -17.298 11.064  1.00 0.00 ? 90  HIS A HE1  3  
ATOM 4071  H HE2  . HIS A 1 12  ? 9.563   -17.742 9.794   1.00 0.00 ? 90  HIS A HE2  3  
ATOM 4072  N N    . ALA A 1 13  ? 14.397  -14.572 6.441   1.00 0.00 ? 91  ALA A N    3  
ATOM 4073  C CA   . ALA A 1 13  ? 15.016  -13.449 7.133   1.00 0.00 ? 91  ALA A CA   3  
ATOM 4074  C C    . ALA A 1 13  ? 14.480  -12.120 6.612   1.00 0.00 ? 91  ALA A C    3  
ATOM 4075  O O    . ALA A 1 13  ? 14.117  -11.238 7.391   1.00 0.00 ? 91  ALA A O    3  
ATOM 4076  C CB   . ALA A 1 13  ? 16.529  -13.505 6.982   1.00 0.00 ? 91  ALA A CB   3  
ATOM 4077  H H    . ALA A 1 13  ? 14.952  -15.153 5.881   1.00 0.00 ? 91  ALA A H    3  
ATOM 4078  H HA   . ALA A 1 13  ? 14.780  -13.534 8.184   1.00 0.00 ? 91  ALA A HA   3  
ATOM 4079  H HB1  . ALA A 1 13  ? 16.918  -14.325 7.569   1.00 0.00 ? 91  ALA A HB1  3  
ATOM 4080  H HB2  . ALA A 1 13  ? 16.782  -13.654 5.943   1.00 0.00 ? 91  ALA A HB2  3  
ATOM 4081  H HB3  . ALA A 1 13  ? 16.960  -12.578 7.330   1.00 0.00 ? 91  ALA A HB3  3  
ATOM 4082  N N    . ARG A 1 14  ? 14.433  -11.983 5.291   1.00 0.00 ? 92  ARG A N    3  
ATOM 4083  C CA   . ARG A 1 14  ? 13.943  -10.760 4.666   1.00 0.00 ? 92  ARG A CA   3  
ATOM 4084  C C    . ARG A 1 14  ? 12.429  -10.642 4.818   1.00 0.00 ? 92  ARG A C    3  
ATOM 4085  O O    . ARG A 1 14  ? 11.890  -9.540  4.932   1.00 0.00 ? 92  ARG A O    3  
ATOM 4086  C CB   . ARG A 1 14  ? 14.322  -10.732 3.185   1.00 0.00 ? 92  ARG A CB   3  
ATOM 4087  C CG   . ARG A 1 14  ? 14.484  -9.329  2.624   1.00 0.00 ? 92  ARG A CG   3  
ATOM 4088  C CD   . ARG A 1 14  ? 15.829  -8.729  3.004   1.00 0.00 ? 92  ARG A CD   3  
ATOM 4089  N NE   . ARG A 1 14  ? 16.901  -9.186  2.123   1.00 0.00 ? 92  ARG A NE   3  
ATOM 4090  C CZ   . ARG A 1 14  ? 17.660  -10.246 2.378   1.00 0.00 ? 92  ARG A CZ   3  
ATOM 4091  N NH1  . ARG A 1 14  ? 17.467  -10.954 3.482   1.00 0.00 ? 92  ARG A NH1  3  
ATOM 4092  N NH2  . ARG A 1 14  ? 18.616  -10.599 1.528   1.00 0.00 ? 92  ARG A NH2  3  
ATOM 4093  H H    . ARG A 1 14  ? 14.737  -12.722 4.723   1.00 0.00 ? 92  ARG A H    3  
ATOM 4094  H HA   . ARG A 1 14  ? 14.409  -9.923  5.164   1.00 0.00 ? 92  ARG A HA   3  
ATOM 4095  H HB2  . ARG A 1 14  ? 15.256  -11.258 3.053   1.00 0.00 ? 92  ARG A HB2  3  
ATOM 4096  H HB3  . ARG A 1 14  ? 13.552  -11.235 2.619   1.00 0.00 ? 92  ARG A HB3  3  
ATOM 4097  H HG2  . ARG A 1 14  ? 14.413  -9.370  1.547   1.00 0.00 ? 92  ARG A HG2  3  
ATOM 4098  H HG3  . ARG A 1 14  ? 13.697  -8.702  3.015   1.00 0.00 ? 92  ARG A HG3  3  
ATOM 4099  H HD2  . ARG A 1 14  ? 15.759  -7.654  2.942   1.00 0.00 ? 92  ARG A HD2  3  
ATOM 4100  H HD3  . ARG A 1 14  ? 16.062  -9.017  4.019   1.00 0.00 ? 92  ARG A HD3  3  
ATOM 4101  H HE   . ARG A 1 14  ? 17.061  -8.677  1.302   1.00 0.00 ? 92  ARG A HE   3  
ATOM 4102  H HH11 . ARG A 1 14  ? 16.747  -10.691 4.124   1.00 0.00 ? 92  ARG A HH11 3  
ATOM 4103  H HH12 . ARG A 1 14  ? 18.039  -11.752 3.671   1.00 0.00 ? 92  ARG A HH12 3  
ATOM 4104  H HH21 . ARG A 1 14  ? 18.764  -10.067 0.694   1.00 0.00 ? 92  ARG A HH21 3  
ATOM 4105  H HH22 . ARG A 1 14  ? 19.187  -11.396 1.721   1.00 0.00 ? 92  ARG A HH22 3  
ATOM 4106  N N    . LEU A 1 15  ? 11.749  -11.783 4.818   1.00 0.00 ? 93  LEU A N    3  
ATOM 4107  C CA   . LEU A 1 15  ? 10.297  -11.807 4.955   1.00 0.00 ? 93  LEU A CA   3  
ATOM 4108  C C    . LEU A 1 15  ? 9.871   -11.312 6.333   1.00 0.00 ? 93  LEU A C    3  
ATOM 4109  O O    . LEU A 1 15  ? 8.945   -10.510 6.457   1.00 0.00 ? 93  LEU A O    3  
ATOM 4110  C CB   . LEU A 1 15  ? 9.767   -13.224 4.723   1.00 0.00 ? 93  LEU A CB   3  
ATOM 4111  C CG   . LEU A 1 15  ? 9.628   -13.658 3.264   1.00 0.00 ? 93  LEU A CG   3  
ATOM 4112  C CD1  . LEU A 1 15  ? 9.336   -15.148 3.176   1.00 0.00 ? 93  LEU A CD1  3  
ATOM 4113  C CD2  . LEU A 1 15  ? 8.535   -12.857 2.570   1.00 0.00 ? 93  LEU A CD2  3  
ATOM 4114  H H    . LEU A 1 15  ? 12.233  -12.629 4.723   1.00 0.00 ? 93  LEU A H    3  
ATOM 4115  H HA   . LEU A 1 15  ? 9.882   -11.150 4.205   1.00 0.00 ? 93  LEU A HA   3  
ATOM 4116  H HB2  . LEU A 1 15  ? 10.440  -13.912 5.210   1.00 0.00 ? 93  LEU A HB2  3  
ATOM 4117  H HB3  . LEU A 1 15  ? 8.791   -13.290 5.184   1.00 0.00 ? 93  LEU A HB3  3  
ATOM 4118  H HG   . LEU A 1 15  ? 10.560  -13.470 2.748   1.00 0.00 ? 93  LEU A HG   3  
ATOM 4119  H HD11 . LEU A 1 15  ? 8.880   -15.480 4.096   1.00 0.00 ? 93  LEU A HD11 3  
ATOM 4120  H HD12 . LEU A 1 15  ? 10.258  -15.686 3.015   1.00 0.00 ? 93  LEU A HD12 3  
ATOM 4121  H HD13 . LEU A 1 15  ? 8.663   -15.335 2.352   1.00 0.00 ? 93  LEU A HD13 3  
ATOM 4122  H HD21 . LEU A 1 15  ? 8.067   -12.195 3.284   1.00 0.00 ? 93  LEU A HD21 3  
ATOM 4123  H HD22 . LEU A 1 15  ? 7.795   -13.532 2.167   1.00 0.00 ? 93  LEU A HD22 3  
ATOM 4124  H HD23 . LEU A 1 15  ? 8.968   -12.275 1.770   1.00 0.00 ? 93  LEU A HD23 3  
ATOM 4125  N N    . ARG A 1 16  ? 10.555  -11.793 7.366   1.00 0.00 ? 94  ARG A N    3  
ATOM 4126  C CA   . ARG A 1 16  ? 10.248  -11.399 8.736   1.00 0.00 ? 94  ARG A CA   3  
ATOM 4127  C C    . ARG A 1 16  ? 10.691  -9.962  9.000   1.00 0.00 ? 94  ARG A C    3  
ATOM 4128  O O    . ARG A 1 16  ? 9.959   -9.177  9.601   1.00 0.00 ? 94  ARG A O    3  
ATOM 4129  C CB   . ARG A 1 16  ? 10.930  -12.344 9.726   1.00 0.00 ? 94  ARG A CB   3  
ATOM 4130  C CG   . ARG A 1 16  ? 10.624  -12.027 11.181  1.00 0.00 ? 94  ARG A CG   3  
ATOM 4131  C CD   . ARG A 1 16  ? 11.595  -12.725 12.120  1.00 0.00 ? 94  ARG A CD   3  
ATOM 4132  N NE   . ARG A 1 16  ? 11.127  -14.055 12.501  1.00 0.00 ? 94  ARG A NE   3  
ATOM 4133  C CZ   . ARG A 1 16  ? 10.114  -14.268 13.333  1.00 0.00 ? 94  ARG A CZ   3  
ATOM 4134  N NH1  . ARG A 1 16  ? 9.466   -13.243 13.868  1.00 0.00 ? 94  ARG A NH1  3  
ATOM 4135  N NH2  . ARG A 1 16  ? 9.748   -15.508 13.631  1.00 0.00 ? 94  ARG A NH2  3  
ATOM 4136  H H    . ARG A 1 16  ? 11.282  -12.430 7.204   1.00 0.00 ? 94  ARG A H    3  
ATOM 4137  H HA   . ARG A 1 16  ? 9.179   -11.463 8.868   1.00 0.00 ? 94  ARG A HA   3  
ATOM 4138  H HB2  . ARG A 1 16  ? 10.605  -13.354 9.525   1.00 0.00 ? 94  ARG A HB2  3  
ATOM 4139  H HB3  . ARG A 1 16  ? 11.999  -12.284 9.585   1.00 0.00 ? 94  ARG A HB3  3  
ATOM 4140  H HG2  . ARG A 1 16  ? 10.700  -10.960 11.331  1.00 0.00 ? 94  ARG A HG2  3  
ATOM 4141  H HG3  . ARG A 1 16  ? 9.620   -12.354 11.407  1.00 0.00 ? 94  ARG A HG3  3  
ATOM 4142  H HD2  . ARG A 1 16  ? 12.550  -12.818 11.625  1.00 0.00 ? 94  ARG A HD2  3  
ATOM 4143  H HD3  . ARG A 1 16  ? 11.708  -12.125 13.010  1.00 0.00 ? 94  ARG A HD3  3  
ATOM 4144  H HE   . ARG A 1 16  ? 11.593  -14.827 12.116  1.00 0.00 ? 94  ARG A HE   3  
ATOM 4145  H HH11 . ARG A 1 16  ? 9.739   -12.308 13.645  1.00 0.00 ? 94  ARG A HH11 3  
ATOM 4146  H HH12 . ARG A 1 16  ? 8.702   -13.406 14.494  1.00 0.00 ? 94  ARG A HH12 3  
ATOM 4147  H HH21 . ARG A 1 16  ? 10.234  -16.283 13.229  1.00 0.00 ? 94  ARG A HH21 3  
ATOM 4148  H HH22 . ARG A 1 16  ? 8.986   -15.667 14.257  1.00 0.00 ? 94  ARG A HH22 3  
ATOM 4149  N N    . ALA A 1 17  ? 11.894  -9.627  8.546   1.00 0.00 ? 95  ALA A N    3  
ATOM 4150  C CA   . ALA A 1 17  ? 12.434  -8.286  8.732   1.00 0.00 ? 95  ALA A CA   3  
ATOM 4151  C C    . ALA A 1 17  ? 11.597  -7.249  7.989   1.00 0.00 ? 95  ALA A C    3  
ATOM 4152  O O    . ALA A 1 17  ? 11.231  -6.215  8.548   1.00 0.00 ? 95  ALA A O    3  
ATOM 4153  C CB   . ALA A 1 17  ? 13.881  -8.230  8.266   1.00 0.00 ? 95  ALA A CB   3  
ATOM 4154  H H    . ALA A 1 17  ? 12.431  -10.297 8.074   1.00 0.00 ? 95  ALA A H    3  
ATOM 4155  H HA   . ALA A 1 17  ? 12.412  -8.060  9.788   1.00 0.00 ? 95  ALA A HA   3  
ATOM 4156  H HB1  . ALA A 1 17  ? 14.448  -9.003  8.764   1.00 0.00 ? 95  ALA A HB1  3  
ATOM 4157  H HB2  . ALA A 1 17  ? 13.922  -8.383  7.198   1.00 0.00 ? 95  ALA A HB2  3  
ATOM 4158  H HB3  . ALA A 1 17  ? 14.300  -7.264  8.508   1.00 0.00 ? 95  ALA A HB3  3  
ATOM 4159  N N    . LEU A 1 18  ? 11.298  -7.533  6.726   1.00 0.00 ? 96  LEU A N    3  
ATOM 4160  C CA   . LEU A 1 18  ? 10.504  -6.625  5.905   1.00 0.00 ? 96  LEU A CA   3  
ATOM 4161  C C    . LEU A 1 18  ? 9.087   -6.493  6.454   1.00 0.00 ? 96  LEU A C    3  
ATOM 4162  O O    . LEU A 1 18  ? 8.561   -5.388  6.583   1.00 0.00 ? 96  LEU A O    3  
ATOM 4163  C CB   . LEU A 1 18  ? 10.459  -7.120  4.459   1.00 0.00 ? 96  LEU A CB   3  
ATOM 4164  C CG   . LEU A 1 18  ? 10.092  -6.077  3.403   1.00 0.00 ? 96  LEU A CG   3  
ATOM 4165  C CD1  . LEU A 1 18  ? 10.447  -6.578  2.012   1.00 0.00 ? 96  LEU A CD1  3  
ATOM 4166  C CD2  . LEU A 1 18  ? 8.613   -5.731  3.487   1.00 0.00 ? 96  LEU A CD2  3  
ATOM 4167  H H    . LEU A 1 18  ? 11.617  -8.373  6.335   1.00 0.00 ? 96  LEU A H    3  
ATOM 4168  H HA   . LEU A 1 18  ? 10.978  -5.655  5.931   1.00 0.00 ? 96  LEU A HA   3  
ATOM 4169  H HB2  . LEU A 1 18  ? 11.434  -7.511  4.213   1.00 0.00 ? 96  LEU A HB2  3  
ATOM 4170  H HB3  . LEU A 1 18  ? 9.730   -7.917  4.406   1.00 0.00 ? 96  LEU A HB3  3  
ATOM 4171  H HG   . LEU A 1 18  ? 10.659  -5.174  3.586   1.00 0.00 ? 96  LEU A HG   3  
ATOM 4172  H HD11 . LEU A 1 18  ? 9.699   -6.244  1.308   1.00 0.00 ? 96  LEU A HD11 3  
ATOM 4173  H HD12 . LEU A 1 18  ? 10.481  -7.657  2.016   1.00 0.00 ? 96  LEU A HD12 3  
ATOM 4174  H HD13 . LEU A 1 18  ? 11.412  -6.188  1.724   1.00 0.00 ? 96  LEU A HD13 3  
ATOM 4175  H HD21 . LEU A 1 18  ? 8.030   -6.640  3.482   1.00 0.00 ? 96  LEU A HD21 3  
ATOM 4176  H HD22 . LEU A 1 18  ? 8.337   -5.122  2.638   1.00 0.00 ? 96  LEU A HD22 3  
ATOM 4177  H HD23 . LEU A 1 18  ? 8.422   -5.185  4.399   1.00 0.00 ? 96  LEU A HD23 3  
ATOM 4178  N N    . ASN A 1 19  ? 8.475   -7.628  6.778   1.00 0.00 ? 97  ASN A N    3  
ATOM 4179  C CA   . ASN A 1 19  ? 7.119   -7.639  7.315   1.00 0.00 ? 97  ASN A CA   3  
ATOM 4180  C C    . ASN A 1 19  ? 7.052   -6.884  8.639   1.00 0.00 ? 97  ASN A C    3  
ATOM 4181  O O    . ASN A 1 19  ? 6.176   -6.046  8.844   1.00 0.00 ? 97  ASN A O    3  
ATOM 4182  C CB   . ASN A 1 19  ? 6.637   -9.078  7.510   1.00 0.00 ? 97  ASN A CB   3  
ATOM 4183  C CG   . ASN A 1 19  ? 5.510   -9.179  8.519   1.00 0.00 ? 97  ASN A CG   3  
ATOM 4184  O OD1  . ASN A 1 19  ? 4.378   -8.782  8.244   1.00 0.00 ? 97  ASN A OD1  3  
ATOM 4185  N ND2  . ASN A 1 19  ? 5.817   -9.711  9.697   1.00 0.00 ? 97  ASN A ND2  3  
ATOM 4186  H H    . ASN A 1 19  ? 8.946   -8.478  6.653   1.00 0.00 ? 97  ASN A H    3  
ATOM 4187  H HA   . ASN A 1 19  ? 6.476   -7.147  6.601   1.00 0.00 ? 97  ASN A HA   3  
ATOM 4188  H HB2  . ASN A 1 19  ? 6.284   -9.464  6.565   1.00 0.00 ? 97  ASN A HB2  3  
ATOM 4189  H HB3  . ASN A 1 19  ? 7.461   -9.684  7.855   1.00 0.00 ? 97  ASN A HB3  3  
ATOM 4190  H HD21 . ASN A 1 19  ? 6.740   -10.005 9.846   1.00 0.00 ? 97  ASN A HD21 3  
ATOM 4191  H HD22 . ASN A 1 19  ? 5.107   -9.789  10.368  1.00 0.00 ? 97  ASN A HD22 3  
ATOM 4192  N N    . GLY A 1 20  ? 7.986   -7.189  9.536   1.00 0.00 ? 98  GLY A N    3  
ATOM 4193  C CA   . GLY A 1 20  ? 8.016   -6.531  10.829  1.00 0.00 ? 98  GLY A CA   3  
ATOM 4194  C C    . GLY A 1 20  ? 8.464   -5.086  10.734  1.00 0.00 ? 98  GLY A C    3  
ATOM 4195  O O    . GLY A 1 20  ? 7.989   -4.230  11.481  1.00 0.00 ? 98  GLY A O    3  
ATOM 4196  H H    . GLY A 1 20  ? 8.660   -7.867  9.317   1.00 0.00 ? 98  GLY A H    3  
ATOM 4197  H HA2  . GLY A 1 20  ? 7.026   -6.562  11.259  1.00 0.00 ? 98  GLY A HA2  3  
ATOM 4198  H HA3  . GLY A 1 20  ? 8.696   -7.065  11.476  1.00 0.00 ? 98  GLY A HA3  3  
ATOM 4199  N N    . LEU A 1 21  ? 9.383   -4.813  9.814   1.00 0.00 ? 99  LEU A N    3  
ATOM 4200  C CA   . LEU A 1 21  ? 9.898   -3.462  9.625   1.00 0.00 ? 99  LEU A CA   3  
ATOM 4201  C C    . LEU A 1 21  ? 8.807   -2.531  9.105   1.00 0.00 ? 99  LEU A C    3  
ATOM 4202  O O    . LEU A 1 21  ? 8.629   -1.422  9.610   1.00 0.00 ? 99  LEU A O    3  
ATOM 4203  C CB   . LEU A 1 21  ? 11.079  -3.476  8.653   1.00 0.00 ? 99  LEU A CB   3  
ATOM 4204  C CG   . LEU A 1 21  ? 12.418  -3.937  9.230   1.00 0.00 ? 99  LEU A CG   3  
ATOM 4205  C CD1  . LEU A 1 21  ? 13.357  -4.375  8.116   1.00 0.00 ? 99  LEU A CD1  3  
ATOM 4206  C CD2  . LEU A 1 21  ? 13.051  -2.830  10.059  1.00 0.00 ? 99  LEU A CD2  3  
ATOM 4207  H H    . LEU A 1 21  ? 9.724   -5.537  9.249   1.00 0.00 ? 99  LEU A H    3  
ATOM 4208  H HA   . LEU A 1 21  ? 10.236  -3.099  10.584  1.00 0.00 ? 99  LEU A HA   3  
ATOM 4209  H HB2  . LEU A 1 21  ? 10.827  -4.134  7.836   1.00 0.00 ? 99  LEU A HB2  3  
ATOM 4210  H HB3  . LEU A 1 21  ? 11.208  -2.471  8.276   1.00 0.00 ? 99  LEU A HB3  3  
ATOM 4211  H HG   . LEU A 1 21  ? 12.250  -4.787  9.877   1.00 0.00 ? 99  LEU A HG   3  
ATOM 4212  H HD11 . LEU A 1 21  ? 13.566  -5.429  8.215   1.00 0.00 ? 99  LEU A HD11 3  
ATOM 4213  H HD12 . LEU A 1 21  ? 14.279  -3.817  8.183   1.00 0.00 ? 99  LEU A HD12 3  
ATOM 4214  H HD13 . LEU A 1 21  ? 12.892  -4.187  7.159   1.00 0.00 ? 99  LEU A HD13 3  
ATOM 4215  H HD21 . LEU A 1 21  ? 13.617  -3.266  10.869  1.00 0.00 ? 99  LEU A HD21 3  
ATOM 4216  H HD22 . LEU A 1 21  ? 12.276  -2.195  10.463  1.00 0.00 ? 99  LEU A HD22 3  
ATOM 4217  H HD23 . LEU A 1 21  ? 13.709  -2.244  9.435   1.00 0.00 ? 99  LEU A HD23 3  
ATOM 4218  N N    . LEU A 1 22  ? 8.078   -2.990  8.093   1.00 0.00 ? 100 LEU A N    3  
ATOM 4219  C CA   . LEU A 1 22  ? 7.002   -2.200  7.505   1.00 0.00 ? 100 LEU A CA   3  
ATOM 4220  C C    . LEU A 1 22  ? 5.859   -2.014  8.497   1.00 0.00 ? 100 LEU A C    3  
ATOM 4221  O O    . LEU A 1 22  ? 5.249   -0.946  8.564   1.00 0.00 ? 100 LEU A O    3  
ATOM 4222  C CB   . LEU A 1 22  ? 6.485   -2.874  6.233   1.00 0.00 ? 100 LEU A CB   3  
ATOM 4223  C CG   . LEU A 1 22  ? 7.365   -2.730  4.991   1.00 0.00 ? 100 LEU A CG   3  
ATOM 4224  C CD1  . LEU A 1 22  ? 6.737   -3.447  3.806   1.00 0.00 ? 100 LEU A CD1  3  
ATOM 4225  C CD2  . LEU A 1 22  ? 7.593   -1.260  4.668   1.00 0.00 ? 100 LEU A CD2  3  
ATOM 4226  H H    . LEU A 1 22  ? 8.267   -3.881  7.733   1.00 0.00 ? 100 LEU A H    3  
ATOM 4227  H HA   . LEU A 1 22  ? 7.404   -1.231  7.251   1.00 0.00 ? 100 LEU A HA   3  
ATOM 4228  H HB2  . LEU A 1 22  ? 6.374   -3.928  6.439   1.00 0.00 ? 100 LEU A HB2  3  
ATOM 4229  H HB3  . LEU A 1 22  ? 5.517   -2.450  6.006   1.00 0.00 ? 100 LEU A HB3  3  
ATOM 4230  H HG   . LEU A 1 22  ? 8.327   -3.184  5.185   1.00 0.00 ? 100 LEU A HG   3  
ATOM 4231  H HD11 . LEU A 1 22  ? 7.400   -3.385  2.956   1.00 0.00 ? 100 LEU A HD11 3  
ATOM 4232  H HD12 . LEU A 1 22  ? 5.794   -2.981  3.562   1.00 0.00 ? 100 LEU A HD12 3  
ATOM 4233  H HD13 . LEU A 1 22  ? 6.572   -4.484  4.059   1.00 0.00 ? 100 LEU A HD13 3  
ATOM 4234  H HD21 . LEU A 1 22  ? 8.278   -0.836  5.388   1.00 0.00 ? 100 LEU A HD21 3  
ATOM 4235  H HD22 . LEU A 1 22  ? 6.652   -0.732  4.711   1.00 0.00 ? 100 LEU A HD22 3  
ATOM 4236  H HD23 . LEU A 1 22  ? 8.012   -1.171  3.677   1.00 0.00 ? 100 LEU A HD23 3  
ATOM 4237  N N    . TYR A 1 23  ? 5.574   -3.059  9.267   1.00 0.00 ? 101 TYR A N    3  
ATOM 4238  C CA   . TYR A 1 23  ? 4.503   -3.011  10.255  1.00 0.00 ? 101 TYR A CA   3  
ATOM 4239  C C    . TYR A 1 23  ? 4.841   -2.034  11.377  1.00 0.00 ? 101 TYR A C    3  
ATOM 4240  O O    . TYR A 1 23  ? 3.993   -1.259  11.819  1.00 0.00 ? 101 TYR A O    3  
ATOM 4241  C CB   . TYR A 1 23  ? 4.253   -4.404  10.835  1.00 0.00 ? 101 TYR A CB   3  
ATOM 4242  C CG   . TYR A 1 23  ? 3.277   -4.413  11.990  1.00 0.00 ? 101 TYR A CG   3  
ATOM 4243  C CD1  . TYR A 1 23  ? 1.992   -3.905  11.841  1.00 0.00 ? 101 TYR A CD1  3  
ATOM 4244  C CD2  . TYR A 1 23  ? 3.639   -4.928  13.228  1.00 0.00 ? 101 TYR A CD2  3  
ATOM 4245  C CE1  . TYR A 1 23  ? 1.096   -3.911  12.893  1.00 0.00 ? 101 TYR A CE1  3  
ATOM 4246  C CE2  . TYR A 1 23  ? 2.749   -4.938  14.285  1.00 0.00 ? 101 TYR A CE2  3  
ATOM 4247  C CZ   . TYR A 1 23  ? 1.479   -4.429  14.113  1.00 0.00 ? 101 TYR A CZ   3  
ATOM 4248  O OH   . TYR A 1 23  ? 0.591   -4.437  15.164  1.00 0.00 ? 101 TYR A OH   3  
ATOM 4249  H H    . TYR A 1 23  ? 6.095   -3.883  9.167   1.00 0.00 ? 101 TYR A H    3  
ATOM 4250  H HA   . TYR A 1 23  ? 3.607   -2.673  9.757   1.00 0.00 ? 101 TYR A HA   3  
ATOM 4251  H HB2  . TYR A 1 23  ? 3.857   -5.043  10.062  1.00 0.00 ? 101 TYR A HB2  3  
ATOM 4252  H HB3  . TYR A 1 23  ? 5.189   -4.812  11.189  1.00 0.00 ? 101 TYR A HB3  3  
ATOM 4253  H HD1  . TYR A 1 23  ? 1.694   -3.500  10.885  1.00 0.00 ? 101 TYR A HD1  3  
ATOM 4254  H HD2  . TYR A 1 23  ? 4.635   -5.325  13.360  1.00 0.00 ? 101 TYR A HD2  3  
ATOM 4255  H HE1  . TYR A 1 23  ? 0.101   -3.512  12.759  1.00 0.00 ? 101 TYR A HE1  3  
ATOM 4256  H HE2  . TYR A 1 23  ? 3.050   -5.343  15.240  1.00 0.00 ? 101 TYR A HE2  3  
ATOM 4257  H HH   . TYR A 1 23  ? 0.036   -5.218  15.107  1.00 0.00 ? 101 TYR A HH   3  
ATOM 4258  N N    . LYS A 1 24  ? 6.088   -2.075  11.833  1.00 0.00 ? 102 LYS A N    3  
ATOM 4259  C CA   . LYS A 1 24  ? 6.543   -1.194  12.902  1.00 0.00 ? 102 LYS A CA   3  
ATOM 4260  C C    . LYS A 1 24  ? 6.680   0.241   12.403  1.00 0.00 ? 102 LYS A C    3  
ATOM 4261  O O    . LYS A 1 24  ? 6.284   1.186   13.085  1.00 0.00 ? 102 LYS A O    3  
ATOM 4262  C CB   . LYS A 1 24  ? 7.882   -1.681  13.459  1.00 0.00 ? 102 LYS A CB   3  
ATOM 4263  C CG   . LYS A 1 24  ? 8.089   -1.347  14.926  1.00 0.00 ? 102 LYS A CG   3  
ATOM 4264  C CD   . LYS A 1 24  ? 8.759   0.006   15.100  1.00 0.00 ? 102 LYS A CD   3  
ATOM 4265  C CE   . LYS A 1 24  ? 9.296   0.184   16.512  1.00 0.00 ? 102 LYS A CE   3  
ATOM 4266  N NZ   . LYS A 1 24  ? 9.483   1.621   16.857  1.00 0.00 ? 102 LYS A NZ   3  
ATOM 4267  H H    . LYS A 1 24  ? 6.720   -2.715  11.441  1.00 0.00 ? 102 LYS A H    3  
ATOM 4268  H HA   . LYS A 1 24  ? 5.805   -1.219  13.689  1.00 0.00 ? 102 LYS A HA   3  
ATOM 4269  H HB2  . LYS A 1 24  ? 7.937   -2.754  13.345  1.00 0.00 ? 102 LYS A HB2  3  
ATOM 4270  H HB3  . LYS A 1 24  ? 8.681   -1.227  12.891  1.00 0.00 ? 102 LYS A HB3  3  
ATOM 4271  H HG2  . LYS A 1 24  ? 7.129   -1.327  15.421  1.00 0.00 ? 102 LYS A HG2  3  
ATOM 4272  H HG3  . LYS A 1 24  ? 8.712   -2.107  15.375  1.00 0.00 ? 102 LYS A HG3  3  
ATOM 4273  H HD2  . LYS A 1 24  ? 9.580   0.084   14.403  1.00 0.00 ? 102 LYS A HD2  3  
ATOM 4274  H HD3  . LYS A 1 24  ? 8.037   0.784   14.898  1.00 0.00 ? 102 LYS A HD3  3  
ATOM 4275  H HE2  . LYS A 1 24  ? 8.598   -0.256  17.207  1.00 0.00 ? 102 LYS A HE2  3  
ATOM 4276  H HE3  . LYS A 1 24  ? 10.247  -0.322  16.588  1.00 0.00 ? 102 LYS A HE3  3  
ATOM 4277  H HZ1  . LYS A 1 24  ? 8.721   1.938   17.490  1.00 0.00 ? 102 LYS A HZ1  3  
ATOM 4278  H HZ2  . LYS A 1 24  ? 9.464   2.201   15.994  1.00 0.00 ? 102 LYS A HZ2  3  
ATOM 4279  H HZ3  . LYS A 1 24  ? 10.396  1.758   17.335  1.00 0.00 ? 102 LYS A HZ3  3  
ATOM 4280  N N    . ALA A 1 25  ? 7.241   0.396   11.208  1.00 0.00 ? 103 ALA A N    3  
ATOM 4281  C CA   . ALA A 1 25  ? 7.427   1.715   10.616  1.00 0.00 ? 103 ALA A CA   3  
ATOM 4282  C C    . ALA A 1 25  ? 6.091   2.329   10.214  1.00 0.00 ? 103 ALA A C    3  
ATOM 4283  O O    . ALA A 1 25  ? 5.861   3.524   10.409  1.00 0.00 ? 103 ALA A O    3  
ATOM 4284  C CB   . ALA A 1 25  ? 8.354   1.628   9.413   1.00 0.00 ? 103 ALA A CB   3  
ATOM 4285  H H    . ALA A 1 25  ? 7.537   -0.396  10.713  1.00 0.00 ? 103 ALA A H    3  
ATOM 4286  H HA   . ALA A 1 25  ? 7.896   2.349   11.355  1.00 0.00 ? 103 ALA A HA   3  
ATOM 4287  H HB1  . ALA A 1 25  ? 8.921   2.543   9.329   1.00 0.00 ? 103 ALA A HB1  3  
ATOM 4288  H HB2  . ALA A 1 25  ? 9.029   0.795   9.538   1.00 0.00 ? 103 ALA A HB2  3  
ATOM 4289  H HB3  . ALA A 1 25  ? 7.767   1.484   8.517   1.00 0.00 ? 103 ALA A HB3  3  
ATOM 4290  N N    . LEU A 1 26  ? 5.212   1.506   9.653   1.00 0.00 ? 104 LEU A N    3  
ATOM 4291  C CA   . LEU A 1 26  ? 3.897   1.969   9.223   1.00 0.00 ? 104 LEU A CA   3  
ATOM 4292  C C    . LEU A 1 26  ? 3.077   2.461   10.411  1.00 0.00 ? 104 LEU A C    3  
ATOM 4293  O O    . LEU A 1 26  ? 2.520   3.559   10.384  1.00 0.00 ? 104 LEU A O    3  
ATOM 4294  C CB   . LEU A 1 26  ? 3.149   0.846   8.502   1.00 0.00 ? 104 LEU A CB   3  
ATOM 4295  C CG   . LEU A 1 26  ? 3.576   0.573   7.060   1.00 0.00 ? 104 LEU A CG   3  
ATOM 4296  C CD1  . LEU A 1 26  ? 3.002   -0.749  6.574   1.00 0.00 ? 104 LEU A CD1  3  
ATOM 4297  C CD2  . LEU A 1 26  ? 3.140   1.712   6.150   1.00 0.00 ? 104 LEU A CD2  3  
ATOM 4298  H H    . LEU A 1 26  ? 5.451   0.565   9.525   1.00 0.00 ? 104 LEU A H    3  
ATOM 4299  H HA   . LEU A 1 26  ? 4.043   2.791   8.537   1.00 0.00 ? 104 LEU A HA   3  
ATOM 4300  H HB2  . LEU A 1 26  ? 3.294   -0.062  9.067   1.00 0.00 ? 104 LEU A HB2  3  
ATOM 4301  H HB3  . LEU A 1 26  ? 2.099   1.100   8.496   1.00 0.00 ? 104 LEU A HB3  3  
ATOM 4302  H HG   . LEU A 1 26  ? 4.654   0.503   7.017   1.00 0.00 ? 104 LEU A HG   3  
ATOM 4303  H HD11 . LEU A 1 26  ? 3.195   -1.517  7.308   1.00 0.00 ? 104 LEU A HD11 3  
ATOM 4304  H HD12 . LEU A 1 26  ? 3.465   -1.021  5.638   1.00 0.00 ? 104 LEU A HD12 3  
ATOM 4305  H HD13 . LEU A 1 26  ? 1.936   -0.647  6.431   1.00 0.00 ? 104 LEU A HD13 3  
ATOM 4306  H HD21 . LEU A 1 26  ? 3.648   1.628   5.200   1.00 0.00 ? 104 LEU A HD21 3  
ATOM 4307  H HD22 . LEU A 1 26  ? 3.392   2.657   6.610   1.00 0.00 ? 104 LEU A HD22 3  
ATOM 4308  H HD23 . LEU A 1 26  ? 2.073   1.660   5.994   1.00 0.00 ? 104 LEU A HD23 3  
ATOM 4309  N N    . THR A 1 27  ? 3.008   1.642   11.456  1.00 0.00 ? 105 THR A N    3  
ATOM 4310  C CA   . THR A 1 27  ? 2.257   1.993   12.654  1.00 0.00 ? 105 THR A CA   3  
ATOM 4311  C C    . THR A 1 27  ? 2.910   3.158   13.390  1.00 0.00 ? 105 THR A C    3  
ATOM 4312  O O    . THR A 1 27  ? 2.238   3.918   14.088  1.00 0.00 ? 105 THR A O    3  
ATOM 4313  C CB   . THR A 1 27  ? 2.140   0.795   13.615  1.00 0.00 ? 105 THR A CB   3  
ATOM 4314  O OG1  . THR A 1 27  ? 1.435   1.184   14.800  1.00 0.00 ? 105 THR A OG1  3  
ATOM 4315  C CG2  . THR A 1 27  ? 3.515   0.264   13.988  1.00 0.00 ? 105 THR A CG2  3  
ATOM 4316  H H    . THR A 1 27  ? 3.473   0.780   11.417  1.00 0.00 ? 105 THR A H    3  
ATOM 4317  H HA   . THR A 1 27  ? 1.261   2.284   12.351  1.00 0.00 ? 105 THR A HA   3  
ATOM 4318  H HB   . THR A 1 27  ? 1.588   0.008   13.120  1.00 0.00 ? 105 THR A HB   3  
ATOM 4319  H HG1  . THR A 1 27  ? 1.678   0.600   15.522  1.00 0.00 ? 105 THR A HG1  3  
ATOM 4320  H HG21 . THR A 1 27  ? 4.209   0.465   13.185  1.00 0.00 ? 105 THR A HG21 3  
ATOM 4321  H HG22 . THR A 1 27  ? 3.457   -0.802  14.155  1.00 0.00 ? 105 THR A HG22 3  
ATOM 4322  H HG23 . THR A 1 27  ? 3.857   0.751   14.889  1.00 0.00 ? 105 THR A HG23 3  
ATOM 4323  N N    . ASP A 1 28  ? 4.221   3.293   13.228  1.00 0.00 ? 106 ASP A N    3  
ATOM 4324  C CA   . ASP A 1 28  ? 4.965   4.367   13.876  1.00 0.00 ? 106 ASP A CA   3  
ATOM 4325  C C    . ASP A 1 28  ? 4.581   5.723   13.292  1.00 0.00 ? 106 ASP A C    3  
ATOM 4326  O O    . ASP A 1 28  ? 4.429   6.705   14.021  1.00 0.00 ? 106 ASP A O    3  
ATOM 4327  C CB   . ASP A 1 28  ? 6.469   4.139   13.723  1.00 0.00 ? 106 ASP A CB   3  
ATOM 4328  C CG   . ASP A 1 28  ? 7.274   5.398   13.980  1.00 0.00 ? 106 ASP A CG   3  
ATOM 4329  O OD1  . ASP A 1 28  ? 7.608   5.661   15.154  1.00 0.00 ? 106 ASP A OD1  3  
ATOM 4330  O OD2  . ASP A 1 28  ? 7.572   6.120   13.006  1.00 0.00 ? 106 ASP A OD2  3  
ATOM 4331  H H    . ASP A 1 28  ? 4.701   2.655   12.659  1.00 0.00 ? 106 ASP A H    3  
ATOM 4332  H HA   . ASP A 1 28  ? 4.714   4.358   14.926  1.00 0.00 ? 106 ASP A HA   3  
ATOM 4333  H HB2  . ASP A 1 28  ? 6.786   3.383   14.426  1.00 0.00 ? 106 ASP A HB2  3  
ATOM 4334  H HB3  . ASP A 1 28  ? 6.675   3.800   12.718  1.00 0.00 ? 106 ASP A HB3  3  
ATOM 4335  N N    . LEU A 1 29  ? 4.425   5.771   11.974  1.00 0.00 ? 107 LEU A N    3  
ATOM 4336  C CA   . LEU A 1 29  ? 4.060   7.007   11.291  1.00 0.00 ? 107 LEU A CA   3  
ATOM 4337  C C    . LEU A 1 29  ? 2.669   7.470   11.711  1.00 0.00 ? 107 LEU A C    3  
ATOM 4338  O O    . LEU A 1 29  ? 2.399   8.670   11.785  1.00 0.00 ? 107 LEU A O    3  
ATOM 4339  C CB   . LEU A 1 29  ? 4.108   6.808   9.775   1.00 0.00 ? 107 LEU A CB   3  
ATOM 4340  C CG   . LEU A 1 29  ? 5.497   6.839   9.137   1.00 0.00 ? 107 LEU A CG   3  
ATOM 4341  C CD1  . LEU A 1 29  ? 5.396   6.670   7.629   1.00 0.00 ? 107 LEU A CD1  3  
ATOM 4342  C CD2  . LEU A 1 29  ? 6.214   8.136   9.483   1.00 0.00 ? 107 LEU A CD2  3  
ATOM 4343  H H    . LEU A 1 29  ? 4.559   4.956   11.446  1.00 0.00 ? 107 LEU A H    3  
ATOM 4344  H HA   . LEU A 1 29  ? 4.778   7.764   11.569  1.00 0.00 ? 107 LEU A HA   3  
ATOM 4345  H HB2  . LEU A 1 29  ? 3.664   5.850   9.553   1.00 0.00 ? 107 LEU A HB2  3  
ATOM 4346  H HB3  . LEU A 1 29  ? 3.516   7.590   9.321   1.00 0.00 ? 107 LEU A HB3  3  
ATOM 4347  H HG   . LEU A 1 29  ? 6.083   6.018   9.526   1.00 0.00 ? 107 LEU A HG   3  
ATOM 4348  H HD11 . LEU A 1 29  ? 6.382   6.725   7.194   1.00 0.00 ? 107 LEU A HD11 3  
ATOM 4349  H HD12 . LEU A 1 29  ? 4.778   7.455   7.219   1.00 0.00 ? 107 LEU A HD12 3  
ATOM 4350  H HD13 . LEU A 1 29  ? 4.955   5.710   7.403   1.00 0.00 ? 107 LEU A HD13 3  
ATOM 4351  H HD21 . LEU A 1 29  ? 7.018   7.929   10.173  1.00 0.00 ? 107 LEU A HD21 3  
ATOM 4352  H HD22 . LEU A 1 29  ? 5.515   8.822   9.940   1.00 0.00 ? 107 LEU A HD22 3  
ATOM 4353  H HD23 . LEU A 1 29  ? 6.616   8.577   8.583   1.00 0.00 ? 107 LEU A HD23 3  
ATOM 4354  N N    . LEU A 1 30  ? 1.790   6.513   11.986  1.00 0.00 ? 108 LEU A N    3  
ATOM 4355  C CA   . LEU A 1 30  ? 0.426   6.822   12.401  1.00 0.00 ? 108 LEU A CA   3  
ATOM 4356  C C    . LEU A 1 30  ? 0.401   7.362   13.828  1.00 0.00 ? 108 LEU A C    3  
ATOM 4357  O O    . LEU A 1 30  ? -0.660  7.691   14.359  1.00 0.00 ? 108 LEU A O    3  
ATOM 4358  C CB   . LEU A 1 30  ? -0.454  5.576   12.300  1.00 0.00 ? 108 LEU A CB   3  
ATOM 4359  C CG   . LEU A 1 30  ? -0.969  5.230   10.902  1.00 0.00 ? 108 LEU A CG   3  
ATOM 4360  C CD1  . LEU A 1 30  ? 0.117   5.459   9.862   1.00 0.00 ? 108 LEU A CD1  3  
ATOM 4361  C CD2  . LEU A 1 30  ? -1.458  3.790   10.855  1.00 0.00 ? 108 LEU A CD2  3  
ATOM 4362  H H    . LEU A 1 30  ? 2.064   5.575   11.908  1.00 0.00 ? 108 LEU A H    3  
ATOM 4363  H HA   . LEU A 1 30  ? 0.042   7.581   11.736  1.00 0.00 ? 108 LEU A HA   3  
ATOM 4364  H HB2  . LEU A 1 30  ? 0.120   4.735   12.658  1.00 0.00 ? 108 LEU A HB2  3  
ATOM 4365  H HB3  . LEU A 1 30  ? -1.311  5.724   12.942  1.00 0.00 ? 108 LEU A HB3  3  
ATOM 4366  H HG   . LEU A 1 30  ? -1.802  5.875   10.662  1.00 0.00 ? 108 LEU A HG   3  
ATOM 4367  H HD11 . LEU A 1 30  ? -0.065  4.827   9.006   1.00 0.00 ? 108 LEU A HD11 3  
ATOM 4368  H HD12 . LEU A 1 30  ? 1.080   5.220   10.288  1.00 0.00 ? 108 LEU A HD12 3  
ATOM 4369  H HD13 . LEU A 1 30  ? 0.107   6.495   9.554   1.00 0.00 ? 108 LEU A HD13 3  
ATOM 4370  H HD21 . LEU A 1 30  ? -0.616  3.128   10.714  1.00 0.00 ? 108 LEU A HD21 3  
ATOM 4371  H HD22 . LEU A 1 30  ? -2.151  3.671   10.034  1.00 0.00 ? 108 LEU A HD22 3  
ATOM 4372  H HD23 . LEU A 1 30  ? -1.954  3.548   11.783  1.00 0.00 ? 108 LEU A HD23 3  
ATOM 4373  N N    . CYS A 1 31  ? 1.576   7.451   14.442  1.00 0.00 ? 109 CYS A N    3  
ATOM 4374  C CA   . CYS A 1 31  ? 1.688   7.953   15.807  1.00 0.00 ? 109 CYS A CA   3  
ATOM 4375  C C    . CYS A 1 31  ? 1.931   9.459   15.815  1.00 0.00 ? 109 CYS A C    3  
ATOM 4376  O O    . CYS A 1 31  ? 1.564   10.153  16.763  1.00 0.00 ? 109 CYS A O    3  
ATOM 4377  C CB   . CYS A 1 31  ? 2.822   7.237   16.543  1.00 0.00 ? 109 CYS A CB   3  
ATOM 4378  S SG   . CYS A 1 31  ? 2.576   5.455   16.725  1.00 0.00 ? 109 CYS A SG   3  
ATOM 4379  H H    . CYS A 1 31  ? 2.386   7.174   13.967  1.00 0.00 ? 109 CYS A H    3  
ATOM 4380  H HA   . CYS A 1 31  ? 0.757   7.748   16.313  1.00 0.00 ? 109 CYS A HA   3  
ATOM 4381  H HB2  . CYS A 1 31  ? 3.744   7.387   16.001  1.00 0.00 ? 109 CYS A HB2  3  
ATOM 4382  H HB3  . CYS A 1 31  ? 2.922   7.659   17.532  1.00 0.00 ? 109 CYS A HB3  3  
ATOM 4383  H HG   . CYS A 1 31  ? 2.904   5.122   17.963  1.00 0.00 ? 109 CYS A HG   3  
ATOM 4384  N N    . THR A 1 32  ? 2.554   9.958   14.752  1.00 0.00 ? 110 THR A N    3  
ATOM 4385  C CA   . THR A 1 32  ? 2.849   11.381  14.637  1.00 0.00 ? 110 THR A CA   3  
ATOM 4386  C C    . THR A 1 32  ? 2.011   12.029  13.542  1.00 0.00 ? 110 THR A C    3  
ATOM 4387  O O    . THR A 1 32  ? 2.163   11.737  12.355  1.00 0.00 ? 110 THR A O    3  
ATOM 4388  C CB   . THR A 1 32  ? 4.341   11.623  14.339  1.00 0.00 ? 110 THR A CB   3  
ATOM 4389  O OG1  . THR A 1 32  ? 5.131   10.574  14.909  1.00 0.00 ? 110 THR A OG1  3  
ATOM 4390  C CG2  . THR A 1 32  ? 4.792   12.965  14.893  1.00 0.00 ? 110 THR A CG2  3  
ATOM 4391  H H    . THR A 1 32  ? 2.822   9.354   14.029  1.00 0.00 ? 110 THR A H    3  
ATOM 4392  H HA   . THR A 1 32  ? 2.612   11.848  15.583  1.00 0.00 ? 110 THR A HA   3  
ATOM 4393  H HB   . THR A 1 32  ? 4.481   11.627  13.267  1.00 0.00 ? 110 THR A HB   3  
ATOM 4394  H HG1  . THR A 1 32  ? 4.674   10.206  15.669  1.00 0.00 ? 110 THR A HG1  3  
ATOM 4395  H HG21 . THR A 1 32  ? 5.841   12.915  15.147  1.00 0.00 ? 110 THR A HG21 3  
ATOM 4396  H HG22 . THR A 1 32  ? 4.219   13.201  15.777  1.00 0.00 ? 110 THR A HG22 3  
ATOM 4397  H HG23 . THR A 1 32  ? 4.639   13.732  14.149  1.00 0.00 ? 110 THR A HG23 3  
ATOM 4398  N N    . PRO A 1 33  ? 1.105   12.932  13.945  1.00 0.00 ? 111 PRO A N    3  
ATOM 4399  C CA   . PRO A 1 33  ? 0.225   13.642  13.012  1.00 0.00 ? 111 PRO A CA   3  
ATOM 4400  C C    . PRO A 1 33  ? 0.984   14.644  12.149  1.00 0.00 ? 111 PRO A C    3  
ATOM 4401  O O    . PRO A 1 33  ? 0.389   15.352  11.336  1.00 0.00 ? 111 PRO A O    3  
ATOM 4402  C CB   . PRO A 1 33  ? -0.759  14.367  13.933  1.00 0.00 ? 111 PRO A CB   3  
ATOM 4403  C CG   . PRO A 1 33  ? -0.022  14.534  15.217  1.00 0.00 ? 111 PRO A CG   3  
ATOM 4404  C CD   . PRO A 1 33  ? 0.869   13.330  15.343  1.00 0.00 ? 111 PRO A CD   3  
ATOM 4405  H HA   . PRO A 1 33  ? -0.314  12.956  12.375  1.00 0.00 ? 111 PRO A HA   3  
ATOM 4406  H HB2  . PRO A 1 33  ? -1.023  15.322  13.502  1.00 0.00 ? 111 PRO A HB2  3  
ATOM 4407  H HB3  . PRO A 1 33  ? -1.646  13.766  14.063  1.00 0.00 ? 111 PRO A HB3  3  
ATOM 4408  H HG2  . PRO A 1 33  ? 0.569   15.437  15.187  1.00 0.00 ? 111 PRO A HG2  3  
ATOM 4409  H HG3  . PRO A 1 33  ? -0.722  14.570  16.040  1.00 0.00 ? 111 PRO A HG3  3  
ATOM 4410  H HD2  . PRO A 1 33  ? 1.796   13.595  15.830  1.00 0.00 ? 111 PRO A HD2  3  
ATOM 4411  H HD3  . PRO A 1 33  ? 0.367   12.544  15.887  1.00 0.00 ? 111 PRO A HD3  3  
ATOM 4412  N N    . GLU A 1 34  ? 2.300   14.698  12.330  1.00 0.00 ? 112 GLU A N    3  
ATOM 4413  C CA   . GLU A 1 34  ? 3.139   15.615  11.567  1.00 0.00 ? 112 GLU A CA   3  
ATOM 4414  C C    . GLU A 1 34  ? 3.004   15.357  10.069  1.00 0.00 ? 112 GLU A C    3  
ATOM 4415  O O    . GLU A 1 34  ? 2.748   16.275  9.290   1.00 0.00 ? 112 GLU A O    3  
ATOM 4416  C CB   . GLU A 1 34  ? 4.602   15.474  11.991  1.00 0.00 ? 112 GLU A CB   3  
ATOM 4417  C CG   . GLU A 1 34  ? 4.979   16.346  13.177  1.00 0.00 ? 112 GLU A CG   3  
ATOM 4418  C CD   . GLU A 1 34  ? 6.337   15.992  13.752  1.00 0.00 ? 112 GLU A CD   3  
ATOM 4419  O OE1  . GLU A 1 34  ? 7.174   15.444  13.005  1.00 0.00 ? 112 GLU A OE1  3  
ATOM 4420  O OE2  . GLU A 1 34  ? 6.563   16.266  14.950  1.00 0.00 ? 112 GLU A OE2  3  
ATOM 4421  H H    . GLU A 1 34  ? 2.716   14.108  12.993  1.00 0.00 ? 112 GLU A H    3  
ATOM 4422  H HA   . GLU A 1 34  ? 2.808   16.621  11.778  1.00 0.00 ? 112 GLU A HA   3  
ATOM 4423  H HB2  . GLU A 1 34  ? 4.791   14.444  12.252  1.00 0.00 ? 112 GLU A HB2  3  
ATOM 4424  H HB3  . GLU A 1 34  ? 5.233   15.746  11.157  1.00 0.00 ? 112 GLU A HB3  3  
ATOM 4425  H HG2  . GLU A 1 34  ? 4.998   17.377  12.858  1.00 0.00 ? 112 GLU A HG2  3  
ATOM 4426  H HG3  . GLU A 1 34  ? 4.234   16.223  13.949  1.00 0.00 ? 112 GLU A HG3  3  
ATOM 4427  N N    . VAL A 1 35  ? 3.178   14.100  9.673   1.00 0.00 ? 113 VAL A N    3  
ATOM 4428  C CA   . VAL A 1 35  ? 3.076   13.719  8.270   1.00 0.00 ? 113 VAL A CA   3  
ATOM 4429  C C    . VAL A 1 35  ? 1.655   13.291  7.918   1.00 0.00 ? 113 VAL A C    3  
ATOM 4430  O O    . VAL A 1 35  ? 1.047   13.825  6.991   1.00 0.00 ? 113 VAL A O    3  
ATOM 4431  C CB   . VAL A 1 35  ? 4.046   12.573  7.927   1.00 0.00 ? 113 VAL A CB   3  
ATOM 4432  C CG1  . VAL A 1 35  ? 3.721   11.335  8.748   1.00 0.00 ? 113 VAL A CG1  3  
ATOM 4433  C CG2  . VAL A 1 35  ? 3.998   12.263  6.438   1.00 0.00 ? 113 VAL A CG2  3  
ATOM 4434  H H    . VAL A 1 35  ? 3.380   13.412  10.341  1.00 0.00 ? 113 VAL A H    3  
ATOM 4435  H HA   . VAL A 1 35  ? 3.341   14.579  7.670   1.00 0.00 ? 113 VAL A HA   3  
ATOM 4436  H HB   . VAL A 1 35  ? 5.048   12.890  8.175   1.00 0.00 ? 113 VAL A HB   3  
ATOM 4437  H HG11 . VAL A 1 35  ? 2.851   10.846  8.334   1.00 0.00 ? 113 VAL A HG11 3  
ATOM 4438  H HG12 . VAL A 1 35  ? 4.561   10.657  8.726   1.00 0.00 ? 113 VAL A HG12 3  
ATOM 4439  H HG13 . VAL A 1 35  ? 3.518   11.624  9.769   1.00 0.00 ? 113 VAL A HG13 3  
ATOM 4440  H HG21 . VAL A 1 35  ? 5.004   12.205  6.051   1.00 0.00 ? 113 VAL A HG21 3  
ATOM 4441  H HG22 . VAL A 1 35  ? 3.498   11.317  6.283   1.00 0.00 ? 113 VAL A HG22 3  
ATOM 4442  H HG23 . VAL A 1 35  ? 3.458   13.044  5.924   1.00 0.00 ? 113 VAL A HG23 3  
ATOM 4443  N N    . SER A 1 36  ? 1.133   12.325  8.666   1.00 0.00 ? 114 SER A N    3  
ATOM 4444  C CA   . SER A 1 36  ? -0.216  11.822  8.432   1.00 0.00 ? 114 SER A CA   3  
ATOM 4445  C C    . SER A 1 36  ? -1.234  12.583  9.277   1.00 0.00 ? 114 SER A C    3  
ATOM 4446  O O    . SER A 1 36  ? -1.868  12.013  10.165  1.00 0.00 ? 114 SER A O    3  
ATOM 4447  C CB   . SER A 1 36  ? -0.288  10.327  8.750   1.00 0.00 ? 114 SER A CB   3  
ATOM 4448  O OG   . SER A 1 36  ? -0.352  10.106  10.148  1.00 0.00 ? 114 SER A OG   3  
ATOM 4449  H H    . SER A 1 36  ? 1.668   11.940  9.392   1.00 0.00 ? 114 SER A H    3  
ATOM 4450  H HA   . SER A 1 36  ? -0.449  11.971  7.388   1.00 0.00 ? 114 SER A HA   3  
ATOM 4451  H HB2  . SER A 1 36  ? -1.169  9.906   8.290   1.00 0.00 ? 114 SER A HB2  3  
ATOM 4452  H HB3  . SER A 1 36  ? 0.592   9.836   8.360   1.00 0.00 ? 114 SER A HB3  3  
ATOM 4453  H HG   . SER A 1 36  ? -0.604  9.195   10.317  1.00 0.00 ? 114 SER A HG   3  
ATOM 4454  N N    . GLN A 1 37  ? -1.383  13.872  8.993   1.00 0.00 ? 115 GLN A N    3  
ATOM 4455  C CA   . GLN A 1 37  ? -2.323  14.712  9.726   1.00 0.00 ? 115 GLN A CA   3  
ATOM 4456  C C    . GLN A 1 37  ? -3.748  14.185  9.586   1.00 0.00 ? 115 GLN A C    3  
ATOM 4457  O O    . GLN A 1 37  ? -4.474  14.065  10.572  1.00 0.00 ? 115 GLN A O    3  
ATOM 4458  C CB   . GLN A 1 37  ? -2.249  16.155  9.225   1.00 0.00 ? 115 GLN A CB   3  
ATOM 4459  C CG   . GLN A 1 37  ? -2.555  16.302  7.744   1.00 0.00 ? 115 GLN A CG   3  
ATOM 4460  C CD   . GLN A 1 37  ? -1.928  17.542  7.138   1.00 0.00 ? 115 GLN A CD   3  
ATOM 4461  O OE1  . GLN A 1 37  ? -0.710  17.622  6.980   1.00 0.00 ? 115 GLN A OE1  3  
ATOM 4462  N NE2  . GLN A 1 37  ? -2.760  18.518  6.793   1.00 0.00 ? 115 GLN A NE2  3  
ATOM 4463  H H    . GLN A 1 37  ? -0.849  14.269  8.274   1.00 0.00 ? 115 GLN A H    3  
ATOM 4464  H HA   . GLN A 1 37  ? -2.045  14.688  10.769  1.00 0.00 ? 115 GLN A HA   3  
ATOM 4465  H HB2  . GLN A 1 37  ? -2.958  16.753  9.779   1.00 0.00 ? 115 GLN A HB2  3  
ATOM 4466  H HB3  . GLN A 1 37  ? -1.254  16.535  9.404   1.00 0.00 ? 115 GLN A HB3  3  
ATOM 4467  H HG2  . GLN A 1 37  ? -2.176  15.435  7.223   1.00 0.00 ? 115 GLN A HG2  3  
ATOM 4468  H HG3  . GLN A 1 37  ? -3.626  16.357  7.615   1.00 0.00 ? 115 GLN A HG3  3  
ATOM 4469  H HE21 . GLN A 1 37  ? -3.719  18.385  6.949   1.00 0.00 ? 115 GLN A HE21 3  
ATOM 4470  H HE22 . GLN A 1 37  ? -2.382  19.331  6.400   1.00 0.00 ? 115 GLN A HE22 3  
ATOM 4471  N N    . GLU A 1 38  ? -4.139  13.873  8.355   1.00 0.00 ? 116 GLU A N    3  
ATOM 4472  C CA   . GLU A 1 38  ? -5.478  13.360  8.087   1.00 0.00 ? 116 GLU A CA   3  
ATOM 4473  C C    . GLU A 1 38  ? -5.670  11.985  8.719   1.00 0.00 ? 116 GLU A C    3  
ATOM 4474  O O    . GLU A 1 38  ? -6.719  11.695  9.297   1.00 0.00 ? 116 GLU A O    3  
ATOM 4475  C CB   . GLU A 1 38  ? -5.725  13.280  6.579   1.00 0.00 ? 116 GLU A CB   3  
ATOM 4476  C CG   . GLU A 1 38  ? -7.181  13.474  6.189   1.00 0.00 ? 116 GLU A CG   3  
ATOM 4477  C CD   . GLU A 1 38  ? -7.585  14.935  6.153   1.00 0.00 ? 116 GLU A CD   3  
ATOM 4478  O OE1  . GLU A 1 38  ? -7.103  15.706  7.009   1.00 0.00 ? 116 GLU A OE1  3  
ATOM 4479  O OE2  . GLU A 1 38  ? -8.384  15.307  5.268   1.00 0.00 ? 116 GLU A OE2  3  
ATOM 4480  H H    . GLU A 1 38  ? -3.514  13.991  7.610   1.00 0.00 ? 116 GLU A H    3  
ATOM 4481  H HA   . GLU A 1 38  ? -6.189  14.046  8.522   1.00 0.00 ? 116 GLU A HA   3  
ATOM 4482  H HB2  . GLU A 1 38  ? -5.137  14.042  6.089   1.00 0.00 ? 116 GLU A HB2  3  
ATOM 4483  H HB3  . GLU A 1 38  ? -5.406  12.310  6.226   1.00 0.00 ? 116 GLU A HB3  3  
ATOM 4484  H HG2  . GLU A 1 38  ? -7.338  13.049  5.209   1.00 0.00 ? 116 GLU A HG2  3  
ATOM 4485  H HG3  . GLU A 1 38  ? -7.804  12.960  6.907   1.00 0.00 ? 116 GLU A HG3  3  
ATOM 4486  N N    . LEU A 1 39  ? -4.651  11.140  8.605   1.00 0.00 ? 117 LEU A N    3  
ATOM 4487  C CA   . LEU A 1 39  ? -4.707  9.794   9.165   1.00 0.00 ? 117 LEU A CA   3  
ATOM 4488  C C    . LEU A 1 39  ? -4.877  9.841   10.680  1.00 0.00 ? 117 LEU A C    3  
ATOM 4489  O O    . LEU A 1 39  ? -5.711  9.132   11.243  1.00 0.00 ? 117 LEU A O    3  
ATOM 4490  C CB   . LEU A 1 39  ? -3.438  9.018   8.806   1.00 0.00 ? 117 LEU A CB   3  
ATOM 4491  C CG   . LEU A 1 39  ? -3.537  7.495   8.888   1.00 0.00 ? 117 LEU A CG   3  
ATOM 4492  C CD1  . LEU A 1 39  ? -4.775  7.000   8.157   1.00 0.00 ? 117 LEU A CD1  3  
ATOM 4493  C CD2  . LEU A 1 39  ? -2.283  6.847   8.319   1.00 0.00 ? 117 LEU A CD2  3  
ATOM 4494  H H    . LEU A 1 39  ? -3.842  11.427  8.134   1.00 0.00 ? 117 LEU A H    3  
ATOM 4495  H HA   . LEU A 1 39  ? -5.560  9.292   8.734   1.00 0.00 ? 117 LEU A HA   3  
ATOM 4496  H HB2  . LEU A 1 39  ? -3.168  9.277   7.794   1.00 0.00 ? 117 LEU A HB2  3  
ATOM 4497  H HB3  . LEU A 1 39  ? -2.655  9.337   9.479   1.00 0.00 ? 117 LEU A HB3  3  
ATOM 4498  H HG   . LEU A 1 39  ? -3.624  7.202   9.926   1.00 0.00 ? 117 LEU A HG   3  
ATOM 4499  H HD11 . LEU A 1 39  ? -4.735  5.925   8.068   1.00 0.00 ? 117 LEU A HD11 3  
ATOM 4500  H HD12 . LEU A 1 39  ? -4.811  7.441   7.171   1.00 0.00 ? 117 LEU A HD12 3  
ATOM 4501  H HD13 . LEU A 1 39  ? -5.658  7.283   8.710   1.00 0.00 ? 117 LEU A HD13 3  
ATOM 4502  H HD21 . LEU A 1 39  ? -2.341  6.839   7.240   1.00 0.00 ? 117 LEU A HD21 3  
ATOM 4503  H HD22 . LEU A 1 39  ? -2.205  5.833   8.682   1.00 0.00 ? 117 LEU A HD22 3  
ATOM 4504  H HD23 . LEU A 1 39  ? -1.415  7.410   8.629   1.00 0.00 ? 117 LEU A HD23 3  
ATOM 4505  N N    . TYR A 1 40  ? -4.082  10.681  11.333  1.00 0.00 ? 118 TYR A N    3  
ATOM 4506  C CA   . TYR A 1 40  ? -4.144  10.821  12.783  1.00 0.00 ? 118 TYR A CA   3  
ATOM 4507  C C    . TYR A 1 40  ? -5.550  11.206  13.234  1.00 0.00 ? 118 TYR A C    3  
ATOM 4508  O O    . TYR A 1 40  ? -6.125  10.575  14.121  1.00 0.00 ? 118 TYR A O    3  
ATOM 4509  C CB   . TYR A 1 40  ? -3.138  11.870  13.259  1.00 0.00 ? 118 TYR A CB   3  
ATOM 4510  C CG   . TYR A 1 40  ? -2.901  11.848  14.752  1.00 0.00 ? 118 TYR A CG   3  
ATOM 4511  C CD1  . TYR A 1 40  ? -2.006  10.949  15.320  1.00 0.00 ? 118 TYR A CD1  3  
ATOM 4512  C CD2  . TYR A 1 40  ? -3.572  12.725  15.595  1.00 0.00 ? 118 TYR A CD2  3  
ATOM 4513  C CE1  . TYR A 1 40  ? -1.786  10.925  16.683  1.00 0.00 ? 118 TYR A CE1  3  
ATOM 4514  C CE2  . TYR A 1 40  ? -3.358  12.708  16.960  1.00 0.00 ? 118 TYR A CE2  3  
ATOM 4515  C CZ   . TYR A 1 40  ? -2.464  11.807  17.499  1.00 0.00 ? 118 TYR A CZ   3  
ATOM 4516  O OH   . TYR A 1 40  ? -2.249  11.786  18.858  1.00 0.00 ? 118 TYR A OH   3  
ATOM 4517  H H    . TYR A 1 40  ? -3.438  11.220  10.829  1.00 0.00 ? 118 TYR A H    3  
ATOM 4518  H HA   . TYR A 1 40  ? -3.888  9.866   13.219  1.00 0.00 ? 118 TYR A HA   3  
ATOM 4519  H HB2  . TYR A 1 40  ? -2.191  11.699  12.771  1.00 0.00 ? 118 TYR A HB2  3  
ATOM 4520  H HB3  . TYR A 1 40  ? -3.501  12.853  12.995  1.00 0.00 ? 118 TYR A HB3  3  
ATOM 4521  H HD1  . TYR A 1 40  ? -1.476  10.260  14.678  1.00 0.00 ? 118 TYR A HD1  3  
ATOM 4522  H HD2  . TYR A 1 40  ? -4.272  13.429  15.170  1.00 0.00 ? 118 TYR A HD2  3  
ATOM 4523  H HE1  . TYR A 1 40  ? -1.086  10.219  17.106  1.00 0.00 ? 118 TYR A HE1  3  
ATOM 4524  H HE2  . TYR A 1 40  ? -3.889  13.398  17.599  1.00 0.00 ? 118 TYR A HE2  3  
ATOM 4525  H HH   . TYR A 1 40  ? -2.279  10.880  19.173  1.00 0.00 ? 118 TYR A HH   3  
ATOM 4526  N N    . ASP A 1 41  ? -6.098  12.247  12.616  1.00 0.00 ? 119 ASP A N    3  
ATOM 4527  C CA   . ASP A 1 41  ? -7.437  12.717  12.951  1.00 0.00 ? 119 ASP A CA   3  
ATOM 4528  C C    . ASP A 1 41  ? -8.410  11.548  13.066  1.00 0.00 ? 119 ASP A C    3  
ATOM 4529  O O    . ASP A 1 41  ? -9.312  11.557  13.905  1.00 0.00 ? 119 ASP A O    3  
ATOM 4530  C CB   . ASP A 1 41  ? -7.932  13.707  11.895  1.00 0.00 ? 119 ASP A CB   3  
ATOM 4531  C CG   . ASP A 1 41  ? -9.107  14.532  12.381  1.00 0.00 ? 119 ASP A CG   3  
ATOM 4532  O OD1  . ASP A 1 41  ? -9.147  14.855  13.586  1.00 0.00 ? 119 ASP A OD1  3  
ATOM 4533  O OD2  . ASP A 1 41  ? -9.988  14.854  11.555  1.00 0.00 ? 119 ASP A OD2  3  
ATOM 4534  H H    . ASP A 1 41  ? -5.589  12.709  11.917  1.00 0.00 ? 119 ASP A H    3  
ATOM 4535  H HA   . ASP A 1 41  ? -7.383  13.219  13.904  1.00 0.00 ? 119 ASP A HA   3  
ATOM 4536  H HB2  . ASP A 1 41  ? -7.127  14.379  11.636  1.00 0.00 ? 119 ASP A HB2  3  
ATOM 4537  H HB3  . ASP A 1 41  ? -8.237  13.161  11.014  1.00 0.00 ? 119 ASP A HB3  3  
ATOM 4538  N N    . LEU A 1 42  ? -8.223  10.544  12.217  1.00 0.00 ? 120 LEU A N    3  
ATOM 4539  C CA   . LEU A 1 42  ? -9.085  9.367   12.222  1.00 0.00 ? 120 LEU A CA   3  
ATOM 4540  C C    . LEU A 1 42  ? -8.708  8.421   13.358  1.00 0.00 ? 120 LEU A C    3  
ATOM 4541  O O    . LEU A 1 42  ? -9.554  7.700   13.885  1.00 0.00 ? 120 LEU A O    3  
ATOM 4542  C CB   . LEU A 1 42  ? -8.992  8.636   10.882  1.00 0.00 ? 120 LEU A CB   3  
ATOM 4543  C CG   . LEU A 1 42  ? -9.246  9.485   9.636   1.00 0.00 ? 120 LEU A CG   3  
ATOM 4544  C CD1  . LEU A 1 42  ? -8.675  8.804   8.401   1.00 0.00 ? 120 LEU A CD1  3  
ATOM 4545  C CD2  . LEU A 1 42  ? -10.735 9.747   9.462   1.00 0.00 ? 120 LEU A CD2  3  
ATOM 4546  H H    . LEU A 1 42  ? -7.488  10.593  11.571  1.00 0.00 ? 120 LEU A H    3  
ATOM 4547  H HA   . LEU A 1 42  ? -10.101 9.701   12.371  1.00 0.00 ? 120 LEU A HA   3  
ATOM 4548  H HB2  . LEU A 1 42  ? -8.001  8.218   10.801  1.00 0.00 ? 120 LEU A HB2  3  
ATOM 4549  H HB3  . LEU A 1 42  ? -9.718  7.835   10.892  1.00 0.00 ? 120 LEU A HB3  3  
ATOM 4550  H HG   . LEU A 1 42  ? -8.748  10.438  9.750   1.00 0.00 ? 120 LEU A HG   3  
ATOM 4551  H HD11 . LEU A 1 42  ? -8.431  9.549   7.659   1.00 0.00 ? 120 LEU A HD11 3  
ATOM 4552  H HD12 . LEU A 1 42  ? -9.407  8.120   7.997   1.00 0.00 ? 120 LEU A HD12 3  
ATOM 4553  H HD13 . LEU A 1 42  ? -7.783  8.257   8.671   1.00 0.00 ? 120 LEU A HD13 3  
ATOM 4554  H HD21 . LEU A 1 42  ? -11.260 9.439   10.355  1.00 0.00 ? 120 LEU A HD21 3  
ATOM 4555  H HD22 . LEU A 1 42  ? -11.103 9.185   8.616   1.00 0.00 ? 120 LEU A HD22 3  
ATOM 4556  H HD23 . LEU A 1 42  ? -10.897 10.801  9.294   1.00 0.00 ? 120 LEU A HD23 3  
ATOM 4557  N N    . ASN A 1 43  ? -7.433  8.431   13.730  1.00 0.00 ? 121 ASN A N    3  
ATOM 4558  C CA   . ASN A 1 43  ? -6.943  7.574   14.805  1.00 0.00 ? 121 ASN A CA   3  
ATOM 4559  C C    . ASN A 1 43  ? -7.007  6.104   14.401  1.00 0.00 ? 121 ASN A C    3  
ATOM 4560  O O    . ASN A 1 43  ? -7.576  5.277   15.114  1.00 0.00 ? 121 ASN A O    3  
ATOM 4561  C CB   . ASN A 1 43  ? -7.761  7.801   16.078  1.00 0.00 ? 121 ASN A CB   3  
ATOM 4562  C CG   . ASN A 1 43  ? -6.985  7.454   17.334  1.00 0.00 ? 121 ASN A CG   3  
ATOM 4563  O OD1  . ASN A 1 43  ? -6.269  8.291   17.885  1.00 0.00 ? 121 ASN A OD1  3  
ATOM 4564  N ND2  . ASN A 1 43  ? -7.122  6.215   17.791  1.00 0.00 ? 121 ASN A ND2  3  
ATOM 4565  H H    . ASN A 1 43  ? -6.805  9.027   13.272  1.00 0.00 ? 121 ASN A H    3  
ATOM 4566  H HA   . ASN A 1 43  ? -5.915  7.839   14.997  1.00 0.00 ? 121 ASN A HA   3  
ATOM 4567  H HB2  . ASN A 1 43  ? -8.051  8.840   16.133  1.00 0.00 ? 121 ASN A HB2  3  
ATOM 4568  H HB3  . ASN A 1 43  ? -8.648  7.186   16.044  1.00 0.00 ? 121 ASN A HB3  3  
ATOM 4569  H HD21 . ASN A 1 43  ? -7.709  5.602   17.300  1.00 0.00 ? 121 ASN A HD21 3  
ATOM 4570  H HD22 . ASN A 1 43  ? -6.632  5.965   18.602  1.00 0.00 ? 121 ASN A HD22 3  
ATOM 4571  N N    . VAL A 1 44  ? -6.419  5.786   13.252  1.00 0.00 ? 122 VAL A N    3  
ATOM 4572  C CA   . VAL A 1 44  ? -6.406  4.416   12.753  1.00 0.00 ? 122 VAL A CA   3  
ATOM 4573  C C    . VAL A 1 44  ? -5.345  3.582   13.463  1.00 0.00 ? 122 VAL A C    3  
ATOM 4574  O O    . VAL A 1 44  ? -4.296  4.095   13.850  1.00 0.00 ? 122 VAL A O    3  
ATOM 4575  C CB   . VAL A 1 44  ? -6.146  4.374   11.236  1.00 0.00 ? 122 VAL A CB   3  
ATOM 4576  C CG1  . VAL A 1 44  ? -4.817  5.033   10.903  1.00 0.00 ? 122 VAL A CG1  3  
ATOM 4577  C CG2  . VAL A 1 44  ? -6.181  2.940   10.730  1.00 0.00 ? 122 VAL A CG2  3  
ATOM 4578  H H    . VAL A 1 44  ? -5.981  6.489   12.728  1.00 0.00 ? 122 VAL A H    3  
ATOM 4579  H HA   . VAL A 1 44  ? -7.378  3.983   12.943  1.00 0.00 ? 122 VAL A HA   3  
ATOM 4580  H HB   . VAL A 1 44  ? -6.931  4.927   10.741  1.00 0.00 ? 122 VAL A HB   3  
ATOM 4581  H HG11 . VAL A 1 44  ? -4.063  4.695   11.599  1.00 0.00 ? 122 VAL A HG11 3  
ATOM 4582  H HG12 . VAL A 1 44  ? -4.524  4.768   9.898   1.00 0.00 ? 122 VAL A HG12 3  
ATOM 4583  H HG13 . VAL A 1 44  ? -4.919  6.106   10.977  1.00 0.00 ? 122 VAL A HG13 3  
ATOM 4584  H HG21 . VAL A 1 44  ? -5.475  2.344   11.289  1.00 0.00 ? 122 VAL A HG21 3  
ATOM 4585  H HG22 . VAL A 1 44  ? -7.175  2.535   10.860  1.00 0.00 ? 122 VAL A HG22 3  
ATOM 4586  H HG23 . VAL A 1 44  ? -5.920  2.920   9.682   1.00 0.00 ? 122 VAL A HG23 3  
ATOM 4587  N N    . GLU A 1 45  ? -5.627  2.294   13.630  1.00 0.00 ? 123 GLU A N    3  
ATOM 4588  C CA   . GLU A 1 45  ? -4.696  1.389   14.294  1.00 0.00 ? 123 GLU A CA   3  
ATOM 4589  C C    . GLU A 1 45  ? -4.487  0.122   13.469  1.00 0.00 ? 123 GLU A C    3  
ATOM 4590  O O    . GLU A 1 45  ? -5.426  -0.638  13.230  1.00 0.00 ? 123 GLU A O    3  
ATOM 4591  C CB   . GLU A 1 45  ? -5.212  1.024   15.688  1.00 0.00 ? 123 GLU A CB   3  
ATOM 4592  C CG   . GLU A 1 45  ? -5.321  2.214   16.627  1.00 0.00 ? 123 GLU A CG   3  
ATOM 4593  C CD   . GLU A 1 45  ? -5.799  1.822   18.012  1.00 0.00 ? 123 GLU A CD   3  
ATOM 4594  O OE1  . GLU A 1 45  ? -5.038  1.140   18.730  1.00 0.00 ? 123 GLU A OE1  3  
ATOM 4595  O OE2  . GLU A 1 45  ? -6.933  2.196   18.377  1.00 0.00 ? 123 GLU A OE2  3  
ATOM 4596  H H    . GLU A 1 45  ? -6.481  1.944   13.300  1.00 0.00 ? 123 GLU A H    3  
ATOM 4597  H HA   . GLU A 1 45  ? -3.751  1.900   14.393  1.00 0.00 ? 123 GLU A HA   3  
ATOM 4598  H HB2  . GLU A 1 45  ? -6.190  0.576   15.591  1.00 0.00 ? 123 GLU A HB2  3  
ATOM 4599  H HB3  . GLU A 1 45  ? -4.539  0.304   16.130  1.00 0.00 ? 123 GLU A HB3  3  
ATOM 4600  H HG2  . GLU A 1 45  ? -4.349  2.676   16.716  1.00 0.00 ? 123 GLU A HG2  3  
ATOM 4601  H HG3  . GLU A 1 45  ? -6.019  2.923   16.209  1.00 0.00 ? 123 GLU A HG3  3  
ATOM 4602  N N    . LEU A 1 46  ? -3.251  -0.098  13.037  1.00 0.00 ? 124 LEU A N    3  
ATOM 4603  C CA   . LEU A 1 46  ? -2.917  -1.272  12.238  1.00 0.00 ? 124 LEU A CA   3  
ATOM 4604  C C    . LEU A 1 46  ? -3.125  -2.553  13.040  1.00 0.00 ? 124 LEU A C    3  
ATOM 4605  O O    . LEU A 1 46  ? -2.959  -2.568  14.260  1.00 0.00 ? 124 LEU A O    3  
ATOM 4606  C CB   . LEU A 1 46  ? -1.468  -1.189  11.755  1.00 0.00 ? 124 LEU A CB   3  
ATOM 4607  C CG   . LEU A 1 46  ? -1.217  -0.297  10.538  1.00 0.00 ? 124 LEU A CG   3  
ATOM 4608  C CD1  . LEU A 1 46  ? 0.251   0.094   10.458  1.00 0.00 ? 124 LEU A CD1  3  
ATOM 4609  C CD2  . LEU A 1 46  ? -1.653  -1.001  9.262   1.00 0.00 ? 124 LEU A CD2  3  
ATOM 4610  H H    . LEU A 1 46  ? -2.545  0.544   13.260  1.00 0.00 ? 124 LEU A H    3  
ATOM 4611  H HA   . LEU A 1 46  ? -3.574  -1.287  11.381  1.00 0.00 ? 124 LEU A HA   3  
ATOM 4612  H HB2  . LEU A 1 46  ? -0.869  -0.813  12.569  1.00 0.00 ? 124 LEU A HB2  3  
ATOM 4613  H HB3  . LEU A 1 46  ? -1.146  -2.190  11.505  1.00 0.00 ? 124 LEU A HB3  3  
ATOM 4614  H HG   . LEU A 1 46  ? -1.798  0.609   10.637  1.00 0.00 ? 124 LEU A HG   3  
ATOM 4615  H HD11 . LEU A 1 46  ? 0.499   0.732   11.292  1.00 0.00 ? 124 LEU A HD11 3  
ATOM 4616  H HD12 . LEU A 1 46  ? 0.432   0.624   9.534   1.00 0.00 ? 124 LEU A HD12 3  
ATOM 4617  H HD13 . LEU A 1 46  ? 0.863   -0.795  10.488  1.00 0.00 ? 124 LEU A HD13 3  
ATOM 4618  H HD21 . LEU A 1 46  ? -1.564  -0.321  8.428   1.00 0.00 ? 124 LEU A HD21 3  
ATOM 4619  H HD22 . LEU A 1 46  ? -2.682  -1.318  9.359   1.00 0.00 ? 124 LEU A HD22 3  
ATOM 4620  H HD23 . LEU A 1 46  ? -1.025  -1.863  9.093   1.00 0.00 ? 124 LEU A HD23 3  
ATOM 4621  N N    . SER A 1 47  ? -3.487  -3.627  12.346  1.00 0.00 ? 125 SER A N    3  
ATOM 4622  C CA   . SER A 1 47  ? -3.719  -4.913  12.993  1.00 0.00 ? 125 SER A CA   3  
ATOM 4623  C C    . SER A 1 47  ? -2.691  -5.944  12.537  1.00 0.00 ? 125 SER A C    3  
ATOM 4624  O O    . SER A 1 47  ? -2.176  -6.723  13.340  1.00 0.00 ? 125 SER A O    3  
ATOM 4625  C CB   . SER A 1 47  ? -5.131  -5.415  12.686  1.00 0.00 ? 125 SER A CB   3  
ATOM 4626  O OG   . SER A 1 47  ? -5.359  -6.686  13.270  1.00 0.00 ? 125 SER A OG   3  
ATOM 4627  H H    . SER A 1 47  ? -3.603  -3.552  11.375  1.00 0.00 ? 125 SER A H    3  
ATOM 4628  H HA   . SER A 1 47  ? -3.620  -4.770  14.059  1.00 0.00 ? 125 SER A HA   3  
ATOM 4629  H HB2  . SER A 1 47  ? -5.852  -4.716  13.082  1.00 0.00 ? 125 SER A HB2  3  
ATOM 4630  H HB3  . SER A 1 47  ? -5.257  -5.495  11.616  1.00 0.00 ? 125 SER A HB3  3  
ATOM 4631  H HG   . SER A 1 47  ? -4.518  -7.084  13.510  1.00 0.00 ? 125 SER A HG   3  
ATOM 4632  N N    . LYS A 1 48  ? -2.395  -5.943  11.242  1.00 0.00 ? 126 LYS A N    3  
ATOM 4633  C CA   . LYS A 1 48  ? -1.428  -6.876  10.676  1.00 0.00 ? 126 LYS A CA   3  
ATOM 4634  C C    . LYS A 1 48  ? -1.069  -6.487  9.246   1.00 0.00 ? 126 LYS A C    3  
ATOM 4635  O O    . LYS A 1 48  ? -1.809  -5.757  8.586   1.00 0.00 ? 126 LYS A O    3  
ATOM 4636  C CB   . LYS A 1 48  ? -1.986  -8.301  10.704  1.00 0.00 ? 126 LYS A CB   3  
ATOM 4637  C CG   . LYS A 1 48  ? -3.211  -8.491  9.826   1.00 0.00 ? 126 LYS A CG   3  
ATOM 4638  C CD   . LYS A 1 48  ? -3.362  -9.937  9.384   1.00 0.00 ? 126 LYS A CD   3  
ATOM 4639  C CE   . LYS A 1 48  ? -4.061  -10.774 10.444  1.00 0.00 ? 126 LYS A CE   3  
ATOM 4640  N NZ   . LYS A 1 48  ? -4.480  -12.101 9.915   1.00 0.00 ? 126 LYS A NZ   3  
ATOM 4641  H H    . LYS A 1 48  ? -2.839  -5.298  10.651  1.00 0.00 ? 126 LYS A H    3  
ATOM 4642  H HA   . LYS A 1 48  ? -0.536  -6.837  11.282  1.00 0.00 ? 126 LYS A HA   3  
ATOM 4643  H HB2  . LYS A 1 48  ? -1.219  -8.982  10.367  1.00 0.00 ? 126 LYS A HB2  3  
ATOM 4644  H HB3  . LYS A 1 48  ? -2.256  -8.549  11.720  1.00 0.00 ? 126 LYS A HB3  3  
ATOM 4645  H HG2  . LYS A 1 48  ? -4.091  -8.203  10.383  1.00 0.00 ? 126 LYS A HG2  3  
ATOM 4646  H HG3  . LYS A 1 48  ? -3.116  -7.864  8.950   1.00 0.00 ? 126 LYS A HG3  3  
ATOM 4647  H HD2  . LYS A 1 48  ? -3.944  -9.968  8.475   1.00 0.00 ? 126 LYS A HD2  3  
ATOM 4648  H HD3  . LYS A 1 48  ? -2.381  -10.351 9.199   1.00 0.00 ? 126 LYS A HD3  3  
ATOM 4649  H HE2  . LYS A 1 48  ? -3.383  -10.923 11.270  1.00 0.00 ? 126 LYS A HE2  3  
ATOM 4650  H HE3  . LYS A 1 48  ? -4.935  -10.240 10.787  1.00 0.00 ? 126 LYS A HE3  3  
ATOM 4651  H HZ1  . LYS A 1 48  ? -3.941  -12.329 9.055   1.00 0.00 ? 126 LYS A HZ1  3  
ATOM 4652  H HZ2  . LYS A 1 48  ? -5.493  -12.089 9.681   1.00 0.00 ? 126 LYS A HZ2  3  
ATOM 4653  H HZ3  . LYS A 1 48  ? -4.308  -12.840 10.626  1.00 0.00 ? 126 LYS A HZ3  3  
ATOM 4654  N N    . VAL A 1 49  ? 0.071   -6.980  8.772   1.00 0.00 ? 127 VAL A N    3  
ATOM 4655  C CA   . VAL A 1 49  ? 0.527   -6.685  7.418   1.00 0.00 ? 127 VAL A CA   3  
ATOM 4656  C C    . VAL A 1 49  ? 0.756   -7.967  6.625   1.00 0.00 ? 127 VAL A C    3  
ATOM 4657  O O    . VAL A 1 49  ? 1.442   -8.880  7.085   1.00 0.00 ? 127 VAL A O    3  
ATOM 4658  C CB   . VAL A 1 49  ? 1.829   -5.863  7.431   1.00 0.00 ? 127 VAL A CB   3  
ATOM 4659  C CG1  . VAL A 1 49  ? 2.355   -5.674  6.017   1.00 0.00 ? 127 VAL A CG1  3  
ATOM 4660  C CG2  . VAL A 1 49  ? 1.603   -4.520  8.109   1.00 0.00 ? 127 VAL A CG2  3  
ATOM 4661  H H    . VAL A 1 49  ? 0.618   -7.555  9.346   1.00 0.00 ? 127 VAL A H    3  
ATOM 4662  H HA   . VAL A 1 49  ? -0.238  -6.102  6.928   1.00 0.00 ? 127 VAL A HA   3  
ATOM 4663  H HB   . VAL A 1 49  ? 2.570   -6.408  7.997   1.00 0.00 ? 127 VAL A HB   3  
ATOM 4664  H HG11 . VAL A 1 49  ? 2.406   -4.619  5.790   1.00 0.00 ? 127 VAL A HG11 3  
ATOM 4665  H HG12 . VAL A 1 49  ? 3.341   -6.108  5.938   1.00 0.00 ? 127 VAL A HG12 3  
ATOM 4666  H HG13 . VAL A 1 49  ? 1.690   -6.160  5.318   1.00 0.00 ? 127 VAL A HG13 3  
ATOM 4667  H HG21 . VAL A 1 49  ? 2.395   -3.840  7.831   1.00 0.00 ? 127 VAL A HG21 3  
ATOM 4668  H HG22 . VAL A 1 49  ? 0.653   -4.113  7.795   1.00 0.00 ? 127 VAL A HG22 3  
ATOM 4669  H HG23 . VAL A 1 49  ? 1.601   -4.652  9.180   1.00 0.00 ? 127 VAL A HG23 3  
ATOM 4670  N N    . SER A 1 50  ? 0.178   -8.028  5.430   1.00 0.00 ? 128 SER A N    3  
ATOM 4671  C CA   . SER A 1 50  ? 0.316   -9.199  4.572   1.00 0.00 ? 128 SER A CA   3  
ATOM 4672  C C    . SER A 1 50  ? 1.223   -8.898  3.383   1.00 0.00 ? 128 SER A C    3  
ATOM 4673  O O    . SER A 1 50  ? 0.894   -8.074  2.529   1.00 0.00 ? 128 SER A O    3  
ATOM 4674  C CB   . SER A 1 50  ? -1.056  -9.660  4.078   1.00 0.00 ? 128 SER A CB   3  
ATOM 4675  O OG   . SER A 1 50  ? -1.008  -10.999 3.614   1.00 0.00 ? 128 SER A OG   3  
ATOM 4676  H H    . SER A 1 50  ? -0.357  -7.267  5.118   1.00 0.00 ? 128 SER A H    3  
ATOM 4677  H HA   . SER A 1 50  ? 0.762   -9.989  5.159   1.00 0.00 ? 128 SER A HA   3  
ATOM 4678  H HB2  . SER A 1 50  ? -1.767  -9.598  4.887   1.00 0.00 ? 128 SER A HB2  3  
ATOM 4679  H HB3  . SER A 1 50  ? -1.377  -9.022  3.267   1.00 0.00 ? 128 SER A HB3  3  
ATOM 4680  H HG   . SER A 1 50  ? -1.125  -11.599 4.354   1.00 0.00 ? 128 SER A HG   3  
ATOM 4681  N N    . LEU A 1 51  ? 2.367   -9.572  3.334   1.00 0.00 ? 129 LEU A N    3  
ATOM 4682  C CA   . LEU A 1 51  ? 3.324   -9.378  2.250   1.00 0.00 ? 129 LEU A CA   3  
ATOM 4683  C C    . LEU A 1 51  ? 3.386   -10.609 1.352   1.00 0.00 ? 129 LEU A C    3  
ATOM 4684  O O    . LEU A 1 51  ? 3.330   -11.743 1.829   1.00 0.00 ? 129 LEU A O    3  
ATOM 4685  C CB   . LEU A 1 51  ? 4.712   -9.075  2.816   1.00 0.00 ? 129 LEU A CB   3  
ATOM 4686  C CG   . LEU A 1 51  ? 5.840   -8.942  1.793   1.00 0.00 ? 129 LEU A CG   3  
ATOM 4687  C CD1  . LEU A 1 51  ? 5.817   -7.565  1.148   1.00 0.00 ? 129 LEU A CD1  3  
ATOM 4688  C CD2  . LEU A 1 51  ? 7.188   -9.203  2.448   1.00 0.00 ? 129 LEU A CD2  3  
ATOM 4689  H H    . LEU A 1 51  ? 2.574   -10.215 4.043   1.00 0.00 ? 129 LEU A H    3  
ATOM 4690  H HA   . LEU A 1 51  ? 2.992   -8.535  1.662   1.00 0.00 ? 129 LEU A HA   3  
ATOM 4691  H HB2  . LEU A 1 51  ? 4.650   -8.146  3.363   1.00 0.00 ? 129 LEU A HB2  3  
ATOM 4692  H HB3  . LEU A 1 51  ? 4.972   -9.874  3.496   1.00 0.00 ? 129 LEU A HB3  3  
ATOM 4693  H HG   . LEU A 1 51  ? 5.698   -9.677  1.013   1.00 0.00 ? 129 LEU A HG   3  
ATOM 4694  H HD11 . LEU A 1 51  ? 4.842   -7.121  1.283   1.00 0.00 ? 129 LEU A HD11 3  
ATOM 4695  H HD12 . LEU A 1 51  ? 6.028   -7.658  0.093   1.00 0.00 ? 129 LEU A HD12 3  
ATOM 4696  H HD13 . LEU A 1 51  ? 6.565   -6.938  1.611   1.00 0.00 ? 129 LEU A HD13 3  
ATOM 4697  H HD21 . LEU A 1 51  ? 7.687   -10.012 1.935   1.00 0.00 ? 129 LEU A HD21 3  
ATOM 4698  H HD22 . LEU A 1 51  ? 7.039   -9.473  3.484   1.00 0.00 ? 129 LEU A HD22 3  
ATOM 4699  H HD23 . LEU A 1 51  ? 7.795   -8.312  2.391   1.00 0.00 ? 129 LEU A HD23 3  
ATOM 4700  N N    . THR A 1 52  ? 3.505   -10.379 0.048   1.00 0.00 ? 130 THR A N    3  
ATOM 4701  C CA   . THR A 1 52  ? 3.576   -11.469 -0.917  1.00 0.00 ? 130 THR A CA   3  
ATOM 4702  C C    . THR A 1 52  ? 4.896   -12.223 -0.798  1.00 0.00 ? 130 THR A C    3  
ATOM 4703  O O    . THR A 1 52  ? 5.912   -11.679 -0.366  1.00 0.00 ? 130 THR A O    3  
ATOM 4704  C CB   . THR A 1 52  ? 3.422   -10.952 -2.360  1.00 0.00 ? 130 THR A CB   3  
ATOM 4705  O OG1  . THR A 1 52  ? 4.215   -9.775  -2.547  1.00 0.00 ? 130 THR A OG1  3  
ATOM 4706  C CG2  . THR A 1 52  ? 1.965   -10.643 -2.671  1.00 0.00 ? 130 THR A CG2  3  
ATOM 4707  H H    . THR A 1 52  ? 3.545   -9.453  -0.271  1.00 0.00 ? 130 THR A H    3  
ATOM 4708  H HA   . THR A 1 52  ? 2.763   -12.150 -0.712  1.00 0.00 ? 130 THR A HA   3  
ATOM 4709  H HB   . THR A 1 52  ? 3.764   -11.719 -3.040  1.00 0.00 ? 130 THR A HB   3  
ATOM 4710  H HG1  . THR A 1 52  ? 4.565   -9.763  -3.441  1.00 0.00 ? 130 THR A HG1  3  
ATOM 4711  H HG21 . THR A 1 52  ? 1.384   -11.552 -2.618  1.00 0.00 ? 130 THR A HG21 3  
ATOM 4712  H HG22 . THR A 1 52  ? 1.890   -10.224 -3.663  1.00 0.00 ? 130 THR A HG22 3  
ATOM 4713  H HG23 . THR A 1 52  ? 1.587   -9.933  -1.951  1.00 0.00 ? 130 THR A HG23 3  
ATOM 4714  N N    . PRO A 1 53  ? 4.882   -13.505 -1.190  1.00 0.00 ? 131 PRO A N    3  
ATOM 4715  C CA   . PRO A 1 53  ? 6.071   -14.361 -1.138  1.00 0.00 ? 131 PRO A CA   3  
ATOM 4716  C C    . PRO A 1 53  ? 7.123   -13.956 -2.165  1.00 0.00 ? 131 PRO A C    3  
ATOM 4717  O O    . PRO A 1 53  ? 8.307   -14.253 -2.005  1.00 0.00 ? 131 PRO A O    3  
ATOM 4718  C CB   . PRO A 1 53  ? 5.520   -15.753 -1.458  1.00 0.00 ? 131 PRO A CB   3  
ATOM 4719  C CG   . PRO A 1 53  ? 4.285   -15.499 -2.251  1.00 0.00 ? 131 PRO A CG   3  
ATOM 4720  C CD   . PRO A 1 53  ? 3.706   -14.219 -1.716  1.00 0.00 ? 131 PRO A CD   3  
ATOM 4721  H HA   . PRO A 1 53  ? 6.514   -14.365 -0.153  1.00 0.00 ? 131 PRO A HA   3  
ATOM 4722  H HB2  . PRO A 1 53  ? 6.250   -16.310 -2.029  1.00 0.00 ? 131 PRO A HB2  3  
ATOM 4723  H HB3  . PRO A 1 53  ? 5.299   -16.276 -0.539  1.00 0.00 ? 131 PRO A HB3  3  
ATOM 4724  H HG2  . PRO A 1 53  ? 4.535   -15.390 -3.295  1.00 0.00 ? 131 PRO A HG2  3  
ATOM 4725  H HG3  . PRO A 1 53  ? 3.587   -16.312 -2.113  1.00 0.00 ? 131 PRO A HG3  3  
ATOM 4726  H HD2  . PRO A 1 53  ? 3.237   -13.656 -2.509  1.00 0.00 ? 131 PRO A HD2  3  
ATOM 4727  H HD3  . PRO A 1 53  ? 2.998   -14.425 -0.927  1.00 0.00 ? 131 PRO A HD3  3  
ATOM 4728  N N    . ASP A 1 54  ? 6.683   -13.277 -3.219  1.00 0.00 ? 132 ASP A N    3  
ATOM 4729  C CA   . ASP A 1 54  ? 7.588   -12.830 -4.272  1.00 0.00 ? 132 ASP A CA   3  
ATOM 4730  C C    . ASP A 1 54  ? 8.194   -11.473 -3.927  1.00 0.00 ? 132 ASP A C    3  
ATOM 4731  O O    . ASP A 1 54  ? 8.977   -10.917 -4.697  1.00 0.00 ? 132 ASP A O    3  
ATOM 4732  C CB   . ASP A 1 54  ? 6.848   -12.747 -5.608  1.00 0.00 ? 132 ASP A CB   3  
ATOM 4733  C CG   . ASP A 1 54  ? 6.556   -14.115 -6.193  1.00 0.00 ? 132 ASP A CG   3  
ATOM 4734  O OD1  . ASP A 1 54  ? 7.514   -14.798 -6.611  1.00 0.00 ? 132 ASP A OD1  3  
ATOM 4735  O OD2  . ASP A 1 54  ? 5.370   -14.502 -6.233  1.00 0.00 ? 132 ASP A OD2  3  
ATOM 4736  H H    . ASP A 1 54  ? 5.728   -13.071 -3.290  1.00 0.00 ? 132 ASP A H    3  
ATOM 4737  H HA   . ASP A 1 54  ? 8.384   -13.554 -4.356  1.00 0.00 ? 132 ASP A HA   3  
ATOM 4738  H HB2  . ASP A 1 54  ? 5.910   -12.231 -5.461  1.00 0.00 ? 132 ASP A HB2  3  
ATOM 4739  H HB3  . ASP A 1 54  ? 7.452   -12.195 -6.312  1.00 0.00 ? 132 ASP A HB3  3  
ATOM 4740  N N    . PHE A 1 55  ? 7.825   -10.944 -2.765  1.00 0.00 ? 133 PHE A N    3  
ATOM 4741  C CA   . PHE A 1 55  ? 8.331   -9.651  -2.319  1.00 0.00 ? 133 PHE A CA   3  
ATOM 4742  C C    . PHE A 1 55  ? 7.959   -8.550  -3.308  1.00 0.00 ? 133 PHE A C    3  
ATOM 4743  O O    . PHE A 1 55  ? 8.630   -7.522  -3.391  1.00 0.00 ? 133 PHE A O    3  
ATOM 4744  C CB   . PHE A 1 55  ? 9.850   -9.705  -2.147  1.00 0.00 ? 133 PHE A CB   3  
ATOM 4745  C CG   . PHE A 1 55  ? 10.284  -10.253 -0.817  1.00 0.00 ? 133 PHE A CG   3  
ATOM 4746  C CD1  . PHE A 1 55  ? 9.773   -9.733  0.361   1.00 0.00 ? 133 PHE A CD1  3  
ATOM 4747  C CD2  . PHE A 1 55  ? 11.202  -11.288 -0.746  1.00 0.00 ? 133 PHE A CD2  3  
ATOM 4748  C CE1  . PHE A 1 55  ? 10.171  -10.235 1.586   1.00 0.00 ? 133 PHE A CE1  3  
ATOM 4749  C CE2  . PHE A 1 55  ? 11.604  -11.795 0.476   1.00 0.00 ? 133 PHE A CE2  3  
ATOM 4750  C CZ   . PHE A 1 55  ? 11.087  -11.268 1.643   1.00 0.00 ? 133 PHE A CZ   3  
ATOM 4751  H H    . PHE A 1 55  ? 7.198   -11.435 -2.194  1.00 0.00 ? 133 PHE A H    3  
ATOM 4752  H HA   . PHE A 1 55  ? 7.877   -9.429  -1.365  1.00 0.00 ? 133 PHE A HA   3  
ATOM 4753  H HB2  . PHE A 1 55  ? 10.270  -10.334 -2.917  1.00 0.00 ? 133 PHE A HB2  3  
ATOM 4754  H HB3  . PHE A 1 55  ? 10.252  -8.708  -2.243  1.00 0.00 ? 133 PHE A HB3  3  
ATOM 4755  H HD1  . PHE A 1 55  ? 9.057   -8.926  0.318   1.00 0.00 ? 133 PHE A HD1  3  
ATOM 4756  H HD2  . PHE A 1 55  ? 11.607  -11.701 -1.659  1.00 0.00 ? 133 PHE A HD2  3  
ATOM 4757  H HE1  . PHE A 1 55  ? 9.765   -9.822  2.497   1.00 0.00 ? 133 PHE A HE1  3  
ATOM 4758  H HE2  . PHE A 1 55  ? 12.320  -12.602 0.517   1.00 0.00 ? 133 PHE A HE2  3  
ATOM 4759  H HZ   . PHE A 1 55  ? 11.399  -11.662 2.599   1.00 0.00 ? 133 PHE A HZ   3  
ATOM 4760  N N    . SER A 1 56  ? 6.885   -8.776  -4.058  1.00 0.00 ? 134 SER A N    3  
ATOM 4761  C CA   . SER A 1 56  ? 6.425   -7.806  -5.046  1.00 0.00 ? 134 SER A CA   3  
ATOM 4762  C C    . SER A 1 56  ? 5.430   -6.829  -4.426  1.00 0.00 ? 134 SER A C    3  
ATOM 4763  O O    . SER A 1 56  ? 5.764   -5.676  -4.154  1.00 0.00 ? 134 SER A O    3  
ATOM 4764  C CB   . SER A 1 56  ? 5.780   -8.523  -6.233  1.00 0.00 ? 134 SER A CB   3  
ATOM 4765  O OG   . SER A 1 56  ? 5.393   -7.601  -7.237  1.00 0.00 ? 134 SER A OG   3  
ATOM 4766  H H    . SER A 1 56  ? 6.391   -9.615  -3.946  1.00 0.00 ? 134 SER A H    3  
ATOM 4767  H HA   . SER A 1 56  ? 7.285   -7.254  -5.394  1.00 0.00 ? 134 SER A HA   3  
ATOM 4768  H HB2  . SER A 1 56  ? 6.486   -9.221  -6.656  1.00 0.00 ? 134 SER A HB2  3  
ATOM 4769  H HB3  . SER A 1 56  ? 4.904   -9.058  -5.895  1.00 0.00 ? 134 SER A HB3  3  
ATOM 4770  H HG   . SER A 1 56  ? 4.445   -7.456  -7.191  1.00 0.00 ? 134 SER A HG   3  
ATOM 4771  N N    . ALA A 1 57  ? 4.207   -7.300  -4.205  1.00 0.00 ? 135 ALA A N    3  
ATOM 4772  C CA   . ALA A 1 57  ? 3.164   -6.470  -3.616  1.00 0.00 ? 135 ALA A CA   3  
ATOM 4773  C C    . ALA A 1 57  ? 3.163   -6.588  -2.095  1.00 0.00 ? 135 ALA A C    3  
ATOM 4774  O O    . ALA A 1 57  ? 3.462   -7.648  -1.545  1.00 0.00 ? 135 ALA A O    3  
ATOM 4775  C CB   . ALA A 1 57  ? 1.804   -6.854  -4.178  1.00 0.00 ? 135 ALA A CB   3  
ATOM 4776  H H    . ALA A 1 57  ? 4.002   -8.228  -4.443  1.00 0.00 ? 135 ALA A H    3  
ATOM 4777  H HA   . ALA A 1 57  ? 3.362   -5.443  -3.887  1.00 0.00 ? 135 ALA A HA   3  
ATOM 4778  H HB1  . ALA A 1 57  ? 1.904   -7.098  -5.226  1.00 0.00 ? 135 ALA A HB1  3  
ATOM 4779  H HB2  . ALA A 1 57  ? 1.422   -7.711  -3.643  1.00 0.00 ? 135 ALA A HB2  3  
ATOM 4780  H HB3  . ALA A 1 57  ? 1.121   -6.025  -4.066  1.00 0.00 ? 135 ALA A HB3  3  
ATOM 4781  N N    . CYS A 1 58  ? 2.825   -5.493  -1.423  1.00 0.00 ? 136 CYS A N    3  
ATOM 4782  C CA   . CYS A 1 58  ? 2.786   -5.474  0.035   1.00 0.00 ? 136 CYS A CA   3  
ATOM 4783  C C    . CYS A 1 58  ? 1.410   -5.049  0.537   1.00 0.00 ? 136 CYS A C    3  
ATOM 4784  O O    . CYS A 1 58  ? 1.074   -3.865  0.532   1.00 0.00 ? 136 CYS A O    3  
ATOM 4785  C CB   . CYS A 1 58  ? 3.856   -4.527  0.582   1.00 0.00 ? 136 CYS A CB   3  
ATOM 4786  S SG   . CYS A 1 58  ? 3.686   -4.160  2.345   1.00 0.00 ? 136 CYS A SG   3  
ATOM 4787  H H    . CYS A 1 58  ? 2.597   -4.678  -1.917  1.00 0.00 ? 136 CYS A H    3  
ATOM 4788  H HA   . CYS A 1 58  ? 2.990   -6.474  0.385   1.00 0.00 ? 136 CYS A HA   3  
ATOM 4789  H HB2  . CYS A 1 58  ? 4.829   -4.970  0.432   1.00 0.00 ? 136 CYS A HB2  3  
ATOM 4790  H HB3  . CYS A 1 58  ? 3.807   -3.592  0.044   1.00 0.00 ? 136 CYS A HB3  3  
ATOM 4791  H HG   . CYS A 1 58  ? 4.777   -4.593  2.959   1.00 0.00 ? 136 CYS A HG   3  
ATOM 4792  N N    . ARG A 1 59  ? 0.616   -6.024  0.967   1.00 0.00 ? 137 ARG A N    3  
ATOM 4793  C CA   . ARG A 1 59  ? -0.725  -5.752  1.469   1.00 0.00 ? 137 ARG A CA   3  
ATOM 4794  C C    . ARG A 1 59  ? -0.694  -5.442  2.963   1.00 0.00 ? 137 ARG A C    3  
ATOM 4795  O O    . ARG A 1 59  ? 0.053   -6.060  3.720   1.00 0.00 ? 137 ARG A O    3  
ATOM 4796  C CB   . ARG A 1 59  ? -1.644  -6.947  1.204   1.00 0.00 ? 137 ARG A CB   3  
ATOM 4797  C CG   . ARG A 1 59  ? -2.352  -6.884  -0.139  1.00 0.00 ? 137 ARG A CG   3  
ATOM 4798  C CD   . ARG A 1 59  ? -1.438  -7.323  -1.272  1.00 0.00 ? 137 ARG A CD   3  
ATOM 4799  N NE   . ARG A 1 59  ? -2.042  -7.095  -2.582  1.00 0.00 ? 137 ARG A NE   3  
ATOM 4800  C CZ   . ARG A 1 59  ? -1.668  -7.735  -3.685  1.00 0.00 ? 137 ARG A CZ   3  
ATOM 4801  N NH1  . ARG A 1 59  ? -0.698  -8.637  -3.635  1.00 0.00 ? 137 ARG A NH1  3  
ATOM 4802  N NH2  . ARG A 1 59  ? -2.266  -7.473  -4.840  1.00 0.00 ? 137 ARG A NH2  3  
ATOM 4803  H H    . ARG A 1 59  ? 0.940   -6.949  0.946   1.00 0.00 ? 137 ARG A H    3  
ATOM 4804  H HA   . ARG A 1 59  ? -1.108  -4.891  0.943   1.00 0.00 ? 137 ARG A HA   3  
ATOM 4805  H HB2  . ARG A 1 59  ? -1.056  -7.852  1.234   1.00 0.00 ? 137 ARG A HB2  3  
ATOM 4806  H HB3  . ARG A 1 59  ? -2.393  -6.988  1.980   1.00 0.00 ? 137 ARG A HB3  3  
ATOM 4807  H HG2  . ARG A 1 59  ? -3.213  -7.536  -0.113  1.00 0.00 ? 137 ARG A HG2  3  
ATOM 4808  H HG3  . ARG A 1 59  ? -2.673  -5.869  -0.319  1.00 0.00 ? 137 ARG A HG3  3  
ATOM 4809  H HD2  . ARG A 1 59  ? -0.516  -6.764  -1.210  1.00 0.00 ? 137 ARG A HD2  3  
ATOM 4810  H HD3  . ARG A 1 59  ? -1.229  -8.376  -1.160  1.00 0.00 ? 137 ARG A HD3  3  
ATOM 4811  H HE   . ARG A 1 59  ? -2.761  -6.432  -2.641  1.00 0.00 ? 137 ARG A HE   3  
ATOM 4812  H HH11 . ARG A 1 59  ? -0.247  -8.837  -2.766  1.00 0.00 ? 137 ARG A HH11 3  
ATOM 4813  H HH12 . ARG A 1 59  ? -0.420  -9.119  -4.466  1.00 0.00 ? 137 ARG A HH12 3  
ATOM 4814  H HH21 . ARG A 1 59  ? -2.998  -6.793  -4.881  1.00 0.00 ? 137 ARG A HH21 3  
ATOM 4815  H HH22 . ARG A 1 59  ? -1.984  -7.955  -5.669  1.00 0.00 ? 137 ARG A HH22 3  
ATOM 4816  N N    . ALA A 1 60  ? -1.512  -4.481  3.380   1.00 0.00 ? 138 ALA A N    3  
ATOM 4817  C CA   . ALA A 1 60  ? -1.579  -4.090  4.782   1.00 0.00 ? 138 ALA A CA   3  
ATOM 4818  C C    . ALA A 1 60  ? -3.025  -4.010  5.261   1.00 0.00 ? 138 ALA A C    3  
ATOM 4819  O O    . ALA A 1 60  ? -3.852  -3.327  4.656   1.00 0.00 ? 138 ALA A O    3  
ATOM 4820  C CB   . ALA A 1 60  ? -0.877  -2.756  4.993   1.00 0.00 ? 138 ALA A CB   3  
ATOM 4821  H H    . ALA A 1 60  ? -2.084  -4.024  2.728   1.00 0.00 ? 138 ALA A H    3  
ATOM 4822  H HA   . ALA A 1 60  ? -1.059  -4.838  5.363   1.00 0.00 ? 138 ALA A HA   3  
ATOM 4823  H HB1  . ALA A 1 60  ? 0.036   -2.736  4.415   1.00 0.00 ? 138 ALA A HB1  3  
ATOM 4824  H HB2  . ALA A 1 60  ? -1.524  -1.954  4.671   1.00 0.00 ? 138 ALA A HB2  3  
ATOM 4825  H HB3  . ALA A 1 60  ? -0.643  -2.634  6.040   1.00 0.00 ? 138 ALA A HB3  3  
ATOM 4826  N N    . TYR A 1 61  ? -3.322  -4.711  6.349   1.00 0.00 ? 139 TYR A N    3  
ATOM 4827  C CA   . TYR A 1 61  ? -4.669  -4.721  6.907   1.00 0.00 ? 139 TYR A CA   3  
ATOM 4828  C C    . TYR A 1 61  ? -4.765  -3.796  8.117   1.00 0.00 ? 139 TYR A C    3  
ATOM 4829  O O    . TYR A 1 61  ? -3.928  -3.846  9.018   1.00 0.00 ? 139 TYR A O    3  
ATOM 4830  C CB   . TYR A 1 61  ? -5.067  -6.143  7.306   1.00 0.00 ? 139 TYR A CB   3  
ATOM 4831  C CG   . TYR A 1 61  ? -5.193  -7.088  6.132   1.00 0.00 ? 139 TYR A CG   3  
ATOM 4832  C CD1  . TYR A 1 61  ? -4.067  -7.538  5.453   1.00 0.00 ? 139 TYR A CD1  3  
ATOM 4833  C CD2  . TYR A 1 61  ? -6.438  -7.531  5.702   1.00 0.00 ? 139 TYR A CD2  3  
ATOM 4834  C CE1  . TYR A 1 61  ? -4.178  -8.401  4.380   1.00 0.00 ? 139 TYR A CE1  3  
ATOM 4835  C CE2  . TYR A 1 61  ? -6.558  -8.394  4.630   1.00 0.00 ? 139 TYR A CE2  3  
ATOM 4836  C CZ   . TYR A 1 61  ? -5.425  -8.827  3.973   1.00 0.00 ? 139 TYR A CZ   3  
ATOM 4837  O OH   . TYR A 1 61  ? -5.540  -9.686  2.904   1.00 0.00 ? 139 TYR A OH   3  
ATOM 4838  H H    . TYR A 1 61  ? -2.619  -5.235  6.787   1.00 0.00 ? 139 TYR A H    3  
ATOM 4839  H HA   . TYR A 1 61  ? -5.347  -4.369  6.144   1.00 0.00 ? 139 TYR A HA   3  
ATOM 4840  H HB2  . TYR A 1 61  ? -4.322  -6.545  7.975   1.00 0.00 ? 139 TYR A HB2  3  
ATOM 4841  H HB3  . TYR A 1 61  ? -6.021  -6.114  7.813   1.00 0.00 ? 139 TYR A HB3  3  
ATOM 4842  H HD1  . TYR A 1 61  ? -3.092  -7.203  5.775   1.00 0.00 ? 139 TYR A HD1  3  
ATOM 4843  H HD2  . TYR A 1 61  ? -7.323  -7.190  6.219   1.00 0.00 ? 139 TYR A HD2  3  
ATOM 4844  H HE1  . TYR A 1 61  ? -3.291  -8.740  3.865   1.00 0.00 ? 139 TYR A HE1  3  
ATOM 4845  H HE2  . TYR A 1 61  ? -7.534  -8.728  4.311   1.00 0.00 ? 139 TYR A HE2  3  
ATOM 4846  H HH   . TYR A 1 61  ? -6.138  -9.310  2.254   1.00 0.00 ? 139 TYR A HH   3  
ATOM 4847  N N    . TRP A 1 62  ? -5.791  -2.954  8.129   1.00 0.00 ? 140 TRP A N    3  
ATOM 4848  C CA   . TRP A 1 62  ? -5.999  -2.017  9.227   1.00 0.00 ? 140 TRP A CA   3  
ATOM 4849  C C    . TRP A 1 62  ? -7.397  -2.168  9.815   1.00 0.00 ? 140 TRP A C    3  
ATOM 4850  O O    . TRP A 1 62  ? -8.346  -2.508  9.107   1.00 0.00 ? 140 TRP A O    3  
ATOM 4851  C CB   . TRP A 1 62  ? -5.786  -0.581  8.747   1.00 0.00 ? 140 TRP A CB   3  
ATOM 4852  C CG   . TRP A 1 62  ? -6.674  -0.200  7.601   1.00 0.00 ? 140 TRP A CG   3  
ATOM 4853  C CD1  . TRP A 1 62  ? -6.501  -0.526  6.286   1.00 0.00 ? 140 TRP A CD1  3  
ATOM 4854  C CD2  . TRP A 1 62  ? -7.873  0.580   7.668   1.00 0.00 ? 140 TRP A CD2  3  
ATOM 4855  N NE1  . TRP A 1 62  ? -7.520  0.004   5.532   1.00 0.00 ? 140 TRP A NE1  3  
ATOM 4856  C CE2  . TRP A 1 62  ? -8.375  0.686   6.356   1.00 0.00 ? 140 TRP A CE2  3  
ATOM 4857  C CE3  . TRP A 1 62  ? -8.573  1.196   8.709   1.00 0.00 ? 140 TRP A CE3  3  
ATOM 4858  C CZ2  . TRP A 1 62  ? -9.542  1.385   6.061   1.00 0.00 ? 140 TRP A CZ2  3  
ATOM 4859  C CZ3  . TRP A 1 62  ? -9.731  1.890   8.414   1.00 0.00 ? 140 TRP A CZ3  3  
ATOM 4860  C CH2  . TRP A 1 62  ? -10.207 1.980   7.099   1.00 0.00 ? 140 TRP A CH2  3  
ATOM 4861  H H    . TRP A 1 62  ? -6.426  -2.962  7.381   1.00 0.00 ? 140 TRP A H    3  
ATOM 4862  H HA   . TRP A 1 62  ? -5.272  -2.242  9.994   1.00 0.00 ? 140 TRP A HA   3  
ATOM 4863  H HB2  . TRP A 1 62  ? -5.985  0.098   9.562   1.00 0.00 ? 140 TRP A HB2  3  
ATOM 4864  H HB3  . TRP A 1 62  ? -4.761  -0.464  8.428   1.00 0.00 ? 140 TRP A HB3  3  
ATOM 4865  H HD1  . TRP A 1 62  ? -5.678  -1.113  5.909   1.00 0.00 ? 140 TRP A HD1  3  
ATOM 4866  H HE1  . TRP A 1 62  ? -7.618  -0.092  4.561   1.00 0.00 ? 140 TRP A HE1  3  
ATOM 4867  H HE3  . TRP A 1 62  ? -8.222  1.139   9.729   1.00 0.00 ? 140 TRP A HE3  3  
ATOM 4868  H HZ2  . TRP A 1 62  ? -9.922  1.463   5.052   1.00 0.00 ? 140 TRP A HZ2  3  
ATOM 4869  H HZ3  . TRP A 1 62  ? -10.285 2.374   9.205   1.00 0.00 ? 140 TRP A HZ3  3  
ATOM 4870  H HH2  . TRP A 1 62  ? -11.115 2.532   6.915   1.00 0.00 ? 140 TRP A HH2  3  
ATOM 4871  N N    . LYS A 1 63  ? -7.520  -1.913  11.113  1.00 0.00 ? 141 LYS A N    3  
ATOM 4872  C CA   . LYS A 1 63  ? -8.803  -2.019  11.797  1.00 0.00 ? 141 LYS A CA   3  
ATOM 4873  C C    . LYS A 1 63  ? -9.850  -1.133  11.129  1.00 0.00 ? 141 LYS A C    3  
ATOM 4874  O O    . LYS A 1 63  ? -9.665  0.079   11.005  1.00 0.00 ? 141 LYS A O    3  
ATOM 4875  C CB   . LYS A 1 63  ? -8.654  -1.630  13.269  1.00 0.00 ? 141 LYS A CB   3  
ATOM 4876  C CG   . LYS A 1 63  ? -7.932  -2.674  14.104  1.00 0.00 ? 141 LYS A CG   3  
ATOM 4877  C CD   . LYS A 1 63  ? -8.406  -2.659  15.547  1.00 0.00 ? 141 LYS A CD   3  
ATOM 4878  C CE   . LYS A 1 63  ? -7.888  -3.864  16.317  1.00 0.00 ? 141 LYS A CE   3  
ATOM 4879  N NZ   . LYS A 1 63  ? -8.816  -5.025  16.222  1.00 0.00 ? 141 LYS A NZ   3  
ATOM 4880  H H    . LYS A 1 63  ? -6.727  -1.646  11.624  1.00 0.00 ? 141 LYS A H    3  
ATOM 4881  H HA   . LYS A 1 63  ? -9.128  -3.047  11.736  1.00 0.00 ? 141 LYS A HA   3  
ATOM 4882  H HB2  . LYS A 1 63  ? -8.101  -0.705  13.330  1.00 0.00 ? 141 LYS A HB2  3  
ATOM 4883  H HB3  . LYS A 1 63  ? -9.638  -1.480  13.691  1.00 0.00 ? 141 LYS A HB3  3  
ATOM 4884  H HG2  . LYS A 1 63  ? -8.121  -3.651  13.684  1.00 0.00 ? 141 LYS A HG2  3  
ATOM 4885  H HG3  . LYS A 1 63  ? -6.871  -2.469  14.080  1.00 0.00 ? 141 LYS A HG3  3  
ATOM 4886  H HD2  . LYS A 1 63  ? -8.048  -1.760  16.026  1.00 0.00 ? 141 LYS A HD2  3  
ATOM 4887  H HD3  . LYS A 1 63  ? -9.487  -2.671  15.562  1.00 0.00 ? 141 LYS A HD3  3  
ATOM 4888  H HE2  . LYS A 1 63  ? -6.928  -4.148  15.912  1.00 0.00 ? 141 LYS A HE2  3  
ATOM 4889  H HE3  . LYS A 1 63  ? -7.773  -3.590  17.355  1.00 0.00 ? 141 LYS A HE3  3  
ATOM 4890  H HZ1  . LYS A 1 63  ? -9.070  -5.198  15.228  1.00 0.00 ? 141 LYS A HZ1  3  
ATOM 4891  H HZ2  . LYS A 1 63  ? -9.685  -4.832  16.760  1.00 0.00 ? 141 LYS A HZ2  3  
ATOM 4892  H HZ3  . LYS A 1 63  ? -8.364  -5.878  16.607  1.00 0.00 ? 141 LYS A HZ3  3  
ATOM 4893  N N    . THR A 1 64  ? -10.951 -1.743  10.702  1.00 0.00 ? 142 THR A N    3  
ATOM 4894  C CA   . THR A 1 64  ? -12.027 -1.009  10.048  1.00 0.00 ? 142 THR A CA   3  
ATOM 4895  C C    . THR A 1 64  ? -13.349 -1.201  10.782  1.00 0.00 ? 142 THR A C    3  
ATOM 4896  O O    . THR A 1 64  ? -13.443 -1.998  11.716  1.00 0.00 ? 142 THR A O    3  
ATOM 4897  C CB   . THR A 1 64  ? -12.198 -1.452  8.582   1.00 0.00 ? 142 THR A CB   3  
ATOM 4898  O OG1  . THR A 1 64  ? -12.608 -2.823  8.529   1.00 0.00 ? 142 THR A OG1  3  
ATOM 4899  C CG2  . THR A 1 64  ? -10.901 -1.274  7.808   1.00 0.00 ? 142 THR A CG2  3  
ATOM 4900  H H    . THR A 1 64  ? -11.040 -2.711  10.829  1.00 0.00 ? 142 THR A H    3  
ATOM 4901  H HA   . THR A 1 64  ? -11.769 0.040   10.057  1.00 0.00 ? 142 THR A HA   3  
ATOM 4902  H HB   . THR A 1 64  ? -12.961 -0.838  8.124   1.00 0.00 ? 142 THR A HB   3  
ATOM 4903  H HG1  . THR A 1 64  ? -12.055 -3.345  9.115   1.00 0.00 ? 142 THR A HG1  3  
ATOM 4904  H HG21 . THR A 1 64  ? -10.227 -2.085  8.043   1.00 0.00 ? 142 THR A HG21 3  
ATOM 4905  H HG22 . THR A 1 64  ? -10.444 -0.335  8.082   1.00 0.00 ? 142 THR A HG22 3  
ATOM 4906  H HG23 . THR A 1 64  ? -11.111 -1.277  6.749   1.00 0.00 ? 142 THR A HG23 3  
ATOM 4907  N N    . THR A 1 65  ? -14.370 -0.465  10.355  1.00 0.00 ? 143 THR A N    3  
ATOM 4908  C CA   . THR A 1 65  ? -15.687 -0.553  10.973  1.00 0.00 ? 143 THR A CA   3  
ATOM 4909  C C    . THR A 1 65  ? -16.611 -1.462  10.170  1.00 0.00 ? 143 THR A C    3  
ATOM 4910  O O    . THR A 1 65  ? -16.244 -1.948  9.099   1.00 0.00 ? 143 THR A O    3  
ATOM 4911  C CB   . THR A 1 65  ? -16.340 0.836   11.106  1.00 0.00 ? 143 THR A CB   3  
ATOM 4912  O OG1  . THR A 1 65  ? -16.560 1.400   9.808   1.00 0.00 ? 143 THR A OG1  3  
ATOM 4913  C CG2  . THR A 1 65  ? -15.463 1.769   11.928  1.00 0.00 ? 143 THR A CG2  3  
ATOM 4914  H H    . THR A 1 65  ? -14.232 0.153   9.607   1.00 0.00 ? 143 THR A H    3  
ATOM 4915  H HA   . THR A 1 65  ? -15.564 -0.966  11.963  1.00 0.00 ? 143 THR A HA   3  
ATOM 4916  H HB   . THR A 1 65  ? -17.290 0.723   11.607  1.00 0.00 ? 143 THR A HB   3  
ATOM 4917  H HG1  . THR A 1 65  ? -16.157 2.270   9.764   1.00 0.00 ? 143 THR A HG1  3  
ATOM 4918  H HG21 . THR A 1 65  ? -15.764 2.792   11.753  1.00 0.00 ? 143 THR A HG21 3  
ATOM 4919  H HG22 . THR A 1 65  ? -14.431 1.642   11.637  1.00 0.00 ? 143 THR A HG22 3  
ATOM 4920  H HG23 . THR A 1 65  ? -15.574 1.535   12.976  1.00 0.00 ? 143 THR A HG23 3  
ATOM 4921  N N    . LEU A 1 66  ? -17.812 -1.686  10.691  1.00 0.00 ? 144 LEU A N    3  
ATOM 4922  C CA   . LEU A 1 66  ? -18.790 -2.536  10.022  1.00 0.00 ? 144 LEU A CA   3  
ATOM 4923  C C    . LEU A 1 66  ? -19.637 -1.727  9.045   1.00 0.00 ? 144 LEU A C    3  
ATOM 4924  O O    . LEU A 1 66  ? -20.829 -1.985  8.880   1.00 0.00 ? 144 LEU A O    3  
ATOM 4925  C CB   . LEU A 1 66  ? -19.692 -3.218  11.052  1.00 0.00 ? 144 LEU A CB   3  
ATOM 4926  C CG   . LEU A 1 66  ? -20.263 -4.578  10.648  1.00 0.00 ? 144 LEU A CG   3  
ATOM 4927  C CD1  . LEU A 1 66  ? -20.479 -5.452  11.874  1.00 0.00 ? 144 LEU A CD1  3  
ATOM 4928  C CD2  . LEU A 1 66  ? -21.565 -4.403  9.880   1.00 0.00 ? 144 LEU A CD2  3  
ATOM 4929  H H    . LEU A 1 66  ? -18.047 -1.271  11.547  1.00 0.00 ? 144 LEU A H    3  
ATOM 4930  H HA   . LEU A 1 66  ? -18.250 -3.292  9.471   1.00 0.00 ? 144 LEU A HA   3  
ATOM 4931  H HB2  . LEU A 1 66  ? -19.117 -3.356  11.955  1.00 0.00 ? 144 LEU A HB2  3  
ATOM 4932  H HB3  . LEU A 1 66  ? -20.522 -2.556  11.253  1.00 0.00 ? 144 LEU A HB3  3  
ATOM 4933  H HG   . LEU A 1 66  ? -19.557 -5.080  10.001  1.00 0.00 ? 144 LEU A HG   3  
ATOM 4934  H HD11 . LEU A 1 66  ? -19.876 -5.083  12.690  1.00 0.00 ? 144 LEU A HD11 3  
ATOM 4935  H HD12 . LEU A 1 66  ? -20.194 -6.468  11.647  1.00 0.00 ? 144 LEU A HD12 3  
ATOM 4936  H HD13 . LEU A 1 66  ? -21.522 -5.425  12.156  1.00 0.00 ? 144 LEU A HD13 3  
ATOM 4937  H HD21 . LEU A 1 66  ? -22.124 -3.581  10.302  1.00 0.00 ? 144 LEU A HD21 3  
ATOM 4938  H HD22 . LEU A 1 66  ? -22.149 -5.309  9.950   1.00 0.00 ? 144 LEU A HD22 3  
ATOM 4939  H HD23 . LEU A 1 66  ? -21.346 -4.195  8.843   1.00 0.00 ? 144 LEU A HD23 3  
ATOM 4940  N N    . SER A 1 67  ? -19.011 -0.749  8.397   1.00 0.00 ? 145 SER A N    3  
ATOM 4941  C CA   . SER A 1 67  ? -19.708 0.099   7.437   1.00 0.00 ? 145 SER A CA   3  
ATOM 4942  C C    . SER A 1 67  ? -18.855 0.323   6.192   1.00 0.00 ? 145 SER A C    3  
ATOM 4943  O O    . SER A 1 67  ? -17.674 0.655   6.286   1.00 0.00 ? 145 SER A O    3  
ATOM 4944  C CB   . SER A 1 67  ? -20.062 1.444   8.075   1.00 0.00 ? 145 SER A CB   3  
ATOM 4945  O OG   . SER A 1 67  ? -21.198 1.327   8.913   1.00 0.00 ? 145 SER A OG   3  
ATOM 4946  H H    . SER A 1 67  ? -18.059 -0.593  8.572   1.00 0.00 ? 145 SER A H    3  
ATOM 4947  H HA   . SER A 1 67  ? -20.619 -0.404  7.149   1.00 0.00 ? 145 SER A HA   3  
ATOM 4948  H HB2  . SER A 1 67  ? -19.227 1.790   8.666   1.00 0.00 ? 145 SER A HB2  3  
ATOM 4949  H HB3  . SER A 1 67  ? -20.274 2.163   7.297   1.00 0.00 ? 145 SER A HB3  3  
ATOM 4950  H HG   . SER A 1 67  ? -20.930 1.415   9.831   1.00 0.00 ? 145 SER A HG   3  
ATOM 4951  N N    . ALA A 1 68  ? -19.464 0.139   5.025   1.00 0.00 ? 146 ALA A N    3  
ATOM 4952  C CA   . ALA A 1 68  ? -18.762 0.322   3.760   1.00 0.00 ? 146 ALA A CA   3  
ATOM 4953  C C    . ALA A 1 68  ? -18.447 1.794   3.516   1.00 0.00 ? 146 ALA A C    3  
ATOM 4954  O O    . ALA A 1 68  ? -17.354 2.137   3.065   1.00 0.00 ? 146 ALA A O    3  
ATOM 4955  C CB   . ALA A 1 68  ? -19.588 -0.240  2.612   1.00 0.00 ? 146 ALA A CB   3  
ATOM 4956  H H    . ALA A 1 68  ? -20.407 -0.125  5.014   1.00 0.00 ? 146 ALA A H    3  
ATOM 4957  H HA   . ALA A 1 68  ? -17.835 -0.231  3.809   1.00 0.00 ? 146 ALA A HA   3  
ATOM 4958  H HB1  . ALA A 1 68  ? -18.934 -0.731  1.907   1.00 0.00 ? 146 ALA A HB1  3  
ATOM 4959  H HB2  . ALA A 1 68  ? -20.302 -0.952  2.998   1.00 0.00 ? 146 ALA A HB2  3  
ATOM 4960  H HB3  . ALA A 1 68  ? -20.112 0.564   2.118   1.00 0.00 ? 146 ALA A HB3  3  
ATOM 4961  N N    . GLU A 1 69  ? -19.411 2.659   3.816   1.00 0.00 ? 147 GLU A N    3  
ATOM 4962  C CA   . GLU A 1 69  ? -19.234 4.094   3.627   1.00 0.00 ? 147 GLU A CA   3  
ATOM 4963  C C    . GLU A 1 69  ? -18.077 4.617   4.473   1.00 0.00 ? 147 GLU A C    3  
ATOM 4964  O O    . GLU A 1 69  ? -17.242 5.384   3.995   1.00 0.00 ? 147 GLU A O    3  
ATOM 4965  C CB   . GLU A 1 69  ? -20.521 4.840   3.986   1.00 0.00 ? 147 GLU A CB   3  
ATOM 4966  C CG   . GLU A 1 69  ? -21.721 4.420   3.153   1.00 0.00 ? 147 GLU A CG   3  
ATOM 4967  C CD   . GLU A 1 69  ? -21.616 4.873   1.710   1.00 0.00 ? 147 GLU A CD   3  
ATOM 4968  O OE1  . GLU A 1 69  ? -21.943 6.045   1.430   1.00 0.00 ? 147 GLU A OE1  3  
ATOM 4969  O OE2  . GLU A 1 69  ? -21.207 4.054   0.860   1.00 0.00 ? 147 GLU A OE2  3  
ATOM 4970  H H    . GLU A 1 69  ? -20.260 2.324   4.172   1.00 0.00 ? 147 GLU A H    3  
ATOM 4971  H HA   . GLU A 1 69  ? -19.008 4.266   2.585   1.00 0.00 ? 147 GLU A HA   3  
ATOM 4972  H HB2  . GLU A 1 69  ? -20.749 4.660   5.026   1.00 0.00 ? 147 GLU A HB2  3  
ATOM 4973  H HB3  . GLU A 1 69  ? -20.361 5.899   3.840   1.00 0.00 ? 147 GLU A HB3  3  
ATOM 4974  H HG2  . GLU A 1 69  ? -21.797 3.344   3.172   1.00 0.00 ? 147 GLU A HG2  3  
ATOM 4975  H HG3  . GLU A 1 69  ? -22.612 4.851   3.586   1.00 0.00 ? 147 GLU A HG3  3  
ATOM 4976  N N    . GLN A 1 70  ? -18.036 4.195   5.733   1.00 0.00 ? 148 GLN A N    3  
ATOM 4977  C CA   . GLN A 1 70  ? -16.983 4.621   6.647   1.00 0.00 ? 148 GLN A CA   3  
ATOM 4978  C C    . GLN A 1 70  ? -15.632 4.054   6.223   1.00 0.00 ? 148 GLN A C    3  
ATOM 4979  O O    . GLN A 1 70  ? -14.613 4.740   6.285   1.00 0.00 ? 148 GLN A O    3  
ATOM 4980  C CB   . GLN A 1 70  ? -17.309 4.181   8.075   1.00 0.00 ? 148 GLN A CB   3  
ATOM 4981  C CG   . GLN A 1 70  ? -16.576 4.981   9.140   1.00 0.00 ? 148 GLN A CG   3  
ATOM 4982  C CD   . GLN A 1 70  ? -15.109 5.180   8.814   1.00 0.00 ? 148 GLN A CD   3  
ATOM 4983  O OE1  . GLN A 1 70  ? -14.629 6.311   8.726   1.00 0.00 ? 148 GLN A OE1  3  
ATOM 4984  N NE2  . GLN A 1 70  ? -14.388 4.080   8.634   1.00 0.00 ? 148 GLN A NE2  3  
ATOM 4985  H H    . GLN A 1 70  ? -18.730 3.584   6.056   1.00 0.00 ? 148 GLN A H    3  
ATOM 4986  H HA   . GLN A 1 70  ? -16.932 5.699   6.615   1.00 0.00 ? 148 GLN A HA   3  
ATOM 4987  H HB2  . GLN A 1 70  ? -18.370 4.291   8.240   1.00 0.00 ? 148 GLN A HB2  3  
ATOM 4988  H HB3  . GLN A 1 70  ? -17.040 3.141   8.189   1.00 0.00 ? 148 GLN A HB3  3  
ATOM 4989  H HG2  . GLN A 1 70  ? -17.043 5.950   9.230   1.00 0.00 ? 148 GLN A HG2  3  
ATOM 4990  H HG3  . GLN A 1 70  ? -16.653 4.457   10.082  1.00 0.00 ? 148 GLN A HG3  3  
ATOM 4991  H HE21 . GLN A 1 70  ? -14.838 3.213   8.718   1.00 0.00 ? 148 GLN A HE21 3  
ATOM 4992  H HE22 . GLN A 1 70  ? -13.437 4.179   8.421   1.00 0.00 ? 148 GLN A HE22 3  
ATOM 4993  N N    . ASN A 1 71  ? -15.633 2.796   5.793   1.00 0.00 ? 149 ASN A N    3  
ATOM 4994  C CA   . ASN A 1 71  ? -14.407 2.136   5.359   1.00 0.00 ? 149 ASN A CA   3  
ATOM 4995  C C    . ASN A 1 71  ? -13.870 2.770   4.080   1.00 0.00 ? 149 ASN A C    3  
ATOM 4996  O O    . ASN A 1 71  ? -12.661 2.928   3.912   1.00 0.00 ? 149 ASN A O    3  
ATOM 4997  C CB   . ASN A 1 71  ? -14.658 0.644   5.135   1.00 0.00 ? 149 ASN A CB   3  
ATOM 4998  C CG   . ASN A 1 71  ? -15.061 -0.072  6.410   1.00 0.00 ? 149 ASN A CG   3  
ATOM 4999  O OD1  . ASN A 1 71  ? -14.776 0.393   7.513   1.00 0.00 ? 149 ASN A OD1  3  
ATOM 5000  N ND2  . ASN A 1 71  ? -15.729 -1.211  6.263   1.00 0.00 ? 149 ASN A ND2  3  
ATOM 5001  H H    . ASN A 1 71  ? -16.477 2.300   5.766   1.00 0.00 ? 149 ASN A H    3  
ATOM 5002  H HA   . ASN A 1 71  ? -13.672 2.255   6.142   1.00 0.00 ? 149 ASN A HA   3  
ATOM 5003  H HB2  . ASN A 1 71  ? -15.451 0.523   4.412   1.00 0.00 ? 149 ASN A HB2  3  
ATOM 5004  H HB3  . ASN A 1 71  ? -13.757 0.185   4.756   1.00 0.00 ? 149 ASN A HB3  3  
ATOM 5005  H HD21 . ASN A 1 71  ? -15.922 -1.521  5.353   1.00 0.00 ? 149 ASN A HD21 3  
ATOM 5006  H HD22 . ASN A 1 71  ? -16.003 -1.694  7.070   1.00 0.00 ? 149 ASN A HD22 3  
ATOM 5007  N N    . ALA A 1 72  ? -14.779 3.133   3.180   1.00 0.00 ? 150 ALA A N    3  
ATOM 5008  C CA   . ALA A 1 72  ? -14.397 3.753   1.917   1.00 0.00 ? 150 ALA A CA   3  
ATOM 5009  C C    . ALA A 1 72  ? -13.708 5.093   2.149   1.00 0.00 ? 150 ALA A C    3  
ATOM 5010  O O    . ALA A 1 72  ? -12.665 5.377   1.558   1.00 0.00 ? 150 ALA A O    3  
ATOM 5011  C CB   . ALA A 1 72  ? -15.619 3.933   1.027   1.00 0.00 ? 150 ALA A CB   3  
ATOM 5012  H H    . ALA A 1 72  ? -15.728 2.982   3.371   1.00 0.00 ? 150 ALA A H    3  
ATOM 5013  H HA   . ALA A 1 72  ? -13.710 3.088   1.413   1.00 0.00 ? 150 ALA A HA   3  
ATOM 5014  H HB1  . ALA A 1 72  ? -16.514 3.853   1.627   1.00 0.00 ? 150 ALA A HB1  3  
ATOM 5015  H HB2  . ALA A 1 72  ? -15.584 4.905   0.560   1.00 0.00 ? 150 ALA A HB2  3  
ATOM 5016  H HB3  . ALA A 1 72  ? -15.625 3.167   0.266   1.00 0.00 ? 150 ALA A HB3  3  
ATOM 5017  N N    . HIS A 1 73  ? -14.297 5.915   3.012   1.00 0.00 ? 151 HIS A N    3  
ATOM 5018  C CA   . HIS A 1 73  ? -13.739 7.227   3.321   1.00 0.00 ? 151 HIS A CA   3  
ATOM 5019  C C    . HIS A 1 73  ? -12.343 7.094   3.923   1.00 0.00 ? 151 HIS A C    3  
ATOM 5020  O O    . HIS A 1 73  ? -11.402 7.756   3.485   1.00 0.00 ? 151 HIS A O    3  
ATOM 5021  C CB   . HIS A 1 73  ? -14.654 7.979   4.288   1.00 0.00 ? 151 HIS A CB   3  
ATOM 5022  C CG   . HIS A 1 73  ? -14.083 9.279   4.764   1.00 0.00 ? 151 HIS A CG   3  
ATOM 5023  N ND1  . HIS A 1 73  ? -14.780 10.468  4.721   1.00 0.00 ? 151 HIS A ND1  3  
ATOM 5024  C CD2  . HIS A 1 73  ? -12.874 9.572   5.297   1.00 0.00 ? 151 HIS A CD2  3  
ATOM 5025  C CE1  . HIS A 1 73  ? -14.024 11.437  5.206   1.00 0.00 ? 151 HIS A CE1  3  
ATOM 5026  N NE2  . HIS A 1 73  ? -12.863 10.920  5.563   1.00 0.00 ? 151 HIS A NE2  3  
ATOM 5027  H H    . HIS A 1 73  ? -15.126 5.633   3.450   1.00 0.00 ? 151 HIS A H    3  
ATOM 5028  H HA   . HIS A 1 73  ? -13.668 7.783   2.399   1.00 0.00 ? 151 HIS A HA   3  
ATOM 5029  H HB2  . HIS A 1 73  ? -15.591 8.190   3.795   1.00 0.00 ? 151 HIS A HB2  3  
ATOM 5030  H HB3  . HIS A 1 73  ? -14.839 7.360   5.154   1.00 0.00 ? 151 HIS A HB3  3  
ATOM 5031  H HD2  . HIS A 1 73  ? -12.067 8.877   5.480   1.00 0.00 ? 151 HIS A HD2  3  
ATOM 5032  H HE1  . HIS A 1 73  ? -14.308 12.475  5.296   1.00 0.00 ? 151 HIS A HE1  3  
ATOM 5033  H HE2  . HIS A 1 73  ? -12.088 11.433  5.873   1.00 0.00 ? 151 HIS A HE2  3  
ATOM 5034  N N    . MET A 1 74  ? -12.216 6.236   4.930   1.00 0.00 ? 152 MET A N    3  
ATOM 5035  C CA   . MET A 1 74  ? -10.935 6.017   5.591   1.00 0.00 ? 152 MET A CA   3  
ATOM 5036  C C    . MET A 1 74  ? -9.916  5.429   4.620   1.00 0.00 ? 152 MET A C    3  
ATOM 5037  O O    . MET A 1 74  ? -8.764  5.859   4.580   1.00 0.00 ? 152 MET A O    3  
ATOM 5038  C CB   . MET A 1 74  ? -11.109 5.086   6.792   1.00 0.00 ? 152 MET A CB   3  
ATOM 5039  C CG   . MET A 1 74  ? -11.524 5.808   8.064   1.00 0.00 ? 152 MET A CG   3  
ATOM 5040  S SD   . MET A 1 74  ? -11.288 4.801   9.542   1.00 0.00 ? 152 MET A SD   3  
ATOM 5041  C CE   . MET A 1 74  ? -9.506  4.865   9.713   1.00 0.00 ? 152 MET A CE   3  
ATOM 5042  H H    . MET A 1 74  ? -13.003 5.737   5.235   1.00 0.00 ? 152 MET A H    3  
ATOM 5043  H HA   . MET A 1 74  ? -10.574 6.974   5.937   1.00 0.00 ? 152 MET A HA   3  
ATOM 5044  H HB2  . MET A 1 74  ? -11.865 4.352   6.557   1.00 0.00 ? 152 MET A HB2  3  
ATOM 5045  H HB3  . MET A 1 74  ? -10.173 4.581   6.980   1.00 0.00 ? 152 MET A HB3  3  
ATOM 5046  H HG2  . MET A 1 74  ? -10.935 6.707   8.161   1.00 0.00 ? 152 MET A HG2  3  
ATOM 5047  H HG3  . MET A 1 74  ? -12.569 6.071   7.988   1.00 0.00 ? 152 MET A HG3  3  
ATOM 5048  H HE1  . MET A 1 74  ? -9.049  4.245   8.956   1.00 0.00 ? 152 MET A HE1  3  
ATOM 5049  H HE2  . MET A 1 74  ? -9.169  5.884   9.596   1.00 0.00 ? 152 MET A HE2  3  
ATOM 5050  H HE3  . MET A 1 74  ? -9.226  4.503   10.692  1.00 0.00 ? 152 MET A HE3  3  
ATOM 5051  N N    . GLU A 1 75  ? -10.349 4.443   3.840   1.00 0.00 ? 153 GLU A N    3  
ATOM 5052  C CA   . GLU A 1 75  ? -9.472  3.796   2.871   1.00 0.00 ? 153 GLU A CA   3  
ATOM 5053  C C    . GLU A 1 75  ? -8.995  4.792   1.819   1.00 0.00 ? 153 GLU A C    3  
ATOM 5054  O O    . GLU A 1 75  ? -7.844  4.749   1.385   1.00 0.00 ? 153 GLU A O    3  
ATOM 5055  C CB   . GLU A 1 75  ? -10.197 2.630   2.194   1.00 0.00 ? 153 GLU A CB   3  
ATOM 5056  C CG   . GLU A 1 75  ? -9.422  2.022   1.037   1.00 0.00 ? 153 GLU A CG   3  
ATOM 5057  C CD   . GLU A 1 75  ? -10.328 1.394   -0.005  1.00 0.00 ? 153 GLU A CD   3  
ATOM 5058  O OE1  . GLU A 1 75  ? -11.361 2.009   -0.341  1.00 0.00 ? 153 GLU A OE1  3  
ATOM 5059  O OE2  . GLU A 1 75  ? -10.003 0.287   -0.484  1.00 0.00 ? 153 GLU A OE2  3  
ATOM 5060  H H    . GLU A 1 75  ? -11.279 4.144   3.919   1.00 0.00 ? 153 GLU A H    3  
ATOM 5061  H HA   . GLU A 1 75  ? -8.614  3.414   3.403   1.00 0.00 ? 153 GLU A HA   3  
ATOM 5062  H HB2  . GLU A 1 75  ? -10.374 1.857   2.927   1.00 0.00 ? 153 GLU A HB2  3  
ATOM 5063  H HB3  . GLU A 1 75  ? -11.146 2.982   1.819   1.00 0.00 ? 153 GLU A HB3  3  
ATOM 5064  H HG2  . GLU A 1 75  ? -8.839  2.798   0.563   1.00 0.00 ? 153 GLU A HG2  3  
ATOM 5065  H HG3  . GLU A 1 75  ? -8.760  1.261   1.423   1.00 0.00 ? 153 GLU A HG3  3  
ATOM 5066  N N    . ALA A 1 76  ? -9.888  5.688   1.413   1.00 0.00 ? 154 ALA A N    3  
ATOM 5067  C CA   . ALA A 1 76  ? -9.558  6.697   0.413   1.00 0.00 ? 154 ALA A CA   3  
ATOM 5068  C C    . ALA A 1 76  ? -8.512  7.672   0.941   1.00 0.00 ? 154 ALA A C    3  
ATOM 5069  O O    . ALA A 1 76  ? -7.554  8.008   0.244   1.00 0.00 ? 154 ALA A O    3  
ATOM 5070  C CB   . ALA A 1 76  ? -10.812 7.445   -0.016  1.00 0.00 ? 154 ALA A CB   3  
ATOM 5071  H H    . ALA A 1 76  ? -10.790 5.672   1.796   1.00 0.00 ? 154 ALA A H    3  
ATOM 5072  H HA   . ALA A 1 76  ? -9.158  6.189   -0.453  1.00 0.00 ? 154 ALA A HA   3  
ATOM 5073  H HB1  . ALA A 1 76  ? -11.593 6.735   -0.246  1.00 0.00 ? 154 ALA A HB1  3  
ATOM 5074  H HB2  . ALA A 1 76  ? -11.137 8.090   0.786   1.00 0.00 ? 154 ALA A HB2  3  
ATOM 5075  H HB3  . ALA A 1 76  ? -10.595 8.039   -0.891  1.00 0.00 ? 154 ALA A HB3  3  
ATOM 5076  N N    . VAL A 1 77  ? -8.702  8.125   2.176   1.00 0.00 ? 155 VAL A N    3  
ATOM 5077  C CA   . VAL A 1 77  ? -7.774  9.062   2.798   1.00 0.00 ? 155 VAL A CA   3  
ATOM 5078  C C    . VAL A 1 77  ? -6.456  8.381   3.146   1.00 0.00 ? 155 VAL A C    3  
ATOM 5079  O O    . VAL A 1 77  ? -5.381  8.952   2.959   1.00 0.00 ? 155 VAL A O    3  
ATOM 5080  C CB   . VAL A 1 77  ? -8.373  9.680   4.076   1.00 0.00 ? 155 VAL A CB   3  
ATOM 5081  C CG1  . VAL A 1 77  ? -8.793  8.590   5.050   1.00 0.00 ? 155 VAL A CG1  3  
ATOM 5082  C CG2  . VAL A 1 77  ? -7.378  10.632  4.723   1.00 0.00 ? 155 VAL A CG2  3  
ATOM 5083  H H    . VAL A 1 77  ? -9.484  7.820   2.682   1.00 0.00 ? 155 VAL A H    3  
ATOM 5084  H HA   . VAL A 1 77  ? -7.582  9.858   2.094   1.00 0.00 ? 155 VAL A HA   3  
ATOM 5085  H HB   . VAL A 1 77  ? -9.252  10.244  3.800   1.00 0.00 ? 155 VAL A HB   3  
ATOM 5086  H HG11 . VAL A 1 77  ? -9.496  7.928   4.567   1.00 0.00 ? 155 VAL A HG11 3  
ATOM 5087  H HG12 . VAL A 1 77  ? -7.923  8.030   5.361   1.00 0.00 ? 155 VAL A HG12 3  
ATOM 5088  H HG13 . VAL A 1 77  ? -9.259  9.041   5.914   1.00 0.00 ? 155 VAL A HG13 3  
ATOM 5089  H HG21 . VAL A 1 77  ? -7.855  11.146  5.544   1.00 0.00 ? 155 VAL A HG21 3  
ATOM 5090  H HG22 . VAL A 1 77  ? -6.532  10.071  5.093   1.00 0.00 ? 155 VAL A HG22 3  
ATOM 5091  H HG23 . VAL A 1 77  ? -7.042  11.353  3.993   1.00 0.00 ? 155 VAL A HG23 3  
ATOM 5092  N N    . LEU A 1 78  ? -6.545  7.156   3.654   1.00 0.00 ? 156 LEU A N    3  
ATOM 5093  C CA   . LEU A 1 78  ? -5.358  6.395   4.028   1.00 0.00 ? 156 LEU A CA   3  
ATOM 5094  C C    . LEU A 1 78  ? -4.553  6.000   2.795   1.00 0.00 ? 156 LEU A C    3  
ATOM 5095  O O    . LEU A 1 78  ? -3.331  6.145   2.768   1.00 0.00 ? 156 LEU A O    3  
ATOM 5096  C CB   . LEU A 1 78  ? -5.757  5.144   4.813   1.00 0.00 ? 156 LEU A CB   3  
ATOM 5097  C CG   . LEU A 1 78  ? -4.628  4.165   5.134   1.00 0.00 ? 156 LEU A CG   3  
ATOM 5098  C CD1  . LEU A 1 78  ? -3.641  4.789   6.108   1.00 0.00 ? 156 LEU A CD1  3  
ATOM 5099  C CD2  . LEU A 1 78  ? -5.190  2.869   5.700   1.00 0.00 ? 156 LEU A CD2  3  
ATOM 5100  H H    . LEU A 1 78  ? -7.429  6.754   3.780   1.00 0.00 ? 156 LEU A H    3  
ATOM 5101  H HA   . LEU A 1 78  ? -4.746  7.024   4.657   1.00 0.00 ? 156 LEU A HA   3  
ATOM 5102  H HB2  . LEU A 1 78  ? -6.193  5.464   5.746   1.00 0.00 ? 156 LEU A HB2  3  
ATOM 5103  H HB3  . LEU A 1 78  ? -6.500  4.614   4.233   1.00 0.00 ? 156 LEU A HB3  3  
ATOM 5104  H HG   . LEU A 1 78  ? -4.094  3.929   4.224   1.00 0.00 ? 156 LEU A HG   3  
ATOM 5105  H HD11 . LEU A 1 78  ? -3.813  5.854   6.162   1.00 0.00 ? 156 LEU A HD11 3  
ATOM 5106  H HD12 . LEU A 1 78  ? -2.633  4.605   5.767   1.00 0.00 ? 156 LEU A HD12 3  
ATOM 5107  H HD13 . LEU A 1 78  ? -3.775  4.352   7.087   1.00 0.00 ? 156 LEU A HD13 3  
ATOM 5108  H HD21 . LEU A 1 78  ? -5.358  2.983   6.761   1.00 0.00 ? 156 LEU A HD21 3  
ATOM 5109  H HD22 . LEU A 1 78  ? -4.486  2.067   5.532   1.00 0.00 ? 156 LEU A HD22 3  
ATOM 5110  H HD23 . LEU A 1 78  ? -6.124  2.637   5.210   1.00 0.00 ? 156 LEU A HD23 3  
ATOM 5111  N N    . GLN A 1 79  ? -5.246  5.504   1.775   1.00 0.00 ? 157 GLN A N    3  
ATOM 5112  C CA   . GLN A 1 79  ? -4.595  5.090   0.538   1.00 0.00 ? 157 GLN A CA   3  
ATOM 5113  C C    . GLN A 1 79  ? -3.845  6.256   -0.098  1.00 0.00 ? 157 GLN A C    3  
ATOM 5114  O O    . GLN A 1 79  ? -2.666  6.140   -0.433  1.00 0.00 ? 157 GLN A O    3  
ATOM 5115  C CB   . GLN A 1 79  ? -5.626  4.534   -0.445  1.00 0.00 ? 157 GLN A CB   3  
ATOM 5116  C CG   . GLN A 1 79  ? -5.953  3.067   -0.219  1.00 0.00 ? 157 GLN A CG   3  
ATOM 5117  C CD   . GLN A 1 79  ? -6.367  2.358   -1.493  1.00 0.00 ? 157 GLN A CD   3  
ATOM 5118  O OE1  . GLN A 1 79  ? -5.758  2.546   -2.547  1.00 0.00 ? 157 GLN A OE1  3  
ATOM 5119  N NE2  . GLN A 1 79  ? -7.407  1.537   -1.403  1.00 0.00 ? 157 GLN A NE2  3  
ATOM 5120  H H    . GLN A 1 79  ? -6.218  5.413   1.857   1.00 0.00 ? 157 GLN A H    3  
ATOM 5121  H HA   . GLN A 1 79  ? -3.886  4.313   0.781   1.00 0.00 ? 157 GLN A HA   3  
ATOM 5122  H HB2  . GLN A 1 79  ? -6.539  5.103   -0.351  1.00 0.00 ? 157 GLN A HB2  3  
ATOM 5123  H HB3  . GLN A 1 79  ? -5.245  4.645   -1.449  1.00 0.00 ? 157 GLN A HB3  3  
ATOM 5124  H HG2  . GLN A 1 79  ? -5.079  2.574   0.181   1.00 0.00 ? 157 GLN A HG2  3  
ATOM 5125  H HG3  . GLN A 1 79  ? -6.762  2.998   0.494   1.00 0.00 ? 157 GLN A HG3  3  
ATOM 5126  H HE21 . GLN A 1 79  ? -7.843  1.438   -0.531  1.00 0.00 ? 157 GLN A HE21 3  
ATOM 5127  H HE22 . GLN A 1 79  ? -7.696  1.066   -2.212  1.00 0.00 ? 157 GLN A HE22 3  
ATOM 5128  N N    . ARG A 1 80  ? -4.537  7.379   -0.263  1.00 0.00 ? 158 ARG A N    3  
ATOM 5129  C CA   . ARG A 1 80  ? -3.936  8.565   -0.861  1.00 0.00 ? 158 ARG A CA   3  
ATOM 5130  C C    . ARG A 1 80  ? -2.715  9.016   -0.065  1.00 0.00 ? 158 ARG A C    3  
ATOM 5131  O O    . ARG A 1 80  ? -1.754  9.542   -0.628  1.00 0.00 ? 158 ARG A O    3  
ATOM 5132  C CB   . ARG A 1 80  ? -4.960  9.700   -0.931  1.00 0.00 ? 158 ARG A CB   3  
ATOM 5133  C CG   . ARG A 1 80  ? -5.232  10.359  0.411   1.00 0.00 ? 158 ARG A CG   3  
ATOM 5134  C CD   . ARG A 1 80  ? -5.819  11.751  0.240   1.00 0.00 ? 158 ARG A CD   3  
ATOM 5135  N NE   . ARG A 1 80  ? -7.247  11.710  -0.063  1.00 0.00 ? 158 ARG A NE   3  
ATOM 5136  C CZ   . ARG A 1 80  ? -8.066  12.741  0.114   1.00 0.00 ? 158 ARG A CZ   3  
ATOM 5137  N NH1  . ARG A 1 80  ? -7.600  13.888  0.588   1.00 0.00 ? 158 ARG A NH1  3  
ATOM 5138  N NH2  . ARG A 1 80  ? -9.354  12.625  -0.185  1.00 0.00 ? 158 ARG A NH2  3  
ATOM 5139  H H    . ARG A 1 80  ? -5.473  7.410   0.024   1.00 0.00 ? 158 ARG A H    3  
ATOM 5140  H HA   . ARG A 1 80  ? -3.625  8.311   -1.863  1.00 0.00 ? 158 ARG A HA   3  
ATOM 5141  H HB2  . ARG A 1 80  ? -4.595  10.457  -1.611  1.00 0.00 ? 158 ARG A HB2  3  
ATOM 5142  H HB3  . ARG A 1 80  ? -5.891  9.306   -1.310  1.00 0.00 ? 158 ARG A HB3  3  
ATOM 5143  H HG2  . ARG A 1 80  ? -5.933  9.751   0.965   1.00 0.00 ? 158 ARG A HG2  3  
ATOM 5144  H HG3  . ARG A 1 80  ? -4.305  10.433  0.960   1.00 0.00 ? 158 ARG A HG3  3  
ATOM 5145  H HD2  . ARG A 1 80  ? -5.671  12.305  1.155   1.00 0.00 ? 158 ARG A HD2  3  
ATOM 5146  H HD3  . ARG A 1 80  ? -5.303  12.247  -0.569  1.00 0.00 ? 158 ARG A HD3  3  
ATOM 5147  H HE   . ARG A 1 80  ? -7.613  10.872  -0.414  1.00 0.00 ? 158 ARG A HE   3  
ATOM 5148  H HH11 . ARG A 1 80  ? -6.630  13.978  0.813   1.00 0.00 ? 158 ARG A HH11 3  
ATOM 5149  H HH12 . ARG A 1 80  ? -8.219  14.663  0.719   1.00 0.00 ? 158 ARG A HH12 3  
ATOM 5150  H HH21 . ARG A 1 80  ? -9.709  11.762  -0.543  1.00 0.00 ? 158 ARG A HH21 3  
ATOM 5151  H HH22 . ARG A 1 80  ? -9.969  13.402  -0.051  1.00 0.00 ? 158 ARG A HH22 3  
ATOM 5152  N N    . SER A 1 81  ? -2.759  8.808   1.247   1.00 0.00 ? 159 SER A N    3  
ATOM 5153  C CA   . SER A 1 81  ? -1.658  9.197   2.120   1.00 0.00 ? 159 SER A CA   3  
ATOM 5154  C C    . SER A 1 81  ? -0.632  8.073   2.233   1.00 0.00 ? 159 SER A C    3  
ATOM 5155  O O    . SER A 1 81  ? 0.184   8.054   3.154   1.00 0.00 ? 159 SER A O    3  
ATOM 5156  C CB   . SER A 1 81  ? -2.186  9.562   3.509   1.00 0.00 ? 159 SER A CB   3  
ATOM 5157  O OG   . SER A 1 81  ? -2.508  10.940  3.585   1.00 0.00 ? 159 SER A OG   3  
ATOM 5158  H H    . SER A 1 81  ? -3.553  8.384   1.636   1.00 0.00 ? 159 SER A H    3  
ATOM 5159  H HA   . SER A 1 81  ? -1.181  10.063  1.686   1.00 0.00 ? 159 SER A HA   3  
ATOM 5160  H HB2  . SER A 1 81  ? -3.073  8.985   3.717   1.00 0.00 ? 159 SER A HB2  3  
ATOM 5161  H HB3  . SER A 1 81  ? -1.430  9.340   4.248   1.00 0.00 ? 159 SER A HB3  3  
ATOM 5162  H HG   . SER A 1 81  ? -1.705  11.461  3.517   1.00 0.00 ? 159 SER A HG   3  
ATOM 5163  N N    . ALA A 1 82  ? -0.679  7.140   1.288   1.00 0.00 ? 160 ALA A N    3  
ATOM 5164  C CA   . ALA A 1 82  ? 0.247   6.014   1.280   1.00 0.00 ? 160 ALA A CA   3  
ATOM 5165  C C    . ALA A 1 82  ? 1.526   6.362   0.526   1.00 0.00 ? 160 ALA A C    3  
ATOM 5166  O O    . ALA A 1 82  ? 2.630   6.110   1.008   1.00 0.00 ? 160 ALA A O    3  
ATOM 5167  C CB   . ALA A 1 82  ? -0.415  4.791   0.663   1.00 0.00 ? 160 ALA A CB   3  
ATOM 5168  H H    . ALA A 1 82  ? -1.352  7.211   0.580   1.00 0.00 ? 160 ALA A H    3  
ATOM 5169  H HA   . ALA A 1 82  ? 0.497   5.780   2.304   1.00 0.00 ? 160 ALA A HA   3  
ATOM 5170  H HB1  . ALA A 1 82  ? -1.402  4.666   1.084   1.00 0.00 ? 160 ALA A HB1  3  
ATOM 5171  H HB2  . ALA A 1 82  ? -0.493  4.924   -0.405  1.00 0.00 ? 160 ALA A HB2  3  
ATOM 5172  H HB3  . ALA A 1 82  ? 0.180   3.915   0.875   1.00 0.00 ? 160 ALA A HB3  3  
ATOM 5173  N N    . ALA A 1 83  ? 1.370   6.942   -0.660  1.00 0.00 ? 161 ALA A N    3  
ATOM 5174  C CA   . ALA A 1 83  ? 2.513   7.325   -1.479  1.00 0.00 ? 161 ALA A CA   3  
ATOM 5175  C C    . ALA A 1 83  ? 3.611   7.954   -0.629  1.00 0.00 ? 161 ALA A C    3  
ATOM 5176  O O    . ALA A 1 83  ? 4.734   7.452   -0.576  1.00 0.00 ? 161 ALA A O    3  
ATOM 5177  C CB   . ALA A 1 83  ? 2.078   8.284   -2.577  1.00 0.00 ? 161 ALA A CB   3  
ATOM 5178  H H    . ALA A 1 83  ? 0.465   7.117   -0.990  1.00 0.00 ? 161 ALA A H    3  
ATOM 5179  H HA   . ALA A 1 83  ? 2.902   6.432   -1.948  1.00 0.00 ? 161 ALA A HA   3  
ATOM 5180  H HB1  . ALA A 1 83  ? 2.914   8.904   -2.865  1.00 0.00 ? 161 ALA A HB1  3  
ATOM 5181  H HB2  . ALA A 1 83  ? 1.735   7.720   -3.432  1.00 0.00 ? 161 ALA A HB2  3  
ATOM 5182  H HB3  . ALA A 1 83  ? 1.276   8.908   -2.212  1.00 0.00 ? 161 ALA A HB3  3  
ATOM 5183  N N    . HIS A 1 84  ? 3.281   9.058   0.034   1.00 0.00 ? 162 HIS A N    3  
ATOM 5184  C CA   . HIS A 1 84  ? 4.240   9.757   0.882   1.00 0.00 ? 162 HIS A CA   3  
ATOM 5185  C C    . HIS A 1 84  ? 4.791   8.827   1.959   1.00 0.00 ? 162 HIS A C    3  
ATOM 5186  O O    . HIS A 1 84  ? 5.987   8.837   2.249   1.00 0.00 ? 162 HIS A O    3  
ATOM 5187  C CB   . HIS A 1 84  ? 3.586   10.977  1.530   1.00 0.00 ? 162 HIS A CB   3  
ATOM 5188  C CG   . HIS A 1 84  ? 4.570   11.994  2.022   1.00 0.00 ? 162 HIS A CG   3  
ATOM 5189  N ND1  . HIS A 1 84  ? 5.661   12.403  1.286   1.00 0.00 ? 162 HIS A ND1  3  
ATOM 5190  C CD2  . HIS A 1 84  ? 4.621   12.686  3.185   1.00 0.00 ? 162 HIS A CD2  3  
ATOM 5191  C CE1  . HIS A 1 84  ? 6.342   13.302  1.974   1.00 0.00 ? 162 HIS A CE1  3  
ATOM 5192  N NE2  . HIS A 1 84  ? 5.732   13.491  3.130   1.00 0.00 ? 162 HIS A NE2  3  
ATOM 5193  H H    . HIS A 1 84  ? 2.370   9.410   -0.049  1.00 0.00 ? 162 HIS A H    3  
ATOM 5194  H HA   . HIS A 1 84  ? 5.057   10.086  0.257   1.00 0.00 ? 162 HIS A HA   3  
ATOM 5195  H HB2  . HIS A 1 84  ? 2.944   11.460  0.808   1.00 0.00 ? 162 HIS A HB2  3  
ATOM 5196  H HB3  . HIS A 1 84  ? 2.992   10.654  2.373   1.00 0.00 ? 162 HIS A HB3  3  
ATOM 5197  H HD2  . HIS A 1 84  ? 3.919   12.617  4.004   1.00 0.00 ? 162 HIS A HD2  3  
ATOM 5198  H HE1  . HIS A 1 84  ? 7.244   13.798  1.648   1.00 0.00 ? 162 HIS A HE1  3  
ATOM 5199  H HE2  . HIS A 1 84  ? 6.073   14.042  3.864   1.00 0.00 ? 162 HIS A HE2  3  
ATOM 5200  N N    . MET A 1 85  ? 3.910   8.027   2.550   1.00 0.00 ? 163 MET A N    3  
ATOM 5201  C CA   . MET A 1 85  ? 4.308   7.091   3.595   1.00 0.00 ? 163 MET A CA   3  
ATOM 5202  C C    . MET A 1 85  ? 5.368   6.122   3.082   1.00 0.00 ? 163 MET A C    3  
ATOM 5203  O O    . MET A 1 85  ? 6.325   5.802   3.788   1.00 0.00 ? 163 MET A O    3  
ATOM 5204  C CB   . MET A 1 85  ? 3.093   6.314   4.104   1.00 0.00 ? 163 MET A CB   3  
ATOM 5205  C CG   . MET A 1 85  ? 2.387   6.986   5.271   1.00 0.00 ? 163 MET A CG   3  
ATOM 5206  S SD   . MET A 1 85  ? 1.558   5.806   6.354   1.00 0.00 ? 163 MET A SD   3  
ATOM 5207  C CE   . MET A 1 85  ? -0.158  6.143   5.971   1.00 0.00 ? 163 MET A CE   3  
ATOM 5208  H H    . MET A 1 85  ? 2.969   8.065   2.276   1.00 0.00 ? 163 MET A H    3  
ATOM 5209  H HA   . MET A 1 85  ? 4.726   7.663   4.410   1.00 0.00 ? 163 MET A HA   3  
ATOM 5210  H HB2  . MET A 1 85  ? 2.385   6.206   3.296   1.00 0.00 ? 163 MET A HB2  3  
ATOM 5211  H HB3  . MET A 1 85  ? 3.415   5.334   4.423   1.00 0.00 ? 163 MET A HB3  3  
ATOM 5212  H HG2  . MET A 1 85  ? 3.116   7.532   5.850   1.00 0.00 ? 163 MET A HG2  3  
ATOM 5213  H HG3  . MET A 1 85  ? 1.652   7.674   4.880   1.00 0.00 ? 163 MET A HG3  3  
ATOM 5214  H HE1  . MET A 1 85  ? -0.355  5.885   4.940   1.00 0.00 ? 163 MET A HE1  3  
ATOM 5215  H HE2  . MET A 1 85  ? -0.793  5.554   6.616   1.00 0.00 ? 163 MET A HE2  3  
ATOM 5216  H HE3  . MET A 1 85  ? -0.362  7.193   6.124   1.00 0.00 ? 163 MET A HE3  3  
ATOM 5217  N N    . ARG A 1 86  ? 5.191   5.656   1.849   1.00 0.00 ? 164 ARG A N    3  
ATOM 5218  C CA   . ARG A 1 86  ? 6.131   4.722   1.243   1.00 0.00 ? 164 ARG A CA   3  
ATOM 5219  C C    . ARG A 1 86  ? 7.548   5.288   1.260   1.00 0.00 ? 164 ARG A C    3  
ATOM 5220  O O    . ARG A 1 86  ? 8.500   4.596   1.621   1.00 0.00 ? 164 ARG A O    3  
ATOM 5221  C CB   . ARG A 1 86  ? 5.714   4.407   -0.195  1.00 0.00 ? 164 ARG A CB   3  
ATOM 5222  C CG   . ARG A 1 86  ? 6.117   3.015   -0.655  1.00 0.00 ? 164 ARG A CG   3  
ATOM 5223  C CD   . ARG A 1 86  ? 6.009   2.875   -2.165  1.00 0.00 ? 164 ARG A CD   3  
ATOM 5224  N NE   . ARG A 1 86  ? 6.943   3.754   -2.864  1.00 0.00 ? 164 ARG A NE   3  
ATOM 5225  C CZ   . ARG A 1 86  ? 6.945   3.924   -4.182  1.00 0.00 ? 164 ARG A CZ   3  
ATOM 5226  N NH1  . ARG A 1 86  ? 6.068   3.280   -4.939  1.00 0.00 ? 164 ARG A NH1  3  
ATOM 5227  N NH2  . ARG A 1 86  ? 7.826   4.742   -4.745  1.00 0.00 ? 164 ARG A NH2  3  
ATOM 5228  H H    . ARG A 1 86  ? 4.409   5.948   1.336   1.00 0.00 ? 164 ARG A H    3  
ATOM 5229  H HA   . ARG A 1 86  ? 6.113   3.811   1.821   1.00 0.00 ? 164 ARG A HA   3  
ATOM 5230  H HB2  . ARG A 1 86  ? 4.640   4.491   -0.273  1.00 0.00 ? 164 ARG A HB2  3  
ATOM 5231  H HB3  . ARG A 1 86  ? 6.173   5.127   -0.856  1.00 0.00 ? 164 ARG A HB3  3  
ATOM 5232  H HG2  . ARG A 1 86  ? 7.139   2.830   -0.359  1.00 0.00 ? 164 ARG A HG2  3  
ATOM 5233  H HG3  . ARG A 1 86  ? 5.467   2.290   -0.187  1.00 0.00 ? 164 ARG A HG3  3  
ATOM 5234  H HD2  . ARG A 1 86  ? 6.223   1.851   -2.434  1.00 0.00 ? 164 ARG A HD2  3  
ATOM 5235  H HD3  . ARG A 1 86  ? 5.002   3.123   -2.465  1.00 0.00 ? 164 ARG A HD3  3  
ATOM 5236  H HE   . ARG A 1 86  ? 7.600   4.240   -2.324  1.00 0.00 ? 164 ARG A HE   3  
ATOM 5237  H HH11 . ARG A 1 86  ? 5.403   2.664   -4.517  1.00 0.00 ? 164 ARG A HH11 3  
ATOM 5238  H HH12 . ARG A 1 86  ? 6.072   3.411   -5.930  1.00 0.00 ? 164 ARG A HH12 3  
ATOM 5239  H HH21 . ARG A 1 86  ? 8.489   5.229   -4.177  1.00 0.00 ? 164 ARG A HH21 3  
ATOM 5240  H HH22 . ARG A 1 86  ? 7.828   4.869   -5.736  1.00 0.00 ? 164 ARG A HH22 3  
ATOM 5241  N N    . HIS A 1 87  ? 7.680   6.552   0.868   1.00 0.00 ? 165 HIS A N    3  
ATOM 5242  C CA   . HIS A 1 87  ? 8.981   7.211   0.839   1.00 0.00 ? 165 HIS A CA   3  
ATOM 5243  C C    . HIS A 1 87  ? 9.537   7.378   2.249   1.00 0.00 ? 165 HIS A C    3  
ATOM 5244  O O    . HIS A 1 87  ? 10.727  7.165   2.488   1.00 0.00 ? 165 HIS A O    3  
ATOM 5245  C CB   . HIS A 1 87  ? 8.869   8.576   0.158   1.00 0.00 ? 165 HIS A CB   3  
ATOM 5246  C CG   . HIS A 1 87  ? 10.190  9.152   -0.250  1.00 0.00 ? 165 HIS A CG   3  
ATOM 5247  N ND1  . HIS A 1 87  ? 10.683  9.066   -1.535  1.00 0.00 ? 165 HIS A ND1  3  
ATOM 5248  C CD2  . HIS A 1 87  ? 11.121  9.825   0.465   1.00 0.00 ? 165 HIS A CD2  3  
ATOM 5249  C CE1  . HIS A 1 87  ? 11.861  9.661   -1.592  1.00 0.00 ? 165 HIS A CE1  3  
ATOM 5250  N NE2  . HIS A 1 87  ? 12.150  10.131  -0.392  1.00 0.00 ? 165 HIS A NE2  3  
ATOM 5251  H H    . HIS A 1 87  ? 6.884   7.052   0.592   1.00 0.00 ? 165 HIS A H    3  
ATOM 5252  H HA   . HIS A 1 87  ? 9.655   6.589   0.270   1.00 0.00 ? 165 HIS A HA   3  
ATOM 5253  H HB2  . HIS A 1 87  ? 8.261   8.479   -0.730  1.00 0.00 ? 165 HIS A HB2  3  
ATOM 5254  H HB3  . HIS A 1 87  ? 8.398   9.272   0.836   1.00 0.00 ? 165 HIS A HB3  3  
ATOM 5255  H HD2  . HIS A 1 87  ? 11.066  10.076  1.515   1.00 0.00 ? 165 HIS A HD2  3  
ATOM 5256  H HE1  . HIS A 1 87  ? 12.483  9.750   -2.471  1.00 0.00 ? 165 HIS A HE1  3  
ATOM 5257  H HE2  . HIS A 1 87  ? 13.002  10.541  -0.136  1.00 0.00 ? 165 HIS A HE2  3  
ATOM 5258  N N    . LEU A 1 88  ? 8.671   7.760   3.181   1.00 0.00 ? 166 LEU A N    3  
ATOM 5259  C CA   . LEU A 1 88  ? 9.075   7.956   4.568   1.00 0.00 ? 166 LEU A CA   3  
ATOM 5260  C C    . LEU A 1 88  ? 9.740   6.700   5.124   1.00 0.00 ? 166 LEU A C    3  
ATOM 5261  O O    . LEU A 1 88  ? 10.669  6.781   5.929   1.00 0.00 ? 166 LEU A O    3  
ATOM 5262  C CB   . LEU A 1 88  ? 7.865   8.327   5.426   1.00 0.00 ? 166 LEU A CB   3  
ATOM 5263  C CG   . LEU A 1 88  ? 7.359   9.764   5.287   1.00 0.00 ? 166 LEU A CG   3  
ATOM 5264  C CD1  . LEU A 1 88  ? 6.135   9.986   6.162   1.00 0.00 ? 166 LEU A CD1  3  
ATOM 5265  C CD2  . LEU A 1 88  ? 8.459   10.753  5.645   1.00 0.00 ? 166 LEU A CD2  3  
ATOM 5266  H H    . LEU A 1 88  ? 7.736   7.914   2.931   1.00 0.00 ? 166 LEU A H    3  
ATOM 5267  H HA   . LEU A 1 88  ? 9.788   8.767   4.594   1.00 0.00 ? 166 LEU A HA   3  
ATOM 5268  H HB2  . LEU A 1 88  ? 7.055   7.665   5.160   1.00 0.00 ? 166 LEU A HB2  3  
ATOM 5269  H HB3  . LEU A 1 88  ? 8.132   8.168   6.461   1.00 0.00 ? 166 LEU A HB3  3  
ATOM 5270  H HG   . LEU A 1 88  ? 7.071   9.940   4.260   1.00 0.00 ? 166 LEU A HG   3  
ATOM 5271  H HD11 . LEU A 1 88  ? 5.952   9.104   6.756   1.00 0.00 ? 166 LEU A HD11 3  
ATOM 5272  H HD12 . LEU A 1 88  ? 5.277   10.183  5.537   1.00 0.00 ? 166 LEU A HD12 3  
ATOM 5273  H HD13 . LEU A 1 88  ? 6.307   10.830  6.813   1.00 0.00 ? 166 LEU A HD13 3  
ATOM 5274  H HD21 . LEU A 1 88  ? 8.878   10.493  6.606   1.00 0.00 ? 166 LEU A HD21 3  
ATOM 5275  H HD22 . LEU A 1 88  ? 8.046   11.750  5.690   1.00 0.00 ? 166 LEU A HD22 3  
ATOM 5276  H HD23 . LEU A 1 88  ? 9.234   10.717  4.893   1.00 0.00 ? 166 LEU A HD23 3  
ATOM 5277  N N    . LEU A 1 89  ? 9.261   5.541   4.688   1.00 0.00 ? 167 LEU A N    3  
ATOM 5278  C CA   . LEU A 1 89  ? 9.810   4.267   5.140   1.00 0.00 ? 167 LEU A CA   3  
ATOM 5279  C C    . LEU A 1 89  ? 11.092  3.929   4.386   1.00 0.00 ? 167 LEU A C    3  
ATOM 5280  O O    . LEU A 1 89  ? 12.010  3.326   4.942   1.00 0.00 ? 167 LEU A O    3  
ATOM 5281  C CB   . LEU A 1 89  ? 8.783   3.150   4.948   1.00 0.00 ? 167 LEU A CB   3  
ATOM 5282  C CG   . LEU A 1 89  ? 7.422   3.369   5.609   1.00 0.00 ? 167 LEU A CG   3  
ATOM 5283  C CD1  . LEU A 1 89  ? 6.667   2.053   5.726   1.00 0.00 ? 167 LEU A CD1  3  
ATOM 5284  C CD2  . LEU A 1 89  ? 7.591   4.012   6.978   1.00 0.00 ? 167 LEU A CD2  3  
ATOM 5285  H H    . LEU A 1 89  ? 8.520   5.540   4.047   1.00 0.00 ? 167 LEU A H    3  
ATOM 5286  H HA   . LEU A 1 89  ? 10.038  4.359   6.191   1.00 0.00 ? 167 LEU A HA   3  
ATOM 5287  H HB2  . LEU A 1 89  ? 8.620   3.029   3.888   1.00 0.00 ? 167 LEU A HB2  3  
ATOM 5288  H HB3  . LEU A 1 89  ? 9.205   2.240   5.351   1.00 0.00 ? 167 LEU A HB3  3  
ATOM 5289  H HG   . LEU A 1 89  ? 6.833   4.037   4.995   1.00 0.00 ? 167 LEU A HG   3  
ATOM 5290  H HD11 . LEU A 1 89  ? 5.606   2.240   5.665   1.00 0.00 ? 167 LEU A HD11 3  
ATOM 5291  H HD12 . LEU A 1 89  ? 6.897   1.589   6.674   1.00 0.00 ? 167 LEU A HD12 3  
ATOM 5292  H HD13 . LEU A 1 89  ? 6.964   1.395   4.922   1.00 0.00 ? 167 LEU A HD13 3  
ATOM 5293  H HD21 . LEU A 1 89  ? 6.627   4.330   7.347   1.00 0.00 ? 167 LEU A HD21 3  
ATOM 5294  H HD22 . LEU A 1 89  ? 8.245   4.867   6.895   1.00 0.00 ? 167 LEU A HD22 3  
ATOM 5295  H HD23 . LEU A 1 89  ? 8.020   3.295   7.662   1.00 0.00 ? 167 LEU A HD23 3  
ATOM 5296  N N    . MET A 1 90  ? 11.149  4.324   3.119   1.00 0.00 ? 168 MET A N    3  
ATOM 5297  C CA   . MET A 1 90  ? 12.321  4.066   2.290   1.00 0.00 ? 168 MET A CA   3  
ATOM 5298  C C    . MET A 1 90  ? 13.600  4.479   3.013   1.00 0.00 ? 168 MET A C    3  
ATOM 5299  O O    . MET A 1 90  ? 14.680  3.966   2.724   1.00 0.00 ? 168 MET A O    3  
ATOM 5300  C CB   . MET A 1 90  ? 12.208  4.815   0.961   1.00 0.00 ? 168 MET A CB   3  
ATOM 5301  C CG   . MET A 1 90  ? 11.521  4.013   -0.132  1.00 0.00 ? 168 MET A CG   3  
ATOM 5302  S SD   . MET A 1 90  ? 12.679  3.028   -1.103  1.00 0.00 ? 168 MET A SD   3  
ATOM 5303  C CE   . MET A 1 90  ? 11.873  3.037   -2.702  1.00 0.00 ? 168 MET A CE   3  
ATOM 5304  H H    . MET A 1 90  ? 10.386  4.801   2.731   1.00 0.00 ? 168 MET A H    3  
ATOM 5305  H HA   . MET A 1 90  ? 12.360  3.005   2.093   1.00 0.00 ? 168 MET A HA   3  
ATOM 5306  H HB2  . MET A 1 90  ? 11.644  5.722   1.120   1.00 0.00 ? 168 MET A HB2  3  
ATOM 5307  H HB3  . MET A 1 90  ? 13.200  5.072   0.620   1.00 0.00 ? 168 MET A HB3  3  
ATOM 5308  H HG2  . MET A 1 90  ? 10.802  3.349   0.324   1.00 0.00 ? 168 MET A HG2  3  
ATOM 5309  H HG3  . MET A 1 90  ? 11.009  4.696   -0.793  1.00 0.00 ? 168 MET A HG3  3  
ATOM 5310  H HE1  . MET A 1 90  ? 11.883  2.040   -3.116  1.00 0.00 ? 168 MET A HE1  3  
ATOM 5311  H HE2  . MET A 1 90  ? 10.852  3.370   -2.589  1.00 0.00 ? 168 MET A HE2  3  
ATOM 5312  H HE3  . MET A 1 90  ? 12.399  3.708   -3.366  1.00 0.00 ? 168 MET A HE3  3  
ATOM 5313  N N    . SER A 1 91  ? 13.468  5.410   3.952   1.00 0.00 ? 169 SER A N    3  
ATOM 5314  C CA   . SER A 1 91  ? 14.614  5.895   4.713   1.00 0.00 ? 169 SER A CA   3  
ATOM 5315  C C    . SER A 1 91  ? 15.412  4.731   5.294   1.00 0.00 ? 169 SER A C    3  
ATOM 5316  O O    . SER A 1 91  ? 16.643  4.731   5.258   1.00 0.00 ? 169 SER A O    3  
ATOM 5317  C CB   . SER A 1 91  ? 14.150  6.822   5.838   1.00 0.00 ? 169 SER A CB   3  
ATOM 5318  O OG   . SER A 1 91  ? 14.050  8.161   5.387   1.00 0.00 ? 169 SER A OG   3  
ATOM 5319  H H    . SER A 1 91  ? 12.580  5.781   4.137   1.00 0.00 ? 169 SER A H    3  
ATOM 5320  H HA   . SER A 1 91  ? 15.248  6.450   4.039   1.00 0.00 ? 169 SER A HA   3  
ATOM 5321  H HB2  . SER A 1 91  ? 13.182  6.500   6.191   1.00 0.00 ? 169 SER A HB2  3  
ATOM 5322  H HB3  . SER A 1 91  ? 14.861  6.780   6.651   1.00 0.00 ? 169 SER A HB3  3  
ATOM 5323  H HG   . SER A 1 91  ? 14.421  8.751   6.047   1.00 0.00 ? 169 SER A HG   3  
ATOM 5324  N N    . GLN A 1 92  ? 14.702  3.743   5.827   1.00 0.00 ? 170 GLN A N    3  
ATOM 5325  C CA   . GLN A 1 92  ? 15.344  2.573   6.416   1.00 0.00 ? 170 GLN A CA   3  
ATOM 5326  C C    . GLN A 1 92  ? 16.458  2.052   5.515   1.00 0.00 ? 170 GLN A C    3  
ATOM 5327  O O    . GLN A 1 92  ? 16.522  2.390   4.333   1.00 0.00 ? 170 GLN A O    3  
ATOM 5328  C CB   . GLN A 1 92  ? 14.314  1.470   6.664   1.00 0.00 ? 170 GLN A CB   3  
ATOM 5329  C CG   . GLN A 1 92  ? 13.246  1.851   7.677   1.00 0.00 ? 170 GLN A CG   3  
ATOM 5330  C CD   . GLN A 1 92  ? 12.440  0.658   8.151   1.00 0.00 ? 170 GLN A CD   3  
ATOM 5331  O OE1  . GLN A 1 92  ? 12.486  0.290   9.325   1.00 0.00 ? 170 GLN A OE1  3  
ATOM 5332  N NE2  . GLN A 1 92  ? 11.694  0.047   7.238   1.00 0.00 ? 170 GLN A NE2  3  
ATOM 5333  H H    . GLN A 1 92  ? 13.725  3.801   5.825   1.00 0.00 ? 170 GLN A H    3  
ATOM 5334  H HA   . GLN A 1 92  ? 15.773  2.871   7.361   1.00 0.00 ? 170 GLN A HA   3  
ATOM 5335  H HB2  . GLN A 1 92  ? 13.826  1.234   5.730   1.00 0.00 ? 170 GLN A HB2  3  
ATOM 5336  H HB3  . GLN A 1 92  ? 14.826  0.591   7.026   1.00 0.00 ? 170 GLN A HB3  3  
ATOM 5337  H HG2  . GLN A 1 92  ? 13.725  2.305   8.532   1.00 0.00 ? 170 GLN A HG2  3  
ATOM 5338  H HG3  . GLN A 1 92  ? 12.575  2.564   7.222   1.00 0.00 ? 170 GLN A HG3  3  
ATOM 5339  H HE21 . GLN A 1 92  ? 11.708  0.395   6.321   1.00 0.00 ? 170 GLN A HE21 3  
ATOM 5340  H HE22 . GLN A 1 92  ? 11.163  -0.727  7.516   1.00 0.00 ? 170 GLN A HE22 3  
ATOM 5341  N N    . GLN A 1 93  ? 17.334  1.228   6.081   1.00 0.00 ? 171 GLN A N    3  
ATOM 5342  C CA   . GLN A 1 93  ? 18.446  0.661   5.327   1.00 0.00 ? 171 GLN A CA   3  
ATOM 5343  C C    . GLN A 1 93  ? 18.390  -0.863  5.338   1.00 0.00 ? 171 GLN A C    3  
ATOM 5344  O O    . GLN A 1 93  ? 18.698  -1.514  4.338   1.00 0.00 ? 171 GLN A O    3  
ATOM 5345  C CB   . GLN A 1 93  ? 19.779  1.138   5.907   1.00 0.00 ? 171 GLN A CB   3  
ATOM 5346  C CG   . GLN A 1 93  ? 19.961  0.793   7.376   1.00 0.00 ? 171 GLN A CG   3  
ATOM 5347  C CD   . GLN A 1 93  ? 21.345  1.138   7.889   1.00 0.00 ? 171 GLN A CD   3  
ATOM 5348  O OE1  . GLN A 1 93  ? 22.114  1.829   7.219   1.00 0.00 ? 171 GLN A OE1  3  
ATOM 5349  N NE2  . GLN A 1 93  ? 21.671  0.659   9.084   1.00 0.00 ? 171 GLN A NE2  3  
ATOM 5350  H H    . GLN A 1 93  ? 17.230  0.996   7.026   1.00 0.00 ? 171 GLN A H    3  
ATOM 5351  H HA   . GLN A 1 93  ? 18.364  1.004   4.307   1.00 0.00 ? 171 GLN A HA   3  
ATOM 5352  H HB2  . GLN A 1 93  ? 20.584  0.684   5.349   1.00 0.00 ? 171 GLN A HB2  3  
ATOM 5353  H HB3  . GLN A 1 93  ? 19.839  2.211   5.802   1.00 0.00 ? 171 GLN A HB3  3  
ATOM 5354  H HG2  . GLN A 1 93  ? 19.233  1.341   7.955   1.00 0.00 ? 171 GLN A HG2  3  
ATOM 5355  H HG3  . GLN A 1 93  ? 19.799  -0.267  7.506   1.00 0.00 ? 171 GLN A HG3  3  
ATOM 5356  H HE21 . GLN A 1 93  ? 21.008  0.115   9.560   1.00 0.00 ? 171 GLN A HE21 3  
ATOM 5357  H HE22 . GLN A 1 93  ? 22.559  0.866   9.439   1.00 0.00 ? 171 GLN A HE22 3  
ATOM 5358  N N    . THR A 1 94  ? 17.996  -1.428  6.475   1.00 0.00 ? 172 THR A N    3  
ATOM 5359  C CA   . THR A 1 94  ? 17.902  -2.876  6.616   1.00 0.00 ? 172 THR A CA   3  
ATOM 5360  C C    . THR A 1 94  ? 17.405  -3.523  5.329   1.00 0.00 ? 172 THR A C    3  
ATOM 5361  O O    . THR A 1 94  ? 18.173  -4.162  4.607   1.00 0.00 ? 172 THR A O    3  
ATOM 5362  C CB   . THR A 1 94  ? 16.959  -3.267  7.770   1.00 0.00 ? 172 THR A CB   3  
ATOM 5363  O OG1  . THR A 1 94  ? 17.362  -2.609  8.977   1.00 0.00 ? 172 THR A OG1  3  
ATOM 5364  C CG2  . THR A 1 94  ? 16.961  -4.773  7.984   1.00 0.00 ? 172 THR A CG2  3  
ATOM 5365  H H    . THR A 1 94  ? 17.765  -0.856  7.236   1.00 0.00 ? 172 THR A H    3  
ATOM 5366  H HA   . THR A 1 94  ? 18.888  -3.254  6.841   1.00 0.00 ? 172 THR A HA   3  
ATOM 5367  H HB   . THR A 1 94  ? 15.956  -2.955  7.517   1.00 0.00 ? 172 THR A HB   3  
ATOM 5368  H HG1  . THR A 1 94  ? 17.973  -3.171  9.459   1.00 0.00 ? 172 THR A HG1  3  
ATOM 5369  H HG21 . THR A 1 94  ? 16.292  -5.023  8.794   1.00 0.00 ? 172 THR A HG21 3  
ATOM 5370  H HG22 . THR A 1 94  ? 17.960  -5.101  8.227   1.00 0.00 ? 172 THR A HG22 3  
ATOM 5371  H HG23 . THR A 1 94  ? 16.630  -5.264  7.081   1.00 0.00 ? 172 THR A HG23 3  
ATOM 5372  N N    . LEU A 1 95  ? 16.119  -3.353  5.044   1.00 0.00 ? 173 LEU A N    3  
ATOM 5373  C CA   . LEU A 1 95  ? 15.520  -3.921  3.841   1.00 0.00 ? 173 LEU A CA   3  
ATOM 5374  C C    . LEU A 1 95  ? 16.330  -3.550  2.603   1.00 0.00 ? 173 LEU A C    3  
ATOM 5375  O O    . LEU A 1 95  ? 17.234  -2.717  2.667   1.00 0.00 ? 173 LEU A O    3  
ATOM 5376  C CB   . LEU A 1 95  ? 14.078  -3.433  3.687   1.00 0.00 ? 173 LEU A CB   3  
ATOM 5377  C CG   . LEU A 1 95  ? 13.888  -2.141  2.891   1.00 0.00 ? 173 LEU A CG   3  
ATOM 5378  C CD1  . LEU A 1 95  ? 12.409  -1.842  2.704   1.00 0.00 ? 173 LEU A CD1  3  
ATOM 5379  C CD2  . LEU A 1 95  ? 14.586  -0.980  3.585   1.00 0.00 ? 173 LEU A CD2  3  
ATOM 5380  H H    . LEU A 1 95  ? 15.558  -2.835  5.657   1.00 0.00 ? 173 LEU A H    3  
ATOM 5381  H HA   . LEU A 1 95  ? 15.518  -4.995  3.948   1.00 0.00 ? 173 LEU A HA   3  
ATOM 5382  H HB2  . LEU A 1 95  ? 13.517  -4.211  3.193   1.00 0.00 ? 173 LEU A HB2  3  
ATOM 5383  H HB3  . LEU A 1 95  ? 13.676  -3.275  4.677   1.00 0.00 ? 173 LEU A HB3  3  
ATOM 5384  H HG   . LEU A 1 95  ? 14.330  -2.261  1.911   1.00 0.00 ? 173 LEU A HG   3  
ATOM 5385  H HD11 . LEU A 1 95  ? 12.152  -0.945  3.248   1.00 0.00 ? 173 LEU A HD11 3  
ATOM 5386  H HD12 . LEU A 1 95  ? 11.824  -2.670  3.078   1.00 0.00 ? 173 LEU A HD12 3  
ATOM 5387  H HD13 . LEU A 1 95  ? 12.201  -1.699  1.654   1.00 0.00 ? 173 LEU A HD13 3  
ATOM 5388  H HD21 . LEU A 1 95  ? 14.173  -0.048  3.228   1.00 0.00 ? 173 LEU A HD21 3  
ATOM 5389  H HD22 . LEU A 1 95  ? 15.644  -1.013  3.365   1.00 0.00 ? 173 LEU A HD22 3  
ATOM 5390  H HD23 . LEU A 1 95  ? 14.437  -1.056  4.651   1.00 0.00 ? 173 LEU A HD23 3  
ATOM 5391  N N    . ARG A 1 96  ? 15.997  -4.173  1.477   1.00 0.00 ? 174 ARG A N    3  
ATOM 5392  C CA   . ARG A 1 96  ? 16.693  -3.908  0.223   1.00 0.00 ? 174 ARG A CA   3  
ATOM 5393  C C    . ARG A 1 96  ? 15.786  -3.167  -0.755  1.00 0.00 ? 174 ARG A C    3  
ATOM 5394  O O    . ARG A 1 96  ? 16.241  -2.311  -1.512  1.00 0.00 ? 174 ARG A O    3  
ATOM 5395  C CB   . ARG A 1 96  ? 17.176  -5.217  -0.403  1.00 0.00 ? 174 ARG A CB   3  
ATOM 5396  C CG   . ARG A 1 96  ? 16.061  -6.046  -1.018  1.00 0.00 ? 174 ARG A CG   3  
ATOM 5397  C CD   . ARG A 1 96  ? 15.852  -5.701  -2.484  1.00 0.00 ? 174 ARG A CD   3  
ATOM 5398  N NE   . ARG A 1 96  ? 16.752  -6.450  -3.356  1.00 0.00 ? 174 ARG A NE   3  
ATOM 5399  C CZ   . ARG A 1 96  ? 16.628  -6.492  -4.678  1.00 0.00 ? 174 ARG A CZ   3  
ATOM 5400  N NH1  . ARG A 1 96  ? 15.648  -5.830  -5.277  1.00 0.00 ? 174 ARG A NH1  3  
ATOM 5401  N NH2  . ARG A 1 96  ? 17.487  -7.197  -5.404  1.00 0.00 ? 174 ARG A NH2  3  
ATOM 5402  H H    . ARG A 1 96  ? 15.267  -4.827  1.489   1.00 0.00 ? 174 ARG A H    3  
ATOM 5403  H HA   . ARG A 1 96  ? 17.548  -3.287  0.443   1.00 0.00 ? 174 ARG A HA   3  
ATOM 5404  H HB2  . ARG A 1 96  ? 17.894  -4.989  -1.178  1.00 0.00 ? 174 ARG A HB2  3  
ATOM 5405  H HB3  . ARG A 1 96  ? 17.658  -5.810  0.359   1.00 0.00 ? 174 ARG A HB3  3  
ATOM 5406  H HG2  . ARG A 1 96  ? 16.317  -7.093  -0.939  1.00 0.00 ? 174 ARG A HG2  3  
ATOM 5407  H HG3  . ARG A 1 96  ? 15.145  -5.857  -0.478  1.00 0.00 ? 174 ARG A HG3  3  
ATOM 5408  H HD2  . ARG A 1 96  ? 14.832  -5.930  -2.753  1.00 0.00 ? 174 ARG A HD2  3  
ATOM 5409  H HD3  . ARG A 1 96  ? 16.031  -4.644  -2.619  1.00 0.00 ? 174 ARG A HD3  3  
ATOM 5410  H HE   . ARG A 1 96  ? 17.484  -6.947  -2.935  1.00 0.00 ? 174 ARG A HE   3  
ATOM 5411  H HH11 . ARG A 1 96  ? 15.000  -5.298  -4.732  1.00 0.00 ? 174 ARG A HH11 3  
ATOM 5412  H HH12 . ARG A 1 96  ? 15.557  -5.863  -6.273  1.00 0.00 ? 174 ARG A HH12 3  
ATOM 5413  H HH21 . ARG A 1 96  ? 18.228  -7.697  -4.957  1.00 0.00 ? 174 ARG A HH21 3  
ATOM 5414  H HH22 . ARG A 1 96  ? 17.393  -7.228  -6.399  1.00 0.00 ? 174 ARG A HH22 3  
ATOM 5415  N N    . ASN A 1 97  ? 14.501  -3.505  -0.735  1.00 0.00 ? 175 ASN A N    3  
ATOM 5416  C CA   . ASN A 1 97  ? 13.530  -2.873  -1.621  1.00 0.00 ? 175 ASN A CA   3  
ATOM 5417  C C    . ASN A 1 97  ? 12.220  -2.601  -0.888  1.00 0.00 ? 175 ASN A C    3  
ATOM 5418  O O    . ASN A 1 97  ? 11.853  -3.324  0.039   1.00 0.00 ? 175 ASN A O    3  
ATOM 5419  C CB   . ASN A 1 97  ? 13.270  -3.759  -2.841  1.00 0.00 ? 175 ASN A CB   3  
ATOM 5420  C CG   . ASN A 1 97  ? 12.431  -4.976  -2.504  1.00 0.00 ? 175 ASN A CG   3  
ATOM 5421  O OD1  . ASN A 1 97  ? 12.835  -5.820  -1.704  1.00 0.00 ? 175 ASN A OD1  3  
ATOM 5422  N ND2  . ASN A 1 97  ? 11.256  -5.072  -3.114  1.00 0.00 ? 175 ASN A ND2  3  
ATOM 5423  H H    . ASN A 1 97  ? 14.197  -4.195  -0.109  1.00 0.00 ? 175 ASN A H    3  
ATOM 5424  H HA   . ASN A 1 97  ? 13.946  -1.933  -1.951  1.00 0.00 ? 175 ASN A HA   3  
ATOM 5425  H HB2  . ASN A 1 97  ? 12.749  -3.183  -3.592  1.00 0.00 ? 175 ASN A HB2  3  
ATOM 5426  H HB3  . ASN A 1 97  ? 14.214  -4.095  -3.243  1.00 0.00 ? 175 ASN A HB3  3  
ATOM 5427  H HD21 . ASN A 1 97  ? 10.999  -4.362  -3.739  1.00 0.00 ? 175 ASN A HD21 3  
ATOM 5428  H HD22 . ASN A 1 97  ? 10.693  -5.848  -2.914  1.00 0.00 ? 175 ASN A HD22 3  
ATOM 5429  N N    . VAL A 1 98  ? 11.518  -1.554  -1.309  1.00 0.00 ? 176 VAL A N    3  
ATOM 5430  C CA   . VAL A 1 98  ? 10.248  -1.187  -0.695  1.00 0.00 ? 176 VAL A CA   3  
ATOM 5431  C C    . VAL A 1 98  ? 9.103   -1.287  -1.696  1.00 0.00 ? 176 VAL A C    3  
ATOM 5432  O O    . VAL A 1 98  ? 8.879   -0.393  -2.512  1.00 0.00 ? 176 VAL A O    3  
ATOM 5433  C CB   . VAL A 1 98  ? 10.293  0.243   -0.124  1.00 0.00 ? 176 VAL A CB   3  
ATOM 5434  C CG1  . VAL A 1 98  ? 9.010   0.558   0.630   1.00 0.00 ? 176 VAL A CG1  3  
ATOM 5435  C CG2  . VAL A 1 98  ? 11.507  0.420   0.775   1.00 0.00 ? 176 VAL A CG2  3  
ATOM 5436  H H    . VAL A 1 98  ? 11.863  -1.016  -2.052  1.00 0.00 ? 176 VAL A H    3  
ATOM 5437  H HA   . VAL A 1 98  ? 10.062  -1.871  0.120   1.00 0.00 ? 176 VAL A HA   3  
ATOM 5438  H HB   . VAL A 1 98  ? 10.378  0.935   -0.949  1.00 0.00 ? 176 VAL A HB   3  
ATOM 5439  H HG11 . VAL A 1 98  ? 9.023   0.057   1.586   1.00 0.00 ? 176 VAL A HG11 3  
ATOM 5440  H HG12 . VAL A 1 98  ? 8.934   1.625   0.782   1.00 0.00 ? 176 VAL A HG12 3  
ATOM 5441  H HG13 . VAL A 1 98  ? 8.162   0.214   0.056   1.00 0.00 ? 176 VAL A HG13 3  
ATOM 5442  H HG21 . VAL A 1 98  ? 11.271  0.072   1.769   1.00 0.00 ? 176 VAL A HG21 3  
ATOM 5443  H HG22 . VAL A 1 98  ? 12.334  -0.152  0.380   1.00 0.00 ? 176 VAL A HG22 3  
ATOM 5444  H HG23 . VAL A 1 98  ? 11.778  1.464   0.813   1.00 0.00 ? 176 VAL A HG23 3  
ATOM 5445  N N    . PRO A 1 99  ? 8.360   -2.402  -1.636  1.00 0.00 ? 177 PRO A N    3  
ATOM 5446  C CA   . PRO A 1 99  ? 7.224   -2.646  -2.530  1.00 0.00 ? 177 PRO A CA   3  
ATOM 5447  C C    . PRO A 1 99  ? 6.045   -1.726  -2.234  1.00 0.00 ? 177 PRO A C    3  
ATOM 5448  O O    . PRO A 1 99  ? 6.005   -1.038  -1.214  1.00 0.00 ? 177 PRO A O    3  
ATOM 5449  C CB   . PRO A 1 99  ? 6.852   -4.103  -2.241  1.00 0.00 ? 177 PRO A CB   3  
ATOM 5450  C CG   . PRO A 1 99  ? 7.333   -4.349  -0.853  1.00 0.00 ? 177 PRO A CG   3  
ATOM 5451  C CD   . PRO A 1 99  ? 8.571   -3.510  -0.689  1.00 0.00 ? 177 PRO A CD   3  
ATOM 5452  H HA   . PRO A 1 99  ? 7.507   -2.544  -3.567  1.00 0.00 ? 177 PRO A HA   3  
ATOM 5453  H HB2  . PRO A 1 99  ? 5.781   -4.225  -2.317  1.00 0.00 ? 177 PRO A HB2  3  
ATOM 5454  H HB3  . PRO A 1 99  ? 7.345   -4.751  -2.950  1.00 0.00 ? 177 PRO A HB3  3  
ATOM 5455  H HG2  . PRO A 1 99  ? 6.578   -4.046  -0.144  1.00 0.00 ? 177 PRO A HG2  3  
ATOM 5456  H HG3  . PRO A 1 99  ? 7.570   -5.395  -0.727  1.00 0.00 ? 177 PRO A HG3  3  
ATOM 5457  H HD2  . PRO A 1 99  ? 8.646   -3.143  0.324   1.00 0.00 ? 177 PRO A HD2  3  
ATOM 5458  H HD3  . PRO A 1 99  ? 9.450   -4.079  -0.952  1.00 0.00 ? 177 PRO A HD3  3  
ATOM 5459  N N    . PRO A 1 100 ? 5.061   -1.712  -3.145  1.00 0.00 ? 178 PRO A N    3  
ATOM 5460  C CA   . PRO A 1 100 ? 3.862   -0.882  -3.002  1.00 0.00 ? 178 PRO A CA   3  
ATOM 5461  C C    . PRO A 1 100 ? 2.950   -1.368  -1.880  1.00 0.00 ? 178 PRO A C    3  
ATOM 5462  O O    . PRO A 1 100 ? 2.648   -2.558  -1.785  1.00 0.00 ? 178 PRO A O    3  
ATOM 5463  C CB   . PRO A 1 100 ? 3.166   -1.027  -4.358  1.00 0.00 ? 178 PRO A CB   3  
ATOM 5464  C CG   . PRO A 1 100 ? 3.635   -2.339  -4.885  1.00 0.00 ? 178 PRO A CG   3  
ATOM 5465  C CD   . PRO A 1 100 ? 5.042   -2.507  -4.384  1.00 0.00 ? 178 PRO A CD   3  
ATOM 5466  H HA   . PRO A 1 100 ? 4.115   0.155   -2.835  1.00 0.00 ? 178 PRO A HA   3  
ATOM 5467  H HB2  . PRO A 1 100 ? 2.094   -1.017  -4.218  1.00 0.00 ? 178 PRO A HB2  3  
ATOM 5468  H HB3  . PRO A 1 100 ? 3.458   -0.214  -5.005  1.00 0.00 ? 178 PRO A HB3  3  
ATOM 5469  H HG2  . PRO A 1 100 ? 3.006   -3.132  -4.510  1.00 0.00 ? 178 PRO A HG2  3  
ATOM 5470  H HG3  . PRO A 1 100 ? 3.621   -2.326  -5.965  1.00 0.00 ? 178 PRO A HG3  3  
ATOM 5471  H HD2  . PRO A 1 100 ? 5.248   -3.547  -4.178  1.00 0.00 ? 178 PRO A HD2  3  
ATOM 5472  H HD3  . PRO A 1 100 ? 5.748   -2.117  -5.102  1.00 0.00 ? 178 PRO A HD3  3  
ATOM 5473  N N    . ILE A 1 101 ? 2.514   -0.440  -1.035  1.00 0.00 ? 179 ILE A N    3  
ATOM 5474  C CA   . ILE A 1 101 ? 1.635   -0.775  0.079   1.00 0.00 ? 179 ILE A CA   3  
ATOM 5475  C C    . ILE A 1 101 ? 0.169   -0.634  -0.316  1.00 0.00 ? 179 ILE A C    3  
ATOM 5476  O O    . ILE A 1 101 ? -0.272  0.436   -0.736  1.00 0.00 ? 179 ILE A O    3  
ATOM 5477  C CB   . ILE A 1 101 ? 1.913   0.117   1.303   1.00 0.00 ? 179 ILE A CB   3  
ATOM 5478  C CG1  . ILE A 1 101 ? 3.341   -0.101  1.807   1.00 0.00 ? 179 ILE A CG1  3  
ATOM 5479  C CG2  . ILE A 1 101 ? 0.907   -0.170  2.408   1.00 0.00 ? 179 ILE A CG2  3  
ATOM 5480  C CD1  . ILE A 1 101 ? 3.860   1.032   2.664   1.00 0.00 ? 179 ILE A CD1  3  
ATOM 5481  H H    . ILE A 1 101 ? 2.789   0.491   -1.163  1.00 0.00 ? 179 ILE A H    3  
ATOM 5482  H HA   . ILE A 1 101 ? 1.825   -1.802  0.356   1.00 0.00 ? 179 ILE A HA   3  
ATOM 5483  H HB   . ILE A 1 101 ? 1.798   1.148   1.004   1.00 0.00 ? 179 ILE A HB   3  
ATOM 5484  H HG12 . ILE A 1 101 ? 3.375   -1.004  2.396   1.00 0.00 ? 179 ILE A HG12 3  
ATOM 5485  H HG13 . ILE A 1 101 ? 4.002   -0.206  0.958   1.00 0.00 ? 179 ILE A HG13 3  
ATOM 5486  H HG21 . ILE A 1 101 ? 0.114   -0.793  2.019   1.00 0.00 ? 179 ILE A HG21 3  
ATOM 5487  H HG22 . ILE A 1 101 ? 1.401   -0.682  3.220   1.00 0.00 ? 179 ILE A HG22 3  
ATOM 5488  H HG23 . ILE A 1 101 ? 0.491   0.759   2.767   1.00 0.00 ? 179 ILE A HG23 3  
ATOM 5489  H HD11 . ILE A 1 101 ? 3.068   1.393   3.303   1.00 0.00 ? 179 ILE A HD11 3  
ATOM 5490  H HD12 . ILE A 1 101 ? 4.681   0.680   3.270   1.00 0.00 ? 179 ILE A HD12 3  
ATOM 5491  H HD13 . ILE A 1 101 ? 4.202   1.837   2.028   1.00 0.00 ? 179 ILE A HD13 3  
ATOM 5492  N N    . VAL A 1 102 ? -0.583  -1.721  -0.177  1.00 0.00 ? 180 VAL A N    3  
ATOM 5493  C CA   . VAL A 1 102 ? -2.001  -1.719  -0.516  1.00 0.00 ? 180 VAL A CA   3  
ATOM 5494  C C    . VAL A 1 102 ? -2.860  -1.994  0.712   1.00 0.00 ? 180 VAL A C    3  
ATOM 5495  O O    . VAL A 1 102 ? -2.795  -3.073  1.300   1.00 0.00 ? 180 VAL A O    3  
ATOM 5496  C CB   . VAL A 1 102 ? -2.321  -2.768  -1.598  1.00 0.00 ? 180 VAL A CB   3  
ATOM 5497  C CG1  . VAL A 1 102 ? -3.790  -2.703  -1.986  1.00 0.00 ? 180 VAL A CG1  3  
ATOM 5498  C CG2  . VAL A 1 102 ? -1.430  -2.566  -2.815  1.00 0.00 ? 180 VAL A CG2  3  
ATOM 5499  H H    . VAL A 1 102 ? -0.174  -2.545  0.163   1.00 0.00 ? 180 VAL A H    3  
ATOM 5500  H HA   . VAL A 1 102 ? -2.249  -0.742  -0.907  1.00 0.00 ? 180 VAL A HA   3  
ATOM 5501  H HB   . VAL A 1 102 ? -2.122  -3.748  -1.191  1.00 0.00 ? 180 VAL A HB   3  
ATOM 5502  H HG11 . VAL A 1 102 ? -4.399  -2.980  -1.138  1.00 0.00 ? 180 VAL A HG11 3  
ATOM 5503  H HG12 . VAL A 1 102 ? -4.037  -1.698  -2.296  1.00 0.00 ? 180 VAL A HG12 3  
ATOM 5504  H HG13 . VAL A 1 102 ? -3.977  -3.387  -2.801  1.00 0.00 ? 180 VAL A HG13 3  
ATOM 5505  H HG21 . VAL A 1 102 ? -0.814  -3.442  -2.958  1.00 0.00 ? 180 VAL A HG21 3  
ATOM 5506  H HG22 . VAL A 1 102 ? -2.045  -2.412  -3.690  1.00 0.00 ? 180 VAL A HG22 3  
ATOM 5507  H HG23 . VAL A 1 102 ? -0.800  -1.703  -2.661  1.00 0.00 ? 180 VAL A HG23 3  
ATOM 5508  N N    . PHE A 1 103 ? -3.667  -1.009  1.096   1.00 0.00 ? 181 PHE A N    3  
ATOM 5509  C CA   . PHE A 1 103 ? -4.540  -1.144  2.255   1.00 0.00 ? 181 PHE A CA   3  
ATOM 5510  C C    . PHE A 1 103 ? -5.819  -1.892  1.889   1.00 0.00 ? 181 PHE A C    3  
ATOM 5511  O O    . PHE A 1 103 ? -6.543  -1.496  0.975   1.00 0.00 ? 181 PHE A O    3  
ATOM 5512  C CB   . PHE A 1 103 ? -4.886  0.234   2.823   1.00 0.00 ? 181 PHE A CB   3  
ATOM 5513  C CG   . PHE A 1 103 ? -3.695  0.982   3.348   1.00 0.00 ? 181 PHE A CG   3  
ATOM 5514  C CD1  . PHE A 1 103 ? -2.951  0.476   4.402   1.00 0.00 ? 181 PHE A CD1  3  
ATOM 5515  C CD2  . PHE A 1 103 ? -3.318  2.192   2.788   1.00 0.00 ? 181 PHE A CD2  3  
ATOM 5516  C CE1  . PHE A 1 103 ? -1.854  1.163   4.887   1.00 0.00 ? 181 PHE A CE1  3  
ATOM 5517  C CE2  . PHE A 1 103 ? -2.222  2.884   3.268   1.00 0.00 ? 181 PHE A CE2  3  
ATOM 5518  C CZ   . PHE A 1 103 ? -1.489  2.368   4.319   1.00 0.00 ? 181 PHE A CZ   3  
ATOM 5519  H H    . PHE A 1 103 ? -3.674  -0.172  0.586   1.00 0.00 ? 181 PHE A H    3  
ATOM 5520  H HA   . PHE A 1 103 ? -4.009  -1.710  3.005   1.00 0.00 ? 181 PHE A HA   3  
ATOM 5521  H HB2  . PHE A 1 103 ? -5.337  0.832   2.046   1.00 0.00 ? 181 PHE A HB2  3  
ATOM 5522  H HB3  . PHE A 1 103 ? -5.589  0.115   3.634   1.00 0.00 ? 181 PHE A HB3  3  
ATOM 5523  H HD1  . PHE A 1 103 ? -3.235  -0.467  4.846   1.00 0.00 ? 181 PHE A HD1  3  
ATOM 5524  H HD2  . PHE A 1 103 ? -3.891  2.597   1.965   1.00 0.00 ? 181 PHE A HD2  3  
ATOM 5525  H HE1  . PHE A 1 103 ? -1.283  0.757   5.708   1.00 0.00 ? 181 PHE A HE1  3  
ATOM 5526  H HE2  . PHE A 1 103 ? -1.939  3.825   2.822   1.00 0.00 ? 181 PHE A HE2  3  
ATOM 5527  H HZ   . PHE A 1 103 ? -0.633  2.907   4.697   1.00 0.00 ? 181 PHE A HZ   3  
ATOM 5528  N N    . VAL A 1 104 ? -6.091  -2.975  2.610   1.00 0.00 ? 182 VAL A N    3  
ATOM 5529  C CA   . VAL A 1 104 ? -7.282  -3.779  2.362   1.00 0.00 ? 182 VAL A CA   3  
ATOM 5530  C C    . VAL A 1 104 ? -8.129  -3.910  3.623   1.00 0.00 ? 182 VAL A C    3  
ATOM 5531  O O    . VAL A 1 104 ? -7.602  -4.107  4.717   1.00 0.00 ? 182 VAL A O    3  
ATOM 5532  C CB   . VAL A 1 104 ? -6.915  -5.186  1.855   1.00 0.00 ? 182 VAL A CB   3  
ATOM 5533  C CG1  . VAL A 1 104 ? -8.166  -6.030  1.669   1.00 0.00 ? 182 VAL A CG1  3  
ATOM 5534  C CG2  . VAL A 1 104 ? -6.125  -5.095  0.558   1.00 0.00 ? 182 VAL A CG2  3  
ATOM 5535  H H    . VAL A 1 104 ? -5.476  -3.240  3.325   1.00 0.00 ? 182 VAL A H    3  
ATOM 5536  H HA   . VAL A 1 104 ? -7.866  -3.285  1.598   1.00 0.00 ? 182 VAL A HA   3  
ATOM 5537  H HB   . VAL A 1 104 ? -6.293  -5.663  2.598   1.00 0.00 ? 182 VAL A HB   3  
ATOM 5538  H HG11 . VAL A 1 104 ? -7.935  -6.884  1.049   1.00 0.00 ? 182 VAL A HG11 3  
ATOM 5539  H HG12 . VAL A 1 104 ? -8.520  -6.369  2.632   1.00 0.00 ? 182 VAL A HG12 3  
ATOM 5540  H HG13 . VAL A 1 104 ? -8.933  -5.437  1.192   1.00 0.00 ? 182 VAL A HG13 3  
ATOM 5541  H HG21 . VAL A 1 104 ? -5.186  -5.616  0.673   1.00 0.00 ? 182 VAL A HG21 3  
ATOM 5542  H HG22 . VAL A 1 104 ? -6.692  -5.548  -0.242  1.00 0.00 ? 182 VAL A HG22 3  
ATOM 5543  H HG23 . VAL A 1 104 ? -5.936  -4.059  0.323   1.00 0.00 ? 182 VAL A HG23 3  
ATOM 5544  N N    . GLN A 1 105 ? -9.444  -3.798  3.461   1.00 0.00 ? 183 GLN A N    3  
ATOM 5545  C CA   . GLN A 1 105 ? -10.363 -3.904  4.587   1.00 0.00 ? 183 GLN A CA   3  
ATOM 5546  C C    . GLN A 1 105 ? -10.466 -5.346  5.073   1.00 0.00 ? 183 GLN A C    3  
ATOM 5547  O O    . GLN A 1 105 ? -10.716 -6.260  4.287   1.00 0.00 ? 183 GLN A O    3  
ATOM 5548  C CB   . GLN A 1 105 ? -11.748 -3.387  4.193   1.00 0.00 ? 183 GLN A CB   3  
ATOM 5549  C CG   . GLN A 1 105 ? -11.779 -1.896  3.896   1.00 0.00 ? 183 GLN A CG   3  
ATOM 5550  C CD   . GLN A 1 105 ? -11.504 -1.586  2.438   1.00 0.00 ? 183 GLN A CD   3  
ATOM 5551  O OE1  . GLN A 1 105 ? -10.470 -1.009  2.098   1.00 0.00 ? 183 GLN A OE1  3  
ATOM 5552  N NE2  . GLN A 1 105 ? -12.429 -1.968  1.566   1.00 0.00 ? 183 GLN A NE2  3  
ATOM 5553  H H    . GLN A 1 105 ? -9.803  -3.641  2.563   1.00 0.00 ? 183 GLN A H    3  
ATOM 5554  H HA   . GLN A 1 105 ? -9.977  -3.294  5.389   1.00 0.00 ? 183 GLN A HA   3  
ATOM 5555  H HB2  . GLN A 1 105 ? -12.078 -3.915  3.311   1.00 0.00 ? 183 GLN A HB2  3  
ATOM 5556  H HB3  . GLN A 1 105 ? -12.437 -3.585  5.001   1.00 0.00 ? 183 GLN A HB3  3  
ATOM 5557  H HG2  . GLN A 1 105 ? -12.755 -1.511  4.151   1.00 0.00 ? 183 GLN A HG2  3  
ATOM 5558  H HG3  . GLN A 1 105 ? -11.030 -1.407  4.501   1.00 0.00 ? 183 GLN A HG3  3  
ATOM 5559  H HE21 . GLN A 1 105 ? -13.228 -2.422  1.909   1.00 0.00 ? 183 GLN A HE21 3  
ATOM 5560  H HE22 . GLN A 1 105 ? -12.278 -1.780  0.617   1.00 0.00 ? 183 GLN A HE22 3  
ATOM 5561  N N    . ASP A 1 106 ? -10.270 -5.543  6.372   1.00 0.00 ? 184 ASP A N    3  
ATOM 5562  C CA   . ASP A 1 106 ? -10.341 -6.874  6.963   1.00 0.00 ? 184 ASP A CA   3  
ATOM 5563  C C    . ASP A 1 106 ? -11.753 -7.441  6.858   1.00 0.00 ? 184 ASP A C    3  
ATOM 5564  O O    . ASP A 1 106 ? -11.971 -8.487  6.247   1.00 0.00 ? 184 ASP A O    3  
ATOM 5565  C CB   . ASP A 1 106 ? -9.903  -6.829  8.428   1.00 0.00 ? 184 ASP A CB   3  
ATOM 5566  C CG   . ASP A 1 106 ? -10.508 -7.952  9.248   1.00 0.00 ? 184 ASP A CG   3  
ATOM 5567  O OD1  . ASP A 1 106 ? -10.039 -9.102  9.114   1.00 0.00 ? 184 ASP A OD1  3  
ATOM 5568  O OD2  . ASP A 1 106 ? -11.448 -7.681  10.023  1.00 0.00 ? 184 ASP A OD2  3  
ATOM 5569  H H    . ASP A 1 106 ? -10.074 -4.774  6.948   1.00 0.00 ? 184 ASP A H    3  
ATOM 5570  H HA   . ASP A 1 106 ? -9.668  -7.516  6.416   1.00 0.00 ? 184 ASP A HA   3  
ATOM 5571  H HB2  . ASP A 1 106 ? -8.827  -6.910  8.478   1.00 0.00 ? 184 ASP A HB2  3  
ATOM 5572  H HB3  . ASP A 1 106 ? -10.210 -5.887  8.860   1.00 0.00 ? 184 ASP A HB3  3  
ATOM 5573  N N    . LYS A 1 107 ? -12.711 -6.743  7.460   1.00 0.00 ? 185 LYS A N    3  
ATOM 5574  C CA   . LYS A 1 107 ? -14.103 -7.175  7.435   1.00 0.00 ? 185 LYS A CA   3  
ATOM 5575  C C    . LYS A 1 107 ? -14.827 -6.609  6.217   1.00 0.00 ? 185 LYS A C    3  
ATOM 5576  O O    . LYS A 1 107 ? -15.355 -7.355  5.394   1.00 0.00 ? 185 LYS A O    3  
ATOM 5577  C CB   . LYS A 1 107 ? -14.818 -6.738  8.715   1.00 0.00 ? 185 LYS A CB   3  
ATOM 5578  C CG   . LYS A 1 107 ? -14.740 -7.761  9.835   1.00 0.00 ? 185 LYS A CG   3  
ATOM 5579  C CD   . LYS A 1 107 ? -14.858 -7.104  11.200  1.00 0.00 ? 185 LYS A CD   3  
ATOM 5580  C CE   . LYS A 1 107 ? -16.300 -6.745  11.523  1.00 0.00 ? 185 LYS A CE   3  
ATOM 5581  N NZ   . LYS A 1 107 ? -16.392 -5.778  12.652  1.00 0.00 ? 185 LYS A NZ   3  
ATOM 5582  H H    . LYS A 1 107 ? -12.476 -5.916  7.931   1.00 0.00 ? 185 LYS A H    3  
ATOM 5583  H HA   . LYS A 1 107 ? -14.115 -8.253  7.376   1.00 0.00 ? 185 LYS A HA   3  
ATOM 5584  H HB2  . LYS A 1 107 ? -14.373 -5.817  9.065   1.00 0.00 ? 185 LYS A HB2  3  
ATOM 5585  H HB3  . LYS A 1 107 ? -15.860 -6.561  8.490   1.00 0.00 ? 185 LYS A HB3  3  
ATOM 5586  H HG2  . LYS A 1 107 ? -15.545 -8.471  9.719   1.00 0.00 ? 185 LYS A HG2  3  
ATOM 5587  H HG3  . LYS A 1 107 ? -13.792 -8.276  9.774   1.00 0.00 ? 185 LYS A HG3  3  
ATOM 5588  H HD2  . LYS A 1 107 ? -14.492 -7.787  11.952  1.00 0.00 ? 185 LYS A HD2  3  
ATOM 5589  H HD3  . LYS A 1 107 ? -14.261 -6.202  11.209  1.00 0.00 ? 185 LYS A HD3  3  
ATOM 5590  H HE2  . LYS A 1 107 ? -16.754 -6.307  10.647  1.00 0.00 ? 185 LYS A HE2  3  
ATOM 5591  H HE3  . LYS A 1 107 ? -16.830 -7.647  11.790  1.00 0.00 ? 185 LYS A HE3  3  
ATOM 5592  H HZ1  . LYS A 1 107 ? -16.404 -4.804  12.287  1.00 0.00 ? 185 LYS A HZ1  3  
ATOM 5593  H HZ2  . LYS A 1 107 ? -15.574 -5.888  13.284  1.00 0.00 ? 185 LYS A HZ2  3  
ATOM 5594  H HZ3  . LYS A 1 107 ? -17.263 -5.944  13.196  1.00 0.00 ? 185 LYS A HZ3  3  
ATOM 5595  N N    . GLY A 1 108 ? -14.847 -5.284  6.109   1.00 0.00 ? 186 GLY A N    3  
ATOM 5596  C CA   . GLY A 1 108 ? -15.507 -4.640  4.989   1.00 0.00 ? 186 GLY A CA   3  
ATOM 5597  C C    . GLY A 1 108 ? -17.011 -4.824  5.019   1.00 0.00 ? 186 GLY A C    3  
ATOM 5598  O O    . GLY A 1 108 ? -17.741 -3.951  5.486   1.00 0.00 ? 186 GLY A O    3  
ATOM 5599  H H    . GLY A 1 108 ? -14.409 -4.738  6.796   1.00 0.00 ? 186 GLY A H    3  
ATOM 5600  H HA2  . GLY A 1 108 ? -15.283 -3.584  5.011   1.00 0.00 ? 186 GLY A HA2  3  
ATOM 5601  H HA3  . GLY A 1 108 ? -15.123 -5.060  4.070   1.00 0.00 ? 186 GLY A HA3  3  
ATOM 5602  N N    . ASN A 1 109 ? -17.477 -5.964  4.517   1.00 0.00 ? 187 ASN A N    3  
ATOM 5603  C CA   . ASN A 1 109 ? -18.905 -6.258  4.486   1.00 0.00 ? 187 ASN A CA   3  
ATOM 5604  C C    . ASN A 1 109 ? -19.183 -7.659  5.023   1.00 0.00 ? 187 ASN A C    3  
ATOM 5605  O O    . ASN A 1 109 ? -18.801 -8.656  4.411   1.00 0.00 ? 187 ASN A O    3  
ATOM 5606  C CB   . ASN A 1 109 ? -19.442 -6.131  3.059   1.00 0.00 ? 187 ASN A CB   3  
ATOM 5607  C CG   . ASN A 1 109 ? -20.952 -6.259  2.997   1.00 0.00 ? 187 ASN A CG   3  
ATOM 5608  O OD1  . ASN A 1 109 ? -21.500 -7.352  3.140   1.00 0.00 ? 187 ASN A OD1  3  
ATOM 5609  N ND2  . ASN A 1 109 ? -21.632 -5.139  2.781   1.00 0.00 ? 187 ASN A ND2  3  
ATOM 5610  H H    . ASN A 1 109 ? -16.845 -6.622  4.158   1.00 0.00 ? 187 ASN A H    3  
ATOM 5611  H HA   . ASN A 1 109 ? -19.405 -5.538  5.115   1.00 0.00 ? 187 ASN A HA   3  
ATOM 5612  H HB2  . ASN A 1 109 ? -19.166 -5.165  2.661   1.00 0.00 ? 187 ASN A HB2  3  
ATOM 5613  H HB3  . ASN A 1 109 ? -19.008 -6.906  2.446   1.00 0.00 ? 187 ASN A HB3  3  
ATOM 5614  H HD21 . ASN A 1 109 ? -21.129 -4.304  2.676   1.00 0.00 ? 187 ASN A HD21 3  
ATOM 5615  H HD22 . ASN A 1 109 ? -22.610 -5.192  2.737   1.00 0.00 ? 187 ASN A HD22 3  
ATOM 5616  N N    . ALA A 1 110 ? -19.850 -7.725  6.170   1.00 0.00 ? 188 ALA A N    3  
ATOM 5617  C CA   . ALA A 1 110 ? -20.182 -9.003  6.789   1.00 0.00 ? 188 ALA A CA   3  
ATOM 5618  C C    . ALA A 1 110 ? -21.673 -9.299  6.671   1.00 0.00 ? 188 ALA A C    3  
ATOM 5619  O O    . ALA A 1 110 ? -22.069 -10.403 6.300   1.00 0.00 ? 188 ALA A O    3  
ATOM 5620  C CB   . ALA A 1 110 ? -19.754 -9.009  8.249   1.00 0.00 ? 188 ALA A CB   3  
ATOM 5621  H H    . ALA A 1 110 ? -20.128 -6.895  6.611   1.00 0.00 ? 188 ALA A H    3  
ATOM 5622  H HA   . ALA A 1 110 ? -19.630 -9.776  6.274   1.00 0.00 ? 188 ALA A HA   3  
ATOM 5623  H HB1  . ALA A 1 110 ? -19.768 -7.999  8.632   1.00 0.00 ? 188 ALA A HB1  3  
ATOM 5624  H HB2  . ALA A 1 110 ? -20.435 -9.621  8.821   1.00 0.00 ? 188 ALA A HB2  3  
ATOM 5625  H HB3  . ALA A 1 110 ? -18.755 -9.411  8.329   1.00 0.00 ? 188 ALA A HB3  3  
ATOM 5626  N N    . ALA A 1 111 ? -22.496 -8.305  6.991   1.00 0.00 ? 189 ALA A N    3  
ATOM 5627  C CA   . ALA A 1 111 ? -23.944 -8.459  6.920   1.00 0.00 ? 189 ALA A CA   3  
ATOM 5628  C C    . ALA A 1 111 ? -24.495 -7.873  5.625   1.00 0.00 ? 189 ALA A C    3  
ATOM 5629  O O    . ALA A 1 111 ? -24.896 -6.709  5.579   1.00 0.00 ? 189 ALA A O    3  
ATOM 5630  C CB   . ALA A 1 111 ? -24.604 -7.801  8.123   1.00 0.00 ? 189 ALA A CB   3  
ATOM 5631  H H    . ALA A 1 111 ? -22.120 -7.448  7.281   1.00 0.00 ? 189 ALA A H    3  
ATOM 5632  H HA   . ALA A 1 111 ? -24.169 -9.516  6.951   1.00 0.00 ? 189 ALA A HA   3  
ATOM 5633  H HB1  . ALA A 1 111 ? -25.600 -8.201  8.249   1.00 0.00 ? 189 ALA A HB1  3  
ATOM 5634  H HB2  . ALA A 1 111 ? -24.020 -8.001  9.008   1.00 0.00 ? 189 ALA A HB2  3  
ATOM 5635  H HB3  . ALA A 1 111 ? -24.662 -6.735  7.963   1.00 0.00 ? 189 ALA A HB3  3  
ATOM 5636  N N    . LEU A 1 112 ? -24.513 -8.686  4.574   1.00 0.00 ? 190 LEU A N    3  
ATOM 5637  C CA   . LEU A 1 112 ? -25.015 -8.248  3.277   1.00 0.00 ? 190 LEU A CA   3  
ATOM 5638  C C    . LEU A 1 112 ? -26.506 -7.935  3.347   1.00 0.00 ? 190 LEU A C    3  
ATOM 5639  O O    . LEU A 1 112 ? -27.183 -8.304  4.306   1.00 0.00 ? 190 LEU A O    3  
ATOM 5640  C CB   . LEU A 1 112 ? -24.758 -9.322  2.219   1.00 0.00 ? 190 LEU A CB   3  
ATOM 5641  C CG   . LEU A 1 112 ? -23.344 -9.368  1.638   1.00 0.00 ? 190 LEU A CG   3  
ATOM 5642  C CD1  . LEU A 1 112 ? -23.012 -10.769 1.151   1.00 0.00 ? 190 LEU A CD1  3  
ATOM 5643  C CD2  . LEU A 1 112 ? -23.198 -8.359  0.508   1.00 0.00 ? 190 LEU A CD2  3  
ATOM 5644  H H    . LEU A 1 112 ? -24.181 -9.602  4.672   1.00 0.00 ? 190 LEU A H    3  
ATOM 5645  H HA   . LEU A 1 112 ? -24.483 -7.349  3.002   1.00 0.00 ? 190 LEU A HA   3  
ATOM 5646  H HB2  . LEU A 1 112 ? -24.962 -10.283 2.666   1.00 0.00 ? 190 LEU A HB2  3  
ATOM 5647  H HB3  . LEU A 1 112 ? -25.446 -9.154  1.403   1.00 0.00 ? 190 LEU A HB3  3  
ATOM 5648  H HG   . LEU A 1 112 ? -22.635 -9.108  2.413   1.00 0.00 ? 190 LEU A HG   3  
ATOM 5649  H HD11 . LEU A 1 112 ? -23.905 -11.375 1.160   1.00 0.00 ? 190 LEU A HD11 3  
ATOM 5650  H HD12 . LEU A 1 112 ? -22.271 -11.211 1.801   1.00 0.00 ? 190 LEU A HD12 3  
ATOM 5651  H HD13 . LEU A 1 112 ? -22.621 -10.717 0.145   1.00 0.00 ? 190 LEU A HD13 3  
ATOM 5652  H HD21 . LEU A 1 112 ? -24.092 -8.369  -0.099  1.00 0.00 ? 190 LEU A HD21 3  
ATOM 5653  H HD22 . LEU A 1 112 ? -22.346 -8.623  -0.102  1.00 0.00 ? 190 LEU A HD22 3  
ATOM 5654  H HD23 . LEU A 1 112 ? -23.055 -7.373  0.922   1.00 0.00 ? 190 LEU A HD23 3  
ATOM 5655  N N    . ALA A 1 113 ? -27.012 -7.253  2.324   1.00 0.00 ? 191 ALA A N    3  
ATOM 5656  C CA   . ALA A 1 113 ? -28.423 -6.894  2.268   1.00 0.00 ? 191 ALA A CA   3  
ATOM 5657  C C    . ALA A 1 113 ? -29.230 -7.952  1.522   1.00 0.00 ? 191 ALA A C    3  
ATOM 5658  O O    . ALA A 1 113 ? -28.665 -8.853  0.903   1.00 0.00 ? 191 ALA A O    3  
ATOM 5659  C CB   . ALA A 1 113 ? -28.596 -5.534  1.609   1.00 0.00 ? 191 ALA A CB   3  
ATOM 5660  H H    . ALA A 1 113 ? -26.421 -6.987  1.589   1.00 0.00 ? 191 ALA A H    3  
ATOM 5661  H HA   . ALA A 1 113 ? -28.791 -6.825  3.282   1.00 0.00 ? 191 ALA A HA   3  
ATOM 5662  H HB1  . ALA A 1 113 ? -28.314 -5.601  0.568   1.00 0.00 ? 191 ALA A HB1  3  
ATOM 5663  H HB2  . ALA A 1 113 ? -29.629 -5.227  1.684   1.00 0.00 ? 191 ALA A HB2  3  
ATOM 5664  H HB3  . ALA A 1 113 ? -27.968 -4.811  2.107   1.00 0.00 ? 191 ALA A HB3  3  
ATOM 5665  N N    . GLU A 1 114 ? -30.552 -7.836  1.587   1.00 0.00 ? 192 GLU A N    3  
ATOM 5666  C CA   . GLU A 1 114 ? -31.435 -8.784  0.918   1.00 0.00 ? 192 GLU A CA   3  
ATOM 5667  C C    . GLU A 1 114 ? -32.342 -8.072  -0.081  1.00 0.00 ? 192 GLU A C    3  
ATOM 5668  O O    . GLU A 1 114 ? -33.534 -8.369  -0.176  1.00 0.00 ? 192 GLU A O    3  
ATOM 5669  C CB   . GLU A 1 114 ? -32.282 -9.538  1.945   1.00 0.00 ? 192 GLU A CB   3  
ATOM 5670  C CG   . GLU A 1 114 ? -31.461 -10.349 2.934   1.00 0.00 ? 192 GLU A CG   3  
ATOM 5671  C CD   . GLU A 1 114 ? -32.185 -10.574 4.247   1.00 0.00 ? 192 GLU A CD   3  
ATOM 5672  O OE1  . GLU A 1 114 ? -32.611 -9.578  4.868   1.00 0.00 ? 192 GLU A OE1  3  
ATOM 5673  O OE2  . GLU A 1 114 ? -32.325 -11.746 4.654   1.00 0.00 ? 192 GLU A OE2  3  
ATOM 5674  H H    . GLU A 1 114 ? -30.943 -7.096  2.097   1.00 0.00 ? 192 GLU A H    3  
ATOM 5675  H HA   . GLU A 1 114 ? -30.819 -9.492  0.385   1.00 0.00 ? 192 GLU A HA   3  
ATOM 5676  H HB2  . GLU A 1 114 ? -32.874 -8.825  2.500   1.00 0.00 ? 192 GLU A HB2  3  
ATOM 5677  H HB3  . GLU A 1 114 ? -32.945 -10.212 1.422   1.00 0.00 ? 192 GLU A HB3  3  
ATOM 5678  H HG2  . GLU A 1 114 ? -31.239 -11.310 2.495   1.00 0.00 ? 192 GLU A HG2  3  
ATOM 5679  H HG3  . GLU A 1 114 ? -30.539 -9.824  3.133   1.00 0.00 ? 192 GLU A HG3  3  
ATOM 5680  N N    . LEU A 1 115 ? -31.770 -7.130  -0.823  1.00 0.00 ? 193 LEU A N    3  
ATOM 5681  C CA   . LEU A 1 115 ? -32.526 -6.374  -1.815  1.00 0.00 ? 193 LEU A CA   3  
ATOM 5682  C C    . LEU A 1 115 ? -33.342 -7.306  -2.705  1.00 0.00 ? 193 LEU A C    3  
ATOM 5683  O O    . LEU A 1 115 ? -32.833 -8.312  -3.200  1.00 0.00 ? 193 LEU A O    3  
ATOM 5684  C CB   . LEU A 1 115 ? -31.580 -5.532  -2.673  1.00 0.00 ? 193 LEU A CB   3  
ATOM 5685  C CG   . LEU A 1 115 ? -31.102 -6.175  -3.975  1.00 0.00 ? 193 LEU A CG   3  
ATOM 5686  C CD1  . LEU A 1 115 ? -32.202 -6.139  -5.024  1.00 0.00 ? 193 LEU A CD1  3  
ATOM 5687  C CD2  . LEU A 1 115 ? -29.851 -5.476  -4.487  1.00 0.00 ? 193 LEU A CD2  3  
ATOM 5688  H H    . LEU A 1 115 ? -30.817 -6.939  -0.702  1.00 0.00 ? 193 LEU A H    3  
ATOM 5689  H HA   . LEU A 1 115 ? -33.201 -5.717  -1.287  1.00 0.00 ? 193 LEU A HA   3  
ATOM 5690  H HB2  . LEU A 1 115 ? -32.090 -4.615  -2.925  1.00 0.00 ? 193 LEU A HB2  3  
ATOM 5691  H HB3  . LEU A 1 115 ? -30.708 -5.304  -2.075  1.00 0.00 ? 193 LEU A HB3  3  
ATOM 5692  H HG   . LEU A 1 115 ? -30.854 -7.211  -3.787  1.00 0.00 ? 193 LEU A HG   3  
ATOM 5693  H HD11 . LEU A 1 115 ? -32.285 -7.107  -5.493  1.00 0.00 ? 193 LEU A HD11 3  
ATOM 5694  H HD12 . LEU A 1 115 ? -31.962 -5.396  -5.771  1.00 0.00 ? 193 LEU A HD12 3  
ATOM 5695  H HD13 . LEU A 1 115 ? -33.140 -5.885  -4.553  1.00 0.00 ? 193 LEU A HD13 3  
ATOM 5696  H HD21 . LEU A 1 115 ? -29.014 -6.157  -4.439  1.00 0.00 ? 193 LEU A HD21 3  
ATOM 5697  H HD22 . LEU A 1 115 ? -29.645 -4.611  -3.874  1.00 0.00 ? 193 LEU A HD22 3  
ATOM 5698  H HD23 . LEU A 1 115 ? -30.005 -5.166  -5.509  1.00 0.00 ? 193 LEU A HD23 3  
ATOM 5699  N N    . ASP A 1 116 ? -34.610 -6.964  -2.905  1.00 0.00 ? 194 ASP A N    3  
ATOM 5700  C CA   . ASP A 1 116 ? -35.497 -7.769  -3.738  1.00 0.00 ? 194 ASP A CA   3  
ATOM 5701  C C    . ASP A 1 116 ? -36.171 -6.909  -4.802  1.00 0.00 ? 194 ASP A C    3  
ATOM 5702  O O    . ASP A 1 116 ? -36.619 -5.797  -4.523  1.00 0.00 ? 194 ASP A O    3  
ATOM 5703  C CB   . ASP A 1 116 ? -36.556 -8.458  -2.875  1.00 0.00 ? 194 ASP A CB   3  
ATOM 5704  C CG   . ASP A 1 116 ? -35.997 -9.638  -2.105  1.00 0.00 ? 194 ASP A CG   3  
ATOM 5705  O OD1  . ASP A 1 116 ? -35.385 -10.523 -2.739  1.00 0.00 ? 194 ASP A OD1  3  
ATOM 5706  O OD2  . ASP A 1 116 ? -36.172 -9.677  -0.869  1.00 0.00 ? 194 ASP A OD2  3  
ATOM 5707  H H    . ASP A 1 116 ? -34.959 -6.151  -2.483  1.00 0.00 ? 194 ASP A H    3  
ATOM 5708  H HA   . ASP A 1 116 ? -34.899 -8.522  -4.227  1.00 0.00 ? 194 ASP A HA   3  
ATOM 5709  H HB2  . ASP A 1 116 ? -36.953 -7.746  -2.167  1.00 0.00 ? 194 ASP A HB2  3  
ATOM 5710  H HB3  . ASP A 1 116 ? -37.354 -8.811  -3.511  1.00 0.00 ? 194 ASP A HB3  3  
ATOM 5711  N N    . GLN A 1 117 ? -36.238 -7.432  -6.023  1.00 0.00 ? 195 GLN A N    3  
ATOM 5712  C CA   . GLN A 1 117 ? -36.856 -6.710  -7.129  1.00 0.00 ? 195 GLN A CA   3  
ATOM 5713  C C    . GLN A 1 117 ? -38.363 -6.944  -7.158  1.00 0.00 ? 195 GLN A C    3  
ATOM 5714  O O    . GLN A 1 117 ? -38.823 -8.068  -7.363  1.00 0.00 ? 195 GLN A O    3  
ATOM 5715  C CB   . GLN A 1 117 ? -36.235 -7.144  -8.458  1.00 0.00 ? 195 GLN A CB   3  
ATOM 5716  C CG   . GLN A 1 117 ? -36.817 -6.425  -9.664  1.00 0.00 ? 195 GLN A CG   3  
ATOM 5717  C CD   . GLN A 1 117 ? -36.418 -4.963  -9.721  1.00 0.00 ? 195 GLN A CD   3  
ATOM 5718  O OE1  . GLN A 1 117 ? -36.075 -4.362  -8.702  1.00 0.00 ? 195 GLN A OE1  3  
ATOM 5719  N NE2  . GLN A 1 117 ? -36.460 -4.383  -10.914 1.00 0.00 ? 195 GLN A NE2  3  
ATOM 5720  H H    . GLN A 1 117 ? -35.863 -8.322  -6.182  1.00 0.00 ? 195 GLN A H    3  
ATOM 5721  H HA   . GLN A 1 117 ? -36.670 -5.657  -6.982  1.00 0.00 ? 195 GLN A HA   3  
ATOM 5722  H HB2  . GLN A 1 117 ? -35.174 -6.949  -8.427  1.00 0.00 ? 195 GLN A HB2  3  
ATOM 5723  H HB3  . GLN A 1 117 ? -36.395 -8.204  -8.587  1.00 0.00 ? 195 GLN A HB3  3  
ATOM 5724  H HG2  . GLN A 1 117 ? -36.465 -6.912  -10.562 1.00 0.00 ? 195 GLN A HG2  3  
ATOM 5725  H HG3  . GLN A 1 117 ? -37.894 -6.488  -9.620  1.00 0.00 ? 195 GLN A HG3  3  
ATOM 5726  H HE21 . GLN A 1 117 ? -36.744 -4.924  -11.682 1.00 0.00 ? 195 GLN A HE21 3  
ATOM 5727  H HE22 . GLN A 1 117 ? -36.209 -3.439  -10.980 1.00 0.00 ? 195 GLN A HE22 3  
ATOM 5728  N N    . LEU A 1 118 ? -39.126 -5.877  -6.950  1.00 0.00 ? 196 LEU A N    3  
ATOM 5729  C CA   . LEU A 1 118 ? -40.582 -5.966  -6.952  1.00 0.00 ? 196 LEU A CA   3  
ATOM 5730  C C    . LEU A 1 118 ? -41.176 -5.151  -8.096  1.00 0.00 ? 196 LEU A C    3  
ATOM 5731  O O    . LEU A 1 118 ? -40.510 -4.287  -8.669  1.00 0.00 ? 196 LEU A O    3  
ATOM 5732  C CB   . LEU A 1 118 ? -41.144 -5.476  -5.616  1.00 0.00 ? 196 LEU A CB   3  
ATOM 5733  C CG   . LEU A 1 118 ? -41.073 -6.467  -4.454  1.00 0.00 ? 196 LEU A CG   3  
ATOM 5734  C CD1  . LEU A 1 118 ? -41.104 -5.732  -3.123  1.00 0.00 ? 196 LEU A CD1  3  
ATOM 5735  C CD2  . LEU A 1 118 ? -42.213 -7.471  -4.538  1.00 0.00 ? 196 LEU A CD2  3  
ATOM 5736  H H    . LEU A 1 118 ? -38.702 -5.009  -6.792  1.00 0.00 ? 196 LEU A H    3  
ATOM 5737  H HA   . LEU A 1 118 ? -40.850 -7.003  -7.088  1.00 0.00 ? 196 LEU A HA   3  
ATOM 5738  H HB2  . LEU A 1 118 ? -40.595 -4.592  -5.331  1.00 0.00 ? 196 LEU A HB2  3  
ATOM 5739  H HB3  . LEU A 1 118 ? -42.183 -5.219  -5.770  1.00 0.00 ? 196 LEU A HB3  3  
ATOM 5740  H HG   . LEU A 1 118 ? -40.141 -7.013  -4.511  1.00 0.00 ? 196 LEU A HG   3  
ATOM 5741  H HD11 . LEU A 1 118 ? -40.918 -6.431  -2.322  1.00 0.00 ? 196 LEU A HD11 3  
ATOM 5742  H HD12 . LEU A 1 118 ? -42.075 -5.278  -2.986  1.00 0.00 ? 196 LEU A HD12 3  
ATOM 5743  H HD13 . LEU A 1 118 ? -40.344 -4.965  -3.117  1.00 0.00 ? 196 LEU A HD13 3  
ATOM 5744  H HD21 . LEU A 1 118 ? -43.107 -7.036  -4.117  1.00 0.00 ? 196 LEU A HD21 3  
ATOM 5745  H HD22 . LEU A 1 118 ? -41.951 -8.361  -3.984  1.00 0.00 ? 196 LEU A HD22 3  
ATOM 5746  H HD23 . LEU A 1 118 ? -42.390 -7.729  -5.572  1.00 0.00 ? 196 LEU A HD23 3  
ATOM 5747  N N    . LEU A 1 119 ? -42.433 -5.429  -8.424  1.00 0.00 ? 197 LEU A N    3  
ATOM 5748  C CA   . LEU A 1 119 ? -43.119 -4.720  -9.498  1.00 0.00 ? 197 LEU A CA   3  
ATOM 5749  C C    . LEU A 1 119 ? -44.265 -3.876  -8.950  1.00 0.00 ? 197 LEU A C    3  
ATOM 5750  O O    . LEU A 1 119 ? -44.556 -3.909  -7.755  1.00 0.00 ? 197 LEU A O    3  
ATOM 5751  C CB   . LEU A 1 119 ? -43.651 -5.713  -10.533 1.00 0.00 ? 197 LEU A CB   3  
ATOM 5752  C CG   . LEU A 1 119 ? -44.503 -6.860  -9.986  1.00 0.00 ? 197 LEU A CG   3  
ATOM 5753  C CD1  . LEU A 1 119 ? -45.971 -6.463  -9.947  1.00 0.00 ? 197 LEU A CD1  3  
ATOM 5754  C CD2  . LEU A 1 119 ? -44.310 -8.115  -10.824 1.00 0.00 ? 197 LEU A CD2  3  
ATOM 5755  H H    . LEU A 1 119 ? -42.912 -6.128  -7.932  1.00 0.00 ? 197 LEU A H    3  
ATOM 5756  H HA   . LEU A 1 119 ? -42.402 -4.067  -9.974  1.00 0.00 ? 197 LEU A HA   3  
ATOM 5757  H HB2  . LEU A 1 119 ? -44.253 -5.163  -11.240 1.00 0.00 ? 197 LEU A HB2  3  
ATOM 5758  H HB3  . LEU A 1 119 ? -42.802 -6.145  -11.043 1.00 0.00 ? 197 LEU A HB3  3  
ATOM 5759  H HG   . LEU A 1 119 ? -44.191 -7.081  -8.974  1.00 0.00 ? 197 LEU A HG   3  
ATOM 5760  H HD11 . LEU A 1 119 ? -46.054 -5.388  -9.985  1.00 0.00 ? 197 LEU A HD11 3  
ATOM 5761  H HD12 . LEU A 1 119 ? -46.418 -6.828  -9.034  1.00 0.00 ? 197 LEU A HD12 3  
ATOM 5762  H HD13 . LEU A 1 119 ? -46.482 -6.894  -10.796 1.00 0.00 ? 197 LEU A HD13 3  
ATOM 5763  H HD21 . LEU A 1 119 ? -43.460 -7.983  -11.478 1.00 0.00 ? 197 LEU A HD21 3  
ATOM 5764  H HD22 . LEU A 1 119 ? -45.195 -8.291  -11.417 1.00 0.00 ? 197 LEU A HD22 3  
ATOM 5765  H HD23 . LEU A 1 119 ? -44.137 -8.959  -10.174 1.00 0.00 ? 197 LEU A HD23 3  
ATOM 5766  N N    . ALA A 1 120 ? -44.912 -3.122  -9.832  1.00 0.00 ? 198 ALA A N    3  
ATOM 5767  C CA   . ALA A 1 120 ? -46.029 -2.273  -9.437  1.00 0.00 ? 198 ALA A CA   3  
ATOM 5768  C C    . ALA A 1 120 ? -46.852 -1.849  -10.648 1.00 0.00 ? 198 ALA A C    3  
ATOM 5769  O O    . ALA A 1 120 ? -46.495 -2.146  -11.788 1.00 0.00 ? 198 ALA A O    3  
ATOM 5770  C CB   . ALA A 1 120 ? -45.522 -1.049  -8.687  1.00 0.00 ? 198 ALA A CB   3  
ATOM 5771  H H    . ALA A 1 120 ? -44.633 -3.138  -10.771 1.00 0.00 ? 198 ALA A H    3  
ATOM 5772  H HA   . ALA A 1 120 ? -46.659 -2.840  -8.766  1.00 0.00 ? 198 ALA A HA   3  
ATOM 5773  H HB1  . ALA A 1 120 ? -46.176 -0.212  -8.883  1.00 0.00 ? 198 ALA A HB1  3  
ATOM 5774  H HB2  . ALA A 1 120 ? -45.510 -1.257  -7.627  1.00 0.00 ? 198 ALA A HB2  3  
ATOM 5775  H HB3  . ALA A 1 120 ? -44.523 -0.812  -9.020  1.00 0.00 ? 198 ALA A HB3  3  
ATOM 5776  N N    . VAL A 1 121 ? -47.957 -1.155  -10.394 1.00 0.00 ? 199 VAL A N    3  
ATOM 5777  C CA   . VAL A 1 121 ? -48.831 -0.690  -11.464 1.00 0.00 ? 199 VAL A CA   3  
ATOM 5778  C C    . VAL A 1 121 ? -49.019 0.821   -11.404 1.00 0.00 ? 199 VAL A C    3  
ATOM 5779  O O    . VAL A 1 121 ? -48.803 1.443   -10.363 1.00 0.00 ? 199 VAL A O    3  
ATOM 5780  C CB   . VAL A 1 121 ? -50.211 -1.371  -11.397 1.00 0.00 ? 199 VAL A CB   3  
ATOM 5781  C CG1  . VAL A 1 121 ? -50.076 -2.873  -11.591 1.00 0.00 ? 199 VAL A CG1  3  
ATOM 5782  C CG2  . VAL A 1 121 ? -50.897 -1.055  -10.076 1.00 0.00 ? 199 VAL A CG2  3  
ATOM 5783  H H    . VAL A 1 121 ? -48.189 -0.949  -9.464  1.00 0.00 ? 199 VAL A H    3  
ATOM 5784  H HA   . VAL A 1 121 ? -48.371 -0.949  -12.407 1.00 0.00 ? 199 VAL A HA   3  
ATOM 5785  H HB   . VAL A 1 121 ? -50.822 -0.980  -12.198 1.00 0.00 ? 199 VAL A HB   3  
ATOM 5786  H HG11 . VAL A 1 121 ? -49.636 -3.312  -10.708 1.00 0.00 ? 199 VAL A HG11 3  
ATOM 5787  H HG12 . VAL A 1 121 ? -51.052 -3.304  -11.762 1.00 0.00 ? 199 VAL A HG12 3  
ATOM 5788  H HG13 . VAL A 1 121 ? -49.442 -3.070  -12.443 1.00 0.00 ? 199 VAL A HG13 3  
ATOM 5789  H HG21 . VAL A 1 121 ? -51.520 -0.182  -10.195 1.00 0.00 ? 199 VAL A HG21 3  
ATOM 5790  H HG22 . VAL A 1 121 ? -51.507 -1.895  -9.777  1.00 0.00 ? 199 VAL A HG22 3  
ATOM 5791  H HG23 . VAL A 1 121 ? -50.150 -0.866  -9.319  1.00 0.00 ? 199 VAL A HG23 3  
ATOM 5792  N N    . ALA A 1 122 ? -49.422 1.408   -12.526 1.00 0.00 ? 200 ALA A N    3  
ATOM 5793  C CA   . ALA A 1 122 ? -49.641 2.847   -12.600 1.00 0.00 ? 200 ALA A CA   3  
ATOM 5794  C C    . ALA A 1 122 ? -50.417 3.220   -13.859 1.00 0.00 ? 200 ALA A C    3  
ATOM 5795  O O    . ALA A 1 122 ? -50.387 2.497   -14.855 1.00 0.00 ? 200 ALA A O    3  
ATOM 5796  C CB   . ALA A 1 122 ? -48.312 3.586   -12.558 1.00 0.00 ? 200 ALA A CB   3  
ATOM 5797  H H    . ALA A 1 122 ? -49.577 0.859   -13.323 1.00 0.00 ? 200 ALA A H    3  
ATOM 5798  H HA   . ALA A 1 122 ? -50.217 3.142   -11.734 1.00 0.00 ? 200 ALA A HA   3  
ATOM 5799  H HB1  . ALA A 1 122 ? -47.509 2.893   -12.764 1.00 0.00 ? 200 ALA A HB1  3  
ATOM 5800  H HB2  . ALA A 1 122 ? -48.312 4.369   -13.302 1.00 0.00 ? 200 ALA A HB2  3  
ATOM 5801  H HB3  . ALA A 1 122 ? -48.172 4.019   -11.579 1.00 0.00 ? 200 ALA A HB3  3  
ATOM 5802  N N    . ASP A 1 123 ? -51.111 4.352   -13.807 1.00 0.00 ? 201 ASP A N    3  
ATOM 5803  C CA   . ASP A 1 123 ? -51.894 4.821   -14.944 1.00 0.00 ? 201 ASP A CA   3  
ATOM 5804  C C    . ASP A 1 123 ? -51.723 6.324   -15.138 1.00 0.00 ? 201 ASP A C    3  
ATOM 5805  O O    . ASP A 1 123 ? -51.397 7.049   -14.198 1.00 0.00 ? 201 ASP A O    3  
ATOM 5806  C CB   . ASP A 1 123 ? -53.373 4.485   -14.745 1.00 0.00 ? 201 ASP A CB   3  
ATOM 5807  C CG   . ASP A 1 123 ? -53.589 3.039   -14.344 1.00 0.00 ? 201 ASP A CG   3  
ATOM 5808  O OD1  . ASP A 1 123 ? -53.237 2.143   -15.140 1.00 0.00 ? 201 ASP A OD1  3  
ATOM 5809  O OD2  . ASP A 1 123 ? -54.110 2.803   -13.234 1.00 0.00 ? 201 ASP A OD2  3  
ATOM 5810  H H    . ASP A 1 123 ? -51.095 4.885   -12.985 1.00 0.00 ? 201 ASP A H    3  
ATOM 5811  H HA   . ASP A 1 123 ? -51.535 4.313   -15.827 1.00 0.00 ? 201 ASP A HA   3  
ATOM 5812  H HB2  . ASP A 1 123 ? -53.778 5.118   -13.969 1.00 0.00 ? 201 ASP A HB2  3  
ATOM 5813  H HB3  . ASP A 1 123 ? -53.904 4.667   -15.667 1.00 0.00 ? 201 ASP A HB3  3  
ATOM 5814  N N    . SER A 1 124 ? -51.945 6.786   -16.365 1.00 0.00 ? 202 SER A N    3  
ATOM 5815  C CA   . SER A 1 124 ? -51.810 8.203   -16.684 1.00 0.00 ? 202 SER A CA   3  
ATOM 5816  C C    . SER A 1 124 ? -52.696 8.579   -17.868 1.00 0.00 ? 202 SER A C    3  
ATOM 5817  O O    . SER A 1 124 ? -52.968 7.757   -18.741 1.00 0.00 ? 202 SER A O    3  
ATOM 5818  C CB   . SER A 1 124 ? -50.351 8.540   -16.997 1.00 0.00 ? 202 SER A CB   3  
ATOM 5819  O OG   . SER A 1 124 ? -50.200 9.917   -17.298 1.00 0.00 ? 202 SER A OG   3  
ATOM 5820  H H    . SER A 1 124 ? -52.202 6.159   -17.072 1.00 0.00 ? 202 SER A H    3  
ATOM 5821  H HA   . SER A 1 124 ? -52.125 8.769   -15.820 1.00 0.00 ? 202 SER A HA   3  
ATOM 5822  H HB2  . SER A 1 124 ? -49.738 8.302   -16.141 1.00 0.00 ? 202 SER A HB2  3  
ATOM 5823  H HB3  . SER A 1 124 ? -50.025 7.960   -17.847 1.00 0.00 ? 202 SER A HB3  3  
ATOM 5824  H HG   . SER A 1 124 ? -49.860 10.014  -18.191 1.00 0.00 ? 202 SER A HG   3  
ATOM 5825  N N    . GLY A 1 125 ? -53.145 9.831   -17.889 1.00 0.00 ? 203 GLY A N    3  
ATOM 5826  C CA   . GLY A 1 125 ? -53.996 10.296  -18.968 1.00 0.00 ? 203 GLY A CA   3  
ATOM 5827  C C    . GLY A 1 125 ? -54.152 11.804  -18.975 1.00 0.00 ? 203 GLY A C    3  
ATOM 5828  O O    . GLY A 1 125 ? -55.107 12.352  -18.424 1.00 0.00 ? 203 GLY A O    3  
ATOM 5829  H H    . GLY A 1 125 ? -52.896 10.443  -17.165 1.00 0.00 ? 203 GLY A H    3  
ATOM 5830  H HA2  . GLY A 1 125 ? -53.567 9.985   -19.909 1.00 0.00 ? 203 GLY A HA2  3  
ATOM 5831  H HA3  . GLY A 1 125 ? -54.971 9.845   -18.862 1.00 0.00 ? 203 GLY A HA3  3  
ATOM 5832  N N    . PRO A 1 126 ? -53.197 12.499  -19.609 1.00 0.00 ? 204 PRO A N    3  
ATOM 5833  C CA   . PRO A 1 126 ? -53.210 13.962  -19.699 1.00 0.00 ? 204 PRO A CA   3  
ATOM 5834  C C    . PRO A 1 126 ? -54.323 14.477  -20.605 1.00 0.00 ? 204 PRO A C    3  
ATOM 5835  O O    . PRO A 1 126 ? -55.096 13.696  -21.160 1.00 0.00 ? 204 PRO A O    3  
ATOM 5836  C CB   . PRO A 1 126 ? -51.840 14.294  -20.295 1.00 0.00 ? 204 PRO A CB   3  
ATOM 5837  C CG   . PRO A 1 126 ? -51.449 13.070  -21.049 1.00 0.00 ? 204 PRO A CG   3  
ATOM 5838  C CD   . PRO A 1 126 ? -52.030 11.911  -20.288 1.00 0.00 ? 204 PRO A CD   3  
ATOM 5839  H HA   . PRO A 1 126 ? -53.301 14.419  -18.724 1.00 0.00 ? 204 PRO A HA   3  
ATOM 5840  H HB2  . PRO A 1 126 ? -51.926 15.151  -20.948 1.00 0.00 ? 204 PRO A HB2  3  
ATOM 5841  H HB3  . PRO A 1 126 ? -51.140 14.508  -19.501 1.00 0.00 ? 204 PRO A HB3  3  
ATOM 5842  H HG2  . PRO A 1 126 ? -51.858 13.107  -22.047 1.00 0.00 ? 204 PRO A HG2  3  
ATOM 5843  H HG3  . PRO A 1 126 ? -50.372 12.991  -21.087 1.00 0.00 ? 204 PRO A HG3  3  
ATOM 5844  H HD2  . PRO A 1 126 ? -52.333 11.128  -20.967 1.00 0.00 ? 204 PRO A HD2  3  
ATOM 5845  H HD3  . PRO A 1 126 ? -51.316 11.535  -19.570 1.00 0.00 ? 204 PRO A HD3  3  
ATOM 5846  N N    . SER A 1 127 ? -54.399 15.796  -20.751 1.00 0.00 ? 205 SER A N    3  
ATOM 5847  C CA   . SER A 1 127 ? -55.420 16.416  -21.588 1.00 0.00 ? 205 SER A CA   3  
ATOM 5848  C C    . SER A 1 127 ? -54.913 17.726  -22.183 1.00 0.00 ? 205 SER A C    3  
ATOM 5849  O O    . SER A 1 127 ? -53.808 18.173  -21.877 1.00 0.00 ? 205 SER A O    3  
ATOM 5850  C CB   . SER A 1 127 ? -56.691 16.669  -20.774 1.00 0.00 ? 205 SER A CB   3  
ATOM 5851  O OG   . SER A 1 127 ? -56.466 17.641  -19.768 1.00 0.00 ? 205 SER A OG   3  
ATOM 5852  H H    . SER A 1 127 ? -53.753 16.366  -20.283 1.00 0.00 ? 205 SER A H    3  
ATOM 5853  H HA   . SER A 1 127 ? -55.648 15.733  -22.392 1.00 0.00 ? 205 SER A HA   3  
ATOM 5854  H HB2  . SER A 1 127 ? -57.471 17.023  -21.431 1.00 0.00 ? 205 SER A HB2  3  
ATOM 5855  H HB3  . SER A 1 127 ? -57.004 15.748  -20.305 1.00 0.00 ? 205 SER A HB3  3  
ATOM 5856  H HG   . SER A 1 127 ? -57.142 18.321  -19.822 1.00 0.00 ? 205 SER A HG   3  
ATOM 5857  N N    . SER A 1 128 ? -55.730 18.336  -23.036 1.00 0.00 ? 206 SER A N    3  
ATOM 5858  C CA   . SER A 1 128 ? -55.365 19.593  -23.678 1.00 0.00 ? 206 SER A CA   3  
ATOM 5859  C C    . SER A 1 128 ? -56.594 20.283  -24.260 1.00 0.00 ? 206 SER A C    3  
ATOM 5860  O O    . SER A 1 128 ? -57.670 19.692  -24.345 1.00 0.00 ? 206 SER A O    3  
ATOM 5861  C CB   . SER A 1 128 ? -54.334 19.346  -24.781 1.00 0.00 ? 206 SER A CB   3  
ATOM 5862  O OG   . SER A 1 128 ? -54.771 18.331  -25.668 1.00 0.00 ? 206 SER A OG   3  
ATOM 5863  H H    . SER A 1 128 ? -56.598 17.929  -23.240 1.00 0.00 ? 206 SER A H    3  
ATOM 5864  H HA   . SER A 1 128 ? -54.928 20.234  -22.927 1.00 0.00 ? 206 SER A HA   3  
ATOM 5865  H HB2  . SER A 1 128 ? -54.185 20.256  -25.341 1.00 0.00 ? 206 SER A HB2  3  
ATOM 5866  H HB3  . SER A 1 128 ? -53.399 19.040  -24.335 1.00 0.00 ? 206 SER A HB3  3  
ATOM 5867  H HG   . SER A 1 128 ? -55.660 18.530  -25.971 1.00 0.00 ? 206 SER A HG   3  
ATOM 5868  N N    . GLY A 1 129 ? -56.426 21.540  -24.661 1.00 0.00 ? 207 GLY A N    3  
ATOM 5869  C CA   . GLY A 1 129 ? -57.530 22.291  -25.230 1.00 0.00 ? 207 GLY A CA   3  
ATOM 5870  C C    . GLY A 1 129 ? -58.691 22.435  -24.266 1.00 0.00 ? 207 GLY A C    3  
ATOM 5871  O O    . GLY A 1 129 ? -59.752 21.846  -24.471 1.00 0.00 ? 207 GLY A O    3  
ATOM 5872  H H    . GLY A 1 129 ? -55.546 21.960  -24.568 1.00 0.00 ? 207 GLY A H    3  
ATOM 5873  H HA2  . GLY A 1 129 ? -57.178 23.275  -25.503 1.00 0.00 ? 207 GLY A HA2  3  
ATOM 5874  H HA3  . GLY A 1 129 ? -57.875 21.784  -26.118 1.00 0.00 ? 207 GLY A HA3  3  
ATOM 5875  N N    . GLY A 1 1   ? -5.742  -18.609 5.977   1.00 0.00 ? 79  GLY A N    4  
ATOM 5876  C CA   . GLY A 1 1   ? -4.739  -18.902 6.983   1.00 0.00 ? 79  GLY A CA   4  
ATOM 5877  C C    . GLY A 1 1   ? -3.680  -19.865 6.484   1.00 0.00 ? 79  GLY A C    4  
ATOM 5878  O O    . GLY A 1 1   ? -3.755  -21.067 6.737   1.00 0.00 ? 79  GLY A O    4  
ATOM 5879  H H1   . GLY A 1 1   ? -6.148  -19.340 5.465   1.00 0.00 ? 79  GLY A H1   4  
ATOM 5880  H HA2  . GLY A 1 1   ? -4.261  -17.980 7.279   1.00 0.00 ? 79  GLY A HA2  4  
ATOM 5881  H HA3  . GLY A 1 1   ? -5.225  -19.336 7.844   1.00 0.00 ? 79  GLY A HA3  4  
ATOM 5882  N N    . SER A 1 2   ? -2.691  -19.337 5.770   1.00 0.00 ? 80  SER A N    4  
ATOM 5883  C CA   . SER A 1 2   ? -1.615  -20.159 5.229   1.00 0.00 ? 80  SER A CA   4  
ATOM 5884  C C    . SER A 1 2   ? -0.508  -19.288 4.642   1.00 0.00 ? 80  SER A C    4  
ATOM 5885  O O    . SER A 1 2   ? -0.651  -18.069 4.540   1.00 0.00 ? 80  SER A O    4  
ATOM 5886  C CB   . SER A 1 2   ? -2.158  -21.105 4.156   1.00 0.00 ? 80  SER A CB   4  
ATOM 5887  O OG   . SER A 1 2   ? -1.271  -22.187 3.934   1.00 0.00 ? 80  SER A OG   4  
ATOM 5888  H H    . SER A 1 2   ? -2.686  -18.371 5.602   1.00 0.00 ? 80  SER A H    4  
ATOM 5889  H HA   . SER A 1 2   ? -1.205  -20.744 6.038   1.00 0.00 ? 80  SER A HA   4  
ATOM 5890  H HB2  . SER A 1 2   ? -3.112  -21.497 4.475   1.00 0.00 ? 80  SER A HB2  4  
ATOM 5891  H HB3  . SER A 1 2   ? -2.283  -20.562 3.230   1.00 0.00 ? 80  SER A HB3  4  
ATOM 5892  H HG   . SER A 1 2   ? -1.650  -22.992 4.295   1.00 0.00 ? 80  SER A HG   4  
ATOM 5893  N N    . SER A 1 3   ? 0.594   -19.922 4.257   1.00 0.00 ? 81  SER A N    4  
ATOM 5894  C CA   . SER A 1 3   ? 1.727   -19.206 3.683   1.00 0.00 ? 81  SER A CA   4  
ATOM 5895  C C    . SER A 1 3   ? 2.590   -20.140 2.840   1.00 0.00 ? 81  SER A C    4  
ATOM 5896  O O    . SER A 1 3   ? 2.883   -21.265 3.242   1.00 0.00 ? 81  SER A O    4  
ATOM 5897  C CB   . SER A 1 3   ? 2.573   -18.575 4.791   1.00 0.00 ? 81  SER A CB   4  
ATOM 5898  O OG   . SER A 1 3   ? 2.087   -17.288 5.132   1.00 0.00 ? 81  SER A OG   4  
ATOM 5899  H H    . SER A 1 3   ? 0.647   -20.895 4.363   1.00 0.00 ? 81  SER A H    4  
ATOM 5900  H HA   . SER A 1 3   ? 1.338   -18.423 3.049   1.00 0.00 ? 81  SER A HA   4  
ATOM 5901  H HB2  . SER A 1 3   ? 2.539   -19.203 5.668   1.00 0.00 ? 81  SER A HB2  4  
ATOM 5902  H HB3  . SER A 1 3   ? 3.595   -18.483 4.453   1.00 0.00 ? 81  SER A HB3  4  
ATOM 5903  H HG   . SER A 1 3   ? 2.579   -16.949 5.884   1.00 0.00 ? 81  SER A HG   4  
ATOM 5904  N N    . GLY A 1 4   ? 2.994   -19.664 1.666   1.00 0.00 ? 82  GLY A N    4  
ATOM 5905  C CA   . GLY A 1 4   ? 3.818   -20.468 0.783   1.00 0.00 ? 82  GLY A CA   4  
ATOM 5906  C C    . GLY A 1 4   ? 5.266   -20.018 0.772   1.00 0.00 ? 82  GLY A C    4  
ATOM 5907  O O    . GLY A 1 4   ? 5.660   -19.192 -0.051  1.00 0.00 ? 82  GLY A O    4  
ATOM 5908  H H    . GLY A 1 4   ? 2.729   -18.759 1.397   1.00 0.00 ? 82  GLY A H    4  
ATOM 5909  H HA2  . GLY A 1 4   ? 3.775   -21.497 1.106   1.00 0.00 ? 82  GLY A HA2  4  
ATOM 5910  H HA3  . GLY A 1 4   ? 3.425   -20.399 -0.221  1.00 0.00 ? 82  GLY A HA3  4  
ATOM 5911  N N    . SER A 1 5   ? 6.060   -20.561 1.689   1.00 0.00 ? 83  SER A N    4  
ATOM 5912  C CA   . SER A 1 5   ? 7.471   -20.206 1.785   1.00 0.00 ? 83  SER A CA   4  
ATOM 5913  C C    . SER A 1 5   ? 8.331   -21.177 0.983   1.00 0.00 ? 83  SER A C    4  
ATOM 5914  O O    . SER A 1 5   ? 8.696   -22.248 1.468   1.00 0.00 ? 83  SER A O    4  
ATOM 5915  C CB   . SER A 1 5   ? 7.918   -20.200 3.248   1.00 0.00 ? 83  SER A CB   4  
ATOM 5916  O OG   . SER A 1 5   ? 7.253   -19.186 3.981   1.00 0.00 ? 83  SER A OG   4  
ATOM 5917  H H    . SER A 1 5   ? 5.687   -21.214 2.318   1.00 0.00 ? 83  SER A H    4  
ATOM 5918  H HA   . SER A 1 5   ? 7.592   -19.214 1.377   1.00 0.00 ? 83  SER A HA   4  
ATOM 5919  H HB2  . SER A 1 5   ? 7.693   -21.156 3.695   1.00 0.00 ? 83  SER A HB2  4  
ATOM 5920  H HB3  . SER A 1 5   ? 8.983   -20.023 3.295   1.00 0.00 ? 83  SER A HB3  4  
ATOM 5921  H HG   . SER A 1 5   ? 6.344   -19.118 3.682   1.00 0.00 ? 83  SER A HG   4  
ATOM 5922  N N    . SER A 1 6   ? 8.652   -20.795 -0.250  1.00 0.00 ? 84  SER A N    4  
ATOM 5923  C CA   . SER A 1 6   ? 9.466   -21.633 -1.122  1.00 0.00 ? 84  SER A CA   4  
ATOM 5924  C C    . SER A 1 6   ? 10.633  -20.839 -1.703  1.00 0.00 ? 84  SER A C    4  
ATOM 5925  O O    . SER A 1 6   ? 10.474  -19.690 -2.112  1.00 0.00 ? 84  SER A O    4  
ATOM 5926  C CB   . SER A 1 6   ? 8.612   -22.207 -2.254  1.00 0.00 ? 84  SER A CB   4  
ATOM 5927  O OG   . SER A 1 6   ? 7.762   -23.237 -1.780  1.00 0.00 ? 84  SER A OG   4  
ATOM 5928  H H    . SER A 1 6   ? 8.330   -19.930 -0.580  1.00 0.00 ? 84  SER A H    4  
ATOM 5929  H HA   . SER A 1 6   ? 9.858   -22.446 -0.530  1.00 0.00 ? 84  SER A HA   4  
ATOM 5930  H HB2  . SER A 1 6   ? 8.004   -21.422 -2.678  1.00 0.00 ? 84  SER A HB2  4  
ATOM 5931  H HB3  . SER A 1 6   ? 9.259   -22.613 -3.019  1.00 0.00 ? 84  SER A HB3  4  
ATOM 5932  H HG   . SER A 1 6   ? 7.128   -23.470 -2.463  1.00 0.00 ? 84  SER A HG   4  
ATOM 5933  N N    . GLY A 1 7   ? 11.807  -21.463 -1.734  1.00 0.00 ? 85  GLY A N    4  
ATOM 5934  C CA   . GLY A 1 7   ? 12.984  -20.802 -2.266  1.00 0.00 ? 85  GLY A CA   4  
ATOM 5935  C C    . GLY A 1 7   ? 14.178  -20.909 -1.338  1.00 0.00 ? 85  GLY A C    4  
ATOM 5936  O O    . GLY A 1 7   ? 14.382  -21.939 -0.695  1.00 0.00 ? 85  GLY A O    4  
ATOM 5937  H H    . GLY A 1 7   ? 11.873  -22.380 -1.394  1.00 0.00 ? 85  GLY A H    4  
ATOM 5938  H HA2  . GLY A 1 7   ? 13.238  -21.250 -3.215  1.00 0.00 ? 85  GLY A HA2  4  
ATOM 5939  H HA3  . GLY A 1 7   ? 12.756  -19.757 -2.421  1.00 0.00 ? 85  GLY A HA3  4  
ATOM 5940  N N    . ARG A 1 8   ? 14.969  -19.843 -1.268  1.00 0.00 ? 86  ARG A N    4  
ATOM 5941  C CA   . ARG A 1 8   ? 16.150  -19.823 -0.414  1.00 0.00 ? 86  ARG A CA   4  
ATOM 5942  C C    . ARG A 1 8   ? 15.776  -19.474 1.024   1.00 0.00 ? 86  ARG A C    4  
ATOM 5943  O O    . ARG A 1 8   ? 14.770  -18.808 1.271   1.00 0.00 ? 86  ARG A O    4  
ATOM 5944  C CB   . ARG A 1 8   ? 17.172  -18.816 -0.944  1.00 0.00 ? 86  ARG A CB   4  
ATOM 5945  C CG   . ARG A 1 8   ? 17.884  -19.278 -2.206  1.00 0.00 ? 86  ARG A CG   4  
ATOM 5946  C CD   . ARG A 1 8   ? 17.103  -18.903 -3.455  1.00 0.00 ? 86  ARG A CD   4  
ATOM 5947  N NE   . ARG A 1 8   ? 16.155  -19.944 -3.843  1.00 0.00 ? 86  ARG A NE   4  
ATOM 5948  C CZ   . ARG A 1 8   ? 15.343  -19.846 -4.889  1.00 0.00 ? 86  ARG A CZ   4  
ATOM 5949  N NH1  . ARG A 1 8   ? 15.363  -18.760 -5.649  1.00 0.00 ? 86  ARG A NH1  4  
ATOM 5950  N NH2  . ARG A 1 8   ? 14.509  -20.837 -5.178  1.00 0.00 ? 86  ARG A NH2  4  
ATOM 5951  H H    . ARG A 1 8   ? 14.753  -19.052 -1.804  1.00 0.00 ? 86  ARG A H    4  
ATOM 5952  H HA   . ARG A 1 8   ? 16.588  -20.810 -0.430  1.00 0.00 ? 86  ARG A HA   4  
ATOM 5953  H HB2  . ARG A 1 8   ? 16.666  -17.888 -1.163  1.00 0.00 ? 86  ARG A HB2  4  
ATOM 5954  H HB3  . ARG A 1 8   ? 17.915  -18.641 -0.182  1.00 0.00 ? 86  ARG A HB3  4  
ATOM 5955  H HG2  . ARG A 1 8   ? 18.857  -18.813 -2.250  1.00 0.00 ? 86  ARG A HG2  4  
ATOM 5956  H HG3  . ARG A 1 8   ? 17.997  -20.352 -2.171  1.00 0.00 ? 86  ARG A HG3  4  
ATOM 5957  H HD2  . ARG A 1 8   ? 16.560  -17.989 -3.263  1.00 0.00 ? 86  ARG A HD2  4  
ATOM 5958  H HD3  . ARG A 1 8   ? 17.800  -18.743 -4.264  1.00 0.00 ? 86  ARG A HD3  4  
ATOM 5959  H HE   . ARG A 1 8   ? 16.124  -20.756 -3.295  1.00 0.00 ? 86  ARG A HE   4  
ATOM 5960  H HH11 . ARG A 1 8   ? 15.991  -18.012 -5.434  1.00 0.00 ? 86  ARG A HH11 4  
ATOM 5961  H HH12 . ARG A 1 8   ? 14.751  -18.689 -6.437  1.00 0.00 ? 86  ARG A HH12 4  
ATOM 5962  H HH21 . ARG A 1 8   ? 14.491  -21.658 -4.607  1.00 0.00 ? 86  ARG A HH21 4  
ATOM 5963  H HH22 . ARG A 1 8   ? 13.897  -20.763 -5.965  1.00 0.00 ? 86  ARG A HH22 4  
ATOM 5964  N N    . LYS A 1 9   ? 16.591  -19.930 1.969   1.00 0.00 ? 87  LYS A N    4  
ATOM 5965  C CA   . LYS A 1 9   ? 16.347  -19.666 3.382   1.00 0.00 ? 87  LYS A CA   4  
ATOM 5966  C C    . LYS A 1 9   ? 16.170  -18.172 3.635   1.00 0.00 ? 87  LYS A C    4  
ATOM 5967  O O    . LYS A 1 9   ? 15.248  -17.758 4.336   1.00 0.00 ? 87  LYS A O    4  
ATOM 5968  C CB   . LYS A 1 9   ? 17.503  -20.204 4.229   1.00 0.00 ? 87  LYS A CB   4  
ATOM 5969  C CG   . LYS A 1 9   ? 17.091  -20.610 5.633   1.00 0.00 ? 87  LYS A CG   4  
ATOM 5970  C CD   . LYS A 1 9   ? 18.181  -21.412 6.324   1.00 0.00 ? 87  LYS A CD   4  
ATOM 5971  C CE   . LYS A 1 9   ? 18.310  -22.806 5.729   1.00 0.00 ? 87  LYS A CE   4  
ATOM 5972  N NZ   . LYS A 1 9   ? 19.364  -23.605 6.412   1.00 0.00 ? 87  LYS A NZ   4  
ATOM 5973  H H    . LYS A 1 9   ? 17.377  -20.456 1.709   1.00 0.00 ? 87  LYS A H    4  
ATOM 5974  H HA   . LYS A 1 9   ? 15.439  -20.177 3.663   1.00 0.00 ? 87  LYS A HA   4  
ATOM 5975  H HB2  . LYS A 1 9   ? 17.924  -21.067 3.736   1.00 0.00 ? 87  LYS A HB2  4  
ATOM 5976  H HB3  . LYS A 1 9   ? 18.262  -19.438 4.307   1.00 0.00 ? 87  LYS A HB3  4  
ATOM 5977  H HG2  . LYS A 1 9   ? 16.892  -19.720 6.212   1.00 0.00 ? 87  LYS A HG2  4  
ATOM 5978  H HG3  . LYS A 1 9   ? 16.195  -21.212 5.576   1.00 0.00 ? 87  LYS A HG3  4  
ATOM 5979  H HD2  . LYS A 1 9   ? 19.123  -20.896 6.211   1.00 0.00 ? 87  LYS A HD2  4  
ATOM 5980  H HD3  . LYS A 1 9   ? 17.941  -21.499 7.374   1.00 0.00 ? 87  LYS A HD3  4  
ATOM 5981  H HE2  . LYS A 1 9   ? 17.363  -23.314 5.829   1.00 0.00 ? 87  LYS A HE2  4  
ATOM 5982  H HE3  . LYS A 1 9   ? 18.561  -22.714 4.682   1.00 0.00 ? 87  LYS A HE3  4  
ATOM 5983  H HZ1  . LYS A 1 9   ? 20.259  -23.540 5.885   1.00 0.00 ? 87  LYS A HZ1  4  
ATOM 5984  H HZ2  . LYS A 1 9   ? 19.078  -24.604 6.464   1.00 0.00 ? 87  LYS A HZ2  4  
ATOM 5985  H HZ3  . LYS A 1 9   ? 19.516  -23.248 7.376   1.00 0.00 ? 87  LYS A HZ3  4  
ATOM 5986  N N    . GLU A 1 10  ? 17.058  -17.370 3.057   1.00 0.00 ? 88  GLU A N    4  
ATOM 5987  C CA   . GLU A 1 10  ? 16.997  -15.922 3.219   1.00 0.00 ? 88  GLU A CA   4  
ATOM 5988  C C    . GLU A 1 10  ? 15.557  -15.425 3.139   1.00 0.00 ? 88  GLU A C    4  
ATOM 5989  O O    . GLU A 1 10  ? 15.113  -14.636 3.973   1.00 0.00 ? 88  GLU A O    4  
ATOM 5990  C CB   . GLU A 1 10  ? 17.847  -15.230 2.151   1.00 0.00 ? 88  GLU A CB   4  
ATOM 5991  C CG   . GLU A 1 10  ? 19.307  -15.651 2.169   1.00 0.00 ? 88  GLU A CG   4  
ATOM 5992  C CD   . GLU A 1 10  ? 20.097  -14.968 3.269   1.00 0.00 ? 88  GLU A CD   4  
ATOM 5993  O OE1  . GLU A 1 10  ? 20.031  -13.725 3.364   1.00 0.00 ? 88  GLU A OE1  4  
ATOM 5994  O OE2  . GLU A 1 10  ? 20.783  -15.679 4.034   1.00 0.00 ? 88  GLU A OE2  4  
ATOM 5995  H H    . GLU A 1 10  ? 17.770  -17.760 2.509   1.00 0.00 ? 88  GLU A H    4  
ATOM 5996  H HA   . GLU A 1 10  ? 17.394  -15.681 4.194   1.00 0.00 ? 88  GLU A HA   4  
ATOM 5997  H HB2  . GLU A 1 10  ? 17.439  -15.461 1.178   1.00 0.00 ? 88  GLU A HB2  4  
ATOM 5998  H HB3  . GLU A 1 10  ? 17.800  -14.163 2.307   1.00 0.00 ? 88  GLU A HB3  4  
ATOM 5999  H HG2  . GLU A 1 10  ? 19.359  -16.719 2.319   1.00 0.00 ? 88  GLU A HG2  4  
ATOM 6000  H HG3  . GLU A 1 10  ? 19.752  -15.400 1.217   1.00 0.00 ? 88  GLU A HG3  4  
ATOM 6001  N N    . ASP A 1 11  ? 14.832  -15.893 2.129   1.00 0.00 ? 89  ASP A N    4  
ATOM 6002  C CA   . ASP A 1 11  ? 13.441  -15.497 1.939   1.00 0.00 ? 89  ASP A CA   4  
ATOM 6003  C C    . ASP A 1 11  ? 12.730  -15.346 3.280   1.00 0.00 ? 89  ASP A C    4  
ATOM 6004  O O    . ASP A 1 11  ? 12.053  -14.348 3.527   1.00 0.00 ? 89  ASP A O    4  
ATOM 6005  C CB   . ASP A 1 11  ? 12.710  -16.525 1.073   1.00 0.00 ? 89  ASP A CB   4  
ATOM 6006  C CG   . ASP A 1 11  ? 13.039  -16.381 -0.400  1.00 0.00 ? 89  ASP A CG   4  
ATOM 6007  O OD1  . ASP A 1 11  ? 12.925  -15.254 -0.925  1.00 0.00 ? 89  ASP A OD1  4  
ATOM 6008  O OD2  . ASP A 1 11  ? 13.411  -17.395 -1.027  1.00 0.00 ? 89  ASP A OD2  4  
ATOM 6009  H H    . ASP A 1 11  ? 15.241  -16.520 1.496   1.00 0.00 ? 89  ASP A H    4  
ATOM 6010  H HA   . ASP A 1 11  ? 13.433  -14.544 1.432   1.00 0.00 ? 89  ASP A HA   4  
ATOM 6011  H HB2  . ASP A 1 11  ? 12.992  -17.519 1.390   1.00 0.00 ? 89  ASP A HB2  4  
ATOM 6012  H HB3  . ASP A 1 11  ? 11.645  -16.400 1.200   1.00 0.00 ? 89  ASP A HB3  4  
ATOM 6013  N N    . HIS A 1 12  ? 12.888  -16.345 4.143   1.00 0.00 ? 90  HIS A N    4  
ATOM 6014  C CA   . HIS A 1 12  ? 12.261  -16.323 5.460   1.00 0.00 ? 90  HIS A CA   4  
ATOM 6015  C C    . HIS A 1 12  ? 12.793  -15.163 6.296   1.00 0.00 ? 90  HIS A C    4  
ATOM 6016  O O    . HIS A 1 12  ? 12.043  -14.517 7.027   1.00 0.00 ? 90  HIS A O    4  
ATOM 6017  C CB   . HIS A 1 12  ? 12.507  -17.646 6.187   1.00 0.00 ? 90  HIS A CB   4  
ATOM 6018  C CG   . HIS A 1 12  ? 11.484  -17.951 7.238   1.00 0.00 ? 90  HIS A CG   4  
ATOM 6019  N ND1  . HIS A 1 12  ? 11.045  -19.229 7.512   1.00 0.00 ? 90  HIS A ND1  4  
ATOM 6020  C CD2  . HIS A 1 12  ? 10.815  -17.135 8.085   1.00 0.00 ? 90  HIS A CD2  4  
ATOM 6021  C CE1  . HIS A 1 12  ? 10.148  -19.185 8.481   1.00 0.00 ? 90  HIS A CE1  4  
ATOM 6022  N NE2  . HIS A 1 12  ? 9.991   -17.926 8.847   1.00 0.00 ? 90  HIS A NE2  4  
ATOM 6023  H H    . HIS A 1 12  ? 13.439  -17.114 3.889   1.00 0.00 ? 90  HIS A H    4  
ATOM 6024  H HA   . HIS A 1 12  ? 11.199  -16.192 5.320   1.00 0.00 ? 90  HIS A HA   4  
ATOM 6025  H HB2  . HIS A 1 12  ? 12.494  -18.452 5.468   1.00 0.00 ? 90  HIS A HB2  4  
ATOM 6026  H HB3  . HIS A 1 12  ? 13.475  -17.612 6.665   1.00 0.00 ? 90  HIS A HB3  4  
ATOM 6027  H HD2  . HIS A 1 12  ? 10.910  -16.060 8.150   1.00 0.00 ? 90  HIS A HD2  4  
ATOM 6028  H HE1  . HIS A 1 12  ? 9.631   -20.034 8.903   1.00 0.00 ? 90  HIS A HE1  4  
ATOM 6029  H HE2  . HIS A 1 12  ? 9.323   -17.604 9.487   1.00 0.00 ? 90  HIS A HE2  4  
ATOM 6030  N N    . ALA A 1 13  ? 14.092  -14.906 6.183   1.00 0.00 ? 91  ALA A N    4  
ATOM 6031  C CA   . ALA A 1 13  ? 14.724  -13.823 6.928   1.00 0.00 ? 91  ALA A CA   4  
ATOM 6032  C C    . ALA A 1 13  ? 14.229  -12.464 6.446   1.00 0.00 ? 91  ALA A C    4  
ATOM 6033  O O    . ALA A 1 13  ? 13.876  -11.601 7.250   1.00 0.00 ? 91  ALA A O    4  
ATOM 6034  C CB   . ALA A 1 13  ? 16.238  -13.910 6.803   1.00 0.00 ? 91  ALA A CB   4  
ATOM 6035  H H    . ALA A 1 13  ? 14.638  -15.456 5.584   1.00 0.00 ? 91  ALA A H    4  
ATOM 6036  H HA   . ALA A 1 13  ? 14.466  -13.940 7.971   1.00 0.00 ? 91  ALA A HA   4  
ATOM 6037  H HB1  . ALA A 1 13  ? 16.588  -14.805 7.298   1.00 0.00 ? 91  ALA A HB1  4  
ATOM 6038  H HB2  . ALA A 1 13  ? 16.511  -13.945 5.759   1.00 0.00 ? 91  ALA A HB2  4  
ATOM 6039  H HB3  . ALA A 1 13  ? 16.687  -13.044 7.265   1.00 0.00 ? 91  ALA A HB3  4  
ATOM 6040  N N    . ARG A 1 14  ? 14.206  -12.280 5.130   1.00 0.00 ? 92  ARG A N    4  
ATOM 6041  C CA   . ARG A 1 14  ? 13.756  -11.024 4.542   1.00 0.00 ? 92  ARG A CA   4  
ATOM 6042  C C    . ARG A 1 14  ? 12.248  -10.858 4.704   1.00 0.00 ? 92  ARG A C    4  
ATOM 6043  O O    . ARG A 1 14  ? 11.747  -9.741  4.846   1.00 0.00 ? 92  ARG A O    4  
ATOM 6044  C CB   . ARG A 1 14  ? 14.129  -10.968 3.059   1.00 0.00 ? 92  ARG A CB   4  
ATOM 6045  C CG   . ARG A 1 14  ? 14.159  -9.558  2.492   1.00 0.00 ? 92  ARG A CG   4  
ATOM 6046  C CD   . ARG A 1 14  ? 14.315  -9.570  0.979   1.00 0.00 ? 92  ARG A CD   4  
ATOM 6047  N NE   . ARG A 1 14  ? 13.679  -8.413  0.354   1.00 0.00 ? 92  ARG A NE   4  
ATOM 6048  C CZ   . ARG A 1 14  ? 13.566  -8.257  -0.960  1.00 0.00 ? 92  ARG A CZ   4  
ATOM 6049  N NH1  . ARG A 1 14  ? 14.043  -9.180  -1.784  1.00 0.00 ? 92  ARG A NH1  4  
ATOM 6050  N NH2  . ARG A 1 14  ? 12.975  -7.176  -1.453  1.00 0.00 ? 92  ARG A NH2  4  
ATOM 6051  H H    . ARG A 1 14  ? 14.499  -13.006 4.540   1.00 0.00 ? 92  ARG A H    4  
ATOM 6052  H HA   . ARG A 1 14  ? 14.253  -10.218 5.060   1.00 0.00 ? 92  ARG A HA   4  
ATOM 6053  H HB2  . ARG A 1 14  ? 15.109  -11.405 2.930   1.00 0.00 ? 92  ARG A HB2  4  
ATOM 6054  H HB3  . ARG A 1 14  ? 13.410  -11.544 2.497   1.00 0.00 ? 92  ARG A HB3  4  
ATOM 6055  H HG2  . ARG A 1 14  ? 13.234  -9.060  2.743   1.00 0.00 ? 92  ARG A HG2  4  
ATOM 6056  H HG3  . ARG A 1 14  ? 14.989  -9.023  2.926   1.00 0.00 ? 92  ARG A HG3  4  
ATOM 6057  H HD2  . ARG A 1 14  ? 15.367  -9.564  0.739   1.00 0.00 ? 92  ARG A HD2  4  
ATOM 6058  H HD3  . ARG A 1 14  ? 13.862  -10.471 0.591   1.00 0.00 ? 92  ARG A HD3  4  
ATOM 6059  H HE   . ARG A 1 14  ? 13.320  -7.719  0.944   1.00 0.00 ? 92  ARG A HE   4  
ATOM 6060  H HH11 . ARG A 1 14  ? 14.488  -9.996  -1.416  1.00 0.00 ? 92  ARG A HH11 4  
ATOM 6061  H HH12 . ARG A 1 14  ? 13.956  -9.061  -2.773  1.00 0.00 ? 92  ARG A HH12 4  
ATOM 6062  H HH21 . ARG A 1 14  ? 12.614  -6.478  -0.835  1.00 0.00 ? 92  ARG A HH21 4  
ATOM 6063  H HH22 . ARG A 1 14  ? 12.891  -7.060  -2.442  1.00 0.00 ? 92  ARG A HH22 4  
ATOM 6064  N N    . LEU A 1 15  ? 11.529  -11.975 4.681   1.00 0.00 ? 93  LEU A N    4  
ATOM 6065  C CA   . LEU A 1 15  ? 10.077  -11.953 4.825   1.00 0.00 ? 93  LEU A CA   4  
ATOM 6066  C C    . LEU A 1 15  ? 9.675   -11.466 6.214   1.00 0.00 ? 93  LEU A C    4  
ATOM 6067  O O    . LEU A 1 15  ? 8.775   -10.638 6.355   1.00 0.00 ? 93  LEU A O    4  
ATOM 6068  C CB   . LEU A 1 15  ? 9.499   -13.347 4.573   1.00 0.00 ? 93  LEU A CB   4  
ATOM 6069  C CG   . LEU A 1 15  ? 9.337   -13.751 3.108   1.00 0.00 ? 93  LEU A CG   4  
ATOM 6070  C CD1  . LEU A 1 15  ? 9.088   -15.247 2.991   1.00 0.00 ? 93  LEU A CD1  4  
ATOM 6071  C CD2  . LEU A 1 15  ? 8.203   -12.968 2.461   1.00 0.00 ? 93  LEU A CD2  4  
ATOM 6072  H H    . LEU A 1 15  ? 11.983  -12.834 4.565   1.00 0.00 ? 93  LEU A H    4  
ATOM 6073  H HA   . LEU A 1 15  ? 9.681   -11.269 4.089   1.00 0.00 ? 93  LEU A HA   4  
ATOM 6074  H HB2  . LEU A 1 15  ? 10.152  -14.065 5.044   1.00 0.00 ? 93  LEU A HB2  4  
ATOM 6075  H HB3  . LEU A 1 15  ? 8.525   -13.389 5.039   1.00 0.00 ? 93  LEU A HB3  4  
ATOM 6076  H HG   . LEU A 1 15  ? 10.249  -13.523 2.574   1.00 0.00 ? 93  LEU A HG   4  
ATOM 6077  H HD11 . LEU A 1 15  ? 8.154   -15.417 2.476   1.00 0.00 ? 93  LEU A HD11 4  
ATOM 6078  H HD12 . LEU A 1 15  ? 9.039   -15.682 3.978   1.00 0.00 ? 93  LEU A HD12 4  
ATOM 6079  H HD13 . LEU A 1 15  ? 9.894   -15.704 2.437   1.00 0.00 ? 93  LEU A HD13 4  
ATOM 6080  H HD21 . LEU A 1 15  ? 7.679   -13.605 1.764   1.00 0.00 ? 93  LEU A HD21 4  
ATOM 6081  H HD22 . LEU A 1 15  ? 8.609   -12.116 1.935   1.00 0.00 ? 93  LEU A HD22 4  
ATOM 6082  H HD23 . LEU A 1 15  ? 7.519   -12.628 3.224   1.00 0.00 ? 93  LEU A HD23 4  
ATOM 6083  N N    . ARG A 1 16  ? 10.348  -11.985 7.235   1.00 0.00 ? 94  ARG A N    4  
ATOM 6084  C CA   . ARG A 1 16  ? 10.062  -11.603 8.612   1.00 0.00 ? 94  ARG A CA   4  
ATOM 6085  C C    . ARG A 1 16  ? 10.555  -10.187 8.898   1.00 0.00 ? 94  ARG A C    4  
ATOM 6086  O O    . ARG A 1 16  ? 9.870   -9.401  9.550   1.00 0.00 ? 94  ARG A O    4  
ATOM 6087  C CB   . ARG A 1 16  ? 10.715  -12.588 9.584   1.00 0.00 ? 94  ARG A CB   4  
ATOM 6088  C CG   . ARG A 1 16  ? 10.256  -12.419 11.023  1.00 0.00 ? 94  ARG A CG   4  
ATOM 6089  C CD   . ARG A 1 16  ? 11.120  -11.414 11.769  1.00 0.00 ? 94  ARG A CD   4  
ATOM 6090  N NE   . ARG A 1 16  ? 10.601  -11.132 13.105  1.00 0.00 ? 94  ARG A NE   4  
ATOM 6091  C CZ   . ARG A 1 16  ? 9.656   -10.231 13.350  1.00 0.00 ? 94  ARG A CZ   4  
ATOM 6092  N NH1  . ARG A 1 16  ? 9.129   -9.530  12.356  1.00 0.00 ? 94  ARG A NH1  4  
ATOM 6093  N NH2  . ARG A 1 16  ? 9.235   -10.031 14.593  1.00 0.00 ? 94  ARG A NH2  4  
ATOM 6094  H H    . ARG A 1 16  ? 11.054  -12.642 7.058   1.00 0.00 ? 94  ARG A H    4  
ATOM 6095  H HA   . ARG A 1 16  ? 8.991   -11.633 8.749   1.00 0.00 ? 94  ARG A HA   4  
ATOM 6096  H HB2  . ARG A 1 16  ? 10.481  -13.594 9.270   1.00 0.00 ? 94  ARG A HB2  4  
ATOM 6097  H HB3  . ARG A 1 16  ? 11.785  -12.449 9.552   1.00 0.00 ? 94  ARG A HB3  4  
ATOM 6098  H HG2  . ARG A 1 16  ? 9.234   -12.070 11.026  1.00 0.00 ? 94  ARG A HG2  4  
ATOM 6099  H HG3  . ARG A 1 16  ? 10.314  -13.374 11.524  1.00 0.00 ? 94  ARG A HG3  4  
ATOM 6100  H HD2  . ARG A 1 16  ? 12.118  -11.815 11.859  1.00 0.00 ? 94  ARG A HD2  4  
ATOM 6101  H HD3  . ARG A 1 16  ? 11.151  -10.496 11.203  1.00 0.00 ? 94  ARG A HD3  4  
ATOM 6102  H HE   . ARG A 1 16  ? 10.976  -11.638 13.854  1.00 0.00 ? 94  ARG A HE   4  
ATOM 6103  H HH11 . ARG A 1 16  ? 9.443   -9.680  11.418  1.00 0.00 ? 94  ARG A HH11 4  
ATOM 6104  H HH12 . ARG A 1 16  ? 8.416   -8.854  12.543  1.00 0.00 ? 94  ARG A HH12 4  
ATOM 6105  H HH21 . ARG A 1 16  ? 9.630   -10.557 15.345  1.00 0.00 ? 94  ARG A HH21 4  
ATOM 6106  H HH22 . ARG A 1 16  ? 8.524   -9.353  14.777  1.00 0.00 ? 94  ARG A HH22 4  
ATOM 6107  N N    . ALA A 1 17  ? 11.747  -9.871  8.404   1.00 0.00 ? 95  ALA A N    4  
ATOM 6108  C CA   . ALA A 1 17  ? 12.331  -8.551  8.604   1.00 0.00 ? 95  ALA A CA   4  
ATOM 6109  C C    . ALA A 1 17  ? 11.527  -7.479  7.878   1.00 0.00 ? 95  ALA A C    4  
ATOM 6110  O O    . ALA A 1 17  ? 11.230  -6.423  8.439   1.00 0.00 ? 95  ALA A O    4  
ATOM 6111  C CB   . ALA A 1 17  ? 13.778  -8.537  8.133   1.00 0.00 ? 95  ALA A CB   4  
ATOM 6112  H H    . ALA A 1 17  ? 12.246  -10.541 7.891   1.00 0.00 ? 95  ALA A H    4  
ATOM 6113  H HA   . ALA A 1 17  ? 12.321  -8.338  9.663   1.00 0.00 ? 95  ALA A HA   4  
ATOM 6114  H HB1  . ALA A 1 17  ? 14.412  -8.939  8.910   1.00 0.00 ? 95  ALA A HB1  4  
ATOM 6115  H HB2  . ALA A 1 17  ? 13.873  -9.140  7.243   1.00 0.00 ? 95  ALA A HB2  4  
ATOM 6116  H HB3  . ALA A 1 17  ? 14.076  -7.522  7.915   1.00 0.00 ? 95  ALA A HB3  4  
ATOM 6117  N N    . LEU A 1 18  ? 11.177  -7.755  6.626   1.00 0.00 ? 96  LEU A N    4  
ATOM 6118  C CA   . LEU A 1 18  ? 10.406  -6.813  5.822   1.00 0.00 ? 96  LEU A CA   4  
ATOM 6119  C C    . LEU A 1 18  ? 8.991   -6.658  6.371   1.00 0.00 ? 96  LEU A C    4  
ATOM 6120  O O    . LEU A 1 18  ? 8.494   -5.543  6.527   1.00 0.00 ? 96  LEU A O    4  
ATOM 6121  C CB   . LEU A 1 18  ? 10.352  -7.280  4.366   1.00 0.00 ? 96  LEU A CB   4  
ATOM 6122  C CG   . LEU A 1 18  ? 10.017  -6.207  3.329   1.00 0.00 ? 96  LEU A CG   4  
ATOM 6123  C CD1  . LEU A 1 18  ? 10.442  -6.657  1.940   1.00 0.00 ? 96  LEU A CD1  4  
ATOM 6124  C CD2  . LEU A 1 18  ? 8.530   -5.885  3.356   1.00 0.00 ? 96  LEU A CD2  4  
ATOM 6125  H H    . LEU A 1 18  ? 11.442  -8.612  6.233   1.00 0.00 ? 96  LEU A H    4  
ATOM 6126  H HA   . LEU A 1 18  ? 10.903  -5.855  5.866   1.00 0.00 ? 96  LEU A HA   4  
ATOM 6127  H HB2  . LEU A 1 18  ? 11.317  -7.692  4.115   1.00 0.00 ? 96  LEU A HB2  4  
ATOM 6128  H HB3  . LEU A 1 18  ? 9.602   -8.055  4.296   1.00 0.00 ? 96  LEU A HB3  4  
ATOM 6129  H HG   . LEU A 1 18  ? 10.561  -5.303  3.567   1.00 0.00 ? 96  LEU A HG   4  
ATOM 6130  H HD11 . LEU A 1 18  ? 10.570  -7.728  1.932   1.00 0.00 ? 96  LEU A HD11 4  
ATOM 6131  H HD12 . LEU A 1 18  ? 11.375  -6.181  1.677   1.00 0.00 ? 96  LEU A HD12 4  
ATOM 6132  H HD13 . LEU A 1 18  ? 9.683   -6.378  1.224   1.00 0.00 ? 96  LEU A HD13 4  
ATOM 6133  H HD21 . LEU A 1 18  ? 8.251   -5.559  4.347   1.00 0.00 ? 96  LEU A HD21 4  
ATOM 6134  H HD22 . LEU A 1 18  ? 7.966   -6.769  3.095   1.00 0.00 ? 96  LEU A HD22 4  
ATOM 6135  H HD23 . LEU A 1 18  ? 8.319   -5.099  2.646   1.00 0.00 ? 96  LEU A HD23 4  
ATOM 6136  N N    . ASN A 1 19  ? 8.349   -7.784  6.663   1.00 0.00 ? 97  ASN A N    4  
ATOM 6137  C CA   . ASN A 1 19  ? 6.992   -7.773  7.197   1.00 0.00 ? 97  ASN A CA   4  
ATOM 6138  C C    . ASN A 1 19  ? 6.936   -7.025  8.525   1.00 0.00 ? 97  ASN A C    4  
ATOM 6139  O O    . ASN A 1 19  ? 6.074   -6.172  8.734   1.00 0.00 ? 97  ASN A O    4  
ATOM 6140  C CB   . ASN A 1 19  ? 6.484   -9.204  7.383   1.00 0.00 ? 97  ASN A CB   4  
ATOM 6141  C CG   . ASN A 1 19  ? 5.320   -9.283  8.353   1.00 0.00 ? 97  ASN A CG   4  
ATOM 6142  O OD1  . ASN A 1 19  ? 4.165   -9.102  7.970   1.00 0.00 ? 97  ASN A OD1  4  
ATOM 6143  N ND2  . ASN A 1 19  ? 5.622   -9.555  9.617   1.00 0.00 ? 97  ASN A ND2  4  
ATOM 6144  H H    . ASN A 1 19  ? 8.798   -8.643  6.517   1.00 0.00 ? 97  ASN A H    4  
ATOM 6145  H HA   . ASN A 1 19  ? 6.360   -7.266  6.484   1.00 0.00 ? 97  ASN A HA   4  
ATOM 6146  H HB2  . ASN A 1 19  ? 6.157   -9.591  6.428   1.00 0.00 ? 97  ASN A HB2  4  
ATOM 6147  H HB3  . ASN A 1 19  ? 7.286   -9.820  7.761   1.00 0.00 ? 97  ASN A HB3  4  
ATOM 6148  H HD21 . ASN A 1 19  ? 6.565   -9.688  9.850   1.00 0.00 ? 97  ASN A HD21 4  
ATOM 6149  H HD22 . ASN A 1 19  ? 4.889   -9.613  10.265  1.00 0.00 ? 97  ASN A HD22 4  
ATOM 6150  N N    . GLY A 1 20  ? 7.862   -7.351  9.422   1.00 0.00 ? 98  GLY A N    4  
ATOM 6151  C CA   . GLY A 1 20  ? 7.901   -6.701  10.719  1.00 0.00 ? 98  GLY A CA   4  
ATOM 6152  C C    . GLY A 1 20  ? 8.346   -5.255  10.629  1.00 0.00 ? 98  GLY A C    4  
ATOM 6153  O O    . GLY A 1 20  ? 7.850   -4.398  11.363  1.00 0.00 ? 98  GLY A O    4  
ATOM 6154  H H    . GLY A 1 20  ? 8.524   -8.039  9.201   1.00 0.00 ? 98  GLY A H    4  
ATOM 6155  H HA2  . GLY A 1 20  ? 6.914   -6.737  11.157  1.00 0.00 ? 98  GLY A HA2  4  
ATOM 6156  H HA3  . GLY A 1 20  ? 8.587   -7.237  11.357  1.00 0.00 ? 98  GLY A HA3  4  
ATOM 6157  N N    . LEU A 1 21  ? 9.284   -4.981  9.729   1.00 0.00 ? 99  LEU A N    4  
ATOM 6158  C CA   . LEU A 1 21  ? 9.798   -3.628  9.547   1.00 0.00 ? 99  LEU A CA   4  
ATOM 6159  C C    . LEU A 1 21  ? 8.700   -2.690  9.057   1.00 0.00 ? 99  LEU A C    4  
ATOM 6160  O O    . LEU A 1 21  ? 8.508   -1.602  9.603   1.00 0.00 ? 99  LEU A O    4  
ATOM 6161  C CB   . LEU A 1 21  ? 10.962  -3.632  8.554   1.00 0.00 ? 99  LEU A CB   4  
ATOM 6162  C CG   . LEU A 1 21  ? 12.315  -4.077  9.109   1.00 0.00 ? 99  LEU A CG   4  
ATOM 6163  C CD1  . LEU A 1 21  ? 13.239  -4.509  7.980   1.00 0.00 ? 99  LEU A CD1  4  
ATOM 6164  C CD2  . LEU A 1 21  ? 12.951  -2.959  9.923   1.00 0.00 ? 99  LEU A CD2  4  
ATOM 6165  H H    . LEU A 1 21  ? 9.640   -5.705  9.174   1.00 0.00 ? 99  LEU A H    4  
ATOM 6166  H HA   . LEU A 1 21  ? 10.154  -3.277  10.504  1.00 0.00 ? 99  LEU A HA   4  
ATOM 6167  H HB2  . LEU A 1 21  ? 10.702  -4.297  7.744   1.00 0.00 ? 99  LEU A HB2  4  
ATOM 6168  H HB3  . LEU A 1 21  ? 11.073  -2.628  8.172   1.00 0.00 ? 99  LEU A HB3  4  
ATOM 6169  H HG   . LEU A 1 21  ? 12.168  -4.926  9.762   1.00 0.00 ? 99  LEU A HG   4  
ATOM 6170  H HD11 . LEU A 1 21  ? 13.226  -5.585  7.897   1.00 0.00 ? 99  LEU A HD11 4  
ATOM 6171  H HD12 . LEU A 1 21  ? 14.244  -4.175  8.191   1.00 0.00 ? 99  LEU A HD12 4  
ATOM 6172  H HD13 . LEU A 1 21  ? 12.902  -4.070  7.052   1.00 0.00 ? 99  LEU A HD13 4  
ATOM 6173  H HD21 . LEU A 1 21  ? 12.752  -3.121  10.972  1.00 0.00 ? 99  LEU A HD21 4  
ATOM 6174  H HD22 . LEU A 1 21  ? 12.533  -2.010  9.619   1.00 0.00 ? 99  LEU A HD22 4  
ATOM 6175  H HD23 . LEU A 1 21  ? 14.018  -2.954  9.755   1.00 0.00 ? 99  LEU A HD23 4  
ATOM 6176  N N    . LEU A 1 22  ? 7.980   -3.118  8.025   1.00 0.00 ? 100 LEU A N    4  
ATOM 6177  C CA   . LEU A 1 22  ? 6.899   -2.317  7.462   1.00 0.00 ? 100 LEU A CA   4  
ATOM 6178  C C    . LEU A 1 22  ? 5.774   -2.131  8.476   1.00 0.00 ? 100 LEU A C    4  
ATOM 6179  O O    . LEU A 1 22  ? 5.175   -1.059  8.564   1.00 0.00 ? 100 LEU A O    4  
ATOM 6180  C CB   . LEU A 1 22  ? 6.354   -2.979  6.195   1.00 0.00 ? 100 LEU A CB   4  
ATOM 6181  C CG   . LEU A 1 22  ? 7.168   -2.758  4.920   1.00 0.00 ? 100 LEU A CG   4  
ATOM 6182  C CD1  . LEU A 1 22  ? 6.552   -3.517  3.755   1.00 0.00 ? 100 LEU A CD1  4  
ATOM 6183  C CD2  . LEU A 1 22  ? 7.266   -1.273  4.600   1.00 0.00 ? 100 LEU A CD2  4  
ATOM 6184  H H    . LEU A 1 22  ? 8.180   -3.993  7.632   1.00 0.00 ? 100 LEU A H    4  
ATOM 6185  H HA   . LEU A 1 22  ? 7.302   -1.348  7.208   1.00 0.00 ? 100 LEU A HA   4  
ATOM 6186  H HB2  . LEU A 1 22  ? 6.302   -4.042  6.374   1.00 0.00 ? 100 LEU A HB2  4  
ATOM 6187  H HB3  . LEU A 1 22  ? 5.359   -2.595  6.024   1.00 0.00 ? 100 LEU A HB3  4  
ATOM 6188  H HG   . LEU A 1 22  ? 8.171   -3.135  5.070   1.00 0.00 ? 100 LEU A HG   4  
ATOM 6189  H HD11 . LEU A 1 22  ? 7.212   -3.466  2.902   1.00 0.00 ? 100 LEU A HD11 4  
ATOM 6190  H HD12 . LEU A 1 22  ? 5.600   -3.075  3.500   1.00 0.00 ? 100 LEU A HD12 4  
ATOM 6191  H HD13 . LEU A 1 22  ? 6.405   -4.550  4.036   1.00 0.00 ? 100 LEU A HD13 4  
ATOM 6192  H HD21 . LEU A 1 22  ? 7.758   -1.143  3.647   1.00 0.00 ? 100 LEU A HD21 4  
ATOM 6193  H HD22 . LEU A 1 22  ? 7.837   -0.776  5.370   1.00 0.00 ? 100 LEU A HD22 4  
ATOM 6194  H HD23 . LEU A 1 22  ? 6.274   -0.849  4.554   1.00 0.00 ? 100 LEU A HD23 4  
ATOM 6195  N N    . TYR A 1 23  ? 5.495   -3.181  9.240   1.00 0.00 ? 101 TYR A N    4  
ATOM 6196  C CA   . TYR A 1 23  ? 4.442   -3.133  10.248  1.00 0.00 ? 101 TYR A CA   4  
ATOM 6197  C C    . TYR A 1 23  ? 4.791   -2.142  11.355  1.00 0.00 ? 101 TYR A C    4  
ATOM 6198  O O    . TYR A 1 23  ? 3.943   -1.372  11.805  1.00 0.00 ? 101 TYR A O    4  
ATOM 6199  C CB   . TYR A 1 23  ? 4.216   -4.523  10.846  1.00 0.00 ? 101 TYR A CB   4  
ATOM 6200  C CG   . TYR A 1 23  ? 3.288   -4.526  12.039  1.00 0.00 ? 101 TYR A CG   4  
ATOM 6201  C CD1  . TYR A 1 23  ? 1.932   -4.261  11.890  1.00 0.00 ? 101 TYR A CD1  4  
ATOM 6202  C CD2  . TYR A 1 23  ? 3.767   -4.792  13.316  1.00 0.00 ? 101 TYR A CD2  4  
ATOM 6203  C CE1  . TYR A 1 23  ? 1.080   -4.261  12.977  1.00 0.00 ? 101 TYR A CE1  4  
ATOM 6204  C CE2  . TYR A 1 23  ? 2.922   -4.796  14.409  1.00 0.00 ? 101 TYR A CE2  4  
ATOM 6205  C CZ   . TYR A 1 23  ? 1.580   -4.530  14.235  1.00 0.00 ? 101 TYR A CZ   4  
ATOM 6206  O OH   . TYR A 1 23  ? 0.735   -4.532  15.321  1.00 0.00 ? 101 TYR A OH   4  
ATOM 6207  H H    . TYR A 1 23  ? 6.007   -4.008  9.124   1.00 0.00 ? 101 TYR A H    4  
ATOM 6208  H HA   . TYR A 1 23  ? 3.533   -2.809  9.763   1.00 0.00 ? 101 TYR A HA   4  
ATOM 6209  H HB2  . TYR A 1 23  ? 3.789   -5.166  10.092  1.00 0.00 ? 101 TYR A HB2  4  
ATOM 6210  H HB3  . TYR A 1 23  ? 5.166   -4.930  11.163  1.00 0.00 ? 101 TYR A HB3  4  
ATOM 6211  H HD1  . TYR A 1 23  ? 1.544   -4.050  10.904  1.00 0.00 ? 101 TYR A HD1  4  
ATOM 6212  H HD2  . TYR A 1 23  ? 4.818   -5.000  13.449  1.00 0.00 ? 101 TYR A HD2  4  
ATOM 6213  H HE1  . TYR A 1 23  ? 0.029   -4.053  12.842  1.00 0.00 ? 101 TYR A HE1  4  
ATOM 6214  H HE2  . TYR A 1 23  ? 3.313   -5.006  15.394  1.00 0.00 ? 101 TYR A HE2  4  
ATOM 6215  H HH   . TYR A 1 23  ? 0.897   -5.316  15.851  1.00 0.00 ? 101 TYR A HH   4  
ATOM 6216  N N    . LYS A 1 24  ? 6.047   -2.168  11.788  1.00 0.00 ? 102 LYS A N    4  
ATOM 6217  C CA   . LYS A 1 24  ? 6.512   -1.272  12.840  1.00 0.00 ? 102 LYS A CA   4  
ATOM 6218  C C    . LYS A 1 24  ? 6.665   0.152   12.314  1.00 0.00 ? 102 LYS A C    4  
ATOM 6219  O O    . LYS A 1 24  ? 6.336   1.117   13.003  1.00 0.00 ? 102 LYS A O    4  
ATOM 6220  C CB   . LYS A 1 24  ? 7.846   -1.764  13.405  1.00 0.00 ? 102 LYS A CB   4  
ATOM 6221  C CG   . LYS A 1 24  ? 8.063   -1.396  14.862  1.00 0.00 ? 102 LYS A CG   4  
ATOM 6222  C CD   . LYS A 1 24  ? 8.689   -0.019  15.003  1.00 0.00 ? 102 LYS A CD   4  
ATOM 6223  C CE   . LYS A 1 24  ? 8.711   0.438   16.453  1.00 0.00 ? 102 LYS A CE   4  
ATOM 6224  N NZ   . LYS A 1 24  ? 9.901   -0.084  17.181  1.00 0.00 ? 102 LYS A NZ   4  
ATOM 6225  H H    . LYS A 1 24  ? 6.677   -2.805  11.389  1.00 0.00 ? 102 LYS A H    4  
ATOM 6226  H HA   . LYS A 1 24  ? 5.774   -1.274  13.628  1.00 0.00 ? 102 LYS A HA   4  
ATOM 6227  H HB2  . LYS A 1 24  ? 7.886   -2.840  13.317  1.00 0.00 ? 102 LYS A HB2  4  
ATOM 6228  H HB3  . LYS A 1 24  ? 8.650   -1.335  12.824  1.00 0.00 ? 102 LYS A HB3  4  
ATOM 6229  H HG2  . LYS A 1 24  ? 7.110   -1.400  15.371  1.00 0.00 ? 102 LYS A HG2  4  
ATOM 6230  H HG3  . LYS A 1 24  ? 8.718   -2.127  15.315  1.00 0.00 ? 102 LYS A HG3  4  
ATOM 6231  H HD2  . LYS A 1 24  ? 9.703   -0.054  14.633  1.00 0.00 ? 102 LYS A HD2  4  
ATOM 6232  H HD3  . LYS A 1 24  ? 8.116   0.688   14.420  1.00 0.00 ? 102 LYS A HD3  4  
ATOM 6233  H HE2  . LYS A 1 24  ? 8.730   1.517   16.477  1.00 0.00 ? 102 LYS A HE2  4  
ATOM 6234  H HE3  . LYS A 1 24  ? 7.816   0.083   16.942  1.00 0.00 ? 102 LYS A HE3  4  
ATOM 6235  H HZ1  . LYS A 1 24  ? 10.302  -0.898  16.672  1.00 0.00 ? 102 LYS A HZ1  4  
ATOM 6236  H HZ2  . LYS A 1 24  ? 9.630   -0.387  18.138  1.00 0.00 ? 102 LYS A HZ2  4  
ATOM 6237  H HZ3  . LYS A 1 24  ? 10.628  0.656   17.256  1.00 0.00 ? 102 LYS A HZ3  4  
ATOM 6238  N N    . ALA A 1 25  ? 7.165   0.274   11.089  1.00 0.00 ? 103 ALA A N    4  
ATOM 6239  C CA   . ALA A 1 25  ? 7.358   1.580   10.469  1.00 0.00 ? 103 ALA A CA   4  
ATOM 6240  C C    . ALA A 1 25  ? 6.020   2.234   10.139  1.00 0.00 ? 103 ALA A C    4  
ATOM 6241  O O    . ALA A 1 25  ? 5.831   3.430   10.364  1.00 0.00 ? 103 ALA A O    4  
ATOM 6242  C CB   . ALA A 1 25  ? 8.207   1.448   9.214   1.00 0.00 ? 103 ALA A CB   4  
ATOM 6243  H H    . ALA A 1 25  ? 7.409   -0.532  10.589  1.00 0.00 ? 103 ALA A H    4  
ATOM 6244  H HA   . ALA A 1 25  ? 7.890   2.206   11.170  1.00 0.00 ? 103 ALA A HA   4  
ATOM 6245  H HB1  . ALA A 1 25  ? 7.564   1.304   8.358   1.00 0.00 ? 103 ALA A HB1  4  
ATOM 6246  H HB2  . ALA A 1 25  ? 8.791   2.346   9.079   1.00 0.00 ? 103 ALA A HB2  4  
ATOM 6247  H HB3  . ALA A 1 25  ? 8.868   0.600   9.314   1.00 0.00 ? 103 ALA A HB3  4  
ATOM 6248  N N    . LEU A 1 26  ? 5.096   1.443   9.605   1.00 0.00 ? 104 LEU A N    4  
ATOM 6249  C CA   . LEU A 1 26  ? 3.776   1.946   9.243   1.00 0.00 ? 104 LEU A CA   4  
ATOM 6250  C C    . LEU A 1 26  ? 3.024   2.439   10.476  1.00 0.00 ? 104 LEU A C    4  
ATOM 6251  O O    . LEU A 1 26  ? 2.501   3.554   10.492  1.00 0.00 ? 104 LEU A O    4  
ATOM 6252  C CB   . LEU A 1 26  ? 2.967   0.852   8.543   1.00 0.00 ? 104 LEU A CB   4  
ATOM 6253  C CG   . LEU A 1 26  ? 3.291   0.619   7.067   1.00 0.00 ? 104 LEU A CG   4  
ATOM 6254  C CD1  . LEU A 1 26  ? 2.801   -0.750  6.622   1.00 0.00 ? 104 LEU A CD1  4  
ATOM 6255  C CD2  . LEU A 1 26  ? 2.675   1.713   6.206   1.00 0.00 ? 104 LEU A CD2  4  
ATOM 6256  H H    . LEU A 1 26  ? 5.306   0.499   9.450   1.00 0.00 ? 104 LEU A H    4  
ATOM 6257  H HA   . LEU A 1 26  ? 3.911   2.773   8.563   1.00 0.00 ? 104 LEU A HA   4  
ATOM 6258  H HB2  . LEU A 1 26  ? 3.138   -0.074  9.069   1.00 0.00 ? 104 LEU A HB2  4  
ATOM 6259  H HB3  . LEU A 1 26  ? 1.921   1.118   8.615   1.00 0.00 ? 104 LEU A HB3  4  
ATOM 6260  H HG   . LEU A 1 26  ? 4.363   0.650   6.931   1.00 0.00 ? 104 LEU A HG   4  
ATOM 6261  H HD11 . LEU A 1 26  ? 2.208   -0.647  5.726   1.00 0.00 ? 104 LEU A HD11 4  
ATOM 6262  H HD12 . LEU A 1 26  ? 2.197   -1.187  7.404   1.00 0.00 ? 104 LEU A HD12 4  
ATOM 6263  H HD13 . LEU A 1 26  ? 3.649   -1.388  6.423   1.00 0.00 ? 104 LEU A HD13 4  
ATOM 6264  H HD21 . LEU A 1 26  ? 2.899   2.678   6.636   1.00 0.00 ? 104 LEU A HD21 4  
ATOM 6265  H HD22 . LEU A 1 26  ? 1.603   1.578   6.165   1.00 0.00 ? 104 LEU A HD22 4  
ATOM 6266  H HD23 . LEU A 1 26  ? 3.083   1.659   5.208   1.00 0.00 ? 104 LEU A HD23 4  
ATOM 6267  N N    . THR A 1 27  ? 2.976   1.603   11.508  1.00 0.00 ? 105 THR A N    4  
ATOM 6268  C CA   . THR A 1 27  ? 2.291   1.954   12.745  1.00 0.00 ? 105 THR A CA   4  
ATOM 6269  C C    . THR A 1 27  ? 2.956   3.146   13.423  1.00 0.00 ? 105 THR A C    4  
ATOM 6270  O O    . THR A 1 27  ? 2.296   3.938   14.096  1.00 0.00 ? 105 THR A O    4  
ATOM 6271  C CB   . THR A 1 27  ? 2.263   0.769   13.728  1.00 0.00 ? 105 THR A CB   4  
ATOM 6272  O OG1  . THR A 1 27  ? 1.676   1.175   14.969  1.00 0.00 ? 105 THR A OG1  4  
ATOM 6273  C CG2  . THR A 1 27  ? 3.667   0.238   13.975  1.00 0.00 ? 105 THR A CG2  4  
ATOM 6274  H H    . THR A 1 27  ? 3.413   0.729   11.434  1.00 0.00 ? 105 THR A H    4  
ATOM 6275  H HA   . THR A 1 27  ? 1.272   2.215   12.499  1.00 0.00 ? 105 THR A HA   4  
ATOM 6276  H HB   . THR A 1 27  ? 1.665   -0.022  13.298  1.00 0.00 ? 105 THR A HB   4  
ATOM 6277  H HG1  . THR A 1 27  ? 2.354   1.555   15.535  1.00 0.00 ? 105 THR A HG1  4  
ATOM 6278  H HG21 . THR A 1 27  ? 4.113   0.769   14.803  1.00 0.00 ? 105 THR A HG21 4  
ATOM 6279  H HG22 . THR A 1 27  ? 4.268   0.382   13.089  1.00 0.00 ? 105 THR A HG22 4  
ATOM 6280  H HG23 . THR A 1 27  ? 3.617   -0.815  14.208  1.00 0.00 ? 105 THR A HG23 4  
ATOM 6281  N N    . ASP A 1 28  ? 4.266   3.269   13.240  1.00 0.00 ? 106 ASP A N    4  
ATOM 6282  C CA   . ASP A 1 28  ? 5.021   4.367   13.833  1.00 0.00 ? 106 ASP A CA   4  
ATOM 6283  C C    . ASP A 1 28  ? 4.633   5.699   13.198  1.00 0.00 ? 106 ASP A C    4  
ATOM 6284  O O    . ASP A 1 28  ? 4.548   6.722   13.878  1.00 0.00 ? 106 ASP A O    4  
ATOM 6285  C CB   . ASP A 1 28  ? 6.523   4.128   13.671  1.00 0.00 ? 106 ASP A CB   4  
ATOM 6286  C CG   . ASP A 1 28  ? 7.328   5.407   13.785  1.00 0.00 ? 106 ASP A CG   4  
ATOM 6287  O OD1  . ASP A 1 28  ? 7.420   5.953   14.904  1.00 0.00 ? 106 ASP A OD1  4  
ATOM 6288  O OD2  . ASP A 1 28  ? 7.867   5.862   12.754  1.00 0.00 ? 106 ASP A OD2  4  
ATOM 6289  H H    . ASP A 1 28  ? 4.737   2.606   12.693  1.00 0.00 ? 106 ASP A H    4  
ATOM 6290  H HA   . ASP A 1 28  ? 4.783   4.403   14.886  1.00 0.00 ? 106 ASP A HA   4  
ATOM 6291  H HB2  . ASP A 1 28  ? 6.857   3.445   14.438  1.00 0.00 ? 106 ASP A HB2  4  
ATOM 6292  H HB3  . ASP A 1 28  ? 6.708   3.692   12.700  1.00 0.00 ? 106 ASP A HB3  4  
ATOM 6293  N N    . LEU A 1 29  ? 4.401   5.679   11.890  1.00 0.00 ? 107 LEU A N    4  
ATOM 6294  C CA   . LEU A 1 29  ? 4.024   6.885   11.161  1.00 0.00 ? 107 LEU A CA   4  
ATOM 6295  C C    . LEU A 1 29  ? 2.617   7.333   11.543  1.00 0.00 ? 107 LEU A C    4  
ATOM 6296  O O    . LEU A 1 29  ? 2.334   8.530   11.620  1.00 0.00 ? 107 LEU A O    4  
ATOM 6297  C CB   . LEU A 1 29  ? 4.102   6.639   9.654   1.00 0.00 ? 107 LEU A CB   4  
ATOM 6298  C CG   . LEU A 1 29  ? 5.508   6.554   9.059   1.00 0.00 ? 107 LEU A CG   4  
ATOM 6299  C CD1  . LEU A 1 29  ? 5.445   6.152   7.594   1.00 0.00 ? 107 LEU A CD1  4  
ATOM 6300  C CD2  . LEU A 1 29  ? 6.236   7.880   9.220   1.00 0.00 ? 107 LEU A CD2  4  
ATOM 6301  H H    . LEU A 1 29  ? 4.485   4.834   11.402  1.00 0.00 ? 107 LEU A H    4  
ATOM 6302  H HA   . LEU A 1 29  ? 4.722   7.665   11.427  1.00 0.00 ? 107 LEU A HA   4  
ATOM 6303  H HB2  . LEU A 1 29  ? 3.598   5.708   9.444   1.00 0.00 ? 107 LEU A HB2  4  
ATOM 6304  H HB3  . LEU A 1 29  ? 3.581   7.448   9.160   1.00 0.00 ? 107 LEU A HB3  4  
ATOM 6305  H HG   . LEU A 1 29  ? 6.070   5.797   9.589   1.00 0.00 ? 107 LEU A HG   4  
ATOM 6306  H HD11 . LEU A 1 29  ? 5.561   5.082   7.509   1.00 0.00 ? 107 LEU A HD11 4  
ATOM 6307  H HD12 . LEU A 1 29  ? 6.239   6.645   7.051   1.00 0.00 ? 107 LEU A HD12 4  
ATOM 6308  H HD13 . LEU A 1 29  ? 4.491   6.446   7.181   1.00 0.00 ? 107 LEU A HD13 4  
ATOM 6309  H HD21 . LEU A 1 29  ? 7.213   7.705   9.647   1.00 0.00 ? 107 LEU A HD21 4  
ATOM 6310  H HD22 . LEU A 1 29  ? 5.668   8.526   9.874   1.00 0.00 ? 107 LEU A HD22 4  
ATOM 6311  H HD23 . LEU A 1 29  ? 6.344   8.351   8.254   1.00 0.00 ? 107 LEU A HD23 4  
ATOM 6312  N N    . LEU A 1 30  ? 1.738   6.367   11.782  1.00 0.00 ? 108 LEU A N    4  
ATOM 6313  C CA   . LEU A 1 30  ? 0.359   6.662   12.158  1.00 0.00 ? 108 LEU A CA   4  
ATOM 6314  C C    . LEU A 1 30  ? 0.277   7.114   13.613  1.00 0.00 ? 108 LEU A C    4  
ATOM 6315  O O    . LEU A 1 30  ? -0.813  7.315   14.150  1.00 0.00 ? 108 LEU A O    4  
ATOM 6316  C CB   . LEU A 1 30  ? -0.523  5.431   11.944  1.00 0.00 ? 108 LEU A CB   4  
ATOM 6317  C CG   . LEU A 1 30  ? -0.988  5.180   10.510  1.00 0.00 ? 108 LEU A CG   4  
ATOM 6318  C CD1  . LEU A 1 30  ? 0.132   5.477   9.525   1.00 0.00 ? 108 LEU A CD1  4  
ATOM 6319  C CD2  . LEU A 1 30  ? -1.475  3.747   10.349  1.00 0.00 ? 108 LEU A CD2  4  
ATOM 6320  H H    . LEU A 1 30  ? 2.021   5.432   11.705  1.00 0.00 ? 108 LEU A H    4  
ATOM 6321  H HA   . LEU A 1 30  ? 0.007   7.462   11.524  1.00 0.00 ? 108 LEU A HA   4  
ATOM 6322  H HB2  . LEU A 1 30  ? 0.034   4.565   12.267  1.00 0.00 ? 108 LEU A HB2  4  
ATOM 6323  H HB3  . LEU A 1 30  ? -1.402  5.543   12.563  1.00 0.00 ? 108 LEU A HB3  4  
ATOM 6324  H HG   . LEU A 1 30  ? -1.814  5.841   10.285  1.00 0.00 ? 108 LEU A HG   4  
ATOM 6325  H HD11 . LEU A 1 30  ? 0.599   6.415   9.785   1.00 0.00 ? 108 LEU A HD11 4  
ATOM 6326  H HD12 . LEU A 1 30  ? -0.274  5.542   8.527   1.00 0.00 ? 108 LEU A HD12 4  
ATOM 6327  H HD13 . LEU A 1 30  ? 0.865   4.685   9.564   1.00 0.00 ? 108 LEU A HD13 4  
ATOM 6328  H HD21 . LEU A 1 30  ? -0.633  3.073   10.409  1.00 0.00 ? 108 LEU A HD21 4  
ATOM 6329  H HD22 . LEU A 1 30  ? -1.957  3.635   9.389   1.00 0.00 ? 108 LEU A HD22 4  
ATOM 6330  H HD23 . LEU A 1 30  ? -2.178  3.515   11.136  1.00 0.00 ? 108 LEU A HD23 4  
ATOM 6331  N N    . CYS A 1 31  ? 1.435   7.275   14.243  1.00 0.00 ? 109 CYS A N    4  
ATOM 6332  C CA   . CYS A 1 31  ? 1.494   7.705   15.636  1.00 0.00 ? 109 CYS A CA   4  
ATOM 6333  C C    . CYS A 1 31  ? 1.719   9.211   15.730  1.00 0.00 ? 109 CYS A C    4  
ATOM 6334  O O    . CYS A 1 31  ? 1.302   9.853   16.695  1.00 0.00 ? 109 CYS A O    4  
ATOM 6335  C CB   . CYS A 1 31  ? 2.609   6.963   16.374  1.00 0.00 ? 109 CYS A CB   4  
ATOM 6336  S SG   . CYS A 1 31  ? 2.279   5.204   16.632  1.00 0.00 ? 109 CYS A SG   4  
ATOM 6337  H H    . CYS A 1 31  ? 2.270   7.099   13.762  1.00 0.00 ? 109 CYS A H    4  
ATOM 6338  H HA   . CYS A 1 31  ? 0.547   7.466   16.096  1.00 0.00 ? 109 CYS A HA   4  
ATOM 6339  H HB2  . CYS A 1 31  ? 3.523   7.045   15.805  1.00 0.00 ? 109 CYS A HB2  4  
ATOM 6340  H HB3  . CYS A 1 31  ? 2.753   7.417   17.343  1.00 0.00 ? 109 CYS A HB3  4  
ATOM 6341  H HG   . CYS A 1 31  ? 2.940   4.524   15.708  1.00 0.00 ? 109 CYS A HG   4  
ATOM 6342  N N    . THR A 1 32  ? 2.383   9.769   14.723  1.00 0.00 ? 110 THR A N    4  
ATOM 6343  C CA   . THR A 1 32  ? 2.667   11.198  14.693  1.00 0.00 ? 110 THR A CA   4  
ATOM 6344  C C    . THR A 1 32  ? 1.889   11.890  13.580  1.00 0.00 ? 110 THR A C    4  
ATOM 6345  O O    . THR A 1 32  ? 2.090   11.629  12.394  1.00 0.00 ? 110 THR A O    4  
ATOM 6346  C CB   . THR A 1 32  ? 4.171   11.468  14.498  1.00 0.00 ? 110 THR A CB   4  
ATOM 6347  O OG1  . THR A 1 32  ? 4.940   10.445  15.140  1.00 0.00 ? 110 THR A OG1  4  
ATOM 6348  C CG2  . THR A 1 32  ? 4.554   12.828  15.062  1.00 0.00 ? 110 THR A CG2  4  
ATOM 6349  H H    . THR A 1 32  ? 2.689   9.204   13.983  1.00 0.00 ? 110 THR A H    4  
ATOM 6350  H HA   . THR A 1 32  ? 2.367   11.617  15.643  1.00 0.00 ? 110 THR A HA   4  
ATOM 6351  H HB   . THR A 1 32  ? 4.388   11.460  13.439  1.00 0.00 ? 110 THR A HB   4  
ATOM 6352  H HG1  . THR A 1 32  ? 4.356   9.741   15.431  1.00 0.00 ? 110 THR A HG1  4  
ATOM 6353  H HG21 . THR A 1 32  ? 4.972   12.703  16.050  1.00 0.00 ? 110 THR A HG21 4  
ATOM 6354  H HG22 . THR A 1 32  ? 3.676   13.454  15.119  1.00 0.00 ? 110 THR A HG22 4  
ATOM 6355  H HG23 . THR A 1 32  ? 5.286   13.291  14.418  1.00 0.00 ? 110 THR A HG23 4  
ATOM 6356  N N    . PRO A 1 33  ? 0.978   12.795  13.968  1.00 0.00 ? 111 PRO A N    4  
ATOM 6357  C CA   . PRO A 1 33  ? 0.152   13.545  13.016  1.00 0.00 ? 111 PRO A CA   4  
ATOM 6358  C C    . PRO A 1 33  ? 0.964   14.559  12.217  1.00 0.00 ? 111 PRO A C    4  
ATOM 6359  O O    . PRO A 1 33  ? 0.414   15.312  11.414  1.00 0.00 ? 111 PRO A O    4  
ATOM 6360  C CB   . PRO A 1 33  ? -0.862  14.259  13.913  1.00 0.00 ? 111 PRO A CB   4  
ATOM 6361  C CG   . PRO A 1 33  ? -0.182  14.379  15.233  1.00 0.00 ? 111 PRO A CG   4  
ATOM 6362  C CD   . PRO A 1 33  ? 0.685   13.157  15.364  1.00 0.00 ? 111 PRO A CD   4  
ATOM 6363  H HA   . PRO A 1 33  ? -0.367  12.885  12.336  1.00 0.00 ? 111 PRO A HA   4  
ATOM 6364  H HB2  . PRO A 1 33  ? -1.093  15.230  13.497  1.00 0.00 ? 111 PRO A HB2  4  
ATOM 6365  H HB3  . PRO A 1 33  ? -1.763  13.668  13.985  1.00 0.00 ? 111 PRO A HB3  4  
ATOM 6366  H HG2  . PRO A 1 33  ? 0.422   15.272  15.255  1.00 0.00 ? 111 PRO A HG2  4  
ATOM 6367  H HG3  . PRO A 1 33  ? -0.918  14.402  16.024  1.00 0.00 ? 111 PRO A HG3  4  
ATOM 6368  H HD2  . PRO A 1 33  ? 1.592   13.395  15.900  1.00 0.00 ? 111 PRO A HD2  4  
ATOM 6369  H HD3  . PRO A 1 33  ? 0.147   12.364  15.863  1.00 0.00 ? 111 PRO A HD3  4  
ATOM 6370  N N    . GLU A 1 34  ? 2.274   14.571  12.443  1.00 0.00 ? 112 GLU A N    4  
ATOM 6371  C CA   . GLU A 1 34  ? 3.160   15.494  11.743  1.00 0.00 ? 112 GLU A CA   4  
ATOM 6372  C C    . GLU A 1 34  ? 3.060   15.304  10.233  1.00 0.00 ? 112 GLU A C    4  
ATOM 6373  O O    . GLU A 1 34  ? 2.848   16.261  9.488   1.00 0.00 ? 112 GLU A O    4  
ATOM 6374  C CB   . GLU A 1 34  ? 4.607   15.292  12.199  1.00 0.00 ? 112 GLU A CB   4  
ATOM 6375  C CG   . GLU A 1 34  ? 4.994   16.147  13.394  1.00 0.00 ? 112 GLU A CG   4  
ATOM 6376  C CD   . GLU A 1 34  ? 5.129   17.615  13.041  1.00 0.00 ? 112 GLU A CD   4  
ATOM 6377  O OE1  . GLU A 1 34  ? 6.074   17.962  12.302  1.00 0.00 ? 112 GLU A OE1  4  
ATOM 6378  O OE2  . GLU A 1 34  ? 4.291   18.417  13.504  1.00 0.00 ? 112 GLU A OE2  4  
ATOM 6379  H H    . GLU A 1 34  ? 2.653   13.946  13.096  1.00 0.00 ? 112 GLU A H    4  
ATOM 6380  H HA   . GLU A 1 34  ? 2.853   16.499  11.989  1.00 0.00 ? 112 GLU A HA   4  
ATOM 6381  H HB2  . GLU A 1 34  ? 4.746   14.254  12.465  1.00 0.00 ? 112 GLU A HB2  4  
ATOM 6382  H HB3  . GLU A 1 34  ? 5.267   15.536  11.380  1.00 0.00 ? 112 GLU A HB3  4  
ATOM 6383  H HG2  . GLU A 1 34  ? 4.235   16.044  14.155  1.00 0.00 ? 112 GLU A HG2  4  
ATOM 6384  H HG3  . GLU A 1 34  ? 5.939   15.796  13.781  1.00 0.00 ? 112 GLU A HG3  4  
ATOM 6385  N N    . VAL A 1 35  ? 3.216   14.062  9.787   1.00 0.00 ? 113 VAL A N    4  
ATOM 6386  C CA   . VAL A 1 35  ? 3.143   13.745  8.365   1.00 0.00 ? 113 VAL A CA   4  
ATOM 6387  C C    . VAL A 1 35  ? 1.724   13.362  7.960   1.00 0.00 ? 113 VAL A C    4  
ATOM 6388  O O    . VAL A 1 35  ? 1.150   13.949  7.042   1.00 0.00 ? 113 VAL A O    4  
ATOM 6389  C CB   . VAL A 1 35  ? 4.098   12.594  7.997   1.00 0.00 ? 113 VAL A CB   4  
ATOM 6390  C CG1  . VAL A 1 35  ? 3.727   11.329  8.755   1.00 0.00 ? 113 VAL A CG1  4  
ATOM 6391  C CG2  . VAL A 1 35  ? 4.083   12.349  6.496   1.00 0.00 ? 113 VAL A CG2  4  
ATOM 6392  H H    . VAL A 1 35  ? 3.383   13.341  10.429  1.00 0.00 ? 113 VAL A H    4  
ATOM 6393  H HA   . VAL A 1 35  ? 3.441   14.623  7.812   1.00 0.00 ? 113 VAL A HA   4  
ATOM 6394  H HB   . VAL A 1 35  ? 5.099   12.879  8.284   1.00 0.00 ? 113 VAL A HB   4  
ATOM 6395  H HG11 . VAL A 1 35  ? 2.860   10.876  8.297   1.00 0.00 ? 113 VAL A HG11 4  
ATOM 6396  H HG12 . VAL A 1 35  ? 4.555   10.635  8.726   1.00 0.00 ? 113 VAL A HG12 4  
ATOM 6397  H HG13 . VAL A 1 35  ? 3.502   11.578  9.782   1.00 0.00 ? 113 VAL A HG13 4  
ATOM 6398  H HG21 . VAL A 1 35  ? 3.320   12.962  6.040   1.00 0.00 ? 113 VAL A HG21 4  
ATOM 6399  H HG22 . VAL A 1 35  ? 5.046   12.605  6.079   1.00 0.00 ? 113 VAL A HG22 4  
ATOM 6400  H HG23 . VAL A 1 35  ? 3.872   11.308  6.302   1.00 0.00 ? 113 VAL A HG23 4  
ATOM 6401  N N    . SER A 1 36  ? 1.162   12.375  8.650   1.00 0.00 ? 114 SER A N    4  
ATOM 6402  C CA   . SER A 1 36  ? -0.189  11.912  8.360   1.00 0.00 ? 114 SER A CA   4  
ATOM 6403  C C    . SER A 1 36  ? -1.213  12.654  9.214   1.00 0.00 ? 114 SER A C    4  
ATOM 6404  O O    . SER A 1 36  ? -1.885  12.057  10.054  1.00 0.00 ? 114 SER A O    4  
ATOM 6405  C CB   . SER A 1 36  ? -0.299  10.406  8.607   1.00 0.00 ? 114 SER A CB   4  
ATOM 6406  O OG   . SER A 1 36  ? -0.238  10.110  9.992   1.00 0.00 ? 114 SER A OG   4  
ATOM 6407  H H    . SER A 1 36  ? 1.671   11.947  9.371   1.00 0.00 ? 114 SER A H    4  
ATOM 6408  H HA   . SER A 1 36  ? -0.392  12.113  7.319   1.00 0.00 ? 114 SER A HA   4  
ATOM 6409  H HB2  . SER A 1 36  ? -1.238  10.046  8.215   1.00 0.00 ? 114 SER A HB2  4  
ATOM 6410  H HB3  . SER A 1 36  ? 0.516   9.902   8.108   1.00 0.00 ? 114 SER A HB3  4  
ATOM 6411  H HG   . SER A 1 36  ? -1.127  10.090  10.354  1.00 0.00 ? 114 SER A HG   4  
ATOM 6412  N N    . GLN A 1 37  ? -1.326  13.959  8.990   1.00 0.00 ? 115 GLN A N    4  
ATOM 6413  C CA   . GLN A 1 37  ? -2.267  14.784  9.739   1.00 0.00 ? 115 GLN A CA   4  
ATOM 6414  C C    . GLN A 1 37  ? -3.699  14.305  9.526   1.00 0.00 ? 115 GLN A C    4  
ATOM 6415  O O    . GLN A 1 37  ? -4.463  14.163  10.480  1.00 0.00 ? 115 GLN A O    4  
ATOM 6416  C CB   . GLN A 1 37  ? -2.139  16.249  9.319   1.00 0.00 ? 115 GLN A CB   4  
ATOM 6417  C CG   . GLN A 1 37  ? -2.885  17.210  10.231  1.00 0.00 ? 115 GLN A CG   4  
ATOM 6418  C CD   . GLN A 1 37  ? -2.385  17.164  11.661  1.00 0.00 ? 115 GLN A CD   4  
ATOM 6419  O OE1  . GLN A 1 37  ? -1.309  17.675  11.972  1.00 0.00 ? 115 GLN A OE1  4  
ATOM 6420  N NE2  . GLN A 1 37  ? -3.166  16.550  12.542  1.00 0.00 ? 115 GLN A NE2  4  
ATOM 6421  H H    . GLN A 1 37  ? -0.762  14.377  8.306   1.00 0.00 ? 115 GLN A H    4  
ATOM 6422  H HA   . GLN A 1 37  ? -2.023  14.696  10.786  1.00 0.00 ? 115 GLN A HA   4  
ATOM 6423  H HB2  . GLN A 1 37  ? -1.094  16.522  9.321   1.00 0.00 ? 115 GLN A HB2  4  
ATOM 6424  H HB3  . GLN A 1 37  ? -2.530  16.360  8.318   1.00 0.00 ? 115 GLN A HB3  4  
ATOM 6425  H HG2  . GLN A 1 37  ? -2.759  18.215  9.854   1.00 0.00 ? 115 GLN A HG2  4  
ATOM 6426  H HG3  . GLN A 1 37  ? -3.934  16.953  10.223  1.00 0.00 ? 115 GLN A HG3  4  
ATOM 6427  H HE21 . GLN A 1 37  ? -4.010  16.165  12.223  1.00 0.00 ? 115 GLN A HE21 4  
ATOM 6428  H HE22 . GLN A 1 37  ? -2.867  16.505  13.473  1.00 0.00 ? 115 GLN A HE22 4  
ATOM 6429  N N    . GLU A 1 38  ? -4.055  14.057  8.269   1.00 0.00 ? 116 GLU A N    4  
ATOM 6430  C CA   . GLU A 1 38  ? -5.396  13.595  7.933   1.00 0.00 ? 116 GLU A CA   4  
ATOM 6431  C C    . GLU A 1 38  ? -5.657  12.209  8.517   1.00 0.00 ? 116 GLU A C    4  
ATOM 6432  O O    . GLU A 1 38  ? -6.752  11.924  9.004   1.00 0.00 ? 116 GLU A O    4  
ATOM 6433  C CB   . GLU A 1 38  ? -5.583  13.564  6.414   1.00 0.00 ? 116 GLU A CB   4  
ATOM 6434  C CG   . GLU A 1 38  ? -5.081  12.285  5.765   1.00 0.00 ? 116 GLU A CG   4  
ATOM 6435  C CD   . GLU A 1 38  ? -3.568  12.237  5.665   1.00 0.00 ? 116 GLU A CD   4  
ATOM 6436  O OE1  . GLU A 1 38  ? -3.002  12.999  4.854   1.00 0.00 ? 116 GLU A OE1  4  
ATOM 6437  O OE2  . GLU A 1 38  ? -2.951  11.436  6.398   1.00 0.00 ? 116 GLU A OE2  4  
ATOM 6438  H H    . GLU A 1 38  ? -3.400  14.189  7.552   1.00 0.00 ? 116 GLU A H    4  
ATOM 6439  H HA   . GLU A 1 38  ? -6.103  14.291  8.359   1.00 0.00 ? 116 GLU A HA   4  
ATOM 6440  H HB2  . GLU A 1 38  ? -6.634  13.668  6.191   1.00 0.00 ? 116 GLU A HB2  4  
ATOM 6441  H HB3  . GLU A 1 38  ? -5.048  14.396  5.981   1.00 0.00 ? 116 GLU A HB3  4  
ATOM 6442  H HG2  . GLU A 1 38  ? -5.414  11.443  6.354   1.00 0.00 ? 116 GLU A HG2  4  
ATOM 6443  H HG3  . GLU A 1 38  ? -5.495  12.214  4.771   1.00 0.00 ? 116 GLU A HG3  4  
ATOM 6444  N N    . LEU A 1 39  ? -4.644  11.352  8.464   1.00 0.00 ? 117 LEU A N    4  
ATOM 6445  C CA   . LEU A 1 39  ? -4.762  9.995   8.987   1.00 0.00 ? 117 LEU A CA   4  
ATOM 6446  C C    . LEU A 1 39  ? -4.982  10.010  10.496  1.00 0.00 ? 117 LEU A C    4  
ATOM 6447  O O    . LEU A 1 39  ? -5.909  9.380   11.005  1.00 0.00 ? 117 LEU A O    4  
ATOM 6448  C CB   . LEU A 1 39  ? -3.507  9.187   8.652   1.00 0.00 ? 117 LEU A CB   4  
ATOM 6449  C CG   . LEU A 1 39  ? -3.659  7.666   8.687   1.00 0.00 ? 117 LEU A CG   4  
ATOM 6450  C CD1  . LEU A 1 39  ? -4.933  7.240   7.974   1.00 0.00 ? 117 LEU A CD1  4  
ATOM 6451  C CD2  . LEU A 1 39  ? -2.445  6.994   8.062   1.00 0.00 ? 117 LEU A CD2  4  
ATOM 6452  H H    . LEU A 1 39  ? -3.796  11.636  8.065   1.00 0.00 ? 117 LEU A H    4  
ATOM 6453  H HA   . LEU A 1 39  ? -5.616  9.531   8.516   1.00 0.00 ? 117 LEU A HA   4  
ATOM 6454  H HB2  . LEU A 1 39  ? -3.191  9.464   7.658   1.00 0.00 ? 117 LEU A HB2  4  
ATOM 6455  H HB3  . LEU A 1 39  ? -2.739  9.460   9.361   1.00 0.00 ? 117 LEU A HB3  4  
ATOM 6456  H HG   . LEU A 1 39  ? -3.729  7.341   9.716   1.00 0.00 ? 117 LEU A HG   4  
ATOM 6457  H HD11 . LEU A 1 39  ? -5.059  7.831   7.079   1.00 0.00 ? 117 LEU A HD11 4  
ATOM 6458  H HD12 . LEU A 1 39  ? -5.779  7.390   8.627   1.00 0.00 ? 117 LEU A HD12 4  
ATOM 6459  H HD13 . LEU A 1 39  ? -4.864  6.195   7.709   1.00 0.00 ? 117 LEU A HD13 4  
ATOM 6460  H HD21 . LEU A 1 39  ? -2.663  5.951   7.886   1.00 0.00 ? 117 LEU A HD21 4  
ATOM 6461  H HD22 . LEU A 1 39  ? -1.602  7.077   8.734   1.00 0.00 ? 117 LEU A HD22 4  
ATOM 6462  H HD23 . LEU A 1 39  ? -2.209  7.476   7.126   1.00 0.00 ? 117 LEU A HD23 4  
ATOM 6463  N N    . TYR A 1 40  ? -4.125  10.736  11.207  1.00 0.00 ? 118 TYR A N    4  
ATOM 6464  C CA   . TYR A 1 40  ? -4.226  10.834  12.658  1.00 0.00 ? 118 TYR A CA   4  
ATOM 6465  C C    . TYR A 1 40  ? -5.629  11.259  13.079  1.00 0.00 ? 118 TYR A C    4  
ATOM 6466  O O    . TYR A 1 40  ? -6.244  10.639  13.947  1.00 0.00 ? 118 TYR A O    4  
ATOM 6467  C CB   . TYR A 1 40  ? -3.196  11.828  13.196  1.00 0.00 ? 118 TYR A CB   4  
ATOM 6468  C CG   . TYR A 1 40  ? -2.996  11.743  14.692  1.00 0.00 ? 118 TYR A CG   4  
ATOM 6469  C CD1  . TYR A 1 40  ? -2.115  10.821  15.244  1.00 0.00 ? 118 TYR A CD1  4  
ATOM 6470  C CD2  . TYR A 1 40  ? -3.689  12.585  15.554  1.00 0.00 ? 118 TYR A CD2  4  
ATOM 6471  C CE1  . TYR A 1 40  ? -1.930  10.739  16.610  1.00 0.00 ? 118 TYR A CE1  4  
ATOM 6472  C CE2  . TYR A 1 40  ? -3.508  12.511  16.922  1.00 0.00 ? 118 TYR A CE2  4  
ATOM 6473  C CZ   . TYR A 1 40  ? -2.628  11.587  17.445  1.00 0.00 ? 118 TYR A CZ   4  
ATOM 6474  O OH   . TYR A 1 40  ? -2.447  11.509  18.807  1.00 0.00 ? 118 TYR A OH   4  
ATOM 6475  H H    . TYR A 1 40  ? -3.407  11.216  10.744  1.00 0.00 ? 118 TYR A H    4  
ATOM 6476  H HA   . TYR A 1 40  ? -4.019  9.857   13.071  1.00 0.00 ? 118 TYR A HA   4  
ATOM 6477  H HB2  . TYR A 1 40  ? -2.244  11.641  12.724  1.00 0.00 ? 118 TYR A HB2  4  
ATOM 6478  H HB3  . TYR A 1 40  ? -3.518  12.832  12.960  1.00 0.00 ? 118 TYR A HB3  4  
ATOM 6479  H HD1  . TYR A 1 40  ? -1.570  10.159  14.587  1.00 0.00 ? 118 TYR A HD1  4  
ATOM 6480  H HD2  . TYR A 1 40  ? -4.378  13.307  15.141  1.00 0.00 ? 118 TYR A HD2  4  
ATOM 6481  H HE1  . TYR A 1 40  ? -1.241  10.016  17.020  1.00 0.00 ? 118 TYR A HE1  4  
ATOM 6482  H HE2  . TYR A 1 40  ? -4.055  13.174  17.576  1.00 0.00 ? 118 TYR A HE2  4  
ATOM 6483  H HH   . TYR A 1 40  ? -3.047  12.118  19.244  1.00 0.00 ? 118 TYR A HH   4  
ATOM 6484  N N    . ASP A 1 41  ? -6.129  12.321  12.458  1.00 0.00 ? 119 ASP A N    4  
ATOM 6485  C CA   . ASP A 1 41  ? -7.461  12.831  12.765  1.00 0.00 ? 119 ASP A CA   4  
ATOM 6486  C C    . ASP A 1 41  ? -8.455  11.686  12.936  1.00 0.00 ? 119 ASP A C    4  
ATOM 6487  O O    . ASP A 1 41  ? -9.412  11.790  13.703  1.00 0.00 ? 119 ASP A O    4  
ATOM 6488  C CB   . ASP A 1 41  ? -7.937  13.775  11.661  1.00 0.00 ? 119 ASP A CB   4  
ATOM 6489  C CG   . ASP A 1 41  ? -9.284  14.398  11.972  1.00 0.00 ? 119 ASP A CG   4  
ATOM 6490  O OD1  . ASP A 1 41  ? -9.350  15.238  12.893  1.00 0.00 ? 119 ASP A OD1  4  
ATOM 6491  O OD2  . ASP A 1 41  ? -10.272 14.044  11.295  1.00 0.00 ? 119 ASP A OD2  4  
ATOM 6492  H H    . ASP A 1 41  ? -5.591  12.773  11.774  1.00 0.00 ? 119 ASP A H    4  
ATOM 6493  H HA   . ASP A 1 41  ? -7.400  13.379  13.693  1.00 0.00 ? 119 ASP A HA   4  
ATOM 6494  H HB2  . ASP A 1 41  ? -7.214  14.569  11.538  1.00 0.00 ? 119 ASP A HB2  4  
ATOM 6495  H HB3  . ASP A 1 41  ? -8.020  13.224  10.736  1.00 0.00 ? 119 ASP A HB3  4  
ATOM 6496  N N    . LEU A 1 42  ? -8.221  10.594  12.215  1.00 0.00 ? 120 LEU A N    4  
ATOM 6497  C CA   . LEU A 1 42  ? -9.096  9.429   12.286  1.00 0.00 ? 120 LEU A CA   4  
ATOM 6498  C C    . LEU A 1 42  ? -8.668  8.494   13.412  1.00 0.00 ? 120 LEU A C    4  
ATOM 6499  O O    . LEU A 1 42  ? -9.500  7.837   14.036  1.00 0.00 ? 120 LEU A O    4  
ATOM 6500  C CB   . LEU A 1 42  ? -9.087  8.679   10.953  1.00 0.00 ? 120 LEU A CB   4  
ATOM 6501  C CG   . LEU A 1 42  ? -9.448  9.503   9.716   1.00 0.00 ? 120 LEU A CG   4  
ATOM 6502  C CD1  . LEU A 1 42  ? -8.956  8.813   8.454   1.00 0.00 ? 120 LEU A CD1  4  
ATOM 6503  C CD2  . LEU A 1 42  ? -10.951 9.734   9.649   1.00 0.00 ? 120 LEU A CD2  4  
ATOM 6504  H H    . LEU A 1 42  ? -7.442  10.570  11.622  1.00 0.00 ? 120 LEU A H    4  
ATOM 6505  H HA   . LEU A 1 42  ? -10.098 9.779   12.486  1.00 0.00 ? 120 LEU A HA   4  
ATOM 6506  H HB2  . LEU A 1 42  ? -8.096  8.279   10.806  1.00 0.00 ? 120 LEU A HB2  4  
ATOM 6507  H HB3  . LEU A 1 42  ? -9.795  7.865   11.028  1.00 0.00 ? 120 LEU A HB3  4  
ATOM 6508  H HG   . LEU A 1 42  ? -8.963  10.467  9.780   1.00 0.00 ? 120 LEU A HG   4  
ATOM 6509  H HD11 . LEU A 1 42  ? -8.879  7.751   8.630   1.00 0.00 ? 120 LEU A HD11 4  
ATOM 6510  H HD12 . LEU A 1 42  ? -7.986  9.204   8.184   1.00 0.00 ? 120 LEU A HD12 4  
ATOM 6511  H HD13 . LEU A 1 42  ? -9.653  8.995   7.649   1.00 0.00 ? 120 LEU A HD13 4  
ATOM 6512  H HD21 . LEU A 1 42  ? -11.387 9.056   8.930   1.00 0.00 ? 120 LEU A HD21 4  
ATOM 6513  H HD22 . LEU A 1 42  ? -11.145 10.753  9.348   1.00 0.00 ? 120 LEU A HD22 4  
ATOM 6514  H HD23 . LEU A 1 42  ? -11.386 9.556   10.621  1.00 0.00 ? 120 LEU A HD23 4  
ATOM 6515  N N    . ASN A 1 43  ? -7.365  8.442   13.668  1.00 0.00 ? 121 ASN A N    4  
ATOM 6516  C CA   . ASN A 1 43  ? -6.827  7.588   14.721  1.00 0.00 ? 121 ASN A CA   4  
ATOM 6517  C C    . ASN A 1 43  ? -6.901  6.118   14.320  1.00 0.00 ? 121 ASN A C    4  
ATOM 6518  O O    . ASN A 1 43  ? -7.457  5.293   15.045  1.00 0.00 ? 121 ASN A O    4  
ATOM 6519  C CB   . ASN A 1 43  ? -7.590  7.812   16.028  1.00 0.00 ? 121 ASN A CB   4  
ATOM 6520  C CG   . ASN A 1 43  ? -6.827  7.306   17.237  1.00 0.00 ? 121 ASN A CG   4  
ATOM 6521  O OD1  . ASN A 1 43  ? -7.069  6.200   17.720  1.00 0.00 ? 121 ASN A OD1  4  
ATOM 6522  N ND2  . ASN A 1 43  ? -5.899  8.117   17.732  1.00 0.00 ? 121 ASN A ND2  4  
ATOM 6523  H H    . ASN A 1 43  ? -6.751  8.990   13.136  1.00 0.00 ? 121 ASN A H    4  
ATOM 6524  H HA   . ASN A 1 43  ? -5.792  7.857   14.868  1.00 0.00 ? 121 ASN A HA   4  
ATOM 6525  H HB2  . ASN A 1 43  ? -7.770  8.869   16.156  1.00 0.00 ? 121 ASN A HB2  4  
ATOM 6526  H HB3  . ASN A 1 43  ? -8.536  7.293   15.979  1.00 0.00 ? 121 ASN A HB3  4  
ATOM 6527  H HD21 . ASN A 1 43  ? -5.761  8.984   17.296  1.00 0.00 ? 121 ASN A HD21 4  
ATOM 6528  H HD22 . ASN A 1 43  ? -5.390  7.816   18.513  1.00 0.00 ? 121 ASN A HD22 4  
ATOM 6529  N N    . VAL A 1 44  ? -6.336  5.797   13.161  1.00 0.00 ? 122 VAL A N    4  
ATOM 6530  C CA   . VAL A 1 44  ? -6.336  4.426   12.664  1.00 0.00 ? 122 VAL A CA   4  
ATOM 6531  C C    . VAL A 1 44  ? -5.254  3.595   13.343  1.00 0.00 ? 122 VAL A C    4  
ATOM 6532  O O    . VAL A 1 44  ? -4.225  4.123   13.765  1.00 0.00 ? 122 VAL A O    4  
ATOM 6533  C CB   . VAL A 1 44  ? -6.120  4.382   11.139  1.00 0.00 ? 122 VAL A CB   4  
ATOM 6534  C CG1  . VAL A 1 44  ? -4.890  5.187   10.750  1.00 0.00 ? 122 VAL A CG1  4  
ATOM 6535  C CG2  . VAL A 1 44  ? -5.999  2.943   10.661  1.00 0.00 ? 122 VAL A CG2  4  
ATOM 6536  H H    . VAL A 1 44  ? -5.908  6.499   12.627  1.00 0.00 ? 122 VAL A H    4  
ATOM 6537  H HA   . VAL A 1 44  ? -7.301  3.992   12.883  1.00 0.00 ? 122 VAL A HA   4  
ATOM 6538  H HB   . VAL A 1 44  ? -6.981  4.827   10.661  1.00 0.00 ? 122 VAL A HB   4  
ATOM 6539  H HG11 . VAL A 1 44  ? -4.252  5.309   11.613  1.00 0.00 ? 122 VAL A HG11 4  
ATOM 6540  H HG12 . VAL A 1 44  ? -4.351  4.668   9.972   1.00 0.00 ? 122 VAL A HG12 4  
ATOM 6541  H HG13 . VAL A 1 44  ? -5.196  6.159   10.390  1.00 0.00 ? 122 VAL A HG13 4  
ATOM 6542  H HG21 . VAL A 1 44  ? -5.753  2.934   9.609   1.00 0.00 ? 122 VAL A HG21 4  
ATOM 6543  H HG22 . VAL A 1 44  ? -5.220  2.442   11.217  1.00 0.00 ? 122 VAL A HG22 4  
ATOM 6544  H HG23 . VAL A 1 44  ? -6.937  2.431   10.815  1.00 0.00 ? 122 VAL A HG23 4  
ATOM 6545  N N    . GLU A 1 45  ? -5.493  2.291   13.445  1.00 0.00 ? 123 GLU A N    4  
ATOM 6546  C CA   . GLU A 1 45  ? -4.537  1.387   14.074  1.00 0.00 ? 123 GLU A CA   4  
ATOM 6547  C C    . GLU A 1 45  ? -4.396  0.099   13.269  1.00 0.00 ? 123 GLU A C    4  
ATOM 6548  O O    . GLU A 1 45  ? -5.383  -0.585  12.992  1.00 0.00 ? 123 GLU A O    4  
ATOM 6549  C CB   . GLU A 1 45  ? -4.974  1.063   15.505  1.00 0.00 ? 123 GLU A CB   4  
ATOM 6550  C CG   . GLU A 1 45  ? -4.618  2.144   16.510  1.00 0.00 ? 123 GLU A CG   4  
ATOM 6551  C CD   . GLU A 1 45  ? -5.480  2.090   17.756  1.00 0.00 ? 123 GLU A CD   4  
ATOM 6552  O OE1  . GLU A 1 45  ? -6.686  1.790   17.631  1.00 0.00 ? 123 GLU A OE1  4  
ATOM 6553  O OE2  . GLU A 1 45  ? -4.949  2.348   18.856  1.00 0.00 ? 123 GLU A OE2  4  
ATOM 6554  H H    . GLU A 1 45  ? -6.331  1.929   13.089  1.00 0.00 ? 123 GLU A H    4  
ATOM 6555  H HA   . GLU A 1 45  ? -3.580  1.885   14.105  1.00 0.00 ? 123 GLU A HA   4  
ATOM 6556  H HB2  . GLU A 1 45  ? -6.045  0.925   15.519  1.00 0.00 ? 123 GLU A HB2  4  
ATOM 6557  H HB3  . GLU A 1 45  ? -4.498  0.143   15.813  1.00 0.00 ? 123 GLU A HB3  4  
ATOM 6558  H HG2  . GLU A 1 45  ? -3.585  2.022   16.801  1.00 0.00 ? 123 GLU A HG2  4  
ATOM 6559  H HG3  . GLU A 1 45  ? -4.747  3.109   16.042  1.00 0.00 ? 123 GLU A HG3  4  
ATOM 6560  N N    . LEU A 1 46  ? -3.163  -0.227  12.896  1.00 0.00 ? 124 LEU A N    4  
ATOM 6561  C CA   . LEU A 1 46  ? -2.891  -1.433  12.122  1.00 0.00 ? 124 LEU A CA   4  
ATOM 6562  C C    . LEU A 1 46  ? -3.301  -2.681  12.897  1.00 0.00 ? 124 LEU A C    4  
ATOM 6563  O O    . LEU A 1 46  ? -3.376  -2.665  14.126  1.00 0.00 ? 124 LEU A O    4  
ATOM 6564  C CB   . LEU A 1 46  ? -1.407  -1.507  11.761  1.00 0.00 ? 124 LEU A CB   4  
ATOM 6565  C CG   . LEU A 1 46  ? -0.955  -0.626  10.596  1.00 0.00 ? 124 LEU A CG   4  
ATOM 6566  C CD1  . LEU A 1 46  ? 0.558   -0.471  10.600  1.00 0.00 ? 124 LEU A CD1  4  
ATOM 6567  C CD2  . LEU A 1 46  ? -1.429  -1.206  9.272   1.00 0.00 ? 124 LEU A CD2  4  
ATOM 6568  H H    . LEU A 1 46  ? -2.418  0.357   13.147  1.00 0.00 ? 124 LEU A H    4  
ATOM 6569  H HA   . LEU A 1 46  ? -3.473  -1.381  11.213  1.00 0.00 ? 124 LEU A HA   4  
ATOM 6570  H HB2  . LEU A 1 46  ? -0.840  -1.219  12.633  1.00 0.00 ? 124 LEU A HB2  4  
ATOM 6571  H HB3  . LEU A 1 46  ? -1.180  -2.533  11.509  1.00 0.00 ? 124 LEU A HB3  4  
ATOM 6572  H HG   . LEU A 1 46  ? -1.391  0.358   10.707  1.00 0.00 ? 124 LEU A HG   4  
ATOM 6573  H HD11 . LEU A 1 46  ? 0.996   -1.224  11.238  1.00 0.00 ? 124 LEU A HD11 4  
ATOM 6574  H HD12 . LEU A 1 46  ? 0.819   0.510   10.970  1.00 0.00 ? 124 LEU A HD12 4  
ATOM 6575  H HD13 . LEU A 1 46  ? 0.935   -0.587  9.595   1.00 0.00 ? 124 LEU A HD13 4  
ATOM 6576  H HD21 . LEU A 1 46  ? -1.298  -0.473  8.490   1.00 0.00 ? 124 LEU A HD21 4  
ATOM 6577  H HD22 . LEU A 1 46  ? -2.475  -1.468  9.348   1.00 0.00 ? 124 LEU A HD22 4  
ATOM 6578  H HD23 . LEU A 1 46  ? -0.853  -2.089  9.039   1.00 0.00 ? 124 LEU A HD23 4  
ATOM 6579  N N    . SER A 1 47  ? -3.563  -3.763  12.171  1.00 0.00 ? 125 SER A N    4  
ATOM 6580  C CA   . SER A 1 47  ? -3.967  -5.020  12.790  1.00 0.00 ? 125 SER A CA   4  
ATOM 6581  C C    . SER A 1 47  ? -3.098  -6.173  12.295  1.00 0.00 ? 125 SER A C    4  
ATOM 6582  O O    . SER A 1 47  ? -2.724  -7.059  13.064  1.00 0.00 ? 125 SER A O    4  
ATOM 6583  C CB   . SER A 1 47  ? -5.439  -5.311  12.491  1.00 0.00 ? 125 SER A CB   4  
ATOM 6584  O OG   . SER A 1 47  ? -5.620  -5.686  11.136  1.00 0.00 ? 125 SER A OG   4  
ATOM 6585  H H    . SER A 1 47  ? -3.486  -3.714  11.195  1.00 0.00 ? 125 SER A H    4  
ATOM 6586  H HA   . SER A 1 47  ? -3.838  -4.920  13.857  1.00 0.00 ? 125 SER A HA   4  
ATOM 6587  H HB2  . SER A 1 47  ? -5.779  -6.117  13.123  1.00 0.00 ? 125 SER A HB2  4  
ATOM 6588  H HB3  . SER A 1 47  ? -6.025  -4.426  12.689  1.00 0.00 ? 125 SER A HB3  4  
ATOM 6589  H HG   . SER A 1 47  ? -5.802  -4.904  10.610  1.00 0.00 ? 125 SER A HG   4  
ATOM 6590  N N    . LYS A 1 48  ? -2.781  -6.155  11.005  1.00 0.00 ? 126 LYS A N    4  
ATOM 6591  C CA   . LYS A 1 48  ? -1.955  -7.196  10.405  1.00 0.00 ? 126 LYS A CA   4  
ATOM 6592  C C    . LYS A 1 48  ? -1.495  -6.788  9.009   1.00 0.00 ? 126 LYS A C    4  
ATOM 6593  O O    . LYS A 1 48  ? -2.183  -6.043  8.310   1.00 0.00 ? 126 LYS A O    4  
ATOM 6594  C CB   . LYS A 1 48  ? -2.731  -8.513  10.333  1.00 0.00 ? 126 LYS A CB   4  
ATOM 6595  C CG   . LYS A 1 48  ? -1.931  -9.659  9.740   1.00 0.00 ? 126 LYS A CG   4  
ATOM 6596  C CD   . LYS A 1 48  ? -2.838  -10.741 9.178   1.00 0.00 ? 126 LYS A CD   4  
ATOM 6597  C CE   . LYS A 1 48  ? -3.229  -10.447 7.737   1.00 0.00 ? 126 LYS A CE   4  
ATOM 6598  N NZ   . LYS A 1 48  ? -4.200  -11.446 7.211   1.00 0.00 ? 126 LYS A NZ   4  
ATOM 6599  H H    . LYS A 1 48  ? -3.109  -5.421  10.443  1.00 0.00 ? 126 LYS A H    4  
ATOM 6600  H HA   . LYS A 1 48  ? -1.087  -7.333  11.031  1.00 0.00 ? 126 LYS A HA   4  
ATOM 6601  H HB2  . LYS A 1 48  ? -3.036  -8.792  11.331  1.00 0.00 ? 126 LYS A HB2  4  
ATOM 6602  H HB3  . LYS A 1 48  ? -3.613  -8.365  9.726   1.00 0.00 ? 126 LYS A HB3  4  
ATOM 6603  H HG2  . LYS A 1 48  ? -1.308  -9.278  8.945   1.00 0.00 ? 126 LYS A HG2  4  
ATOM 6604  H HG3  . LYS A 1 48  ? -1.309  -10.089 10.512  1.00 0.00 ? 126 LYS A HG3  4  
ATOM 6605  H HD2  . LYS A 1 48  ? -2.320  -11.687 9.212   1.00 0.00 ? 126 LYS A HD2  4  
ATOM 6606  H HD3  . LYS A 1 48  ? -3.734  -10.796 9.780   1.00 0.00 ? 126 LYS A HD3  4  
ATOM 6607  H HE2  . LYS A 1 48  ? -3.676  -9.466  7.692   1.00 0.00 ? 126 LYS A HE2  4  
ATOM 6608  H HE3  . LYS A 1 48  ? -2.339  -10.466 7.126   1.00 0.00 ? 126 LYS A HE3  4  
ATOM 6609  H HZ1  . LYS A 1 48  ? -3.692  -12.271 6.832   1.00 0.00 ? 126 LYS A HZ1  4  
ATOM 6610  H HZ2  . LYS A 1 48  ? -4.770  -11.025 6.450   1.00 0.00 ? 126 LYS A HZ2  4  
ATOM 6611  H HZ3  . LYS A 1 48  ? -4.835  -11.763 7.971   1.00 0.00 ? 126 LYS A HZ3  4  
ATOM 6612  N N    . VAL A 1 49  ? -0.329  -7.283  8.607   1.00 0.00 ? 127 VAL A N    4  
ATOM 6613  C CA   . VAL A 1 49  ? 0.222   -6.972  7.293   1.00 0.00 ? 127 VAL A CA   4  
ATOM 6614  C C    . VAL A 1 49  ? 0.530   -8.244  6.512   1.00 0.00 ? 127 VAL A C    4  
ATOM 6615  O O    . VAL A 1 49  ? 1.232   -9.130  7.000   1.00 0.00 ? 127 VAL A O    4  
ATOM 6616  C CB   . VAL A 1 49  ? 1.506   -6.129  7.407   1.00 0.00 ? 127 VAL A CB   4  
ATOM 6617  C CG1  . VAL A 1 49  ? 2.219   -6.058  6.066   1.00 0.00 ? 127 VAL A CG1  4  
ATOM 6618  C CG2  . VAL A 1 49  ? 1.183   -4.734  7.923   1.00 0.00 ? 127 VAL A CG2  4  
ATOM 6619  H H    . VAL A 1 49  ? 0.174   -7.871  9.209   1.00 0.00 ? 127 VAL A H    4  
ATOM 6620  H HA   . VAL A 1 49  ? -0.514  -6.397  6.750   1.00 0.00 ? 127 VAL A HA   4  
ATOM 6621  H HB   . VAL A 1 49  ? 2.165   -6.608  8.116   1.00 0.00 ? 127 VAL A HB   4  
ATOM 6622  H HG11 . VAL A 1 49  ? 1.555   -6.403  5.287   1.00 0.00 ? 127 VAL A HG11 4  
ATOM 6623  H HG12 . VAL A 1 49  ? 2.512   -5.037  5.867   1.00 0.00 ? 127 VAL A HG12 4  
ATOM 6624  H HG13 . VAL A 1 49  ? 3.098   -6.686  6.093   1.00 0.00 ? 127 VAL A HG13 4  
ATOM 6625  H HG21 . VAL A 1 49  ? 1.359   -4.695  8.987   1.00 0.00 ? 127 VAL A HG21 4  
ATOM 6626  H HG22 . VAL A 1 49  ? 1.814   -4.011  7.427   1.00 0.00 ? 127 VAL A HG22 4  
ATOM 6627  H HG23 . VAL A 1 49  ? 0.147   -4.506  7.720   1.00 0.00 ? 127 VAL A HG23 4  
ATOM 6628  N N    . SER A 1 50  ? 0.002   -8.327  5.295   1.00 0.00 ? 128 SER A N    4  
ATOM 6629  C CA   . SER A 1 50  ? 0.218   -9.493  4.446   1.00 0.00 ? 128 SER A CA   4  
ATOM 6630  C C    . SER A 1 50  ? 1.141   -9.153  3.280   1.00 0.00 ? 128 SER A C    4  
ATOM 6631  O O    . SER A 1 50  ? 0.823   -8.302  2.448   1.00 0.00 ? 128 SER A O    4  
ATOM 6632  C CB   . SER A 1 50  ? -1.118  -10.019 3.916   1.00 0.00 ? 128 SER A CB   4  
ATOM 6633  O OG   . SER A 1 50  ? -1.697  -10.944 4.821   1.00 0.00 ? 128 SER A OG   4  
ATOM 6634  H H    . SER A 1 50  ? -0.549  -7.588  4.962   1.00 0.00 ? 128 SER A H    4  
ATOM 6635  H HA   . SER A 1 50  ? 0.683   -10.259 5.047   1.00 0.00 ? 128 SER A HA   4  
ATOM 6636  H HB2  . SER A 1 50  ? -1.799  -9.193  3.780   1.00 0.00 ? 128 SER A HB2  4  
ATOM 6637  H HB3  . SER A 1 50  ? -0.957  -10.513 2.969   1.00 0.00 ? 128 SER A HB3  4  
ATOM 6638  H HG   . SER A 1 50  ? -2.638  -10.771 4.897   1.00 0.00 ? 128 SER A HG   4  
ATOM 6639  N N    . LEU A 1 51  ? 2.287   -9.822  3.227   1.00 0.00 ? 129 LEU A N    4  
ATOM 6640  C CA   . LEU A 1 51  ? 3.259   -9.592  2.164   1.00 0.00 ? 129 LEU A CA   4  
ATOM 6641  C C    . LEU A 1 51  ? 3.335   -10.793 1.226   1.00 0.00 ? 129 LEU A C    4  
ATOM 6642  O O    . LEU A 1 51  ? 3.274   -11.942 1.665   1.00 0.00 ? 129 LEU A O    4  
ATOM 6643  C CB   . LEU A 1 51  ? 4.639   -9.308  2.760   1.00 0.00 ? 129 LEU A CB   4  
ATOM 6644  C CG   . LEU A 1 51  ? 5.802   -9.263  1.769   1.00 0.00 ? 129 LEU A CG   4  
ATOM 6645  C CD1  . LEU A 1 51  ? 5.853   -7.915  1.066   1.00 0.00 ? 129 LEU A CD1  4  
ATOM 6646  C CD2  . LEU A 1 51  ? 7.118   -9.547  2.478   1.00 0.00 ? 129 LEU A CD2  4  
ATOM 6647  H H    . LEU A 1 51  ? 2.485   -10.488 3.918   1.00 0.00 ? 129 LEU A H    4  
ATOM 6648  H HA   . LEU A 1 51  ? 2.935   -8.730  1.600   1.00 0.00 ? 129 LEU A HA   4  
ATOM 6649  H HB2  . LEU A 1 51  ? 4.593   -8.352  3.259   1.00 0.00 ? 129 LEU A HB2  4  
ATOM 6650  H HB3  . LEU A 1 51  ? 4.851   -10.081 3.485   1.00 0.00 ? 129 LEU A HB3  4  
ATOM 6651  H HG   . LEU A 1 51  ? 5.655   -10.026 1.016   1.00 0.00 ? 129 LEU A HG   4  
ATOM 6652  H HD11 . LEU A 1 51  ? 5.000   -7.323  1.361   1.00 0.00 ? 129 LEU A HD11 4  
ATOM 6653  H HD12 . LEU A 1 51  ? 5.834   -8.066  -0.003  1.00 0.00 ? 129 LEU A HD12 4  
ATOM 6654  H HD13 . LEU A 1 51  ? 6.762   -7.401  1.341   1.00 0.00 ? 129 LEU A HD13 4  
ATOM 6655  H HD21 . LEU A 1 51  ? 7.884   -9.756  1.744   1.00 0.00 ? 129 LEU A HD21 4  
ATOM 6656  H HD22 . LEU A 1 51  ? 7.000   -10.402 3.128   1.00 0.00 ? 129 LEU A HD22 4  
ATOM 6657  H HD23 . LEU A 1 51  ? 7.405   -8.686  3.063   1.00 0.00 ? 129 LEU A HD23 4  
ATOM 6658  N N    . THR A 1 52  ? 3.471   -10.519 -0.068  1.00 0.00 ? 130 THR A N    4  
ATOM 6659  C CA   . THR A 1 52  ? 3.557   -11.576 -1.067  1.00 0.00 ? 130 THR A CA   4  
ATOM 6660  C C    . THR A 1 52  ? 4.876   -12.333 -0.956  1.00 0.00 ? 130 THR A C    4  
ATOM 6661  O O    . THR A 1 52  ? 5.884   -11.806 -0.485  1.00 0.00 ? 130 THR A O    4  
ATOM 6662  C CB   . THR A 1 52  ? 3.421   -11.012 -2.494  1.00 0.00 ? 130 THR A CB   4  
ATOM 6663  O OG1  . THR A 1 52  ? 4.373   -9.962  -2.699  1.00 0.00 ? 130 THR A OG1  4  
ATOM 6664  C CG2  . THR A 1 52  ? 2.015   -10.483 -2.736  1.00 0.00 ? 130 THR A CG2  4  
ATOM 6665  H H    . THR A 1 52  ? 3.514   -9.584  -0.355  1.00 0.00 ? 130 THR A H    4  
ATOM 6666  H HA   . THR A 1 52  ? 2.742   -12.265 -0.896  1.00 0.00 ? 130 THR A HA   4  
ATOM 6667  H HB   . THR A 1 52  ? 3.617   -11.807 -3.200  1.00 0.00 ? 130 THR A HB   4  
ATOM 6668  H HG1  . THR A 1 52  ? 4.088   -9.175  -2.227  1.00 0.00 ? 130 THR A HG1  4  
ATOM 6669  H HG21 . THR A 1 52  ? 1.474   -11.174 -3.365  1.00 0.00 ? 130 THR A HG21 4  
ATOM 6670  H HG22 . THR A 1 52  ? 2.072   -9.521  -3.221  1.00 0.00 ? 130 THR A HG22 4  
ATOM 6671  H HG23 . THR A 1 52  ? 1.503   -10.381 -1.791  1.00 0.00 ? 130 THR A HG23 4  
ATOM 6672  N N    . PRO A 1 53  ? 4.872   -13.599 -1.399  1.00 0.00 ? 131 PRO A N    4  
ATOM 6673  C CA   . PRO A 1 53  ? 6.061   -14.455 -1.361  1.00 0.00 ? 131 PRO A CA   4  
ATOM 6674  C C    . PRO A 1 53  ? 7.130   -14.007 -2.352  1.00 0.00 ? 131 PRO A C    4  
ATOM 6675  O O    . PRO A 1 53  ? 8.312   -14.304 -2.180  1.00 0.00 ? 131 PRO A O    4  
ATOM 6676  C CB   . PRO A 1 53  ? 5.518   -15.834 -1.746  1.00 0.00 ? 131 PRO A CB   4  
ATOM 6677  C CG   . PRO A 1 53  ? 4.297   -15.549 -2.549  1.00 0.00 ? 131 PRO A CG   4  
ATOM 6678  C CD   . PRO A 1 53  ? 3.706   -14.292 -1.973  1.00 0.00 ? 131 PRO A CD   4  
ATOM 6679  H HA   . PRO A 1 53  ? 6.487   -14.498 -0.369  1.00 0.00 ? 131 PRO A HA   4  
ATOM 6680  H HB2  . PRO A 1 53  ? 6.259   -16.365 -2.326  1.00 0.00 ? 131 PRO A HB2  4  
ATOM 6681  H HB3  . PRO A 1 53  ? 5.282   -16.393 -0.853  1.00 0.00 ? 131 PRO A HB3  4  
ATOM 6682  H HG2  . PRO A 1 53  ? 4.564   -15.398 -3.584  1.00 0.00 ? 131 PRO A HG2  4  
ATOM 6683  H HG3  . PRO A 1 53  ? 3.598   -16.367 -2.456  1.00 0.00 ? 131 PRO A HG3  4  
ATOM 6684  H HD2  . PRO A 1 53  ? 3.249   -13.698 -2.752  1.00 0.00 ? 131 PRO A HD2  4  
ATOM 6685  H HD3  . PRO A 1 53  ? 2.984   -14.531 -1.206  1.00 0.00 ? 131 PRO A HD3  4  
ATOM 6686  N N    . ASP A 1 54  ? 6.706   -13.292 -3.388  1.00 0.00 ? 132 ASP A N    4  
ATOM 6687  C CA   . ASP A 1 54  ? 7.628   -12.802 -4.407  1.00 0.00 ? 132 ASP A CA   4  
ATOM 6688  C C    . ASP A 1 54  ? 8.176   -11.430 -4.029  1.00 0.00 ? 132 ASP A C    4  
ATOM 6689  O O    . ASP A 1 54  ? 8.927   -10.818 -4.789  1.00 0.00 ? 132 ASP A O    4  
ATOM 6690  C CB   . ASP A 1 54  ? 6.929   -12.730 -5.765  1.00 0.00 ? 132 ASP A CB   4  
ATOM 6691  C CG   . ASP A 1 54  ? 7.058   -14.019 -6.552  1.00 0.00 ? 132 ASP A CG   4  
ATOM 6692  O OD1  . ASP A 1 54  ? 8.202   -14.419 -6.854  1.00 0.00 ? 132 ASP A OD1  4  
ATOM 6693  O OD2  . ASP A 1 54  ? 6.014   -14.629 -6.865  1.00 0.00 ? 132 ASP A OD2  4  
ATOM 6694  H H    . ASP A 1 54  ? 5.751   -13.088 -3.470  1.00 0.00 ? 132 ASP A H    4  
ATOM 6695  H HA   . ASP A 1 54  ? 8.451   -13.498 -4.472  1.00 0.00 ? 132 ASP A HA   4  
ATOM 6696  H HB2  . ASP A 1 54  ? 5.879   -12.526 -5.612  1.00 0.00 ? 132 ASP A HB2  4  
ATOM 6697  H HB3  . ASP A 1 54  ? 7.366   -11.930 -6.345  1.00 0.00 ? 132 ASP A HB3  4  
ATOM 6698  N N    . PHE A 1 55  ? 7.794   -10.950 -2.850  1.00 0.00 ? 133 PHE A N    4  
ATOM 6699  C CA   . PHE A 1 55  ? 8.245   -9.648  -2.371  1.00 0.00 ? 133 PHE A CA   4  
ATOM 6700  C C    . PHE A 1 55  ? 7.844   -8.543  -3.343  1.00 0.00 ? 133 PHE A C    4  
ATOM 6701  O O    . PHE A 1 55  ? 8.510   -7.512  -3.437  1.00 0.00 ? 133 PHE A O    4  
ATOM 6702  C CB   . PHE A 1 55  ? 9.763   -9.649  -2.181  1.00 0.00 ? 133 PHE A CB   4  
ATOM 6703  C CG   . PHE A 1 55  ? 10.205  -10.267 -0.885  1.00 0.00 ? 133 PHE A CG   4  
ATOM 6704  C CD1  . PHE A 1 55  ? 9.761   -9.759  0.326   1.00 0.00 ? 133 PHE A CD1  4  
ATOM 6705  C CD2  . PHE A 1 55  ? 11.062  -11.355 -0.877  1.00 0.00 ? 133 PHE A CD2  4  
ATOM 6706  C CE1  . PHE A 1 55  ? 10.166  -10.324 1.520   1.00 0.00 ? 133 PHE A CE1  4  
ATOM 6707  C CE2  . PHE A 1 55  ? 11.471  -11.925 0.314   1.00 0.00 ? 133 PHE A CE2  4  
ATOM 6708  C CZ   . PHE A 1 55  ? 11.021  -11.409 1.514   1.00 0.00 ? 133 PHE A CZ   4  
ATOM 6709  H H    . PHE A 1 55  ? 7.194   -11.484 -2.288  1.00 0.00 ? 133 PHE A H    4  
ATOM 6710  H HA   . PHE A 1 55  ? 7.772   -9.464  -1.419  1.00 0.00 ? 133 PHE A HA   4  
ATOM 6711  H HB2  . PHE A 1 55  ? 10.219  -10.207 -2.985  1.00 0.00 ? 133 PHE A HB2  4  
ATOM 6712  H HB3  . PHE A 1 55  ? 10.122  -8.632  -2.205  1.00 0.00 ? 133 PHE A HB3  4  
ATOM 6713  H HD1  . PHE A 1 55  ? 9.092   -8.911  0.332   1.00 0.00 ? 133 PHE A HD1  4  
ATOM 6714  H HD2  . PHE A 1 55  ? 11.414  -11.759 -1.815  1.00 0.00 ? 133 PHE A HD2  4  
ATOM 6715  H HE1  . PHE A 1 55  ? 9.813   -9.920  2.457   1.00 0.00 ? 133 PHE A HE1  4  
ATOM 6716  H HE2  . PHE A 1 55  ? 12.139  -12.773 0.306   1.00 0.00 ? 133 PHE A HE2  4  
ATOM 6717  H HZ   . PHE A 1 55  ? 11.339  -11.853 2.446   1.00 0.00 ? 133 PHE A HZ   4  
ATOM 6718  N N    . SER A 1 56  ? 6.750   -8.766  -4.066  1.00 0.00 ? 134 SER A N    4  
ATOM 6719  C CA   . SER A 1 56  ? 6.262   -7.791  -5.034  1.00 0.00 ? 134 SER A CA   4  
ATOM 6720  C C    . SER A 1 56  ? 5.279   -6.824  -4.382  1.00 0.00 ? 134 SER A C    4  
ATOM 6721  O O    . SER A 1 56  ? 5.623   -5.681  -4.082  1.00 0.00 ? 134 SER A O    4  
ATOM 6722  C CB   . SER A 1 56  ? 5.591   -8.503  -6.211  1.00 0.00 ? 134 SER A CB   4  
ATOM 6723  O OG   . SER A 1 56  ? 6.525   -9.284  -6.935  1.00 0.00 ? 134 SER A OG   4  
ATOM 6724  H H    . SER A 1 56  ? 6.262   -9.608  -3.945  1.00 0.00 ? 134 SER A H    4  
ATOM 6725  H HA   . SER A 1 56  ? 7.111   -7.233  -5.399  1.00 0.00 ? 134 SER A HA   4  
ATOM 6726  H HB2  . SER A 1 56  ? 4.810   -9.150  -5.839  1.00 0.00 ? 134 SER A HB2  4  
ATOM 6727  H HB3  . SER A 1 56  ? 5.162   -7.767  -6.875  1.00 0.00 ? 134 SER A HB3  4  
ATOM 6728  H HG   . SER A 1 56  ? 6.795   -8.809  -7.725  1.00 0.00 ? 134 SER A HG   4  
ATOM 6729  N N    . ALA A 1 57  ? 4.054   -7.291  -4.166  1.00 0.00 ? 135 ALA A N    4  
ATOM 6730  C CA   . ALA A 1 57  ? 3.021   -6.469  -3.548  1.00 0.00 ? 135 ALA A CA   4  
ATOM 6731  C C    . ALA A 1 57  ? 3.020   -6.635  -2.032  1.00 0.00 ? 135 ALA A C    4  
ATOM 6732  O O    . ALA A 1 57  ? 3.391   -7.689  -1.514  1.00 0.00 ? 135 ALA A O    4  
ATOM 6733  C CB   . ALA A 1 57  ? 1.655   -6.819  -4.120  1.00 0.00 ? 135 ALA A CB   4  
ATOM 6734  H H    . ALA A 1 57  ? 3.840   -8.211  -4.427  1.00 0.00 ? 135 ALA A H    4  
ATOM 6735  H HA   . ALA A 1 57  ? 3.229   -5.436  -3.787  1.00 0.00 ? 135 ALA A HA   4  
ATOM 6736  H HB1  . ALA A 1 57  ? 1.738   -6.957  -5.188  1.00 0.00 ? 135 ALA A HB1  4  
ATOM 6737  H HB2  . ALA A 1 57  ? 1.298   -7.732  -3.666  1.00 0.00 ? 135 ALA A HB2  4  
ATOM 6738  H HB3  . ALA A 1 57  ? 0.962   -6.018  -3.912  1.00 0.00 ? 135 ALA A HB3  4  
ATOM 6739  N N    . CYS A 1 58  ? 2.602   -5.590  -1.327  1.00 0.00 ? 136 CYS A N    4  
ATOM 6740  C CA   . CYS A 1 58  ? 2.555   -5.620  0.130   1.00 0.00 ? 136 CYS A CA   4  
ATOM 6741  C C    . CYS A 1 58  ? 1.192   -5.163  0.640   1.00 0.00 ? 136 CYS A C    4  
ATOM 6742  O O    . CYS A 1 58  ? 0.901   -3.967  0.676   1.00 0.00 ? 136 CYS A O    4  
ATOM 6743  C CB   . CYS A 1 58  ? 3.656   -4.733  0.715   1.00 0.00 ? 136 CYS A CB   4  
ATOM 6744  S SG   . CYS A 1 58  ? 3.557   -4.520  2.508   1.00 0.00 ? 136 CYS A SG   4  
ATOM 6745  H H    . CYS A 1 58  ? 2.319   -4.778  -1.798  1.00 0.00 ? 136 CYS A H    4  
ATOM 6746  H HA   . CYS A 1 58  ? 2.720   -6.639  0.445   1.00 0.00 ? 136 CYS A HA   4  
ATOM 6747  H HB2  . CYS A 1 58  ? 4.617   -5.169  0.489   1.00 0.00 ? 136 CYS A HB2  4  
ATOM 6748  H HB3  . CYS A 1 58  ? 3.597   -3.754  0.263   1.00 0.00 ? 136 CYS A HB3  4  
ATOM 6749  H HG   . CYS A 1 58  ? 3.688   -5.712  3.069   1.00 0.00 ? 136 CYS A HG   4  
ATOM 6750  N N    . ARG A 1 59  ? 0.360   -6.123  1.030   1.00 0.00 ? 137 ARG A N    4  
ATOM 6751  C CA   . ARG A 1 59  ? -0.973  -5.819  1.535   1.00 0.00 ? 137 ARG A CA   4  
ATOM 6752  C C    . ARG A 1 59  ? -0.940  -5.562  3.038   1.00 0.00 ? 137 ARG A C    4  
ATOM 6753  O O    . ARG A 1 59  ? -0.219  -6.231  3.777   1.00 0.00 ? 137 ARG A O    4  
ATOM 6754  C CB   . ARG A 1 59  ? -1.934  -6.969  1.224   1.00 0.00 ? 137 ARG A CB   4  
ATOM 6755  C CG   . ARG A 1 59  ? -2.535  -6.900  -0.170  1.00 0.00 ? 137 ARG A CG   4  
ATOM 6756  C CD   . ARG A 1 59  ? -1.658  -7.609  -1.191  1.00 0.00 ? 137 ARG A CD   4  
ATOM 6757  N NE   . ARG A 1 59  ? -2.424  -8.066  -2.347  1.00 0.00 ? 137 ARG A NE   4  
ATOM 6758  C CZ   . ARG A 1 59  ? -2.857  -7.258  -3.308  1.00 0.00 ? 137 ARG A CZ   4  
ATOM 6759  N NH1  . ARG A 1 59  ? -2.600  -5.959  -3.252  1.00 0.00 ? 137 ARG A NH1  4  
ATOM 6760  N NH2  . ARG A 1 59  ? -3.548  -7.750  -4.329  1.00 0.00 ? 137 ARG A NH2  4  
ATOM 6761  H H    . ARG A 1 59  ? 0.650   -7.057  0.977   1.00 0.00 ? 137 ARG A H    4  
ATOM 6762  H HA   . ARG A 1 59  ? -1.322  -4.926  1.036   1.00 0.00 ? 137 ARG A HA   4  
ATOM 6763  H HB2  . ARG A 1 59  ? -1.400  -7.903  1.316   1.00 0.00 ? 137 ARG A HB2  4  
ATOM 6764  H HB3  . ARG A 1 59  ? -2.740  -6.952  1.941   1.00 0.00 ? 137 ARG A HB3  4  
ATOM 6765  H HG2  . ARG A 1 59  ? -3.506  -7.373  -0.157  1.00 0.00 ? 137 ARG A HG2  4  
ATOM 6766  H HG3  . ARG A 1 59  ? -2.640  -5.864  -0.456  1.00 0.00 ? 137 ARG A HG3  4  
ATOM 6767  H HD2  . ARG A 1 59  ? -0.893  -6.924  -1.526  1.00 0.00 ? 137 ARG A HD2  4  
ATOM 6768  H HD3  . ARG A 1 59  ? -1.195  -8.461  -0.717  1.00 0.00 ? 137 ARG A HD3  4  
ATOM 6769  H HE   . ARG A 1 59  ? -2.625  -9.023  -2.408  1.00 0.00 ? 137 ARG A HE   4  
ATOM 6770  H HH11 . ARG A 1 59  ? -2.079  -5.586  -2.485  1.00 0.00 ? 137 ARG A HH11 4  
ATOM 6771  H HH12 . ARG A 1 59  ? -2.926  -5.352  -3.978  1.00 0.00 ? 137 ARG A HH12 4  
ATOM 6772  H HH21 . ARG A 1 59  ? -3.743  -8.729  -4.375  1.00 0.00 ? 137 ARG A HH21 4  
ATOM 6773  H HH22 . ARG A 1 59  ? -3.873  -7.141  -5.052  1.00 0.00 ? 137 ARG A HH22 4  
ATOM 6774  N N    . ALA A 1 60  ? -1.727  -4.587  3.484   1.00 0.00 ? 138 ALA A N    4  
ATOM 6775  C CA   . ALA A 1 60  ? -1.788  -4.243  4.899   1.00 0.00 ? 138 ALA A CA   4  
ATOM 6776  C C    . ALA A 1 60  ? -3.232  -4.070  5.360   1.00 0.00 ? 138 ALA A C    4  
ATOM 6777  O O    . ALA A 1 60  ? -3.985  -3.279  4.790   1.00 0.00 ? 138 ALA A O    4  
ATOM 6778  C CB   . ALA A 1 60  ? -0.990  -2.976  5.169   1.00 0.00 ? 138 ALA A CB   4  
ATOM 6779  H H    . ALA A 1 60  ? -2.279  -4.089  2.847   1.00 0.00 ? 138 ALA A H    4  
ATOM 6780  H HA   . ALA A 1 60  ? -1.337  -5.050  5.459   1.00 0.00 ? 138 ALA A HA   4  
ATOM 6781  H HB1  . ALA A 1 60  ? -1.613  -2.113  4.982   1.00 0.00 ? 138 ALA A HB1  4  
ATOM 6782  H HB2  . ALA A 1 60  ? -0.664  -2.969  6.199   1.00 0.00 ? 138 ALA A HB2  4  
ATOM 6783  H HB3  . ALA A 1 60  ? -0.130  -2.947  4.518   1.00 0.00 ? 138 ALA A HB3  4  
ATOM 6784  N N    . TYR A 1 61  ? -3.612  -4.813  6.393   1.00 0.00 ? 139 TYR A N    4  
ATOM 6785  C CA   . TYR A 1 61  ? -4.966  -4.744  6.927   1.00 0.00 ? 139 TYR A CA   4  
ATOM 6786  C C    . TYR A 1 61  ? -5.012  -3.882  8.186   1.00 0.00 ? 139 TYR A C    4  
ATOM 6787  O O    . TYR A 1 61  ? -4.189  -4.039  9.088   1.00 0.00 ? 139 TYR A O    4  
ATOM 6788  C CB   . TYR A 1 61  ? -5.487  -6.148  7.238   1.00 0.00 ? 139 TYR A CB   4  
ATOM 6789  C CG   . TYR A 1 61  ? -5.604  -7.034  6.018   1.00 0.00 ? 139 TYR A CG   4  
ATOM 6790  C CD1  . TYR A 1 61  ? -4.521  -7.781  5.572   1.00 0.00 ? 139 TYR A CD1  4  
ATOM 6791  C CD2  . TYR A 1 61  ? -6.797  -7.122  5.311   1.00 0.00 ? 139 TYR A CD2  4  
ATOM 6792  C CE1  . TYR A 1 61  ? -4.623  -8.591  4.457   1.00 0.00 ? 139 TYR A CE1  4  
ATOM 6793  C CE2  . TYR A 1 61  ? -6.908  -7.931  4.197   1.00 0.00 ? 139 TYR A CE2  4  
ATOM 6794  C CZ   . TYR A 1 61  ? -5.819  -8.663  3.774   1.00 0.00 ? 139 TYR A CZ   4  
ATOM 6795  O OH   . TYR A 1 61  ? -5.925  -9.469  2.663   1.00 0.00 ? 139 TYR A OH   4  
ATOM 6796  H H    . TYR A 1 61  ? -2.966  -5.424  6.805   1.00 0.00 ? 139 TYR A H    4  
ATOM 6797  H HA   . TYR A 1 61  ? -5.597  -4.294  6.174   1.00 0.00 ? 139 TYR A HA   4  
ATOM 6798  H HB2  . TYR A 1 61  ? -4.816  -6.628  7.932   1.00 0.00 ? 139 TYR A HB2  4  
ATOM 6799  H HB3  . TYR A 1 61  ? -6.467  -6.070  7.687   1.00 0.00 ? 139 TYR A HB3  4  
ATOM 6800  H HD1  . TYR A 1 61  ? -3.586  -7.723  6.110   1.00 0.00 ? 139 TYR A HD1  4  
ATOM 6801  H HD2  . TYR A 1 61  ? -7.648  -6.547  5.645   1.00 0.00 ? 139 TYR A HD2  4  
ATOM 6802  H HE1  . TYR A 1 61  ? -3.770  -9.165  4.126   1.00 0.00 ? 139 TYR A HE1  4  
ATOM 6803  H HE2  . TYR A 1 61  ? -7.845  -7.987  3.661   1.00 0.00 ? 139 TYR A HE2  4  
ATOM 6804  H HH   . TYR A 1 61  ? -6.732  -9.254  2.188   1.00 0.00 ? 139 TYR A HH   4  
ATOM 6805  N N    . TRP A 1 62  ? -5.979  -2.974  8.238   1.00 0.00 ? 140 TRP A N    4  
ATOM 6806  C CA   . TRP A 1 62  ? -6.133  -2.087  9.386   1.00 0.00 ? 140 TRP A CA   4  
ATOM 6807  C C    . TRP A 1 62  ? -7.530  -2.211  9.985   1.00 0.00 ? 140 TRP A C    4  
ATOM 6808  O O    . TRP A 1 62  ? -8.459  -2.680  9.328   1.00 0.00 ? 140 TRP A O    4  
ATOM 6809  C CB   . TRP A 1 62  ? -5.867  -0.638  8.976   1.00 0.00 ? 140 TRP A CB   4  
ATOM 6810  C CG   . TRP A 1 62  ? -6.648  -0.208  7.771   1.00 0.00 ? 140 TRP A CG   4  
ATOM 6811  C CD1  . TRP A 1 62  ? -6.398  -0.542  6.471   1.00 0.00 ? 140 TRP A CD1  4  
ATOM 6812  C CD2  . TRP A 1 62  ? -7.804  0.637   7.756   1.00 0.00 ? 140 TRP A CD2  4  
ATOM 6813  N NE1  . TRP A 1 62  ? -7.329  0.044   5.648   1.00 0.00 ? 140 TRP A NE1  4  
ATOM 6814  C CE2  . TRP A 1 62  ? -8.203  0.772   6.411   1.00 0.00 ? 140 TRP A CE2  4  
ATOM 6815  C CE3  . TRP A 1 62  ? -8.542  1.290   8.746   1.00 0.00 ? 140 TRP A CE3  4  
ATOM 6816  C CZ2  . TRP A 1 62  ? -9.306  1.534   6.036   1.00 0.00 ? 140 TRP A CZ2  4  
ATOM 6817  C CZ3  . TRP A 1 62  ? -9.636  2.047   8.372   1.00 0.00 ? 140 TRP A CZ3  4  
ATOM 6818  C CH2  . TRP A 1 62  ? -10.010 2.163   7.026   1.00 0.00 ? 140 TRP A CH2  4  
ATOM 6819  H H    . TRP A 1 62  ? -6.604  -2.897  7.487   1.00 0.00 ? 140 TRP A H    4  
ATOM 6820  H HA   . TRP A 1 62  ? -5.408  -2.381  10.130  1.00 0.00 ? 140 TRP A HA   4  
ATOM 6821  H HB2  . TRP A 1 62  ? -6.131  0.015   9.794   1.00 0.00 ? 140 TRP A HB2  4  
ATOM 6822  H HB3  . TRP A 1 62  ? -4.817  -0.522  8.752   1.00 0.00 ? 140 TRP A HB3  4  
ATOM 6823  H HD1  . TRP A 1 62  ? -5.583  -1.173  6.151   1.00 0.00 ? 140 TRP A HD1  4  
ATOM 6824  H HE1  . TRP A 1 62  ? -7.363  -0.046  4.672   1.00 0.00 ? 140 TRP A HE1  4  
ATOM 6825  H HE3  . TRP A 1 62  ? -8.270  1.212   9.788   1.00 0.00 ? 140 TRP A HE3  4  
ATOM 6826  H HZ2  . TRP A 1 62  ? -9.607  1.633   5.003   1.00 0.00 ? 140 TRP A HZ2  4  
ATOM 6827  H HZ3  . TRP A 1 62  ? -10.218 2.559   9.123   1.00 0.00 ? 140 TRP A HZ3  4  
ATOM 6828  H HH2  . TRP A 1 62  ? -10.871 2.765   6.780   1.00 0.00 ? 140 TRP A HH2  4  
ATOM 6829  N N    . LYS A 1 63  ? -7.672  -1.787  11.236  1.00 0.00 ? 141 LYS A N    4  
ATOM 6830  C CA   . LYS A 1 63  ? -8.956  -1.848  11.924  1.00 0.00 ? 141 LYS A CA   4  
ATOM 6831  C C    . LYS A 1 63  ? -9.966  -0.906  11.277  1.00 0.00 ? 141 LYS A C    4  
ATOM 6832  O O    . LYS A 1 63  ? -9.754  0.306   11.220  1.00 0.00 ? 141 LYS A O    4  
ATOM 6833  C CB   . LYS A 1 63  ? -8.784  -1.490  13.402  1.00 0.00 ? 141 LYS A CB   4  
ATOM 6834  C CG   . LYS A 1 63  ? -7.869  -2.440  14.155  1.00 0.00 ? 141 LYS A CG   4  
ATOM 6835  C CD   . LYS A 1 63  ? -7.615  -1.962  15.575  1.00 0.00 ? 141 LYS A CD   4  
ATOM 6836  C CE   . LYS A 1 63  ? -6.379  -2.617  16.172  1.00 0.00 ? 141 LYS A CE   4  
ATOM 6837  N NZ   . LYS A 1 63  ? -6.204  -2.266  17.608  1.00 0.00 ? 141 LYS A NZ   4  
ATOM 6838  H H    . LYS A 1 63  ? -6.894  -1.422  11.708  1.00 0.00 ? 141 LYS A H    4  
ATOM 6839  H HA   . LYS A 1 63  ? -9.325  -2.859  11.848  1.00 0.00 ? 141 LYS A HA   4  
ATOM 6840  H HB2  . LYS A 1 63  ? -8.371  -0.494  13.473  1.00 0.00 ? 141 LYS A HB2  4  
ATOM 6841  H HB3  . LYS A 1 63  ? -9.753  -1.503  13.879  1.00 0.00 ? 141 LYS A HB3  4  
ATOM 6842  H HG2  . LYS A 1 63  ? -8.331  -3.416  14.193  1.00 0.00 ? 141 LYS A HG2  4  
ATOM 6843  H HG3  . LYS A 1 63  ? -6.925  -2.507  13.633  1.00 0.00 ? 141 LYS A HG3  4  
ATOM 6844  H HD2  . LYS A 1 63  ? -7.471  -0.891  15.565  1.00 0.00 ? 141 LYS A HD2  4  
ATOM 6845  H HD3  . LYS A 1 63  ? -8.472  -2.205  16.187  1.00 0.00 ? 141 LYS A HD3  4  
ATOM 6846  H HE2  . LYS A 1 63  ? -6.477  -3.688  16.081  1.00 0.00 ? 141 LYS A HE2  4  
ATOM 6847  H HE3  . LYS A 1 63  ? -5.511  -2.287  15.620  1.00 0.00 ? 141 LYS A HE3  4  
ATOM 6848  H HZ1  . LYS A 1 63  ? -6.651  -1.349  17.809  1.00 0.00 ? 141 LYS A HZ1  4  
ATOM 6849  H HZ2  . LYS A 1 63  ? -5.192  -2.203  17.839  1.00 0.00 ? 141 LYS A HZ2  4  
ATOM 6850  H HZ3  . LYS A 1 63  ? -6.641  -2.993  18.210  1.00 0.00 ? 141 LYS A HZ3  4  
ATOM 6851  N N    . THR A 1 64  ? -11.067 -1.470  10.789  1.00 0.00 ? 142 THR A N    4  
ATOM 6852  C CA   . THR A 1 64  ? -12.110 -0.681  10.146  1.00 0.00 ? 142 THR A CA   4  
ATOM 6853  C C    . THR A 1 64  ? -13.398 -0.705  10.960  1.00 0.00 ? 142 THR A C    4  
ATOM 6854  O O    . THR A 1 64  ? -13.496 -1.407  11.968  1.00 0.00 ? 142 THR A O    4  
ATOM 6855  C CB   . THR A 1 64  ? -12.405 -1.193  8.723   1.00 0.00 ? 142 THR A CB   4  
ATOM 6856  O OG1  . THR A 1 64  ? -12.563 -2.616  8.738   1.00 0.00 ? 142 THR A OG1  4  
ATOM 6857  C CG2  . THR A 1 64  ? -11.284 -0.811  7.768   1.00 0.00 ? 142 THR A CG2  4  
ATOM 6858  H H    . THR A 1 64  ? -11.178 -2.441  10.864  1.00 0.00 ? 142 THR A H    4  
ATOM 6859  H HA   . THR A 1 64  ? -11.760 0.338   10.074  1.00 0.00 ? 142 THR A HA   4  
ATOM 6860  H HB   . THR A 1 64  ? -13.323 -0.740  8.377   1.00 0.00 ? 142 THR A HB   4  
ATOM 6861  H HG1  . THR A 1 64  ? -11.779 -3.029  8.366   1.00 0.00 ? 142 THR A HG1  4  
ATOM 6862  H HG21 . THR A 1 64  ? -10.352 -1.227  8.121   1.00 0.00 ? 142 THR A HG21 4  
ATOM 6863  H HG22 . THR A 1 64  ? -11.203 0.264   7.719   1.00 0.00 ? 142 THR A HG22 4  
ATOM 6864  H HG23 . THR A 1 64  ? -11.502 -1.201  6.785   1.00 0.00 ? 142 THR A HG23 4  
ATOM 6865  N N    . THR A 1 65  ? -14.388 0.064   10.517  1.00 0.00 ? 143 THR A N    4  
ATOM 6866  C CA   . THR A 1 65  ? -15.671 0.131   11.204  1.00 0.00 ? 143 THR A CA   4  
ATOM 6867  C C    . THR A 1 65  ? -16.633 -0.928  10.678  1.00 0.00 ? 143 THR A C    4  
ATOM 6868  O O    . THR A 1 65  ? -16.278 -1.727  9.811   1.00 0.00 ? 143 THR A O    4  
ATOM 6869  C CB   . THR A 1 65  ? -16.319 1.520   11.049  1.00 0.00 ? 143 THR A CB   4  
ATOM 6870  O OG1  . THR A 1 65  ? -16.660 1.751   9.678   1.00 0.00 ? 143 THR A OG1  4  
ATOM 6871  C CG2  . THR A 1 65  ? -15.380 2.613   11.535  1.00 0.00 ? 143 THR A CG2  4  
ATOM 6872  H H    . THR A 1 65  ? -14.249 0.600   9.708   1.00 0.00 ? 143 THR A H    4  
ATOM 6873  H HA   . THR A 1 65  ? -15.496 -0.046  12.255  1.00 0.00 ? 143 THR A HA   4  
ATOM 6874  H HB   . THR A 1 65  ? -17.220 1.548   11.646  1.00 0.00 ? 143 THR A HB   4  
ATOM 6875  H HG1  . THR A 1 65  ? -17.091 0.971   9.319   1.00 0.00 ? 143 THR A HG1  4  
ATOM 6876  H HG21 . THR A 1 65  ? -15.245 2.524   12.603  1.00 0.00 ? 143 THR A HG21 4  
ATOM 6877  H HG22 . THR A 1 65  ? -15.803 3.580   11.304  1.00 0.00 ? 143 THR A HG22 4  
ATOM 6878  H HG23 . THR A 1 65  ? -14.425 2.511   11.043  1.00 0.00 ? 143 THR A HG23 4  
ATOM 6879  N N    . LEU A 1 66  ? -17.851 -0.929  11.207  1.00 0.00 ? 144 LEU A N    4  
ATOM 6880  C CA   . LEU A 1 66  ? -18.866 -1.890  10.789  1.00 0.00 ? 144 LEU A CA   4  
ATOM 6881  C C    . LEU A 1 66  ? -19.528 -1.452  9.487   1.00 0.00 ? 144 LEU A C    4  
ATOM 6882  O O    . LEU A 1 66  ? -20.063 -2.275  8.744   1.00 0.00 ? 144 LEU A O    4  
ATOM 6883  C CB   . LEU A 1 66  ? -19.923 -2.053  11.883  1.00 0.00 ? 144 LEU A CB   4  
ATOM 6884  C CG   . LEU A 1 66  ? -21.199 -2.792  11.478  1.00 0.00 ? 144 LEU A CG   4  
ATOM 6885  C CD1  . LEU A 1 66  ? -20.898 -4.252  11.179  1.00 0.00 ? 144 LEU A CD1  4  
ATOM 6886  C CD2  . LEU A 1 66  ? -22.252 -2.675  12.570  1.00 0.00 ? 144 LEU A CD2  4  
ATOM 6887  H H    . LEU A 1 66  ? -18.075 -0.268  11.894  1.00 0.00 ? 144 LEU A H    4  
ATOM 6888  H HA   . LEU A 1 66  ? -18.377 -2.839  10.629  1.00 0.00 ? 144 LEU A HA   4  
ATOM 6889  H HB2  . LEU A 1 66  ? -19.473 -2.594  12.700  1.00 0.00 ? 144 LEU A HB2  4  
ATOM 6890  H HB3  . LEU A 1 66  ? -20.204 -1.065  12.219  1.00 0.00 ? 144 LEU A HB3  4  
ATOM 6891  H HG   . LEU A 1 66  ? -21.598 -2.342  10.579  1.00 0.00 ? 144 LEU A HG   4  
ATOM 6892  H HD11 . LEU A 1 66  ? -21.809 -4.827  11.240  1.00 0.00 ? 144 LEU A HD11 4  
ATOM 6893  H HD12 . LEU A 1 66  ? -20.186 -4.627  11.898  1.00 0.00 ? 144 LEU A HD12 4  
ATOM 6894  H HD13 . LEU A 1 66  ? -20.484 -4.337  10.185  1.00 0.00 ? 144 LEU A HD13 4  
ATOM 6895  H HD21 . LEU A 1 66  ? -22.359 -1.640  12.858  1.00 0.00 ? 144 LEU A HD21 4  
ATOM 6896  H HD22 . LEU A 1 66  ? -21.947 -3.258  13.428  1.00 0.00 ? 144 LEU A HD22 4  
ATOM 6897  H HD23 . LEU A 1 66  ? -23.197 -3.046  12.201  1.00 0.00 ? 144 LEU A HD23 4  
ATOM 6898  N N    . SER A 1 67  ? -19.486 -0.152  9.216   1.00 0.00 ? 145 SER A N    4  
ATOM 6899  C CA   . SER A 1 67  ? -20.083 0.396   8.004   1.00 0.00 ? 145 SER A CA   4  
ATOM 6900  C C    . SER A 1 67  ? -19.071 0.419   6.862   1.00 0.00 ? 145 SER A C    4  
ATOM 6901  O O    . SER A 1 67  ? -17.949 0.897   7.023   1.00 0.00 ? 145 SER A O    4  
ATOM 6902  C CB   . SER A 1 67  ? -20.609 1.809   8.262   1.00 0.00 ? 145 SER A CB   4  
ATOM 6903  O OG   . SER A 1 67  ? -21.827 1.775   8.987   1.00 0.00 ? 145 SER A OG   4  
ATOM 6904  H H    . SER A 1 67  ? -19.045 0.454   9.848   1.00 0.00 ? 145 SER A H    4  
ATOM 6905  H HA   . SER A 1 67  ? -20.909 -0.241  7.724   1.00 0.00 ? 145 SER A HA   4  
ATOM 6906  H HB2  . SER A 1 67  ? -19.880 2.363   8.834   1.00 0.00 ? 145 SER A HB2  4  
ATOM 6907  H HB3  . SER A 1 67  ? -20.780 2.306   7.318   1.00 0.00 ? 145 SER A HB3  4  
ATOM 6908  H HG   . SER A 1 67  ? -21.895 0.943   9.461   1.00 0.00 ? 145 SER A HG   4  
ATOM 6909  N N    . ALA A 1 68  ? -19.478 -0.101  5.709   1.00 0.00 ? 146 ALA A N    4  
ATOM 6910  C CA   . ALA A 1 68  ? -18.608 -0.139  4.539   1.00 0.00 ? 146 ALA A CA   4  
ATOM 6911  C C    . ALA A 1 68  ? -18.303 1.268   4.036   1.00 0.00 ? 146 ALA A C    4  
ATOM 6912  O O    . ALA A 1 68  ? -17.195 1.545   3.578   1.00 0.00 ? 146 ALA A O    4  
ATOM 6913  C CB   . ALA A 1 68  ? -19.246 -0.970  3.435   1.00 0.00 ? 146 ALA A CB   4  
ATOM 6914  H H    . ALA A 1 68  ? -20.384 -0.467  5.643   1.00 0.00 ? 146 ALA A H    4  
ATOM 6915  H HA   . ALA A 1 68  ? -17.683 -0.617  4.827   1.00 0.00 ? 146 ALA A HA   4  
ATOM 6916  H HB1  . ALA A 1 68  ? -20.088 -1.515  3.836   1.00 0.00 ? 146 ALA A HB1  4  
ATOM 6917  H HB2  . ALA A 1 68  ? -19.582 -0.318  2.643   1.00 0.00 ? 146 ALA A HB2  4  
ATOM 6918  H HB3  . ALA A 1 68  ? -18.519 -1.666  3.044   1.00 0.00 ? 146 ALA A HB3  4  
ATOM 6919  N N    . GLU A 1 69  ? -19.293 2.151   4.125   1.00 0.00 ? 147 GLU A N    4  
ATOM 6920  C CA   . GLU A 1 69  ? -19.129 3.529   3.677   1.00 0.00 ? 147 GLU A CA   4  
ATOM 6921  C C    . GLU A 1 69  ? -17.945 4.191   4.376   1.00 0.00 ? 147 GLU A C    4  
ATOM 6922  O O    . GLU A 1 69  ? -17.104 4.818   3.733   1.00 0.00 ? 147 GLU A O    4  
ATOM 6923  C CB   . GLU A 1 69  ? -20.405 4.330   3.942   1.00 0.00 ? 147 GLU A CB   4  
ATOM 6924  C CG   . GLU A 1 69  ? -21.504 4.078   2.924   1.00 0.00 ? 147 GLU A CG   4  
ATOM 6925  C CD   . GLU A 1 69  ? -21.406 4.995   1.720   1.00 0.00 ? 147 GLU A CD   4  
ATOM 6926  O OE1  . GLU A 1 69  ? -21.881 6.147   1.811   1.00 0.00 ? 147 GLU A OE1  4  
ATOM 6927  O OE2  . GLU A 1 69  ? -20.854 4.561   0.688   1.00 0.00 ? 147 GLU A OE2  4  
ATOM 6928  H H    . GLU A 1 69  ? -20.153 1.869   4.499   1.00 0.00 ? 147 GLU A H    4  
ATOM 6929  H HA   . GLU A 1 69  ? -18.940 3.511   2.614   1.00 0.00 ? 147 GLU A HA   4  
ATOM 6930  H HB2  . GLU A 1 69  ? -20.782 4.071   4.920   1.00 0.00 ? 147 GLU A HB2  4  
ATOM 6931  H HB3  . GLU A 1 69  ? -20.163 5.383   3.927   1.00 0.00 ? 147 GLU A HB3  4  
ATOM 6932  H HG2  . GLU A 1 69  ? -21.436 3.056   2.584   1.00 0.00 ? 147 GLU A HG2  4  
ATOM 6933  H HG3  . GLU A 1 69  ? -22.461 4.235   3.400   1.00 0.00 ? 147 GLU A HG3  4  
ATOM 6934  N N    . GLN A 1 70  ? -17.888 4.045   5.696   1.00 0.00 ? 148 GLN A N    4  
ATOM 6935  C CA   . GLN A 1 70  ? -16.808 4.630   6.482   1.00 0.00 ? 148 GLN A CA   4  
ATOM 6936  C C    . GLN A 1 70  ? -15.457 4.060   6.061   1.00 0.00 ? 148 GLN A C    4  
ATOM 6937  O O    . GLN A 1 70  ? -14.459 4.777   6.010   1.00 0.00 ? 148 GLN A O    4  
ATOM 6938  C CB   . GLN A 1 70  ? -17.039 4.376   7.973   1.00 0.00 ? 148 GLN A CB   4  
ATOM 6939  C CG   . GLN A 1 70  ? -15.898 4.855   8.856   1.00 0.00 ? 148 GLN A CG   4  
ATOM 6940  C CD   . GLN A 1 70  ? -14.687 3.946   8.788   1.00 0.00 ? 148 GLN A CD   4  
ATOM 6941  O OE1  . GLN A 1 70  ? -14.796 2.773   8.431   1.00 0.00 ? 148 GLN A OE1  4  
ATOM 6942  N NE2  . GLN A 1 70  ? -13.523 4.484   9.133   1.00 0.00 ? 148 GLN A NE2  4  
ATOM 6943  H H    . GLN A 1 70  ? -18.588 3.533   6.151   1.00 0.00 ? 148 GLN A H    4  
ATOM 6944  H HA   . GLN A 1 70  ? -16.807 5.694   6.304   1.00 0.00 ? 148 GLN A HA   4  
ATOM 6945  H HB2  . GLN A 1 70  ? -17.940 4.886   8.277   1.00 0.00 ? 148 GLN A HB2  4  
ATOM 6946  H HB3  . GLN A 1 70  ? -17.165 3.315   8.130   1.00 0.00 ? 148 GLN A HB3  4  
ATOM 6947  H HG2  . GLN A 1 70  ? -15.604 5.844   8.537   1.00 0.00 ? 148 GLN A HG2  4  
ATOM 6948  H HG3  . GLN A 1 70  ? -16.244 4.895   9.878   1.00 0.00 ? 148 GLN A HG3  4  
ATOM 6949  H HE21 . GLN A 1 70  ? -13.512 5.425   9.408   1.00 0.00 ? 148 GLN A HE21 4  
ATOM 6950  H HE22 . GLN A 1 70  ? -12.724 3.920   9.099   1.00 0.00 ? 148 GLN A HE22 4  
ATOM 6951  N N    . ASN A 1 71  ? -15.434 2.766   5.759   1.00 0.00 ? 149 ASN A N    4  
ATOM 6952  C CA   . ASN A 1 71  ? -14.206 2.100   5.343   1.00 0.00 ? 149 ASN A CA   4  
ATOM 6953  C C    . ASN A 1 71  ? -13.696 2.673   4.024   1.00 0.00 ? 149 ASN A C    4  
ATOM 6954  O O    . ASN A 1 71  ? -12.490 2.811   3.820   1.00 0.00 ? 149 ASN A O    4  
ATOM 6955  C CB   . ASN A 1 71  ? -14.440 0.595   5.201   1.00 0.00 ? 149 ASN A CB   4  
ATOM 6956  C CG   . ASN A 1 71  ? -15.147 0.004   6.405   1.00 0.00 ? 149 ASN A CG   4  
ATOM 6957  O OD1  . ASN A 1 71  ? -15.368 0.686   7.406   1.00 0.00 ? 149 ASN A OD1  4  
ATOM 6958  N ND2  . ASN A 1 71  ? -15.506 -1.272  6.314   1.00 0.00 ? 149 ASN A ND2  4  
ATOM 6959  H H    . ASN A 1 71  ? -16.263 2.246   5.818   1.00 0.00 ? 149 ASN A H    4  
ATOM 6960  H HA   . ASN A 1 71  ? -13.462 2.269   6.107   1.00 0.00 ? 149 ASN A HA   4  
ATOM 6961  H HB2  . ASN A 1 71  ? -15.047 0.412   4.326   1.00 0.00 ? 149 ASN A HB2  4  
ATOM 6962  H HB3  . ASN A 1 71  ? -13.489 0.097   5.085   1.00 0.00 ? 149 ASN A HB3  4  
ATOM 6963  H HD21 . ASN A 1 71  ? -15.297 -1.753  5.486   1.00 0.00 ? 149 ASN A HD21 4  
ATOM 6964  H HD22 . ASN A 1 71  ? -15.965 -1.679  7.077   1.00 0.00 ? 149 ASN A HD22 4  
ATOM 6965  N N    . ALA A 1 72  ? -14.624 3.006   3.132   1.00 0.00 ? 150 ALA A N    4  
ATOM 6966  C CA   . ALA A 1 72  ? -14.269 3.567   1.834   1.00 0.00 ? 150 ALA A CA   4  
ATOM 6967  C C    . ALA A 1 72  ? -13.618 4.937   1.988   1.00 0.00 ? 150 ALA A C    4  
ATOM 6968  O O    . ALA A 1 72  ? -12.577 5.212   1.389   1.00 0.00 ? 150 ALA A O    4  
ATOM 6969  C CB   . ALA A 1 72  ? -15.501 3.662   0.946   1.00 0.00 ? 150 ALA A CB   4  
ATOM 6970  H H    . ALA A 1 72  ? -15.569 2.873   3.353   1.00 0.00 ? 150 ALA A H    4  
ATOM 6971  H HA   . ALA A 1 72  ? -13.566 2.896   1.362   1.00 0.00 ? 150 ALA A HA   4  
ATOM 6972  H HB1  . ALA A 1 72  ? -15.920 2.676   0.807   1.00 0.00 ? 150 ALA A HB1  4  
ATOM 6973  H HB2  . ALA A 1 72  ? -16.233 4.302   1.415   1.00 0.00 ? 150 ALA A HB2  4  
ATOM 6974  H HB3  . ALA A 1 72  ? -15.222 4.074   -0.012  1.00 0.00 ? 150 ALA A HB3  4  
ATOM 6975  N N    . HIS A 1 73  ? -14.237 5.795   2.793   1.00 0.00 ? 151 HIS A N    4  
ATOM 6976  C CA   . HIS A 1 73  ? -13.717 7.138   3.024   1.00 0.00 ? 151 HIS A CA   4  
ATOM 6977  C C    . HIS A 1 73  ? -12.327 7.081   3.651   1.00 0.00 ? 151 HIS A C    4  
ATOM 6978  O O    . HIS A 1 73  ? -11.393 7.722   3.170   1.00 0.00 ? 151 HIS A O    4  
ATOM 6979  C CB   . HIS A 1 73  ? -14.665 7.926   3.929   1.00 0.00 ? 151 HIS A CB   4  
ATOM 6980  C CG   . HIS A 1 73  ? -14.026 9.117   4.573   1.00 0.00 ? 151 HIS A CG   4  
ATOM 6981  N ND1  . HIS A 1 73  ? -14.422 10.413  4.317   1.00 0.00 ? 151 HIS A ND1  4  
ATOM 6982  C CD2  . HIS A 1 73  ? -13.015 9.204   5.468   1.00 0.00 ? 151 HIS A CD2  4  
ATOM 6983  C CE1  . HIS A 1 73  ? -13.680 11.246  5.026   1.00 0.00 ? 151 HIS A CE1  4  
ATOM 6984  N NE2  . HIS A 1 73  ? -12.819 10.537  5.734   1.00 0.00 ? 151 HIS A NE2  4  
ATOM 6985  H H    . HIS A 1 73  ? -15.063 5.518   3.242   1.00 0.00 ? 151 HIS A H    4  
ATOM 6986  H HA   . HIS A 1 73  ? -13.647 7.636   2.069   1.00 0.00 ? 151 HIS A HA   4  
ATOM 6987  H HB2  . HIS A 1 73  ? -15.503 8.275   3.343   1.00 0.00 ? 151 HIS A HB2  4  
ATOM 6988  H HB3  . HIS A 1 73  ? -15.026 7.277   4.714   1.00 0.00 ? 151 HIS A HB3  4  
ATOM 6989  H HD2  . HIS A 1 73  ? -12.463 8.378   5.895   1.00 0.00 ? 151 HIS A HD2  4  
ATOM 6990  H HE1  . HIS A 1 73  ? -13.763 12.322  5.028   1.00 0.00 ? 151 HIS A HE1  4  
ATOM 6991  H HE2  . HIS A 1 73  ? -12.096 10.909  6.280   1.00 0.00 ? 151 HIS A HE2  4  
ATOM 6992  N N    . MET A 1 74  ? -12.199 6.311   4.727   1.00 0.00 ? 152 MET A N    4  
ATOM 6993  C CA   . MET A 1 74  ? -10.923 6.172   5.418   1.00 0.00 ? 152 MET A CA   4  
ATOM 6994  C C    . MET A 1 74  ? -9.892  5.487   4.526   1.00 0.00 ? 152 MET A C    4  
ATOM 6995  O O    . MET A 1 74  ? -8.735  5.901   4.470   1.00 0.00 ? 152 MET A O    4  
ATOM 6996  C CB   . MET A 1 74  ? -11.104 5.374   6.712   1.00 0.00 ? 152 MET A CB   4  
ATOM 6997  C CG   . MET A 1 74  ? -11.408 6.242   7.922   1.00 0.00 ? 152 MET A CG   4  
ATOM 6998  S SD   . MET A 1 74  ? -10.830 5.509   9.465   1.00 0.00 ? 152 MET A SD   4  
ATOM 6999  C CE   . MET A 1 74  ? -9.068  5.417   9.156   1.00 0.00 ? 152 MET A CE   4  
ATOM 7000  H H    . MET A 1 74  ? -12.980 5.825   5.063   1.00 0.00 ? 152 MET A H    4  
ATOM 7001  H HA   . MET A 1 74  ? -10.569 7.162   5.663   1.00 0.00 ? 152 MET A HA   4  
ATOM 7002  H HB2  . MET A 1 74  ? -11.918 4.678   6.580   1.00 0.00 ? 152 MET A HB2  4  
ATOM 7003  H HB3  . MET A 1 74  ? -10.197 4.823   6.911   1.00 0.00 ? 152 MET A HB3  4  
ATOM 7004  H HG2  . MET A 1 74  ? -10.927 7.200   7.793   1.00 0.00 ? 152 MET A HG2  4  
ATOM 7005  H HG3  . MET A 1 74  ? -12.477 6.384   7.986   1.00 0.00 ? 152 MET A HG3  4  
ATOM 7006  H HE1  . MET A 1 74  ? -8.868  5.686   8.130   1.00 0.00 ? 152 MET A HE1  4  
ATOM 7007  H HE2  . MET A 1 74  ? -8.551  6.099   9.815   1.00 0.00 ? 152 MET A HE2  4  
ATOM 7008  H HE3  . MET A 1 74  ? -8.723  4.409   9.338   1.00 0.00 ? 152 MET A HE3  4  
ATOM 7009  N N    . GLU A 1 75  ? -10.322 4.439   3.830   1.00 0.00 ? 153 GLU A N    4  
ATOM 7010  C CA   . GLU A 1 75  ? -9.435  3.698   2.941   1.00 0.00 ? 153 GLU A CA   4  
ATOM 7011  C C    . GLU A 1 75  ? -8.919  4.592   1.817   1.00 0.00 ? 153 GLU A C    4  
ATOM 7012  O O    . GLU A 1 75  ? -7.756  4.506   1.426   1.00 0.00 ? 153 GLU A O    4  
ATOM 7013  C CB   . GLU A 1 75  ? -10.162 2.488   2.351   1.00 0.00 ? 153 GLU A CB   4  
ATOM 7014  C CG   . GLU A 1 75  ? -9.459  1.881   1.149   1.00 0.00 ? 153 GLU A CG   4  
ATOM 7015  C CD   . GLU A 1 75  ? -9.849  2.549   -0.155  1.00 0.00 ? 153 GLU A CD   4  
ATOM 7016  O OE1  . GLU A 1 75  ? -9.227  3.574   -0.505  1.00 0.00 ? 153 GLU A OE1  4  
ATOM 7017  O OE2  . GLU A 1 75  ? -10.777 2.049   -0.824  1.00 0.00 ? 153 GLU A OE2  4  
ATOM 7018  H H    . GLU A 1 75  ? -11.256 4.158   3.917   1.00 0.00 ? 153 GLU A H    4  
ATOM 7019  H HA   . GLU A 1 75  ? -8.595  3.352   3.524   1.00 0.00 ? 153 GLU A HA   4  
ATOM 7020  H HB2  . GLU A 1 75  ? -10.249 1.728   3.114   1.00 0.00 ? 153 GLU A HB2  4  
ATOM 7021  H HB3  . GLU A 1 75  ? -11.153 2.792   2.046   1.00 0.00 ? 153 GLU A HB3  4  
ATOM 7022  H HG2  . GLU A 1 75  ? -8.392  1.983   1.283   1.00 0.00 ? 153 GLU A HG2  4  
ATOM 7023  H HG3  . GLU A 1 75  ? -9.714  0.833   1.090   1.00 0.00 ? 153 GLU A HG3  4  
ATOM 7024  N N    . ALA A 1 76  ? -9.794  5.450   1.303   1.00 0.00 ? 154 ALA A N    4  
ATOM 7025  C CA   . ALA A 1 76  ? -9.428  6.361   0.226   1.00 0.00 ? 154 ALA A CA   4  
ATOM 7026  C C    . ALA A 1 76  ? -8.354  7.344   0.680   1.00 0.00 ? 154 ALA A C    4  
ATOM 7027  O O    . ALA A 1 76  ? -7.383  7.593   -0.036  1.00 0.00 ? 154 ALA A O    4  
ATOM 7028  C CB   . ALA A 1 76  ? -10.655 7.110   -0.272  1.00 0.00 ? 154 ALA A CB   4  
ATOM 7029  H H    . ALA A 1 76  ? -10.707 5.472   1.657   1.00 0.00 ? 154 ALA A H    4  
ATOM 7030  H HA   . ALA A 1 76  ? -9.039  5.772   -0.592  1.00 0.00 ? 154 ALA A HA   4  
ATOM 7031  H HB1  . ALA A 1 76  ? -11.433 6.402   -0.517  1.00 0.00 ? 154 ALA A HB1  4  
ATOM 7032  H HB2  . ALA A 1 76  ? -11.006 7.779   0.499   1.00 0.00 ? 154 ALA A HB2  4  
ATOM 7033  H HB3  . ALA A 1 76  ? -10.396 7.680   -1.152  1.00 0.00 ? 154 ALA A HB3  4  
ATOM 7034  N N    . VAL A 1 77  ? -8.534  7.902   1.873   1.00 0.00 ? 155 VAL A N    4  
ATOM 7035  C CA   . VAL A 1 77  ? -7.580  8.857   2.423   1.00 0.00 ? 155 VAL A CA   4  
ATOM 7036  C C    . VAL A 1 77  ? -6.284  8.167   2.831   1.00 0.00 ? 155 VAL A C    4  
ATOM 7037  O O    . VAL A 1 77  ? -5.191  8.683   2.593   1.00 0.00 ? 155 VAL A O    4  
ATOM 7038  C CB   . VAL A 1 77  ? -8.164  9.594   3.643   1.00 0.00 ? 155 VAL A CB   4  
ATOM 7039  C CG1  . VAL A 1 77  ? -8.652  8.599   4.684   1.00 0.00 ? 155 VAL A CG1  4  
ATOM 7040  C CG2  . VAL A 1 77  ? -7.131  10.538  4.239   1.00 0.00 ? 155 VAL A CG2  4  
ATOM 7041  H H    . VAL A 1 77  ? -9.328  7.663   2.397   1.00 0.00 ? 155 VAL A H    4  
ATOM 7042  H HA   . VAL A 1 77  ? -7.362  9.589   1.658   1.00 0.00 ? 155 VAL A HA   4  
ATOM 7043  H HB   . VAL A 1 77  ? -9.009  10.181  3.314   1.00 0.00 ? 155 VAL A HB   4  
ATOM 7044  H HG11 . VAL A 1 77  ? -7.832  7.964   4.988   1.00 0.00 ? 155 VAL A HG11 4  
ATOM 7045  H HG12 . VAL A 1 77  ? -9.032  9.133   5.543   1.00 0.00 ? 155 VAL A HG12 4  
ATOM 7046  H HG13 . VAL A 1 77  ? -9.438  7.991   4.261   1.00 0.00 ? 155 VAL A HG13 4  
ATOM 7047  H HG21 . VAL A 1 77  ? -6.641  11.082  3.445   1.00 0.00 ? 155 VAL A HG21 4  
ATOM 7048  H HG22 . VAL A 1 77  ? -7.620  11.235  4.904   1.00 0.00 ? 155 VAL A HG22 4  
ATOM 7049  H HG23 . VAL A 1 77  ? -6.398  9.969   4.791   1.00 0.00 ? 155 VAL A HG23 4  
ATOM 7050  N N    . LEU A 1 78  ? -6.412  6.997   3.447   1.00 0.00 ? 156 LEU A N    4  
ATOM 7051  C CA   . LEU A 1 78  ? -5.250  6.234   3.890   1.00 0.00 ? 156 LEU A CA   4  
ATOM 7052  C C    . LEU A 1 78  ? -4.442  5.733   2.697   1.00 0.00 ? 156 LEU A C    4  
ATOM 7053  O O    . LEU A 1 78  ? -3.215  5.825   2.684   1.00 0.00 ? 156 LEU A O    4  
ATOM 7054  C CB   . LEU A 1 78  ? -5.691  5.052   4.755   1.00 0.00 ? 156 LEU A CB   4  
ATOM 7055  C CG   . LEU A 1 78  ? -4.595  4.059   5.143   1.00 0.00 ? 156 LEU A CG   4  
ATOM 7056  C CD1  . LEU A 1 78  ? -3.539  4.738   6.001   1.00 0.00 ? 156 LEU A CD1  4  
ATOM 7057  C CD2  . LEU A 1 78  ? -5.192  2.865   5.873   1.00 0.00 ? 156 LEU A CD2  4  
ATOM 7058  H H    . LEU A 1 78  ? -7.309  6.637   3.609   1.00 0.00 ? 156 LEU A H    4  
ATOM 7059  H HA   . LEU A 1 78  ? -4.628  6.890   4.480   1.00 0.00 ? 156 LEU A HA   4  
ATOM 7060  H HB2  . LEU A 1 78  ? -6.115  5.448   5.664   1.00 0.00 ? 156 LEU A HB2  4  
ATOM 7061  H HB3  . LEU A 1 78  ? -6.452  4.511   4.211   1.00 0.00 ? 156 LEU A HB3  4  
ATOM 7062  H HG   . LEU A 1 78  ? -4.112  3.696   4.246   1.00 0.00 ? 156 LEU A HG   4  
ATOM 7063  H HD11 . LEU A 1 78  ? -3.638  5.809   5.913   1.00 0.00 ? 156 LEU A HD11 4  
ATOM 7064  H HD12 . LEU A 1 78  ? -2.557  4.438   5.667   1.00 0.00 ? 156 LEU A HD12 4  
ATOM 7065  H HD13 . LEU A 1 78  ? -3.672  4.446   7.033   1.00 0.00 ? 156 LEU A HD13 4  
ATOM 7066  H HD21 . LEU A 1 78  ? -5.428  3.146   6.889   1.00 0.00 ? 156 LEU A HD21 4  
ATOM 7067  H HD22 . LEU A 1 78  ? -4.477  2.054   5.881   1.00 0.00 ? 156 LEU A HD22 4  
ATOM 7068  H HD23 . LEU A 1 78  ? -6.092  2.547   5.368   1.00 0.00 ? 156 LEU A HD23 4  
ATOM 7069  N N    . GLN A 1 79  ? -5.139  5.204   1.697   1.00 0.00 ? 157 GLN A N    4  
ATOM 7070  C CA   . GLN A 1 79  ? -4.486  4.689   0.499   1.00 0.00 ? 157 GLN A CA   4  
ATOM 7071  C C    . GLN A 1 79  ? -3.676  5.782   -0.191  1.00 0.00 ? 157 GLN A C    4  
ATOM 7072  O O    . GLN A 1 79  ? -2.501  5.593   -0.506  1.00 0.00 ? 157 GLN A O    4  
ATOM 7073  C CB   . GLN A 1 79  ? -5.524  4.118   -0.469  1.00 0.00 ? 157 GLN A CB   4  
ATOM 7074  C CG   . GLN A 1 79  ? -5.832  2.649   -0.233  1.00 0.00 ? 157 GLN A CG   4  
ATOM 7075  C CD   . GLN A 1 79  ? -6.242  1.928   -1.502  1.00 0.00 ? 157 GLN A CD   4  
ATOM 7076  O OE1  . GLN A 1 79  ? -7.327  1.350   -1.578  1.00 0.00 ? 157 GLN A OE1  4  
ATOM 7077  N NE2  . GLN A 1 79  ? -5.375  1.957   -2.507  1.00 0.00 ? 157 GLN A NE2  4  
ATOM 7078  H H    . GLN A 1 79  ? -6.115  5.158   1.766   1.00 0.00 ? 157 GLN A H    4  
ATOM 7079  H HA   . GLN A 1 79  ? -3.816  3.899   0.801   1.00 0.00 ? 157 GLN A HA   4  
ATOM 7080  H HB2  . GLN A 1 79  ? -6.441  4.678   -0.365  1.00 0.00 ? 157 GLN A HB2  4  
ATOM 7081  H HB3  . GLN A 1 79  ? -5.156  4.229   -1.478  1.00 0.00 ? 157 GLN A HB3  4  
ATOM 7082  H HG2  . GLN A 1 79  ? -4.951  2.169   0.166   1.00 0.00 ? 157 GLN A HG2  4  
ATOM 7083  H HG3  . GLN A 1 79  ? -6.637  2.574   0.483   1.00 0.00 ? 157 GLN A HG3  4  
ATOM 7084  H HE21 . GLN A 1 79  ? -4.530  2.436   -2.374  1.00 0.00 ? 157 GLN A HE21 4  
ATOM 7085  H HE22 . GLN A 1 79  ? -5.614  1.499   -3.338  1.00 0.00 ? 157 GLN A HE22 4  
ATOM 7086  N N    . ARG A 1 80  ? -4.313  6.925   -0.424  1.00 0.00 ? 158 ARG A N    4  
ATOM 7087  C CA   . ARG A 1 80  ? -3.652  8.048   -1.079  1.00 0.00 ? 158 ARG A CA   4  
ATOM 7088  C C    . ARG A 1 80  ? -2.479  8.551   -0.243  1.00 0.00 ? 158 ARG A C    4  
ATOM 7089  O O    . ARG A 1 80  ? -1.507  9.086   -0.777  1.00 0.00 ? 158 ARG A O    4  
ATOM 7090  C CB   . ARG A 1 80  ? -4.647  9.185   -1.316  1.00 0.00 ? 158 ARG A CB   4  
ATOM 7091  C CG   . ARG A 1 80  ? -4.976  9.978   -0.062  1.00 0.00 ? 158 ARG A CG   4  
ATOM 7092  C CD   . ARG A 1 80  ? -5.539  11.350  -0.401  1.00 0.00 ? 158 ARG A CD   4  
ATOM 7093  N NE   . ARG A 1 80  ? -6.836  11.260  -1.066  1.00 0.00 ? 158 ARG A NE   4  
ATOM 7094  C CZ   . ARG A 1 80  ? -7.608  12.312  -1.316  1.00 0.00 ? 158 ARG A CZ   4  
ATOM 7095  N NH1  . ARG A 1 80  ? -7.215  13.527  -0.958  1.00 0.00 ? 158 ARG A NH1  4  
ATOM 7096  N NH2  . ARG A 1 80  ? -8.775  12.150  -1.926  1.00 0.00 ? 158 ARG A NH2  4  
ATOM 7097  H H    . ARG A 1 80  ? -5.249  7.016   -0.150  1.00 0.00 ? 158 ARG A H    4  
ATOM 7098  H HA   . ARG A 1 80  ? -3.279  7.704   -2.032  1.00 0.00 ? 158 ARG A HA   4  
ATOM 7099  H HB2  . ARG A 1 80  ? -4.233  9.865   -2.046  1.00 0.00 ? 158 ARG A HB2  4  
ATOM 7100  H HB3  . ARG A 1 80  ? -5.565  8.769   -1.704  1.00 0.00 ? 158 ARG A HB3  4  
ATOM 7101  H HG2  . ARG A 1 80  ? -5.709  9.434   0.515   1.00 0.00 ? 158 ARG A HG2  4  
ATOM 7102  H HG3  . ARG A 1 80  ? -4.076  10.102  0.521   1.00 0.00 ? 158 ARG A HG3  4  
ATOM 7103  H HD2  . ARG A 1 80  ? -5.652  11.914  0.513   1.00 0.00 ? 158 ARG A HD2  4  
ATOM 7104  H HD3  . ARG A 1 80  ? -4.844  11.857  -1.054  1.00 0.00 ? 158 ARG A HD3  4  
ATOM 7105  H HE   . ARG A 1 80  ? -7.145  10.372  -1.340  1.00 0.00 ? 158 ARG A HE   4  
ATOM 7106  H HH11 . ARG A 1 80  ? -6.336  13.652  -0.499  1.00 0.00 ? 158 ARG A HH11 4  
ATOM 7107  H HH12 . ARG A 1 80  ? -7.798  14.317  -1.148  1.00 0.00 ? 158 ARG A HH12 4  
ATOM 7108  H HH21 . ARG A 1 80  ? -9.074  11.236  -2.198  1.00 0.00 ? 158 ARG A HH21 4  
ATOM 7109  H HH22 . ARG A 1 80  ? -9.355  12.942  -2.113  1.00 0.00 ? 158 ARG A HH22 4  
ATOM 7110  N N    . SER A 1 81  ? -2.576  8.375   1.071   1.00 0.00 ? 159 SER A N    4  
ATOM 7111  C CA   . SER A 1 81  ? -1.525  8.815   1.981   1.00 0.00 ? 159 SER A CA   4  
ATOM 7112  C C    . SER A 1 81  ? -0.452  7.741   2.131   1.00 0.00 ? 159 SER A C    4  
ATOM 7113  O O    . SER A 1 81  ? 0.331   7.759   3.080   1.00 0.00 ? 159 SER A O    4  
ATOM 7114  C CB   . SER A 1 81  ? -2.117  9.156   3.350   1.00 0.00 ? 159 SER A CB   4  
ATOM 7115  O OG   . SER A 1 81  ? -2.536  10.509  3.402   1.00 0.00 ? 159 SER A OG   4  
ATOM 7116  H H    . SER A 1 81  ? -3.376  7.942   1.437   1.00 0.00 ? 159 SER A H    4  
ATOM 7117  H HA   . SER A 1 81  ? -1.074  9.702   1.562   1.00 0.00 ? 159 SER A HA   4  
ATOM 7118  H HB2  . SER A 1 81  ? -2.968  8.521   3.540   1.00 0.00 ? 159 SER A HB2  4  
ATOM 7119  H HB3  . SER A 1 81  ? -1.369  8.993   4.113   1.00 0.00 ? 159 SER A HB3  4  
ATOM 7120  H HG   . SER A 1 81  ? -2.275  10.892  4.243   1.00 0.00 ? 159 SER A HG   4  
ATOM 7121  N N    . ALA A 1 82  ? -0.423  6.807   1.187   1.00 0.00 ? 160 ALA A N    4  
ATOM 7122  C CA   . ALA A 1 82  ? 0.554   5.725   1.211   1.00 0.00 ? 160 ALA A CA   4  
ATOM 7123  C C    . ALA A 1 82  ? 1.842   6.133   0.504   1.00 0.00 ? 160 ALA A C    4  
ATOM 7124  O O    . ALA A 1 82  ? 2.939   5.911   1.015   1.00 0.00 ? 160 ALA A O    4  
ATOM 7125  C CB   . ALA A 1 82  ? -0.028  4.473   0.572   1.00 0.00 ? 160 ALA A CB   4  
ATOM 7126  H H    . ALA A 1 82  ? -1.074  6.846   0.455   1.00 0.00 ? 160 ALA A H    4  
ATOM 7127  H HA   . ALA A 1 82  ? 0.778   5.501   2.245   1.00 0.00 ? 160 ALA A HA   4  
ATOM 7128  H HB1  . ALA A 1 82  ? -0.976  4.241   1.035   1.00 0.00 ? 160 ALA A HB1  4  
ATOM 7129  H HB2  . ALA A 1 82  ? -0.174  4.643   -0.484  1.00 0.00 ? 160 ALA A HB2  4  
ATOM 7130  H HB3  . ALA A 1 82  ? 0.653   3.647   0.714   1.00 0.00 ? 160 ALA A HB3  4  
ATOM 7131  N N    . ALA A 1 83  ? 1.701   6.730   -0.675  1.00 0.00 ? 161 ALA A N    4  
ATOM 7132  C CA   . ALA A 1 83  ? 2.853   7.169   -1.452  1.00 0.00 ? 161 ALA A CA   4  
ATOM 7133  C C    . ALA A 1 83  ? 3.898   7.828   -0.558  1.00 0.00 ? 161 ALA A C    4  
ATOM 7134  O O    . ALA A 1 83  ? 5.036   7.364   -0.470  1.00 0.00 ? 161 ALA A O    4  
ATOM 7135  C CB   . ALA A 1 83  ? 2.415   8.127   -2.550  1.00 0.00 ? 161 ALA A CB   4  
ATOM 7136  H H    . ALA A 1 83  ? 0.800   6.879   -1.030  1.00 0.00 ? 161 ALA A H    4  
ATOM 7137  H HA   . ALA A 1 83  ? 3.291   6.300   -1.920  1.00 0.00 ? 161 ALA A HA   4  
ATOM 7138  H HB1  . ALA A 1 83  ? 2.558   7.659   -3.513  1.00 0.00 ? 161 ALA A HB1  4  
ATOM 7139  H HB2  . ALA A 1 83  ? 1.372   8.372   -2.419  1.00 0.00 ? 161 ALA A HB2  4  
ATOM 7140  H HB3  . ALA A 1 83  ? 3.006   9.029   -2.496  1.00 0.00 ? 161 ALA A HB3  4  
ATOM 7141  N N    . HIS A 1 84  ? 3.506   8.912   0.104   1.00 0.00 ? 162 HIS A N    4  
ATOM 7142  C CA   . HIS A 1 84  ? 4.410   9.635   0.991   1.00 0.00 ? 162 HIS A CA   4  
ATOM 7143  C C    . HIS A 1 84  ? 4.963   8.712   2.073   1.00 0.00 ? 162 HIS A C    4  
ATOM 7144  O O    . HIS A 1 84  ? 6.146   8.771   2.408   1.00 0.00 ? 162 HIS A O    4  
ATOM 7145  C CB   . HIS A 1 84  ? 3.688   10.819  1.635   1.00 0.00 ? 162 HIS A CB   4  
ATOM 7146  C CG   . HIS A 1 84  ? 4.613   11.809  2.274   1.00 0.00 ? 162 HIS A CG   4  
ATOM 7147  N ND1  . HIS A 1 84  ? 5.819   12.180  1.718   1.00 0.00 ? 162 HIS A ND1  4  
ATOM 7148  C CD2  . HIS A 1 84  ? 4.502   12.507  3.429   1.00 0.00 ? 162 HIS A CD2  4  
ATOM 7149  C CE1  . HIS A 1 84  ? 6.411   13.062  2.503   1.00 0.00 ? 162 HIS A CE1  4  
ATOM 7150  N NE2  . HIS A 1 84  ? 5.632   13.278  3.548   1.00 0.00 ? 162 HIS A NE2  4  
ATOM 7151  H H    . HIS A 1 84  ? 2.587   9.233   -0.007  1.00 0.00 ? 162 HIS A H    4  
ATOM 7152  H HA   . HIS A 1 84  ? 5.232   10.005  0.397   1.00 0.00 ? 162 HIS A HA   4  
ATOM 7153  H HB2  . HIS A 1 84  ? 3.118   11.339  0.879   1.00 0.00 ? 162 HIS A HB2  4  
ATOM 7154  H HB3  . HIS A 1 84  ? 3.016   10.451  2.397   1.00 0.00 ? 162 HIS A HB3  4  
ATOM 7155  H HD2  . HIS A 1 84  ? 3.678   12.465  4.127   1.00 0.00 ? 162 HIS A HD2  4  
ATOM 7156  H HE1  . HIS A 1 84  ? 7.368   13.528  2.323   1.00 0.00 ? 162 HIS A HE1  4  
ATOM 7157  H HE2  . HIS A 1 84  ? 5.870   13.823  4.326   1.00 0.00 ? 162 HIS A HE2  4  
ATOM 7158  N N    . MET A 1 85  ? 4.099   7.860   2.616   1.00 0.00 ? 163 MET A N    4  
ATOM 7159  C CA   . MET A 1 85  ? 4.502   6.924   3.659   1.00 0.00 ? 163 MET A CA   4  
ATOM 7160  C C    . MET A 1 85  ? 5.654   6.044   3.185   1.00 0.00 ? 163 MET A C    4  
ATOM 7161  O O    . MET A 1 85  ? 6.648   5.874   3.890   1.00 0.00 ? 163 MET A O    4  
ATOM 7162  C CB   . MET A 1 85  ? 3.316   6.052   4.077   1.00 0.00 ? 163 MET A CB   4  
ATOM 7163  C CG   . MET A 1 85  ? 2.487   6.653   5.201   1.00 0.00 ? 163 MET A CG   4  
ATOM 7164  S SD   . MET A 1 85  ? 1.591   5.405   6.145   1.00 0.00 ? 163 MET A SD   4  
ATOM 7165  C CE   . MET A 1 85  ? -0.097  5.968   5.934   1.00 0.00 ? 163 MET A CE   4  
ATOM 7166  H H    . MET A 1 85  ? 3.169   7.860   2.307   1.00 0.00 ? 163 MET A H    4  
ATOM 7167  H HA   . MET A 1 85  ? 4.831   7.500   4.511   1.00 0.00 ? 163 MET A HA   4  
ATOM 7168  H HB2  . MET A 1 85  ? 2.673   5.906   3.222   1.00 0.00 ? 163 MET A HB2  4  
ATOM 7169  H HB3  . MET A 1 85  ? 3.688   5.094   4.407   1.00 0.00 ? 163 MET A HB3  4  
ATOM 7170  H HG2  . MET A 1 85  ? 3.144   7.187   5.870   1.00 0.00 ? 163 MET A HG2  4  
ATOM 7171  H HG3  . MET A 1 85  ? 1.774   7.342   4.773   1.00 0.00 ? 163 MET A HG3  4  
ATOM 7172  H HE1  . MET A 1 85  ? -0.388  5.853   4.901   1.00 0.00 ? 163 MET A HE1  4  
ATOM 7173  H HE2  . MET A 1 85  ? -0.752  5.382   6.561   1.00 0.00 ? 163 MET A HE2  4  
ATOM 7174  H HE3  . MET A 1 85  ? -0.166  7.009   6.214   1.00 0.00 ? 163 MET A HE3  4  
ATOM 7175  N N    . ARG A 1 86  ? 5.512   5.486   1.987   1.00 0.00 ? 164 ARG A N    4  
ATOM 7176  C CA   . ARG A 1 86  ? 6.540   4.622   1.420   1.00 0.00 ? 164 ARG A CA   4  
ATOM 7177  C C    . ARG A 1 86  ? 7.885   5.340   1.367   1.00 0.00 ? 164 ARG A C    4  
ATOM 7178  O O    . ARG A 1 86  ? 8.915   4.780   1.743   1.00 0.00 ? 164 ARG A O    4  
ATOM 7179  C CB   . ARG A 1 86  ? 6.137   4.167   0.016   1.00 0.00 ? 164 ARG A CB   4  
ATOM 7180  C CG   . ARG A 1 86  ? 6.773   2.852   -0.404  1.00 0.00 ? 164 ARG A CG   4  
ATOM 7181  C CD   . ARG A 1 86  ? 6.540   2.568   -1.880  1.00 0.00 ? 164 ARG A CD   4  
ATOM 7182  N NE   . ARG A 1 86  ? 7.371   3.410   -2.737  1.00 0.00 ? 164 ARG A NE   4  
ATOM 7183  C CZ   . ARG A 1 86  ? 7.127   3.613   -4.027  1.00 0.00 ? 164 ARG A CZ   4  
ATOM 7184  N NH1  . ARG A 1 86  ? 6.081   3.039   -4.605  1.00 0.00 ? 164 ARG A NH1  4  
ATOM 7185  N NH2  . ARG A 1 86  ? 7.929   4.393   -4.740  1.00 0.00 ? 164 ARG A NH2  4  
ATOM 7186  H H    . ARG A 1 86  ? 4.696   5.659   1.472   1.00 0.00 ? 164 ARG A H    4  
ATOM 7187  H HA   . ARG A 1 86  ? 6.633   3.755   2.056   1.00 0.00 ? 164 ARG A HA   4  
ATOM 7188  H HB2  . ARG A 1 86  ? 5.063   4.050   -0.018  1.00 0.00 ? 164 ARG A HB2  4  
ATOM 7189  H HB3  . ARG A 1 86  ? 6.429   4.927   -0.693  1.00 0.00 ? 164 ARG A HB3  4  
ATOM 7190  H HG2  . ARG A 1 86  ? 7.836   2.903   -0.222  1.00 0.00 ? 164 ARG A HG2  4  
ATOM 7191  H HG3  . ARG A 1 86  ? 6.343   2.053   0.180   1.00 0.00 ? 164 ARG A HG3  4  
ATOM 7192  H HD2  . ARG A 1 86  ? 6.774   1.532   -2.075  1.00 0.00 ? 164 ARG A HD2  4  
ATOM 7193  H HD3  . ARG A 1 86  ? 5.501   2.752   -2.109  1.00 0.00 ? 164 ARG A HD3  4  
ATOM 7194  H HE   . ARG A 1 86  ? 8.149   3.844   -2.330  1.00 0.00 ? 164 ARG A HE   4  
ATOM 7195  H HH11 . ARG A 1 86  ? 5.474   2.452   -4.070  1.00 0.00 ? 164 ARG A HH11 4  
ATOM 7196  H HH12 . ARG A 1 86  ? 5.898   3.195   -5.576  1.00 0.00 ? 164 ARG A HH12 4  
ATOM 7197  H HH21 . ARG A 1 86  ? 8.718   4.828   -4.308  1.00 0.00 ? 164 ARG A HH21 4  
ATOM 7198  H HH22 . ARG A 1 86  ? 7.744   4.545   -5.711  1.00 0.00 ? 164 ARG A HH22 4  
ATOM 7199  N N    . HIS A 1 87  ? 7.868   6.583   0.896   1.00 0.00 ? 165 HIS A N    4  
ATOM 7200  C CA   . HIS A 1 87  ? 9.087   7.379   0.794   1.00 0.00 ? 165 HIS A CA   4  
ATOM 7201  C C    . HIS A 1 87  ? 9.671   7.658   2.175   1.00 0.00 ? 165 HIS A C    4  
ATOM 7202  O O    . HIS A 1 87  ? 10.883  7.572   2.378   1.00 0.00 ? 165 HIS A O    4  
ATOM 7203  C CB   . HIS A 1 87  ? 8.802   8.696   0.071   1.00 0.00 ? 165 HIS A CB   4  
ATOM 7204  C CG   . HIS A 1 87  ? 10.013  9.560   -0.097  1.00 0.00 ? 165 HIS A CG   4  
ATOM 7205  N ND1  . HIS A 1 87  ? 11.141  9.153   -0.779  1.00 0.00 ? 165 HIS A ND1  4  
ATOM 7206  C CD2  . HIS A 1 87  ? 10.269  10.819  0.332   1.00 0.00 ? 165 HIS A CD2  4  
ATOM 7207  C CE1  . HIS A 1 87  ? 12.038  10.122  -0.761  1.00 0.00 ? 165 HIS A CE1  4  
ATOM 7208  N NE2  . HIS A 1 87  ? 11.534  11.145  -0.093  1.00 0.00 ? 165 HIS A NE2  4  
ATOM 7209  H H    . HIS A 1 87  ? 7.017   6.975   0.611   1.00 0.00 ? 165 HIS A H    4  
ATOM 7210  H HA   . HIS A 1 87  ? 9.805   6.812   0.221   1.00 0.00 ? 165 HIS A HA   4  
ATOM 7211  H HB2  . HIS A 1 87  ? 8.409   8.482   -0.912  1.00 0.00 ? 165 HIS A HB2  4  
ATOM 7212  H HB3  . HIS A 1 87  ? 8.069   9.256   0.633   1.00 0.00 ? 165 HIS A HB3  4  
ATOM 7213  H HD2  . HIS A 1 87  ? 9.603   11.450  0.904   1.00 0.00 ? 165 HIS A HD2  4  
ATOM 7214  H HE1  . HIS A 1 87  ? 13.017  10.087  -1.215  1.00 0.00 ? 165 HIS A HE1  4  
ATOM 7215  H HE2  . HIS A 1 87  ? 12.022  11.960  0.143   1.00 0.00 ? 165 HIS A HE2  4  
ATOM 7216  N N    . LEU A 1 88  ? 8.802   7.995   3.122   1.00 0.00 ? 166 LEU A N    4  
ATOM 7217  C CA   . LEU A 1 88  ? 9.231   8.289   4.485   1.00 0.00 ? 166 LEU A CA   4  
ATOM 7218  C C    . LEU A 1 88  ? 10.026  7.125   5.068   1.00 0.00 ? 166 LEU A C    4  
ATOM 7219  O O    . LEU A 1 88  ? 10.992  7.326   5.806   1.00 0.00 ? 166 LEU A O    4  
ATOM 7220  C CB   . LEU A 1 88  ? 8.020   8.587   5.369   1.00 0.00 ? 166 LEU A CB   4  
ATOM 7221  C CG   . LEU A 1 88  ? 7.381   9.965   5.190   1.00 0.00 ? 166 LEU A CG   4  
ATOM 7222  C CD1  . LEU A 1 88  ? 6.080   10.057  5.973   1.00 0.00 ? 166 LEU A CD1  4  
ATOM 7223  C CD2  . LEU A 1 88  ? 8.345   11.060  5.624   1.00 0.00 ? 166 LEU A CD2  4  
ATOM 7224  H H    . LEU A 1 88  ? 7.849   8.047   2.901   1.00 0.00 ? 166 LEU A H    4  
ATOM 7225  H HA   . LEU A 1 88  ? 9.866   9.161   4.451   1.00 0.00 ? 166 LEU A HA   4  
ATOM 7226  H HB2  . LEU A 1 88  ? 7.266   7.844   5.159   1.00 0.00 ? 166 LEU A HB2  4  
ATOM 7227  H HB3  . LEU A 1 88  ? 8.333   8.498   6.400   1.00 0.00 ? 166 LEU A HB3  4  
ATOM 7228  H HG   . LEU A 1 88  ? 7.152   10.116  4.144   1.00 0.00 ? 166 LEU A HG   4  
ATOM 7229  H HD11 . LEU A 1 88  ? 5.883   9.111   6.455   1.00 0.00 ? 166 LEU A HD11 4  
ATOM 7230  H HD12 . LEU A 1 88  ? 5.271   10.293  5.298   1.00 0.00 ? 166 LEU A HD12 4  
ATOM 7231  H HD13 . LEU A 1 88  ? 6.164   10.833  6.720   1.00 0.00 ? 166 LEU A HD13 4  
ATOM 7232  H HD21 . LEU A 1 88  ? 7.802   11.826  6.158   1.00 0.00 ? 166 LEU A HD21 4  
ATOM 7233  H HD22 . LEU A 1 88  ? 8.815   11.492  4.753   1.00 0.00 ? 166 LEU A HD22 4  
ATOM 7234  H HD23 . LEU A 1 88  ? 9.101   10.638  6.270   1.00 0.00 ? 166 LEU A HD23 4  
ATOM 7235  N N    . LEU A 1 89  ? 9.616   5.907   4.731   1.00 0.00 ? 167 LEU A N    4  
ATOM 7236  C CA   . LEU A 1 89  ? 10.291  4.709   5.219   1.00 0.00 ? 167 LEU A CA   4  
ATOM 7237  C C    . LEU A 1 89  ? 11.639  4.525   4.529   1.00 0.00 ? 167 LEU A C    4  
ATOM 7238  O O    . LEU A 1 89  ? 12.626  4.155   5.164   1.00 0.00 ? 167 LEU A O    4  
ATOM 7239  C CB   . LEU A 1 89  ? 9.414   3.477   4.990   1.00 0.00 ? 167 LEU A CB   4  
ATOM 7240  C CG   . LEU A 1 89  ? 8.033   3.504   5.645   1.00 0.00 ? 167 LEU A CG   4  
ATOM 7241  C CD1  . LEU A 1 89  ? 7.351   2.152   5.509   1.00 0.00 ? 167 LEU A CD1  4  
ATOM 7242  C CD2  . LEU A 1 89  ? 8.146   3.901   7.110   1.00 0.00 ? 167 LEU A CD2  4  
ATOM 7243  H H    . LEU A 1 89  ? 8.841   5.810   4.140   1.00 0.00 ? 167 LEU A H    4  
ATOM 7244  H HA   . LEU A 1 89  ? 10.456  4.831   6.279   1.00 0.00 ? 167 LEU A HA   4  
ATOM 7245  H HB2  . LEU A 1 89  ? 9.273   3.365   3.926   1.00 0.00 ? 167 LEU A HB2  4  
ATOM 7246  H HB3  . LEU A 1 89  ? 9.947   2.618   5.373   1.00 0.00 ? 167 LEU A HB3  4  
ATOM 7247  H HG   . LEU A 1 89  ? 7.418   4.239   5.145   1.00 0.00 ? 167 LEU A HG   4  
ATOM 7248  H HD11 . LEU A 1 89  ? 6.283   2.292   5.447   1.00 0.00 ? 167 LEU A HD11 4  
ATOM 7249  H HD12 . LEU A 1 89  ? 7.584   1.542   6.370   1.00 0.00 ? 167 LEU A HD12 4  
ATOM 7250  H HD13 . LEU A 1 89  ? 7.703   1.660   4.614   1.00 0.00 ? 167 LEU A HD13 4  
ATOM 7251  H HD21 . LEU A 1 89  ? 7.440   3.328   7.693   1.00 0.00 ? 167 LEU A HD21 4  
ATOM 7252  H HD22 . LEU A 1 89  ? 7.927   4.954   7.215   1.00 0.00 ? 167 LEU A HD22 4  
ATOM 7253  H HD23 . LEU A 1 89  ? 9.148   3.704   7.460   1.00 0.00 ? 167 LEU A HD23 4  
ATOM 7254  N N    . MET A 1 90  ? 11.671  4.786   3.227   1.00 0.00 ? 168 MET A N    4  
ATOM 7255  C CA   . MET A 1 90  ? 12.899  4.652   2.451   1.00 0.00 ? 168 MET A CA   4  
ATOM 7256  C C    . MET A 1 90  ? 14.097  5.180   3.234   1.00 0.00 ? 168 MET A C    4  
ATOM 7257  O O    . MET A 1 90  ? 15.182  4.600   3.194   1.00 0.00 ? 168 MET A O    4  
ATOM 7258  C CB   . MET A 1 90  ? 12.774  5.401   1.123   1.00 0.00 ? 168 MET A CB   4  
ATOM 7259  C CG   . MET A 1 90  ? 11.827  4.735   0.138   1.00 0.00 ? 168 MET A CG   4  
ATOM 7260  S SD   . MET A 1 90  ? 11.779  5.576   -1.457  1.00 0.00 ? 168 MET A SD   4  
ATOM 7261  C CE   . MET A 1 90  ? 11.538  4.189   -2.564  1.00 0.00 ? 168 MET A CE   4  
ATOM 7262  H H    . MET A 1 90  ? 10.851  5.078   2.776   1.00 0.00 ? 168 MET A H    4  
ATOM 7263  H HA   . MET A 1 90  ? 13.050  3.602   2.250   1.00 0.00 ? 168 MET A HA   4  
ATOM 7264  H HB2  . MET A 1 90  ? 12.412  6.399   1.319   1.00 0.00 ? 168 MET A HB2  4  
ATOM 7265  H HB3  . MET A 1 90  ? 13.749  5.463   0.665   1.00 0.00 ? 168 MET A HB3  4  
ATOM 7266  H HG2  . MET A 1 90  ? 12.148  3.716   -0.019  1.00 0.00 ? 168 MET A HG2  4  
ATOM 7267  H HG3  . MET A 1 90  ? 10.832  4.735   0.559   1.00 0.00 ? 168 MET A HG3  4  
ATOM 7268  H HE1  . MET A 1 90  ? 12.476  3.935   -3.033  1.00 0.00 ? 168 MET A HE1  4  
ATOM 7269  H HE2  . MET A 1 90  ? 11.173  3.341   -2.004  1.00 0.00 ? 168 MET A HE2  4  
ATOM 7270  H HE3  . MET A 1 90  ? 10.817  4.456   -3.323  1.00 0.00 ? 168 MET A HE3  4  
ATOM 7271  N N    . SER A 1 91  ? 13.893  6.284   3.946   1.00 0.00 ? 169 SER A N    4  
ATOM 7272  C CA   . SER A 1 91  ? 14.958  6.892   4.736   1.00 0.00 ? 169 SER A CA   4  
ATOM 7273  C C    . SER A 1 91  ? 15.840  5.823   5.374   1.00 0.00 ? 169 SER A C    4  
ATOM 7274  O O    . SER A 1 91  ? 17.065  5.934   5.374   1.00 0.00 ? 169 SER A O    4  
ATOM 7275  C CB   . SER A 1 91  ? 14.366  7.795   5.819   1.00 0.00 ? 169 SER A CB   4  
ATOM 7276  O OG   . SER A 1 91  ? 15.326  8.727   6.287   1.00 0.00 ? 169 SER A OG   4  
ATOM 7277  H H    . SER A 1 91  ? 13.006  6.700   3.939   1.00 0.00 ? 169 SER A H    4  
ATOM 7278  H HA   . SER A 1 91  ? 15.563  7.491   4.071   1.00 0.00 ? 169 SER A HA   4  
ATOM 7279  H HB2  . SER A 1 91  ? 13.525  8.336   5.414   1.00 0.00 ? 169 SER A HB2  4  
ATOM 7280  H HB3  . SER A 1 91  ? 14.037  7.188   6.650   1.00 0.00 ? 169 SER A HB3  4  
ATOM 7281  H HG   . SER A 1 91  ? 15.317  8.742   7.247   1.00 0.00 ? 169 SER A HG   4  
ATOM 7282  N N    . GLN A 1 92  ? 15.205  4.789   5.917   1.00 0.00 ? 170 GLN A N    4  
ATOM 7283  C CA   . GLN A 1 92  ? 15.932  3.700   6.560   1.00 0.00 ? 170 GLN A CA   4  
ATOM 7284  C C    . GLN A 1 92  ? 17.017  3.152   5.639   1.00 0.00 ? 170 GLN A C    4  
ATOM 7285  O O    . GLN A 1 92  ? 17.158  3.595   4.500   1.00 0.00 ? 170 GLN A O    4  
ATOM 7286  C CB   . GLN A 1 92  ? 14.968  2.580   6.956   1.00 0.00 ? 170 GLN A CB   4  
ATOM 7287  C CG   . GLN A 1 92  ? 14.066  2.939   8.126   1.00 0.00 ? 170 GLN A CG   4  
ATOM 7288  C CD   . GLN A 1 92  ? 14.840  3.174   9.409   1.00 0.00 ? 170 GLN A CD   4  
ATOM 7289  O OE1  . GLN A 1 92  ? 15.983  2.738   9.546   1.00 0.00 ? 170 GLN A OE1  4  
ATOM 7290  N NE2  . GLN A 1 92  ? 14.218  3.865   10.357  1.00 0.00 ? 170 GLN A NE2  4  
ATOM 7291  H H    . GLN A 1 92  ? 14.227  4.758   5.886   1.00 0.00 ? 170 GLN A H    4  
ATOM 7292  H HA   . GLN A 1 92  ? 16.398  4.093   7.451   1.00 0.00 ? 170 GLN A HA   4  
ATOM 7293  H HB2  . GLN A 1 92  ? 14.344  2.342   6.108   1.00 0.00 ? 170 GLN A HB2  4  
ATOM 7294  H HB3  . GLN A 1 92  ? 15.542  1.707   7.228   1.00 0.00 ? 170 GLN A HB3  4  
ATOM 7295  H HG2  . GLN A 1 92  ? 13.523  3.840   7.882   1.00 0.00 ? 170 GLN A HG2  4  
ATOM 7296  H HG3  . GLN A 1 92  ? 13.367  2.131   8.286   1.00 0.00 ? 170 GLN A HG3  4  
ATOM 7297  H HE21 . GLN A 1 92  ? 13.307  4.180   10.178  1.00 0.00 ? 170 GLN A HE21 4  
ATOM 7298  H HE22 . GLN A 1 92  ? 14.694  4.030   11.196  1.00 0.00 ? 170 GLN A HE22 4  
ATOM 7299  N N    . GLN A 1 93  ? 17.779  2.186   6.141   1.00 0.00 ? 171 GLN A N    4  
ATOM 7300  C CA   . GLN A 1 93  ? 18.852  1.578   5.363   1.00 0.00 ? 171 GLN A CA   4  
ATOM 7301  C C    . GLN A 1 93  ? 18.738  0.057   5.374   1.00 0.00 ? 171 GLN A C    4  
ATOM 7302  O O    . GLN A 1 93  ? 18.661  -0.578  4.322   1.00 0.00 ? 171 GLN A O    4  
ATOM 7303  C CB   . GLN A 1 93  ? 20.214  2.003   5.915   1.00 0.00 ? 171 GLN A CB   4  
ATOM 7304  C CG   . GLN A 1 93  ? 21.355  1.818   4.927   1.00 0.00 ? 171 GLN A CG   4  
ATOM 7305  C CD   . GLN A 1 93  ? 21.494  2.986   3.971   1.00 0.00 ? 171 GLN A CD   4  
ATOM 7306  O OE1  . GLN A 1 93  ? 21.515  4.145   4.386   1.00 0.00 ? 171 GLN A OE1  4  
ATOM 7307  N NE2  . GLN A 1 93  ? 21.590  2.686   2.680   1.00 0.00 ? 171 GLN A NE2  4  
ATOM 7308  H H    . GLN A 1 93  ? 17.617  1.876   7.056   1.00 0.00 ? 171 GLN A H    4  
ATOM 7309  H HA   . GLN A 1 93  ? 18.762  1.926   4.346   1.00 0.00 ? 171 GLN A HA   4  
ATOM 7310  H HB2  . GLN A 1 93  ? 20.169  3.046   6.189   1.00 0.00 ? 171 GLN A HB2  4  
ATOM 7311  H HB3  . GLN A 1 93  ? 20.431  1.417   6.796   1.00 0.00 ? 171 GLN A HB3  4  
ATOM 7312  H HG2  . GLN A 1 93  ? 22.278  1.713   5.478   1.00 0.00 ? 171 GLN A HG2  4  
ATOM 7313  H HG3  . GLN A 1 93  ? 21.175  0.921   4.353   1.00 0.00 ? 171 GLN A HG3  4  
ATOM 7314  H HE21 . GLN A 1 93  ? 21.564  1.741   2.422   1.00 0.00 ? 171 GLN A HE21 4  
ATOM 7315  H HE22 . GLN A 1 93  ? 21.680  3.422   2.040   1.00 0.00 ? 171 GLN A HE22 4  
ATOM 7316  N N    . THR A 1 94  ? 18.729  -0.522  6.570   1.00 0.00 ? 172 THR A N    4  
ATOM 7317  C CA   . THR A 1 94  ? 18.625  -1.969  6.718   1.00 0.00 ? 172 THR A CA   4  
ATOM 7318  C C    . THR A 1 94  ? 17.691  -2.563  5.671   1.00 0.00 ? 172 THR A C    4  
ATOM 7319  O O    . THR A 1 94  ? 17.919  -3.667  5.175   1.00 0.00 ? 172 THR A O    4  
ATOM 7320  C CB   . THR A 1 94  ? 18.119  -2.355  8.121   1.00 0.00 ? 172 THR A CB   4  
ATOM 7321  O OG1  . THR A 1 94  ? 16.948  -1.599  8.445   1.00 0.00 ? 172 THR A OG1  4  
ATOM 7322  C CG2  . THR A 1 94  ? 19.193  -2.111  9.170   1.00 0.00 ? 172 THR A CG2  4  
ATOM 7323  H H    . THR A 1 94  ? 18.793  0.038   7.372   1.00 0.00 ? 172 THR A H    4  
ATOM 7324  H HA   . THR A 1 94  ? 19.612  -2.389  6.586   1.00 0.00 ? 172 THR A HA   4  
ATOM 7325  H HB   . THR A 1 94  ? 17.871  -3.407  8.120   1.00 0.00 ? 172 THR A HB   4  
ATOM 7326  H HG1  . THR A 1 94  ? 17.086  -0.678  8.210   1.00 0.00 ? 172 THR A HG1  4  
ATOM 7327  H HG21 . THR A 1 94  ? 20.000  -1.541  8.734   1.00 0.00 ? 172 THR A HG21 4  
ATOM 7328  H HG22 . THR A 1 94  ? 19.572  -3.057  9.526   1.00 0.00 ? 172 THR A HG22 4  
ATOM 7329  H HG23 . THR A 1 94  ? 18.770  -1.559  9.996   1.00 0.00 ? 172 THR A HG23 4  
ATOM 7330  N N    . LEU A 1 95  ? 16.637  -1.825  5.339   1.00 0.00 ? 173 LEU A N    4  
ATOM 7331  C CA   . LEU A 1 95  ? 15.667  -2.280  4.349   1.00 0.00 ? 173 LEU A CA   4  
ATOM 7332  C C    . LEU A 1 95  ? 16.267  -2.256  2.947   1.00 0.00 ? 173 LEU A C    4  
ATOM 7333  O O    . LEU A 1 95  ? 16.933  -1.295  2.562   1.00 0.00 ? 173 LEU A O    4  
ATOM 7334  C CB   . LEU A 1 95  ? 14.414  -1.403  4.394   1.00 0.00 ? 173 LEU A CB   4  
ATOM 7335  C CG   . LEU A 1 95  ? 13.314  -1.853  5.356   1.00 0.00 ? 173 LEU A CG   4  
ATOM 7336  C CD1  . LEU A 1 95  ? 13.578  -1.318  6.755   1.00 0.00 ? 173 LEU A CD1  4  
ATOM 7337  C CD2  . LEU A 1 95  ? 11.950  -1.398  4.858   1.00 0.00 ? 173 LEU A CD2  4  
ATOM 7338  H H    . LEU A 1 95  ? 16.508  -0.954  5.768   1.00 0.00 ? 173 LEU A H    4  
ATOM 7339  H HA   . LEU A 1 95  ? 15.395  -3.295  4.594   1.00 0.00 ? 173 LEU A HA   4  
ATOM 7340  H HB2  . LEU A 1 95  ? 14.717  -0.408  4.681   1.00 0.00 ? 173 LEU A HB2  4  
ATOM 7341  H HB3  . LEU A 1 95  ? 13.994  -1.377  3.398   1.00 0.00 ? 173 LEU A HB3  4  
ATOM 7342  H HG   . LEU A 1 95  ? 13.310  -2.933  5.408   1.00 0.00 ? 173 LEU A HG   4  
ATOM 7343  H HD11 . LEU A 1 95  ? 13.209  -0.306  6.829   1.00 0.00 ? 173 LEU A HD11 4  
ATOM 7344  H HD12 . LEU A 1 95  ? 14.640  -1.329  6.951   1.00 0.00 ? 173 LEU A HD12 4  
ATOM 7345  H HD13 . LEU A 1 95  ? 13.072  -1.940  7.480   1.00 0.00 ? 173 LEU A HD13 4  
ATOM 7346  H HD21 . LEU A 1 95  ? 11.372  -2.260  4.558   1.00 0.00 ? 173 LEU A HD21 4  
ATOM 7347  H HD22 . LEU A 1 95  ? 12.078  -0.738  4.012   1.00 0.00 ? 173 LEU A HD22 4  
ATOM 7348  H HD23 . LEU A 1 95  ? 11.434  -0.875  5.649   1.00 0.00 ? 173 LEU A HD23 4  
ATOM 7349  N N    . ARG A 1 96  ? 16.026  -3.320  2.187   1.00 0.00 ? 174 ARG A N    4  
ATOM 7350  C CA   . ARG A 1 96  ? 16.542  -3.421  0.827   1.00 0.00 ? 174 ARG A CA   4  
ATOM 7351  C C    . ARG A 1 96  ? 15.555  -2.827  -0.174  1.00 0.00 ? 174 ARG A C    4  
ATOM 7352  O O    . ARG A 1 96  ? 15.774  -1.740  -0.706  1.00 0.00 ? 174 ARG A O    4  
ATOM 7353  C CB   . ARG A 1 96  ? 16.827  -4.882  0.474   1.00 0.00 ? 174 ARG A CB   4  
ATOM 7354  C CG   . ARG A 1 96  ? 18.168  -5.382  0.986   1.00 0.00 ? 174 ARG A CG   4  
ATOM 7355  C CD   . ARG A 1 96  ? 18.059  -5.913  2.407   1.00 0.00 ? 174 ARG A CD   4  
ATOM 7356  N NE   . ARG A 1 96  ? 17.564  -7.287  2.440   1.00 0.00 ? 174 ARG A NE   4  
ATOM 7357  C CZ   . ARG A 1 96  ? 18.317  -8.346  2.163   1.00 0.00 ? 174 ARG A CZ   4  
ATOM 7358  N NH1  . ARG A 1 96  ? 19.592  -8.190  1.834   1.00 0.00 ? 174 ARG A NH1  4  
ATOM 7359  N NH2  . ARG A 1 96  ? 17.794  -9.565  2.216   1.00 0.00 ? 174 ARG A NH2  4  
ATOM 7360  H H    . ARG A 1 96  ? 15.488  -4.054  2.550   1.00 0.00 ? 174 ARG A H    4  
ATOM 7361  H HA   . ARG A 1 96  ? 17.464  -2.862  0.780   1.00 0.00 ? 174 ARG A HA   4  
ATOM 7362  H HB2  . ARG A 1 96  ? 16.051  -5.501  0.900   1.00 0.00 ? 174 ARG A HB2  4  
ATOM 7363  H HB3  . ARG A 1 96  ? 16.813  -4.989  -0.600  1.00 0.00 ? 174 ARG A HB3  4  
ATOM 7364  H HG2  . ARG A 1 96  ? 18.515  -6.176  0.342   1.00 0.00 ? 174 ARG A HG2  4  
ATOM 7365  H HG3  . ARG A 1 96  ? 18.875  -4.566  0.969   1.00 0.00 ? 174 ARG A HG3  4  
ATOM 7366  H HD2  . ARG A 1 96  ? 19.036  -5.882  2.864   1.00 0.00 ? 174 ARG A HD2  4  
ATOM 7367  H HD3  . ARG A 1 96  ? 17.381  -5.282  2.962   1.00 0.00 ? 174 ARG A HD3  4  
ATOM 7368  H HE   . ARG A 1 96  ? 16.625  -7.425  2.681   1.00 0.00 ? 174 ARG A HE   4  
ATOM 7369  H HH11 . ARG A 1 96  ? 19.988  -7.273  1.795   1.00 0.00 ? 174 ARG A HH11 4  
ATOM 7370  H HH12 . ARG A 1 96  ? 20.156  -8.989  1.628   1.00 0.00 ? 174 ARG A HH12 4  
ATOM 7371  H HH21 . ARG A 1 96  ? 16.834  -9.686  2.464   1.00 0.00 ? 174 ARG A HH21 4  
ATOM 7372  H HH22 . ARG A 1 96  ? 18.361  -10.361 2.007   1.00 0.00 ? 174 ARG A HH22 4  
ATOM 7373  N N    . ASN A 1 97  ? 14.469  -3.550  -0.426  1.00 0.00 ? 175 ASN A N    4  
ATOM 7374  C CA   . ASN A 1 97  ? 13.449  -3.096  -1.364  1.00 0.00 ? 175 ASN A CA   4  
ATOM 7375  C C    . ASN A 1 97  ? 12.123  -2.853  -0.651  1.00 0.00 ? 175 ASN A C    4  
ATOM 7376  O O    . ASN A 1 97  ? 11.713  -3.637  0.205   1.00 0.00 ? 175 ASN A O    4  
ATOM 7377  C CB   . ASN A 1 97  ? 13.259  -4.125  -2.481  1.00 0.00 ? 175 ASN A CB   4  
ATOM 7378  C CG   . ASN A 1 97  ? 12.558  -3.541  -3.692  1.00 0.00 ? 175 ASN A CG   4  
ATOM 7379  O OD1  . ASN A 1 97  ? 12.220  -2.357  -3.717  1.00 0.00 ? 175 ASN A OD1  4  
ATOM 7380  N ND2  . ASN A 1 97  ? 12.336  -4.371  -4.704  1.00 0.00 ? 175 ASN A ND2  4  
ATOM 7381  H H    . ASN A 1 97  ? 14.350  -4.410  0.029   1.00 0.00 ? 175 ASN A H    4  
ATOM 7382  H HA   . ASN A 1 97  ? 13.788  -2.167  -1.797  1.00 0.00 ? 175 ASN A HA   4  
ATOM 7383  H HB2  . ASN A 1 97  ? 14.226  -4.492  -2.792  1.00 0.00 ? 175 ASN A HB2  4  
ATOM 7384  H HB3  . ASN A 1 97  ? 12.669  -4.948  -2.108  1.00 0.00 ? 175 ASN A HB3  4  
ATOM 7385  H HD21 . ASN A 1 97  ? 12.632  -5.301  -4.614  1.00 0.00 ? 175 ASN A HD21 4  
ATOM 7386  H HD22 . ASN A 1 97  ? 11.885  -4.020  -5.500  1.00 0.00 ? 175 ASN A HD22 4  
ATOM 7387  N N    . VAL A 1 98  ? 11.456  -1.760  -1.009  1.00 0.00 ? 176 VAL A N    4  
ATOM 7388  C CA   . VAL A 1 98  ? 10.175  -1.414  -0.405  1.00 0.00 ? 176 VAL A CA   4  
ATOM 7389  C C    . VAL A 1 98  ? 9.056   -1.434  -1.440  1.00 0.00 ? 176 VAL A C    4  
ATOM 7390  O O    . VAL A 1 98  ? 8.866   -0.488  -2.205  1.00 0.00 ? 176 VAL A O    4  
ATOM 7391  C CB   . VAL A 1 98  ? 10.224  -0.023  0.255   1.00 0.00 ? 176 VAL A CB   4  
ATOM 7392  C CG1  . VAL A 1 98  ? 8.863   0.346   0.825   1.00 0.00 ? 176 VAL A CG1  4  
ATOM 7393  C CG2  . VAL A 1 98  ? 11.292  0.016   1.337   1.00 0.00 ? 176 VAL A CG2  4  
ATOM 7394  H H    . VAL A 1 98  ? 11.834  -1.174  -1.697  1.00 0.00 ? 176 VAL A H    4  
ATOM 7395  H HA   . VAL A 1 98  ? 9.958   -2.145  0.360   1.00 0.00 ? 176 VAL A HA   4  
ATOM 7396  H HB   . VAL A 1 98  ? 10.481  0.704   -0.502  1.00 0.00 ? 176 VAL A HB   4  
ATOM 7397  H HG11 . VAL A 1 98  ? 8.567   -0.393  1.556   1.00 0.00 ? 176 VAL A HG11 4  
ATOM 7398  H HG12 . VAL A 1 98  ? 8.920   1.317   1.295   1.00 0.00 ? 176 VAL A HG12 4  
ATOM 7399  H HG13 . VAL A 1 98  ? 8.134   0.374   0.028   1.00 0.00 ? 176 VAL A HG13 4  
ATOM 7400  H HG21 . VAL A 1 98  ? 11.646  1.029   1.457   1.00 0.00 ? 176 VAL A HG21 4  
ATOM 7401  H HG22 . VAL A 1 98  ? 10.873  -0.331  2.270   1.00 0.00 ? 176 VAL A HG22 4  
ATOM 7402  H HG23 . VAL A 1 98  ? 12.116  -0.622  1.053   1.00 0.00 ? 176 VAL A HG23 4  
ATOM 7403  N N    . PRO A 1 99  ? 8.294   -2.538  -1.466  1.00 0.00 ? 177 PRO A N    4  
ATOM 7404  C CA   . PRO A 1 99  ? 7.179   -2.709  -2.402  1.00 0.00 ? 177 PRO A CA   4  
ATOM 7405  C C    . PRO A 1 99  ? 6.006   -1.789  -2.080  1.00 0.00 ? 177 PRO A C    4  
ATOM 7406  O O    . PRO A 1 99  ? 5.963   -1.140  -1.034  1.00 0.00 ? 177 PRO A O    4  
ATOM 7407  C CB   . PRO A 1 99  ? 6.777   -4.173  -2.212  1.00 0.00 ? 177 PRO A CB   4  
ATOM 7408  C CG   . PRO A 1 99  ? 7.218   -4.511  -0.829  1.00 0.00 ? 177 PRO A CG   4  
ATOM 7409  C CD   . PRO A 1 99  ? 8.463   -3.705  -0.583  1.00 0.00 ? 177 PRO A CD   4  
ATOM 7410  H HA   . PRO A 1 99  ? 7.491   -2.549  -3.424  1.00 0.00 ? 177 PRO A HA   4  
ATOM 7411  H HB2  . PRO A 1 99  ? 5.706   -4.273  -2.322  1.00 0.00 ? 177 PRO A HB2  4  
ATOM 7412  H HB3  . PRO A 1 99  ? 7.278   -4.786  -2.946  1.00 0.00 ? 177 PRO A HB3  4  
ATOM 7413  H HG2  . PRO A 1 99  ? 6.449   -4.239  -0.122  1.00 0.00 ? 177 PRO A HG2  4  
ATOM 7414  H HG3  . PRO A 1 99  ? 7.436   -5.566  -0.761  1.00 0.00 ? 177 PRO A HG3  4  
ATOM 7415  H HD2  . PRO A 1 99  ? 8.517   -3.400  0.452   1.00 0.00 ? 177 PRO A HD2  4  
ATOM 7416  H HD3  . PRO A 1 99  ? 9.340   -4.272  -0.858  1.00 0.00 ? 177 PRO A HD3  4  
ATOM 7417  N N    . PRO A 1 100 ? 5.031   -1.729  -2.999  1.00 0.00 ? 178 PRO A N    4  
ATOM 7418  C CA   . PRO A 1 100 ? 3.839   -0.892  -2.834  1.00 0.00 ? 178 PRO A CA   4  
ATOM 7419  C C    . PRO A 1 100 ? 2.912   -1.411  -1.741  1.00 0.00 ? 178 PRO A C    4  
ATOM 7420  O O    . PRO A 1 100 ? 2.584   -2.598  -1.705  1.00 0.00 ? 178 PRO A O    4  
ATOM 7421  C CB   . PRO A 1 100 ? 3.154   -0.976  -4.201  1.00 0.00 ? 178 PRO A CB   4  
ATOM 7422  C CG   . PRO A 1 100 ? 3.615   -2.271  -4.775  1.00 0.00 ? 178 PRO A CG   4  
ATOM 7423  C CD   . PRO A 1 100 ? 5.016   -2.474  -4.269  1.00 0.00 ? 178 PRO A CD   4  
ATOM 7424  H HA   . PRO A 1 100 ? 4.101   0.135   -2.624  1.00 0.00 ? 178 PRO A HA   4  
ATOM 7425  H HB2  . PRO A 1 100 ? 2.081   -0.960  -4.070  1.00 0.00 ? 178 PRO A HB2  4  
ATOM 7426  H HB3  . PRO A 1 100 ? 3.461   -0.142  -4.813  1.00 0.00 ? 178 PRO A HB3  4  
ATOM 7427  H HG2  . PRO A 1 100 ? 2.974   -3.071  -4.438  1.00 0.00 ? 178 PRO A HG2  4  
ATOM 7428  H HG3  . PRO A 1 100 ? 3.611   -2.216  -5.854  1.00 0.00 ? 178 PRO A HG3  4  
ATOM 7429  H HD2  . PRO A 1 100 ? 5.209   -3.524  -4.102  1.00 0.00 ? 178 PRO A HD2  4  
ATOM 7430  H HD3  . PRO A 1 100 ? 5.732   -2.063  -4.964  1.00 0.00 ? 178 PRO A HD3  4  
ATOM 7431  N N    . ILE A 1 101 ? 2.492   -0.517  -0.853  1.00 0.00 ? 179 ILE A N    4  
ATOM 7432  C CA   . ILE A 1 101 ? 1.601   -0.886  0.240   1.00 0.00 ? 179 ILE A CA   4  
ATOM 7433  C C    . ILE A 1 101 ? 0.140   -0.695  -0.153  1.00 0.00 ? 179 ILE A C    4  
ATOM 7434  O O    . ILE A 1 101 ? -0.266  0.391   -0.566  1.00 0.00 ? 179 ILE A O    4  
ATOM 7435  C CB   . ILE A 1 101 ? 1.892   -0.061  1.508   1.00 0.00 ? 179 ILE A CB   4  
ATOM 7436  C CG1  . ILE A 1 101 ? 3.310   -0.340  2.010   1.00 0.00 ? 179 ILE A CG1  4  
ATOM 7437  C CG2  . ILE A 1 101 ? 0.870   -0.374  2.590   1.00 0.00 ? 179 ILE A CG2  4  
ATOM 7438  C CD1  . ILE A 1 101 ? 3.853   0.739   2.920   1.00 0.00 ? 179 ILE A CD1  4  
ATOM 7439  H H    . ILE A 1 101 ? 2.788   0.413   -0.935  1.00 0.00 ? 179 ILE A H    4  
ATOM 7440  H HA   . ILE A 1 101 ? 1.768   -1.929  0.468   1.00 0.00 ? 179 ILE A HA   4  
ATOM 7441  H HB   . ILE A 1 101 ? 1.807   0.985   1.256   1.00 0.00 ? 179 ILE A HB   4  
ATOM 7442  H HG12 . ILE A 1 101 ? 3.315   -1.269  2.559   1.00 0.00 ? 179 ILE A HG12 4  
ATOM 7443  H HG13 . ILE A 1 101 ? 3.974   -0.425  1.162   1.00 0.00 ? 179 ILE A HG13 4  
ATOM 7444  H HG21 . ILE A 1 101 ? 1.346   -0.930  3.384   1.00 0.00 ? 179 ILE A HG21 4  
ATOM 7445  H HG22 . ILE A 1 101 ? 0.472   0.549   2.986   1.00 0.00 ? 179 ILE A HG22 4  
ATOM 7446  H HG23 . ILE A 1 101 ? 0.068   -0.961  2.169   1.00 0.00 ? 179 ILE A HG23 4  
ATOM 7447  H HD11 . ILE A 1 101 ? 4.172   0.298   3.853   1.00 0.00 ? 179 ILE A HD11 4  
ATOM 7448  H HD12 . ILE A 1 101 ? 4.692   1.224   2.444   1.00 0.00 ? 179 ILE A HD12 4  
ATOM 7449  H HD13 . ILE A 1 101 ? 3.079   1.469   3.114   1.00 0.00 ? 179 ILE A HD13 4  
ATOM 7450  N N    . VAL A 1 102 ? -0.647  -1.758  -0.019  1.00 0.00 ? 180 VAL A N    4  
ATOM 7451  C CA   . VAL A 1 102 ? -2.064  -1.707  -0.358  1.00 0.00 ? 180 VAL A CA   4  
ATOM 7452  C C    . VAL A 1 102 ? -2.931  -2.016  0.858   1.00 0.00 ? 180 VAL A C    4  
ATOM 7453  O O    . VAL A 1 102 ? -2.879  -3.117  1.407   1.00 0.00 ? 180 VAL A O    4  
ATOM 7454  C CB   . VAL A 1 102 ? -2.408  -2.698  -1.485  1.00 0.00 ? 180 VAL A CB   4  
ATOM 7455  C CG1  . VAL A 1 102 ? -3.880  -2.597  -1.855  1.00 0.00 ? 180 VAL A CG1  4  
ATOM 7456  C CG2  . VAL A 1 102 ? -1.527  -2.450  -2.700  1.00 0.00 ? 180 VAL A CG2  4  
ATOM 7457  H H    . VAL A 1 102 ? -0.265  -2.596  0.315   1.00 0.00 ? 180 VAL A H    4  
ATOM 7458  H HA   . VAL A 1 102 ? -2.289  -0.709  -0.703  1.00 0.00 ? 180 VAL A HA   4  
ATOM 7459  H HB   . VAL A 1 102 ? -2.218  -3.699  -1.127  1.00 0.00 ? 180 VAL A HB   4  
ATOM 7460  H HG11 . VAL A 1 102 ? -4.205  -3.527  -2.298  1.00 0.00 ? 180 VAL A HG11 4  
ATOM 7461  H HG12 . VAL A 1 102 ? -4.462  -2.397  -0.967  1.00 0.00 ? 180 VAL A HG12 4  
ATOM 7462  H HG13 . VAL A 1 102 ? -4.018  -1.794  -2.564  1.00 0.00 ? 180 VAL A HG13 4  
ATOM 7463  H HG21 . VAL A 1 102 ? -0.864  -1.621  -2.499  1.00 0.00 ? 180 VAL A HG21 4  
ATOM 7464  H HG22 . VAL A 1 102 ? -0.943  -3.335  -2.908  1.00 0.00 ? 180 VAL A HG22 4  
ATOM 7465  H HG23 . VAL A 1 102 ? -2.146  -2.218  -3.553  1.00 0.00 ? 180 VAL A HG23 4  
ATOM 7466  N N    . PHE A 1 103 ? -3.728  -1.038  1.274   1.00 0.00 ? 181 PHE A N    4  
ATOM 7467  C CA   . PHE A 1 103 ? -4.607  -1.205  2.426   1.00 0.00 ? 181 PHE A CA   4  
ATOM 7468  C C    . PHE A 1 103 ? -5.890  -1.929  2.030   1.00 0.00 ? 181 PHE A C    4  
ATOM 7469  O O    . PHE A 1 103 ? -6.603  -1.502  1.121   1.00 0.00 ? 181 PHE A O    4  
ATOM 7470  C CB   . PHE A 1 103 ? -4.944  0.156   3.039   1.00 0.00 ? 181 PHE A CB   4  
ATOM 7471  C CG   . PHE A 1 103 ? -3.748  0.877   3.591   1.00 0.00 ? 181 PHE A CG   4  
ATOM 7472  C CD1  . PHE A 1 103 ? -3.154  0.458   4.771   1.00 0.00 ? 181 PHE A CD1  4  
ATOM 7473  C CD2  . PHE A 1 103 ? -3.216  1.973   2.931   1.00 0.00 ? 181 PHE A CD2  4  
ATOM 7474  C CE1  . PHE A 1 103 ? -2.054  1.121   5.283   1.00 0.00 ? 181 PHE A CE1  4  
ATOM 7475  C CE2  . PHE A 1 103 ? -2.116  2.639   3.437   1.00 0.00 ? 181 PHE A CE2  4  
ATOM 7476  C CZ   . PHE A 1 103 ? -1.533  2.211   4.614   1.00 0.00 ? 181 PHE A CZ   4  
ATOM 7477  H H    . PHE A 1 103 ? -3.725  -0.182  0.795   1.00 0.00 ? 181 PHE A H    4  
ATOM 7478  H HA   . PHE A 1 103 ? -4.083  -1.800  3.157   1.00 0.00 ? 181 PHE A HA   4  
ATOM 7479  H HB2  . PHE A 1 103 ? -5.388  0.784   2.281   1.00 0.00 ? 181 PHE A HB2  4  
ATOM 7480  H HB3  . PHE A 1 103 ? -5.649  0.015   3.843   1.00 0.00 ? 181 PHE A HB3  4  
ATOM 7481  H HD1  . PHE A 1 103 ? -3.559  -0.395  5.295   1.00 0.00 ? 181 PHE A HD1  4  
ATOM 7482  H HD2  . PHE A 1 103 ? -3.671  2.308   2.009   1.00 0.00 ? 181 PHE A HD2  4  
ATOM 7483  H HE1  . PHE A 1 103 ? -1.600  0.784   6.203   1.00 0.00 ? 181 PHE A HE1  4  
ATOM 7484  H HE2  . PHE A 1 103 ? -1.711  3.491   2.911   1.00 0.00 ? 181 PHE A HE2  4  
ATOM 7485  H HZ   . PHE A 1 103 ? -0.674  2.731   5.011   1.00 0.00 ? 181 PHE A HZ   4  
ATOM 7486  N N    . VAL A 1 104 ? -6.179  -3.028  2.719   1.00 0.00 ? 182 VAL A N    4  
ATOM 7487  C CA   . VAL A 1 104 ? -7.376  -3.812  2.441   1.00 0.00 ? 182 VAL A CA   4  
ATOM 7488  C C    . VAL A 1 104 ? -8.272  -3.903  3.672   1.00 0.00 ? 182 VAL A C    4  
ATOM 7489  O O    . VAL A 1 104 ? -7.786  -3.988  4.799   1.00 0.00 ? 182 VAL A O    4  
ATOM 7490  C CB   . VAL A 1 104 ? -7.019  -5.236  1.973   1.00 0.00 ? 182 VAL A CB   4  
ATOM 7491  C CG1  . VAL A 1 104 ? -8.279  -6.068  1.784   1.00 0.00 ? 182 VAL A CG1  4  
ATOM 7492  C CG2  . VAL A 1 104 ? -6.206  -5.186  0.689   1.00 0.00 ? 182 VAL A CG2  4  
ATOM 7493  H H    . VAL A 1 104 ? -5.573  -3.319  3.432   1.00 0.00 ? 182 VAL A H    4  
ATOM 7494  H HA   . VAL A 1 104 ? -7.920  -3.321  1.647   1.00 0.00 ? 182 VAL A HA   4  
ATOM 7495  H HB   . VAL A 1 104 ? -6.417  -5.704  2.738   1.00 0.00 ? 182 VAL A HB   4  
ATOM 7496  H HG11 . VAL A 1 104 ? -8.677  -6.341  2.750   1.00 0.00 ? 182 VAL A HG11 4  
ATOM 7497  H HG12 . VAL A 1 104 ? -9.013  -5.492  1.240   1.00 0.00 ? 182 VAL A HG12 4  
ATOM 7498  H HG13 . VAL A 1 104 ? -8.038  -6.963  1.229   1.00 0.00 ? 182 VAL A HG13 4  
ATOM 7499  H HG21 . VAL A 1 104 ? -6.725  -5.729  -0.087  1.00 0.00 ? 182 VAL A HG21 4  
ATOM 7500  H HG22 . VAL A 1 104 ? -6.077  -4.157  0.384   1.00 0.00 ? 182 VAL A HG22 4  
ATOM 7501  H HG23 . VAL A 1 104 ? -5.238  -5.635  0.857   1.00 0.00 ? 182 VAL A HG23 4  
ATOM 7502  N N    . GLN A 1 105 ? -9.581  -3.885  3.446   1.00 0.00 ? 183 GLN A N    4  
ATOM 7503  C CA   . GLN A 1 105 ? -10.545 -3.966  4.538   1.00 0.00 ? 183 GLN A CA   4  
ATOM 7504  C C    . GLN A 1 105 ? -10.553 -5.360  5.155   1.00 0.00 ? 183 GLN A C    4  
ATOM 7505  O O    . GLN A 1 105 ? -10.580 -6.364  4.444   1.00 0.00 ? 183 GLN A O    4  
ATOM 7506  C CB   . GLN A 1 105 ? -11.945 -3.608  4.037   1.00 0.00 ? 183 GLN A CB   4  
ATOM 7507  C CG   . GLN A 1 105 ? -12.081 -2.161  3.591   1.00 0.00 ? 183 GLN A CG   4  
ATOM 7508  C CD   . GLN A 1 105 ? -13.363 -1.905  2.824   1.00 0.00 ? 183 GLN A CD   4  
ATOM 7509  O OE1  . GLN A 1 105 ? -14.264 -2.745  2.798   1.00 0.00 ? 183 GLN A OE1  4  
ATOM 7510  N NE2  . GLN A 1 105 ? -13.454 -0.740  2.193   1.00 0.00 ? 183 GLN A NE2  4  
ATOM 7511  H H    . GLN A 1 105 ? -9.907  -3.816  2.525   1.00 0.00 ? 183 GLN A H    4  
ATOM 7512  H HA   . GLN A 1 105 ? -10.250 -3.253  5.293   1.00 0.00 ? 183 GLN A HA   4  
ATOM 7513  H HB2  . GLN A 1 105 ? -12.189 -4.245  3.200   1.00 0.00 ? 183 GLN A HB2  4  
ATOM 7514  H HB3  . GLN A 1 105 ? -12.655 -3.784  4.832   1.00 0.00 ? 183 GLN A HB3  4  
ATOM 7515  H HG2  . GLN A 1 105 ? -12.069 -1.526  4.464   1.00 0.00 ? 183 GLN A HG2  4  
ATOM 7516  H HG3  . GLN A 1 105 ? -11.243 -1.914  2.955   1.00 0.00 ? 183 GLN A HG3  4  
ATOM 7517  H HE21 . GLN A 1 105 ? -12.696 -0.120  2.256   1.00 0.00 ? 183 GLN A HE21 4  
ATOM 7518  H HE22 . GLN A 1 105 ? -14.271 -0.549  1.689   1.00 0.00 ? 183 GLN A HE22 4  
ATOM 7519  N N    . ASP A 1 106 ? -10.530 -5.414  6.482   1.00 0.00 ? 184 ASP A N    4  
ATOM 7520  C CA   . ASP A 1 106 ? -10.535 -6.686  7.196   1.00 0.00 ? 184 ASP A CA   4  
ATOM 7521  C C    . ASP A 1 106 ? -11.924 -7.316  7.172   1.00 0.00 ? 184 ASP A C    4  
ATOM 7522  O O    . ASP A 1 106 ? -12.449 -7.729  8.207   1.00 0.00 ? 184 ASP A O    4  
ATOM 7523  C CB   . ASP A 1 106 ? -10.077 -6.486  8.641   1.00 0.00 ? 184 ASP A CB   4  
ATOM 7524  C CG   . ASP A 1 106 ? -8.592  -6.196  8.743   1.00 0.00 ? 184 ASP A CG   4  
ATOM 7525  O OD1  . ASP A 1 106 ? -8.200  -5.029  8.531   1.00 0.00 ? 184 ASP A OD1  4  
ATOM 7526  O OD2  . ASP A 1 106 ? -7.823  -7.135  9.035   1.00 0.00 ? 184 ASP A OD2  4  
ATOM 7527  H H    . ASP A 1 106 ? -10.509 -4.579  6.994   1.00 0.00 ? 184 ASP A H    4  
ATOM 7528  H HA   . ASP A 1 106 ? -9.845  -7.349  6.697   1.00 0.00 ? 184 ASP A HA   4  
ATOM 7529  H HB2  . ASP A 1 106 ? -10.617 -5.656  9.072   1.00 0.00 ? 184 ASP A HB2  4  
ATOM 7530  H HB3  . ASP A 1 106 ? -10.290 -7.381  9.207   1.00 0.00 ? 184 ASP A HB3  4  
ATOM 7531  N N    . LYS A 1 107 ? -12.516 -7.387  5.985   1.00 0.00 ? 185 LYS A N    4  
ATOM 7532  C CA   . LYS A 1 107 ? -13.845 -7.967  5.825   1.00 0.00 ? 185 LYS A CA   4  
ATOM 7533  C C    . LYS A 1 107 ? -13.829 -9.084  4.787   1.00 0.00 ? 185 LYS A C    4  
ATOM 7534  O O    . LYS A 1 107 ? -13.366 -8.894  3.663   1.00 0.00 ? 185 LYS A O    4  
ATOM 7535  C CB   . LYS A 1 107 ? -14.848 -6.887  5.413   1.00 0.00 ? 185 LYS A CB   4  
ATOM 7536  C CG   . LYS A 1 107 ? -15.047 -5.809  6.463   1.00 0.00 ? 185 LYS A CG   4  
ATOM 7537  C CD   . LYS A 1 107 ? -15.855 -6.322  7.643   1.00 0.00 ? 185 LYS A CD   4  
ATOM 7538  C CE   . LYS A 1 107 ? -15.575 -5.516  8.903   1.00 0.00 ? 185 LYS A CE   4  
ATOM 7539  N NZ   . LYS A 1 107 ? -14.412 -6.058  9.660   1.00 0.00 ? 185 LYS A NZ   4  
ATOM 7540  H H    . LYS A 1 107 ? -12.047 -7.041  5.196   1.00 0.00 ? 185 LYS A H    4  
ATOM 7541  H HA   . LYS A 1 107 ? -14.143 -8.380  6.776   1.00 0.00 ? 185 LYS A HA   4  
ATOM 7542  H HB2  . LYS A 1 107 ? -14.501 -6.417  4.505   1.00 0.00 ? 185 LYS A HB2  4  
ATOM 7543  H HB3  . LYS A 1 107 ? -15.804 -7.355  5.222   1.00 0.00 ? 185 LYS A HB3  4  
ATOM 7544  H HG2  . LYS A 1 107 ? -14.081 -5.482  6.818   1.00 0.00 ? 185 LYS A HG2  4  
ATOM 7545  H HG3  . LYS A 1 107 ? -15.570 -4.975  6.016   1.00 0.00 ? 185 LYS A HG3  4  
ATOM 7546  H HD2  . LYS A 1 107 ? -16.907 -6.247  7.408   1.00 0.00 ? 185 LYS A HD2  4  
ATOM 7547  H HD3  . LYS A 1 107 ? -15.598 -7.356  7.823   1.00 0.00 ? 185 LYS A HD3  4  
ATOM 7548  H HE2  . LYS A 1 107 ? -15.367 -4.495  8.623   1.00 0.00 ? 185 LYS A HE2  4  
ATOM 7549  H HE3  . LYS A 1 107 ? -16.450 -5.545  9.535   1.00 0.00 ? 185 LYS A HE3  4  
ATOM 7550  H HZ1  . LYS A 1 107 ? -13.835 -6.663  9.042   1.00 0.00 ? 185 LYS A HZ1  4  
ATOM 7551  H HZ2  . LYS A 1 107 ? -14.744 -6.622  10.468  1.00 0.00 ? 185 LYS A HZ2  4  
ATOM 7552  H HZ3  . LYS A 1 107 ? -13.822 -5.278  10.014  1.00 0.00 ? 185 LYS A HZ3  4  
ATOM 7553  N N    . GLY A 1 108 ? -14.340 -10.250 5.171   1.00 0.00 ? 186 GLY A N    4  
ATOM 7554  C CA   . GLY A 1 108 ? -14.376 -11.380 4.262   1.00 0.00 ? 186 GLY A CA   4  
ATOM 7555  C C    . GLY A 1 108 ? -15.482 -11.261 3.232   1.00 0.00 ? 186 GLY A C    4  
ATOM 7556  O O    . GLY A 1 108 ? -16.273 -12.185 3.051   1.00 0.00 ? 186 GLY A O    4  
ATOM 7557  H H    . GLY A 1 108 ? -14.695 -10.344 6.080   1.00 0.00 ? 186 GLY A H    4  
ATOM 7558  H HA2  . GLY A 1 108 ? -13.427 -11.447 3.750   1.00 0.00 ? 186 GLY A HA2  4  
ATOM 7559  H HA3  . GLY A 1 108 ? -14.529 -12.284 4.834   1.00 0.00 ? 186 GLY A HA3  4  
ATOM 7560  N N    . ASN A 1 109 ? -15.538 -10.118 2.556   1.00 0.00 ? 187 ASN A N    4  
ATOM 7561  C CA   . ASN A 1 109 ? -16.557 -9.880  1.541   1.00 0.00 ? 187 ASN A CA   4  
ATOM 7562  C C    . ASN A 1 109 ? -15.932 -9.797  0.151   1.00 0.00 ? 187 ASN A C    4  
ATOM 7563  O O    . ASN A 1 109 ? -15.424 -8.751  -0.250  1.00 0.00 ? 187 ASN A O    4  
ATOM 7564  C CB   . ASN A 1 109 ? -17.320 -8.589  1.847   1.00 0.00 ? 187 ASN A CB   4  
ATOM 7565  C CG   . ASN A 1 109 ? -18.435 -8.801  2.852   1.00 0.00 ? 187 ASN A CG   4  
ATOM 7566  O OD1  . ASN A 1 109 ? -19.168 -9.788  2.784   1.00 0.00 ? 187 ASN A OD1  4  
ATOM 7567  N ND2  . ASN A 1 109 ? -18.568 -7.874  3.793   1.00 0.00 ? 187 ASN A ND2  4  
ATOM 7568  H H    . ASN A 1 109 ? -14.879 -9.418  2.745   1.00 0.00 ? 187 ASN A H    4  
ATOM 7569  H HA   . ASN A 1 109 ? -17.247 -10.709 1.563   1.00 0.00 ? 187 ASN A HA   4  
ATOM 7570  H HB2  . ASN A 1 109 ? -16.633 -7.859  2.249   1.00 0.00 ? 187 ASN A HB2  4  
ATOM 7571  H HB3  . ASN A 1 109 ? -17.751 -8.207  0.933   1.00 0.00 ? 187 ASN A HB3  4  
ATOM 7572  H HD21 . ASN A 1 109 ? -17.947 -7.115  3.786   1.00 0.00 ? 187 ASN A HD21 4  
ATOM 7573  H HD22 . ASN A 1 109 ? -19.280 -7.986  4.456   1.00 0.00 ? 187 ASN A HD22 4  
ATOM 7574  N N    . ALA A 1 110 ? -15.974 -10.908 -0.577  1.00 0.00 ? 188 ALA A N    4  
ATOM 7575  C CA   . ALA A 1 110 ? -15.414 -10.960 -1.922  1.00 0.00 ? 188 ALA A CA   4  
ATOM 7576  C C    . ALA A 1 110 ? -16.515 -10.930 -2.977  1.00 0.00 ? 188 ALA A C    4  
ATOM 7577  O O    . ALA A 1 110 ? -17.143 -11.949 -3.261  1.00 0.00 ? 188 ALA A O    4  
ATOM 7578  C CB   . ALA A 1 110 ? -14.556 -12.205 -2.088  1.00 0.00 ? 188 ALA A CB   4  
ATOM 7579  H H    . ALA A 1 110 ? -16.392 -11.710 -0.202  1.00 0.00 ? 188 ALA A H    4  
ATOM 7580  H HA   . ALA A 1 110 ? -14.780 -10.095 -2.054  1.00 0.00 ? 188 ALA A HA   4  
ATOM 7581  H HB1  . ALA A 1 110 ? -13.980 -12.367 -1.189  1.00 0.00 ? 188 ALA A HB1  4  
ATOM 7582  H HB2  . ALA A 1 110 ? -15.192 -13.059 -2.268  1.00 0.00 ? 188 ALA A HB2  4  
ATOM 7583  H HB3  . ALA A 1 110 ? -13.887 -12.072 -2.925  1.00 0.00 ? 188 ALA A HB3  4  
ATOM 7584  N N    . ALA A 1 111 ? -16.744 -9.754  -3.553  1.00 0.00 ? 189 ALA A N    4  
ATOM 7585  C CA   . ALA A 1 111 ? -17.769 -9.592  -4.576  1.00 0.00 ? 189 ALA A CA   4  
ATOM 7586  C C    . ALA A 1 111 ? -17.150 -9.531  -5.968  1.00 0.00 ? 189 ALA A C    4  
ATOM 7587  O O    . ALA A 1 111 ? -16.939 -8.450  -6.519  1.00 0.00 ? 189 ALA A O    4  
ATOM 7588  C CB   . ALA A 1 111 ? -18.591 -8.340  -4.307  1.00 0.00 ? 189 ALA A CB   4  
ATOM 7589  H H    . ALA A 1 111 ? -16.211 -8.978  -3.283  1.00 0.00 ? 189 ALA A H    4  
ATOM 7590  H HA   . ALA A 1 111 ? -18.431 -10.445 -4.525  1.00 0.00 ? 189 ALA A HA   4  
ATOM 7591  H HB1  . ALA A 1 111 ? -19.357 -8.563  -3.579  1.00 0.00 ? 189 ALA A HB1  4  
ATOM 7592  H HB2  . ALA A 1 111 ? -17.947 -7.562  -3.925  1.00 0.00 ? 189 ALA A HB2  4  
ATOM 7593  H HB3  . ALA A 1 111 ? -19.052 -8.008  -5.225  1.00 0.00 ? 189 ALA A HB3  4  
ATOM 7594  N N    . LEU A 1 112 ? -16.859 -10.698 -6.533  1.00 0.00 ? 190 LEU A N    4  
ATOM 7595  C CA   . LEU A 1 112 ? -16.262 -10.778 -7.861  1.00 0.00 ? 190 LEU A CA   4  
ATOM 7596  C C    . LEU A 1 112 ? -17.233 -11.402 -8.858  1.00 0.00 ? 190 LEU A C    4  
ATOM 7597  O O    . LEU A 1 112 ? -16.844 -12.224 -9.688  1.00 0.00 ? 190 LEU A O    4  
ATOM 7598  C CB   . LEU A 1 112 ? -14.969 -11.594 -7.813  1.00 0.00 ? 190 LEU A CB   4  
ATOM 7599  C CG   . LEU A 1 112 ? -14.022 -11.422 -9.002  1.00 0.00 ? 190 LEU A CG   4  
ATOM 7600  C CD1  . LEU A 1 112 ? -13.276 -10.101 -8.904  1.00 0.00 ? 190 LEU A CD1  4  
ATOM 7601  C CD2  . LEU A 1 112 ? -13.043 -12.585 -9.076  1.00 0.00 ? 190 LEU A CD2  4  
ATOM 7602  H H    . LEU A 1 112 ? -17.049 -11.526 -6.045  1.00 0.00 ? 190 LEU A H    4  
ATOM 7603  H HA   . LEU A 1 112 ? -16.032 -9.773  -8.182  1.00 0.00 ? 190 LEU A HA   4  
ATOM 7604  H HB2  . LEU A 1 112 ? -14.432 -11.311 -6.920  1.00 0.00 ? 190 LEU A HB2  4  
ATOM 7605  H HB3  . LEU A 1 112 ? -15.240 -12.638 -7.753  1.00 0.00 ? 190 LEU A HB3  4  
ATOM 7606  H HG   . LEU A 1 112 ? -14.600 -11.411 -9.916  1.00 0.00 ? 190 LEU A HG   4  
ATOM 7607  H HD11 . LEU A 1 112 ? -13.765 -9.464  -8.182  1.00 0.00 ? 190 LEU A HD11 4  
ATOM 7608  H HD12 . LEU A 1 112 ? -13.274 -9.616  -9.869  1.00 0.00 ? 190 LEU A HD12 4  
ATOM 7609  H HD13 . LEU A 1 112 ? -12.258 -10.285 -8.591  1.00 0.00 ? 190 LEU A HD13 4  
ATOM 7610  H HD21 . LEU A 1 112 ? -13.116 -13.175 -8.174  1.00 0.00 ? 190 LEU A HD21 4  
ATOM 7611  H HD22 . LEU A 1 112 ? -12.038 -12.203 -9.177  1.00 0.00 ? 190 LEU A HD22 4  
ATOM 7612  H HD23 . LEU A 1 112 ? -13.282 -13.202 -9.930  1.00 0.00 ? 190 LEU A HD23 4  
ATOM 7613  N N    . ALA A 1 113 ? -18.498 -11.005 -8.771  1.00 0.00 ? 191 ALA A N    4  
ATOM 7614  C CA   . ALA A 1 113 ? -19.525 -11.522 -9.668  1.00 0.00 ? 191 ALA A CA   4  
ATOM 7615  C C    . ALA A 1 113 ? -19.638 -10.666 -10.924 1.00 0.00 ? 191 ALA A C    4  
ATOM 7616  O O    . ALA A 1 113 ? -20.730 -10.473 -11.458 1.00 0.00 ? 191 ALA A O    4  
ATOM 7617  C CB   . ALA A 1 113 ? -20.865 -11.592 -8.952  1.00 0.00 ? 191 ALA A CB   4  
ATOM 7618  H H    . ALA A 1 113 ? -18.747 -10.348 -8.089  1.00 0.00 ? 191 ALA A H    4  
ATOM 7619  H HA   . ALA A 1 113 ? -19.244 -12.526 -9.953  1.00 0.00 ? 191 ALA A HA   4  
ATOM 7620  H HB1  . ALA A 1 113 ? -21.612 -11.075 -9.536  1.00 0.00 ? 191 ALA A HB1  4  
ATOM 7621  H HB2  . ALA A 1 113 ? -21.155 -12.625 -8.830  1.00 0.00 ? 191 ALA A HB2  4  
ATOM 7622  H HB3  . ALA A 1 113 ? -20.780 -11.125 -7.982  1.00 0.00 ? 191 ALA A HB3  4  
ATOM 7623  N N    . GLU A 1 114 ? -18.503 -10.154 -11.391 1.00 0.00 ? 192 GLU A N    4  
ATOM 7624  C CA   . GLU A 1 114 ? -18.477 -9.317  -12.584 1.00 0.00 ? 192 GLU A CA   4  
ATOM 7625  C C    . GLU A 1 114 ? -17.691 -9.991  -13.705 1.00 0.00 ? 192 GLU A C    4  
ATOM 7626  O O    . GLU A 1 114 ? -16.463 -9.912  -13.752 1.00 0.00 ? 192 GLU A O    4  
ATOM 7627  C CB   . GLU A 1 114 ? -17.862 -7.953  -12.264 1.00 0.00 ? 192 GLU A CB   4  
ATOM 7628  C CG   . GLU A 1 114 ? -18.755 -7.067  -11.411 1.00 0.00 ? 192 GLU A CG   4  
ATOM 7629  C CD   . GLU A 1 114 ? -18.100 -5.746  -11.058 1.00 0.00 ? 192 GLU A CD   4  
ATOM 7630  O OE1  . GLU A 1 114 ? -17.174 -5.331  -11.786 1.00 0.00 ? 192 GLU A OE1  4  
ATOM 7631  O OE2  . GLU A 1 114 ? -18.512 -5.128  -10.055 1.00 0.00 ? 192 GLU A OE2  4  
ATOM 7632  H H    . GLU A 1 114 ? -17.664 -10.344 -10.922 1.00 0.00 ? 192 GLU A H    4  
ATOM 7633  H HA   . GLU A 1 114 ? -19.496 -9.174  -12.911 1.00 0.00 ? 192 GLU A HA   4  
ATOM 7634  H HB2  . GLU A 1 114 ? -16.932 -8.106  -11.737 1.00 0.00 ? 192 GLU A HB2  4  
ATOM 7635  H HB3  . GLU A 1 114 ? -17.659 -7.437  -13.191 1.00 0.00 ? 192 GLU A HB3  4  
ATOM 7636  H HG2  . GLU A 1 114 ? -19.665 -6.866  -11.955 1.00 0.00 ? 192 GLU A HG2  4  
ATOM 7637  H HG3  . GLU A 1 114 ? -18.992 -7.591  -10.497 1.00 0.00 ? 192 GLU A HG3  4  
ATOM 7638  N N    . LEU A 1 115 ? -18.408 -10.654 -14.606 1.00 0.00 ? 193 LEU A N    4  
ATOM 7639  C CA   . LEU A 1 115 ? -17.779 -11.343 -15.727 1.00 0.00 ? 193 LEU A CA   4  
ATOM 7640  C C    . LEU A 1 115 ? -17.653 -10.419 -16.934 1.00 0.00 ? 193 LEU A C    4  
ATOM 7641  O O    . LEU A 1 115 ? -18.456 -9.503  -17.113 1.00 0.00 ? 193 LEU A O    4  
ATOM 7642  C CB   . LEU A 1 115 ? -18.586 -12.586 -16.105 1.00 0.00 ? 193 LEU A CB   4  
ATOM 7643  C CG   . LEU A 1 115 ? -18.466 -13.779 -15.156 1.00 0.00 ? 193 LEU A CG   4  
ATOM 7644  C CD1  . LEU A 1 115 ? -19.468 -14.861 -15.528 1.00 0.00 ? 193 LEU A CD1  4  
ATOM 7645  C CD2  . LEU A 1 115 ? -17.049 -14.333 -15.172 1.00 0.00 ? 193 LEU A CD2  4  
ATOM 7646  H H    . LEU A 1 115 ? -19.383 -10.681 -14.516 1.00 0.00 ? 193 LEU A H    4  
ATOM 7647  H HA   . LEU A 1 115 ? -16.790 -11.647 -15.417 1.00 0.00 ? 193 LEU A HA   4  
ATOM 7648  H HB2  . LEU A 1 115 ? -19.627 -12.304 -16.151 1.00 0.00 ? 193 LEU A HB2  4  
ATOM 7649  H HB3  . LEU A 1 115 ? -18.259 -12.907 -17.084 1.00 0.00 ? 193 LEU A HB3  4  
ATOM 7650  H HG   . LEU A 1 115 ? -18.687 -13.453 -14.149 1.00 0.00 ? 193 LEU A HG   4  
ATOM 7651  H HD11 . LEU A 1 115 ? -19.041 -15.832 -15.329 1.00 0.00 ? 193 LEU A HD11 4  
ATOM 7652  H HD12 . LEU A 1 115 ? -19.709 -14.782 -16.578 1.00 0.00 ? 193 LEU A HD12 4  
ATOM 7653  H HD13 . LEU A 1 115 ? -20.368 -14.735 -14.943 1.00 0.00 ? 193 LEU A HD13 4  
ATOM 7654  H HD21 . LEU A 1 115 ? -16.510 -13.917 -16.011 1.00 0.00 ? 193 LEU A HD21 4  
ATOM 7655  H HD22 . LEU A 1 115 ? -17.085 -15.409 -15.266 1.00 0.00 ? 193 LEU A HD22 4  
ATOM 7656  H HD23 . LEU A 1 115 ? -16.548 -14.068 -14.254 1.00 0.00 ? 193 LEU A HD23 4  
ATOM 7657  N N    . ASP A 1 116 ? -16.642 -10.666 -17.759 1.00 0.00 ? 194 ASP A N    4  
ATOM 7658  C CA   . ASP A 1 116 ? -16.413 -9.857  -18.951 1.00 0.00 ? 194 ASP A CA   4  
ATOM 7659  C C    . ASP A 1 116 ? -16.446 -10.721 -20.208 1.00 0.00 ? 194 ASP A C    4  
ATOM 7660  O O    . ASP A 1 116 ? -15.601 -11.596 -20.392 1.00 0.00 ? 194 ASP A O    4  
ATOM 7661  C CB   . ASP A 1 116 ? -15.070 -9.132  -18.851 1.00 0.00 ? 194 ASP A CB   4  
ATOM 7662  C CG   . ASP A 1 116 ? -14.897 -8.082  -19.931 1.00 0.00 ? 194 ASP A CG   4  
ATOM 7663  O OD1  . ASP A 1 116 ? -15.545 -7.019  -19.835 1.00 0.00 ? 194 ASP A OD1  4  
ATOM 7664  O OD2  . ASP A 1 116 ? -14.113 -8.324  -20.872 1.00 0.00 ? 194 ASP A OD2  4  
ATOM 7665  H H    . ASP A 1 116 ? -16.035 -11.410 -17.562 1.00 0.00 ? 194 ASP A H    4  
ATOM 7666  H HA   . ASP A 1 116 ? -17.203 -9.125  -19.012 1.00 0.00 ? 194 ASP A HA   4  
ATOM 7667  H HB2  . ASP A 1 116 ? -15.002 -8.645  -17.888 1.00 0.00 ? 194 ASP A HB2  4  
ATOM 7668  H HB3  . ASP A 1 116 ? -14.271 -9.853  -18.942 1.00 0.00 ? 194 ASP A HB3  4  
ATOM 7669  N N    . GLN A 1 117 ? -17.427 -10.468 -21.068 1.00 0.00 ? 195 GLN A N    4  
ATOM 7670  C CA   . GLN A 1 117 ? -17.571 -11.225 -22.306 1.00 0.00 ? 195 GLN A CA   4  
ATOM 7671  C C    . GLN A 1 117 ? -16.996 -10.449 -23.487 1.00 0.00 ? 195 GLN A C    4  
ATOM 7672  O O    . GLN A 1 117 ? -17.436 -9.339  -23.788 1.00 0.00 ? 195 GLN A O    4  
ATOM 7673  C CB   . GLN A 1 117 ? -19.043 -11.550 -22.562 1.00 0.00 ? 195 GLN A CB   4  
ATOM 7674  C CG   . GLN A 1 117 ? -19.258 -12.562 -23.676 1.00 0.00 ? 195 GLN A CG   4  
ATOM 7675  C CD   . GLN A 1 117 ? -20.529 -13.368 -23.494 1.00 0.00 ? 195 GLN A CD   4  
ATOM 7676  O OE1  . GLN A 1 117 ? -21.596 -12.815 -23.230 1.00 0.00 ? 195 GLN A OE1  4  
ATOM 7677  N NE2  . GLN A 1 117 ? -20.421 -14.684 -23.636 1.00 0.00 ? 195 GLN A NE2  4  
ATOM 7678  H H    . GLN A 1 117 ? -18.070 -9.758  -20.865 1.00 0.00 ? 195 GLN A H    4  
ATOM 7679  H HA   . GLN A 1 117 ? -17.022 -12.148 -22.196 1.00 0.00 ? 195 GLN A HA   4  
ATOM 7680  H HB2  . GLN A 1 117 ? -19.475 -11.946 -21.656 1.00 0.00 ? 195 GLN A HB2  4  
ATOM 7681  H HB3  . GLN A 1 117 ? -19.559 -10.639 -22.829 1.00 0.00 ? 195 GLN A HB3  4  
ATOM 7682  H HG2  . GLN A 1 117 ? -19.315 -12.036 -24.617 1.00 0.00 ? 195 GLN A HG2  4  
ATOM 7683  H HG3  . GLN A 1 117 ? -18.418 -13.241 -23.695 1.00 0.00 ? 195 GLN A HG3  4  
ATOM 7684  H HE21 . GLN A 1 117 ? -19.538 -15.056 -23.845 1.00 0.00 ? 195 GLN A HE21 4  
ATOM 7685  H HE22 . GLN A 1 117 ? -21.226 -15.230 -23.523 1.00 0.00 ? 195 GLN A HE22 4  
ATOM 7686  N N    . LEU A 1 118 ? -16.010 -11.041 -24.153 1.00 0.00 ? 196 LEU A N    4  
ATOM 7687  C CA   . LEU A 1 118 ? -15.374 -10.405 -25.302 1.00 0.00 ? 196 LEU A CA   4  
ATOM 7688  C C    . LEU A 1 118 ? -16.028 -10.855 -26.605 1.00 0.00 ? 196 LEU A C    4  
ATOM 7689  O O    . LEU A 1 118 ? -16.286 -12.043 -26.804 1.00 0.00 ? 196 LEU A O    4  
ATOM 7690  C CB   . LEU A 1 118 ? -13.880 -10.733 -25.329 1.00 0.00 ? 196 LEU A CB   4  
ATOM 7691  C CG   . LEU A 1 118 ? -13.510 -12.142 -25.792 1.00 0.00 ? 196 LEU A CG   4  
ATOM 7692  C CD1  . LEU A 1 118 ? -13.314 -12.175 -27.299 1.00 0.00 ? 196 LEU A CD1  4  
ATOM 7693  C CD2  . LEU A 1 118 ? -12.257 -12.626 -25.078 1.00 0.00 ? 196 LEU A CD2  4  
ATOM 7694  H H    . LEU A 1 118 ? -15.702 -11.925 -23.867 1.00 0.00 ? 196 LEU A H    4  
ATOM 7695  H HA   . LEU A 1 118 ? -15.499 -9.337  -25.201 1.00 0.00 ? 196 LEU A HA   4  
ATOM 7696  H HB2  . LEU A 1 118 ? -13.400 -10.030 -25.992 1.00 0.00 ? 196 LEU A HB2  4  
ATOM 7697  H HB3  . LEU A 1 118 ? -13.496 -10.600 -24.327 1.00 0.00 ? 196 LEU A HB3  4  
ATOM 7698  H HG   . LEU A 1 118 ? -14.318 -12.818 -25.546 1.00 0.00 ? 196 LEU A HG   4  
ATOM 7699  H HD11 . LEU A 1 118 ? -12.386 -11.685 -27.552 1.00 0.00 ? 196 LEU A HD11 4  
ATOM 7700  H HD12 . LEU A 1 118 ? -14.134 -11.663 -27.780 1.00 0.00 ? 196 LEU A HD12 4  
ATOM 7701  H HD13 . LEU A 1 118 ? -13.283 -13.201 -27.636 1.00 0.00 ? 196 LEU A HD13 4  
ATOM 7702  H HD21 . LEU A 1 118 ? -12.271 -12.284 -24.054 1.00 0.00 ? 196 LEU A HD21 4  
ATOM 7703  H HD22 . LEU A 1 118 ? -11.383 -12.231 -25.577 1.00 0.00 ? 196 LEU A HD22 4  
ATOM 7704  H HD23 . LEU A 1 118 ? -12.225 -13.705 -25.096 1.00 0.00 ? 196 LEU A HD23 4  
ATOM 7705  N N    . LEU A 1 119 ? -16.293 -9.899  -27.489 1.00 0.00 ? 197 LEU A N    4  
ATOM 7706  C CA   . LEU A 1 119 ? -16.915 -10.197 -28.774 1.00 0.00 ? 197 LEU A CA   4  
ATOM 7707  C C    . LEU A 1 119 ? -16.618 -9.099  -29.790 1.00 0.00 ? 197 LEU A C    4  
ATOM 7708  O O    . LEU A 1 119 ? -16.967 -7.937  -29.583 1.00 0.00 ? 197 LEU A O    4  
ATOM 7709  C CB   . LEU A 1 119 ? -18.427 -10.357 -28.606 1.00 0.00 ? 197 LEU A CB   4  
ATOM 7710  C CG   . LEU A 1 119 ? -19.248 -10.374 -29.896 1.00 0.00 ? 197 LEU A CG   4  
ATOM 7711  C CD1  . LEU A 1 119 ? -19.311 -11.780 -30.471 1.00 0.00 ? 197 LEU A CD1  4  
ATOM 7712  C CD2  . LEU A 1 119 ? -20.648 -9.835  -29.644 1.00 0.00 ? 197 LEU A CD2  4  
ATOM 7713  H H    . LEU A 1 119 ? -16.065 -8.972  -27.273 1.00 0.00 ? 197 LEU A H    4  
ATOM 7714  H HA   . LEU A 1 119 ? -16.501 -11.127 -29.135 1.00 0.00 ? 197 LEU A HA   4  
ATOM 7715  H HB2  . LEU A 1 119 ? -18.606 -11.288 -28.089 1.00 0.00 ? 197 LEU A HB2  4  
ATOM 7716  H HB3  . LEU A 1 119 ? -18.780 -9.536  -27.999 1.00 0.00 ? 197 LEU A HB3  4  
ATOM 7717  H HG   . LEU A 1 119 ? -18.770 -9.736  -30.628 1.00 0.00 ? 197 LEU A HG   4  
ATOM 7718  H HD11 . LEU A 1 119 ? -18.953 -11.770 -31.489 1.00 0.00 ? 197 LEU A HD11 4  
ATOM 7719  H HD12 . LEU A 1 119 ? -20.332 -12.132 -30.451 1.00 0.00 ? 197 LEU A HD12 4  
ATOM 7720  H HD13 . LEU A 1 119 ? -18.693 -12.439 -29.879 1.00 0.00 ? 197 LEU A HD13 4  
ATOM 7721  H HD21 . LEU A 1 119 ? -21.208 -10.549 -29.059 1.00 0.00 ? 197 LEU A HD21 4  
ATOM 7722  H HD22 . LEU A 1 119 ? -21.147 -9.675  -30.589 1.00 0.00 ? 197 LEU A HD22 4  
ATOM 7723  H HD23 . LEU A 1 119 ? -20.583 -8.901  -29.107 1.00 0.00 ? 197 LEU A HD23 4  
ATOM 7724  N N    . ALA A 1 120 ? -15.974 -9.476  -30.890 1.00 0.00 ? 198 ALA A N    4  
ATOM 7725  C CA   . ALA A 1 120 ? -15.634 -8.524  -31.940 1.00 0.00 ? 198 ALA A CA   4  
ATOM 7726  C C    . ALA A 1 120 ? -15.440 -9.229  -33.278 1.00 0.00 ? 198 ALA A C    4  
ATOM 7727  O O    . ALA A 1 120 ? -14.542 -10.057 -33.431 1.00 0.00 ? 198 ALA A O    4  
ATOM 7728  C CB   . ALA A 1 120 ? -14.380 -7.748  -31.564 1.00 0.00 ? 198 ALA A CB   4  
ATOM 7729  H H    . ALA A 1 120 ? -15.722 -10.416 -30.997 1.00 0.00 ? 198 ALA A H    4  
ATOM 7730  H HA   . ALA A 1 120 ? -16.449 -7.820  -32.029 1.00 0.00 ? 198 ALA A HA   4  
ATOM 7731  H HB1  . ALA A 1 120 ? -13.848 -7.469  -32.461 1.00 0.00 ? 198 ALA A HB1  4  
ATOM 7732  H HB2  . ALA A 1 120 ? -14.657 -6.859  -31.017 1.00 0.00 ? 198 ALA A HB2  4  
ATOM 7733  H HB3  . ALA A 1 120 ? -13.746 -8.367  -30.947 1.00 0.00 ? 198 ALA A HB3  4  
ATOM 7734  N N    . VAL A 1 121 ? -16.289 -8.896  -34.245 1.00 0.00 ? 199 VAL A N    4  
ATOM 7735  C CA   . VAL A 1 121 ? -16.211 -9.497  -35.571 1.00 0.00 ? 199 VAL A CA   4  
ATOM 7736  C C    . VAL A 1 121 ? -16.467 -8.461  -36.660 1.00 0.00 ? 199 VAL A C    4  
ATOM 7737  O O    . VAL A 1 121 ? -17.375 -7.637  -36.547 1.00 0.00 ? 199 VAL A O    4  
ATOM 7738  C CB   . VAL A 1 121 ? -17.222 -10.649 -35.726 1.00 0.00 ? 199 VAL A CB   4  
ATOM 7739  C CG1  . VAL A 1 121 ? -17.160 -11.229 -37.131 1.00 0.00 ? 199 VAL A CG1  4  
ATOM 7740  C CG2  . VAL A 1 121 ? -16.964 -11.726 -34.683 1.00 0.00 ? 199 VAL A CG2  4  
ATOM 7741  H H    . VAL A 1 121 ? -16.984 -8.229  -34.063 1.00 0.00 ? 199 VAL A H    4  
ATOM 7742  H HA   . VAL A 1 121 ? -15.216 -9.899  -35.698 1.00 0.00 ? 199 VAL A HA   4  
ATOM 7743  H HB   . VAL A 1 121 ? -18.214 -10.253 -35.567 1.00 0.00 ? 199 VAL A HB   4  
ATOM 7744  H HG11 . VAL A 1 121 ? -18.162 -11.339 -37.519 1.00 0.00 ? 199 VAL A HG11 4  
ATOM 7745  H HG12 . VAL A 1 121 ? -16.595 -10.566 -37.770 1.00 0.00 ? 199 VAL A HG12 4  
ATOM 7746  H HG13 . VAL A 1 121 ? -16.679 -12.195 -37.100 1.00 0.00 ? 199 VAL A HG13 4  
ATOM 7747  H HG21 . VAL A 1 121 ? -17.833 -12.363 -34.603 1.00 0.00 ? 199 VAL A HG21 4  
ATOM 7748  H HG22 . VAL A 1 121 ? -16.110 -12.318 -34.980 1.00 0.00 ? 199 VAL A HG22 4  
ATOM 7749  H HG23 . VAL A 1 121 ? -16.766 -11.263 -33.728 1.00 0.00 ? 199 VAL A HG23 4  
ATOM 7750  N N    . ALA A 1 122 ? -15.662 -8.509  -37.716 1.00 0.00 ? 200 ALA A N    4  
ATOM 7751  C CA   . ALA A 1 122 ? -15.803 -7.576  -38.828 1.00 0.00 ? 200 ALA A CA   4  
ATOM 7752  C C    . ALA A 1 122 ? -14.868 -7.944  -39.975 1.00 0.00 ? 200 ALA A C    4  
ATOM 7753  O O    . ALA A 1 122 ? -13.647 -7.933  -39.821 1.00 0.00 ? 200 ALA A O    4  
ATOM 7754  C CB   . ALA A 1 122 ? -15.533 -6.153  -38.360 1.00 0.00 ? 200 ALA A CB   4  
ATOM 7755  H H    . ALA A 1 122 ? -14.957 -9.188  -37.749 1.00 0.00 ? 200 ALA A H    4  
ATOM 7756  H HA   . ALA A 1 122 ? -16.824 -7.627  -39.178 1.00 0.00 ? 200 ALA A HA   4  
ATOM 7757  H HB1  . ALA A 1 122 ? -16.471 -5.630  -38.243 1.00 0.00 ? 200 ALA A HB1  4  
ATOM 7758  H HB2  . ALA A 1 122 ? -15.014 -6.178  -37.414 1.00 0.00 ? 200 ALA A HB2  4  
ATOM 7759  H HB3  . ALA A 1 122 ? -14.925 -5.643  -39.092 1.00 0.00 ? 200 ALA A HB3  4  
ATOM 7760  N N    . ASP A 1 123 ? -15.449 -8.270  -41.124 1.00 0.00 ? 201 ASP A N    4  
ATOM 7761  C CA   . ASP A 1 123 ? -14.668 -8.641  -42.298 1.00 0.00 ? 201 ASP A CA   4  
ATOM 7762  C C    . ASP A 1 123 ? -14.179 -7.401  -43.039 1.00 0.00 ? 201 ASP A C    4  
ATOM 7763  O O    . ASP A 1 123 ? -14.838 -6.914  -43.958 1.00 0.00 ? 201 ASP A O    4  
ATOM 7764  C CB   . ASP A 1 123 ? -15.501 -9.516  -43.236 1.00 0.00 ? 201 ASP A CB   4  
ATOM 7765  C CG   . ASP A 1 123 ? -14.648 -10.255 -44.248 1.00 0.00 ? 201 ASP A CG   4  
ATOM 7766  O OD1  . ASP A 1 123 ? -14.217 -9.623  -45.236 1.00 0.00 ? 201 ASP A OD1  4  
ATOM 7767  O OD2  . ASP A 1 123 ? -14.411 -11.465 -44.053 1.00 0.00 ? 201 ASP A OD2  4  
ATOM 7768  H H    . ASP A 1 123 ? -16.428 -8.260  -41.184 1.00 0.00 ? 201 ASP A H    4  
ATOM 7769  H HA   . ASP A 1 123 ? -13.811 -9.205  -41.961 1.00 0.00 ? 201 ASP A HA   4  
ATOM 7770  H HB2  . ASP A 1 123 ? -16.045 -10.244 -42.651 1.00 0.00 ? 201 ASP A HB2  4  
ATOM 7771  H HB3  . ASP A 1 123 ? -16.203 -8.892  -43.770 1.00 0.00 ? 201 ASP A HB3  4  
ATOM 7772  N N    . SER A 1 124 ? -13.019 -6.894  -42.633 1.00 0.00 ? 202 SER A N    4  
ATOM 7773  C CA   . SER A 1 124 ? -12.444 -5.707  -43.256 1.00 0.00 ? 202 SER A CA   4  
ATOM 7774  C C    . SER A 1 124 ? -11.046 -6.000  -43.794 1.00 0.00 ? 202 SER A C    4  
ATOM 7775  O O    . SER A 1 124 ? -10.258 -6.698  -43.158 1.00 0.00 ? 202 SER A O    4  
ATOM 7776  C CB   . SER A 1 124 ? -12.385 -4.556  -42.250 1.00 0.00 ? 202 SER A CB   4  
ATOM 7777  O OG   . SER A 1 124 ? -12.371 -3.302  -42.911 1.00 0.00 ? 202 SER A OG   4  
ATOM 7778  H H    . SER A 1 124 ? -12.540 -7.327  -41.895 1.00 0.00 ? 202 SER A H    4  
ATOM 7779  H HA   . SER A 1 124 ? -13.081 -5.423  -44.079 1.00 0.00 ? 202 SER A HA   4  
ATOM 7780  H HB2  . SER A 1 124 ? -13.249 -4.600  -41.605 1.00 0.00 ? 202 SER A HB2  4  
ATOM 7781  H HB3  . SER A 1 124 ? -11.487 -4.646  -41.655 1.00 0.00 ? 202 SER A HB3  4  
ATOM 7782  H HG   . SER A 1 124 ? -13.273 -3.014  -43.070 1.00 0.00 ? 202 SER A HG   4  
ATOM 7783  N N    . GLY A 1 125 ? -10.747 -5.458  -44.971 1.00 0.00 ? 203 GLY A N    4  
ATOM 7784  C CA   . GLY A 1 125 ? -9.445  -5.672  -45.576 1.00 0.00 ? 203 GLY A CA   4  
ATOM 7785  C C    . GLY A 1 125 ? -9.040  -4.537  -46.495 1.00 0.00 ? 203 GLY A C    4  
ATOM 7786  O O    . GLY A 1 125 ? -9.095  -4.651  -47.719 1.00 0.00 ? 203 GLY A O    4  
ATOM 7787  H H    . GLY A 1 125 ? -11.415 -4.910  -45.432 1.00 0.00 ? 203 GLY A H    4  
ATOM 7788  H HA2  . GLY A 1 125 ? -8.708  -5.768  -44.793 1.00 0.00 ? 203 GLY A HA2  4  
ATOM 7789  H HA3  . GLY A 1 125 ? -9.472  -6.589  -46.146 1.00 0.00 ? 203 GLY A HA3  4  
ATOM 7790  N N    . PRO A 1 126 ? -8.622  -3.409  -45.900 1.00 0.00 ? 204 PRO A N    4  
ATOM 7791  C CA   . PRO A 1 126 ? -8.199  -2.226  -46.655 1.00 0.00 ? 204 PRO A CA   4  
ATOM 7792  C C    . PRO A 1 126 ? -6.879  -2.446  -47.385 1.00 0.00 ? 204 PRO A C    4  
ATOM 7793  O O    . PRO A 1 126 ? -6.154  -3.400  -47.103 1.00 0.00 ? 204 PRO A O    4  
ATOM 7794  C CB   . PRO A 1 126 ? -8.040  -1.153  -45.575 1.00 0.00 ? 204 PRO A CB   4  
ATOM 7795  C CG   . PRO A 1 126 ? -7.765  -1.914  -44.324 1.00 0.00 ? 204 PRO A CG   4  
ATOM 7796  C CD   . PRO A 1 126 ? -8.531  -3.202  -44.445 1.00 0.00 ? 204 PRO A CD   4  
ATOM 7797  H HA   . PRO A 1 126 ? -8.954  -1.917  -47.364 1.00 0.00 ? 204 PRO A HA   4  
ATOM 7798  H HB2  . PRO A 1 126 ? -7.218  -0.500  -45.830 1.00 0.00 ? 204 PRO A HB2  4  
ATOM 7799  H HB3  . PRO A 1 126 ? -8.952  -0.580  -45.495 1.00 0.00 ? 204 PRO A HB3  4  
ATOM 7800  H HG2  . PRO A 1 126 ? -6.707  -2.113  -44.240 1.00 0.00 ? 204 PRO A HG2  4  
ATOM 7801  H HG3  . PRO A 1 126 ? -8.111  -1.352  -43.469 1.00 0.00 ? 204 PRO A HG3  4  
ATOM 7802  H HD2  . PRO A 1 126 ? -7.989  -4.009  -43.974 1.00 0.00 ? 204 PRO A HD2  4  
ATOM 7803  H HD3  . PRO A 1 126 ? -9.513  -3.100  -44.008 1.00 0.00 ? 204 PRO A HD3  4  
ATOM 7804  N N    . SER A 1 127 ? -6.572  -1.557  -48.325 1.00 0.00 ? 205 SER A N    4  
ATOM 7805  C CA   . SER A 1 127 ? -5.339  -1.657  -49.098 1.00 0.00 ? 205 SER A CA   4  
ATOM 7806  C C    . SER A 1 127 ? -4.978  -0.311  -49.720 1.00 0.00 ? 205 SER A C    4  
ATOM 7807  O O    . SER A 1 127 ? -5.658  0.169   -50.626 1.00 0.00 ? 205 SER A O    4  
ATOM 7808  C CB   . SER A 1 127 ? -5.484  -2.715  -50.193 1.00 0.00 ? 205 SER A CB   4  
ATOM 7809  O OG   . SER A 1 127 ? -5.121  -3.998  -49.714 1.00 0.00 ? 205 SER A OG   4  
ATOM 7810  H H    . SER A 1 127 ? -7.191  -0.819  -48.504 1.00 0.00 ? 205 SER A H    4  
ATOM 7811  H HA   . SER A 1 127 ? -4.549  -1.953  -48.425 1.00 0.00 ? 205 SER A HA   4  
ATOM 7812  H HB2  . SER A 1 127 ? -6.509  -2.746  -50.528 1.00 0.00 ? 205 SER A HB2  4  
ATOM 7813  H HB3  . SER A 1 127 ? -4.841  -2.459  -51.024 1.00 0.00 ? 205 SER A HB3  4  
ATOM 7814  H HG   . SER A 1 127 ? -5.713  -4.254  -49.003 1.00 0.00 ? 205 SER A HG   4  
ATOM 7815  N N    . SER A 1 128 ? -3.902  0.292   -49.225 1.00 0.00 ? 206 SER A N    4  
ATOM 7816  C CA   . SER A 1 128 ? -3.451  1.585   -49.728 1.00 0.00 ? 206 SER A CA   4  
ATOM 7817  C C    . SER A 1 128 ? -2.420  1.406   -50.838 1.00 0.00 ? 206 SER A C    4  
ATOM 7818  O O    . SER A 1 128 ? -1.215  1.415   -50.589 1.00 0.00 ? 206 SER A O    4  
ATOM 7819  C CB   . SER A 1 128 ? -2.855  2.418   -48.592 1.00 0.00 ? 206 SER A CB   4  
ATOM 7820  O OG   . SER A 1 128 ? -3.788  2.587   -47.539 1.00 0.00 ? 206 SER A OG   4  
ATOM 7821  H H    . SER A 1 128 ? -3.401  -0.141  -48.502 1.00 0.00 ? 206 SER A H    4  
ATOM 7822  H HA   . SER A 1 128 ? -4.310  2.102   -50.130 1.00 0.00 ? 206 SER A HA   4  
ATOM 7823  H HB2  . SER A 1 128 ? -1.980  1.919   -48.204 1.00 0.00 ? 206 SER A HB2  4  
ATOM 7824  H HB3  . SER A 1 128 ? -2.577  3.391   -48.971 1.00 0.00 ? 206 SER A HB3  4  
ATOM 7825  H HG   . SER A 1 128 ? -3.339  2.934   -46.765 1.00 0.00 ? 206 SER A HG   4  
ATOM 7826  N N    . GLY A 1 129 ? -2.904  1.242   -52.066 1.00 0.00 ? 207 GLY A N    4  
ATOM 7827  C CA   . GLY A 1 129 ? -2.012  1.063   -53.197 1.00 0.00 ? 207 GLY A CA   4  
ATOM 7828  C C    . GLY A 1 129 ? -2.701  1.310   -54.524 1.00 0.00 ? 207 GLY A C    4  
ATOM 7829  O O    . GLY A 1 129 ? -2.847  2.454   -54.952 1.00 0.00 ? 207 GLY A O    4  
ATOM 7830  H H    . GLY A 1 129 ? -3.874  1.244   -52.205 1.00 0.00 ? 207 GLY A H    4  
ATOM 7831  H HA2  . GLY A 1 129 ? -1.184  1.749   -53.100 1.00 0.00 ? 207 GLY A HA2  4  
ATOM 7832  H HA3  . GLY A 1 129 ? -1.632  0.052   -53.184 1.00 0.00 ? 207 GLY A HA3  4  
ATOM 7833  N N    . GLY A 1 1   ? 12.855  -8.124  -7.481  1.00 0.00 ? 79  GLY A N    5  
ATOM 7834  C CA   . GLY A 1 1   ? 13.838  -7.209  -8.032  1.00 0.00 ? 79  GLY A CA   5  
ATOM 7835  C C    . GLY A 1 1   ? 15.110  -7.914  -8.461  1.00 0.00 ? 79  GLY A C    5  
ATOM 7836  O O    . GLY A 1 1   ? 15.297  -8.206  -9.642  1.00 0.00 ? 79  GLY A O    5  
ATOM 7837  H H1   . GLY A 1 1   ? 12.287  -7.839  -6.735  1.00 0.00 ? 79  GLY A H1   5  
ATOM 7838  H HA2  . GLY A 1 1   ? 13.409  -6.710  -8.887  1.00 0.00 ? 79  GLY A HA2  5  
ATOM 7839  H HA3  . GLY A 1 1   ? 14.085  -6.471  -7.283  1.00 0.00 ? 79  GLY A HA3  5  
ATOM 7840  N N    . SER A 1 2   ? 15.987  -8.186  -7.500  1.00 0.00 ? 80  SER A N    5  
ATOM 7841  C CA   . SER A 1 2   ? 17.250  -8.855  -7.785  1.00 0.00 ? 80  SER A CA   5  
ATOM 7842  C C    . SER A 1 2   ? 17.112  -10.366 -7.627  1.00 0.00 ? 80  SER A C    5  
ATOM 7843  O O    . SER A 1 2   ? 16.972  -10.875 -6.515  1.00 0.00 ? 80  SER A O    5  
ATOM 7844  C CB   . SER A 1 2   ? 18.350  -8.333  -6.859  1.00 0.00 ? 80  SER A CB   5  
ATOM 7845  O OG   . SER A 1 2   ? 18.582  -6.951  -7.071  1.00 0.00 ? 80  SER A OG   5  
ATOM 7846  H H    . SER A 1 2   ? 15.780  -7.927  -6.577  1.00 0.00 ? 80  SER A H    5  
ATOM 7847  H HA   . SER A 1 2   ? 17.519  -8.635  -8.808  1.00 0.00 ? 80  SER A HA   5  
ATOM 7848  H HB2  . SER A 1 2   ? 18.052  -8.482  -5.832  1.00 0.00 ? 80  SER A HB2  5  
ATOM 7849  H HB3  . SER A 1 2   ? 19.265  -8.873  -7.050  1.00 0.00 ? 80  SER A HB3  5  
ATOM 7850  H HG   . SER A 1 2   ? 17.799  -6.453  -6.824  1.00 0.00 ? 80  SER A HG   5  
ATOM 7851  N N    . SER A 1 3   ? 17.153  -11.079 -8.749  1.00 0.00 ? 81  SER A N    5  
ATOM 7852  C CA   . SER A 1 3   ? 17.028  -12.531 -8.737  1.00 0.00 ? 81  SER A CA   5  
ATOM 7853  C C    . SER A 1 3   ? 18.263  -13.177 -8.117  1.00 0.00 ? 81  SER A C    5  
ATOM 7854  O O    . SER A 1 3   ? 19.364  -13.087 -8.660  1.00 0.00 ? 81  SER A O    5  
ATOM 7855  C CB   . SER A 1 3   ? 16.822  -13.059 -10.158 1.00 0.00 ? 81  SER A CB   5  
ATOM 7856  O OG   . SER A 1 3   ? 18.015  -12.961 -10.917 1.00 0.00 ? 81  SER A OG   5  
ATOM 7857  H H    . SER A 1 3   ? 17.266  -10.615 -9.605  1.00 0.00 ? 81  SER A H    5  
ATOM 7858  H HA   . SER A 1 3   ? 16.165  -12.785 -8.139  1.00 0.00 ? 81  SER A HA   5  
ATOM 7859  H HB2  . SER A 1 3   ? 16.520  -14.094 -10.115 1.00 0.00 ? 81  SER A HB2  5  
ATOM 7860  H HB3  . SER A 1 3   ? 16.051  -12.479 -10.646 1.00 0.00 ? 81  SER A HB3  5  
ATOM 7861  H HG   . SER A 1 3   ? 18.601  -13.686 -10.686 1.00 0.00 ? 81  SER A HG   5  
ATOM 7862  N N    . GLY A 1 4   ? 18.072  -13.830 -6.975  1.00 0.00 ? 82  GLY A N    5  
ATOM 7863  C CA   . GLY A 1 4   ? 19.178  -14.482 -6.299  1.00 0.00 ? 82  GLY A CA   5  
ATOM 7864  C C    . GLY A 1 4   ? 18.716  -15.415 -5.197  1.00 0.00 ? 82  GLY A C    5  
ATOM 7865  O O    . GLY A 1 4   ? 18.042  -16.411 -5.460  1.00 0.00 ? 82  GLY A O    5  
ATOM 7866  H H    . GLY A 1 4   ? 17.172  -13.870 -6.588  1.00 0.00 ? 82  GLY A H    5  
ATOM 7867  H HA2  . GLY A 1 4   ? 19.745  -15.049 -7.022  1.00 0.00 ? 82  GLY A HA2  5  
ATOM 7868  H HA3  . GLY A 1 4   ? 19.818  -13.726 -5.868  1.00 0.00 ? 82  GLY A HA3  5  
ATOM 7869  N N    . SER A 1 5   ? 19.080  -15.094 -3.960  1.00 0.00 ? 83  SER A N    5  
ATOM 7870  C CA   . SER A 1 5   ? 18.703  -15.914 -2.815  1.00 0.00 ? 83  SER A CA   5  
ATOM 7871  C C    . SER A 1 5   ? 17.193  -16.128 -2.773  1.00 0.00 ? 83  SER A C    5  
ATOM 7872  O O    . SER A 1 5   ? 16.443  -15.253 -2.339  1.00 0.00 ? 83  SER A O    5  
ATOM 7873  C CB   . SER A 1 5   ? 19.172  -15.259 -1.514  1.00 0.00 ? 83  SER A CB   5  
ATOM 7874  O OG   . SER A 1 5   ? 18.472  -14.051 -1.270  1.00 0.00 ? 83  SER A OG   5  
ATOM 7875  H H    . SER A 1 5   ? 19.617  -14.287 -3.814  1.00 0.00 ? 83  SER A H    5  
ATOM 7876  H HA   . SER A 1 5   ? 19.187  -16.873 -2.920  1.00 0.00 ? 83  SER A HA   5  
ATOM 7877  H HB2  . SER A 1 5   ? 18.999  -15.934 -0.691  1.00 0.00 ? 83  SER A HB2  5  
ATOM 7878  H HB3  . SER A 1 5   ? 20.228  -15.041 -1.585  1.00 0.00 ? 83  SER A HB3  5  
ATOM 7879  H HG   . SER A 1 5   ? 19.047  -13.435 -0.810  1.00 0.00 ? 83  SER A HG   5  
ATOM 7880  N N    . SER A 1 6   ? 16.754  -17.297 -3.229  1.00 0.00 ? 84  SER A N    5  
ATOM 7881  C CA   . SER A 1 6   ? 15.333  -17.625 -3.248  1.00 0.00 ? 84  SER A CA   5  
ATOM 7882  C C    . SER A 1 6   ? 15.098  -19.049 -2.752  1.00 0.00 ? 84  SER A C    5  
ATOM 7883  O O    . SER A 1 6   ? 15.640  -20.007 -3.301  1.00 0.00 ? 84  SER A O    5  
ATOM 7884  C CB   . SER A 1 6   ? 14.771  -17.466 -4.662  1.00 0.00 ? 84  SER A CB   5  
ATOM 7885  O OG   . SER A 1 6   ? 13.360  -17.595 -4.667  1.00 0.00 ? 84  SER A OG   5  
ATOM 7886  H H    . SER A 1 6   ? 17.401  -17.953 -3.562  1.00 0.00 ? 84  SER A H    5  
ATOM 7887  H HA   . SER A 1 6   ? 14.825  -16.938 -2.588  1.00 0.00 ? 84  SER A HA   5  
ATOM 7888  H HB2  . SER A 1 6   ? 15.032  -16.491 -5.043  1.00 0.00 ? 84  SER A HB2  5  
ATOM 7889  H HB3  . SER A 1 6   ? 15.192  -18.228 -5.302  1.00 0.00 ? 84  SER A HB3  5  
ATOM 7890  H HG   . SER A 1 6   ? 13.097  -18.264 -4.030  1.00 0.00 ? 84  SER A HG   5  
ATOM 7891  N N    . GLY A 1 7   ? 14.285  -19.178 -1.708  1.00 0.00 ? 85  GLY A N    5  
ATOM 7892  C CA   . GLY A 1 7   ? 13.992  -20.487 -1.154  1.00 0.00 ? 85  GLY A CA   5  
ATOM 7893  C C    . GLY A 1 7   ? 14.818  -20.793 0.080   1.00 0.00 ? 85  GLY A C    5  
ATOM 7894  O O    . GLY A 1 7   ? 14.325  -21.401 1.030   1.00 0.00 ? 85  GLY A O    5  
ATOM 7895  H H    . GLY A 1 7   ? 13.881  -18.378 -1.310  1.00 0.00 ? 85  GLY A H    5  
ATOM 7896  H HA2  . GLY A 1 7   ? 12.945  -20.529 -0.893  1.00 0.00 ? 85  GLY A HA2  5  
ATOM 7897  H HA3  . GLY A 1 7   ? 14.196  -21.237 -1.904  1.00 0.00 ? 85  GLY A HA3  5  
ATOM 7898  N N    . ARG A 1 8   ? 16.078  -20.372 0.066   1.00 0.00 ? 86  ARG A N    5  
ATOM 7899  C CA   . ARG A 1 8   ? 16.975  -20.607 1.191   1.00 0.00 ? 86  ARG A CA   5  
ATOM 7900  C C    . ARG A 1 8   ? 16.410  -20.002 2.472   1.00 0.00 ? 86  ARG A C    5  
ATOM 7901  O O    . ARG A 1 8   ? 15.410  -19.284 2.445   1.00 0.00 ? 86  ARG A O    5  
ATOM 7902  C CB   . ARG A 1 8   ? 18.356  -20.017 0.901   1.00 0.00 ? 86  ARG A CB   5  
ATOM 7903  C CG   . ARG A 1 8   ? 19.092  -20.715 -0.231  1.00 0.00 ? 86  ARG A CG   5  
ATOM 7904  C CD   . ARG A 1 8   ? 20.482  -20.132 -0.435  1.00 0.00 ? 86  ARG A CD   5  
ATOM 7905  N NE   . ARG A 1 8   ? 21.326  -20.303 0.744   1.00 0.00 ? 86  ARG A NE   5  
ATOM 7906  C CZ   . ARG A 1 8   ? 22.612  -19.972 0.782   1.00 0.00 ? 86  ARG A CZ   5  
ATOM 7907  N NH1  . ARG A 1 8   ? 23.198  -19.455 -0.289  1.00 0.00 ? 86  ARG A NH1  5  
ATOM 7908  N NH2  . ARG A 1 8   ? 23.314  -20.159 1.892   1.00 0.00 ? 86  ARG A NH2  5  
ATOM 7909  H H    . ARG A 1 8   ? 16.413  -19.892 -0.721  1.00 0.00 ? 86  ARG A H    5  
ATOM 7910  H HA   . ARG A 1 8   ? 17.070  -21.674 1.322   1.00 0.00 ? 86  ARG A HA   5  
ATOM 7911  H HB2  . ARG A 1 8   ? 18.242  -18.975 0.638   1.00 0.00 ? 86  ARG A HB2  5  
ATOM 7912  H HB3  . ARG A 1 8   ? 18.960  -20.090 1.793   1.00 0.00 ? 86  ARG A HB3  5  
ATOM 7913  H HG2  . ARG A 1 8   ? 19.186  -21.765 0.007   1.00 0.00 ? 86  ARG A HG2  5  
ATOM 7914  H HG3  . ARG A 1 8   ? 18.524  -20.599 -1.142  1.00 0.00 ? 86  ARG A HG3  5  
ATOM 7915  H HD2  . ARG A 1 8   ? 20.946  -20.629 -1.274  1.00 0.00 ? 86  ARG A HD2  5  
ATOM 7916  H HD3  . ARG A 1 8   ? 20.387  -19.078 -0.649  1.00 0.00 ? 86  ARG A HD3  5  
ATOM 7917  H HE   . ARG A 1 8   ? 20.913  -20.684 1.547   1.00 0.00 ? 86  ARG A HE   5  
ATOM 7918  H HH11 . ARG A 1 8   ? 22.671  -19.313 -1.127  1.00 0.00 ? 86  ARG A HH11 5  
ATOM 7919  H HH12 . ARG A 1 8   ? 24.166  -19.205 -0.258  1.00 0.00 ? 86  ARG A HH12 5  
ATOM 7920  H HH21 . ARG A 1 8   ? 22.876  -20.548 2.701   1.00 0.00 ? 86  ARG A HH21 5  
ATOM 7921  H HH22 . ARG A 1 8   ? 24.282  -19.909 1.919   1.00 0.00 ? 86  ARG A HH22 5  
ATOM 7922  N N    . LYS A 1 9   ? 17.056  -20.297 3.595   1.00 0.00 ? 87  LYS A N    5  
ATOM 7923  C CA   . LYS A 1 9   ? 16.620  -19.782 4.887   1.00 0.00 ? 87  LYS A CA   5  
ATOM 7924  C C    . LYS A 1 9   ? 16.452  -18.267 4.841   1.00 0.00 ? 87  LYS A C    5  
ATOM 7925  O O    . LYS A 1 9   ? 15.440  -17.732 5.292   1.00 0.00 ? 87  LYS A O    5  
ATOM 7926  C CB   . LYS A 1 9   ? 17.626  -20.162 5.977   1.00 0.00 ? 87  LYS A CB   5  
ATOM 7927  C CG   . LYS A 1 9   ? 17.017  -20.242 7.366   1.00 0.00 ? 87  LYS A CG   5  
ATOM 7928  C CD   . LYS A 1 9   ? 18.084  -20.192 8.446   1.00 0.00 ? 87  LYS A CD   5  
ATOM 7929  C CE   . LYS A 1 9   ? 18.803  -21.526 8.581   1.00 0.00 ? 87  LYS A CE   5  
ATOM 7930  N NZ   . LYS A 1 9   ? 17.898  -22.594 9.089   1.00 0.00 ? 87  LYS A NZ   5  
ATOM 7931  H H    . LYS A 1 9   ? 17.847  -20.875 3.553   1.00 0.00 ? 87  LYS A H    5  
ATOM 7932  H HA   . LYS A 1 9   ? 15.666  -20.231 5.118   1.00 0.00 ? 87  LYS A HA   5  
ATOM 7933  H HB2  . LYS A 1 9   ? 18.051  -21.125 5.737   1.00 0.00 ? 87  LYS A HB2  5  
ATOM 7934  H HB3  . LYS A 1 9   ? 18.415  -19.424 5.994   1.00 0.00 ? 87  LYS A HB3  5  
ATOM 7935  H HG2  . LYS A 1 9   ? 16.343  -19.409 7.502   1.00 0.00 ? 87  LYS A HG2  5  
ATOM 7936  H HG3  . LYS A 1 9   ? 16.469  -21.169 7.456   1.00 0.00 ? 87  LYS A HG3  5  
ATOM 7937  H HD2  . LYS A 1 9   ? 18.807  -19.431 8.192   1.00 0.00 ? 87  LYS A HD2  5  
ATOM 7938  H HD3  . LYS A 1 9   ? 17.618  -19.947 9.390   1.00 0.00 ? 87  LYS A HD3  5  
ATOM 7939  H HE2  . LYS A 1 9   ? 19.181  -21.816 7.613   1.00 0.00 ? 87  LYS A HE2  5  
ATOM 7940  H HE3  . LYS A 1 9   ? 19.628  -21.407 9.268   1.00 0.00 ? 87  LYS A HE3  5  
ATOM 7941  H HZ1  . LYS A 1 9   ? 17.242  -22.893 8.339   1.00 0.00 ? 87  LYS A HZ1  5  
ATOM 7942  H HZ2  . LYS A 1 9   ? 17.346  -22.241 9.896   1.00 0.00 ? 87  LYS A HZ2  5  
ATOM 7943  H HZ3  . LYS A 1 9   ? 18.454  -23.418 9.396   1.00 0.00 ? 87  LYS A HZ3  5  
ATOM 7944  N N    . GLU A 1 10  ? 17.451  -17.582 4.292   1.00 0.00 ? 88  GLU A N    5  
ATOM 7945  C CA   . GLU A 1 10  ? 17.412  -16.128 4.188   1.00 0.00 ? 88  GLU A CA   5  
ATOM 7946  C C    . GLU A 1 10  ? 16.005  -15.645 3.846   1.00 0.00 ? 88  GLU A C    5  
ATOM 7947  O O    . GLU A 1 10  ? 15.471  -14.746 4.496   1.00 0.00 ? 88  GLU A O    5  
ATOM 7948  C CB   . GLU A 1 10  ? 18.401  -15.645 3.125   1.00 0.00 ? 88  GLU A CB   5  
ATOM 7949  C CG   . GLU A 1 10  ? 19.839  -16.048 3.404   1.00 0.00 ? 88  GLU A CG   5  
ATOM 7950  C CD   . GLU A 1 10  ? 20.752  -15.814 2.216   1.00 0.00 ? 88  GLU A CD   5  
ATOM 7951  O OE1  . GLU A 1 10  ? 20.569  -14.793 1.520   1.00 0.00 ? 88  GLU A OE1  5  
ATOM 7952  O OE2  . GLU A 1 10  ? 21.647  -16.652 1.981   1.00 0.00 ? 88  GLU A OE2  5  
ATOM 7953  H H    . GLU A 1 10  ? 18.231  -18.066 3.951   1.00 0.00 ? 88  GLU A H    5  
ATOM 7954  H HA   . GLU A 1 10  ? 17.697  -15.719 5.145   1.00 0.00 ? 88  GLU A HA   5  
ATOM 7955  H HB2  . GLU A 1 10  ? 18.113  -16.055 2.168   1.00 0.00 ? 88  GLU A HB2  5  
ATOM 7956  H HB3  . GLU A 1 10  ? 18.355  -14.567 3.072   1.00 0.00 ? 88  GLU A HB3  5  
ATOM 7957  H HG2  . GLU A 1 10  ? 20.206  -15.469 4.239   1.00 0.00 ? 88  GLU A HG2  5  
ATOM 7958  H HG3  . GLU A 1 10  ? 19.863  -17.097 3.657   1.00 0.00 ? 88  GLU A HG3  5  
ATOM 7959  N N    . ASP A 1 11  ? 15.412  -16.247 2.822   1.00 0.00 ? 89  ASP A N    5  
ATOM 7960  C CA   . ASP A 1 11  ? 14.067  -15.879 2.393   1.00 0.00 ? 89  ASP A CA   5  
ATOM 7961  C C    . ASP A 1 11  ? 13.175  -15.583 3.595   1.00 0.00 ? 89  ASP A C    5  
ATOM 7962  O O    . ASP A 1 11  ? 12.530  -14.537 3.659   1.00 0.00 ? 89  ASP A O    5  
ATOM 7963  C CB   . ASP A 1 11  ? 13.453  -16.999 1.551   1.00 0.00 ? 89  ASP A CB   5  
ATOM 7964  C CG   . ASP A 1 11  ? 12.460  -16.477 0.530   1.00 0.00 ? 89  ASP A CG   5  
ATOM 7965  O OD1  . ASP A 1 11  ? 12.639  -15.335 0.058   1.00 0.00 ? 89  ASP A OD1  5  
ATOM 7966  O OD2  . ASP A 1 11  ? 11.505  -17.212 0.204   1.00 0.00 ? 89  ASP A OD2  5  
ATOM 7967  H H    . ASP A 1 11  ? 15.889  -16.957 2.342   1.00 0.00 ? 89  ASP A H    5  
ATOM 7968  H HA   . ASP A 1 11  ? 14.144  -14.988 1.789   1.00 0.00 ? 89  ASP A HA   5  
ATOM 7969  H HB2  . ASP A 1 11  ? 14.241  -17.519 1.025   1.00 0.00 ? 89  ASP A HB2  5  
ATOM 7970  H HB3  . ASP A 1 11  ? 12.942  -17.692 2.202   1.00 0.00 ? 89  ASP A HB3  5  
ATOM 7971  N N    . HIS A 1 12  ? 13.144  -16.512 4.545   1.00 0.00 ? 90  HIS A N    5  
ATOM 7972  C CA   . HIS A 1 12  ? 12.331  -16.351 5.745   1.00 0.00 ? 90  HIS A CA   5  
ATOM 7973  C C    . HIS A 1 12  ? 12.824  -15.173 6.581   1.00 0.00 ? 90  HIS A C    5  
ATOM 7974  O O    . HIS A 1 12  ? 12.029  -14.451 7.183   1.00 0.00 ? 90  HIS A O    5  
ATOM 7975  C CB   . HIS A 1 12  ? 12.358  -17.631 6.581   1.00 0.00 ? 90  HIS A CB   5  
ATOM 7976  C CG   . HIS A 1 12  ? 11.726  -18.805 5.898   1.00 0.00 ? 90  HIS A CG   5  
ATOM 7977  N ND1  . HIS A 1 12  ? 12.318  -20.049 5.840   1.00 0.00 ? 90  HIS A ND1  5  
ATOM 7978  C CD2  . HIS A 1 12  ? 10.547  -18.920 5.245   1.00 0.00 ? 90  HIS A CD2  5  
ATOM 7979  C CE1  . HIS A 1 12  ? 11.531  -20.878 5.178   1.00 0.00 ? 90  HIS A CE1  5  
ATOM 7980  N NE2  . HIS A 1 12  ? 10.449  -20.218 4.806   1.00 0.00 ? 90  HIS A NE2  5  
ATOM 7981  H H    . HIS A 1 12  ? 13.680  -17.325 4.437   1.00 0.00 ? 90  HIS A H    5  
ATOM 7982  H HA   . HIS A 1 12  ? 11.316  -16.156 5.434   1.00 0.00 ? 90  HIS A HA   5  
ATOM 7983  H HB2  . HIS A 1 12  ? 13.383  -17.888 6.801   1.00 0.00 ? 90  HIS A HB2  5  
ATOM 7984  H HB3  . HIS A 1 12  ? 11.828  -17.460 7.507   1.00 0.00 ? 90  HIS A HB3  5  
ATOM 7985  H HD2  . HIS A 1 12  ? 9.817   -18.137 5.095   1.00 0.00 ? 90  HIS A HD2  5  
ATOM 7986  H HE1  . HIS A 1 12  ? 11.735  -21.919 4.975   1.00 0.00 ? 90  HIS A HE1  5  
ATOM 7987  H HE2  . HIS A 1 12  ? 9.742   -20.572 4.228   1.00 0.00 ? 90  HIS A HE2  5  
ATOM 7988  N N    . ALA A 1 13  ? 14.139  -14.987 6.614   1.00 0.00 ? 91  ALA A N    5  
ATOM 7989  C CA   . ALA A 1 13  ? 14.737  -13.896 7.375   1.00 0.00 ? 91  ALA A CA   5  
ATOM 7990  C C    . ALA A 1 13  ? 14.288  -12.542 6.838   1.00 0.00 ? 91  ALA A C    5  
ATOM 7991  O O    . ALA A 1 13  ? 13.884  -11.664 7.601   1.00 0.00 ? 91  ALA A O    5  
ATOM 7992  C CB   . ALA A 1 13  ? 16.254  -14.002 7.344   1.00 0.00 ? 91  ALA A CB   5  
ATOM 7993  H H    . ALA A 1 13  ? 14.721  -15.596 6.114   1.00 0.00 ? 91  ALA A H    5  
ATOM 7994  H HA   . ALA A 1 13  ? 14.415  -13.990 8.402   1.00 0.00 ? 91  ALA A HA   5  
ATOM 7995  H HB1  . ALA A 1 13  ? 16.581  -14.185 6.331   1.00 0.00 ? 91  ALA A HB1  5  
ATOM 7996  H HB2  . ALA A 1 13  ? 16.687  -13.079 7.701   1.00 0.00 ? 91  ALA A HB2  5  
ATOM 7997  H HB3  . ALA A 1 13  ? 16.571  -14.817 7.978   1.00 0.00 ? 91  ALA A HB3  5  
ATOM 7998  N N    . ARG A 1 14  ? 14.362  -12.378 5.521   1.00 0.00 ? 92  ARG A N    5  
ATOM 7999  C CA   . ARG A 1 14  ? 13.965  -11.129 4.883   1.00 0.00 ? 92  ARG A CA   5  
ATOM 8000  C C    . ARG A 1 14  ? 12.452  -10.943 4.946   1.00 0.00 ? 92  ARG A C    5  
ATOM 8001  O O    . ARG A 1 14  ? 11.958  -9.821  5.071   1.00 0.00 ? 92  ARG A O    5  
ATOM 8002  C CB   . ARG A 1 14  ? 14.432  -11.105 3.426   1.00 0.00 ? 92  ARG A CB   5  
ATOM 8003  C CG   . ARG A 1 14  ? 14.680  -9.705  2.889   1.00 0.00 ? 92  ARG A CG   5  
ATOM 8004  C CD   . ARG A 1 14  ? 15.912  -9.076  3.521   1.00 0.00 ? 92  ARG A CD   5  
ATOM 8005  N NE   . ARG A 1 14  ? 17.138  -9.458  2.825   1.00 0.00 ? 92  ARG A NE   5  
ATOM 8006  C CZ   . ARG A 1 14  ? 17.855  -10.532 3.136   1.00 0.00 ? 92  ARG A CZ   5  
ATOM 8007  N NH1  . ARG A 1 14  ? 17.469  -11.328 4.124   1.00 0.00 ? 92  ARG A NH1  5  
ATOM 8008  N NH2  . ARG A 1 14  ? 18.959  -10.813 2.456   1.00 0.00 ? 92  ARG A NH2  5  
ATOM 8009  H H    . ARG A 1 14  ? 14.692  -13.115 4.965   1.00 0.00 ? 92  ARG A H    5  
ATOM 8010  H HA   . ARG A 1 14  ? 14.438  -10.318 5.417   1.00 0.00 ? 92  ARG A HA   5  
ATOM 8011  H HB2  . ARG A 1 14  ? 15.352  -11.665 3.346   1.00 0.00 ? 92  ARG A HB2  5  
ATOM 8012  H HB3  . ARG A 1 14  ? 13.678  -11.574 2.812   1.00 0.00 ? 92  ARG A HB3  5  
ATOM 8013  H HG2  . ARG A 1 14  ? 14.825  -9.759  1.820   1.00 0.00 ? 92  ARG A HG2  5  
ATOM 8014  H HG3  . ARG A 1 14  ? 13.820  -9.088  3.107   1.00 0.00 ? 92  ARG A HG3  5  
ATOM 8015  H HD2  . ARG A 1 14  ? 15.810  -8.002  3.486   1.00 0.00 ? 92  ARG A HD2  5  
ATOM 8016  H HD3  . ARG A 1 14  ? 15.977  -9.398  4.549   1.00 0.00 ? 92  ARG A HD3  5  
ATOM 8017  H HE   . ARG A 1 14  ? 17.442  -8.884  2.092   1.00 0.00 ? 92  ARG A HE   5  
ATOM 8018  H HH11 . ARG A 1 14  ? 16.636  -11.119 4.636   1.00 0.00 ? 92  ARG A HH11 5  
ATOM 8019  H HH12 . ARG A 1 14  ? 18.010  -12.137 4.354   1.00 0.00 ? 92  ARG A HH12 5  
ATOM 8020  H HH21 . ARG A 1 14  ? 19.253  -10.216 1.711   1.00 0.00 ? 92  ARG A HH21 5  
ATOM 8021  H HH22 . ARG A 1 14  ? 19.498  -11.622 2.691   1.00 0.00 ? 92  ARG A HH22 5  
ATOM 8022  N N    . LEU A 1 15  ? 11.721  -12.049 4.860   1.00 0.00 ? 93  LEU A N    5  
ATOM 8023  C CA   . LEU A 1 15  ? 10.263  -12.008 4.907   1.00 0.00 ? 93  LEU A CA   5  
ATOM 8024  C C    . LEU A 1 15  ? 9.776   -11.496 6.259   1.00 0.00 ? 93  LEU A C    5  
ATOM 8025  O O    . LEU A 1 15  ? 8.877   -10.657 6.329   1.00 0.00 ? 93  LEU A O    5  
ATOM 8026  C CB   . LEU A 1 15  ? 9.686   -13.399 4.638   1.00 0.00 ? 93  LEU A CB   5  
ATOM 8027  C CG   . LEU A 1 15  ? 9.631   -13.831 3.173   1.00 0.00 ? 93  LEU A CG   5  
ATOM 8028  C CD1  . LEU A 1 15  ? 9.479   -15.340 3.066   1.00 0.00 ? 93  LEU A CD1  5  
ATOM 8029  C CD2  . LEU A 1 15  ? 8.491   -13.126 2.452   1.00 0.00 ? 93  LEU A CD2  5  
ATOM 8030  H H    . LEU A 1 15  ? 12.171  -12.913 4.762   1.00 0.00 ? 93  LEU A H    5  
ATOM 8031  H HA   . LEU A 1 15  ? 9.926   -11.332 4.136   1.00 0.00 ? 93  LEU A HA   5  
ATOM 8032  H HB2  . LEU A 1 15  ? 10.290  -14.117 5.172   1.00 0.00 ? 93  LEU A HB2  5  
ATOM 8033  H HB3  . LEU A 1 15  ? 8.678   -13.419 5.029   1.00 0.00 ? 93  LEU A HB3  5  
ATOM 8034  H HG   . LEU A 1 15  ? 10.557  -13.554 2.687   1.00 0.00 ? 93  LEU A HG   5  
ATOM 8035  H HD11 . LEU A 1 15  ? 9.502   -15.775 4.054   1.00 0.00 ? 93  LEU A HD11 5  
ATOM 8036  H HD12 . LEU A 1 15  ? 10.288  -15.743 2.476   1.00 0.00 ? 93  LEU A HD12 5  
ATOM 8037  H HD13 . LEU A 1 15  ? 8.537   -15.574 2.591   1.00 0.00 ? 93  LEU A HD13 5  
ATOM 8038  H HD21 . LEU A 1 15  ? 7.599   -13.172 3.058   1.00 0.00 ? 93  LEU A HD21 5  
ATOM 8039  H HD22 . LEU A 1 15  ? 8.308   -13.614 1.505   1.00 0.00 ? 93  LEU A HD22 5  
ATOM 8040  H HD23 . LEU A 1 15  ? 8.758   -12.094 2.280   1.00 0.00 ? 93  LEU A HD23 5  
ATOM 8041  N N    . ARG A 1 16  ? 10.377  -12.003 7.330   1.00 0.00 ? 94  ARG A N    5  
ATOM 8042  C CA   . ARG A 1 16  ? 10.006  -11.596 8.680   1.00 0.00 ? 94  ARG A CA   5  
ATOM 8043  C C    . ARG A 1 16  ? 10.459  -10.166 8.960   1.00 0.00 ? 94  ARG A C    5  
ATOM 8044  O O    . ARG A 1 16  ? 9.718   -9.372  9.539   1.00 0.00 ? 94  ARG A O    5  
ATOM 8045  C CB   . ARG A 1 16  ? 10.617  -12.548 9.709   1.00 0.00 ? 94  ARG A CB   5  
ATOM 8046  C CG   . ARG A 1 16  ? 10.179  -12.264 11.137  1.00 0.00 ? 94  ARG A CG   5  
ATOM 8047  C CD   . ARG A 1 16  ? 10.983  -13.078 12.138  1.00 0.00 ? 94  ARG A CD   5  
ATOM 8048  N NE   . ARG A 1 16  ? 10.388  -14.389 12.382  1.00 0.00 ? 94  ARG A NE   5  
ATOM 8049  C CZ   . ARG A 1 16  ? 9.375   -14.592 13.218  1.00 0.00 ? 94  ARG A CZ   5  
ATOM 8050  N NH1  . ARG A 1 16  ? 8.849   -13.575 13.886  1.00 0.00 ? 94  ARG A NH1  5  
ATOM 8051  N NH2  . ARG A 1 16  ? 8.888   -15.814 13.387  1.00 0.00 ? 94  ARG A NH2  5  
ATOM 8052  H H    . ARG A 1 16  ? 11.087  -12.668 7.210   1.00 0.00 ? 94  ARG A H    5  
ATOM 8053  H HA   . ARG A 1 16  ? 8.930   -11.641 8.755   1.00 0.00 ? 94  ARG A HA   5  
ATOM 8054  H HB2  . ARG A 1 16  ? 10.330  -13.559 9.463   1.00 0.00 ? 94  ARG A HB2  5  
ATOM 8055  H HB3  . ARG A 1 16  ? 11.693  -12.466 9.663   1.00 0.00 ? 94  ARG A HB3  5  
ATOM 8056  H HG2  . ARG A 1 16  ? 10.323  -11.214 11.346  1.00 0.00 ? 94  ARG A HG2  5  
ATOM 8057  H HG3  . ARG A 1 16  ? 9.134   -12.514 11.239  1.00 0.00 ? 94  ARG A HG3  5  
ATOM 8058  H HD2  . ARG A 1 16  ? 11.983  -13.214 11.752  1.00 0.00 ? 94  ARG A HD2  5  
ATOM 8059  H HD3  . ARG A 1 16  ? 11.028  -12.534 13.070  1.00 0.00 ? 94  ARG A HD3  5  
ATOM 8060  H HE   . ARG A 1 16  ? 10.761  -15.154 11.899  1.00 0.00 ? 94  ARG A HE   5  
ATOM 8061  H HH11 . ARG A 1 16  ? 9.214   -12.653 13.761  1.00 0.00 ? 94  ARG A HH11 5  
ATOM 8062  H HH12 . ARG A 1 16  ? 8.086   -13.731 14.514  1.00 0.00 ? 94  ARG A HH12 5  
ATOM 8063  H HH21 . ARG A 1 16  ? 9.282   -16.583 12.884  1.00 0.00 ? 94  ARG A HH21 5  
ATOM 8064  H HH22 . ARG A 1 16  ? 8.126   -15.966 14.016  1.00 0.00 ? 94  ARG A HH22 5  
ATOM 8065  N N    . ALA A 1 17  ? 11.680  -9.846  8.546   1.00 0.00 ? 95  ALA A N    5  
ATOM 8066  C CA   . ALA A 1 17  ? 12.232  -8.512  8.751   1.00 0.00 ? 95  ALA A CA   5  
ATOM 8067  C C    . ALA A 1 17  ? 11.472  -7.473  7.935   1.00 0.00 ? 95  ALA A C    5  
ATOM 8068  O O    . ALA A 1 17  ? 11.194  -6.373  8.415   1.00 0.00 ? 95  ALA A O    5  
ATOM 8069  C CB   . ALA A 1 17  ? 13.710  -8.491  8.391   1.00 0.00 ? 95  ALA A CB   5  
ATOM 8070  H H    . ALA A 1 17  ? 12.223  -10.523 8.090   1.00 0.00 ? 95  ALA A H    5  
ATOM 8071  H HA   . ALA A 1 17  ? 12.138  -8.270  9.800   1.00 0.00 ? 95  ALA A HA   5  
ATOM 8072  H HB1  . ALA A 1 17  ? 14.107  -7.501  8.562   1.00 0.00 ? 95  ALA A HB1  5  
ATOM 8073  H HB2  . ALA A 1 17  ? 14.240  -9.203  9.007   1.00 0.00 ? 95  ALA A HB2  5  
ATOM 8074  H HB3  . ALA A 1 17  ? 13.831  -8.754  7.351   1.00 0.00 ? 95  ALA A HB3  5  
ATOM 8075  N N    . LEU A 1 18  ? 11.138  -7.826  6.699   1.00 0.00 ? 96  LEU A N    5  
ATOM 8076  C CA   . LEU A 1 18  ? 10.410  -6.923  5.815   1.00 0.00 ? 96  LEU A CA   5  
ATOM 8077  C C    . LEU A 1 18  ? 8.976   -6.726  6.298   1.00 0.00 ? 96  LEU A C    5  
ATOM 8078  O O    . LEU A 1 18  ? 8.478   -5.602  6.352   1.00 0.00 ? 96  LEU A O    5  
ATOM 8079  C CB   . LEU A 1 18  ? 10.407  -7.468  4.386   1.00 0.00 ? 96  LEU A CB   5  
ATOM 8080  C CG   . LEU A 1 18  ? 10.101  -6.456  3.281   1.00 0.00 ? 96  LEU A CG   5  
ATOM 8081  C CD1  . LEU A 1 18  ? 10.410  -7.046  1.915   1.00 0.00 ? 96  LEU A CD1  5  
ATOM 8082  C CD2  . LEU A 1 18  ? 8.648   -6.010  3.355   1.00 0.00 ? 96  LEU A CD2  5  
ATOM 8083  H H    . LEU A 1 18  ? 11.386  -8.716  6.372   1.00 0.00 ? 96  LEU A H    5  
ATOM 8084  H HA   . LEU A 1 18  ? 10.915  -5.969  5.827   1.00 0.00 ? 96  LEU A HA   5  
ATOM 8085  H HB2  . LEU A 1 18  ? 11.383  -7.885  4.190   1.00 0.00 ? 96  LEU A HB2  5  
ATOM 8086  H HB3  . LEU A 1 18  ? 9.665   -8.252  4.333   1.00 0.00 ? 96  LEU A HB3  5  
ATOM 8087  H HG   . LEU A 1 18  ? 10.727  -5.584  3.417   1.00 0.00 ? 96  LEU A HG   5  
ATOM 8088  H HD11 . LEU A 1 18  ? 11.117  -6.413  1.401   1.00 0.00 ? 96  LEU A HD11 5  
ATOM 8089  H HD12 . LEU A 1 18  ? 9.500   -7.113  1.337   1.00 0.00 ? 96  LEU A HD12 5  
ATOM 8090  H HD13 . LEU A 1 18  ? 10.832  -8.033  2.036   1.00 0.00 ? 96  LEU A HD13 5  
ATOM 8091  H HD21 . LEU A 1 18  ? 8.580   -5.101  3.935   1.00 0.00 ? 96  LEU A HD21 5  
ATOM 8092  H HD22 . LEU A 1 18  ? 8.058   -6.782  3.827   1.00 0.00 ? 96  LEU A HD22 5  
ATOM 8093  H HD23 . LEU A 1 18  ? 8.276   -5.829  2.358   1.00 0.00 ? 96  LEU A HD23 5  
ATOM 8094  N N    . ASN A 1 19  ? 8.320   -7.826  6.651   1.00 0.00 ? 97  ASN A N    5  
ATOM 8095  C CA   . ASN A 1 19  ? 6.944   -7.774  7.132   1.00 0.00 ? 97  ASN A CA   5  
ATOM 8096  C C    . ASN A 1 19  ? 6.859   -7.026  8.459   1.00 0.00 ? 97  ASN A C    5  
ATOM 8097  O O    . ASN A 1 19  ? 5.994   -6.173  8.649   1.00 0.00 ? 97  ASN A O    5  
ATOM 8098  C CB   . ASN A 1 19  ? 6.384   -9.189  7.294   1.00 0.00 ? 97  ASN A CB   5  
ATOM 8099  C CG   . ASN A 1 19  ? 5.233   -9.245  8.279   1.00 0.00 ? 97  ASN A CG   5  
ATOM 8100  O OD1  . ASN A 1 19  ? 4.195   -8.616  8.075   1.00 0.00 ? 97  ASN A OD1  5  
ATOM 8101  N ND2  . ASN A 1 19  ? 5.412   -10.002 9.355   1.00 0.00 ? 97  ASN A ND2  5  
ATOM 8102  H H    . ASN A 1 19  ? 8.770   -8.694  6.586   1.00 0.00 ? 97  ASN A H    5  
ATOM 8103  H HA   . ASN A 1 19  ? 6.355   -7.246  6.396   1.00 0.00 ? 97  ASN A HA   5  
ATOM 8104  H HB2  . ASN A 1 19  ? 6.031   -9.541  6.336   1.00 0.00 ? 97  ASN A HB2  5  
ATOM 8105  H HB3  . ASN A 1 19  ? 7.168   -9.842  7.646   1.00 0.00 ? 97  ASN A HB3  5  
ATOM 8106  H HD21 . ASN A 1 19  ? 6.265   -10.475 9.452   1.00 0.00 ? 97  ASN A HD21 5  
ATOM 8107  H HD22 . ASN A 1 19  ? 4.683   -10.058 10.008  1.00 0.00 ? 97  ASN A HD22 5  
ATOM 8108  N N    . GLY A 1 20  ? 7.766   -7.353  9.375   1.00 0.00 ? 98  GLY A N    5  
ATOM 8109  C CA   . GLY A 1 20  ? 7.777   -6.704  10.673  1.00 0.00 ? 98  GLY A CA   5  
ATOM 8110  C C    . GLY A 1 20  ? 8.213   -5.254  10.591  1.00 0.00 ? 98  GLY A C    5  
ATOM 8111  O O    . GLY A 1 20  ? 7.640   -4.388  11.254  1.00 0.00 ? 98  GLY A O    5  
ATOM 8112  H H    . GLY A 1 20  ? 8.432   -8.042  9.168   1.00 0.00 ? 98  GLY A H    5  
ATOM 8113  H HA2  . GLY A 1 20  ? 6.784   -6.747  11.093  1.00 0.00 ? 98  GLY A HA2  5  
ATOM 8114  H HA3  . GLY A 1 20  ? 8.456   -7.235  11.323  1.00 0.00 ? 98  GLY A HA3  5  
ATOM 8115  N N    . LEU A 1 21  ? 9.230   -4.988  9.779   1.00 0.00 ? 99  LEU A N    5  
ATOM 8116  C CA   . LEU A 1 21  ? 9.744   -3.633  9.614   1.00 0.00 ? 99  LEU A CA   5  
ATOM 8117  C C    . LEU A 1 21  ? 8.661   -2.701  9.079   1.00 0.00 ? 99  LEU A C    5  
ATOM 8118  O O    . LEU A 1 21  ? 8.467   -1.598  9.591   1.00 0.00 ? 99  LEU A O    5  
ATOM 8119  C CB   . LEU A 1 21  ? 10.946  -3.634  8.669   1.00 0.00 ? 99  LEU A CB   5  
ATOM 8120  C CG   . LEU A 1 21  ? 12.276  -4.082  9.274   1.00 0.00 ? 99  LEU A CG   5  
ATOM 8121  C CD1  . LEU A 1 21  ? 13.263  -4.455  8.179   1.00 0.00 ? 99  LEU A CD1  5  
ATOM 8122  C CD2  . LEU A 1 21  ? 12.852  -2.990  10.164  1.00 0.00 ? 99  LEU A CD2  5  
ATOM 8123  H H    . LEU A 1 21  ? 9.645   -5.720  9.277   1.00 0.00 ? 99  LEU A H    5  
ATOM 8124  H HA   . LEU A 1 21  ? 10.059  -3.278  10.584  1.00 0.00 ? 99  LEU A HA   5  
ATOM 8125  H HB2  . LEU A 1 21  ? 10.719  -4.293  7.846   1.00 0.00 ? 99  LEU A HB2  5  
ATOM 8126  H HB3  . LEU A 1 21  ? 11.073  -2.627  8.296   1.00 0.00 ? 99  LEU A HB3  5  
ATOM 8127  H HG   . LEU A 1 21  ? 12.109  -4.958  9.885   1.00 0.00 ? 99  LEU A HG   5  
ATOM 8128  H HD11 . LEU A 1 21  ? 14.221  -4.005  8.389   1.00 0.00 ? 99  LEU A HD11 5  
ATOM 8129  H HD12 . LEU A 1 21  ? 12.897  -4.097  7.228   1.00 0.00 ? 99  LEU A HD12 5  
ATOM 8130  H HD13 . LEU A 1 21  ? 13.369  -5.530  8.142   1.00 0.00 ? 99  LEU A HD13 5  
ATOM 8131  H HD21 . LEU A 1 21  ? 12.053  -2.355  10.518  1.00 0.00 ? 99  LEU A HD21 5  
ATOM 8132  H HD22 . LEU A 1 21  ? 13.557  -2.398  9.597   1.00 0.00 ? 99  LEU A HD22 5  
ATOM 8133  H HD23 . LEU A 1 21  ? 13.355  -3.440  11.007  1.00 0.00 ? 99  LEU A HD23 5  
ATOM 8134  N N    . LEU A 1 22  ? 7.957   -3.153  8.047   1.00 0.00 ? 100 LEU A N    5  
ATOM 8135  C CA   . LEU A 1 22  ? 6.891   -2.361  7.442   1.00 0.00 ? 100 LEU A CA   5  
ATOM 8136  C C    . LEU A 1 22  ? 5.750   -2.140  8.430   1.00 0.00 ? 100 LEU A C    5  
ATOM 8137  O O    . LEU A 1 22  ? 5.189   -1.047  8.511   1.00 0.00 ? 100 LEU A O    5  
ATOM 8138  C CB   . LEU A 1 22  ? 6.365   -3.054  6.184   1.00 0.00 ? 100 LEU A CB   5  
ATOM 8139  C CG   . LEU A 1 22  ? 7.277   -3.001  4.958   1.00 0.00 ? 100 LEU A CG   5  
ATOM 8140  C CD1  . LEU A 1 22  ? 6.628   -3.711  3.779   1.00 0.00 ? 100 LEU A CD1  5  
ATOM 8141  C CD2  . LEU A 1 22  ? 7.607   -1.560  4.599   1.00 0.00 ? 100 LEU A CD2  5  
ATOM 8142  H H    . LEU A 1 22  ? 8.157   -4.040  7.682   1.00 0.00 ? 100 LEU A H    5  
ATOM 8143  H HA   . LEU A 1 22  ? 7.306   -1.402  7.169   1.00 0.00 ? 100 LEU A HA   5  
ATOM 8144  H HB2  . LEU A 1 22  ? 6.195   -4.092  6.425   1.00 0.00 ? 100 LEU A HB2  5  
ATOM 8145  H HB3  . LEU A 1 22  ? 5.426   -2.588  5.920   1.00 0.00 ? 100 LEU A HB3  5  
ATOM 8146  H HG   . LEU A 1 22  ? 8.204   -3.511  5.184   1.00 0.00 ? 100 LEU A HG   5  
ATOM 8147  H HD11 . LEU A 1 22  ? 7.352   -3.828  2.987   1.00 0.00 ? 100 LEU A HD11 5  
ATOM 8148  H HD12 . LEU A 1 22  ? 5.795   -3.125  3.421   1.00 0.00 ? 100 LEU A HD12 5  
ATOM 8149  H HD13 . LEU A 1 22  ? 6.276   -4.682  4.094   1.00 0.00 ? 100 LEU A HD13 5  
ATOM 8150  H HD21 . LEU A 1 22  ? 8.395   -1.200  5.244   1.00 0.00 ? 100 LEU A HD21 5  
ATOM 8151  H HD22 . LEU A 1 22  ? 6.727   -0.946  4.730   1.00 0.00 ? 100 LEU A HD22 5  
ATOM 8152  H HD23 . LEU A 1 22  ? 7.932   -1.510  3.571   1.00 0.00 ? 100 LEU A HD23 5  
ATOM 8153  N N    . TYR A 1 23  ? 5.414   -3.183  9.180   1.00 0.00 ? 101 TYR A N    5  
ATOM 8154  C CA   . TYR A 1 23  ? 4.339   -3.103  10.163  1.00 0.00 ? 101 TYR A CA   5  
ATOM 8155  C C    . TYR A 1 23  ? 4.694   -2.125  11.279  1.00 0.00 ? 101 TYR A C    5  
ATOM 8156  O O    . TYR A 1 23  ? 3.871   -1.305  11.687  1.00 0.00 ? 101 TYR A O    5  
ATOM 8157  C CB   . TYR A 1 23  ? 4.055   -4.485  10.752  1.00 0.00 ? 101 TYR A CB   5  
ATOM 8158  C CG   . TYR A 1 23  ? 3.184   -4.449  11.988  1.00 0.00 ? 101 TYR A CG   5  
ATOM 8159  C CD1  . TYR A 1 23  ? 1.807   -4.293  11.887  1.00 0.00 ? 101 TYR A CD1  5  
ATOM 8160  C CD2  . TYR A 1 23  ? 3.738   -4.570  13.256  1.00 0.00 ? 101 TYR A CD2  5  
ATOM 8161  C CE1  . TYR A 1 23  ? 1.008   -4.259  13.013  1.00 0.00 ? 101 TYR A CE1  5  
ATOM 8162  C CE2  . TYR A 1 23  ? 2.947   -4.539  14.387  1.00 0.00 ? 101 TYR A CE2  5  
ATOM 8163  C CZ   . TYR A 1 23  ? 1.582   -4.383  14.261  1.00 0.00 ? 101 TYR A CZ   5  
ATOM 8164  O OH   . TYR A 1 23  ? 0.790   -4.349  15.386  1.00 0.00 ? 101 TYR A OH   5  
ATOM 8165  H H    . TYR A 1 23  ? 5.898   -4.028  9.070   1.00 0.00 ? 101 TYR A H    5  
ATOM 8166  H HA   . TYR A 1 23  ? 3.453   -2.749  9.657   1.00 0.00 ? 101 TYR A HA   5  
ATOM 8167  H HB2  . TYR A 1 23  ? 3.553   -5.089  10.011  1.00 0.00 ? 101 TYR A HB2  5  
ATOM 8168  H HB3  . TYR A 1 23  ? 4.990   -4.955  11.018  1.00 0.00 ? 101 TYR A HB3  5  
ATOM 8169  H HD1  . TYR A 1 23  ? 1.360   -4.197  10.908  1.00 0.00 ? 101 TYR A HD1  5  
ATOM 8170  H HD2  . TYR A 1 23  ? 4.808   -4.692  13.351  1.00 0.00 ? 101 TYR A HD2  5  
ATOM 8171  H HE1  . TYR A 1 23  ? -0.061  -4.138  12.914  1.00 0.00 ? 101 TYR A HE1  5  
ATOM 8172  H HE2  . TYR A 1 23  ? 3.396   -4.635  15.365  1.00 0.00 ? 101 TYR A HE2  5  
ATOM 8173  H HH   . TYR A 1 23  ? -0.102  -4.092  15.141  1.00 0.00 ? 101 TYR A HH   5  
ATOM 8174  N N    . LYS A 1 24  ? 5.925   -2.217  11.768  1.00 0.00 ? 102 LYS A N    5  
ATOM 8175  C CA   . LYS A 1 24  ? 6.393   -1.341  12.836  1.00 0.00 ? 102 LYS A CA   5  
ATOM 8176  C C    . LYS A 1 24  ? 6.555   0.090   12.334  1.00 0.00 ? 102 LYS A C    5  
ATOM 8177  O O    . LYS A 1 24  ? 6.113   1.039   12.981  1.00 0.00 ? 102 LYS A O    5  
ATOM 8178  C CB   . LYS A 1 24  ? 7.723   -1.850  13.396  1.00 0.00 ? 102 LYS A CB   5  
ATOM 8179  C CG   . LYS A 1 24  ? 8.463   -0.822  14.234  1.00 0.00 ? 102 LYS A CG   5  
ATOM 8180  C CD   . LYS A 1 24  ? 7.681   -0.452  15.482  1.00 0.00 ? 102 LYS A CD   5  
ATOM 8181  C CE   . LYS A 1 24  ? 7.605   -1.616  16.458  1.00 0.00 ? 102 LYS A CE   5  
ATOM 8182  N NZ   . LYS A 1 24  ? 6.997   -1.212  17.757  1.00 0.00 ? 102 LYS A NZ   5  
ATOM 8183  H H    . LYS A 1 24  ? 6.536   -2.891  11.402  1.00 0.00 ? 102 LYS A H    5  
ATOM 8184  H HA   . LYS A 1 24  ? 5.653   -1.352  13.622  1.00 0.00 ? 102 LYS A HA   5  
ATOM 8185  H HB2  . LYS A 1 24  ? 7.532   -2.716  14.013  1.00 0.00 ? 102 LYS A HB2  5  
ATOM 8186  H HB3  . LYS A 1 24  ? 8.360   -2.138  12.572  1.00 0.00 ? 102 LYS A HB3  5  
ATOM 8187  H HG2  . LYS A 1 24  ? 9.418   -1.231  14.529  1.00 0.00 ? 102 LYS A HG2  5  
ATOM 8188  H HG3  . LYS A 1 24  ? 8.619   0.068   13.640  1.00 0.00 ? 102 LYS A HG3  5  
ATOM 8189  H HD2  . LYS A 1 24  ? 8.168   0.380   15.969  1.00 0.00 ? 102 LYS A HD2  5  
ATOM 8190  H HD3  . LYS A 1 24  ? 6.678   -0.167  15.197  1.00 0.00 ? 102 LYS A HD3  5  
ATOM 8191  H HE2  . LYS A 1 24  ? 7.007   -2.399  16.019  1.00 0.00 ? 102 LYS A HE2  5  
ATOM 8192  H HE3  . LYS A 1 24  ? 8.605   -1.983  16.637  1.00 0.00 ? 102 LYS A HE3  5  
ATOM 8193  H HZ1  . LYS A 1 24  ? 7.301   -1.862  18.510  1.00 0.00 ? 102 LYS A HZ1  5  
ATOM 8194  H HZ2  . LYS A 1 24  ? 5.960   -1.239  17.689  1.00 0.00 ? 102 LYS A HZ2  5  
ATOM 8195  H HZ3  . LYS A 1 24  ? 7.293   -0.247  18.006  1.00 0.00 ? 102 LYS A HZ3  5  
ATOM 8196  N N    . ALA A 1 25  ? 7.190   0.237   11.176  1.00 0.00 ? 103 ALA A N    5  
ATOM 8197  C CA   . ALA A 1 25  ? 7.407   1.552   10.585  1.00 0.00 ? 103 ALA A CA   5  
ATOM 8198  C C    . ALA A 1 25  ? 6.083   2.214   10.217  1.00 0.00 ? 103 ALA A C    5  
ATOM 8199  O O    . ALA A 1 25  ? 5.921   3.426   10.364  1.00 0.00 ? 103 ALA A O    5  
ATOM 8200  C CB   . ALA A 1 25  ? 8.302   1.440   9.360   1.00 0.00 ? 103 ALA A CB   5  
ATOM 8201  H H    . ALA A 1 25  ? 7.520   -0.557  10.707  1.00 0.00 ? 103 ALA A H    5  
ATOM 8202  H HA   . ALA A 1 25  ? 7.914   2.167   11.316  1.00 0.00 ? 103 ALA A HA   5  
ATOM 8203  H HB1  . ALA A 1 25  ? 9.124   0.773   9.576   1.00 0.00 ? 103 ALA A HB1  5  
ATOM 8204  H HB2  . ALA A 1 25  ? 7.730   1.050   8.531   1.00 0.00 ? 103 ALA A HB2  5  
ATOM 8205  H HB3  . ALA A 1 25  ? 8.688   2.415   9.106   1.00 0.00 ? 103 ALA A HB3  5  
ATOM 8206  N N    . LEU A 1 26  ? 5.140   1.411   9.736   1.00 0.00 ? 104 LEU A N    5  
ATOM 8207  C CA   . LEU A 1 26  ? 3.830   1.919   9.345   1.00 0.00 ? 104 LEU A CA   5  
ATOM 8208  C C    . LEU A 1 26  ? 3.064   2.441   10.557  1.00 0.00 ? 104 LEU A C    5  
ATOM 8209  O O    . LEU A 1 26  ? 2.546   3.558   10.544  1.00 0.00 ? 104 LEU A O    5  
ATOM 8210  C CB   . LEU A 1 26  ? 3.022   0.821   8.652   1.00 0.00 ? 104 LEU A CB   5  
ATOM 8211  C CG   . LEU A 1 26  ? 3.357   0.567   7.181   1.00 0.00 ? 104 LEU A CG   5  
ATOM 8212  C CD1  . LEU A 1 26  ? 2.812   -0.780  6.734   1.00 0.00 ? 104 LEU A CD1  5  
ATOM 8213  C CD2  . LEU A 1 26  ? 2.805   1.684   6.308   1.00 0.00 ? 104 LEU A CD2  5  
ATOM 8214  H H    . LEU A 1 26  ? 5.328   0.454   9.642   1.00 0.00 ? 104 LEU A H    5  
ATOM 8215  H HA   . LEU A 1 26  ? 3.983   2.733   8.653   1.00 0.00 ? 104 LEU A HA   5  
ATOM 8216  H HB2  . LEU A 1 26  ? 3.184   -0.100  9.191   1.00 0.00 ? 104 LEU A HB2  5  
ATOM 8217  H HB3  . LEU A 1 26  ? 1.977   1.092   8.712   1.00 0.00 ? 104 LEU A HB3  5  
ATOM 8218  H HG   . LEU A 1 26  ? 4.432   0.548   7.062   1.00 0.00 ? 104 LEU A HG   5  
ATOM 8219  H HD11 . LEU A 1 26  ? 3.586   -1.528  6.819   1.00 0.00 ? 104 LEU A HD11 5  
ATOM 8220  H HD12 . LEU A 1 26  ? 2.487   -0.714  5.706   1.00 0.00 ? 104 LEU A HD12 5  
ATOM 8221  H HD13 . LEU A 1 26  ? 1.975   -1.055  7.359   1.00 0.00 ? 104 LEU A HD13 5  
ATOM 8222  H HD21 . LEU A 1 26  ? 1.743   1.543   6.172   1.00 0.00 ? 104 LEU A HD21 5  
ATOM 8223  H HD22 . LEU A 1 26  ? 3.296   1.666   5.346   1.00 0.00 ? 104 LEU A HD22 5  
ATOM 8224  H HD23 . LEU A 1 26  ? 2.983   2.636   6.786   1.00 0.00 ? 104 LEU A HD23 5  
ATOM 8225  N N    . THR A 1 27  ? 2.998   1.625   11.605  1.00 0.00 ? 105 THR A N    5  
ATOM 8226  C CA   . THR A 1 27  ? 2.298   2.005   12.825  1.00 0.00 ? 105 THR A CA   5  
ATOM 8227  C C    . THR A 1 27  ? 2.948   3.219   13.478  1.00 0.00 ? 105 THR A C    5  
ATOM 8228  O O    . THR A 1 27  ? 2.284   3.997   14.164  1.00 0.00 ? 105 THR A O    5  
ATOM 8229  C CB   . THR A 1 27  ? 2.268   0.846   13.840  1.00 0.00 ? 105 THR A CB   5  
ATOM 8230  O OG1  . THR A 1 27  ? 1.511   1.224   14.994  1.00 0.00 ? 105 THR A OG1  5  
ATOM 8231  C CG2  . THR A 1 27  ? 3.678   0.456   14.257  1.00 0.00 ? 105 THR A CG2  5  
ATOM 8232  H H    . THR A 1 27  ? 3.431   0.748   11.554  1.00 0.00 ? 105 THR A H    5  
ATOM 8233  H HA   . THR A 1 27  ? 1.279   2.251   12.562  1.00 0.00 ? 105 THR A HA   5  
ATOM 8234  H HB   . THR A 1 27  ? 1.797   -0.008  13.374  1.00 0.00 ? 105 THR A HB   5  
ATOM 8235  H HG1  . THR A 1 27  ? 0.627   1.487   14.725  1.00 0.00 ? 105 THR A HG1  5  
ATOM 8236  H HG21 . THR A 1 27  ? 4.192   0.012   13.418  1.00 0.00 ? 105 THR A HG21 5  
ATOM 8237  H HG22 . THR A 1 27  ? 3.629   -0.256  15.067  1.00 0.00 ? 105 THR A HG22 5  
ATOM 8238  H HG23 . THR A 1 27  ? 4.213   1.336   14.582  1.00 0.00 ? 105 THR A HG23 5  
ATOM 8239  N N    . ASP A 1 28  ? 4.248   3.377   13.258  1.00 0.00 ? 106 ASP A N    5  
ATOM 8240  C CA   . ASP A 1 28  ? 4.988   4.500   13.824  1.00 0.00 ? 106 ASP A CA   5  
ATOM 8241  C C    . ASP A 1 28  ? 4.570   5.812   13.169  1.00 0.00 ? 106 ASP A C    5  
ATOM 8242  O O    . ASP A 1 28  ? 4.330   6.810   13.850  1.00 0.00 ? 106 ASP A O    5  
ATOM 8243  C CB   . ASP A 1 28  ? 6.493   4.285   13.651  1.00 0.00 ? 106 ASP A CB   5  
ATOM 8244  C CG   . ASP A 1 28  ? 7.308   5.447   14.185  1.00 0.00 ? 106 ASP A CG   5  
ATOM 8245  O OD1  . ASP A 1 28  ? 7.105   5.825   15.357  1.00 0.00 ? 106 ASP A OD1  5  
ATOM 8246  O OD2  . ASP A 1 28  ? 8.151   5.976   13.430  1.00 0.00 ? 106 ASP A OD2  5  
ATOM 8247  H H    . ASP A 1 28  ? 4.722   2.724   12.702  1.00 0.00 ? 106 ASP A H    5  
ATOM 8248  H HA   . ASP A 1 28  ? 4.760   4.550   14.878  1.00 0.00 ? 106 ASP A HA   5  
ATOM 8249  H HB2  . ASP A 1 28  ? 6.786   3.390   14.180  1.00 0.00 ? 106 ASP A HB2  5  
ATOM 8250  H HB3  . ASP A 1 28  ? 6.714   4.166   12.600  1.00 0.00 ? 106 ASP A HB3  5  
ATOM 8251  N N    . LEU A 1 29  ? 4.485   5.805   11.843  1.00 0.00 ? 107 LEU A N    5  
ATOM 8252  C CA   . LEU A 1 29  ? 4.097   6.995   11.094  1.00 0.00 ? 107 LEU A CA   5  
ATOM 8253  C C    . LEU A 1 29  ? 2.682   7.431   11.461  1.00 0.00 ? 107 LEU A C    5  
ATOM 8254  O O    . LEU A 1 29  ? 2.368   8.622   11.460  1.00 0.00 ? 107 LEU A O    5  
ATOM 8255  C CB   . LEU A 1 29  ? 4.187   6.728   9.591   1.00 0.00 ? 107 LEU A CB   5  
ATOM 8256  C CG   . LEU A 1 29  ? 5.594   6.736   8.991   1.00 0.00 ? 107 LEU A CG   5  
ATOM 8257  C CD1  . LEU A 1 29  ? 5.545   6.389   7.511   1.00 0.00 ? 107 LEU A CD1  5  
ATOM 8258  C CD2  . LEU A 1 29  ? 6.256   8.089   9.202   1.00 0.00 ? 107 LEU A CD2  5  
ATOM 8259  H H    . LEU A 1 29  ? 4.689   4.980   11.355  1.00 0.00 ? 107 LEU A H    5  
ATOM 8260  H HA   . LEU A 1 29  ? 4.783   7.788   11.353  1.00 0.00 ? 107 LEU A HA   5  
ATOM 8261  H HB2  . LEU A 1 29  ? 3.752   5.759   9.401   1.00 0.00 ? 107 LEU A HB2  5  
ATOM 8262  H HB3  . LEU A 1 29  ? 3.607   7.487   9.086   1.00 0.00 ? 107 LEU A HB3  5  
ATOM 8263  H HG   . LEU A 1 29  ? 6.194   5.987   9.489   1.00 0.00 ? 107 LEU A HG   5  
ATOM 8264  H HD11 . LEU A 1 29  ? 5.255   5.356   7.393   1.00 0.00 ? 107 LEU A HD11 5  
ATOM 8265  H HD12 . LEU A 1 29  ? 6.520   6.542   7.073   1.00 0.00 ? 107 LEU A HD12 5  
ATOM 8266  H HD13 . LEU A 1 29  ? 4.825   7.025   7.016   1.00 0.00 ? 107 LEU A HD13 5  
ATOM 8267  H HD21 . LEU A 1 29  ? 5.554   8.874   8.961   1.00 0.00 ? 107 LEU A HD21 5  
ATOM 8268  H HD22 . LEU A 1 29  ? 7.121   8.170   8.560   1.00 0.00 ? 107 LEU A HD22 5  
ATOM 8269  H HD23 . LEU A 1 29  ? 6.562   8.183   10.233  1.00 0.00 ? 107 LEU A HD23 5  
ATOM 8270  N N    . LEU A 1 30  ? 1.832   6.460   11.776  1.00 0.00 ? 108 LEU A N    5  
ATOM 8271  C CA   . LEU A 1 30  ? 0.450   6.743   12.148  1.00 0.00 ? 108 LEU A CA   5  
ATOM 8272  C C    . LEU A 1 30  ? 0.367   7.270   13.577  1.00 0.00 ? 108 LEU A C    5  
ATOM 8273  O O    . LEU A 1 30  ? -0.716  7.587   14.070  1.00 0.00 ? 108 LEU A O    5  
ATOM 8274  C CB   . LEU A 1 30  ? -0.405  5.482   12.007  1.00 0.00 ? 108 LEU A CB   5  
ATOM 8275  C CG   . LEU A 1 30  ? -0.875  5.145   10.591  1.00 0.00 ? 108 LEU A CG   5  
ATOM 8276  C CD1  . LEU A 1 30  ? 0.230   5.416   9.583   1.00 0.00 ? 108 LEU A CD1  5  
ATOM 8277  C CD2  . LEU A 1 30  ? -1.328  3.694   10.512  1.00 0.00 ? 108 LEU A CD2  5  
ATOM 8278  H H    . LEU A 1 30  ? 2.140   5.530   11.759  1.00 0.00 ? 108 LEU A H    5  
ATOM 8279  H HA   . LEU A 1 30  ? 0.075   7.500   11.475  1.00 0.00 ? 108 LEU A HA   5  
ATOM 8280  H HB2  . LEU A 1 30  ? 0.174   4.647   12.370  1.00 0.00 ? 108 LEU A HB2  5  
ATOM 8281  H HB3  . LEU A 1 30  ? -1.282  5.607   12.627  1.00 0.00 ? 108 LEU A HB3  5  
ATOM 8282  H HG   . LEU A 1 30  ? -1.718  5.773   10.339  1.00 0.00 ? 108 LEU A HG   5  
ATOM 8283  H HD11 . LEU A 1 30  ? 1.188   5.202   10.032  1.00 0.00 ? 108 LEU A HD11 5  
ATOM 8284  H HD12 . LEU A 1 30  ? 0.197   6.453   9.283   1.00 0.00 ? 108 LEU A HD12 5  
ATOM 8285  H HD13 . LEU A 1 30  ? 0.089   4.786   8.717   1.00 0.00 ? 108 LEU A HD13 5  
ATOM 8286  H HD21 . LEU A 1 30  ? -1.963  3.563   9.648   1.00 0.00 ? 108 LEU A HD21 5  
ATOM 8287  H HD22 . LEU A 1 30  ? -1.879  3.439   11.405  1.00 0.00 ? 108 LEU A HD22 5  
ATOM 8288  H HD23 . LEU A 1 30  ? -0.464  3.052   10.425  1.00 0.00 ? 108 LEU A HD23 5  
ATOM 8289  N N    . CYS A 1 31  ? 1.517   7.363   14.235  1.00 0.00 ? 109 CYS A N    5  
ATOM 8290  C CA   . CYS A 1 31  ? 1.575   7.853   15.607  1.00 0.00 ? 109 CYS A CA   5  
ATOM 8291  C C    . CYS A 1 31  ? 1.890   9.345   15.638  1.00 0.00 ? 109 CYS A C    5  
ATOM 8292  O O    . CYS A 1 31  ? 1.678   10.016  16.649  1.00 0.00 ? 109 CYS A O    5  
ATOM 8293  C CB   . CYS A 1 31  ? 2.629   7.081   16.403  1.00 0.00 ? 109 CYS A CB   5  
ATOM 8294  S SG   . CYS A 1 31  ? 2.235   5.333   16.646  1.00 0.00 ? 109 CYS A SG   5  
ATOM 8295  H H    . CYS A 1 31  ? 2.347   7.095   13.788  1.00 0.00 ? 109 CYS A H    5  
ATOM 8296  H HA   . CYS A 1 31  ? 0.607   7.693   16.057  1.00 0.00 ? 109 CYS A HA   5  
ATOM 8297  H HB2  . CYS A 1 31  ? 3.573   7.134   15.882  1.00 0.00 ? 109 CYS A HB2  5  
ATOM 8298  H HB3  . CYS A 1 31  ? 2.736   7.534   17.377  1.00 0.00 ? 109 CYS A HB3  5  
ATOM 8299  H HG   . CYS A 1 31  ? 2.785   4.946   17.787  1.00 0.00 ? 109 CYS A HG   5  
ATOM 8300  N N    . THR A 1 32  ? 2.400   9.861   14.524  1.00 0.00 ? 110 THR A N    5  
ATOM 8301  C CA   . THR A 1 32  ? 2.747   11.273  14.424  1.00 0.00 ? 110 THR A CA   5  
ATOM 8302  C C    . THR A 1 32  ? 1.919   11.968  13.349  1.00 0.00 ? 110 THR A C    5  
ATOM 8303  O O    . THR A 1 32  ? 2.046   11.689  12.156  1.00 0.00 ? 110 THR A O    5  
ATOM 8304  C CB   . THR A 1 32  ? 4.242   11.463  14.107  1.00 0.00 ? 110 THR A CB   5  
ATOM 8305  O OG1  . THR A 1 32  ? 4.999   10.372  14.643  1.00 0.00 ? 110 THR A OG1  5  
ATOM 8306  C CG2  . THR A 1 32  ? 4.756   12.774  14.683  1.00 0.00 ? 110 THR A CG2  5  
ATOM 8307  H H    . THR A 1 32  ? 2.546   9.276   13.751  1.00 0.00 ? 110 THR A H    5  
ATOM 8308  H HA   . THR A 1 32  ? 2.541   11.735  15.378  1.00 0.00 ? 110 THR A HA   5  
ATOM 8309  H HB   . THR A 1 32  ? 4.367   11.484  13.034  1.00 0.00 ? 110 THR A HB   5  
ATOM 8310  H HG1  . THR A 1 32  ? 5.881   10.676  14.872  1.00 0.00 ? 110 THR A HG1  5  
ATOM 8311  H HG21 . THR A 1 32  ? 4.249   12.981  15.614  1.00 0.00 ? 110 THR A HG21 5  
ATOM 8312  H HG22 . THR A 1 32  ? 4.564   13.573  13.983  1.00 0.00 ? 110 THR A HG22 5  
ATOM 8313  H HG23 . THR A 1 32  ? 5.818   12.697  14.860  1.00 0.00 ? 110 THR A HG23 5  
ATOM 8314  N N    . PRO A 1 33  ? 1.051   12.896  13.777  1.00 0.00 ? 111 PRO A N    5  
ATOM 8315  C CA   . PRO A 1 33  ? 0.186   13.651  12.866  1.00 0.00 ? 111 PRO A CA   5  
ATOM 8316  C C    . PRO A 1 33  ? 0.969   14.639  12.009  1.00 0.00 ? 111 PRO A C    5  
ATOM 8317  O O    . PRO A 1 33  ? 0.400   15.323  11.159  1.00 0.00 ? 111 PRO A O    5  
ATOM 8318  C CB   . PRO A 1 33  ? -0.761  14.396  13.811  1.00 0.00 ? 111 PRO A CB   5  
ATOM 8319  C CG   . PRO A 1 33  ? -0.003  14.516  15.088  1.00 0.00 ? 111 PRO A CG   5  
ATOM 8320  C CD   . PRO A 1 33  ? 0.846   13.279  15.184  1.00 0.00 ? 111 PRO A CD   5  
ATOM 8321  H HA   . PRO A 1 33  ? -0.385  12.994  12.226  1.00 0.00 ? 111 PRO A HA   5  
ATOM 8322  H HB2  . PRO A 1 33  ? -0.996  15.366  13.397  1.00 0.00 ? 111 PRO A HB2  5  
ATOM 8323  H HB3  . PRO A 1 33  ? -1.667  13.824  13.942  1.00 0.00 ? 111 PRO A HB3  5  
ATOM 8324  H HG2  . PRO A 1 33  ? 0.619   15.398  15.064  1.00 0.00 ? 111 PRO A HG2  5  
ATOM 8325  H HG3  . PRO A 1 33  ? -0.691  14.564  15.919  1.00 0.00 ? 111 PRO A HG3  5  
ATOM 8326  H HD2  . PRO A 1 33  ? 1.788   13.504  15.663  1.00 0.00 ? 111 PRO A HD2  5  
ATOM 8327  H HD3  . PRO A 1 33  ? 0.323   12.503  15.723  1.00 0.00 ? 111 PRO A HD3  5  
ATOM 8328  N N    . GLU A 1 34  ? 2.277   14.707  12.238  1.00 0.00 ? 112 GLU A N    5  
ATOM 8329  C CA   . GLU A 1 34  ? 3.137   15.613  11.485  1.00 0.00 ? 112 GLU A CA   5  
ATOM 8330  C C    . GLU A 1 34  ? 2.991   15.381  9.984   1.00 0.00 ? 112 GLU A C    5  
ATOM 8331  O O    . GLU A 1 34  ? 2.754   16.317  9.220   1.00 0.00 ? 112 GLU A O    5  
ATOM 8332  C CB   . GLU A 1 34  ? 4.598   15.428  11.901  1.00 0.00 ? 112 GLU A CB   5  
ATOM 8333  C CG   . GLU A 1 34  ? 4.982   16.215  13.142  1.00 0.00 ? 112 GLU A CG   5  
ATOM 8334  C CD   . GLU A 1 34  ? 6.105   15.561  13.924  1.00 0.00 ? 112 GLU A CD   5  
ATOM 8335  O OE1  . GLU A 1 34  ? 6.529   14.453  13.536  1.00 0.00 ? 112 GLU A OE1  5  
ATOM 8336  O OE2  . GLU A 1 34  ? 6.558   16.157  14.924  1.00 0.00 ? 112 GLU A OE2  5  
ATOM 8337  H H    . GLU A 1 34  ? 2.672   14.136  12.929  1.00 0.00 ? 112 GLU A H    5  
ATOM 8338  H HA   . GLU A 1 34  ? 2.833   16.624  11.712  1.00 0.00 ? 112 GLU A HA   5  
ATOM 8339  H HB2  . GLU A 1 34  ? 4.774   14.380  12.095  1.00 0.00 ? 112 GLU A HB2  5  
ATOM 8340  H HB3  . GLU A 1 34  ? 5.234   15.745  11.088  1.00 0.00 ? 112 GLU A HB3  5  
ATOM 8341  H HG2  . GLU A 1 34  ? 5.301   17.202  12.843  1.00 0.00 ? 112 GLU A HG2  5  
ATOM 8342  H HG3  . GLU A 1 34  ? 4.117   16.297  13.784  1.00 0.00 ? 112 GLU A HG3  5  
ATOM 8343  N N    . VAL A 1 35  ? 3.134   14.126  9.568   1.00 0.00 ? 113 VAL A N    5  
ATOM 8344  C CA   . VAL A 1 35  ? 3.018   13.770  8.160   1.00 0.00 ? 113 VAL A CA   5  
ATOM 8345  C C    . VAL A 1 35  ? 1.589   13.372  7.810   1.00 0.00 ? 113 VAL A C    5  
ATOM 8346  O O    . VAL A 1 35  ? 0.981   13.937  6.901   1.00 0.00 ? 113 VAL A O    5  
ATOM 8347  C CB   . VAL A 1 35  ? 3.966   12.612  7.793   1.00 0.00 ? 113 VAL A CB   5  
ATOM 8348  C CG1  . VAL A 1 35  ? 3.629   11.370  8.603   1.00 0.00 ? 113 VAL A CG1  5  
ATOM 8349  C CG2  . VAL A 1 35  ? 3.899   12.321  6.302   1.00 0.00 ? 113 VAL A CG2  5  
ATOM 8350  H H    . VAL A 1 35  ? 3.323   13.424  10.225  1.00 0.00 ? 113 VAL A H    5  
ATOM 8351  H HA   . VAL A 1 35  ? 3.295   14.633  7.573   1.00 0.00 ? 113 VAL A HA   5  
ATOM 8352  H HB   . VAL A 1 35  ? 4.976   12.910  8.036   1.00 0.00 ? 113 VAL A HB   5  
ATOM 8353  H HG11 . VAL A 1 35  ? 4.458   10.679  8.564   1.00 0.00 ? 113 VAL A HG11 5  
ATOM 8354  H HG12 . VAL A 1 35  ? 3.440   11.649  9.630   1.00 0.00 ? 113 VAL A HG12 5  
ATOM 8355  H HG13 . VAL A 1 35  ? 2.749   10.899  8.190   1.00 0.00 ? 113 VAL A HG13 5  
ATOM 8356  H HG21 . VAL A 1 35  ? 3.167   12.968  5.842   1.00 0.00 ? 113 VAL A HG21 5  
ATOM 8357  H HG22 . VAL A 1 35  ? 4.867   12.498  5.856   1.00 0.00 ? 113 VAL A HG22 5  
ATOM 8358  H HG23 . VAL A 1 35  ? 3.616   11.290  6.148   1.00 0.00 ? 113 VAL A HG23 5  
ATOM 8359  N N    . SER A 1 36  ? 1.057   12.395  8.538   1.00 0.00 ? 114 SER A N    5  
ATOM 8360  C CA   . SER A 1 36  ? -0.301  11.918  8.302   1.00 0.00 ? 114 SER A CA   5  
ATOM 8361  C C    . SER A 1 36  ? -1.299  12.667  9.180   1.00 0.00 ? 114 SER A C    5  
ATOM 8362  O O    . SER A 1 36  ? -1.928  12.081  10.060  1.00 0.00 ? 114 SER A O    5  
ATOM 8363  C CB   . SER A 1 36  ? -0.391  10.416  8.575   1.00 0.00 ? 114 SER A CB   5  
ATOM 8364  O OG   . SER A 1 36  ? -1.281  9.785   7.671   1.00 0.00 ? 114 SER A OG   5  
ATOM 8365  H H    . SER A 1 36  ? 1.592   11.983  9.248   1.00 0.00 ? 114 SER A H    5  
ATOM 8366  H HA   . SER A 1 36  ? -0.541  12.102  7.266   1.00 0.00 ? 114 SER A HA   5  
ATOM 8367  H HB2  . SER A 1 36  ? 0.587   9.973   8.466   1.00 0.00 ? 114 SER A HB2  5  
ATOM 8368  H HB3  . SER A 1 36  ? -0.748  10.257  9.583   1.00 0.00 ? 114 SER A HB3  5  
ATOM 8369  H HG   . SER A 1 36  ? -1.314  10.286  6.852   1.00 0.00 ? 114 SER A HG   5  
ATOM 8370  N N    . GLN A 1 37  ? -1.438  13.965  8.932   1.00 0.00 ? 115 GLN A N    5  
ATOM 8371  C CA   . GLN A 1 37  ? -2.359  14.795  9.700   1.00 0.00 ? 115 GLN A CA   5  
ATOM 8372  C C    . GLN A 1 37  ? -3.793  14.298  9.551   1.00 0.00 ? 115 GLN A C    5  
ATOM 8373  O O    . GLN A 1 37  ? -4.516  14.158  10.536  1.00 0.00 ? 115 GLN A O    5  
ATOM 8374  C CB   . GLN A 1 37  ? -2.262  16.253  9.248   1.00 0.00 ? 115 GLN A CB   5  
ATOM 8375  C CG   . GLN A 1 37  ? -0.846  16.805  9.271   1.00 0.00 ? 115 GLN A CG   5  
ATOM 8376  C CD   . GLN A 1 37  ? -0.684  18.034  8.397   1.00 0.00 ? 115 GLN A CD   5  
ATOM 8377  O OE1  . GLN A 1 37  ? -1.528  18.321  7.547   1.00 0.00 ? 115 GLN A OE1  5  
ATOM 8378  N NE2  . GLN A 1 37  ? 0.403   18.767  8.603   1.00 0.00 ? 115 GLN A NE2  5  
ATOM 8379  H H    . GLN A 1 37  ? -0.908  14.375  8.217   1.00 0.00 ? 115 GLN A H    5  
ATOM 8380  H HA   . GLN A 1 37  ? -2.075  14.730  10.739  1.00 0.00 ? 115 GLN A HA   5  
ATOM 8381  H HB2  . GLN A 1 37  ? -2.640  16.331  8.239   1.00 0.00 ? 115 GLN A HB2  5  
ATOM 8382  H HB3  . GLN A 1 37  ? -2.872  16.861  9.900   1.00 0.00 ? 115 GLN A HB3  5  
ATOM 8383  H HG2  . GLN A 1 37  ? -0.592  17.069  10.286  1.00 0.00 ? 115 GLN A HG2  5  
ATOM 8384  H HG3  . GLN A 1 37  ? -0.170  16.040  8.919   1.00 0.00 ? 115 GLN A HG3  5  
ATOM 8385  H HE21 . GLN A 1 37  ? 1.033   18.477  9.296   1.00 0.00 ? 115 GLN A HE21 5  
ATOM 8386  H HE22 . GLN A 1 37  ? 0.534   19.566  8.052   1.00 0.00 ? 115 GLN A HE22 5  
ATOM 8387  N N    . GLU A 1 38  ? -4.196  14.033  8.312   1.00 0.00 ? 116 GLU A N    5  
ATOM 8388  C CA   . GLU A 1 38  ? -5.545  13.552  8.035   1.00 0.00 ? 116 GLU A CA   5  
ATOM 8389  C C    . GLU A 1 38  ? -5.774  12.182  8.666   1.00 0.00 ? 116 GLU A C    5  
ATOM 8390  O O    . GLU A 1 38  ? -6.831  11.920  9.242   1.00 0.00 ? 116 GLU A O    5  
ATOM 8391  C CB   . GLU A 1 38  ? -5.784  13.477  6.526   1.00 0.00 ? 116 GLU A CB   5  
ATOM 8392  C CG   . GLU A 1 38  ? -6.081  14.824  5.889   1.00 0.00 ? 116 GLU A CG   5  
ATOM 8393  C CD   . GLU A 1 38  ? -6.601  14.697  4.470   1.00 0.00 ? 116 GLU A CD   5  
ATOM 8394  O OE1  . GLU A 1 38  ? -5.953  14.004  3.659   1.00 0.00 ? 116 GLU A OE1  5  
ATOM 8395  O OE2  . GLU A 1 38  ? -7.659  15.291  4.172   1.00 0.00 ? 116 GLU A OE2  5  
ATOM 8396  H H    . GLU A 1 38  ? -3.573  14.164  7.567   1.00 0.00 ? 116 GLU A H    5  
ATOM 8397  H HA   . GLU A 1 38  ? -6.242  14.254  8.466   1.00 0.00 ? 116 GLU A HA   5  
ATOM 8398  H HB2  . GLU A 1 38  ? -4.904  13.065  6.054   1.00 0.00 ? 116 GLU A HB2  5  
ATOM 8399  H HB3  . GLU A 1 38  ? -6.622  12.822  6.338   1.00 0.00 ? 116 GLU A HB3  5  
ATOM 8400  H HG2  . GLU A 1 38  ? -6.823  15.334  6.484   1.00 0.00 ? 116 GLU A HG2  5  
ATOM 8401  H HG3  . GLU A 1 38  ? -5.172  15.408  5.872   1.00 0.00 ? 116 GLU A HG3  5  
ATOM 8402  N N    . LEU A 1 39  ? -4.778  11.311  8.553   1.00 0.00 ? 117 LEU A N    5  
ATOM 8403  C CA   . LEU A 1 39  ? -4.869  9.966   9.111   1.00 0.00 ? 117 LEU A CA   5  
ATOM 8404  C C    . LEU A 1 39  ? -5.009  10.015  10.630  1.00 0.00 ? 117 LEU A C    5  
ATOM 8405  O O    . LEU A 1 39  ? -5.910  9.401   11.201  1.00 0.00 ? 117 LEU A O    5  
ATOM 8406  C CB   . LEU A 1 39  ? -3.636  9.148   8.727   1.00 0.00 ? 117 LEU A CB   5  
ATOM 8407  C CG   . LEU A 1 39  ? -3.724  7.642   8.978   1.00 0.00 ? 117 LEU A CG   5  
ATOM 8408  C CD1  . LEU A 1 39  ? -5.008  7.077   8.389   1.00 0.00 ? 117 LEU A CD1  5  
ATOM 8409  C CD2  . LEU A 1 39  ? -2.511  6.932   8.396   1.00 0.00 ? 117 LEU A CD2  5  
ATOM 8410  H H    . LEU A 1 39  ? -3.960  11.577  8.083   1.00 0.00 ? 117 LEU A H    5  
ATOM 8411  H HA   . LEU A 1 39  ? -5.748  9.495   8.697   1.00 0.00 ? 117 LEU A HA   5  
ATOM 8412  H HB2  . LEU A 1 39  ? -3.455  9.297   7.674   1.00 0.00 ? 117 LEU A HB2  5  
ATOM 8413  H HB3  . LEU A 1 39  ? -2.797  9.530   9.292   1.00 0.00 ? 117 LEU A HB3  5  
ATOM 8414  H HG   . LEU A 1 39  ? -3.739  7.461   10.044  1.00 0.00 ? 117 LEU A HG   5  
ATOM 8415  H HD11 . LEU A 1 39  ? -5.817  7.215   9.090   1.00 0.00 ? 117 LEU A HD11 5  
ATOM 8416  H HD12 . LEU A 1 39  ? -4.879  6.024   8.190   1.00 0.00 ? 117 LEU A HD12 5  
ATOM 8417  H HD13 . LEU A 1 39  ? -5.238  7.592   7.467   1.00 0.00 ? 117 LEU A HD13 5  
ATOM 8418  H HD21 . LEU A 1 39  ? -1.620  7.267   8.906   1.00 0.00 ? 117 LEU A HD21 5  
ATOM 8419  H HD22 . LEU A 1 39  ? -2.430  7.161   7.343   1.00 0.00 ? 117 LEU A HD22 5  
ATOM 8420  H HD23 . LEU A 1 39  ? -2.621  5.866   8.525   1.00 0.00 ? 117 LEU A HD23 5  
ATOM 8421  N N    . TYR A 1 40  ? -4.112  10.751  11.277  1.00 0.00 ? 118 TYR A N    5  
ATOM 8422  C CA   . TYR A 1 40  ? -4.134  10.881  12.729  1.00 0.00 ? 118 TYR A CA   5  
ATOM 8423  C C    . TYR A 1 40  ? -5.519  11.295  13.218  1.00 0.00 ? 118 TYR A C    5  
ATOM 8424  O O    . TYR A 1 40  ? -6.064  10.701  14.149  1.00 0.00 ? 118 TYR A O    5  
ATOM 8425  C CB   . TYR A 1 40  ? -3.093  11.903  13.187  1.00 0.00 ? 118 TYR A CB   5  
ATOM 8426  C CG   . TYR A 1 40  ? -2.847  11.890  14.679  1.00 0.00 ? 118 TYR A CG   5  
ATOM 8427  C CD1  . TYR A 1 40  ? -2.130  10.860  15.275  1.00 0.00 ? 118 TYR A CD1  5  
ATOM 8428  C CD2  . TYR A 1 40  ? -3.331  12.907  15.492  1.00 0.00 ? 118 TYR A CD2  5  
ATOM 8429  C CE1  . TYR A 1 40  ? -1.903  10.843  16.638  1.00 0.00 ? 118 TYR A CE1  5  
ATOM 8430  C CE2  . TYR A 1 40  ? -3.107  12.899  16.855  1.00 0.00 ? 118 TYR A CE2  5  
ATOM 8431  C CZ   . TYR A 1 40  ? -2.393  11.865  17.423  1.00 0.00 ? 118 TYR A CZ   5  
ATOM 8432  O OH   . TYR A 1 40  ? -2.170  11.853  18.781  1.00 0.00 ? 118 TYR A OH   5  
ATOM 8433  H H    . TYR A 1 40  ? -3.417  11.217  10.766  1.00 0.00 ? 118 TYR A H    5  
ATOM 8434  H HA   . TYR A 1 40  ? -3.889  9.918   13.152  1.00 0.00 ? 118 TYR A HA   5  
ATOM 8435  H HB2  . TYR A 1 40  ? -2.155  11.697  12.695  1.00 0.00 ? 118 TYR A HB2  5  
ATOM 8436  H HB3  . TYR A 1 40  ? -3.427  12.894  12.914  1.00 0.00 ? 118 TYR A HB3  5  
ATOM 8437  H HD1  . TYR A 1 40  ? -1.747  10.060  14.657  1.00 0.00 ? 118 TYR A HD1  5  
ATOM 8438  H HD2  . TYR A 1 40  ? -3.890  13.716  15.043  1.00 0.00 ? 118 TYR A HD2  5  
ATOM 8439  H HE1  . TYR A 1 40  ? -1.344  10.033  17.083  1.00 0.00 ? 118 TYR A HE1  5  
ATOM 8440  H HE2  . TYR A 1 40  ? -3.492  13.700  17.470  1.00 0.00 ? 118 TYR A HE2  5  
ATOM 8441  H HH   . TYR A 1 40  ? -2.480  11.022  19.149  1.00 0.00 ? 118 TYR A HH   5  
ATOM 8442  N N    . ASP A 1 41  ? -6.082  12.316  12.582  1.00 0.00 ? 119 ASP A N    5  
ATOM 8443  C CA   . ASP A 1 41  ? -7.404  12.810  12.950  1.00 0.00 ? 119 ASP A CA   5  
ATOM 8444  C C    . ASP A 1 41  ? -8.394  11.658  13.093  1.00 0.00 ? 119 ASP A C    5  
ATOM 8445  O O    . ASP A 1 41  ? -9.409  11.779  13.780  1.00 0.00 ? 119 ASP A O    5  
ATOM 8446  C CB   . ASP A 1 41  ? -7.909  13.806  11.904  1.00 0.00 ? 119 ASP A CB   5  
ATOM 8447  C CG   . ASP A 1 41  ? -7.328  15.192  12.097  1.00 0.00 ? 119 ASP A CG   5  
ATOM 8448  O OD1  . ASP A 1 41  ? -6.088  15.308  12.183  1.00 0.00 ? 119 ASP A OD1  5  
ATOM 8449  O OD2  . ASP A 1 41  ? -8.113  16.162  12.162  1.00 0.00 ? 119 ASP A OD2  5  
ATOM 8450  H H    . ASP A 1 41  ? -5.598  12.748  11.848  1.00 0.00 ? 119 ASP A H    5  
ATOM 8451  H HA   . ASP A 1 41  ? -7.318  13.314  13.901  1.00 0.00 ? 119 ASP A HA   5  
ATOM 8452  H HB2  . ASP A 1 41  ? -7.635  13.454  10.920  1.00 0.00 ? 119 ASP A HB2  5  
ATOM 8453  H HB3  . ASP A 1 41  ? -8.985  13.873  11.971  1.00 0.00 ? 119 ASP A HB3  5  
ATOM 8454  N N    . LEU A 1 42  ? -8.093  10.542  12.439  1.00 0.00 ? 120 LEU A N    5  
ATOM 8455  C CA   . LEU A 1 42  ? -8.957  9.367   12.492  1.00 0.00 ? 120 LEU A CA   5  
ATOM 8456  C C    . LEU A 1 42  ? -8.561  8.452   13.647  1.00 0.00 ? 120 LEU A C    5  
ATOM 8457  O O    . LEU A 1 42  ? -9.413  7.819   14.269  1.00 0.00 ? 120 LEU A O    5  
ATOM 8458  C CB   . LEU A 1 42  ? -8.889  8.599   11.171  1.00 0.00 ? 120 LEU A CB   5  
ATOM 8459  C CG   . LEU A 1 42  ? -9.306  9.375   9.921   1.00 0.00 ? 120 LEU A CG   5  
ATOM 8460  C CD1  . LEU A 1 42  ? -8.869  8.638   8.665   1.00 0.00 ? 120 LEU A CD1  5  
ATOM 8461  C CD2  . LEU A 1 42  ? -10.811 9.603   9.912   1.00 0.00 ? 120 LEU A CD2  5  
ATOM 8462  H H    . LEU A 1 42  ? -7.271  10.505  11.908  1.00 0.00 ? 120 LEU A H    5  
ATOM 8463  H HA   . LEU A 1 42  ? -9.970  9.708   12.650  1.00 0.00 ? 120 LEU A HA   5  
ATOM 8464  H HB2  . LEU A 1 42  ? -7.870  8.271   11.032  1.00 0.00 ? 120 LEU A HB2  5  
ATOM 8465  H HB3  . LEU A 1 42  ? -9.535  7.737   11.257  1.00 0.00 ? 120 LEU A HB3  5  
ATOM 8466  H HG   . LEU A 1 42  ? -8.821  10.342  9.927   1.00 0.00 ? 120 LEU A HG   5  
ATOM 8467  H HD11 . LEU A 1 42  ? -9.268  9.140   7.796   1.00 0.00 ? 120 LEU A HD11 5  
ATOM 8468  H HD12 . LEU A 1 42  ? -9.238  7.624   8.696   1.00 0.00 ? 120 LEU A HD12 5  
ATOM 8469  H HD13 . LEU A 1 42  ? -7.790  8.627   8.611   1.00 0.00 ? 120 LEU A HD13 5  
ATOM 8470  H HD21 . LEU A 1 42  ? -11.265 8.973   9.161   1.00 0.00 ? 120 LEU A HD21 5  
ATOM 8471  H HD22 . LEU A 1 42  ? -11.016 10.639  9.685   1.00 0.00 ? 120 LEU A HD22 5  
ATOM 8472  H HD23 . LEU A 1 42  ? -11.218 9.358   10.882  1.00 0.00 ? 120 LEU A HD23 5  
ATOM 8473  N N    . ASN A 1 43  ? -7.264  8.390   13.928  1.00 0.00 ? 121 ASN A N    5  
ATOM 8474  C CA   . ASN A 1 43  ? -6.755  7.554   15.009  1.00 0.00 ? 121 ASN A CA   5  
ATOM 8475  C C    . ASN A 1 43  ? -6.771  6.081   14.611  1.00 0.00 ? 121 ASN A C    5  
ATOM 8476  O O    . ASN A 1 43  ? -7.177  5.220   15.392  1.00 0.00 ? 121 ASN A O    5  
ATOM 8477  C CB   . ASN A 1 43  ? -7.587  7.760   16.276  1.00 0.00 ? 121 ASN A CB   5  
ATOM 8478  C CG   . ASN A 1 43  ? -7.965  9.213   16.489  1.00 0.00 ? 121 ASN A CG   5  
ATOM 8479  O OD1  . ASN A 1 43  ? -9.052  9.646   16.106  1.00 0.00 ? 121 ASN A OD1  5  
ATOM 8480  N ND2  . ASN A 1 43  ? -7.066  9.974   17.103  1.00 0.00 ? 121 ASN A ND2  5  
ATOM 8481  H H    . ASN A 1 43  ? -6.633  8.918   13.395  1.00 0.00 ? 121 ASN A H    5  
ATOM 8482  H HA   . ASN A 1 43  ? -5.736  7.850   15.206  1.00 0.00 ? 121 ASN A HA   5  
ATOM 8483  H HB2  . ASN A 1 43  ? -8.495  7.180   16.202  1.00 0.00 ? 121 ASN A HB2  5  
ATOM 8484  H HB3  . ASN A 1 43  ? -7.020  7.425   17.131  1.00 0.00 ? 121 ASN A HB3  5  
ATOM 8485  H HD21 . ASN A 1 43  ? -6.221  9.561   17.380  1.00 0.00 ? 121 ASN A HD21 5  
ATOM 8486  H HD22 . ASN A 1 43  ? -7.285  10.917  17.254  1.00 0.00 ? 121 ASN A HD22 5  
ATOM 8487  N N    . VAL A 1 44  ? -6.327  5.798   13.390  1.00 0.00 ? 122 VAL A N    5  
ATOM 8488  C CA   . VAL A 1 44  ? -6.288  4.430   12.889  1.00 0.00 ? 122 VAL A CA   5  
ATOM 8489  C C    . VAL A 1 44  ? -5.180  3.628   13.563  1.00 0.00 ? 122 VAL A C    5  
ATOM 8490  O O    . VAL A 1 44  ? -4.219  4.195   14.081  1.00 0.00 ? 122 VAL A O    5  
ATOM 8491  C CB   . VAL A 1 44  ? -6.075  4.397   11.364  1.00 0.00 ? 122 VAL A CB   5  
ATOM 8492  C CG1  . VAL A 1 44  ? -4.800  5.136   10.986  1.00 0.00 ? 122 VAL A CG1  5  
ATOM 8493  C CG2  . VAL A 1 44  ? -6.038  2.961   10.862  1.00 0.00 ? 122 VAL A CG2  5  
ATOM 8494  H H    . VAL A 1 44  ? -6.016  6.527   12.814  1.00 0.00 ? 122 VAL A H    5  
ATOM 8495  H HA   . VAL A 1 44  ? -7.239  3.967   13.109  1.00 0.00 ? 122 VAL A HA   5  
ATOM 8496  H HB   . VAL A 1 44  ? -6.908  4.899   10.893  1.00 0.00 ? 122 VAL A HB   5  
ATOM 8497  H HG11 . VAL A 1 44  ? -4.991  6.199   10.973  1.00 0.00 ? 122 VAL A HG11 5  
ATOM 8498  H HG12 . VAL A 1 44  ? -4.029  4.915   11.709  1.00 0.00 ? 122 VAL A HG12 5  
ATOM 8499  H HG13 . VAL A 1 44  ? -4.477  4.817   10.006  1.00 0.00 ? 122 VAL A HG13 5  
ATOM 8500  H HG21 . VAL A 1 44  ? -6.875  2.416   11.271  1.00 0.00 ? 122 VAL A HG21 5  
ATOM 8501  H HG22 . VAL A 1 44  ? -6.097  2.955   9.783   1.00 0.00 ? 122 VAL A HG22 5  
ATOM 8502  H HG23 . VAL A 1 44  ? -5.116  2.494   11.174  1.00 0.00 ? 122 VAL A HG23 5  
ATOM 8503  N N    . GLU A 1 45  ? -5.322  2.307   13.551  1.00 0.00 ? 123 GLU A N    5  
ATOM 8504  C CA   . GLU A 1 45  ? -4.332  1.427   14.161  1.00 0.00 ? 123 GLU A CA   5  
ATOM 8505  C C    . GLU A 1 45  ? -4.181  0.138   13.359  1.00 0.00 ? 123 GLU A C    5  
ATOM 8506  O O    . GLU A 1 45  ? -5.151  -0.589  13.142  1.00 0.00 ? 123 GLU A O    5  
ATOM 8507  C CB   . GLU A 1 45  ? -4.728  1.101   15.603  1.00 0.00 ? 123 GLU A CB   5  
ATOM 8508  C CG   . GLU A 1 45  ? -4.710  2.306   16.527  1.00 0.00 ? 123 GLU A CG   5  
ATOM 8509  C CD   . GLU A 1 45  ? -4.651  1.918   17.992  1.00 0.00 ? 123 GLU A CD   5  
ATOM 8510  O OE1  . GLU A 1 45  ? -5.680  1.456   18.526  1.00 0.00 ? 123 GLU A OE1  5  
ATOM 8511  O OE2  . GLU A 1 45  ? -3.573  2.077   18.604  1.00 0.00 ? 123 GLU A OE2  5  
ATOM 8512  H H    . GLU A 1 45  ? -6.110  1.914   13.122  1.00 0.00 ? 123 GLU A H    5  
ATOM 8513  H HA   . GLU A 1 45  ? -3.385  1.947   14.167  1.00 0.00 ? 123 GLU A HA   5  
ATOM 8514  H HB2  . GLU A 1 45  ? -5.725  0.686   15.605  1.00 0.00 ? 123 GLU A HB2  5  
ATOM 8515  H HB3  . GLU A 1 45  ? -4.041  0.364   15.993  1.00 0.00 ? 123 GLU A HB3  5  
ATOM 8516  H HG2  . GLU A 1 45  ? -3.845  2.909   16.295  1.00 0.00 ? 123 GLU A HG2  5  
ATOM 8517  H HG3  . GLU A 1 45  ? -5.606  2.886   16.360  1.00 0.00 ? 123 GLU A HG3  5  
ATOM 8518  N N    . LEU A 1 46  ? -2.958  -0.139  12.921  1.00 0.00 ? 124 LEU A N    5  
ATOM 8519  C CA   . LEU A 1 46  ? -2.678  -1.340  12.142  1.00 0.00 ? 124 LEU A CA   5  
ATOM 8520  C C    . LEU A 1 46  ? -2.957  -2.597  12.960  1.00 0.00 ? 124 LEU A C    5  
ATOM 8521  O O    . LEU A 1 46  ? -2.745  -2.620  14.172  1.00 0.00 ? 124 LEU A O    5  
ATOM 8522  C CB   . LEU A 1 46  ? -1.223  -1.338  11.669  1.00 0.00 ? 124 LEU A CB   5  
ATOM 8523  C CG   . LEU A 1 46  ? -0.918  -0.482  10.439  1.00 0.00 ? 124 LEU A CG   5  
ATOM 8524  C CD1  . LEU A 1 46  ? 0.577   -0.227  10.324  1.00 0.00 ? 124 LEU A CD1  5  
ATOM 8525  C CD2  . LEU A 1 46  ? -1.446  -1.152  9.179   1.00 0.00 ? 124 LEU A CD2  5  
ATOM 8526  H H    . LEU A 1 46  ? -2.225  0.478   13.125  1.00 0.00 ? 124 LEU A H    5  
ATOM 8527  H HA   . LEU A 1 46  ? -3.328  -1.334  11.279  1.00 0.00 ? 124 LEU A HA   5  
ATOM 8528  H HB2  . LEU A 1 46  ? -0.612  -0.978  12.482  1.00 0.00 ? 124 LEU A HB2  5  
ATOM 8529  H HB3  . LEU A 1 46  ? -0.949  -2.358  11.440  1.00 0.00 ? 124 LEU A HB3  5  
ATOM 8530  H HG   . LEU A 1 46  ? -1.412  0.475   10.543  1.00 0.00 ? 124 LEU A HG   5  
ATOM 8531  H HD11 . LEU A 1 46  ? 1.103   -0.837  11.043  1.00 0.00 ? 124 LEU A HD11 5  
ATOM 8532  H HD12 . LEU A 1 46  ? 0.780   0.815   10.518  1.00 0.00 ? 124 LEU A HD12 5  
ATOM 8533  H HD13 . LEU A 1 46  ? 0.909   -0.479  9.327   1.00 0.00 ? 124 LEU A HD13 5  
ATOM 8534  H HD21 . LEU A 1 46  ? -1.023  -2.142  9.094   1.00 0.00 ? 124 LEU A HD21 5  
ATOM 8535  H HD22 . LEU A 1 46  ? -1.165  -0.566  8.316   1.00 0.00 ? 124 LEU A HD22 5  
ATOM 8536  H HD23 . LEU A 1 46  ? -2.522  -1.222  9.233   1.00 0.00 ? 124 LEU A HD23 5  
ATOM 8537  N N    . SER A 1 47  ? -3.431  -3.641  12.288  1.00 0.00 ? 125 SER A N    5  
ATOM 8538  C CA   . SER A 1 47  ? -3.741  -4.901  12.952  1.00 0.00 ? 125 SER A CA   5  
ATOM 8539  C C    . SER A 1 47  ? -2.809  -6.011  12.474  1.00 0.00 ? 125 SER A C    5  
ATOM 8540  O O    . SER A 1 47  ? -2.413  -6.882  13.249  1.00 0.00 ? 125 SER A O    5  
ATOM 8541  C CB   . SER A 1 47  ? -5.196  -5.295  12.693  1.00 0.00 ? 125 SER A CB   5  
ATOM 8542  O OG   . SER A 1 47  ? -5.394  -5.653  11.336  1.00 0.00 ? 125 SER A OG   5  
ATOM 8543  H H    . SER A 1 47  ? -3.579  -3.560  11.322  1.00 0.00 ? 125 SER A H    5  
ATOM 8544  H HA   . SER A 1 47  ? -3.599  -4.760  14.013  1.00 0.00 ? 125 SER A HA   5  
ATOM 8545  H HB2  . SER A 1 47  ? -5.455  -6.137  13.316  1.00 0.00 ? 125 SER A HB2  5  
ATOM 8546  H HB3  . SER A 1 47  ? -5.840  -4.460  12.930  1.00 0.00 ? 125 SER A HB3  5  
ATOM 8547  H HG   . SER A 1 47  ? -5.700  -4.888  10.844  1.00 0.00 ? 125 SER A HG   5  
ATOM 8548  N N    . LYS A 1 48  ? -2.462  -5.972  11.192  1.00 0.00 ? 126 LYS A N    5  
ATOM 8549  C CA   . LYS A 1 48  ? -1.576  -6.971  10.608  1.00 0.00 ? 126 LYS A CA   5  
ATOM 8550  C C    . LYS A 1 48  ? -1.222  -6.610  9.169   1.00 0.00 ? 126 LYS A C    5  
ATOM 8551  O O    . LYS A 1 48  ? -1.962  -5.890  8.499   1.00 0.00 ? 126 LYS A O    5  
ATOM 8552  C CB   . LYS A 1 48  ? -2.233  -8.353  10.652  1.00 0.00 ? 126 LYS A CB   5  
ATOM 8553  C CG   . LYS A 1 48  ? -3.480  -8.461  9.791   1.00 0.00 ? 126 LYS A CG   5  
ATOM 8554  C CD   . LYS A 1 48  ? -3.974  -9.895  9.702   1.00 0.00 ? 126 LYS A CD   5  
ATOM 8555  C CE   . LYS A 1 48  ? -4.733  -10.302 10.955  1.00 0.00 ? 126 LYS A CE   5  
ATOM 8556  N NZ   . LYS A 1 48  ? -5.234  -11.702 10.870  1.00 0.00 ? 126 LYS A NZ   5  
ATOM 8557  H H    . LYS A 1 48  ? -2.810  -5.252  10.625  1.00 0.00 ? 126 LYS A H    5  
ATOM 8558  H HA   . LYS A 1 48  ? -0.670  -6.994  11.194  1.00 0.00 ? 126 LYS A HA   5  
ATOM 8559  H HB2  . LYS A 1 48  ? -1.520  -9.088  10.309  1.00 0.00 ? 126 LYS A HB2  5  
ATOM 8560  H HB3  . LYS A 1 48  ? -2.506  -8.577  11.673  1.00 0.00 ? 126 LYS A HB3  5  
ATOM 8561  H HG2  . LYS A 1 48  ? -4.259  -7.850  10.223  1.00 0.00 ? 126 LYS A HG2  5  
ATOM 8562  H HG3  . LYS A 1 48  ? -3.251  -8.105  8.796   1.00 0.00 ? 126 LYS A HG3  5  
ATOM 8563  H HD2  . LYS A 1 48  ? -4.631  -9.988  8.851   1.00 0.00 ? 126 LYS A HD2  5  
ATOM 8564  H HD3  . LYS A 1 48  ? -3.124  -10.552 9.576   1.00 0.00 ? 126 LYS A HD3  5  
ATOM 8565  H HE2  . LYS A 1 48  ? -4.072  -10.217 11.804  1.00 0.00 ? 126 LYS A HE2  5  
ATOM 8566  H HE3  . LYS A 1 48  ? -5.572  -9.635  11.084  1.00 0.00 ? 126 LYS A HE3  5  
ATOM 8567  H HZ1  . LYS A 1 48  ? -4.711  -12.309 11.533  1.00 0.00 ? 126 LYS A HZ1  5  
ATOM 8568  H HZ2  . LYS A 1 48  ? -5.104  -12.070 9.906   1.00 0.00 ? 126 LYS A HZ2  5  
ATOM 8569  H HZ3  . LYS A 1 48  ? -6.245  -11.735 11.110  1.00 0.00 ? 126 LYS A HZ3  5  
ATOM 8570  N N    . VAL A 1 49  ? -0.086  -7.116  8.699   1.00 0.00 ? 127 VAL A N    5  
ATOM 8571  C CA   . VAL A 1 49  ? 0.365   -6.849  7.339   1.00 0.00 ? 127 VAL A CA   5  
ATOM 8572  C C    . VAL A 1 49  ? 0.638   -8.146  6.586   1.00 0.00 ? 127 VAL A C    5  
ATOM 8573  O O    . VAL A 1 49  ? 1.301   -9.047  7.100   1.00 0.00 ? 127 VAL A O    5  
ATOM 8574  C CB   . VAL A 1 49  ? 1.639   -5.984  7.329   1.00 0.00 ? 127 VAL A CB   5  
ATOM 8575  C CG1  . VAL A 1 49  ? 2.146   -5.796  5.908   1.00 0.00 ? 127 VAL A CG1  5  
ATOM 8576  C CG2  . VAL A 1 49  ? 1.376   -4.641  7.993   1.00 0.00 ? 127 VAL A CG2  5  
ATOM 8577  H H    . VAL A 1 49  ? 0.461   -7.684  9.281   1.00 0.00 ? 127 VAL A H    5  
ATOM 8578  H HA   . VAL A 1 49  ? -0.417  -6.306  6.828   1.00 0.00 ? 127 VAL A HA   5  
ATOM 8579  H HB   . VAL A 1 49  ? 2.403   -6.498  7.895   1.00 0.00 ? 127 VAL A HB   5  
ATOM 8580  H HG11 . VAL A 1 49  ? 1.906   -4.798  5.570   1.00 0.00 ? 127 VAL A HG11 5  
ATOM 8581  H HG12 . VAL A 1 49  ? 3.217   -5.937  5.885   1.00 0.00 ? 127 VAL A HG12 5  
ATOM 8582  H HG13 . VAL A 1 49  ? 1.674   -6.518  5.258   1.00 0.00 ? 127 VAL A HG13 5  
ATOM 8583  H HG21 . VAL A 1 49  ? 1.491   -3.852  7.265   1.00 0.00 ? 127 VAL A HG21 5  
ATOM 8584  H HG22 . VAL A 1 49  ? 0.370   -4.624  8.386   1.00 0.00 ? 127 VAL A HG22 5  
ATOM 8585  H HG23 . VAL A 1 49  ? 2.079   -4.493  8.799   1.00 0.00 ? 127 VAL A HG23 5  
ATOM 8586  N N    . SER A 1 50  ? 0.124   -8.234  5.363   1.00 0.00 ? 128 SER A N    5  
ATOM 8587  C CA   . SER A 1 50  ? 0.310   -9.423  4.539   1.00 0.00 ? 128 SER A CA   5  
ATOM 8588  C C    . SER A 1 50  ? 1.184   -9.113  3.328   1.00 0.00 ? 128 SER A C    5  
ATOM 8589  O O    . SER A 1 50  ? 0.828   -8.288  2.486   1.00 0.00 ? 128 SER A O    5  
ATOM 8590  C CB   . SER A 1 50  ? -1.044  -9.968  4.080   1.00 0.00 ? 128 SER A CB   5  
ATOM 8591  O OG   . SER A 1 50  ? -0.954  -11.342 3.745   1.00 0.00 ? 128 SER A OG   5  
ATOM 8592  H H    . SER A 1 50  ? -0.395  -7.482  5.008   1.00 0.00 ? 128 SER A H    5  
ATOM 8593  H HA   . SER A 1 50  ? 0.803   -10.170 5.142   1.00 0.00 ? 128 SER A HA   5  
ATOM 8594  H HB2  . SER A 1 50  ? -1.765  -9.850  4.875   1.00 0.00 ? 128 SER A HB2  5  
ATOM 8595  H HB3  . SER A 1 50  ? -1.374  -9.419  3.210   1.00 0.00 ? 128 SER A HB3  5  
ATOM 8596  H HG   . SER A 1 50  ? -1.529  -11.529 3.000   1.00 0.00 ? 128 SER A HG   5  
ATOM 8597  N N    . LEU A 1 51  ? 2.329   -9.780  3.246   1.00 0.00 ? 129 LEU A N    5  
ATOM 8598  C CA   . LEU A 1 51  ? 3.256   -9.577  2.138   1.00 0.00 ? 129 LEU A CA   5  
ATOM 8599  C C    . LEU A 1 51  ? 3.308   -10.809 1.239   1.00 0.00 ? 129 LEU A C    5  
ATOM 8600  O O    . LEU A 1 51  ? 3.275   -11.943 1.718   1.00 0.00 ? 129 LEU A O    5  
ATOM 8601  C CB   . LEU A 1 51  ? 4.655   -9.260  2.669   1.00 0.00 ? 129 LEU A CB   5  
ATOM 8602  C CG   . LEU A 1 51  ? 5.771   -9.202  1.625   1.00 0.00 ? 129 LEU A CG   5  
ATOM 8603  C CD1  . LEU A 1 51  ? 5.725   -7.885  0.866   1.00 0.00 ? 129 LEU A CD1  5  
ATOM 8604  C CD2  . LEU A 1 51  ? 7.129   -9.390  2.286   1.00 0.00 ? 129 LEU A CD2  5  
ATOM 8605  H H    . LEU A 1 51  ? 2.559   -10.425 3.947   1.00 0.00 ? 129 LEU A H    5  
ATOM 8606  H HA   . LEU A 1 51  ? 2.900   -8.739  1.558   1.00 0.00 ? 129 LEU A HA   5  
ATOM 8607  H HB2  . LEU A 1 51  ? 4.612   -8.300  3.160   1.00 0.00 ? 129 LEU A HB2  5  
ATOM 8608  H HB3  . LEU A 1 51  ? 4.915   -10.021 3.391   1.00 0.00 ? 129 LEU A HB3  5  
ATOM 8609  H HG   . LEU A 1 51  ? 5.631   -10.002 0.912   1.00 0.00 ? 129 LEU A HG   5  
ATOM 8610  H HD11 . LEU A 1 51  ? 6.022   -7.081  1.522   1.00 0.00 ? 129 LEU A HD11 5  
ATOM 8611  H HD12 . LEU A 1 51  ? 4.719   -7.708  0.513   1.00 0.00 ? 129 LEU A HD12 5  
ATOM 8612  H HD13 . LEU A 1 51  ? 6.399   -7.931  0.023   1.00 0.00 ? 129 LEU A HD13 5  
ATOM 8613  H HD21 . LEU A 1 51  ? 7.641   -8.440  2.334   1.00 0.00 ? 129 LEU A HD21 5  
ATOM 8614  H HD22 . LEU A 1 51  ? 7.718   -10.087 1.707   1.00 0.00 ? 129 LEU A HD22 5  
ATOM 8615  H HD23 . LEU A 1 51  ? 6.993   -9.777  3.285   1.00 0.00 ? 129 LEU A HD23 5  
ATOM 8616  N N    . THR A 1 52  ? 3.392   -10.579 -0.067  1.00 0.00 ? 130 THR A N    5  
ATOM 8617  C CA   . THR A 1 52  ? 3.451   -11.669 -1.033  1.00 0.00 ? 130 THR A CA   5  
ATOM 8618  C C    . THR A 1 52  ? 4.779   -12.411 -0.945  1.00 0.00 ? 130 THR A C    5  
ATOM 8619  O O    . THR A 1 52  ? 5.790   -11.872 -0.493  1.00 0.00 ? 130 THR A O    5  
ATOM 8620  C CB   . THR A 1 52  ? 3.256   -11.155 -2.472  1.00 0.00 ? 130 THR A CB   5  
ATOM 8621  O OG1  . THR A 1 52  ? 3.896   -9.883  -2.629  1.00 0.00 ? 130 THR A OG1  5  
ATOM 8622  C CG2  . THR A 1 52  ? 1.778   -11.029 -2.807  1.00 0.00 ? 130 THR A CG2  5  
ATOM 8623  H H    . THR A 1 52  ? 3.415   -9.653  -0.388  1.00 0.00 ? 130 THR A H    5  
ATOM 8624  H HA   . THR A 1 52  ? 2.649   -12.357 -0.808  1.00 0.00 ? 130 THR A HA   5  
ATOM 8625  H HB   . THR A 1 52  ? 3.706   -11.862 -3.154  1.00 0.00 ? 130 THR A HB   5  
ATOM 8626  H HG1  . THR A 1 52  ? 3.251   -9.183  -2.502  1.00 0.00 ? 130 THR A HG1  5  
ATOM 8627  H HG21 . THR A 1 52  ? 1.635   -10.218 -3.506  1.00 0.00 ? 130 THR A HG21 5  
ATOM 8628  H HG22 . THR A 1 52  ? 1.220   -10.830 -1.904  1.00 0.00 ? 130 THR A HG22 5  
ATOM 8629  H HG23 . THR A 1 52  ? 1.430   -11.951 -3.249  1.00 0.00 ? 130 THR A HG23 5  
ATOM 8630  N N    . PRO A 1 53  ? 4.781   -13.677 -1.388  1.00 0.00 ? 131 PRO A N    5  
ATOM 8631  C CA   . PRO A 1 53  ? 5.981   -14.519 -1.371  1.00 0.00 ? 131 PRO A CA   5  
ATOM 8632  C C    . PRO A 1 53  ? 7.026   -14.061 -2.382  1.00 0.00 ? 131 PRO A C    5  
ATOM 8633  O O    . PRO A 1 53  ? 8.218   -14.325 -2.221  1.00 0.00 ? 131 PRO A O    5  
ATOM 8634  C CB   . PRO A 1 53  ? 5.447   -15.904 -1.746  1.00 0.00 ? 131 PRO A CB   5  
ATOM 8635  C CG   . PRO A 1 53  ? 4.207   -15.634 -2.527  1.00 0.00 ? 131 PRO A CG   5  
ATOM 8636  C CD   . PRO A 1 53  ? 3.613   -14.383 -1.941  1.00 0.00 ? 131 PRO A CD   5  
ATOM 8637  H HA   . PRO A 1 53  ? 6.425   -14.557 -0.388  1.00 0.00 ? 131 PRO A HA   5  
ATOM 8638  H HB2  . PRO A 1 53  ? 6.182   -16.428 -2.339  1.00 0.00 ? 131 PRO A HB2  5  
ATOM 8639  H HB3  . PRO A 1 53  ? 5.233   -16.466 -0.849  1.00 0.00 ? 131 PRO A HB3  5  
ATOM 8640  H HG2  . PRO A 1 53  ? 4.454   -15.480 -3.566  1.00 0.00 ? 131 PRO A HG2  5  
ATOM 8641  H HG3  . PRO A 1 53  ? 3.520   -16.460 -2.421  1.00 0.00 ? 131 PRO A HG3  5  
ATOM 8642  H HD2  . PRO A 1 53  ? 3.136   -13.795 -2.711  1.00 0.00 ? 131 PRO A HD2  5  
ATOM 8643  H HD3  . PRO A 1 53  ? 2.908   -14.629 -1.160  1.00 0.00 ? 131 PRO A HD3  5  
ATOM 8644  N N    . ASP A 1 54  ? 6.573   -13.372 -3.424  1.00 0.00 ? 132 ASP A N    5  
ATOM 8645  C CA   . ASP A 1 54  ? 7.469   -12.875 -4.461  1.00 0.00 ? 132 ASP A CA   5  
ATOM 8646  C C    . ASP A 1 54  ? 8.074   -11.534 -4.059  1.00 0.00 ? 132 ASP A C    5  
ATOM 8647  O O    . ASP A 1 54  ? 8.796   -10.908 -4.836  1.00 0.00 ? 132 ASP A O    5  
ATOM 8648  C CB   . ASP A 1 54  ? 6.721   -12.734 -5.787  1.00 0.00 ? 132 ASP A CB   5  
ATOM 8649  C CG   . ASP A 1 54  ? 6.573   -14.057 -6.512  1.00 0.00 ? 132 ASP A CG   5  
ATOM 8650  O OD1  . ASP A 1 54  ? 7.590   -14.570 -7.026  1.00 0.00 ? 132 ASP A OD1  5  
ATOM 8651  O OD2  . ASP A 1 54  ? 5.441   -14.581 -6.565  1.00 0.00 ? 132 ASP A OD2  5  
ATOM 8652  H H    . ASP A 1 54  ? 5.611   -13.193 -3.497  1.00 0.00 ? 132 ASP A H    5  
ATOM 8653  H HA   . ASP A 1 54  ? 8.266   -13.593 -4.582  1.00 0.00 ? 132 ASP A HA   5  
ATOM 8654  H HB2  . ASP A 1 54  ? 5.735   -12.337 -5.597  1.00 0.00 ? 132 ASP A HB2  5  
ATOM 8655  H HB3  . ASP A 1 54  ? 7.262   -12.052 -6.427  1.00 0.00 ? 132 ASP A HB3  5  
ATOM 8656  N N    . PHE A 1 55  ? 7.774   -11.096 -2.840  1.00 0.00 ? 133 PHE A N    5  
ATOM 8657  C CA   . PHE A 1 55  ? 8.287   -9.828  -2.335  1.00 0.00 ? 133 PHE A CA   5  
ATOM 8658  C C    . PHE A 1 55  ? 7.935   -8.684  -3.282  1.00 0.00 ? 133 PHE A C    5  
ATOM 8659  O O    . PHE A 1 55  ? 8.622   -7.663  -3.320  1.00 0.00 ? 133 PHE A O    5  
ATOM 8660  C CB   . PHE A 1 55  ? 9.804   -9.904  -2.150  1.00 0.00 ? 133 PHE A CB   5  
ATOM 8661  C CG   . PHE A 1 55  ? 10.218  -10.405 -0.796  1.00 0.00 ? 133 PHE A CG   5  
ATOM 8662  C CD1  . PHE A 1 55  ? 9.770   -9.779  0.356   1.00 0.00 ? 133 PHE A CD1  5  
ATOM 8663  C CD2  . PHE A 1 55  ? 11.055  -11.502 -0.675  1.00 0.00 ? 133 PHE A CD2  5  
ATOM 8664  C CE1  . PHE A 1 55  ? 10.150  -10.238 1.603   1.00 0.00 ? 133 PHE A CE1  5  
ATOM 8665  C CE2  . PHE A 1 55  ? 11.438  -11.966 0.570   1.00 0.00 ? 133 PHE A CE2  5  
ATOM 8666  C CZ   . PHE A 1 55  ? 10.984  -11.333 1.710   1.00 0.00 ? 133 PHE A CZ   5  
ATOM 8667  H H    . PHE A 1 55  ? 7.194   -11.640 -2.267  1.00 0.00 ? 133 PHE A H    5  
ATOM 8668  H HA   . PHE A 1 55  ? 7.825   -9.642  -1.378  1.00 0.00 ? 133 PHE A HA   5  
ATOM 8669  H HB2  . PHE A 1 55  ? 10.217  -10.572 -2.891  1.00 0.00 ? 133 PHE A HB2  5  
ATOM 8670  H HB3  . PHE A 1 55  ? 10.225  -8.919  -2.284  1.00 0.00 ? 133 PHE A HB3  5  
ATOM 8671  H HD1  . PHE A 1 55  ? 9.116   -8.923  0.274   1.00 0.00 ? 133 PHE A HD1  5  
ATOM 8672  H HD2  . PHE A 1 55  ? 11.410  -11.999 -1.567  1.00 0.00 ? 133 PHE A HD2  5  
ATOM 8673  H HE1  . PHE A 1 55  ? 9.793   -9.741  2.493   1.00 0.00 ? 133 PHE A HE1  5  
ATOM 8674  H HE2  . PHE A 1 55  ? 12.091  -12.823 0.649   1.00 0.00 ? 133 PHE A HE2  5  
ATOM 8675  H HZ   . PHE A 1 55  ? 11.283  -11.693 2.683   1.00 0.00 ? 133 PHE A HZ   5  
ATOM 8676  N N    . SER A 1 56  ? 6.861   -8.863  -4.044  1.00 0.00 ? 134 SER A N    5  
ATOM 8677  C CA   . SER A 1 56  ? 6.420   -7.849  -4.994  1.00 0.00 ? 134 SER A CA   5  
ATOM 8678  C C    . SER A 1 56  ? 5.440   -6.881  -4.339  1.00 0.00 ? 134 SER A C    5  
ATOM 8679  O O    . SER A 1 56  ? 5.790   -5.744  -4.024  1.00 0.00 ? 134 SER A O    5  
ATOM 8680  C CB   . SER A 1 56  ? 5.767   -8.508  -6.210  1.00 0.00 ? 134 SER A CB   5  
ATOM 8681  O OG   . SER A 1 56  ? 5.114   -7.548  -7.022  1.00 0.00 ? 134 SER A OG   5  
ATOM 8682  H H    . SER A 1 56  ? 6.355   -9.699  -3.967  1.00 0.00 ? 134 SER A H    5  
ATOM 8683  H HA   . SER A 1 56  ? 7.290   -7.298  -5.318  1.00 0.00 ? 134 SER A HA   5  
ATOM 8684  H HB2  . SER A 1 56  ? 6.525   -9.004  -6.798  1.00 0.00 ? 134 SER A HB2  5  
ATOM 8685  H HB3  . SER A 1 56  ? 5.040   -9.234  -5.876  1.00 0.00 ? 134 SER A HB3  5  
ATOM 8686  H HG   . SER A 1 56  ? 5.635   -6.741  -7.046  1.00 0.00 ? 134 SER A HG   5  
ATOM 8687  N N    . ALA A 1 57  ? 4.210   -7.340  -4.137  1.00 0.00 ? 135 ALA A N    5  
ATOM 8688  C CA   . ALA A 1 57  ? 3.178   -6.517  -3.517  1.00 0.00 ? 135 ALA A CA   5  
ATOM 8689  C C    . ALA A 1 57  ? 3.178   -6.686  -2.002  1.00 0.00 ? 135 ALA A C    5  
ATOM 8690  O O    . ALA A 1 57  ? 3.556   -7.738  -1.485  1.00 0.00 ? 135 ALA A O    5  
ATOM 8691  C CB   . ALA A 1 57  ? 1.812   -6.864  -4.090  1.00 0.00 ? 135 ALA A CB   5  
ATOM 8692  H H    . ALA A 1 57  ? 3.991   -8.256  -4.409  1.00 0.00 ? 135 ALA A H    5  
ATOM 8693  H HA   . ALA A 1 57  ? 3.389   -5.484  -3.754  1.00 0.00 ? 135 ALA A HA   5  
ATOM 8694  H HB1  . ALA A 1 57  ? 1.886   -6.959  -5.163  1.00 0.00 ? 135 ALA A HB1  5  
ATOM 8695  H HB2  . ALA A 1 57  ? 1.471   -7.797  -3.668  1.00 0.00 ? 135 ALA A HB2  5  
ATOM 8696  H HB3  . ALA A 1 57  ? 1.111   -6.080  -3.846  1.00 0.00 ? 135 ALA A HB3  5  
ATOM 8697  N N    . CYS A 1 58  ? 2.751   -5.645  -1.296  1.00 0.00 ? 136 CYS A N    5  
ATOM 8698  C CA   . CYS A 1 58  ? 2.703   -5.678  0.162   1.00 0.00 ? 136 CYS A CA   5  
ATOM 8699  C C    . CYS A 1 58  ? 1.348   -5.197  0.672   1.00 0.00 ? 136 CYS A C    5  
ATOM 8700  O O    . CYS A 1 58  ? 1.079   -3.997  0.710   1.00 0.00 ? 136 CYS A O    5  
ATOM 8701  C CB   . CYS A 1 58  ? 3.819   -4.813  0.750   1.00 0.00 ? 136 CYS A CB   5  
ATOM 8702  S SG   . CYS A 1 58  ? 3.794   -4.701  2.554   1.00 0.00 ? 136 CYS A SG   5  
ATOM 8703  H H    . CYS A 1 58  ? 2.463   -4.834  -1.765  1.00 0.00 ? 136 CYS A H    5  
ATOM 8704  H HA   . CYS A 1 58  ? 2.849   -6.701  0.474   1.00 0.00 ? 136 CYS A HA   5  
ATOM 8705  H HB2  . CYS A 1 58  ? 4.774   -5.226  0.460   1.00 0.00 ? 136 CYS A HB2  5  
ATOM 8706  H HB3  . CYS A 1 58  ? 3.733   -3.811  0.355   1.00 0.00 ? 136 CYS A HB3  5  
ATOM 8707  H HG   . CYS A 1 58  ? 3.605   -3.432  2.882   1.00 0.00 ? 136 CYS A HG   5  
ATOM 8708  N N    . ARG A 1 59  ? 0.499   -6.143  1.062   1.00 0.00 ? 137 ARG A N    5  
ATOM 8709  C CA   . ARG A 1 59  ? -0.829  -5.816  1.567   1.00 0.00 ? 137 ARG A CA   5  
ATOM 8710  C C    . ARG A 1 59  ? -0.782  -5.509  3.061   1.00 0.00 ? 137 ARG A C    5  
ATOM 8711  O O    . ARG A 1 59  ? -0.049  -6.150  3.813   1.00 0.00 ? 137 ARG A O    5  
ATOM 8712  C CB   . ARG A 1 59  ? -1.797  -6.970  1.302   1.00 0.00 ? 137 ARG A CB   5  
ATOM 8713  C CG   . ARG A 1 59  ? -2.410  -6.945  -0.089  1.00 0.00 ? 137 ARG A CG   5  
ATOM 8714  C CD   . ARG A 1 59  ? -1.538  -7.680  -1.095  1.00 0.00 ? 137 ARG A CD   5  
ATOM 8715  N NE   . ARG A 1 59  ? -1.450  -9.108  -0.802  1.00 0.00 ? 137 ARG A NE   5  
ATOM 8716  C CZ   . ARG A 1 59  ? -1.035  -10.014 -1.681  1.00 0.00 ? 137 ARG A CZ   5  
ATOM 8717  N NH1  . ARG A 1 59  ? -0.672  -9.642  -2.901  1.00 0.00 ? 137 ARG A NH1  5  
ATOM 8718  N NH2  . ARG A 1 59  ? -0.983  -11.295 -1.340  1.00 0.00 ? 137 ARG A NH2  5  
ATOM 8719  H H    . ARG A 1 59  ? 0.772   -7.082  1.008   1.00 0.00 ? 137 ARG A H    5  
ATOM 8720  H HA   . ARG A 1 59  ? -1.177  -4.939  1.042   1.00 0.00 ? 137 ARG A HA   5  
ATOM 8721  H HB2  . ARG A 1 59  ? -1.266  -7.904  1.420   1.00 0.00 ? 137 ARG A HB2  5  
ATOM 8722  H HB3  . ARG A 1 59  ? -2.597  -6.926  2.025   1.00 0.00 ? 137 ARG A HB3  5  
ATOM 8723  H HG2  . ARG A 1 59  ? -3.379  -7.420  -0.054  1.00 0.00 ? 137 ARG A HG2  5  
ATOM 8724  H HG3  . ARG A 1 59  ? -2.521  -5.918  -0.404  1.00 0.00 ? 137 ARG A HG3  5  
ATOM 8725  H HD2  . ARG A 1 59  ? -1.961  -7.550  -2.080  1.00 0.00 ? 137 ARG A HD2  5  
ATOM 8726  H HD3  . ARG A 1 59  ? -0.546  -7.255  -1.070  1.00 0.00 ? 137 ARG A HD3  5  
ATOM 8727  H HE   . ARG A 1 59  ? -1.714  -9.405  0.093   1.00 0.00 ? 137 ARG A HE   5  
ATOM 8728  H HH11 . ARG A 1 59  ? -0.710  -8.677  -3.160  1.00 0.00 ? 137 ARG A HH11 5  
ATOM 8729  H HH12 . ARG A 1 59  ? -0.359  -10.326 -3.560  1.00 0.00 ? 137 ARG A HH12 5  
ATOM 8730  H HH21 . ARG A 1 59  ? -1.255  -11.580 -0.421  1.00 0.00 ? 137 ARG A HH21 5  
ATOM 8731  H HH22 . ARG A 1 59  ? -0.671  -11.976 -2.001  1.00 0.00 ? 137 ARG A HH22 5  
ATOM 8732  N N    . ALA A 1 60  ? -1.569  -4.525  3.482   1.00 0.00 ? 138 ALA A N    5  
ATOM 8733  C CA   . ALA A 1 60  ? -1.619  -4.135  4.886   1.00 0.00 ? 138 ALA A CA   5  
ATOM 8734  C C    . ALA A 1 60  ? -3.059  -4.041  5.379   1.00 0.00 ? 138 ALA A C    5  
ATOM 8735  O O    . ALA A 1 60  ? -3.881  -3.337  4.793   1.00 0.00 ? 138 ALA A O    5  
ATOM 8736  C CB   . ALA A 1 60  ? -0.901  -2.809  5.091   1.00 0.00 ? 138 ALA A CB   5  
ATOM 8737  H H    . ALA A 1 60  ? -2.131  -4.052  2.834   1.00 0.00 ? 138 ALA A H    5  
ATOM 8738  H HA   . ALA A 1 60  ? -1.101  -4.889  5.461   1.00 0.00 ? 138 ALA A HA   5  
ATOM 8739  H HB1  . ALA A 1 60  ? -1.630  -2.018  5.189   1.00 0.00 ? 138 ALA A HB1  5  
ATOM 8740  H HB2  . ALA A 1 60  ? -0.301  -2.860  5.987   1.00 0.00 ? 138 ALA A HB2  5  
ATOM 8741  H HB3  . ALA A 1 60  ? -0.266  -2.609  4.241   1.00 0.00 ? 138 ALA A HB3  5  
ATOM 8742  N N    . TYR A 1 61  ? -3.357  -4.755  6.459   1.00 0.00 ? 139 TYR A N    5  
ATOM 8743  C CA   . TYR A 1 61  ? -4.699  -4.754  7.029   1.00 0.00 ? 139 TYR A CA   5  
ATOM 8744  C C    . TYR A 1 61  ? -4.773  -3.840  8.247   1.00 0.00 ? 139 TYR A C    5  
ATOM 8745  O O    . TYR A 1 61  ? -3.931  -3.911  9.142   1.00 0.00 ? 139 TYR A O    5  
ATOM 8746  C CB   . TYR A 1 61  ? -5.112  -6.175  7.417   1.00 0.00 ? 139 TYR A CB   5  
ATOM 8747  C CG   . TYR A 1 61  ? -5.327  -7.089  6.232   1.00 0.00 ? 139 TYR A CG   5  
ATOM 8748  C CD1  . TYR A 1 61  ? -4.260  -7.494  5.440   1.00 0.00 ? 139 TYR A CD1  5  
ATOM 8749  C CD2  . TYR A 1 61  ? -6.597  -7.546  5.903   1.00 0.00 ? 139 TYR A CD2  5  
ATOM 8750  C CE1  . TYR A 1 61  ? -4.452  -8.328  4.355   1.00 0.00 ? 139 TYR A CE1  5  
ATOM 8751  C CE2  . TYR A 1 61  ? -6.798  -8.381  4.822   1.00 0.00 ? 139 TYR A CE2  5  
ATOM 8752  C CZ   . TYR A 1 61  ? -5.722  -8.770  4.051   1.00 0.00 ? 139 TYR A CZ   5  
ATOM 8753  O OH   . TYR A 1 61  ? -5.919  -9.601  2.972   1.00 0.00 ? 139 TYR A OH   5  
ATOM 8754  H H    . TYR A 1 61  ? -2.659  -5.297  6.882   1.00 0.00 ? 139 TYR A H    5  
ATOM 8755  H HA   . TYR A 1 61  ? -5.380  -4.386  6.275   1.00 0.00 ? 139 TYR A HA   5  
ATOM 8756  H HB2  . TYR A 1 61  ? -4.341  -6.610  8.035   1.00 0.00 ? 139 TYR A HB2  5  
ATOM 8757  H HB3  . TYR A 1 61  ? -6.035  -6.134  7.977   1.00 0.00 ? 139 TYR A HB3  5  
ATOM 8758  H HD1  . TYR A 1 61  ? -3.265  -7.147  5.681   1.00 0.00 ? 139 TYR A HD1  5  
ATOM 8759  H HD2  . TYR A 1 61  ? -7.438  -7.239  6.509   1.00 0.00 ? 139 TYR A HD2  5  
ATOM 8760  H HE1  . TYR A 1 61  ? -3.610  -8.633  3.751   1.00 0.00 ? 139 TYR A HE1  5  
ATOM 8761  H HE2  . TYR A 1 61  ? -7.793  -8.726  4.583   1.00 0.00 ? 139 TYR A HE2  5  
ATOM 8762  H HH   . TYR A 1 61  ? -6.517  -9.181  2.350   1.00 0.00 ? 139 TYR A HH   5  
ATOM 8763  N N    . TRP A 1 62  ? -5.787  -2.982  8.274   1.00 0.00 ? 140 TRP A N    5  
ATOM 8764  C CA   . TRP A 1 62  ? -5.972  -2.053  9.383   1.00 0.00 ? 140 TRP A CA   5  
ATOM 8765  C C    . TRP A 1 62  ? -7.365  -2.197  9.987   1.00 0.00 ? 140 TRP A C    5  
ATOM 8766  O O    . TRP A 1 62  ? -8.342  -2.421  9.273   1.00 0.00 ? 140 TRP A O    5  
ATOM 8767  C CB   . TRP A 1 62  ? -5.754  -0.614  8.912   1.00 0.00 ? 140 TRP A CB   5  
ATOM 8768  C CG   . TRP A 1 62  ? -6.618  -0.232  7.749   1.00 0.00 ? 140 TRP A CG   5  
ATOM 8769  C CD1  . TRP A 1 62  ? -6.422  -0.564  6.439   1.00 0.00 ? 140 TRP A CD1  5  
ATOM 8770  C CD2  . TRP A 1 62  ? -7.813  0.555   7.791   1.00 0.00 ? 140 TRP A CD2  5  
ATOM 8771  N NE1  . TRP A 1 62  ? -7.423  -0.030  5.664   1.00 0.00 ? 140 TRP A NE1  5  
ATOM 8772  C CE2  . TRP A 1 62  ? -8.289  0.660   6.470   1.00 0.00 ? 140 TRP A CE2  5  
ATOM 8773  C CE3  . TRP A 1 62  ? -8.528  1.180   8.816   1.00 0.00 ? 140 TRP A CE3  5  
ATOM 8774  C CZ2  . TRP A 1 62  ? -9.446  1.365   6.150   1.00 0.00 ? 140 TRP A CZ2  5  
ATOM 8775  C CZ3  . TRP A 1 62  ? -9.676  1.880   8.497   1.00 0.00 ? 140 TRP A CZ3  5  
ATOM 8776  C CH2  . TRP A 1 62  ? -10.126 1.967   7.173   1.00 0.00 ? 140 TRP A CH2  5  
ATOM 8777  H H    . TRP A 1 62  ? -6.426  -2.973  7.531   1.00 0.00 ? 140 TRP A H    5  
ATOM 8778  H HA   . TRP A 1 62  ? -5.238  -2.290  10.139  1.00 0.00 ? 140 TRP A HA   5  
ATOM 8779  H HB2  . TRP A 1 62  ? -5.972  0.061   9.726   1.00 0.00 ? 140 TRP A HB2  5  
ATOM 8780  H HB3  . TRP A 1 62  ? -4.722  -0.493  8.616   1.00 0.00 ? 140 TRP A HB3  5  
ATOM 8781  H HD1  . TRP A 1 62  ? -5.595  -1.158  6.079   1.00 0.00 ? 140 TRP A HD1  5  
ATOM 8782  H HE1  . TRP A 1 62  ? -7.504  -0.130  4.692   1.00 0.00 ? 140 TRP A HE1  5  
ATOM 8783  H HE3  . TRP A 1 62  ? -8.197  1.124   9.843   1.00 0.00 ? 140 TRP A HE3  5  
ATOM 8784  H HZ2  . TRP A 1 62  ? -9.807  1.441   5.134   1.00 0.00 ? 140 TRP A HZ2  5  
ATOM 8785  H HZ3  . TRP A 1 62  ? -10.241 2.369   9.276   1.00 0.00 ? 140 TRP A HZ3  5  
ATOM 8786  H HH2  . TRP A 1 62  ? -11.028 2.524   6.970   1.00 0.00 ? 140 TRP A HH2  5  
ATOM 8787  N N    . LYS A 1 63  ? -7.449  -2.068  11.307  1.00 0.00 ? 141 LYS A N    5  
ATOM 8788  C CA   . LYS A 1 63  ? -8.722  -2.183  12.008  1.00 0.00 ? 141 LYS A CA   5  
ATOM 8789  C C    . LYS A 1 63  ? -9.831  -1.469  11.242  1.00 0.00 ? 141 LYS A C    5  
ATOM 8790  O O    . LYS A 1 63  ? -9.727  -0.278  10.944  1.00 0.00 ? 141 LYS A O    5  
ATOM 8791  C CB   . LYS A 1 63  ? -8.606  -1.601  13.418  1.00 0.00 ? 141 LYS A CB   5  
ATOM 8792  C CG   . LYS A 1 63  ? -7.829  -2.484  14.379  1.00 0.00 ? 141 LYS A CG   5  
ATOM 8793  C CD   . LYS A 1 63  ? -8.256  -2.254  15.819  1.00 0.00 ? 141 LYS A CD   5  
ATOM 8794  C CE   . LYS A 1 63  ? -7.115  -2.524  16.788  1.00 0.00 ? 141 LYS A CE   5  
ATOM 8795  N NZ   . LYS A 1 63  ? -7.060  -3.956  17.194  1.00 0.00 ? 141 LYS A NZ   5  
ATOM 8796  H H    . LYS A 1 63  ? -6.634  -1.891  11.823  1.00 0.00 ? 141 LYS A H    5  
ATOM 8797  H HA   . LYS A 1 63  ? -8.969  -3.231  12.080  1.00 0.00 ? 141 LYS A HA   5  
ATOM 8798  H HB2  . LYS A 1 63  ? -8.109  -0.644  13.360  1.00 0.00 ? 141 LYS A HB2  5  
ATOM 8799  H HB3  . LYS A 1 63  ? -9.599  -1.457  13.819  1.00 0.00 ? 141 LYS A HB3  5  
ATOM 8800  H HG2  . LYS A 1 63  ? -8.004  -3.519  14.124  1.00 0.00 ? 141 LYS A HG2  5  
ATOM 8801  H HG3  . LYS A 1 63  ? -6.775  -2.262  14.285  1.00 0.00 ? 141 LYS A HG3  5  
ATOM 8802  H HD2  . LYS A 1 63  ? -8.573  -1.228  15.931  1.00 0.00 ? 141 LYS A HD2  5  
ATOM 8803  H HD3  . LYS A 1 63  ? -9.079  -2.914  16.051  1.00 0.00 ? 141 LYS A HD3  5  
ATOM 8804  H HE2  . LYS A 1 63  ? -6.184  -2.257  16.312  1.00 0.00 ? 141 LYS A HE2  5  
ATOM 8805  H HE3  . LYS A 1 63  ? -7.257  -1.914  17.669  1.00 0.00 ? 141 LYS A HE3  5  
ATOM 8806  H HZ1  . LYS A 1 63  ? -7.757  -4.142  17.942  1.00 0.00 ? 141 LYS A HZ1  5  
ATOM 8807  H HZ2  . LYS A 1 63  ? -6.112  -4.189  17.553  1.00 0.00 ? 141 LYS A HZ2  5  
ATOM 8808  H HZ3  . LYS A 1 63  ? -7.270  -4.566  16.379  1.00 0.00 ? 141 LYS A HZ3  5  
ATOM 8809  N N    . THR A 1 64  ? -10.894 -2.202  10.926  1.00 0.00 ? 142 THR A N    5  
ATOM 8810  C CA   . THR A 1 64  ? -12.022 -1.639  10.195  1.00 0.00 ? 142 THR A CA   5  
ATOM 8811  C C    . THR A 1 64  ? -13.347 -2.059  10.820  1.00 0.00 ? 142 THR A C    5  
ATOM 8812  O O    . THR A 1 64  ? -13.374 -2.729  11.853  1.00 0.00 ? 142 THR A O    5  
ATOM 8813  C CB   . THR A 1 64  ? -12.005 -2.071  8.716   1.00 0.00 ? 142 THR A CB   5  
ATOM 8814  O OG1  . THR A 1 64  ? -11.723 -3.471  8.618   1.00 0.00 ? 142 THR A OG1  5  
ATOM 8815  C CG2  . THR A 1 64  ? -10.965 -1.282  7.934   1.00 0.00 ? 142 THR A CG2  5  
ATOM 8816  H H    . THR A 1 64  ? -10.918 -3.145  11.191  1.00 0.00 ? 142 THR A H    5  
ATOM 8817  H HA   . THR A 1 64  ? -11.941 -0.562  10.235  1.00 0.00 ? 142 THR A HA   5  
ATOM 8818  H HB   . THR A 1 64  ? -12.979 -1.876  8.289   1.00 0.00 ? 142 THR A HB   5  
ATOM 8819  H HG1  . THR A 1 64  ? -11.856 -3.761  7.712   1.00 0.00 ? 142 THR A HG1  5  
ATOM 8820  H HG21 . THR A 1 64  ? -10.047 -1.849  7.884   1.00 0.00 ? 142 THR A HG21 5  
ATOM 8821  H HG22 . THR A 1 64  ? -10.781 -0.340  8.429   1.00 0.00 ? 142 THR A HG22 5  
ATOM 8822  H HG23 . THR A 1 64  ? -11.330 -1.099  6.935   1.00 0.00 ? 142 THR A HG23 5  
ATOM 8823  N N    . THR A 1 65  ? -14.447 -1.662  10.188  1.00 0.00 ? 143 THR A N    5  
ATOM 8824  C CA   . THR A 1 65  ? -15.776 -1.996  10.683  1.00 0.00 ? 143 THR A CA   5  
ATOM 8825  C C    . THR A 1 65  ? -16.701 -2.406  9.542   1.00 0.00 ? 143 THR A C    5  
ATOM 8826  O O    . THR A 1 65  ? -16.314 -2.372  8.373   1.00 0.00 ? 143 THR A O    5  
ATOM 8827  C CB   . THR A 1 65  ? -16.408 -0.814  11.441  1.00 0.00 ? 143 THR A CB   5  
ATOM 8828  O OG1  . THR A 1 65  ? -17.787 -1.088  11.715  1.00 0.00 ? 143 THR A OG1  5  
ATOM 8829  C CG2  . THR A 1 65  ? -16.291 0.471   10.634  1.00 0.00 ? 143 THR A CG2  5  
ATOM 8830  H H    . THR A 1 65  ? -14.361 -1.130  9.370   1.00 0.00 ? 143 THR A H    5  
ATOM 8831  H HA   . THR A 1 65  ? -15.678 -2.825  11.369  1.00 0.00 ? 143 THR A HA   5  
ATOM 8832  H HB   . THR A 1 65  ? -15.882 -0.683  12.376  1.00 0.00 ? 143 THR A HB   5  
ATOM 8833  H HG1  . THR A 1 65  ? -17.858 -1.583  12.534  1.00 0.00 ? 143 THR A HG1  5  
ATOM 8834  H HG21 . THR A 1 65  ? -15.651 0.303   9.780   1.00 0.00 ? 143 THR A HG21 5  
ATOM 8835  H HG22 . THR A 1 65  ? -15.869 1.248   11.253  1.00 0.00 ? 143 THR A HG22 5  
ATOM 8836  H HG23 . THR A 1 65  ? -17.271 0.772   10.295  1.00 0.00 ? 143 THR A HG23 5  
ATOM 8837  N N    . LEU A 1 66  ? -17.924 -2.792  9.887   1.00 0.00 ? 144 LEU A N    5  
ATOM 8838  C CA   . LEU A 1 66  ? -18.905 -3.208  8.891   1.00 0.00 ? 144 LEU A CA   5  
ATOM 8839  C C    . LEU A 1 66  ? -19.502 -1.999  8.177   1.00 0.00 ? 144 LEU A C    5  
ATOM 8840  O O    . LEU A 1 66  ? -20.425 -2.133  7.374   1.00 0.00 ? 144 LEU A O    5  
ATOM 8841  C CB   . LEU A 1 66  ? -20.017 -4.025  9.551   1.00 0.00 ? 144 LEU A CB   5  
ATOM 8842  C CG   . LEU A 1 66  ? -20.875 -4.873  8.611   1.00 0.00 ? 144 LEU A CG   5  
ATOM 8843  C CD1  . LEU A 1 66  ? -20.090 -6.075  8.110   1.00 0.00 ? 144 LEU A CD1  5  
ATOM 8844  C CD2  . LEU A 1 66  ? -22.150 -5.320  9.312   1.00 0.00 ? 144 LEU A CD2  5  
ATOM 8845  H H    . LEU A 1 66  ? -18.174 -2.798  10.834  1.00 0.00 ? 144 LEU A H    5  
ATOM 8846  H HA   . LEU A 1 66  ? -18.398 -3.825  8.164   1.00 0.00 ? 144 LEU A HA   5  
ATOM 8847  H HB2  . LEU A 1 66  ? -19.559 -4.688  10.268  1.00 0.00 ? 144 LEU A HB2  5  
ATOM 8848  H HB3  . LEU A 1 66  ? -20.671 -3.336  10.066  1.00 0.00 ? 144 LEU A HB3  5  
ATOM 8849  H HG   . LEU A 1 66  ? -21.155 -4.277  7.754   1.00 0.00 ? 144 LEU A HG   5  
ATOM 8850  H HD11 . LEU A 1 66  ? -19.271 -6.276  8.784   1.00 0.00 ? 144 LEU A HD11 5  
ATOM 8851  H HD12 . LEU A 1 66  ? -19.702 -5.866  7.124   1.00 0.00 ? 144 LEU A HD12 5  
ATOM 8852  H HD13 . LEU A 1 66  ? -20.740 -6.936  8.065   1.00 0.00 ? 144 LEU A HD13 5  
ATOM 8853  H HD21 . LEU A 1 66  ? -22.944 -4.621  9.094   1.00 0.00 ? 144 LEU A HD21 5  
ATOM 8854  H HD22 . LEU A 1 66  ? -21.982 -5.354  10.378  1.00 0.00 ? 144 LEU A HD22 5  
ATOM 8855  H HD23 . LEU A 1 66  ? -22.428 -6.302  8.959   1.00 0.00 ? 144 LEU A HD23 5  
ATOM 8856  N N    . SER A 1 67  ? -18.966 -0.819  8.473   1.00 0.00 ? 145 SER A N    5  
ATOM 8857  C CA   . SER A 1 67  ? -19.447 0.414   7.861   1.00 0.00 ? 145 SER A CA   5  
ATOM 8858  C C    . SER A 1 67  ? -18.666 0.729   6.589   1.00 0.00 ? 145 SER A C    5  
ATOM 8859  O O    . SER A 1 67  ? -17.525 1.187   6.645   1.00 0.00 ? 145 SER A O    5  
ATOM 8860  C CB   . SER A 1 67  ? -19.328 1.578   8.847   1.00 0.00 ? 145 SER A CB   5  
ATOM 8861  O OG   . SER A 1 67  ? -19.739 1.189   10.147  1.00 0.00 ? 145 SER A OG   5  
ATOM 8862  H H    . SER A 1 67  ? -18.232 -0.777  9.122   1.00 0.00 ? 145 SER A H    5  
ATOM 8863  H HA   . SER A 1 67  ? -20.487 0.274   7.606   1.00 0.00 ? 145 SER A HA   5  
ATOM 8864  H HB2  . SER A 1 67  ? -18.301 1.906   8.891   1.00 0.00 ? 145 SER A HB2  5  
ATOM 8865  H HB3  . SER A 1 67  ? -19.953 2.394   8.514   1.00 0.00 ? 145 SER A HB3  5  
ATOM 8866  H HG   . SER A 1 67  ? -20.540 1.662   10.384  1.00 0.00 ? 145 SER A HG   5  
ATOM 8867  N N    . ALA A 1 68  ? -19.290 0.481   5.442   1.00 0.00 ? 146 ALA A N    5  
ATOM 8868  C CA   . ALA A 1 68  ? -18.656 0.739   4.156   1.00 0.00 ? 146 ALA A CA   5  
ATOM 8869  C C    . ALA A 1 68  ? -18.403 2.230   3.958   1.00 0.00 ? 146 ALA A C    5  
ATOM 8870  O O    . ALA A 1 68  ? -17.449 2.623   3.286   1.00 0.00 ? 146 ALA A O    5  
ATOM 8871  C CB   . ALA A 1 68  ? -19.514 0.193   3.025   1.00 0.00 ? 146 ALA A CB   5  
ATOM 8872  H H    . ALA A 1 68  ? -20.199 0.116   5.462   1.00 0.00 ? 146 ALA A H    5  
ATOM 8873  H HA   . ALA A 1 68  ? -17.709 0.218   4.140   1.00 0.00 ? 146 ALA A HA   5  
ATOM 8874  H HB1  . ALA A 1 68  ? -19.247 -0.837  2.836   1.00 0.00 ? 146 ALA A HB1  5  
ATOM 8875  H HB2  . ALA A 1 68  ? -20.556 0.249   3.304   1.00 0.00 ? 146 ALA A HB2  5  
ATOM 8876  H HB3  . ALA A 1 68  ? -19.348 0.778   2.132   1.00 0.00 ? 146 ALA A HB3  5  
ATOM 8877  N N    . GLU A 1 69  ? -19.263 3.055   4.547   1.00 0.00 ? 147 GLU A N    5  
ATOM 8878  C CA   . GLU A 1 69  ? -19.132 4.502   4.433   1.00 0.00 ? 147 GLU A CA   5  
ATOM 8879  C C    . GLU A 1 69  ? -17.836 4.984   5.078   1.00 0.00 ? 147 GLU A C    5  
ATOM 8880  O O    . GLU A 1 69  ? -17.088 5.762   4.486   1.00 0.00 ? 147 GLU A O    5  
ATOM 8881  C CB   . GLU A 1 69  ? -20.329 5.198   5.086   1.00 0.00 ? 147 GLU A CB   5  
ATOM 8882  C CG   . GLU A 1 69  ? -21.633 5.001   4.332   1.00 0.00 ? 147 GLU A CG   5  
ATOM 8883  C CD   . GLU A 1 69  ? -21.715 5.847   3.077   1.00 0.00 ? 147 GLU A CD   5  
ATOM 8884  O OE1  . GLU A 1 69  ? -21.378 7.048   3.147   1.00 0.00 ? 147 GLU A OE1  5  
ATOM 8885  O OE2  . GLU A 1 69  ? -22.117 5.309   2.024   1.00 0.00 ? 147 GLU A OE2  5  
ATOM 8886  H H    . GLU A 1 69  ? -20.003 2.681   5.069   1.00 0.00 ? 147 GLU A H    5  
ATOM 8887  H HA   . GLU A 1 69  ? -19.112 4.752   3.383   1.00 0.00 ? 147 GLU A HA   5  
ATOM 8888  H HB2  . GLU A 1 69  ? -20.453 4.811   6.087   1.00 0.00 ? 147 GLU A HB2  5  
ATOM 8889  H HB3  . GLU A 1 69  ? -20.127 6.257   5.142   1.00 0.00 ? 147 GLU A HB3  5  
ATOM 8890  H HG2  . GLU A 1 69  ? -21.719 3.961   4.053   1.00 0.00 ? 147 GLU A HG2  5  
ATOM 8891  H HG3  . GLU A 1 69  ? -22.454 5.266   4.982   1.00 0.00 ? 147 GLU A HG3  5  
ATOM 8892  N N    . GLN A 1 70  ? -17.578 4.516   6.295   1.00 0.00 ? 148 GLN A N    5  
ATOM 8893  C CA   . GLN A 1 70  ? -16.373 4.899   7.021   1.00 0.00 ? 148 GLN A CA   5  
ATOM 8894  C C    . GLN A 1 70  ? -15.131 4.295   6.374   1.00 0.00 ? 148 GLN A C    5  
ATOM 8895  O O    . GLN A 1 70  ? -14.076 4.926   6.324   1.00 0.00 ? 148 GLN A O    5  
ATOM 8896  C CB   . GLN A 1 70  ? -16.469 4.454   8.482   1.00 0.00 ? 148 GLN A CB   5  
ATOM 8897  C CG   . GLN A 1 70  ? -15.919 3.059   8.730   1.00 0.00 ? 148 GLN A CG   5  
ATOM 8898  C CD   . GLN A 1 70  ? -14.411 3.044   8.883   1.00 0.00 ? 148 GLN A CD   5  
ATOM 8899  O OE1  . GLN A 1 70  ? -13.787 4.084   9.097   1.00 0.00 ? 148 GLN A OE1  5  
ATOM 8900  N NE2  . GLN A 1 70  ? -13.816 1.862   8.775   1.00 0.00 ? 148 GLN A NE2  5  
ATOM 8901  H H    . GLN A 1 70  ? -18.212 3.898   6.714   1.00 0.00 ? 148 GLN A H    5  
ATOM 8902  H HA   . GLN A 1 70  ? -16.294 5.975   6.987   1.00 0.00 ? 148 GLN A HA   5  
ATOM 8903  H HB2  . GLN A 1 70  ? -15.916 5.150   9.095   1.00 0.00 ? 148 GLN A HB2  5  
ATOM 8904  H HB3  . GLN A 1 70  ? -17.506 4.468   8.782   1.00 0.00 ? 148 GLN A HB3  5  
ATOM 8905  H HG2  . GLN A 1 70  ? -16.361 2.667   9.634   1.00 0.00 ? 148 GLN A HG2  5  
ATOM 8906  H HG3  . GLN A 1 70  ? -16.188 2.427   7.896   1.00 0.00 ? 148 GLN A HG3  5  
ATOM 8907  H HE21 . GLN A 1 70  ? -14.377 1.076   8.603   1.00 0.00 ? 148 GLN A HE21 5  
ATOM 8908  H HE22 . GLN A 1 70  ? -12.842 1.824   8.869   1.00 0.00 ? 148 GLN A HE22 5  
ATOM 8909  N N    . ASN A 1 71  ? -15.265 3.069   5.878   1.00 0.00 ? 149 ASN A N    5  
ATOM 8910  C CA   . ASN A 1 71  ? -14.154 2.379   5.234   1.00 0.00 ? 149 ASN A CA   5  
ATOM 8911  C C    . ASN A 1 71  ? -13.792 3.047   3.911   1.00 0.00 ? 149 ASN A C    5  
ATOM 8912  O O    . ASN A 1 71  ? -12.618 3.152   3.557   1.00 0.00 ? 149 ASN A O    5  
ATOM 8913  C CB   . ASN A 1 71  ? -14.507 0.910   4.997   1.00 0.00 ? 149 ASN A CB   5  
ATOM 8914  C CG   . ASN A 1 71  ? -14.339 0.066   6.246   1.00 0.00 ? 149 ASN A CG   5  
ATOM 8915  O OD1  . ASN A 1 71  ? -13.347 0.190   6.964   1.00 0.00 ? 149 ASN A OD1  5  
ATOM 8916  N ND2  . ASN A 1 71  ? -15.311 -0.799  6.510   1.00 0.00 ? 149 ASN A ND2  5  
ATOM 8917  H H    . ASN A 1 71  ? -16.132 2.617   5.948   1.00 0.00 ? 149 ASN A H    5  
ATOM 8918  H HA   . ASN A 1 71  ? -13.302 2.433   5.896   1.00 0.00 ? 149 ASN A HA   5  
ATOM 8919  H HB2  . ASN A 1 71  ? -15.536 0.841   4.675   1.00 0.00 ? 149 ASN A HB2  5  
ATOM 8920  H HB3  . ASN A 1 71  ? -13.865 0.511   4.226   1.00 0.00 ? 149 ASN A HB3  5  
ATOM 8921  H HD21 . ASN A 1 71  ? -16.072 -0.844  5.893   1.00 0.00 ? 149 ASN A HD21 5  
ATOM 8922  H HD22 . ASN A 1 71  ? -15.229 -1.357  7.312   1.00 0.00 ? 149 ASN A HD22 5  
ATOM 8923  N N    . ALA A 1 72  ? -14.810 3.498   3.185   1.00 0.00 ? 150 ALA A N    5  
ATOM 8924  C CA   . ALA A 1 72  ? -14.600 4.158   1.902   1.00 0.00 ? 150 ALA A CA   5  
ATOM 8925  C C    . ALA A 1 72  ? -13.867 5.484   2.081   1.00 0.00 ? 150 ALA A C    5  
ATOM 8926  O O    . ALA A 1 72  ? -12.902 5.772   1.372   1.00 0.00 ? 150 ALA A O    5  
ATOM 8927  C CB   . ALA A 1 72  ? -15.930 4.378   1.198   1.00 0.00 ? 150 ALA A CB   5  
ATOM 8928  H H    . ALA A 1 72  ? -15.723 3.385   3.520   1.00 0.00 ? 150 ALA A H    5  
ATOM 8929  H HA   . ALA A 1 72  ? -13.997 3.506   1.286   1.00 0.00 ? 150 ALA A HA   5  
ATOM 8930  H HB1  . ALA A 1 72  ? -16.569 3.522   1.361   1.00 0.00 ? 150 ALA A HB1  5  
ATOM 8931  H HB2  . ALA A 1 72  ? -16.405 5.263   1.594   1.00 0.00 ? 150 ALA A HB2  5  
ATOM 8932  H HB3  . ALA A 1 72  ? -15.760 4.504   0.139   1.00 0.00 ? 150 ALA A HB3  5  
ATOM 8933  N N    . HIS A 1 73  ? -14.333 6.288   3.031   1.00 0.00 ? 151 HIS A N    5  
ATOM 8934  C CA   . HIS A 1 73  ? -13.722 7.585   3.302   1.00 0.00 ? 151 HIS A CA   5  
ATOM 8935  C C    . HIS A 1 73  ? -12.320 7.414   3.880   1.00 0.00 ? 151 HIS A C    5  
ATOM 8936  O O    . HIS A 1 73  ? -11.372 8.058   3.432   1.00 0.00 ? 151 HIS A O    5  
ATOM 8937  C CB   . HIS A 1 73  ? -14.590 8.389   4.269   1.00 0.00 ? 151 HIS A CB   5  
ATOM 8938  C CG   . HIS A 1 73  ? -13.863 9.521   4.928   1.00 0.00 ? 151 HIS A CG   5  
ATOM 8939  N ND1  . HIS A 1 73  ? -14.175 10.846  4.708   1.00 0.00 ? 151 HIS A ND1  5  
ATOM 8940  C CD2  . HIS A 1 73  ? -12.833 9.519   5.807   1.00 0.00 ? 151 HIS A CD2  5  
ATOM 8941  C CE1  . HIS A 1 73  ? -13.368 11.610  5.422   1.00 0.00 ? 151 HIS A CE1  5  
ATOM 8942  N NE2  . HIS A 1 73  ? -12.544 10.830  6.098   1.00 0.00 ? 151 HIS A NE2  5  
ATOM 8943  H H    . HIS A 1 73  ? -15.105 6.003   3.562   1.00 0.00 ? 151 HIS A H    5  
ATOM 8944  H HA   . HIS A 1 73  ? -13.650 8.119   2.367   1.00 0.00 ? 151 HIS A HA   5  
ATOM 8945  H HB2  . HIS A 1 73  ? -15.429 8.804   3.730   1.00 0.00 ? 151 HIS A HB2  5  
ATOM 8946  H HB3  . HIS A 1 73  ? -14.957 7.733   5.045   1.00 0.00 ? 151 HIS A HB3  5  
ATOM 8947  H HD2  . HIS A 1 73  ? -12.331 8.649   6.205   1.00 0.00 ? 151 HIS A HD2  5  
ATOM 8948  H HE1  . HIS A 1 73  ? -13.380 12.690  5.449   1.00 0.00 ? 151 HIS A HE1  5  
ATOM 8949  H HE2  . HIS A 1 73  ? -11.789 11.141  6.639   1.00 0.00 ? 151 HIS A HE2  5  
ATOM 8950  N N    . MET A 1 74  ? -12.198 6.543   4.876   1.00 0.00 ? 152 MET A N    5  
ATOM 8951  C CA   . MET A 1 74  ? -10.911 6.289   5.514   1.00 0.00 ? 152 MET A CA   5  
ATOM 8952  C C    . MET A 1 74  ? -9.929  5.665   4.528   1.00 0.00 ? 152 MET A C    5  
ATOM 8953  O O    . MET A 1 74  ? -8.757  6.038   4.487   1.00 0.00 ? 152 MET A O    5  
ATOM 8954  C CB   . MET A 1 74  ? -11.091 5.368   6.723   1.00 0.00 ? 152 MET A CB   5  
ATOM 8955  C CG   . MET A 1 74  ? -11.550 6.095   7.977   1.00 0.00 ? 152 MET A CG   5  
ATOM 8956  S SD   . MET A 1 74  ? -11.216 5.160   9.483   1.00 0.00 ? 152 MET A SD   5  
ATOM 8957  C CE   . MET A 1 74  ? -9.427  5.219   9.528   1.00 0.00 ? 152 MET A CE   5  
ATOM 8958  H H    . MET A 1 74  ? -12.990 6.060   5.190   1.00 0.00 ? 152 MET A H    5  
ATOM 8959  H HA   . MET A 1 74  ? -10.515 7.235   5.850   1.00 0.00 ? 152 MET A HA   5  
ATOM 8960  H HB2  . MET A 1 74  ? -11.825 4.615   6.481   1.00 0.00 ? 152 MET A HB2  5  
ATOM 8961  H HB3  . MET A 1 74  ? -10.149 4.886   6.937   1.00 0.00 ? 152 MET A HB3  5  
ATOM 8962  H HG2  . MET A 1 74  ? -11.035 7.042   8.038   1.00 0.00 ? 152 MET A HG2  5  
ATOM 8963  H HG3  . MET A 1 74  ? -12.613 6.270   7.906   1.00 0.00 ? 152 MET A HG3  5  
ATOM 8964  H HE1  . MET A 1 74  ? -9.109  5.899   10.305  1.00 0.00 ? 152 MET A HE1  5  
ATOM 8965  H HE2  . MET A 1 74  ? -9.039  4.232   9.733   1.00 0.00 ? 152 MET A HE2  5  
ATOM 8966  H HE3  . MET A 1 74  ? -9.054  5.563   8.574   1.00 0.00 ? 152 MET A HE3  5  
ATOM 8967  N N    . GLU A 1 75  ? -10.415 4.716   3.735   1.00 0.00 ? 153 GLU A N    5  
ATOM 8968  C CA   . GLU A 1 75  ? -9.578  4.041   2.750   1.00 0.00 ? 153 GLU A CA   5  
ATOM 8969  C C    . GLU A 1 75  ? -9.061  5.028   1.708   1.00 0.00 ? 153 GLU A C    5  
ATOM 8970  O O    . GLU A 1 75  ? -7.902  4.967   1.301   1.00 0.00 ? 153 GLU A O    5  
ATOM 8971  C CB   . GLU A 1 75  ? -10.363 2.921   2.063   1.00 0.00 ? 153 GLU A CB   5  
ATOM 8972  C CG   . GLU A 1 75  ? -9.673  2.364   0.829   1.00 0.00 ? 153 GLU A CG   5  
ATOM 8973  C CD   . GLU A 1 75  ? -10.029 3.127   -0.433  1.00 0.00 ? 153 GLU A CD   5  
ATOM 8974  O OE1  . GLU A 1 75  ? -11.058 2.794   -1.058  1.00 0.00 ? 153 GLU A OE1  5  
ATOM 8975  O OE2  . GLU A 1 75  ? -9.279  4.057   -0.794  1.00 0.00 ? 153 GLU A OE2  5  
ATOM 8976  H H    . GLU A 1 75  ? -11.359 4.462   3.815   1.00 0.00 ? 153 GLU A H    5  
ATOM 8977  H HA   . GLU A 1 75  ? -8.736  3.611   3.270   1.00 0.00 ? 153 GLU A HA   5  
ATOM 8978  H HB2  . GLU A 1 75  ? -10.505 2.114   2.766   1.00 0.00 ? 153 GLU A HB2  5  
ATOM 8979  H HB3  . GLU A 1 75  ? -11.328 3.304   1.768   1.00 0.00 ? 153 GLU A HB3  5  
ATOM 8980  H HG2  . GLU A 1 75  ? -8.605  2.418   0.974   1.00 0.00 ? 153 GLU A HG2  5  
ATOM 8981  H HG3  . GLU A 1 75  ? -9.967  1.332   0.703   1.00 0.00 ? 153 GLU A HG3  5  
ATOM 8982  N N    . ALA A 1 76  ? -9.931  5.937   1.280   1.00 0.00 ? 154 ALA A N    5  
ATOM 8983  C CA   . ALA A 1 76  ? -9.564  6.939   0.286   1.00 0.00 ? 154 ALA A CA   5  
ATOM 8984  C C    . ALA A 1 76  ? -8.475  7.865   0.817   1.00 0.00 ? 154 ALA A C    5  
ATOM 8985  O O    . ALA A 1 76  ? -7.506  8.164   0.120   1.00 0.00 ? 154 ALA A O    5  
ATOM 8986  C CB   . ALA A 1 76  ? -10.786 7.743   -0.130  1.00 0.00 ? 154 ALA A CB   5  
ATOM 8987  H H    . ALA A 1 76  ? -10.842 5.935   1.641   1.00 0.00 ? 154 ALA A H    5  
ATOM 8988  H HA   . ALA A 1 76  ? -9.189  6.422   -0.586  1.00 0.00 ? 154 ALA A HA   5  
ATOM 8989  H HB1  . ALA A 1 76  ? -10.525 8.393   -0.953  1.00 0.00 ? 154 ALA A HB1  5  
ATOM 8990  H HB2  . ALA A 1 76  ? -11.572 7.069   -0.438  1.00 0.00 ? 154 ALA A HB2  5  
ATOM 8991  H HB3  . ALA A 1 76  ? -11.127 8.337   0.704   1.00 0.00 ? 154 ALA A HB3  5  
ATOM 8992  N N    . VAL A 1 77  ? -8.641  8.316   2.057   1.00 0.00 ? 155 VAL A N    5  
ATOM 8993  C CA   . VAL A 1 77  ? -7.672  9.208   2.682   1.00 0.00 ? 155 VAL A CA   5  
ATOM 8994  C C    . VAL A 1 77  ? -6.382  8.468   3.020   1.00 0.00 ? 155 VAL A C    5  
ATOM 8995  O O    . VAL A 1 77  ? -5.284  8.997   2.839   1.00 0.00 ? 155 VAL A O    5  
ATOM 8996  C CB   . VAL A 1 77  ? -8.239  9.842   3.966   1.00 0.00 ? 155 VAL A CB   5  
ATOM 8997  C CG1  . VAL A 1 77  ? -8.697  8.764   4.936   1.00 0.00 ? 155 VAL A CG1  5  
ATOM 8998  C CG2  . VAL A 1 77  ? -7.204  10.749  4.614   1.00 0.00 ? 155 VAL A CG2  5  
ATOM 8999  H H    . VAL A 1 77  ? -9.434  8.042   2.563   1.00 0.00 ? 155 VAL A H    5  
ATOM 9000  H HA   . VAL A 1 77  ? -7.448  10.001  1.982   1.00 0.00 ? 155 VAL A HA   5  
ATOM 9001  H HB   . VAL A 1 77  ? -9.096  10.443  3.698   1.00 0.00 ? 155 VAL A HB   5  
ATOM 9002  H HG11 . VAL A 1 77  ? -7.848  8.172   5.243   1.00 0.00 ? 155 VAL A HG11 5  
ATOM 9003  H HG12 . VAL A 1 77  ? -9.147  9.227   5.802   1.00 0.00 ? 155 VAL A HG12 5  
ATOM 9004  H HG13 . VAL A 1 77  ? -9.422  8.128   4.450   1.00 0.00 ? 155 VAL A HG13 5  
ATOM 9005  H HG21 . VAL A 1 77  ? -7.674  11.674  4.914   1.00 0.00 ? 155 VAL A HG21 5  
ATOM 9006  H HG22 . VAL A 1 77  ? -6.788  10.259  5.482   1.00 0.00 ? 155 VAL A HG22 5  
ATOM 9007  H HG23 . VAL A 1 77  ? -6.415  10.959  3.907   1.00 0.00 ? 155 VAL A HG23 5  
ATOM 9008  N N    . LEU A 1 78  ? -6.522  7.243   3.512   1.00 0.00 ? 156 LEU A N    5  
ATOM 9009  C CA   . LEU A 1 78  ? -5.368  6.428   3.876   1.00 0.00 ? 156 LEU A CA   5  
ATOM 9010  C C    . LEU A 1 78  ? -4.548  6.063   2.642   1.00 0.00 ? 156 LEU A C    5  
ATOM 9011  O O    . LEU A 1 78  ? -3.319  6.113   2.665   1.00 0.00 ? 156 LEU A O    5  
ATOM 9012  C CB   . LEU A 1 78  ? -5.822  5.157   4.596   1.00 0.00 ? 156 LEU A CB   5  
ATOM 9013  C CG   . LEU A 1 78  ? -4.710  4.225   5.078   1.00 0.00 ? 156 LEU A CG   5  
ATOM 9014  C CD1  . LEU A 1 78  ? -3.833  4.927   6.104   1.00 0.00 ? 156 LEU A CD1  5  
ATOM 9015  C CD2  . LEU A 1 78  ? -5.299  2.949   5.661   1.00 0.00 ? 156 LEU A CD2  5  
ATOM 9016  H H    . LEU A 1 78  ? -7.422  6.875   3.634   1.00 0.00 ? 156 LEU A H    5  
ATOM 9017  H HA   . LEU A 1 78  ? -4.750  7.009   4.545   1.00 0.00 ? 156 LEU A HA   5  
ATOM 9018  H HB2  . LEU A 1 78  ? -6.401  5.453   5.456   1.00 0.00 ? 156 LEU A HB2  5  
ATOM 9019  H HB3  . LEU A 1 78  ? -6.450  4.600   3.915   1.00 0.00 ? 156 LEU A HB3  5  
ATOM 9020  H HG   . LEU A 1 78  ? -4.087  3.953   4.238   1.00 0.00 ? 156 LEU A HG   5  
ATOM 9021  H HD11 . LEU A 1 78  ? -4.079  5.977   6.129   1.00 0.00 ? 156 LEU A HD11 5  
ATOM 9022  H HD12 . LEU A 1 78  ? -2.795  4.806   5.833   1.00 0.00 ? 156 LEU A HD12 5  
ATOM 9023  H HD13 . LEU A 1 78  ? -4.003  4.493   7.079   1.00 0.00 ? 156 LEU A HD13 5  
ATOM 9024  H HD21 . LEU A 1 78  ? -4.661  2.113   5.415   1.00 0.00 ? 156 LEU A HD21 5  
ATOM 9025  H HD22 . LEU A 1 78  ? -6.283  2.785   5.247   1.00 0.00 ? 156 LEU A HD22 5  
ATOM 9026  H HD23 . LEU A 1 78  ? -5.371  3.043   6.735   1.00 0.00 ? 156 LEU A HD23 5  
ATOM 9027  N N    . GLN A 1 79  ? -5.239  5.697   1.567   1.00 0.00 ? 157 GLN A N    5  
ATOM 9028  C CA   . GLN A 1 79  ? -4.574  5.325   0.324   1.00 0.00 ? 157 GLN A CA   5  
ATOM 9029  C C    . GLN A 1 79  ? -3.776  6.497   -0.239  1.00 0.00 ? 157 GLN A C    5  
ATOM 9030  O O    . GLN A 1 79  ? -2.590  6.364   -0.542  1.00 0.00 ? 157 GLN A O    5  
ATOM 9031  C CB   . GLN A 1 79  ? -5.601  4.852   -0.706  1.00 0.00 ? 157 GLN A CB   5  
ATOM 9032  C CG   . GLN A 1 79  ? -5.919  3.368   -0.611  1.00 0.00 ? 157 GLN A CG   5  
ATOM 9033  C CD   . GLN A 1 79  ? -5.000  2.518   -1.465  1.00 0.00 ? 157 GLN A CD   5  
ATOM 9034  O OE1  . GLN A 1 79  ? -5.347  2.140   -2.584  1.00 0.00 ? 157 GLN A OE1  5  
ATOM 9035  N NE2  . GLN A 1 79  ? -3.818  2.213   -0.941  1.00 0.00 ? 157 GLN A NE2  5  
ATOM 9036  H H    . GLN A 1 79  ? -6.217  5.677   1.611   1.00 0.00 ? 157 GLN A H    5  
ATOM 9037  H HA   . GLN A 1 79  ? -3.895  4.514   0.540   1.00 0.00 ? 157 GLN A HA   5  
ATOM 9038  H HB2  . GLN A 1 79  ? -6.518  5.404   -0.564  1.00 0.00 ? 157 GLN A HB2  5  
ATOM 9039  H HB3  . GLN A 1 79  ? -5.220  5.053   -1.696  1.00 0.00 ? 157 GLN A HB3  5  
ATOM 9040  H HG2  . GLN A 1 79  ? -5.818  3.057   0.418   1.00 0.00 ? 157 GLN A HG2  5  
ATOM 9041  H HG3  . GLN A 1 79  ? -6.937  3.210   -0.935  1.00 0.00 ? 157 GLN A HG3  5  
ATOM 9042  H HE21 . GLN A 1 79  ? -3.610  2.548   -0.043  1.00 0.00 ? 157 GLN A HE21 5  
ATOM 9043  H HE22 . GLN A 1 79  ? -3.205  1.664   -1.470  1.00 0.00 ? 157 GLN A HE22 5  
ATOM 9044  N N    . ARG A 1 80  ? -4.434  7.643   -0.375  1.00 0.00 ? 158 ARG A N    5  
ATOM 9045  C CA   . ARG A 1 80  ? -3.785  8.838   -0.903  1.00 0.00 ? 158 ARG A CA   5  
ATOM 9046  C C    . ARG A 1 80  ? -2.658  9.296   0.018   1.00 0.00 ? 158 ARG A C    5  
ATOM 9047  O O    . ARG A 1 80  ? -1.826  10.119  -0.365  1.00 0.00 ? 158 ARG A O    5  
ATOM 9048  C CB   . ARG A 1 80  ? -4.806  9.964   -1.075  1.00 0.00 ? 158 ARG A CB   5  
ATOM 9049  C CG   . ARG A 1 80  ? -5.603  10.262  0.184   1.00 0.00 ? 158 ARG A CG   5  
ATOM 9050  C CD   . ARG A 1 80  ? -4.877  11.252  1.082   1.00 0.00 ? 158 ARG A CD   5  
ATOM 9051  N NE   . ARG A 1 80  ? -5.102  12.634  0.666   1.00 0.00 ? 158 ARG A NE   5  
ATOM 9052  C CZ   . ARG A 1 80  ? -4.281  13.303  -0.136  1.00 0.00 ? 158 ARG A CZ   5  
ATOM 9053  N NH1  . ARG A 1 80  ? -3.188  12.720  -0.607  1.00 0.00 ? 158 ARG A NH1  5  
ATOM 9054  N NH2  . ARG A 1 80  ? -4.554  14.559  -0.468  1.00 0.00 ? 158 ARG A NH2  5  
ATOM 9055  H H    . ARG A 1 80  ? -5.378  7.687   -0.116  1.00 0.00 ? 158 ARG A H    5  
ATOM 9056  H HA   . ARG A 1 80  ? -3.369  8.591   -1.868  1.00 0.00 ? 158 ARG A HA   5  
ATOM 9057  H HB2  . ARG A 1 80  ? -4.286  10.865  -1.367  1.00 0.00 ? 158 ARG A HB2  5  
ATOM 9058  H HB3  . ARG A 1 80  ? -5.499  9.689   -1.857  1.00 0.00 ? 158 ARG A HB3  5  
ATOM 9059  H HG2  . ARG A 1 80  ? -6.558  10.681  -0.096  1.00 0.00 ? 158 ARG A HG2  5  
ATOM 9060  H HG3  . ARG A 1 80  ? -5.757  9.342   0.728   1.00 0.00 ? 158 ARG A HG3  5  
ATOM 9061  H HD2  . ARG A 1 80  ? -5.232  11.128  2.094   1.00 0.00 ? 158 ARG A HD2  5  
ATOM 9062  H HD3  . ARG A 1 80  ? -3.818  11.042  1.044   1.00 0.00 ? 158 ARG A HD3  5  
ATOM 9063  H HE   . ARG A 1 80  ? -5.904  13.085  1.003   1.00 0.00 ? 158 ARG A HE   5  
ATOM 9064  H HH11 . ARG A 1 80  ? -2.980  11.774  -0.359  1.00 0.00 ? 158 ARG A HH11 5  
ATOM 9065  H HH12 . ARG A 1 80  ? -2.572  13.226  -1.212  1.00 0.00 ? 158 ARG A HH12 5  
ATOM 9066  H HH21 . ARG A 1 80  ? -5.377  15.002  -0.115  1.00 0.00 ? 158 ARG A HH21 5  
ATOM 9067  H HH22 . ARG A 1 80  ? -3.936  15.061  -1.072  1.00 0.00 ? 158 ARG A HH22 5  
ATOM 9068  N N    . SER A 1 81  ? -2.637  8.757   1.233   1.00 0.00 ? 159 SER A N    5  
ATOM 9069  C CA   . SER A 1 81  ? -1.614  9.114   2.209   1.00 0.00 ? 159 SER A CA   5  
ATOM 9070  C C    . SER A 1 81  ? -0.571  8.007   2.332   1.00 0.00 ? 159 SER A C    5  
ATOM 9071  O O    . SER A 1 81  ? 0.313   8.064   3.186   1.00 0.00 ? 159 SER A O    5  
ATOM 9072  C CB   . SER A 1 81  ? -2.253  9.382   3.573   1.00 0.00 ? 159 SER A CB   5  
ATOM 9073  O OG   . SER A 1 81  ? -2.891  10.647  3.598   1.00 0.00 ? 159 SER A OG   5  
ATOM 9074  H H    . SER A 1 81  ? -3.327  8.106   1.479   1.00 0.00 ? 159 SER A H    5  
ATOM 9075  H HA   . SER A 1 81  ? -1.127  10.014  1.866   1.00 0.00 ? 159 SER A HA   5  
ATOM 9076  H HB2  . SER A 1 81  ? -2.987  8.618   3.780   1.00 0.00 ? 159 SER A HB2  5  
ATOM 9077  H HB3  . SER A 1 81  ? -1.488  9.362   4.336   1.00 0.00 ? 159 SER A HB3  5  
ATOM 9078  H HG   . SER A 1 81  ? -2.434  11.247  3.004   1.00 0.00 ? 159 SER A HG   5  
ATOM 9079  N N    . ALA A 1 82  ? -0.682  7.000   1.472   1.00 0.00 ? 160 ALA A N    5  
ATOM 9080  C CA   . ALA A 1 82  ? 0.251   5.880   1.482   1.00 0.00 ? 160 ALA A CA   5  
ATOM 9081  C C    . ALA A 1 82  ? 1.513   6.211   0.693   1.00 0.00 ? 160 ALA A C    5  
ATOM 9082  O O    . ALA A 1 82  ? 2.628   6.008   1.174   1.00 0.00 ? 160 ALA A O    5  
ATOM 9083  C CB   . ALA A 1 82  ? -0.414  4.633   0.919   1.00 0.00 ? 160 ALA A CB   5  
ATOM 9084  H H    . ALA A 1 82  ? -1.409  7.010   0.815   1.00 0.00 ? 160 ALA A H    5  
ATOM 9085  H HA   . ALA A 1 82  ? 0.522   5.681   2.509   1.00 0.00 ? 160 ALA A HA   5  
ATOM 9086  H HB1  . ALA A 1 82  ? -1.416  4.550   1.316   1.00 0.00 ? 160 ALA A HB1  5  
ATOM 9087  H HB2  . ALA A 1 82  ? -0.458  4.704   -0.158  1.00 0.00 ? 160 ALA A HB2  5  
ATOM 9088  H HB3  . ALA A 1 82  ? 0.158   3.762   1.200   1.00 0.00 ? 160 ALA A HB3  5  
ATOM 9089  N N    . ALA A 1 83  ? 1.330   6.721   -0.520  1.00 0.00 ? 161 ALA A N    5  
ATOM 9090  C CA   . ALA A 1 83  ? 2.455   7.080   -1.375  1.00 0.00 ? 161 ALA A CA   5  
ATOM 9091  C C    . ALA A 1 83  ? 3.552   7.774   -0.576  1.00 0.00 ? 161 ALA A C    5  
ATOM 9092  O O    . ALA A 1 83  ? 4.687   7.300   -0.519  1.00 0.00 ? 161 ALA A O    5  
ATOM 9093  C CB   . ALA A 1 83  ? 1.986   7.972   -2.516  1.00 0.00 ? 161 ALA A CB   5  
ATOM 9094  H H    . ALA A 1 83  ? 0.417   6.859   -0.848  1.00 0.00 ? 161 ALA A H    5  
ATOM 9095  H HA   . ALA A 1 83  ? 2.854   6.171   -1.802  1.00 0.00 ? 161 ALA A HA   5  
ATOM 9096  H HB1  . ALA A 1 83  ? 2.199   9.003   -2.277  1.00 0.00 ? 161 ALA A HB1  5  
ATOM 9097  H HB2  . ALA A 1 83  ? 2.505   7.698   -3.423  1.00 0.00 ? 161 ALA A HB2  5  
ATOM 9098  H HB3  . ALA A 1 83  ? 0.923   7.847   -2.657  1.00 0.00 ? 161 ALA A HB3  5  
ATOM 9099  N N    . HIS A 1 84  ? 3.207   8.901   0.040   1.00 0.00 ? 162 HIS A N    5  
ATOM 9100  C CA   . HIS A 1 84  ? 4.164   9.660   0.837   1.00 0.00 ? 162 HIS A CA   5  
ATOM 9101  C C    . HIS A 1 84  ? 4.762   8.793   1.941   1.00 0.00 ? 162 HIS A C    5  
ATOM 9102  O O    . HIS A 1 84  ? 5.967   8.830   2.189   1.00 0.00 ? 162 HIS A O    5  
ATOM 9103  C CB   . HIS A 1 84  ? 3.490   10.889  1.447   1.00 0.00 ? 162 HIS A CB   5  
ATOM 9104  C CG   . HIS A 1 84  ? 4.457   11.921  1.941   1.00 0.00 ? 162 HIS A CG   5  
ATOM 9105  N ND1  . HIS A 1 84  ? 5.705   12.109  1.385   1.00 0.00 ? 162 HIS A ND1  5  
ATOM 9106  C CD2  . HIS A 1 84  ? 4.354   12.824  2.943   1.00 0.00 ? 162 HIS A CD2  5  
ATOM 9107  C CE1  . HIS A 1 84  ? 6.328   13.082  2.025   1.00 0.00 ? 162 HIS A CE1  5  
ATOM 9108  N NE2  . HIS A 1 84  ? 5.529   13.533  2.976   1.00 0.00 ? 162 HIS A NE2  5  
ATOM 9109  H H    . HIS A 1 84  ? 2.287   9.228   -0.043  1.00 0.00 ? 162 HIS A H    5  
ATOM 9110  H HA   . HIS A 1 84  ? 4.958   9.984   0.182   1.00 0.00 ? 162 HIS A HA   5  
ATOM 9111  H HB2  . HIS A 1 84  ? 2.862   11.355  0.701   1.00 0.00 ? 162 HIS A HB2  5  
ATOM 9112  H HB3  . HIS A 1 84  ? 2.879   10.579  2.283   1.00 0.00 ? 162 HIS A HB3  5  
ATOM 9113  H HD2  . HIS A 1 84  ? 3.505   12.962  3.598   1.00 0.00 ? 162 HIS A HD2  5  
ATOM 9114  H HE1  . HIS A 1 84  ? 7.321   13.447  1.809   1.00 0.00 ? 162 HIS A HE1  5  
ATOM 9115  H HE2  . HIS A 1 84  ? 5.777   14.196  3.653   1.00 0.00 ? 162 HIS A HE2  5  
ATOM 9116  N N    . MET A 1 85  ? 3.911   8.014   2.601   1.00 0.00 ? 163 MET A N    5  
ATOM 9117  C CA   . MET A 1 85  ? 4.356   7.137   3.678   1.00 0.00 ? 163 MET A CA   5  
ATOM 9118  C C    . MET A 1 85  ? 5.426   6.169   3.184   1.00 0.00 ? 163 MET A C    5  
ATOM 9119  O O    . MET A 1 85  ? 6.427   5.936   3.862   1.00 0.00 ? 163 MET A O    5  
ATOM 9120  C CB   . MET A 1 85  ? 3.172   6.356   4.251   1.00 0.00 ? 163 MET A CB   5  
ATOM 9121  C CG   . MET A 1 85  ? 2.477   7.065   5.403   1.00 0.00 ? 163 MET A CG   5  
ATOM 9122  S SD   . MET A 1 85  ? 1.622   5.923   6.506   1.00 0.00 ? 163 MET A SD   5  
ATOM 9123  C CE   . MET A 1 85  ? -0.074  6.145   5.974   1.00 0.00 ? 163 MET A CE   5  
ATOM 9124  H H    . MET A 1 85  ? 2.962   8.028   2.357   1.00 0.00 ? 163 MET A H    5  
ATOM 9125  H HA   . MET A 1 85  ? 4.778   7.756   4.455   1.00 0.00 ? 163 MET A HA   5  
ATOM 9126  H HB2  . MET A 1 85  ? 2.448   6.196   3.466   1.00 0.00 ? 163 MET A HB2  5  
ATOM 9127  H HB3  . MET A 1 85  ? 3.524   5.399   4.606   1.00 0.00 ? 163 MET A HB3  5  
ATOM 9128  H HG2  . MET A 1 85  ? 3.217   7.607   5.973   1.00 0.00 ? 163 MET A HG2  5  
ATOM 9129  H HG3  . MET A 1 85  ? 1.757   7.760   4.997   1.00 0.00 ? 163 MET A HG3  5  
ATOM 9130  H HE1  . MET A 1 85  ? -0.404  5.263   5.447   1.00 0.00 ? 163 MET A HE1  5  
ATOM 9131  H HE2  . MET A 1 85  ? -0.703  6.306   6.837   1.00 0.00 ? 163 MET A HE2  5  
ATOM 9132  H HE3  . MET A 1 85  ? -0.136  7.002   5.318   1.00 0.00 ? 163 MET A HE3  5  
ATOM 9133  N N    . ARG A 1 86  ? 5.209   5.608   1.998   1.00 0.00 ? 164 ARG A N    5  
ATOM 9134  C CA   . ARG A 1 86  ? 6.155   4.665   1.415   1.00 0.00 ? 164 ARG A CA   5  
ATOM 9135  C C    . ARG A 1 86  ? 7.546   5.283   1.310   1.00 0.00 ? 164 ARG A C    5  
ATOM 9136  O O    . ARG A 1 86  ? 8.545   4.653   1.658   1.00 0.00 ? 164 ARG A O    5  
ATOM 9137  C CB   . ARG A 1 86  ? 5.677   4.220   0.031   1.00 0.00 ? 164 ARG A CB   5  
ATOM 9138  C CG   . ARG A 1 86  ? 6.219   2.866   -0.395  1.00 0.00 ? 164 ARG A CG   5  
ATOM 9139  C CD   . ARG A 1 86  ? 5.938   2.590   -1.863  1.00 0.00 ? 164 ARG A CD   5  
ATOM 9140  N NE   . ARG A 1 86  ? 4.507   2.598   -2.158  1.00 0.00 ? 164 ARG A NE   5  
ATOM 9141  C CZ   . ARG A 1 86  ? 4.010   2.589   -3.389  1.00 0.00 ? 164 ARG A CZ   5  
ATOM 9142  N NH1  . ARG A 1 86  ? 4.824   2.570   -4.436  1.00 0.00 ? 164 ARG A NH1  5  
ATOM 9143  N NH2  . ARG A 1 86  ? 2.697   2.597   -3.576  1.00 0.00 ? 164 ARG A NH2  5  
ATOM 9144  H H    . ARG A 1 86  ? 4.393   5.834   1.505   1.00 0.00 ? 164 ARG A H    5  
ATOM 9145  H HA   . ARG A 1 86  ? 6.206   3.802   2.063   1.00 0.00 ? 164 ARG A HA   5  
ATOM 9146  H HB2  . ARG A 1 86  ? 4.598   4.166   0.036   1.00 0.00 ? 164 ARG A HB2  5  
ATOM 9147  H HB3  . ARG A 1 86  ? 5.990   4.954   -0.697  1.00 0.00 ? 164 ARG A HB3  5  
ATOM 9148  H HG2  . ARG A 1 86  ? 7.287   2.849   -0.235  1.00 0.00 ? 164 ARG A HG2  5  
ATOM 9149  H HG3  . ARG A 1 86  ? 5.752   2.098   0.203   1.00 0.00 ? 164 ARG A HG3  5  
ATOM 9150  H HD2  . ARG A 1 86  ? 6.422   3.350   -2.458  1.00 0.00 ? 164 ARG A HD2  5  
ATOM 9151  H HD3  . ARG A 1 86  ? 6.343   1.622   -2.118  1.00 0.00 ? 164 ARG A HD3  5  
ATOM 9152  H HE   . ARG A 1 86  ? 3.888   2.612   -1.399  1.00 0.00 ? 164 ARG A HE   5  
ATOM 9153  H HH11 . ARG A 1 86  ? 5.814   2.562   -4.298  1.00 0.00 ? 164 ARG A HH11 5  
ATOM 9154  H HH12 . ARG A 1 86  ? 4.447   2.561   -5.362  1.00 0.00 ? 164 ARG A HH12 5  
ATOM 9155  H HH21 . ARG A 1 86  ? 2.080   2.611   -2.790  1.00 0.00 ? 164 ARG A HH21 5  
ATOM 9156  H HH22 . ARG A 1 86  ? 2.324   2.590   -4.503  1.00 0.00 ? 164 ARG A HH22 5  
ATOM 9157  N N    . HIS A 1 87  ? 7.603   6.521   0.828   1.00 0.00 ? 165 HIS A N    5  
ATOM 9158  C CA   . HIS A 1 87  ? 8.871   7.225   0.677   1.00 0.00 ? 165 HIS A CA   5  
ATOM 9159  C C    . HIS A 1 87  ? 9.528   7.457   2.035   1.00 0.00 ? 165 HIS A C    5  
ATOM 9160  O O    . HIS A 1 87  ? 10.730  7.242   2.199   1.00 0.00 ? 165 HIS A O    5  
ATOM 9161  C CB   . HIS A 1 87  ? 8.655   8.562   -0.032  1.00 0.00 ? 165 HIS A CB   5  
ATOM 9162  C CG   . HIS A 1 87  ? 9.923   9.320   -0.280  1.00 0.00 ? 165 HIS A CG   5  
ATOM 9163  N ND1  . HIS A 1 87  ? 10.455  9.506   -1.538  1.00 0.00 ? 165 HIS A ND1  5  
ATOM 9164  C CD2  . HIS A 1 87  ? 10.764  9.943   0.579   1.00 0.00 ? 165 HIS A CD2  5  
ATOM 9165  C CE1  . HIS A 1 87  ? 11.570  10.209  -1.443  1.00 0.00 ? 165 HIS A CE1  5  
ATOM 9166  N NE2  . HIS A 1 87  ? 11.779  10.487  -0.169  1.00 0.00 ? 165 HIS A NE2  5  
ATOM 9167  H H    . HIS A 1 87  ? 6.772   6.971   0.568   1.00 0.00 ? 165 HIS A H    5  
ATOM 9168  H HA   . HIS A 1 87  ? 9.523   6.609   0.076   1.00 0.00 ? 165 HIS A HA   5  
ATOM 9169  H HB2  . HIS A 1 87  ? 8.185   8.383   -0.988  1.00 0.00 ? 165 HIS A HB2  5  
ATOM 9170  H HB3  . HIS A 1 87  ? 8.009   9.182   0.571   1.00 0.00 ? 165 HIS A HB3  5  
ATOM 9171  H HD2  . HIS A 1 87  ? 10.658  10.001  1.653   1.00 0.00 ? 165 HIS A HD2  5  
ATOM 9172  H HE1  . HIS A 1 87  ? 12.202  10.506  -2.266  1.00 0.00 ? 165 HIS A HE1  5  
ATOM 9173  H HE2  . HIS A 1 87  ? 12.580  10.923  0.189   1.00 0.00 ? 165 HIS A HE2  5  
ATOM 9174  N N    . LEU A 1 88  ? 8.734   7.897   3.004   1.00 0.00 ? 166 LEU A N    5  
ATOM 9175  C CA   . LEU A 1 88  ? 9.238   8.158   4.348   1.00 0.00 ? 166 LEU A CA   5  
ATOM 9176  C C    . LEU A 1 88  ? 9.923   6.923   4.922   1.00 0.00 ? 166 LEU A C    5  
ATOM 9177  O O    . LEU A 1 88  ? 10.908  7.030   5.655   1.00 0.00 ? 166 LEU A O    5  
ATOM 9178  C CB   . LEU A 1 88  ? 8.096   8.596   5.266   1.00 0.00 ? 166 LEU A CB   5  
ATOM 9179  C CG   . LEU A 1 88  ? 7.568   10.015  5.052   1.00 0.00 ? 166 LEU A CG   5  
ATOM 9180  C CD1  . LEU A 1 88  ? 6.401   10.297  5.984   1.00 0.00 ? 166 LEU A CD1  5  
ATOM 9181  C CD2  . LEU A 1 88  ? 8.678   11.034  5.261   1.00 0.00 ? 166 LEU A CD2  5  
ATOM 9182  H H    . LEU A 1 88  ? 7.785   8.049   2.813   1.00 0.00 ? 166 LEU A H    5  
ATOM 9183  H HA   . LEU A 1 88  ? 9.962   8.957   4.280   1.00 0.00 ? 166 LEU A HA   5  
ATOM 9184  H HB2  . LEU A 1 88  ? 7.274   7.912   5.121   1.00 0.00 ? 166 LEU A HB2  5  
ATOM 9185  H HB3  . LEU A 1 88  ? 8.447   8.523   6.286   1.00 0.00 ? 166 LEU A HB3  5  
ATOM 9186  H HG   . LEU A 1 88  ? 7.213   10.110  4.035   1.00 0.00 ? 166 LEU A HG   5  
ATOM 9187  H HD11 . LEU A 1 88  ? 6.158   9.402   6.538   1.00 0.00 ? 166 LEU A HD11 5  
ATOM 9188  H HD12 . LEU A 1 88  ? 5.543   10.605  5.405   1.00 0.00 ? 166 LEU A HD12 5  
ATOM 9189  H HD13 . LEU A 1 88  ? 6.672   11.085  6.672   1.00 0.00 ? 166 LEU A HD13 5  
ATOM 9190  H HD21 . LEU A 1 88  ? 9.422   10.920  4.485   1.00 0.00 ? 166 LEU A HD21 5  
ATOM 9191  H HD22 . LEU A 1 88  ? 9.137   10.874  6.226   1.00 0.00 ? 166 LEU A HD22 5  
ATOM 9192  H HD23 . LEU A 1 88  ? 8.265   12.031  5.219   1.00 0.00 ? 166 LEU A HD23 5  
ATOM 9193  N N    . LEU A 1 89  ? 9.399   5.750   4.583   1.00 0.00 ? 167 LEU A N    5  
ATOM 9194  C CA   . LEU A 1 89  ? 9.961   4.493   5.064   1.00 0.00 ? 167 LEU A CA   5  
ATOM 9195  C C    . LEU A 1 89  ? 11.270  4.173   4.349   1.00 0.00 ? 167 LEU A C    5  
ATOM 9196  O O    . LEU A 1 89  ? 12.218  3.683   4.960   1.00 0.00 ? 167 LEU A O    5  
ATOM 9197  C CB   . LEU A 1 89  ? 8.962   3.353   4.857   1.00 0.00 ? 167 LEU A CB   5  
ATOM 9198  C CG   . LEU A 1 89  ? 7.655   3.455   5.643   1.00 0.00 ? 167 LEU A CG   5  
ATOM 9199  C CD1  . LEU A 1 89  ? 6.961   2.103   5.702   1.00 0.00 ? 167 LEU A CD1  5  
ATOM 9200  C CD2  . LEU A 1 89  ? 7.916   3.985   7.045   1.00 0.00 ? 167 LEU A CD2  5  
ATOM 9201  H H    . LEU A 1 89  ? 8.615   5.729   3.996   1.00 0.00 ? 167 LEU A H    5  
ATOM 9202  H HA   . LEU A 1 89  ? 10.158  4.600   6.120   1.00 0.00 ? 167 LEU A HA   5  
ATOM 9203  H HB2  . LEU A 1 89  ? 8.715   3.317   3.807   1.00 0.00 ? 167 LEU A HB2  5  
ATOM 9204  H HB3  . LEU A 1 89  ? 9.450   2.431   5.141   1.00 0.00 ? 167 LEU A HB3  5  
ATOM 9205  H HG   . LEU A 1 89  ? 6.993   4.147   5.141   1.00 0.00 ? 167 LEU A HG   5  
ATOM 9206  H HD11 . LEU A 1 89  ? 5.891   2.248   5.724   1.00 0.00 ? 167 LEU A HD11 5  
ATOM 9207  H HD12 . LEU A 1 89  ? 7.271   1.578   6.594   1.00 0.00 ? 167 LEU A HD12 5  
ATOM 9208  H HD13 . LEU A 1 89  ? 7.229   1.522   4.832   1.00 0.00 ? 167 LEU A HD13 5  
ATOM 9209  H HD21 . LEU A 1 89  ? 8.895   3.669   7.372   1.00 0.00 ? 167 LEU A HD21 5  
ATOM 9210  H HD22 . LEU A 1 89  ? 7.168   3.596   7.722   1.00 0.00 ? 167 LEU A HD22 5  
ATOM 9211  H HD23 . LEU A 1 89  ? 7.869   5.063   7.037   1.00 0.00 ? 167 LEU A HD23 5  
ATOM 9212  N N    . MET A 1 90  ? 11.314  4.458   3.051   1.00 0.00 ? 168 MET A N    5  
ATOM 9213  C CA   . MET A 1 90  ? 12.509  4.203   2.254   1.00 0.00 ? 168 MET A CA   5  
ATOM 9214  C C    . MET A 1 90  ? 13.767  4.602   3.018   1.00 0.00 ? 168 MET A C    5  
ATOM 9215  O O    . MET A 1 90  ? 14.782  3.908   2.966   1.00 0.00 ? 168 MET A O    5  
ATOM 9216  C CB   . MET A 1 90  ? 12.437  4.969   0.931   1.00 0.00 ? 168 MET A CB   5  
ATOM 9217  C CG   . MET A 1 90  ? 11.393  4.424   -0.030  1.00 0.00 ? 168 MET A CG   5  
ATOM 9218  S SD   . MET A 1 90  ? 11.424  5.252   -1.632  1.00 0.00 ? 168 MET A SD   5  
ATOM 9219  C CE   . MET A 1 90  ? 11.212  3.859   -2.738  1.00 0.00 ? 168 MET A CE   5  
ATOM 9220  H H    . MET A 1 90  ? 10.526  4.848   2.619   1.00 0.00 ? 168 MET A H    5  
ATOM 9221  H HA   . MET A 1 90  ? 12.548  3.145   2.045   1.00 0.00 ? 168 MET A HA   5  
ATOM 9222  H HB2  . MET A 1 90  ? 12.200  6.001   1.139   1.00 0.00 ? 168 MET A HB2  5  
ATOM 9223  H HB3  . MET A 1 90  ? 13.401  4.919   0.447   1.00 0.00 ? 168 MET A HB3  5  
ATOM 9224  H HG2  . MET A 1 90  ? 11.578  3.371   -0.183  1.00 0.00 ? 168 MET A HG2  5  
ATOM 9225  H HG3  . MET A 1 90  ? 10.416  4.556   0.409   1.00 0.00 ? 168 MET A HG3  5  
ATOM 9226  H HE1  . MET A 1 90  ? 12.151  3.639   -3.224  1.00 0.00 ? 168 MET A HE1  5  
ATOM 9227  H HE2  . MET A 1 90  ? 10.889  2.998   -2.173  1.00 0.00 ? 168 MET A HE2  5  
ATOM 9228  H HE3  . MET A 1 90  ? 10.469  4.102   -3.483  1.00 0.00 ? 168 MET A HE3  5  
ATOM 9229  N N    . SER A 1 91  ? 13.694  5.725   3.726   1.00 0.00 ? 169 SER A N    5  
ATOM 9230  C CA   . SER A 1 91  ? 14.829  6.218   4.497   1.00 0.00 ? 169 SER A CA   5  
ATOM 9231  C C    . SER A 1 91  ? 15.577  5.065   5.160   1.00 0.00 ? 169 SER A C    5  
ATOM 9232  O O    . SER A 1 91  ? 16.788  4.924   4.999   1.00 0.00 ? 169 SER A O    5  
ATOM 9233  C CB   . SER A 1 91  ? 14.357  7.212   5.560   1.00 0.00 ? 169 SER A CB   5  
ATOM 9234  O OG   . SER A 1 91  ? 15.446  7.950   6.087   1.00 0.00 ? 169 SER A OG   5  
ATOM 9235  H H    . SER A 1 91  ? 12.856  6.235   3.727   1.00 0.00 ? 169 SER A H    5  
ATOM 9236  H HA   . SER A 1 91  ? 15.498  6.722   3.817   1.00 0.00 ? 169 SER A HA   5  
ATOM 9237  H HB2  . SER A 1 91  ? 13.652  7.900   5.118   1.00 0.00 ? 169 SER A HB2  5  
ATOM 9238  H HB3  . SER A 1 91  ? 13.878  6.674   6.365   1.00 0.00 ? 169 SER A HB3  5  
ATOM 9239  H HG   . SER A 1 91  ? 15.402  8.856   5.771   1.00 0.00 ? 169 SER A HG   5  
ATOM 9240  N N    . GLN A 1 92  ? 14.845  4.244   5.907   1.00 0.00 ? 170 GLN A N    5  
ATOM 9241  C CA   . GLN A 1 92  ? 15.438  3.104   6.595   1.00 0.00 ? 170 GLN A CA   5  
ATOM 9242  C C    . GLN A 1 92  ? 16.205  2.218   5.619   1.00 0.00 ? 170 GLN A C    5  
ATOM 9243  O O    . GLN A 1 92  ? 15.631  1.328   4.992   1.00 0.00 ? 170 GLN A O    5  
ATOM 9244  C CB   . GLN A 1 92  ? 14.355  2.287   7.301   1.00 0.00 ? 170 GLN A CB   5  
ATOM 9245  C CG   . GLN A 1 92  ? 13.488  3.110   8.240   1.00 0.00 ? 170 GLN A CG   5  
ATOM 9246  C CD   . GLN A 1 92  ? 12.310  3.753   7.534   1.00 0.00 ? 170 GLN A CD   5  
ATOM 9247  O OE1  . GLN A 1 92  ? 11.373  3.071   7.119   1.00 0.00 ? 170 GLN A OE1  5  
ATOM 9248  N NE2  . GLN A 1 92  ? 12.353  5.072   7.393   1.00 0.00 ? 170 GLN A NE2  5  
ATOM 9249  H H    . GLN A 1 92  ? 13.884  4.409   5.997   1.00 0.00 ? 170 GLN A H    5  
ATOM 9250  H HA   . GLN A 1 92  ? 16.128  3.485   7.333   1.00 0.00 ? 170 GLN A HA   5  
ATOM 9251  H HB2  . GLN A 1 92  ? 13.716  1.838   6.555   1.00 0.00 ? 170 GLN A HB2  5  
ATOM 9252  H HB3  . GLN A 1 92  ? 14.828  1.505   7.876   1.00 0.00 ? 170 GLN A HB3  5  
ATOM 9253  H HG2  . GLN A 1 92  ? 13.111  2.464   9.019   1.00 0.00 ? 170 GLN A HG2  5  
ATOM 9254  H HG3  . GLN A 1 92  ? 14.094  3.888   8.680   1.00 0.00 ? 170 GLN A HG3  5  
ATOM 9255  H HE21 . GLN A 1 92  ? 13.132  5.550   7.747   1.00 0.00 ? 170 GLN A HE21 5  
ATOM 9256  H HE22 . GLN A 1 92  ? 11.606  5.514   6.940   1.00 0.00 ? 170 GLN A HE22 5  
ATOM 9257  N N    . GLN A 1 93  ? 17.505  2.468   5.496   1.00 0.00 ? 171 GLN A N    5  
ATOM 9258  C CA   . GLN A 1 93  ? 18.349  1.693   4.595   1.00 0.00 ? 171 GLN A CA   5  
ATOM 9259  C C    . GLN A 1 93  ? 18.239  0.202   4.893   1.00 0.00 ? 171 GLN A C    5  
ATOM 9260  O O    . GLN A 1 93  ? 18.214  -0.625  3.981   1.00 0.00 ? 171 GLN A O    5  
ATOM 9261  C CB   . GLN A 1 93  ? 19.806  2.143   4.714   1.00 0.00 ? 171 GLN A CB   5  
ATOM 9262  C CG   . GLN A 1 93  ? 20.382  1.977   6.111   1.00 0.00 ? 171 GLN A CG   5  
ATOM 9263  C CD   . GLN A 1 93  ? 21.675  2.745   6.305   1.00 0.00 ? 171 GLN A CD   5  
ATOM 9264  O OE1  . GLN A 1 93  ? 21.945  3.717   5.599   1.00 0.00 ? 171 GLN A OE1  5  
ATOM 9265  N NE2  . GLN A 1 93  ? 22.482  2.312   7.267   1.00 0.00 ? 171 GLN A NE2  5  
ATOM 9266  H H    . GLN A 1 93  ? 17.905  3.191   6.022   1.00 0.00 ? 171 GLN A H    5  
ATOM 9267  H HA   . GLN A 1 93  ? 18.009  1.871   3.586   1.00 0.00 ? 171 GLN A HA   5  
ATOM 9268  H HB2  . GLN A 1 93  ? 20.407  1.564   4.029   1.00 0.00 ? 171 GLN A HB2  5  
ATOM 9269  H HB3  . GLN A 1 93  ? 19.872  3.187   4.444   1.00 0.00 ? 171 GLN A HB3  5  
ATOM 9270  H HG2  . GLN A 1 93  ? 19.659  2.333   6.830   1.00 0.00 ? 171 GLN A HG2  5  
ATOM 9271  H HG3  . GLN A 1 93  ? 20.574  0.928   6.285   1.00 0.00 ? 171 GLN A HG3  5  
ATOM 9272  H HE21 . GLN A 1 93  ? 22.202  1.531   7.789   1.00 0.00 ? 171 GLN A HE21 5  
ATOM 9273  H HE22 . GLN A 1 93  ? 23.324  2.790   7.413   1.00 0.00 ? 171 GLN A HE22 5  
ATOM 9274  N N    . THR A 1 94  ? 18.175  -0.136  6.178   1.00 0.00 ? 172 THR A N    5  
ATOM 9275  C CA   . THR A 1 94  ? 18.069  -1.528  6.597   1.00 0.00 ? 172 THR A CA   5  
ATOM 9276  C C    . THR A 1 94  ? 17.235  -2.338  5.611   1.00 0.00 ? 172 THR A C    5  
ATOM 9277  O O    . THR A 1 94  ? 17.568  -3.480  5.291   1.00 0.00 ? 172 THR A O    5  
ATOM 9278  C CB   . THR A 1 94  ? 17.443  -1.646  8.000   1.00 0.00 ? 172 THR A CB   5  
ATOM 9279  O OG1  . THR A 1 94  ? 17.444  -3.014  8.423   1.00 0.00 ? 172 THR A OG1  5  
ATOM 9280  C CG2  . THR A 1 94  ? 16.020  -1.110  8.004   1.00 0.00 ? 172 THR A CG2  5  
ATOM 9281  H H    . THR A 1 94  ? 18.199  0.568   6.858   1.00 0.00 ? 172 THR A H    5  
ATOM 9282  H HA   . THR A 1 94  ? 19.066  -1.942  6.635   1.00 0.00 ? 172 THR A HA   5  
ATOM 9283  H HB   . THR A 1 94  ? 18.034  -1.063  8.691   1.00 0.00 ? 172 THR A HB   5  
ATOM 9284  H HG1  . THR A 1 94  ? 18.246  -3.195  8.920   1.00 0.00 ? 172 THR A HG1  5  
ATOM 9285  H HG21 . THR A 1 94  ? 15.964  -0.230  7.379   1.00 0.00 ? 172 THR A HG21 5  
ATOM 9286  H HG22 . THR A 1 94  ? 15.735  -0.852  9.014   1.00 0.00 ? 172 THR A HG22 5  
ATOM 9287  H HG23 . THR A 1 94  ? 15.350  -1.865  7.622   1.00 0.00 ? 172 THR A HG23 5  
ATOM 9288  N N    . LEU A 1 95  ? 16.149  -1.740  5.131   1.00 0.00 ? 173 LEU A N    5  
ATOM 9289  C CA   . LEU A 1 95  ? 15.267  -2.406  4.180   1.00 0.00 ? 173 LEU A CA   5  
ATOM 9290  C C    . LEU A 1 95  ? 15.852  -2.363  2.772   1.00 0.00 ? 173 LEU A C    5  
ATOM 9291  O O    . LEU A 1 95  ? 16.059  -1.289  2.208   1.00 0.00 ? 173 LEU A O    5  
ATOM 9292  C CB   . LEU A 1 95  ? 13.885  -1.750  4.190   1.00 0.00 ? 173 LEU A CB   5  
ATOM 9293  C CG   . LEU A 1 95  ? 12.977  -2.117  5.364   1.00 0.00 ? 173 LEU A CG   5  
ATOM 9294  C CD1  . LEU A 1 95  ? 12.041  -0.965  5.695   1.00 0.00 ? 173 LEU A CD1  5  
ATOM 9295  C CD2  . LEU A 1 95  ? 12.184  -3.378  5.052   1.00 0.00 ? 173 LEU A CD2  5  
ATOM 9296  H H    . LEU A 1 95  ? 15.936  -0.830  5.423   1.00 0.00 ? 173 LEU A H    5  
ATOM 9297  H HA   . LEU A 1 95  ? 15.169  -3.437  4.485   1.00 0.00 ? 173 LEU A HA   5  
ATOM 9298  H HB2  . LEU A 1 95  ? 14.027  -0.680  4.204   1.00 0.00 ? 173 LEU A HB2  5  
ATOM 9299  H HB3  . LEU A 1 95  ? 13.379  -2.032  3.278   1.00 0.00 ? 173 LEU A HB3  5  
ATOM 9300  H HG   . LEU A 1 95  ? 13.586  -2.312  6.236   1.00 0.00 ? 173 LEU A HG   5  
ATOM 9301  H HD11 . LEU A 1 95  ? 11.646  -1.096  6.692   1.00 0.00 ? 173 LEU A HD11 5  
ATOM 9302  H HD12 . LEU A 1 95  ? 11.227  -0.947  4.985   1.00 0.00 ? 173 LEU A HD12 5  
ATOM 9303  H HD13 . LEU A 1 95  ? 12.584  -0.033  5.643   1.00 0.00 ? 173 LEU A HD13 5  
ATOM 9304  H HD21 . LEU A 1 95  ? 11.853  -3.349  4.024   1.00 0.00 ? 173 LEU A HD21 5  
ATOM 9305  H HD22 . LEU A 1 95  ? 11.325  -3.434  5.705   1.00 0.00 ? 173 LEU A HD22 5  
ATOM 9306  H HD23 . LEU A 1 95  ? 12.811  -4.244  5.204   1.00 0.00 ? 173 LEU A HD23 5  
ATOM 9307  N N    . ARG A 1 96  ? 16.114  -3.538  2.210   1.00 0.00 ? 174 ARG A N    5  
ATOM 9308  C CA   . ARG A 1 96  ? 16.675  -3.635  0.867   1.00 0.00 ? 174 ARG A CA   5  
ATOM 9309  C C    . ARG A 1 96  ? 15.723  -3.035  -0.164  1.00 0.00 ? 174 ARG A C    5  
ATOM 9310  O O    . ARG A 1 96  ? 15.998  -1.982  -0.738  1.00 0.00 ? 174 ARG A O    5  
ATOM 9311  C CB   . ARG A 1 96  ? 16.968  -5.095  0.517   1.00 0.00 ? 174 ARG A CB   5  
ATOM 9312  C CG   . ARG A 1 96  ? 17.588  -5.279  -0.858  1.00 0.00 ? 174 ARG A CG   5  
ATOM 9313  C CD   . ARG A 1 96  ? 18.913  -4.542  -0.975  1.00 0.00 ? 174 ARG A CD   5  
ATOM 9314  N NE   . ARG A 1 96  ? 19.811  -5.179  -1.934  1.00 0.00 ? 174 ARG A NE   5  
ATOM 9315  C CZ   . ARG A 1 96  ? 21.080  -4.823  -2.102  1.00 0.00 ? 174 ARG A CZ   5  
ATOM 9316  N NH1  . ARG A 1 96  ? 21.597  -3.840  -1.378  1.00 0.00 ? 174 ARG A NH1  5  
ATOM 9317  N NH2  . ARG A 1 96  ? 21.834  -5.451  -2.995  1.00 0.00 ? 174 ARG A NH2  5  
ATOM 9318  H H    . ARG A 1 96  ? 15.928  -4.360  2.710   1.00 0.00 ? 174 ARG A H    5  
ATOM 9319  H HA   . ARG A 1 96  ? 17.600  -3.078  0.853   1.00 0.00 ? 174 ARG A HA   5  
ATOM 9320  H HB2  . ARG A 1 96  ? 17.649  -5.499  1.252   1.00 0.00 ? 174 ARG A HB2  5  
ATOM 9321  H HB3  . ARG A 1 96  ? 16.044  -5.652  0.549   1.00 0.00 ? 174 ARG A HB3  5  
ATOM 9322  H HG2  . ARG A 1 96  ? 17.759  -6.332  -1.028  1.00 0.00 ? 174 ARG A HG2  5  
ATOM 9323  H HG3  . ARG A 1 96  ? 16.906  -4.898  -1.604  1.00 0.00 ? 174 ARG A HG3  5  
ATOM 9324  H HD2  . ARG A 1 96  ? 18.719  -3.529  -1.296  1.00 0.00 ? 174 ARG A HD2  5  
ATOM 9325  H HD3  . ARG A 1 96  ? 19.388  -4.527  -0.006  1.00 0.00 ? 174 ARG A HD3  5  
ATOM 9326  H HE   . ARG A 1 96  ? 19.449  -5.908  -2.480  1.00 0.00 ? 174 ARG A HE   5  
ATOM 9327  H HH11 . ARG A 1 96  ? 21.031  -3.366  -0.703  1.00 0.00 ? 174 ARG A HH11 5  
ATOM 9328  H HH12 . ARG A 1 96  ? 22.553  -3.574  -1.505  1.00 0.00 ? 174 ARG A HH12 5  
ATOM 9329  H HH21 . ARG A 1 96  ? 21.448  -6.192  -3.542  1.00 0.00 ? 174 ARG A HH21 5  
ATOM 9330  H HH22 . ARG A 1 96  ? 22.788  -5.182  -3.120  1.00 0.00 ? 174 ARG A HH22 5  
ATOM 9331  N N    . ASN A 1 97  ? 14.603  -3.713  -0.393  1.00 0.00 ? 175 ASN A N    5  
ATOM 9332  C CA   . ASN A 1 97  ? 13.611  -3.248  -1.355  1.00 0.00 ? 175 ASN A CA   5  
ATOM 9333  C C    . ASN A 1 97  ? 12.267  -3.003  -0.675  1.00 0.00 ? 175 ASN A C    5  
ATOM 9334  O O    . ASN A 1 97  ? 11.778  -3.845  0.078   1.00 0.00 ? 175 ASN A O    5  
ATOM 9335  C CB   . ASN A 1 97  ? 13.446  -4.268  -2.483  1.00 0.00 ? 175 ASN A CB   5  
ATOM 9336  C CG   . ASN A 1 97  ? 13.596  -5.697  -1.997  1.00 0.00 ? 175 ASN A CG   5  
ATOM 9337  O OD1  . ASN A 1 97  ? 14.532  -6.020  -1.265  1.00 0.00 ? 175 ASN A OD1  5  
ATOM 9338  N ND2  . ASN A 1 97  ? 12.672  -6.559  -2.403  1.00 0.00 ? 175 ASN A ND2  5  
ATOM 9339  H H    . ASN A 1 97  ? 14.440  -4.546  0.097   1.00 0.00 ? 175 ASN A H    5  
ATOM 9340  H HA   . ASN A 1 97  ? 13.965  -2.317  -1.772  1.00 0.00 ? 175 ASN A HA   5  
ATOM 9341  H HB2  . ASN A 1 97  ? 12.464  -4.158  -2.919  1.00 0.00 ? 175 ASN A HB2  5  
ATOM 9342  H HB3  . ASN A 1 97  ? 14.194  -4.084  -3.240  1.00 0.00 ? 175 ASN A HB3  5  
ATOM 9343  H HD21 . ASN A 1 97  ? 11.956  -6.231  -2.986  1.00 0.00 ? 175 ASN A HD21 5  
ATOM 9344  H HD22 . ASN A 1 97  ? 12.744  -7.490  -2.103  1.00 0.00 ? 175 ASN A HD22 5  
ATOM 9345  N N    . VAL A 1 98  ? 11.674  -1.845  -0.948  1.00 0.00 ? 176 VAL A N    5  
ATOM 9346  C CA   . VAL A 1 98  ? 10.386  -1.489  -0.365  1.00 0.00 ? 176 VAL A CA   5  
ATOM 9347  C C    . VAL A 1 98  ? 9.283   -1.505  -1.418  1.00 0.00 ? 176 VAL A C    5  
ATOM 9348  O O    . VAL A 1 98  ? 9.113   -0.559  -2.188  1.00 0.00 ? 176 VAL A O    5  
ATOM 9349  C CB   . VAL A 1 98  ? 10.433  -0.098  0.294   1.00 0.00 ? 176 VAL A CB   5  
ATOM 9350  C CG1  . VAL A 1 98  ? 9.091   0.239   0.926   1.00 0.00 ? 176 VAL A CG1  5  
ATOM 9351  C CG2  . VAL A 1 98  ? 11.549  -0.034  1.325   1.00 0.00 ? 176 VAL A CG2  5  
ATOM 9352  H H    . VAL A 1 98  ? 12.114  -1.215  -1.556  1.00 0.00 ? 176 VAL A H    5  
ATOM 9353  H HA   . VAL A 1 98  ? 10.152  -2.218  0.398   1.00 0.00 ? 176 VAL A HA   5  
ATOM 9354  H HB   . VAL A 1 98  ? 10.638  0.635   -0.474  1.00 0.00 ? 176 VAL A HB   5  
ATOM 9355  H HG11 . VAL A 1 98  ? 8.980   1.312   0.984   1.00 0.00 ? 176 VAL A HG11 5  
ATOM 9356  H HG12 . VAL A 1 98  ? 8.295   -0.175  0.325   1.00 0.00 ? 176 VAL A HG12 5  
ATOM 9357  H HG13 . VAL A 1 98  ? 9.047   -0.180  1.921   1.00 0.00 ? 176 VAL A HG13 5  
ATOM 9358  H HG21 . VAL A 1 98  ? 12.199  0.798   1.100   1.00 0.00 ? 176 VAL A HG21 5  
ATOM 9359  H HG22 . VAL A 1 98  ? 11.123  0.098   2.309   1.00 0.00 ? 176 VAL A HG22 5  
ATOM 9360  H HG23 . VAL A 1 98  ? 12.116  -0.952  1.299   1.00 0.00 ? 176 VAL A HG23 5  
ATOM 9361  N N    . PRO A 1 99  ? 8.515   -2.603  -1.453  1.00 0.00 ? 177 PRO A N    5  
ATOM 9362  C CA   . PRO A 1 99  ? 7.413   -2.768  -2.407  1.00 0.00 ? 177 PRO A CA   5  
ATOM 9363  C C    . PRO A 1 99  ? 6.242   -1.839  -2.106  1.00 0.00 ? 177 PRO A C    5  
ATOM 9364  O O    . PRO A 1 99  ? 6.186   -1.190  -1.062  1.00 0.00 ? 177 PRO A O    5  
ATOM 9365  C CB   . PRO A 1 99  ? 6.998   -4.230  -2.220  1.00 0.00 ? 177 PRO A CB   5  
ATOM 9366  C CG   . PRO A 1 99  ? 7.414   -4.566  -0.829  1.00 0.00 ? 177 PRO A CG   5  
ATOM 9367  C CD   . PRO A 1 99  ? 8.661   -3.769  -0.565  1.00 0.00 ? 177 PRO A CD   5  
ATOM 9368  H HA   . PRO A 1 99  ? 7.743   -2.613  -3.424  1.00 0.00 ? 177 PRO A HA   5  
ATOM 9369  H HB2  . PRO A 1 99  ? 5.929   -4.322  -2.346  1.00 0.00 ? 177 PRO A HB2  5  
ATOM 9370  H HB3  . PRO A 1 99  ? 7.507   -4.848  -2.944  1.00 0.00 ? 177 PRO A HB3  5  
ATOM 9371  H HG2  . PRO A 1 99  ? 6.636   -4.287  -0.136  1.00 0.00 ? 177 PRO A HG2  5  
ATOM 9372  H HG3  . PRO A 1 99  ? 7.623   -5.623  -0.755  1.00 0.00 ? 177 PRO A HG3  5  
ATOM 9373  H HD2  . PRO A 1 99  ? 8.701   -3.462  0.470   1.00 0.00 ? 177 PRO A HD2  5  
ATOM 9374  H HD3  . PRO A 1 99  ? 9.538   -4.342  -0.824  1.00 0.00 ? 177 PRO A HD3  5  
ATOM 9375  N N    . PRO A 1 100 ? 5.283   -1.773  -3.042  1.00 0.00 ? 178 PRO A N    5  
ATOM 9376  C CA   . PRO A 1 100 ? 4.095   -0.926  -2.898  1.00 0.00 ? 178 PRO A CA   5  
ATOM 9377  C C    . PRO A 1 100 ? 3.145   -1.439  -1.821  1.00 0.00 ? 178 PRO A C    5  
ATOM 9378  O O    . PRO A 1 100 ? 2.850   -2.632  -1.757  1.00 0.00 ? 178 PRO A O    5  
ATOM 9379  C CB   . PRO A 1 100 ? 3.434   -1.007  -4.277  1.00 0.00 ? 178 PRO A CB   5  
ATOM 9380  C CG   . PRO A 1 100 ? 3.895   -2.306  -4.842  1.00 0.00 ? 178 PRO A CG   5  
ATOM 9381  C CD   . PRO A 1 100 ? 5.285   -2.519  -4.311  1.00 0.00 ? 178 PRO A CD   5  
ATOM 9382  H HA   . PRO A 1 100 ? 4.361   0.099   -2.684  1.00 0.00 ? 178 PRO A HA   5  
ATOM 9383  H HB2  . PRO A 1 100 ? 2.359   -0.983  -4.165  1.00 0.00 ? 178 PRO A HB2  5  
ATOM 9384  H HB3  . PRO A 1 100 ? 3.757   -0.175  -4.884  1.00 0.00 ? 178 PRO A HB3  5  
ATOM 9385  H HG2  . PRO A 1 100 ? 3.242   -3.101  -4.515  1.00 0.00 ? 178 PRO A HG2  5  
ATOM 9386  H HG3  . PRO A 1 100 ? 3.910   -2.251  -5.921  1.00 0.00 ? 178 PRO A HG3  5  
ATOM 9387  H HD2  . PRO A 1 100 ? 5.467   -3.570  -4.140  1.00 0.00 ? 178 PRO A HD2  5  
ATOM 9388  H HD3  . PRO A 1 100 ? 6.017   -2.114  -4.995  1.00 0.00 ? 178 PRO A HD3  5  
ATOM 9389  N N    . ILE A 1 101 ? 2.670   -0.529  -0.977  1.00 0.00 ? 179 ILE A N    5  
ATOM 9390  C CA   . ILE A 1 101 ? 1.752   -0.890  0.096   1.00 0.00 ? 179 ILE A CA   5  
ATOM 9391  C C    . ILE A 1 101 ? 0.301   -0.732  -0.345  1.00 0.00 ? 179 ILE A C    5  
ATOM 9392  O O    . ILE A 1 101 ? -0.066  0.267   -0.964  1.00 0.00 ? 179 ILE A O    5  
ATOM 9393  C CB   . ILE A 1 101 ? 1.990   -0.032  1.353   1.00 0.00 ? 179 ILE A CB   5  
ATOM 9394  C CG1  . ILE A 1 101 ? 3.369   -0.329  1.946   1.00 0.00 ? 179 ILE A CG1  5  
ATOM 9395  C CG2  . ILE A 1 101 ? 0.899   -0.286  2.382   1.00 0.00 ? 179 ILE A CG2  5  
ATOM 9396  C CD1  . ILE A 1 101 ? 3.883   0.763   2.858   1.00 0.00 ? 179 ILE A CD1  5  
ATOM 9397  H H    . ILE A 1 101 ? 2.942   0.406   -1.079  1.00 0.00 ? 179 ILE A H    5  
ATOM 9398  H HA   . ILE A 1 101 ? 1.928   -1.925  0.352   1.00 0.00 ? 179 ILE A HA   5  
ATOM 9399  H HB   . ILE A 1 101 ? 1.946   1.007   1.066   1.00 0.00 ? 179 ILE A HB   5  
ATOM 9400  H HG12 . ILE A 1 101 ? 3.319   -1.242  2.518   1.00 0.00 ? 179 ILE A HG12 5  
ATOM 9401  H HG13 . ILE A 1 101 ? 4.079   -0.453  1.141   1.00 0.00 ? 179 ILE A HG13 5  
ATOM 9402  H HG21 . ILE A 1 101 ? 1.340   -0.687  3.283   1.00 0.00 ? 179 ILE A HG21 5  
ATOM 9403  H HG22 . ILE A 1 101 ? 0.398   0.642   2.611   1.00 0.00 ? 179 ILE A HG22 5  
ATOM 9404  H HG23 . ILE A 1 101 ? 0.186   -0.992  1.985   1.00 0.00 ? 179 ILE A HG23 5  
ATOM 9405  H HD11 . ILE A 1 101 ? 4.614   0.350   3.537   1.00 0.00 ? 179 ILE A HD11 5  
ATOM 9406  H HD12 . ILE A 1 101 ? 4.339   1.542   2.266   1.00 0.00 ? 179 ILE A HD12 5  
ATOM 9407  H HD13 . ILE A 1 101 ? 3.060   1.176   3.423   1.00 0.00 ? 179 ILE A HD13 5  
ATOM 9408  N N    . VAL A 1 102 ? -0.522  -1.724  -0.021  1.00 0.00 ? 180 VAL A N    5  
ATOM 9409  C CA   . VAL A 1 102 ? -1.935  -1.695  -0.381  1.00 0.00 ? 180 VAL A CA   5  
ATOM 9410  C C    . VAL A 1 102 ? -2.816  -2.005  0.824   1.00 0.00 ? 180 VAL A C    5  
ATOM 9411  O O    . VAL A 1 102 ? -2.744  -3.094  1.395   1.00 0.00 ? 180 VAL A O    5  
ATOM 9412  C CB   . VAL A 1 102 ? -2.248  -2.700  -1.505  1.00 0.00 ? 180 VAL A CB   5  
ATOM 9413  C CG1  . VAL A 1 102 ? -3.709  -2.602  -1.917  1.00 0.00 ? 180 VAL A CG1  5  
ATOM 9414  C CG2  . VAL A 1 102 ? -1.332  -2.468  -2.697  1.00 0.00 ? 180 VAL A CG2  5  
ATOM 9415  H H    . VAL A 1 102 ? -0.171  -2.494  0.473   1.00 0.00 ? 180 VAL A H    5  
ATOM 9416  H HA   . VAL A 1 102 ? -2.168  -0.703  -0.739  1.00 0.00 ? 180 VAL A HA   5  
ATOM 9417  H HB   . VAL A 1 102 ? -2.070  -3.697  -1.129  1.00 0.00 ? 180 VAL A HB   5  
ATOM 9418  H HG11 . VAL A 1 102 ? -3.785  -2.671  -2.993  1.00 0.00 ? 180 VAL A HG11 5  
ATOM 9419  H HG12 . VAL A 1 102 ? -4.267  -3.408  -1.464  1.00 0.00 ? 180 VAL A HG12 5  
ATOM 9420  H HG13 . VAL A 1 102 ? -4.113  -1.655  -1.589  1.00 0.00 ? 180 VAL A HG13 5  
ATOM 9421  H HG21 . VAL A 1 102 ? -0.601  -1.714  -2.447  1.00 0.00 ? 180 VAL A HG21 5  
ATOM 9422  H HG22 . VAL A 1 102 ? -0.827  -3.390  -2.948  1.00 0.00 ? 180 VAL A HG22 5  
ATOM 9423  H HG23 . VAL A 1 102 ? -1.917  -2.138  -3.542  1.00 0.00 ? 180 VAL A HG23 5  
ATOM 9424  N N    . PHE A 1 103 ? -3.648  -1.042  1.206   1.00 0.00 ? 181 PHE A N    5  
ATOM 9425  C CA   . PHE A 1 103 ? -4.543  -1.212  2.344   1.00 0.00 ? 181 PHE A CA   5  
ATOM 9426  C C    . PHE A 1 103 ? -5.801  -1.975  1.937   1.00 0.00 ? 181 PHE A C    5  
ATOM 9427  O O    . PHE A 1 103 ? -6.490  -1.598  0.989   1.00 0.00 ? 181 PHE A O    5  
ATOM 9428  C CB   . PHE A 1 103 ? -4.926  0.150   2.927   1.00 0.00 ? 181 PHE A CB   5  
ATOM 9429  C CG   . PHE A 1 103 ? -3.770  0.881   3.549   1.00 0.00 ? 181 PHE A CG   5  
ATOM 9430  C CD1  . PHE A 1 103 ? -3.188  0.418   4.718   1.00 0.00 ? 181 PHE A CD1  5  
ATOM 9431  C CD2  . PHE A 1 103 ? -3.266  2.032   2.964   1.00 0.00 ? 181 PHE A CD2  5  
ATOM 9432  C CE1  . PHE A 1 103 ? -2.126  1.090   5.292   1.00 0.00 ? 181 PHE A CE1  5  
ATOM 9433  C CE2  . PHE A 1 103 ? -2.204  2.708   3.534   1.00 0.00 ? 181 PHE A CE2  5  
ATOM 9434  C CZ   . PHE A 1 103 ? -1.632  2.235   4.699   1.00 0.00 ? 181 PHE A CZ   5  
ATOM 9435  H H    . PHE A 1 103 ? -3.659  -0.196  0.710   1.00 0.00 ? 181 PHE A H    5  
ATOM 9436  H HA   . PHE A 1 103 ? -4.019  -1.781  3.095   1.00 0.00 ? 181 PHE A HA   5  
ATOM 9437  H HB2  . PHE A 1 103 ? -5.326  0.771   2.140   1.00 0.00 ? 181 PHE A HB2  5  
ATOM 9438  H HB3  . PHE A 1 103 ? -5.679  0.009   3.687   1.00 0.00 ? 181 PHE A HB3  5  
ATOM 9439  H HD1  . PHE A 1 103 ? -3.572  -0.478  5.182   1.00 0.00 ? 181 PHE A HD1  5  
ATOM 9440  H HD2  . PHE A 1 103 ? -3.713  2.403   2.052   1.00 0.00 ? 181 PHE A HD2  5  
ATOM 9441  H HE1  . PHE A 1 103 ? -1.680  0.718   6.203   1.00 0.00 ? 181 PHE A HE1  5  
ATOM 9442  H HE2  . PHE A 1 103 ? -1.820  3.603   3.067   1.00 0.00 ? 181 PHE A HE2  5  
ATOM 9443  H HZ   . PHE A 1 103 ? -0.802  2.762   5.146   1.00 0.00 ? 181 PHE A HZ   5  
ATOM 9444  N N    . VAL A 1 104 ? -6.093  -3.051  2.661   1.00 0.00 ? 182 VAL A N    5  
ATOM 9445  C CA   . VAL A 1 104 ? -7.267  -3.867  2.377   1.00 0.00 ? 182 VAL A CA   5  
ATOM 9446  C C    . VAL A 1 104 ? -8.170  -3.975  3.601   1.00 0.00 ? 182 VAL A C    5  
ATOM 9447  O O    . VAL A 1 104 ? -7.692  -4.040  4.733   1.00 0.00 ? 182 VAL A O    5  
ATOM 9448  C CB   . VAL A 1 104 ? -6.869  -5.283  1.920   1.00 0.00 ? 182 VAL A CB   5  
ATOM 9449  C CG1  . VAL A 1 104 ? -8.089  -6.190  1.865   1.00 0.00 ? 182 VAL A CG1  5  
ATOM 9450  C CG2  . VAL A 1 104 ? -6.173  -5.230  0.568   1.00 0.00 ? 182 VAL A CG2  5  
ATOM 9451  H H    . VAL A 1 104 ? -5.505  -3.301  3.404   1.00 0.00 ? 182 VAL A H    5  
ATOM 9452  H HA   . VAL A 1 104 ? -7.817  -3.394  1.576   1.00 0.00 ? 182 VAL A HA   5  
ATOM 9453  H HB   . VAL A 1 104 ? -6.177  -5.691  2.642   1.00 0.00 ? 182 VAL A HB   5  
ATOM 9454  H HG11 . VAL A 1 104 ? -8.928  -5.639  1.466   1.00 0.00 ? 182 VAL A HG11 5  
ATOM 9455  H HG12 . VAL A 1 104 ? -7.879  -7.039  1.231   1.00 0.00 ? 182 VAL A HG12 5  
ATOM 9456  H HG13 . VAL A 1 104 ? -8.327  -6.533  2.861   1.00 0.00 ? 182 VAL A HG13 5  
ATOM 9457  H HG21 . VAL A 1 104 ? -6.763  -5.766  -0.161  1.00 0.00 ? 182 VAL A HG21 5  
ATOM 9458  H HG22 . VAL A 1 104 ? -6.066  -4.200  0.258   1.00 0.00 ? 182 VAL A HG22 5  
ATOM 9459  H HG23 . VAL A 1 104 ? -5.197  -5.684  0.647   1.00 0.00 ? 182 VAL A HG23 5  
ATOM 9460  N N    . GLN A 1 105 ? -9.478  -3.995  3.364   1.00 0.00 ? 183 GLN A N    5  
ATOM 9461  C CA   . GLN A 1 105 ? -10.448 -4.095  4.448   1.00 0.00 ? 183 GLN A CA   5  
ATOM 9462  C C    . GLN A 1 105 ? -10.428 -5.488  5.070   1.00 0.00 ? 183 GLN A C    5  
ATOM 9463  O O    . GLN A 1 105 ? -10.461 -6.495  4.362   1.00 0.00 ? 183 GLN A O    5  
ATOM 9464  C CB   . GLN A 1 105 ? -11.853 -3.774  3.935   1.00 0.00 ? 183 GLN A CB   5  
ATOM 9465  C CG   . GLN A 1 105 ? -12.098 -2.288  3.722   1.00 0.00 ? 183 GLN A CG   5  
ATOM 9466  C CD   . GLN A 1 105 ? -13.524 -1.986  3.308   1.00 0.00 ? 183 GLN A CD   5  
ATOM 9467  O OE1  . GLN A 1 105 ? -14.477 -2.445  3.938   1.00 0.00 ? 183 GLN A OE1  5  
ATOM 9468  N NE2  . GLN A 1 105 ? -13.679 -1.208  2.242   1.00 0.00 ? 183 GLN A NE2  5  
ATOM 9469  H H    . GLN A 1 105 ? -9.798  -3.940  2.440   1.00 0.00 ? 183 GLN A H    5  
ATOM 9470  H HA   . GLN A 1 105 ? -10.177 -3.373  5.203   1.00 0.00 ? 183 GLN A HA   5  
ATOM 9471  H HB2  . GLN A 1 105 ? -12.004 -4.280  2.993   1.00 0.00 ? 183 GLN A HB2  5  
ATOM 9472  H HB3  . GLN A 1 105 ? -12.576 -4.137  4.650   1.00 0.00 ? 183 GLN A HB3  5  
ATOM 9473  H HG2  . GLN A 1 105 ? -11.889 -1.767  4.645   1.00 0.00 ? 183 GLN A HG2  5  
ATOM 9474  H HG3  . GLN A 1 105 ? -11.431 -1.934  2.951   1.00 0.00 ? 183 GLN A HG3  5  
ATOM 9475  H HE21 . GLN A 1 105 ? -12.874 -0.879  1.789   1.00 0.00 ? 183 GLN A HE21 5  
ATOM 9476  H HE22 . GLN A 1 105 ? -14.589 -0.997  1.952   1.00 0.00 ? 183 GLN A HE22 5  
ATOM 9477  N N    . ASP A 1 106 ? -10.372 -5.537  6.396   1.00 0.00 ? 184 ASP A N    5  
ATOM 9478  C CA   . ASP A 1 106 ? -10.348 -6.806  7.114   1.00 0.00 ? 184 ASP A CA   5  
ATOM 9479  C C    . ASP A 1 106 ? -11.576 -7.646  6.775   1.00 0.00 ? 184 ASP A C    5  
ATOM 9480  O O    . ASP A 1 106 ? -11.458 -8.801  6.366   1.00 0.00 ? 184 ASP A O    5  
ATOM 9481  C CB   . ASP A 1 106 ? -10.282 -6.562  8.622   1.00 0.00 ? 184 ASP A CB   5  
ATOM 9482  C CG   . ASP A 1 106 ? -10.509 -7.829  9.424   1.00 0.00 ? 184 ASP A CG   5  
ATOM 9483  O OD1  . ASP A 1 106 ? -9.552  -8.618  9.572   1.00 0.00 ? 184 ASP A OD1  5  
ATOM 9484  O OD2  . ASP A 1 106 ? -11.643 -8.031  9.904   1.00 0.00 ? 184 ASP A OD2  5  
ATOM 9485  H H    . ASP A 1 106 ? -10.347 -4.699  6.905   1.00 0.00 ? 184 ASP A H    5  
ATOM 9486  H HA   . ASP A 1 106 ? -9.464  -7.344  6.806   1.00 0.00 ? 184 ASP A HA   5  
ATOM 9487  H HB2  . ASP A 1 106 ? -9.308  -6.169  8.875   1.00 0.00 ? 184 ASP A HB2  5  
ATOM 9488  H HB3  . ASP A 1 106 ? -11.038 -5.843  8.898   1.00 0.00 ? 184 ASP A HB3  5  
ATOM 9489  N N    . LYS A 1 107 ? -12.754 -7.057  6.948   1.00 0.00 ? 185 LYS A N    5  
ATOM 9490  C CA   . LYS A 1 107 ? -14.005 -7.750  6.661   1.00 0.00 ? 185 LYS A CA   5  
ATOM 9491  C C    . LYS A 1 107 ? -14.525 -7.381  5.275   1.00 0.00 ? 185 LYS A C    5  
ATOM 9492  O O    . LYS A 1 107 ? -15.023 -6.277  5.062   1.00 0.00 ? 185 LYS A O    5  
ATOM 9493  C CB   . LYS A 1 107 ? -15.056 -7.407  7.720   1.00 0.00 ? 185 LYS A CB   5  
ATOM 9494  C CG   . LYS A 1 107 ? -15.035 -8.336  8.921   1.00 0.00 ? 185 LYS A CG   5  
ATOM 9495  C CD   . LYS A 1 107 ? -15.848 -9.595  8.667   1.00 0.00 ? 185 LYS A CD   5  
ATOM 9496  C CE   . LYS A 1 107 ? -15.796 -10.541 9.856   1.00 0.00 ? 185 LYS A CE   5  
ATOM 9497  N NZ   . LYS A 1 107 ? -16.811 -10.191 10.888  1.00 0.00 ? 185 LYS A NZ   5  
ATOM 9498  H H    . LYS A 1 107 ? -12.784 -6.134  7.277   1.00 0.00 ? 185 LYS A H    5  
ATOM 9499  H HA   . LYS A 1 107 ? -13.811 -8.811  6.689   1.00 0.00 ? 185 LYS A HA   5  
ATOM 9500  H HB2  . LYS A 1 107 ? -14.884 -6.399  8.067   1.00 0.00 ? 185 LYS A HB2  5  
ATOM 9501  H HB3  . LYS A 1 107 ? -16.036 -7.460  7.267   1.00 0.00 ? 185 LYS A HB3  5  
ATOM 9502  H HG2  . LYS A 1 107 ? -14.013 -8.617  9.130   1.00 0.00 ? 185 LYS A HG2  5  
ATOM 9503  H HG3  . LYS A 1 107 ? -15.449 -7.817  9.773   1.00 0.00 ? 185 LYS A HG3  5  
ATOM 9504  H HD2  . LYS A 1 107 ? -16.876 -9.319  8.486   1.00 0.00 ? 185 LYS A HD2  5  
ATOM 9505  H HD3  . LYS A 1 107 ? -15.451 -10.100 7.798   1.00 0.00 ? 185 LYS A HD3  5  
ATOM 9506  H HE2  . LYS A 1 107 ? -15.981 -11.546 9.508   1.00 0.00 ? 185 LYS A HE2  5  
ATOM 9507  H HE3  . LYS A 1 107 ? -14.812 -10.489 10.298  1.00 0.00 ? 185 LYS A HE3  5  
ATOM 9508  H HZ1  . LYS A 1 107 ? -17.369 -11.032 11.140  1.00 0.00 ? 185 LYS A HZ1  5  
ATOM 9509  H HZ2  . LYS A 1 107 ? -17.453 -9.459  10.524  1.00 0.00 ? 185 LYS A HZ2  5  
ATOM 9510  H HZ3  . LYS A 1 107 ? -16.341 -9.831  11.743  1.00 0.00 ? 185 LYS A HZ3  5  
ATOM 9511  N N    . GLY A 1 108 ? -14.407 -8.316  4.336   1.00 0.00 ? 186 GLY A N    5  
ATOM 9512  C CA   . GLY A 1 108 ? -14.871 -8.070  2.983   1.00 0.00 ? 186 GLY A CA   5  
ATOM 9513  C C    . GLY A 1 108 ? -16.307 -8.507  2.775   1.00 0.00 ? 186 GLY A C    5  
ATOM 9514  O O    . GLY A 1 108 ? -16.659 -9.021  1.713   1.00 0.00 ? 186 GLY A O    5  
ATOM 9515  H H    . GLY A 1 108 ? -14.002 -9.178  4.564   1.00 0.00 ? 186 GLY A H    5  
ATOM 9516  H HA2  . GLY A 1 108 ? -14.793 -7.013  2.774   1.00 0.00 ? 186 GLY A HA2  5  
ATOM 9517  H HA3  . GLY A 1 108 ? -14.239 -8.611  2.295   1.00 0.00 ? 186 GLY A HA3  5  
ATOM 9518  N N    . ASN A 1 109 ? -17.140 -8.305  3.791   1.00 0.00 ? 187 ASN A N    5  
ATOM 9519  C CA   . ASN A 1 109 ? -18.546 -8.685  3.714   1.00 0.00 ? 187 ASN A CA   5  
ATOM 9520  C C    . ASN A 1 109 ? -19.149 -8.269  2.376   1.00 0.00 ? 187 ASN A C    5  
ATOM 9521  O O    . ASN A 1 109 ? -19.016 -7.121  1.953   1.00 0.00 ? 187 ASN A O    5  
ATOM 9522  C CB   . ASN A 1 109 ? -19.331 -8.045  4.861   1.00 0.00 ? 187 ASN A CB   5  
ATOM 9523  C CG   . ASN A 1 109 ? -20.576 -8.834  5.220   1.00 0.00 ? 187 ASN A CG   5  
ATOM 9524  O OD1  . ASN A 1 109 ? -21.511 -8.934  4.425   1.00 0.00 ? 187 ASN A OD1  5  
ATOM 9525  N ND2  . ASN A 1 109 ? -20.593 -9.398  6.422   1.00 0.00 ? 187 ASN A ND2  5  
ATOM 9526  H H    . ASN A 1 109 ? -16.801 -7.891  4.612   1.00 0.00 ? 187 ASN A H    5  
ATOM 9527  H HA   . ASN A 1 109 ? -18.604 -9.759  3.805   1.00 0.00 ? 187 ASN A HA   5  
ATOM 9528  H HB2  . ASN A 1 109 ? -18.699 -7.991  5.736   1.00 0.00 ? 187 ASN A HB2  5  
ATOM 9529  H HB3  . ASN A 1 109 ? -19.629 -7.048  4.574   1.00 0.00 ? 187 ASN A HB3  5  
ATOM 9530  H HD21 . ASN A 1 109 ? -19.813 -9.276  7.002   1.00 0.00 ? 187 ASN A HD21 5  
ATOM 9531  H HD22 . ASN A 1 109 ? -21.385 -9.914  6.679   1.00 0.00 ? 187 ASN A HD22 5  
ATOM 9532  N N    . ALA A 1 110 ? -19.814 -9.211  1.715   1.00 0.00 ? 188 ALA A N    5  
ATOM 9533  C CA   . ALA A 1 110 ? -20.441 -8.943  0.427   1.00 0.00 ? 188 ALA A CA   5  
ATOM 9534  C C    . ALA A 1 110 ? -21.668 -8.052  0.588   1.00 0.00 ? 188 ALA A C    5  
ATOM 9535  O O    . ALA A 1 110 ? -22.737 -8.518  0.982   1.00 0.00 ? 188 ALA A O    5  
ATOM 9536  C CB   . ALA A 1 110 ? -20.819 -10.248 -0.258  1.00 0.00 ? 188 ALA A CB   5  
ATOM 9537  H H    . ALA A 1 110 ? -19.886 -10.108 2.104   1.00 0.00 ? 188 ALA A H    5  
ATOM 9538  H HA   . ALA A 1 110 ? -19.719 -8.434  -0.196  1.00 0.00 ? 188 ALA A HA   5  
ATOM 9539  H HB1  . ALA A 1 110 ? -21.566 -10.053 -1.014  1.00 0.00 ? 188 ALA A HB1  5  
ATOM 9540  H HB2  . ALA A 1 110 ? -19.944 -10.679 -0.719  1.00 0.00 ? 188 ALA A HB2  5  
ATOM 9541  H HB3  . ALA A 1 110 ? -21.218 -10.935 0.473   1.00 0.00 ? 188 ALA A HB3  5  
ATOM 9542  N N    . ALA A 1 111 ? -21.507 -6.769  0.281   1.00 0.00 ? 189 ALA A N    5  
ATOM 9543  C CA   . ALA A 1 111 ? -22.602 -5.814  0.391   1.00 0.00 ? 189 ALA A CA   5  
ATOM 9544  C C    . ALA A 1 111 ? -22.756 -5.005  -0.892  1.00 0.00 ? 189 ALA A C    5  
ATOM 9545  O O    . ALA A 1 111 ? -22.765 -3.773  -0.864  1.00 0.00 ? 189 ALA A O    5  
ATOM 9546  C CB   . ALA A 1 111 ? -22.379 -4.888  1.577   1.00 0.00 ? 189 ALA A CB   5  
ATOM 9547  H H    . ALA A 1 111 ? -20.631 -6.458  -0.028  1.00 0.00 ? 189 ALA A H    5  
ATOM 9548  H HA   . ALA A 1 111 ? -23.513 -6.369  0.565   1.00 0.00 ? 189 ALA A HA   5  
ATOM 9549  H HB1  . ALA A 1 111 ? -22.068 -3.917  1.221   1.00 0.00 ? 189 ALA A HB1  5  
ATOM 9550  H HB2  . ALA A 1 111 ? -23.298 -4.791  2.136   1.00 0.00 ? 189 ALA A HB2  5  
ATOM 9551  H HB3  . ALA A 1 111 ? -21.611 -5.300  2.215   1.00 0.00 ? 189 ALA A HB3  5  
ATOM 9552  N N    . LEU A 1 112 ? -22.875 -5.703  -2.016  1.00 0.00 ? 190 LEU A N    5  
ATOM 9553  C CA   . LEU A 1 112 ? -23.027 -5.049  -3.311  1.00 0.00 ? 190 LEU A CA   5  
ATOM 9554  C C    . LEU A 1 112 ? -24.501 -4.842  -3.646  1.00 0.00 ? 190 LEU A C    5  
ATOM 9555  O O    . LEU A 1 112 ? -25.021 -5.431  -4.593  1.00 0.00 ? 190 LEU A O    5  
ATOM 9556  C CB   . LEU A 1 112 ? -22.355 -5.879  -4.406  1.00 0.00 ? 190 LEU A CB   5  
ATOM 9557  C CG   . LEU A 1 112 ? -21.919 -5.113  -5.656  1.00 0.00 ? 190 LEU A CG   5  
ATOM 9558  C CD1  . LEU A 1 112 ? -20.788 -5.846  -6.362  1.00 0.00 ? 190 LEU A CD1  5  
ATOM 9559  C CD2  . LEU A 1 112 ? -23.097 -4.912  -6.597  1.00 0.00 ? 190 LEU A CD2  5  
ATOM 9560  H H    . LEU A 1 112 ? -22.861 -6.682  -1.975  1.00 0.00 ? 190 LEU A H    5  
ATOM 9561  H HA   . LEU A 1 112 ? -22.545 -4.085  -3.254  1.00 0.00 ? 190 LEU A HA   5  
ATOM 9562  H HB2  . LEU A 1 112 ? -21.479 -6.341  -3.979  1.00 0.00 ? 190 LEU A HB2  5  
ATOM 9563  H HB3  . LEU A 1 112 ? -23.052 -6.646  -4.713  1.00 0.00 ? 190 LEU A HB3  5  
ATOM 9564  H HG   . LEU A 1 112 ? -21.553 -4.139  -5.364  1.00 0.00 ? 190 LEU A HG   5  
ATOM 9565  H HD11 . LEU A 1 112 ? -19.841 -5.506  -5.973  1.00 0.00 ? 190 LEU A HD11 5  
ATOM 9566  H HD12 . LEU A 1 112 ? -20.836 -5.643  -7.422  1.00 0.00 ? 190 LEU A HD12 5  
ATOM 9567  H HD13 . LEU A 1 112 ? -20.888 -6.908  -6.194  1.00 0.00 ? 190 LEU A HD13 5  
ATOM 9568  H HD21 . LEU A 1 112 ? -22.748 -4.928  -7.619  1.00 0.00 ? 190 LEU A HD21 5  
ATOM 9569  H HD22 . LEU A 1 112 ? -23.565 -3.960  -6.391  1.00 0.00 ? 190 LEU A HD22 5  
ATOM 9570  H HD23 . LEU A 1 112 ? -23.815 -5.706  -6.450  1.00 0.00 ? 190 LEU A HD23 5  
ATOM 9571  N N    . ALA A 1 113 ? -25.168 -3.999  -2.865  1.00 0.00 ? 191 ALA A N    5  
ATOM 9572  C CA   . ALA A 1 113 ? -26.580 -3.710  -3.081  1.00 0.00 ? 191 ALA A CA   5  
ATOM 9573  C C    . ALA A 1 113 ? -26.841 -2.208  -3.071  1.00 0.00 ? 191 ALA A C    5  
ATOM 9574  O O    . ALA A 1 113 ? -27.311 -1.658  -2.075  1.00 0.00 ? 191 ALA A O    5  
ATOM 9575  C CB   . ALA A 1 113 ? -27.428 -4.403  -2.025  1.00 0.00 ? 191 ALA A CB   5  
ATOM 9576  H H    . ALA A 1 113 ? -24.698 -3.559  -2.125  1.00 0.00 ? 191 ALA A H    5  
ATOM 9577  H HA   . ALA A 1 113 ? -26.857 -4.107  -4.047  1.00 0.00 ? 191 ALA A HA   5  
ATOM 9578  H HB1  . ALA A 1 113 ? -28.322 -4.799  -2.485  1.00 0.00 ? 191 ALA A HB1  5  
ATOM 9579  H HB2  . ALA A 1 113 ? -26.863 -5.209  -1.582  1.00 0.00 ? 191 ALA A HB2  5  
ATOM 9580  H HB3  . ALA A 1 113 ? -27.702 -3.691  -1.260  1.00 0.00 ? 191 ALA A HB3  5  
ATOM 9581  N N    . GLU A 1 114 ? -26.534 -1.550  -4.184  1.00 0.00 ? 192 GLU A N    5  
ATOM 9582  C CA   . GLU A 1 114 ? -26.735 -0.111  -4.301  1.00 0.00 ? 192 GLU A CA   5  
ATOM 9583  C C    . GLU A 1 114 ? -27.838 0.205   -5.307  1.00 0.00 ? 192 GLU A C    5  
ATOM 9584  O O    . GLU A 1 114 ? -27.607 0.211   -6.517  1.00 0.00 ? 192 GLU A O    5  
ATOM 9585  C CB   . GLU A 1 114 ? -25.434 0.576   -4.722  1.00 0.00 ? 192 GLU A CB   5  
ATOM 9586  C CG   . GLU A 1 114 ? -24.293 0.374   -3.739  1.00 0.00 ? 192 GLU A CG   5  
ATOM 9587  C CD   . GLU A 1 114 ? -22.942 0.721   -4.333  1.00 0.00 ? 192 GLU A CD   5  
ATOM 9588  O OE1  . GLU A 1 114 ? -22.807 1.832   -4.890  1.00 0.00 ? 192 GLU A OE1  5  
ATOM 9589  O OE2  . GLU A 1 114 ? -22.020 -0.116  -4.243  1.00 0.00 ? 192 GLU A OE2  5  
ATOM 9590  H H    . GLU A 1 114 ? -26.163 -2.045  -4.945  1.00 0.00 ? 192 GLU A H    5  
ATOM 9591  H HA   . GLU A 1 114 ? -27.030 0.262   -3.332  1.00 0.00 ? 192 GLU A HA   5  
ATOM 9592  H HB2  . GLU A 1 114 ? -25.128 0.184   -5.682  1.00 0.00 ? 192 GLU A HB2  5  
ATOM 9593  H HB3  . GLU A 1 114 ? -25.615 1.636   -4.817  1.00 0.00 ? 192 GLU A HB3  5  
ATOM 9594  H HG2  . GLU A 1 114 ? -24.462 1.002   -2.877  1.00 0.00 ? 192 GLU A HG2  5  
ATOM 9595  H HG3  . GLU A 1 114 ? -24.279 -0.662  -3.431  1.00 0.00 ? 192 GLU A HG3  5  
ATOM 9596  N N    . LEU A 1 115 ? -29.037 0.466   -4.798  1.00 0.00 ? 193 LEU A N    5  
ATOM 9597  C CA   . LEU A 1 115 ? -30.178 0.782   -5.651  1.00 0.00 ? 193 LEU A CA   5  
ATOM 9598  C C    . LEU A 1 115 ? -30.431 2.285   -5.686  1.00 0.00 ? 193 LEU A C    5  
ATOM 9599  O O    . LEU A 1 115 ? -31.579 2.731   -5.706  1.00 0.00 ? 193 LEU A O    5  
ATOM 9600  C CB   . LEU A 1 115 ? -31.428 0.053   -5.155  1.00 0.00 ? 193 LEU A CB   5  
ATOM 9601  C CG   . LEU A 1 115 ? -31.523 -1.432  -5.506  1.00 0.00 ? 193 LEU A CG   5  
ATOM 9602  C CD1  . LEU A 1 115 ? -32.660 -2.090  -4.739  1.00 0.00 ? 193 LEU A CD1  5  
ATOM 9603  C CD2  . LEU A 1 115 ? -31.711 -1.615  -7.004  1.00 0.00 ? 193 LEU A CD2  5  
ATOM 9604  H H    . LEU A 1 115 ? -29.159 0.445   -3.827  1.00 0.00 ? 193 LEU A H    5  
ATOM 9605  H HA   . LEU A 1 115 ? -29.947 0.445   -6.651  1.00 0.00 ? 193 LEU A HA   5  
ATOM 9606  H HB2  . LEU A 1 115 ? -31.457 0.142   -4.080  1.00 0.00 ? 193 LEU A HB2  5  
ATOM 9607  H HB3  . LEU A 1 115 ? -32.289 0.550   -5.579  1.00 0.00 ? 193 LEU A HB3  5  
ATOM 9608  H HG   . LEU A 1 115 ? -30.602 -1.922  -5.221  1.00 0.00 ? 193 LEU A HG   5  
ATOM 9609  H HD11 . LEU A 1 115 ? -32.754 -3.120  -5.049  1.00 0.00 ? 193 LEU A HD11 5  
ATOM 9610  H HD12 . LEU A 1 115 ? -33.582 -1.566  -4.945  1.00 0.00 ? 193 LEU A HD12 5  
ATOM 9611  H HD13 . LEU A 1 115 ? -32.451 -2.049  -3.680  1.00 0.00 ? 193 LEU A HD13 5  
ATOM 9612  H HD21 . LEU A 1 115 ? -31.752 -0.648  -7.482  1.00 0.00 ? 193 LEU A HD21 5  
ATOM 9613  H HD22 . LEU A 1 115 ? -32.633 -2.147  -7.189  1.00 0.00 ? 193 LEU A HD22 5  
ATOM 9614  H HD23 . LEU A 1 115 ? -30.882 -2.180  -7.405  1.00 0.00 ? 193 LEU A HD23 5  
ATOM 9615  N N    . ASP A 1 116 ? -29.353 3.062   -5.694  1.00 0.00 ? 194 ASP A N    5  
ATOM 9616  C CA   . ASP A 1 116 ? -29.459 4.516   -5.730  1.00 0.00 ? 194 ASP A CA   5  
ATOM 9617  C C    . ASP A 1 116 ? -28.699 5.087   -6.923  1.00 0.00 ? 194 ASP A C    5  
ATOM 9618  O O    . ASP A 1 116 ? -27.519 5.422   -6.816  1.00 0.00 ? 194 ASP A O    5  
ATOM 9619  C CB   . ASP A 1 116 ? -28.922 5.119   -4.431  1.00 0.00 ? 194 ASP A CB   5  
ATOM 9620  C CG   . ASP A 1 116 ? -28.794 6.628   -4.504  1.00 0.00 ? 194 ASP A CG   5  
ATOM 9621  O OD1  . ASP A 1 116 ? -29.784 7.291   -4.881  1.00 0.00 ? 194 ASP A OD1  5  
ATOM 9622  O OD2  . ASP A 1 116 ? -27.705 7.147   -4.183  1.00 0.00 ? 194 ASP A OD2  5  
ATOM 9623  H H    . ASP A 1 116 ? -28.465 2.647   -5.677  1.00 0.00 ? 194 ASP A H    5  
ATOM 9624  H HA   . ASP A 1 116 ? -30.503 4.770   -5.830  1.00 0.00 ? 194 ASP A HA   5  
ATOM 9625  H HB2  . ASP A 1 116 ? -29.594 4.873   -3.622  1.00 0.00 ? 194 ASP A HB2  5  
ATOM 9626  H HB3  . ASP A 1 116 ? -27.947 4.703   -4.224  1.00 0.00 ? 194 ASP A HB3  5  
ATOM 9627  N N    . GLN A 1 117 ? -29.382 5.192   -8.058  1.00 0.00 ? 195 GLN A N    5  
ATOM 9628  C CA   . GLN A 1 117 ? -28.770 5.721   -9.272  1.00 0.00 ? 195 GLN A CA   5  
ATOM 9629  C C    . GLN A 1 117 ? -29.627 6.828   -9.876  1.00 0.00 ? 195 GLN A C    5  
ATOM 9630  O O    . GLN A 1 117 ? -30.645 6.561   -10.516 1.00 0.00 ? 195 GLN A O    5  
ATOM 9631  C CB   . GLN A 1 117 ? -28.567 4.602   -10.294 1.00 0.00 ? 195 GLN A CB   5  
ATOM 9632  C CG   . GLN A 1 117 ? -27.347 3.738   -10.017 1.00 0.00 ? 195 GLN A CG   5  
ATOM 9633  C CD   . GLN A 1 117 ? -26.857 3.007   -11.251 1.00 0.00 ? 195 GLN A CD   5  
ATOM 9634  O OE1  . GLN A 1 117 ? -27.253 1.870   -11.512 1.00 0.00 ? 195 GLN A OE1  5  
ATOM 9635  N NE2  . GLN A 1 117 ? -25.990 3.656   -12.020 1.00 0.00 ? 195 GLN A NE2  5  
ATOM 9636  H H    . GLN A 1 117 ? -30.319 4.908   -8.080  1.00 0.00 ? 195 GLN A H    5  
ATOM 9637  H HA   . GLN A 1 117 ? -27.808 6.132   -9.005  1.00 0.00 ? 195 GLN A HA   5  
ATOM 9638  H HB2  . GLN A 1 117 ? -29.439 3.966   -10.293 1.00 0.00 ? 195 GLN A HB2  5  
ATOM 9639  H HB3  . GLN A 1 117 ? -28.454 5.042   -11.274 1.00 0.00 ? 195 GLN A HB3  5  
ATOM 9640  H HG2  . GLN A 1 117 ? -26.550 4.370   -9.652  1.00 0.00 ? 195 GLN A HG2  5  
ATOM 9641  H HG3  . GLN A 1 117 ? -27.602 3.010   -9.262  1.00 0.00 ? 195 GLN A HG3  5  
ATOM 9642  H HE21 . GLN A 1 117 ? -25.718 4.559   -11.750 1.00 0.00 ? 195 GLN A HE21 5  
ATOM 9643  H HE22 . GLN A 1 117 ? -25.657 3.207   -12.823 1.00 0.00 ? 195 GLN A HE22 5  
ATOM 9644  N N    . LEU A 1 118 ? -29.210 8.072   -9.667  1.00 0.00 ? 196 LEU A N    5  
ATOM 9645  C CA   . LEU A 1 118 ? -29.939 9.222   -10.191 1.00 0.00 ? 196 LEU A CA   5  
ATOM 9646  C C    . LEU A 1 118 ? -28.994 10.197  -10.885 1.00 0.00 ? 196 LEU A C    5  
ATOM 9647  O O    . LEU A 1 118 ? -27.854 10.385  -10.456 1.00 0.00 ? 196 LEU A O    5  
ATOM 9648  C CB   . LEU A 1 118 ? -30.687 9.934   -9.063  1.00 0.00 ? 196 LEU A CB   5  
ATOM 9649  C CG   . LEU A 1 118 ? -31.488 11.172  -9.465  1.00 0.00 ? 196 LEU A CG   5  
ATOM 9650  C CD1  . LEU A 1 118 ? -32.688 11.353  -8.549  1.00 0.00 ? 196 LEU A CD1  5  
ATOM 9651  C CD2  . LEU A 1 118 ? -30.604 12.411  -9.440  1.00 0.00 ? 196 LEU A CD2  5  
ATOM 9652  H H    . LEU A 1 118 ? -28.392 8.222   -9.149  1.00 0.00 ? 196 LEU A H    5  
ATOM 9653  H HA   . LEU A 1 118 ? -30.655 8.858   -10.913 1.00 0.00 ? 196 LEU A HA   5  
ATOM 9654  H HB2  . LEU A 1 118 ? -31.372 9.226   -8.622  1.00 0.00 ? 196 LEU A HB2  5  
ATOM 9655  H HB3  . LEU A 1 118 ? -29.959 10.235  -8.323  1.00 0.00 ? 196 LEU A HB3  5  
ATOM 9656  H HG   . LEU A 1 118 ? -31.856 11.044  -10.474 1.00 0.00 ? 196 LEU A HG   5  
ATOM 9657  H HD11 . LEU A 1 118 ? -33.294 10.460  -8.569  1.00 0.00 ? 196 LEU A HD11 5  
ATOM 9658  H HD12 . LEU A 1 118 ? -33.276 12.194  -8.886  1.00 0.00 ? 196 LEU A HD12 5  
ATOM 9659  H HD13 . LEU A 1 118 ? -32.347 11.535  -7.540  1.00 0.00 ? 196 LEU A HD13 5  
ATOM 9660  H HD21 . LEU A 1 118 ? -29.780 12.279  -10.126 1.00 0.00 ? 196 LEU A HD21 5  
ATOM 9661  H HD22 . LEU A 1 118 ? -30.220 12.558  -8.440  1.00 0.00 ? 196 LEU A HD22 5  
ATOM 9662  H HD23 . LEU A 1 118 ? -31.184 13.273  -9.734  1.00 0.00 ? 196 LEU A HD23 5  
ATOM 9663  N N    . LEU A 1 119 ? -29.474 10.817  -11.957 1.00 0.00 ? 197 LEU A N    5  
ATOM 9664  C CA   . LEU A 1 119 ? -28.672 11.776  -12.709 1.00 0.00 ? 197 LEU A CA   5  
ATOM 9665  C C    . LEU A 1 119 ? -28.468 13.060  -11.912 1.00 0.00 ? 197 LEU A C    5  
ATOM 9666  O O    . LEU A 1 119 ? -29.407 13.826  -11.699 1.00 0.00 ? 197 LEU A O    5  
ATOM 9667  C CB   . LEU A 1 119 ? -29.343 12.094  -14.046 1.00 0.00 ? 197 LEU A CB   5  
ATOM 9668  C CG   . LEU A 1 119 ? -28.790 13.301  -14.805 1.00 0.00 ? 197 LEU A CG   5  
ATOM 9669  C CD1  . LEU A 1 119 ? -27.469 12.952  -15.472 1.00 0.00 ? 197 LEU A CD1  5  
ATOM 9670  C CD2  . LEU A 1 119 ? -29.797 13.791  -15.835 1.00 0.00 ? 197 LEU A CD2  5  
ATOM 9671  H H    . LEU A 1 119 ? -30.389 10.627  -12.251 1.00 0.00 ? 197 LEU A H    5  
ATOM 9672  H HA   . LEU A 1 119 ? -27.708 11.326  -12.898 1.00 0.00 ? 197 LEU A HA   5  
ATOM 9673  H HB2  . LEU A 1 119 ? -29.240 11.228  -14.682 1.00 0.00 ? 197 LEU A HB2  5  
ATOM 9674  H HB3  . LEU A 1 119 ? -30.391 12.275  -13.855 1.00 0.00 ? 197 LEU A HB3  5  
ATOM 9675  H HG   . LEU A 1 119 ? -28.607 14.105  -14.106 1.00 0.00 ? 197 LEU A HG   5  
ATOM 9676  H HD11 . LEU A 1 119 ? -26.932 13.859  -15.704 1.00 0.00 ? 197 LEU A HD11 5  
ATOM 9677  H HD12 . LEU A 1 119 ? -27.659 12.404  -16.383 1.00 0.00 ? 197 LEU A HD12 5  
ATOM 9678  H HD13 . LEU A 1 119 ? -26.877 12.344  -14.804 1.00 0.00 ? 197 LEU A HD13 5  
ATOM 9679  H HD21 . LEU A 1 119 ? -29.963 14.849  -15.701 1.00 0.00 ? 197 LEU A HD21 5  
ATOM 9680  H HD22 . LEU A 1 119 ? -30.730 13.261  -15.707 1.00 0.00 ? 197 LEU A HD22 5  
ATOM 9681  H HD23 . LEU A 1 119 ? -29.413 13.610  -16.828 1.00 0.00 ? 197 LEU A HD23 5  
ATOM 9682  N N    . ALA A 1 120 ? -27.234 13.289  -11.474 1.00 0.00 ? 198 ALA A N    5  
ATOM 9683  C CA   . ALA A 1 120 ? -26.906 14.482  -10.703 1.00 0.00 ? 198 ALA A CA   5  
ATOM 9684  C C    . ALA A 1 120 ? -25.426 14.827  -10.829 1.00 0.00 ? 198 ALA A C    5  
ATOM 9685  O O    . ALA A 1 120 ? -24.560 14.043  -10.440 1.00 0.00 ? 198 ALA A O    5  
ATOM 9686  C CB   . ALA A 1 120 ? -27.281 14.286  -9.242  1.00 0.00 ? 198 ALA A CB   5  
ATOM 9687  H H    . ALA A 1 120 ? -26.528 12.640  -11.675 1.00 0.00 ? 198 ALA A H    5  
ATOM 9688  H HA   . ALA A 1 120 ? -27.491 15.302  -11.093 1.00 0.00 ? 198 ALA A HA   5  
ATOM 9689  H HB1  . ALA A 1 120 ? -27.350 15.249  -8.757  1.00 0.00 ? 198 ALA A HB1  5  
ATOM 9690  H HB2  . ALA A 1 120 ? -28.235 13.783  -9.180  1.00 0.00 ? 198 ALA A HB2  5  
ATOM 9691  H HB3  . ALA A 1 120 ? -26.526 13.689  -8.753  1.00 0.00 ? 198 ALA A HB3  5  
ATOM 9692  N N    . VAL A 1 121 ? -25.142 16.005  -11.377 1.00 0.00 ? 199 VAL A N    5  
ATOM 9693  C CA   . VAL A 1 121 ? -23.766 16.454  -11.554 1.00 0.00 ? 199 VAL A CA   5  
ATOM 9694  C C    . VAL A 1 121 ? -23.494 17.720  -10.750 1.00 0.00 ? 199 VAL A C    5  
ATOM 9695  O O    . VAL A 1 121 ? -23.904 18.814  -11.137 1.00 0.00 ? 199 VAL A O    5  
ATOM 9696  C CB   . VAL A 1 121 ? -23.451 16.723  -13.037 1.00 0.00 ? 199 VAL A CB   5  
ATOM 9697  C CG1  . VAL A 1 121 ? -22.027 17.235  -13.196 1.00 0.00 ? 199 VAL A CG1  5  
ATOM 9698  C CG2  . VAL A 1 121 ? -23.669 15.466  -13.865 1.00 0.00 ? 199 VAL A CG2  5  
ATOM 9699  H H    . VAL A 1 121 ? -25.876 16.586  -11.668 1.00 0.00 ? 199 VAL A H    5  
ATOM 9700  H HA   . VAL A 1 121 ? -23.111 15.669  -11.205 1.00 0.00 ? 199 VAL A HA   5  
ATOM 9701  H HB   . VAL A 1 121 ? -24.126 17.486  -13.395 1.00 0.00 ? 199 VAL A HB   5  
ATOM 9702  H HG11 . VAL A 1 121 ? -21.398 16.439  -13.567 1.00 0.00 ? 199 VAL A HG11 5  
ATOM 9703  H HG12 . VAL A 1 121 ? -22.016 18.060  -13.894 1.00 0.00 ? 199 VAL A HG12 5  
ATOM 9704  H HG13 . VAL A 1 121 ? -21.656 17.569  -12.238 1.00 0.00 ? 199 VAL A HG13 5  
ATOM 9705  H HG21 . VAL A 1 121 ? -24.726 15.332  -14.043 1.00 0.00 ? 199 VAL A HG21 5  
ATOM 9706  H HG22 . VAL A 1 121 ? -23.154 15.562  -14.810 1.00 0.00 ? 199 VAL A HG22 5  
ATOM 9707  H HG23 . VAL A 1 121 ? -23.282 14.611  -13.331 1.00 0.00 ? 199 VAL A HG23 5  
ATOM 9708  N N    . ALA A 1 122 ? -22.798 17.563  -9.628  1.00 0.00 ? 200 ALA A N    5  
ATOM 9709  C CA   . ALA A 1 122 ? -22.468 18.694  -8.770  1.00 0.00 ? 200 ALA A CA   5  
ATOM 9710  C C    . ALA A 1 122 ? -21.313 19.504  -9.349  1.00 0.00 ? 200 ALA A C    5  
ATOM 9711  O O    . ALA A 1 122 ? -21.368 20.733  -9.399  1.00 0.00 ? 200 ALA A O    5  
ATOM 9712  C CB   . ALA A 1 122 ? -22.126 18.211  -7.368  1.00 0.00 ? 200 ALA A CB   5  
ATOM 9713  H H    . ALA A 1 122 ? -22.499 16.666  -9.373  1.00 0.00 ? 200 ALA A H    5  
ATOM 9714  H HA   . ALA A 1 122 ? -23.341 19.328  -8.702  1.00 0.00 ? 200 ALA A HA   5  
ATOM 9715  H HB1  . ALA A 1 122 ? -21.064 18.323  -7.199  1.00 0.00 ? 200 ALA A HB1  5  
ATOM 9716  H HB2  . ALA A 1 122 ? -22.670 18.796  -6.643  1.00 0.00 ? 200 ALA A HB2  5  
ATOM 9717  H HB3  . ALA A 1 122 ? -22.398 17.170  -7.270  1.00 0.00 ? 200 ALA A HB3  5  
ATOM 9718  N N    . ASP A 1 123 ? -20.268 18.808  -9.784  1.00 0.00 ? 201 ASP A N    5  
ATOM 9719  C CA   . ASP A 1 123 ? -19.100 19.463  -10.360 1.00 0.00 ? 201 ASP A CA   5  
ATOM 9720  C C    . ASP A 1 123 ? -18.880 19.013  -11.801 1.00 0.00 ? 201 ASP A C    5  
ATOM 9721  O O    . ASP A 1 123 ? -19.306 17.927  -12.195 1.00 0.00 ? 201 ASP A O    5  
ATOM 9722  C CB   . ASP A 1 123 ? -17.855 19.162  -9.524  1.00 0.00 ? 201 ASP A CB   5  
ATOM 9723  C CG   . ASP A 1 123 ? -17.720 20.091  -8.333  1.00 0.00 ? 201 ASP A CG   5  
ATOM 9724  O OD1  . ASP A 1 123 ? -17.773 21.323  -8.532  1.00 0.00 ? 201 ASP A OD1  5  
ATOM 9725  O OD2  . ASP A 1 123 ? -17.561 19.586  -7.202  1.00 0.00 ? 201 ASP A OD2  5  
ATOM 9726  H H    . ASP A 1 123 ? -20.284 17.830  -9.717  1.00 0.00 ? 201 ASP A H    5  
ATOM 9727  H HA   . ASP A 1 123 ? -19.279 20.528  -10.352 1.00 0.00 ? 201 ASP A HA   5  
ATOM 9728  H HB2  . ASP A 1 123 ? -17.911 18.146  -9.159  1.00 0.00 ? 201 ASP A HB2  5  
ATOM 9729  H HB3  . ASP A 1 123 ? -16.978 19.270  -10.144 1.00 0.00 ? 201 ASP A HB3  5  
ATOM 9730  N N    . SER A 1 124 ? -18.213 19.855  -12.584 1.00 0.00 ? 202 SER A N    5  
ATOM 9731  C CA   . SER A 1 124 ? -17.941 19.547  -13.983 1.00 0.00 ? 202 SER A CA   5  
ATOM 9732  C C    . SER A 1 124 ? -17.557 18.080  -14.150 1.00 0.00 ? 202 SER A C    5  
ATOM 9733  O O    . SER A 1 124 ? -18.218 17.331  -14.869 1.00 0.00 ? 202 SER A O    5  
ATOM 9734  C CB   . SER A 1 124 ? -16.822 20.443  -14.516 1.00 0.00 ? 202 SER A CB   5  
ATOM 9735  O OG   . SER A 1 124 ? -17.235 21.797  -14.571 1.00 0.00 ? 202 SER A OG   5  
ATOM 9736  H H    . SER A 1 124 ? -17.899 20.706  -12.212 1.00 0.00 ? 202 SER A H    5  
ATOM 9737  H HA   . SER A 1 124 ? -18.842 19.737  -14.546 1.00 0.00 ? 202 SER A HA   5  
ATOM 9738  H HB2  . SER A 1 124 ? -15.963 20.367  -13.867 1.00 0.00 ? 202 SER A HB2  5  
ATOM 9739  H HB3  . SER A 1 124 ? -16.550 20.121  -15.511 1.00 0.00 ? 202 SER A HB3  5  
ATOM 9740  H HG   . SER A 1 124 ? -17.526 22.079  -13.701 1.00 0.00 ? 202 SER A HG   5  
ATOM 9741  N N    . GLY A 1 125 ? -16.481 17.676  -13.481 1.00 0.00 ? 203 GLY A N    5  
ATOM 9742  C CA   . GLY A 1 125 ? -16.027 16.300  -13.569 1.00 0.00 ? 203 GLY A CA   5  
ATOM 9743  C C    . GLY A 1 125 ? -15.297 16.012  -14.866 1.00 0.00 ? 203 GLY A C    5  
ATOM 9744  O O    . GLY A 1 125 ? -15.613 16.569  -15.918 1.00 0.00 ? 203 GLY A O    5  
ATOM 9745  H H    . GLY A 1 125 ? -15.993 18.317  -12.923 1.00 0.00 ? 203 GLY A H    5  
ATOM 9746  H HA2  . GLY A 1 125 ? -15.362 16.099  -12.742 1.00 0.00 ? 203 GLY A HA2  5  
ATOM 9747  H HA3  . GLY A 1 125 ? -16.882 15.645  -13.498 1.00 0.00 ? 203 GLY A HA3  5  
ATOM 9748  N N    . PRO A 1 126 ? -14.294 15.124  -14.801 1.00 0.00 ? 204 PRO A N    5  
ATOM 9749  C CA   . PRO A 1 126 ? -13.496 14.744  -15.970 1.00 0.00 ? 204 PRO A CA   5  
ATOM 9750  C C    . PRO A 1 126 ? -14.294 13.917  -16.973 1.00 0.00 ? 204 PRO A C    5  
ATOM 9751  O O    . PRO A 1 126 ? -14.530 12.728  -16.763 1.00 0.00 ? 204 PRO A O    5  
ATOM 9752  C CB   . PRO A 1 126 ? -12.363 13.908  -15.370 1.00 0.00 ? 204 PRO A CB   5  
ATOM 9753  C CG   . PRO A 1 126 ? -12.922 13.369  -14.099 1.00 0.00 ? 204 PRO A CG   5  
ATOM 9754  C CD   . PRO A 1 126 ? -13.863 14.421  -13.581 1.00 0.00 ? 204 PRO A CD   5  
ATOM 9755  H HA   . PRO A 1 126 ? -13.083 15.610  -16.467 1.00 0.00 ? 204 PRO A HA   5  
ATOM 9756  H HB2  . PRO A 1 126 ? -12.096 13.114  -16.053 1.00 0.00 ? 204 PRO A HB2  5  
ATOM 9757  H HB3  . PRO A 1 126 ? -11.505 14.537  -15.187 1.00 0.00 ? 204 PRO A HB3  5  
ATOM 9758  H HG2  . PRO A 1 126 ? -13.457 12.451  -14.293 1.00 0.00 ? 204 PRO A HG2  5  
ATOM 9759  H HG3  . PRO A 1 126 ? -12.125 13.198  -13.391 1.00 0.00 ? 204 PRO A HG3  5  
ATOM 9760  H HD2  . PRO A 1 126 ? -14.704 13.963  -13.082 1.00 0.00 ? 204 PRO A HD2  5  
ATOM 9761  H HD3  . PRO A 1 126 ? -13.346 15.094  -12.912 1.00 0.00 ? 204 PRO A HD3  5  
ATOM 9762  N N    . SER A 1 127 ? -14.706 14.555  -18.064 1.00 0.00 ? 205 SER A N    5  
ATOM 9763  C CA   . SER A 1 127 ? -15.480 13.879  -19.098 1.00 0.00 ? 205 SER A CA   5  
ATOM 9764  C C    . SER A 1 127 ? -14.616 12.875  -19.854 1.00 0.00 ? 205 SER A C    5  
ATOM 9765  O O    . SER A 1 127 ? -15.043 11.752  -20.125 1.00 0.00 ? 205 SER A O    5  
ATOM 9766  C CB   . SER A 1 127 ? -16.068 14.900  -20.074 1.00 0.00 ? 205 SER A CB   5  
ATOM 9767  O OG   . SER A 1 127 ? -15.043 15.596  -20.763 1.00 0.00 ? 205 SER A OG   5  
ATOM 9768  H H    . SER A 1 127 ? -14.486 15.504  -18.174 1.00 0.00 ? 205 SER A H    5  
ATOM 9769  H HA   . SER A 1 127 ? -16.288 13.350  -18.615 1.00 0.00 ? 205 SER A HA   5  
ATOM 9770  H HB2  . SER A 1 127 ? -16.687 14.390  -20.796 1.00 0.00 ? 205 SER A HB2  5  
ATOM 9771  H HB3  . SER A 1 127 ? -16.667 15.614  -19.527 1.00 0.00 ? 205 SER A HB3  5  
ATOM 9772  H HG   . SER A 1 127 ? -15.293 15.705  -21.683 1.00 0.00 ? 205 SER A HG   5  
ATOM 9773  N N    . SER A 1 128 ? -13.399 13.287  -20.192 1.00 0.00 ? 206 SER A N    5  
ATOM 9774  C CA   . SER A 1 128 ? -12.475 12.425  -20.920 1.00 0.00 ? 206 SER A CA   5  
ATOM 9775  C C    . SER A 1 128 ? -12.273 11.103  -20.187 1.00 0.00 ? 206 SER A C    5  
ATOM 9776  O O    . SER A 1 128 ? -12.559 10.033  -20.724 1.00 0.00 ? 206 SER A O    5  
ATOM 9777  C CB   . SER A 1 128 ? -11.129 13.128  -21.107 1.00 0.00 ? 206 SER A CB   5  
ATOM 9778  O OG   . SER A 1 128 ? -11.300 14.412  -21.682 1.00 0.00 ? 206 SER A OG   5  
ATOM 9779  H H    . SER A 1 128 ? -13.116 14.193  -19.947 1.00 0.00 ? 206 SER A H    5  
ATOM 9780  H HA   . SER A 1 128 ? -12.904 12.224  -21.890 1.00 0.00 ? 206 SER A HA   5  
ATOM 9781  H HB2  . SER A 1 128 ? -10.647 13.238  -20.148 1.00 0.00 ? 206 SER A HB2  5  
ATOM 9782  H HB3  . SER A 1 128 ? -10.504 12.535  -21.759 1.00 0.00 ? 206 SER A HB3  5  
ATOM 9783  H HG   . SER A 1 128 ? -10.614 14.564  -22.337 1.00 0.00 ? 206 SER A HG   5  
ATOM 9784  N N    . GLY A 1 129 ? -11.778 11.185  -18.956 1.00 0.00 ? 207 GLY A N    5  
ATOM 9785  C CA   . GLY A 1 129 ? -11.545 9.988   -18.169 1.00 0.00 ? 207 GLY A CA   5  
ATOM 9786  C C    . GLY A 1 129 ? -11.068 10.302  -16.765 1.00 0.00 ? 207 GLY A C    5  
ATOM 9787  O O    . GLY A 1 129 ? -11.829 10.811  -15.943 1.00 0.00 ? 207 GLY A O    5  
ATOM 9788  H H    . GLY A 1 129 ? -11.568 12.065  -18.580 1.00 0.00 ? 207 GLY A H    5  
ATOM 9789  H HA2  . GLY A 1 129 ? -12.465 9.426   -18.108 1.00 0.00 ? 207 GLY A HA2  5  
ATOM 9790  H HA3  . GLY A 1 129 ? -10.799 9.385   -18.664 1.00 0.00 ? 207 GLY A HA3  5  
ATOM 9791  N N    . GLY A 1 1   ? 22.102  -7.110  -3.771  1.00 0.00 ? 79  GLY A N    6  
ATOM 9792  C CA   . GLY A 1 1   ? 22.633  -8.195  -2.968  1.00 0.00 ? 79  GLY A CA   6  
ATOM 9793  C C    . GLY A 1 1   ? 21.998  -9.530  -3.303  1.00 0.00 ? 79  GLY A C    6  
ATOM 9794  O O    . GLY A 1 1   ? 22.696  -10.512 -3.556  1.00 0.00 ? 79  GLY A O    6  
ATOM 9795  H H1   . GLY A 1 1   ? 21.809  -7.281  -4.691  1.00 0.00 ? 79  GLY A H1   6  
ATOM 9796  H HA2  . GLY A 1 1   ? 23.698  -8.264  -3.133  1.00 0.00 ? 79  GLY A HA2  6  
ATOM 9797  H HA3  . GLY A 1 1   ? 22.455  -7.977  -1.925  1.00 0.00 ? 79  GLY A HA3  6  
ATOM 9798  N N    . SER A 1 2   ? 20.669  -9.567  -3.304  1.00 0.00 ? 80  SER A N    6  
ATOM 9799  C CA   . SER A 1 2   ? 19.939  -10.793 -3.605  1.00 0.00 ? 80  SER A CA   6  
ATOM 9800  C C    . SER A 1 2   ? 18.768  -10.512 -4.541  1.00 0.00 ? 80  SER A C    6  
ATOM 9801  O O    . SER A 1 2   ? 18.097  -9.487  -4.423  1.00 0.00 ? 80  SER A O    6  
ATOM 9802  C CB   . SER A 1 2   ? 19.432  -11.440 -2.315  1.00 0.00 ? 80  SER A CB   6  
ATOM 9803  O OG   . SER A 1 2   ? 20.498  -11.684 -1.414  1.00 0.00 ? 80  SER A OG   6  
ATOM 9804  H H    . SER A 1 2   ? 20.168  -8.751  -3.094  1.00 0.00 ? 80  SER A H    6  
ATOM 9805  H HA   . SER A 1 2   ? 20.621  -11.473 -4.095  1.00 0.00 ? 80  SER A HA   6  
ATOM 9806  H HB2  . SER A 1 2   ? 18.719  -10.782 -1.842  1.00 0.00 ? 80  SER A HB2  6  
ATOM 9807  H HB3  . SER A 1 2   ? 18.953  -12.380 -2.551  1.00 0.00 ? 80  SER A HB3  6  
ATOM 9808  H HG   . SER A 1 2   ? 20.915  -12.521 -1.630  1.00 0.00 ? 80  SER A HG   6  
ATOM 9809  N N    . SER A 1 3   ? 18.528  -11.430 -5.472  1.00 0.00 ? 81  SER A N    6  
ATOM 9810  C CA   . SER A 1 3   ? 17.441  -11.280 -6.432  1.00 0.00 ? 81  SER A CA   6  
ATOM 9811  C C    . SER A 1 3   ? 17.288  -12.538 -7.282  1.00 0.00 ? 81  SER A C    6  
ATOM 9812  O O    . SER A 1 3   ? 18.133  -12.838 -8.124  1.00 0.00 ? 81  SER A O    6  
ATOM 9813  C CB   . SER A 1 3   ? 17.691  -10.069 -7.333  1.00 0.00 ? 81  SER A CB   6  
ATOM 9814  O OG   . SER A 1 3   ? 18.927  -10.188 -8.015  1.00 0.00 ? 81  SER A OG   6  
ATOM 9815  H H    . SER A 1 3   ? 19.099  -12.226 -5.516  1.00 0.00 ? 81  SER A H    6  
ATOM 9816  H HA   . SER A 1 3   ? 16.528  -11.122 -5.877  1.00 0.00 ? 81  SER A HA   6  
ATOM 9817  H HB2  . SER A 1 3   ? 16.898  -9.996  -8.061  1.00 0.00 ? 81  SER A HB2  6  
ATOM 9818  H HB3  . SER A 1 3   ? 17.710  -9.173  -6.730  1.00 0.00 ? 81  SER A HB3  6  
ATOM 9819  H HG   . SER A 1 3   ? 18.918  -9.628  -8.795  1.00 0.00 ? 81  SER A HG   6  
ATOM 9820  N N    . GLY A 1 4   ? 16.203  -13.272 -7.053  1.00 0.00 ? 82  GLY A N    6  
ATOM 9821  C CA   . GLY A 1 4   ? 15.959  -14.489 -7.804  1.00 0.00 ? 82  GLY A CA   6  
ATOM 9822  C C    . GLY A 1 4   ? 14.673  -15.177 -7.391  1.00 0.00 ? 82  GLY A C    6  
ATOM 9823  O O    . GLY A 1 4   ? 13.752  -14.535 -6.885  1.00 0.00 ? 82  GLY A O    6  
ATOM 9824  H H    . GLY A 1 4   ? 15.564  -12.984 -6.368  1.00 0.00 ? 82  GLY A H    6  
ATOM 9825  H HA2  . GLY A 1 4   ? 15.904  -14.246 -8.854  1.00 0.00 ? 82  GLY A HA2  6  
ATOM 9826  H HA3  . GLY A 1 4   ? 16.783  -15.168 -7.644  1.00 0.00 ? 82  GLY A HA3  6  
ATOM 9827  N N    . SER A 1 5   ? 14.607  -16.486 -7.609  1.00 0.00 ? 83  SER A N    6  
ATOM 9828  C CA   . SER A 1 5   ? 13.422  -17.261 -7.261  1.00 0.00 ? 83  SER A CA   6  
ATOM 9829  C C    . SER A 1 5   ? 13.429  -17.630 -5.780  1.00 0.00 ? 83  SER A C    6  
ATOM 9830  O O    . SER A 1 5   ? 14.477  -17.936 -5.211  1.00 0.00 ? 83  SER A O    6  
ATOM 9831  C CB   . SER A 1 5   ? 13.346  -18.528 -8.114  1.00 0.00 ? 83  SER A CB   6  
ATOM 9832  O OG   . SER A 1 5   ? 12.004  -18.954 -8.277  1.00 0.00 ? 83  SER A OG   6  
ATOM 9833  H H    . SER A 1 5   ? 15.374  -16.942 -8.015  1.00 0.00 ? 83  SER A H    6  
ATOM 9834  H HA   . SER A 1 5   ? 12.555  -16.649 -7.462  1.00 0.00 ? 83  SER A HA   6  
ATOM 9835  H HB2  . SER A 1 5   ? 13.768  -18.330 -9.087  1.00 0.00 ? 83  SER A HB2  6  
ATOM 9836  H HB3  . SER A 1 5   ? 13.906  -19.317 -7.632  1.00 0.00 ? 83  SER A HB3  6  
ATOM 9837  H HG   . SER A 1 5   ? 11.717  -19.416 -7.486  1.00 0.00 ? 83  SER A HG   6  
ATOM 9838  N N    . SER A 1 6   ? 12.253  -17.599 -5.163  1.00 0.00 ? 84  SER A N    6  
ATOM 9839  C CA   . SER A 1 6   ? 12.123  -17.927 -3.748  1.00 0.00 ? 84  SER A CA   6  
ATOM 9840  C C    . SER A 1 6   ? 12.568  -19.361 -3.480  1.00 0.00 ? 84  SER A C    6  
ATOM 9841  O O    . SER A 1 6   ? 12.309  -20.263 -4.276  1.00 0.00 ? 84  SER A O    6  
ATOM 9842  C CB   . SER A 1 6   ? 10.676  -17.736 -3.289  1.00 0.00 ? 84  SER A CB   6  
ATOM 9843  O OG   . SER A 1 6   ? 10.588  -17.710 -1.875  1.00 0.00 ? 84  SER A OG   6  
ATOM 9844  H H    . SER A 1 6   ? 11.453  -17.348 -5.672  1.00 0.00 ? 84  SER A H    6  
ATOM 9845  H HA   . SER A 1 6   ? 12.760  -17.255 -3.193  1.00 0.00 ? 84  SER A HA   6  
ATOM 9846  H HB2  . SER A 1 6   ? 10.298  -16.802 -3.678  1.00 0.00 ? 84  SER A HB2  6  
ATOM 9847  H HB3  . SER A 1 6   ? 10.072  -18.551 -3.661  1.00 0.00 ? 84  SER A HB3  6  
ATOM 9848  H HG   . SER A 1 6   ? 11.370  -17.287 -1.513  1.00 0.00 ? 84  SER A HG   6  
ATOM 9849  N N    . GLY A 1 7   ? 13.240  -19.565 -2.350  1.00 0.00 ? 85  GLY A N    6  
ATOM 9850  C CA   . GLY A 1 7   ? 13.711  -20.891 -1.996  1.00 0.00 ? 85  GLY A CA   6  
ATOM 9851  C C    . GLY A 1 7   ? 14.762  -20.860 -0.904  1.00 0.00 ? 85  GLY A C    6  
ATOM 9852  O O    . GLY A 1 7   ? 14.666  -21.593 0.080   1.00 0.00 ? 85  GLY A O    6  
ATOM 9853  H H    . GLY A 1 7   ? 13.417  -18.808 -1.754  1.00 0.00 ? 85  GLY A H    6  
ATOM 9854  H HA2  . GLY A 1 7   ? 12.872  -21.480 -1.657  1.00 0.00 ? 85  GLY A HA2  6  
ATOM 9855  H HA3  . GLY A 1 7   ? 14.135  -21.356 -2.873  1.00 0.00 ? 85  GLY A HA3  6  
ATOM 9856  N N    . ARG A 1 8   ? 15.768  -20.010 -1.077  1.00 0.00 ? 86  ARG A N    6  
ATOM 9857  C CA   . ARG A 1 8   ? 16.843  -19.888 -0.100  1.00 0.00 ? 86  ARG A CA   6  
ATOM 9858  C C    . ARG A 1 8   ? 16.298  -19.451 1.257   1.00 0.00 ? 86  ARG A C    6  
ATOM 9859  O O    . ARG A 1 8   ? 15.387  -18.626 1.335   1.00 0.00 ? 86  ARG A O    6  
ATOM 9860  C CB   . ARG A 1 8   ? 17.893  -18.888 -0.586  1.00 0.00 ? 86  ARG A CB   6  
ATOM 9861  C CG   . ARG A 1 8   ? 18.825  -19.451 -1.647  1.00 0.00 ? 86  ARG A CG   6  
ATOM 9862  C CD   . ARG A 1 8   ? 19.619  -18.349 -2.332  1.00 0.00 ? 86  ARG A CD   6  
ATOM 9863  N NE   . ARG A 1 8   ? 18.752  -17.395 -3.018  1.00 0.00 ? 86  ARG A NE   6  
ATOM 9864  C CZ   . ARG A 1 8   ? 18.272  -17.587 -4.242  1.00 0.00 ? 86  ARG A CZ   6  
ATOM 9865  N NH1  . ARG A 1 8   ? 18.573  -18.691 -4.910  1.00 0.00 ? 86  ARG A NH1  6  
ATOM 9866  N NH2  . ARG A 1 8   ? 17.489  -16.672 -4.799  1.00 0.00 ? 86  ARG A NH2  6  
ATOM 9867  H H    . ARG A 1 8   ? 15.790  -19.451 -1.882  1.00 0.00 ? 86  ARG A H    6  
ATOM 9868  H HA   . ARG A 1 8   ? 17.305  -20.858 0.007   1.00 0.00 ? 86  ARG A HA   6  
ATOM 9869  H HB2  . ARG A 1 8   ? 17.389  -18.028 -1.001  1.00 0.00 ? 86  ARG A HB2  6  
ATOM 9870  H HB3  . ARG A 1 8   ? 18.491  -18.574 0.257   1.00 0.00 ? 86  ARG A HB3  6  
ATOM 9871  H HG2  . ARG A 1 8   ? 19.514  -20.138 -1.180  1.00 0.00 ? 86  ARG A HG2  6  
ATOM 9872  H HG3  . ARG A 1 8   ? 18.238  -19.973 -2.388  1.00 0.00 ? 86  ARG A HG3  6  
ATOM 9873  H HD2  . ARG A 1 8   ? 20.197  -17.824 -1.586  1.00 0.00 ? 86  ARG A HD2  6  
ATOM 9874  H HD3  . ARG A 1 8   ? 20.285  -18.799 -3.052  1.00 0.00 ? 86  ARG A HD3  6  
ATOM 9875  H HE   . ARG A 1 8   ? 18.517  -16.572 -2.542  1.00 0.00 ? 86  ARG A HE   6  
ATOM 9876  H HH11 . ARG A 1 8   ? 19.162  -19.383 -4.492  1.00 0.00 ? 86  ARG A HH11 6  
ATOM 9877  H HH12 . ARG A 1 8   ? 18.210  -18.834 -5.831  1.00 0.00 ? 86  ARG A HH12 6  
ATOM 9878  H HH21 . ARG A 1 8   ? 17.260  -15.838 -4.299  1.00 0.00 ? 86  ARG A HH21 6  
ATOM 9879  H HH22 . ARG A 1 8   ? 17.129  -16.817 -5.720  1.00 0.00 ? 86  ARG A HH22 6  
ATOM 9880  N N    . LYS A 1 9   ? 16.860  -20.009 2.323   1.00 0.00 ? 87  LYS A N    6  
ATOM 9881  C CA   . LYS A 1 9   ? 16.432  -19.677 3.677   1.00 0.00 ? 87  LYS A CA   6  
ATOM 9882  C C    . LYS A 1 9   ? 16.297  -18.168 3.850   1.00 0.00 ? 87  LYS A C    6  
ATOM 9883  O O    . LYS A 1 9   ? 15.359  -17.689 4.486   1.00 0.00 ? 87  LYS A O    6  
ATOM 9884  C CB   . LYS A 1 9   ? 17.428  -20.231 4.699   1.00 0.00 ? 87  LYS A CB   6  
ATOM 9885  C CG   . LYS A 1 9   ? 17.167  -21.679 5.078   1.00 0.00 ? 87  LYS A CG   6  
ATOM 9886  C CD   . LYS A 1 9   ? 15.900  -21.819 5.905   1.00 0.00 ? 87  LYS A CD   6  
ATOM 9887  C CE   . LYS A 1 9   ? 15.771  -23.216 6.493   1.00 0.00 ? 87  LYS A CE   6  
ATOM 9888  N NZ   . LYS A 1 9   ? 14.680  -23.293 7.505   1.00 0.00 ? 87  LYS A NZ   6  
ATOM 9889  H H    . LYS A 1 9   ? 17.583  -20.660 2.196   1.00 0.00 ? 87  LYS A H    6  
ATOM 9890  H HA   . LYS A 1 9   ? 15.468  -20.134 3.841   1.00 0.00 ? 87  LYS A HA   6  
ATOM 9891  H HB2  . LYS A 1 9   ? 18.424  -20.162 4.287   1.00 0.00 ? 87  LYS A HB2  6  
ATOM 9892  H HB3  . LYS A 1 9   ? 17.376  -19.631 5.596   1.00 0.00 ? 87  LYS A HB3  6  
ATOM 9893  H HG2  . LYS A 1 9   ? 17.062  -22.265 4.177   1.00 0.00 ? 87  LYS A HG2  6  
ATOM 9894  H HG3  . LYS A 1 9   ? 18.005  -22.047 5.653   1.00 0.00 ? 87  LYS A HG3  6  
ATOM 9895  H HD2  . LYS A 1 9   ? 15.926  -21.102 6.712   1.00 0.00 ? 87  LYS A HD2  6  
ATOM 9896  H HD3  . LYS A 1 9   ? 15.045  -21.623 5.274   1.00 0.00 ? 87  LYS A HD3  6  
ATOM 9897  H HE2  . LYS A 1 9   ? 15.559  -23.910 5.695   1.00 0.00 ? 87  LYS A HE2  6  
ATOM 9898  H HE3  . LYS A 1 9   ? 16.706  -23.482 6.963   1.00 0.00 ? 87  LYS A HE3  6  
ATOM 9899  H HZ1  . LYS A 1 9   ? 14.949  -22.767 8.360   1.00 0.00 ? 87  LYS A HZ1  6  
ATOM 9900  H HZ2  . LYS A 1 9   ? 14.502  -24.284 7.763   1.00 0.00 ? 87  LYS A HZ2  6  
ATOM 9901  H HZ3  . LYS A 1 9   ? 13.806  -22.884 7.119   1.00 0.00 ? 87  LYS A HZ3  6  
ATOM 9902  N N    . GLU A 1 10  ? 17.240  -17.424 3.279   1.00 0.00 ? 88  GLU A N    6  
ATOM 9903  C CA   . GLU A 1 10  ? 17.224  -15.969 3.370   1.00 0.00 ? 88  GLU A CA   6  
ATOM 9904  C C    . GLU A 1 10  ? 15.803  -15.431 3.233   1.00 0.00 ? 88  GLU A C    6  
ATOM 9905  O O    . GLU A 1 10  ? 15.393  -14.535 3.972   1.00 0.00 ? 88  GLU A O    6  
ATOM 9906  C CB   . GLU A 1 10  ? 18.119  -15.358 2.290   1.00 0.00 ? 88  GLU A CB   6  
ATOM 9907  C CG   . GLU A 1 10  ? 19.572  -15.792 2.386   1.00 0.00 ? 88  GLU A CG   6  
ATOM 9908  C CD   . GLU A 1 10  ? 20.362  -14.967 3.383   1.00 0.00 ? 88  GLU A CD   6  
ATOM 9909  O OE1  . GLU A 1 10  ? 19.824  -14.679 4.473   1.00 0.00 ? 88  GLU A OE1  6  
ATOM 9910  O OE2  . GLU A 1 10  ? 21.518  -14.610 3.074   1.00 0.00 ? 88  GLU A OE2  6  
ATOM 9911  H H    . GLU A 1 10  ? 17.963  -17.865 2.785   1.00 0.00 ? 88  GLU A H    6  
ATOM 9912  H HA   . GLU A 1 10  ? 17.608  -15.694 4.341   1.00 0.00 ? 88  GLU A HA   6  
ATOM 9913  H HB2  . GLU A 1 10  ? 17.741  -15.647 1.320   1.00 0.00 ? 88  GLU A HB2  6  
ATOM 9914  H HB3  . GLU A 1 10  ? 18.080  -14.282 2.374   1.00 0.00 ? 88  GLU A HB3  6  
ATOM 9915  H HG2  . GLU A 1 10  ? 19.606  -16.827 2.691   1.00 0.00 ? 88  GLU A HG2  6  
ATOM 9916  H HG3  . GLU A 1 10  ? 20.030  -15.690 1.413   1.00 0.00 ? 88  GLU A HG3  6  
ATOM 9917  N N    . ASP A 1 11  ? 15.056  -15.983 2.284   1.00 0.00 ? 89  ASP A N    6  
ATOM 9918  C CA   . ASP A 1 11  ? 13.681  -15.560 2.049   1.00 0.00 ? 89  ASP A CA   6  
ATOM 9919  C C    . ASP A 1 11  ? 12.946  -15.345 3.369   1.00 0.00 ? 89  ASP A C    6  
ATOM 9920  O O    . ASP A 1 11  ? 12.247  -14.346 3.547   1.00 0.00 ? 89  ASP A O    6  
ATOM 9921  C CB   . ASP A 1 11  ? 12.942  -16.598 1.203   1.00 0.00 ? 89  ASP A CB   6  
ATOM 9922  C CG   . ASP A 1 11  ? 11.794  -15.995 0.418   1.00 0.00 ? 89  ASP A CG   6  
ATOM 9923  O OD1  . ASP A 1 11  ? 12.063  -15.246 -0.545  1.00 0.00 ? 89  ASP A OD1  6  
ATOM 9924  O OD2  . ASP A 1 11  ? 10.628  -16.272 0.765   1.00 0.00 ? 89  ASP A OD2  6  
ATOM 9925  H H    . ASP A 1 11  ? 15.439  -16.694 1.727   1.00 0.00 ? 89  ASP A H    6  
ATOM 9926  H HA   . ASP A 1 11  ? 13.709  -14.625 1.511   1.00 0.00 ? 89  ASP A HA   6  
ATOM 9927  H HB2  . ASP A 1 11  ? 13.636  -17.044 0.505   1.00 0.00 ? 89  ASP A HB2  6  
ATOM 9928  H HB3  . ASP A 1 11  ? 12.547  -17.366 1.852   1.00 0.00 ? 89  ASP A HB3  6  
ATOM 9929  N N    . HIS A 1 12  ? 13.108  -16.288 4.291   1.00 0.00 ? 90  HIS A N    6  
ATOM 9930  C CA   . HIS A 1 12  ? 12.459  -16.202 5.595   1.00 0.00 ? 90  HIS A CA   6  
ATOM 9931  C C    . HIS A 1 12  ? 12.998  -15.018 6.392   1.00 0.00 ? 90  HIS A C    6  
ATOM 9932  O O    . HIS A 1 12  ? 12.258  -14.364 7.127   1.00 0.00 ? 90  HIS A O    6  
ATOM 9933  C CB   . HIS A 1 12  ? 12.669  -17.498 6.379   1.00 0.00 ? 90  HIS A CB   6  
ATOM 9934  C CG   . HIS A 1 12  ? 12.335  -18.731 5.598   1.00 0.00 ? 90  HIS A CG   6  
ATOM 9935  N ND1  . HIS A 1 12  ? 13.293  -19.588 5.098   1.00 0.00 ? 90  HIS A ND1  6  
ATOM 9936  C CD2  . HIS A 1 12  ? 11.140  -19.251 5.232   1.00 0.00 ? 90  HIS A CD2  6  
ATOM 9937  C CE1  . HIS A 1 12  ? 12.702  -20.581 4.458   1.00 0.00 ? 90  HIS A CE1  6  
ATOM 9938  N NE2  . HIS A 1 12  ? 11.395  -20.400 4.524   1.00 0.00 ? 90  HIS A NE2  6  
ATOM 9939  H H    . HIS A 1 12  ? 13.677  -17.060 4.090   1.00 0.00 ? 90  HIS A H    6  
ATOM 9940  H HA   . HIS A 1 12  ? 11.402  -16.058 5.430   1.00 0.00 ? 90  HIS A HA   6  
ATOM 9941  H HB2  . HIS A 1 12  ? 13.704  -17.566 6.678   1.00 0.00 ? 90  HIS A HB2  6  
ATOM 9942  H HB3  . HIS A 1 12  ? 12.044  -17.483 7.260   1.00 0.00 ? 90  HIS A HB3  6  
ATOM 9943  H HD2  . HIS A 1 12  ? 10.166  -18.838 5.454   1.00 0.00 ? 90  HIS A HD2  6  
ATOM 9944  H HE1  . HIS A 1 12  ? 13.201  -21.401 3.964   1.00 0.00 ? 90  HIS A HE1  6  
ATOM 9945  H HE2  . HIS A 1 12  ? 10.726  -20.944 4.060   1.00 0.00 ? 90  HIS A HE2  6  
ATOM 9946  N N    . ALA A 1 13  ? 14.291  -14.749 6.243   1.00 0.00 ? 91  ALA A N    6  
ATOM 9947  C CA   . ALA A 1 13  ? 14.928  -13.644 6.948   1.00 0.00 ? 91  ALA A CA   6  
ATOM 9948  C C    . ALA A 1 13  ? 14.376  -12.303 6.479   1.00 0.00 ? 91  ALA A C    6  
ATOM 9949  O O    . ALA A 1 13  ? 14.038  -11.441 7.291   1.00 0.00 ? 91  ALA A O    6  
ATOM 9950  C CB   . ALA A 1 13  ? 16.436  -13.694 6.754   1.00 0.00 ? 91  ALA A CB   6  
ATOM 9951  H H    . ALA A 1 13  ? 14.829  -15.307 5.643   1.00 0.00 ? 91  ALA A H    6  
ATOM 9952  H HA   . ALA A 1 13  ? 14.722  -13.758 8.003   1.00 0.00 ? 91  ALA A HA   6  
ATOM 9953  H HB1  . ALA A 1 13  ? 16.851  -14.483 7.364   1.00 0.00 ? 91  ALA A HB1  6  
ATOM 9954  H HB2  . ALA A 1 13  ? 16.659  -13.885 5.715   1.00 0.00 ? 91  ALA A HB2  6  
ATOM 9955  H HB3  . ALA A 1 13  ? 16.868  -12.748 7.047   1.00 0.00 ? 91  ALA A HB3  6  
ATOM 9956  N N    . ARG A 1 14  ? 14.288  -12.132 5.164   1.00 0.00 ? 92  ARG A N    6  
ATOM 9957  C CA   . ARG A 1 14  ? 13.779  -10.893 4.587   1.00 0.00 ? 92  ARG A CA   6  
ATOM 9958  C C    . ARG A 1 14  ? 12.274  -10.769 4.808   1.00 0.00 ? 92  ARG A C    6  
ATOM 9959  O O    . ARG A 1 14  ? 11.739  -9.663  4.902   1.00 0.00 ? 92  ARG A O    6  
ATOM 9960  C CB   . ARG A 1 14  ? 14.091  -10.837 3.090   1.00 0.00 ? 92  ARG A CB   6  
ATOM 9961  C CG   . ARG A 1 14  ? 14.201  -9.423  2.544   1.00 0.00 ? 92  ARG A CG   6  
ATOM 9962  C CD   . ARG A 1 14  ? 14.785  -9.412  1.140   1.00 0.00 ? 92  ARG A CD   6  
ATOM 9963  N NE   . ARG A 1 14  ? 16.127  -9.986  1.100   1.00 0.00 ? 92  ARG A NE   6  
ATOM 9964  C CZ   . ARG A 1 14  ? 16.367  -11.282 0.931   1.00 0.00 ? 92  ARG A CZ   6  
ATOM 9965  N NH1  . ARG A 1 14  ? 15.361  -12.133 0.786   1.00 0.00 ? 92  ARG A NH1  6  
ATOM 9966  N NH2  . ARG A 1 14  ? 17.617  -11.728 0.906   1.00 0.00 ? 92  ARG A NH2  6  
ATOM 9967  H H    . ARG A 1 14  ? 14.573  -12.855 4.567   1.00 0.00 ? 92  ARG A H    6  
ATOM 9968  H HA   . ARG A 1 14  ? 14.273  -10.070 5.080   1.00 0.00 ? 92  ARG A HA   6  
ATOM 9969  H HB2  . ARG A 1 14  ? 15.028  -11.343 2.910   1.00 0.00 ? 92  ARG A HB2  6  
ATOM 9970  H HB3  . ARG A 1 14  ? 13.307  -11.347 2.552   1.00 0.00 ? 92  ARG A HB3  6  
ATOM 9971  H HG2  . ARG A 1 14  ? 13.217  -8.980  2.516   1.00 0.00 ? 92  ARG A HG2  6  
ATOM 9972  H HG3  . ARG A 1 14  ? 14.840  -8.845  3.195   1.00 0.00 ? 92  ARG A HG3  6  
ATOM 9973  H HD2  . ARG A 1 14  ? 14.139  -9.986  0.492   1.00 0.00 ? 92  ARG A HD2  6  
ATOM 9974  H HD3  . ARG A 1 14  ? 14.829  -8.391  0.791   1.00 0.00 ? 92  ARG A HD3  6  
ATOM 9975  H HE   . ARG A 1 14  ? 16.885  -9.375  1.205   1.00 0.00 ? 92  ARG A HE   6  
ATOM 9976  H HH11 . ARG A 1 14  ? 14.419  -11.799 0.804   1.00 0.00 ? 92  ARG A HH11 6  
ATOM 9977  H HH12 . ARG A 1 14  ? 15.545  -13.108 0.658   1.00 0.00 ? 92  ARG A HH12 6  
ATOM 9978  H HH21 . ARG A 1 14  ? 18.378  -11.089 1.015   1.00 0.00 ? 92  ARG A HH21 6  
ATOM 9979  H HH22 . ARG A 1 14  ? 17.797  -12.703 0.779   1.00 0.00 ? 92  ARG A HH22 6  
ATOM 9980  N N    . LEU A 1 15  ? 11.597  -11.909 4.891   1.00 0.00 ? 93  LEU A N    6  
ATOM 9981  C CA   . LEU A 1 15  ? 10.154  -11.928 5.101   1.00 0.00 ? 93  LEU A CA   6  
ATOM 9982  C C    . LEU A 1 15  ? 9.795   -11.361 6.471   1.00 0.00 ? 93  LEU A C    6  
ATOM 9983  O O    . LEU A 1 15  ? 8.870   -10.560 6.599   1.00 0.00 ? 93  LEU A O    6  
ATOM 9984  C CB   . LEU A 1 15  ? 9.619   -13.355 4.971   1.00 0.00 ? 93  LEU A CB   6  
ATOM 9985  C CG   . LEU A 1 15  ? 9.407   -13.865 3.545   1.00 0.00 ? 93  LEU A CG   6  
ATOM 9986  C CD1  . LEU A 1 15  ? 9.278   -15.381 3.534   1.00 0.00 ? 93  LEU A CD1  6  
ATOM 9987  C CD2  . LEU A 1 15  ? 8.177   -13.219 2.925   1.00 0.00 ? 93  LEU A CD2  6  
ATOM 9988  H H    . LEU A 1 15  ? 12.078  -12.758 4.808   1.00 0.00 ? 93  LEU A H    6  
ATOM 9989  H HA   . LEU A 1 15  ? 9.700   -11.311 4.340   1.00 0.00 ? 93  LEU A HA   6  
ATOM 9990  H HB2  . LEU A 1 15  ? 10.319  -14.017 5.458   1.00 0.00 ? 93  LEU A HB2  6  
ATOM 9991  H HB3  . LEU A 1 15  ? 8.668   -13.399 5.484   1.00 0.00 ? 93  LEU A HB3  6  
ATOM 9992  H HG   . LEU A 1 15  ? 10.265  -13.600 2.943   1.00 0.00 ? 93  LEU A HG   6  
ATOM 9993  H HD11 . LEU A 1 15  ? 8.538   -15.673 2.805   1.00 0.00 ? 93  LEU A HD11 6  
ATOM 9994  H HD12 . LEU A 1 15  ? 8.974   -15.723 4.512   1.00 0.00 ? 93  LEU A HD12 6  
ATOM 9995  H HD13 . LEU A 1 15  ? 10.230  -15.821 3.278   1.00 0.00 ? 93  LEU A HD13 6  
ATOM 9996  H HD21 . LEU A 1 15  ? 7.619   -13.962 2.375   1.00 0.00 ? 93  LEU A HD21 6  
ATOM 9997  H HD22 . LEU A 1 15  ? 8.485   -12.431 2.253   1.00 0.00 ? 93  LEU A HD22 6  
ATOM 9998  H HD23 . LEU A 1 15  ? 7.555   -12.805 3.705   1.00 0.00 ? 93  LEU A HD23 6  
ATOM 9999  N N    . ARG A 1 16  ? 10.535  -11.782 7.491   1.00 0.00 ? 94  ARG A N    6  
ATOM 10000 C CA   . ARG A 1 16  ? 10.296  -11.315 8.852   1.00 0.00 ? 94  ARG A CA   6  
ATOM 10001 C C    . ARG A 1 16  ? 10.734  -9.863  9.013   1.00 0.00 ? 94  ARG A C    6  
ATOM 10002 O O    . ARG A 1 16  ? 10.025  -9.053  9.609   1.00 0.00 ? 94  ARG A O    6  
ATOM 10003 C CB   . ARG A 1 16  ? 11.041  -12.198 9.855   1.00 0.00 ? 94  ARG A CB   6  
ATOM 10004 C CG   . ARG A 1 16  ? 10.887  -11.745 11.297  1.00 0.00 ? 94  ARG A CG   6  
ATOM 10005 C CD   . ARG A 1 16  ? 12.027  -12.253 12.166  1.00 0.00 ? 94  ARG A CD   6  
ATOM 10006 N NE   . ARG A 1 16  ? 11.771  -13.597 12.675  1.00 0.00 ? 94  ARG A NE   6  
ATOM 10007 C CZ   . ARG A 1 16  ? 12.571  -14.225 13.530  1.00 0.00 ? 94  ARG A CZ   6  
ATOM 10008 N NH1  . ARG A 1 16  ? 13.672  -13.632 13.969  1.00 0.00 ? 94  ARG A NH1  6  
ATOM 10009 N NH2  . ARG A 1 16  ? 12.269  -15.447 13.948  1.00 0.00 ? 94  ARG A NH2  6  
ATOM 10010 H H    . ARG A 1 16  ? 11.259  -12.422 7.326   1.00 0.00 ? 94  ARG A H    6  
ATOM 10011 H HA   . ARG A 1 16  ? 9.236   -11.383 9.044   1.00 0.00 ? 94  ARG A HA   6  
ATOM 10012 H HB2  . ARG A 1 16  ? 10.666  -13.208 9.776   1.00 0.00 ? 94  ARG A HB2  6  
ATOM 10013 H HB3  . ARG A 1 16  ? 12.092  -12.193 9.609   1.00 0.00 ? 94  ARG A HB3  6  
ATOM 10014 H HG2  . ARG A 1 16  ? 10.881  -10.665 11.327  1.00 0.00 ? 94  ARG A HG2  6  
ATOM 10015 H HG3  . ARG A 1 16  ? 9.954   -12.124 11.686  1.00 0.00 ? 94  ARG A HG3  6  
ATOM 10016 H HD2  . ARG A 1 16  ? 12.932  -12.269 11.576  1.00 0.00 ? 94  ARG A HD2  6  
ATOM 10017 H HD3  . ARG A 1 16  ? 12.154  -11.579 13.000  1.00 0.00 ? 94  ARG A HD3  6  
ATOM 10018 H HE   . ARG A 1 16  ? 10.962  -14.054 12.364  1.00 0.00 ? 94  ARG A HE   6  
ATOM 10019 H HH11 . ARG A 1 16  ? 13.902  -12.710 13.657  1.00 0.00 ? 94  ARG A HH11 6  
ATOM 10020 H HH12 . ARG A 1 16  ? 14.272  -14.106 14.614  1.00 0.00 ? 94  ARG A HH12 6  
ATOM 10021 H HH21 . ARG A 1 16  ? 11.439  -15.897 13.619  1.00 0.00 ? 94  ARG A HH21 6  
ATOM 10022 H HH22 . ARG A 1 16  ? 12.872  -15.919 14.591  1.00 0.00 ? 94  ARG A HH22 6  
ATOM 10023 N N    . ALA A 1 17  ? 11.908  -9.541  8.479   1.00 0.00 ? 95  ALA A N    6  
ATOM 10024 C CA   . ALA A 1 17  ? 12.439  -8.186  8.562   1.00 0.00 ? 95  ALA A CA   6  
ATOM 10025 C C    . ALA A 1 17  ? 11.561  -7.203  7.796   1.00 0.00 ? 95  ALA A C    6  
ATOM 10026 O O    . ALA A 1 17  ? 11.229  -6.129  8.298   1.00 0.00 ? 95  ALA A O    6  
ATOM 10027 C CB   . ALA A 1 17  ? 13.865  -8.146  8.033   1.00 0.00 ? 95  ALA A CB   6  
ATOM 10028 H H    . ALA A 1 17  ? 12.427  -10.231 8.016   1.00 0.00 ? 95  ALA A H    6  
ATOM 10029 H HA   . ALA A 1 17  ? 12.460  -7.899  9.604   1.00 0.00 ? 95  ALA A HA   6  
ATOM 10030 H HB1  . ALA A 1 17  ? 14.435  -8.951  8.474   1.00 0.00 ? 95  ALA A HB1  6  
ATOM 10031 H HB2  . ALA A 1 17  ? 13.854  -8.258  6.959   1.00 0.00 ? 95  ALA A HB2  6  
ATOM 10032 H HB3  . ALA A 1 17  ? 14.318  -7.200  8.292   1.00 0.00 ? 95  ALA A HB3  6  
ATOM 10033 N N    . LEU A 1 18  ? 11.187  -7.577  6.577   1.00 0.00 ? 96  LEU A N    6  
ATOM 10034 C CA   . LEU A 1 18  ? 10.347  -6.728  5.740   1.00 0.00 ? 96  LEU A CA   6  
ATOM 10035 C C    . LEU A 1 18  ? 8.955   -6.574  6.344   1.00 0.00 ? 96  LEU A C    6  
ATOM 10036 O O    . LEU A 1 18  ? 8.426   -5.467  6.435   1.00 0.00 ? 96  LEU A O    6  
ATOM 10037 C CB   . LEU A 1 18  ? 10.242  -7.311  4.330   1.00 0.00 ? 96  LEU A CB   6  
ATOM 10038 C CG   . LEU A 1 18  ? 9.808   -6.339  3.232   1.00 0.00 ? 96  LEU A CG   6  
ATOM 10039 C CD1  . LEU A 1 18  ? 10.027  -6.954  1.858   1.00 0.00 ? 96  LEU A CD1  6  
ATOM 10040 C CD2  . LEU A 1 18  ? 8.350   -5.943  3.415   1.00 0.00 ? 96  LEU A CD2  6  
ATOM 10041 H H    . LEU A 1 18  ? 11.483  -8.444  6.230   1.00 0.00 ? 96  LEU A H    6  
ATOM 10042 H HA   . LEU A 1 18  ? 10.811  -5.754  5.684   1.00 0.00 ? 96  LEU A HA   6  
ATOM 10043 H HB2  . LEU A 1 18  ? 11.211  -7.703  4.061   1.00 0.00 ? 96  LEU A HB2  6  
ATOM 10044 H HB3  . LEU A 1 18  ? 9.525   -8.119  4.360   1.00 0.00 ? 96  LEU A HB3  6  
ATOM 10045 H HG   . LEU A 1 18  ? 10.410  -5.443  3.295   1.00 0.00 ? 96  LEU A HG   6  
ATOM 10046 H HD11 . LEU A 1 18  ? 10.875  -6.484  1.384   1.00 0.00 ? 96  LEU A HD11 6  
ATOM 10047 H HD12 . LEU A 1 18  ? 9.146   -6.803  1.252   1.00 0.00 ? 96  LEU A HD12 6  
ATOM 10048 H HD13 . LEU A 1 18  ? 10.213  -8.013  1.963   1.00 0.00 ? 96  LEU A HD13 6  
ATOM 10049 H HD21 . LEU A 1 18  ? 7.981   -5.500  2.502   1.00 0.00 ? 96  LEU A HD21 6  
ATOM 10050 H HD22 . LEU A 1 18  ? 8.270   -5.228  4.221   1.00 0.00 ? 96  LEU A HD22 6  
ATOM 10051 H HD23 . LEU A 1 18  ? 7.766   -6.820  3.652   1.00 0.00 ? 96  LEU A HD23 6  
ATOM 10052 N N    . ASN A 1 19  ? 8.369   -7.693  6.758   1.00 0.00 ? 97  ASN A N    6  
ATOM 10053 C CA   . ASN A 1 19  ? 7.038   -7.683  7.356   1.00 0.00 ? 97  ASN A CA   6  
ATOM 10054 C C    . ASN A 1 19  ? 7.023   -6.850  8.634   1.00 0.00 ? 97  ASN A C    6  
ATOM 10055 O O    . ASN A 1 19  ? 6.141   -6.016  8.834   1.00 0.00 ? 97  ASN A O    6  
ATOM 10056 C CB   . ASN A 1 19  ? 6.581   -9.111  7.658   1.00 0.00 ? 97  ASN A CB   6  
ATOM 10057 C CG   . ASN A 1 19  ? 5.492   -9.159  8.713   1.00 0.00 ? 97  ASN A CG   6  
ATOM 10058 O OD1  . ASN A 1 19  ? 4.339   -8.819  8.446   1.00 0.00 ? 97  ASN A OD1  6  
ATOM 10059 N ND2  . ASN A 1 19  ? 5.855   -9.581  9.919   1.00 0.00 ? 97  ASN A ND2  6  
ATOM 10060 H H    . ASN A 1 19  ? 8.841   -8.546  6.659   1.00 0.00 ? 97  ASN A H    6  
ATOM 10061 H HA   . ASN A 1 19  ? 6.358   -7.240  6.644   1.00 0.00 ? 97  ASN A HA   6  
ATOM 10062 H HB2  . ASN A 1 19  ? 6.198   -9.559  6.753   1.00 0.00 ? 97  ASN A HB2  6  
ATOM 10063 H HB3  . ASN A 1 19  ? 7.424   -9.686  8.011   1.00 0.00 ? 97  ASN A HB3  6  
ATOM 10064 H HD21 . ASN A 1 19  ? 6.791   -9.835  10.059  1.00 0.00 ? 97  ASN A HD21 6  
ATOM 10065 H HD22 . ASN A 1 19  ? 5.170   -9.622  10.619  1.00 0.00 ? 97  ASN A HD22 6  
ATOM 10066 N N    . GLY A 1 20  ? 8.007   -7.083  9.498   1.00 0.00 ? 98  GLY A N    6  
ATOM 10067 C CA   . GLY A 1 20  ? 8.088   -6.347  10.746  1.00 0.00 ? 98  GLY A CA   6  
ATOM 10068 C C    . GLY A 1 20  ? 8.496   -4.902  10.541  1.00 0.00 ? 98  GLY A C    6  
ATOM 10069 O O    . GLY A 1 20  ? 8.001   -4.006  11.227  1.00 0.00 ? 98  GLY A O    6  
ATOM 10070 H H    . GLY A 1 20  ? 8.683   -7.760  9.286   1.00 0.00 ? 98  GLY A H    6  
ATOM 10071 H HA2  . GLY A 1 20  ? 7.124   -6.373  11.230  1.00 0.00 ? 98  GLY A HA2  6  
ATOM 10072 H HA3  . GLY A 1 20  ? 8.814   -6.826  11.386  1.00 0.00 ? 98  GLY A HA3  6  
ATOM 10073 N N    . LEU A 1 21  ? 9.401   -4.672  9.596   1.00 0.00 ? 99  LEU A N    6  
ATOM 10074 C CA   . LEU A 1 21  ? 9.877   -3.325  9.304   1.00 0.00 ? 99  LEU A CA   6  
ATOM 10075 C C    . LEU A 1 21  ? 8.736   -2.439  8.814   1.00 0.00 ? 99  LEU A C    6  
ATOM 10076 O O    . LEU A 1 21  ? 8.545   -1.325  9.305   1.00 0.00 ? 99  LEU A O    6  
ATOM 10077 C CB   . LEU A 1 21  ? 10.988  -3.372  8.253   1.00 0.00 ? 99  LEU A CB   6  
ATOM 10078 C CG   . LEU A 1 21  ? 12.375  -3.767  8.761   1.00 0.00 ? 99  LEU A CG   6  
ATOM 10079 C CD1  . LEU A 1 21  ? 13.246  -4.252  7.612   1.00 0.00 ? 99  LEU A CD1  6  
ATOM 10080 C CD2  . LEU A 1 21  ? 13.035  -2.598  9.477   1.00 0.00 ? 99  LEU A CD2  6  
ATOM 10081 H H    . LEU A 1 21  ? 9.759   -5.426  9.083   1.00 0.00 ? 99  LEU A H    6  
ATOM 10082 H HA   . LEU A 1 21  ? 10.274  -2.908  10.217  1.00 0.00 ? 99  LEU A HA   6  
ATOM 10083 H HB2  . LEU A 1 21  ? 10.698  -4.084  7.497   1.00 0.00 ? 99  LEU A HB2  6  
ATOM 10084 H HB3  . LEU A 1 21  ? 11.065  -2.389  7.810   1.00 0.00 ? 99  LEU A HB3  6  
ATOM 10085 H HG   . LEU A 1 21  ? 12.275  -4.579  9.468   1.00 0.00 ? 99  LEU A HG   6  
ATOM 10086 H HD11 . LEU A 1 21  ? 13.308  -5.329  7.637   1.00 0.00 ? 99  LEU A HD11 6  
ATOM 10087 H HD12 . LEU A 1 21  ? 14.236  -3.831  7.709   1.00 0.00 ? 99  LEU A HD12 6  
ATOM 10088 H HD13 . LEU A 1 21  ? 12.812  -3.937  6.674   1.00 0.00 ? 99  LEU A HD13 6  
ATOM 10089 H HD21 . LEU A 1 21  ? 12.289  -2.048  10.031  1.00 0.00 ? 99  LEU A HD21 6  
ATOM 10090 H HD22 . LEU A 1 21  ? 13.496  -1.945  8.749   1.00 0.00 ? 99  LEU A HD22 6  
ATOM 10091 H HD23 . LEU A 1 21  ? 13.788  -2.969  10.156  1.00 0.00 ? 99  LEU A HD23 6  
ATOM 10092 N N    . LEU A 1 22  ? 7.979   -2.940  7.845   1.00 0.00 ? 100 LEU A N    6  
ATOM 10093 C CA   . LEU A 1 22  ? 6.854   -2.196  7.289   1.00 0.00 ? 100 LEU A CA   6  
ATOM 10094 C C    . LEU A 1 22  ? 5.746   -2.030  8.325   1.00 0.00 ? 100 LEU A C    6  
ATOM 10095 O O    . LEU A 1 22  ? 5.123   -0.972  8.418   1.00 0.00 ? 100 LEU A O    6  
ATOM 10096 C CB   . LEU A 1 22  ? 6.308   -2.907  6.050   1.00 0.00 ? 100 LEU A CB   6  
ATOM 10097 C CG   . LEU A 1 22  ? 7.101   -2.710  4.758   1.00 0.00 ? 100 LEU A CG   6  
ATOM 10098 C CD1  . LEU A 1 22  ? 6.546   -3.592  3.651   1.00 0.00 ? 100 LEU A CD1  6  
ATOM 10099 C CD2  . LEU A 1 22  ? 7.082   -1.247  4.338   1.00 0.00 ? 100 LEU A CD2  6  
ATOM 10100 H H    . LEU A 1 22  ? 8.180   -3.832  7.493   1.00 0.00 ? 100 LEU A H    6  
ATOM 10101 H HA   . LEU A 1 22  ? 7.213   -1.218  7.004   1.00 0.00 ? 100 LEU A HA   6  
ATOM 10102 H HB2  . LEU A 1 22  ? 6.279   -3.965  6.262   1.00 0.00 ? 100 LEU A HB2  6  
ATOM 10103 H HB3  . LEU A 1 22  ? 5.302   -2.548  5.880   1.00 0.00 ? 100 LEU A HB3  6  
ATOM 10104 H HG   . LEU A 1 22  ? 8.130   -2.997  4.928   1.00 0.00 ? 100 LEU A HG   6  
ATOM 10105 H HD11 . LEU A 1 22  ? 6.338   -4.575  4.044   1.00 0.00 ? 100 LEU A HD11 6  
ATOM 10106 H HD12 . LEU A 1 22  ? 7.271   -3.668  2.854   1.00 0.00 ? 100 LEU A HD12 6  
ATOM 10107 H HD13 . LEU A 1 22  ? 5.635   -3.157  3.267   1.00 0.00 ? 100 LEU A HD13 6  
ATOM 10108 H HD21 . LEU A 1 22  ? 7.650   -1.127  3.428   1.00 0.00 ? 100 LEU A HD21 6  
ATOM 10109 H HD22 . LEU A 1 22  ? 7.522   -0.643  5.119   1.00 0.00 ? 100 LEU A HD22 6  
ATOM 10110 H HD23 . LEU A 1 22  ? 6.062   -0.934  4.171   1.00 0.00 ? 100 LEU A HD23 6  
ATOM 10111 N N    . TYR A 1 23  ? 5.507   -3.081  9.101   1.00 0.00 ? 101 TYR A N    6  
ATOM 10112 C CA   . TYR A 1 23  ? 4.474   -3.053  10.129  1.00 0.00 ? 101 TYR A CA   6  
ATOM 10113 C C    . TYR A 1 23  ? 4.838   -2.071  11.239  1.00 0.00 ? 101 TYR A C    6  
ATOM 10114 O O    . TYR A 1 23  ? 3.992   -1.316  11.718  1.00 0.00 ? 101 TYR A O    6  
ATOM 10115 C CB   . TYR A 1 23  ? 4.271   -4.450  10.717  1.00 0.00 ? 101 TYR A CB   6  
ATOM 10116 C CG   . TYR A 1 23  ? 3.406   -4.466  11.957  1.00 0.00 ? 101 TYR A CG   6  
ATOM 10117 C CD1  . TYR A 1 23  ? 2.035   -4.261  11.873  1.00 0.00 ? 101 TYR A CD1  6  
ATOM 10118 C CD2  . TYR A 1 23  ? 3.960   -4.686  13.212  1.00 0.00 ? 101 TYR A CD2  6  
ATOM 10119 C CE1  . TYR A 1 23  ? 1.240   -4.274  13.003  1.00 0.00 ? 101 TYR A CE1  6  
ATOM 10120 C CE2  . TYR A 1 23  ? 3.174   -4.702  14.347  1.00 0.00 ? 101 TYR A CE2  6  
ATOM 10121 C CZ   . TYR A 1 23  ? 1.814   -4.495  14.238  1.00 0.00 ? 101 TYR A CZ   6  
ATOM 10122 O OH   . TYR A 1 23  ? 1.027   -4.509  15.367  1.00 0.00 ? 101 TYR A OH   6  
ATOM 10123 H H    . TYR A 1 23  ? 6.037   -3.897  8.978   1.00 0.00 ? 101 TYR A H    6  
ATOM 10124 H HA   . TYR A 1 23  ? 3.553   -2.730  9.666   1.00 0.00 ? 101 TYR A HA   6  
ATOM 10125 H HB2  . TYR A 1 23  ? 3.801   -5.079  9.977   1.00 0.00 ? 101 TYR A HB2  6  
ATOM 10126 H HB3  . TYR A 1 23  ? 5.233   -4.867  10.977  1.00 0.00 ? 101 TYR A HB3  6  
ATOM 10127 H HD1  . TYR A 1 23  ? 1.588   -4.088  10.905  1.00 0.00 ? 101 TYR A HD1  6  
ATOM 10128 H HD2  . TYR A 1 23  ? 5.026   -4.847  13.294  1.00 0.00 ? 101 TYR A HD2  6  
ATOM 10129 H HE1  . TYR A 1 23  ? 0.176   -4.112  12.918  1.00 0.00 ? 101 TYR A HE1  6  
ATOM 10130 H HE2  . TYR A 1 23  ? 3.623   -4.875  15.314  1.00 0.00 ? 101 TYR A HE2  6  
ATOM 10131 H HH   . TYR A 1 23  ? 0.226   -5.009  15.192  1.00 0.00 ? 101 TYR A HH   6  
ATOM 10132 N N    . LYS A 1 24  ? 6.104   -2.086  11.642  1.00 0.00 ? 102 LYS A N    6  
ATOM 10133 C CA   . LYS A 1 24  ? 6.583   -1.197  12.694  1.00 0.00 ? 102 LYS A CA   6  
ATOM 10134 C C    . LYS A 1 24  ? 6.705   0.235   12.182  1.00 0.00 ? 102 LYS A C    6  
ATOM 10135 O O    . LYS A 1 24  ? 6.353   1.186   12.880  1.00 0.00 ? 102 LYS A O    6  
ATOM 10136 C CB   . LYS A 1 24  ? 7.937   -1.679  13.220  1.00 0.00 ? 102 LYS A CB   6  
ATOM 10137 C CG   . LYS A 1 24  ? 8.647   -0.660  14.095  1.00 0.00 ? 102 LYS A CG   6  
ATOM 10138 C CD   . LYS A 1 24  ? 7.832   -0.323  15.332  1.00 0.00 ? 102 LYS A CD   6  
ATOM 10139 C CE   . LYS A 1 24  ? 8.726   0.052   16.504  1.00 0.00 ? 102 LYS A CE   6  
ATOM 10140 N NZ   . LYS A 1 24  ? 9.516   -1.111  16.993  1.00 0.00 ? 102 LYS A NZ   6  
ATOM 10141 H H    . LYS A 1 24  ? 6.732   -2.711  11.222  1.00 0.00 ? 102 LYS A H    6  
ATOM 10142 H HA   . LYS A 1 24  ? 5.865   -1.218  13.500  1.00 0.00 ? 102 LYS A HA   6  
ATOM 10143 H HB2  . LYS A 1 24  ? 7.785   -2.577  13.800  1.00 0.00 ? 102 LYS A HB2  6  
ATOM 10144 H HB3  . LYS A 1 24  ? 8.576   -1.907  12.379  1.00 0.00 ? 102 LYS A HB3  6  
ATOM 10145 H HG2  . LYS A 1 24  ? 9.599   -1.066  14.404  1.00 0.00 ? 102 LYS A HG2  6  
ATOM 10146 H HG3  . LYS A 1 24  ? 8.806   0.243   13.523  1.00 0.00 ? 102 LYS A HG3  6  
ATOM 10147 H HD2  . LYS A 1 24  ? 7.182   0.510   15.109  1.00 0.00 ? 102 LYS A HD2  6  
ATOM 10148 H HD3  . LYS A 1 24  ? 7.237   -1.183  15.606  1.00 0.00 ? 102 LYS A HD3  6  
ATOM 10149 H HE2  . LYS A 1 24  ? 9.404   0.830   16.187  1.00 0.00 ? 102 LYS A HE2  6  
ATOM 10150 H HE3  . LYS A 1 24  ? 8.107   0.421   17.309  1.00 0.00 ? 102 LYS A HE3  6  
ATOM 10151 H HZ1  . LYS A 1 24  ? 10.532  -0.889  16.966  1.00 0.00 ? 102 LYS A HZ1  6  
ATOM 10152 H HZ2  . LYS A 1 24  ? 9.338   -1.942  16.394  1.00 0.00 ? 102 LYS A HZ2  6  
ATOM 10153 H HZ3  . LYS A 1 24  ? 9.248   -1.339  17.972  1.00 0.00 ? 102 LYS A HZ3  6  
ATOM 10154 N N    . ALA A 1 25  ? 7.204   0.381   10.959  1.00 0.00 ? 103 ALA A N    6  
ATOM 10155 C CA   . ALA A 1 25  ? 7.368   1.696   10.353  1.00 0.00 ? 103 ALA A CA   6  
ATOM 10156 C C    . ALA A 1 25  ? 6.017   2.325   10.030  1.00 0.00 ? 103 ALA A C    6  
ATOM 10157 O O    . ALA A 1 25  ? 5.802   3.514   10.264  1.00 0.00 ? 103 ALA A O    6  
ATOM 10158 C CB   . ALA A 1 25  ? 8.220   1.595   9.096   1.00 0.00 ? 103 ALA A CB   6  
ATOM 10159 H H    . ALA A 1 25  ? 7.466   -0.416  10.452  1.00 0.00 ? 103 ALA A H    6  
ATOM 10160 H HA   . ALA A 1 25  ? 7.888   2.327   11.060  1.00 0.00 ? 103 ALA A HA   6  
ATOM 10161 H HB1  . ALA A 1 25  ? 8.711   2.541   8.918   1.00 0.00 ? 103 ALA A HB1  6  
ATOM 10162 H HB2  . ALA A 1 25  ? 8.963   0.822   9.226   1.00 0.00 ? 103 ALA A HB2  6  
ATOM 10163 H HB3  . ALA A 1 25  ? 7.590   1.352   8.253   1.00 0.00 ? 103 ALA A HB3  6  
ATOM 10164 N N    . LEU A 1 26  ? 5.109   1.519   9.490   1.00 0.00 ? 104 LEU A N    6  
ATOM 10165 C CA   . LEU A 1 26  ? 3.778   1.997   9.133   1.00 0.00 ? 104 LEU A CA   6  
ATOM 10166 C C    . LEU A 1 26  ? 3.015   2.456   10.372  1.00 0.00 ? 104 LEU A C    6  
ATOM 10167 O O    . LEU A 1 26  ? 2.467   3.559   10.404  1.00 0.00 ? 104 LEU A O    6  
ATOM 10168 C CB   . LEU A 1 26  ? 2.994   0.896   8.417   1.00 0.00 ? 104 LEU A CB   6  
ATOM 10169 C CG   . LEU A 1 26  ? 3.312   0.702   6.933   1.00 0.00 ? 104 LEU A CG   6  
ATOM 10170 C CD1  . LEU A 1 26  ? 2.808   -0.649  6.451   1.00 0.00 ? 104 LEU A CD1  6  
ATOM 10171 C CD2  . LEU A 1 26  ? 2.705   1.827   6.107   1.00 0.00 ? 104 LEU A CD2  6  
ATOM 10172 H H    . LEU A 1 26  ? 5.339   0.581   9.327   1.00 0.00 ? 104 LEU A H    6  
ATOM 10173 H HA   . LEU A 1 26  ? 3.895   2.837   8.465   1.00 0.00 ? 104 LEU A HA   6  
ATOM 10174 H HB2  . LEU A 1 26  ? 3.196   -0.036  8.922   1.00 0.00 ? 104 LEU A HB2  6  
ATOM 10175 H HB3  . LEU A 1 26  ? 1.943   1.129   8.503   1.00 0.00 ? 104 LEU A HB3  6  
ATOM 10176 H HG   . LEU A 1 26  ? 4.385   0.726   6.795   1.00 0.00 ? 104 LEU A HG   6  
ATOM 10177 H HD11 . LEU A 1 26  ? 2.208   -0.513  5.563   1.00 0.00 ? 104 LEU A HD11 6  
ATOM 10178 H HD12 . LEU A 1 26  ? 2.208   -1.106  7.224   1.00 0.00 ? 104 LEU A HD12 6  
ATOM 10179 H HD13 . LEU A 1 26  ? 3.649   -1.287  6.224   1.00 0.00 ? 104 LEU A HD13 6  
ATOM 10180 H HD21 . LEU A 1 26  ? 1.670   1.600   5.896   1.00 0.00 ? 104 LEU A HD21 6  
ATOM 10181 H HD22 . LEU A 1 26  ? 3.248   1.925   5.178   1.00 0.00 ? 104 LEU A HD22 6  
ATOM 10182 H HD23 . LEU A 1 26  ? 2.765   2.753   6.660   1.00 0.00 ? 104 LEU A HD23 6  
ATOM 10183 N N    . THR A 1 27  ? 2.983   1.604   11.391  1.00 0.00 ? 105 THR A N    6  
ATOM 10184 C CA   . THR A 1 27  ? 2.289   1.922   12.632  1.00 0.00 ? 105 THR A CA   6  
ATOM 10185 C C    . THR A 1 27  ? 2.948   3.097   13.346  1.00 0.00 ? 105 THR A C    6  
ATOM 10186 O O    . THR A 1 27  ? 2.291   3.839   14.076  1.00 0.00 ? 105 THR A O    6  
ATOM 10187 C CB   . THR A 1 27  ? 2.256   0.711   13.584  1.00 0.00 ? 105 THR A CB   6  
ATOM 10188 O OG1  . THR A 1 27  ? 1.591   1.063   14.802  1.00 0.00 ? 105 THR A OG1  6  
ATOM 10189 C CG2  . THR A 1 27  ? 3.665   0.226   13.892  1.00 0.00 ? 105 THR A CG2  6  
ATOM 10190 H H    . THR A 1 27  ? 3.439   0.740   11.305  1.00 0.00 ? 105 THR A H    6  
ATOM 10191 H HA   . THR A 1 27  ? 1.271   2.187   12.386  1.00 0.00 ? 105 THR A HA   6  
ATOM 10192 H HB   . THR A 1 27  ? 1.712   -0.090  13.104  1.00 0.00 ? 105 THR A HB   6  
ATOM 10193 H HG1  . THR A 1 27  ? 1.937   1.898   15.126  1.00 0.00 ? 105 THR A HG1  6  
ATOM 10194 H HG21 . THR A 1 27  ? 4.305   0.417   13.043  1.00 0.00 ? 105 THR A HG21 6  
ATOM 10195 H HG22 . THR A 1 27  ? 3.644   -0.834  14.096  1.00 0.00 ? 105 THR A HG22 6  
ATOM 10196 H HG23 . THR A 1 27  ? 4.046   0.752   14.754  1.00 0.00 ? 105 THR A HG23 6  
ATOM 10197 N N    . ASP A 1 28  ? 4.248   3.260   13.129  1.00 0.00 ? 106 ASP A N    6  
ATOM 10198 C CA   . ASP A 1 28  ? 4.996   4.347   13.751  1.00 0.00 ? 106 ASP A CA   6  
ATOM 10199 C C    . ASP A 1 28  ? 4.619   5.689   13.132  1.00 0.00 ? 106 ASP A C    6  
ATOM 10200 O O    . ASP A 1 28  ? 4.581   6.712   13.817  1.00 0.00 ? 106 ASP A O    6  
ATOM 10201 C CB   . ASP A 1 28  ? 6.500   4.109   13.605  1.00 0.00 ? 106 ASP A CB   6  
ATOM 10202 C CG   . ASP A 1 28  ? 7.324   5.120   14.377  1.00 0.00 ? 106 ASP A CG   6  
ATOM 10203 O OD1  . ASP A 1 28  ? 7.119   5.240   15.603  1.00 0.00 ? 106 ASP A OD1  6  
ATOM 10204 O OD2  . ASP A 1 28  ? 8.175   5.790   13.756  1.00 0.00 ? 106 ASP A OD2  6  
ATOM 10205 H H    . ASP A 1 28  ? 4.716   2.635   12.537  1.00 0.00 ? 106 ASP A H    6  
ATOM 10206 H HA   . ASP A 1 28  ? 4.744   4.365   14.800  1.00 0.00 ? 106 ASP A HA   6  
ATOM 10207 H HB2  . ASP A 1 28  ? 6.739   3.121   13.972  1.00 0.00 ? 106 ASP A HB2  6  
ATOM 10208 H HB3  . ASP A 1 28  ? 6.768   4.174   12.561  1.00 0.00 ? 106 ASP A HB3  6  
ATOM 10209 N N    . LEU A 1 29  ? 4.342   5.679   11.833  1.00 0.00 ? 107 LEU A N    6  
ATOM 10210 C CA   . LEU A 1 29  ? 3.968   6.896   11.120  1.00 0.00 ? 107 LEU A CA   6  
ATOM 10211 C C    . LEU A 1 29  ? 2.585   7.376   11.549  1.00 0.00 ? 107 LEU A C    6  
ATOM 10212 O O    . LEU A 1 29  ? 2.326   8.578   11.615  1.00 0.00 ? 107 LEU A O    6  
ATOM 10213 C CB   . LEU A 1 29  ? 3.991   6.654   9.610   1.00 0.00 ? 107 LEU A CB   6  
ATOM 10214 C CG   . LEU A 1 29  ? 5.373   6.506   8.974   1.00 0.00 ? 107 LEU A CG   6  
ATOM 10215 C CD1  . LEU A 1 29  ? 5.250   6.061   7.525   1.00 0.00 ? 107 LEU A CD1  6  
ATOM 10216 C CD2  . LEU A 1 29  ? 6.147   7.813   9.069   1.00 0.00 ? 107 LEU A CD2  6  
ATOM 10217 H H    . LEU A 1 29  ? 4.389   4.834   11.340  1.00 0.00 ? 107 LEU A H    6  
ATOM 10218 H HA   . LEU A 1 29  ? 4.693   7.659   11.365  1.00 0.00 ? 107 LEU A HA   6  
ATOM 10219 H HB2  . LEU A 1 29  ? 3.438   5.749   9.412   1.00 0.00 ? 107 LEU A HB2  6  
ATOM 10220 H HB3  . LEU A 1 29  ? 3.494   7.488   9.135   1.00 0.00 ? 107 LEU A HB3  6  
ATOM 10221 H HG   . LEU A 1 29  ? 5.929   5.748   9.509   1.00 0.00 ? 107 LEU A HG   6  
ATOM 10222 H HD11 . LEU A 1 29  ? 6.124   6.377   6.976   1.00 0.00 ? 107 LEU A HD11 6  
ATOM 10223 H HD12 . LEU A 1 29  ? 4.369   6.506   7.086   1.00 0.00 ? 107 LEU A HD12 6  
ATOM 10224 H HD13 . LEU A 1 29  ? 5.167   4.985   7.485   1.00 0.00 ? 107 LEU A HD13 6  
ATOM 10225 H HD21 . LEU A 1 29  ? 6.328   8.049   10.107  1.00 0.00 ? 107 LEU A HD21 6  
ATOM 10226 H HD22 . LEU A 1 29  ? 5.570   8.606   8.616   1.00 0.00 ? 107 LEU A HD22 6  
ATOM 10227 H HD23 . LEU A 1 29  ? 7.089   7.712   8.552   1.00 0.00 ? 107 LEU A HD23 6  
ATOM 10228 N N    . LEU A 1 30  ? 1.701   6.429   11.842  1.00 0.00 ? 108 LEU A N    6  
ATOM 10229 C CA   . LEU A 1 30  ? 0.344   6.754   12.268  1.00 0.00 ? 108 LEU A CA   6  
ATOM 10230 C C    . LEU A 1 30  ? 0.332   7.260   13.707  1.00 0.00 ? 108 LEU A C    6  
ATOM 10231 O O    . LEU A 1 30  ? -0.726  7.563   14.259  1.00 0.00 ? 108 LEU A O    6  
ATOM 10232 C CB   . LEU A 1 30  ? -0.560  5.527   12.139  1.00 0.00 ? 108 LEU A CB   6  
ATOM 10233 C CG   . LEU A 1 30  ? -1.091  5.229   10.737  1.00 0.00 ? 108 LEU A CG   6  
ATOM 10234 C CD1  . LEU A 1 30  ? -0.007  5.456   9.695   1.00 0.00 ? 108 LEU A CD1  6  
ATOM 10235 C CD2  . LEU A 1 30  ? -1.619  3.804   10.658  1.00 0.00 ? 108 LEU A CD2  6  
ATOM 10236 H H    . LEU A 1 30  ? 1.966   5.488   11.771  1.00 0.00 ? 108 LEU A H    6  
ATOM 10237 H HA   . LEU A 1 30  ? -0.028  7.534   11.621  1.00 0.00 ? 108 LEU A HA   6  
ATOM 10238 H HB2  . LEU A 1 30  ? 0.002   4.666   12.469  1.00 0.00 ? 108 LEU A HB2  6  
ATOM 10239 H HB3  . LEU A 1 30  ? -1.409  5.673   12.792  1.00 0.00 ? 108 LEU A HB3  6  
ATOM 10240 H HG   . LEU A 1 30  ? -1.909  5.902   10.518  1.00 0.00 ? 108 LEU A HG   6  
ATOM 10241 H HD11 . LEU A 1 30  ? 0.686   4.629   9.711   1.00 0.00 ? 108 LEU A HD11 6  
ATOM 10242 H HD12 . LEU A 1 30  ? 0.521   6.372   9.919   1.00 0.00 ? 108 LEU A HD12 6  
ATOM 10243 H HD13 . LEU A 1 30  ? -0.458  5.531   8.716   1.00 0.00 ? 108 LEU A HD13 6  
ATOM 10244 H HD21 . LEU A 1 30  ? -0.789  3.113   10.661  1.00 0.00 ? 108 LEU A HD21 6  
ATOM 10245 H HD22 . LEU A 1 30  ? -2.186  3.680   9.747   1.00 0.00 ? 108 LEU A HD22 6  
ATOM 10246 H HD23 . LEU A 1 30  ? -2.255  3.608   11.508  1.00 0.00 ? 108 LEU A HD23 6  
ATOM 10247 N N    . CYS A 1 31  ? 1.513   7.352   14.306  1.00 0.00 ? 109 CYS A N    6  
ATOM 10248 C CA   . CYS A 1 31  ? 1.639   7.823   15.681  1.00 0.00 ? 109 CYS A CA   6  
ATOM 10249 C C    . CYS A 1 31  ? 1.831   9.336   15.722  1.00 0.00 ? 109 CYS A C    6  
ATOM 10250 O O    . CYS A 1 31  ? 1.364   10.008  16.642  1.00 0.00 ? 109 CYS A O    6  
ATOM 10251 C CB   . CYS A 1 31  ? 2.811   7.129   16.375  1.00 0.00 ? 109 CYS A CB   6  
ATOM 10252 S SG   . CYS A 1 31  ? 2.553   5.364   16.674  1.00 0.00 ? 109 CYS A SG   6  
ATOM 10253 H H    . CYS A 1 31  ? 2.321   7.096   13.814  1.00 0.00 ? 109 CYS A H    6  
ATOM 10254 H HA   . CYS A 1 31  ? 0.726   7.575   16.200  1.00 0.00 ? 109 CYS A HA   6  
ATOM 10255 H HB2  . CYS A 1 31  ? 3.695   7.231   15.763  1.00 0.00 ? 109 CYS A HB2  6  
ATOM 10256 H HB3  . CYS A 1 31  ? 2.986   7.603   17.330  1.00 0.00 ? 109 CYS A HB3  6  
ATOM 10257 H HG   . CYS A 1 31  ? 2.073   4.828   15.562  1.00 0.00 ? 109 CYS A HG   6  
ATOM 10258 N N    . THR A 1 32  ? 2.523   9.866   14.718  1.00 0.00 ? 110 THR A N    6  
ATOM 10259 C CA   . THR A 1 32  ? 2.781   11.299  14.641  1.00 0.00 ? 110 THR A CA   6  
ATOM 10260 C C    . THR A 1 32  ? 1.966   11.944  13.525  1.00 0.00 ? 110 THR A C    6  
ATOM 10261 O O    . THR A 1 32  ? 2.132   11.635  12.345  1.00 0.00 ? 110 THR A O    6  
ATOM 10262 C CB   . THR A 1 32  ? 4.275   11.589  14.404  1.00 0.00 ? 110 THR A CB   6  
ATOM 10263 O OG1  . THR A 1 32  ? 5.077   10.647  15.125  1.00 0.00 ? 110 THR A OG1  6  
ATOM 10264 C CG2  . THR A 1 32  ? 4.627   13.003  14.842  1.00 0.00 ? 110 THR A CG2  6  
ATOM 10265 H H    . THR A 1 32  ? 2.870   9.279   14.015  1.00 0.00 ? 110 THR A H    6  
ATOM 10266 H HA   . THR A 1 32  ? 2.494   11.741  15.584  1.00 0.00 ? 110 THR A HA   6  
ATOM 10267 H HB   . THR A 1 32  ? 4.482   11.493  13.348  1.00 0.00 ? 110 THR A HB   6  
ATOM 10268 H HG1  . THR A 1 32  ? 4.930   10.756  16.067  1.00 0.00 ? 110 THR A HG1  6  
ATOM 10269 H HG21 . THR A 1 32  ? 3.720   13.556  15.038  1.00 0.00 ? 110 THR A HG21 6  
ATOM 10270 H HG22 . THR A 1 32  ? 5.186   13.493  14.059  1.00 0.00 ? 110 THR A HG22 6  
ATOM 10271 H HG23 . THR A 1 32  ? 5.225   12.962  15.740  1.00 0.00 ? 110 THR A HG23 6  
ATOM 10272 N N    . PRO A 1 33  ? 1.065   12.862  13.904  1.00 0.00 ? 111 PRO A N    6  
ATOM 10273 C CA   . PRO A 1 33  ? 0.208   13.570  12.949  1.00 0.00 ? 111 PRO A CA   6  
ATOM 10274 C C    . PRO A 1 33  ? 0.991   14.553  12.085  1.00 0.00 ? 111 PRO A C    6  
ATOM 10275 O O    . PRO A 1 33  ? 0.414   15.273  11.271  1.00 0.00 ? 111 PRO A O    6  
ATOM 10276 C CB   . PRO A 1 33  ? -0.781  14.318  13.847  1.00 0.00 ? 111 PRO A CB   6  
ATOM 10277 C CG   . PRO A 1 33  ? -0.061  14.492  15.140  1.00 0.00 ? 111 PRO A CG   6  
ATOM 10278 C CD   . PRO A 1 33  ? 0.814   13.279  15.294  1.00 0.00 ? 111 PRO A CD   6  
ATOM 10279 H HA   . PRO A 1 33  ? -0.330  12.883  12.313  1.00 0.00 ? 111 PRO A HA   6  
ATOM 10280 H HB2  . PRO A 1 33  ? -1.028  15.271  13.400  1.00 0.00 ? 111 PRO A HB2  6  
ATOM 10281 H HB3  . PRO A 1 33  ? -1.677  13.729  13.971  1.00 0.00 ? 111 PRO A HB3  6  
ATOM 10282 H HG2  . PRO A 1 33  ? 0.541   15.387  15.108  1.00 0.00 ? 111 PRO A HG2  6  
ATOM 10283 H HG3  . PRO A 1 33  ? -0.772  14.546  15.951  1.00 0.00 ? 111 PRO A HG3  6  
ATOM 10284 H HD2  . PRO A 1 33  ? 1.736   13.540  15.791  1.00 0.00 ? 111 PRO A HD2  6  
ATOM 10285 H HD3  . PRO A 1 33  ? 0.294   12.505  15.840  1.00 0.00 ? 111 PRO A HD3  6  
ATOM 10286 N N    . GLU A 1 34  ? 2.307   14.577  12.269  1.00 0.00 ? 112 GLU A N    6  
ATOM 10287 C CA   . GLU A 1 34  ? 3.168   15.473  11.506  1.00 0.00 ? 112 GLU A CA   6  
ATOM 10288 C C    . GLU A 1 34  ? 2.941   15.299  10.007  1.00 0.00 ? 112 GLU A C    6  
ATOM 10289 O O    . GLU A 1 34  ? 2.695   16.268  9.289   1.00 0.00 ? 112 GLU A O    6  
ATOM 10290 C CB   . GLU A 1 34  ? 4.638   15.214  11.844  1.00 0.00 ? 112 GLU A CB   6  
ATOM 10291 C CG   . GLU A 1 34  ? 5.096   15.888  13.126  1.00 0.00 ? 112 GLU A CG   6  
ATOM 10292 C CD   . GLU A 1 34  ? 5.345   17.373  12.947  1.00 0.00 ? 112 GLU A CD   6  
ATOM 10293 O OE1  . GLU A 1 34  ? 4.388   18.099  12.606  1.00 0.00 ? 112 GLU A OE1  6  
ATOM 10294 O OE2  . GLU A 1 34  ? 6.498   17.809  13.150  1.00 0.00 ? 112 GLU A OE2  6  
ATOM 10295 H H    . GLU A 1 34  ? 2.708   13.979  12.934  1.00 0.00 ? 112 GLU A H    6  
ATOM 10296 H HA   . GLU A 1 34  ? 2.919   16.487  11.780  1.00 0.00 ? 112 GLU A HA   6  
ATOM 10297 H HB2  . GLU A 1 34  ? 4.789   14.150  11.947  1.00 0.00 ? 112 GLU A HB2  6  
ATOM 10298 H HB3  . GLU A 1 34  ? 5.250   15.578  11.032  1.00 0.00 ? 112 GLU A HB3  6  
ATOM 10299 H HG2  . GLU A 1 34  ? 4.334   15.755  13.879  1.00 0.00 ? 112 GLU A HG2  6  
ATOM 10300 H HG3  . GLU A 1 34  ? 6.012   15.421  13.456  1.00 0.00 ? 112 GLU A HG3  6  
ATOM 10301 N N    . VAL A 1 35  ? 3.026   14.057  9.541   1.00 0.00 ? 113 VAL A N    6  
ATOM 10302 C CA   . VAL A 1 35  ? 2.830   13.755  8.129   1.00 0.00 ? 113 VAL A CA   6  
ATOM 10303 C C    . VAL A 1 35  ? 1.377   13.396  7.840   1.00 0.00 ? 113 VAL A C    6  
ATOM 10304 O O    . VAL A 1 35  ? 0.730   14.015  6.995   1.00 0.00 ? 113 VAL A O    6  
ATOM 10305 C CB   . VAL A 1 35  ? 3.734   12.594  7.672   1.00 0.00 ? 113 VAL A CB   6  
ATOM 10306 C CG1  . VAL A 1 35  ? 3.424   11.333  8.463   1.00 0.00 ? 113 VAL A CG1  6  
ATOM 10307 C CG2  . VAL A 1 35  ? 3.573   12.350  6.179   1.00 0.00 ? 113 VAL A CG2  6  
ATOM 10308 H H    . VAL A 1 35  ? 3.225   13.326  10.163  1.00 0.00 ? 113 VAL A H    6  
ATOM 10309 H HA   . VAL A 1 35  ? 3.094   14.634  7.559   1.00 0.00 ? 113 VAL A HA   6  
ATOM 10310 H HB   . VAL A 1 35  ? 4.761   12.868  7.862   1.00 0.00 ? 113 VAL A HB   6  
ATOM 10311 H HG11 . VAL A 1 35  ? 4.249   10.641  8.375   1.00 0.00 ? 113 VAL A HG11 6  
ATOM 10312 H HG12 . VAL A 1 35  ? 3.275   11.587  9.503   1.00 0.00 ? 113 VAL A HG12 6  
ATOM 10313 H HG13 . VAL A 1 35  ? 2.528   10.874  8.072   1.00 0.00 ? 113 VAL A HG13 6  
ATOM 10314 H HG21 . VAL A 1 35  ? 4.538   12.134  5.745   1.00 0.00 ? 113 VAL A HG21 6  
ATOM 10315 H HG22 . VAL A 1 35  ? 2.911   11.511  6.020   1.00 0.00 ? 113 VAL A HG22 6  
ATOM 10316 H HG23 . VAL A 1 35  ? 3.157   13.230  5.713   1.00 0.00 ? 113 VAL A HG23 6  
ATOM 10317 N N    . SER A 1 36  ? 0.869   12.393  8.548   1.00 0.00 ? 114 SER A N    6  
ATOM 10318 C CA   . SER A 1 36  ? -0.509  11.949  8.366   1.00 0.00 ? 114 SER A CA   6  
ATOM 10319 C C    . SER A 1 36  ? -1.442  12.660  9.342   1.00 0.00 ? 114 SER A C    6  
ATOM 10320 O O    . SER A 1 36  ? -1.985  12.043  10.257  1.00 0.00 ? 114 SER A O    6  
ATOM 10321 C CB   . SER A 1 36  ? -0.608  10.435  8.559   1.00 0.00 ? 114 SER A CB   6  
ATOM 10322 O OG   . SER A 1 36  ? -0.603  10.094  9.934   1.00 0.00 ? 114 SER A OG   6  
ATOM 10323 H H    . SER A 1 36  ? 1.435   11.939  9.207   1.00 0.00 ? 114 SER A H    6  
ATOM 10324 H HA   . SER A 1 36  ? -0.806  12.195  7.358   1.00 0.00 ? 114 SER A HA   6  
ATOM 10325 H HB2  . SER A 1 36  ? -1.525  10.078  8.116   1.00 0.00 ? 114 SER A HB2  6  
ATOM 10326 H HB3  . SER A 1 36  ? 0.234   9.957   8.078   1.00 0.00 ? 114 SER A HB3  6  
ATOM 10327 H HG   . SER A 1 36  ? -0.700  9.144   10.030  1.00 0.00 ? 114 SER A HG   6  
ATOM 10328 N N    . GLN A 1 37  ? -1.622  13.961  9.137   1.00 0.00 ? 115 GLN A N    6  
ATOM 10329 C CA   . GLN A 1 37  ? -2.488  14.756  9.999   1.00 0.00 ? 115 GLN A CA   6  
ATOM 10330 C C    . GLN A 1 37  ? -3.918  14.227  9.970   1.00 0.00 ? 115 GLN A C    6  
ATOM 10331 O O    . GLN A 1 37  ? -4.545  14.048  11.014  1.00 0.00 ? 115 GLN A O    6  
ATOM 10332 C CB   . GLN A 1 37  ? -2.466  16.223  9.566   1.00 0.00 ? 115 GLN A CB   6  
ATOM 10333 C CG   . GLN A 1 37  ? -3.098  17.166  10.577  1.00 0.00 ? 115 GLN A CG   6  
ATOM 10334 C CD   . GLN A 1 37  ? -3.484  18.500  9.970   1.00 0.00 ? 115 GLN A CD   6  
ATOM 10335 O OE1  . GLN A 1 37  ? -3.861  18.577  8.800   1.00 0.00 ? 115 GLN A OE1  6  
ATOM 10336 N NE2  . GLN A 1 37  ? -3.391  19.561  10.763  1.00 0.00 ? 115 GLN A NE2  6  
ATOM 10337 H H    . GLN A 1 37  ? -1.161  14.395  8.391   1.00 0.00 ? 115 GLN A H    6  
ATOM 10338 H HA   . GLN A 1 37  ? -2.111  14.682  11.008  1.00 0.00 ? 115 GLN A HA   6  
ATOM 10339 H HB2  . GLN A 1 37  ? -1.441  16.526  9.415   1.00 0.00 ? 115 GLN A HB2  6  
ATOM 10340 H HB3  . GLN A 1 37  ? -3.003  16.319  8.633   1.00 0.00 ? 115 GLN A HB3  6  
ATOM 10341 H HG2  . GLN A 1 37  ? -3.986  16.700  10.978  1.00 0.00 ? 115 GLN A HG2  6  
ATOM 10342 H HG3  . GLN A 1 37  ? -2.392  17.340  11.376  1.00 0.00 ? 115 GLN A HG3  6  
ATOM 10343 H HE21 . GLN A 1 37  ? -3.082  19.424  11.684  1.00 0.00 ? 115 GLN A HE21 6  
ATOM 10344 H HE22 . GLN A 1 37  ? -3.633  20.436  10.396  1.00 0.00 ? 115 GLN A HE22 6  
ATOM 10345 N N    . GLU A 1 38  ? -4.428  13.978  8.768   1.00 0.00 ? 116 GLU A N    6  
ATOM 10346 C CA   . GLU A 1 38  ? -5.785  13.471  8.605   1.00 0.00 ? 116 GLU A CA   6  
ATOM 10347 C C    . GLU A 1 38  ? -5.909  12.057  9.165   1.00 0.00 ? 116 GLU A C    6  
ATOM 10348 O O    . GLU A 1 38  ? -6.893  11.722  9.826   1.00 0.00 ? 116 GLU A O    6  
ATOM 10349 C CB   . GLU A 1 38  ? -6.183  13.481  7.127   1.00 0.00 ? 116 GLU A CB   6  
ATOM 10350 C CG   . GLU A 1 38  ? -7.674  13.669  6.900   1.00 0.00 ? 116 GLU A CG   6  
ATOM 10351 C CD   . GLU A 1 38  ? -7.990  14.215  5.521   1.00 0.00 ? 116 GLU A CD   6  
ATOM 10352 O OE1  . GLU A 1 38  ? -7.454  13.673  4.532   1.00 0.00 ? 116 GLU A OE1  6  
ATOM 10353 O OE2  . GLU A 1 38  ? -8.772  15.184  5.431   1.00 0.00 ? 116 GLU A OE2  6  
ATOM 10354 H H    . GLU A 1 38  ? -3.879  14.141  7.973   1.00 0.00 ? 116 GLU A H    6  
ATOM 10355 H HA   . GLU A 1 38  ? -6.451  14.121  9.152   1.00 0.00 ? 116 GLU A HA   6  
ATOM 10356 H HB2  . GLU A 1 38  ? -5.660  14.286  6.632   1.00 0.00 ? 116 GLU A HB2  6  
ATOM 10357 H HB3  . GLU A 1 38  ? -5.888  12.543  6.681   1.00 0.00 ? 116 GLU A HB3  6  
ATOM 10358 H HG2  . GLU A 1 38  ? -8.165  12.714  7.013   1.00 0.00 ? 116 GLU A HG2  6  
ATOM 10359 H HG3  . GLU A 1 38  ? -8.054  14.357  7.640   1.00 0.00 ? 116 GLU A HG3  6  
ATOM 10360 N N    . LEU A 1 39  ? -4.903  11.231  8.898   1.00 0.00 ? 117 LEU A N    6  
ATOM 10361 C CA   . LEU A 1 39  ? -4.898  9.852   9.375   1.00 0.00 ? 117 LEU A CA   6  
ATOM 10362 C C    . LEU A 1 39  ? -4.902  9.803   10.899  1.00 0.00 ? 117 LEU A C    6  
ATOM 10363 O O    . LEU A 1 39  ? -5.594  8.982   11.502  1.00 0.00 ? 117 LEU A O    6  
ATOM 10364 C CB   . LEU A 1 39  ? -3.675  9.109   8.833   1.00 0.00 ? 117 LEU A CB   6  
ATOM 10365 C CG   . LEU A 1 39  ? -3.764  7.583   8.830   1.00 0.00 ? 117 LEU A CG   6  
ATOM 10366 C CD1  . LEU A 1 39  ? -4.970  7.120   8.026   1.00 0.00 ? 117 LEU A CD1  6  
ATOM 10367 C CD2  . LEU A 1 39  ? -2.485  6.975   8.273   1.00 0.00 ? 117 LEU A CD2  6  
ATOM 10368 H H    . LEU A 1 39  ? -4.146  11.555  8.367   1.00 0.00 ? 117 LEU A H    6  
ATOM 10369 H HA   . LEU A 1 39  ? -5.792  9.371   9.008   1.00 0.00 ? 117 LEU A HA   6  
ATOM 10370 H HB2  . LEU A 1 39  ? -3.515  9.433   7.816   1.00 0.00 ? 117 LEU A HB2  6  
ATOM 10371 H HB3  . LEU A 1 39  ? -2.824  9.391   9.436   1.00 0.00 ? 117 LEU A HB3  6  
ATOM 10372 H HG   . LEU A 1 39  ? -3.888  7.234   9.845   1.00 0.00 ? 117 LEU A HG   6  
ATOM 10373 H HD11 . LEU A 1 39  ? -4.934  7.558   7.040   1.00 0.00 ? 117 LEU A HD11 6  
ATOM 10374 H HD12 . LEU A 1 39  ? -5.876  7.431   8.525   1.00 0.00 ? 117 LEU A HD12 6  
ATOM 10375 H HD13 . LEU A 1 39  ? -4.955  6.043   7.943   1.00 0.00 ? 117 LEU A HD13 6  
ATOM 10376 H HD21 . LEU A 1 39  ? -1.634  7.530   8.641   1.00 0.00 ? 117 LEU A HD21 6  
ATOM 10377 H HD22 . LEU A 1 39  ? -2.505  7.020   7.194   1.00 0.00 ? 117 LEU A HD22 6  
ATOM 10378 H HD23 . LEU A 1 39  ? -2.408  5.946   8.590   1.00 0.00 ? 117 LEU A HD23 6  
ATOM 10379 N N    . TYR A 1 40  ? -4.129  10.689  11.516  1.00 0.00 ? 118 TYR A N    6  
ATOM 10380 C CA   . TYR A 1 40  ? -4.043  10.747  12.971  1.00 0.00 ? 118 TYR A CA   6  
ATOM 10381 C C    . TYR A 1 40  ? -5.402  11.070  13.584  1.00 0.00 ? 118 TYR A C    6  
ATOM 10382 O O    . TYR A 1 40  ? -5.876  10.367  14.477  1.00 0.00 ? 118 TYR A O    6  
ATOM 10383 C CB   . TYR A 1 40  ? -3.015  11.795  13.401  1.00 0.00 ? 118 TYR A CB   6  
ATOM 10384 C CG   . TYR A 1 40  ? -2.715  11.776  14.883  1.00 0.00 ? 118 TYR A CG   6  
ATOM 10385 C CD1  . TYR A 1 40  ? -1.874  10.814  15.429  1.00 0.00 ? 118 TYR A CD1  6  
ATOM 10386 C CD2  . TYR A 1 40  ? -3.273  12.719  15.737  1.00 0.00 ? 118 TYR A CD2  6  
ATOM 10387 C CE1  . TYR A 1 40  ? -1.597  10.792  16.782  1.00 0.00 ? 118 TYR A CE1  6  
ATOM 10388 C CE2  . TYR A 1 40  ? -3.000  12.706  17.091  1.00 0.00 ? 118 TYR A CE2  6  
ATOM 10389 C CZ   . TYR A 1 40  ? -2.162  11.740  17.609  1.00 0.00 ? 118 TYR A CZ   6  
ATOM 10390 O OH   . TYR A 1 40  ? -1.889  11.723  18.958  1.00 0.00 ? 118 TYR A OH   6  
ATOM 10391 H H    . TYR A 1 40  ? -3.601  11.318  10.982  1.00 0.00 ? 118 TYR A H    6  
ATOM 10392 H HA   . TYR A 1 40  ? -3.723  9.777   13.323  1.00 0.00 ? 118 TYR A HA   6  
ATOM 10393 H HB2  . TYR A 1 40  ? -2.090  11.620  12.874  1.00 0.00 ? 118 TYR A HB2  6  
ATOM 10394 H HB3  . TYR A 1 40  ? -3.387  12.778  13.150  1.00 0.00 ? 118 TYR A HB3  6  
ATOM 10395 H HD1  . TYR A 1 40  ? -1.433  10.072  14.778  1.00 0.00 ? 118 TYR A HD1  6  
ATOM 10396 H HD2  . TYR A 1 40  ? -3.929  13.474  15.328  1.00 0.00 ? 118 TYR A HD2  6  
ATOM 10397 H HE1  . TYR A 1 40  ? -0.941  10.036  17.188  1.00 0.00 ? 118 TYR A HE1  6  
ATOM 10398 H HE2  . TYR A 1 40  ? -3.443  13.448  17.739  1.00 0.00 ? 118 TYR A HE2  6  
ATOM 10399 H HH   . TYR A 1 40  ? -2.081  12.585  19.334  1.00 0.00 ? 118 TYR A HH   6  
ATOM 10400 N N    . ASP A 1 41  ? -6.025  12.137  13.097  1.00 0.00 ? 119 ASP A N    6  
ATOM 10401 C CA   . ASP A 1 41  ? -7.331  12.554  13.594  1.00 0.00 ? 119 ASP A CA   6  
ATOM 10402 C C    . ASP A 1 41  ? -8.270  11.359  13.723  1.00 0.00 ? 119 ASP A C    6  
ATOM 10403 O O    . ASP A 1 41  ? -9.122  11.317  14.611  1.00 0.00 ? 119 ASP A O    6  
ATOM 10404 C CB   . ASP A 1 41  ? -7.944  13.602  12.665  1.00 0.00 ? 119 ASP A CB   6  
ATOM 10405 C CG   . ASP A 1 41  ? -9.409  13.855  12.962  1.00 0.00 ? 119 ASP A CG   6  
ATOM 10406 O OD1  . ASP A 1 41  ? -9.762  13.955  14.156  1.00 0.00 ? 119 ASP A OD1  6  
ATOM 10407 O OD2  . ASP A 1 41  ? -10.202 13.950  12.002  1.00 0.00 ? 119 ASP A OD2  6  
ATOM 10408 H H    . ASP A 1 41  ? -5.596  12.657  12.385  1.00 0.00 ? 119 ASP A H    6  
ATOM 10409 H HA   . ASP A 1 41  ? -7.190  12.991  14.571  1.00 0.00 ? 119 ASP A HA   6  
ATOM 10410 H HB2  . ASP A 1 41  ? -7.407  14.533  12.779  1.00 0.00 ? 119 ASP A HB2  6  
ATOM 10411 H HB3  . ASP A 1 41  ? -7.856  13.263  11.643  1.00 0.00 ? 119 ASP A HB3  6  
ATOM 10412 N N    . LEU A 1 42  ? -8.110  10.388  12.830  1.00 0.00 ? 120 LEU A N    6  
ATOM 10413 C CA   . LEU A 1 42  ? -8.944  9.192   12.842  1.00 0.00 ? 120 LEU A CA   6  
ATOM 10414 C C    . LEU A 1 42  ? -8.509  8.236   13.949  1.00 0.00 ? 120 LEU A C    6  
ATOM 10415 O O    . LEU A 1 42  ? -9.326  7.505   14.507  1.00 0.00 ? 120 LEU A O    6  
ATOM 10416 C CB   . LEU A 1 42  ? -8.877  8.485   11.487  1.00 0.00 ? 120 LEU A CB   6  
ATOM 10417 C CG   . LEU A 1 42  ? -9.064  9.373   10.257  1.00 0.00 ? 120 LEU A CG   6  
ATOM 10418 C CD1  . LEU A 1 42  ? -8.501  8.695   9.018   1.00 0.00 ? 120 LEU A CD1  6  
ATOM 10419 C CD2  . LEU A 1 42  ? -10.535 9.709   10.061  1.00 0.00 ? 120 LEU A CD2  6  
ATOM 10420 H H    . LEU A 1 42  ? -7.414  10.477  12.146  1.00 0.00 ? 120 LEU A H    6  
ATOM 10421 H HA   . LEU A 1 42  ? -9.962  9.500   13.028  1.00 0.00 ? 120 LEU A HA   6  
ATOM 10422 H HB2  . LEU A 1 42  ? -7.910  8.012   11.409  1.00 0.00 ? 120 LEU A HB2  6  
ATOM 10423 H HB3  . LEU A 1 42  ? -9.648  7.728   11.471  1.00 0.00 ? 120 LEU A HB3  6  
ATOM 10424 H HG   . LEU A 1 42  ? -8.525  10.299  10.404  1.00 0.00 ? 120 LEU A HG   6  
ATOM 10425 H HD11 . LEU A 1 42  ? -9.200  7.953   8.664   1.00 0.00 ? 120 LEU A HD11 6  
ATOM 10426 H HD12 . LEU A 1 42  ? -7.564  8.218   9.263   1.00 0.00 ? 120 LEU A HD12 6  
ATOM 10427 H HD13 . LEU A 1 42  ? -8.337  9.433   8.247   1.00 0.00 ? 120 LEU A HD13 6  
ATOM 10428 H HD21 . LEU A 1 42  ? -11.073 9.516   10.977  1.00 0.00 ? 120 LEU A HD21 6  
ATOM 10429 H HD22 . LEU A 1 42  ? -10.942 9.097   9.269   1.00 0.00 ? 120 LEU A HD22 6  
ATOM 10430 H HD23 . LEU A 1 42  ? -10.635 10.752  9.798   1.00 0.00 ? 120 LEU A HD23 6  
ATOM 10431 N N    . ASN A 1 43  ? -7.218  8.250   14.262  1.00 0.00 ? 121 ASN A N    6  
ATOM 10432 C CA   . ASN A 1 43  ? -6.675  7.386   15.304  1.00 0.00 ? 121 ASN A CA   6  
ATOM 10433 C C    . ASN A 1 43  ? -6.722  5.922   14.876  1.00 0.00 ? 121 ASN A C    6  
ATOM 10434 O O    . ASN A 1 43  ? -7.109  5.049   15.653  1.00 0.00 ? 121 ASN A O    6  
ATOM 10435 C CB   . ASN A 1 43  ? -7.453  7.573   16.608  1.00 0.00 ? 121 ASN A CB   6  
ATOM 10436 C CG   . ASN A 1 43  ? -6.789  6.880   17.782  1.00 0.00 ? 121 ASN A CG   6  
ATOM 10437 O OD1  . ASN A 1 43  ? -5.562  6.851   17.887  1.00 0.00 ? 121 ASN A OD1  6  
ATOM 10438 N ND2  . ASN A 1 43  ? -7.598  6.318   18.672  1.00 0.00 ? 121 ASN A ND2  6  
ATOM 10439 H H    . ASN A 1 43  ? -6.615  8.855   13.782  1.00 0.00 ? 121 ASN A H    6  
ATOM 10440 H HA   . ASN A 1 43  ? -5.645  7.668   15.466  1.00 0.00 ? 121 ASN A HA   6  
ATOM 10441 H HB2  . ASN A 1 43  ? -7.522  8.628   16.830  1.00 0.00 ? 121 ASN A HB2  6  
ATOM 10442 H HB3  . ASN A 1 43  ? -8.447  7.168   16.489  1.00 0.00 ? 121 ASN A HB3  6  
ATOM 10443 H HD21 . ASN A 1 43  ? -8.565  6.381   18.524  1.00 0.00 ? 121 ASN A HD21 6  
ATOM 10444 H HD22 . ASN A 1 43  ? -7.195  5.864   19.442  1.00 0.00 ? 121 ASN A HD22 6  
ATOM 10445 N N    . VAL A 1 44  ? -6.326  5.661   13.635  1.00 0.00 ? 122 VAL A N    6  
ATOM 10446 C CA   . VAL A 1 44  ? -6.322  4.303   13.103  1.00 0.00 ? 122 VAL A CA   6  
ATOM 10447 C C    . VAL A 1 44  ? -5.113  3.521   13.604  1.00 0.00 ? 122 VAL A C    6  
ATOM 10448 O O    . VAL A 1 44  ? -4.042  4.088   13.823  1.00 0.00 ? 122 VAL A O    6  
ATOM 10449 C CB   . VAL A 1 44  ? -6.317  4.304   11.563  1.00 0.00 ? 122 VAL A CB   6  
ATOM 10450 C CG1  . VAL A 1 44  ? -5.108  5.059   11.032  1.00 0.00 ? 122 VAL A CG1  6  
ATOM 10451 C CG2  . VAL A 1 44  ? -6.342  2.879   11.030  1.00 0.00 ? 122 VAL A CG2  6  
ATOM 10452 H H    . VAL A 1 44  ? -6.029  6.399   13.063  1.00 0.00 ? 122 VAL A H    6  
ATOM 10453 H HA   . VAL A 1 44  ? -7.222  3.810   13.439  1.00 0.00 ? 122 VAL A HA   6  
ATOM 10454 H HB   . VAL A 1 44  ? -7.208  4.809   11.220  1.00 0.00 ? 122 VAL A HB   6  
ATOM 10455 H HG11 . VAL A 1 44  ? -5.440  5.880   10.414  1.00 0.00 ? 122 VAL A HG11 6  
ATOM 10456 H HG12 . VAL A 1 44  ? -4.530  5.441   11.861  1.00 0.00 ? 122 VAL A HG12 6  
ATOM 10457 H HG13 . VAL A 1 44  ? -4.496  4.391   10.444  1.00 0.00 ? 122 VAL A HG13 6  
ATOM 10458 H HG21 . VAL A 1 44  ? -7.308  2.439   11.227  1.00 0.00 ? 122 VAL A HG21 6  
ATOM 10459 H HG22 . VAL A 1 44  ? -6.161  2.889   9.965   1.00 0.00 ? 122 VAL A HG22 6  
ATOM 10460 H HG23 . VAL A 1 44  ? -5.574  2.298   11.520  1.00 0.00 ? 122 VAL A HG23 6  
ATOM 10461 N N    . GLU A 1 45  ? -5.292  2.216   13.783  1.00 0.00 ? 123 GLU A N    6  
ATOM 10462 C CA   . GLU A 1 45  ? -4.214  1.356   14.258  1.00 0.00 ? 123 GLU A CA   6  
ATOM 10463 C C    . GLU A 1 45  ? -4.145  0.069   13.441  1.00 0.00 ? 123 GLU A C    6  
ATOM 10464 O O    . GLU A 1 45  ? -5.124  -0.671  13.343  1.00 0.00 ? 123 GLU A O    6  
ATOM 10465 C CB   . GLU A 1 45  ? -4.413  1.023   15.739  1.00 0.00 ? 123 GLU A CB   6  
ATOM 10466 C CG   . GLU A 1 45  ? -4.262  2.224   16.658  1.00 0.00 ? 123 GLU A CG   6  
ATOM 10467 C CD   . GLU A 1 45  ? -4.726  1.937   18.073  1.00 0.00 ? 123 GLU A CD   6  
ATOM 10468 O OE1  . GLU A 1 45  ? -3.990  1.247   18.809  1.00 0.00 ? 123 GLU A OE1  6  
ATOM 10469 O OE2  . GLU A 1 45  ? -5.824  2.401   18.444  1.00 0.00 ? 123 GLU A OE2  6  
ATOM 10470 H H    . GLU A 1 45  ? -6.168  1.823   13.591  1.00 0.00 ? 123 GLU A H    6  
ATOM 10471 H HA   . GLU A 1 45  ? -3.285  1.893   14.142  1.00 0.00 ? 123 GLU A HA   6  
ATOM 10472 H HB2  . GLU A 1 45  ? -5.404  0.614   15.874  1.00 0.00 ? 123 GLU A HB2  6  
ATOM 10473 H HB3  . GLU A 1 45  ? -3.685  0.281   16.029  1.00 0.00 ? 123 GLU A HB3  6  
ATOM 10474 H HG2  . GLU A 1 45  ? -3.221  2.510   16.688  1.00 0.00 ? 123 GLU A HG2  6  
ATOM 10475 H HG3  . GLU A 1 45  ? -4.847  3.040   16.262  1.00 0.00 ? 123 GLU A HG3  6  
ATOM 10476 N N    . LEU A 1 46  ? -2.980  -0.191  12.857  1.00 0.00 ? 124 LEU A N    6  
ATOM 10477 C CA   . LEU A 1 46  ? -2.781  -1.388  12.047  1.00 0.00 ? 124 LEU A CA   6  
ATOM 10478 C C    . LEU A 1 46  ? -3.237  -2.635  12.798  1.00 0.00 ? 124 LEU A C    6  
ATOM 10479 O O    . LEU A 1 46  ? -3.239  -2.665  14.029  1.00 0.00 ? 124 LEU A O    6  
ATOM 10480 C CB   . LEU A 1 46  ? -1.309  -1.524  11.655  1.00 0.00 ? 124 LEU A CB   6  
ATOM 10481 C CG   . LEU A 1 46  ? -0.845  -0.664  10.479  1.00 0.00 ? 124 LEU A CG   6  
ATOM 10482 C CD1  . LEU A 1 46  ? 0.672   -0.560  10.459  1.00 0.00 ? 124 LEU A CD1  6  
ATOM 10483 C CD2  . LEU A 1 46  ? -1.360  -1.235  9.166   1.00 0.00 ? 124 LEU A CD2  6  
ATOM 10484 H H    . LEU A 1 46  ? -2.237  0.436   12.971  1.00 0.00 ? 124 LEU A H    6  
ATOM 10485 H HA   . LEU A 1 46  ? -3.376  -1.285  11.152  1.00 0.00 ? 124 LEU A HA   6  
ATOM 10486 H HB2  . LEU A 1 46  ? -0.712  -1.257  12.514  1.00 0.00 ? 124 LEU A HB2  6  
ATOM 10487 H HB3  . LEU A 1 46  ? -1.129  -2.559  11.401  1.00 0.00 ? 124 LEU A HB3  6  
ATOM 10488 H HG   . LEU A 1 46  ? -1.246  0.334   10.591  1.00 0.00 ? 124 LEU A HG   6  
ATOM 10489 H HD11 . LEU A 1 46  ? 1.011   -0.438  9.441   1.00 0.00 ? 124 LEU A HD11 6  
ATOM 10490 H HD12 . LEU A 1 46  ? 1.100   -1.459  10.876  1.00 0.00 ? 124 LEU A HD12 6  
ATOM 10491 H HD13 . LEU A 1 46  ? 0.982   0.292   11.047  1.00 0.00 ? 124 LEU A HD13 6  
ATOM 10492 H HD21 . LEU A 1 46  ? -2.411  -1.466  9.261   1.00 0.00 ? 124 LEU A HD21 6  
ATOM 10493 H HD22 . LEU A 1 46  ? -0.814  -2.136  8.927   1.00 0.00 ? 124 LEU A HD22 6  
ATOM 10494 H HD23 . LEU A 1 46  ? -1.221  -0.509  8.379   1.00 0.00 ? 124 LEU A HD23 6  
ATOM 10495 N N    . SER A 1 47  ? -3.620  -3.664  12.049  1.00 0.00 ? 125 SER A N    6  
ATOM 10496 C CA   . SER A 1 47  ? -4.078  -4.914  12.644  1.00 0.00 ? 125 SER A CA   6  
ATOM 10497 C C    . SER A 1 47  ? -3.199  -6.080  12.203  1.00 0.00 ? 125 SER A C    6  
ATOM 10498 O O    . SER A 1 47  ? -2.865  -6.957  13.000  1.00 0.00 ? 125 SER A O    6  
ATOM 10499 C CB   . SER A 1 47  ? -5.534  -5.183  12.257  1.00 0.00 ? 125 SER A CB   6  
ATOM 10500 O OG   . SER A 1 47  ? -6.043  -6.314  12.944  1.00 0.00 ? 125 SER A OG   6  
ATOM 10501 H H    . SER A 1 47  ? -3.596  -3.579  11.073  1.00 0.00 ? 125 SER A H    6  
ATOM 10502 H HA   . SER A 1 47  ? -4.012  -4.814  13.717  1.00 0.00 ? 125 SER A HA   6  
ATOM 10503 H HB2  . SER A 1 47  ? -6.136  -4.323  12.509  1.00 0.00 ? 125 SER A HB2  6  
ATOM 10504 H HB3  . SER A 1 47  ? -5.594  -5.365  11.194  1.00 0.00 ? 125 SER A HB3  6  
ATOM 10505 H HG   . SER A 1 47  ? -6.859  -6.601  12.527  1.00 0.00 ? 125 SER A HG   6  
ATOM 10506 N N    . LYS A 1 48  ? -2.828  -6.084  10.927  1.00 0.00 ? 126 LYS A N    6  
ATOM 10507 C CA   . LYS A 1 48  ? -1.987  -7.140  10.377  1.00 0.00 ? 126 LYS A CA   6  
ATOM 10508 C C    . LYS A 1 48  ? -1.518  -6.785  8.970   1.00 0.00 ? 126 LYS A C    6  
ATOM 10509 O O    . LYS A 1 48  ? -2.231  -6.123  8.216   1.00 0.00 ? 126 LYS A O    6  
ATOM 10510 C CB   . LYS A 1 48  ? -2.749  -8.467  10.353  1.00 0.00 ? 126 LYS A CB   6  
ATOM 10511 C CG   . LYS A 1 48  ? -1.968  -9.605  9.720   1.00 0.00 ? 126 LYS A CG   6  
ATOM 10512 C CD   . LYS A 1 48  ? -2.894  -10.640 9.102   1.00 0.00 ? 126 LYS A CD   6  
ATOM 10513 C CE   . LYS A 1 48  ? -3.744  -11.329 10.159  1.00 0.00 ? 126 LYS A CE   6  
ATOM 10514 N NZ   . LYS A 1 48  ? -4.341  -12.596 9.652   1.00 0.00 ? 126 LYS A NZ   6  
ATOM 10515 H H    . LYS A 1 48  ? -3.127  -5.357  10.341  1.00 0.00 ? 126 LYS A H    6  
ATOM 10516 H HA   . LYS A 1 48  ? -1.123  -7.243  11.017  1.00 0.00 ? 126 LYS A HA   6  
ATOM 10517 H HB2  . LYS A 1 48  ? -2.994  -8.746  11.367  1.00 0.00 ? 126 LYS A HB2  6  
ATOM 10518 H HB3  . LYS A 1 48  ? -3.664  -8.332  9.795   1.00 0.00 ? 126 LYS A HB3  6  
ATOM 10519 H HG2  . LYS A 1 48  ? -1.327  -9.205  8.948   1.00 0.00 ? 126 LYS A HG2  6  
ATOM 10520 H HG3  . LYS A 1 48  ? -1.366  -10.082 10.480  1.00 0.00 ? 126 LYS A HG3  6  
ATOM 10521 H HD2  . LYS A 1 48  ? -3.546  -10.151 8.395   1.00 0.00 ? 126 LYS A HD2  6  
ATOM 10522 H HD3  . LYS A 1 48  ? -2.298  -11.384 8.591   1.00 0.00 ? 126 LYS A HD3  6  
ATOM 10523 H HE2  . LYS A 1 48  ? -3.123  -11.550 11.014  1.00 0.00 ? 126 LYS A HE2  6  
ATOM 10524 H HE3  . LYS A 1 48  ? -4.538  -10.660 10.455  1.00 0.00 ? 126 LYS A HE3  6  
ATOM 10525 H HZ1  . LYS A 1 48  ? -4.112  -13.380 10.295  1.00 0.00 ? 126 LYS A HZ1  6  
ATOM 10526 H HZ2  . LYS A 1 48  ? -3.963  -12.815 8.708   1.00 0.00 ? 126 LYS A HZ2  6  
ATOM 10527 H HZ3  . LYS A 1 48  ? -5.374  -12.503 9.588   1.00 0.00 ? 126 LYS A HZ3  6  
ATOM 10528 N N    . VAL A 1 49  ? -0.315  -7.231  8.622   1.00 0.00 ? 127 VAL A N    6  
ATOM 10529 C CA   . VAL A 1 49  ? 0.248   -6.963  7.304   1.00 0.00 ? 127 VAL A CA   6  
ATOM 10530 C C    . VAL A 1 49  ? 0.572   -8.259  6.570   1.00 0.00 ? 127 VAL A C    6  
ATOM 10531 O O    . VAL A 1 49  ? 1.278   -9.121  7.093   1.00 0.00 ? 127 VAL A O    6  
ATOM 10532 C CB   . VAL A 1 49  ? 1.526   -6.109  7.403   1.00 0.00 ? 127 VAL A CB   6  
ATOM 10533 C CG1  . VAL A 1 49  ? 2.151   -5.922  6.029   1.00 0.00 ? 127 VAL A CG1  6  
ATOM 10534 C CG2  . VAL A 1 49  ? 1.221   -4.765  8.047   1.00 0.00 ? 127 VAL A CG2  6  
ATOM 10535 H H    . VAL A 1 49  ? 0.206   -7.754  9.267   1.00 0.00 ? 127 VAL A H    6  
ATOM 10536 H HA   . VAL A 1 49  ? -0.485  -6.411  6.734   1.00 0.00 ? 127 VAL A HA   6  
ATOM 10537 H HB   . VAL A 1 49  ? 2.236   -6.631  8.028   1.00 0.00 ? 127 VAL A HB   6  
ATOM 10538 H HG11 . VAL A 1 49  ? 1.698   -6.610  5.331   1.00 0.00 ? 127 VAL A HG11 6  
ATOM 10539 H HG12 . VAL A 1 49  ? 1.988   -4.908  5.694   1.00 0.00 ? 127 VAL A HG12 6  
ATOM 10540 H HG13 . VAL A 1 49  ? 3.212   -6.115  6.087   1.00 0.00 ? 127 VAL A HG13 6  
ATOM 10541 H HG21 . VAL A 1 49  ? 1.706   -4.709  9.009   1.00 0.00 ? 127 VAL A HG21 6  
ATOM 10542 H HG22 . VAL A 1 49  ? 1.586   -3.970  7.413   1.00 0.00 ? 127 VAL A HG22 6  
ATOM 10543 H HG23 . VAL A 1 49  ? 0.154   -4.661  8.175   1.00 0.00 ? 127 VAL A HG23 6  
ATOM 10544 N N    . SER A 1 50  ? 0.051   -8.390  5.354   1.00 0.00 ? 128 SER A N    6  
ATOM 10545 C CA   . SER A 1 50  ? 0.281   -9.584  4.549   1.00 0.00 ? 128 SER A CA   6  
ATOM 10546 C C    . SER A 1 50  ? 1.206   -9.276  3.375   1.00 0.00 ? 128 SER A C    6  
ATOM 10547 O O    . SER A 1 50  ? 0.887   -8.450  2.518   1.00 0.00 ? 128 SER A O    6  
ATOM 10548 C CB   . SER A 1 50  ? -1.047  -10.142 4.034   1.00 0.00 ? 128 SER A CB   6  
ATOM 10549 O OG   . SER A 1 50  ? -0.857  -11.377 3.366   1.00 0.00 ? 128 SER A OG   6  
ATOM 10550 H H    . SER A 1 50  ? -0.504  -7.668  4.992   1.00 0.00 ? 128 SER A H    6  
ATOM 10551 H HA   . SER A 1 50  ? 0.752   -10.323 5.179   1.00 0.00 ? 128 SER A HA   6  
ATOM 10552 H HB2  . SER A 1 50  ? -1.717  -10.296 4.866   1.00 0.00 ? 128 SER A HB2  6  
ATOM 10553 H HB3  . SER A 1 50  ? -1.487  -9.436  3.343   1.00 0.00 ? 128 SER A HB3  6  
ATOM 10554 H HG   . SER A 1 50  ? -0.054  -11.794 3.687   1.00 0.00 ? 128 SER A HG   6  
ATOM 10555 N N    . LEU A 1 51  ? 2.352   -9.947  3.342   1.00 0.00 ? 129 LEU A N    6  
ATOM 10556 C CA   . LEU A 1 51  ? 3.325   -9.747  2.274   1.00 0.00 ? 129 LEU A CA   6  
ATOM 10557 C C    . LEU A 1 51  ? 3.386   -10.965 1.358   1.00 0.00 ? 129 LEU A C    6  
ATOM 10558 O O    . LEU A 1 51  ? 3.340   -12.106 1.819   1.00 0.00 ? 129 LEU A O    6  
ATOM 10559 C CB   . LEU A 1 51  ? 4.709   -9.468  2.863   1.00 0.00 ? 129 LEU A CB   6  
ATOM 10560 C CG   . LEU A 1 51  ? 5.833   -9.231  1.854   1.00 0.00 ? 129 LEU A CG   6  
ATOM 10561 C CD1  . LEU A 1 51  ? 5.784   -7.805  1.325   1.00 0.00 ? 129 LEU A CD1  6  
ATOM 10562 C CD2  . LEU A 1 51  ? 7.187   -9.521  2.485   1.00 0.00 ? 129 LEU A CD2  6  
ATOM 10563 H H    . LEU A 1 51  ? 2.550   -10.592 4.052   1.00 0.00 ? 129 LEU A H    6  
ATOM 10564 H HA   . LEU A 1 51  ? 3.010   -8.891  1.695   1.00 0.00 ? 129 LEU A HA   6  
ATOM 10565 H HB2  . LEU A 1 51  ? 4.632   -8.589  3.485   1.00 0.00 ? 129 LEU A HB2  6  
ATOM 10566 H HB3  . LEU A 1 51  ? 4.984   -10.316 3.473   1.00 0.00 ? 129 LEU A HB3  6  
ATOM 10567 H HG   . LEU A 1 51  ? 5.703   -9.902  1.015   1.00 0.00 ? 129 LEU A HG   6  
ATOM 10568 H HD11 . LEU A 1 51  ? 6.788   -7.424  1.224   1.00 0.00 ? 129 LEU A HD11 6  
ATOM 10569 H HD12 . LEU A 1 51  ? 5.230   -7.185  2.014   1.00 0.00 ? 129 LEU A HD12 6  
ATOM 10570 H HD13 . LEU A 1 51  ? 5.296   -7.796  0.361   1.00 0.00 ? 129 LEU A HD13 6  
ATOM 10571 H HD21 . LEU A 1 51  ? 7.764   -10.150 1.824   1.00 0.00 ? 129 LEU A HD21 6  
ATOM 10572 H HD22 . LEU A 1 51  ? 7.043   -10.026 3.429   1.00 0.00 ? 129 LEU A HD22 6  
ATOM 10573 H HD23 . LEU A 1 51  ? 7.713   -8.592  2.650   1.00 0.00 ? 129 LEU A HD23 6  
ATOM 10574 N N    . THR A 1 52  ? 3.492   -10.715 0.056   1.00 0.00 ? 130 THR A N    6  
ATOM 10575 C CA   . THR A 1 52  ? 3.560   -11.791 -0.925  1.00 0.00 ? 130 THR A CA   6  
ATOM 10576 C C    . THR A 1 52  ? 4.887   -12.537 -0.832  1.00 0.00 ? 130 THR A C    6  
ATOM 10577 O O    . THR A 1 52  ? 5.901   -11.996 -0.391  1.00 0.00 ? 130 THR A O    6  
ATOM 10578 C CB   . THR A 1 52  ? 3.386   -11.255 -2.359  1.00 0.00 ? 130 THR A CB   6  
ATOM 10579 O OG1  . THR A 1 52  ? 4.233   -10.119 -2.564  1.00 0.00 ? 130 THR A OG1  6  
ATOM 10580 C CG2  . THR A 1 52  ? 1.938   -10.869 -2.619  1.00 0.00 ? 130 THR A CG2  6  
ATOM 10581 H H    . THR A 1 52  ? 3.524   -9.785  -0.250  1.00 0.00 ? 130 THR A H    6  
ATOM 10582 H HA   . THR A 1 52  ? 2.755   -12.481 -0.720  1.00 0.00 ? 130 THR A HA   6  
ATOM 10583 H HB   . THR A 1 52  ? 3.666   -12.034 -3.054  1.00 0.00 ? 130 THR A HB   6  
ATOM 10584 H HG1  . THR A 1 52  ? 4.546   -10.113 -3.472  1.00 0.00 ? 130 THR A HG1  6  
ATOM 10585 H HG21 . THR A 1 52  ? 1.425   -11.692 -3.093  1.00 0.00 ? 130 THR A HG21 6  
ATOM 10586 H HG22 . THR A 1 52  ? 1.907   -10.005 -3.267  1.00 0.00 ? 130 THR A HG22 6  
ATOM 10587 H HG23 . THR A 1 52  ? 1.454   -10.634 -1.683  1.00 0.00 ? 130 THR A HG23 6  
ATOM 10588 N N    . PRO A 1 53  ? 4.882   -13.809 -1.256  1.00 0.00 ? 131 PRO A N    6  
ATOM 10589 C CA   . PRO A 1 53  ? 6.078   -14.656 -1.231  1.00 0.00 ? 131 PRO A CA   6  
ATOM 10590 C C    . PRO A 1 53  ? 7.122   -14.216 -2.253  1.00 0.00 ? 131 PRO A C    6  
ATOM 10591 O O    . PRO A 1 53  ? 8.312   -14.491 -2.096  1.00 0.00 ? 131 PRO A O    6  
ATOM 10592 C CB   . PRO A 1 53  ? 5.538   -16.044 -1.584  1.00 0.00 ? 131 PRO A CB   6  
ATOM 10593 C CG   . PRO A 1 53  ? 4.296   -15.780 -2.364  1.00 0.00 ? 131 PRO A CG   6  
ATOM 10594 C CD   . PRO A 1 53  ? 3.709   -14.518 -1.794  1.00 0.00 ? 131 PRO A CD   6  
ATOM 10595 H HA   . PRO A 1 53  ? 6.526   -14.681 -0.249  1.00 0.00 ? 131 PRO A HA   6  
ATOM 10596 H HB2  . PRO A 1 53  ? 6.269   -16.579 -2.172  1.00 0.00 ? 131 PRO A HB2  6  
ATOM 10597 H HB3  . PRO A 1 53  ? 5.325   -16.592 -0.678  1.00 0.00 ? 131 PRO A HB3  6  
ATOM 10598 H HG2  . PRO A 1 53  ? 4.540   -15.643 -3.406  1.00 0.00 ? 131 PRO A HG2  6  
ATOM 10599 H HG3  . PRO A 1 53  ? 3.606   -16.602 -2.244  1.00 0.00 ? 131 PRO A HG3  6  
ATOM 10600 H HD2  . PRO A 1 53  ? 3.231   -13.940 -2.571  1.00 0.00 ? 131 PRO A HD2  6  
ATOM 10601 H HD3  . PRO A 1 53  ? 3.006   -14.751 -1.008  1.00 0.00 ? 131 PRO A HD3  6  
ATOM 10602 N N    . ASP A 1 54  ? 6.668   -13.532 -3.297  1.00 0.00 ? 132 ASP A N    6  
ATOM 10603 C CA   . ASP A 1 54  ? 7.564   -13.052 -4.344  1.00 0.00 ? 132 ASP A CA   6  
ATOM 10604 C C    . ASP A 1 54  ? 8.152   -11.694 -3.975  1.00 0.00 ? 132 ASP A C    6  
ATOM 10605 O O    . ASP A 1 54  ? 8.864   -11.078 -4.769  1.00 0.00 ? 132 ASP A O    6  
ATOM 10606 C CB   . ASP A 1 54  ? 6.819   -12.954 -5.676  1.00 0.00 ? 132 ASP A CB   6  
ATOM 10607 C CG   . ASP A 1 54  ? 6.835   -14.260 -6.446  1.00 0.00 ? 132 ASP A CG   6  
ATOM 10608 O OD1  . ASP A 1 54  ? 7.818   -14.507 -7.176  1.00 0.00 ? 132 ASP A OD1  6  
ATOM 10609 O OD2  . ASP A 1 54  ? 5.865   -15.036 -6.318  1.00 0.00 ? 132 ASP A OD2  6  
ATOM 10610 H H    . ASP A 1 54  ? 5.709   -13.344 -3.366  1.00 0.00 ? 132 ASP A H    6  
ATOM 10611 H HA   . ASP A 1 54  ? 8.369   -13.764 -4.444  1.00 0.00 ? 132 ASP A HA   6  
ATOM 10612 H HB2  . ASP A 1 54  ? 5.790   -12.682 -5.487  1.00 0.00 ? 132 ASP A HB2  6  
ATOM 10613 H HB3  . ASP A 1 54  ? 7.282   -12.192 -6.285  1.00 0.00 ? 132 ASP A HB3  6  
ATOM 10614 N N    . PHE A 1 55  ? 7.850   -11.232 -2.766  1.00 0.00 ? 133 PHE A N    6  
ATOM 10615 C CA   . PHE A 1 55  ? 8.347   -9.946  -2.293  1.00 0.00 ? 133 PHE A CA   6  
ATOM 10616 C C    . PHE A 1 55  ? 7.987   -8.830  -3.270  1.00 0.00 ? 133 PHE A C    6  
ATOM 10617 O O    . PHE A 1 55  ? 8.659   -7.800  -3.328  1.00 0.00 ? 133 PHE A O    6  
ATOM 10618 C CB   . PHE A 1 55  ? 9.864   -10.001 -2.100  1.00 0.00 ? 133 PHE A CB   6  
ATOM 10619 C CG   . PHE A 1 55  ? 10.279  -10.546 -0.764  1.00 0.00 ? 133 PHE A CG   6  
ATOM 10620 C CD1  . PHE A 1 55  ? 9.737   -10.037 0.406   1.00 0.00 ? 133 PHE A CD1  6  
ATOM 10621 C CD2  . PHE A 1 55  ? 11.211  -11.568 -0.677  1.00 0.00 ? 133 PHE A CD2  6  
ATOM 10622 C CE1  . PHE A 1 55  ? 10.118  -10.536 1.637   1.00 0.00 ? 133 PHE A CE1  6  
ATOM 10623 C CE2  . PHE A 1 55  ? 11.595  -12.072 0.552   1.00 0.00 ? 133 PHE A CE2  6  
ATOM 10624 C CZ   . PHE A 1 55  ? 11.047  -11.556 1.710   1.00 0.00 ? 133 PHE A CZ   6  
ATOM 10625 H H    . PHE A 1 55  ? 7.277   -11.769 -2.179  1.00 0.00 ? 133 PHE A H    6  
ATOM 10626 H HA   . PHE A 1 55  ? 7.879   -9.740  -1.342  1.00 0.00 ? 133 PHE A HA   6  
ATOM 10627 H HB2  . PHE A 1 55  ? 10.294  -10.632 -2.863  1.00 0.00 ? 133 PHE A HB2  6  
ATOM 10628 H HB3  . PHE A 1 55  ? 10.268  -9.004  -2.194  1.00 0.00 ? 133 PHE A HB3  6  
ATOM 10629 H HD1  . PHE A 1 55  ? 9.010   -9.241  0.350   1.00 0.00 ? 133 PHE A HD1  6  
ATOM 10630 H HD2  . PHE A 1 55  ? 11.640  -11.973 -1.583  1.00 0.00 ? 133 PHE A HD2  6  
ATOM 10631 H HE1  . PHE A 1 55  ? 9.688   -10.132 2.541   1.00 0.00 ? 133 PHE A HE1  6  
ATOM 10632 H HE2  . PHE A 1 55  ? 12.322  -12.869 0.605   1.00 0.00 ? 133 PHE A HE2  6  
ATOM 10633 H HZ   . PHE A 1 55  ? 11.347  -11.947 2.670   1.00 0.00 ? 133 PHE A HZ   6  
ATOM 10634 N N    . SER A 1 56  ? 6.923   -9.044  -4.037  1.00 0.00 ? 134 SER A N    6  
ATOM 10635 C CA   . SER A 1 56  ? 6.476   -8.060  -5.016  1.00 0.00 ? 134 SER A CA   6  
ATOM 10636 C C    . SER A 1 56  ? 5.461   -7.103  -4.399  1.00 0.00 ? 134 SER A C    6  
ATOM 10637 O O    . SER A 1 56  ? 5.769   -5.942  -4.130  1.00 0.00 ? 134 SER A O    6  
ATOM 10638 C CB   . SER A 1 56  ? 5.862   -8.759  -6.230  1.00 0.00 ? 134 SER A CB   6  
ATOM 10639 O OG   . SER A 1 56  ? 6.067   -8.004  -7.411  1.00 0.00 ? 134 SER A OG   6  
ATOM 10640 H H    . SER A 1 56  ? 6.429   -9.886  -3.945  1.00 0.00 ? 134 SER A H    6  
ATOM 10641 H HA   . SER A 1 56  ? 7.339   -7.494  -5.335  1.00 0.00 ? 134 SER A HA   6  
ATOM 10642 H HB2  . SER A 1 56  ? 6.320   -9.729  -6.353  1.00 0.00 ? 134 SER A HB2  6  
ATOM 10643 H HB3  . SER A 1 56  ? 4.800   -8.880  -6.074  1.00 0.00 ? 134 SER A HB3  6  
ATOM 10644 H HG   . SER A 1 56  ? 5.282   -7.485  -7.600  1.00 0.00 ? 134 SER A HG   6  
ATOM 10645 N N    . ALA A 1 57  ? 4.248   -7.600  -4.176  1.00 0.00 ? 135 ALA A N    6  
ATOM 10646 C CA   . ALA A 1 57  ? 3.187   -6.791  -3.589  1.00 0.00 ? 135 ALA A CA   6  
ATOM 10647 C C    . ALA A 1 57  ? 3.173   -6.923  -2.070  1.00 0.00 ? 135 ALA A C    6  
ATOM 10648 O O    . ALA A 1 57  ? 3.517   -7.973  -1.526  1.00 0.00 ? 135 ALA A O    6  
ATOM 10649 C CB   . ALA A 1 57  ? 1.838   -7.189  -4.168  1.00 0.00 ? 135 ALA A CB   6  
ATOM 10650 H H    . ALA A 1 57  ? 4.063   -8.533  -4.411  1.00 0.00 ? 135 ALA A H    6  
ATOM 10651 H HA   . ALA A 1 57  ? 3.372   -5.758  -3.848  1.00 0.00 ? 135 ALA A HA   6  
ATOM 10652 H HB1  . ALA A 1 57  ? 1.130   -6.388  -4.012  1.00 0.00 ? 135 ALA A HB1  6  
ATOM 10653 H HB2  . ALA A 1 57  ? 1.942   -7.377  -5.226  1.00 0.00 ? 135 ALA A HB2  6  
ATOM 10654 H HB3  . ALA A 1 57  ? 1.485   -8.083  -3.676  1.00 0.00 ? 135 ALA A HB3  6  
ATOM 10655 N N    . CYS A 1 58  ? 2.773   -5.854  -1.391  1.00 0.00 ? 136 CYS A N    6  
ATOM 10656 C CA   . CYS A 1 58  ? 2.715   -5.851  0.066   1.00 0.00 ? 136 CYS A CA   6  
ATOM 10657 C C    . CYS A 1 58  ? 1.334   -5.426  0.555   1.00 0.00 ? 136 CYS A C    6  
ATOM 10658 O O    . CYS A 1 58  ? 0.999   -4.242  0.547   1.00 0.00 ? 136 CYS A O    6  
ATOM 10659 C CB   . CYS A 1 58  ? 3.781   -4.915  0.638   1.00 0.00 ? 136 CYS A CB   6  
ATOM 10660 S SG   . CYS A 1 58  ? 3.667   -4.671  2.426   1.00 0.00 ? 136 CYS A SG   6  
ATOM 10661 H H    . CYS A 1 58  ? 2.510   -5.047  -1.881  1.00 0.00 ? 136 CYS A H    6  
ATOM 10662 H HA   . CYS A 1 58  ? 2.910   -6.856  0.407   1.00 0.00 ? 136 CYS A HA   6  
ATOM 10663 H HB2  . CYS A 1 58  ? 4.758   -5.322  0.424   1.00 0.00 ? 136 CYS A HB2  6  
ATOM 10664 H HB3  . CYS A 1 58  ? 3.690   -3.948  0.166   1.00 0.00 ? 136 CYS A HB3  6  
ATOM 10665 H HG   . CYS A 1 58  ? 3.339   -3.407  2.646   1.00 0.00 ? 136 CYS A HG   6  
ATOM 10666 N N    . ARG A 1 59  ? 0.536   -6.402  0.977   1.00 0.00 ? 137 ARG A N    6  
ATOM 10667 C CA   . ARG A 1 59  ? -0.811  -6.129  1.466   1.00 0.00 ? 137 ARG A CA   6  
ATOM 10668 C C    . ARG A 1 59  ? -0.786  -5.751  2.944   1.00 0.00 ? 137 ARG A C    6  
ATOM 10669 O O    . ARG A 1 59  ? -0.032  -6.324  3.729   1.00 0.00 ? 137 ARG A O    6  
ATOM 10670 C CB   . ARG A 1 59  ? -1.709  -7.350  1.256   1.00 0.00 ? 137 ARG A CB   6  
ATOM 10671 C CG   . ARG A 1 59  ? -2.425  -7.356  -0.084  1.00 0.00 ? 137 ARG A CG   6  
ATOM 10672 C CD   . ARG A 1 59  ? -1.602  -8.060  -1.152  1.00 0.00 ? 137 ARG A CD   6  
ATOM 10673 N NE   . ARG A 1 59  ? -1.356  -9.460  -0.819  1.00 0.00 ? 137 ARG A NE   6  
ATOM 10674 C CZ   . ARG A 1 59  ? -0.978  -10.372 -1.708  1.00 0.00 ? 137 ARG A CZ   6  
ATOM 10675 N NH1  . ARG A 1 59  ? -0.803  -10.031 -2.978  1.00 0.00 ? 137 ARG A NH1  6  
ATOM 10676 N NH2  . ARG A 1 59  ? -0.774  -11.627 -1.328  1.00 0.00 ? 137 ARG A NH2  6  
ATOM 10677 H H    . ARG A 1 59  ? 0.859   -7.326  0.959   1.00 0.00 ? 137 ARG A H    6  
ATOM 10678 H HA   . ARG A 1 59  ? -1.208  -5.300  0.901   1.00 0.00 ? 137 ARG A HA   6  
ATOM 10679 H HB2  . ARG A 1 59  ? -1.104  -8.243  1.320   1.00 0.00 ? 137 ARG A HB2  6  
ATOM 10680 H HB3  . ARG A 1 59  ? -2.454  -7.372  2.038   1.00 0.00 ? 137 ARG A HB3  6  
ATOM 10681 H HG2  . ARG A 1 59  ? -3.368  -7.870  0.024   1.00 0.00 ? 137 ARG A HG2  6  
ATOM 10682 H HG3  . ARG A 1 59  ? -2.601  -6.336  -0.392  1.00 0.00 ? 137 ARG A HG3  6  
ATOM 10683 H HD2  . ARG A 1 59  ? -2.136  -8.011  -2.090  1.00 0.00 ? 137 ARG A HD2  6  
ATOM 10684 H HD3  . ARG A 1 59  ? -0.655  -7.551  -1.251  1.00 0.00 ? 137 ARG A HD3  6  
ATOM 10685 H HE   . ARG A 1 59  ? -1.480  -9.733  0.113   1.00 0.00 ? 137 ARG A HE   6  
ATOM 10686 H HH11 . ARG A 1 59  ? -0.955  -9.086  -3.267  1.00 0.00 ? 137 ARG A HH11 6  
ATOM 10687 H HH12 . ARG A 1 59  ? -0.517  -10.720 -3.645  1.00 0.00 ? 137 ARG A HH12 6  
ATOM 10688 H HH21 . ARG A 1 59  ? -0.905  -11.887 -0.372  1.00 0.00 ? 137 ARG A HH21 6  
ATOM 10689 H HH22 . ARG A 1 59  ? -0.490  -12.312 -1.998  1.00 0.00 ? 137 ARG A HH22 6  
ATOM 10690 N N    . ALA A 1 60  ? -1.616  -4.781  3.315   1.00 0.00 ? 138 ALA A N    6  
ATOM 10691 C CA   . ALA A 1 60  ? -1.690  -4.327  4.698   1.00 0.00 ? 138 ALA A CA   6  
ATOM 10692 C C    . ALA A 1 60  ? -3.139  -4.201  5.157   1.00 0.00 ? 138 ALA A C    6  
ATOM 10693 O O    . ALA A 1 60  ? -3.921  -3.447  4.577   1.00 0.00 ? 138 ALA A O    6  
ATOM 10694 C CB   . ALA A 1 60  ? -0.966  -2.999  4.857   1.00 0.00 ? 138 ALA A CB   6  
ATOM 10695 H H    . ALA A 1 60  ? -2.193  -4.363  2.643   1.00 0.00 ? 138 ALA A H    6  
ATOM 10696 H HA   . ALA A 1 60  ? -1.190  -5.058  5.317   1.00 0.00 ? 138 ALA A HA   6  
ATOM 10697 H HB1  . ALA A 1 60  ? 0.007   -3.170  5.293   1.00 0.00 ? 138 ALA A HB1  6  
ATOM 10698 H HB2  . ALA A 1 60  ? -0.852  -2.533  3.890   1.00 0.00 ? 138 ALA A HB2  6  
ATOM 10699 H HB3  . ALA A 1 60  ? -1.541  -2.351  5.503   1.00 0.00 ? 138 ALA A HB3  6  
ATOM 10700 N N    . TYR A 1 61  ? -3.491  -4.943  6.201   1.00 0.00 ? 139 TYR A N    6  
ATOM 10701 C CA   . TYR A 1 61  ? -4.847  -4.916  6.736   1.00 0.00 ? 139 TYR A CA   6  
ATOM 10702 C C    . TYR A 1 61  ? -4.922  -4.046  7.987   1.00 0.00 ? 139 TYR A C    6  
ATOM 10703 O O    . TYR A 1 61  ? -4.152  -4.228  8.930   1.00 0.00 ? 139 TYR A O    6  
ATOM 10704 C CB   . TYR A 1 61  ? -5.318  -6.335  7.059   1.00 0.00 ? 139 TYR A CB   6  
ATOM 10705 C CG   . TYR A 1 61  ? -5.393  -7.239  5.849   1.00 0.00 ? 139 TYR A CG   6  
ATOM 10706 C CD1  . TYR A 1 61  ? -4.259  -7.882  5.367   1.00 0.00 ? 139 TYR A CD1  6  
ATOM 10707 C CD2  . TYR A 1 61  ? -6.596  -7.449  5.187   1.00 0.00 ? 139 TYR A CD2  6  
ATOM 10708 C CE1  . TYR A 1 61  ? -4.323  -8.707  4.261   1.00 0.00 ? 139 TYR A CE1  6  
ATOM 10709 C CE2  . TYR A 1 61  ? -6.669  -8.274  4.082   1.00 0.00 ? 139 TYR A CE2  6  
ATOM 10710 C CZ   . TYR A 1 61  ? -5.530  -8.901  3.623   1.00 0.00 ? 139 TYR A CZ   6  
ATOM 10711 O OH   . TYR A 1 61  ? -5.598  -9.723  2.521   1.00 0.00 ? 139 TYR A OH   6  
ATOM 10712 H H    . TYR A 1 61  ? -2.823  -5.525  6.621   1.00 0.00 ? 139 TYR A H    6  
ATOM 10713 H HA   . TYR A 1 61  ? -5.493  -4.496  5.980   1.00 0.00 ? 139 TYR A HA   6  
ATOM 10714 H HB2  . TYR A 1 61  ? -4.635  -6.782  7.764   1.00 0.00 ? 139 TYR A HB2  6  
ATOM 10715 H HB3  . TYR A 1 61  ? -6.304  -6.288  7.500   1.00 0.00 ? 139 TYR A HB3  6  
ATOM 10716 H HD1  . TYR A 1 61  ? -3.315  -7.728  5.869   1.00 0.00 ? 139 TYR A HD1  6  
ATOM 10717 H HD2  . TYR A 1 61  ? -7.487  -6.956  5.549   1.00 0.00 ? 139 TYR A HD2  6  
ATOM 10718 H HE1  . TYR A 1 61  ? -3.431  -9.199  3.901   1.00 0.00 ? 139 TYR A HE1  6  
ATOM 10719 H HE2  . TYR A 1 61  ? -7.614  -8.425  3.581   1.00 0.00 ? 139 TYR A HE2  6  
ATOM 10720 H HH   . TYR A 1 61  ? -5.154  -9.302  1.781   1.00 0.00 ? 139 TYR A HH   6  
ATOM 10721 N N    . TRP A 1 62  ? -5.855  -3.101  7.986   1.00 0.00 ? 140 TRP A N    6  
ATOM 10722 C CA   . TRP A 1 62  ? -6.032  -2.202  9.121   1.00 0.00 ? 140 TRP A CA   6  
ATOM 10723 C C    . TRP A 1 62  ? -7.435  -2.331  9.704   1.00 0.00 ? 140 TRP A C    6  
ATOM 10724 O O    . TRP A 1 62  ? -8.369  -2.744  9.016   1.00 0.00 ? 140 TRP A O    6  
ATOM 10725 C CB   . TRP A 1 62  ? -5.774  -0.755  8.697   1.00 0.00 ? 140 TRP A CB   6  
ATOM 10726 C CG   . TRP A 1 62  ? -6.562  -0.340  7.492   1.00 0.00 ? 140 TRP A CG   6  
ATOM 10727 C CD1  . TRP A 1 62  ? -6.295  -0.654  6.190   1.00 0.00 ? 140 TRP A CD1  6  
ATOM 10728 C CD2  . TRP A 1 62  ? -7.744  0.468   7.478   1.00 0.00 ? 140 TRP A CD2  6  
ATOM 10729 N NE1  . TRP A 1 62  ? -7.240  -0.090  5.367   1.00 0.00 ? 140 TRP A NE1  6  
ATOM 10730 C CE2  . TRP A 1 62  ? -8.140  0.603   6.133   1.00 0.00 ? 140 TRP A CE2  6  
ATOM 10731 C CE3  . TRP A 1 62  ? -8.507  1.090   8.470   1.00 0.00 ? 140 TRP A CE3  6  
ATOM 10732 C CZ2  . TRP A 1 62  ? -9.264  1.333   5.758   1.00 0.00 ? 140 TRP A CZ2  6  
ATOM 10733 C CZ3  . TRP A 1 62  ? -9.622  1.815   8.096   1.00 0.00 ? 140 TRP A CZ3  6  
ATOM 10734 C CH2  . TRP A 1 62  ? -9.993  1.931   6.750   1.00 0.00 ? 140 TRP A CH2  6  
ATOM 10735 H H    . TRP A 1 62  ? -6.438  -3.005  7.205   1.00 0.00 ? 140 TRP A H    6  
ATOM 10736 H HA   . TRP A 1 62  ? -5.313  -2.479  9.878   1.00 0.00 ? 140 TRP A HA   6  
ATOM 10737 H HB2  . TRP A 1 62  ? -6.037  -0.096  9.511   1.00 0.00 ? 140 TRP A HB2  6  
ATOM 10738 H HB3  . TRP A 1 62  ? -4.725  -0.637  8.467   1.00 0.00 ? 140 TRP A HB3  6  
ATOM 10739 H HD1  . TRP A 1 62  ? -5.459  -1.257  5.869   1.00 0.00 ? 140 TRP A HD1  6  
ATOM 10740 H HE1  . TRP A 1 62  ? -7.266  -0.173  4.391   1.00 0.00 ? 140 TRP A HE1  6  
ATOM 10741 H HE3  . TRP A 1 62  ? -8.237  1.012   9.513   1.00 0.00 ? 140 TRP A HE3  6  
ATOM 10742 H HZ2  . TRP A 1 62  ? -9.564  1.432   4.724   1.00 0.00 ? 140 TRP A HZ2  6  
ATOM 10743 H HZ3  . TRP A 1 62  ? -10.224 2.303   8.849   1.00 0.00 ? 140 TRP A HZ3  6  
ATOM 10744 H HH2  . TRP A 1 62  ? -10.871 2.508   6.504   1.00 0.00 ? 140 TRP A HH2  6  
ATOM 10745 N N    . LYS A 1 63  ? -7.578  -1.975  10.976  1.00 0.00 ? 141 LYS A N    6  
ATOM 10746 C CA   . LYS A 1 63  ? -8.868  -2.050  11.652  1.00 0.00 ? 141 LYS A CA   6  
ATOM 10747 C C    . LYS A 1 63  ? -9.909  -1.200  10.932  1.00 0.00 ? 141 LYS A C    6  
ATOM 10748 O O    . LYS A 1 63  ? -9.731  0.007   10.761  1.00 0.00 ? 141 LYS A O    6  
ATOM 10749 C CB   . LYS A 1 63  ? -8.733  -1.588  13.105  1.00 0.00 ? 141 LYS A CB   6  
ATOM 10750 C CG   . LYS A 1 63  ? -7.910  -2.528  13.968  1.00 0.00 ? 141 LYS A CG   6  
ATOM 10751 C CD   . LYS A 1 63  ? -7.673  -1.949  15.353  1.00 0.00 ? 141 LYS A CD   6  
ATOM 10752 C CE   . LYS A 1 63  ? -7.116  -2.995  16.307  1.00 0.00 ? 141 LYS A CE   6  
ATOM 10753 N NZ   . LYS A 1 63  ? -6.467  -2.374  17.494  1.00 0.00 ? 141 LYS A NZ   6  
ATOM 10754 H H    . LYS A 1 63  ? -6.796  -1.654  11.473  1.00 0.00 ? 141 LYS A H    6  
ATOM 10755 H HA   . LYS A 1 63  ? -9.190  -3.080  11.639  1.00 0.00 ? 141 LYS A HA   6  
ATOM 10756 H HB2  . LYS A 1 63  ? -8.263  -0.616  13.118  1.00 0.00 ? 141 LYS A HB2  6  
ATOM 10757 H HB3  . LYS A 1 63  ? -9.720  -1.507  13.537  1.00 0.00 ? 141 LYS A HB3  6  
ATOM 10758 H HG2  . LYS A 1 63  ? -8.437  -3.465  14.067  1.00 0.00 ? 141 LYS A HG2  6  
ATOM 10759 H HG3  . LYS A 1 63  ? -6.955  -2.698  13.491  1.00 0.00 ? 141 LYS A HG3  6  
ATOM 10760 H HD2  . LYS A 1 63  ? -6.967  -1.135  15.278  1.00 0.00 ? 141 LYS A HD2  6  
ATOM 10761 H HD3  . LYS A 1 63  ? -8.610  -1.580  15.745  1.00 0.00 ? 141 LYS A HD3  6  
ATOM 10762 H HE2  . LYS A 1 63  ? -7.925  -3.627  16.639  1.00 0.00 ? 141 LYS A HE2  6  
ATOM 10763 H HE3  . LYS A 1 63  ? -6.387  -3.592  15.779  1.00 0.00 ? 141 LYS A HE3  6  
ATOM 10764 H HZ1  . LYS A 1 63  ? -6.250  -1.375  17.300  1.00 0.00 ? 141 LYS A HZ1  6  
ATOM 10765 H HZ2  . LYS A 1 63  ? -5.582  -2.872  17.718  1.00 0.00 ? 141 LYS A HZ2  6  
ATOM 10766 H HZ3  . LYS A 1 63  ? -7.100  -2.427  18.317  1.00 0.00 ? 141 LYS A HZ3  6  
ATOM 10767 N N    . THR A 1 64  ? -10.998 -1.837  10.512  1.00 0.00 ? 142 THR A N    6  
ATOM 10768 C CA   . THR A 1 64  ? -12.068 -1.139  9.810   1.00 0.00 ? 142 THR A CA   6  
ATOM 10769 C C    . THR A 1 64  ? -13.402 -1.314  10.528  1.00 0.00 ? 142 THR A C    6  
ATOM 10770 O O    . THR A 1 64  ? -13.583 -2.253  11.304  1.00 0.00 ? 142 THR A O    6  
ATOM 10771 C CB   . THR A 1 64  ? -12.209 -1.639  8.360   1.00 0.00 ? 142 THR A CB   6  
ATOM 10772 O OG1  . THR A 1 64  ? -12.389 -3.060  8.348   1.00 0.00 ? 142 THR A OG1  6  
ATOM 10773 C CG2  . THR A 1 64  ? -10.983 -1.271  7.539   1.00 0.00 ? 142 THR A CG2  6  
ATOM 10774 H H    . THR A 1 64  ? -11.082 -2.799  10.678  1.00 0.00 ? 142 THR A H    6  
ATOM 10775 H HA   . THR A 1 64  ? -11.820 -0.088  9.784   1.00 0.00 ? 142 THR A HA   6  
ATOM 10776 H HB   . THR A 1 64  ? -13.076 -1.170  7.916   1.00 0.00 ? 142 THR A HB   6  
ATOM 10777 H HG1  . THR A 1 64  ? -11.979 -3.442  9.127   1.00 0.00 ? 142 THR A HG1  6  
ATOM 10778 H HG21 . THR A 1 64  ? -11.275 -1.099  6.514   1.00 0.00 ? 142 THR A HG21 6  
ATOM 10779 H HG22 . THR A 1 64  ? -10.267 -2.079  7.579   1.00 0.00 ? 142 THR A HG22 6  
ATOM 10780 H HG23 . THR A 1 64  ? -10.537 -0.374  7.942   1.00 0.00 ? 142 THR A HG23 6  
ATOM 10781 N N    . THR A 1 65  ? -14.335 -0.404  10.264  1.00 0.00 ? 143 THR A N    6  
ATOM 10782 C CA   . THR A 1 65  ? -15.652 -0.458  10.885  1.00 0.00 ? 143 THR A CA   6  
ATOM 10783 C C    . THR A 1 65  ? -16.622 -1.284  10.048  1.00 0.00 ? 143 THR A C    6  
ATOM 10784 O O    . THR A 1 65  ? -16.307 -1.680  8.925   1.00 0.00 ? 143 THR A O    6  
ATOM 10785 C CB   . THR A 1 65  ? -16.237 0.953   11.085  1.00 0.00 ? 143 THR A CB   6  
ATOM 10786 O OG1  . THR A 1 65  ? -16.423 1.590   9.816   1.00 0.00 ? 143 THR A OG1  6  
ATOM 10787 C CG2  . THR A 1 65  ? -15.321 1.801   11.954  1.00 0.00 ? 143 THR A CG2  6  
ATOM 10788 H H    . THR A 1 65  ? -14.130 0.320   9.637   1.00 0.00 ? 143 THR A H    6  
ATOM 10789 H HA   . THR A 1 65  ? -15.545 -0.921  11.856  1.00 0.00 ? 143 THR A HA   6  
ATOM 10790 H HB   . THR A 1 65  ? -17.195 0.863   11.577  1.00 0.00 ? 143 THR A HB   6  
ATOM 10791 H HG1  . THR A 1 65  ? -16.808 0.964   9.197   1.00 0.00 ? 143 THR A HG1  6  
ATOM 10792 H HG21 . THR A 1 65  ? -14.292 1.556   11.738  1.00 0.00 ? 143 THR A HG21 6  
ATOM 10793 H HG22 . THR A 1 65  ? -15.528 1.603   12.995  1.00 0.00 ? 143 THR A HG22 6  
ATOM 10794 H HG23 . THR A 1 65  ? -15.493 2.846   11.745  1.00 0.00 ? 143 THR A HG23 6  
ATOM 10795 N N    . LEU A 1 66  ? -17.802 -1.542  10.601  1.00 0.00 ? 144 LEU A N    6  
ATOM 10796 C CA   . LEU A 1 66  ? -18.819 -2.321  9.904   1.00 0.00 ? 144 LEU A CA   6  
ATOM 10797 C C    . LEU A 1 66  ? -19.662 -1.430  8.997   1.00 0.00 ? 144 LEU A C    6  
ATOM 10798 O O    . LEU A 1 66  ? -20.864 -1.646  8.841   1.00 0.00 ? 144 LEU A O    6  
ATOM 10799 C CB   . LEU A 1 66  ? -19.719 -3.039  10.911  1.00 0.00 ? 144 LEU A CB   6  
ATOM 10800 C CG   . LEU A 1 66  ? -20.412 -4.306  10.409  1.00 0.00 ? 144 LEU A CG   6  
ATOM 10801 C CD1  . LEU A 1 66  ? -19.453 -5.486  10.438  1.00 0.00 ? 144 LEU A CD1  6  
ATOM 10802 C CD2  . LEU A 1 66  ? -21.651 -4.602  11.241  1.00 0.00 ? 144 LEU A CD2  6  
ATOM 10803 H H    . LEU A 1 66  ? -17.995 -1.200  11.498  1.00 0.00 ? 144 LEU A H    6  
ATOM 10804 H HA   . LEU A 1 66  ? -18.314 -3.057  9.296   1.00 0.00 ? 144 LEU A HA   6  
ATOM 10805 H HB2  . LEU A 1 66  ? -19.112 -3.309  11.762  1.00 0.00 ? 144 LEU A HB2  6  
ATOM 10806 H HB3  . LEU A 1 66  ? -20.485 -2.344  11.224  1.00 0.00 ? 144 LEU A HB3  6  
ATOM 10807 H HG   . LEU A 1 66  ? -20.724 -4.156  9.384   1.00 0.00 ? 144 LEU A HG   6  
ATOM 10808 H HD11 . LEU A 1 66  ? -19.652 -6.132  9.597   1.00 0.00 ? 144 LEU A HD11 6  
ATOM 10809 H HD12 . LEU A 1 66  ? -19.590 -6.038  11.356  1.00 0.00 ? 144 LEU A HD12 6  
ATOM 10810 H HD13 . LEU A 1 66  ? -18.436 -5.125  10.384  1.00 0.00 ? 144 LEU A HD13 6  
ATOM 10811 H HD21 . LEU A 1 66  ? -22.530 -4.520  10.619  1.00 0.00 ? 144 LEU A HD21 6  
ATOM 10812 H HD22 . LEU A 1 66  ? -21.717 -3.892  12.053  1.00 0.00 ? 144 LEU A HD22 6  
ATOM 10813 H HD23 . LEU A 1 66  ? -21.585 -5.603  11.642  1.00 0.00 ? 144 LEU A HD23 6  
ATOM 10814 N N    . SER A 1 67  ? -19.023 -0.429  8.400   1.00 0.00 ? 145 SER A N    6  
ATOM 10815 C CA   . SER A 1 67  ? -19.714 0.496   7.509   1.00 0.00 ? 145 SER A CA   6  
ATOM 10816 C C    . SER A 1 67  ? -18.876 0.780   6.266   1.00 0.00 ? 145 SER A C    6  
ATOM 10817 O O    . SER A 1 67  ? -17.738 1.238   6.362   1.00 0.00 ? 145 SER A O    6  
ATOM 10818 C CB   . SER A 1 67  ? -20.024 1.804   8.239   1.00 0.00 ? 145 SER A CB   6  
ATOM 10819 O OG   . SER A 1 67  ? -21.148 1.658   9.090   1.00 0.00 ? 145 SER A OG   6  
ATOM 10820 H H    . SER A 1 67  ? -18.064 -0.309  8.564   1.00 0.00 ? 145 SER A H    6  
ATOM 10821 H HA   . SER A 1 67  ? -20.641 0.034   7.206   1.00 0.00 ? 145 SER A HA   6  
ATOM 10822 H HB2  . SER A 1 67  ? -19.172 2.091   8.835   1.00 0.00 ? 145 SER A HB2  6  
ATOM 10823 H HB3  . SER A 1 67  ? -20.234 2.576   7.514   1.00 0.00 ? 145 SER A HB3  6  
ATOM 10824 H HG   . SER A 1 67  ? -21.486 2.526   9.326   1.00 0.00 ? 145 SER A HG   6  
ATOM 10825 N N    . ALA A 1 68  ? -19.450 0.506   5.099   1.00 0.00 ? 146 ALA A N    6  
ATOM 10826 C CA   . ALA A 1 68  ? -18.759 0.734   3.836   1.00 0.00 ? 146 ALA A CA   6  
ATOM 10827 C C    . ALA A 1 68  ? -18.418 2.210   3.655   1.00 0.00 ? 146 ALA A C    6  
ATOM 10828 O O    . ALA A 1 68  ? -17.330 2.552   3.193   1.00 0.00 ? 146 ALA A O    6  
ATOM 10829 C CB   . ALA A 1 68  ? -19.607 0.240   2.673   1.00 0.00 ? 146 ALA A CB   6  
ATOM 10830 H H    . ALA A 1 68  ? -20.360 0.143   5.087   1.00 0.00 ? 146 ALA A H    6  
ATOM 10831 H HA   . ALA A 1 68  ? -17.842 0.163   3.849   1.00 0.00 ? 146 ALA A HA   6  
ATOM 10832 H HB1  . ALA A 1 68  ? -19.879 1.077   2.046   1.00 0.00 ? 146 ALA A HB1  6  
ATOM 10833 H HB2  . ALA A 1 68  ? -19.042 -0.475  2.094   1.00 0.00 ? 146 ALA A HB2  6  
ATOM 10834 H HB3  . ALA A 1 68  ? -20.501 -0.230  3.054   1.00 0.00 ? 146 ALA A HB3  6  
ATOM 10835 N N    . GLU A 1 69  ? -19.355 3.078   4.022   1.00 0.00 ? 147 GLU A N    6  
ATOM 10836 C CA   . GLU A 1 69  ? -19.153 4.517   3.898   1.00 0.00 ? 147 GLU A CA   6  
ATOM 10837 C C    . GLU A 1 69  ? -17.950 4.970   4.720   1.00 0.00 ? 147 GLU A C    6  
ATOM 10838 O O    . GLU A 1 69  ? -17.099 5.714   4.234   1.00 0.00 ? 147 GLU A O    6  
ATOM 10839 C CB   . GLU A 1 69  ? -20.406 5.271   4.348   1.00 0.00 ? 147 GLU A CB   6  
ATOM 10840 C CG   . GLU A 1 69  ? -20.339 6.768   4.096   1.00 0.00 ? 147 GLU A CG   6  
ATOM 10841 C CD   . GLU A 1 69  ? -21.610 7.486   4.507   1.00 0.00 ? 147 GLU A CD   6  
ATOM 10842 O OE1  . GLU A 1 69  ? -22.535 7.579   3.674   1.00 0.00 ? 147 GLU A OE1  6  
ATOM 10843 O OE2  . GLU A 1 69  ? -21.679 7.954   5.662   1.00 0.00 ? 147 GLU A OE2  6  
ATOM 10844 H H    . GLU A 1 69  ? -20.202 2.743   4.383   1.00 0.00 ? 147 GLU A H    6  
ATOM 10845 H HA   . GLU A 1 69  ? -18.967 4.737   2.858   1.00 0.00 ? 147 GLU A HA   6  
ATOM 10846 H HB2  . GLU A 1 69  ? -21.260 4.875   3.818   1.00 0.00 ? 147 GLU A HB2  6  
ATOM 10847 H HB3  . GLU A 1 69  ? -20.546 5.112   5.407   1.00 0.00 ? 147 GLU A HB3  6  
ATOM 10848 H HG2  . GLU A 1 69  ? -19.514 7.178   4.659   1.00 0.00 ? 147 GLU A HG2  6  
ATOM 10849 H HG3  . GLU A 1 69  ? -20.173 6.935   3.042   1.00 0.00 ? 147 GLU A HG3  6  
ATOM 10850 N N    . GLN A 1 70  ? -17.889 4.516   5.967   1.00 0.00 ? 148 GLN A N    6  
ATOM 10851 C CA   . GLN A 1 70  ? -16.791 4.876   6.858   1.00 0.00 ? 148 GLN A CA   6  
ATOM 10852 C C    . GLN A 1 70  ? -15.471 4.303   6.353   1.00 0.00 ? 148 GLN A C    6  
ATOM 10853 O O    . GLN A 1 70  ? -14.445 4.981   6.364   1.00 0.00 ? 148 GLN A O    6  
ATOM 10854 C CB   . GLN A 1 70  ? -17.071 4.373   8.275   1.00 0.00 ? 148 GLN A CB   6  
ATOM 10855 C CG   . GLN A 1 70  ? -16.369 5.180   9.356   1.00 0.00 ? 148 GLN A CG   6  
ATOM 10856 C CD   . GLN A 1 70  ? -14.903 5.416   9.049   1.00 0.00 ? 148 GLN A CD   6  
ATOM 10857 O OE1  . GLN A 1 70  ? -14.428 6.552   9.068   1.00 0.00 ? 148 GLN A OE1  6  
ATOM 10858 N NE2  . GLN A 1 70  ? -14.177 4.341   8.764   1.00 0.00 ? 148 GLN A NE2  6  
ATOM 10859 H H    . GLN A 1 70  ? -18.598 3.926   6.297   1.00 0.00 ? 148 GLN A H    6  
ATOM 10860 H HA   . GLN A 1 70  ? -16.719 5.953   6.875   1.00 0.00 ? 148 GLN A HA   6  
ATOM 10861 H HB2  . GLN A 1 70  ? -18.134 4.417   8.457   1.00 0.00 ? 148 GLN A HB2  6  
ATOM 10862 H HB3  . GLN A 1 70  ? -16.742 3.347   8.352   1.00 0.00 ? 148 GLN A HB3  6  
ATOM 10863 H HG2  . GLN A 1 70  ? -16.860 6.137   9.449   1.00 0.00 ? 148 GLN A HG2  6  
ATOM 10864 H HG3  . GLN A 1 70  ? -16.445 4.646   10.292  1.00 0.00 ? 148 GLN A HG3  6  
ATOM 10865 H HE21 . GLN A 1 70  ? -14.624 3.468   8.767   1.00 0.00 ? 148 GLN A HE21 6  
ATOM 10866 H HE22 . GLN A 1 70  ? -13.228 4.464   8.561   1.00 0.00 ? 148 GLN A HE22 6  
ATOM 10867 N N    . ASN A 1 71  ? -15.506 3.050   5.912   1.00 0.00 ? 149 ASN A N    6  
ATOM 10868 C CA   . ASN A 1 71  ? -14.311 2.385   5.405   1.00 0.00 ? 149 ASN A CA   6  
ATOM 10869 C C    . ASN A 1 71  ? -13.844 3.026   4.101   1.00 0.00 ? 149 ASN A C    6  
ATOM 10870 O O    . ASN A 1 71  ? -12.645 3.130   3.844   1.00 0.00 ? 149 ASN A O    6  
ATOM 10871 C CB   . ASN A 1 71  ? -14.586 0.896   5.184   1.00 0.00 ? 149 ASN A CB   6  
ATOM 10872 C CG   . ASN A 1 71  ? -14.870 0.162   6.480   1.00 0.00 ? 149 ASN A CG   6  
ATOM 10873 O OD1  . ASN A 1 71  ? -14.513 0.629   7.562   1.00 0.00 ? 149 ASN A OD1  6  
ATOM 10874 N ND2  . ASN A 1 71  ? -15.515 -0.994  6.376   1.00 0.00 ? 149 ASN A ND2  6  
ATOM 10875 H H    . ASN A 1 71  ? -16.354 2.560   5.929   1.00 0.00 ? 149 ASN A H    6  
ATOM 10876 H HA   . ASN A 1 71  ? -13.532 2.492   6.144   1.00 0.00 ? 149 ASN A HA   6  
ATOM 10877 H HB2  . ASN A 1 71  ? -15.443 0.786   4.535   1.00 0.00 ? 149 ASN A HB2  6  
ATOM 10878 H HB3  . ASN A 1 71  ? -13.725 0.442   4.715   1.00 0.00 ? 149 ASN A HB3  6  
ATOM 10879 H HD21 . ASN A 1 71  ? -15.768 -1.305  5.481   1.00 0.00 ? 149 ASN A HD21 6  
ATOM 10880 H HD22 . ASN A 1 71  ? -15.712 -1.489  7.198   1.00 0.00 ? 149 ASN A HD22 6  
ATOM 10881 N N    . ALA A 1 72  ? -14.800 3.454   3.283   1.00 0.00 ? 150 ALA A N    6  
ATOM 10882 C CA   . ALA A 1 72  ? -14.487 4.088   2.008   1.00 0.00 ? 150 ALA A CA   6  
ATOM 10883 C C    . ALA A 1 72  ? -13.730 5.395   2.216   1.00 0.00 ? 150 ALA A C    6  
ATOM 10884 O O    . ALA A 1 72  ? -12.690 5.628   1.598   1.00 0.00 ? 150 ALA A O    6  
ATOM 10885 C CB   . ALA A 1 72  ? -15.761 4.334   1.214   1.00 0.00 ? 150 ALA A CB   6  
ATOM 10886 H H    . ALA A 1 72  ? -15.737 3.343   3.544   1.00 0.00 ? 150 ALA A H    6  
ATOM 10887 H HA   . ALA A 1 72  ? -13.864 3.410   1.443   1.00 0.00 ? 150 ALA A HA   6  
ATOM 10888 H HB1  . ALA A 1 72  ? -16.543 4.663   1.883   1.00 0.00 ? 150 ALA A HB1  6  
ATOM 10889 H HB2  . ALA A 1 72  ? -15.580 5.094   0.470   1.00 0.00 ? 150 ALA A HB2  6  
ATOM 10890 H HB3  . ALA A 1 72  ? -16.064 3.418   0.728   1.00 0.00 ? 150 ALA A HB3  6  
ATOM 10891 N N    . HIS A 1 73  ? -14.259 6.247   3.089   1.00 0.00 ? 151 HIS A N    6  
ATOM 10892 C CA   . HIS A 1 73  ? -13.632 7.533   3.378   1.00 0.00 ? 151 HIS A CA   6  
ATOM 10893 C C    . HIS A 1 73  ? -12.244 7.338   3.981   1.00 0.00 ? 151 HIS A C    6  
ATOM 10894 O O    . HIS A 1 73  ? -11.279 7.973   3.559   1.00 0.00 ? 151 HIS A O    6  
ATOM 10895 C CB   . HIS A 1 73  ? -14.506 8.346   4.333   1.00 0.00 ? 151 HIS A CB   6  
ATOM 10896 C CG   . HIS A 1 73  ? -13.788 9.497   4.968   1.00 0.00 ? 151 HIS A CG   6  
ATOM 10897 N ND1  . HIS A 1 73  ? -14.228 10.801  4.877   1.00 0.00 ? 151 HIS A ND1  6  
ATOM 10898 C CD2  . HIS A 1 73  ? -12.656 9.535   5.708   1.00 0.00 ? 151 HIS A CD2  6  
ATOM 10899 C CE1  . HIS A 1 73  ? -13.396 11.591  5.532   1.00 0.00 ? 151 HIS A CE1  6  
ATOM 10900 N NE2  . HIS A 1 73  ? -12.434 10.847  6.047   1.00 0.00 ? 151 HIS A NE2  6  
ATOM 10901 H H    . HIS A 1 73  ? -15.089 6.006   3.550   1.00 0.00 ? 151 HIS A H    6  
ATOM 10902 H HA   . HIS A 1 73  ? -13.534 8.070   2.447   1.00 0.00 ? 151 HIS A HA   6  
ATOM 10903 H HB2  . HIS A 1 73  ? -15.351 8.743   3.788   1.00 0.00 ? 151 HIS A HB2  6  
ATOM 10904 H HB3  . HIS A 1 73  ? -14.864 7.701   5.122   1.00 0.00 ? 151 HIS A HB3  6  
ATOM 10905 H HD2  . HIS A 1 73  ? -12.040 8.689   5.982   1.00 0.00 ? 151 HIS A HD2  6  
ATOM 10906 H HE1  . HIS A 1 73  ? -13.487 12.662  5.632   1.00 0.00 ? 151 HIS A HE1  6  
ATOM 10907 H HE2  . HIS A 1 73  ? -11.640 11.190  6.508   1.00 0.00 ? 151 HIS A HE2  6  
ATOM 10908 N N    . MET A 1 74  ? -12.153 6.455   4.970   1.00 0.00 ? 152 MET A N    6  
ATOM 10909 C CA   . MET A 1 74  ? -10.883 6.177   5.631   1.00 0.00 ? 152 MET A CA   6  
ATOM 10910 C C    . MET A 1 74  ? -9.890  5.550   4.657   1.00 0.00 ? 152 MET A C    6  
ATOM 10911 O O    . MET A 1 74  ? -8.723  5.936   4.614   1.00 0.00 ? 152 MET A O    6  
ATOM 10912 C CB   . MET A 1 74  ? -11.099 5.247   6.827   1.00 0.00 ? 152 MET A CB   6  
ATOM 10913 C CG   . MET A 1 74  ? -11.402 5.983   8.122   1.00 0.00 ? 152 MET A CG   6  
ATOM 10914 S SD   . MET A 1 74  ? -11.000 5.009   9.585   1.00 0.00 ? 152 MET A SD   6  
ATOM 10915 C CE   . MET A 1 74  ? -9.215  5.158   9.611   1.00 0.00 ? 152 MET A CE   6  
ATOM 10916 H H    . MET A 1 74  ? -12.958 5.979   5.263   1.00 0.00 ? 152 MET A H    6  
ATOM 10917 H HA   . MET A 1 74  ? -10.481 7.114   5.983   1.00 0.00 ? 152 MET A HA   6  
ATOM 10918 H HB2  . MET A 1 74  ? -11.926 4.588   6.611   1.00 0.00 ? 152 MET A HB2  6  
ATOM 10919 H HB3  . MET A 1 74  ? -10.207 4.656   6.974   1.00 0.00 ? 152 MET A HB3  6  
ATOM 10920 H HG2  . MET A 1 74  ? -10.825 6.896   8.145   1.00 0.00 ? 152 MET A HG2  6  
ATOM 10921 H HG3  . MET A 1 74  ? -12.454 6.224   8.144   1.00 0.00 ? 152 MET A HG3  6  
ATOM 10922 H HE1  . MET A 1 74  ? -8.937  6.070   10.118  1.00 0.00 ? 152 MET A HE1  6  
ATOM 10923 H HE2  . MET A 1 74  ? -8.791  4.312   10.132  1.00 0.00 ? 152 MET A HE2  6  
ATOM 10924 H HE3  . MET A 1 74  ? -8.841  5.181   8.598   1.00 0.00 ? 152 MET A HE3  6  
ATOM 10925 N N    . GLU A 1 75  ? -10.362 4.581   3.879   1.00 0.00 ? 153 GLU A N    6  
ATOM 10926 C CA   . GLU A 1 75  ? -9.514  3.901   2.907   1.00 0.00 ? 153 GLU A CA   6  
ATOM 10927 C C    . GLU A 1 75  ? -8.994  4.880   1.859   1.00 0.00 ? 153 GLU A C    6  
ATOM 10928 O O    . GLU A 1 75  ? -7.855  4.774   1.405   1.00 0.00 ? 153 GLU A O    6  
ATOM 10929 C CB   . GLU A 1 75  ? -10.287 2.770   2.225   1.00 0.00 ? 153 GLU A CB   6  
ATOM 10930 C CG   . GLU A 1 75  ? -9.559  2.165   1.037   1.00 0.00 ? 153 GLU A CG   6  
ATOM 10931 C CD   . GLU A 1 75  ? -10.318 1.011   0.413   1.00 0.00 ? 153 GLU A CD   6  
ATOM 10932 O OE1  . GLU A 1 75  ? -11.545 1.146   0.216   1.00 0.00 ? 153 GLU A OE1  6  
ATOM 10933 O OE2  . GLU A 1 75  ? -9.688  -0.027  0.122   1.00 0.00 ? 153 GLU A OE2  6  
ATOM 10934 H H    . GLU A 1 75  ? -11.303 4.317   3.961   1.00 0.00 ? 153 GLU A H    6  
ATOM 10935 H HA   . GLU A 1 75  ? -8.673  3.480   3.438   1.00 0.00 ? 153 GLU A HA   6  
ATOM 10936 H HB2  . GLU A 1 75  ? -10.468 1.987   2.947   1.00 0.00 ? 153 GLU A HB2  6  
ATOM 10937 H HB3  . GLU A 1 75  ? -11.235 3.155   1.881   1.00 0.00 ? 153 GLU A HB3  6  
ATOM 10938 H HG2  . GLU A 1 75  ? -9.420  2.931   0.288   1.00 0.00 ? 153 GLU A HG2  6  
ATOM 10939 H HG3  . GLU A 1 75  ? -8.595  1.806   1.366   1.00 0.00 ? 153 GLU A HG3  6  
ATOM 10940 N N    . ALA A 1 76  ? -9.838  5.834   1.479   1.00 0.00 ? 154 ALA A N    6  
ATOM 10941 C CA   . ALA A 1 76  ? -9.464  6.834   0.486   1.00 0.00 ? 154 ALA A CA   6  
ATOM 10942 C C    . ALA A 1 76  ? -8.349  7.734   1.006   1.00 0.00 ? 154 ALA A C    6  
ATOM 10943 O O    . ALA A 1 76  ? -7.389  8.026   0.292   1.00 0.00 ? 154 ALA A O    6  
ATOM 10944 C CB   . ALA A 1 76  ? -10.676 7.665   0.092   1.00 0.00 ? 154 ALA A CB   6  
ATOM 10945 H H    . ALA A 1 76  ? -10.733 5.867   1.877   1.00 0.00 ? 154 ALA A H    6  
ATOM 10946 H HA   . ALA A 1 76  ? -9.113  6.314   -0.394  1.00 0.00 ? 154 ALA A HA   6  
ATOM 10947 H HB1  . ALA A 1 76  ? -10.448 8.714   0.218   1.00 0.00 ? 154 ALA A HB1  6  
ATOM 10948 H HB2  . ALA A 1 76  ? -10.925 7.472   -0.940  1.00 0.00 ? 154 ALA A HB2  6  
ATOM 10949 H HB3  . ALA A 1 76  ? -11.513 7.401   0.721   1.00 0.00 ? 154 ALA A HB3  6  
ATOM 10950 N N    . VAL A 1 77  ? -8.481  8.172   2.254   1.00 0.00 ? 155 VAL A N    6  
ATOM 10951 C CA   . VAL A 1 77  ? -7.484  9.039   2.870   1.00 0.00 ? 155 VAL A CA   6  
ATOM 10952 C C    . VAL A 1 77  ? -6.199  8.274   3.168   1.00 0.00 ? 155 VAL A C    6  
ATOM 10953 O O    . VAL A 1 77  ? -5.098  8.786   2.965   1.00 0.00 ? 155 VAL A O    6  
ATOM 10954 C CB   . VAL A 1 77  ? -8.012  9.662   4.176   1.00 0.00 ? 155 VAL A CB   6  
ATOM 10955 C CG1  . VAL A 1 77  ? -8.513  8.580   5.120   1.00 0.00 ? 155 VAL A CG1  6  
ATOM 10956 C CG2  . VAL A 1 77  ? -6.931  10.502  4.840   1.00 0.00 ? 155 VAL A CG2  6  
ATOM 10957 H H    . VAL A 1 77  ? -9.268  7.905   2.773   1.00 0.00 ? 155 VAL A H    6  
ATOM 10958 H HA   . VAL A 1 77  ? -7.263  9.839   2.178   1.00 0.00 ? 155 VAL A HA   6  
ATOM 10959 H HB   . VAL A 1 77  ? -8.842  10.309  3.933   1.00 0.00 ? 155 VAL A HB   6  
ATOM 10960 H HG11 . VAL A 1 77  ? -9.332  8.049   4.656   1.00 0.00 ? 155 VAL A HG11 6  
ATOM 10961 H HG12 . VAL A 1 77  ? -7.711  7.889   5.335   1.00 0.00 ? 155 VAL A HG12 6  
ATOM 10962 H HG13 . VAL A 1 77  ? -8.854  9.034   6.039   1.00 0.00 ? 155 VAL A HG13 6  
ATOM 10963 H HG21 . VAL A 1 77  ? -7.330  10.961  5.732   1.00 0.00 ? 155 VAL A HG21 6  
ATOM 10964 H HG22 . VAL A 1 77  ? -6.095  9.870   5.104   1.00 0.00 ? 155 VAL A HG22 6  
ATOM 10965 H HG23 . VAL A 1 77  ? -6.600  11.269  4.157   1.00 0.00 ? 155 VAL A HG23 6  
ATOM 10966 N N    . LEU A 1 78  ? -6.347  7.045   3.648   1.00 0.00 ? 156 LEU A N    6  
ATOM 10967 C CA   . LEU A 1 78  ? -5.198  6.207   3.974   1.00 0.00 ? 156 LEU A CA   6  
ATOM 10968 C C    . LEU A 1 78  ? -4.461  5.778   2.709   1.00 0.00 ? 156 LEU A C    6  
ATOM 10969 O O    . LEU A 1 78  ? -3.233  5.821   2.651   1.00 0.00 ? 156 LEU A O    6  
ATOM 10970 C CB   . LEU A 1 78  ? -5.648  4.974   4.759   1.00 0.00 ? 156 LEU A CB   6  
ATOM 10971 C CG   . LEU A 1 78  ? -4.555  3.960   5.101   1.00 0.00 ? 156 LEU A CG   6  
ATOM 10972 C CD1  . LEU A 1 78  ? -3.610  4.527   6.149   1.00 0.00 ? 156 LEU A CD1  6  
ATOM 10973 C CD2  . LEU A 1 78  ? -5.170  2.655   5.585   1.00 0.00 ? 156 LEU A CD2  6  
ATOM 10974 H H    . LEU A 1 78  ? -7.250  6.691   3.788   1.00 0.00 ? 156 LEU A H    6  
ATOM 10975 H HA   . LEU A 1 78  ? -4.527  6.789   4.587   1.00 0.00 ? 156 LEU A HA   6  
ATOM 10976 H HB2  . LEU A 1 78  ? -6.085  5.313   5.686   1.00 0.00 ? 156 LEU A HB2  6  
ATOM 10977 H HB3  . LEU A 1 78  ? -6.400  4.465   4.173   1.00 0.00 ? 156 LEU A HB3  6  
ATOM 10978 H HG   . LEU A 1 78  ? -3.977  3.749   4.211   1.00 0.00 ? 156 LEU A HG   6  
ATOM 10979 H HD11 . LEU A 1 78  ? -3.874  4.137   7.120   1.00 0.00 ? 156 LEU A HD11 6  
ATOM 10980 H HD12 . LEU A 1 78  ? -3.688  5.604   6.160   1.00 0.00 ? 156 LEU A HD12 6  
ATOM 10981 H HD13 . LEU A 1 78  ? -2.595  4.243   5.910   1.00 0.00 ? 156 LEU A HD13 6  
ATOM 10982 H HD21 . LEU A 1 78  ? -5.823  2.854   6.421   1.00 0.00 ? 156 LEU A HD21 6  
ATOM 10983 H HD22 . LEU A 1 78  ? -4.384  1.980   5.894   1.00 0.00 ? 156 LEU A HD22 6  
ATOM 10984 H HD23 . LEU A 1 78  ? -5.737  2.206   4.783   1.00 0.00 ? 156 LEU A HD23 6  
ATOM 10985 N N    . GLN A 1 79  ? -5.221  5.367   1.699   1.00 0.00 ? 157 GLN A N    6  
ATOM 10986 C CA   . GLN A 1 79  ? -4.639  4.931   0.435   1.00 0.00 ? 157 GLN A CA   6  
ATOM 10987 C C    . GLN A 1 79  ? -3.872  6.068   -0.231  1.00 0.00 ? 157 GLN A C    6  
ATOM 10988 O O    . GLN A 1 79  ? -2.708  5.912   -0.601  1.00 0.00 ? 157 GLN A O    6  
ATOM 10989 C CB   . GLN A 1 79  ? -5.733  4.419   -0.504  1.00 0.00 ? 157 GLN A CB   6  
ATOM 10990 C CG   . GLN A 1 79  ? -6.149  2.984   -0.228  1.00 0.00 ? 157 GLN A CG   6  
ATOM 10991 C CD   . GLN A 1 79  ? -6.658  2.275   -1.468  1.00 0.00 ? 157 GLN A CD   6  
ATOM 10992 O OE1  . GLN A 1 79  ? -7.775  2.521   -1.923  1.00 0.00 ? 157 GLN A OE1  6  
ATOM 10993 N NE2  . GLN A 1 79  ? -5.839  1.388   -2.021  1.00 0.00 ? 157 GLN A NE2  6  
ATOM 10994 H H    . GLN A 1 79  ? -6.194  5.355   1.807   1.00 0.00 ? 157 GLN A H    6  
ATOM 10995 H HA   . GLN A 1 79  ? -3.953  4.126   0.646   1.00 0.00 ? 157 GLN A HA   6  
ATOM 10996 H HB2  . GLN A 1 79  ? -6.603  5.050   -0.402  1.00 0.00 ? 157 GLN A HB2  6  
ATOM 10997 H HB3  . GLN A 1 79  ? -5.373  4.477   -1.521  1.00 0.00 ? 157 GLN A HB3  6  
ATOM 10998 H HG2  . GLN A 1 79  ? -5.296  2.442   0.153   1.00 0.00 ? 157 GLN A HG2  6  
ATOM 10999 H HG3  . GLN A 1 79  ? -6.933  2.987   0.515   1.00 0.00 ? 157 GLN A HG3  6  
ATOM 11000 H HE21 . GLN A 1 79  ? -4.964  1.243   -1.603  1.00 0.00 ? 157 GLN A HE21 6  
ATOM 11001 H HE22 . GLN A 1 79  ? -6.143  0.915   -2.823  1.00 0.00 ? 157 GLN A HE22 6  
ATOM 11002 N N    . ARG A 1 80  ? -4.531  7.212   -0.382  1.00 0.00 ? 158 ARG A N    6  
ATOM 11003 C CA   . ARG A 1 80  ? -3.911  8.375   -1.005  1.00 0.00 ? 158 ARG A CA   6  
ATOM 11004 C C    . ARG A 1 80  ? -2.735  8.876   -0.172  1.00 0.00 ? 158 ARG A C    6  
ATOM 11005 O O    . ARG A 1 80  ? -1.923  9.673   -0.642  1.00 0.00 ? 158 ARG A O    6  
ATOM 11006 C CB   . ARG A 1 80  ? -4.939  9.495   -1.181  1.00 0.00 ? 158 ARG A CB   6  
ATOM 11007 C CG   . ARG A 1 80  ? -5.417  10.094  0.131   1.00 0.00 ? 158 ARG A CG   6  
ATOM 11008 C CD   . ARG A 1 80  ? -4.475  11.181  0.624   1.00 0.00 ? 158 ARG A CD   6  
ATOM 11009 N NE   . ARG A 1 80  ? -5.081  11.997  1.672   1.00 0.00 ? 158 ARG A NE   6  
ATOM 11010 C CZ   . ARG A 1 80  ? -4.548  13.127  2.124   1.00 0.00 ? 158 ARG A CZ   6  
ATOM 11011 N NH1  . ARG A 1 80  ? -3.405  13.572  1.622   1.00 0.00 ? 158 ARG A NH1  6  
ATOM 11012 N NH2  . ARG A 1 80  ? -5.160  13.814  3.081   1.00 0.00 ? 158 ARG A NH2  6  
ATOM 11013 H H    . ARG A 1 80  ? -5.457  7.276   -0.068  1.00 0.00 ? 158 ARG A H    6  
ATOM 11014 H HA   . ARG A 1 80  ? -3.548  8.077   -1.977  1.00 0.00 ? 158 ARG A HA   6  
ATOM 11015 H HB2  . ARG A 1 80  ? -4.497  10.284  -1.772  1.00 0.00 ? 158 ARG A HB2  6  
ATOM 11016 H HB3  . ARG A 1 80  ? -5.796  9.101   -1.706  1.00 0.00 ? 158 ARG A HB3  6  
ATOM 11017 H HG2  . ARG A 1 80  ? -6.398  10.523  -0.016  1.00 0.00 ? 158 ARG A HG2  6  
ATOM 11018 H HG3  . ARG A 1 80  ? -5.471  9.313   0.874   1.00 0.00 ? 158 ARG A HG3  6  
ATOM 11019 H HD2  . ARG A 1 80  ? -3.582  10.716  1.014   1.00 0.00 ? 158 ARG A HD2  6  
ATOM 11020 H HD3  . ARG A 1 80  ? -4.214  11.817  -0.209  1.00 0.00 ? 158 ARG A HD3  6  
ATOM 11021 H HE   . ARG A 1 80  ? -5.927  11.687  2.057   1.00 0.00 ? 158 ARG A HE   6  
ATOM 11022 H HH11 . ARG A 1 80  ? -2.942  13.057  0.901   1.00 0.00 ? 158 ARG A HH11 6  
ATOM 11023 H HH12 . ARG A 1 80  ? -3.006  14.424  1.964   1.00 0.00 ? 158 ARG A HH12 6  
ATOM 11024 H HH21 . ARG A 1 80  ? -6.022  13.482  3.461   1.00 0.00 ? 158 ARG A HH21 6  
ATOM 11025 H HH22 . ARG A 1 80  ? -4.758  14.664  3.420   1.00 0.00 ? 158 ARG A HH22 6  
ATOM 11026 N N    . SER A 1 81  ? -2.650  8.403   1.067   1.00 0.00 ? 159 SER A N    6  
ATOM 11027 C CA   . SER A 1 81  ? -1.576  8.806   1.967   1.00 0.00 ? 159 SER A CA   6  
ATOM 11028 C C    . SER A 1 81  ? -0.523  7.709   2.082   1.00 0.00 ? 159 SER A C    6  
ATOM 11029 O O    . SER A 1 81  ? 0.278   7.696   3.016   1.00 0.00 ? 159 SER A O    6  
ATOM 11030 C CB   . SER A 1 81  ? -2.139  9.135   3.351   1.00 0.00 ? 159 SER A CB   6  
ATOM 11031 O OG   . SER A 1 81  ? -2.543  10.491  3.428   1.00 0.00 ? 159 SER A OG   6  
ATOM 11032 H H    . SER A 1 81  ? -3.328  7.770   1.384   1.00 0.00 ? 159 SER A H    6  
ATOM 11033 H HA   . SER A 1 81  ? -1.114  9.691   1.556   1.00 0.00 ? 159 SER A HA   6  
ATOM 11034 H HB2  . SER A 1 81  ? -2.993  8.506   3.549   1.00 0.00 ? 159 SER A HB2  6  
ATOM 11035 H HB3  . SER A 1 81  ? -1.379  8.955   4.098   1.00 0.00 ? 159 SER A HB3  6  
ATOM 11036 H HG   . SER A 1 81  ? -1.770  11.050  3.545   1.00 0.00 ? 159 SER A HG   6  
ATOM 11037 N N    . ALA A 1 82  ? -0.530  6.788   1.123   1.00 0.00 ? 160 ALA A N    6  
ATOM 11038 C CA   . ALA A 1 82  ? 0.425   5.687   1.114   1.00 0.00 ? 160 ALA A CA   6  
ATOM 11039 C C    . ALA A 1 82  ? 1.708   6.079   0.389   1.00 0.00 ? 160 ALA A C    6  
ATOM 11040 O O    . ALA A 1 82  ? 2.807   5.897   0.911   1.00 0.00 ? 160 ALA A O    6  
ATOM 11041 C CB   . ALA A 1 82  ? -0.194  4.456   0.468   1.00 0.00 ? 160 ALA A CB   6  
ATOM 11042 H H    . ALA A 1 82  ? -1.193  6.851   0.405   1.00 0.00 ? 160 ALA A H    6  
ATOM 11043 H HA   . ALA A 1 82  ? 0.663   5.443   2.140   1.00 0.00 ? 160 ALA A HA   6  
ATOM 11044 H HB1  . ALA A 1 82  ? 0.453   3.605   0.623   1.00 0.00 ? 160 ALA A HB1  6  
ATOM 11045 H HB2  . ALA A 1 82  ? -1.158  4.262   0.914   1.00 0.00 ? 160 ALA A HB2  6  
ATOM 11046 H HB3  . ALA A 1 82  ? -0.315  4.629   -0.591  1.00 0.00 ? 160 ALA A HB3  6  
ATOM 11047 N N    . ALA A 1 83  ? 1.559   6.616   -0.817  1.00 0.00 ? 161 ALA A N    6  
ATOM 11048 C CA   . ALA A 1 83  ? 2.706   7.035   -1.613  1.00 0.00 ? 161 ALA A CA   6  
ATOM 11049 C C    . ALA A 1 83  ? 3.745   7.743   -0.750  1.00 0.00 ? 161 ALA A C    6  
ATOM 11050 O O    . ALA A 1 83  ? 4.892   7.305   -0.655  1.00 0.00 ? 161 ALA A O    6  
ATOM 11051 C CB   . ALA A 1 83  ? 2.257   7.940   -2.751  1.00 0.00 ? 161 ALA A CB   6  
ATOM 11052 H H    . ALA A 1 83  ? 0.657   6.736   -1.180  1.00 0.00 ? 161 ALA A H    6  
ATOM 11053 H HA   . ALA A 1 83  ? 3.154   6.151   -2.045  1.00 0.00 ? 161 ALA A HA   6  
ATOM 11054 H HB1  . ALA A 1 83  ? 1.476   8.599   -2.399  1.00 0.00 ? 161 ALA A HB1  6  
ATOM 11055 H HB2  . ALA A 1 83  ? 3.095   8.527   -3.096  1.00 0.00 ? 161 ALA A HB2  6  
ATOM 11056 H HB3  . ALA A 1 83  ? 1.881   7.337   -3.563  1.00 0.00 ? 161 ALA A HB3  6  
ATOM 11057 N N    . HIS A 1 84  ? 3.336   8.841   -0.121  1.00 0.00 ? 162 HIS A N    6  
ATOM 11058 C CA   . HIS A 1 84  ? 4.232   9.610   0.735   1.00 0.00 ? 162 HIS A CA   6  
ATOM 11059 C C    . HIS A 1 84  ? 4.813   8.733   1.840   1.00 0.00 ? 162 HIS A C    6  
ATOM 11060 O O    . HIS A 1 84  ? 6.004   8.808   2.143   1.00 0.00 ? 162 HIS A O    6  
ATOM 11061 C CB   . HIS A 1 84  ? 3.491   10.799  1.347   1.00 0.00 ? 162 HIS A CB   6  
ATOM 11062 C CG   . HIS A 1 84  ? 4.401   11.856  1.893   1.00 0.00 ? 162 HIS A CG   6  
ATOM 11063 N ND1  . HIS A 1 84  ? 5.614   12.173  1.320   1.00 0.00 ? 162 HIS A ND1  6  
ATOM 11064 C CD2  . HIS A 1 84  ? 4.268   12.672  2.965   1.00 0.00 ? 162 HIS A CD2  6  
ATOM 11065 C CE1  . HIS A 1 84  ? 6.189   13.137  2.016   1.00 0.00 ? 162 HIS A CE1  6  
ATOM 11066 N NE2  . HIS A 1 84  ? 5.393   13.458  3.020   1.00 0.00 ? 162 HIS A NE2  6  
ATOM 11067 H H    . HIS A 1 84  ? 2.410   9.140   -0.236  1.00 0.00 ? 162 HIS A H    6  
ATOM 11068 H HA   . HIS A 1 84  ? 5.041   9.979   0.122   1.00 0.00 ? 162 HIS A HA   6  
ATOM 11069 H HB2  . HIS A 1 84  ? 2.869   11.255  0.592   1.00 0.00 ? 162 HIS A HB2  6  
ATOM 11070 H HB3  . HIS A 1 84  ? 2.867   10.447  2.157   1.00 0.00 ? 162 HIS A HB3  6  
ATOM 11071 H HD2  . HIS A 1 84  ? 3.433   12.699  3.651   1.00 0.00 ? 162 HIS A HD2  6  
ATOM 11072 H HE1  . HIS A 1 84  ? 7.147   13.587  1.802   1.00 0.00 ? 162 HIS A HE1  6  
ATOM 11073 H HE2  . HIS A 1 84  ? 5.616   14.084  3.739   1.00 0.00 ? 162 HIS A HE2  6  
ATOM 11074 N N    . MET A 1 85  ? 3.964   7.904   2.439   1.00 0.00 ? 163 MET A N    6  
ATOM 11075 C CA   . MET A 1 85  ? 4.395   7.013   3.510   1.00 0.00 ? 163 MET A CA   6  
ATOM 11076 C C    . MET A 1 85  ? 5.536   6.114   3.044   1.00 0.00 ? 163 MET A C    6  
ATOM 11077 O O    . MET A 1 85  ? 6.536   5.953   3.743   1.00 0.00 ? 163 MET A O    6  
ATOM 11078 C CB   . MET A 1 85  ? 3.221   6.159   3.994   1.00 0.00 ? 163 MET A CB   6  
ATOM 11079 C CG   . MET A 1 85  ? 2.431   6.796   5.124   1.00 0.00 ? 163 MET A CG   6  
ATOM 11080 S SD   . MET A 1 85  ? 1.658   5.577   6.205   1.00 0.00 ? 163 MET A SD   6  
ATOM 11081 C CE   . MET A 1 85  ? -0.073  5.838   5.825   1.00 0.00 ? 163 MET A CE   6  
ATOM 11082 H H    . MET A 1 85  ? 3.027   7.890   2.153   1.00 0.00 ? 163 MET A H    6  
ATOM 11083 H HA   . MET A 1 85  ? 4.745   7.624   4.328   1.00 0.00 ? 163 MET A HA   6  
ATOM 11084 H HB2  . MET A 1 85  ? 2.550   5.988   3.165   1.00 0.00 ? 163 MET A HB2  6  
ATOM 11085 H HB3  . MET A 1 85  ? 3.601   5.209   4.340   1.00 0.00 ? 163 MET A HB3  6  
ATOM 11086 H HG2  . MET A 1 85  ? 3.099   7.406   5.714   1.00 0.00 ? 163 MET A HG2  6  
ATOM 11087 H HG3  . MET A 1 85  ? 1.659   7.420   4.698   1.00 0.00 ? 163 MET A HG3  6  
ATOM 11088 H HE1  . MET A 1 85  ? -0.630  4.939   6.047   1.00 0.00 ? 163 MET A HE1  6  
ATOM 11089 H HE2  . MET A 1 85  ? -0.454  6.654   6.422   1.00 0.00 ? 163 MET A HE2  6  
ATOM 11090 H HE3  . MET A 1 85  ? -0.180  6.077   4.777   1.00 0.00 ? 163 MET A HE3  6  
ATOM 11091 N N    . ARG A 1 86  ? 5.378   5.531   1.860   1.00 0.00 ? 164 ARG A N    6  
ATOM 11092 C CA   . ARG A 1 86  ? 6.395   4.648   1.303   1.00 0.00 ? 164 ARG A CA   6  
ATOM 11093 C C    . ARG A 1 86  ? 7.744   5.355   1.220   1.00 0.00 ? 164 ARG A C    6  
ATOM 11094 O O    . ARG A 1 86  ? 8.777   4.791   1.582   1.00 0.00 ? 164 ARG A O    6  
ATOM 11095 C CB   . ARG A 1 86  ? 5.974   4.164   -0.086  1.00 0.00 ? 164 ARG A CB   6  
ATOM 11096 C CG   . ARG A 1 86  ? 6.571   2.819   -0.470  1.00 0.00 ? 164 ARG A CG   6  
ATOM 11097 C CD   . ARG A 1 86  ? 6.471   2.572   -1.967  1.00 0.00 ? 164 ARG A CD   6  
ATOM 11098 N NE   . ARG A 1 86  ? 7.275   3.520   -2.733  1.00 0.00 ? 164 ARG A NE   6  
ATOM 11099 C CZ   . ARG A 1 86  ? 7.047   3.814   -4.008  1.00 0.00 ? 164 ARG A CZ   6  
ATOM 11100 N NH1  . ARG A 1 86  ? 6.045   3.237   -4.657  1.00 0.00 ? 164 ARG A NH1  6  
ATOM 11101 N NH2  . ARG A 1 86  ? 7.823   4.688   -4.638  1.00 0.00 ? 164 ARG A NH2  6  
ATOM 11102 H H    . ARG A 1 86  ? 4.559   5.699   1.350   1.00 0.00 ? 164 ARG A H    6  
ATOM 11103 H HA   . ARG A 1 86  ? 6.489   3.795   1.958   1.00 0.00 ? 164 ARG A HA   6  
ATOM 11104 H HB2  . ARG A 1 86  ? 4.898   4.076   -0.114  1.00 0.00 ? 164 ARG A HB2  6  
ATOM 11105 H HB3  . ARG A 1 86  ? 6.287   4.894   -0.818  1.00 0.00 ? 164 ARG A HB3  6  
ATOM 11106 H HG2  . ARG A 1 86  ? 7.612   2.803   -0.182  1.00 0.00 ? 164 ARG A HG2  6  
ATOM 11107 H HG3  . ARG A 1 86  ? 6.038   2.038   0.052   1.00 0.00 ? 164 ARG A HG3  6  
ATOM 11108 H HD2  . ARG A 1 86  ? 6.816   1.571   -2.176  1.00 0.00 ? 164 ARG A HD2  6  
ATOM 11109 H HD3  . ARG A 1 86  ? 5.438   2.666   -2.265  1.00 0.00 ? 164 ARG A HD3  6  
ATOM 11110 H HE   . ARG A 1 86  ? 8.020   3.959   -2.273  1.00 0.00 ? 164 ARG A HE   6  
ATOM 11111 H HH11 . ARG A 1 86  ? 5.459   2.579   -4.185  1.00 0.00 ? 164 ARG A HH11 6  
ATOM 11112 H HH12 . ARG A 1 86  ? 5.876   3.461   -5.617  1.00 0.00 ? 164 ARG A HH12 6  
ATOM 11113 H HH21 . ARG A 1 86  ? 8.579   5.125   -4.152  1.00 0.00 ? 164 ARG A HH21 6  
ATOM 11114 H HH22 . ARG A 1 86  ? 7.651   4.908   -5.597  1.00 0.00 ? 164 ARG A HH22 6  
ATOM 11115 N N    . HIS A 1 87  ? 7.728   6.595   0.739   1.00 0.00 ? 165 HIS A N    6  
ATOM 11116 C CA   . HIS A 1 87  ? 8.950   7.380   0.608   1.00 0.00 ? 165 HIS A CA   6  
ATOM 11117 C C    . HIS A 1 87  ? 9.551   7.682   1.978   1.00 0.00 ? 165 HIS A C    6  
ATOM 11118 O O    . HIS A 1 87  ? 10.765  7.599   2.167   1.00 0.00 ? 165 HIS A O    6  
ATOM 11119 C CB   . HIS A 1 87  ? 8.666   8.685   -0.137  1.00 0.00 ? 165 HIS A CB   6  
ATOM 11120 C CG   . HIS A 1 87  ? 9.888   9.518   -0.372  1.00 0.00 ? 165 HIS A CG   6  
ATOM 11121 N ND1  . HIS A 1 87  ? 10.468  9.670   -1.613  1.00 0.00 ? 165 HIS A ND1  6  
ATOM 11122 C CD2  . HIS A 1 87  ? 10.638  10.250  0.485   1.00 0.00 ? 165 HIS A CD2  6  
ATOM 11123 C CE1  . HIS A 1 87  ? 11.524  10.457  -1.510  1.00 0.00 ? 165 HIS A CE1  6  
ATOM 11124 N NE2  . HIS A 1 87  ? 11.649  10.823  -0.247  1.00 0.00 ? 165 HIS A NE2  6  
ATOM 11125 H H    . HIS A 1 87  ? 6.874   6.990   0.467   1.00 0.00 ? 165 HIS A H    6  
ATOM 11126 H HA   . HIS A 1 87  ? 9.659   6.798   0.039   1.00 0.00 ? 165 HIS A HA   6  
ATOM 11127 H HB2  . HIS A 1 87  ? 8.232   8.455   -1.098  1.00 0.00 ? 165 HIS A HB2  6  
ATOM 11128 H HB3  . HIS A 1 87  ? 7.966   9.274   0.438   1.00 0.00 ? 165 HIS A HB3  6  
ATOM 11129 H HD2  . HIS A 1 87  ? 10.474  10.363  1.547   1.00 0.00 ? 165 HIS A HD2  6  
ATOM 11130 H HE1  . HIS A 1 87  ? 12.175  10.751  -2.320  1.00 0.00 ? 165 HIS A HE1  6  
ATOM 11131 H HE2  . HIS A 1 87  ? 12.398  11.337  0.119   1.00 0.00 ? 165 HIS A HE2  6  
ATOM 11132 N N    . LEU A 1 88  ? 8.693   8.035   2.929   1.00 0.00 ? 166 LEU A N    6  
ATOM 11133 C CA   . LEU A 1 88  ? 9.139   8.351   4.282   1.00 0.00 ? 166 LEU A CA   6  
ATOM 11134 C C    . LEU A 1 88  ? 9.937   7.195   4.876   1.00 0.00 ? 166 LEU A C    6  
ATOM 11135 O O    . LEU A 1 88  ? 10.913  7.406   5.598   1.00 0.00 ? 166 LEU A O    6  
ATOM 11136 C CB   . LEU A 1 88  ? 7.938   8.668   5.175   1.00 0.00 ? 166 LEU A CB   6  
ATOM 11137 C CG   . LEU A 1 88  ? 7.311   10.050  4.989   1.00 0.00 ? 166 LEU A CG   6  
ATOM 11138 C CD1  . LEU A 1 88  ? 6.036   10.172  5.808   1.00 0.00 ? 166 LEU A CD1  6  
ATOM 11139 C CD2  . LEU A 1 88  ? 8.300   11.141  5.373   1.00 0.00 ? 166 LEU A CD2  6  
ATOM 11140 H H    . LEU A 1 88  ? 7.738   8.083   2.719   1.00 0.00 ? 166 LEU A H    6  
ATOM 11141 H HA   . LEU A 1 88  ? 9.776   9.221   4.226   1.00 0.00 ? 166 LEU A HA   6  
ATOM 11142 H HB2  . LEU A 1 88  ? 7.176   7.930   4.978   1.00 0.00 ? 166 LEU A HB2  6  
ATOM 11143 H HB3  . LEU A 1 88  ? 8.261   8.586   6.203   1.00 0.00 ? 166 LEU A HB3  6  
ATOM 11144 H HG   . LEU A 1 88  ? 7.052   10.184  3.947   1.00 0.00 ? 166 LEU A HG   6  
ATOM 11145 H HD11 . LEU A 1 88  ? 5.930   9.304   6.441   1.00 0.00 ? 166 LEU A HD11 6  
ATOM 11146 H HD12 . LEU A 1 88  ? 5.186   10.239  5.144   1.00 0.00 ? 166 LEU A HD12 6  
ATOM 11147 H HD13 . LEU A 1 88  ? 6.084   11.061  6.420   1.00 0.00 ? 166 LEU A HD13 6  
ATOM 11148 H HD21 . LEU A 1 88  ? 8.302   11.908  4.613   1.00 0.00 ? 166 LEU A HD21 6  
ATOM 11149 H HD22 . LEU A 1 88  ? 9.290   10.716  5.458   1.00 0.00 ? 166 LEU A HD22 6  
ATOM 11150 H HD23 . LEU A 1 88  ? 8.010   11.573  6.319   1.00 0.00 ? 166 LEU A HD23 6  
ATOM 11151 N N    . LEU A 1 89  ? 9.518   5.973   4.567   1.00 0.00 ? 167 LEU A N    6  
ATOM 11152 C CA   . LEU A 1 89  ? 10.195  4.782   5.069   1.00 0.00 ? 167 LEU A CA   6  
ATOM 11153 C C    . LEU A 1 89  ? 11.517  4.560   4.341   1.00 0.00 ? 167 LEU A C    6  
ATOM 11154 O O    . LEU A 1 89  ? 12.509  4.152   4.946   1.00 0.00 ? 167 LEU A O    6  
ATOM 11155 C CB   . LEU A 1 89  ? 9.298   3.554   4.905   1.00 0.00 ? 167 LEU A CB   6  
ATOM 11156 C CG   . LEU A 1 89  ? 7.919   3.638   5.561   1.00 0.00 ? 167 LEU A CG   6  
ATOM 11157 C CD1  . LEU A 1 89  ? 7.182   2.314   5.427   1.00 0.00 ? 167 LEU A CD1  6  
ATOM 11158 C CD2  . LEU A 1 89  ? 8.048   4.032   7.025   1.00 0.00 ? 167 LEU A CD2  6  
ATOM 11159 H H    . LEU A 1 89  ? 8.735   5.867   3.988   1.00 0.00 ? 167 LEU A H    6  
ATOM 11160 H HA   . LEU A 1 89  ? 10.397  4.933   6.119   1.00 0.00 ? 167 LEU A HA   6  
ATOM 11161 H HB2  . LEU A 1 89  ? 9.151   3.390   3.849   1.00 0.00 ? 167 LEU A HB2  6  
ATOM 11162 H HB3  . LEU A 1 89  ? 9.817   2.707   5.331   1.00 0.00 ? 167 LEU A HB3  6  
ATOM 11163 H HG   . LEU A 1 89  ? 7.334   4.397   5.060   1.00 0.00 ? 167 LEU A HG   6  
ATOM 11164 H HD11 . LEU A 1 89  ? 7.474   1.832   4.506   1.00 0.00 ? 167 LEU A HD11 6  
ATOM 11165 H HD12 . LEU A 1 89  ? 6.118   2.494   5.417   1.00 0.00 ? 167 LEU A HD12 6  
ATOM 11166 H HD13 . LEU A 1 89  ? 7.431   1.677   6.263   1.00 0.00 ? 167 LEU A HD13 6  
ATOM 11167 H HD21 . LEU A 1 89  ? 7.440   3.376   7.629   1.00 0.00 ? 167 LEU A HD21 6  
ATOM 11168 H HD22 . LEU A 1 89  ? 7.715   5.052   7.154   1.00 0.00 ? 167 LEU A HD22 6  
ATOM 11169 H HD23 . LEU A 1 89  ? 9.081   3.949   7.331   1.00 0.00 ? 167 LEU A HD23 6  
ATOM 11170 N N    . MET A 1 90  ? 11.524  4.833   3.040   1.00 0.00 ? 168 MET A N    6  
ATOM 11171 C CA   . MET A 1 90  ? 12.726  4.666   2.231   1.00 0.00 ? 168 MET A CA   6  
ATOM 11172 C C    . MET A 1 90  ? 13.942  5.259   2.936   1.00 0.00 ? 168 MET A C    6  
ATOM 11173 O O    . MET A 1 90  ? 15.065  4.787   2.759   1.00 0.00 ? 168 MET A O    6  
ATOM 11174 C CB   . MET A 1 90  ? 12.542  5.327   0.864   1.00 0.00 ? 168 MET A CB   6  
ATOM 11175 C CG   . MET A 1 90  ? 11.650  4.536   -0.079  1.00 0.00 ? 168 MET A CG   6  
ATOM 11176 S SD   . MET A 1 90  ? 11.582  5.248   -1.733  1.00 0.00 ? 168 MET A SD   6  
ATOM 11177 C CE   . MET A 1 90  ? 11.142  3.809   -2.704  1.00 0.00 ? 168 MET A CE   6  
ATOM 11178 H H    . MET A 1 90  ? 10.702  5.155   2.614   1.00 0.00 ? 168 MET A H    6  
ATOM 11179 H HA   . MET A 1 90  ? 12.886  3.608   2.091   1.00 0.00 ? 168 MET A HA   6  
ATOM 11180 H HB2  . MET A 1 90  ? 12.102  6.304   1.006   1.00 0.00 ? 168 MET A HB2  6  
ATOM 11181 H HB3  . MET A 1 90  ? 13.509  5.441   0.398   1.00 0.00 ? 168 MET A HB3  6  
ATOM 11182 H HG2  . MET A 1 90  ? 12.031  3.528   -0.152  1.00 0.00 ? 168 MET A HG2  6  
ATOM 11183 H HG3  . MET A 1 90  ? 10.650  4.512   0.330   1.00 0.00 ? 168 MET A HG3  6  
ATOM 11184 H HE1  . MET A 1 90  ? 10.110  3.884   -3.012  1.00 0.00 ? 168 MET A HE1  6  
ATOM 11185 H HE2  . MET A 1 90  ? 11.776  3.756   -3.577  1.00 0.00 ? 168 MET A HE2  6  
ATOM 11186 H HE3  . MET A 1 90  ? 11.276  2.918   -2.107  1.00 0.00 ? 168 MET A HE3  6  
ATOM 11187 N N    . SER A 1 91  ? 13.711  6.296   3.735   1.00 0.00 ? 169 SER A N    6  
ATOM 11188 C CA   . SER A 1 91  ? 14.789  6.955   4.463   1.00 0.00 ? 169 SER A CA   6  
ATOM 11189 C C    . SER A 1 91  ? 15.779  5.933   5.011   1.00 0.00 ? 169 SER A C    6  
ATOM 11190 O O    . SER A 1 91  ? 16.992  6.093   4.874   1.00 0.00 ? 169 SER A O    6  
ATOM 11191 C CB   . SER A 1 91  ? 14.220  7.796   5.607   1.00 0.00 ? 169 SER A CB   6  
ATOM 11192 O OG   . SER A 1 91  ? 15.132  8.807   6.000   1.00 0.00 ? 169 SER A OG   6  
ATOM 11193 H H    . SER A 1 91  ? 12.794  6.627   3.835   1.00 0.00 ? 169 SER A H    6  
ATOM 11194 H HA   . SER A 1 91  ? 15.305  7.606   3.772   1.00 0.00 ? 169 SER A HA   6  
ATOM 11195 H HB2  . SER A 1 91  ? 13.301  8.262   5.286   1.00 0.00 ? 169 SER A HB2  6  
ATOM 11196 H HB3  . SER A 1 91  ? 14.022  7.156   6.456   1.00 0.00 ? 169 SER A HB3  6  
ATOM 11197 H HG   . SER A 1 91  ? 16.029  8.516   5.822   1.00 0.00 ? 169 SER A HG   6  
ATOM 11198 N N    . GLN A 1 92  ? 15.253  4.882   5.632   1.00 0.00 ? 170 GLN A N    6  
ATOM 11199 C CA   . GLN A 1 92  ? 16.090  3.834   6.202   1.00 0.00 ? 170 GLN A CA   6  
ATOM 11200 C C    . GLN A 1 92  ? 16.599  2.893   5.115   1.00 0.00 ? 170 GLN A C    6  
ATOM 11201 O O    . GLN A 1 92  ? 15.859  2.526   4.203   1.00 0.00 ? 170 GLN A O    6  
ATOM 11202 C CB   . GLN A 1 92  ? 15.309  3.043   7.253   1.00 0.00 ? 170 GLN A CB   6  
ATOM 11203 C CG   . GLN A 1 92  ? 14.913  3.869   8.466   1.00 0.00 ? 170 GLN A CG   6  
ATOM 11204 C CD   . GLN A 1 92  ? 16.109  4.476   9.174   1.00 0.00 ? 170 GLN A CD   6  
ATOM 11205 O OE1  . GLN A 1 92  ? 17.237  4.007   9.024   1.00 0.00 ? 170 GLN A OE1  6  
ATOM 11206 N NE2  . GLN A 1 92  ? 15.867  5.524   9.952   1.00 0.00 ? 170 GLN A NE2  6  
ATOM 11207 H H    . GLN A 1 92  ? 14.279  4.811   5.709   1.00 0.00 ? 170 GLN A H    6  
ATOM 11208 H HA   . GLN A 1 92  ? 16.937  4.307   6.676   1.00 0.00 ? 170 GLN A HA   6  
ATOM 11209 H HB2  . GLN A 1 92  ? 14.410  2.654   6.799   1.00 0.00 ? 170 GLN A HB2  6  
ATOM 11210 H HB3  . GLN A 1 92  ? 15.918  2.217   7.590   1.00 0.00 ? 170 GLN A HB3  6  
ATOM 11211 H HG2  . GLN A 1 92  ? 14.262  4.668   8.144   1.00 0.00 ? 170 GLN A HG2  6  
ATOM 11212 H HG3  . GLN A 1 92  ? 14.385  3.233   9.161   1.00 0.00 ? 170 GLN A HG3  6  
ATOM 11213 H HE21 . GLN A 1 92  ? 14.942  5.842   10.025  1.00 0.00 ? 170 GLN A HE21 6  
ATOM 11214 H HE22 . GLN A 1 92  ? 16.620  5.936   10.422  1.00 0.00 ? 170 GLN A HE22 6  
ATOM 11215 N N    . GLN A 1 93  ? 17.867  2.507   5.219   1.00 0.00 ? 171 GLN A N    6  
ATOM 11216 C CA   . GLN A 1 93  ? 18.474  1.609   4.243   1.00 0.00 ? 171 GLN A CA   6  
ATOM 11217 C C    . GLN A 1 93  ? 18.545  0.185   4.784   1.00 0.00 ? 171 GLN A C    6  
ATOM 11218 O O    . GLN A 1 93  ? 18.440  -0.783  4.030   1.00 0.00 ? 171 GLN A O    6  
ATOM 11219 C CB   . GLN A 1 93  ? 19.876  2.097   3.873   1.00 0.00 ? 171 GLN A CB   6  
ATOM 11220 C CG   . GLN A 1 93  ? 19.882  3.419   3.122   1.00 0.00 ? 171 GLN A CG   6  
ATOM 11221 C CD   . GLN A 1 93  ? 19.784  3.236   1.620   1.00 0.00 ? 171 GLN A CD   6  
ATOM 11222 O OE1  . GLN A 1 93  ? 20.094  2.168   1.091   1.00 0.00 ? 171 GLN A OE1  6  
ATOM 11223 N NE2  . GLN A 1 93  ? 19.351  4.281   0.924   1.00 0.00 ? 171 GLN A NE2  6  
ATOM 11224 H H    . GLN A 1 93  ? 18.406  2.833   5.969   1.00 0.00 ? 171 GLN A H    6  
ATOM 11225 H HA   . GLN A 1 93  ? 17.856  1.615   3.358   1.00 0.00 ? 171 GLN A HA   6  
ATOM 11226 H HB2  . GLN A 1 93  ? 20.452  2.220   4.778   1.00 0.00 ? 171 GLN A HB2  6  
ATOM 11227 H HB3  . GLN A 1 93  ? 20.351  1.353   3.252   1.00 0.00 ? 171 GLN A HB3  6  
ATOM 11228 H HG2  . GLN A 1 93  ? 19.040  4.010   3.452   1.00 0.00 ? 171 GLN A HG2  6  
ATOM 11229 H HG3  . GLN A 1 93  ? 20.799  3.942   3.348   1.00 0.00 ? 171 GLN A HG3  6  
ATOM 11230 H HE21 . GLN A 1 93  ? 19.124  5.100   1.412   1.00 0.00 ? 171 GLN A HE21 6  
ATOM 11231 H HE22 . GLN A 1 93  ? 19.279  4.191   -0.049  1.00 0.00 ? 171 GLN A HE22 6  
ATOM 11232 N N    . THR A 1 94  ? 18.725  0.063   6.096   1.00 0.00 ? 172 THR A N    6  
ATOM 11233 C CA   . THR A 1 94  ? 18.811  -1.242  6.737   1.00 0.00 ? 172 THR A CA   6  
ATOM 11234 C C    . THR A 1 94  ? 17.852  -2.236  6.093   1.00 0.00 ? 172 THR A C    6  
ATOM 11235 O O    . THR A 1 94  ? 18.252  -3.332  5.696   1.00 0.00 ? 172 THR A O    6  
ATOM 11236 C CB   . THR A 1 94  ? 18.501  -1.150  8.243   1.00 0.00 ? 172 THR A CB   6  
ATOM 11237 O OG1  . THR A 1 94  ? 19.492  -0.351  8.900   1.00 0.00 ? 172 THR A OG1  6  
ATOM 11238 C CG2  . THR A 1 94  ? 18.459  -2.534  8.873   1.00 0.00 ? 172 THR A CG2  6  
ATOM 11239 H H    . THR A 1 94  ? 18.801  0.872   6.644   1.00 0.00 ? 172 THR A H    6  
ATOM 11240 H HA   . THR A 1 94  ? 19.822  -1.605  6.621   1.00 0.00 ? 172 THR A HA   6  
ATOM 11241 H HB   . THR A 1 94  ? 17.534  -0.684  8.368   1.00 0.00 ? 172 THR A HB   6  
ATOM 11242 H HG1  . THR A 1 94  ? 19.740  0.382   8.331   1.00 0.00 ? 172 THR A HG1  6  
ATOM 11243 H HG21 . THR A 1 94  ? 18.698  -3.277  8.127   1.00 0.00 ? 172 THR A HG21 6  
ATOM 11244 H HG22 . THR A 1 94  ? 17.471  -2.721  9.265   1.00 0.00 ? 172 THR A HG22 6  
ATOM 11245 H HG23 . THR A 1 94  ? 19.180  -2.586  9.675   1.00 0.00 ? 172 THR A HG23 6  
ATOM 11246 N N    . LEU A 1 95  ? 16.586  -1.849  5.990   1.00 0.00 ? 173 LEU A N    6  
ATOM 11247 C CA   . LEU A 1 95  ? 15.569  -2.706  5.392   1.00 0.00 ? 173 LEU A CA   6  
ATOM 11248 C C    . LEU A 1 95  ? 15.917  -3.035  3.944   1.00 0.00 ? 173 LEU A C    6  
ATOM 11249 O O    . LEU A 1 95  ? 16.854  -2.473  3.377   1.00 0.00 ? 173 LEU A O    6  
ATOM 11250 C CB   . LEU A 1 95  ? 14.199  -2.029  5.458   1.00 0.00 ? 173 LEU A CB   6  
ATOM 11251 C CG   . LEU A 1 95  ? 14.078  -0.689  4.731   1.00 0.00 ? 173 LEU A CG   6  
ATOM 11252 C CD1  . LEU A 1 95  ? 13.684  -0.903  3.278   1.00 0.00 ? 173 LEU A CD1  6  
ATOM 11253 C CD2  . LEU A 1 95  ? 13.068  0.209   5.432   1.00 0.00 ? 173 LEU A CD2  6  
ATOM 11254 H H    . LEU A 1 95  ? 16.328  -0.965  6.324   1.00 0.00 ? 173 LEU A H    6  
ATOM 11255 H HA   . LEU A 1 95  ? 15.535  -3.625  5.959   1.00 0.00 ? 173 LEU A HA   6  
ATOM 11256 H HB2  . LEU A 1 95  ? 13.475  -2.704  5.028   1.00 0.00 ? 173 LEU A HB2  6  
ATOM 11257 H HB3  . LEU A 1 95  ? 13.962  -1.864  6.499   1.00 0.00 ? 173 LEU A HB3  6  
ATOM 11258 H HG   . LEU A 1 95  ? 15.037  -0.190  4.746   1.00 0.00 ? 173 LEU A HG   6  
ATOM 11259 H HD11 . LEU A 1 95  ? 13.377  0.037   2.846   1.00 0.00 ? 173 LEU A HD11 6  
ATOM 11260 H HD12 . LEU A 1 95  ? 12.866  -1.607  3.227   1.00 0.00 ? 173 LEU A HD12 6  
ATOM 11261 H HD13 . LEU A 1 95  ? 14.529  -1.294  2.730   1.00 0.00 ? 173 LEU A HD13 6  
ATOM 11262 H HD21 . LEU A 1 95  ? 12.293  0.491   4.735   1.00 0.00 ? 173 LEU A HD21 6  
ATOM 11263 H HD22 . LEU A 1 95  ? 13.566  1.096   5.795   1.00 0.00 ? 173 LEU A HD22 6  
ATOM 11264 H HD23 . LEU A 1 95  ? 12.629  -0.324  6.263   1.00 0.00 ? 173 LEU A HD23 6  
ATOM 11265 N N    . ARG A 1 96  ? 15.155  -3.948  3.350   1.00 0.00 ? 174 ARG A N    6  
ATOM 11266 C CA   . ARG A 1 96  ? 15.383  -4.351  1.968   1.00 0.00 ? 174 ARG A CA   6  
ATOM 11267 C C    . ARG A 1 96  ? 14.346  -3.724  1.041   1.00 0.00 ? 174 ARG A C    6  
ATOM 11268 O O    . ARG A 1 96  ? 13.528  -2.911  1.469   1.00 0.00 ? 174 ARG A O    6  
ATOM 11269 C CB   . ARG A 1 96  ? 15.337  -5.875  1.845   1.00 0.00 ? 174 ARG A CB   6  
ATOM 11270 C CG   . ARG A 1 96  ? 16.588  -6.566  2.363   1.00 0.00 ? 174 ARG A CG   6  
ATOM 11271 C CD   . ARG A 1 96  ? 17.637  -6.711  1.271   1.00 0.00 ? 174 ARG A CD   6  
ATOM 11272 N NE   . ARG A 1 96  ? 18.874  -7.302  1.775   1.00 0.00 ? 174 ARG A NE   6  
ATOM 11273 C CZ   . ARG A 1 96  ? 20.042  -7.207  1.150   1.00 0.00 ? 174 ARG A CZ   6  
ATOM 11274 N NH1  . ARG A 1 96  ? 20.132  -6.548  0.003   1.00 0.00 ? 174 ARG A NH1  6  
ATOM 11275 N NH2  . ARG A 1 96  ? 21.123  -7.772  1.672   1.00 0.00 ? 174 ARG A NH2  6  
ATOM 11276 H H    . ARG A 1 96  ? 14.423  -4.361  3.854   1.00 0.00 ? 174 ARG A H    6  
ATOM 11277 H HA   . ARG A 1 96  ? 16.363  -4.005  1.678   1.00 0.00 ? 174 ARG A HA   6  
ATOM 11278 H HB2  . ARG A 1 96  ? 14.491  -6.245  2.404   1.00 0.00 ? 174 ARG A HB2  6  
ATOM 11279 H HB3  . ARG A 1 96  ? 15.213  -6.137  0.805   1.00 0.00 ? 174 ARG A HB3  6  
ATOM 11280 H HG2  . ARG A 1 96  ? 17.004  -5.980  3.169   1.00 0.00 ? 174 ARG A HG2  6  
ATOM 11281 H HG3  . ARG A 1 96  ? 16.322  -7.547  2.727   1.00 0.00 ? 174 ARG A HG3  6  
ATOM 11282 H HD2  . ARG A 1 96  ? 17.240  -7.343  0.490   1.00 0.00 ? 174 ARG A HD2  6  
ATOM 11283 H HD3  . ARG A 1 96  ? 17.854  -5.734  0.867   1.00 0.00 ? 174 ARG A HD3  6  
ATOM 11284 H HE   . ARG A 1 96  ? 18.830  -7.794  2.621   1.00 0.00 ? 174 ARG A HE   6  
ATOM 11285 H HH11 . ARG A 1 96  ? 19.319  -6.120  -0.392  1.00 0.00 ? 174 ARG A HH11 6  
ATOM 11286 H HH12 . ARG A 1 96  ? 21.013  -6.476  -0.465  1.00 0.00 ? 174 ARG A HH12 6  
ATOM 11287 H HH21 . ARG A 1 96  ? 21.059  -8.270  2.536   1.00 0.00 ? 174 ARG A HH21 6  
ATOM 11288 H HH22 . ARG A 1 96  ? 22.002  -7.700  1.201   1.00 0.00 ? 174 ARG A HH22 6  
ATOM 11289 N N    . ASN A 1 97  ? 14.387  -4.108  -0.231  1.00 0.00 ? 175 ASN A N    6  
ATOM 11290 C CA   . ASN A 1 97  ? 13.451  -3.583  -1.219  1.00 0.00 ? 175 ASN A CA   6  
ATOM 11291 C C    . ASN A 1 97  ? 12.086  -3.321  -0.590  1.00 0.00 ? 175 ASN A C    6  
ATOM 11292 O O    . ASN A 1 97  ? 11.505  -4.200  0.047   1.00 0.00 ? 175 ASN A O    6  
ATOM 11293 C CB   . ASN A 1 97  ? 13.309  -4.560  -2.387  1.00 0.00 ? 175 ASN A CB   6  
ATOM 11294 C CG   . ASN A 1 97  ? 12.960  -3.861  -3.687  1.00 0.00 ? 175 ASN A CG   6  
ATOM 11295 O OD1  . ASN A 1 97  ? 13.716  -3.021  -4.175  1.00 0.00 ? 175 ASN A OD1  6  
ATOM 11296 N ND2  . ASN A 1 97  ? 11.809  -4.205  -4.253  1.00 0.00 ? 175 ASN A ND2  6  
ATOM 11297 H H    . ASN A 1 97  ? 15.063  -4.760  -0.512  1.00 0.00 ? 175 ASN A H    6  
ATOM 11298 H HA   . ASN A 1 97  ? 13.849  -2.650  -1.588  1.00 0.00 ? 175 ASN A HA   6  
ATOM 11299 H HB2  . ASN A 1 97  ? 14.242  -5.087  -2.524  1.00 0.00 ? 175 ASN A HB2  6  
ATOM 11300 H HB3  . ASN A 1 97  ? 12.528  -5.271  -2.161  1.00 0.00 ? 175 ASN A HB3  6  
ATOM 11301 H HD21 . ASN A 1 97  ? 11.257  -4.881  -3.807  1.00 0.00 ? 175 ASN A HD21 6  
ATOM 11302 H HD22 . ASN A 1 97  ? 11.559  -3.769  -5.094  1.00 0.00 ? 175 ASN A HD22 6  
ATOM 11303 N N    . VAL A 1 98  ? 11.579  -2.107  -0.774  1.00 0.00 ? 176 VAL A N    6  
ATOM 11304 C CA   . VAL A 1 98  ? 10.281  -1.729  -0.227  1.00 0.00 ? 176 VAL A CA   6  
ATOM 11305 C C    . VAL A 1 98  ? 9.204   -1.744  -1.306  1.00 0.00 ? 176 VAL A C    6  
ATOM 11306 O O    . VAL A 1 98  ? 9.058   -0.802  -2.085  1.00 0.00 ? 176 VAL A O    6  
ATOM 11307 C CB   . VAL A 1 98  ? 10.328  -0.331  0.417   1.00 0.00 ? 176 VAL A CB   6  
ATOM 11308 C CG1  . VAL A 1 98  ? 8.978   0.026   1.020   1.00 0.00 ? 176 VAL A CG1  6  
ATOM 11309 C CG2  . VAL A 1 98  ? 11.425  -0.266  1.469   1.00 0.00 ? 176 VAL A CG2  6  
ATOM 11310 H H    . VAL A 1 98  ? 12.089  -1.449  -1.291  1.00 0.00 ? 176 VAL A H    6  
ATOM 11311 H HA   . VAL A 1 98  ? 10.020  -2.446  0.539   1.00 0.00 ? 176 VAL A HA   6  
ATOM 11312 H HB   . VAL A 1 98  ? 10.555  0.391   -0.354  1.00 0.00 ? 176 VAL A HB   6  
ATOM 11313 H HG11 . VAL A 1 98  ? 8.925   -0.351  2.031   1.00 0.00 ? 176 VAL A HG11 6  
ATOM 11314 H HG12 . VAL A 1 98  ? 8.859   1.099   1.027   1.00 0.00 ? 176 VAL A HG12 6  
ATOM 11315 H HG13 . VAL A 1 98  ? 8.192   -0.420  0.429   1.00 0.00 ? 176 VAL A HG13 6  
ATOM 11316 H HG21 . VAL A 1 98  ? 12.238  -0.915  1.181   1.00 0.00 ? 176 VAL A HG21 6  
ATOM 11317 H HG22 . VAL A 1 98  ? 11.787  0.749   1.550   1.00 0.00 ? 176 VAL A HG22 6  
ATOM 11318 H HG23 . VAL A 1 98  ? 11.030  -0.584  2.422   1.00 0.00 ? 176 VAL A HG23 6  
ATOM 11319 N N    . PRO A 1 99  ? 8.430   -2.838  -1.354  1.00 0.00 ? 177 PRO A N    6  
ATOM 11320 C CA   . PRO A 1 99  ? 7.351   -3.002  -2.333  1.00 0.00 ? 177 PRO A CA   6  
ATOM 11321 C C    . PRO A 1 99  ? 6.179   -2.065  -2.066  1.00 0.00 ? 177 PRO A C    6  
ATOM 11322 O O    . PRO A 1 99  ? 6.102   -1.408  -1.027  1.00 0.00 ? 177 PRO A O    6  
ATOM 11323 C CB   . PRO A 1 99  ? 6.923   -4.460  -2.148  1.00 0.00 ? 177 PRO A CB   6  
ATOM 11324 C CG   . PRO A 1 99  ? 7.303   -4.792  -0.747  1.00 0.00 ? 177 PRO A CG   6  
ATOM 11325 C CD   . PRO A 1 99  ? 8.548   -4.000  -0.456  1.00 0.00 ? 177 PRO A CD   6  
ATOM 11326 H HA   . PRO A 1 99  ? 7.706   -2.855  -3.343  1.00 0.00 ? 177 PRO A HA   6  
ATOM 11327 H HB2  . PRO A 1 99  ? 5.856   -4.547  -2.301  1.00 0.00 ? 177 PRO A HB2  6  
ATOM 11328 H HB3  . PRO A 1 99  ? 7.446   -5.085  -2.857  1.00 0.00 ? 177 PRO A HB3  6  
ATOM 11329 H HG2  . PRO A 1 99  ? 6.510   -4.504  -0.073  1.00 0.00 ? 177 PRO A HG2  6  
ATOM 11330 H HG3  . PRO A 1 99  ? 7.504   -5.850  -0.662  1.00 0.00 ? 177 PRO A HG3  6  
ATOM 11331 H HD2  . PRO A 1 99  ? 8.564   -3.688  0.578   1.00 0.00 ? 177 PRO A HD2  6  
ATOM 11332 H HD3  . PRO A 1 99  ? 9.428   -4.580  -0.691  1.00 0.00 ? 177 PRO A HD3  6  
ATOM 11333 N N    . PRO A 1 100 ? 5.242   -1.999  -3.024  1.00 0.00 ? 178 PRO A N    6  
ATOM 11334 C CA   . PRO A 1 100 ? 4.056   -1.145  -2.914  1.00 0.00 ? 178 PRO A CA   6  
ATOM 11335 C C    . PRO A 1 100 ? 3.078   -1.645  -1.856  1.00 0.00 ? 178 PRO A C    6  
ATOM 11336 O O    . PRO A 1 100 ? 2.754   -2.832  -1.809  1.00 0.00 ? 178 PRO A O    6  
ATOM 11337 C CB   . PRO A 1 100 ? 3.427   -1.231  -4.307  1.00 0.00 ? 178 PRO A CB   6  
ATOM 11338 C CG   . PRO A 1 100 ? 3.893   -2.537  -4.854  1.00 0.00 ? 178 PRO A CG   6  
ATOM 11339 C CD   . PRO A 1 100 ? 5.270   -2.754  -4.288  1.00 0.00 ? 178 PRO A CD   6  
ATOM 11340 H HA   . PRO A 1 100 ? 4.323   -0.121  -2.701  1.00 0.00 ? 178 PRO A HA   6  
ATOM 11341 H HB2  . PRO A 1 100 ? 2.350   -1.201  -4.221  1.00 0.00 ? 178 PRO A HB2  6  
ATOM 11342 H HB3  . PRO A 1 100 ? 3.769   -0.405  -4.912  1.00 0.00 ? 178 PRO A HB3  6  
ATOM 11343 H HG2  . PRO A 1 100 ? 3.229   -3.326  -4.537  1.00 0.00 ? 178 PRO A HG2  6  
ATOM 11344 H HG3  . PRO A 1 100 ? 3.935   -2.489  -5.932  1.00 0.00 ? 178 PRO A HG3  6  
ATOM 11345 H HD2  . PRO A 1 100 ? 5.442   -3.804  -4.107  1.00 0.00 ? 178 PRO A HD2  6  
ATOM 11346 H HD3  . PRO A 1 100 ? 6.019   -2.357  -4.957  1.00 0.00 ? 178 PRO A HD3  6  
ATOM 11347 N N    . ILE A 1 101 ? 2.611   -0.733  -1.010  1.00 0.00 ? 179 ILE A N    6  
ATOM 11348 C CA   . ILE A 1 101 ? 1.669   -1.082  0.045   1.00 0.00 ? 179 ILE A CA   6  
ATOM 11349 C C    . ILE A 1 101 ? 0.229   -0.906  -0.423  1.00 0.00 ? 179 ILE A C    6  
ATOM 11350 O O    . ILE A 1 101 ? -0.133  0.133   -0.975  1.00 0.00 ? 179 ILE A O    6  
ATOM 11351 C CB   . ILE A 1 101 ? 1.895   -0.227  1.307   1.00 0.00 ? 179 ILE A CB   6  
ATOM 11352 C CG1  . ILE A 1 101 ? 3.282   -0.500  1.892   1.00 0.00 ? 179 ILE A CG1  6  
ATOM 11353 C CG2  . ILE A 1 101 ? 0.814   -0.510  2.339   1.00 0.00 ? 179 ILE A CG2  6  
ATOM 11354 C CD1  . ILE A 1 101 ? 3.778   0.598   2.807   1.00 0.00 ? 179 ILE A CD1  6  
ATOM 11355 H H    . ILE A 1 101 ? 2.907   0.197   -1.099  1.00 0.00 ? 179 ILE A H    6  
ATOM 11356 H HA   . ILE A 1 101 ? 1.828   -2.119  0.304   1.00 0.00 ? 179 ILE A HA   6  
ATOM 11357 H HB   . ILE A 1 101 ? 1.828   0.813   1.026   1.00 0.00 ? 179 ILE A HB   6  
ATOM 11358 H HG12 . ILE A 1 101 ? 3.253   -1.416  2.460   1.00 0.00 ? 179 ILE A HG12 6  
ATOM 11359 H HG13 . ILE A 1 101 ? 3.992   -0.604  1.084   1.00 0.00 ? 179 ILE A HG13 6  
ATOM 11360 H HG21 . ILE A 1 101 ? 0.055   -1.141  1.901   1.00 0.00 ? 179 ILE A HG21 6  
ATOM 11361 H HG22 . ILE A 1 101 ? 1.251   -1.012  3.189   1.00 0.00 ? 179 ILE A HG22 6  
ATOM 11362 H HG23 . ILE A 1 101 ? 0.369   0.420   2.659   1.00 0.00 ? 179 ILE A HG23 6  
ATOM 11363 H HD11 . ILE A 1 101 ? 4.066   1.456   2.218   1.00 0.00 ? 179 ILE A HD11 6  
ATOM 11364 H HD12 . ILE A 1 101 ? 2.993   0.878   3.493   1.00 0.00 ? 179 ILE A HD12 6  
ATOM 11365 H HD13 . ILE A 1 101 ? 4.633   0.243   3.365   1.00 0.00 ? 179 ILE A HD13 6  
ATOM 11366 N N    . VAL A 1 102 ? -0.590  -1.928  -0.197  1.00 0.00 ? 180 VAL A N    6  
ATOM 11367 C CA   . VAL A 1 102 ? -1.993  -1.886  -0.593  1.00 0.00 ? 180 VAL A CA   6  
ATOM 11368 C C    . VAL A 1 102 ? -2.909  -2.104  0.606   1.00 0.00 ? 180 VAL A C    6  
ATOM 11369 O O    . VAL A 1 102 ? -2.897  -3.168  1.225   1.00 0.00 ? 180 VAL A O    6  
ATOM 11370 C CB   . VAL A 1 102 ? -2.306  -2.948  -1.664  1.00 0.00 ? 180 VAL A CB   6  
ATOM 11371 C CG1  . VAL A 1 102 ? -3.745  -2.819  -2.139  1.00 0.00 ? 180 VAL A CG1  6  
ATOM 11372 C CG2  . VAL A 1 102 ? -1.338  -2.828  -2.831  1.00 0.00 ? 180 VAL A CG2  6  
ATOM 11373 H H    . VAL A 1 102 ? -0.243  -2.730  0.248   1.00 0.00 ? 180 VAL A H    6  
ATOM 11374 H HA   . VAL A 1 102 ? -2.192  -0.911  -1.013  1.00 0.00 ? 180 VAL A HA   6  
ATOM 11375 H HB   . VAL A 1 102 ? -2.183  -3.925  -1.220  1.00 0.00 ? 180 VAL A HB   6  
ATOM 11376 H HG11 . VAL A 1 102 ? -4.292  -2.181  -1.461  1.00 0.00 ? 180 VAL A HG11 6  
ATOM 11377 H HG12 . VAL A 1 102 ? -3.760  -2.391  -3.130  1.00 0.00 ? 180 VAL A HG12 6  
ATOM 11378 H HG13 . VAL A 1 102 ? -4.205  -3.796  -2.161  1.00 0.00 ? 180 VAL A HG13 6  
ATOM 11379 H HG21 . VAL A 1 102 ? -1.895  -2.733  -3.751  1.00 0.00 ? 180 VAL A HG21 6  
ATOM 11380 H HG22 . VAL A 1 102 ? -0.715  -1.955  -2.695  1.00 0.00 ? 180 VAL A HG22 6  
ATOM 11381 H HG23 . VAL A 1 102 ? -0.716  -3.710  -2.876  1.00 0.00 ? 180 VAL A HG23 6  
ATOM 11382 N N    . PHE A 1 103 ? -3.704  -1.089  0.929   1.00 0.00 ? 181 PHE A N    6  
ATOM 11383 C CA   . PHE A 1 103 ? -4.627  -1.169  2.054   1.00 0.00 ? 181 PHE A CA   6  
ATOM 11384 C C    . PHE A 1 103 ? -5.910  -1.894  1.656   1.00 0.00 ? 181 PHE A C    6  
ATOM 11385 O O    . PHE A 1 103 ? -6.614  -1.474  0.737   1.00 0.00 ? 181 PHE A O    6  
ATOM 11386 C CB   . PHE A 1 103 ? -4.959  0.233   2.570   1.00 0.00 ? 181 PHE A CB   6  
ATOM 11387 C CG   . PHE A 1 103 ? -3.789  0.932   3.200   1.00 0.00 ? 181 PHE A CG   6  
ATOM 11388 C CD1  . PHE A 1 103 ? -3.256  0.478   4.396   1.00 0.00 ? 181 PHE A CD1  6  
ATOM 11389 C CD2  . PHE A 1 103 ? -3.222  2.044   2.597   1.00 0.00 ? 181 PHE A CD2  6  
ATOM 11390 C CE1  . PHE A 1 103 ? -2.180  1.121   4.978   1.00 0.00 ? 181 PHE A CE1  6  
ATOM 11391 C CE2  . PHE A 1 103 ? -2.146  2.690   3.174   1.00 0.00 ? 181 PHE A CE2  6  
ATOM 11392 C CZ   . PHE A 1 103 ? -1.623  2.227   4.366   1.00 0.00 ? 181 PHE A CZ   6  
ATOM 11393 H H    . PHE A 1 103 ? -3.668  -0.266  0.397   1.00 0.00 ? 181 PHE A H    6  
ATOM 11394 H HA   . PHE A 1 103 ? -4.143  -1.727  2.841   1.00 0.00 ? 181 PHE A HA   6  
ATOM 11395 H HB2  . PHE A 1 103 ? -5.303  0.839   1.745   1.00 0.00 ? 181 PHE A HB2  6  
ATOM 11396 H HB3  . PHE A 1 103 ? -5.742  0.160   3.309   1.00 0.00 ? 181 PHE A HB3  6  
ATOM 11397 H HD1  . PHE A 1 103 ? -3.689  -0.387  4.875   1.00 0.00 ? 181 PHE A HD1  6  
ATOM 11398 H HD2  . PHE A 1 103 ? -3.631  2.406   1.664   1.00 0.00 ? 181 PHE A HD2  6  
ATOM 11399 H HE1  . PHE A 1 103 ? -1.773  0.757   5.910   1.00 0.00 ? 181 PHE A HE1  6  
ATOM 11400 H HE2  . PHE A 1 103 ? -1.713  3.555   2.693   1.00 0.00 ? 181 PHE A HE2  6  
ATOM 11401 H HZ   . PHE A 1 103 ? -0.783  2.731   4.819   1.00 0.00 ? 181 PHE A HZ   6  
ATOM 11402 N N    . VAL A 1 104 ? -6.207  -2.986  2.353   1.00 0.00 ? 182 VAL A N    6  
ATOM 11403 C CA   . VAL A 1 104 ? -7.404  -3.769  2.073   1.00 0.00 ? 182 VAL A CA   6  
ATOM 11404 C C    . VAL A 1 104 ? -8.298  -3.866  3.304   1.00 0.00 ? 182 VAL A C    6  
ATOM 11405 O O    . VAL A 1 104 ? -7.811  -3.951  4.431   1.00 0.00 ? 182 VAL A O    6  
ATOM 11406 C CB   . VAL A 1 104 ? -7.047  -5.191  1.599   1.00 0.00 ? 182 VAL A CB   6  
ATOM 11407 C CG1  . VAL A 1 104 ? -8.304  -6.028  1.427   1.00 0.00 ? 182 VAL A CG1  6  
ATOM 11408 C CG2  . VAL A 1 104 ? -6.251  -5.135  0.304   1.00 0.00 ? 182 VAL A CG2  6  
ATOM 11409 H H    . VAL A 1 104 ? -5.607  -3.271  3.073   1.00 0.00 ? 182 VAL A H    6  
ATOM 11410 H HA   . VAL A 1 104 ? -7.949  -3.275  1.282   1.00 0.00 ? 182 VAL A HA   6  
ATOM 11411 H HB   . VAL A 1 104 ? -6.432  -5.656  2.355   1.00 0.00 ? 182 VAL A HB   6  
ATOM 11412 H HG11 . VAL A 1 104 ? -8.116  -6.817  0.713   1.00 0.00 ? 182 VAL A HG11 6  
ATOM 11413 H HG12 . VAL A 1 104 ? -8.583  -6.460  2.377   1.00 0.00 ? 182 VAL A HG12 6  
ATOM 11414 H HG13 . VAL A 1 104 ? -9.107  -5.402  1.066   1.00 0.00 ? 182 VAL A HG13 6  
ATOM 11415 H HG21 . VAL A 1 104 ? -6.094  -4.105  0.022   1.00 0.00 ? 182 VAL A HG21 6  
ATOM 11416 H HG22 . VAL A 1 104 ? -5.295  -5.619  0.447   1.00 0.00 ? 182 VAL A HG22 6  
ATOM 11417 H HG23 . VAL A 1 104 ? -6.797  -5.644  -0.477  1.00 0.00 ? 182 VAL A HG23 6  
ATOM 11418 N N    . GLN A 1 105 ? -9.608  -3.852  3.080   1.00 0.00 ? 183 GLN A N    6  
ATOM 11419 C CA   . GLN A 1 105 ? -10.570 -3.938  4.172   1.00 0.00 ? 183 GLN A CA   6  
ATOM 11420 C C    . GLN A 1 105 ? -10.582 -5.337  4.779   1.00 0.00 ? 183 GLN A C    6  
ATOM 11421 O O    . GLN A 1 105 ? -10.711 -6.333  4.066   1.00 0.00 ? 183 GLN A O    6  
ATOM 11422 C CB   . GLN A 1 105 ? -11.970 -3.573  3.676   1.00 0.00 ? 183 GLN A CB   6  
ATOM 11423 C CG   . GLN A 1 105 ? -12.144 -2.093  3.379   1.00 0.00 ? 183 GLN A CG   6  
ATOM 11424 C CD   . GLN A 1 105 ? -13.421 -1.796  2.618   1.00 0.00 ? 183 GLN A CD   6  
ATOM 11425 O OE1  . GLN A 1 105 ? -13.401 -1.601  1.402   1.00 0.00 ? 183 GLN A OE1  6  
ATOM 11426 N NE2  . GLN A 1 105 ? -14.540 -1.759  3.331   1.00 0.00 ? 183 GLN A NE2  6  
ATOM 11427 H H    . GLN A 1 105 ? -9.935  -3.783  2.160   1.00 0.00 ? 183 GLN A H    6  
ATOM 11428 H HA   . GLN A 1 105 ? -10.272 -3.232  4.933   1.00 0.00 ? 183 GLN A HA   6  
ATOM 11429 H HB2  . GLN A 1 105 ? -12.175 -4.126  2.772   1.00 0.00 ? 183 GLN A HB2  6  
ATOM 11430 H HB3  . GLN A 1 105 ? -12.691 -3.853  4.431   1.00 0.00 ? 183 GLN A HB3  6  
ATOM 11431 H HG2  . GLN A 1 105 ? -12.166 -1.551  4.313   1.00 0.00 ? 183 GLN A HG2  6  
ATOM 11432 H HG3  . GLN A 1 105 ? -11.304 -1.756  2.789   1.00 0.00 ? 183 GLN A HG3  6  
ATOM 11433 H HE21 . GLN A 1 105 ? -14.480 -1.922  4.296   1.00 0.00 ? 183 GLN A HE21 6  
ATOM 11434 H HE22 . GLN A 1 105 ? -15.380 -1.569  2.864   1.00 0.00 ? 183 GLN A HE22 6  
ATOM 11435 N N    . ASP A 1 106 ? -10.445 -5.405  6.099   1.00 0.00 ? 184 ASP A N    6  
ATOM 11436 C CA   . ASP A 1 106 ? -10.440 -6.683  6.802   1.00 0.00 ? 184 ASP A CA   6  
ATOM 11437 C C    . ASP A 1 106 ? -11.406 -7.667  6.149   1.00 0.00 ? 184 ASP A C    6  
ATOM 11438 O O    . ASP A 1 106 ? -11.026 -8.780  5.787   1.00 0.00 ? 184 ASP A O    6  
ATOM 11439 C CB   . ASP A 1 106 ? -10.814 -6.482  8.271   1.00 0.00 ? 184 ASP A CB   6  
ATOM 11440 C CG   . ASP A 1 106 ? -11.460 -7.712  8.878   1.00 0.00 ? 184 ASP A CG   6  
ATOM 11441 O OD1  . ASP A 1 106 ? -10.831 -8.790  8.846   1.00 0.00 ? 184 ASP A OD1  6  
ATOM 11442 O OD2  . ASP A 1 106 ? -12.595 -7.596  9.385   1.00 0.00 ? 184 ASP A OD2  6  
ATOM 11443 H H    . ASP A 1 106 ? -10.346 -4.576  6.612   1.00 0.00 ? 184 ASP A H    6  
ATOM 11444 H HA   . ASP A 1 106 ? -9.441  -7.088  6.746   1.00 0.00 ? 184 ASP A HA   6  
ATOM 11445 H HB2  . ASP A 1 106 ? -9.921  -6.253  8.835   1.00 0.00 ? 184 ASP A HB2  6  
ATOM 11446 H HB3  . ASP A 1 106 ? -11.506 -5.657  8.351   1.00 0.00 ? 184 ASP A HB3  6  
ATOM 11447 N N    . LYS A 1 107 ? -12.659 -7.248  6.001   1.00 0.00 ? 185 LYS A N    6  
ATOM 11448 C CA   . LYS A 1 107 ? -13.681 -8.091  5.392   1.00 0.00 ? 185 LYS A CA   6  
ATOM 11449 C C    . LYS A 1 107 ? -13.282 -8.490  3.975   1.00 0.00 ? 185 LYS A C    6  
ATOM 11450 O O    . LYS A 1 107 ? -13.358 -9.661  3.605   1.00 0.00 ? 185 LYS A O    6  
ATOM 11451 C CB   . LYS A 1 107 ? -15.025 -7.360  5.368   1.00 0.00 ? 185 LYS A CB   6  
ATOM 11452 C CG   . LYS A 1 107 ? -14.960 -5.986  4.725   1.00 0.00 ? 185 LYS A CG   6  
ATOM 11453 C CD   . LYS A 1 107 ? -15.998 -5.045  5.313   1.00 0.00 ? 185 LYS A CD   6  
ATOM 11454 C CE   . LYS A 1 107 ? -15.477 -4.349  6.561   1.00 0.00 ? 185 LYS A CE   6  
ATOM 11455 N NZ   . LYS A 1 107 ? -16.586 -3.852  7.422   1.00 0.00 ? 185 LYS A NZ   6  
ATOM 11456 H H    . LYS A 1 107 ? -12.902 -6.349  6.309   1.00 0.00 ? 185 LYS A H    6  
ATOM 11457 H HA   . LYS A 1 107 ? -13.776 -8.983  5.991   1.00 0.00 ? 185 LYS A HA   6  
ATOM 11458 H HB2  . LYS A 1 107 ? -15.737 -7.958  4.817   1.00 0.00 ? 185 LYS A HB2  6  
ATOM 11459 H HB3  . LYS A 1 107 ? -15.376 -7.244  6.383   1.00 0.00 ? 185 LYS A HB3  6  
ATOM 11460 H HG2  . LYS A 1 107 ? -13.978 -5.568  4.890   1.00 0.00 ? 185 LYS A HG2  6  
ATOM 11461 H HG3  . LYS A 1 107 ? -15.137 -6.085  3.664   1.00 0.00 ? 185 LYS A HG3  6  
ATOM 11462 H HD2  . LYS A 1 107 ? -16.252 -4.297  4.577   1.00 0.00 ? 185 LYS A HD2  6  
ATOM 11463 H HD3  . LYS A 1 107 ? -16.881 -5.613  5.570   1.00 0.00 ? 185 LYS A HD3  6  
ATOM 11464 H HE2  . LYS A 1 107 ? -14.881 -5.050  7.126   1.00 0.00 ? 185 LYS A HE2  6  
ATOM 11465 H HE3  . LYS A 1 107 ? -14.863 -3.513  6.261   1.00 0.00 ? 185 LYS A HE3  6  
ATOM 11466 H HZ1  . LYS A 1 107 ? -17.047 -3.034  6.974   1.00 0.00 ? 185 LYS A HZ1  6  
ATOM 11467 H HZ2  . LYS A 1 107 ? -16.215 -3.561  8.349   1.00 0.00 ? 185 LYS A HZ2  6  
ATOM 11468 H HZ3  . LYS A 1 107 ? -17.293 -4.601  7.563   1.00 0.00 ? 185 LYS A HZ3  6  
ATOM 11469 N N    . GLY A 1 108 ? -12.856 -7.509  3.185   1.00 0.00 ? 186 GLY A N    6  
ATOM 11470 C CA   . GLY A 1 108 ? -12.450 -7.780  1.818   1.00 0.00 ? 186 GLY A CA   6  
ATOM 11471 C C    . GLY A 1 108 ? -13.627 -8.097  0.916   1.00 0.00 ? 186 GLY A C    6  
ATOM 11472 O O    . GLY A 1 108 ? -13.936 -7.338  -0.002  1.00 0.00 ? 186 GLY A O    6  
ATOM 11473 H H    . GLY A 1 108 ? -12.817 -6.594  3.534   1.00 0.00 ? 186 GLY A H    6  
ATOM 11474 H HA2  . GLY A 1 108 ? -11.935 -6.914  1.429   1.00 0.00 ? 186 GLY A HA2  6  
ATOM 11475 H HA3  . GLY A 1 108 ? -11.773 -8.621  1.816   1.00 0.00 ? 186 GLY A HA3  6  
ATOM 11476 N N    . ASN A 1 109 ? -14.284 -9.222  1.177   1.00 0.00 ? 187 ASN A N    6  
ATOM 11477 C CA   . ASN A 1 109 ? -15.432 -9.639  0.380   1.00 0.00 ? 187 ASN A CA   6  
ATOM 11478 C C    . ASN A 1 109 ? -16.532 -10.213 1.269   1.00 0.00 ? 187 ASN A C    6  
ATOM 11479 O O    . ASN A 1 109 ? -16.296 -10.543 2.431   1.00 0.00 ? 187 ASN A O    6  
ATOM 11480 C CB   . ASN A 1 109 ? -15.007 -10.678 -0.659  1.00 0.00 ? 187 ASN A CB   6  
ATOM 11481 C CG   . ASN A 1 109 ? -13.919 -10.162 -1.581  1.00 0.00 ? 187 ASN A CG   6  
ATOM 11482 O OD1  . ASN A 1 109 ? -14.201 -9.602  -2.640  1.00 0.00 ? 187 ASN A OD1  6  
ATOM 11483 N ND2  . ASN A 1 109 ? -12.667 -10.350 -1.180  1.00 0.00 ? 187 ASN A ND2  6  
ATOM 11484 H H    . ASN A 1 109 ? -13.990 -9.786  1.923   1.00 0.00 ? 187 ASN A H    6  
ATOM 11485 H HA   . ASN A 1 109 ? -15.815 -8.768  -0.130  1.00 0.00 ? 187 ASN A HA   6  
ATOM 11486 H HB2  . ASN A 1 109 ? -14.635 -11.556 -0.151  1.00 0.00 ? 187 ASN A HB2  6  
ATOM 11487 H HB3  . ASN A 1 109 ? -15.863 -10.950 -1.259  1.00 0.00 ? 187 ASN A HB3  6  
ATOM 11488 H HD21 . ASN A 1 109 ? -12.517 -10.804 -0.325  1.00 0.00 ? 187 ASN A HD21 6  
ATOM 11489 H HD22 . ASN A 1 109 ? -11.943 -10.025 -1.757  1.00 0.00 ? 187 ASN A HD22 6  
ATOM 11490 N N    . ALA A 1 110 ? -17.734 -10.328 0.714   1.00 0.00 ? 188 ALA A N    6  
ATOM 11491 C CA   . ALA A 1 110 ? -18.869 -10.864 1.454   1.00 0.00 ? 188 ALA A CA   6  
ATOM 11492 C C    . ALA A 1 110 ? -19.345 -12.181 0.852   1.00 0.00 ? 188 ALA A C    6  
ATOM 11493 O O    . ALA A 1 110 ? -19.198 -12.415 -0.347  1.00 0.00 ? 188 ALA A O    6  
ATOM 11494 C CB   . ALA A 1 110 ? -20.006 -9.853  1.482   1.00 0.00 ? 188 ALA A CB   6  
ATOM 11495 H H    . ALA A 1 110 ? -17.859 -10.047 -0.216  1.00 0.00 ? 188 ALA A H    6  
ATOM 11496 H HA   . ALA A 1 110 ? -18.551 -11.039 2.472   1.00 0.00 ? 188 ALA A HA   6  
ATOM 11497 H HB1  . ALA A 1 110 ? -20.084 -9.428  2.472   1.00 0.00 ? 188 ALA A HB1  6  
ATOM 11498 H HB2  . ALA A 1 110 ? -19.807 -9.068  0.768   1.00 0.00 ? 188 ALA A HB2  6  
ATOM 11499 H HB3  . ALA A 1 110 ? -20.932 -10.346 1.227   1.00 0.00 ? 188 ALA A HB3  6  
ATOM 11500 N N    . ALA A 1 111 ? -19.914 -13.039 1.692   1.00 0.00 ? 189 ALA A N    6  
ATOM 11501 C CA   . ALA A 1 111 ? -20.413 -14.333 1.242   1.00 0.00 ? 189 ALA A CA   6  
ATOM 11502 C C    . ALA A 1 111 ? -21.936 -14.340 1.170   1.00 0.00 ? 189 ALA A C    6  
ATOM 11503 O O    . ALA A 1 111 ? -22.609 -14.785 2.101   1.00 0.00 ? 189 ALA A O    6  
ATOM 11504 C CB   . ALA A 1 111 ? -19.921 -15.438 2.165   1.00 0.00 ? 189 ALA A CB   6  
ATOM 11505 H H    . ALA A 1 111 ? -20.002 -12.796 2.637   1.00 0.00 ? 189 ALA A H    6  
ATOM 11506 H HA   . ALA A 1 111 ? -20.015 -14.518 0.254   1.00 0.00 ? 189 ALA A HA   6  
ATOM 11507 H HB1  . ALA A 1 111 ? -20.654 -16.230 2.199   1.00 0.00 ? 189 ALA A HB1  6  
ATOM 11508 H HB2  . ALA A 1 111 ? -18.986 -15.829 1.791   1.00 0.00 ? 189 ALA A HB2  6  
ATOM 11509 H HB3  . ALA A 1 111 ? -19.774 -15.040 3.157   1.00 0.00 ? 189 ALA A HB3  6  
ATOM 11510 N N    . LEU A 1 112 ? -22.473 -13.843 0.062   1.00 0.00 ? 190 LEU A N    6  
ATOM 11511 C CA   . LEU A 1 112 ? -23.919 -13.791 -0.131  1.00 0.00 ? 190 LEU A CA   6  
ATOM 11512 C C    . LEU A 1 112 ? -24.332 -14.587 -1.365  1.00 0.00 ? 190 LEU A C    6  
ATOM 11513 O O    . LEU A 1 112 ? -23.659 -14.549 -2.394  1.00 0.00 ? 190 LEU A O    6  
ATOM 11514 C CB   . LEU A 1 112 ? -24.383 -12.340 -0.266  1.00 0.00 ? 190 LEU A CB   6  
ATOM 11515 C CG   . LEU A 1 112 ? -23.937 -11.608 -1.532  1.00 0.00 ? 190 LEU A CG   6  
ATOM 11516 C CD1  . LEU A 1 112 ? -24.963 -10.558 -1.931  1.00 0.00 ? 190 LEU A CD1  6  
ATOM 11517 C CD2  . LEU A 1 112 ? -22.571 -10.970 -1.326  1.00 0.00 ? 190 LEU A CD2  6  
ATOM 11518 H H    . LEU A 1 112 ? -21.886 -13.503 -0.644  1.00 0.00 ? 190 LEU A H    6  
ATOM 11519 H HA   . LEU A 1 112 ? -24.385 -14.230 0.739   1.00 0.00 ? 190 LEU A HA   6  
ATOM 11520 H HB2  . LEU A 1 112 ? -25.462 -12.335 -0.244  1.00 0.00 ? 190 LEU A HB2  6  
ATOM 11521 H HB3  . LEU A 1 112 ? -24.005 -11.792 0.585   1.00 0.00 ? 190 LEU A HB3  6  
ATOM 11522 H HG   . LEU A 1 112 ? -23.857 -12.320 -2.342  1.00 0.00 ? 190 LEU A HG   6  
ATOM 11523 H HD11 . LEU A 1 112 ? -24.672 -9.600  -1.530  1.00 0.00 ? 190 LEU A HD11 6  
ATOM 11524 H HD12 . LEU A 1 112 ? -25.931 -10.834 -1.539  1.00 0.00 ? 190 LEU A HD12 6  
ATOM 11525 H HD13 . LEU A 1 112 ? -25.015 -10.498 -3.009  1.00 0.00 ? 190 LEU A HD13 6  
ATOM 11526 H HD21 . LEU A 1 112 ? -22.547 -10.007 -1.815  1.00 0.00 ? 190 LEU A HD21 6  
ATOM 11527 H HD22 . LEU A 1 112 ? -21.809 -11.608 -1.750  1.00 0.00 ? 190 LEU A HD22 6  
ATOM 11528 H HD23 . LEU A 1 112 ? -22.389 -10.843 -0.270  1.00 0.00 ? 190 LEU A HD23 6  
ATOM 11529 N N    . ALA A 1 113 ? -25.445 -15.305 -1.254  1.00 0.00 ? 191 ALA A N    6  
ATOM 11530 C CA   . ALA A 1 113 ? -25.951 -16.106 -2.361  1.00 0.00 ? 191 ALA A CA   6  
ATOM 11531 C C    . ALA A 1 113 ? -27.404 -15.761 -2.670  1.00 0.00 ? 191 ALA A C    6  
ATOM 11532 O O    . ALA A 1 113 ? -28.324 -16.404 -2.164  1.00 0.00 ? 191 ALA A O    6  
ATOM 11533 C CB   . ALA A 1 113 ? -25.813 -17.588 -2.047  1.00 0.00 ? 191 ALA A CB   6  
ATOM 11534 H H    . ALA A 1 113 ? -25.938 -15.295 -0.407  1.00 0.00 ? 191 ALA A H    6  
ATOM 11535 H HA   . ALA A 1 113 ? -25.348 -15.891 -3.232  1.00 0.00 ? 191 ALA A HA   6  
ATOM 11536 H HB1  . ALA A 1 113 ? -26.794 -18.040 -2.007  1.00 0.00 ? 191 ALA A HB1  6  
ATOM 11537 H HB2  . ALA A 1 113 ? -25.227 -18.067 -2.817  1.00 0.00 ? 191 ALA A HB2  6  
ATOM 11538 H HB3  . ALA A 1 113 ? -25.323 -17.709 -1.092  1.00 0.00 ? 191 ALA A HB3  6  
ATOM 1