data_2EH0
# 
_entry.id   2EH0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2EH0         
RCSB  RCSB026653   
WWPDB D_1000026653 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hsk002000575.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2EH0 
_pdbx_database_status.recvd_initial_deposition_date   2007-03-02 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Inoue, K.'                                              1 
'Nagashima, T.'                                          2 
'Hayashi, F.'                                            3 
'Yokoyama, S.'                                           4 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 5 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of the FHA domain from human Kinesin-like protein KIF1B' 
_citation.journal_abbrev            'to be published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Inoue, K.'     1 
primary 'Nagashima, T.' 2 
primary 'Hayashi, F.'   3 
primary 'Yokoyama, S.'  4 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Kinesin-like protein KIF1B' 
_entity.formula_weight             14459.121 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'FHA domain' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        Klp 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGTPHLVNLNEDPLMSECLLYYIKDGITRVGQADAERRQDIVLSGAHIKEEHCIFRSERSNSGEVIVTLEPCERS
ETYVNGKRVSQPVQLRSGNRIIMGKNHVFRFNHPEQARAEREKTSGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGTPHLVNLNEDPLMSECLLYYIKDGITRVGQADAERRQDIVLSGAHIKEEHCIFRSERSNSGEVIVTLEPCERS
ETYVNGKRVSQPVQLRSGNRIIMGKNHVFRFNHPEQARAEREKTSGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hsk002000575.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   THR n 
1 9   PRO n 
1 10  HIS n 
1 11  LEU n 
1 12  VAL n 
1 13  ASN n 
1 14  LEU n 
1 15  ASN n 
1 16  GLU n 
1 17  ASP n 
1 18  PRO n 
1 19  LEU n 
1 20  MET n 
1 21  SER n 
1 22  GLU n 
1 23  CYS n 
1 24  LEU n 
1 25  LEU n 
1 26  TYR n 
1 27  TYR n 
1 28  ILE n 
1 29  LYS n 
1 30  ASP n 
1 31  GLY n 
1 32  ILE n 
1 33  THR n 
1 34  ARG n 
1 35  VAL n 
1 36  GLY n 
1 37  GLN n 
1 38  ALA n 
1 39  ASP n 
1 40  ALA n 
1 41  GLU n 
1 42  ARG n 
1 43  ARG n 
1 44  GLN n 
1 45  ASP n 
1 46  ILE n 
1 47  VAL n 
1 48  LEU n 
1 49  SER n 
1 50  GLY n 
1 51  ALA n 
1 52  HIS n 
1 53  ILE n 
1 54  LYS n 
1 55  GLU n 
1 56  GLU n 
1 57  HIS n 
1 58  CYS n 
1 59  ILE n 
1 60  PHE n 
1 61  ARG n 
1 62  SER n 
1 63  GLU n 
1 64  ARG n 
1 65  SER n 
1 66  ASN n 
1 67  SER n 
1 68  GLY n 
1 69  GLU n 
1 70  VAL n 
1 71  ILE n 
1 72  VAL n 
1 73  THR n 
1 74  LEU n 
1 75  GLU n 
1 76  PRO n 
1 77  CYS n 
1 78  GLU n 
1 79  ARG n 
1 80  SER n 
1 81  GLU n 
1 82  THR n 
1 83  TYR n 
1 84  VAL n 
1 85  ASN n 
1 86  GLY n 
1 87  LYS n 
1 88  ARG n 
1 89  VAL n 
1 90  SER n 
1 91  GLN n 
1 92  PRO n 
1 93  VAL n 
1 94  GLN n 
1 95  LEU n 
1 96  ARG n 
1 97  SER n 
1 98  GLY n 
1 99  ASN n 
1 100 ARG n 
1 101 ILE n 
1 102 ILE n 
1 103 MET n 
1 104 GLY n 
1 105 LYS n 
1 106 ASN n 
1 107 HIS n 
1 108 VAL n 
1 109 PHE n 
1 110 ARG n 
1 111 PHE n 
1 112 ASN n 
1 113 HIS n 
1 114 PRO n 
1 115 GLU n 
1 116 GLN n 
1 117 ALA n 
1 118 ARG n 
1 119 ALA n 
1 120 GLU n 
1 121 ARG n 
1 122 GLU n 
1 123 LYS n 
1 124 THR n 
1 125 SER n 
1 126 GLY n 
1 127 PRO n 
1 128 SER n 
1 129 SER n 
1 130 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P050725-20 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    KIF1B_HUMAN 
_struct_ref.pdbx_db_accession          O60333 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;TPHLVNLNEDPLMSECLLYYIKDGITRVGQADAERRQDIVLSGAHIKEEHCIFRSERSNSGEVIVTLEPCERSETYVNGK
RVSQPVQLRSGNRIIMGKNHVFRFNHPEQARAEREKT
;
_struct_ref.pdbx_align_begin           531 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2EH0 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 124 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O60333 
_struct_ref_seq.db_align_beg                  531 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  647 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       124 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2EH0 GLY A 1   ? UNP O60333 ? ? 'EXPRESSION TAG' 1   1  
1 2EH0 SER A 2   ? UNP O60333 ? ? 'EXPRESSION TAG' 2   2  
1 2EH0 SER A 3   ? UNP O60333 ? ? 'EXPRESSION TAG' 3   3  
1 2EH0 GLY A 4   ? UNP O60333 ? ? 'EXPRESSION TAG' 4   4  
1 2EH0 SER A 5   ? UNP O60333 ? ? 'EXPRESSION TAG' 5   5  
1 2EH0 SER A 6   ? UNP O60333 ? ? 'EXPRESSION TAG' 6   6  
1 2EH0 GLY A 7   ? UNP O60333 ? ? 'EXPRESSION TAG' 7   7  
1 2EH0 SER A 125 ? UNP O60333 ? ? 'EXPRESSION TAG' 125 8  
1 2EH0 GLY A 126 ? UNP O60333 ? ? 'EXPRESSION TAG' 126 9  
1 2EH0 PRO A 127 ? UNP O60333 ? ? 'EXPRESSION TAG' 127 10 
1 2EH0 SER A 128 ? UNP O60333 ? ? 'EXPRESSION TAG' 128 11 
1 2EH0 SER A 129 ? UNP O60333 ? ? 'EXPRESSION TAG' 129 12 
1 2EH0 GLY A 130 ? UNP O60333 ? ? 'EXPRESSION TAG' 130 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY 1 
2 1 3D_13C-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'1.32mM U-15N, 13C-labeled protein; 20mM d-Tris-HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 INOVA Varian 800 ? 
2 INOVA Varian 900 ? 
# 
_pdbx_nmr_refine.entry_id           2EH0 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   2EH0 
_pdbx_nmr_details.text       'spectrometer_id 1 for 3D_15N_separated_NOESY; spectrometer_id 2 for 3D_13C_separated_NOESY;' 
# 
_pdbx_nmr_ensemble.entry_id                                      2EH0 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'structures with the least restraint violations, structures with the lowest energy, target function' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2EH0 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           VNMR    6.1C     Varian          1 
processing           NMRPipe 20060324 'Delaglio, F.'  2 
'data analysis'      NMRView 5.0.4    'Johnson, B.A.' 3 
'data analysis'      Kujira  0.9807   'Kobayashi, N.' 4 
'structure solution' CYANA   2.1      'Guntert, P.'   5 
refinement           CYANA   2.1      'Guntert, P.'   6 
# 
_exptl.entry_id          2EH0 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2EH0 
_struct.title                     'Solution structure of the FHA domain from human Kinesin-like protein KIF1B' 
_struct.pdbx_descriptor           'Kinesin-like protein KIF1B' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2EH0 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
_struct_keywords.text            
;FHA domain, Kinesin-like protein KIF1B, Klp, KIF1B, KIAA0591, KIAA1448, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSPORT PROTEIN
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       HIS 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        113 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       ARG 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        118 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        HIS 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         113 
_struct_conf.end_auth_comp_id        ARG 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         118 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 5 ? 
C ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 25  ? TYR A 27  ? LEU A 25  TYR A 27  
A 2 HIS A 10  ? VAL A 12  ? HIS A 10  VAL A 12  
A 3 ARG A 110 ? ASN A 112 ? ARG A 110 ASN A 112 
B 1 ILE A 46  ? VAL A 47  ? ILE A 46  VAL A 47  
B 2 GLY A 31  ? GLY A 36  ? GLY A 31  GLY A 36  
B 3 CYS A 58  ? ARG A 64  ? CYS A 58  ARG A 64  
B 4 VAL A 70  ? LEU A 74  ? VAL A 70  LEU A 74  
B 5 VAL A 93  ? GLN A 94  ? VAL A 93  GLN A 94  
C 1 LYS A 87  ? ARG A 88  ? LYS A 87  ARG A 88  
C 2 THR A 82  ? VAL A 84  ? THR A 82  VAL A 84  
C 3 ILE A 102 ? MET A 103 ? ILE A 102 MET A 103 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O TYR A 26 ? O TYR A 26 N LEU A 11  ? N LEU A 11  
A 2 3 N HIS A 10 ? N HIS A 10 O ASN A 112 ? O ASN A 112 
B 1 2 O ILE A 46 ? O ILE A 46 N GLY A 36  ? N GLY A 36  
B 2 3 N VAL A 35 ? N VAL A 35 O CYS A 58  ? O CYS A 58  
B 3 4 N ARG A 61 ? N ARG A 61 O THR A 73  ? O THR A 73  
B 4 5 N LEU A 74 ? N LEU A 74 O VAL A 93  ? O VAL A 93  
C 1 2 O LYS A 87 ? O LYS A 87 N VAL A 84  ? N VAL A 84  
C 2 3 N TYR A 83 ? N TYR A 83 O ILE A 102 ? O ILE A 102 
# 
_database_PDB_matrix.entry_id          2EH0 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2EH0 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? -4.162  1.968   -23.106 1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? -3.594  0.863   -23.855 1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? -3.924  -0.483  -23.241 1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? -4.911  -0.618  -22.518 1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? -3.802  2.873   -23.222 1.00 0.00 ? 1   GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? -3.977  0.891   -24.864 1.00 0.00 ? 1   GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? -2.520  0.977   -23.885 1.00 0.00 ? 1   GLY A HA3  1  
ATOM 8     N N    . SER A 1 2   ? -3.098  -1.483  -23.532 1.00 0.00 ? 2   SER A N    1  
ATOM 9     C CA   . SER A 1 2   ? -3.311  -2.828  -23.008 1.00 0.00 ? 2   SER A CA   1  
ATOM 10    C C    . SER A 1 2   ? -2.087  -3.310  -22.236 1.00 0.00 ? 2   SER A C    1  
ATOM 11    O O    . SER A 1 2   ? -1.074  -3.685  -22.828 1.00 0.00 ? 2   SER A O    1  
ATOM 12    C CB   . SER A 1 2   ? -3.624  -3.798  -24.149 1.00 0.00 ? 2   SER A CB   1  
ATOM 13    O OG   . SER A 1 2   ? -4.609  -3.265  -25.017 1.00 0.00 ? 2   SER A OG   1  
ATOM 14    H H    . SER A 1 2   ? -2.329  -1.313  -24.115 1.00 0.00 ? 2   SER A H    1  
ATOM 15    H HA   . SER A 1 2   ? -4.155  -2.792  -22.336 1.00 0.00 ? 2   SER A HA   1  
ATOM 16    H HB2  . SER A 1 2   ? -2.725  -3.985  -24.716 1.00 0.00 ? 2   SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2   ? -3.990  -4.728  -23.736 1.00 0.00 ? 2   SER A HB3  1  
ATOM 18    H HG   . SER A 1 2   ? -5.482  -3.443  -24.659 1.00 0.00 ? 2   SER A HG   1  
ATOM 19    N N    . SER A 1 3   ? -2.188  -3.297  -20.911 1.00 0.00 ? 3   SER A N    1  
ATOM 20    C CA   . SER A 1 3   ? -1.088  -3.729  -20.057 1.00 0.00 ? 3   SER A CA   1  
ATOM 21    C C    . SER A 1 3   ? -1.234  -5.202  -19.686 1.00 0.00 ? 3   SER A C    1  
ATOM 22    O O    . SER A 1 3   ? -0.415  -6.035  -20.072 1.00 0.00 ? 3   SER A O    1  
ATOM 23    C CB   . SER A 1 3   ? -1.034  -2.875  -18.788 1.00 0.00 ? 3   SER A CB   1  
ATOM 24    O OG   . SER A 1 3   ? -0.395  -3.571  -17.732 1.00 0.00 ? 3   SER A OG   1  
ATOM 25    H H    . SER A 1 3   ? -3.021  -2.987  -20.499 1.00 0.00 ? 3   SER A H    1  
ATOM 26    H HA   . SER A 1 3   ? -0.169  -3.598  -20.608 1.00 0.00 ? 3   SER A HA   1  
ATOM 27    H HB2  . SER A 1 3   ? -0.484  -1.969  -18.991 1.00 0.00 ? 3   SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3   ? -2.040  -2.626  -18.483 1.00 0.00 ? 3   SER A HB3  1  
ATOM 29    H HG   . SER A 1 3   ? -0.978  -3.602  -16.970 1.00 0.00 ? 3   SER A HG   1  
ATOM 30    N N    . GLY A 1 4   ? -2.285  -5.515  -18.934 1.00 0.00 ? 4   GLY A N    1  
ATOM 31    C CA   . GLY A 1 4   ? -2.521  -6.887  -18.523 1.00 0.00 ? 4   GLY A CA   1  
ATOM 32    C C    . GLY A 1 4   ? -3.968  -7.140  -18.153 1.00 0.00 ? 4   GLY A C    1  
ATOM 33    O O    . GLY A 1 4   ? -4.442  -6.676  -17.116 1.00 0.00 ? 4   GLY A O    1  
ATOM 34    H H    . GLY A 1 4   ? -2.905  -4.809  -18.656 1.00 0.00 ? 4   GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4   ? -2.246  -7.546  -19.333 1.00 0.00 ? 4   GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4   ? -1.899  -7.106  -17.667 1.00 0.00 ? 4   GLY A HA3  1  
ATOM 37    N N    . SER A 1 5   ? -4.675  -7.878  -19.004 1.00 0.00 ? 5   SER A N    1  
ATOM 38    C CA   . SER A 1 5   ? -6.079  -8.188  -18.764 1.00 0.00 ? 5   SER A CA   1  
ATOM 39    C C    . SER A 1 5   ? -6.333  -8.446  -17.282 1.00 0.00 ? 5   SER A C    1  
ATOM 40    O O    . SER A 1 5   ? -7.277  -7.913  -16.700 1.00 0.00 ? 5   SER A O    1  
ATOM 41    C CB   . SER A 1 5   ? -6.502  -9.407  -19.585 1.00 0.00 ? 5   SER A CB   1  
ATOM 42    O OG   . SER A 1 5   ? -7.589  -10.081 -18.975 1.00 0.00 ? 5   SER A OG   1  
ATOM 43    H H    . SER A 1 5   ? -4.241  -8.220  -19.814 1.00 0.00 ? 5   SER A H    1  
ATOM 44    H HA   . SER A 1 5   ? -6.665  -7.335  -19.074 1.00 0.00 ? 5   SER A HA   1  
ATOM 45    H HB2  . SER A 1 5   ? -6.800  -9.088  -20.572 1.00 0.00 ? 5   SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5   ? -5.669  -10.091 -19.665 1.00 0.00 ? 5   SER A HB3  1  
ATOM 47    H HG   . SER A 1 5   ? -7.569  -11.009 -19.221 1.00 0.00 ? 5   SER A HG   1  
ATOM 48    N N    . SER A 1 6   ? -5.482  -9.270  -16.677 1.00 0.00 ? 6   SER A N    1  
ATOM 49    C CA   . SER A 1 6   ? -5.615  -9.603  -15.264 1.00 0.00 ? 6   SER A CA   1  
ATOM 50    C C    . SER A 1 6   ? -5.708  -8.339  -14.414 1.00 0.00 ? 6   SER A C    1  
ATOM 51    O O    . SER A 1 6   ? -5.184  -7.289  -14.782 1.00 0.00 ? 6   SER A O    1  
ATOM 52    C CB   . SER A 1 6   ? -4.429  -10.453 -14.805 1.00 0.00 ? 6   SER A CB   1  
ATOM 53    O OG   . SER A 1 6   ? -4.527  -10.763 -13.425 1.00 0.00 ? 6   SER A OG   1  
ATOM 54    H H    . SER A 1 6   ? -4.749  -9.664  -17.195 1.00 0.00 ? 6   SER A H    1  
ATOM 55    H HA   . SER A 1 6   ? -6.524  -10.173 -15.141 1.00 0.00 ? 6   SER A HA   1  
ATOM 56    H HB2  . SER A 1 6   ? -4.409  -11.373 -15.368 1.00 0.00 ? 6   SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6   ? -3.511  -9.908  -14.975 1.00 0.00 ? 6   SER A HB3  1  
ATOM 58    H HG   . SER A 1 6   ? -4.076  -10.089 -12.912 1.00 0.00 ? 6   SER A HG   1  
ATOM 59    N N    . GLY A 1 7   ? -6.382  -8.450  -13.272 1.00 0.00 ? 7   GLY A N    1  
ATOM 60    C CA   . GLY A 1 7   ? -6.533  -7.310  -12.387 1.00 0.00 ? 7   GLY A CA   1  
ATOM 61    C C    . GLY A 1 7   ? -5.497  -7.293  -11.281 1.00 0.00 ? 7   GLY A C    1  
ATOM 62    O O    . GLY A 1 7   ? -4.505  -6.566  -11.358 1.00 0.00 ? 7   GLY A O    1  
ATOM 63    H H    . GLY A 1 7   ? -6.779  -9.312  -13.030 1.00 0.00 ? 7   GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7   ? -6.440  -6.403  -12.966 1.00 0.00 ? 7   GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7   ? -7.517  -7.342  -11.942 1.00 0.00 ? 7   GLY A HA3  1  
ATOM 66    N N    . THR A 1 8   ? -5.725  -8.095  -10.246 1.00 0.00 ? 8   THR A N    1  
ATOM 67    C CA   . THR A 1 8   ? -4.806  -8.168  -9.117  1.00 0.00 ? 8   THR A CA   1  
ATOM 68    C C    . THR A 1 8   ? -4.614  -6.799  -8.476  1.00 0.00 ? 8   THR A C    1  
ATOM 69    O O    . THR A 1 8   ? -4.775  -5.759  -9.114  1.00 0.00 ? 8   THR A O    1  
ATOM 70    C CB   . THR A 1 8   ? -3.433  -8.719  -9.546  1.00 0.00 ? 8   THR A CB   1  
ATOM 71    O OG1  . THR A 1 8   ? -3.092  -9.860  -8.751  1.00 0.00 ? 8   THR A OG1  1  
ATOM 72    C CG2  . THR A 1 8   ? -2.355  -7.655  -9.404  1.00 0.00 ? 8   THR A CG2  1  
ATOM 73    H H    . THR A 1 8   ? -6.533  -8.650  -10.242 1.00 0.00 ? 8   THR A H    1  
ATOM 74    H HA   . THR A 1 8   ? -5.228  -8.842  -8.386  1.00 0.00 ? 8   THR A HA   1  
ATOM 75    H HB   . THR A 1 8   ? -3.489  -9.016  -10.584 1.00 0.00 ? 8   THR A HB   1  
ATOM 76    H HG1  . THR A 1 8   ? -2.691  -10.531 -9.309  1.00 0.00 ? 8   THR A HG1  1  
ATOM 77    H HG21 . THR A 1 8   ? -2.588  -6.818  -10.044 1.00 0.00 ? 8   THR A HG21 1  
ATOM 78    H HG22 . THR A 1 8   ? -1.399  -8.070  -9.689  1.00 0.00 ? 8   THR A HG22 1  
ATOM 79    H HG23 . THR A 1 8   ? -2.311  -7.322  -8.378  1.00 0.00 ? 8   THR A HG23 1  
ATOM 80    N N    . PRO A 1 9   ? -4.259  -6.795  -7.182  1.00 0.00 ? 9   PRO A N    1  
ATOM 81    C CA   . PRO A 1 9   ? -4.036  -5.559  -6.426  1.00 0.00 ? 9   PRO A CA   1  
ATOM 82    C C    . PRO A 1 9   ? -2.777  -4.825  -6.874  1.00 0.00 ? 9   PRO A C    1  
ATOM 83    O O    . PRO A 1 9   ? -1.667  -5.346  -6.756  1.00 0.00 ? 9   PRO A O    1  
ATOM 84    C CB   . PRO A 1 9   ? -3.884  -6.049  -4.983  1.00 0.00 ? 9   PRO A CB   1  
ATOM 85    C CG   . PRO A 1 9   ? -3.411  -7.456  -5.108  1.00 0.00 ? 9   PRO A CG   1  
ATOM 86    C CD   . PRO A 1 9   ? -4.048  -7.997  -6.358  1.00 0.00 ? 9   PRO A CD   1  
ATOM 87    H HA   . PRO A 1 9   ? -4.883  -4.893  -6.495  1.00 0.00 ? 9   PRO A HA   1  
ATOM 88    H HB2  . PRO A 1 9   ? -3.162  -5.433  -4.466  1.00 0.00 ? 9   PRO A HB2  1  
ATOM 89    H HB3  . PRO A 1 9   ? -4.838  -5.996  -4.480  1.00 0.00 ? 9   PRO A HB3  1  
ATOM 90    H HG2  . PRO A 1 9   ? -2.336  -7.475  -5.197  1.00 0.00 ? 9   PRO A HG2  1  
ATOM 91    H HG3  . PRO A 1 9   ? -3.729  -8.027  -4.249  1.00 0.00 ? 9   PRO A HG3  1  
ATOM 92    H HD2  . PRO A 1 9   ? -3.383  -8.691  -6.851  1.00 0.00 ? 9   PRO A HD2  1  
ATOM 93    H HD3  . PRO A 1 9   ? -4.989  -8.474  -6.126  1.00 0.00 ? 9   PRO A HD3  1  
ATOM 94    N N    . HIS A 1 10  ? -2.956  -3.612  -7.388  1.00 0.00 ? 10  HIS A N    1  
ATOM 95    C CA   . HIS A 1 10  ? -1.833  -2.806  -7.853  1.00 0.00 ? 10  HIS A CA   1  
ATOM 96    C C    . HIS A 1 10  ? -1.988  -1.353  -7.413  1.00 0.00 ? 10  HIS A C    1  
ATOM 97    O O    . HIS A 1 10  ? -3.105  -0.858  -7.253  1.00 0.00 ? 10  HIS A O    1  
ATOM 98    C CB   . HIS A 1 10  ? -1.721  -2.880  -9.376  1.00 0.00 ? 10  HIS A CB   1  
ATOM 99    C CG   . HIS A 1 10  ? -2.827  -2.171  -10.094 1.00 0.00 ? 10  HIS A CG   1  
ATOM 100   N ND1  . HIS A 1 10  ? -3.939  -2.819  -10.591 1.00 0.00 ? 10  HIS A ND1  1  
ATOM 101   C CD2  . HIS A 1 10  ? -2.991  -0.861  -10.396 1.00 0.00 ? 10  HIS A CD2  1  
ATOM 102   C CE1  . HIS A 1 10  ? -4.737  -1.939  -11.169 1.00 0.00 ? 10  HIS A CE1  1  
ATOM 103   N NE2  . HIS A 1 10  ? -4.185  -0.743  -11.064 1.00 0.00 ? 10  HIS A NE2  1  
ATOM 104   H H    . HIS A 1 10  ? -3.864  -3.252  -7.456  1.00 0.00 ? 10  HIS A H    1  
ATOM 105   H HA   . HIS A 1 10  ? -0.932  -3.207  -7.415  1.00 0.00 ? 10  HIS A HA   1  
ATOM 106   H HB2  . HIS A 1 10  ? -0.787  -2.433  -9.684  1.00 0.00 ? 10  HIS A HB2  1  
ATOM 107   H HB3  . HIS A 1 10  ? -1.736  -3.916  -9.682  1.00 0.00 ? 10  HIS A HB3  1  
ATOM 108   H HD1  . HIS A 1 10  ? -4.115  -3.780  -10.530 1.00 0.00 ? 10  HIS A HD1  1  
ATOM 109   H HD2  . HIS A 1 10  ? -2.308  -0.058  -10.156 1.00 0.00 ? 10  HIS A HD2  1  
ATOM 110   H HE1  . HIS A 1 10  ? -5.680  -2.158  -11.646 1.00 0.00 ? 10  HIS A HE1  1  
ATOM 111   N N    . LEU A 1 11  ? -0.863  -0.676  -7.218  1.00 0.00 ? 11  LEU A N    1  
ATOM 112   C CA   . LEU A 1 11  ? -0.873  0.721   -6.795  1.00 0.00 ? 11  LEU A CA   1  
ATOM 113   C C    . LEU A 1 11  ? -0.677  1.652   -7.987  1.00 0.00 ? 11  LEU A C    1  
ATOM 114   O O    . LEU A 1 11  ? 0.182   1.417   -8.837  1.00 0.00 ? 11  LEU A O    1  
ATOM 115   C CB   . LEU A 1 11  ? 0.220   0.967   -5.755  1.00 0.00 ? 11  LEU A CB   1  
ATOM 116   C CG   . LEU A 1 11  ? 0.069   0.217   -4.431  1.00 0.00 ? 11  LEU A CG   1  
ATOM 117   C CD1  . LEU A 1 11  ? 1.388   0.199   -3.674  1.00 0.00 ? 11  LEU A CD1  1  
ATOM 118   C CD2  . LEU A 1 11  ? -1.026  0.846   -3.583  1.00 0.00 ? 11  LEU A CD2  1  
ATOM 119   H H    . LEU A 1 11  ? -0.003  -1.124  -7.362  1.00 0.00 ? 11  LEU A H    1  
ATOM 120   H HA   . LEU A 1 11  ? -1.836  0.924   -6.350  1.00 0.00 ? 11  LEU A HA   1  
ATOM 121   H HB2  . LEU A 1 11  ? 1.164   0.679   -6.192  1.00 0.00 ? 11  LEU A HB2  1  
ATOM 122   H HB3  . LEU A 1 11  ? 0.235   2.026   -5.536  1.00 0.00 ? 11  LEU A HB3  1  
ATOM 123   H HG   . LEU A 1 11  ? -0.212  -0.807  -4.636  1.00 0.00 ? 11  LEU A HG   1  
ATOM 124   H HD11 . LEU A 1 11  ? 2.202   0.350   -4.366  1.00 0.00 ? 11  LEU A HD11 1  
ATOM 125   H HD12 . LEU A 1 11  ? 1.507   -0.755  -3.182  1.00 0.00 ? 11  LEU A HD12 1  
ATOM 126   H HD13 . LEU A 1 11  ? 1.390   0.988   -2.936  1.00 0.00 ? 11  LEU A HD13 1  
ATOM 127   H HD21 . LEU A 1 11  ? -0.718  1.833   -3.272  1.00 0.00 ? 11  LEU A HD21 1  
ATOM 128   H HD22 . LEU A 1 11  ? -1.204  0.232   -2.713  1.00 0.00 ? 11  LEU A HD22 1  
ATOM 129   H HD23 . LEU A 1 11  ? -1.934  0.919   -4.164  1.00 0.00 ? 11  LEU A HD23 1  
ATOM 130   N N    . VAL A 1 12  ? -1.477  2.712   -8.042  1.00 0.00 ? 12  VAL A N    1  
ATOM 131   C CA   . VAL A 1 12  ? -1.389  3.681   -9.128  1.00 0.00 ? 12  VAL A CA   1  
ATOM 132   C C    . VAL A 1 12  ? -0.796  4.999   -8.642  1.00 0.00 ? 12  VAL A C    1  
ATOM 133   O O    . VAL A 1 12  ? -1.058  5.432   -7.521  1.00 0.00 ? 12  VAL A O    1  
ATOM 134   C CB   . VAL A 1 12  ? -2.771  3.952   -9.752  1.00 0.00 ? 12  VAL A CB   1  
ATOM 135   C CG1  . VAL A 1 12  ? -2.621  4.498   -11.164 1.00 0.00 ? 12  VAL A CG1  1  
ATOM 136   C CG2  . VAL A 1 12  ? -3.614  2.685   -9.748  1.00 0.00 ? 12  VAL A CG2  1  
ATOM 137   H H    . VAL A 1 12  ? -2.142  2.845   -7.335  1.00 0.00 ? 12  VAL A H    1  
ATOM 138   H HA   . VAL A 1 12  ? -0.746  3.269   -9.892  1.00 0.00 ? 12  VAL A HA   1  
ATOM 139   H HB   . VAL A 1 12  ? -3.274  4.696   -9.153  1.00 0.00 ? 12  VAL A HB   1  
ATOM 140   H HG11 . VAL A 1 12  ? -3.593  4.552   -11.633 1.00 0.00 ? 12  VAL A HG11 1  
ATOM 141   H HG12 . VAL A 1 12  ? -2.184  5.485   -11.124 1.00 0.00 ? 12  VAL A HG12 1  
ATOM 142   H HG13 . VAL A 1 12  ? -1.981  3.843   -11.737 1.00 0.00 ? 12  VAL A HG13 1  
ATOM 143   H HG21 . VAL A 1 12  ? -4.068  2.558   -8.777  1.00 0.00 ? 12  VAL A HG21 1  
ATOM 144   H HG22 . VAL A 1 12  ? -4.385  2.765   -10.499 1.00 0.00 ? 12  VAL A HG22 1  
ATOM 145   H HG23 . VAL A 1 12  ? -2.986  1.833   -9.966  1.00 0.00 ? 12  VAL A HG23 1  
ATOM 146   N N    . ASN A 1 13  ? 0.004   5.632   -9.494  1.00 0.00 ? 13  ASN A N    1  
ATOM 147   C CA   . ASN A 1 13  ? 0.635   6.901   -9.151  1.00 0.00 ? 13  ASN A CA   1  
ATOM 148   C C    . ASN A 1 13  ? -0.311  8.068   -9.417  1.00 0.00 ? 13  ASN A C    1  
ATOM 149   O O    . ASN A 1 13  ? -0.556  8.433   -10.568 1.00 0.00 ? 13  ASN A O    1  
ATOM 150   C CB   . ASN A 1 13  ? 1.927   7.084   -9.949  1.00 0.00 ? 13  ASN A CB   1  
ATOM 151   C CG   . ASN A 1 13  ? 2.775   8.225   -9.421  1.00 0.00 ? 13  ASN A CG   1  
ATOM 152   O OD1  . ASN A 1 13  ? 2.283   9.334   -9.212  1.00 0.00 ? 13  ASN A OD1  1  
ATOM 153   N ND2  . ASN A 1 13  ? 4.058   7.957   -9.204  1.00 0.00 ? 13  ASN A ND2  1  
ATOM 154   H H    . ASN A 1 13  ? 0.175   5.236   -10.374 1.00 0.00 ? 13  ASN A H    1  
ATOM 155   H HA   . ASN A 1 13  ? 0.873   6.879   -8.098  1.00 0.00 ? 13  ASN A HA   1  
ATOM 156   H HB2  . ASN A 1 13  ? 2.508   6.175   -9.896  1.00 0.00 ? 13  ASN A HB2  1  
ATOM 157   H HB3  . ASN A 1 13  ? 1.680   7.290   -10.980 1.00 0.00 ? 13  ASN A HB3  1  
ATOM 158   H HD21 . ASN A 1 13  ? 4.380   7.051   -9.394  1.00 0.00 ? 13  ASN A HD21 1  
ATOM 159   H HD22 . ASN A 1 13  ? 4.629   8.676   -8.863  1.00 0.00 ? 13  ASN A HD22 1  
ATOM 160   N N    . LEU A 1 14  ? -0.840  8.650   -8.347  1.00 0.00 ? 14  LEU A N    1  
ATOM 161   C CA   . LEU A 1 14  ? -1.759  9.777   -8.464  1.00 0.00 ? 14  LEU A CA   1  
ATOM 162   C C    . LEU A 1 14  ? -1.142  11.046  -7.886  1.00 0.00 ? 14  LEU A C    1  
ATOM 163   O O    . LEU A 1 14  ? -1.805  12.076  -7.774  1.00 0.00 ? 14  LEU A O    1  
ATOM 164   C CB   . LEU A 1 14  ? -3.075  9.464   -7.749  1.00 0.00 ? 14  LEU A CB   1  
ATOM 165   C CG   . LEU A 1 14  ? -2.966  9.131   -6.260  1.00 0.00 ? 14  LEU A CG   1  
ATOM 166   C CD1  . LEU A 1 14  ? -4.302  9.347   -5.566  1.00 0.00 ? 14  LEU A CD1  1  
ATOM 167   C CD2  . LEU A 1 14  ? -2.489  7.699   -6.068  1.00 0.00 ? 14  LEU A CD2  1  
ATOM 168   H H    . LEU A 1 14  ? -0.608  8.315   -7.456  1.00 0.00 ? 14  LEU A H    1  
ATOM 169   H HA   . LEU A 1 14  ? -1.959  9.934   -9.514  1.00 0.00 ? 14  LEU A HA   1  
ATOM 170   H HB2  . LEU A 1 14  ? -3.718  10.325  -7.848  1.00 0.00 ? 14  LEU A HB2  1  
ATOM 171   H HB3  . LEU A 1 14  ? -3.528  8.619   -8.246  1.00 0.00 ? 14  LEU A HB3  1  
ATOM 172   H HG   . LEU A 1 14  ? -2.242  9.790   -5.802  1.00 0.00 ? 14  LEU A HG   1  
ATOM 173   H HD11 . LEU A 1 14  ? -4.138  9.500   -4.510  1.00 0.00 ? 14  LEU A HD11 1  
ATOM 174   H HD12 . LEU A 1 14  ? -4.928  8.479   -5.712  1.00 0.00 ? 14  LEU A HD12 1  
ATOM 175   H HD13 . LEU A 1 14  ? -4.789  10.215  -5.985  1.00 0.00 ? 14  LEU A HD13 1  
ATOM 176   H HD21 . LEU A 1 14  ? -3.204  7.158   -5.466  1.00 0.00 ? 14  LEU A HD21 1  
ATOM 177   H HD22 . LEU A 1 14  ? -1.530  7.703   -5.572  1.00 0.00 ? 14  LEU A HD22 1  
ATOM 178   H HD23 . LEU A 1 14  ? -2.393  7.219   -7.032  1.00 0.00 ? 14  LEU A HD23 1  
ATOM 179   N N    . ASN A 1 15  ? 0.134   10.964  -7.523  1.00 0.00 ? 15  ASN A N    1  
ATOM 180   C CA   . ASN A 1 15  ? 0.842   12.107  -6.957  1.00 0.00 ? 15  ASN A CA   1  
ATOM 181   C C    . ASN A 1 15  ? 0.618   13.358  -7.801  1.00 0.00 ? 15  ASN A C    1  
ATOM 182   O O    . ASN A 1 15  ? 0.021   13.294  -8.875  1.00 0.00 ? 15  ASN A O    1  
ATOM 183   C CB   . ASN A 1 15  ? 2.339   11.807  -6.858  1.00 0.00 ? 15  ASN A CB   1  
ATOM 184   C CG   . ASN A 1 15  ? 2.618   10.459  -6.222  1.00 0.00 ? 15  ASN A CG   1  
ATOM 185   O OD1  . ASN A 1 15  ? 1.758   9.886   -5.552  1.00 0.00 ? 15  ASN A OD1  1  
ATOM 186   N ND2  . ASN A 1 15  ? 3.825   9.946   -6.429  1.00 0.00 ? 15  ASN A ND2  1  
ATOM 187   H H    . ASN A 1 15  ? 0.611   10.116  -7.636  1.00 0.00 ? 15  ASN A H    1  
ATOM 188   H HA   . ASN A 1 15  ? 0.452   12.281  -5.966  1.00 0.00 ? 15  ASN A HA   1  
ATOM 189   H HB2  . ASN A 1 15  ? 2.768   11.811  -7.850  1.00 0.00 ? 15  ASN A HB2  1  
ATOM 190   H HB3  . ASN A 1 15  ? 2.815   12.572  -6.262  1.00 0.00 ? 15  ASN A HB3  1  
ATOM 191   H HD21 . ASN A 1 15  ? 4.460   10.458  -6.972  1.00 0.00 ? 15  ASN A HD21 1  
ATOM 192   H HD22 . ASN A 1 15  ? 4.032   9.075   -6.030  1.00 0.00 ? 15  ASN A HD22 1  
ATOM 193   N N    . GLU A 1 16  ? 1.101   14.493  -7.307  1.00 0.00 ? 16  GLU A N    1  
ATOM 194   C CA   . GLU A 1 16  ? 0.953   15.759  -8.017  1.00 0.00 ? 16  GLU A CA   1  
ATOM 195   C C    . GLU A 1 16  ? 2.106   15.974  -8.993  1.00 0.00 ? 16  GLU A C    1  
ATOM 196   O O    . GLU A 1 16  ? 2.314   17.081  -9.490  1.00 0.00 ? 16  GLU A O    1  
ATOM 197   C CB   . GLU A 1 16  ? 0.888   16.921  -7.023  1.00 0.00 ? 16  GLU A CB   1  
ATOM 198   C CG   . GLU A 1 16  ? -0.086  16.691  -5.880  1.00 0.00 ? 16  GLU A CG   1  
ATOM 199   C CD   . GLU A 1 16  ? 0.186   17.591  -4.691  1.00 0.00 ? 16  GLU A CD   1  
ATOM 200   O OE1  . GLU A 1 16  ? 0.122   18.828  -4.857  1.00 0.00 ? 16  GLU A OE1  1  
ATOM 201   O OE2  . GLU A 1 16  ? 0.464   17.061  -3.595  1.00 0.00 ? 16  GLU A OE2  1  
ATOM 202   H H    . GLU A 1 16  ? 1.568   14.480  -6.446  1.00 0.00 ? 16  GLU A H    1  
ATOM 203   H HA   . GLU A 1 16  ? 0.029   15.721  -8.573  1.00 0.00 ? 16  GLU A HA   1  
ATOM 204   H HB2  . GLU A 1 16  ? 1.871   17.078  -6.605  1.00 0.00 ? 16  GLU A HB2  1  
ATOM 205   H HB3  . GLU A 1 16  ? 0.585   17.813  -7.552  1.00 0.00 ? 16  GLU A HB3  1  
ATOM 206   H HG2  . GLU A 1 16  ? -1.088  16.881  -6.234  1.00 0.00 ? 16  GLU A HG2  1  
ATOM 207   H HG3  . GLU A 1 16  ? -0.008  15.662  -5.559  1.00 0.00 ? 16  GLU A HG3  1  
ATOM 208   N N    . ASP A 1 17  ? 2.852   14.908  -9.262  1.00 0.00 ? 17  ASP A N    1  
ATOM 209   C CA   . ASP A 1 17  ? 3.984   14.979  -10.179 1.00 0.00 ? 17  ASP A CA   1  
ATOM 210   C C    . ASP A 1 17  ? 3.684   14.225  -11.471 1.00 0.00 ? 17  ASP A C    1  
ATOM 211   O O    . ASP A 1 17  ? 4.099   13.081  -11.661 1.00 0.00 ? 17  ASP A O    1  
ATOM 212   C CB   . ASP A 1 17  ? 5.239   14.406  -9.518  1.00 0.00 ? 17  ASP A CB   1  
ATOM 213   C CG   . ASP A 1 17  ? 6.021   15.456  -8.753  1.00 0.00 ? 17  ASP A CG   1  
ATOM 214   O OD1  . ASP A 1 17  ? 5.774   16.659  -8.978  1.00 0.00 ? 17  ASP A OD1  1  
ATOM 215   O OD2  . ASP A 1 17  ? 6.880   15.074  -7.931  1.00 0.00 ? 17  ASP A OD2  1  
ATOM 216   H H    . ASP A 1 17  ? 2.635   14.053  -8.834  1.00 0.00 ? 17  ASP A H    1  
ATOM 217   H HA   . ASP A 1 17  ? 4.155   16.018  -10.415 1.00 0.00 ? 17  ASP A HA   1  
ATOM 218   H HB2  . ASP A 1 17  ? 4.951   13.626  -8.829  1.00 0.00 ? 17  ASP A HB2  1  
ATOM 219   H HB3  . ASP A 1 17  ? 5.880   13.989  -10.281 1.00 0.00 ? 17  ASP A HB3  1  
ATOM 220   N N    . PRO A 1 18  ? 2.947   14.878  -12.380 1.00 0.00 ? 18  PRO A N    1  
ATOM 221   C CA   . PRO A 1 18  ? 2.575   14.288  -13.670 1.00 0.00 ? 18  PRO A CA   1  
ATOM 222   C C    . PRO A 1 18  ? 3.771   14.137  -14.604 1.00 0.00 ? 18  PRO A C    1  
ATOM 223   O O    . PRO A 1 18  ? 3.670   13.515  -15.663 1.00 0.00 ? 18  PRO A O    1  
ATOM 224   C CB   . PRO A 1 18  ? 1.572   15.293  -14.243 1.00 0.00 ? 18  PRO A CB   1  
ATOM 225   C CG   . PRO A 1 18  ? 1.922   16.589  -13.597 1.00 0.00 ? 18  PRO A CG   1  
ATOM 226   C CD   . PRO A 1 18  ? 2.419   16.244  -12.221 1.00 0.00 ? 18  PRO A CD   1  
ATOM 227   H HA   . PRO A 1 18  ? 2.095   13.329  -13.544 1.00 0.00 ? 18  PRO A HA   1  
ATOM 228   H HB2  . PRO A 1 18  ? 1.684   15.343  -15.318 1.00 0.00 ? 18  PRO A HB2  1  
ATOM 229   H HB3  . PRO A 1 18  ? 0.568   14.986  -13.994 1.00 0.00 ? 18  PRO A HB3  1  
ATOM 230   H HG2  . PRO A 1 18  ? 2.697   17.084  -14.163 1.00 0.00 ? 18  PRO A HG2  1  
ATOM 231   H HG3  . PRO A 1 18  ? 1.045   17.215  -13.532 1.00 0.00 ? 18  PRO A HG3  1  
ATOM 232   H HD2  . PRO A 1 18  ? 3.201   16.926  -11.920 1.00 0.00 ? 18  PRO A HD2  1  
ATOM 233   H HD3  . PRO A 1 18  ? 1.606   16.262  -11.510 1.00 0.00 ? 18  PRO A HD3  1  
ATOM 234   N N    . LEU A 1 19  ? 4.902   14.708  -14.207 1.00 0.00 ? 19  LEU A N    1  
ATOM 235   C CA   . LEU A 1 19  ? 6.119   14.636  -15.009 1.00 0.00 ? 19  LEU A CA   1  
ATOM 236   C C    . LEU A 1 19  ? 7.002   13.477  -14.556 1.00 0.00 ? 19  LEU A C    1  
ATOM 237   O O    . LEU A 1 19  ? 7.970   13.124  -15.227 1.00 0.00 ? 19  LEU A O    1  
ATOM 238   C CB   . LEU A 1 19  ? 6.894   15.951  -14.914 1.00 0.00 ? 19  LEU A CB   1  
ATOM 239   C CG   . LEU A 1 19  ? 6.051   17.223  -14.832 1.00 0.00 ? 19  LEU A CG   1  
ATOM 240   C CD1  . LEU A 1 19  ? 6.935   18.435  -14.581 1.00 0.00 ? 19  LEU A CD1  1  
ATOM 241   C CD2  . LEU A 1 19  ? 5.238   17.408  -16.105 1.00 0.00 ? 19  LEU A CD2  1  
ATOM 242   H H    . LEU A 1 19  ? 4.921   15.190  -13.354 1.00 0.00 ? 19  LEU A H    1  
ATOM 243   H HA   . LEU A 1 19  ? 5.829   14.471  -16.036 1.00 0.00 ? 19  LEU A HA   1  
ATOM 244   H HB2  . LEU A 1 19  ? 7.513   15.907  -14.031 1.00 0.00 ? 19  LEU A HB2  1  
ATOM 245   H HB3  . LEU A 1 19  ? 7.524   16.026  -15.789 1.00 0.00 ? 19  LEU A HB3  1  
ATOM 246   H HG   . LEU A 1 19  ? 5.361   17.137  -14.003 1.00 0.00 ? 19  LEU A HG   1  
ATOM 247   H HD11 . LEU A 1 19  ? 7.735   18.453  -15.306 1.00 0.00 ? 19  LEU A HD11 1  
ATOM 248   H HD12 . LEU A 1 19  ? 7.352   18.376  -13.586 1.00 0.00 ? 19  LEU A HD12 1  
ATOM 249   H HD13 . LEU A 1 19  ? 6.346   19.336  -14.671 1.00 0.00 ? 19  LEU A HD13 1  
ATOM 250   H HD21 . LEU A 1 19  ? 4.730   18.360  -16.073 1.00 0.00 ? 19  LEU A HD21 1  
ATOM 251   H HD22 . LEU A 1 19  ? 4.511   16.614  -16.186 1.00 0.00 ? 19  LEU A HD22 1  
ATOM 252   H HD23 . LEU A 1 19  ? 5.898   17.380  -16.960 1.00 0.00 ? 19  LEU A HD23 1  
ATOM 253   N N    . MET A 1 20  ? 6.659   12.890  -13.414 1.00 0.00 ? 20  MET A N    1  
ATOM 254   C CA   . MET A 1 20  ? 7.418   11.769  -12.874 1.00 0.00 ? 20  MET A CA   1  
ATOM 255   C C    . MET A 1 20  ? 7.877   10.835  -13.989 1.00 0.00 ? 20  MET A C    1  
ATOM 256   O O    . MET A 1 20  ? 7.061   10.312  -14.749 1.00 0.00 ? 20  MET A O    1  
ATOM 257   C CB   . MET A 1 20  ? 6.575   10.995  -11.859 1.00 0.00 ? 20  MET A CB   1  
ATOM 258   C CG   . MET A 1 20  ? 5.355   10.323  -12.469 1.00 0.00 ? 20  MET A CG   1  
ATOM 259   S SD   . MET A 1 20  ? 3.995   10.157  -11.297 1.00 0.00 ? 20  MET A SD   1  
ATOM 260   C CE   . MET A 1 20  ? 2.769   9.340   -12.316 1.00 0.00 ? 20  MET A CE   1  
ATOM 261   H H    . MET A 1 20  ? 5.876   13.217  -12.924 1.00 0.00 ? 20  MET A H    1  
ATOM 262   H HA   . MET A 1 20  ? 8.288   12.169  -12.375 1.00 0.00 ? 20  MET A HA   1  
ATOM 263   H HB2  . MET A 1 20  ? 7.189   10.233  -11.404 1.00 0.00 ? 20  MET A HB2  1  
ATOM 264   H HB3  . MET A 1 20  ? 6.237   11.678  -11.094 1.00 0.00 ? 20  MET A HB3  1  
ATOM 265   H HG2  . MET A 1 20  ? 5.018   10.913  -13.308 1.00 0.00 ? 20  MET A HG2  1  
ATOM 266   H HG3  . MET A 1 20  ? 5.638   9.340   -12.813 1.00 0.00 ? 20  MET A HG3  1  
ATOM 267   H HE1  . MET A 1 20  ? 1.843   9.255   -11.766 1.00 0.00 ? 20  MET A HE1  1  
ATOM 268   H HE2  . MET A 1 20  ? 2.603   9.917   -13.213 1.00 0.00 ? 20  MET A HE2  1  
ATOM 269   H HE3  . MET A 1 20  ? 3.121   8.354   -12.581 1.00 0.00 ? 20  MET A HE3  1  
ATOM 270   N N    . SER A 1 21  ? 9.187   10.629  -14.082 1.00 0.00 ? 21  SER A N    1  
ATOM 271   C CA   . SER A 1 21  ? 9.753   9.761   -15.107 1.00 0.00 ? 21  SER A CA   1  
ATOM 272   C C    . SER A 1 21  ? 9.686   8.298   -14.679 1.00 0.00 ? 21  SER A C    1  
ATOM 273   O O    . SER A 1 21  ? 10.033  7.399   -15.445 1.00 0.00 ? 21  SER A O    1  
ATOM 274   C CB   . SER A 1 21  ? 11.204  10.153  -15.393 1.00 0.00 ? 21  SER A CB   1  
ATOM 275   O OG   . SER A 1 21  ? 12.083  9.589   -14.436 1.00 0.00 ? 21  SER A OG   1  
ATOM 276   H H    . SER A 1 21  ? 9.786   11.074  -13.447 1.00 0.00 ? 21  SER A H    1  
ATOM 277   H HA   . SER A 1 21  ? 9.171   9.887   -16.007 1.00 0.00 ? 21  SER A HA   1  
ATOM 278   H HB2  . SER A 1 21  ? 11.483  9.799   -16.374 1.00 0.00 ? 21  SER A HB2  1  
ATOM 279   H HB3  . SER A 1 21  ? 11.296  11.229  -15.359 1.00 0.00 ? 21  SER A HB3  1  
ATOM 280   H HG   . SER A 1 21  ? 12.912  10.074  -14.437 1.00 0.00 ? 21  SER A HG   1  
ATOM 281   N N    . GLU A 1 22  ? 9.236   8.068   -13.449 1.00 0.00 ? 22  GLU A N    1  
ATOM 282   C CA   . GLU A 1 22  ? 9.124   6.715   -12.918 1.00 0.00 ? 22  GLU A CA   1  
ATOM 283   C C    . GLU A 1 22  ? 7.860   6.032   -13.432 1.00 0.00 ? 22  GLU A C    1  
ATOM 284   O O    . GLU A 1 22  ? 7.042   6.649   -14.115 1.00 0.00 ? 22  GLU A O    1  
ATOM 285   C CB   . GLU A 1 22  ? 9.115   6.743   -11.388 1.00 0.00 ? 22  GLU A CB   1  
ATOM 286   C CG   . GLU A 1 22  ? 10.308  7.464   -10.785 1.00 0.00 ? 22  GLU A CG   1  
ATOM 287   C CD   . GLU A 1 22  ? 11.593  7.204   -11.547 1.00 0.00 ? 22  GLU A CD   1  
ATOM 288   O OE1  . GLU A 1 22  ? 11.988  6.024   -11.659 1.00 0.00 ? 22  GLU A OE1  1  
ATOM 289   O OE2  . GLU A 1 22  ? 12.204  8.179   -12.032 1.00 0.00 ? 22  GLU A OE2  1  
ATOM 290   H H    . GLU A 1 22  ? 8.975   8.826   -12.886 1.00 0.00 ? 22  GLU A H    1  
ATOM 291   H HA   . GLU A 1 22  ? 9.983   6.154   -13.253 1.00 0.00 ? 22  GLU A HA   1  
ATOM 292   H HB2  . GLU A 1 22  ? 8.215   7.237   -11.054 1.00 0.00 ? 22  GLU A HB2  1  
ATOM 293   H HB3  . GLU A 1 22  ? 9.113   5.726   -11.022 1.00 0.00 ? 22  GLU A HB3  1  
ATOM 294   H HG2  . GLU A 1 22  ? 10.113  8.526   -10.793 1.00 0.00 ? 22  GLU A HG2  1  
ATOM 295   H HG3  . GLU A 1 22  ? 10.438  7.131   -9.766  1.00 0.00 ? 22  GLU A HG3  1  
ATOM 296   N N    . CYS A 1 23  ? 7.708   4.755   -13.100 1.00 0.00 ? 23  CYS A N    1  
ATOM 297   C CA   . CYS A 1 23  ? 6.545   3.986   -13.529 1.00 0.00 ? 23  CYS A CA   1  
ATOM 298   C C    . CYS A 1 23  ? 5.251   4.674   -13.104 1.00 0.00 ? 23  CYS A C    1  
ATOM 299   O O    . CYS A 1 23  ? 5.238   5.465   -12.159 1.00 0.00 ? 23  CYS A O    1  
ATOM 300   C CB   . CYS A 1 23  ? 6.599   2.572   -12.948 1.00 0.00 ? 23  CYS A CB   1  
ATOM 301   S SG   . CYS A 1 23  ? 8.253   1.841   -12.940 1.00 0.00 ? 23  CYS A SG   1  
ATOM 302   H H    . CYS A 1 23  ? 8.394   4.317   -12.553 1.00 0.00 ? 23  CYS A H    1  
ATOM 303   H HA   . CYS A 1 23  ? 6.568   3.925   -14.606 1.00 0.00 ? 23  CYS A HA   1  
ATOM 304   H HB2  . CYS A 1 23  ? 6.246   2.597   -11.928 1.00 0.00 ? 23  CYS A HB2  1  
ATOM 305   H HB3  . CYS A 1 23  ? 5.956   1.928   -13.529 1.00 0.00 ? 23  CYS A HB3  1  
ATOM 306   H HG   . CYS A 1 23  ? 8.498   1.373   -14.154 1.00 0.00 ? 23  CYS A HG   1  
ATOM 307   N N    . LEU A 1 24  ? 4.167   4.370   -13.808 1.00 0.00 ? 24  LEU A N    1  
ATOM 308   C CA   . LEU A 1 24  ? 2.867   4.960   -13.505 1.00 0.00 ? 24  LEU A CA   1  
ATOM 309   C C    . LEU A 1 24  ? 2.170   4.196   -12.384 1.00 0.00 ? 24  LEU A C    1  
ATOM 310   O O    . LEU A 1 24  ? 1.520   4.791   -11.523 1.00 0.00 ? 24  LEU A O    1  
ATOM 311   C CB   . LEU A 1 24  ? 1.986   4.971   -14.755 1.00 0.00 ? 24  LEU A CB   1  
ATOM 312   C CG   . LEU A 1 24  ? 2.323   6.031   -15.804 1.00 0.00 ? 24  LEU A CG   1  
ATOM 313   C CD1  . LEU A 1 24  ? 2.075   7.426   -15.252 1.00 0.00 ? 24  LEU A CD1  1  
ATOM 314   C CD2  . LEU A 1 24  ? 3.766   5.886   -16.265 1.00 0.00 ? 24  LEU A CD2  1  
ATOM 315   H H    . LEU A 1 24  ? 4.240   3.733   -14.549 1.00 0.00 ? 24  LEU A H    1  
ATOM 316   H HA   . LEU A 1 24  ? 3.033   5.977   -13.182 1.00 0.00 ? 24  LEU A HA   1  
ATOM 317   H HB2  . LEU A 1 24  ? 2.068   4.003   -15.225 1.00 0.00 ? 24  LEU A HB2  1  
ATOM 318   H HB3  . LEU A 1 24  ? 0.965   5.130   -14.437 1.00 0.00 ? 24  LEU A HB3  1  
ATOM 319   H HG   . LEU A 1 24  ? 1.681   5.894   -16.664 1.00 0.00 ? 24  LEU A HG   1  
ATOM 320   H HD11 . LEU A 1 24  ? 1.639   7.351   -14.267 1.00 0.00 ? 24  LEU A HD11 1  
ATOM 321   H HD12 . LEU A 1 24  ? 1.400   7.958   -15.906 1.00 0.00 ? 24  LEU A HD12 1  
ATOM 322   H HD13 . LEU A 1 24  ? 3.012   7.961   -15.191 1.00 0.00 ? 24  LEU A HD13 1  
ATOM 323   H HD21 . LEU A 1 24  ? 4.430   6.158   -15.458 1.00 0.00 ? 24  LEU A HD21 1  
ATOM 324   H HD22 . LEU A 1 24  ? 3.940   6.535   -17.110 1.00 0.00 ? 24  LEU A HD22 1  
ATOM 325   H HD23 . LEU A 1 24  ? 3.950   4.862   -16.554 1.00 0.00 ? 24  LEU A HD23 1  
ATOM 326   N N    . LEU A 1 25  ? 2.311   2.875   -12.399 1.00 0.00 ? 25  LEU A N    1  
ATOM 327   C CA   . LEU A 1 25  ? 1.697   2.028   -11.382 1.00 0.00 ? 25  LEU A CA   1  
ATOM 328   C C    . LEU A 1 25  ? 2.586   0.832   -11.059 1.00 0.00 ? 25  LEU A C    1  
ATOM 329   O O    . LEU A 1 25  ? 3.617   0.621   -11.699 1.00 0.00 ? 25  LEU A O    1  
ATOM 330   C CB   . LEU A 1 25  ? 0.324   1.545   -11.854 1.00 0.00 ? 25  LEU A CB   1  
ATOM 331   C CG   . LEU A 1 25  ? 0.306   0.223   -12.623 1.00 0.00 ? 25  LEU A CG   1  
ATOM 332   C CD1  . LEU A 1 25  ? 0.133   -0.948  -11.668 1.00 0.00 ? 25  LEU A CD1  1  
ATOM 333   C CD2  . LEU A 1 25  ? -0.800  0.229   -13.668 1.00 0.00 ? 25  LEU A CD2  1  
ATOM 334   H H    . LEU A 1 25  ? 2.840   2.458   -13.110 1.00 0.00 ? 25  LEU A H    1  
ATOM 335   H HA   . LEU A 1 25  ? 1.573   2.621   -10.488 1.00 0.00 ? 25  LEU A HA   1  
ATOM 336   H HB2  . LEU A 1 25  ? -0.303  1.429   -10.984 1.00 0.00 ? 25  LEU A HB2  1  
ATOM 337   H HB3  . LEU A 1 25  ? -0.091  2.308   -12.496 1.00 0.00 ? 25  LEU A HB3  1  
ATOM 338   H HG   . LEU A 1 25  ? 1.251   0.099   -13.135 1.00 0.00 ? 25  LEU A HG   1  
ATOM 339   H HD11 . LEU A 1 25  ? -0.536  -1.673  -12.106 1.00 0.00 ? 25  LEU A HD11 1  
ATOM 340   H HD12 . LEU A 1 25  ? -0.280  -0.593  -10.735 1.00 0.00 ? 25  LEU A HD12 1  
ATOM 341   H HD13 . LEU A 1 25  ? 1.093   -1.408  -11.485 1.00 0.00 ? 25  LEU A HD13 1  
ATOM 342   H HD21 . LEU A 1 25  ? -1.718  -0.122  -13.223 1.00 0.00 ? 25  LEU A HD21 1  
ATOM 343   H HD22 . LEU A 1 25  ? -0.525  -0.420  -14.487 1.00 0.00 ? 25  LEU A HD22 1  
ATOM 344   H HD23 . LEU A 1 25  ? -0.940  1.235   -14.038 1.00 0.00 ? 25  LEU A HD23 1  
ATOM 345   N N    . TYR A 1 26  ? 2.181   0.051   -10.064 1.00 0.00 ? 26  TYR A N    1  
ATOM 346   C CA   . TYR A 1 26  ? 2.941   -1.124  -9.656  1.00 0.00 ? 26  TYR A CA   1  
ATOM 347   C C    . TYR A 1 26  ? 2.010   -2.251  -9.219  1.00 0.00 ? 26  TYR A C    1  
ATOM 348   O O    . TYR A 1 26  ? 1.207   -2.087  -8.300  1.00 0.00 ? 26  TYR A O    1  
ATOM 349   C CB   . TYR A 1 26  ? 3.898   -0.768  -8.517  1.00 0.00 ? 26  TYR A CB   1  
ATOM 350   C CG   . TYR A 1 26  ? 5.016   0.161   -8.933  1.00 0.00 ? 26  TYR A CG   1  
ATOM 351   C CD1  . TYR A 1 26  ? 6.063   -0.292  -9.726  1.00 0.00 ? 26  TYR A CD1  1  
ATOM 352   C CD2  . TYR A 1 26  ? 5.026   1.491   -8.532  1.00 0.00 ? 26  TYR A CD2  1  
ATOM 353   C CE1  . TYR A 1 26  ? 7.087   0.553   -10.108 1.00 0.00 ? 26  TYR A CE1  1  
ATOM 354   C CE2  . TYR A 1 26  ? 6.045   2.344   -8.911  1.00 0.00 ? 26  TYR A CE2  1  
ATOM 355   C CZ   . TYR A 1 26  ? 7.073   1.870   -9.699  1.00 0.00 ? 26  TYR A CZ   1  
ATOM 356   O OH   . TYR A 1 26  ? 8.091   2.715   -10.077 1.00 0.00 ? 26  TYR A OH   1  
ATOM 357   H H    . TYR A 1 26  ? 1.351   0.271   -9.591  1.00 0.00 ? 26  TYR A H    1  
ATOM 358   H HA   . TYR A 1 26  ? 3.518   -1.458  -10.506 1.00 0.00 ? 26  TYR A HA   1  
ATOM 359   H HB2  . TYR A 1 26  ? 3.343   -0.285  -7.727  1.00 0.00 ? 26  TYR A HB2  1  
ATOM 360   H HB3  . TYR A 1 26  ? 4.344   -1.674  -8.134  1.00 0.00 ? 26  TYR A HB3  1  
ATOM 361   H HD1  . TYR A 1 26  ? 6.071   -1.324  -10.045 1.00 0.00 ? 26  TYR A HD1  1  
ATOM 362   H HD2  . TYR A 1 26  ? 4.219   1.859   -7.915  1.00 0.00 ? 26  TYR A HD2  1  
ATOM 363   H HE1  . TYR A 1 26  ? 7.892   0.182   -10.725 1.00 0.00 ? 26  TYR A HE1  1  
ATOM 364   H HE2  . TYR A 1 26  ? 6.035   3.375   -8.590  1.00 0.00 ? 26  TYR A HE2  1  
ATOM 365   H HH   . TYR A 1 26  ? 7.727   3.451   -10.575 1.00 0.00 ? 26  TYR A HH   1  
ATOM 366   N N    . TYR A 1 27  ? 2.123   -3.394  -9.886  1.00 0.00 ? 27  TYR A N    1  
ATOM 367   C CA   . TYR A 1 27  ? 1.291   -4.549  -9.569  1.00 0.00 ? 27  TYR A CA   1  
ATOM 368   C C    . TYR A 1 27  ? 1.847   -5.309  -8.369  1.00 0.00 ? 27  TYR A C    1  
ATOM 369   O O    . TYR A 1 27  ? 3.039   -5.613  -8.310  1.00 0.00 ? 27  TYR A O    1  
ATOM 370   C CB   . TYR A 1 27  ? 1.196   -5.482  -10.778 1.00 0.00 ? 27  TYR A CB   1  
ATOM 371   C CG   . TYR A 1 27  ? 0.023   -5.182  -11.683 1.00 0.00 ? 27  TYR A CG   1  
ATOM 372   C CD1  . TYR A 1 27  ? -0.070  -3.968  -12.352 1.00 0.00 ? 27  TYR A CD1  1  
ATOM 373   C CD2  . TYR A 1 27  ? -0.992  -6.112  -11.869 1.00 0.00 ? 27  TYR A CD2  1  
ATOM 374   C CE1  . TYR A 1 27  ? -1.140  -3.689  -13.181 1.00 0.00 ? 27  TYR A CE1  1  
ATOM 375   C CE2  . TYR A 1 27  ? -2.065  -5.842  -12.697 1.00 0.00 ? 27  TYR A CE2  1  
ATOM 376   C CZ   . TYR A 1 27  ? -2.135  -4.629  -13.350 1.00 0.00 ? 27  TYR A CZ   1  
ATOM 377   O OH   . TYR A 1 27  ? -3.203  -4.356  -14.173 1.00 0.00 ? 27  TYR A OH   1  
ATOM 378   H H    . TYR A 1 27  ? 2.781   -3.463  -10.609 1.00 0.00 ? 27  TYR A H    1  
ATOM 379   H HA   . TYR A 1 27  ? 0.302   -4.189  -9.326  1.00 0.00 ? 27  TYR A HA   1  
ATOM 380   H HB2  . TYR A 1 27  ? 2.098   -5.394  -11.364 1.00 0.00 ? 27  TYR A HB2  1  
ATOM 381   H HB3  . TYR A 1 27  ? 1.096   -6.500  -10.431 1.00 0.00 ? 27  TYR A HB3  1  
ATOM 382   H HD1  . TYR A 1 27  ? 0.711   -3.233  -12.218 1.00 0.00 ? 27  TYR A HD1  1  
ATOM 383   H HD2  . TYR A 1 27  ? -0.934  -7.061  -11.356 1.00 0.00 ? 27  TYR A HD2  1  
ATOM 384   H HE1  . TYR A 1 27  ? -1.195  -2.739  -13.692 1.00 0.00 ? 27  TYR A HE1  1  
ATOM 385   H HE2  . TYR A 1 27  ? -2.844  -6.578  -12.829 1.00 0.00 ? 27  TYR A HE2  1  
ATOM 386   H HH   . TYR A 1 27  ? -3.739  -5.147  -14.275 1.00 0.00 ? 27  TYR A HH   1  
ATOM 387   N N    . ILE A 1 28  ? 0.975   -5.612  -7.413  1.00 0.00 ? 28  ILE A N    1  
ATOM 388   C CA   . ILE A 1 28  ? 1.377   -6.338  -6.215  1.00 0.00 ? 28  ILE A CA   1  
ATOM 389   C C    . ILE A 1 28  ? 1.183   -7.840  -6.390  1.00 0.00 ? 28  ILE A C    1  
ATOM 390   O O    . ILE A 1 28  ? 0.097   -8.300  -6.744  1.00 0.00 ? 28  ILE A O    1  
ATOM 391   C CB   . ILE A 1 28  ? 0.584   -5.870  -4.981  1.00 0.00 ? 28  ILE A CB   1  
ATOM 392   C CG1  . ILE A 1 28  ? 0.668   -4.348  -4.841  1.00 0.00 ? 28  ILE A CG1  1  
ATOM 393   C CG2  . ILE A 1 28  ? 1.107   -6.552  -3.725  1.00 0.00 ? 28  ILE A CG2  1  
ATOM 394   C CD1  . ILE A 1 28  ? 0.221   -3.840  -3.488  1.00 0.00 ? 28  ILE A CD1  1  
ATOM 395   H H    . ILE A 1 28  ? 0.039   -5.343  -7.518  1.00 0.00 ? 28  ILE A H    1  
ATOM 396   H HA   . ILE A 1 28  ? 2.425   -6.139  -6.041  1.00 0.00 ? 28  ILE A HA   1  
ATOM 397   H HB   . ILE A 1 28  ? -0.448  -6.156  -5.114  1.00 0.00 ? 28  ILE A HB   1  
ATOM 398   H HG12 . ILE A 1 28  ? 1.689   -4.034  -4.992  1.00 0.00 ? 28  ILE A HG12 1  
ATOM 399   H HG13 . ILE A 1 28  ? 0.040   -3.890  -5.592  1.00 0.00 ? 28  ILE A HG13 1  
ATOM 400   H HG21 . ILE A 1 28  ? 1.844   -5.920  -3.253  1.00 0.00 ? 28  ILE A HG21 1  
ATOM 401   H HG22 . ILE A 1 28  ? 0.289   -6.722  -3.041  1.00 0.00 ? 28  ILE A HG22 1  
ATOM 402   H HG23 . ILE A 1 28  ? 1.558   -7.496  -3.989  1.00 0.00 ? 28  ILE A HG23 1  
ATOM 403   H HD11 . ILE A 1 28  ? -0.227  -4.650  -2.930  1.00 0.00 ? 28  ILE A HD11 1  
ATOM 404   H HD12 . ILE A 1 28  ? 1.075   -3.461  -2.946  1.00 0.00 ? 28  ILE A HD12 1  
ATOM 405   H HD13 . ILE A 1 28  ? -0.503  -3.051  -3.620  1.00 0.00 ? 28  ILE A HD13 1  
ATOM 406   N N    . LYS A 1 29  ? 2.242   -8.602  -6.139  1.00 0.00 ? 29  LYS A N    1  
ATOM 407   C CA   . LYS A 1 29  ? 2.189   -10.053 -6.265  1.00 0.00 ? 29  LYS A CA   1  
ATOM 408   C C    . LYS A 1 29  ? 1.659   -10.692 -4.985  1.00 0.00 ? 29  LYS A C    1  
ATOM 409   O O    . LYS A 1 29  ? 1.247   -9.996  -4.057  1.00 0.00 ? 29  LYS A O    1  
ATOM 410   C CB   . LYS A 1 29  ? 3.578   -10.609 -6.588  1.00 0.00 ? 29  LYS A CB   1  
ATOM 411   C CG   . LYS A 1 29  ? 4.713   -9.790  -5.998  1.00 0.00 ? 29  LYS A CG   1  
ATOM 412   C CD   . LYS A 1 29  ? 4.487   -9.505  -4.523  1.00 0.00 ? 29  LYS A CD   1  
ATOM 413   C CE   . LYS A 1 29  ? 4.888   -10.690 -3.658  1.00 0.00 ? 29  LYS A CE   1  
ATOM 414   N NZ   . LYS A 1 29  ? 4.995   -10.317 -2.221  1.00 0.00 ? 29  LYS A NZ   1  
ATOM 415   H H    . LYS A 1 29  ? 3.081   -8.177  -5.860  1.00 0.00 ? 29  LYS A H    1  
ATOM 416   H HA   . LYS A 1 29  ? 1.518   -10.291 -7.077  1.00 0.00 ? 29  LYS A HA   1  
ATOM 417   H HB2  . LYS A 1 29  ? 3.649   -11.615 -6.201  1.00 0.00 ? 29  LYS A HB2  1  
ATOM 418   H HB3  . LYS A 1 29  ? 3.701   -10.636 -7.661  1.00 0.00 ? 29  LYS A HB3  1  
ATOM 419   H HG2  . LYS A 1 29  ? 5.636   -10.338 -6.111  1.00 0.00 ? 29  LYS A HG2  1  
ATOM 420   H HG3  . LYS A 1 29  ? 4.781   -8.852  -6.531  1.00 0.00 ? 29  LYS A HG3  1  
ATOM 421   H HD2  . LYS A 1 29  ? 5.078   -8.648  -4.236  1.00 0.00 ? 29  LYS A HD2  1  
ATOM 422   H HD3  . LYS A 1 29  ? 3.439   -9.291  -4.363  1.00 0.00 ? 29  LYS A HD3  1  
ATOM 423   H HE2  . LYS A 1 29  ? 4.145   -11.465 -3.766  1.00 0.00 ? 29  LYS A HE2  1  
ATOM 424   H HE3  . LYS A 1 29  ? 5.845   -11.059 -3.998  1.00 0.00 ? 29  LYS A HE3  1  
ATOM 425   H HZ1  . LYS A 1 29  ? 4.353   -10.903 -1.651  1.00 0.00 ? 29  LYS A HZ1  1  
ATOM 426   H HZ2  . LYS A 1 29  ? 4.741   -9.317  -2.092  1.00 0.00 ? 29  LYS A HZ2  1  
ATOM 427   H HZ3  . LYS A 1 29  ? 5.969   -10.462 -1.886  1.00 0.00 ? 29  LYS A HZ3  1  
ATOM 428   N N    . ASP A 1 30  ? 1.673   -12.020 -4.942  1.00 0.00 ? 30  ASP A N    1  
ATOM 429   C CA   . ASP A 1 30  ? 1.197   -12.752 -3.775  1.00 0.00 ? 30  ASP A CA   1  
ATOM 430   C C    . ASP A 1 30  ? 2.322   -12.958 -2.766  1.00 0.00 ? 30  ASP A C    1  
ATOM 431   O O    . ASP A 1 30  ? 3.366   -13.522 -3.091  1.00 0.00 ? 30  ASP A O    1  
ATOM 432   C CB   . ASP A 1 30  ? 0.618   -14.104 -4.195  1.00 0.00 ? 30  ASP A CB   1  
ATOM 433   C CG   . ASP A 1 30  ? 0.063   -14.887 -3.022  1.00 0.00 ? 30  ASP A CG   1  
ATOM 434   O OD1  . ASP A 1 30  ? -0.957  -14.452 -2.448  1.00 0.00 ? 30  ASP A OD1  1  
ATOM 435   O OD2  . ASP A 1 30  ? 0.650   -15.934 -2.676  1.00 0.00 ? 30  ASP A OD2  1  
ATOM 436   H H    . ASP A 1 30  ? 2.014   -12.519 -5.714  1.00 0.00 ? 30  ASP A H    1  
ATOM 437   H HA   . ASP A 1 30  ? 0.417   -12.166 -3.311  1.00 0.00 ? 30  ASP A HA   1  
ATOM 438   H HB2  . ASP A 1 30  ? -0.180  -13.941 -4.905  1.00 0.00 ? 30  ASP A HB2  1  
ATOM 439   H HB3  . ASP A 1 30  ? 1.395   -14.691 -4.662  1.00 0.00 ? 30  ASP A HB3  1  
ATOM 440   N N    . GLY A 1 31  ? 2.102   -12.496 -1.538  1.00 0.00 ? 31  GLY A N    1  
ATOM 441   C CA   . GLY A 1 31  ? 3.107   -12.638 -0.501  1.00 0.00 ? 31  GLY A CA   1  
ATOM 442   C C    . GLY A 1 31  ? 3.305   -11.362 0.293   1.00 0.00 ? 31  GLY A C    1  
ATOM 443   O O    . GLY A 1 31  ? 2.337   -10.704 0.675   1.00 0.00 ? 31  GLY A O    1  
ATOM 444   H H    . GLY A 1 31  ? 1.250   -12.055 -1.336  1.00 0.00 ? 31  GLY A H    1  
ATOM 445   H HA2  . GLY A 1 31  ? 2.804   -13.426 0.173   1.00 0.00 ? 31  GLY A HA2  1  
ATOM 446   H HA3  . GLY A 1 31  ? 4.045   -12.912 -0.960  1.00 0.00 ? 31  GLY A HA3  1  
ATOM 447   N N    . ILE A 1 32  ? 4.562   -11.012 0.543   1.00 0.00 ? 32  ILE A N    1  
ATOM 448   C CA   . ILE A 1 32  ? 4.883   -9.807  1.297   1.00 0.00 ? 32  ILE A CA   1  
ATOM 449   C C    . ILE A 1 32  ? 5.642   -8.804  0.434   1.00 0.00 ? 32  ILE A C    1  
ATOM 450   O O    . ILE A 1 32  ? 6.728   -9.097  -0.068  1.00 0.00 ? 32  ILE A O    1  
ATOM 451   C CB   . ILE A 1 32  ? 5.724   -10.132 2.546   1.00 0.00 ? 32  ILE A CB   1  
ATOM 452   C CG1  . ILE A 1 32  ? 4.882   -10.897 3.570   1.00 0.00 ? 32  ILE A CG1  1  
ATOM 453   C CG2  . ILE A 1 32  ? 6.279   -8.854  3.158   1.00 0.00 ? 32  ILE A CG2  1  
ATOM 454   C CD1  . ILE A 1 32  ? 4.266   -12.164 3.019   1.00 0.00 ? 32  ILE A CD1  1  
ATOM 455   H H    . ILE A 1 32  ? 5.291   -11.577 0.212   1.00 0.00 ? 32  ILE A H    1  
ATOM 456   H HA   . ILE A 1 32  ? 3.955   -9.358  1.619   1.00 0.00 ? 32  ILE A HA   1  
ATOM 457   H HB   . ILE A 1 32  ? 6.556   -10.748 2.243   1.00 0.00 ? 32  ILE A HB   1  
ATOM 458   H HG12 . ILE A 1 32  ? 5.504   -11.169 4.408   1.00 0.00 ? 32  ILE A HG12 1  
ATOM 459   H HG13 . ILE A 1 32  ? 4.080   -10.259 3.913   1.00 0.00 ? 32  ILE A HG13 1  
ATOM 460   H HG21 . ILE A 1 32  ? 6.354   -8.971  4.229   1.00 0.00 ? 32  ILE A HG21 1  
ATOM 461   H HG22 . ILE A 1 32  ? 7.258   -8.656  2.749   1.00 0.00 ? 32  ILE A HG22 1  
ATOM 462   H HG23 . ILE A 1 32  ? 5.619   -8.030  2.932   1.00 0.00 ? 32  ILE A HG23 1  
ATOM 463   H HD11 . ILE A 1 32  ? 3.270   -11.951 2.656   1.00 0.00 ? 32  ILE A HD11 1  
ATOM 464   H HD12 . ILE A 1 32  ? 4.872   -12.536 2.206   1.00 0.00 ? 32  ILE A HD12 1  
ATOM 465   H HD13 . ILE A 1 32  ? 4.212   -12.908 3.799   1.00 0.00 ? 32  ILE A HD13 1  
ATOM 466   N N    . THR A 1 33  ? 5.064   -7.619  0.268   1.00 0.00 ? 33  THR A N    1  
ATOM 467   C CA   . THR A 1 33  ? 5.685   -6.572  -0.533  1.00 0.00 ? 33  THR A CA   1  
ATOM 468   C C    . THR A 1 33  ? 6.219   -5.448  0.348   1.00 0.00 ? 33  THR A C    1  
ATOM 469   O O    . THR A 1 33  ? 5.474   -4.551  0.745   1.00 0.00 ? 33  THR A O    1  
ATOM 470   C CB   . THR A 1 33  ? 4.694   -5.982  -1.554  1.00 0.00 ? 33  THR A CB   1  
ATOM 471   O OG1  . THR A 1 33  ? 4.410   -6.945  -2.575  1.00 0.00 ? 33  THR A OG1  1  
ATOM 472   C CG2  . THR A 1 33  ? 5.255   -4.717  -2.185  1.00 0.00 ? 33  THR A CG2  1  
ATOM 473   H H    . THR A 1 33  ? 4.199   -7.446  0.694   1.00 0.00 ? 33  THR A H    1  
ATOM 474   H HA   . THR A 1 33  ? 6.509   -7.012  -1.077  1.00 0.00 ? 33  THR A HA   1  
ATOM 475   H HB   . THR A 1 33  ? 3.776   -5.733  -1.039  1.00 0.00 ? 33  THR A HB   1  
ATOM 476   H HG1  . THR A 1 33  ? 4.113   -6.493  -3.368  1.00 0.00 ? 33  THR A HG1  1  
ATOM 477   H HG21 . THR A 1 33  ? 5.270   -4.827  -3.259  1.00 0.00 ? 33  THR A HG21 1  
ATOM 478   H HG22 . THR A 1 33  ? 6.260   -4.551  -1.826  1.00 0.00 ? 33  THR A HG22 1  
ATOM 479   H HG23 . THR A 1 33  ? 4.633   -3.875  -1.919  1.00 0.00 ? 33  THR A HG23 1  
ATOM 480   N N    . ARG A 1 34  ? 7.512   -5.502  0.650   1.00 0.00 ? 34  ARG A N    1  
ATOM 481   C CA   . ARG A 1 34  ? 8.144   -4.488  1.486   1.00 0.00 ? 34  ARG A CA   1  
ATOM 482   C C    . ARG A 1 34  ? 8.319   -3.182  0.717   1.00 0.00 ? 34  ARG A C    1  
ATOM 483   O O    . ARG A 1 34  ? 8.884   -3.164  -0.377  1.00 0.00 ? 34  ARG A O    1  
ATOM 484   C CB   . ARG A 1 34  ? 9.502   -4.984  1.987   1.00 0.00 ? 34  ARG A CB   1  
ATOM 485   C CG   . ARG A 1 34  ? 9.417   -5.811  3.259   1.00 0.00 ? 34  ARG A CG   1  
ATOM 486   C CD   . ARG A 1 34  ? 10.798  -6.189  3.771   1.00 0.00 ? 34  ARG A CD   1  
ATOM 487   N NE   . ARG A 1 34  ? 10.764  -7.389  4.602   1.00 0.00 ? 34  ARG A NE   1  
ATOM 488   C CZ   . ARG A 1 34  ? 11.711  -7.703  5.479   1.00 0.00 ? 34  ARG A CZ   1  
ATOM 489   N NH1  . ARG A 1 34  ? 12.761  -6.909  5.638   1.00 0.00 ? 34  ARG A NH1  1  
ATOM 490   N NH2  . ARG A 1 34  ? 11.609  -8.813  6.198   1.00 0.00 ? 34  ARG A NH2  1  
ATOM 491   H H    . ARG A 1 34  ? 8.053   -6.242  0.304   1.00 0.00 ? 34  ARG A H    1  
ATOM 492   H HA   . ARG A 1 34  ? 7.501   -4.309  2.334   1.00 0.00 ? 34  ARG A HA   1  
ATOM 493   H HB2  . ARG A 1 34  ? 9.956   -5.592  1.218   1.00 0.00 ? 34  ARG A HB2  1  
ATOM 494   H HB3  . ARG A 1 34  ? 10.134  -4.130  2.179   1.00 0.00 ? 34  ARG A HB3  1  
ATOM 495   H HG2  . ARG A 1 34  ? 8.909   -5.235  4.019   1.00 0.00 ? 34  ARG A HG2  1  
ATOM 496   H HG3  . ARG A 1 34  ? 8.859   -6.712  3.055   1.00 0.00 ? 34  ARG A HG3  1  
ATOM 497   H HD2  . ARG A 1 34  ? 11.445  -6.367  2.925   1.00 0.00 ? 34  ARG A HD2  1  
ATOM 498   H HD3  . ARG A 1 34  ? 11.187  -5.368  4.355   1.00 0.00 ? 34  ARG A HD3  1  
ATOM 499   H HE   . ARG A 1 34  ? 9.997   -7.990  4.500   1.00 0.00 ? 34  ARG A HE   1  
ATOM 500   H HH11 . ARG A 1 34  ? 12.840  -6.071  5.098   1.00 0.00 ? 34  ARG A HH11 1  
ATOM 501   H HH12 . ARG A 1 34  ? 13.472  -7.147  6.300   1.00 0.00 ? 34  ARG A HH12 1  
ATOM 502   H HH21 . ARG A 1 34  ? 10.819  -9.414  6.081   1.00 0.00 ? 34  ARG A HH21 1  
ATOM 503   H HH22 . ARG A 1 34  ? 12.323  -9.049  6.858   1.00 0.00 ? 34  ARG A HH22 1  
ATOM 504   N N    . VAL A 1 35  ? 7.830   -2.090  1.296   1.00 0.00 ? 35  VAL A N    1  
ATOM 505   C CA   . VAL A 1 35  ? 7.933   -0.779  0.667   1.00 0.00 ? 35  VAL A CA   1  
ATOM 506   C C    . VAL A 1 35  ? 8.975   0.086   1.366   1.00 0.00 ? 35  VAL A C    1  
ATOM 507   O O    . VAL A 1 35  ? 8.721   0.640   2.435   1.00 0.00 ? 35  VAL A O    1  
ATOM 508   C CB   . VAL A 1 35  ? 6.580   -0.044  0.677   1.00 0.00 ? 35  VAL A CB   1  
ATOM 509   C CG1  . VAL A 1 35  ? 6.605   1.135   -0.283  1.00 0.00 ? 35  VAL A CG1  1  
ATOM 510   C CG2  . VAL A 1 35  ? 5.450   -1.001  0.329   1.00 0.00 ? 35  VAL A CG2  1  
ATOM 511   H H    . VAL A 1 35  ? 7.390   -2.168  2.169   1.00 0.00 ? 35  VAL A H    1  
ATOM 512   H HA   . VAL A 1 35  ? 8.231   -0.925  -0.362  1.00 0.00 ? 35  VAL A HA   1  
ATOM 513   H HB   . VAL A 1 35  ? 6.407   0.336   1.674   1.00 0.00 ? 35  VAL A HB   1  
ATOM 514   H HG11 . VAL A 1 35  ? 6.948   2.017   0.238   1.00 0.00 ? 35  VAL A HG11 1  
ATOM 515   H HG12 . VAL A 1 35  ? 7.273   0.918   -1.104  1.00 0.00 ? 35  VAL A HG12 1  
ATOM 516   H HG13 . VAL A 1 35  ? 5.610   1.309   -0.665  1.00 0.00 ? 35  VAL A HG13 1  
ATOM 517   H HG21 . VAL A 1 35  ? 4.747   -0.507  -0.324  1.00 0.00 ? 35  VAL A HG21 1  
ATOM 518   H HG22 . VAL A 1 35  ? 5.856   -1.869  -0.168  1.00 0.00 ? 35  VAL A HG22 1  
ATOM 519   H HG23 . VAL A 1 35  ? 4.946   -1.309  1.235   1.00 0.00 ? 35  VAL A HG23 1  
ATOM 520   N N    . GLY A 1 36  ? 10.150  0.199   0.754   1.00 0.00 ? 36  GLY A N    1  
ATOM 521   C CA   . GLY A 1 36  ? 11.214  0.999   1.332   1.00 0.00 ? 36  GLY A CA   1  
ATOM 522   C C    . GLY A 1 36  ? 12.138  1.582   0.281   1.00 0.00 ? 36  GLY A C    1  
ATOM 523   O O    . GLY A 1 36  ? 11.682  2.052   -0.761  1.00 0.00 ? 36  GLY A O    1  
ATOM 524   H H    . GLY A 1 36  ? 10.296  -0.266  -0.097  1.00 0.00 ? 36  GLY A H    1  
ATOM 525   H HA2  . GLY A 1 36  ? 10.775  1.806   1.899   1.00 0.00 ? 36  GLY A HA2  1  
ATOM 526   H HA3  . GLY A 1 36  ? 11.794  0.378   1.999   1.00 0.00 ? 36  GLY A HA3  1  
ATOM 527   N N    . GLN A 1 37  ? 13.438  1.553   0.555   1.00 0.00 ? 37  GLN A N    1  
ATOM 528   C CA   . GLN A 1 37  ? 14.426  2.085   -0.374  1.00 0.00 ? 37  GLN A CA   1  
ATOM 529   C C    . GLN A 1 37  ? 15.150  0.958   -1.104  1.00 0.00 ? 37  GLN A C    1  
ATOM 530   O O    . GLN A 1 37  ? 15.065  -0.205  -0.710  1.00 0.00 ? 37  GLN A O    1  
ATOM 531   C CB   . GLN A 1 37  ? 15.438  2.959   0.369   1.00 0.00 ? 37  GLN A CB   1  
ATOM 532   C CG   . GLN A 1 37  ? 14.902  4.334   0.734   1.00 0.00 ? 37  GLN A CG   1  
ATOM 533   C CD   . GLN A 1 37  ? 14.785  5.252   -0.466  1.00 0.00 ? 37  GLN A CD   1  
ATOM 534   O OE1  . GLN A 1 37  ? 15.785  5.609   -1.089  1.00 0.00 ? 37  GLN A OE1  1  
ATOM 535   N NE2  . GLN A 1 37  ? 13.559  5.641   -0.797  1.00 0.00 ? 37  GLN A NE2  1  
ATOM 536   H H    . GLN A 1 37  ? 13.738  1.165   1.403   1.00 0.00 ? 37  GLN A H    1  
ATOM 537   H HA   . GLN A 1 37  ? 13.906  2.691   -1.101  1.00 0.00 ? 37  GLN A HA   1  
ATOM 538   H HB2  . GLN A 1 37  ? 15.730  2.456   1.279   1.00 0.00 ? 37  GLN A HB2  1  
ATOM 539   H HB3  . GLN A 1 37  ? 16.309  3.091   -0.256  1.00 0.00 ? 37  GLN A HB3  1  
ATOM 540   H HG2  . GLN A 1 37  ? 13.923  4.219   1.177   1.00 0.00 ? 37  GLN A HG2  1  
ATOM 541   H HG3  . GLN A 1 37  ? 15.569  4.787   1.453   1.00 0.00 ? 37  GLN A HG3  1  
ATOM 542   H HE21 . GLN A 1 37  ? 12.809  5.318   -0.254  1.00 0.00 ? 37  GLN A HE21 1  
ATOM 543   H HE22 . GLN A 1 37  ? 13.454  6.235   -1.568  1.00 0.00 ? 37  GLN A HE22 1  
ATOM 544   N N    . ALA A 1 38  ? 15.861  1.310   -2.170  1.00 0.00 ? 38  ALA A N    1  
ATOM 545   C CA   . ALA A 1 38  ? 16.601  0.329   -2.954  1.00 0.00 ? 38  ALA A CA   1  
ATOM 546   C C    . ALA A 1 38  ? 17.885  -0.086  -2.243  1.00 0.00 ? 38  ALA A C    1  
ATOM 547   O O    . ALA A 1 38  ? 18.638  -0.924  -2.740  1.00 0.00 ? 38  ALA A O    1  
ATOM 548   C CB   . ALA A 1 38  ? 16.915  0.884   -4.335  1.00 0.00 ? 38  ALA A CB   1  
ATOM 549   H H    . ALA A 1 38  ? 15.891  2.253   -2.434  1.00 0.00 ? 38  ALA A H    1  
ATOM 550   H HA   . ALA A 1 38  ? 15.972  -0.542  -3.077  1.00 0.00 ? 38  ALA A HA   1  
ATOM 551   H HB1  . ALA A 1 38  ? 16.861  0.089   -5.063  1.00 0.00 ? 38  ALA A HB1  1  
ATOM 552   H HB2  . ALA A 1 38  ? 16.196  1.651   -4.585  1.00 0.00 ? 38  ALA A HB2  1  
ATOM 553   H HB3  . ALA A 1 38  ? 17.908  1.307   -4.335  1.00 0.00 ? 38  ALA A HB3  1  
ATOM 554   N N    . ASP A 1 39  ? 18.130  0.507   -1.080  1.00 0.00 ? 39  ASP A N    1  
ATOM 555   C CA   . ASP A 1 39  ? 19.324  0.199   -0.301  1.00 0.00 ? 39  ASP A CA   1  
ATOM 556   C C    . ASP A 1 39  ? 18.982  -0.697  0.886   1.00 0.00 ? 39  ASP A C    1  
ATOM 557   O O    . ASP A 1 39  ? 19.852  -1.369  1.439   1.00 0.00 ? 39  ASP A O    1  
ATOM 558   C CB   . ASP A 1 39  ? 19.985  1.487   0.190   1.00 0.00 ? 39  ASP A CB   1  
ATOM 559   C CG   . ASP A 1 39  ? 20.917  2.090   -0.843  1.00 0.00 ? 39  ASP A CG   1  
ATOM 560   O OD1  . ASP A 1 39  ? 20.535  2.138   -2.030  1.00 0.00 ? 39  ASP A OD1  1  
ATOM 561   O OD2  . ASP A 1 39  ? 22.030  2.513   -0.463  1.00 0.00 ? 39  ASP A OD2  1  
ATOM 562   H H    . ASP A 1 39  ? 17.492  1.167   -0.736  1.00 0.00 ? 39  ASP A H    1  
ATOM 563   H HA   . ASP A 1 39  ? 20.013  -0.326  -0.945  1.00 0.00 ? 39  ASP A HA   1  
ATOM 564   H HB2  . ASP A 1 39  ? 19.218  2.212   0.421   1.00 0.00 ? 39  ASP A HB2  1  
ATOM 565   H HB3  . ASP A 1 39  ? 20.555  1.274   1.083   1.00 0.00 ? 39  ASP A HB3  1  
ATOM 566   N N    . ALA A 1 40  ? 17.710  -0.699  1.272   1.00 0.00 ? 40  ALA A N    1  
ATOM 567   C CA   . ALA A 1 40  ? 17.254  -1.513  2.392   1.00 0.00 ? 40  ALA A CA   1  
ATOM 568   C C    . ALA A 1 40  ? 17.948  -2.870  2.403   1.00 0.00 ? 40  ALA A C    1  
ATOM 569   O O    . ALA A 1 40  ? 18.213  -3.450  1.351   1.00 0.00 ? 40  ALA A O    1  
ATOM 570   C CB   . ALA A 1 40  ? 15.744  -1.690  2.334   1.00 0.00 ? 40  ALA A CB   1  
ATOM 571   H H    . ALA A 1 40  ? 17.064  -0.142  0.790   1.00 0.00 ? 40  ALA A H    1  
ATOM 572   H HA   . ALA A 1 40  ? 17.496  -0.988  3.305   1.00 0.00 ? 40  ALA A HA   1  
ATOM 573   H HB1  . ALA A 1 40  ? 15.508  -2.591  1.789   1.00 0.00 ? 40  ALA A HB1  1  
ATOM 574   H HB2  . ALA A 1 40  ? 15.353  -1.763  3.339   1.00 0.00 ? 40  ALA A HB2  1  
ATOM 575   H HB3  . ALA A 1 40  ? 15.301  -0.841  1.836   1.00 0.00 ? 40  ALA A HB3  1  
ATOM 576   N N    . GLU A 1 41  ? 18.239  -3.371  3.600   1.00 0.00 ? 41  GLU A N    1  
ATOM 577   C CA   . GLU A 1 41  ? 18.904  -4.660  3.747   1.00 0.00 ? 41  GLU A CA   1  
ATOM 578   C C    . GLU A 1 41  ? 18.385  -5.660  2.717   1.00 0.00 ? 41  GLU A C    1  
ATOM 579   O O    . GLU A 1 41  ? 19.160  -6.398  2.108   1.00 0.00 ? 41  GLU A O    1  
ATOM 580   C CB   . GLU A 1 41  ? 18.693  -5.210  5.159   1.00 0.00 ? 41  GLU A CB   1  
ATOM 581   C CG   . GLU A 1 41  ? 18.722  -4.142  6.239   1.00 0.00 ? 41  GLU A CG   1  
ATOM 582   C CD   . GLU A 1 41  ? 19.106  -4.696  7.597   1.00 0.00 ? 41  GLU A CD   1  
ATOM 583   O OE1  . GLU A 1 41  ? 19.269  -5.929  7.710   1.00 0.00 ? 41  GLU A OE1  1  
ATOM 584   O OE2  . GLU A 1 41  ? 19.242  -3.897  8.547   1.00 0.00 ? 41  GLU A OE2  1  
ATOM 585   H H    . GLU A 1 41  ? 18.002  -2.861  4.402   1.00 0.00 ? 41  GLU A H    1  
ATOM 586   H HA   . GLU A 1 41  ? 19.960  -4.509  3.584   1.00 0.00 ? 41  GLU A HA   1  
ATOM 587   H HB2  . GLU A 1 41  ? 17.735  -5.708  5.199   1.00 0.00 ? 41  GLU A HB2  1  
ATOM 588   H HB3  . GLU A 1 41  ? 19.471  -5.929  5.372   1.00 0.00 ? 41  GLU A HB3  1  
ATOM 589   H HG2  . GLU A 1 41  ? 19.441  -3.385  5.960   1.00 0.00 ? 41  GLU A HG2  1  
ATOM 590   H HG3  . GLU A 1 41  ? 17.742  -3.695  6.312   1.00 0.00 ? 41  GLU A HG3  1  
ATOM 591   N N    . ARG A 1 42  ? 17.070  -5.678  2.529   1.00 0.00 ? 42  ARG A N    1  
ATOM 592   C CA   . ARG A 1 42  ? 16.447  -6.588  1.575   1.00 0.00 ? 42  ARG A CA   1  
ATOM 593   C C    . ARG A 1 42  ? 15.936  -5.828  0.354   1.00 0.00 ? 42  ARG A C    1  
ATOM 594   O O    . ARG A 1 42  ? 15.782  -4.608  0.389   1.00 0.00 ? 42  ARG A O    1  
ATOM 595   C CB   . ARG A 1 42  ? 15.295  -7.344  2.237   1.00 0.00 ? 42  ARG A CB   1  
ATOM 596   C CG   . ARG A 1 42  ? 15.750  -8.381  3.251   1.00 0.00 ? 42  ARG A CG   1  
ATOM 597   C CD   . ARG A 1 42  ? 16.376  -9.589  2.571   1.00 0.00 ? 42  ARG A CD   1  
ATOM 598   N NE   . ARG A 1 42  ? 15.384  -10.393 1.862   1.00 0.00 ? 42  ARG A NE   1  
ATOM 599   C CZ   . ARG A 1 42  ? 15.664  -11.546 1.265   1.00 0.00 ? 42  ARG A CZ   1  
ATOM 600   N NH1  . ARG A 1 42  ? 16.898  -12.028 1.292   1.00 0.00 ? 42  ARG A NH1  1  
ATOM 601   N NH2  . ARG A 1 42  ? 14.707  -12.220 0.640   1.00 0.00 ? 42  ARG A NH2  1  
ATOM 602   H H    . ARG A 1 42  ? 16.505  -5.065  3.044   1.00 0.00 ? 42  ARG A H    1  
ATOM 603   H HA   . ARG A 1 42  ? 17.195  -7.297  1.255   1.00 0.00 ? 42  ARG A HA   1  
ATOM 604   H HB2  . ARG A 1 42  ? 14.656  -6.635  2.743   1.00 0.00 ? 42  ARG A HB2  1  
ATOM 605   H HB3  . ARG A 1 42  ? 14.723  -7.848  1.472   1.00 0.00 ? 42  ARG A HB3  1  
ATOM 606   H HG2  . ARG A 1 42  ? 16.481  -7.933  3.907   1.00 0.00 ? 42  ARG A HG2  1  
ATOM 607   H HG3  . ARG A 1 42  ? 14.897  -8.706  3.828   1.00 0.00 ? 42  ARG A HG3  1  
ATOM 608   H HD2  . ARG A 1 42  ? 17.116  -9.243  1.865   1.00 0.00 ? 42  ARG A HD2  1  
ATOM 609   H HD3  . ARG A 1 42  ? 16.852  -10.201 3.321   1.00 0.00 ? 42  ARG A HD3  1  
ATOM 610   H HE   . ARG A 1 42  ? 14.465  -10.055 1.829   1.00 0.00 ? 42  ARG A HE   1  
ATOM 611   H HH11 . ARG A 1 42  ? 17.621  -11.523 1.763   1.00 0.00 ? 42  ARG A HH11 1  
ATOM 612   H HH12 . ARG A 1 42  ? 17.106  -12.897 0.842   1.00 0.00 ? 42  ARG A HH12 1  
ATOM 613   H HH21 . ARG A 1 42  ? 13.775  -11.860 0.617   1.00 0.00 ? 42  ARG A HH21 1  
ATOM 614   H HH22 . ARG A 1 42  ? 14.918  -13.087 0.191   1.00 0.00 ? 42  ARG A HH22 1  
ATOM 615   N N    . ARG A 1 43  ? 15.675  -6.560  -0.725  1.00 0.00 ? 43  ARG A N    1  
ATOM 616   C CA   . ARG A 1 43  ? 15.184  -5.956  -1.957  1.00 0.00 ? 43  ARG A CA   1  
ATOM 617   C C    . ARG A 1 43  ? 13.697  -5.629  -1.847  1.00 0.00 ? 43  ARG A C    1  
ATOM 618   O O    . ARG A 1 43  ? 12.855  -6.527  -1.831  1.00 0.00 ? 43  ARG A O    1  
ATOM 619   C CB   . ARG A 1 43  ? 15.425  -6.893  -3.142  1.00 0.00 ? 43  ARG A CB   1  
ATOM 620   C CG   . ARG A 1 43  ? 15.027  -6.296  -4.482  1.00 0.00 ? 43  ARG A CG   1  
ATOM 621   C CD   . ARG A 1 43  ? 14.797  -7.377  -5.527  1.00 0.00 ? 43  ARG A CD   1  
ATOM 622   N NE   . ARG A 1 43  ? 15.811  -8.425  -5.462  1.00 0.00 ? 43  ARG A NE   1  
ATOM 623   C CZ   . ARG A 1 43  ? 15.686  -9.607  -6.056  1.00 0.00 ? 43  ARG A CZ   1  
ATOM 624   N NH1  . ARG A 1 43  ? 14.596  -9.888  -6.756  1.00 0.00 ? 43  ARG A NH1  1  
ATOM 625   N NH2  . ARG A 1 43  ? 16.653  -10.509 -5.952  1.00 0.00 ? 43  ARG A NH2  1  
ATOM 626   H H    . ARG A 1 43  ? 15.818  -7.529  -0.692  1.00 0.00 ? 43  ARG A H    1  
ATOM 627   H HA   . ARG A 1 43  ? 15.730  -5.038  -2.118  1.00 0.00 ? 43  ARG A HA   1  
ATOM 628   H HB2  . ARG A 1 43  ? 16.475  -7.142  -3.181  1.00 0.00 ? 43  ARG A HB2  1  
ATOM 629   H HB3  . ARG A 1 43  ? 14.854  -7.797  -2.991  1.00 0.00 ? 43  ARG A HB3  1  
ATOM 630   H HG2  . ARG A 1 43  ? 14.115  -5.731  -4.357  1.00 0.00 ? 43  ARG A HG2  1  
ATOM 631   H HG3  . ARG A 1 43  ? 15.815  -5.641  -4.821  1.00 0.00 ? 43  ARG A HG3  1  
ATOM 632   H HD2  . ARG A 1 43  ? 13.826  -7.818  -5.361  1.00 0.00 ? 43  ARG A HD2  1  
ATOM 633   H HD3  . ARG A 1 43  ? 14.823  -6.923  -6.506  1.00 0.00 ? 43  ARG A HD3  1  
ATOM 634   H HE   . ARG A 1 43  ? 16.625  -8.238  -4.950  1.00 0.00 ? 43  ARG A HE   1  
ATOM 635   H HH11 . ARG A 1 43  ? 13.866  -9.209  -6.838  1.00 0.00 ? 43  ARG A HH11 1  
ATOM 636   H HH12 . ARG A 1 43  ? 14.504  -10.778 -7.204  1.00 0.00 ? 43  ARG A HH12 1  
ATOM 637   H HH21 . ARG A 1 43  ? 17.477  -10.301 -5.425  1.00 0.00 ? 43  ARG A HH21 1  
ATOM 638   H HH22 . ARG A 1 43  ? 16.558  -11.398 -6.399  1.00 0.00 ? 43  ARG A HH22 1  
ATOM 639   N N    . GLN A 1 44  ? 13.383  -4.340  -1.771  1.00 0.00 ? 44  GLN A N    1  
ATOM 640   C CA   . GLN A 1 44  ? 11.999  -3.897  -1.661  1.00 0.00 ? 44  GLN A CA   1  
ATOM 641   C C    . GLN A 1 44  ? 11.299  -3.956  -3.015  1.00 0.00 ? 44  GLN A C    1  
ATOM 642   O O    . GLN A 1 44  ? 11.821  -3.466  -4.016  1.00 0.00 ? 44  GLN A O    1  
ATOM 643   C CB   . GLN A 1 44  ? 11.940  -2.473  -1.105  1.00 0.00 ? 44  GLN A CB   1  
ATOM 644   C CG   . GLN A 1 44  ? 12.894  -2.232  0.054   1.00 0.00 ? 44  GLN A CG   1  
ATOM 645   C CD   . GLN A 1 44  ? 12.609  -3.132  1.240   1.00 0.00 ? 44  GLN A CD   1  
ATOM 646   O OE1  . GLN A 1 44  ? 12.672  -4.357  1.134   1.00 0.00 ? 44  GLN A OE1  1  
ATOM 647   N NE2  . GLN A 1 44  ? 12.295  -2.527  2.380   1.00 0.00 ? 44  GLN A NE2  1  
ATOM 648   H H    . GLN A 1 44  ? 14.099  -3.672  -1.789  1.00 0.00 ? 44  GLN A H    1  
ATOM 649   H HA   . GLN A 1 44  ? 11.491  -4.561  -0.978  1.00 0.00 ? 44  GLN A HA   1  
ATOM 650   H HB2  . GLN A 1 44  ? 12.185  -1.780  -1.896  1.00 0.00 ? 44  GLN A HB2  1  
ATOM 651   H HB3  . GLN A 1 44  ? 10.935  -2.274  -0.763  1.00 0.00 ? 44  GLN A HB3  1  
ATOM 652   H HG2  . GLN A 1 44  ? 13.903  -2.416  -0.283  1.00 0.00 ? 44  GLN A HG2  1  
ATOM 653   H HG3  . GLN A 1 44  ? 12.803  -1.203  0.370   1.00 0.00 ? 44  GLN A HG3  1  
ATOM 654   H HE21 . GLN A 1 44  ? 12.263  -1.547  2.390   1.00 0.00 ? 44  GLN A HE21 1  
ATOM 655   H HE22 . GLN A 1 44  ? 12.105  -3.084  3.163   1.00 0.00 ? 44  GLN A HE22 1  
ATOM 656   N N    . ASP A 1 45  ? 10.115  -4.559  -3.038  1.00 0.00 ? 45  ASP A N    1  
ATOM 657   C CA   . ASP A 1 45  ? 9.343   -4.681  -4.269  1.00 0.00 ? 45  ASP A CA   1  
ATOM 658   C C    . ASP A 1 45  ? 9.120   -3.315  -4.909  1.00 0.00 ? 45  ASP A C    1  
ATOM 659   O O    . ASP A 1 45  ? 9.194   -3.171  -6.129  1.00 0.00 ? 45  ASP A O    1  
ATOM 660   C CB   . ASP A 1 45  ? 7.998   -5.352  -3.987  1.00 0.00 ? 45  ASP A CB   1  
ATOM 661   C CG   . ASP A 1 45  ? 7.376   -5.947  -5.235  1.00 0.00 ? 45  ASP A CG   1  
ATOM 662   O OD1  . ASP A 1 45  ? 7.972   -5.802  -6.322  1.00 0.00 ? 45  ASP A OD1  1  
ATOM 663   O OD2  . ASP A 1 45  ? 6.291   -6.557  -5.125  1.00 0.00 ? 45  ASP A OD2  1  
ATOM 664   H H    . ASP A 1 45  ? 9.752   -4.929  -2.206  1.00 0.00 ? 45  ASP A H    1  
ATOM 665   H HA   . ASP A 1 45  ? 9.906   -5.298  -4.953  1.00 0.00 ? 45  ASP A HA   1  
ATOM 666   H HB2  . ASP A 1 45  ? 8.142   -6.145  -3.267  1.00 0.00 ? 45  ASP A HB2  1  
ATOM 667   H HB3  . ASP A 1 45  ? 7.316   -4.620  -3.580  1.00 0.00 ? 45  ASP A HB3  1  
ATOM 668   N N    . ILE A 1 46  ? 8.847   -2.315  -4.077  1.00 0.00 ? 46  ILE A N    1  
ATOM 669   C CA   . ILE A 1 46  ? 8.613   -0.961  -4.562  1.00 0.00 ? 46  ILE A CA   1  
ATOM 670   C C    . ILE A 1 46  ? 9.557   0.033   -3.894  1.00 0.00 ? 46  ILE A C    1  
ATOM 671   O O    . ILE A 1 46  ? 9.780   -0.023  -2.685  1.00 0.00 ? 46  ILE A O    1  
ATOM 672   C CB   . ILE A 1 46  ? 7.159   -0.517  -4.314  1.00 0.00 ? 46  ILE A CB   1  
ATOM 673   C CG1  . ILE A 1 46  ? 6.246   -1.043  -5.423  1.00 0.00 ? 46  ILE A CG1  1  
ATOM 674   C CG2  . ILE A 1 46  ? 7.076   1.000   -4.226  1.00 0.00 ? 46  ILE A CG2  1  
ATOM 675   C CD1  . ILE A 1 46  ? 4.802   -1.192  -4.997  1.00 0.00 ? 46  ILE A CD1  1  
ATOM 676   H H    . ILE A 1 46  ? 8.802   -2.493  -3.115  1.00 0.00 ? 46  ILE A H    1  
ATOM 677   H HA   . ILE A 1 46  ? 8.793   -0.953  -5.627  1.00 0.00 ? 46  ILE A HA   1  
ATOM 678   H HB   . ILE A 1 46  ? 6.838   -0.926  -3.368  1.00 0.00 ? 46  ILE A HB   1  
ATOM 679   H HG12 . ILE A 1 46  ? 6.275   -0.361  -6.258  1.00 0.00 ? 46  ILE A HG12 1  
ATOM 680   H HG13 . ILE A 1 46  ? 6.600   -2.012  -5.741  1.00 0.00 ? 46  ILE A HG13 1  
ATOM 681   H HG21 . ILE A 1 46  ? 7.606   1.438   -5.059  1.00 0.00 ? 46  ILE A HG21 1  
ATOM 682   H HG22 . ILE A 1 46  ? 6.041   1.305   -4.259  1.00 0.00 ? 46  ILE A HG22 1  
ATOM 683   H HG23 . ILE A 1 46  ? 7.521   1.332   -3.300  1.00 0.00 ? 46  ILE A HG23 1  
ATOM 684   H HD11 . ILE A 1 46  ? 4.187   -0.505  -5.561  1.00 0.00 ? 46  ILE A HD11 1  
ATOM 685   H HD12 . ILE A 1 46  ? 4.473   -2.204  -5.184  1.00 0.00 ? 46  ILE A HD12 1  
ATOM 686   H HD13 . ILE A 1 46  ? 4.712   -0.972  -3.944  1.00 0.00 ? 46  ILE A HD13 1  
ATOM 687   N N    . VAL A 1 47  ? 10.108  0.944   -4.690  1.00 0.00 ? 47  VAL A N    1  
ATOM 688   C CA   . VAL A 1 47  ? 11.026  1.953   -4.177  1.00 0.00 ? 47  VAL A CA   1  
ATOM 689   C C    . VAL A 1 47  ? 10.485  3.359   -4.411  1.00 0.00 ? 47  VAL A C    1  
ATOM 690   O O    . VAL A 1 47  ? 9.964   3.665   -5.485  1.00 0.00 ? 47  VAL A O    1  
ATOM 691   C CB   . VAL A 1 47  ? 12.415  1.834   -4.832  1.00 0.00 ? 47  VAL A CB   1  
ATOM 692   C CG1  . VAL A 1 47  ? 13.414  2.748   -4.137  1.00 0.00 ? 47  VAL A CG1  1  
ATOM 693   C CG2  . VAL A 1 47  ? 12.894  0.390   -4.805  1.00 0.00 ? 47  VAL A CG2  1  
ATOM 694   H H    . VAL A 1 47  ? 9.891   0.938   -5.646  1.00 0.00 ? 47  VAL A H    1  
ATOM 695   H HA   . VAL A 1 47  ? 11.138  1.793   -3.114  1.00 0.00 ? 47  VAL A HA   1  
ATOM 696   H HB   . VAL A 1 47  ? 12.333  2.145   -5.863  1.00 0.00 ? 47  VAL A HB   1  
ATOM 697   H HG11 . VAL A 1 47  ? 14.020  2.167   -3.457  1.00 0.00 ? 47  VAL A HG11 1  
ATOM 698   H HG12 . VAL A 1 47  ? 14.047  3.216   -4.876  1.00 0.00 ? 47  VAL A HG12 1  
ATOM 699   H HG13 . VAL A 1 47  ? 12.881  3.508   -3.585  1.00 0.00 ? 47  VAL A HG13 1  
ATOM 700   H HG21 . VAL A 1 47  ? 13.972  0.369   -4.743  1.00 0.00 ? 47  VAL A HG21 1  
ATOM 701   H HG22 . VAL A 1 47  ? 12.473  -0.112  -3.947  1.00 0.00 ? 47  VAL A HG22 1  
ATOM 702   H HG23 . VAL A 1 47  ? 12.575  -0.112  -5.708  1.00 0.00 ? 47  VAL A HG23 1  
ATOM 703   N N    . LEU A 1 48  ? 10.612  4.212   -3.400  1.00 0.00 ? 48  LEU A N    1  
ATOM 704   C CA   . LEU A 1 48  ? 10.136  5.587   -3.496  1.00 0.00 ? 48  LEU A CA   1  
ATOM 705   C C    . LEU A 1 48  ? 11.305  6.566   -3.541  1.00 0.00 ? 48  LEU A C    1  
ATOM 706   O O    . LEU A 1 48  ? 12.428  6.225   -3.169  1.00 0.00 ? 48  LEU A O    1  
ATOM 707   C CB   . LEU A 1 48  ? 9.226   5.916   -2.311  1.00 0.00 ? 48  LEU A CB   1  
ATOM 708   C CG   . LEU A 1 48  ? 8.295   4.795   -1.848  1.00 0.00 ? 48  LEU A CG   1  
ATOM 709   C CD1  . LEU A 1 48  ? 7.520   4.225   -3.026  1.00 0.00 ? 48  LEU A CD1  1  
ATOM 710   C CD2  . LEU A 1 48  ? 9.086   3.700   -1.147  1.00 0.00 ? 48  LEU A CD2  1  
ATOM 711   H H    . LEU A 1 48  ? 11.035  3.910   -2.570  1.00 0.00 ? 48  LEU A H    1  
ATOM 712   H HA   . LEU A 1 48  ? 9.569   5.679   -4.410  1.00 0.00 ? 48  LEU A HA   1  
ATOM 713   H HB2  . LEU A 1 48  ? 9.854   6.189   -1.477  1.00 0.00 ? 48  LEU A HB2  1  
ATOM 714   H HB3  . LEU A 1 48  ? 8.614   6.762   -2.590  1.00 0.00 ? 48  LEU A HB3  1  
ATOM 715   H HG   . LEU A 1 48  ? 7.581   5.197   -1.142  1.00 0.00 ? 48  LEU A HG   1  
ATOM 716   H HD11 . LEU A 1 48  ? 8.083   3.419   -3.471  1.00 0.00 ? 48  LEU A HD11 1  
ATOM 717   H HD12 . LEU A 1 48  ? 7.359   5.000   -3.760  1.00 0.00 ? 48  LEU A HD12 1  
ATOM 718   H HD13 . LEU A 1 48  ? 6.566   3.852   -2.682  1.00 0.00 ? 48  LEU A HD13 1  
ATOM 719   H HD21 . LEU A 1 48  ? 9.165   2.842   -1.797  1.00 0.00 ? 48  LEU A HD21 1  
ATOM 720   H HD22 . LEU A 1 48  ? 8.578   3.417   -0.237  1.00 0.00 ? 48  LEU A HD22 1  
ATOM 721   H HD23 . LEU A 1 48  ? 10.074  4.066   -0.910  1.00 0.00 ? 48  LEU A HD23 1  
ATOM 722   N N    . SER A 1 49  ? 11.032  7.785   -3.997  1.00 0.00 ? 49  SER A N    1  
ATOM 723   C CA   . SER A 1 49  ? 12.062  8.813   -4.092  1.00 0.00 ? 49  SER A CA   1  
ATOM 724   C C    . SER A 1 49  ? 12.011  9.746   -2.886  1.00 0.00 ? 49  SER A C    1  
ATOM 725   O O    . SER A 1 49  ? 11.138  9.623   -2.028  1.00 0.00 ? 49  SER A O    1  
ATOM 726   C CB   . SER A 1 49  ? 11.891  9.618   -5.382  1.00 0.00 ? 49  SER A CB   1  
ATOM 727   O OG   . SER A 1 49  ? 12.609  9.027   -6.451  1.00 0.00 ? 49  SER A OG   1  
ATOM 728   H H    . SER A 1 49  ? 10.117  7.996   -4.278  1.00 0.00 ? 49  SER A H    1  
ATOM 729   H HA   . SER A 1 49  ? 13.022  8.320   -4.110  1.00 0.00 ? 49  SER A HA   1  
ATOM 730   H HB2  . SER A 1 49  ? 10.844  9.655   -5.644  1.00 0.00 ? 49  SER A HB2  1  
ATOM 731   H HB3  . SER A 1 49  ? 12.259  10.622  -5.228  1.00 0.00 ? 49  SER A HB3  1  
ATOM 732   H HG   . SER A 1 49  ? 12.520  9.572   -7.236  1.00 0.00 ? 49  SER A HG   1  
ATOM 733   N N    . GLY A 1 50  ? 12.954  10.681  -2.828  1.00 0.00 ? 50  GLY A N    1  
ATOM 734   C CA   . GLY A 1 50  ? 13.000  11.622  -1.725  1.00 0.00 ? 50  GLY A CA   1  
ATOM 735   C C    . GLY A 1 50  ? 13.816  11.106  -0.556  1.00 0.00 ? 50  GLY A C    1  
ATOM 736   O O    . GLY A 1 50  ? 14.470  10.069  -0.657  1.00 0.00 ? 50  GLY A O    1  
ATOM 737   H H    . GLY A 1 50  ? 13.625  10.733  -3.541  1.00 0.00 ? 50  GLY A H    1  
ATOM 738   H HA2  . GLY A 1 50  ? 13.434  12.548  -2.072  1.00 0.00 ? 50  GLY A HA2  1  
ATOM 739   H HA3  . GLY A 1 50  ? 11.991  11.813  -1.388  1.00 0.00 ? 50  GLY A HA3  1  
ATOM 740   N N    . ALA A 1 51  ? 13.779  11.833  0.556   1.00 0.00 ? 51  ALA A N    1  
ATOM 741   C CA   . ALA A 1 51  ? 14.520  11.442  1.749   1.00 0.00 ? 51  ALA A CA   1  
ATOM 742   C C    . ALA A 1 51  ? 13.578  11.174  2.918   1.00 0.00 ? 51  ALA A C    1  
ATOM 743   O O    . ALA A 1 51  ? 14.001  10.701  3.973   1.00 0.00 ? 51  ALA A O    1  
ATOM 744   C CB   . ALA A 1 51  ? 15.530  12.518  2.118   1.00 0.00 ? 51  ALA A CB   1  
ATOM 745   H H    . ALA A 1 51  ? 13.239  12.650  0.576   1.00 0.00 ? 51  ALA A H    1  
ATOM 746   H HA   . ALA A 1 51  ? 15.063  10.536  1.522   1.00 0.00 ? 51  ALA A HA   1  
ATOM 747   H HB1  . ALA A 1 51  ? 15.220  13.463  1.697   1.00 0.00 ? 51  ALA A HB1  1  
ATOM 748   H HB2  . ALA A 1 51  ? 15.587  12.604  3.194   1.00 0.00 ? 51  ALA A HB2  1  
ATOM 749   H HB3  . ALA A 1 51  ? 16.501  12.250  1.727   1.00 0.00 ? 51  ALA A HB3  1  
ATOM 750   N N    . HIS A 1 52  ? 12.300  11.480  2.723   1.00 0.00 ? 52  HIS A N    1  
ATOM 751   C CA   . HIS A 1 52  ? 11.297  11.273  3.763   1.00 0.00 ? 52  HIS A CA   1  
ATOM 752   C C    . HIS A 1 52  ? 10.876  9.807   3.826   1.00 0.00 ? 52  HIS A C    1  
ATOM 753   O O    . HIS A 1 52  ? 9.918   9.457   4.515   1.00 0.00 ? 52  HIS A O    1  
ATOM 754   C CB   . HIS A 1 52  ? 10.076  12.156  3.506   1.00 0.00 ? 52  HIS A CB   1  
ATOM 755   C CG   . HIS A 1 52  ? 9.324   12.514  4.751   1.00 0.00 ? 52  HIS A CG   1  
ATOM 756   N ND1  . HIS A 1 52  ? 9.092   11.619  5.774   1.00 0.00 ? 52  HIS A ND1  1  
ATOM 757   C CD2  . HIS A 1 52  ? 8.751   13.679  5.135   1.00 0.00 ? 52  HIS A CD2  1  
ATOM 758   C CE1  . HIS A 1 52  ? 8.408   12.218  6.733   1.00 0.00 ? 52  HIS A CE1  1  
ATOM 759   N NE2  . HIS A 1 52  ? 8.189   13.469  6.370   1.00 0.00 ? 52  HIS A NE2  1  
ATOM 760   H H    . HIS A 1 52  ? 12.024  11.854  1.861   1.00 0.00 ? 52  HIS A H    1  
ATOM 761   H HA   . HIS A 1 52  ? 11.738  11.549  4.708   1.00 0.00 ? 52  HIS A HA   1  
ATOM 762   H HB2  . HIS A 1 52  ? 10.396  13.074  3.037   1.00 0.00 ? 52  HIS A HB2  1  
ATOM 763   H HB3  . HIS A 1 52  ? 9.396   11.637  2.845   1.00 0.00 ? 52  HIS A HB3  1  
ATOM 764   H HD2  . HIS A 1 52  ? 8.739   14.603  4.575   1.00 0.00 ? 52  HIS A HD2  1  
ATOM 765   H HE1  . HIS A 1 52  ? 8.084   11.763  7.657   1.00 0.00 ? 52  HIS A HE1  1  
ATOM 766   H HE2  . HIS A 1 52  ? 7.631   14.108  6.859   1.00 0.00 ? 52  HIS A HE2  1  
ATOM 767   N N    . ILE A 1 53  ? 11.598  8.958   3.104   1.00 0.00 ? 53  ILE A N    1  
ATOM 768   C CA   . ILE A 1 53  ? 11.299  7.531   3.079   1.00 0.00 ? 53  ILE A CA   1  
ATOM 769   C C    . ILE A 1 53  ? 12.265  6.752   3.965   1.00 0.00 ? 53  ILE A C    1  
ATOM 770   O O    . ILE A 1 53  ? 13.371  7.210   4.251   1.00 0.00 ? 53  ILE A O    1  
ATOM 771   C CB   . ILE A 1 53  ? 11.365  6.967   1.647   1.00 0.00 ? 53  ILE A CB   1  
ATOM 772   C CG1  . ILE A 1 53  ? 10.736  7.951   0.659   1.00 0.00 ? 53  ILE A CG1  1  
ATOM 773   C CG2  . ILE A 1 53  ? 10.667  5.617   1.577   1.00 0.00 ? 53  ILE A CG2  1  
ATOM 774   C CD1  . ILE A 1 53  ? 9.232   8.058   0.787   1.00 0.00 ? 53  ILE A CD1  1  
ATOM 775   H H    . ILE A 1 53  ? 12.350  9.298   2.575   1.00 0.00 ? 53  ILE A H    1  
ATOM 776   H HA   . ILE A 1 53  ? 10.294  7.395   3.452   1.00 0.00 ? 53  ILE A HA   1  
ATOM 777   H HB   . ILE A 1 53  ? 12.403  6.822   1.389   1.00 0.00 ? 53  ILE A HB   1  
ATOM 778   H HG12 . ILE A 1 53  ? 11.153  8.932   0.822   1.00 0.00 ? 53  ILE A HG12 1  
ATOM 779   H HG13 . ILE A 1 53  ? 10.962  7.631   -0.349  1.00 0.00 ? 53  ILE A HG13 1  
ATOM 780   H HG21 . ILE A 1 53  ? 11.347  4.843   1.900   1.00 0.00 ? 53  ILE A HG21 1  
ATOM 781   H HG22 . ILE A 1 53  ? 9.801   5.626   2.222   1.00 0.00 ? 53  ILE A HG22 1  
ATOM 782   H HG23 . ILE A 1 53  ? 10.357  5.424   0.561   1.00 0.00 ? 53  ILE A HG23 1  
ATOM 783   H HD11 . ILE A 1 53  ? 8.959   8.049   1.833   1.00 0.00 ? 53  ILE A HD11 1  
ATOM 784   H HD12 . ILE A 1 53  ? 8.897   8.980   0.336   1.00 0.00 ? 53  ILE A HD12 1  
ATOM 785   H HD13 . ILE A 1 53  ? 8.767   7.221   0.287   1.00 0.00 ? 53  ILE A HD13 1  
ATOM 786   N N    . LYS A 1 54  ? 11.839  5.569   4.397   1.00 0.00 ? 54  LYS A N    1  
ATOM 787   C CA   . LYS A 1 54  ? 12.666  4.723   5.249   1.00 0.00 ? 54  LYS A CA   1  
ATOM 788   C C    . LYS A 1 54  ? 12.862  3.346   4.621   1.00 0.00 ? 54  LYS A C    1  
ATOM 789   O O    . LYS A 1 54  ? 12.030  2.886   3.841   1.00 0.00 ? 54  LYS A O    1  
ATOM 790   C CB   . LYS A 1 54  ? 12.028  4.578   6.632   1.00 0.00 ? 54  LYS A CB   1  
ATOM 791   C CG   . LYS A 1 54  ? 11.676  5.905   7.282   1.00 0.00 ? 54  LYS A CG   1  
ATOM 792   C CD   . LYS A 1 54  ? 12.913  6.609   7.816   1.00 0.00 ? 54  LYS A CD   1  
ATOM 793   C CE   . LYS A 1 54  ? 13.272  6.122   9.211   1.00 0.00 ? 54  LYS A CE   1  
ATOM 794   N NZ   . LYS A 1 54  ? 14.737  6.209   9.469   1.00 0.00 ? 54  LYS A NZ   1  
ATOM 795   H H    . LYS A 1 54  ? 10.947  5.258   4.135   1.00 0.00 ? 54  LYS A H    1  
ATOM 796   H HA   . LYS A 1 54  ? 13.629  5.198   5.354   1.00 0.00 ? 54  LYS A HA   1  
ATOM 797   H HB2  . LYS A 1 54  ? 11.123  3.996   6.539   1.00 0.00 ? 54  LYS A HB2  1  
ATOM 798   H HB3  . LYS A 1 54  ? 12.717  4.055   7.280   1.00 0.00 ? 54  LYS A HB3  1  
ATOM 799   H HG2  . LYS A 1 54  ? 11.202  6.540   6.548   1.00 0.00 ? 54  LYS A HG2  1  
ATOM 800   H HG3  . LYS A 1 54  ? 10.994  5.725   8.100   1.00 0.00 ? 54  LYS A HG3  1  
ATOM 801   H HD2  . LYS A 1 54  ? 13.743  6.413   7.153   1.00 0.00 ? 54  LYS A HD2  1  
ATOM 802   H HD3  . LYS A 1 54  ? 12.723  7.673   7.853   1.00 0.00 ? 54  LYS A HD3  1  
ATOM 803   H HE2  . LYS A 1 54  ? 12.751  6.728   9.936   1.00 0.00 ? 54  LYS A HE2  1  
ATOM 804   H HE3  . LYS A 1 54  ? 12.959  5.093   9.311   1.00 0.00 ? 54  LYS A HE3  1  
ATOM 805   H HZ1  . LYS A 1 54  ? 14.959  5.816   10.405  1.00 0.00 ? 54  LYS A HZ1  1  
ATOM 806   H HZ2  . LYS A 1 54  ? 15.045  7.202   9.439   1.00 0.00 ? 54  LYS A HZ2  1  
ATOM 807   H HZ3  . LYS A 1 54  ? 15.259  5.674   8.747   1.00 0.00 ? 54  LYS A HZ3  1  
ATOM 808   N N    . GLU A 1 55  ? 13.968  2.694   4.969   1.00 0.00 ? 55  GLU A N    1  
ATOM 809   C CA   . GLU A 1 55  ? 14.271  1.370   4.440   1.00 0.00 ? 55  GLU A CA   1  
ATOM 810   C C    . GLU A 1 55  ? 13.107  0.411   4.672   1.00 0.00 ? 55  GLU A C    1  
ATOM 811   O O    . GLU A 1 55  ? 12.802  -0.426  3.824   1.00 0.00 ? 55  GLU A O    1  
ATOM 812   C CB   . GLU A 1 55  ? 15.540  0.815   5.090   1.00 0.00 ? 55  GLU A CB   1  
ATOM 813   C CG   . GLU A 1 55  ? 16.823  1.372   4.494   1.00 0.00 ? 55  GLU A CG   1  
ATOM 814   C CD   . GLU A 1 55  ? 17.134  2.773   4.986   1.00 0.00 ? 55  GLU A CD   1  
ATOM 815   O OE1  . GLU A 1 55  ? 16.879  3.055   6.175   1.00 0.00 ? 55  GLU A OE1  1  
ATOM 816   O OE2  . GLU A 1 55  ? 17.633  3.586   4.180   1.00 0.00 ? 55  GLU A OE2  1  
ATOM 817   H H    . GLU A 1 55  ? 14.593  3.114   5.596   1.00 0.00 ? 55  GLU A H    1  
ATOM 818   H HA   . GLU A 1 55  ? 14.435  1.468   3.377   1.00 0.00 ? 55  GLU A HA   1  
ATOM 819   H HB2  . GLU A 1 55  ? 15.524  1.052   6.144   1.00 0.00 ? 55  GLU A HB2  1  
ATOM 820   H HB3  . GLU A 1 55  ? 15.550  -0.258  4.972   1.00 0.00 ? 55  GLU A HB3  1  
ATOM 821   H HG2  . GLU A 1 55  ? 17.642  0.723   4.764   1.00 0.00 ? 55  GLU A HG2  1  
ATOM 822   H HG3  . GLU A 1 55  ? 16.724  1.397   3.419   1.00 0.00 ? 55  GLU A HG3  1  
ATOM 823   N N    . GLU A 1 56  ? 12.462  0.542   5.827   1.00 0.00 ? 56  GLU A N    1  
ATOM 824   C CA   . GLU A 1 56  ? 11.332  -0.314  6.170   1.00 0.00 ? 56  GLU A CA   1  
ATOM 825   C C    . GLU A 1 56  ? 10.069  0.514   6.388   1.00 0.00 ? 56  GLU A C    1  
ATOM 826   O O    . GLU A 1 56  ? 9.271   0.226   7.281   1.00 0.00 ? 56  GLU A O    1  
ATOM 827   C CB   . GLU A 1 56  ? 11.645  -1.128  7.428   1.00 0.00 ? 56  GLU A CB   1  
ATOM 828   C CG   . GLU A 1 56  ? 12.309  -2.464  7.138   1.00 0.00 ? 56  GLU A CG   1  
ATOM 829   C CD   . GLU A 1 56  ? 13.007  -3.044  8.353   1.00 0.00 ? 56  GLU A CD   1  
ATOM 830   O OE1  . GLU A 1 56  ? 12.458  -2.922  9.468   1.00 0.00 ? 56  GLU A OE1  1  
ATOM 831   O OE2  . GLU A 1 56  ? 14.104  -3.619  8.188   1.00 0.00 ? 56  GLU A OE2  1  
ATOM 832   H H    . GLU A 1 56  ? 12.752  1.229   6.462   1.00 0.00 ? 56  GLU A H    1  
ATOM 833   H HA   . GLU A 1 56  ? 11.166  -0.991  5.346   1.00 0.00 ? 56  GLU A HA   1  
ATOM 834   H HB2  . GLU A 1 56  ? 12.303  -0.552  8.061   1.00 0.00 ? 56  GLU A HB2  1  
ATOM 835   H HB3  . GLU A 1 56  ? 10.723  -1.316  7.958   1.00 0.00 ? 56  GLU A HB3  1  
ATOM 836   H HG2  . GLU A 1 56  ? 11.555  -3.163  6.809   1.00 0.00 ? 56  GLU A HG2  1  
ATOM 837   H HG3  . GLU A 1 56  ? 13.038  -2.326  6.354   1.00 0.00 ? 56  GLU A HG3  1  
ATOM 838   N N    . HIS A 1 57  ? 9.894   1.544   5.567   1.00 0.00 ? 57  HIS A N    1  
ATOM 839   C CA   . HIS A 1 57  ? 8.729   2.414   5.669   1.00 0.00 ? 57  HIS A CA   1  
ATOM 840   C C    . HIS A 1 57  ? 7.480   1.611   6.018   1.00 0.00 ? 57  HIS A C    1  
ATOM 841   O O    . HIS A 1 57  ? 6.959   1.707   7.130   1.00 0.00 ? 57  HIS A O    1  
ATOM 842   C CB   . HIS A 1 57  ? 8.513   3.169   4.357   1.00 0.00 ? 57  HIS A CB   1  
ATOM 843   C CG   . HIS A 1 57  ? 7.824   4.488   4.531   1.00 0.00 ? 57  HIS A CG   1  
ATOM 844   N ND1  . HIS A 1 57  ? 8.473   5.625   4.962   1.00 0.00 ? 57  HIS A ND1  1  
ATOM 845   C CD2  . HIS A 1 57  ? 6.535   4.846   4.327   1.00 0.00 ? 57  HIS A CD2  1  
ATOM 846   C CE1  . HIS A 1 57  ? 7.612   6.626   5.018   1.00 0.00 ? 57  HIS A CE1  1  
ATOM 847   N NE2  . HIS A 1 57  ? 6.429   6.180   4.637   1.00 0.00 ? 57  HIS A NE2  1  
ATOM 848   H H    . HIS A 1 57  ? 10.565  1.722   4.875   1.00 0.00 ? 57  HIS A H    1  
ATOM 849   H HA   . HIS A 1 57  ? 8.915   3.127   6.458   1.00 0.00 ? 57  HIS A HA   1  
ATOM 850   H HB2  . HIS A 1 57  ? 9.471   3.355   3.895   1.00 0.00 ? 57  HIS A HB2  1  
ATOM 851   H HB3  . HIS A 1 57  ? 7.911   2.564   3.695   1.00 0.00 ? 57  HIS A HB3  1  
ATOM 852   H HD1  . HIS A 1 57  ? 9.422   5.689   5.195   1.00 0.00 ? 57  HIS A HD1  1  
ATOM 853   H HD2  . HIS A 1 57  ? 5.736   4.203   3.984   1.00 0.00 ? 57  HIS A HD2  1  
ATOM 854   H HE1  . HIS A 1 57  ? 7.837   7.637   5.323   1.00 0.00 ? 57  HIS A HE1  1  
ATOM 855   H HE2  . HIS A 1 57  ? 5.596   6.694   4.667   1.00 0.00 ? 57  HIS A HE2  1  
ATOM 856   N N    . CYS A 1 58  ? 7.004   0.820   5.062   1.00 0.00 ? 58  CYS A N    1  
ATOM 857   C CA   . CYS A 1 58  ? 5.815   0.001   5.268   1.00 0.00 ? 58  CYS A CA   1  
ATOM 858   C C    . CYS A 1 58  ? 5.889   -1.282  4.447   1.00 0.00 ? 58  CYS A C    1  
ATOM 859   O O    . CYS A 1 58  ? 6.893   -1.550  3.786   1.00 0.00 ? 58  CYS A O    1  
ATOM 860   C CB   . CYS A 1 58  ? 4.558   0.788   4.896   1.00 0.00 ? 58  CYS A CB   1  
ATOM 861   S SG   . CYS A 1 58  ? 4.406   1.144   3.130   1.00 0.00 ? 58  CYS A SG   1  
ATOM 862   H H    . CYS A 1 58  ? 7.463   0.787   4.197   1.00 0.00 ? 58  CYS A H    1  
ATOM 863   H HA   . CYS A 1 58  ? 5.770   -0.259  6.315   1.00 0.00 ? 58  CYS A HA   1  
ATOM 864   H HB2  . CYS A 1 58  ? 3.687   0.221   5.192   1.00 0.00 ? 58  CYS A HB2  1  
ATOM 865   H HB3  . CYS A 1 58  ? 4.562   1.730   5.424   1.00 0.00 ? 58  CYS A HB3  1  
ATOM 866   H HG   . CYS A 1 58  ? 3.705   0.167   2.575   1.00 0.00 ? 58  CYS A HG   1  
ATOM 867   N N    . ILE A 1 59  ? 4.821   -2.071  4.494   1.00 0.00 ? 59  ILE A N    1  
ATOM 868   C CA   . ILE A 1 59  ? 4.766   -3.326  3.754   1.00 0.00 ? 59  ILE A CA   1  
ATOM 869   C C    . ILE A 1 59  ? 3.357   -3.598  3.238   1.00 0.00 ? 59  ILE A C    1  
ATOM 870   O O    . ILE A 1 59  ? 2.379   -3.059  3.757   1.00 0.00 ? 59  ILE A O    1  
ATOM 871   C CB   . ILE A 1 59  ? 5.220   -4.513  4.624   1.00 0.00 ? 59  ILE A CB   1  
ATOM 872   C CG1  . ILE A 1 59  ? 6.500   -4.157  5.383   1.00 0.00 ? 59  ILE A CG1  1  
ATOM 873   C CG2  . ILE A 1 59  ? 5.434   -5.749  3.764   1.00 0.00 ? 59  ILE A CG2  1  
ATOM 874   C CD1  . ILE A 1 59  ? 6.791   -5.080  6.545   1.00 0.00 ? 59  ILE A CD1  1  
ATOM 875   H H    . ILE A 1 59  ? 4.052   -1.803  5.038   1.00 0.00 ? 59  ILE A H    1  
ATOM 876   H HA   . ILE A 1 59  ? 5.438   -3.245  2.912   1.00 0.00 ? 59  ILE A HA   1  
ATOM 877   H HB   . ILE A 1 59  ? 4.437   -4.729  5.335   1.00 0.00 ? 59  ILE A HB   1  
ATOM 878   H HG12 . ILE A 1 59  ? 7.338   -4.204  4.705   1.00 0.00 ? 59  ILE A HG12 1  
ATOM 879   H HG13 . ILE A 1 59  ? 6.413   -3.152  5.770   1.00 0.00 ? 59  ILE A HG13 1  
ATOM 880   H HG21 . ILE A 1 59  ? 4.500   -6.282  3.662   1.00 0.00 ? 59  ILE A HG21 1  
ATOM 881   H HG22 . ILE A 1 59  ? 5.786   -5.451  2.788   1.00 0.00 ? 59  ILE A HG22 1  
ATOM 882   H HG23 . ILE A 1 59  ? 6.166   -6.390  4.231   1.00 0.00 ? 59  ILE A HG23 1  
ATOM 883   H HD11 . ILE A 1 59  ? 7.345   -5.939  6.193   1.00 0.00 ? 59  ILE A HD11 1  
ATOM 884   H HD12 . ILE A 1 59  ? 7.375   -4.555  7.286   1.00 0.00 ? 59  ILE A HD12 1  
ATOM 885   H HD13 . ILE A 1 59  ? 5.861   -5.409  6.985   1.00 0.00 ? 59  ILE A HD13 1  
ATOM 886   N N    . PHE A 1 60  ? 3.261   -4.439  2.214   1.00 0.00 ? 60  PHE A N    1  
ATOM 887   C CA   . PHE A 1 60  ? 1.971   -4.785  1.627   1.00 0.00 ? 60  PHE A CA   1  
ATOM 888   C C    . PHE A 1 60  ? 1.799   -6.298  1.544   1.00 0.00 ? 60  PHE A C    1  
ATOM 889   O O    . PHE A 1 60  ? 2.459   -6.966  0.748   1.00 0.00 ? 60  PHE A O    1  
ATOM 890   C CB   . PHE A 1 60  ? 1.840   -4.168  0.233   1.00 0.00 ? 60  PHE A CB   1  
ATOM 891   C CG   . PHE A 1 60  ? 1.318   -2.760  0.247   1.00 0.00 ? 60  PHE A CG   1  
ATOM 892   C CD1  . PHE A 1 60  ? 0.022   -2.491  0.656   1.00 0.00 ? 60  PHE A CD1  1  
ATOM 893   C CD2  . PHE A 1 60  ? 2.124   -1.705  -0.150  1.00 0.00 ? 60  PHE A CD2  1  
ATOM 894   C CE1  . PHE A 1 60  ? -0.461  -1.196  0.670   1.00 0.00 ? 60  PHE A CE1  1  
ATOM 895   C CE2  . PHE A 1 60  ? 1.646   -0.408  -0.137  1.00 0.00 ? 60  PHE A CE2  1  
ATOM 896   C CZ   . PHE A 1 60  ? 0.352   -0.153  0.272   1.00 0.00 ? 60  PHE A CZ   1  
ATOM 897   H H    . PHE A 1 60  ? 4.077   -4.837  1.844   1.00 0.00 ? 60  PHE A H    1  
ATOM 898   H HA   . PHE A 1 60  ? 1.200   -4.381  2.264   1.00 0.00 ? 60  PHE A HA   1  
ATOM 899   H HB2  . PHE A 1 60  ? 2.810   -4.157  -0.241  1.00 0.00 ? 60  PHE A HB2  1  
ATOM 900   H HB3  . PHE A 1 60  ? 1.163   -4.769  -0.356  1.00 0.00 ? 60  PHE A HB3  1  
ATOM 901   H HD1  . PHE A 1 60  ? -0.615  -3.307  0.967   1.00 0.00 ? 60  PHE A HD1  1  
ATOM 902   H HD2  . PHE A 1 60  ? 3.136   -1.902  -0.472  1.00 0.00 ? 60  PHE A HD2  1  
ATOM 903   H HE1  . PHE A 1 60  ? -1.474  -1.001  0.991   1.00 0.00 ? 60  PHE A HE1  1  
ATOM 904   H HE2  . PHE A 1 60  ? 2.284   0.406   -0.450  1.00 0.00 ? 60  PHE A HE2  1  
ATOM 905   H HZ   . PHE A 1 60  ? -0.023  0.859   0.283   1.00 0.00 ? 60  PHE A HZ   1  
ATOM 906   N N    . ARG A 1 61  ? 0.909   -6.833  2.374   1.00 0.00 ? 61  ARG A N    1  
ATOM 907   C CA   . ARG A 1 61  ? 0.650   -8.268  2.396   1.00 0.00 ? 61  ARG A CA   1  
ATOM 908   C C    . ARG A 1 61  ? -0.625  -8.603  1.628   1.00 0.00 ? 61  ARG A C    1  
ATOM 909   O O    . ARG A 1 61  ? -1.694  -8.066  1.916   1.00 0.00 ? 61  ARG A O    1  
ATOM 910   C CB   . ARG A 1 61  ? 0.535   -8.764  3.839   1.00 0.00 ? 61  ARG A CB   1  
ATOM 911   C CG   . ARG A 1 61  ? 0.930   -10.221 4.015   1.00 0.00 ? 61  ARG A CG   1  
ATOM 912   C CD   . ARG A 1 61  ? 0.388   -10.791 5.316   1.00 0.00 ? 61  ARG A CD   1  
ATOM 913   N NE   . ARG A 1 61  ? -0.990  -11.254 5.179   1.00 0.00 ? 61  ARG A NE   1  
ATOM 914   C CZ   . ARG A 1 61  ? -1.806  -11.450 6.209   1.00 0.00 ? 61  ARG A CZ   1  
ATOM 915   N NH1  . ARG A 1 61  ? -1.384  -11.223 7.445   1.00 0.00 ? 61  ARG A NH1  1  
ATOM 916   N NH2  . ARG A 1 61  ? -3.047  -11.872 6.003   1.00 0.00 ? 61  ARG A NH2  1  
ATOM 917   H H    . ARG A 1 61  ? 0.414   -6.248  2.985   1.00 0.00 ? 61  ARG A H    1  
ATOM 918   H HA   . ARG A 1 61  ? 1.484   -8.762  1.920   1.00 0.00 ? 61  ARG A HA   1  
ATOM 919   H HB2  . ARG A 1 61  ? 1.175   -8.162  4.467   1.00 0.00 ? 61  ARG A HB2  1  
ATOM 920   H HB3  . ARG A 1 61  ? -0.488  -8.648  4.165   1.00 0.00 ? 61  ARG A HB3  1  
ATOM 921   H HG2  . ARG A 1 61  ? 0.533   -10.794 3.191   1.00 0.00 ? 61  ARG A HG2  1  
ATOM 922   H HG3  . ARG A 1 61  ? 2.007   -10.294 4.021   1.00 0.00 ? 61  ARG A HG3  1  
ATOM 923   H HD2  . ARG A 1 61  ? 1.009   -11.623 5.616   1.00 0.00 ? 61  ARG A HD2  1  
ATOM 924   H HD3  . ARG A 1 61  ? 0.426   -10.023 6.074   1.00 0.00 ? 61  ARG A HD3  1  
ATOM 925   H HE   . ARG A 1 61  ? -1.323  -11.428 4.274   1.00 0.00 ? 61  ARG A HE   1  
ATOM 926   H HH11 . ARG A 1 61  ? -0.450  -10.904 7.603   1.00 0.00 ? 61  ARG A HH11 1  
ATOM 927   H HH12 . ARG A 1 61  ? -2.001  -11.370 8.219   1.00 0.00 ? 61  ARG A HH12 1  
ATOM 928   H HH21 . ARG A 1 61  ? -3.368  -12.044 5.073   1.00 0.00 ? 61  ARG A HH21 1  
ATOM 929   H HH22 . ARG A 1 61  ? -3.660  -12.019 6.779   1.00 0.00 ? 61  ARG A HH22 1  
ATOM 930   N N    . SER A 1 62  ? -0.503  -9.494  0.649   1.00 0.00 ? 62  SER A N    1  
ATOM 931   C CA   . SER A 1 62  ? -1.644  -9.897  -0.164  1.00 0.00 ? 62  SER A CA   1  
ATOM 932   C C    . SER A 1 62  ? -1.873  -11.403 -0.069  1.00 0.00 ? 62  SER A C    1  
ATOM 933   O O    . SER A 1 62  ? -1.113  -12.193 -0.628  1.00 0.00 ? 62  SER A O    1  
ATOM 934   C CB   . SER A 1 62  ? -1.426  -9.494  -1.623  1.00 0.00 ? 62  SER A CB   1  
ATOM 935   O OG   . SER A 1 62  ? -1.653  -8.107  -1.809  1.00 0.00 ? 62  SER A OG   1  
ATOM 936   H H    . SER A 1 62  ? 0.377   -9.887  0.468   1.00 0.00 ? 62  SER A H    1  
ATOM 937   H HA   . SER A 1 62  ? -2.518  -9.388  0.215   1.00 0.00 ? 62  SER A HA   1  
ATOM 938   H HB2  . SER A 1 62  ? -0.410  -9.722  -1.909  1.00 0.00 ? 62  SER A HB2  1  
ATOM 939   H HB3  . SER A 1 62  ? -2.110  -10.046 -2.252  1.00 0.00 ? 62  SER A HB3  1  
ATOM 940   H HG   . SER A 1 62  ? -2.238  -7.976  -2.558  1.00 0.00 ? 62  SER A HG   1  
ATOM 941   N N    . GLU A 1 63  ? -2.926  -11.791 0.643   1.00 0.00 ? 63  GLU A N    1  
ATOM 942   C CA   . GLU A 1 63  ? -3.255  -13.202 0.812   1.00 0.00 ? 63  GLU A CA   1  
ATOM 943   C C    . GLU A 1 63  ? -4.758  -13.430 0.678   1.00 0.00 ? 63  GLU A C    1  
ATOM 944   O O    . GLU A 1 63  ? -5.562  -12.587 1.076   1.00 0.00 ? 63  GLU A O    1  
ATOM 945   C CB   . GLU A 1 63  ? -2.772  -13.701 2.176   1.00 0.00 ? 63  GLU A CB   1  
ATOM 946   C CG   . GLU A 1 63  ? -2.844  -15.211 2.331   1.00 0.00 ? 63  GLU A CG   1  
ATOM 947   C CD   . GLU A 1 63  ? -1.818  -15.934 1.482   1.00 0.00 ? 63  GLU A CD   1  
ATOM 948   O OE1  . GLU A 1 63  ? -0.924  -15.259 0.928   1.00 0.00 ? 63  GLU A OE1  1  
ATOM 949   O OE2  . GLU A 1 63  ? -1.907  -17.175 1.370   1.00 0.00 ? 63  GLU A OE2  1  
ATOM 950   H H    . GLU A 1 63  ? -3.495  -11.114 1.065   1.00 0.00 ? 63  GLU A H    1  
ATOM 951   H HA   . GLU A 1 63  ? -2.748  -13.755 0.037   1.00 0.00 ? 63  GLU A HA   1  
ATOM 952   H HB2  . GLU A 1 63  ? -1.747  -13.393 2.316   1.00 0.00 ? 63  GLU A HB2  1  
ATOM 953   H HB3  . GLU A 1 63  ? -3.382  -13.252 2.946   1.00 0.00 ? 63  GLU A HB3  1  
ATOM 954   H HG2  . GLU A 1 63  ? -2.673  -15.462 3.367   1.00 0.00 ? 63  GLU A HG2  1  
ATOM 955   H HG3  . GLU A 1 63  ? -3.830  -15.543 2.040   1.00 0.00 ? 63  GLU A HG3  1  
ATOM 956   N N    . ARG A 1 64  ? -5.128  -14.575 0.114   1.00 0.00 ? 64  ARG A N    1  
ATOM 957   C CA   . ARG A 1 64  ? -6.534  -14.914 -0.075  1.00 0.00 ? 64  ARG A CA   1  
ATOM 958   C C    . ARG A 1 64  ? -7.143  -15.447 1.218   1.00 0.00 ? 64  ARG A C    1  
ATOM 959   O O    . ARG A 1 64  ? -6.902  -16.591 1.604   1.00 0.00 ? 64  ARG A O    1  
ATOM 960   C CB   . ARG A 1 64  ? -6.685  -15.952 -1.189  1.00 0.00 ? 64  ARG A CB   1  
ATOM 961   C CG   . ARG A 1 64  ? -7.979  -15.818 -1.975  1.00 0.00 ? 64  ARG A CG   1  
ATOM 962   C CD   . ARG A 1 64  ? -8.022  -16.786 -3.147  1.00 0.00 ? 64  ARG A CD   1  
ATOM 963   N NE   . ARG A 1 64  ? -6.869  -16.627 -4.030  1.00 0.00 ? 64  ARG A NE   1  
ATOM 964   C CZ   . ARG A 1 64  ? -6.418  -17.587 -4.829  1.00 0.00 ? 64  ARG A CZ   1  
ATOM 965   N NH1  . ARG A 1 64  ? -7.019  -18.769 -4.856  1.00 0.00 ? 64  ARG A NH1  1  
ATOM 966   N NH2  . ARG A 1 64  ? -5.364  -17.366 -5.604  1.00 0.00 ? 64  ARG A NH2  1  
ATOM 967   H H    . ARG A 1 64  ? -4.440  -15.206 -0.183  1.00 0.00 ? 64  ARG A H    1  
ATOM 968   H HA   . ARG A 1 64  ? -7.057  -14.013 -0.361  1.00 0.00 ? 64  ARG A HA   1  
ATOM 969   H HB2  . ARG A 1 64  ? -5.859  -15.847 -1.877  1.00 0.00 ? 64  ARG A HB2  1  
ATOM 970   H HB3  . ARG A 1 64  ? -6.655  -16.938 -0.751  1.00 0.00 ? 64  ARG A HB3  1  
ATOM 971   H HG2  . ARG A 1 64  ? -8.811  -16.028 -1.319  1.00 0.00 ? 64  ARG A HG2  1  
ATOM 972   H HG3  . ARG A 1 64  ? -8.059  -14.808 -2.349  1.00 0.00 ? 64  ARG A HG3  1  
ATOM 973   H HD2  . ARG A 1 64  ? -8.032  -17.795 -2.763  1.00 0.00 ? 64  ARG A HD2  1  
ATOM 974   H HD3  . ARG A 1 64  ? -8.924  -16.606 -3.712  1.00 0.00 ? 64  ARG A HD3  1  
ATOM 975   H HE   . ARG A 1 64  ? -6.410  -15.762 -4.026  1.00 0.00 ? 64  ARG A HE   1  
ATOM 976   H HH11 . ARG A 1 64  ? -7.814  -18.938 -4.274  1.00 0.00 ? 64  ARG A HH11 1  
ATOM 977   H HH12 . ARG A 1 64  ? -6.678  -19.490 -5.460  1.00 0.00 ? 64  ARG A HH12 1  
ATOM 978   H HH21 . ARG A 1 64  ? -4.908  -16.477 -5.586  1.00 0.00 ? 64  ARG A HH21 1  
ATOM 979   H HH22 . ARG A 1 64  ? -5.025  -18.089 -6.205  1.00 0.00 ? 64  ARG A HH22 1  
ATOM 980   N N    . SER A 1 65  ? -7.933  -14.611 1.883   1.00 0.00 ? 65  SER A N    1  
ATOM 981   C CA   . SER A 1 65  ? -8.574  -14.996 3.135   1.00 0.00 ? 65  SER A CA   1  
ATOM 982   C C    . SER A 1 65  ? -9.093  -16.429 3.061   1.00 0.00 ? 65  SER A C    1  
ATOM 983   O O    . SER A 1 65  ? -9.308  -16.967 1.976   1.00 0.00 ? 65  SER A O    1  
ATOM 984   C CB   . SER A 1 65  ? -9.724  -14.042 3.459   1.00 0.00 ? 65  SER A CB   1  
ATOM 985   O OG   . SER A 1 65  ? -10.311 -14.356 4.711   1.00 0.00 ? 65  SER A OG   1  
ATOM 986   H H    . SER A 1 65  ? -8.087  -13.712 1.524   1.00 0.00 ? 65  SER A H    1  
ATOM 987   H HA   . SER A 1 65  ? -7.834  -14.934 3.919   1.00 0.00 ? 65  SER A HA   1  
ATOM 988   H HB2  . SER A 1 65  ? -9.350  -13.030 3.495   1.00 0.00 ? 65  SER A HB2  1  
ATOM 989   H HB3  . SER A 1 65  ? -10.480 -14.119 2.691   1.00 0.00 ? 65  SER A HB3  1  
ATOM 990   H HG   . SER A 1 65  ? -10.541 -13.544 5.169   1.00 0.00 ? 65  SER A HG   1  
ATOM 991   N N    . ASN A 1 66  ? -9.291  -17.041 4.224   1.00 0.00 ? 66  ASN A N    1  
ATOM 992   C CA   . ASN A 1 66  ? -9.784  -18.412 4.292   1.00 0.00 ? 66  ASN A CA   1  
ATOM 993   C C    . ASN A 1 66  ? -11.050 -18.577 3.457   1.00 0.00 ? 66  ASN A C    1  
ATOM 994   O O    . ASN A 1 66  ? -11.330 -19.660 2.943   1.00 0.00 ? 66  ASN A O    1  
ATOM 995   C CB   . ASN A 1 66  ? -10.063 -18.804 5.745   1.00 0.00 ? 66  ASN A CB   1  
ATOM 996   C CG   . ASN A 1 66  ? -10.017 -20.304 5.958   1.00 0.00 ? 66  ASN A CG   1  
ATOM 997   O OD1  . ASN A 1 66  ? -10.336 -21.081 5.057   1.00 0.00 ? 66  ASN A OD1  1  
ATOM 998   N ND2  . ASN A 1 66  ? -9.620  -20.720 7.155   1.00 0.00 ? 66  ASN A ND2  1  
ATOM 999   H H    . ASN A 1 66  ? -9.101  -16.560 5.056   1.00 0.00 ? 66  ASN A H    1  
ATOM 1000  H HA   . ASN A 1 66  ? -9.017  -19.060 3.895   1.00 0.00 ? 66  ASN A HA   1  
ATOM 1001  H HB2  . ASN A 1 66  ? -9.322  -18.346 6.384   1.00 0.00 ? 66  ASN A HB2  1  
ATOM 1002  H HB3  . ASN A 1 66  ? -11.043 -18.448 6.025   1.00 0.00 ? 66  ASN A HB3  1  
ATOM 1003  H HD21 . ASN A 1 66  ? -9.382  -20.045 7.824   1.00 0.00 ? 66  ASN A HD21 1  
ATOM 1004  H HD22 . ASN A 1 66  ? -9.581  -21.685 7.320   1.00 0.00 ? 66  ASN A HD22 1  
ATOM 1005  N N    . SER A 1 67  ? -11.810 -17.495 3.325   1.00 0.00 ? 67  SER A N    1  
ATOM 1006  C CA   . SER A 1 67  ? -13.048 -17.521 2.554   1.00 0.00 ? 67  SER A CA   1  
ATOM 1007  C C    . SER A 1 67  ? -12.760 -17.724 1.070   1.00 0.00 ? 67  SER A C    1  
ATOM 1008  O O    . SER A 1 67  ? -13.574 -18.286 0.339   1.00 0.00 ? 67  SER A O    1  
ATOM 1009  C CB   . SER A 1 67  ? -13.829 -16.221 2.761   1.00 0.00 ? 67  SER A CB   1  
ATOM 1010  O OG   . SER A 1 67  ? -14.888 -16.109 1.827   1.00 0.00 ? 67  SER A OG   1  
ATOM 1011  H H    . SER A 1 67  ? -11.534 -16.661 3.759   1.00 0.00 ? 67  SER A H    1  
ATOM 1012  H HA   . SER A 1 67  ? -13.643 -18.348 2.910   1.00 0.00 ? 67  SER A HA   1  
ATOM 1013  H HB2  . SER A 1 67  ? -14.241 -16.207 3.758   1.00 0.00 ? 67  SER A HB2  1  
ATOM 1014  H HB3  . SER A 1 67  ? -13.162 -15.380 2.635   1.00 0.00 ? 67  SER A HB3  1  
ATOM 1015  H HG   . SER A 1 67  ? -15.713 -15.959 2.294   1.00 0.00 ? 67  SER A HG   1  
ATOM 1016  N N    . GLY A 1 68  ? -11.593 -17.260 0.631   1.00 0.00 ? 68  GLY A N    1  
ATOM 1017  C CA   . GLY A 1 68  ? -11.217 -17.400 -0.764  1.00 0.00 ? 68  GLY A CA   1  
ATOM 1018  C C    . GLY A 1 68  ? -11.167 -16.068 -1.486  1.00 0.00 ? 68  GLY A C    1  
ATOM 1019  O O    . GLY A 1 68  ? -11.193 -16.021 -2.716  1.00 0.00 ? 68  GLY A O    1  
ATOM 1020  H H    . GLY A 1 68  ? -10.983 -16.820 1.259   1.00 0.00 ? 68  GLY A H    1  
ATOM 1021  H HA2  . GLY A 1 68  ? -10.244 -17.864 -0.818  1.00 0.00 ? 68  GLY A HA2  1  
ATOM 1022  H HA3  . GLY A 1 68  ? -11.937 -18.037 -1.257  1.00 0.00 ? 68  GLY A HA3  1  
ATOM 1023  N N    . GLU A 1 69  ? -11.097 -14.983 -0.721  1.00 0.00 ? 69  GLU A N    1  
ATOM 1024  C CA   . GLU A 1 69  ? -11.046 -13.645 -1.298  1.00 0.00 ? 69  GLU A CA   1  
ATOM 1025  C C    . GLU A 1 69  ? -9.677  -13.009 -1.077  1.00 0.00 ? 69  GLU A C    1  
ATOM 1026  O O    . GLU A 1 69  ? -9.083  -13.142 -0.006  1.00 0.00 ? 69  GLU A O    1  
ATOM 1027  C CB   . GLU A 1 69  ? -12.135 -12.761 -0.687  1.00 0.00 ? 69  GLU A CB   1  
ATOM 1028  C CG   . GLU A 1 69  ? -11.727 -12.108 0.623   1.00 0.00 ? 69  GLU A CG   1  
ATOM 1029  C CD   . GLU A 1 69  ? -12.918 -11.701 1.468   1.00 0.00 ? 69  GLU A CD   1  
ATOM 1030  O OE1  . GLU A 1 69  ? -13.854 -11.085 0.917   1.00 0.00 ? 69  GLU A OE1  1  
ATOM 1031  O OE2  . GLU A 1 69  ? -12.913 -11.998 2.681   1.00 0.00 ? 69  GLU A OE2  1  
ATOM 1032  H H    . GLU A 1 69  ? -11.080 -15.085 0.253   1.00 0.00 ? 69  GLU A H    1  
ATOM 1033  H HA   . GLU A 1 69  ? -11.221 -13.734 -2.359  1.00 0.00 ? 69  GLU A HA   1  
ATOM 1034  H HB2  . GLU A 1 69  ? -12.386 -11.981 -1.392  1.00 0.00 ? 69  GLU A HB2  1  
ATOM 1035  H HB3  . GLU A 1 69  ? -13.012 -13.365 -0.506  1.00 0.00 ? 69  GLU A HB3  1  
ATOM 1036  H HG2  . GLU A 1 69  ? -11.127 -12.807 1.186   1.00 0.00 ? 69  GLU A HG2  1  
ATOM 1037  H HG3  . GLU A 1 69  ? -11.141 -11.227 0.404   1.00 0.00 ? 69  GLU A HG3  1  
ATOM 1038  N N    . VAL A 1 70  ? -9.180  -12.318 -2.098  1.00 0.00 ? 70  VAL A N    1  
ATOM 1039  C CA   . VAL A 1 70  ? -7.881  -11.661 -2.017  1.00 0.00 ? 70  VAL A CA   1  
ATOM 1040  C C    . VAL A 1 70  ? -7.959  -10.390 -1.178  1.00 0.00 ? 70  VAL A C    1  
ATOM 1041  O O    . VAL A 1 70  ? -8.652  -9.438  -1.540  1.00 0.00 ? 70  VAL A O    1  
ATOM 1042  C CB   . VAL A 1 70  ? -7.342  -11.307 -3.416  1.00 0.00 ? 70  VAL A CB   1  
ATOM 1043  C CG1  . VAL A 1 70  ? -6.074  -10.475 -3.305  1.00 0.00 ? 70  VAL A CG1  1  
ATOM 1044  C CG2  . VAL A 1 70  ? -7.091  -12.571 -4.225  1.00 0.00 ? 70  VAL A CG2  1  
ATOM 1045  H H    . VAL A 1 70  ? -9.700  -12.248 -2.926  1.00 0.00 ? 70  VAL A H    1  
ATOM 1046  H HA   . VAL A 1 70  ? -7.188  -12.347 -1.550  1.00 0.00 ? 70  VAL A HA   1  
ATOM 1047  H HB   . VAL A 1 70  ? -8.089  -10.719 -3.929  1.00 0.00 ? 70  VAL A HB   1  
ATOM 1048  H HG11 . VAL A 1 70  ? -5.583  -10.438 -4.266  1.00 0.00 ? 70  VAL A HG11 1  
ATOM 1049  H HG12 . VAL A 1 70  ? -6.327  -9.473  -2.990  1.00 0.00 ? 70  VAL A HG12 1  
ATOM 1050  H HG13 . VAL A 1 70  ? -5.411  -10.923 -2.580  1.00 0.00 ? 70  VAL A HG13 1  
ATOM 1051  H HG21 . VAL A 1 70  ? -6.051  -12.614 -4.513  1.00 0.00 ? 70  VAL A HG21 1  
ATOM 1052  H HG22 . VAL A 1 70  ? -7.335  -13.436 -3.626  1.00 0.00 ? 70  VAL A HG22 1  
ATOM 1053  H HG23 . VAL A 1 70  ? -7.709  -12.561 -5.111  1.00 0.00 ? 70  VAL A HG23 1  
ATOM 1054  N N    . ILE A 1 71  ? -7.245  -10.383 -0.058  1.00 0.00 ? 71  ILE A N    1  
ATOM 1055  C CA   . ILE A 1 71  ? -7.233  -9.228  0.832   1.00 0.00 ? 71  ILE A CA   1  
ATOM 1056  C C    . ILE A 1 71  ? -5.832  -8.638  0.947   1.00 0.00 ? 71  ILE A C    1  
ATOM 1057  O O    . ILE A 1 71  ? -4.835  -9.348  0.816   1.00 0.00 ? 71  ILE A O    1  
ATOM 1058  C CB   . ILE A 1 71  ? -7.741  -9.595  2.238   1.00 0.00 ? 71  ILE A CB   1  
ATOM 1059  C CG1  . ILE A 1 71  ? -9.079  -10.331 2.145   1.00 0.00 ? 71  ILE A CG1  1  
ATOM 1060  C CG2  . ILE A 1 71  ? -7.875  -8.346  3.096   1.00 0.00 ? 71  ILE A CG2  1  
ATOM 1061  C CD1  . ILE A 1 71  ? -10.274 -9.405  2.086   1.00 0.00 ? 71  ILE A CD1  1  
ATOM 1062  H H    . ILE A 1 71  ? -6.714  -11.172 0.176   1.00 0.00 ? 71  ILE A H    1  
ATOM 1063  H HA   . ILE A 1 71  ? -7.894  -8.481  0.416   1.00 0.00 ? 71  ILE A HA   1  
ATOM 1064  H HB   . ILE A 1 71  ? -7.013  -10.244 2.701   1.00 0.00 ? 71  ILE A HB   1  
ATOM 1065  H HG12 . ILE A 1 71  ? -9.087  -10.939 1.255   1.00 0.00 ? 71  ILE A HG12 1  
ATOM 1066  H HG13 . ILE A 1 71  ? -9.193  -10.966 3.012   1.00 0.00 ? 71  ILE A HG13 1  
ATOM 1067  H HG21 . ILE A 1 71  ? -6.893  -7.984  3.361   1.00 0.00 ? 71  ILE A HG21 1  
ATOM 1068  H HG22 . ILE A 1 71  ? -8.401  -7.584  2.541   1.00 0.00 ? 71  ILE A HG22 1  
ATOM 1069  H HG23 . ILE A 1 71  ? -8.426  -8.583  3.994   1.00 0.00 ? 71  ILE A HG23 1  
ATOM 1070  H HD11 . ILE A 1 71  ? -10.220 -8.804  1.190   1.00 0.00 ? 71  ILE A HD11 1  
ATOM 1071  H HD12 . ILE A 1 71  ? -11.182 -9.990  2.071   1.00 0.00 ? 71  ILE A HD12 1  
ATOM 1072  H HD13 . ILE A 1 71  ? -10.274 -8.761  2.952   1.00 0.00 ? 71  ILE A HD13 1  
ATOM 1073  N N    . VAL A 1 72  ? -5.763  -7.334  1.195   1.00 0.00 ? 72  VAL A N    1  
ATOM 1074  C CA   . VAL A 1 72  ? -4.484  -6.648  1.331   1.00 0.00 ? 72  VAL A CA   1  
ATOM 1075  C C    . VAL A 1 72  ? -4.411  -5.876  2.644   1.00 0.00 ? 72  VAL A C    1  
ATOM 1076  O O    . VAL A 1 72  ? -5.336  -5.144  3.000   1.00 0.00 ? 72  VAL A O    1  
ATOM 1077  C CB   . VAL A 1 72  ? -4.242  -5.674  0.163   1.00 0.00 ? 72  VAL A CB   1  
ATOM 1078  C CG1  . VAL A 1 72  ? -2.963  -4.881  0.384   1.00 0.00 ? 72  VAL A CG1  1  
ATOM 1079  C CG2  . VAL A 1 72  ? -4.188  -6.429  -1.157  1.00 0.00 ? 72  VAL A CG2  1  
ATOM 1080  H H    . VAL A 1 72  ? -6.593  -6.821  1.289   1.00 0.00 ? 72  VAL A H    1  
ATOM 1081  H HA   . VAL A 1 72  ? -3.702  -7.393  1.319   1.00 0.00 ? 72  VAL A HA   1  
ATOM 1082  H HB   . VAL A 1 72  ? -5.067  -4.979  0.122   1.00 0.00 ? 72  VAL A HB   1  
ATOM 1083  H HG11 . VAL A 1 72  ? -2.558  -5.116  1.358   1.00 0.00 ? 72  VAL A HG11 1  
ATOM 1084  H HG12 . VAL A 1 72  ? -2.242  -5.138  -0.378  1.00 0.00 ? 72  VAL A HG12 1  
ATOM 1085  H HG13 . VAL A 1 72  ? -3.181  -3.824  0.332   1.00 0.00 ? 72  VAL A HG13 1  
ATOM 1086  H HG21 . VAL A 1 72  ? -3.631  -7.345  -1.026  1.00 0.00 ? 72  VAL A HG21 1  
ATOM 1087  H HG22 . VAL A 1 72  ? -5.192  -6.662  -1.479  1.00 0.00 ? 72  VAL A HG22 1  
ATOM 1088  H HG23 . VAL A 1 72  ? -3.704  -5.817  -1.904  1.00 0.00 ? 72  VAL A HG23 1  
ATOM 1089  N N    . THR A 1 73  ? -3.306  -6.044  3.363   1.00 0.00 ? 73  THR A N    1  
ATOM 1090  C CA   . THR A 1 73  ? -3.112  -5.365  4.638   1.00 0.00 ? 73  THR A CA   1  
ATOM 1091  C C    . THR A 1 73  ? -1.810  -4.572  4.645   1.00 0.00 ? 73  THR A C    1  
ATOM 1092  O O    . THR A 1 73  ? -0.755  -5.087  4.272   1.00 0.00 ? 73  THR A O    1  
ATOM 1093  C CB   . THR A 1 73  ? -3.099  -6.363  5.810   1.00 0.00 ? 73  THR A CB   1  
ATOM 1094  O OG1  . THR A 1 73  ? -3.932  -7.487  5.506   1.00 0.00 ? 73  THR A OG1  1  
ATOM 1095  C CG2  . THR A 1 73  ? -3.581  -5.700  7.091   1.00 0.00 ? 73  THR A CG2  1  
ATOM 1096  H H    . THR A 1 73  ? -2.605  -6.641  3.027   1.00 0.00 ? 73  THR A H    1  
ATOM 1097  H HA   . THR A 1 73  ? -3.938  -4.683  4.781   1.00 0.00 ? 73  THR A HA   1  
ATOM 1098  H HB   . THR A 1 73  ? -2.085  -6.706  5.960   1.00 0.00 ? 73  THR A HB   1  
ATOM 1099  H HG1  . THR A 1 73  ? -3.493  -8.046  4.861   1.00 0.00 ? 73  THR A HG1  1  
ATOM 1100  H HG21 . THR A 1 73  ? -3.070  -4.758  7.223   1.00 0.00 ? 73  THR A HG21 1  
ATOM 1101  H HG22 . THR A 1 73  ? -3.369  -6.343  7.932   1.00 0.00 ? 73  THR A HG22 1  
ATOM 1102  H HG23 . THR A 1 73  ? -4.645  -5.527  7.029   1.00 0.00 ? 73  THR A HG23 1  
ATOM 1103  N N    . LEU A 1 74  ? -1.890  -3.317  5.073   1.00 0.00 ? 74  LEU A N    1  
ATOM 1104  C CA   . LEU A 1 74  ? -0.717  -2.452  5.131   1.00 0.00 ? 74  LEU A CA   1  
ATOM 1105  C C    . LEU A 1 74  ? -0.012  -2.578  6.478   1.00 0.00 ? 74  LEU A C    1  
ATOM 1106  O O    . LEU A 1 74  ? -0.621  -2.380  7.528   1.00 0.00 ? 74  LEU A O    1  
ATOM 1107  C CB   . LEU A 1 74  ? -1.119  -0.996  4.888   1.00 0.00 ? 74  LEU A CB   1  
ATOM 1108  C CG   . LEU A 1 74  ? 0.016   0.028   4.917   1.00 0.00 ? 74  LEU A CG   1  
ATOM 1109  C CD1  . LEU A 1 74  ? 0.707   0.097   3.564   1.00 0.00 ? 74  LEU A CD1  1  
ATOM 1110  C CD2  . LEU A 1 74  ? -0.512  1.398   5.319   1.00 0.00 ? 74  LEU A CD2  1  
ATOM 1111  H H    . LEU A 1 74  ? -2.758  -2.962  5.358   1.00 0.00 ? 74  LEU A H    1  
ATOM 1112  H HA   . LEU A 1 74  ? -0.037  -2.763  4.352   1.00 0.00 ? 74  LEU A HA   1  
ATOM 1113  H HB2  . LEU A 1 74  ? -1.589  -0.941  3.918   1.00 0.00 ? 74  LEU A HB2  1  
ATOM 1114  H HB3  . LEU A 1 74  ? -1.835  -0.720  5.649   1.00 0.00 ? 74  LEU A HB3  1  
ATOM 1115  H HG   . LEU A 1 74  ? 0.749   -0.277  5.651   1.00 0.00 ? 74  LEU A HG   1  
ATOM 1116  H HD11 . LEU A 1 74  ? 0.672   -0.872  3.092   1.00 0.00 ? 74  LEU A HD11 1  
ATOM 1117  H HD12 . LEU A 1 74  ? 1.737   0.394   3.702   1.00 0.00 ? 74  LEU A HD12 1  
ATOM 1118  H HD13 . LEU A 1 74  ? 0.205   0.822   2.940   1.00 0.00 ? 74  LEU A HD13 1  
ATOM 1119  H HD21 . LEU A 1 74  ? -0.572  2.031   4.446   1.00 0.00 ? 74  LEU A HD21 1  
ATOM 1120  H HD22 . LEU A 1 74  ? 0.156   1.843   6.042   1.00 0.00 ? 74  LEU A HD22 1  
ATOM 1121  H HD23 . LEU A 1 74  ? -1.494  1.291   5.756   1.00 0.00 ? 74  LEU A HD23 1  
ATOM 1122  N N    . GLU A 1 75  ? 1.275   -2.908  6.438   1.00 0.00 ? 75  GLU A N    1  
ATOM 1123  C CA   . GLU A 1 75  ? 2.062   -3.059  7.656   1.00 0.00 ? 75  GLU A CA   1  
ATOM 1124  C C    . GLU A 1 75  ? 3.108   -1.953  7.769   1.00 0.00 ? 75  GLU A C    1  
ATOM 1125  O O    . GLU A 1 75  ? 4.283   -2.140  7.454   1.00 0.00 ? 75  GLU A O    1  
ATOM 1126  C CB   . GLU A 1 75  ? 2.747   -4.427  7.680   1.00 0.00 ? 75  GLU A CB   1  
ATOM 1127  C CG   . GLU A 1 75  ? 1.957   -5.516  6.973   1.00 0.00 ? 75  GLU A CG   1  
ATOM 1128  C CD   . GLU A 1 75  ? 2.349   -6.909  7.427   1.00 0.00 ? 75  GLU A CD   1  
ATOM 1129  O OE1  . GLU A 1 75  ? 2.003   -7.282  8.567   1.00 0.00 ? 75  GLU A OE1  1  
ATOM 1130  O OE2  . GLU A 1 75  ? 3.003   -7.626  6.640   1.00 0.00 ? 75  GLU A OE2  1  
ATOM 1131  H H    . GLU A 1 75  ? 1.705   -3.053  5.569   1.00 0.00 ? 75  GLU A H    1  
ATOM 1132  H HA   . GLU A 1 75  ? 1.389   -2.989  8.497   1.00 0.00 ? 75  GLU A HA   1  
ATOM 1133  H HB2  . GLU A 1 75  ? 3.712   -4.342  7.202   1.00 0.00 ? 75  GLU A HB2  1  
ATOM 1134  H HB3  . GLU A 1 75  ? 2.890   -4.726  8.708   1.00 0.00 ? 75  GLU A HB3  1  
ATOM 1135  H HG2  . GLU A 1 75  ? 0.907   -5.371  7.176   1.00 0.00 ? 75  GLU A HG2  1  
ATOM 1136  H HG3  . GLU A 1 75  ? 2.132   -5.437  5.910   1.00 0.00 ? 75  GLU A HG3  1  
ATOM 1137  N N    . PRO A 1 76  ? 2.670   -0.772  8.230   1.00 0.00 ? 76  PRO A N    1  
ATOM 1138  C CA   . PRO A 1 76  ? 3.551   0.388   8.395   1.00 0.00 ? 76  PRO A CA   1  
ATOM 1139  C C    . PRO A 1 76  ? 4.547   0.202   9.535   1.00 0.00 ? 76  PRO A C    1  
ATOM 1140  O O    . PRO A 1 76  ? 4.577   -0.847  10.181  1.00 0.00 ? 76  PRO A O    1  
ATOM 1141  C CB   . PRO A 1 76  ? 2.581   1.528   8.714   1.00 0.00 ? 76  PRO A CB   1  
ATOM 1142  C CG   . PRO A 1 76  ? 1.391   0.857   9.309   1.00 0.00 ? 76  PRO A CG   1  
ATOM 1143  C CD   . PRO A 1 76  ? 1.283   -0.477  8.624   1.00 0.00 ? 76  PRO A CD   1  
ATOM 1144  H HA   . PRO A 1 76  ? 4.086   0.613   7.485   1.00 0.00 ? 76  PRO A HA   1  
ATOM 1145  H HB2  . PRO A 1 76  ? 3.041   2.211   9.415   1.00 0.00 ? 76  PRO A HB2  1  
ATOM 1146  H HB3  . PRO A 1 76  ? 2.325   2.053   7.806   1.00 0.00 ? 76  PRO A HB3  1  
ATOM 1147  H HG2  . PRO A 1 76  ? 1.537   0.723   10.370  1.00 0.00 ? 76  PRO A HG2  1  
ATOM 1148  H HG3  . PRO A 1 76  ? 0.506   1.447   9.122   1.00 0.00 ? 76  PRO A HG3  1  
ATOM 1149  H HD2  . PRO A 1 76  ? 0.910   -1.224  9.310   1.00 0.00 ? 76  PRO A HD2  1  
ATOM 1150  H HD3  . PRO A 1 76  ? 0.643   -0.406  7.757   1.00 0.00 ? 76  PRO A HD3  1  
ATOM 1151  N N    . CYS A 1 77  ? 5.360   1.224   9.777   1.00 0.00 ? 77  CYS A N    1  
ATOM 1152  C CA   . CYS A 1 77  ? 6.358   1.172   10.840  1.00 0.00 ? 77  CYS A CA   1  
ATOM 1153  C C    . CYS A 1 77  ? 6.088   2.243   11.892  1.00 0.00 ? 77  CYS A C    1  
ATOM 1154  O O    . CYS A 1 77  ? 5.125   3.002   11.785  1.00 0.00 ? 77  CYS A O    1  
ATOM 1155  C CB   . CYS A 1 77  ? 7.761   1.353   10.259  1.00 0.00 ? 77  CYS A CB   1  
ATOM 1156  S SG   . CYS A 1 77  ? 9.060   0.510   11.192  1.00 0.00 ? 77  CYS A SG   1  
ATOM 1157  H H    . CYS A 1 77  ? 5.288   2.033   9.228   1.00 0.00 ? 77  CYS A H    1  
ATOM 1158  H HA   . CYS A 1 77  ? 6.293   0.201   11.307  1.00 0.00 ? 77  CYS A HA   1  
ATOM 1159  H HB2  . CYS A 1 77  ? 7.778   0.967   9.251   1.00 0.00 ? 77  CYS A HB2  1  
ATOM 1160  H HB3  . CYS A 1 77  ? 8.001   2.406   10.238  1.00 0.00 ? 77  CYS A HB3  1  
ATOM 1161  H HG   . CYS A 1 77  ? 10.227  1.003   10.804  1.00 0.00 ? 77  CYS A HG   1  
ATOM 1162  N N    . GLU A 1 78  ? 6.943   2.295   12.908  1.00 0.00 ? 78  GLU A N    1  
ATOM 1163  C CA   . GLU A 1 78  ? 6.794   3.271   13.981  1.00 0.00 ? 78  GLU A CA   1  
ATOM 1164  C C    . GLU A 1 78  ? 7.670   4.495   13.729  1.00 0.00 ? 78  GLU A C    1  
ATOM 1165  O O    . GLU A 1 78  ? 7.502   5.534   14.368  1.00 0.00 ? 78  GLU A O    1  
ATOM 1166  C CB   . GLU A 1 78  ? 7.155   2.641   15.328  1.00 0.00 ? 78  GLU A CB   1  
ATOM 1167  C CG   . GLU A 1 78  ? 7.665   3.642   16.351  1.00 0.00 ? 78  GLU A CG   1  
ATOM 1168  C CD   . GLU A 1 78  ? 7.590   3.114   17.771  1.00 0.00 ? 78  GLU A CD   1  
ATOM 1169  O OE1  . GLU A 1 78  ? 7.020   2.021   17.967  1.00 0.00 ? 78  GLU A OE1  1  
ATOM 1170  O OE2  . GLU A 1 78  ? 8.101   3.795   18.685  1.00 0.00 ? 78  GLU A OE2  1  
ATOM 1171  H H    . GLU A 1 78  ? 7.691   1.663   12.938  1.00 0.00 ? 78  GLU A H    1  
ATOM 1172  H HA   . GLU A 1 78  ? 5.761   3.582   14.006  1.00 0.00 ? 78  GLU A HA   1  
ATOM 1173  H HB2  . GLU A 1 78  ? 6.278   2.158   15.733  1.00 0.00 ? 78  GLU A HB2  1  
ATOM 1174  H HB3  . GLU A 1 78  ? 7.923   1.898   15.169  1.00 0.00 ? 78  GLU A HB3  1  
ATOM 1175  H HG2  . GLU A 1 78  ? 8.695   3.876   16.125  1.00 0.00 ? 78  GLU A HG2  1  
ATOM 1176  H HG3  . GLU A 1 78  ? 7.070   4.541   16.285  1.00 0.00 ? 78  GLU A HG3  1  
ATOM 1177  N N    . ARG A 1 79  ? 8.605   4.364   12.794  1.00 0.00 ? 79  ARG A N    1  
ATOM 1178  C CA   . ARG A 1 79  ? 9.509   5.457   12.458  1.00 0.00 ? 79  ARG A CA   1  
ATOM 1179  C C    . ARG A 1 79  ? 9.361   5.854   10.992  1.00 0.00 ? 79  ARG A C    1  
ATOM 1180  O O    . ARG A 1 79  ? 10.322  6.286   10.355  1.00 0.00 ? 79  ARG A O    1  
ATOM 1181  C CB   . ARG A 1 79  ? 10.957  5.057   12.745  1.00 0.00 ? 79  ARG A CB   1  
ATOM 1182  C CG   . ARG A 1 79  ? 11.145  4.374   14.090  1.00 0.00 ? 79  ARG A CG   1  
ATOM 1183  C CD   . ARG A 1 79  ? 11.055  5.368   15.237  1.00 0.00 ? 79  ARG A CD   1  
ATOM 1184  N NE   . ARG A 1 79  ? 11.098  4.708   16.539  1.00 0.00 ? 79  ARG A NE   1  
ATOM 1185  C CZ   . ARG A 1 79  ? 11.068  5.360   17.695  1.00 0.00 ? 79  ARG A CZ   1  
ATOM 1186  N NH1  . ARG A 1 79  ? 10.995  6.684   17.712  1.00 0.00 ? 79  ARG A NH1  1  
ATOM 1187  N NH2  . ARG A 1 79  ? 11.111  4.689   18.839  1.00 0.00 ? 79  ARG A NH2  1  
ATOM 1188  H H    . ARG A 1 79  ? 8.690   3.510   12.319  1.00 0.00 ? 79  ARG A H    1  
ATOM 1189  H HA   . ARG A 1 79  ? 9.250   6.304   13.076  1.00 0.00 ? 79  ARG A HA   1  
ATOM 1190  H HB2  . ARG A 1 79  ? 11.291  4.379   11.973  1.00 0.00 ? 79  ARG A HB2  1  
ATOM 1191  H HB3  . ARG A 1 79  ? 11.573  5.943   12.727  1.00 0.00 ? 79  ARG A HB3  1  
ATOM 1192  H HG2  . ARG A 1 79  ? 10.375  3.627   14.215  1.00 0.00 ? 79  ARG A HG2  1  
ATOM 1193  H HG3  . ARG A 1 79  ? 12.116  3.901   14.110  1.00 0.00 ? 79  ARG A HG3  1  
ATOM 1194  H HD2  . ARG A 1 79  ? 11.884  6.056   15.166  1.00 0.00 ? 79  ARG A HD2  1  
ATOM 1195  H HD3  . ARG A 1 79  ? 10.126  5.913   15.150  1.00 0.00 ? 79  ARG A HD3  1  
ATOM 1196  H HE   . ARG A 1 79  ? 11.152  3.730   16.550  1.00 0.00 ? 79  ARG A HE   1  
ATOM 1197  H HH11 . ARG A 1 79  ? 10.962  7.193   16.852  1.00 0.00 ? 79  ARG A HH11 1  
ATOM 1198  H HH12 . ARG A 1 79  ? 10.972  7.173   18.584  1.00 0.00 ? 79  ARG A HH12 1  
ATOM 1199  H HH21 . ARG A 1 79  ? 11.166  3.691   18.830  1.00 0.00 ? 79  ARG A HH21 1  
ATOM 1200  H HH22 . ARG A 1 79  ? 11.089  5.181   19.709  1.00 0.00 ? 79  ARG A HH22 1  
ATOM 1201  N N    . SER A 1 80  ? 8.151   5.703   10.463  1.00 0.00 ? 80  SER A N    1  
ATOM 1202  C CA   . SER A 1 80  ? 7.878   6.042   9.071   1.00 0.00 ? 80  SER A CA   1  
ATOM 1203  C C    . SER A 1 80  ? 6.596   6.860   8.952   1.00 0.00 ? 80  SER A C    1  
ATOM 1204  O O    . SER A 1 80  ? 5.673   6.707   9.752   1.00 0.00 ? 80  SER A O    1  
ATOM 1205  C CB   . SER A 1 80  ? 7.764   4.770   8.228   1.00 0.00 ? 80  SER A CB   1  
ATOM 1206  O OG   . SER A 1 80  ? 6.613   4.023   8.584   1.00 0.00 ? 80  SER A OG   1  
ATOM 1207  H H    . SER A 1 80  ? 7.425   5.354   11.022  1.00 0.00 ? 80  SER A H    1  
ATOM 1208  H HA   . SER A 1 80  ? 8.704   6.633   8.705   1.00 0.00 ? 80  SER A HA   1  
ATOM 1209  H HB2  . SER A 1 80  ? 7.696   5.038   7.184   1.00 0.00 ? 80  SER A HB2  1  
ATOM 1210  H HB3  . SER A 1 80  ? 8.640   4.157   8.386   1.00 0.00 ? 80  SER A HB3  1  
ATOM 1211  H HG   . SER A 1 80  ? 6.119   4.498   9.256   1.00 0.00 ? 80  SER A HG   1  
ATOM 1212  N N    . GLU A 1 81  ? 6.547   7.730   7.948   1.00 0.00 ? 81  GLU A N    1  
ATOM 1213  C CA   . GLU A 1 81  ? 5.379   8.574   7.725   1.00 0.00 ? 81  GLU A CA   1  
ATOM 1214  C C    . GLU A 1 81  ? 4.432   7.936   6.713   1.00 0.00 ? 81  GLU A C    1  
ATOM 1215  O O    . GLU A 1 81  ? 4.645   8.027   5.503   1.00 0.00 ? 81  GLU A O    1  
ATOM 1216  C CB   . GLU A 1 81  ? 5.809   9.959   7.237   1.00 0.00 ? 81  GLU A CB   1  
ATOM 1217  C CG   . GLU A 1 81  ? 4.865   11.073  7.659   1.00 0.00 ? 81  GLU A CG   1  
ATOM 1218  C CD   . GLU A 1 81  ? 5.102   11.529  9.085   1.00 0.00 ? 81  GLU A CD   1  
ATOM 1219  O OE1  . GLU A 1 81  ? 4.911   10.711  10.009  1.00 0.00 ? 81  GLU A OE1  1  
ATOM 1220  O OE2  . GLU A 1 81  ? 5.478   12.704  9.278   1.00 0.00 ? 81  GLU A OE2  1  
ATOM 1221  H H    . GLU A 1 81  ? 7.315   7.807   7.344   1.00 0.00 ? 81  GLU A H    1  
ATOM 1222  H HA   . GLU A 1 81  ? 4.862   8.680   8.667   1.00 0.00 ? 81  GLU A HA   1  
ATOM 1223  H HB2  . GLU A 1 81  ? 6.790   10.178  7.630   1.00 0.00 ? 81  GLU A HB2  1  
ATOM 1224  H HB3  . GLU A 1 81  ? 5.858   9.947   6.158   1.00 0.00 ? 81  GLU A HB3  1  
ATOM 1225  H HG2  . GLU A 1 81  ? 5.007   11.916  6.999   1.00 0.00 ? 81  GLU A HG2  1  
ATOM 1226  H HG3  . GLU A 1 81  ? 3.849   10.718  7.574   1.00 0.00 ? 81  GLU A HG3  1  
ATOM 1227  N N    . THR A 1 82  ? 3.386   7.289   7.216   1.00 0.00 ? 82  THR A N    1  
ATOM 1228  C CA   . THR A 1 82  ? 2.407   6.634   6.357   1.00 0.00 ? 82  THR A CA   1  
ATOM 1229  C C    . THR A 1 82  ? 0.988   7.061   6.715   1.00 0.00 ? 82  THR A C    1  
ATOM 1230  O O    . THR A 1 82  ? 0.626   7.122   7.890   1.00 0.00 ? 82  THR A O    1  
ATOM 1231  C CB   . THR A 1 82  ? 2.510   5.101   6.456   1.00 0.00 ? 82  THR A CB   1  
ATOM 1232  O OG1  . THR A 1 82  ? 3.881   4.709   6.583   1.00 0.00 ? 82  THR A OG1  1  
ATOM 1233  C CG2  . THR A 1 82  ? 1.900   4.437   5.230   1.00 0.00 ? 82  THR A CG2  1  
ATOM 1234  H H    . THR A 1 82  ? 3.271   7.252   8.188   1.00 0.00 ? 82  THR A H    1  
ATOM 1235  H HA   . THR A 1 82  ? 2.613   6.923   5.336   1.00 0.00 ? 82  THR A HA   1  
ATOM 1236  H HB   . THR A 1 82  ? 1.967   4.774   7.331   1.00 0.00 ? 82  THR A HB   1  
ATOM 1237  H HG1  . THR A 1 82  ? 3.927   3.791   6.861   1.00 0.00 ? 82  THR A HG1  1  
ATOM 1238  H HG21 . THR A 1 82  ? 1.152   5.089   4.804   1.00 0.00 ? 82  THR A HG21 1  
ATOM 1239  H HG22 . THR A 1 82  ? 1.441   3.503   5.517   1.00 0.00 ? 82  THR A HG22 1  
ATOM 1240  H HG23 . THR A 1 82  ? 2.673   4.250   4.500   1.00 0.00 ? 82  THR A HG23 1  
ATOM 1241  N N    . TYR A 1 83  ? 0.189   7.356   5.696   1.00 0.00 ? 83  TYR A N    1  
ATOM 1242  C CA   . TYR A 1 83  ? -1.191  7.779   5.904   1.00 0.00 ? 83  TYR A CA   1  
ATOM 1243  C C    . TYR A 1 83  ? -2.140  7.006   4.994   1.00 0.00 ? 83  TYR A C    1  
ATOM 1244  O O    . TYR A 1 83  ? -1.887  6.851   3.800   1.00 0.00 ? 83  TYR A O    1  
ATOM 1245  C CB   . TYR A 1 83  ? -1.330  9.281   5.647   1.00 0.00 ? 83  TYR A CB   1  
ATOM 1246  C CG   . TYR A 1 83  ? -0.629  10.138  6.676   1.00 0.00 ? 83  TYR A CG   1  
ATOM 1247  C CD1  . TYR A 1 83  ? -1.226  10.419  7.899   1.00 0.00 ? 83  TYR A CD1  1  
ATOM 1248  C CD2  . TYR A 1 83  ? 0.630   10.669  6.425   1.00 0.00 ? 83  TYR A CD2  1  
ATOM 1249  C CE1  . TYR A 1 83  ? -0.590  11.202  8.842   1.00 0.00 ? 83  TYR A CE1  1  
ATOM 1250  C CE2  . TYR A 1 83  ? 1.275   11.453  7.363   1.00 0.00 ? 83  TYR A CE2  1  
ATOM 1251  C CZ   . TYR A 1 83  ? 0.661   11.717  8.569   1.00 0.00 ? 83  TYR A CZ   1  
ATOM 1252  O OH   . TYR A 1 83  ? 1.299   12.498  9.505   1.00 0.00 ? 83  TYR A OH   1  
ATOM 1253  H H    . TYR A 1 83  ? 0.535   7.289   4.781   1.00 0.00 ? 83  TYR A H    1  
ATOM 1254  H HA   . TYR A 1 83  ? -1.449  7.574   6.932   1.00 0.00 ? 83  TYR A HA   1  
ATOM 1255  H HB2  . TYR A 1 83  ? -0.911  9.514   4.681   1.00 0.00 ? 83  TYR A HB2  1  
ATOM 1256  H HB3  . TYR A 1 83  ? -2.377  9.544   5.653   1.00 0.00 ? 83  TYR A HB3  1  
ATOM 1257  H HD1  . TYR A 1 83  ? -2.206  10.014  8.110   1.00 0.00 ? 83  TYR A HD1  1  
ATOM 1258  H HD2  . TYR A 1 83  ? 1.109   10.461  5.479   1.00 0.00 ? 83  TYR A HD2  1  
ATOM 1259  H HE1  . TYR A 1 83  ? -1.070  11.409  9.787   1.00 0.00 ? 83  TYR A HE1  1  
ATOM 1260  H HE2  . TYR A 1 83  ? 2.254   11.856  7.150   1.00 0.00 ? 83  TYR A HE2  1  
ATOM 1261  H HH   . TYR A 1 83  ? 2.223   12.597  9.263   1.00 0.00 ? 83  TYR A HH   1  
ATOM 1262  N N    . VAL A 1 84  ? -3.237  6.523   5.569   1.00 0.00 ? 84  VAL A N    1  
ATOM 1263  C CA   . VAL A 1 84  ? -4.228  5.767   4.811   1.00 0.00 ? 84  VAL A CA   1  
ATOM 1264  C C    . VAL A 1 84  ? -5.590  6.451   4.852   1.00 0.00 ? 84  VAL A C    1  
ATOM 1265  O O    . VAL A 1 84  ? -5.922  7.138   5.817   1.00 0.00 ? 84  VAL A O    1  
ATOM 1266  C CB   . VAL A 1 84  ? -4.370  4.331   5.350   1.00 0.00 ? 84  VAL A CB   1  
ATOM 1267  C CG1  . VAL A 1 84  ? -5.675  3.710   4.875   1.00 0.00 ? 84  VAL A CG1  1  
ATOM 1268  C CG2  . VAL A 1 84  ? -3.181  3.483   4.926   1.00 0.00 ? 84  VAL A CG2  1  
ATOM 1269  H H    . VAL A 1 84  ? -3.384  6.679   6.525   1.00 0.00 ? 84  VAL A H    1  
ATOM 1270  H HA   . VAL A 1 84  ? -3.893  5.713   3.785   1.00 0.00 ? 84  VAL A HA   1  
ATOM 1271  H HB   . VAL A 1 84  ? -4.389  4.373   6.429   1.00 0.00 ? 84  VAL A HB   1  
ATOM 1272  H HG11 . VAL A 1 84  ? -5.632  2.638   5.006   1.00 0.00 ? 84  VAL A HG11 1  
ATOM 1273  H HG12 . VAL A 1 84  ? -6.496  4.111   5.451   1.00 0.00 ? 84  VAL A HG12 1  
ATOM 1274  H HG13 . VAL A 1 84  ? -5.823  3.938   3.830   1.00 0.00 ? 84  VAL A HG13 1  
ATOM 1275  H HG21 . VAL A 1 84  ? -2.479  4.094   4.379   1.00 0.00 ? 84  VAL A HG21 1  
ATOM 1276  H HG22 . VAL A 1 84  ? -2.699  3.077   5.802   1.00 0.00 ? 84  VAL A HG22 1  
ATOM 1277  H HG23 . VAL A 1 84  ? -3.521  2.674   4.295   1.00 0.00 ? 84  VAL A HG23 1  
ATOM 1278  N N    . ASN A 1 85  ? -6.375  6.257   3.797   1.00 0.00 ? 85  ASN A N    1  
ATOM 1279  C CA   . ASN A 1 85  ? -7.702  6.855   3.712   1.00 0.00 ? 85  ASN A CA   1  
ATOM 1280  C C    . ASN A 1 85  ? -7.692  8.281   4.255   1.00 0.00 ? 85  ASN A C    1  
ATOM 1281  O O    . ASN A 1 85  ? -8.716  8.793   4.704   1.00 0.00 ? 85  ASN A O    1  
ATOM 1282  C CB   . ASN A 1 85  ? -8.716  6.010   4.486   1.00 0.00 ? 85  ASN A CB   1  
ATOM 1283  C CG   . ASN A 1 85  ? -9.350  4.936   3.624   1.00 0.00 ? 85  ASN A CG   1  
ATOM 1284  O OD1  . ASN A 1 85  ? -9.290  3.749   3.948   1.00 0.00 ? 85  ASN A OD1  1  
ATOM 1285  N ND2  . ASN A 1 85  ? -9.963  5.347   2.520   1.00 0.00 ? 85  ASN A ND2  1  
ATOM 1286  H H    . ASN A 1 85  ? -6.054  5.698   3.058   1.00 0.00 ? 85  ASN A H    1  
ATOM 1287  H HA   . ASN A 1 85  ? -7.988  6.881   2.671   1.00 0.00 ? 85  ASN A HA   1  
ATOM 1288  H HB2  . ASN A 1 85  ? -8.217  5.531   5.316   1.00 0.00 ? 85  ASN A HB2  1  
ATOM 1289  H HB3  . ASN A 1 85  ? -9.498  6.652   4.863   1.00 0.00 ? 85  ASN A HB3  1  
ATOM 1290  H HD21 . ASN A 1 85  ? -9.971  6.308   2.326   1.00 0.00 ? 85  ASN A HD21 1  
ATOM 1291  H HD22 . ASN A 1 85  ? -10.382 4.673   1.946   1.00 0.00 ? 85  ASN A HD22 1  
ATOM 1292  N N    . GLY A 1 86  ? -6.525  8.918   4.209   1.00 0.00 ? 86  GLY A N    1  
ATOM 1293  C CA   . GLY A 1 86  ? -6.403  10.278  4.698   1.00 0.00 ? 86  GLY A CA   1  
ATOM 1294  C C    . GLY A 1 86  ? -5.772  10.345  6.075   1.00 0.00 ? 86  GLY A C    1  
ATOM 1295  O O    . GLY A 1 86  ? -4.953  11.222  6.349   1.00 0.00 ? 86  GLY A O    1  
ATOM 1296  H H    . GLY A 1 86  ? -5.741  8.460   3.840   1.00 0.00 ? 86  GLY A H    1  
ATOM 1297  H HA2  . GLY A 1 86  ? -5.796  10.845  4.008   1.00 0.00 ? 86  GLY A HA2  1  
ATOM 1298  H HA3  . GLY A 1 86  ? -7.387  10.722  4.745   1.00 0.00 ? 86  GLY A HA3  1  
ATOM 1299  N N    . LYS A 1 87  ? -6.154  9.416   6.945   1.00 0.00 ? 87  LYS A N    1  
ATOM 1300  C CA   . LYS A 1 87  ? -5.621  9.372   8.301   1.00 0.00 ? 87  LYS A CA   1  
ATOM 1301  C C    . LYS A 1 87  ? -4.271  8.662   8.332   1.00 0.00 ? 87  LYS A C    1  
ATOM 1302  O O    . LYS A 1 87  ? -3.725  8.300   7.290   1.00 0.00 ? 87  LYS A O    1  
ATOM 1303  C CB   . LYS A 1 87  ? -6.604  8.662   9.235   1.00 0.00 ? 87  LYS A CB   1  
ATOM 1304  C CG   . LYS A 1 87  ? -6.720  7.170   8.975   1.00 0.00 ? 87  LYS A CG   1  
ATOM 1305  C CD   . LYS A 1 87  ? -8.117  6.657   9.281   1.00 0.00 ? 87  LYS A CD   1  
ATOM 1306  C CE   . LYS A 1 87  ? -8.211  6.103   10.694  1.00 0.00 ? 87  LYS A CE   1  
ATOM 1307  N NZ   . LYS A 1 87  ? -9.624  5.943   11.134  1.00 0.00 ? 87  LYS A NZ   1  
ATOM 1308  H H    . LYS A 1 87  ? -6.810  8.743   6.667   1.00 0.00 ? 87  LYS A H    1  
ATOM 1309  H HA   . LYS A 1 87  ? -5.487  10.388  8.639   1.00 0.00 ? 87  LYS A HA   1  
ATOM 1310  H HB2  . LYS A 1 87  ? -6.280  8.804   10.255  1.00 0.00 ? 87  LYS A HB2  1  
ATOM 1311  H HB3  . LYS A 1 87  ? -7.582  9.104   9.112   1.00 0.00 ? 87  LYS A HB3  1  
ATOM 1312  H HG2  . LYS A 1 87  ? -6.496  6.976   7.937   1.00 0.00 ? 87  LYS A HG2  1  
ATOM 1313  H HG3  . LYS A 1 87  ? -6.010  6.648   9.602   1.00 0.00 ? 87  LYS A HG3  1  
ATOM 1314  H HD2  . LYS A 1 87  ? -8.820  7.471   9.178   1.00 0.00 ? 87  LYS A HD2  1  
ATOM 1315  H HD3  . LYS A 1 87  ? -8.365  5.874   8.578   1.00 0.00 ? 87  LYS A HD3  1  
ATOM 1316  H HE2  . LYS A 1 87  ? -7.723  5.140   10.722  1.00 0.00 ? 87  LYS A HE2  1  
ATOM 1317  H HE3  . LYS A 1 87  ? -7.707  6.781   11.367  1.00 0.00 ? 87  LYS A HE3  1  
ATOM 1318  H HZ1  . LYS A 1 87  ? -9.827  6.586   11.926  1.00 0.00 ? 87  LYS A HZ1  1  
ATOM 1319  H HZ2  . LYS A 1 87  ? -9.794  4.965   11.444  1.00 0.00 ? 87  LYS A HZ2  1  
ATOM 1320  H HZ3  . LYS A 1 87  ? -10.270 6.163   10.350  1.00 0.00 ? 87  LYS A HZ3  1  
ATOM 1321  N N    . ARG A 1 88  ? -3.739  8.465   9.534   1.00 0.00 ? 88  ARG A N    1  
ATOM 1322  C CA   . ARG A 1 88  ? -2.453  7.798   9.700   1.00 0.00 ? 88  ARG A CA   1  
ATOM 1323  C C    . ARG A 1 88  ? -2.631  6.284   9.775   1.00 0.00 ? 88  ARG A C    1  
ATOM 1324  O O    . ARG A 1 88  ? -3.746  5.787   9.932   1.00 0.00 ? 88  ARG A O    1  
ATOM 1325  C CB   . ARG A 1 88  ? -1.752  8.303   10.962  1.00 0.00 ? 88  ARG A CB   1  
ATOM 1326  C CG   . ARG A 1 88  ? -0.319  7.813   11.101  1.00 0.00 ? 88  ARG A CG   1  
ATOM 1327  C CD   . ARG A 1 88  ? 0.490   8.712   12.022  1.00 0.00 ? 88  ARG A CD   1  
ATOM 1328  N NE   . ARG A 1 88  ? 1.561   7.983   12.696  1.00 0.00 ? 88  ARG A NE   1  
ATOM 1329  C CZ   . ARG A 1 88  ? 2.672   7.581   12.088  1.00 0.00 ? 88  ARG A CZ   1  
ATOM 1330  N NH1  . ARG A 1 88  ? 2.857   7.837   10.800  1.00 0.00 ? 88  ARG A NH1  1  
ATOM 1331  N NH2  . ARG A 1 88  ? 3.601   6.923   12.769  1.00 0.00 ? 88  ARG A NH2  1  
ATOM 1332  H H    . ARG A 1 88  ? -4.222  8.776   10.328  1.00 0.00 ? 88  ARG A H    1  
ATOM 1333  H HA   . ARG A 1 88  ? -1.843  8.034   8.841   1.00 0.00 ? 88  ARG A HA   1  
ATOM 1334  H HB2  . ARG A 1 88  ? -1.740  9.383   10.946  1.00 0.00 ? 88  ARG A HB2  1  
ATOM 1335  H HB3  . ARG A 1 88  ? -2.308  7.970   11.826  1.00 0.00 ? 88  ARG A HB3  1  
ATOM 1336  H HG2  . ARG A 1 88  ? -0.328  6.813   11.508  1.00 0.00 ? 88  ARG A HG2  1  
ATOM 1337  H HG3  . ARG A 1 88  ? 0.143   7.803   10.125  1.00 0.00 ? 88  ARG A HG3  1  
ATOM 1338  H HD2  . ARG A 1 88  ? 0.923   9.509   11.437  1.00 0.00 ? 88  ARG A HD2  1  
ATOM 1339  H HD3  . ARG A 1 88  ? -0.171  9.131   12.766  1.00 0.00 ? 88  ARG A HD3  1  
ATOM 1340  H HE   . ARG A 1 88  ? 1.445   7.783   13.648  1.00 0.00 ? 88  ARG A HE   1  
ATOM 1341  H HH11 . ARG A 1 88  ? 2.159   8.334   10.285  1.00 0.00 ? 88  ARG A HH11 1  
ATOM 1342  H HH12 . ARG A 1 88  ? 3.694   7.535   10.345  1.00 0.00 ? 88  ARG A HH12 1  
ATOM 1343  H HH21 . ARG A 1 88  ? 3.466   6.728   13.740  1.00 0.00 ? 88  ARG A HH21 1  
ATOM 1344  H HH22 . ARG A 1 88  ? 4.436   6.621   12.311  1.00 0.00 ? 88  ARG A HH22 1  
ATOM 1345  N N    . VAL A 1 89  ? -1.525  5.557   9.662   1.00 0.00 ? 89  VAL A N    1  
ATOM 1346  C CA   . VAL A 1 89  ? -1.558  4.100   9.717   1.00 0.00 ? 89  VAL A CA   1  
ATOM 1347  C C    . VAL A 1 89  ? -0.298  3.546   10.372  1.00 0.00 ? 89  VAL A C    1  
ATOM 1348  O O    . VAL A 1 89  ? 0.786   3.587   9.790   1.00 0.00 ? 89  VAL A O    1  
ATOM 1349  C CB   . VAL A 1 89  ? -1.704  3.488   8.311   1.00 0.00 ? 89  VAL A CB   1  
ATOM 1350  C CG1  . VAL A 1 89  ? -0.530  3.886   7.431   1.00 0.00 ? 89  VAL A CG1  1  
ATOM 1351  C CG2  . VAL A 1 89  ? -1.826  1.974   8.400   1.00 0.00 ? 89  VAL A CG2  1  
ATOM 1352  H H    . VAL A 1 89  ? -0.665  6.011   9.538   1.00 0.00 ? 89  VAL A H    1  
ATOM 1353  H HA   . VAL A 1 89  ? -2.416  3.808   10.305  1.00 0.00 ? 89  VAL A HA   1  
ATOM 1354  H HB   . VAL A 1 89  ? -2.608  3.875   7.865   1.00 0.00 ? 89  VAL A HB   1  
ATOM 1355  H HG11 . VAL A 1 89  ? 0.306   3.232   7.629   1.00 0.00 ? 89  VAL A HG11 1  
ATOM 1356  H HG12 . VAL A 1 89  ? -0.814  3.803   6.392   1.00 0.00 ? 89  VAL A HG12 1  
ATOM 1357  H HG13 . VAL A 1 89  ? -0.248  4.906   7.647   1.00 0.00 ? 89  VAL A HG13 1  
ATOM 1358  H HG21 . VAL A 1 89  ? -1.674  1.660   9.421   1.00 0.00 ? 89  VAL A HG21 1  
ATOM 1359  H HG22 . VAL A 1 89  ? -2.810  1.673   8.073   1.00 0.00 ? 89  VAL A HG22 1  
ATOM 1360  H HG23 . VAL A 1 89  ? -1.080  1.515   7.767   1.00 0.00 ? 89  VAL A HG23 1  
ATOM 1361  N N    . SER A 1 90  ? -0.448  3.028   11.587  1.00 0.00 ? 90  SER A N    1  
ATOM 1362  C CA   . SER A 1 90  ? 0.679   2.468   12.323  1.00 0.00 ? 90  SER A CA   1  
ATOM 1363  C C    . SER A 1 90  ? 0.454   0.988   12.619  1.00 0.00 ? 90  SER A C    1  
ATOM 1364  O O    . SER A 1 90  ? 1.393   0.256   12.928  1.00 0.00 ? 90  SER A O    1  
ATOM 1365  C CB   . SER A 1 90  ? 0.893   3.234   13.630  1.00 0.00 ? 90  SER A CB   1  
ATOM 1366  O OG   . SER A 1 90  ? 2.104   2.847   14.256  1.00 0.00 ? 90  SER A OG   1  
ATOM 1367  H H    . SER A 1 90  ? -1.338  3.024   11.998  1.00 0.00 ? 90  SER A H    1  
ATOM 1368  H HA   . SER A 1 90  ? 1.561   2.569   11.708  1.00 0.00 ? 90  SER A HA   1  
ATOM 1369  H HB2  . SER A 1 90  ? 0.932   4.292   13.422  1.00 0.00 ? 90  SER A HB2  1  
ATOM 1370  H HB3  . SER A 1 90  ? 0.072   3.029   14.303  1.00 0.00 ? 90  SER A HB3  1  
ATOM 1371  H HG   . SER A 1 90  ? 2.038   2.997   15.202  1.00 0.00 ? 90  SER A HG   1  
ATOM 1372  N N    . GLN A 1 91  ? -0.800  0.556   12.522  1.00 0.00 ? 91  GLN A N    1  
ATOM 1373  C CA   . GLN A 1 91  ? -1.150  -0.835  12.780  1.00 0.00 ? 91  GLN A CA   1  
ATOM 1374  C C    . GLN A 1 91  ? -1.517  -1.553  11.486  1.00 0.00 ? 91  GLN A C    1  
ATOM 1375  O O    . GLN A 1 91  ? -1.915  -0.937  10.497  1.00 0.00 ? 91  GLN A O    1  
ATOM 1376  C CB   . GLN A 1 91  ? -2.313  -0.916  13.770  1.00 0.00 ? 91  GLN A CB   1  
ATOM 1377  C CG   . GLN A 1 91  ? -1.875  -0.903  15.226  1.00 0.00 ? 91  GLN A CG   1  
ATOM 1378  C CD   . GLN A 1 91  ? -3.047  -0.930  16.188  1.00 0.00 ? 91  GLN A CD   1  
ATOM 1379  O OE1  . GLN A 1 91  ? -4.144  -0.477  15.861  1.00 0.00 ? 91  GLN A OE1  1  
ATOM 1380  N NE2  . GLN A 1 91  ? -2.820  -1.462  17.383  1.00 0.00 ? 91  GLN A NE2  1  
ATOM 1381  H H    . GLN A 1 91  ? -1.505  1.188   12.272  1.00 0.00 ? 91  GLN A H    1  
ATOM 1382  H HA   . GLN A 1 91  ? -0.287  -1.319  13.213  1.00 0.00 ? 91  GLN A HA   1  
ATOM 1383  H HB2  . GLN A 1 91  ? -2.969  -0.074  13.606  1.00 0.00 ? 91  GLN A HB2  1  
ATOM 1384  H HB3  . GLN A 1 91  ? -2.861  -1.829  13.590  1.00 0.00 ? 91  GLN A HB3  1  
ATOM 1385  H HG2  . GLN A 1 91  ? -1.258  -1.770  15.411  1.00 0.00 ? 91  GLN A HG2  1  
ATOM 1386  H HG3  . GLN A 1 91  ? -1.300  -0.007  15.407  1.00 0.00 ? 91  GLN A HG3  1  
ATOM 1387  H HE21 . GLN A 1 91  ? -1.920  -1.802  17.574  1.00 0.00 ? 91  GLN A HE21 1  
ATOM 1388  H HE22 . GLN A 1 91  ? -3.559  -1.492  18.024  1.00 0.00 ? 91  GLN A HE22 1  
ATOM 1389  N N    . PRO A 1 92  ? -1.382  -2.888  11.490  1.00 0.00 ? 92  PRO A N    1  
ATOM 1390  C CA   . PRO A 1 92  ? -1.695  -3.718  10.323  1.00 0.00 ? 92  PRO A CA   1  
ATOM 1391  C C    . PRO A 1 92  ? -3.192  -3.773  10.035  1.00 0.00 ? 92  PRO A C    1  
ATOM 1392  O O    . PRO A 1 92  ? -3.912  -4.601  10.592  1.00 0.00 ? 92  PRO A O    1  
ATOM 1393  C CB   . PRO A 1 92  ? -1.177  -5.102  10.724  1.00 0.00 ? 92  PRO A CB   1  
ATOM 1394  C CG   . PRO A 1 92  ? -1.209  -5.102  12.213  1.00 0.00 ? 92  PRO A CG   1  
ATOM 1395  C CD   . PRO A 1 92  ? -0.914  -3.688  12.633  1.00 0.00 ? 92  PRO A CD   1  
ATOM 1396  H HA   . PRO A 1 92  ? -1.172  -3.378  9.441   1.00 0.00 ? 92  PRO A HA   1  
ATOM 1397  H HB2  . PRO A 1 92  ? -1.825  -5.864  10.314  1.00 0.00 ? 92  PRO A HB2  1  
ATOM 1398  H HB3  . PRO A 1 92  ? -0.173  -5.236  10.350  1.00 0.00 ? 92  PRO A HB3  1  
ATOM 1399  H HG2  . PRO A 1 92  ? -2.187  -5.400  12.560  1.00 0.00 ? 92  PRO A HG2  1  
ATOM 1400  H HG3  . PRO A 1 92  ? -0.453  -5.772  12.596  1.00 0.00 ? 92  PRO A HG3  1  
ATOM 1401  H HD2  . PRO A 1 92  ? -1.463  -3.439  13.529  1.00 0.00 ? 92  PRO A HD2  1  
ATOM 1402  H HD3  . PRO A 1 92  ? 0.147   -3.555  12.788  1.00 0.00 ? 92  PRO A HD3  1  
ATOM 1403  N N    . VAL A 1 93  ? -3.654  -2.885  9.160   1.00 0.00 ? 93  VAL A N    1  
ATOM 1404  C CA   . VAL A 1 93  ? -5.065  -2.833  8.797   1.00 0.00 ? 93  VAL A CA   1  
ATOM 1405  C C    . VAL A 1 93  ? -5.263  -3.147  7.318   1.00 0.00 ? 93  VAL A C    1  
ATOM 1406  O O    . VAL A 1 93  ? -4.350  -2.981  6.511   1.00 0.00 ? 93  VAL A O    1  
ATOM 1407  C CB   . VAL A 1 93  ? -5.673  -1.451  9.103   1.00 0.00 ? 93  VAL A CB   1  
ATOM 1408  C CG1  . VAL A 1 93  ? -5.560  -1.135  10.587  1.00 0.00 ? 93  VAL A CG1  1  
ATOM 1409  C CG2  . VAL A 1 93  ? -4.997  -0.375  8.267   1.00 0.00 ? 93  VAL A CG2  1  
ATOM 1410  H H    . VAL A 1 93  ? -3.031  -2.250  8.749   1.00 0.00 ? 93  VAL A H    1  
ATOM 1411  H HA   . VAL A 1 93  ? -5.589  -3.572  9.385   1.00 0.00 ? 93  VAL A HA   1  
ATOM 1412  H HB   . VAL A 1 93  ? -6.721  -1.476  8.842   1.00 0.00 ? 93  VAL A HB   1  
ATOM 1413  H HG11 . VAL A 1 93  ? -4.603  -1.475  10.955  1.00 0.00 ? 93  VAL A HG11 1  
ATOM 1414  H HG12 . VAL A 1 93  ? -5.645  -0.068  10.735  1.00 0.00 ? 93  VAL A HG12 1  
ATOM 1415  H HG13 . VAL A 1 93  ? -6.351  -1.638  11.123  1.00 0.00 ? 93  VAL A HG13 1  
ATOM 1416  H HG21 . VAL A 1 93  ? -3.940  -0.362  8.483   1.00 0.00 ? 93  VAL A HG21 1  
ATOM 1417  H HG22 . VAL A 1 93  ? -5.149  -0.586  7.219   1.00 0.00 ? 93  VAL A HG22 1  
ATOM 1418  H HG23 . VAL A 1 93  ? -5.425  0.588   8.505   1.00 0.00 ? 93  VAL A HG23 1  
ATOM 1419  N N    . GLN A 1 94  ? -6.464  -3.600  6.971   1.00 0.00 ? 94  GLN A N    1  
ATOM 1420  C CA   . GLN A 1 94  ? -6.782  -3.938  5.589   1.00 0.00 ? 94  GLN A CA   1  
ATOM 1421  C C    . GLN A 1 94  ? -7.056  -2.680  4.771   1.00 0.00 ? 94  GLN A C    1  
ATOM 1422  O O    . GLN A 1 94  ? -7.674  -1.732  5.258   1.00 0.00 ? 94  GLN A O    1  
ATOM 1423  C CB   . GLN A 1 94  ? -7.994  -4.869  5.535   1.00 0.00 ? 94  GLN A CB   1  
ATOM 1424  C CG   . GLN A 1 94  ? -7.651  -6.329  5.786   1.00 0.00 ? 94  GLN A CG   1  
ATOM 1425  C CD   . GLN A 1 94  ? -8.880  -7.186  6.014   1.00 0.00 ? 94  GLN A CD   1  
ATOM 1426  O OE1  . GLN A 1 94  ? -10.010 -6.732  5.835   1.00 0.00 ? 94  GLN A OE1  1  
ATOM 1427  N NE2  . GLN A 1 94  ? -8.665  -8.435  6.411   1.00 0.00 ? 94  GLN A NE2  1  
ATOM 1428  H H    . GLN A 1 94  ? -7.150  -3.711  7.660   1.00 0.00 ? 94  GLN A H    1  
ATOM 1429  H HA   . GLN A 1 94  ? -5.929  -4.447  5.167   1.00 0.00 ? 94  GLN A HA   1  
ATOM 1430  H HB2  . GLN A 1 94  ? -8.707  -4.556  6.282   1.00 0.00 ? 94  GLN A HB2  1  
ATOM 1431  H HB3  . GLN A 1 94  ? -8.449  -4.792  4.559   1.00 0.00 ? 94  GLN A HB3  1  
ATOM 1432  H HG2  . GLN A 1 94  ? -7.117  -6.713  4.928   1.00 0.00 ? 94  GLN A HG2  1  
ATOM 1433  H HG3  . GLN A 1 94  ? -7.018  -6.392  6.659   1.00 0.00 ? 94  GLN A HG3  1  
ATOM 1434  H HE21 . GLN A 1 94  ? -7.737  -8.728  6.534   1.00 0.00 ? 94  GLN A HE21 1  
ATOM 1435  H HE22 . GLN A 1 94  ? -9.441  -9.011  6.566   1.00 0.00 ? 94  GLN A HE22 1  
ATOM 1436  N N    . LEU A 1 95  ? -6.592  -2.677  3.526   1.00 0.00 ? 95  LEU A N    1  
ATOM 1437  C CA   . LEU A 1 95  ? -6.787  -1.535  2.639   1.00 0.00 ? 95  LEU A CA   1  
ATOM 1438  C C    . LEU A 1 95  ? -8.102  -1.656  1.877   1.00 0.00 ? 95  LEU A C    1  
ATOM 1439  O O    . LEU A 1 95  ? -8.600  -2.759  1.649   1.00 0.00 ? 95  LEU A O    1  
ATOM 1440  C CB   . LEU A 1 95  ? -5.621  -1.424  1.655   1.00 0.00 ? 95  LEU A CB   1  
ATOM 1441  C CG   . LEU A 1 95  ? -4.307  -0.891  2.227   1.00 0.00 ? 95  LEU A CG   1  
ATOM 1442  C CD1  . LEU A 1 95  ? -4.536  0.426   2.951   1.00 0.00 ? 95  LEU A CD1  1  
ATOM 1443  C CD2  . LEU A 1 95  ? -3.679  -1.914  3.162   1.00 0.00 ? 95  LEU A CD2  1  
ATOM 1444  H H    . LEU A 1 95  ? -6.107  -3.461  3.194   1.00 0.00 ? 95  LEU A H    1  
ATOM 1445  H HA   . LEU A 1 95  ? -6.818  -0.644  3.249   1.00 0.00 ? 95  LEU A HA   1  
ATOM 1446  H HB2  . LEU A 1 95  ? -5.432  -2.409  1.254   1.00 0.00 ? 95  LEU A HB2  1  
ATOM 1447  H HB3  . LEU A 1 95  ? -5.927  -0.765  0.855   1.00 0.00 ? 95  LEU A HB3  1  
ATOM 1448  H HG   . LEU A 1 95  ? -3.616  -0.710  1.416   1.00 0.00 ? 95  LEU A HG   1  
ATOM 1449  H HD11 . LEU A 1 95  ? -3.686  1.074   2.798   1.00 0.00 ? 95  LEU A HD11 1  
ATOM 1450  H HD12 . LEU A 1 95  ? -4.661  0.239   4.008   1.00 0.00 ? 95  LEU A HD12 1  
ATOM 1451  H HD13 . LEU A 1 95  ? -5.426  0.900   2.563   1.00 0.00 ? 95  LEU A HD13 1  
ATOM 1452  H HD21 . LEU A 1 95  ? -3.517  -1.464  4.131   1.00 0.00 ? 95  LEU A HD21 1  
ATOM 1453  H HD22 . LEU A 1 95  ? -2.734  -2.241  2.754   1.00 0.00 ? 95  LEU A HD22 1  
ATOM 1454  H HD23 . LEU A 1 95  ? -4.340  -2.762  3.264   1.00 0.00 ? 95  LEU A HD23 1  
ATOM 1455  N N    . ARG A 1 96  ? -8.658  -0.515  1.482   1.00 0.00 ? 96  ARG A N    1  
ATOM 1456  C CA   . ARG A 1 96  ? -9.915  -0.493  0.744   1.00 0.00 ? 96  ARG A CA   1  
ATOM 1457  C C    . ARG A 1 96  ? -9.686  -0.086  -0.708  1.00 0.00 ? 96  ARG A C    1  
ATOM 1458  O O    . ARG A 1 96  ? -8.586  0.320   -1.083  1.00 0.00 ? 96  ARG A O    1  
ATOM 1459  C CB   . ARG A 1 96  ? -10.903 0.470   1.405   1.00 0.00 ? 96  ARG A CB   1  
ATOM 1460  C CG   . ARG A 1 96  ? -11.881 -0.213  2.347   1.00 0.00 ? 96  ARG A CG   1  
ATOM 1461  C CD   . ARG A 1 96  ? -11.244 -1.405  3.044   1.00 0.00 ? 96  ARG A CD   1  
ATOM 1462  N NE   . ARG A 1 96  ? -11.552 -2.663  2.369   1.00 0.00 ? 96  ARG A NE   1  
ATOM 1463  C CZ   . ARG A 1 96  ? -12.754 -3.228  2.382   1.00 0.00 ? 96  ARG A CZ   1  
ATOM 1464  N NH1  . ARG A 1 96  ? -13.755 -2.650  3.032   1.00 0.00 ? 96  ARG A NH1  1  
ATOM 1465  N NH2  . ARG A 1 96  ? -12.956 -4.374  1.744   1.00 0.00 ? 96  ARG A NH2  1  
ATOM 1466  H H    . ARG A 1 96  ? -8.214  0.332   1.694   1.00 0.00 ? 96  ARG A H    1  
ATOM 1467  H HA   . ARG A 1 96  ? -10.330 -1.490  0.765   1.00 0.00 ? 96  ARG A HA   1  
ATOM 1468  H HB2  . ARG A 1 96  ? -10.348 1.205   1.969   1.00 0.00 ? 96  ARG A HB2  1  
ATOM 1469  H HB3  . ARG A 1 96  ? -11.469 0.970   0.634   1.00 0.00 ? 96  ARG A HB3  1  
ATOM 1470  H HG2  . ARG A 1 96  ? -12.202 0.498   3.095   1.00 0.00 ? 96  ARG A HG2  1  
ATOM 1471  H HG3  . ARG A 1 96  ? -12.735 -0.552  1.780   1.00 0.00 ? 96  ARG A HG3  1  
ATOM 1472  H HD2  . ARG A 1 96  ? -10.173 -1.267  3.057   1.00 0.00 ? 96  ARG A HD2  1  
ATOM 1473  H HD3  . ARG A 1 96  ? -11.612 -1.451  4.058   1.00 0.00 ? 96  ARG A HD3  1  
ATOM 1474  H HE   . ARG A 1 96  ? -10.827 -3.107  1.883   1.00 0.00 ? 96  ARG A HE   1  
ATOM 1475  H HH11 . ARG A 1 96  ? -13.606 -1.787  3.513   1.00 0.00 ? 96  ARG A HH11 1  
ATOM 1476  H HH12 . ARG A 1 96  ? -14.660 -3.078  3.039   1.00 0.00 ? 96  ARG A HH12 1  
ATOM 1477  H HH21 . ARG A 1 96  ? -12.204 -4.812  1.253   1.00 0.00 ? 96  ARG A HH21 1  
ATOM 1478  H HH22 . ARG A 1 96  ? -13.861 -4.799  1.755   1.00 0.00 ? 96  ARG A HH22 1  
ATOM 1479  N N    . SER A 1 97  ? -10.731 -0.197  -1.521  1.00 0.00 ? 97  SER A N    1  
ATOM 1480  C CA   . SER A 1 97  ? -10.643 0.155   -2.934  1.00 0.00 ? 97  SER A CA   1  
ATOM 1481  C C    . SER A 1 97  ? -10.815 1.659   -3.130  1.00 0.00 ? 97  SER A C    1  
ATOM 1482  O O    . SER A 1 97  ? -11.923 2.185   -3.034  1.00 0.00 ? 97  SER A O    1  
ATOM 1483  C CB   . SER A 1 97  ? -11.703 -0.600  -3.737  1.00 0.00 ? 97  SER A CB   1  
ATOM 1484  O OG   . SER A 1 97  ? -11.355 -0.661  -5.110  1.00 0.00 ? 97  SER A OG   1  
ATOM 1485  H H    . SER A 1 97  ? -11.582 -0.527  -1.163  1.00 0.00 ? 97  SER A H    1  
ATOM 1486  H HA   . SER A 1 97  ? -9.663  -0.132  -3.286  1.00 0.00 ? 97  SER A HA   1  
ATOM 1487  H HB2  . SER A 1 97  ? -11.791 -1.606  -3.356  1.00 0.00 ? 97  SER A HB2  1  
ATOM 1488  H HB3  . SER A 1 97  ? -12.652 -0.094  -3.640  1.00 0.00 ? 97  SER A HB3  1  
ATOM 1489  H HG   . SER A 1 97  ? -11.691 -1.476  -5.489  1.00 0.00 ? 97  SER A HG   1  
ATOM 1490  N N    . GLY A 1 98  ? -9.709  2.344   -3.405  1.00 0.00 ? 98  GLY A N    1  
ATOM 1491  C CA   . GLY A 1 98  ? -9.758  3.780   -3.611  1.00 0.00 ? 98  GLY A CA   1  
ATOM 1492  C C    . GLY A 1 98  ? -9.127  4.551   -2.468  1.00 0.00 ? 98  GLY A C    1  
ATOM 1493  O O    . GLY A 1 98  ? -9.141  5.781   -2.459  1.00 0.00 ? 98  GLY A O    1  
ATOM 1494  H H    . GLY A 1 98  ? -8.853  1.870   -3.469  1.00 0.00 ? 98  GLY A H    1  
ATOM 1495  H HA2  . GLY A 1 98  ? -9.236  4.019   -4.525  1.00 0.00 ? 98  GLY A HA2  1  
ATOM 1496  H HA3  . GLY A 1 98  ? -10.790 4.083   -3.707  1.00 0.00 ? 98  GLY A HA3  1  
ATOM 1497  N N    . ASN A 1 99  ? -8.573  3.826   -1.502  1.00 0.00 ? 99  ASN A N    1  
ATOM 1498  C CA   . ASN A 1 99  ? -7.936  4.450   -0.348  1.00 0.00 ? 99  ASN A CA   1  
ATOM 1499  C C    . ASN A 1 99  ? -6.644  5.152   -0.754  1.00 0.00 ? 99  ASN A C    1  
ATOM 1500  O O    . ASN A 1 99  ? -5.927  4.690   -1.642  1.00 0.00 ? 99  ASN A O    1  
ATOM 1501  C CB   . ASN A 1 99  ? -7.644  3.402   0.728   1.00 0.00 ? 99  ASN A CB   1  
ATOM 1502  C CG   . ASN A 1 99  ? -6.308  2.714   0.518   1.00 0.00 ? 99  ASN A CG   1  
ATOM 1503  O OD1  . ASN A 1 99  ? -5.403  2.827   1.345   1.00 0.00 ? 99  ASN A OD1  1  
ATOM 1504  N ND2  . ASN A 1 99  ? -6.180  1.997   -0.592  1.00 0.00 ? 99  ASN A ND2  1  
ATOM 1505  H H    . ASN A 1 99  ? -8.594  2.848   -1.566  1.00 0.00 ? 99  ASN A H    1  
ATOM 1506  H HA   . ASN A 1 99  ? -8.620  5.183   0.052   1.00 0.00 ? 99  ASN A HA   1  
ATOM 1507  H HB2  . ASN A 1 99  ? -7.631  3.882   1.696   1.00 0.00 ? 99  ASN A HB2  1  
ATOM 1508  H HB3  . ASN A 1 99  ? -8.420  2.652   0.713   1.00 0.00 ? 99  ASN A HB3  1  
ATOM 1509  H HD21 . ASN A 1 99  ? -6.944  1.952   -1.205  1.00 0.00 ? 99  ASN A HD21 1  
ATOM 1510  H HD22 . ASN A 1 99  ? -5.328  1.542   -0.753  1.00 0.00 ? 99  ASN A HD22 1  
ATOM 1511  N N    . ARG A 1 100 ? -6.353  6.270   -0.097  1.00 0.00 ? 100 ARG A N    1  
ATOM 1512  C CA   . ARG A 1 100 ? -5.148  7.037   -0.390  1.00 0.00 ? 100 ARG A CA   1  
ATOM 1513  C C    . ARG A 1 100 ? -4.022  6.669   0.573   1.00 0.00 ? 100 ARG A C    1  
ATOM 1514  O O    . ARG A 1 100 ? -4.085  6.978   1.763   1.00 0.00 ? 100 ARG A O    1  
ATOM 1515  C CB   . ARG A 1 100 ? -5.438  8.536   -0.303  1.00 0.00 ? 100 ARG A CB   1  
ATOM 1516  C CG   . ARG A 1 100 ? -4.505  9.387   -1.149  1.00 0.00 ? 100 ARG A CG   1  
ATOM 1517  C CD   . ARG A 1 100 ? -5.071  10.780  -1.373  1.00 0.00 ? 100 ARG A CD   1  
ATOM 1518  N NE   . ARG A 1 100 ? -4.724  11.693  -0.288  1.00 0.00 ? 100 ARG A NE   1  
ATOM 1519  C CZ   . ARG A 1 100 ? -4.965  12.999  -0.320  1.00 0.00 ? 100 ARG A CZ   1  
ATOM 1520  N NH1  . ARG A 1 100 ? -5.552  13.542  -1.378  1.00 0.00 ? 100 ARG A NH1  1  
ATOM 1521  N NH2  . ARG A 1 100 ? -4.620  13.765  0.707   1.00 0.00 ? 100 ARG A NH2  1  
ATOM 1522  H H    . ARG A 1 100 ? -6.964  6.588   0.600   1.00 0.00 ? 100 ARG A H    1  
ATOM 1523  H HA   . ARG A 1 100 ? -4.838  6.797   -1.396  1.00 0.00 ? 100 ARG A HA   1  
ATOM 1524  H HB2  . ARG A 1 100 ? -6.451  8.715   -0.633  1.00 0.00 ? 100 ARG A HB2  1  
ATOM 1525  H HB3  . ARG A 1 100 ? -5.342  8.850   0.726   1.00 0.00 ? 100 ARG A HB3  1  
ATOM 1526  H HG2  . ARG A 1 100 ? -3.554  9.474   -0.644  1.00 0.00 ? 100 ARG A HG2  1  
ATOM 1527  H HG3  . ARG A 1 100 ? -4.364  8.907   -2.106  1.00 0.00 ? 100 ARG A HG3  1  
ATOM 1528  H HD2  . ARG A 1 100 ? -4.676  11.171  -2.299  1.00 0.00 ? 100 ARG A HD2  1  
ATOM 1529  H HD3  . ARG A 1 100 ? -6.147  10.710  -1.443  1.00 0.00 ? 100 ARG A HD3  1  
ATOM 1530  H HE   . ARG A 1 100 ? -4.290  11.313  0.504   1.00 0.00 ? 100 ARG A HE   1  
ATOM 1531  H HH11 . ARG A 1 100 ? -5.815  12.968  -2.153  1.00 0.00 ? 100 ARG A HH11 1  
ATOM 1532  H HH12 . ARG A 1 100 ? -5.734  14.526  -1.399  1.00 0.00 ? 100 ARG A HH12 1  
ATOM 1533  H HH21 . ARG A 1 100 ? -4.177  13.359  1.506   1.00 0.00 ? 100 ARG A HH21 1  
ATOM 1534  H HH22 . ARG A 1 100 ? -4.802  14.747  0.682   1.00 0.00 ? 100 ARG A HH22 1  
ATOM 1535  N N    . ILE A 1 101 ? -2.996  6.007   0.049   1.00 0.00 ? 101 ILE A N    1  
ATOM 1536  C CA   . ILE A 1 101 ? -1.857  5.598   0.862   1.00 0.00 ? 101 ILE A CA   1  
ATOM 1537  C C    . ILE A 1 101 ? -0.616  6.414   0.519   1.00 0.00 ? 101 ILE A C    1  
ATOM 1538  O O    . ILE A 1 101 ? -0.083  6.318   -0.587  1.00 0.00 ? 101 ILE A O    1  
ATOM 1539  C CB   . ILE A 1 101 ? -1.541  4.102   0.676   1.00 0.00 ? 101 ILE A CB   1  
ATOM 1540  C CG1  . ILE A 1 101 ? -2.826  3.274   0.749   1.00 0.00 ? 101 ILE A CG1  1  
ATOM 1541  C CG2  . ILE A 1 101 ? -0.544  3.636   1.726   1.00 0.00 ? 101 ILE A CG2  1  
ATOM 1542  C CD1  . ILE A 1 101 ? -2.773  2.002   -0.067  1.00 0.00 ? 101 ILE A CD1  1  
ATOM 1543  H H    . ILE A 1 101 ? -3.004  5.789   -0.906  1.00 0.00 ? 101 ILE A H    1  
ATOM 1544  H HA   . ILE A 1 101 ? -2.110  5.765   1.899   1.00 0.00 ? 101 ILE A HA   1  
ATOM 1545  H HB   . ILE A 1 101 ? -1.092  3.970   -0.296  1.00 0.00 ? 101 ILE A HB   1  
ATOM 1546  H HG12 . ILE A 1 101 ? -3.013  3.001   1.776   1.00 0.00 ? 101 ILE A HG12 1  
ATOM 1547  H HG13 . ILE A 1 101 ? -3.650  3.869   0.384   1.00 0.00 ? 101 ILE A HG13 1  
ATOM 1548  H HG21 . ILE A 1 101 ? -1.036  3.572   2.686   1.00 0.00 ? 101 ILE A HG21 1  
ATOM 1549  H HG22 . ILE A 1 101 ? -0.161  2.665   1.453   1.00 0.00 ? 101 ILE A HG22 1  
ATOM 1550  H HG23 . ILE A 1 101 ? 0.271   4.341   1.786   1.00 0.00 ? 101 ILE A HG23 1  
ATOM 1551  H HD11 . ILE A 1 101 ? -1.770  1.858   -0.443  1.00 0.00 ? 101 ILE A HD11 1  
ATOM 1552  H HD12 . ILE A 1 101 ? -3.046  1.162   0.556   1.00 0.00 ? 101 ILE A HD12 1  
ATOM 1553  H HD13 . ILE A 1 101 ? -3.460  2.076   -0.895  1.00 0.00 ? 101 ILE A HD13 1  
ATOM 1554  N N    . ILE A 1 102 ? -0.159  7.215   1.476   1.00 0.00 ? 102 ILE A N    1  
ATOM 1555  C CA   . ILE A 1 102 ? 1.022   8.046   1.276   1.00 0.00 ? 102 ILE A CA   1  
ATOM 1556  C C    . ILE A 1 102 ? 2.226   7.478   2.020   1.00 0.00 ? 102 ILE A C    1  
ATOM 1557  O O    . ILE A 1 102 ? 2.101   6.988   3.142   1.00 0.00 ? 102 ILE A O    1  
ATOM 1558  C CB   . ILE A 1 102 ? 0.779   9.493   1.746   1.00 0.00 ? 102 ILE A CB   1  
ATOM 1559  C CG1  . ILE A 1 102 ? -0.039  10.260  0.705   1.00 0.00 ? 102 ILE A CG1  1  
ATOM 1560  C CG2  . ILE A 1 102 ? 2.103   10.194  2.009   1.00 0.00 ? 102 ILE A CG2  1  
ATOM 1561  C CD1  . ILE A 1 102 ? -1.525  10.263  0.987   1.00 0.00 ? 102 ILE A CD1  1  
ATOM 1562  H H    . ILE A 1 102 ? -0.626  7.248   2.336   1.00 0.00 ? 102 ILE A H    1  
ATOM 1563  H HA   . ILE A 1 102 ? 1.241   8.065   0.218   1.00 0.00 ? 102 ILE A HA   1  
ATOM 1564  H HB   . ILE A 1 102 ? 0.227   9.458   2.673   1.00 0.00 ? 102 ILE A HB   1  
ATOM 1565  H HG12 . ILE A 1 102 ? 0.295   11.285  0.678   1.00 0.00 ? 102 ILE A HG12 1  
ATOM 1566  H HG13 . ILE A 1 102 ? 0.115   9.809   -0.265  1.00 0.00 ? 102 ILE A HG13 1  
ATOM 1567  H HG21 . ILE A 1 102 ? 2.005   11.245  1.783   1.00 0.00 ? 102 ILE A HG21 1  
ATOM 1568  H HG22 . ILE A 1 102 ? 2.373   10.074  3.048   1.00 0.00 ? 102 ILE A HG22 1  
ATOM 1569  H HG23 . ILE A 1 102 ? 2.870   9.761   1.385   1.00 0.00 ? 102 ILE A HG23 1  
ATOM 1570  H HD11 . ILE A 1 102 ? -1.690  10.375  2.049   1.00 0.00 ? 102 ILE A HD11 1  
ATOM 1571  H HD12 . ILE A 1 102 ? -1.989  11.086  0.463   1.00 0.00 ? 102 ILE A HD12 1  
ATOM 1572  H HD13 . ILE A 1 102 ? -1.958  9.332   0.652   1.00 0.00 ? 102 ILE A HD13 1  
ATOM 1573  N N    . MET A 1 103 ? 3.393   7.549   1.387   1.00 0.00 ? 103 MET A N    1  
ATOM 1574  C CA   . MET A 1 103 ? 4.621   7.044   1.990   1.00 0.00 ? 103 MET A CA   1  
ATOM 1575  C C    . MET A 1 103 ? 5.735   8.083   1.906   1.00 0.00 ? 103 MET A C    1  
ATOM 1576  O O    . MET A 1 103 ? 6.380   8.232   0.870   1.00 0.00 ? 103 MET A O    1  
ATOM 1577  C CB   . MET A 1 103 ? 5.060   5.751   1.299   1.00 0.00 ? 103 MET A CB   1  
ATOM 1578  C CG   . MET A 1 103 ? 4.036   4.632   1.396   1.00 0.00 ? 103 MET A CG   1  
ATOM 1579  S SD   . MET A 1 103 ? 2.582   4.930   0.372   1.00 0.00 ? 103 MET A SD   1  
ATOM 1580  C CE   . MET A 1 103 ? 1.973   3.259   0.154   1.00 0.00 ? 103 MET A CE   1  
ATOM 1581  H H    . MET A 1 103 ? 3.430   7.951   0.494   1.00 0.00 ? 103 MET A H    1  
ATOM 1582  H HA   . MET A 1 103 ? 4.417   6.834   3.029   1.00 0.00 ? 103 MET A HA   1  
ATOM 1583  H HB2  . MET A 1 103 ? 5.237   5.958   0.254   1.00 0.00 ? 103 MET A HB2  1  
ATOM 1584  H HB3  . MET A 1 103 ? 5.979   5.409   1.751   1.00 0.00 ? 103 MET A HB3  1  
ATOM 1585  H HG2  . MET A 1 103 ? 4.499   3.710   1.078   1.00 0.00 ? 103 MET A HG2  1  
ATOM 1586  H HG3  . MET A 1 103 ? 3.722   4.539   2.425   1.00 0.00 ? 103 MET A HG3  1  
ATOM 1587  H HE1  . MET A 1 103 ? 0.986   3.291   -0.283  1.00 0.00 ? 103 MET A HE1  1  
ATOM 1588  H HE2  . MET A 1 103 ? 2.639   2.716   -0.499  1.00 0.00 ? 103 MET A HE2  1  
ATOM 1589  H HE3  . MET A 1 103 ? 1.928   2.766   1.114   1.00 0.00 ? 103 MET A HE3  1  
ATOM 1590  N N    . GLY A 1 104 ? 5.954   8.799   3.005   1.00 0.00 ? 104 GLY A N    1  
ATOM 1591  C CA   . GLY A 1 104 ? 6.990   9.815   3.034   1.00 0.00 ? 104 GLY A CA   1  
ATOM 1592  C C    . GLY A 1 104 ? 6.423   11.218  3.120   1.00 0.00 ? 104 GLY A C    1  
ATOM 1593  O O    . GLY A 1 104 ? 5.942   11.638  4.173   1.00 0.00 ? 104 GLY A O    1  
ATOM 1594  H H    . GLY A 1 104 ? 5.407   8.636   3.802   1.00 0.00 ? 104 GLY A H    1  
ATOM 1595  H HA2  . GLY A 1 104 ? 7.625   9.641   3.889   1.00 0.00 ? 104 GLY A HA2  1  
ATOM 1596  H HA3  . GLY A 1 104 ? 7.583   9.733   2.135   1.00 0.00 ? 104 GLY A HA3  1  
ATOM 1597  N N    . LYS A 1 105 ? 6.481   11.947  2.010   1.00 0.00 ? 105 LYS A N    1  
ATOM 1598  C CA   . LYS A 1 105 ? 5.971   13.312  1.964   1.00 0.00 ? 105 LYS A CA   1  
ATOM 1599  C C    . LYS A 1 105 ? 4.889   13.452  0.897   1.00 0.00 ? 105 LYS A C    1  
ATOM 1600  O O    . LYS A 1 105 ? 3.713   13.627  1.212   1.00 0.00 ? 105 LYS A O    1  
ATOM 1601  C CB   . LYS A 1 105 ? 7.110   14.295  1.683   1.00 0.00 ? 105 LYS A CB   1  
ATOM 1602  C CG   . LYS A 1 105 ? 6.845   15.697  2.203   1.00 0.00 ? 105 LYS A CG   1  
ATOM 1603  C CD   . LYS A 1 105 ? 6.109   16.543  1.177   1.00 0.00 ? 105 LYS A CD   1  
ATOM 1604  C CE   . LYS A 1 105 ? 6.133   18.017  1.550   1.00 0.00 ? 105 LYS A CE   1  
ATOM 1605  N NZ   . LYS A 1 105 ? 5.660   18.244  2.944   1.00 0.00 ? 105 LYS A NZ   1  
ATOM 1606  H H    . LYS A 1 105 ? 6.877   11.556  1.202   1.00 0.00 ? 105 LYS A H    1  
ATOM 1607  H HA   . LYS A 1 105 ? 5.540   13.538  2.927   1.00 0.00 ? 105 LYS A HA   1  
ATOM 1608  H HB2  . LYS A 1 105 ? 8.011   13.925  2.148   1.00 0.00 ? 105 LYS A HB2  1  
ATOM 1609  H HB3  . LYS A 1 105 ? 7.263   14.353  0.615   1.00 0.00 ? 105 LYS A HB3  1  
ATOM 1610  H HG2  . LYS A 1 105 ? 6.243   15.632  3.098   1.00 0.00 ? 105 LYS A HG2  1  
ATOM 1611  H HG3  . LYS A 1 105 ? 7.789   16.169  2.435   1.00 0.00 ? 105 LYS A HG3  1  
ATOM 1612  H HD2  . LYS A 1 105 ? 6.583   16.419  0.215   1.00 0.00 ? 105 LYS A HD2  1  
ATOM 1613  H HD3  . LYS A 1 105 ? 5.082   16.211  1.120   1.00 0.00 ? 105 LYS A HD3  1  
ATOM 1614  H HE2  . LYS A 1 105 ? 7.145   18.382  1.459   1.00 0.00 ? 105 LYS A HE2  1  
ATOM 1615  H HE3  . LYS A 1 105 ? 5.493   18.558  0.869   1.00 0.00 ? 105 LYS A HE3  1  
ATOM 1616  H HZ1  . LYS A 1 105 ? 4.985   17.502  3.218   1.00 0.00 ? 105 LYS A HZ1  1  
ATOM 1617  H HZ2  . LYS A 1 105 ? 5.189   19.169  3.014   1.00 0.00 ? 105 LYS A HZ2  1  
ATOM 1618  H HZ3  . LYS A 1 105 ? 6.464   18.227  3.602   1.00 0.00 ? 105 LYS A HZ3  1  
ATOM 1619  N N    . ASN A 1 106 ? 5.296   13.372  -0.366  1.00 0.00 ? 106 ASN A N    1  
ATOM 1620  C CA   . ASN A 1 106 ? 4.361   13.489  -1.479  1.00 0.00 ? 106 ASN A CA   1  
ATOM 1621  C C    . ASN A 1 106 ? 4.397   12.239  -2.353  1.00 0.00 ? 106 ASN A C    1  
ATOM 1622  O O    . ASN A 1 106 ? 4.645   12.318  -3.557  1.00 0.00 ? 106 ASN A O    1  
ATOM 1623  C CB   . ASN A 1 106 ? 4.690   14.724  -2.320  1.00 0.00 ? 106 ASN A CB   1  
ATOM 1624  C CG   . ASN A 1 106 ? 6.047   14.623  -2.989  1.00 0.00 ? 106 ASN A CG   1  
ATOM 1625  O OD1  . ASN A 1 106 ? 7.059   14.378  -2.331  1.00 0.00 ? 106 ASN A OD1  1  
ATOM 1626  N ND2  . ASN A 1 106 ? 6.075   14.812  -4.303  1.00 0.00 ? 106 ASN A ND2  1  
ATOM 1627  H H    . ASN A 1 106 ? 6.248   13.231  -0.554  1.00 0.00 ? 106 ASN A H    1  
ATOM 1628  H HA   . ASN A 1 106 ? 3.369   13.598  -1.068  1.00 0.00 ? 106 ASN A HA   1  
ATOM 1629  H HB2  . ASN A 1 106 ? 3.939   14.838  -3.089  1.00 0.00 ? 106 ASN A HB2  1  
ATOM 1630  H HB3  . ASN A 1 106 ? 4.685   15.597  -1.685  1.00 0.00 ? 106 ASN A HB3  1  
ATOM 1631  H HD21 . ASN A 1 106 ? 5.230   15.004  -4.761  1.00 0.00 ? 106 ASN A HD21 1  
ATOM 1632  H HD22 . ASN A 1 106 ? 6.939   14.752  -4.761  1.00 0.00 ? 106 ASN A HD22 1  
ATOM 1633  N N    . HIS A 1 107 ? 4.148   11.087  -1.740  1.00 0.00 ? 107 HIS A N    1  
ATOM 1634  C CA   . HIS A 1 107 ? 4.151   9.820   -2.463  1.00 0.00 ? 107 HIS A CA   1  
ATOM 1635  C C    . HIS A 1 107 ? 2.835   9.075   -2.258  1.00 0.00 ? 107 HIS A C    1  
ATOM 1636  O O    . HIS A 1 107 ? 2.766   8.114   -1.492  1.00 0.00 ? 107 HIS A O    1  
ATOM 1637  C CB   . HIS A 1 107 ? 5.320   8.948   -2.003  1.00 0.00 ? 107 HIS A CB   1  
ATOM 1638  C CG   . HIS A 1 107 ? 6.575   9.167   -2.790  1.00 0.00 ? 107 HIS A CG   1  
ATOM 1639  N ND1  . HIS A 1 107 ? 6.649   8.986   -4.155  1.00 0.00 ? 107 HIS A ND1  1  
ATOM 1640  C CD2  . HIS A 1 107 ? 7.811   9.555   -2.396  1.00 0.00 ? 107 HIS A CD2  1  
ATOM 1641  C CE1  . HIS A 1 107 ? 7.876   9.252   -4.566  1.00 0.00 ? 107 HIS A CE1  1  
ATOM 1642  N NE2  . HIS A 1 107 ? 8.601   9.600   -3.518  1.00 0.00 ? 107 HIS A NE2  1  
ATOM 1643  H H    . HIS A 1 107 ? 3.957   11.089  -0.779  1.00 0.00 ? 107 HIS A H    1  
ATOM 1644  H HA   . HIS A 1 107 ? 4.267   10.037  -3.513  1.00 0.00 ? 107 HIS A HA   1  
ATOM 1645  H HB2  . HIS A 1 107 ? 5.536   9.166   -0.967  1.00 0.00 ? 107 HIS A HB2  1  
ATOM 1646  H HB3  . HIS A 1 107 ? 5.044   7.908   -2.097  1.00 0.00 ? 107 HIS A HB3  1  
ATOM 1647  H HD2  . HIS A 1 107 ? 8.120   9.786   -1.386  1.00 0.00 ? 107 HIS A HD2  1  
ATOM 1648  H HE1  . HIS A 1 107 ? 8.227   9.195   -5.586  1.00 0.00 ? 107 HIS A HE1  1  
ATOM 1649  H HE2  . HIS A 1 107 ? 9.566   9.765   -3.530  1.00 0.00 ? 107 HIS A HE2  1  
ATOM 1650  N N    . VAL A 1 108 ? 1.792   9.525   -2.949  1.00 0.00 ? 108 VAL A N    1  
ATOM 1651  C CA   . VAL A 1 108 ? 0.478   8.902   -2.844  1.00 0.00 ? 108 VAL A CA   1  
ATOM 1652  C C    . VAL A 1 108 ? 0.366   7.697   -3.771  1.00 0.00 ? 108 VAL A C    1  
ATOM 1653  O O    . VAL A 1 108 ? 1.142   7.553   -4.716  1.00 0.00 ? 108 VAL A O    1  
ATOM 1654  C CB   . VAL A 1 108 ? -0.645  9.900   -3.179  1.00 0.00 ? 108 VAL A CB   1  
ATOM 1655  C CG1  . VAL A 1 108 ? -1.997  9.346   -2.754  1.00 0.00 ? 108 VAL A CG1  1  
ATOM 1656  C CG2  . VAL A 1 108 ? -0.379  11.243  -2.517  1.00 0.00 ? 108 VAL A CG2  1  
ATOM 1657  H H    . VAL A 1 108 ? 1.909   10.295  -3.544  1.00 0.00 ? 108 VAL A H    1  
ATOM 1658  H HA   . VAL A 1 108 ? 0.346   8.572   -1.823  1.00 0.00 ? 108 VAL A HA   1  
ATOM 1659  H HB   . VAL A 1 108 ? -0.662  10.047  -4.249  1.00 0.00 ? 108 VAL A HB   1  
ATOM 1660  H HG11 . VAL A 1 108 ? -2.744  10.122  -2.831  1.00 0.00 ? 108 VAL A HG11 1  
ATOM 1661  H HG12 . VAL A 1 108 ? -2.266  8.520   -3.397  1.00 0.00 ? 108 VAL A HG12 1  
ATOM 1662  H HG13 . VAL A 1 108 ? -1.939  9.002   -1.732  1.00 0.00 ? 108 VAL A HG13 1  
ATOM 1663  H HG21 . VAL A 1 108 ? 0.579   11.217  -2.020  1.00 0.00 ? 108 VAL A HG21 1  
ATOM 1664  H HG22 . VAL A 1 108 ? -0.373  12.019  -3.268  1.00 0.00 ? 108 VAL A HG22 1  
ATOM 1665  H HG23 . VAL A 1 108 ? -1.155  11.449  -1.793  1.00 0.00 ? 108 VAL A HG23 1  
ATOM 1666  N N    . PHE A 1 109 ? -0.605  6.833   -3.495  1.00 0.00 ? 109 PHE A N    1  
ATOM 1667  C CA   . PHE A 1 109 ? -0.819  5.639   -4.304  1.00 0.00 ? 109 PHE A CA   1  
ATOM 1668  C C    . PHE A 1 109 ? -2.266  5.164   -4.201  1.00 0.00 ? 109 PHE A C    1  
ATOM 1669  O O    . PHE A 1 109 ? -2.820  5.061   -3.107  1.00 0.00 ? 109 PHE A O    1  
ATOM 1670  C CB   . PHE A 1 109 ? 0.129   4.521   -3.863  1.00 0.00 ? 109 PHE A CB   1  
ATOM 1671  C CG   . PHE A 1 109 ? 1.572   4.803   -4.170  1.00 0.00 ? 109 PHE A CG   1  
ATOM 1672  C CD1  . PHE A 1 109 ? 1.968   5.136   -5.455  1.00 0.00 ? 109 PHE A CD1  1  
ATOM 1673  C CD2  . PHE A 1 109 ? 2.532   4.735   -3.173  1.00 0.00 ? 109 PHE A CD2  1  
ATOM 1674  C CE1  . PHE A 1 109 ? 3.295   5.395   -5.741  1.00 0.00 ? 109 PHE A CE1  1  
ATOM 1675  C CE2  . PHE A 1 109 ? 3.861   4.994   -3.453  1.00 0.00 ? 109 PHE A CE2  1  
ATOM 1676  C CZ   . PHE A 1 109 ? 4.242   5.325   -4.738  1.00 0.00 ? 109 PHE A CZ   1  
ATOM 1677  H H    . PHE A 1 109 ? -1.191  7.002   -2.727  1.00 0.00 ? 109 PHE A H    1  
ATOM 1678  H HA   . PHE A 1 109 ? -0.608  5.893   -5.331  1.00 0.00 ? 109 PHE A HA   1  
ATOM 1679  H HB2  . PHE A 1 109 ? 0.038   4.382   -2.796  1.00 0.00 ? 109 PHE A HB2  1  
ATOM 1680  H HB3  . PHE A 1 109 ? -0.147  3.606   -4.366  1.00 0.00 ? 109 PHE A HB3  1  
ATOM 1681  H HD1  . PHE A 1 109 ? 1.228   5.192   -6.240  1.00 0.00 ? 109 PHE A HD1  1  
ATOM 1682  H HD2  . PHE A 1 109 ? 2.234   4.476   -2.167  1.00 0.00 ? 109 PHE A HD2  1  
ATOM 1683  H HE1  . PHE A 1 109 ? 3.591   5.654   -6.746  1.00 0.00 ? 109 PHE A HE1  1  
ATOM 1684  H HE2  . PHE A 1 109 ? 4.598   4.938   -2.666  1.00 0.00 ? 109 PHE A HE2  1  
ATOM 1685  H HZ   . PHE A 1 109 ? 5.280   5.526   -4.958  1.00 0.00 ? 109 PHE A HZ   1  
ATOM 1686  N N    . ARG A 1 110 ? -2.871  4.877   -5.349  1.00 0.00 ? 110 ARG A N    1  
ATOM 1687  C CA   . ARG A 1 110 ? -4.253  4.416   -5.389  1.00 0.00 ? 110 ARG A CA   1  
ATOM 1688  C C    . ARG A 1 110 ? -4.316  2.893   -5.468  1.00 0.00 ? 110 ARG A C    1  
ATOM 1689  O O    . ARG A 1 110 ? -3.808  2.289   -6.413  1.00 0.00 ? 110 ARG A O    1  
ATOM 1690  C CB   . ARG A 1 110 ? -4.984  5.030   -6.585  1.00 0.00 ? 110 ARG A CB   1  
ATOM 1691  C CG   . ARG A 1 110 ? -6.470  4.713   -6.619  1.00 0.00 ? 110 ARG A CG   1  
ATOM 1692  C CD   . ARG A 1 110 ? -7.260  5.819   -7.300  1.00 0.00 ? 110 ARG A CD   1  
ATOM 1693  N NE   . ARG A 1 110 ? -8.610  5.390   -7.655  1.00 0.00 ? 110 ARG A NE   1  
ATOM 1694  C CZ   . ARG A 1 110 ? -8.904  4.743   -8.777  1.00 0.00 ? 110 ARG A CZ   1  
ATOM 1695  N NH1  . ARG A 1 110 ? -7.949  4.453   -9.649  1.00 0.00 ? 110 ARG A NH1  1  
ATOM 1696  N NH2  . ARG A 1 110 ? -10.157 4.385   -9.029  1.00 0.00 ? 110 ARG A NH2  1  
ATOM 1697  H H    . ARG A 1 110 ? -2.377  4.979   -6.189  1.00 0.00 ? 110 ARG A H    1  
ATOM 1698  H HA   . ARG A 1 110 ? -4.737  4.737   -4.479  1.00 0.00 ? 110 ARG A HA   1  
ATOM 1699  H HB2  . ARG A 1 110 ? -4.868  6.103   -6.551  1.00 0.00 ? 110 ARG A HB2  1  
ATOM 1700  H HB3  . ARG A 1 110 ? -4.537  4.657   -7.494  1.00 0.00 ? 110 ARG A HB3  1  
ATOM 1701  H HG2  . ARG A 1 110 ? -6.620  3.792   -7.162  1.00 0.00 ? 110 ARG A HG2  1  
ATOM 1702  H HG3  . ARG A 1 110 ? -6.827  4.599   -5.606  1.00 0.00 ? 110 ARG A HG3  1  
ATOM 1703  H HD2  . ARG A 1 110 ? -7.326  6.663   -6.629  1.00 0.00 ? 110 ARG A HD2  1  
ATOM 1704  H HD3  . ARG A 1 110 ? -6.738  6.115   -8.198  1.00 0.00 ? 110 ARG A HD3  1  
ATOM 1705  H HE   . ARG A 1 110 ? -9.331  5.594   -7.025  1.00 0.00 ? 110 ARG A HE   1  
ATOM 1706  H HH11 . ARG A 1 110 ? -7.004  4.720   -9.461  1.00 0.00 ? 110 ARG A HH11 1  
ATOM 1707  H HH12 . ARG A 1 110 ? -8.173  3.964   -10.493 1.00 0.00 ? 110 ARG A HH12 1  
ATOM 1708  H HH21 . ARG A 1 110 ? -10.880 4.602   -8.374  1.00 0.00 ? 110 ARG A HH21 1  
ATOM 1709  H HH22 . ARG A 1 110 ? -10.377 3.898   -9.874  1.00 0.00 ? 110 ARG A HH22 1  
ATOM 1710  N N    . PHE A 1 111 ? -4.942  2.279   -4.470  1.00 0.00 ? 111 PHE A N    1  
ATOM 1711  C CA   . PHE A 1 111 ? -5.070  0.827   -4.426  1.00 0.00 ? 111 PHE A CA   1  
ATOM 1712  C C    . PHE A 1 111 ? -6.220  0.355   -5.310  1.00 0.00 ? 111 PHE A C    1  
ATOM 1713  O O    . PHE A 1 111 ? -7.390  0.539   -4.976  1.00 0.00 ? 111 PHE A O    1  
ATOM 1714  C CB   . PHE A 1 111 ? -5.293  0.358   -2.987  1.00 0.00 ? 111 PHE A CB   1  
ATOM 1715  C CG   . PHE A 1 111 ? -5.381  -1.136  -2.850  1.00 0.00 ? 111 PHE A CG   1  
ATOM 1716  C CD1  . PHE A 1 111 ? -4.264  -1.930  -3.050  1.00 0.00 ? 111 PHE A CD1  1  
ATOM 1717  C CD2  . PHE A 1 111 ? -6.582  -1.745  -2.523  1.00 0.00 ? 111 PHE A CD2  1  
ATOM 1718  C CE1  . PHE A 1 111 ? -4.342  -3.305  -2.925  1.00 0.00 ? 111 PHE A CE1  1  
ATOM 1719  C CE2  . PHE A 1 111 ? -6.666  -3.118  -2.396  1.00 0.00 ? 111 PHE A CE2  1  
ATOM 1720  C CZ   . PHE A 1 111 ? -5.545  -3.899  -2.599  1.00 0.00 ? 111 PHE A CZ   1  
ATOM 1721  H H    . PHE A 1 111 ? -5.327  2.816   -3.745  1.00 0.00 ? 111 PHE A H    1  
ATOM 1722  H HA   . PHE A 1 111 ? -4.150  0.403   -4.795  1.00 0.00 ? 111 PHE A HA   1  
ATOM 1723  H HB2  . PHE A 1 111 ? -4.472  0.698   -2.373  1.00 0.00 ? 111 PHE A HB2  1  
ATOM 1724  H HB3  . PHE A 1 111 ? -6.214  0.781   -2.616  1.00 0.00 ? 111 PHE A HB3  1  
ATOM 1725  H HD1  . PHE A 1 111 ? -3.322  -1.466  -3.306  1.00 0.00 ? 111 PHE A HD1  1  
ATOM 1726  H HD2  . PHE A 1 111 ? -7.460  -1.135  -2.365  1.00 0.00 ? 111 PHE A HD2  1  
ATOM 1727  H HE1  . PHE A 1 111 ? -3.463  -3.912  -3.085  1.00 0.00 ? 111 PHE A HE1  1  
ATOM 1728  H HE2  . PHE A 1 111 ? -7.608  -3.581  -2.141  1.00 0.00 ? 111 PHE A HE2  1  
ATOM 1729  H HZ   . PHE A 1 111 ? -5.608  -4.973  -2.500  1.00 0.00 ? 111 PHE A HZ   1  
ATOM 1730  N N    . ASN A 1 112 ? -5.878  -0.253  -6.441  1.00 0.00 ? 112 ASN A N    1  
ATOM 1731  C CA   . ASN A 1 112 ? -6.881  -0.751  -7.376  1.00 0.00 ? 112 ASN A CA   1  
ATOM 1732  C C    . ASN A 1 112 ? -7.171  -2.228  -7.126  1.00 0.00 ? 112 ASN A C    1  
ATOM 1733  O O    . ASN A 1 112 ? -6.300  -3.081  -7.299  1.00 0.00 ? 112 ASN A O    1  
ATOM 1734  C CB   . ASN A 1 112 ? -6.410  -0.548  -8.817  1.00 0.00 ? 112 ASN A CB   1  
ATOM 1735  C CG   . ASN A 1 112 ? -6.727  0.840   -9.339  1.00 0.00 ? 112 ASN A CG   1  
ATOM 1736  O OD1  . ASN A 1 112 ? -7.241  1.687   -8.609  1.00 0.00 ? 112 ASN A OD1  1  
ATOM 1737  N ND2  . ASN A 1 112 ? -6.420  1.079   -10.609 1.00 0.00 ? 112 ASN A ND2  1  
ATOM 1738  H H    . ASN A 1 112 ? -4.928  -0.370  -6.653  1.00 0.00 ? 112 ASN A H    1  
ATOM 1739  H HA   . ASN A 1 112 ? -7.788  -0.186  -7.220  1.00 0.00 ? 112 ASN A HA   1  
ATOM 1740  H HB2  . ASN A 1 112 ? -5.341  -0.694  -8.864  1.00 0.00 ? 112 ASN A HB2  1  
ATOM 1741  H HB3  . ASN A 1 112 ? -6.896  -1.272  -9.454  1.00 0.00 ? 112 ASN A HB3  1  
ATOM 1742  H HD21 . ASN A 1 112 ? -6.012  0.356   -11.131 1.00 0.00 ? 112 ASN A HD21 1  
ATOM 1743  H HD22 . ASN A 1 112 ? -6.613  1.968   -10.972 1.00 0.00 ? 112 ASN A HD22 1  
ATOM 1744  N N    . HIS A 1 113 ? -8.402  -2.523  -6.720  1.00 0.00 ? 113 HIS A N    1  
ATOM 1745  C CA   . HIS A 1 113 ? -8.809  -3.897  -6.448  1.00 0.00 ? 113 HIS A CA   1  
ATOM 1746  C C    . HIS A 1 113 ? -9.951  -4.318  -7.368  1.00 0.00 ? 113 HIS A C    1  
ATOM 1747  O O    . HIS A 1 113 ? -11.087 -4.515  -6.936  1.00 0.00 ? 113 HIS A O    1  
ATOM 1748  C CB   . HIS A 1 113 ? -9.233  -4.046  -4.987  1.00 0.00 ? 113 HIS A CB   1  
ATOM 1749  C CG   . HIS A 1 113 ? -9.123  -5.448  -4.471  1.00 0.00 ? 113 HIS A CG   1  
ATOM 1750  N ND1  . HIS A 1 113 ? -9.348  -6.558  -5.256  1.00 0.00 ? 113 HIS A ND1  1  
ATOM 1751  C CD2  . HIS A 1 113 ? -8.809  -5.916  -3.241  1.00 0.00 ? 113 HIS A CD2  1  
ATOM 1752  C CE1  . HIS A 1 113 ? -9.178  -7.649  -4.531  1.00 0.00 ? 113 HIS A CE1  1  
ATOM 1753  N NE2  . HIS A 1 113 ? -8.850  -7.287  -3.304  1.00 0.00 ? 113 HIS A NE2  1  
ATOM 1754  H H    . HIS A 1 113 ? -9.052  -1.800  -6.601  1.00 0.00 ? 113 HIS A H    1  
ATOM 1755  H HA   . HIS A 1 113 ? -7.959  -4.537  -6.634  1.00 0.00 ? 113 HIS A HA   1  
ATOM 1756  H HB2  . HIS A 1 113 ? -8.608  -3.416  -4.371  1.00 0.00 ? 113 HIS A HB2  1  
ATOM 1757  H HB3  . HIS A 1 113 ? -10.263 -3.733  -4.884  1.00 0.00 ? 113 HIS A HB3  1  
ATOM 1758  H HD2  . HIS A 1 113 ? -8.570  -5.322  -2.369  1.00 0.00 ? 113 HIS A HD2  1  
ATOM 1759  H HE1  . HIS A 1 113 ? -9.287  -8.665  -4.881  1.00 0.00 ? 113 HIS A HE1  1  
ATOM 1760  H HE2  . HIS A 1 113 ? -8.750  -7.896  -2.543  1.00 0.00 ? 113 HIS A HE2  1  
ATOM 1761  N N    . PRO A 1 114 ? -9.645  -4.459  -8.666  1.00 0.00 ? 114 PRO A N    1  
ATOM 1762  C CA   . PRO A 1 114 ? -10.632 -4.857  -9.673  1.00 0.00 ? 114 PRO A CA   1  
ATOM 1763  C C    . PRO A 1 114 ? -11.066 -6.311  -9.517  1.00 0.00 ? 114 PRO A C    1  
ATOM 1764  O O    . PRO A 1 114 ? -12.224 -6.651  -9.756  1.00 0.00 ? 114 PRO A O    1  
ATOM 1765  C CB   . PRO A 1 114 ? -9.889  -4.661  -10.997 1.00 0.00 ? 114 PRO A CB   1  
ATOM 1766  C CG   . PRO A 1 114 ? -8.447  -4.790  -10.644 1.00 0.00 ? 114 PRO A CG   1  
ATOM 1767  C CD   . PRO A 1 114 ? -8.311  -4.241  -9.250  1.00 0.00 ? 114 PRO A CD   1  
ATOM 1768  H HA   . PRO A 1 114 ? -11.503 -4.219  -9.650  1.00 0.00 ? 114 PRO A HA   1  
ATOM 1769  H HB2  . PRO A 1 114 ? -10.194 -5.422  -11.701 1.00 0.00 ? 114 PRO A HB2  1  
ATOM 1770  H HB3  . PRO A 1 114 ? -10.111 -3.683  -11.397 1.00 0.00 ? 114 PRO A HB3  1  
ATOM 1771  H HG2  . PRO A 1 114 ? -8.155  -5.829  -10.667 1.00 0.00 ? 114 PRO A HG2  1  
ATOM 1772  H HG3  . PRO A 1 114 ? -7.848  -4.214  -11.333 1.00 0.00 ? 114 PRO A HG3  1  
ATOM 1773  H HD2  . PRO A 1 114 ? -7.556  -4.785  -8.702  1.00 0.00 ? 114 PRO A HD2  1  
ATOM 1774  H HD3  . PRO A 1 114 ? -8.072  -3.188  -9.282  1.00 0.00 ? 114 PRO A HD3  1  
ATOM 1775  N N    . GLU A 1 115 ? -10.129 -7.163  -9.114  1.00 0.00 ? 115 GLU A N    1  
ATOM 1776  C CA   . GLU A 1 115 ? -10.416 -8.581  -8.927  1.00 0.00 ? 115 GLU A CA   1  
ATOM 1777  C C    . GLU A 1 115 ? -11.643 -8.775  -8.041  1.00 0.00 ? 115 GLU A C    1  
ATOM 1778  O O    . GLU A 1 115 ? -12.521 -9.580  -8.349  1.00 0.00 ? 115 GLU A O    1  
ATOM 1779  C CB   . GLU A 1 115 ? -9.210  -9.290  -8.308  1.00 0.00 ? 115 GLU A CB   1  
ATOM 1780  C CG   . GLU A 1 115 ? -9.071  -10.741 -8.737  1.00 0.00 ? 115 GLU A CG   1  
ATOM 1781  C CD   . GLU A 1 115 ? -8.387  -11.597 -7.688  1.00 0.00 ? 115 GLU A CD   1  
ATOM 1782  O OE1  . GLU A 1 115 ? -7.321  -11.182 -7.187  1.00 0.00 ? 115 GLU A OE1  1  
ATOM 1783  O OE2  . GLU A 1 115 ? -8.918  -12.682 -7.369  1.00 0.00 ? 115 GLU A OE2  1  
ATOM 1784  H H    . GLU A 1 115 ? -9.223  -6.831  -8.940  1.00 0.00 ? 115 GLU A H    1  
ATOM 1785  H HA   . GLU A 1 115 ? -10.615 -9.010  -9.897  1.00 0.00 ? 115 GLU A HA   1  
ATOM 1786  H HB2  . GLU A 1 115 ? -8.311  -8.764  -8.594  1.00 0.00 ? 115 GLU A HB2  1  
ATOM 1787  H HB3  . GLU A 1 115 ? -9.305  -9.263  -7.232  1.00 0.00 ? 115 GLU A HB3  1  
ATOM 1788  H HG2  . GLU A 1 115 ? -10.055 -11.144 -8.922  1.00 0.00 ? 115 GLU A HG2  1  
ATOM 1789  H HG3  . GLU A 1 115 ? -8.490  -10.780 -9.647  1.00 0.00 ? 115 GLU A HG3  1  
ATOM 1790  N N    . GLN A 1 116 ? -11.696 -8.030  -6.941  1.00 0.00 ? 116 GLN A N    1  
ATOM 1791  C CA   . GLN A 1 116 ? -12.815 -8.121  -6.011  1.00 0.00 ? 116 GLN A CA   1  
ATOM 1792  C C    . GLN A 1 116 ? -13.932 -7.163  -6.408  1.00 0.00 ? 116 GLN A C    1  
ATOM 1793  O O    . GLN A 1 116 ? -15.109 -7.523  -6.388  1.00 0.00 ? 116 GLN A O    1  
ATOM 1794  C CB   . GLN A 1 116 ? -12.347 -7.816  -4.586  1.00 0.00 ? 116 GLN A CB   1  
ATOM 1795  C CG   . GLN A 1 116 ? -13.346 -8.227  -3.517  1.00 0.00 ? 116 GLN A CG   1  
ATOM 1796  C CD   . GLN A 1 116 ? -13.144 -9.655  -3.047  1.00 0.00 ? 116 GLN A CD   1  
ATOM 1797  O OE1  . GLN A 1 116 ? -13.552 -10.021 -1.945  1.00 0.00 ? 116 GLN A OE1  1  
ATOM 1798  N NE2  . GLN A 1 116 ? -12.511 -10.469 -3.883  1.00 0.00 ? 116 GLN A NE2  1  
ATOM 1799  H H    . GLN A 1 116 ? -10.965 -7.406  -6.751  1.00 0.00 ? 116 GLN A H    1  
ATOM 1800  H HA   . GLN A 1 116 ? -13.194 -9.131  -6.046  1.00 0.00 ? 116 GLN A HA   1  
ATOM 1801  H HB2  . GLN A 1 116 ? -11.421 -8.340  -4.404  1.00 0.00 ? 116 GLN A HB2  1  
ATOM 1802  H HB3  . GLN A 1 116 ? -12.174 -6.754  -4.497  1.00 0.00 ? 116 GLN A HB3  1  
ATOM 1803  H HG2  . GLN A 1 116 ? -13.238 -7.568  -2.669  1.00 0.00 ? 116 GLN A HG2  1  
ATOM 1804  H HG3  . GLN A 1 116 ? -14.344 -8.134  -3.920  1.00 0.00 ? 116 GLN A HG3  1  
ATOM 1805  H HE21 . GLN A 1 116 ? -12.212 -10.107 -4.745  1.00 0.00 ? 116 GLN A HE21 1  
ATOM 1806  H HE22 . GLN A 1 116 ? -12.366 -11.397 -3.605  1.00 0.00 ? 116 GLN A HE22 1  
ATOM 1807  N N    . ALA A 1 117 ? -13.557 -5.940  -6.768  1.00 0.00 ? 117 ALA A N    1  
ATOM 1808  C CA   . ALA A 1 117 ? -14.527 -4.930  -7.171  1.00 0.00 ? 117 ALA A CA   1  
ATOM 1809  C C    . ALA A 1 117 ? -15.448 -5.460  -8.266  1.00 0.00 ? 117 ALA A C    1  
ATOM 1810  O O    . ALA A 1 117 ? -16.504 -4.886  -8.532  1.00 0.00 ? 117 ALA A O    1  
ATOM 1811  C CB   . ALA A 1 117 ? -13.814 -3.671  -7.642  1.00 0.00 ? 117 ALA A CB   1  
ATOM 1812  H H    . ALA A 1 117 ? -12.604 -5.712  -6.763  1.00 0.00 ? 117 ALA A H    1  
ATOM 1813  H HA   . ALA A 1 117 ? -15.122 -4.675  -6.306  1.00 0.00 ? 117 ALA A HA   1  
ATOM 1814  H HB1  . ALA A 1 117 ? -14.544 -2.944  -7.966  1.00 0.00 ? 117 ALA A HB1  1  
ATOM 1815  H HB2  . ALA A 1 117 ? -13.234 -3.261  -6.828  1.00 0.00 ? 117 ALA A HB2  1  
ATOM 1816  H HB3  . ALA A 1 117 ? -13.159 -3.915  -8.465  1.00 0.00 ? 117 ALA A HB3  1  
ATOM 1817  N N    . ARG A 1 118 ? -15.040 -6.556  -8.896  1.00 0.00 ? 118 ARG A N    1  
ATOM 1818  C CA   . ARG A 1 118 ? -15.828 -7.161  -9.963  1.00 0.00 ? 118 ARG A CA   1  
ATOM 1819  C C    . ARG A 1 118 ? -16.972 -7.993  -9.390  1.00 0.00 ? 118 ARG A C    1  
ATOM 1820  O O    . ARG A 1 118 ? -18.038 -8.099  -9.994  1.00 0.00 ? 118 ARG A O    1  
ATOM 1821  C CB   . ARG A 1 118 ? -14.939 -8.038  -10.848 1.00 0.00 ? 118 ARG A CB   1  
ATOM 1822  C CG   . ARG A 1 118 ? -14.873 -9.488  -10.397 1.00 0.00 ? 118 ARG A CG   1  
ATOM 1823  C CD   . ARG A 1 118 ? -13.609 -10.170 -10.898 1.00 0.00 ? 118 ARG A CD   1  
ATOM 1824  N NE   . ARG A 1 118 ? -13.763 -10.677 -12.259 1.00 0.00 ? 118 ARG A NE   1  
ATOM 1825  C CZ   . ARG A 1 118 ? -14.496 -11.741 -12.568 1.00 0.00 ? 118 ARG A CZ   1  
ATOM 1826  N NH1  . ARG A 1 118 ? -15.139 -12.406 -11.619 1.00 0.00 ? 118 ARG A NH1  1  
ATOM 1827  N NH2  . ARG A 1 118 ? -14.588 -12.141 -13.830 1.00 0.00 ? 118 ARG A NH2  1  
ATOM 1828  H H    . ARG A 1 118 ? -14.188 -6.968  -8.638  1.00 0.00 ? 118 ARG A H    1  
ATOM 1829  H HA   . ARG A 1 118 ? -16.243 -6.365  -10.562 1.00 0.00 ? 118 ARG A HA   1  
ATOM 1830  H HB2  . ARG A 1 118 ? -15.322 -8.015  -11.857 1.00 0.00 ? 118 ARG A HB2  1  
ATOM 1831  H HB3  . ARG A 1 118 ? -13.938 -7.636  -10.841 1.00 0.00 ? 118 ARG A HB3  1  
ATOM 1832  H HG2  . ARG A 1 118 ? -14.883 -9.521  -9.318  1.00 0.00 ? 118 ARG A HG2  1  
ATOM 1833  H HG3  . ARG A 1 118 ? -15.733 -10.015 -10.783 1.00 0.00 ? 118 ARG A HG3  1  
ATOM 1834  H HD2  . ARG A 1 118 ? -12.800 -9.456  -10.879 1.00 0.00 ? 118 ARG A HD2  1  
ATOM 1835  H HD3  . ARG A 1 118 ? -13.377 -10.995 -10.241 1.00 0.00 ? 118 ARG A HD3  1  
ATOM 1836  H HE   . ARG A 1 118 ? -13.297 -10.200 -12.976 1.00 0.00 ? 118 ARG A HE   1  
ATOM 1837  H HH11 . ARG A 1 118 ? -15.073 -12.106 -10.667 1.00 0.00 ? 118 ARG A HH11 1  
ATOM 1838  H HH12 . ARG A 1 118 ? -15.691 -13.206 -11.855 1.00 0.00 ? 118 ARG A HH12 1  
ATOM 1839  H HH21 . ARG A 1 118 ? -14.105 -11.641 -14.549 1.00 0.00 ? 118 ARG A HH21 1  
ATOM 1840  H HH22 . ARG A 1 118 ? -15.139 -12.941 -14.062 1.00 0.00 ? 118 ARG A HH22 1  
ATOM 1841  N N    . ALA A 1 119 ? -16.740 -8.581  -8.221  1.00 0.00 ? 119 ALA A N    1  
ATOM 1842  C CA   . ALA A 1 119 ? -17.751 -9.402  -7.565  1.00 0.00 ? 119 ALA A CA   1  
ATOM 1843  C C    . ALA A 1 119 ? -18.640 -8.557  -6.658  1.00 0.00 ? 119 ALA A C    1  
ATOM 1844  O O    . ALA A 1 119 ? -19.680 -9.019  -6.191  1.00 0.00 ? 119 ALA A O    1  
ATOM 1845  C CB   . ALA A 1 119 ? -17.090 -10.518 -6.769  1.00 0.00 ? 119 ALA A CB   1  
ATOM 1846  H H    . ALA A 1 119 ? -15.870 -8.459  -7.788  1.00 0.00 ? 119 ALA A H    1  
ATOM 1847  H HA   . ALA A 1 119 ? -18.363 -9.854  -8.332  1.00 0.00 ? 119 ALA A HA   1  
ATOM 1848  H HB1  . ALA A 1 119 ? -16.866 -10.165 -5.774  1.00 0.00 ? 119 ALA A HB1  1  
ATOM 1849  H HB2  . ALA A 1 119 ? -17.762 -11.362 -6.710  1.00 0.00 ? 119 ALA A HB2  1  
ATOM 1850  H HB3  . ALA A 1 119 ? -16.177 -10.817 -7.260  1.00 0.00 ? 119 ALA A HB3  1  
ATOM 1851  N N    . GLU A 1 120 ? -18.222 -7.319  -6.413  1.00 0.00 ? 120 GLU A N    1  
ATOM 1852  C CA   . GLU A 1 120 ? -18.981 -6.412  -5.561  1.00 0.00 ? 120 GLU A CA   1  
ATOM 1853  C C    . GLU A 1 120 ? -20.480 -6.563  -5.803  1.00 0.00 ? 120 GLU A C    1  
ATOM 1854  O O    . GLU A 1 120 ? -21.282 -6.474  -4.873  1.00 0.00 ? 120 GLU A O    1  
ATOM 1855  C CB   . GLU A 1 120 ? -18.556 -4.964  -5.813  1.00 0.00 ? 120 GLU A CB   1  
ATOM 1856  C CG   . GLU A 1 120 ? -19.166 -4.360  -7.066  1.00 0.00 ? 120 GLU A CG   1  
ATOM 1857  C CD   . GLU A 1 120 ? -18.686 -2.945  -7.326  1.00 0.00 ? 120 GLU A CD   1  
ATOM 1858  O OE1  . GLU A 1 120 ? -18.025 -2.370  -6.436  1.00 0.00 ? 120 GLU A OE1  1  
ATOM 1859  O OE2  . GLU A 1 120 ? -18.972 -2.414  -8.419  1.00 0.00 ? 120 GLU A OE2  1  
ATOM 1860  H H    . GLU A 1 120 ? -17.384 -7.009  -6.815  1.00 0.00 ? 120 GLU A H    1  
ATOM 1861  H HA   . GLU A 1 120 ? -18.767 -6.666  -4.533  1.00 0.00 ? 120 GLU A HA   1  
ATOM 1862  H HB2  . GLU A 1 120 ? -18.851 -4.362  -4.966  1.00 0.00 ? 120 GLU A HB2  1  
ATOM 1863  H HB3  . GLU A 1 120 ? -17.480 -4.929  -5.909  1.00 0.00 ? 120 GLU A HB3  1  
ATOM 1864  H HG2  . GLU A 1 120 ? -18.900 -4.975  -7.913  1.00 0.00 ? 120 GLU A HG2  1  
ATOM 1865  H HG3  . GLU A 1 120 ? -20.241 -4.346  -6.957  1.00 0.00 ? 120 GLU A HG3  1  
ATOM 1866  N N    . ARG A 1 121 ? -20.850 -6.792  -7.059  1.00 0.00 ? 121 ARG A N    1  
ATOM 1867  C CA   . ARG A 1 121 ? -22.252 -6.954  -7.425  1.00 0.00 ? 121 ARG A CA   1  
ATOM 1868  C C    . ARG A 1 121 ? -22.805 -8.271  -6.888  1.00 0.00 ? 121 ARG A C    1  
ATOM 1869  O O    . ARG A 1 121 ? -23.798 -8.287  -6.161  1.00 0.00 ? 121 ARG A O    1  
ATOM 1870  C CB   . ARG A 1 121 ? -22.413 -6.903  -8.945  1.00 0.00 ? 121 ARG A CB   1  
ATOM 1871  C CG   . ARG A 1 121 ? -22.182 -5.521  -9.536  1.00 0.00 ? 121 ARG A CG   1  
ATOM 1872  C CD   . ARG A 1 121 ? -23.078 -4.480  -8.884  1.00 0.00 ? 121 ARG A CD   1  
ATOM 1873  N NE   . ARG A 1 121 ? -24.481 -4.885  -8.889  1.00 0.00 ? 121 ARG A NE   1  
ATOM 1874  C CZ   . ARG A 1 121 ? -25.272 -4.782  -9.952  1.00 0.00 ? 121 ARG A CZ   1  
ATOM 1875  N NH1  . ARG A 1 121 ? -24.799 -4.291  -11.089 1.00 0.00 ? 121 ARG A NH1  1  
ATOM 1876  N NH2  . ARG A 1 121 ? -26.538 -5.172  -9.878  1.00 0.00 ? 121 ARG A NH2  1  
ATOM 1877  H H    . ARG A 1 121 ? -20.164 -6.853  -7.756  1.00 0.00 ? 121 ARG A H    1  
ATOM 1878  H HA   . ARG A 1 121 ? -22.806 -6.139  -6.985  1.00 0.00 ? 121 ARG A HA   1  
ATOM 1879  H HB2  . ARG A 1 121 ? -21.706 -7.585  -9.394  1.00 0.00 ? 121 ARG A HB2  1  
ATOM 1880  H HB3  . ARG A 1 121 ? -23.415 -7.216  -9.199  1.00 0.00 ? 121 ARG A HB3  1  
ATOM 1881  H HG2  . ARG A 1 121 ? -21.150 -5.241  -9.379  1.00 0.00 ? 121 ARG A HG2  1  
ATOM 1882  H HG3  . ARG A 1 121 ? -22.392 -5.553  -10.594 1.00 0.00 ? 121 ARG A HG3  1  
ATOM 1883  H HD2  . ARG A 1 121 ? -22.758 -4.337  -7.863  1.00 0.00 ? 121 ARG A HD2  1  
ATOM 1884  H HD3  . ARG A 1 121 ? -22.979 -3.550  -9.425  1.00 0.00 ? 121 ARG A HD3  1  
ATOM 1885  H HE   . ARG A 1 121 ? -24.851 -5.250  -8.059  1.00 0.00 ? 121 ARG A HE   1  
ATOM 1886  H HH11 . ARG A 1 121 ? -23.845 -3.998  -11.148 1.00 0.00 ? 121 ARG A HH11 1  
ATOM 1887  H HH12 . ARG A 1 121 ? -25.396 -4.217  -11.888 1.00 0.00 ? 121 ARG A HH12 1  
ATOM 1888  H HH21 . ARG A 1 121 ? -26.898 -5.543  -9.022  1.00 0.00 ? 121 ARG A HH21 1  
ATOM 1889  H HH22 . ARG A 1 121 ? -27.132 -5.095  -10.678 1.00 0.00 ? 121 ARG A HH22 1  
ATOM 1890  N N    . GLU A 1 122 ? -22.156 -9.372  -7.253  1.00 0.00 ? 122 GLU A N    1  
ATOM 1891  C CA   . GLU A 1 122 ? -22.585 -10.694 -6.809  1.00 0.00 ? 122 GLU A CA   1  
ATOM 1892  C C    . GLU A 1 122 ? -22.978 -10.671 -5.335  1.00 0.00 ? 122 GLU A C    1  
ATOM 1893  O O    . GLU A 1 122 ? -23.998 -11.239 -4.943  1.00 0.00 ? 122 GLU A O    1  
ATOM 1894  C CB   . GLU A 1 122 ? -21.471 -11.718 -7.036  1.00 0.00 ? 122 GLU A CB   1  
ATOM 1895  C CG   . GLU A 1 122 ? -21.132 -11.935 -8.501  1.00 0.00 ? 122 GLU A CG   1  
ATOM 1896  C CD   . GLU A 1 122 ? -19.895 -12.790 -8.693  1.00 0.00 ? 122 GLU A CD   1  
ATOM 1897  O OE1  . GLU A 1 122 ? -19.680 -13.713 -7.879  1.00 0.00 ? 122 GLU A OE1  1  
ATOM 1898  O OE2  . GLU A 1 122 ? -19.142 -12.537 -9.657  1.00 0.00 ? 122 GLU A OE2  1  
ATOM 1899  H H    . GLU A 1 122 ? -21.371 -9.295  -7.835  1.00 0.00 ? 122 GLU A H    1  
ATOM 1900  H HA   . GLU A 1 122 ? -23.446 -10.977 -7.394  1.00 0.00 ? 122 GLU A HA   1  
ATOM 1901  H HB2  . GLU A 1 122 ? -20.580 -11.382 -6.526  1.00 0.00 ? 122 GLU A HB2  1  
ATOM 1902  H HB3  . GLU A 1 122 ? -21.780 -12.665 -6.616  1.00 0.00 ? 122 GLU A HB3  1  
ATOM 1903  H HG2  . GLU A 1 122 ? -21.967 -12.423 -8.982  1.00 0.00 ? 122 GLU A HG2  1  
ATOM 1904  H HG3  . GLU A 1 122 ? -20.963 -10.974 -8.964  1.00 0.00 ? 122 GLU A HG3  1  
ATOM 1905  N N    . LYS A 1 123 ? -22.161 -10.011 -4.521  1.00 0.00 ? 123 LYS A N    1  
ATOM 1906  C CA   . LYS A 1 123 ? -22.421 -9.913  -3.090  1.00 0.00 ? 123 LYS A CA   1  
ATOM 1907  C C    . LYS A 1 123 ? -23.904 -9.677  -2.821  1.00 0.00 ? 123 LYS A C    1  
ATOM 1908  O O    . LYS A 1 123 ? -24.653 -9.282  -3.716  1.00 0.00 ? 123 LYS A O    1  
ATOM 1909  C CB   . LYS A 1 123 ? -21.595 -8.780  -2.477  1.00 0.00 ? 123 LYS A CB   1  
ATOM 1910  C CG   . LYS A 1 123 ? -21.359 -8.938  -0.985  1.00 0.00 ? 123 LYS A CG   1  
ATOM 1911  C CD   . LYS A 1 123 ? -20.393 -7.888  -0.459  1.00 0.00 ? 123 LYS A CD   1  
ATOM 1912  C CE   . LYS A 1 123 ? -20.416 -7.822  1.060   1.00 0.00 ? 123 LYS A CE   1  
ATOM 1913  N NZ   . LYS A 1 123 ? -21.674 -7.209  1.570   1.00 0.00 ? 123 LYS A NZ   1  
ATOM 1914  H H    . LYS A 1 123 ? -21.363 -9.579  -4.892  1.00 0.00 ? 123 LYS A H    1  
ATOM 1915  H HA   . LYS A 1 123 ? -22.129 -10.847 -2.634  1.00 0.00 ? 123 LYS A HA   1  
ATOM 1916  H HB2  . LYS A 1 123 ? -20.635 -8.743  -2.970  1.00 0.00 ? 123 LYS A HB2  1  
ATOM 1917  H HB3  . LYS A 1 123 ? -22.111 -7.845  -2.641  1.00 0.00 ? 123 LYS A HB3  1  
ATOM 1918  H HG2  . LYS A 1 123 ? -22.301 -8.836  -0.467  1.00 0.00 ? 123 LYS A HG2  1  
ATOM 1919  H HG3  . LYS A 1 123 ? -20.947 -9.919  -0.796  1.00 0.00 ? 123 LYS A HG3  1  
ATOM 1920  H HD2  . LYS A 1 123 ? -19.393 -8.137  -0.782  1.00 0.00 ? 123 LYS A HD2  1  
ATOM 1921  H HD3  . LYS A 1 123 ? -20.672 -6.923  -0.858  1.00 0.00 ? 123 LYS A HD3  1  
ATOM 1922  H HE2  . LYS A 1 123 ? -20.329 -8.823  1.453   1.00 0.00 ? 123 LYS A HE2  1  
ATOM 1923  H HE3  . LYS A 1 123 ? -19.577 -7.230  1.394   1.00 0.00 ? 123 LYS A HE3  1  
ATOM 1924  H HZ1  . LYS A 1 123 ? -22.194 -6.759  0.790   1.00 0.00 ? 123 LYS A HZ1  1  
ATOM 1925  H HZ2  . LYS A 1 123 ? -21.455 -6.489  2.288   1.00 0.00 ? 123 LYS A HZ2  1  
ATOM 1926  H HZ3  . LYS A 1 123 ? -22.278 -7.938  2.000   1.00 0.00 ? 123 LYS A HZ3  1  
ATOM 1927  N N    . THR A 1 124 ? -24.323 -9.920  -1.583  1.00 0.00 ? 124 THR A N    1  
ATOM 1928  C CA   . THR A 1 124 ? -25.716 -9.734  -1.197  1.00 0.00 ? 124 THR A CA   1  
ATOM 1929  C C    . THR A 1 124 ? -26.276 -8.436  -1.769  1.00 0.00 ? 124 THR A C    1  
ATOM 1930  O O    . THR A 1 124 ? -25.596 -7.411  -1.788  1.00 0.00 ? 124 THR A O    1  
ATOM 1931  C CB   . THR A 1 124 ? -25.877 -9.719  0.335   1.00 0.00 ? 124 THR A CB   1  
ATOM 1932  O OG1  . THR A 1 124 ? -24.689 -9.206  0.947   1.00 0.00 ? 124 THR A OG1  1  
ATOM 1933  C CG2  . THR A 1 124 ? -26.164 -11.117 0.862   1.00 0.00 ? 124 THR A CG2  1  
ATOM 1934  H H    . THR A 1 124 ? -23.679 -10.233 -0.914  1.00 0.00 ? 124 THR A H    1  
ATOM 1935  H HA   . THR A 1 124 ? -26.285 -10.564 -1.590  1.00 0.00 ? 124 THR A HA   1  
ATOM 1936  H HB   . THR A 1 124 ? -26.710 -9.077  0.587   1.00 0.00 ? 124 THR A HB   1  
ATOM 1937  H HG1  . THR A 1 124 ? -24.913 -8.796  1.786   1.00 0.00 ? 124 THR A HG1  1  
ATOM 1938  H HG21 . THR A 1 124 ? -25.759 -11.848 0.180   1.00 0.00 ? 124 THR A HG21 1  
ATOM 1939  H HG22 . THR A 1 124 ? -27.231 -11.257 0.949   1.00 0.00 ? 124 THR A HG22 1  
ATOM 1940  H HG23 . THR A 1 124 ? -25.704 -11.236 1.832   1.00 0.00 ? 124 THR A HG23 1  
ATOM 1941  N N    . SER A 1 125 ? -27.521 -8.488  -2.232  1.00 0.00 ? 125 SER A N    1  
ATOM 1942  C CA   . SER A 1 125 ? -28.172 -7.316  -2.807  1.00 0.00 ? 125 SER A CA   1  
ATOM 1943  C C    . SER A 1 125 ? -29.470 -7.000  -2.071  1.00 0.00 ? 125 SER A C    1  
ATOM 1944  O O    . SER A 1 125 ? -29.748 -5.846  -1.749  1.00 0.00 ? 125 SER A O    1  
ATOM 1945  C CB   . SER A 1 125 ? -28.457 -7.543  -4.293  1.00 0.00 ? 125 SER A CB   1  
ATOM 1946  O OG   . SER A 1 125 ? -27.283 -7.378  -5.069  1.00 0.00 ? 125 SER A OG   1  
ATOM 1947  H H    . SER A 1 125 ? -28.012 -9.335  -2.189  1.00 0.00 ? 125 SER A H    1  
ATOM 1948  H HA   . SER A 1 125 ? -27.499 -6.479  -2.702  1.00 0.00 ? 125 SER A HA   1  
ATOM 1949  H HB2  . SER A 1 125 ? -28.831 -8.546  -4.436  1.00 0.00 ? 125 SER A HB2  1  
ATOM 1950  H HB3  . SER A 1 125 ? -29.198 -6.831  -4.627  1.00 0.00 ? 125 SER A HB3  1  
ATOM 1951  H HG   . SER A 1 125 ? -27.422 -7.751  -5.943  1.00 0.00 ? 125 SER A HG   1  
ATOM 1952  N N    . GLY A 1 126 ? -30.261 -8.035  -1.807  1.00 0.00 ? 126 GLY A N    1  
ATOM 1953  C CA   . GLY A 1 126 ? -31.521 -7.848  -1.111  1.00 0.00 ? 126 GLY A CA   1  
ATOM 1954  C C    . GLY A 1 126 ? -31.426 -6.810  -0.011  1.00 0.00 ? 126 GLY A C    1  
ATOM 1955  O O    . GLY A 1 126 ? -32.077 -5.765  -0.056  1.00 0.00 ? 126 GLY A O    1  
ATOM 1956  H H    . GLY A 1 126 ? -29.988 -8.934  -2.088  1.00 0.00 ? 126 GLY A H    1  
ATOM 1957  H HA2  . GLY A 1 126 ? -32.270 -7.536  -1.823  1.00 0.00 ? 126 GLY A HA2  1  
ATOM 1958  H HA3  . GLY A 1 126 ? -31.822 -8.790  -0.676  1.00 0.00 ? 126 GLY A HA3  1  
ATOM 1959  N N    . PRO A 1 127 ? -30.600 -7.094  1.007   1.00 0.00 ? 127 PRO A N    1  
ATOM 1960  C CA   . PRO A 1 127 ? -30.405 -6.190  2.144   1.00 0.00 ? 127 PRO A CA   1  
ATOM 1961  C C    . PRO A 1 127 ? -29.647 -4.925  1.755   1.00 0.00 ? 127 PRO A C    1  
ATOM 1962  O O    . PRO A 1 127 ? -29.033 -4.861  0.690   1.00 0.00 ? 127 PRO A O    1  
ATOM 1963  C CB   . PRO A 1 127 ? -29.579 -7.026  3.125   1.00 0.00 ? 127 PRO A CB   1  
ATOM 1964  C CG   . PRO A 1 127 ? -28.867 -8.018  2.271   1.00 0.00 ? 127 PRO A CG   1  
ATOM 1965  C CD   . PRO A 1 127 ? -29.794 -8.321  1.127   1.00 0.00 ? 127 PRO A CD   1  
ATOM 1966  H HA   . PRO A 1 127 ? -31.345 -5.919  2.602   1.00 0.00 ? 127 PRO A HA   1  
ATOM 1967  H HB2  . PRO A 1 127 ? -28.885 -6.387  3.652   1.00 0.00 ? 127 PRO A HB2  1  
ATOM 1968  H HB3  . PRO A 1 127 ? -30.236 -7.513  3.830   1.00 0.00 ? 127 PRO A HB3  1  
ATOM 1969  H HG2  . PRO A 1 127 ? -27.945 -7.592  1.905   1.00 0.00 ? 127 PRO A HG2  1  
ATOM 1970  H HG3  . PRO A 1 127 ? -28.668 -8.915  2.839   1.00 0.00 ? 127 PRO A HG3  1  
ATOM 1971  H HD2  . PRO A 1 127 ? -29.231 -8.502  0.223   1.00 0.00 ? 127 PRO A HD2  1  
ATOM 1972  H HD3  . PRO A 1 127 ? -30.418 -9.170  1.361   1.00 0.00 ? 127 PRO A HD3  1  
ATOM 1973  N N    . SER A 1 128 ? -29.695 -3.921  2.624   1.00 0.00 ? 128 SER A N    1  
ATOM 1974  C CA   . SER A 1 128 ? -29.016 -2.656  2.369   1.00 0.00 ? 128 SER A CA   1  
ATOM 1975  C C    . SER A 1 128 ? -28.008 -2.348  3.473   1.00 0.00 ? 128 SER A C    1  
ATOM 1976  O O    . SER A 1 128 ? -28.255 -2.621  4.648   1.00 0.00 ? 128 SER A O    1  
ATOM 1977  C CB   . SER A 1 128 ? -30.033 -1.519  2.261   1.00 0.00 ? 128 SER A CB   1  
ATOM 1978  O OG   . SER A 1 128 ? -30.984 -1.584  3.310   1.00 0.00 ? 128 SER A OG   1  
ATOM 1979  H H    . SER A 1 128 ? -30.201 -4.033  3.456   1.00 0.00 ? 128 SER A H    1  
ATOM 1980  H HA   . SER A 1 128 ? -28.488 -2.746  1.432   1.00 0.00 ? 128 SER A HA   1  
ATOM 1981  H HB2  . SER A 1 128 ? -29.519 -0.572  2.316   1.00 0.00 ? 128 SER A HB2  1  
ATOM 1982  H HB3  . SER A 1 128 ? -30.552 -1.592  1.316   1.00 0.00 ? 128 SER A HB3  1  
ATOM 1983  H HG   . SER A 1 128 ? -30.682 -2.203  3.978   1.00 0.00 ? 128 SER A HG   1  
ATOM 1984  N N    . SER A 1 129 ? -26.872 -1.777  3.086   1.00 0.00 ? 129 SER A N    1  
ATOM 1985  C CA   . SER A 1 129 ? -25.824 -1.435  4.041   1.00 0.00 ? 129 SER A CA   1  
ATOM 1986  C C    . SER A 1 129 ? -25.542 0.064   4.024   1.00 0.00 ? 129 SER A C    1  
ATOM 1987  O O    . SER A 1 129 ? -26.133 0.809   3.244   1.00 0.00 ? 129 SER A O    1  
ATOM 1988  C CB   . SER A 1 129 ? -24.543 -2.210  3.724   1.00 0.00 ? 129 SER A CB   1  
ATOM 1989  O OG   . SER A 1 129 ? -24.737 -3.604  3.888   1.00 0.00 ? 129 SER A OG   1  
ATOM 1990  H H    . SER A 1 129 ? -26.734 -1.584  2.135   1.00 0.00 ? 129 SER A H    1  
ATOM 1991  H HA   . SER A 1 129 ? -26.169 -1.714  5.025   1.00 0.00 ? 129 SER A HA   1  
ATOM 1992  H HB2  . SER A 1 129 ? -24.252 -2.017  2.703   1.00 0.00 ? 129 SER A HB2  1  
ATOM 1993  H HB3  . SER A 1 129 ? -23.756 -1.886  4.390   1.00 0.00 ? 129 SER A HB3  1  
ATOM 1994  H HG   . SER A 1 129 ? -25.478 -3.757  4.479   1.00 0.00 ? 129 SER A HG   1  
ATOM 1995  N N    . GLY A 1 130 ? -24.634 0.499   4.893   1.00 0.00 ? 130 GLY A N    1  
ATOM 1996  C CA   . GLY A 1 130 ? -24.289 1.907   4.963   1.00 0.00 ? 130 GLY A CA   1  
ATOM 1997  C C    . GLY A 1 130 ? -23.622 2.276   6.273   1.00 0.00 ? 130 GLY A C    1  
ATOM 1998  O O    . GLY A 1 130 ? -22.503 2.787   6.284   1.00 0.00 ? 130 GLY A O    1  
ATOM 1999  H H    . GLY A 1 130 ? -24.195 -0.141  5.491   1.00 0.00 ? 130 GLY A H    1  
ATOM 2000  H HA2  . GLY A 1 130 ? -23.619 2.143   4.150   1.00 0.00 ? 130 GLY A HA2  1  
ATOM 2001  H HA3  . GLY A 1 130 ? -25.191 2.492   4.854   1.00 0.00 ? 130 GLY A HA3  1  
ATOM 2002  N N    . GLY A 1 1   ? 3.001   -12.712 -26.544 1.00 0.00 ? 1   GLY A N    2  
ATOM 2003  C CA   . GLY A 1 1   ? 1.837   -13.362 -27.116 1.00 0.00 ? 1   GLY A CA   2  
ATOM 2004  C C    . GLY A 1 1   ? 0.620   -13.270 -26.218 1.00 0.00 ? 1   GLY A C    2  
ATOM 2005  O O    . GLY A 1 1   ? 0.732   -13.379 -24.997 1.00 0.00 ? 1   GLY A O    2  
ATOM 2006  H H1   . GLY A 1 1   ? 3.144   -11.753 -26.688 1.00 0.00 ? 1   GLY A H1   2  
ATOM 2007  H HA2  . GLY A 1 1   ? 1.608   -12.898 -28.064 1.00 0.00 ? 1   GLY A HA2  2  
ATOM 2008  H HA3  . GLY A 1 1   ? 2.067   -14.404 -27.284 1.00 0.00 ? 1   GLY A HA3  2  
ATOM 2009  N N    . SER A 1 2   ? -0.546  -13.066 -26.822 1.00 0.00 ? 2   SER A N    2  
ATOM 2010  C CA   . SER A 1 2   ? -1.789  -12.953 -26.067 1.00 0.00 ? 2   SER A CA   2  
ATOM 2011  C C    . SER A 1 2   ? -1.818  -13.953 -24.915 1.00 0.00 ? 2   SER A C    2  
ATOM 2012  O O    . SER A 1 2   ? -1.846  -15.164 -25.131 1.00 0.00 ? 2   SER A O    2  
ATOM 2013  C CB   . SER A 1 2   ? -2.991  -13.181 -26.986 1.00 0.00 ? 2   SER A CB   2  
ATOM 2014  O OG   . SER A 1 2   ? -2.809  -14.337 -27.786 1.00 0.00 ? 2   SER A OG   2  
ATOM 2015  H H    . SER A 1 2   ? -0.571  -12.987 -27.799 1.00 0.00 ? 2   SER A H    2  
ATOM 2016  H HA   . SER A 1 2   ? -1.841  -11.953 -25.662 1.00 0.00 ? 2   SER A HA   2  
ATOM 2017  H HB2  . SER A 1 2   ? -3.879  -13.309 -26.387 1.00 0.00 ? 2   SER A HB2  2  
ATOM 2018  H HB3  . SER A 1 2   ? -3.113  -12.325 -27.634 1.00 0.00 ? 2   SER A HB3  2  
ATOM 2019  H HG   . SER A 1 2   ? -2.953  -14.114 -28.708 1.00 0.00 ? 2   SER A HG   2  
ATOM 2020  N N    . SER A 1 3   ? -1.811  -13.435 -23.691 1.00 0.00 ? 3   SER A N    2  
ATOM 2021  C CA   . SER A 1 3   ? -1.832  -14.282 -22.504 1.00 0.00 ? 3   SER A CA   2  
ATOM 2022  C C    . SER A 1 3   ? -2.999  -13.912 -21.594 1.00 0.00 ? 3   SER A C    2  
ATOM 2023  O O    . SER A 1 3   ? -3.331  -14.643 -20.662 1.00 0.00 ? 3   SER A O    2  
ATOM 2024  C CB   . SER A 1 3   ? -0.514  -14.156 -21.738 1.00 0.00 ? 3   SER A CB   2  
ATOM 2025  O OG   . SER A 1 3   ? -0.689  -14.464 -20.366 1.00 0.00 ? 3   SER A OG   2  
ATOM 2026  H H    . SER A 1 3   ? -1.788  -12.461 -23.584 1.00 0.00 ? 3   SER A H    2  
ATOM 2027  H HA   . SER A 1 3   ? -1.954  -15.305 -22.828 1.00 0.00 ? 3   SER A HA   2  
ATOM 2028  H HB2  . SER A 1 3   ? 0.210   -14.837 -22.157 1.00 0.00 ? 3   SER A HB2  2  
ATOM 2029  H HB3  . SER A 1 3   ? -0.146  -13.143 -21.823 1.00 0.00 ? 3   SER A HB3  2  
ATOM 2030  H HG   . SER A 1 3   ? 0.161   -14.676 -19.974 1.00 0.00 ? 3   SER A HG   2  
ATOM 2031  N N    . GLY A 1 4   ? -3.619  -12.769 -21.872 1.00 0.00 ? 4   GLY A N    2  
ATOM 2032  C CA   . GLY A 1 4   ? -4.743  -12.320 -21.070 1.00 0.00 ? 4   GLY A CA   2  
ATOM 2033  C C    . GLY A 1 4   ? -4.335  -11.944 -19.660 1.00 0.00 ? 4   GLY A C    2  
ATOM 2034  O O    . GLY A 1 4   ? -3.749  -12.752 -18.940 1.00 0.00 ? 4   GLY A O    2  
ATOM 2035  H H    . GLY A 1 4   ? -3.311  -12.226 -22.628 1.00 0.00 ? 4   GLY A H    2  
ATOM 2036  H HA2  . GLY A 1 4   ? -5.190  -11.460 -21.546 1.00 0.00 ? 4   GLY A HA2  2  
ATOM 2037  H HA3  . GLY A 1 4   ? -5.475  -13.113 -21.022 1.00 0.00 ? 4   GLY A HA3  2  
ATOM 2038  N N    . SER A 1 5   ? -4.644  -10.713 -19.264 1.00 0.00 ? 5   SER A N    2  
ATOM 2039  C CA   . SER A 1 5   ? -4.301  -10.229 -17.932 1.00 0.00 ? 5   SER A CA   2  
ATOM 2040  C C    . SER A 1 5   ? -5.541  -10.151 -17.047 1.00 0.00 ? 5   SER A C    2  
ATOM 2041  O O    . SER A 1 5   ? -6.537  -9.525  -17.409 1.00 0.00 ? 5   SER A O    2  
ATOM 2042  C CB   . SER A 1 5   ? -3.636  -8.854  -18.022 1.00 0.00 ? 5   SER A CB   2  
ATOM 2043  O OG   . SER A 1 5   ? -3.291  -8.370  -16.735 1.00 0.00 ? 5   SER A OG   2  
ATOM 2044  H H    . SER A 1 5   ? -5.112  -10.115 -19.885 1.00 0.00 ? 5   SER A H    2  
ATOM 2045  H HA   . SER A 1 5   ? -3.604  -10.929 -17.495 1.00 0.00 ? 5   SER A HA   2  
ATOM 2046  H HB2  . SER A 1 5   ? -2.739  -8.929  -18.617 1.00 0.00 ? 5   SER A HB2  2  
ATOM 2047  H HB3  . SER A 1 5   ? -4.318  -8.157  -18.485 1.00 0.00 ? 5   SER A HB3  2  
ATOM 2048  H HG   . SER A 1 5   ? -3.468  -7.428  -16.690 1.00 0.00 ? 5   SER A HG   2  
ATOM 2049  N N    . SER A 1 6   ? -5.471  -10.790 -15.884 1.00 0.00 ? 6   SER A N    2  
ATOM 2050  C CA   . SER A 1 6   ? -6.589  -10.797 -14.947 1.00 0.00 ? 6   SER A CA   2  
ATOM 2051  C C    . SER A 1 6   ? -6.489  -9.625  -13.975 1.00 0.00 ? 6   SER A C    2  
ATOM 2052  O O    . SER A 1 6   ? -5.449  -8.977  -13.870 1.00 0.00 ? 6   SER A O    2  
ATOM 2053  C CB   . SER A 1 6   ? -6.624  -12.116 -14.172 1.00 0.00 ? 6   SER A CB   2  
ATOM 2054  O OG   . SER A 1 6   ? -7.546  -12.051 -13.097 1.00 0.00 ? 6   SER A OG   2  
ATOM 2055  H H    . SER A 1 6   ? -4.649  -11.272 -15.652 1.00 0.00 ? 6   SER A H    2  
ATOM 2056  H HA   . SER A 1 6   ? -7.500  -10.700 -15.518 1.00 0.00 ? 6   SER A HA   2  
ATOM 2057  H HB2  . SER A 1 6   ? -6.920  -12.913 -14.836 1.00 0.00 ? 6   SER A HB2  2  
ATOM 2058  H HB3  . SER A 1 6   ? -5.641  -12.323 -13.776 1.00 0.00 ? 6   SER A HB3  2  
ATOM 2059  H HG   . SER A 1 6   ? -8.302  -12.610 -13.289 1.00 0.00 ? 6   SER A HG   2  
ATOM 2060  N N    . GLY A 1 7   ? -7.582  -9.359  -13.265 1.00 0.00 ? 7   GLY A N    2  
ATOM 2061  C CA   . GLY A 1 7   ? -7.598  -8.266  -12.310 1.00 0.00 ? 7   GLY A CA   2  
ATOM 2062  C C    . GLY A 1 7   ? -6.616  -8.473  -11.174 1.00 0.00 ? 7   GLY A C    2  
ATOM 2063  O O    . GLY A 1 7   ? -6.616  -9.520  -10.526 1.00 0.00 ? 7   GLY A O    2  
ATOM 2064  H H    . GLY A 1 7   ? -8.383  -9.910  -13.390 1.00 0.00 ? 7   GLY A H    2  
ATOM 2065  H HA2  . GLY A 1 7   ? -7.350  -7.350  -12.825 1.00 0.00 ? 7   GLY A HA2  2  
ATOM 2066  H HA3  . GLY A 1 7   ? -8.593  -8.178  -11.899 1.00 0.00 ? 7   GLY A HA3  2  
ATOM 2067  N N    . THR A 1 8   ? -5.774  -7.473  -10.932 1.00 0.00 ? 8   THR A N    2  
ATOM 2068  C CA   . THR A 1 8   ? -4.780  -7.552  -9.869  1.00 0.00 ? 8   THR A CA   2  
ATOM 2069  C C    . THR A 1 8   ? -4.599  -6.201  -9.185  1.00 0.00 ? 8   THR A C    2  
ATOM 2070  O O    . THR A 1 8   ? -4.689  -5.145  -9.811  1.00 0.00 ? 8   THR A O    2  
ATOM 2071  C CB   . THR A 1 8   ? -3.418  -8.029  -10.407 1.00 0.00 ? 8   THR A CB   2  
ATOM 2072  O OG1  . THR A 1 8   ? -3.200  -9.397  -10.043 1.00 0.00 ? 8   THR A OG1  2  
ATOM 2073  C CG2  . THR A 1 8   ? -2.289  -7.168  -9.862  1.00 0.00 ? 8   THR A CG2  2  
ATOM 2074  H H    . THR A 1 8   ? -5.823  -6.665  -11.483 1.00 0.00 ? 8   THR A H    2  
ATOM 2075  H HA   . THR A 1 8   ? -5.128  -8.270  -9.140  1.00 0.00 ? 8   THR A HA   2  
ATOM 2076  H HB   . THR A 1 8   ? -3.426  -7.948  -11.484 1.00 0.00 ? 8   THR A HB   2  
ATOM 2077  H HG1  . THR A 1 8   ? -2.574  -9.795  -10.653 1.00 0.00 ? 8   THR A HG1  2  
ATOM 2078  H HG21 . THR A 1 8   ? -1.348  -7.514  -10.261 1.00 0.00 ? 8   THR A HG21 2  
ATOM 2079  H HG22 . THR A 1 8   ? -2.271  -7.238  -8.784  1.00 0.00 ? 8   THR A HG22 2  
ATOM 2080  H HG23 . THR A 1 8   ? -2.448  -6.140  -10.153 1.00 0.00 ? 8   THR A HG23 2  
ATOM 2081  N N    . PRO A 1 9   ? -4.337  -6.233  -7.870  1.00 0.00 ? 9   PRO A N    2  
ATOM 2082  C CA   . PRO A 1 9   ? -4.135  -5.019  -7.074  1.00 0.00 ? 9   PRO A CA   2  
ATOM 2083  C C    . PRO A 1 9   ? -2.830  -4.310  -7.417  1.00 0.00 ? 9   PRO A C    2  
ATOM 2084  O O    . PRO A 1 9   ? -1.790  -4.949  -7.584  1.00 0.00 ? 9   PRO A O    2  
ATOM 2085  C CB   . PRO A 1 9   ? -4.099  -5.541  -5.635  1.00 0.00 ? 9   PRO A CB   2  
ATOM 2086  C CG   . PRO A 1 9   ? -3.654  -6.958  -5.757  1.00 0.00 ? 9   PRO A CG   2  
ATOM 2087  C CD   . PRO A 1 9   ? -4.215  -7.457  -7.060  1.00 0.00 ? 9   PRO A CD   2  
ATOM 2088  H HA   . PRO A 1 9   ? -4.959  -4.329  -7.187  1.00 0.00 ? 9   PRO A HA   2  
ATOM 2089  H HB2  . PRO A 1 9   ? -3.400  -4.956  -5.055  1.00 0.00 ? 9   PRO A HB2  2  
ATOM 2090  H HB3  . PRO A 1 9   ? -5.084  -5.473  -5.198  1.00 0.00 ? 9   PRO A HB3  2  
ATOM 2091  H HG2  . PRO A 1 9   ? -2.576  -7.005  -5.771  1.00 0.00 ? 9   PRO A HG2  2  
ATOM 2092  H HG3  . PRO A 1 9   ? -4.046  -7.537  -4.935  1.00 0.00 ? 9   PRO A HG3  2  
ATOM 2093  H HD2  . PRO A 1 9   ? -3.535  -8.158  -7.520  1.00 0.00 ? 9   PRO A HD2  2  
ATOM 2094  H HD3  . PRO A 1 9   ? -5.182  -7.913  -6.905  1.00 0.00 ? 9   PRO A HD3  2  
ATOM 2095  N N    . HIS A 1 10  ? -2.890  -2.987  -7.520  1.00 0.00 ? 10  HIS A N    2  
ATOM 2096  C CA   . HIS A 1 10  ? -1.711  -2.191  -7.842  1.00 0.00 ? 10  HIS A CA   2  
ATOM 2097  C C    . HIS A 1 10  ? -1.902  -0.738  -7.415  1.00 0.00 ? 10  HIS A C    2  
ATOM 2098  O O    . HIS A 1 10  ? -3.031  -0.271  -7.254  1.00 0.00 ? 10  HIS A O    2  
ATOM 2099  C CB   . HIS A 1 10  ? -1.417  -2.259  -9.341  1.00 0.00 ? 10  HIS A CB   2  
ATOM 2100  C CG   . HIS A 1 10  ? -2.569  -1.833  -10.197 1.00 0.00 ? 10  HIS A CG   2  
ATOM 2101  N ND1  . HIS A 1 10  ? -3.654  -2.643  -10.457 1.00 0.00 ? 10  HIS A ND1  2  
ATOM 2102  C CD2  . HIS A 1 10  ? -2.803  -0.672  -10.853 1.00 0.00 ? 10  HIS A CD2  2  
ATOM 2103  C CE1  . HIS A 1 10  ? -4.505  -2.000  -11.237 1.00 0.00 ? 10  HIS A CE1  2  
ATOM 2104  N NE2  . HIS A 1 10  ? -4.012  -0.801  -11.491 1.00 0.00 ? 10  HIS A NE2  2  
ATOM 2105  H H    . HIS A 1 10  ? -3.747  -2.535  -7.376  1.00 0.00 ? 10  HIS A H    2  
ATOM 2106  H HA   . HIS A 1 10  ? -0.873  -2.604  -7.301  1.00 0.00 ? 10  HIS A HA   2  
ATOM 2107  H HB2  . HIS A 1 10  ? -0.580  -1.615  -9.567  1.00 0.00 ? 10  HIS A HB2  2  
ATOM 2108  H HB3  . HIS A 1 10  ? -1.164  -3.276  -9.606  1.00 0.00 ? 10  HIS A HB3  2  
ATOM 2109  H HD1  . HIS A 1 10  ? -3.781  -3.555  -10.122 1.00 0.00 ? 10  HIS A HD1  2  
ATOM 2110  H HD2  . HIS A 1 10  ? -2.159  0.196   -10.871 1.00 0.00 ? 10  HIS A HD2  2  
ATOM 2111  H HE1  . HIS A 1 10  ? -5.443  -2.387  -11.604 1.00 0.00 ? 10  HIS A HE1  2  
ATOM 2112  N N    . LEU A 1 11  ? -0.794  -0.030  -7.232  1.00 0.00 ? 11  LEU A N    2  
ATOM 2113  C CA   . LEU A 1 11  ? -0.839  1.370   -6.823  1.00 0.00 ? 11  LEU A CA   2  
ATOM 2114  C C    . LEU A 1 11  ? -0.674  2.294   -8.025  1.00 0.00 ? 11  LEU A C    2  
ATOM 2115  O O    . LEU A 1 11  ? 0.223   2.106   -8.847  1.00 0.00 ? 11  LEU A O    2  
ATOM 2116  C CB   . LEU A 1 11  ? 0.253   1.656   -5.791  1.00 0.00 ? 11  LEU A CB   2  
ATOM 2117  C CG   . LEU A 1 11  ? 0.461   0.585   -4.720  1.00 0.00 ? 11  LEU A CG   2  
ATOM 2118  C CD1  . LEU A 1 11  ? 1.871   0.661   -4.156  1.00 0.00 ? 11  LEU A CD1  2  
ATOM 2119  C CD2  . LEU A 1 11  ? -0.569  0.734   -3.609  1.00 0.00 ? 11  LEU A CD2  2  
ATOM 2120  H H    . LEU A 1 11  ? 0.076   -0.456  -7.376  1.00 0.00 ? 11  LEU A H    2  
ATOM 2121  H HA   . LEU A 1 11  ? -1.804  1.553   -6.374  1.00 0.00 ? 11  LEU A HA   2  
ATOM 2122  H HB2  . LEU A 1 11  ? 1.185   1.778   -6.321  1.00 0.00 ? 11  LEU A HB2  2  
ATOM 2123  H HB3  . LEU A 1 11  ? 0.001   2.580   -5.291  1.00 0.00 ? 11  LEU A HB3  2  
ATOM 2124  H HG   . LEU A 1 11  ? 0.333   -0.392  -5.166  1.00 0.00 ? 11  LEU A HG   2  
ATOM 2125  H HD11 . LEU A 1 11  ? 1.869   1.264   -3.261  1.00 0.00 ? 11  LEU A HD11 2  
ATOM 2126  H HD12 . LEU A 1 11  ? 2.528   1.105   -4.888  1.00 0.00 ? 11  LEU A HD12 2  
ATOM 2127  H HD13 . LEU A 1 11  ? 2.218   -0.335  -3.918  1.00 0.00 ? 11  LEU A HD13 2  
ATOM 2128  H HD21 . LEU A 1 11  ? -1.303  -0.053  -3.691  1.00 0.00 ? 11  LEU A HD21 2  
ATOM 2129  H HD22 . LEU A 1 11  ? -1.057  1.693   -3.698  1.00 0.00 ? 11  LEU A HD22 2  
ATOM 2130  H HD23 . LEU A 1 11  ? -0.075  0.670   -2.650  1.00 0.00 ? 11  LEU A HD23 2  
ATOM 2131  N N    . VAL A 1 12  ? -1.543  3.295   -8.120  1.00 0.00 ? 12  VAL A N    2  
ATOM 2132  C CA   . VAL A 1 12  ? -1.491  4.252   -9.219  1.00 0.00 ? 12  VAL A CA   2  
ATOM 2133  C C    . VAL A 1 12  ? -1.032  5.622   -8.734  1.00 0.00 ? 12  VAL A C    2  
ATOM 2134  O O    . VAL A 1 12  ? -1.464  6.097   -7.685  1.00 0.00 ? 12  VAL A O    2  
ATOM 2135  C CB   . VAL A 1 12  ? -2.863  4.394   -9.904  1.00 0.00 ? 12  VAL A CB   2  
ATOM 2136  C CG1  . VAL A 1 12  ? -2.704  4.965   -11.305 1.00 0.00 ? 12  VAL A CG1  2  
ATOM 2137  C CG2  . VAL A 1 12  ? -3.580  3.053   -9.944  1.00 0.00 ? 12  VAL A CG2  2  
ATOM 2138  H H    . VAL A 1 12  ? -2.236  3.393   -7.433  1.00 0.00 ? 12  VAL A H    2  
ATOM 2139  H HA   . VAL A 1 12  ? -0.785  3.884   -9.949  1.00 0.00 ? 12  VAL A HA   2  
ATOM 2140  H HB   . VAL A 1 12  ? -3.462  5.082   -9.325  1.00 0.00 ? 12  VAL A HB   2  
ATOM 2141  H HG11 . VAL A 1 12  ? -3.678  5.092   -11.754 1.00 0.00 ? 12  VAL A HG11 2  
ATOM 2142  H HG12 . VAL A 1 12  ? -2.204  5.921   -11.250 1.00 0.00 ? 12  VAL A HG12 2  
ATOM 2143  H HG13 . VAL A 1 12  ? -2.117  4.286   -11.906 1.00 0.00 ? 12  VAL A HG13 2  
ATOM 2144  H HG21 . VAL A 1 12  ? -3.859  2.764   -8.942  1.00 0.00 ? 12  VAL A HG21 2  
ATOM 2145  H HG22 . VAL A 1 12  ? -4.467  3.138   -10.555 1.00 0.00 ? 12  VAL A HG22 2  
ATOM 2146  H HG23 . VAL A 1 12  ? -2.924  2.306   -10.365 1.00 0.00 ? 12  VAL A HG23 2  
ATOM 2147  N N    . ASN A 1 13  ? -0.154  6.254   -9.506  1.00 0.00 ? 13  ASN A N    2  
ATOM 2148  C CA   . ASN A 1 13  ? 0.364   7.571   -9.155  1.00 0.00 ? 13  ASN A CA   2  
ATOM 2149  C C    . ASN A 1 13  ? -0.706  8.643   -9.340  1.00 0.00 ? 13  ASN A C    2  
ATOM 2150  O O    . ASN A 1 13  ? -0.584  9.515   -10.203 1.00 0.00 ? 13  ASN A O    2  
ATOM 2151  C CB   . ASN A 1 13  ? 1.589   7.904   -10.009 1.00 0.00 ? 13  ASN A CB   2  
ATOM 2152  C CG   . ASN A 1 13  ? 1.224   8.219   -11.447 1.00 0.00 ? 13  ASN A CG   2  
ATOM 2153  O OD1  . ASN A 1 13  ? 0.881   7.325   -12.221 1.00 0.00 ? 13  ASN A OD1  2  
ATOM 2154  N ND2  . ASN A 1 13  ? 1.296   9.494   -11.810 1.00 0.00 ? 13  ASN A ND2  2  
ATOM 2155  H H    . ASN A 1 13  ? 0.153   5.824   -10.332 1.00 0.00 ? 13  ASN A H    2  
ATOM 2156  H HA   . ASN A 1 13  ? 0.656   7.546   -8.116  1.00 0.00 ? 13  ASN A HA   2  
ATOM 2157  H HB2  . ASN A 1 13  ? 2.090   8.765   -9.589  1.00 0.00 ? 13  ASN A HB2  2  
ATOM 2158  H HB3  . ASN A 1 13  ? 2.264   7.062   -10.004 1.00 0.00 ? 13  ASN A HB3  2  
ATOM 2159  H HD21 . ASN A 1 13  ? 1.577   10.151  -11.140 1.00 0.00 ? 13  ASN A HD21 2  
ATOM 2160  H HD22 . ASN A 1 13  ? 1.065   9.725   -12.734 1.00 0.00 ? 13  ASN A HD22 2  
ATOM 2161  N N    . LEU A 1 14  ? -1.752  8.574   -8.525  1.00 0.00 ? 14  LEU A N    2  
ATOM 2162  C CA   . LEU A 1 14  ? -2.844  9.539   -8.598  1.00 0.00 ? 14  LEU A CA   2  
ATOM 2163  C C    . LEU A 1 14  ? -2.396  10.907  -8.094  1.00 0.00 ? 14  LEU A C    2  
ATOM 2164  O O    . LEU A 1 14  ? -3.176  11.858  -8.075  1.00 0.00 ? 14  LEU A O    2  
ATOM 2165  C CB   . LEU A 1 14  ? -4.040  9.048   -7.781  1.00 0.00 ? 14  LEU A CB   2  
ATOM 2166  C CG   . LEU A 1 14  ? -3.845  9.005   -6.265  1.00 0.00 ? 14  LEU A CG   2  
ATOM 2167  C CD1  . LEU A 1 14  ? -5.164  9.258   -5.550  1.00 0.00 ? 14  LEU A CD1  2  
ATOM 2168  C CD2  . LEU A 1 14  ? -3.254  7.669   -5.840  1.00 0.00 ? 14  LEU A CD2  2  
ATOM 2169  H H    . LEU A 1 14  ? -1.793  7.857   -7.859  1.00 0.00 ? 14  LEU A H    2  
ATOM 2170  H HA   . LEU A 1 14  ? -3.138  9.629   -9.633  1.00 0.00 ? 14  LEU A HA   2  
ATOM 2171  H HB2  . LEU A 1 14  ? -4.873  9.702   -7.989  1.00 0.00 ? 14  LEU A HB2  2  
ATOM 2172  H HB3  . LEU A 1 14  ? -4.278  8.047   -8.113  1.00 0.00 ? 14  LEU A HB3  2  
ATOM 2173  H HG   . LEU A 1 14  ? -3.154  9.785   -5.975  1.00 0.00 ? 14  LEU A HG   2  
ATOM 2174  H HD11 . LEU A 1 14  ? -5.005  9.233   -4.483  1.00 0.00 ? 14  LEU A HD11 2  
ATOM 2175  H HD12 . LEU A 1 14  ? -5.875  8.494   -5.826  1.00 0.00 ? 14  LEU A HD12 2  
ATOM 2176  H HD13 . LEU A 1 14  ? -5.547  10.227  -5.835  1.00 0.00 ? 14  LEU A HD13 2  
ATOM 2177  H HD21 . LEU A 1 14  ? -3.871  7.231   -5.069  1.00 0.00 ? 14  LEU A HD21 2  
ATOM 2178  H HD22 . LEU A 1 14  ? -2.255  7.822   -5.459  1.00 0.00 ? 14  LEU A HD22 2  
ATOM 2179  H HD23 . LEU A 1 14  ? -3.216  7.005   -6.692  1.00 0.00 ? 14  LEU A HD23 2  
ATOM 2180  N N    . ASN A 1 15  ? -1.134  10.998  -7.687  1.00 0.00 ? 15  ASN A N    2  
ATOM 2181  C CA   . ASN A 1 15  ? -0.581  12.250  -7.184  1.00 0.00 ? 15  ASN A CA   2  
ATOM 2182  C C    . ASN A 1 15  ? -0.761  13.372  -8.202  1.00 0.00 ? 15  ASN A C    2  
ATOM 2183  O O    . ASN A 1 15  ? -1.413  13.191  -9.230  1.00 0.00 ? 15  ASN A O    2  
ATOM 2184  C CB   . ASN A 1 15  ? 0.903   12.080  -6.853  1.00 0.00 ? 15  ASN A CB   2  
ATOM 2185  C CG   . ASN A 1 15  ? 1.670   11.397  -7.969  1.00 0.00 ? 15  ASN A CG   2  
ATOM 2186  O OD1  . ASN A 1 15  ? 1.369   11.582  -9.148  1.00 0.00 ? 15  ASN A OD1  2  
ATOM 2187  N ND2  . ASN A 1 15  ? 2.667   10.601  -7.600  1.00 0.00 ? 15  ASN A ND2  2  
ATOM 2188  H H    . ASN A 1 15  ? -0.560  10.204  -7.726  1.00 0.00 ? 15  ASN A H    2  
ATOM 2189  H HA   . ASN A 1 15  ? -1.115  12.509  -6.282  1.00 0.00 ? 15  ASN A HA   2  
ATOM 2190  H HB2  . ASN A 1 15  ? 1.341   13.053  -6.685  1.00 0.00 ? 15  ASN A HB2  2  
ATOM 2191  H HB3  . ASN A 1 15  ? 1.000   11.486  -5.957  1.00 0.00 ? 15  ASN A HB3  2  
ATOM 2192  H HD21 . ASN A 1 15  ? 2.850   10.501  -6.642  1.00 0.00 ? 15  ASN A HD21 2  
ATOM 2193  H HD22 . ASN A 1 15  ? 3.180   10.147  -8.301  1.00 0.00 ? 15  ASN A HD22 2  
ATOM 2194  N N    . GLU A 1 16  ? -0.178  14.530  -7.908  1.00 0.00 ? 16  GLU A N    2  
ATOM 2195  C CA   . GLU A 1 16  ? -0.275  15.681  -8.798  1.00 0.00 ? 16  GLU A CA   2  
ATOM 2196  C C    . GLU A 1 16  ? 1.072   15.979  -9.451  1.00 0.00 ? 16  GLU A C    2  
ATOM 2197  O O    . GLU A 1 16  ? 1.318   17.095  -9.909  1.00 0.00 ? 16  GLU A O    2  
ATOM 2198  C CB   . GLU A 1 16  ? -0.764  16.909  -8.028  1.00 0.00 ? 16  GLU A CB   2  
ATOM 2199  C CG   . GLU A 1 16  ? -1.924  16.619  -7.091  1.00 0.00 ? 16  GLU A CG   2  
ATOM 2200  C CD   . GLU A 1 16  ? -2.062  17.656  -5.993  1.00 0.00 ? 16  GLU A CD   2  
ATOM 2201  O OE1  . GLU A 1 16  ? -1.126  17.785  -5.177  1.00 0.00 ? 16  GLU A OE1  2  
ATOM 2202  O OE2  . GLU A 1 16  ? -3.107  18.339  -5.952  1.00 0.00 ? 16  GLU A OE2  2  
ATOM 2203  H H    . GLU A 1 16  ? 0.328   14.612  -7.073  1.00 0.00 ? 16  GLU A H    2  
ATOM 2204  H HA   . GLU A 1 16  ? -0.991  15.444  -9.570  1.00 0.00 ? 16  GLU A HA   2  
ATOM 2205  H HB2  . GLU A 1 16  ? 0.055   17.302  -7.443  1.00 0.00 ? 16  GLU A HB2  2  
ATOM 2206  H HB3  . GLU A 1 16  ? -1.081  17.660  -8.736  1.00 0.00 ? 16  GLU A HB3  2  
ATOM 2207  H HG2  . GLU A 1 16  ? -2.838  16.601  -7.665  1.00 0.00 ? 16  GLU A HG2  2  
ATOM 2208  H HG3  . GLU A 1 16  ? -1.768  15.652  -6.634  1.00 0.00 ? 16  GLU A HG3  2  
ATOM 2209  N N    . ASP A 1 17  ? 1.939   14.974  -9.489  1.00 0.00 ? 17  ASP A N    2  
ATOM 2210  C CA   . ASP A 1 17  ? 3.261   15.126  -10.085 1.00 0.00 ? 17  ASP A CA   2  
ATOM 2211  C C    . ASP A 1 17  ? 3.344   14.391  -11.419 1.00 0.00 ? 17  ASP A C    2  
ATOM 2212  O O    . ASP A 1 17  ? 3.869   13.281  -11.512 1.00 0.00 ? 17  ASP A O    2  
ATOM 2213  C CB   . ASP A 1 17  ? 4.338   14.603  -9.132  1.00 0.00 ? 17  ASP A CB   2  
ATOM 2214  C CG   . ASP A 1 17  ? 4.710   15.616  -8.068  1.00 0.00 ? 17  ASP A CG   2  
ATOM 2215  O OD1  . ASP A 1 17  ? 5.547   16.498  -8.355  1.00 0.00 ? 17  ASP A OD1  2  
ATOM 2216  O OD2  . ASP A 1 17  ? 4.166   15.527  -6.947  1.00 0.00 ? 17  ASP A OD2  2  
ATOM 2217  H H    . ASP A 1 17  ? 1.684   14.107  -9.107  1.00 0.00 ? 17  ASP A H    2  
ATOM 2218  H HA   . ASP A 1 17  ? 3.427   16.179  -10.258 1.00 0.00 ? 17  ASP A HA   2  
ATOM 2219  H HB2  . ASP A 1 17  ? 3.973   13.712  -8.642  1.00 0.00 ? 17  ASP A HB2  2  
ATOM 2220  H HB3  . ASP A 1 17  ? 5.224   14.361  -9.700  1.00 0.00 ? 17  ASP A HB3  2  
ATOM 2221  N N    . PRO A 1 18  ? 2.812   15.021  -12.477 1.00 0.00 ? 18  PRO A N    2  
ATOM 2222  C CA   . PRO A 1 18  ? 2.813   14.444  -13.824 1.00 0.00 ? 18  PRO A CA   2  
ATOM 2223  C C    . PRO A 1 18  ? 4.210   14.395  -14.433 1.00 0.00 ? 18  PRO A C    2  
ATOM 2224  O O    . PRO A 1 18  ? 4.400   13.879  -15.535 1.00 0.00 ? 18  PRO A O    2  
ATOM 2225  C CB   . PRO A 1 18  ? 1.917   15.398  -14.619 1.00 0.00 ? 18  PRO A CB   2  
ATOM 2226  C CG   . PRO A 1 18  ? 2.007   16.696  -13.892 1.00 0.00 ? 18  PRO A CG   2  
ATOM 2227  C CD   . PRO A 1 18  ? 2.170   16.345  -12.438 1.00 0.00 ? 18  PRO A CD   2  
ATOM 2228  H HA   . PRO A 1 18  ? 2.383   13.454  -13.832 1.00 0.00 ? 18  PRO A HA   2  
ATOM 2229  H HB2  . PRO A 1 18  ? 2.288   15.485  -15.631 1.00 0.00 ? 18  PRO A HB2  2  
ATOM 2230  H HB3  . PRO A 1 18  ? 0.906   15.022  -14.631 1.00 0.00 ? 18  PRO A HB3  2  
ATOM 2231  H HG2  . PRO A 1 18  ? 2.862   17.254  -14.241 1.00 0.00 ? 18  PRO A HG2  2  
ATOM 2232  H HG3  . PRO A 1 18  ? 1.100   17.263  -14.041 1.00 0.00 ? 18  PRO A HG3  2  
ATOM 2233  H HD2  . PRO A 1 18  ? 2.803   17.067  -11.945 1.00 0.00 ? 18  PRO A HD2  2  
ATOM 2234  H HD3  . PRO A 1 18  ? 1.206   16.292  -11.953 1.00 0.00 ? 18  PRO A HD3  2  
ATOM 2235  N N    . LEU A 1 19  ? 5.185   14.932  -13.708 1.00 0.00 ? 19  LEU A N    2  
ATOM 2236  C CA   . LEU A 1 19  ? 6.567   14.949  -14.177 1.00 0.00 ? 19  LEU A CA   2  
ATOM 2237  C C    . LEU A 1 19  ? 7.345   13.761  -13.620 1.00 0.00 ? 19  LEU A C    2  
ATOM 2238  O O    . LEU A 1 19  ? 8.412   13.414  -14.124 1.00 0.00 ? 19  LEU A O    2  
ATOM 2239  C CB   . LEU A 1 19  ? 7.249   16.256  -13.769 1.00 0.00 ? 19  LEU A CB   2  
ATOM 2240  C CG   . LEU A 1 19  ? 6.410   17.525  -13.918 1.00 0.00 ? 19  LEU A CG   2  
ATOM 2241  C CD1  . LEU A 1 19  ? 7.159   18.728  -13.365 1.00 0.00 ? 19  LEU A CD1  2  
ATOM 2242  C CD2  . LEU A 1 19  ? 6.038   17.751  -15.376 1.00 0.00 ? 19  LEU A CD2  2  
ATOM 2243  H H    . LEU A 1 19  ? 4.972   15.328  -12.838 1.00 0.00 ? 19  LEU A H    2  
ATOM 2244  H HA   . LEU A 1 19  ? 6.552   14.881  -15.254 1.00 0.00 ? 19  LEU A HA   2  
ATOM 2245  H HB2  . LEU A 1 19  ? 7.536   16.169  -12.732 1.00 0.00 ? 19  LEU A HB2  2  
ATOM 2246  H HB3  . LEU A 1 19  ? 8.135   16.369  -14.378 1.00 0.00 ? 19  LEU A HB3  2  
ATOM 2247  H HG   . LEU A 1 19  ? 5.495   17.414  -13.352 1.00 0.00 ? 19  LEU A HG   2  
ATOM 2248  H HD11 . LEU A 1 19  ? 8.190   18.686  -13.681 1.00 0.00 ? 19  LEU A HD11 2  
ATOM 2249  H HD12 . LEU A 1 19  ? 7.112   18.716  -12.286 1.00 0.00 ? 19  LEU A HD12 2  
ATOM 2250  H HD13 . LEU A 1 19  ? 6.705   19.636  -13.735 1.00 0.00 ? 19  LEU A HD13 2  
ATOM 2251  H HD21 . LEU A 1 19  ? 5.243   17.075  -15.654 1.00 0.00 ? 19  LEU A HD21 2  
ATOM 2252  H HD22 . LEU A 1 19  ? 6.901   17.567  -16.000 1.00 0.00 ? 19  LEU A HD22 2  
ATOM 2253  H HD23 . LEU A 1 19  ? 5.708   18.771  -15.510 1.00 0.00 ? 19  LEU A HD23 2  
ATOM 2254  N N    . MET A 1 20  ? 6.801   13.139  -12.579 1.00 0.00 ? 20  MET A N    2  
ATOM 2255  C CA   . MET A 1 20  ? 7.442   11.987  -11.956 1.00 0.00 ? 20  MET A CA   2  
ATOM 2256  C C    . MET A 1 20  ? 8.142   11.124  -13.001 1.00 0.00 ? 20  MET A C    2  
ATOM 2257  O O    . MET A 1 20  ? 7.516   10.653  -13.950 1.00 0.00 ? 20  MET A O    2  
ATOM 2258  C CB   . MET A 1 20  ? 6.411   11.152  -11.195 1.00 0.00 ? 20  MET A CB   2  
ATOM 2259  C CG   . MET A 1 20  ? 5.439   10.414  -12.100 1.00 0.00 ? 20  MET A CG   2  
ATOM 2260  S SD   . MET A 1 20  ? 4.134   9.575   -11.182 1.00 0.00 ? 20  MET A SD   2  
ATOM 2261  C CE   . MET A 1 20  ? 4.946   8.033   -10.770 1.00 0.00 ? 20  MET A CE   2  
ATOM 2262  H H    . MET A 1 20  ? 5.947   13.462  -12.221 1.00 0.00 ? 20  MET A H    2  
ATOM 2263  H HA   . MET A 1 20  ? 8.179   12.356  -11.258 1.00 0.00 ? 20  MET A HA   2  
ATOM 2264  H HB2  . MET A 1 20  ? 6.931   10.423  -10.591 1.00 0.00 ? 20  MET A HB2  2  
ATOM 2265  H HB3  . MET A 1 20  ? 5.843   11.804  -10.548 1.00 0.00 ? 20  MET A HB3  2  
ATOM 2266  H HG2  . MET A 1 20  ? 4.984   11.125  -12.774 1.00 0.00 ? 20  MET A HG2  2  
ATOM 2267  H HG3  . MET A 1 20  ? 5.987   9.680   -12.672 1.00 0.00 ? 20  MET A HG3  2  
ATOM 2268  H HE1  . MET A 1 20  ? 5.599   8.186   -9.923  1.00 0.00 ? 20  MET A HE1  2  
ATOM 2269  H HE2  . MET A 1 20  ? 4.204   7.289   -10.523 1.00 0.00 ? 20  MET A HE2  2  
ATOM 2270  H HE3  . MET A 1 20  ? 5.527   7.696   -11.616 1.00 0.00 ? 20  MET A HE3  2  
ATOM 2271  N N    . SER A 1 21  ? 9.443   10.921  -12.820 1.00 0.00 ? 21  SER A N    2  
ATOM 2272  C CA   . SER A 1 21  ? 10.229  10.118  -13.749 1.00 0.00 ? 21  SER A CA   2  
ATOM 2273  C C    . SER A 1 21  ? 10.174  8.641   -13.371 1.00 0.00 ? 21  SER A C    2  
ATOM 2274  O O    . SER A 1 21  ? 10.609  7.778   -14.133 1.00 0.00 ? 21  SER A O    2  
ATOM 2275  C CB   . SER A 1 21  ? 11.681  10.598  -13.770 1.00 0.00 ? 21  SER A CB   2  
ATOM 2276  O OG   . SER A 1 21  ? 12.476  9.780   -14.611 1.00 0.00 ? 21  SER A OG   2  
ATOM 2277  H H    . SER A 1 21  ? 9.886   11.324  -12.043 1.00 0.00 ? 21  SER A H    2  
ATOM 2278  H HA   . SER A 1 21  ? 9.804   10.241  -14.734 1.00 0.00 ? 21  SER A HA   2  
ATOM 2279  H HB2  . SER A 1 21  ? 11.717  11.613  -14.136 1.00 0.00 ? 21  SER A HB2  2  
ATOM 2280  H HB3  . SER A 1 21  ? 12.083  10.562  -12.768 1.00 0.00 ? 21  SER A HB3  2  
ATOM 2281  H HG   . SER A 1 21  ? 12.928  9.119   -14.081 1.00 0.00 ? 21  SER A HG   2  
ATOM 2282  N N    . GLU A 1 22  ? 9.637   8.359   -12.188 1.00 0.00 ? 22  GLU A N    2  
ATOM 2283  C CA   . GLU A 1 22  ? 9.527   6.987   -11.708 1.00 0.00 ? 22  GLU A CA   2  
ATOM 2284  C C    . GLU A 1 22  ? 8.285   6.308   -12.279 1.00 0.00 ? 22  GLU A C    2  
ATOM 2285  O O    . GLU A 1 22  ? 7.513   6.923   -13.016 1.00 0.00 ? 22  GLU A O    2  
ATOM 2286  C CB   . GLU A 1 22  ? 9.478   6.960   -10.179 1.00 0.00 ? 22  GLU A CB   2  
ATOM 2287  C CG   . GLU A 1 22  ? 8.119   7.326   -9.607  1.00 0.00 ? 22  GLU A CG   2  
ATOM 2288  C CD   . GLU A 1 22  ? 8.155   8.598   -8.782  1.00 0.00 ? 22  GLU A CD   2  
ATOM 2289  O OE1  . GLU A 1 22  ? 9.096   9.398   -8.969  1.00 0.00 ? 22  GLU A OE1  2  
ATOM 2290  O OE2  . GLU A 1 22  ? 7.244   8.793   -7.951  1.00 0.00 ? 22  GLU A OE2  2  
ATOM 2291  H H    . GLU A 1 22  ? 9.308   9.091   -11.625 1.00 0.00 ? 22  GLU A H    2  
ATOM 2292  H HA   . GLU A 1 22  ? 10.401  6.448   -12.040 1.00 0.00 ? 22  GLU A HA   2  
ATOM 2293  H HB2  . GLU A 1 22  ? 9.734   5.967   -9.839  1.00 0.00 ? 22  GLU A HB2  2  
ATOM 2294  H HB3  . GLU A 1 22  ? 10.206  7.660   -9.796  1.00 0.00 ? 22  GLU A HB3  2  
ATOM 2295  H HG2  . GLU A 1 22  ? 7.425   7.463   -10.422 1.00 0.00 ? 22  GLU A HG2  2  
ATOM 2296  H HG3  . GLU A 1 22  ? 7.778   6.516   -8.978  1.00 0.00 ? 22  GLU A HG3  2  
ATOM 2297  N N    . CYS A 1 23  ? 8.100   5.039   -11.934 1.00 0.00 ? 23  CYS A N    2  
ATOM 2298  C CA   . CYS A 1 23  ? 6.953   4.276   -12.413 1.00 0.00 ? 23  CYS A CA   2  
ATOM 2299  C C    . CYS A 1 23  ? 5.646   4.974   -12.052 1.00 0.00 ? 23  CYS A C    2  
ATOM 2300  O O    . CYS A 1 23  ? 5.489   5.486   -10.942 1.00 0.00 ? 23  CYS A O    2  
ATOM 2301  C CB   . CYS A 1 23  ? 6.971   2.865   -11.824 1.00 0.00 ? 23  CYS A CB   2  
ATOM 2302  S SG   . CYS A 1 23  ? 6.116   1.632   -12.833 1.00 0.00 ? 23  CYS A SG   2  
ATOM 2303  H H    . CYS A 1 23  ? 8.750   4.604   -11.343 1.00 0.00 ? 23  CYS A H    2  
ATOM 2304  H HA   . CYS A 1 23  ? 7.026   4.209   -13.488 1.00 0.00 ? 23  CYS A HA   2  
ATOM 2305  H HB2  . CYS A 1 23  ? 7.996   2.542   -11.712 1.00 0.00 ? 23  CYS A HB2  2  
ATOM 2306  H HB3  . CYS A 1 23  ? 6.498   2.882   -10.853 1.00 0.00 ? 23  CYS A HB3  2  
ATOM 2307  H HG   . CYS A 1 23  ? 7.016   1.038   -13.601 1.00 0.00 ? 23  CYS A HG   2  
ATOM 2308  N N    . LEU A 1 24  ? 4.711   4.994   -12.995 1.00 0.00 ? 24  LEU A N    2  
ATOM 2309  C CA   . LEU A 1 24  ? 3.417   5.632   -12.778 1.00 0.00 ? 24  LEU A CA   2  
ATOM 2310  C C    . LEU A 1 24  ? 2.543   4.788   -11.856 1.00 0.00 ? 24  LEU A C    2  
ATOM 2311  O O    . LEU A 1 24  ? 1.654   5.306   -11.180 1.00 0.00 ? 24  LEU A O    2  
ATOM 2312  C CB   . LEU A 1 24  ? 2.705   5.854   -14.113 1.00 0.00 ? 24  LEU A CB   2  
ATOM 2313  C CG   . LEU A 1 24  ? 3.172   7.059   -14.930 1.00 0.00 ? 24  LEU A CG   2  
ATOM 2314  C CD1  . LEU A 1 24  ? 2.772   8.356   -14.245 1.00 0.00 ? 24  LEU A CD1  2  
ATOM 2315  C CD2  . LEU A 1 24  ? 4.679   7.008   -15.142 1.00 0.00 ? 24  LEU A CD2  2  
ATOM 2316  H H    . LEU A 1 24  ? 4.895   4.570   -13.859 1.00 0.00 ? 24  LEU A H    2  
ATOM 2317  H HA   . LEU A 1 24  ? 3.594   6.588   -12.310 1.00 0.00 ? 24  LEU A HA   2  
ATOM 2318  H HB2  . LEU A 1 24  ? 2.849   4.970   -14.716 1.00 0.00 ? 24  LEU A HB2  2  
ATOM 2319  H HB3  . LEU A 1 24  ? 1.652   5.980   -13.908 1.00 0.00 ? 24  LEU A HB3  2  
ATOM 2320  H HG   . LEU A 1 24  ? 2.696   7.034   -15.901 1.00 0.00 ? 24  LEU A HG   2  
ATOM 2321  H HD11 . LEU A 1 24  ? 2.857   8.240   -13.176 1.00 0.00 ? 24  LEU A HD11 2  
ATOM 2322  H HD12 . LEU A 1 24  ? 1.751   8.598   -14.501 1.00 0.00 ? 24  LEU A HD12 2  
ATOM 2323  H HD13 . LEU A 1 24  ? 3.423   9.153   -14.574 1.00 0.00 ? 24  LEU A HD13 2  
ATOM 2324  H HD21 . LEU A 1 24  ? 5.180   7.198   -14.205 1.00 0.00 ? 24  LEU A HD21 2  
ATOM 2325  H HD22 . LEU A 1 24  ? 4.966   7.760   -15.863 1.00 0.00 ? 24  LEU A HD22 2  
ATOM 2326  H HD23 . LEU A 1 24  ? 4.958   6.032   -15.510 1.00 0.00 ? 24  LEU A HD23 2  
ATOM 2327  N N    . LEU A 1 25  ? 2.802   3.485   -11.833 1.00 0.00 ? 25  LEU A N    2  
ATOM 2328  C CA   . LEU A 1 25  ? 2.040   2.568   -10.992 1.00 0.00 ? 25  LEU A CA   2  
ATOM 2329  C C    . LEU A 1 25  ? 2.903   1.391   -10.548 1.00 0.00 ? 25  LEU A C    2  
ATOM 2330  O O    . LEU A 1 25  ? 3.946   1.115   -11.141 1.00 0.00 ? 25  LEU A O    2  
ATOM 2331  C CB   . LEU A 1 25  ? 0.810   2.058   -11.745 1.00 0.00 ? 25  LEU A CB   2  
ATOM 2332  C CG   . LEU A 1 25  ? 0.977   0.727   -12.480 1.00 0.00 ? 25  LEU A CG   2  
ATOM 2333  C CD1  . LEU A 1 25  ? 0.703   -0.438  -11.543 1.00 0.00 ? 25  LEU A CD1  2  
ATOM 2334  C CD2  . LEU A 1 25  ? 0.058   0.668   -13.691 1.00 0.00 ? 25  LEU A CD2  2  
ATOM 2335  H H    . LEU A 1 25  ? 3.523   3.130   -12.394 1.00 0.00 ? 25  LEU A H    2  
ATOM 2336  H HA   . LEU A 1 25  ? 1.716   3.112   -10.117 1.00 0.00 ? 25  LEU A HA   2  
ATOM 2337  H HB2  . LEU A 1 25  ? 0.009   1.942   -11.030 1.00 0.00 ? 25  LEU A HB2  2  
ATOM 2338  H HB3  . LEU A 1 25  ? 0.534   2.807   -12.473 1.00 0.00 ? 25  LEU A HB3  2  
ATOM 2339  H HG   . LEU A 1 25  ? 1.997   0.642   -12.829 1.00 0.00 ? 25  LEU A HG   2  
ATOM 2340  H HD11 . LEU A 1 25  ? -0.041  -0.149  -10.816 1.00 0.00 ? 25  LEU A HD11 2  
ATOM 2341  H HD12 . LEU A 1 25  ? 1.615   -0.713  -11.034 1.00 0.00 ? 25  LEU A HD12 2  
ATOM 2342  H HD13 . LEU A 1 25  ? 0.341   -1.282  -12.113 1.00 0.00 ? 25  LEU A HD13 2  
ATOM 2343  H HD21 . LEU A 1 25  ? 0.633   0.841   -14.588 1.00 0.00 ? 25  LEU A HD21 2  
ATOM 2344  H HD22 . LEU A 1 25  ? -0.706  1.427   -13.600 1.00 0.00 ? 25  LEU A HD22 2  
ATOM 2345  H HD23 . LEU A 1 25  ? -0.408  -0.306  -13.742 1.00 0.00 ? 25  LEU A HD23 2  
ATOM 2346  N N    . TYR A 1 26  ? 2.460   0.702   -9.503  1.00 0.00 ? 26  TYR A N    2  
ATOM 2347  C CA   . TYR A 1 26  ? 3.192   -0.446  -8.979  1.00 0.00 ? 26  TYR A CA   2  
ATOM 2348  C C    . TYR A 1 26  ? 2.273   -1.654  -8.824  1.00 0.00 ? 26  TYR A C    2  
ATOM 2349  O O    . TYR A 1 26  ? 1.272   -1.599  -8.110  1.00 0.00 ? 26  TYR A O    2  
ATOM 2350  C CB   . TYR A 1 26  ? 3.828   -0.099  -7.631  1.00 0.00 ? 26  TYR A CB   2  
ATOM 2351  C CG   . TYR A 1 26  ? 4.941   0.920   -7.731  1.00 0.00 ? 26  TYR A CG   2  
ATOM 2352  C CD1  . TYR A 1 26  ? 6.064   0.676   -8.512  1.00 0.00 ? 26  TYR A CD1  2  
ATOM 2353  C CD2  . TYR A 1 26  ? 4.870   2.125   -7.045  1.00 0.00 ? 26  TYR A CD2  2  
ATOM 2354  C CE1  . TYR A 1 26  ? 7.084   1.604   -8.606  1.00 0.00 ? 26  TYR A CE1  2  
ATOM 2355  C CE2  . TYR A 1 26  ? 5.883   3.059   -7.134  1.00 0.00 ? 26  TYR A CE2  2  
ATOM 2356  C CZ   . TYR A 1 26  ? 6.988   2.794   -7.915  1.00 0.00 ? 26  TYR A CZ   2  
ATOM 2357  O OH   . TYR A 1 26  ? 8.001   3.721   -8.006  1.00 0.00 ? 26  TYR A OH   2  
ATOM 2358  H H    . TYR A 1 26  ? 1.622   0.971   -9.072  1.00 0.00 ? 26  TYR A H    2  
ATOM 2359  H HA   . TYR A 1 26  ? 3.974   -0.690  -9.683  1.00 0.00 ? 26  TYR A HA   2  
ATOM 2360  H HB2  . TYR A 1 26  ? 3.071   0.301   -6.976  1.00 0.00 ? 26  TYR A HB2  2  
ATOM 2361  H HB3  . TYR A 1 26  ? 4.239   -0.997  -7.194  1.00 0.00 ? 26  TYR A HB3  2  
ATOM 2362  H HD1  . TYR A 1 26  ? 6.136   -0.257  -9.052  1.00 0.00 ? 26  TYR A HD1  2  
ATOM 2363  H HD2  . TYR A 1 26  ? 4.003   2.330   -6.433  1.00 0.00 ? 26  TYR A HD2  2  
ATOM 2364  H HE1  . TYR A 1 26  ? 7.949   1.397   -9.218  1.00 0.00 ? 26  TYR A HE1  2  
ATOM 2365  H HE2  . TYR A 1 26  ? 5.809   3.991   -6.593  1.00 0.00 ? 26  TYR A HE2  2  
ATOM 2366  H HH   . TYR A 1 26  ? 7.685   4.572   -7.691  1.00 0.00 ? 26  TYR A HH   2  
ATOM 2367  N N    . TYR A 1 27  ? 2.623   -2.744  -9.498  1.00 0.00 ? 27  TYR A N    2  
ATOM 2368  C CA   . TYR A 1 27  ? 1.830   -3.966  -9.439  1.00 0.00 ? 27  TYR A CA   2  
ATOM 2369  C C    . TYR A 1 27  ? 2.180   -4.783  -8.199  1.00 0.00 ? 27  TYR A C    2  
ATOM 2370  O O    . TYR A 1 27  ? 3.347   -4.886  -7.820  1.00 0.00 ? 27  TYR A O    2  
ATOM 2371  C CB   . TYR A 1 27  ? 2.054   -4.806  -10.697 1.00 0.00 ? 27  TYR A CB   2  
ATOM 2372  C CG   . TYR A 1 27  ? 1.168   -4.410  -11.856 1.00 0.00 ? 27  TYR A CG   2  
ATOM 2373  C CD1  . TYR A 1 27  ? -0.117  -4.921  -11.981 1.00 0.00 ? 27  TYR A CD1  2  
ATOM 2374  C CD2  . TYR A 1 27  ? 1.617   -3.522  -12.826 1.00 0.00 ? 27  TYR A CD2  2  
ATOM 2375  C CE1  . TYR A 1 27  ? -0.929  -4.562  -13.039 1.00 0.00 ? 27  TYR A CE1  2  
ATOM 2376  C CE2  . TYR A 1 27  ? 0.811   -3.156  -13.887 1.00 0.00 ? 27  TYR A CE2  2  
ATOM 2377  C CZ   . TYR A 1 27  ? -0.461  -3.679  -13.989 1.00 0.00 ? 27  TYR A CZ   2  
ATOM 2378  O OH   . TYR A 1 27  ? -1.267  -3.318  -15.044 1.00 0.00 ? 27  TYR A OH   2  
ATOM 2379  H H    . TYR A 1 27  ? 3.432   -2.726  -10.051 1.00 0.00 ? 27  TYR A H    2  
ATOM 2380  H HA   . TYR A 1 27  ? 0.788   -3.684  -9.387  1.00 0.00 ? 27  TYR A HA   2  
ATOM 2381  H HB2  . TYR A 1 27  ? 3.080   -4.701  -11.013 1.00 0.00 ? 27  TYR A HB2  2  
ATOM 2382  H HB3  . TYR A 1 27  ? 1.857   -5.844  -10.468 1.00 0.00 ? 27  TYR A HB3  2  
ATOM 2383  H HD1  . TYR A 1 27  ? -0.481  -5.613  -11.235 1.00 0.00 ? 27  TYR A HD1  2  
ATOM 2384  H HD2  . TYR A 1 27  ? 2.614   -3.114  -12.744 1.00 0.00 ? 27  TYR A HD2  2  
ATOM 2385  H HE1  . TYR A 1 27  ? -1.926  -4.971  -13.119 1.00 0.00 ? 27  TYR A HE1  2  
ATOM 2386  H HE2  . TYR A 1 27  ? 1.178   -2.464  -14.632 1.00 0.00 ? 27  TYR A HE2  2  
ATOM 2387  H HH   . TYR A 1 27  ? -0.722  -3.012  -15.773 1.00 0.00 ? 27  TYR A HH   2  
ATOM 2388  N N    . ILE A 1 28  ? 1.161   -5.361  -7.572  1.00 0.00 ? 28  ILE A N    2  
ATOM 2389  C CA   . ILE A 1 28  ? 1.360   -6.170  -6.376  1.00 0.00 ? 28  ILE A CA   2  
ATOM 2390  C C    . ILE A 1 28  ? 1.070   -7.641  -6.653  1.00 0.00 ? 28  ILE A C    2  
ATOM 2391  O O    . ILE A 1 28  ? 0.309   -7.975  -7.561  1.00 0.00 ? 28  ILE A O    2  
ATOM 2392  C CB   . ILE A 1 28  ? 0.466   -5.691  -5.217  1.00 0.00 ? 28  ILE A CB   2  
ATOM 2393  C CG1  . ILE A 1 28  ? 0.622   -4.183  -5.012  1.00 0.00 ? 28  ILE A CG1  2  
ATOM 2394  C CG2  . ILE A 1 28  ? 0.808   -6.443  -3.939  1.00 0.00 ? 28  ILE A CG2  2  
ATOM 2395  C CD1  . ILE A 1 28  ? 0.262   -3.722  -3.617  1.00 0.00 ? 28  ILE A CD1  2  
ATOM 2396  H H    . ILE A 1 28  ? 0.254   -5.241  -7.922  1.00 0.00 ? 28  ILE A H    2  
ATOM 2397  H HA   . ILE A 1 28  ? 2.393   -6.068  -6.073  1.00 0.00 ? 28  ILE A HA   2  
ATOM 2398  H HB   . ILE A 1 28  ? -0.560  -5.909  -5.470  1.00 0.00 ? 28  ILE A HB   2  
ATOM 2399  H HG12 . ILE A 1 28  ? 1.647   -3.905  -5.199  1.00 0.00 ? 28  ILE A HG12 2  
ATOM 2400  H HG13 . ILE A 1 28  ? -0.020  -3.664  -5.710  1.00 0.00 ? 28  ILE A HG13 2  
ATOM 2401  H HG21 . ILE A 1 28  ? 0.189   -6.079  -3.131  1.00 0.00 ? 28  ILE A HG21 2  
ATOM 2402  H HG22 . ILE A 1 28  ? 0.627   -7.497  -4.083  1.00 0.00 ? 28  ILE A HG22 2  
ATOM 2403  H HG23 . ILE A 1 28  ? 1.847   -6.285  -3.695  1.00 0.00 ? 28  ILE A HG23 2  
ATOM 2404  H HD11 . ILE A 1 28  ? -0.713  -4.104  -3.353  1.00 0.00 ? 28  ILE A HD11 2  
ATOM 2405  H HD12 . ILE A 1 28  ? 0.995   -4.091  -2.915  1.00 0.00 ? 28  ILE A HD12 2  
ATOM 2406  H HD13 . ILE A 1 28  ? 0.246   -2.643  -3.587  1.00 0.00 ? 28  ILE A HD13 2  
ATOM 2407  N N    . LYS A 1 29  ? 1.681   -8.518  -5.862  1.00 0.00 ? 29  LYS A N    2  
ATOM 2408  C CA   . LYS A 1 29  ? 1.487   -9.954  -6.019  1.00 0.00 ? 29  LYS A CA   2  
ATOM 2409  C C    . LYS A 1 29  ? 1.159   -10.608 -4.680  1.00 0.00 ? 29  LYS A C    2  
ATOM 2410  O O    . LYS A 1 29  ? 0.993   -9.925  -3.670  1.00 0.00 ? 29  LYS A O    2  
ATOM 2411  C CB   . LYS A 1 29  ? 2.740   -10.596 -6.619  1.00 0.00 ? 29  LYS A CB   2  
ATOM 2412  C CG   . LYS A 1 29  ? 4.035   -10.093 -6.004  1.00 0.00 ? 29  LYS A CG   2  
ATOM 2413  C CD   . LYS A 1 29  ? 4.400   -10.877 -4.754  1.00 0.00 ? 29  LYS A CD   2  
ATOM 2414  C CE   . LYS A 1 29  ? 3.914   -10.175 -3.495  1.00 0.00 ? 29  LYS A CE   2  
ATOM 2415  N NZ   . LYS A 1 29  ? 4.943   -10.192 -2.419  1.00 0.00 ? 29  LYS A NZ   2  
ATOM 2416  H H    . LYS A 1 29  ? 2.276   -8.190  -5.155  1.00 0.00 ? 29  LYS A H    2  
ATOM 2417  H HA   . LYS A 1 29  ? 0.658   -10.106 -6.693  1.00 0.00 ? 29  LYS A HA   2  
ATOM 2418  H HB2  . LYS A 1 29  ? 2.687   -11.665 -6.472  1.00 0.00 ? 29  LYS A HB2  2  
ATOM 2419  H HB3  . LYS A 1 29  ? 2.765   -10.388 -7.679  1.00 0.00 ? 29  LYS A HB3  2  
ATOM 2420  H HG2  . LYS A 1 29  ? 4.830   -10.199 -6.726  1.00 0.00 ? 29  LYS A HG2  2  
ATOM 2421  H HG3  . LYS A 1 29  ? 3.918   -9.051  -5.743  1.00 0.00 ? 29  LYS A HG3  2  
ATOM 2422  H HD2  . LYS A 1 29  ? 3.944   -11.854 -4.806  1.00 0.00 ? 29  LYS A HD2  2  
ATOM 2423  H HD3  . LYS A 1 29  ? 5.475   -10.981 -4.706  1.00 0.00 ? 29  LYS A HD3  2  
ATOM 2424  H HE2  . LYS A 1 29  ? 3.677   -9.151  -3.738  1.00 0.00 ? 29  LYS A HE2  2  
ATOM 2425  H HE3  . LYS A 1 29  ? 3.026   -10.675 -3.140  1.00 0.00 ? 29  LYS A HE3  2  
ATOM 2426  H HZ1  . LYS A 1 29  ? 4.970   -9.272  -1.935  1.00 0.00 ? 29  LYS A HZ1  2  
ATOM 2427  H HZ2  . LYS A 1 29  ? 5.881   -10.385 -2.825  1.00 0.00 ? 29  LYS A HZ2  2  
ATOM 2428  H HZ3  . LYS A 1 29  ? 4.721   -10.931 -1.723  1.00 0.00 ? 29  LYS A HZ3  2  
ATOM 2429  N N    . ASP A 1 30  ? 1.069   -11.933 -4.681  1.00 0.00 ? 30  ASP A N    2  
ATOM 2430  C CA   . ASP A 1 30  ? 0.763   -12.679 -3.466  1.00 0.00 ? 30  ASP A CA   2  
ATOM 2431  C C    . ASP A 1 30  ? 2.014   -12.861 -2.611  1.00 0.00 ? 30  ASP A C    2  
ATOM 2432  O O    . ASP A 1 30  ? 3.071   -13.242 -3.112  1.00 0.00 ? 30  ASP A O    2  
ATOM 2433  C CB   . ASP A 1 30  ? 0.167   -14.043 -3.816  1.00 0.00 ? 30  ASP A CB   2  
ATOM 2434  C CG   . ASP A 1 30  ? -1.228  -13.933 -4.399  1.00 0.00 ? 30  ASP A CG   2  
ATOM 2435  O OD1  . ASP A 1 30  ? -1.434  -13.079 -5.287  1.00 0.00 ? 30  ASP A OD1  2  
ATOM 2436  O OD2  . ASP A 1 30  ? -2.114  -14.701 -3.969  1.00 0.00 ? 30  ASP A OD2  2  
ATOM 2437  H H    . ASP A 1 30  ? 1.212   -12.422 -5.519  1.00 0.00 ? 30  ASP A H    2  
ATOM 2438  H HA   . ASP A 1 30  ? 0.037   -12.113 -2.903  1.00 0.00 ? 30  ASP A HA   2  
ATOM 2439  H HB2  . ASP A 1 30  ? 0.802   -14.532 -4.540  1.00 0.00 ? 30  ASP A HB2  2  
ATOM 2440  H HB3  . ASP A 1 30  ? 0.117   -14.647 -2.922  1.00 0.00 ? 30  ASP A HB3  2  
ATOM 2441  N N    . GLY A 1 31  ? 1.885   -12.586 -1.316  1.00 0.00 ? 31  GLY A N    2  
ATOM 2442  C CA   . GLY A 1 31  ? 3.012   -12.724 -0.413  1.00 0.00 ? 31  GLY A CA   2  
ATOM 2443  C C    . GLY A 1 31  ? 3.262   -11.468 0.399   1.00 0.00 ? 31  GLY A C    2  
ATOM 2444  O O    . GLY A 1 31  ? 2.339   -10.915 0.997   1.00 0.00 ? 31  GLY A O    2  
ATOM 2445  H H    . GLY A 1 31  ? 1.018   -12.286 -0.972  1.00 0.00 ? 31  GLY A H    2  
ATOM 2446  H HA2  . GLY A 1 31  ? 2.820   -13.544 0.262   1.00 0.00 ? 31  GLY A HA2  2  
ATOM 2447  H HA3  . GLY A 1 31  ? 3.897   -12.946 -0.991  1.00 0.00 ? 31  GLY A HA3  2  
ATOM 2448  N N    . ILE A 1 32  ? 4.512   -11.019 0.421   1.00 0.00 ? 32  ILE A N    2  
ATOM 2449  C CA   . ILE A 1 32  ? 4.880   -9.821  1.166   1.00 0.00 ? 32  ILE A CA   2  
ATOM 2450  C C    . ILE A 1 32  ? 5.539   -8.789  0.257   1.00 0.00 ? 32  ILE A C    2  
ATOM 2451  O O    . ILE A 1 32  ? 6.597   -9.039  -0.320  1.00 0.00 ? 32  ILE A O    2  
ATOM 2452  C CB   . ILE A 1 32  ? 5.837   -10.152 2.327   1.00 0.00 ? 32  ILE A CB   2  
ATOM 2453  C CG1  . ILE A 1 32  ? 5.066   -10.786 3.487   1.00 0.00 ? 32  ILE A CG1  2  
ATOM 2454  C CG2  . ILE A 1 32  ? 6.562   -8.897  2.789   1.00 0.00 ? 32  ILE A CG2  2  
ATOM 2455  C CD1  . ILE A 1 32  ? 4.171   -9.813  4.221   1.00 0.00 ? 32  ILE A CD1  2  
ATOM 2456  H H    . ILE A 1 32  ? 5.203   -11.504 -0.076  1.00 0.00 ? 32  ILE A H    2  
ATOM 2457  H HA   . ILE A 1 32  ? 3.977   -9.397  1.580   1.00 0.00 ? 32  ILE A HA   2  
ATOM 2458  H HB   . ILE A 1 32  ? 6.574   -10.853 1.967   1.00 0.00 ? 32  ILE A HB   2  
ATOM 2459  H HG12 . ILE A 1 32  ? 4.448   -11.584 3.106   1.00 0.00 ? 32  ILE A HG12 2  
ATOM 2460  H HG13 . ILE A 1 32  ? 5.771   -11.191 4.198   1.00 0.00 ? 32  ILE A HG13 2  
ATOM 2461  H HG21 . ILE A 1 32  ? 5.844   -8.108  2.957   1.00 0.00 ? 32  ILE A HG21 2  
ATOM 2462  H HG22 . ILE A 1 32  ? 7.089   -9.105  3.708   1.00 0.00 ? 32  ILE A HG22 2  
ATOM 2463  H HG23 . ILE A 1 32  ? 7.266   -8.588  2.031   1.00 0.00 ? 32  ILE A HG23 2  
ATOM 2464  H HD11 . ILE A 1 32  ? 3.487   -9.354  3.520   1.00 0.00 ? 32  ILE A HD11 2  
ATOM 2465  H HD12 . ILE A 1 32  ? 3.608   -10.341 4.977   1.00 0.00 ? 32  ILE A HD12 2  
ATOM 2466  H HD13 . ILE A 1 32  ? 4.774   -9.049  4.687   1.00 0.00 ? 32  ILE A HD13 2  
ATOM 2467  N N    . THR A 1 33  ? 4.906   -7.626  0.136   1.00 0.00 ? 33  THR A N    2  
ATOM 2468  C CA   . THR A 1 33  ? 5.430   -6.555  -0.702  1.00 0.00 ? 33  THR A CA   2  
ATOM 2469  C C    . THR A 1 33  ? 5.921   -5.385  0.144   1.00 0.00 ? 33  THR A C    2  
ATOM 2470  O O    . THR A 1 33  ? 5.143   -4.506  0.514   1.00 0.00 ? 33  THR A O    2  
ATOM 2471  C CB   . THR A 1 33  ? 4.367   -6.046  -1.694  1.00 0.00 ? 33  THR A CB   2  
ATOM 2472  O OG1  . THR A 1 33  ? 4.091   -7.052  -2.674  1.00 0.00 ? 33  THR A OG1  2  
ATOM 2473  C CG2  . THR A 1 33  ? 4.836   -4.774  -2.384  1.00 0.00 ? 33  THR A CG2  2  
ATOM 2474  H H    . THR A 1 33  ? 4.066   -7.487  0.621   1.00 0.00 ? 33  THR A H    2  
ATOM 2475  H HA   . THR A 1 33  ? 6.261   -6.950  -1.268  1.00 0.00 ? 33  THR A HA   2  
ATOM 2476  H HB   . THR A 1 33  ? 3.461   -5.828  -1.147  1.00 0.00 ? 33  THR A HB   2  
ATOM 2477  H HG1  . THR A 1 33  ? 4.809   -7.085  -3.311  1.00 0.00 ? 33  THR A HG1  2  
ATOM 2478  H HG21 . THR A 1 33  ? 4.162   -3.965  -2.143  1.00 0.00 ? 33  THR A HG21 2  
ATOM 2479  H HG22 . THR A 1 33  ? 4.847   -4.927  -3.453  1.00 0.00 ? 33  THR A HG22 2  
ATOM 2480  H HG23 . THR A 1 33  ? 5.831   -4.526  -2.045  1.00 0.00 ? 33  THR A HG23 2  
ATOM 2481  N N    . ARG A 1 34  ? 7.215   -5.381  0.446   1.00 0.00 ? 34  ARG A N    2  
ATOM 2482  C CA   . ARG A 1 34  ? 7.808   -4.319  1.249   1.00 0.00 ? 34  ARG A CA   2  
ATOM 2483  C C    . ARG A 1 34  ? 7.967   -3.042  0.430   1.00 0.00 ? 34  ARG A C    2  
ATOM 2484  O O    . ARG A 1 34  ? 8.436   -3.076  -0.708  1.00 0.00 ? 34  ARG A O    2  
ATOM 2485  C CB   . ARG A 1 34  ? 9.168   -4.761  1.793   1.00 0.00 ? 34  ARG A CB   2  
ATOM 2486  C CG   . ARG A 1 34  ? 9.132   -6.101  2.509   1.00 0.00 ? 34  ARG A CG   2  
ATOM 2487  C CD   . ARG A 1 34  ? 10.185  -6.178  3.603   1.00 0.00 ? 34  ARG A CD   2  
ATOM 2488  N NE   . ARG A 1 34  ? 9.973   -7.320  4.488   1.00 0.00 ? 34  ARG A NE   2  
ATOM 2489  C CZ   . ARG A 1 34  ? 10.735  -7.583  5.543   1.00 0.00 ? 34  ARG A CZ   2  
ATOM 2490  N NH1  . ARG A 1 34  ? 11.753  -6.789  5.845   1.00 0.00 ? 34  ARG A NH1  2  
ATOM 2491  N NH2  . ARG A 1 34  ? 10.479  -8.642  6.301   1.00 0.00 ? 34  ARG A NH2  2  
ATOM 2492  H H    . ARG A 1 34  ? 7.784   -6.110  0.122   1.00 0.00 ? 34  ARG A H    2  
ATOM 2493  H HA   . ARG A 1 34  ? 7.146   -4.121  2.079   1.00 0.00 ? 34  ARG A HA   2  
ATOM 2494  H HB2  . ARG A 1 34  ? 9.865   -4.836  0.971   1.00 0.00 ? 34  ARG A HB2  2  
ATOM 2495  H HB3  . ARG A 1 34  ? 9.524   -4.016  2.489   1.00 0.00 ? 34  ARG A HB3  2  
ATOM 2496  H HG2  . ARG A 1 34  ? 8.156   -6.235  2.953   1.00 0.00 ? 34  ARG A HG2  2  
ATOM 2497  H HG3  . ARG A 1 34  ? 9.313   -6.887  1.791   1.00 0.00 ? 34  ARG A HG3  2  
ATOM 2498  H HD2  . ARG A 1 34  ? 11.157  -6.267  3.143   1.00 0.00 ? 34  ARG A HD2  2  
ATOM 2499  H HD3  . ARG A 1 34  ? 10.145  -5.270  4.186   1.00 0.00 ? 34  ARG A HD3  2  
ATOM 2500  H HE   . ARG A 1 34  ? 9.226   -7.920  4.283   1.00 0.00 ? 34  ARG A HE   2  
ATOM 2501  H HH11 . ARG A 1 34  ? 11.948  -5.990  5.277   1.00 0.00 ? 34  ARG A HH11 2  
ATOM 2502  H HH12 . ARG A 1 34  ? 12.324  -6.989  6.641   1.00 0.00 ? 34  ARG A HH12 2  
ATOM 2503  H HH21 . ARG A 1 34  ? 9.712   -9.243  6.077   1.00 0.00 ? 34  ARG A HH21 2  
ATOM 2504  H HH22 . ARG A 1 34  ? 11.053  -8.840  7.095   1.00 0.00 ? 34  ARG A HH22 2  
ATOM 2505  N N    . VAL A 1 35  ? 7.572   -1.916  1.016   1.00 0.00 ? 35  VAL A N    2  
ATOM 2506  C CA   . VAL A 1 35  ? 7.671   -0.627  0.341   1.00 0.00 ? 35  VAL A CA   2  
ATOM 2507  C C    . VAL A 1 35  ? 8.712   0.264   1.008   1.00 0.00 ? 35  VAL A C    2  
ATOM 2508  O O    . VAL A 1 35  ? 8.417   0.967   1.974   1.00 0.00 ? 35  VAL A O    2  
ATOM 2509  C CB   . VAL A 1 35  ? 6.316   0.105   0.329   1.00 0.00 ? 35  VAL A CB   2  
ATOM 2510  C CG1  . VAL A 1 35  ? 6.334   1.245   -0.678  1.00 0.00 ? 35  VAL A CG1  2  
ATOM 2511  C CG2  . VAL A 1 35  ? 5.187   -0.868  0.025   1.00 0.00 ? 35  VAL A CG2  2  
ATOM 2512  H H    . VAL A 1 35  ? 7.206   -1.953  1.924   1.00 0.00 ? 35  VAL A H    2  
ATOM 2513  H HA   . VAL A 1 35  ? 7.968   -0.808  -0.682  1.00 0.00 ? 35  VAL A HA   2  
ATOM 2514  H HB   . VAL A 1 35  ? 6.147   0.524   1.310   1.00 0.00 ? 35  VAL A HB   2  
ATOM 2515  H HG11 . VAL A 1 35  ? 6.603   2.163   -0.177  1.00 0.00 ? 35  VAL A HG11 2  
ATOM 2516  H HG12 . VAL A 1 35  ? 7.056   1.030   -1.452  1.00 0.00 ? 35  VAL A HG12 2  
ATOM 2517  H HG13 . VAL A 1 35  ? 5.353   1.350   -1.119  1.00 0.00 ? 35  VAL A HG13 2  
ATOM 2518  H HG21 . VAL A 1 35  ? 4.684   -1.134  0.943   1.00 0.00 ? 35  VAL A HG21 2  
ATOM 2519  H HG22 . VAL A 1 35  ? 4.484   -0.404  -0.650  1.00 0.00 ? 35  VAL A HG22 2  
ATOM 2520  H HG23 . VAL A 1 35  ? 5.592   -1.759  -0.433  1.00 0.00 ? 35  VAL A HG23 2  
ATOM 2521  N N    . GLY A 1 36  ? 9.934   0.231   0.485   1.00 0.00 ? 36  GLY A N    2  
ATOM 2522  C CA   . GLY A 1 36  ? 11.002  1.041   1.042   1.00 0.00 ? 36  GLY A CA   2  
ATOM 2523  C C    . GLY A 1 36  ? 12.056  1.397   0.013   1.00 0.00 ? 36  GLY A C    2  
ATOM 2524  O O    . GLY A 1 36  ? 11.736  1.893   -1.067  1.00 0.00 ? 36  GLY A O    2  
ATOM 2525  H H    . GLY A 1 36  ? 10.112  -0.348  -0.286  1.00 0.00 ? 36  GLY A H    2  
ATOM 2526  H HA2  . GLY A 1 36  ? 10.579  1.951   1.439   1.00 0.00 ? 36  GLY A HA2  2  
ATOM 2527  H HA3  . GLY A 1 36  ? 11.471  0.493   1.846   1.00 0.00 ? 36  GLY A HA3  2  
ATOM 2528  N N    . GLN A 1 37  ? 13.318  1.146   0.349   1.00 0.00 ? 37  GLN A N    2  
ATOM 2529  C CA   . GLN A 1 37  ? 14.423  1.446   -0.554  1.00 0.00 ? 37  GLN A CA   2  
ATOM 2530  C C    . GLN A 1 37  ? 15.144  0.170   -0.974  1.00 0.00 ? 37  GLN A C    2  
ATOM 2531  O O    . GLN A 1 37  ? 14.831  -0.918  -0.494  1.00 0.00 ? 37  GLN A O    2  
ATOM 2532  C CB   . GLN A 1 37  ? 15.408  2.407   0.114   1.00 0.00 ? 37  GLN A CB   2  
ATOM 2533  C CG   . GLN A 1 37  ? 14.879  3.827   0.245   1.00 0.00 ? 37  GLN A CG   2  
ATOM 2534  C CD   . GLN A 1 37  ? 14.238  4.331   -1.032  1.00 0.00 ? 37  GLN A CD   2  
ATOM 2535  O OE1  . GLN A 1 37  ? 14.904  4.915   -1.887  1.00 0.00 ? 37  GLN A OE1  2  
ATOM 2536  N NE2  . GLN A 1 37  ? 12.936  4.107   -1.170  1.00 0.00 ? 37  GLN A NE2  2  
ATOM 2537  H H    . GLN A 1 37  ? 13.509  0.750   1.224   1.00 0.00 ? 37  GLN A H    2  
ATOM 2538  H HA   . GLN A 1 37  ? 14.013  1.920   -1.433  1.00 0.00 ? 37  GLN A HA   2  
ATOM 2539  H HB2  . GLN A 1 37  ? 15.638  2.039   1.103   1.00 0.00 ? 37  GLN A HB2  2  
ATOM 2540  H HB3  . GLN A 1 37  ? 16.315  2.437   -0.470  1.00 0.00 ? 37  GLN A HB3  2  
ATOM 2541  H HG2  . GLN A 1 37  ? 14.142  3.851   1.034   1.00 0.00 ? 37  GLN A HG2  2  
ATOM 2542  H HG3  . GLN A 1 37  ? 15.700  4.480   0.502   1.00 0.00 ? 37  GLN A HG3  2  
ATOM 2543  H HE21 . GLN A 1 37  ? 12.469  3.636   -0.447  1.00 0.00 ? 37  GLN A HE21 2  
ATOM 2544  H HE22 . GLN A 1 37  ? 12.496  4.423   -1.985  1.00 0.00 ? 37  GLN A HE22 2  
ATOM 2545  N N    . ALA A 1 38  ? 16.111  0.313   -1.875  1.00 0.00 ? 38  ALA A N    2  
ATOM 2546  C CA   . ALA A 1 38  ? 16.879  -0.828  -2.358  1.00 0.00 ? 38  ALA A CA   2  
ATOM 2547  C C    . ALA A 1 38  ? 18.044  -1.141  -1.426  1.00 0.00 ? 38  ALA A C    2  
ATOM 2548  O O    . ALA A 1 38  ? 18.793  -2.092  -1.651  1.00 0.00 ? 38  ALA A O    2  
ATOM 2549  C CB   . ALA A 1 38  ? 17.385  -0.564  -3.769  1.00 0.00 ? 38  ALA A CB   2  
ATOM 2550  H H    . ALA A 1 38  ? 16.314  1.207   -2.220  1.00 0.00 ? 38  ALA A H    2  
ATOM 2551  H HA   . ALA A 1 38  ? 16.219  -1.683  -2.393  1.00 0.00 ? 38  ALA A HA   2  
ATOM 2552  H HB1  . ALA A 1 38  ? 17.571  0.493   -3.892  1.00 0.00 ? 38  ALA A HB1  2  
ATOM 2553  H HB2  . ALA A 1 38  ? 18.301  -1.112  -3.930  1.00 0.00 ? 38  ALA A HB2  2  
ATOM 2554  H HB3  . ALA A 1 38  ? 16.642  -0.885  -4.484  1.00 0.00 ? 38  ALA A HB3  2  
ATOM 2555  N N    . ASP A 1 39  ? 18.191  -0.336  -0.380  1.00 0.00 ? 39  ASP A N    2  
ATOM 2556  C CA   . ASP A 1 39  ? 19.266  -0.528  0.587   1.00 0.00 ? 39  ASP A CA   2  
ATOM 2557  C C    . ASP A 1 39  ? 18.762  -1.275  1.818   1.00 0.00 ? 39  ASP A C    2  
ATOM 2558  O O    . ASP A 1 39  ? 19.534  -1.929  2.518   1.00 0.00 ? 39  ASP A O    2  
ATOM 2559  C CB   . ASP A 1 39  ? 19.856  0.822   1.000   1.00 0.00 ? 39  ASP A CB   2  
ATOM 2560  C CG   . ASP A 1 39  ? 18.800  1.785   1.506   1.00 0.00 ? 39  ASP A CG   2  
ATOM 2561  O OD1  . ASP A 1 39  ? 18.150  1.471   2.526   1.00 0.00 ? 39  ASP A OD1  2  
ATOM 2562  O OD2  . ASP A 1 39  ? 18.624  2.852   0.883   1.00 0.00 ? 39  ASP A OD2  2  
ATOM 2563  H H    . ASP A 1 39  ? 17.562  0.405   -0.255  1.00 0.00 ? 39  ASP A H    2  
ATOM 2564  H HA   . ASP A 1 39  ? 20.037  -1.117  0.114   1.00 0.00 ? 39  ASP A HA   2  
ATOM 2565  H HB2  . ASP A 1 39  ? 20.580  0.665   1.787   1.00 0.00 ? 39  ASP A HB2  2  
ATOM 2566  H HB3  . ASP A 1 39  ? 20.347  1.269   0.148   1.00 0.00 ? 39  ASP A HB3  2  
ATOM 2567  N N    . ALA A 1 40  ? 17.463  -1.171  2.076   1.00 0.00 ? 40  ALA A N    2  
ATOM 2568  C CA   . ALA A 1 40  ? 16.856  -1.838  3.222   1.00 0.00 ? 40  ALA A CA   2  
ATOM 2569  C C    . ALA A 1 40  ? 17.401  -3.253  3.386   1.00 0.00 ? 40  ALA A C    2  
ATOM 2570  O O    . ALA A 1 40  ? 17.635  -3.955  2.403   1.00 0.00 ? 40  ALA A O    2  
ATOM 2571  C CB   . ALA A 1 40  ? 15.342  -1.867  3.075   1.00 0.00 ? 40  ALA A CB   2  
ATOM 2572  H H    . ALA A 1 40  ? 16.899  -0.635  1.481   1.00 0.00 ? 40  ALA A H    2  
ATOM 2573  H HA   . ALA A 1 40  ? 17.096  -1.266  4.107   1.00 0.00 ? 40  ALA A HA   2  
ATOM 2574  H HB1  . ALA A 1 40  ? 14.884  -1.723  4.042   1.00 0.00 ? 40  ALA A HB1  2  
ATOM 2575  H HB2  . ALA A 1 40  ? 15.031  -1.076  2.407   1.00 0.00 ? 40  ALA A HB2  2  
ATOM 2576  H HB3  . ALA A 1 40  ? 15.038  -2.821  2.670   1.00 0.00 ? 40  ALA A HB3  2  
ATOM 2577  N N    . GLU A 1 41  ? 17.602  -3.664  4.634   1.00 0.00 ? 41  GLU A N    2  
ATOM 2578  C CA   . GLU A 1 41  ? 18.121  -4.995  4.925   1.00 0.00 ? 41  GLU A CA   2  
ATOM 2579  C C    . GLU A 1 41  ? 17.584  -6.018  3.928   1.00 0.00 ? 41  GLU A C    2  
ATOM 2580  O O    . GLU A 1 41  ? 18.352  -6.723  3.273   1.00 0.00 ? 41  GLU A O    2  
ATOM 2581  C CB   . GLU A 1 41  ? 17.749  -5.411  6.349   1.00 0.00 ? 41  GLU A CB   2  
ATOM 2582  C CG   . GLU A 1 41  ? 17.691  -4.250  7.327   1.00 0.00 ? 41  GLU A CG   2  
ATOM 2583  C CD   . GLU A 1 41  ? 18.902  -3.344  7.230   1.00 0.00 ? 41  GLU A CD   2  
ATOM 2584  O OE1  . GLU A 1 41  ? 20.033  -3.842  7.410   1.00 0.00 ? 41  GLU A OE1  2  
ATOM 2585  O OE2  . GLU A 1 41  ? 18.719  -2.135  6.972   1.00 0.00 ? 41  GLU A OE2  2  
ATOM 2586  H H    . GLU A 1 41  ? 17.396  -3.058  5.376   1.00 0.00 ? 41  GLU A H    2  
ATOM 2587  H HA   . GLU A 1 41  ? 19.196  -4.957  4.840   1.00 0.00 ? 41  GLU A HA   2  
ATOM 2588  H HB2  . GLU A 1 41  ? 16.781  -5.889  6.331   1.00 0.00 ? 41  GLU A HB2  2  
ATOM 2589  H HB3  . GLU A 1 41  ? 18.483  -6.119  6.707   1.00 0.00 ? 41  GLU A HB3  2  
ATOM 2590  H HG2  . GLU A 1 41  ? 16.806  -3.666  7.121   1.00 0.00 ? 41  GLU A HG2  2  
ATOM 2591  H HG3  . GLU A 1 41  ? 17.634  -4.644  8.332   1.00 0.00 ? 41  GLU A HG3  2  
ATOM 2592  N N    . ARG A 1 42  ? 16.262  -6.093  3.819   1.00 0.00 ? 42  ARG A N    2  
ATOM 2593  C CA   . ARG A 1 42  ? 15.622  -7.030  2.904   1.00 0.00 ? 42  ARG A CA   2  
ATOM 2594  C C    . ARG A 1 42  ? 15.069  -6.304  1.681   1.00 0.00 ? 42  ARG A C    2  
ATOM 2595  O O    . ARG A 1 42  ? 14.245  -5.398  1.805   1.00 0.00 ? 42  ARG A O    2  
ATOM 2596  C CB   . ARG A 1 42  ? 14.497  -7.783  3.616   1.00 0.00 ? 42  ARG A CB   2  
ATOM 2597  C CG   . ARG A 1 42  ? 14.964  -9.038  4.335   1.00 0.00 ? 42  ARG A CG   2  
ATOM 2598  C CD   . ARG A 1 42  ? 16.138  -8.749  5.256   1.00 0.00 ? 42  ARG A CD   2  
ATOM 2599  N NE   . ARG A 1 42  ? 16.729  -9.972  5.792   1.00 0.00 ? 42  ARG A NE   2  
ATOM 2600  C CZ   . ARG A 1 42  ? 17.490  -10.006 6.880   1.00 0.00 ? 42  ARG A CZ   2  
ATOM 2601  N NH1  . ARG A 1 42  ? 17.752  -8.889  7.544   1.00 0.00 ? 42  ARG A NH1  2  
ATOM 2602  N NH2  . ARG A 1 42  ? 17.991  -11.158 7.305   1.00 0.00 ? 42  ARG A NH2  2  
ATOM 2603  H H    . ARG A 1 42  ? 15.703  -5.504  4.368   1.00 0.00 ? 42  ARG A H    2  
ATOM 2604  H HA   . ARG A 1 42  ? 16.369  -7.739  2.580   1.00 0.00 ? 42  ARG A HA   2  
ATOM 2605  H HB2  . ARG A 1 42  ? 14.043  -7.126  4.344   1.00 0.00 ? 42  ARG A HB2  2  
ATOM 2606  H HB3  . ARG A 1 42  ? 13.753  -8.068  2.887   1.00 0.00 ? 42  ARG A HB3  2  
ATOM 2607  H HG2  . ARG A 1 42  ? 14.147  -9.430  4.924   1.00 0.00 ? 42  ARG A HG2  2  
ATOM 2608  H HG3  . ARG A 1 42  ? 15.265  -9.771  3.601   1.00 0.00 ? 42  ARG A HG3  2  
ATOM 2609  H HD2  . ARG A 1 42  ? 16.891  -8.211  4.699   1.00 0.00 ? 42  ARG A HD2  2  
ATOM 2610  H HD3  . ARG A 1 42  ? 15.793  -8.137  6.076   1.00 0.00 ? 42  ARG A HD3  2  
ATOM 2611  H HE   . ARG A 1 42  ? 16.548  -10.809 5.317   1.00 0.00 ? 42  ARG A HE   2  
ATOM 2612  H HH11 . ARG A 1 42  ? 17.375  -8.019  7.226   1.00 0.00 ? 42  ARG A HH11 2  
ATOM 2613  H HH12 . ARG A 1 42  ? 18.325  -8.917  8.364   1.00 0.00 ? 42  ARG A HH12 2  
ATOM 2614  H HH21 . ARG A 1 42  ? 17.796  -12.003 6.807   1.00 0.00 ? 42  ARG A HH21 2  
ATOM 2615  H HH22 . ARG A 1 42  ? 18.564  -11.182 8.124   1.00 0.00 ? 42  ARG A HH22 2  
ATOM 2616  N N    . ARG A 1 43  ? 15.528  -6.709  0.502   1.00 0.00 ? 43  ARG A N    2  
ATOM 2617  C CA   . ARG A 1 43  ? 15.080  -6.097  -0.743  1.00 0.00 ? 43  ARG A CA   2  
ATOM 2618  C C    . ARG A 1 43  ? 13.600  -5.734  -0.670  1.00 0.00 ? 43  ARG A C    2  
ATOM 2619  O O    . ARG A 1 43  ? 12.775  -6.542  -0.244  1.00 0.00 ? 43  ARG A O    2  
ATOM 2620  C CB   . ARG A 1 43  ? 15.327  -7.043  -1.920  1.00 0.00 ? 43  ARG A CB   2  
ATOM 2621  C CG   . ARG A 1 43  ? 15.024  -6.423  -3.274  1.00 0.00 ? 43  ARG A CG   2  
ATOM 2622  C CD   . ARG A 1 43  ? 16.147  -5.503  -3.729  1.00 0.00 ? 43  ARG A CD   2  
ATOM 2623  N NE   . ARG A 1 43  ? 17.262  -6.246  -4.309  1.00 0.00 ? 43  ARG A NE   2  
ATOM 2624  C CZ   . ARG A 1 43  ? 18.432  -5.695  -4.615  1.00 0.00 ? 43  ARG A CZ   2  
ATOM 2625  N NH1  . ARG A 1 43  ? 18.637  -4.404  -4.398  1.00 0.00 ? 43  ARG A NH1  2  
ATOM 2626  N NH2  . ARG A 1 43  ? 19.398  -6.438  -5.140  1.00 0.00 ? 43  ARG A NH2  2  
ATOM 2627  H H    . ARG A 1 43  ? 16.184  -7.437  0.467   1.00 0.00 ? 43  ARG A H    2  
ATOM 2628  H HA   . ARG A 1 43  ? 15.653  -5.193  -0.893  1.00 0.00 ? 43  ARG A HA   2  
ATOM 2629  H HB2  . ARG A 1 43  ? 16.363  -7.347  -1.911  1.00 0.00 ? 43  ARG A HB2  2  
ATOM 2630  H HB3  . ARG A 1 43  ? 14.703  -7.916  -1.800  1.00 0.00 ? 43  ARG A HB3  2  
ATOM 2631  H HG2  . ARG A 1 43  ? 14.903  -7.211  -4.002  1.00 0.00 ? 43  ARG A HG2  2  
ATOM 2632  H HG3  . ARG A 1 43  ? 14.110  -5.853  -3.202  1.00 0.00 ? 43  ARG A HG3  2  
ATOM 2633  H HD2  . ARG A 1 43  ? 15.757  -4.821  -4.469  1.00 0.00 ? 43  ARG A HD2  2  
ATOM 2634  H HD3  . ARG A 1 43  ? 16.503  -4.944  -2.876  1.00 0.00 ? 43  ARG A HD3  2  
ATOM 2635  H HE   . ARG A 1 43  ? 17.132  -7.202  -4.478  1.00 0.00 ? 43  ARG A HE   2  
ATOM 2636  H HH11 . ARG A 1 43  ? 17.911  -3.843  -4.002  1.00 0.00 ? 43  ARG A HH11 2  
ATOM 2637  H HH12 . ARG A 1 43  ? 19.519  -3.992  -4.629  1.00 0.00 ? 43  ARG A HH12 2  
ATOM 2638  H HH21 . ARG A 1 43  ? 19.247  -7.412  -5.305  1.00 0.00 ? 43  ARG A HH21 2  
ATOM 2639  H HH22 . ARG A 1 43  ? 20.278  -6.022  -5.371  1.00 0.00 ? 43  ARG A HH22 2  
ATOM 2640  N N    . GLN A 1 44  ? 13.273  -4.515  -1.086  1.00 0.00 ? 44  GLN A N    2  
ATOM 2641  C CA   . GLN A 1 44  ? 11.892  -4.046  -1.066  1.00 0.00 ? 44  GLN A CA   2  
ATOM 2642  C C    . GLN A 1 44  ? 11.269  -4.128  -2.455  1.00 0.00 ? 44  GLN A C    2  
ATOM 2643  O O    . GLN A 1 44  ? 11.854  -3.670  -3.437  1.00 0.00 ? 44  GLN A O    2  
ATOM 2644  C CB   . GLN A 1 44  ? 11.828  -2.608  -0.549  1.00 0.00 ? 44  GLN A CB   2  
ATOM 2645  C CG   . GLN A 1 44  ? 12.527  -2.409  0.786   1.00 0.00 ? 44  GLN A CG   2  
ATOM 2646  C CD   . GLN A 1 44  ? 11.655  -2.799  1.964   1.00 0.00 ? 44  GLN A CD   2  
ATOM 2647  O OE1  . GLN A 1 44  ? 10.660  -2.137  2.261   1.00 0.00 ? 44  GLN A OE1  2  
ATOM 2648  N NE2  . GLN A 1 44  ? 12.026  -3.877  2.644   1.00 0.00 ? 44  GLN A NE2  2  
ATOM 2649  H H    . GLN A 1 44  ? 13.976  -3.918  -1.414  1.00 0.00 ? 44  GLN A H    2  
ATOM 2650  H HA   . GLN A 1 44  ? 11.335  -4.685  -0.397  1.00 0.00 ? 44  GLN A HA   2  
ATOM 2651  H HB2  . GLN A 1 44  ? 12.291  -1.956  -1.274  1.00 0.00 ? 44  GLN A HB2  2  
ATOM 2652  H HB3  . GLN A 1 44  ? 10.792  -2.326  -0.434  1.00 0.00 ? 44  GLN A HB3  2  
ATOM 2653  H HG2  . GLN A 1 44  ? 13.420  -3.015  0.804   1.00 0.00 ? 44  GLN A HG2  2  
ATOM 2654  H HG3  . GLN A 1 44  ? 12.797  -1.368  0.885   1.00 0.00 ? 44  GLN A HG3  2  
ATOM 2655  H HE21 . GLN A 1 44  ? 12.831  -4.354  2.352   1.00 0.00 ? 44  GLN A HE21 2  
ATOM 2656  H HE22 . GLN A 1 44  ? 11.482  -4.151  3.411   1.00 0.00 ? 44  GLN A HE22 2  
ATOM 2657  N N    . ASP A 1 45  ? 10.080  -4.715  -2.531  1.00 0.00 ? 45  ASP A N    2  
ATOM 2658  C CA   . ASP A 1 45  ? 9.376   -4.857  -3.801  1.00 0.00 ? 45  ASP A CA   2  
ATOM 2659  C C    . ASP A 1 45  ? 9.295   -3.519  -4.529  1.00 0.00 ? 45  ASP A C    2  
ATOM 2660  O O    . ASP A 1 45  ? 9.648   -3.419  -5.704  1.00 0.00 ? 45  ASP A O    2  
ATOM 2661  C CB   . ASP A 1 45  ? 7.970   -5.412  -3.570  1.00 0.00 ? 45  ASP A CB   2  
ATOM 2662  C CG   . ASP A 1 45  ? 7.478   -6.246  -4.736  1.00 0.00 ? 45  ASP A CG   2  
ATOM 2663  O OD1  . ASP A 1 45  ? 7.360   -5.696  -5.851  1.00 0.00 ? 45  ASP A OD1  2  
ATOM 2664  O OD2  . ASP A 1 45  ? 7.212   -7.449  -4.535  1.00 0.00 ? 45  ASP A OD2  2  
ATOM 2665  H H    . ASP A 1 45  ? 9.664   -5.061  -1.713  1.00 0.00 ? 45  ASP A H    2  
ATOM 2666  H HA   . ASP A 1 45  ? 9.932   -5.552  -4.412  1.00 0.00 ? 45  ASP A HA   2  
ATOM 2667  H HB2  . ASP A 1 45  ? 7.976   -6.032  -2.685  1.00 0.00 ? 45  ASP A HB2  2  
ATOM 2668  H HB3  . ASP A 1 45  ? 7.285   -4.590  -3.424  1.00 0.00 ? 45  ASP A HB3  2  
ATOM 2669  N N    . ILE A 1 46  ? 8.827   -2.494  -3.824  1.00 0.00 ? 46  ILE A N    2  
ATOM 2670  C CA   . ILE A 1 46  ? 8.700   -1.163  -4.404  1.00 0.00 ? 46  ILE A CA   2  
ATOM 2671  C C    . ILE A 1 46  ? 9.721   -0.203  -3.804  1.00 0.00 ? 46  ILE A C    2  
ATOM 2672  O O    . ILE A 1 46  ? 9.693   0.083   -2.607  1.00 0.00 ? 46  ILE A O    2  
ATOM 2673  C CB   . ILE A 1 46  ? 7.286   -0.590  -4.192  1.00 0.00 ? 46  ILE A CB   2  
ATOM 2674  C CG1  . ILE A 1 46  ? 6.282   -1.301  -5.100  1.00 0.00 ? 46  ILE A CG1  2  
ATOM 2675  C CG2  . ILE A 1 46  ? 7.278   0.909   -4.455  1.00 0.00 ? 46  ILE A CG2  2  
ATOM 2676  C CD1  . ILE A 1 46  ? 4.881   -1.350  -4.531  1.00 0.00 ? 46  ILE A CD1  2  
ATOM 2677  H H    . ILE A 1 46  ? 8.562   -2.637  -2.892  1.00 0.00 ? 46  ILE A H    2  
ATOM 2678  H HA   . ILE A 1 46  ? 8.878   -1.244  -5.466  1.00 0.00 ? 46  ILE A HA   2  
ATOM 2679  H HB   . ILE A 1 46  ? 7.007   -0.751  -3.162  1.00 0.00 ? 46  ILE A HB   2  
ATOM 2680  H HG12 . ILE A 1 46  ? 6.237   -0.789  -6.048  1.00 0.00 ? 46  ILE A HG12 2  
ATOM 2681  H HG13 . ILE A 1 46  ? 6.611   -2.318  -5.261  1.00 0.00 ? 46  ILE A HG13 2  
ATOM 2682  H HG21 . ILE A 1 46  ? 7.533   1.435   -3.547  1.00 0.00 ? 46  ILE A HG21 2  
ATOM 2683  H HG22 . ILE A 1 46  ? 8.001   1.143   -5.221  1.00 0.00 ? 46  ILE A HG22 2  
ATOM 2684  H HG23 . ILE A 1 46  ? 6.295   1.212   -4.782  1.00 0.00 ? 46  ILE A HG23 2  
ATOM 2685  H HD11 . ILE A 1 46  ? 4.922   -1.207  -3.461  1.00 0.00 ? 46  ILE A HD11 2  
ATOM 2686  H HD12 . ILE A 1 46  ? 4.285   -0.566  -4.975  1.00 0.00 ? 46  ILE A HD12 2  
ATOM 2687  H HD13 . ILE A 1 46  ? 4.436   -2.309  -4.749  1.00 0.00 ? 46  ILE A HD13 2  
ATOM 2688  N N    . VAL A 1 47  ? 10.623  0.295   -4.645  1.00 0.00 ? 47  VAL A N    2  
ATOM 2689  C CA   . VAL A 1 47  ? 11.652  1.226   -4.200  1.00 0.00 ? 47  VAL A CA   2  
ATOM 2690  C C    . VAL A 1 47  ? 11.264  2.666   -4.516  1.00 0.00 ? 47  VAL A C    2  
ATOM 2691  O O    . VAL A 1 47  ? 11.312  3.096   -5.669  1.00 0.00 ? 47  VAL A O    2  
ATOM 2692  C CB   . VAL A 1 47  ? 13.011  0.917   -4.856  1.00 0.00 ? 47  VAL A CB   2  
ATOM 2693  C CG1  . VAL A 1 47  ? 14.107  1.777   -4.245  1.00 0.00 ? 47  VAL A CG1  2  
ATOM 2694  C CG2  . VAL A 1 47  ? 13.343  -0.561  -4.720  1.00 0.00 ? 47  VAL A CG2  2  
ATOM 2695  H H    . VAL A 1 47  ? 10.594  0.030   -5.588  1.00 0.00 ? 47  VAL A H    2  
ATOM 2696  H HA   . VAL A 1 47  ? 11.759  1.119   -3.130  1.00 0.00 ? 47  VAL A HA   2  
ATOM 2697  H HB   . VAL A 1 47  ? 12.942  1.154   -5.908  1.00 0.00 ? 47  VAL A HB   2  
ATOM 2698  H HG11 . VAL A 1 47  ? 13.710  2.755   -4.015  1.00 0.00 ? 47  VAL A HG11 2  
ATOM 2699  H HG12 . VAL A 1 47  ? 14.468  1.311   -3.340  1.00 0.00 ? 47  VAL A HG12 2  
ATOM 2700  H HG13 . VAL A 1 47  ? 14.920  1.876   -4.949  1.00 0.00 ? 47  VAL A HG13 2  
ATOM 2701  H HG21 . VAL A 1 47  ? 13.291  -1.033  -5.690  1.00 0.00 ? 47  VAL A HG21 2  
ATOM 2702  H HG22 . VAL A 1 47  ? 14.340  -0.670  -4.320  1.00 0.00 ? 47  VAL A HG22 2  
ATOM 2703  H HG23 . VAL A 1 47  ? 12.635  -1.030  -4.053  1.00 0.00 ? 47  VAL A HG23 2  
ATOM 2704  N N    . LEU A 1 48  ? 10.878  3.409   -3.484  1.00 0.00 ? 48  LEU A N    2  
ATOM 2705  C CA   . LEU A 1 48  ? 10.482  4.803   -3.650  1.00 0.00 ? 48  LEU A CA   2  
ATOM 2706  C C    . LEU A 1 48  ? 11.699  5.690   -3.893  1.00 0.00 ? 48  LEU A C    2  
ATOM 2707  O O    . LEU A 1 48  ? 12.839  5.252   -3.742  1.00 0.00 ? 48  LEU A O    2  
ATOM 2708  C CB   . LEU A 1 48  ? 9.722   5.288   -2.414  1.00 0.00 ? 48  LEU A CB   2  
ATOM 2709  C CG   . LEU A 1 48  ? 8.462   4.502   -2.049  1.00 0.00 ? 48  LEU A CG   2  
ATOM 2710  C CD1  . LEU A 1 48  ? 7.761   4.005   -3.304  1.00 0.00 ? 48  LEU A CD1  2  
ATOM 2711  C CD2  . LEU A 1 48  ? 8.807   3.337   -1.133  1.00 0.00 ? 48  LEU A CD2  2  
ATOM 2712  H H    . LEU A 1 48  ? 10.860  3.012   -2.588  1.00 0.00 ? 48  LEU A H    2  
ATOM 2713  H HA   . LEU A 1 48  ? 9.831   4.862   -4.509  1.00 0.00 ? 48  LEU A HA   2  
ATOM 2714  H HB2  . LEU A 1 48  ? 10.395  5.242   -1.573  1.00 0.00 ? 48  LEU A HB2  2  
ATOM 2715  H HB3  . LEU A 1 48  ? 9.433   6.316   -2.587  1.00 0.00 ? 48  LEU A HB3  2  
ATOM 2716  H HG   . LEU A 1 48  ? 7.779   5.153   -1.522  1.00 0.00 ? 48  LEU A HG   2  
ATOM 2717  H HD11 . LEU A 1 48  ? 8.424   3.356   -3.854  1.00 0.00 ? 48  LEU A HD11 2  
ATOM 2718  H HD12 . LEU A 1 48  ? 7.488   4.848   -3.922  1.00 0.00 ? 48  LEU A HD12 2  
ATOM 2719  H HD13 . LEU A 1 48  ? 6.870   3.460   -3.027  1.00 0.00 ? 48  LEU A HD13 2  
ATOM 2720  H HD21 . LEU A 1 48  ? 9.861   3.363   -0.900  1.00 0.00 ? 48  LEU A HD21 2  
ATOM 2721  H HD22 . LEU A 1 48  ? 8.570   2.407   -1.628  1.00 0.00 ? 48  LEU A HD22 2  
ATOM 2722  H HD23 . LEU A 1 48  ? 8.234   3.415   -0.220  1.00 0.00 ? 48  LEU A HD23 2  
ATOM 2723  N N    . SER A 1 49  ? 11.448  6.940   -4.270  1.00 0.00 ? 49  SER A N    2  
ATOM 2724  C CA   . SER A 1 49  ? 12.522  7.889   -4.536  1.00 0.00 ? 49  SER A CA   2  
ATOM 2725  C C    . SER A 1 49  ? 12.743  8.809   -3.339  1.00 0.00 ? 49  SER A C    2  
ATOM 2726  O O    . SER A 1 49  ? 11.964  8.805   -2.387  1.00 0.00 ? 49  SER A O    2  
ATOM 2727  C CB   . SER A 1 49  ? 12.202  8.719   -5.780  1.00 0.00 ? 49  SER A CB   2  
ATOM 2728  O OG   . SER A 1 49  ? 11.849  7.887   -6.871  1.00 0.00 ? 49  SER A OG   2  
ATOM 2729  H H    . SER A 1 49  ? 10.517  7.230   -4.373  1.00 0.00 ? 49  SER A H    2  
ATOM 2730  H HA   . SER A 1 49  ? 13.426  7.325   -4.712  1.00 0.00 ? 49  SER A HA   2  
ATOM 2731  H HB2  . SER A 1 49  ? 11.377  9.381   -5.566  1.00 0.00 ? 49  SER A HB2  2  
ATOM 2732  H HB3  . SER A 1 49  ? 13.070  9.302   -6.053  1.00 0.00 ? 49  SER A HB3  2  
ATOM 2733  H HG   . SER A 1 49  ? 12.465  7.153   -6.927  1.00 0.00 ? 49  SER A HG   2  
ATOM 2734  N N    . GLY A 1 50  ? 13.811  9.599   -3.396  1.00 0.00 ? 50  GLY A N    2  
ATOM 2735  C CA   . GLY A 1 50  ? 14.117  10.514  -2.312  1.00 0.00 ? 50  GLY A CA   2  
ATOM 2736  C C    . GLY A 1 50  ? 14.589  9.796   -1.063  1.00 0.00 ? 50  GLY A C    2  
ATOM 2737  O O    . GLY A 1 50  ? 14.363  8.597   -0.906  1.00 0.00 ? 50  GLY A O    2  
ATOM 2738  H H    . GLY A 1 50  ? 14.397  9.559   -4.181  1.00 0.00 ? 50  GLY A H    2  
ATOM 2739  H HA2  . GLY A 1 50  ? 14.889  11.195  -2.637  1.00 0.00 ? 50  GLY A HA2  2  
ATOM 2740  H HA3  . GLY A 1 50  ? 13.228  11.080  -2.074  1.00 0.00 ? 50  GLY A HA3  2  
ATOM 2741  N N    . ALA A 1 51  ? 15.248  10.531  -0.174  1.00 0.00 ? 51  ALA A N    2  
ATOM 2742  C CA   . ALA A 1 51  ? 15.753  9.957   1.067   1.00 0.00 ? 51  ALA A CA   2  
ATOM 2743  C C    . ALA A 1 51  ? 14.726  10.081  2.187   1.00 0.00 ? 51  ALA A C    2  
ATOM 2744  O O    . ALA A 1 51  ? 15.011  9.764   3.343   1.00 0.00 ? 51  ALA A O    2  
ATOM 2745  C CB   . ALA A 1 51  ? 17.057  10.631  1.468   1.00 0.00 ? 51  ALA A CB   2  
ATOM 2746  H H    . ALA A 1 51  ? 15.397  11.482  -0.356  1.00 0.00 ? 51  ALA A H    2  
ATOM 2747  H HA   . ALA A 1 51  ? 15.957  8.910   0.893   1.00 0.00 ? 51  ALA A HA   2  
ATOM 2748  H HB1  . ALA A 1 51  ? 17.279  10.401  2.499   1.00 0.00 ? 51  ALA A HB1  2  
ATOM 2749  H HB2  . ALA A 1 51  ? 17.857  10.269  0.838   1.00 0.00 ? 51  ALA A HB2  2  
ATOM 2750  H HB3  . ALA A 1 51  ? 16.961  11.700  1.350   1.00 0.00 ? 51  ALA A HB3  2  
ATOM 2751  N N    . HIS A 1 52  ? 13.530  10.544  1.838   1.00 0.00 ? 52  HIS A N    2  
ATOM 2752  C CA   . HIS A 1 52  ? 12.459  10.710  2.815   1.00 0.00 ? 52  HIS A CA   2  
ATOM 2753  C C    . HIS A 1 52  ? 11.660  9.420   2.969   1.00 0.00 ? 52  HIS A C    2  
ATOM 2754  O O    . HIS A 1 52  ? 10.671  9.375   3.701   1.00 0.00 ? 52  HIS A O    2  
ATOM 2755  C CB   . HIS A 1 52  ? 11.532  11.851  2.398   1.00 0.00 ? 52  HIS A CB   2  
ATOM 2756  C CG   . HIS A 1 52  ? 12.215  13.182  2.322   1.00 0.00 ? 52  HIS A CG   2  
ATOM 2757  N ND1  . HIS A 1 52  ? 12.157  14.117  3.335   1.00 0.00 ? 52  HIS A ND1  2  
ATOM 2758  C CD2  . HIS A 1 52  ? 12.977  13.732  1.348   1.00 0.00 ? 52  HIS A CD2  2  
ATOM 2759  C CE1  . HIS A 1 52  ? 12.852  15.185  2.985   1.00 0.00 ? 52  HIS A CE1  2  
ATOM 2760  N NE2  . HIS A 1 52  ? 13.360  14.976  1.784   1.00 0.00 ? 52  HIS A NE2  2  
ATOM 2761  H H    . HIS A 1 52  ? 13.363  10.780  0.902   1.00 0.00 ? 52  HIS A H    2  
ATOM 2762  H HA   . HIS A 1 52  ? 12.912  10.954  3.764   1.00 0.00 ? 52  HIS A HA   2  
ATOM 2763  H HB2  . HIS A 1 52  ? 11.121  11.634  1.423   1.00 0.00 ? 52  HIS A HB2  2  
ATOM 2764  H HB3  . HIS A 1 52  ? 10.726  11.932  3.113   1.00 0.00 ? 52  HIS A HB3  2  
ATOM 2765  H HD2  . HIS A 1 52  ? 13.236  13.277  0.402   1.00 0.00 ? 52  HIS A HD2  2  
ATOM 2766  H HE1  . HIS A 1 52  ? 12.982  16.076  3.580   1.00 0.00 ? 52  HIS A HE1  2  
ATOM 2767  H HE2  . HIS A 1 52  ? 13.846  15.642  1.254   1.00 0.00 ? 52  HIS A HE2  2  
ATOM 2768  N N    . ILE A 1 53  ? 12.095  8.374   2.275   1.00 0.00 ? 53  ILE A N    2  
ATOM 2769  C CA   . ILE A 1 53  ? 11.420  7.083   2.336   1.00 0.00 ? 53  ILE A CA   2  
ATOM 2770  C C    . ILE A 1 53  ? 12.213  6.087   3.175   1.00 0.00 ? 53  ILE A C    2  
ATOM 2771  O O    . ILE A 1 53  ? 13.226  5.549   2.728   1.00 0.00 ? 53  ILE A O    2  
ATOM 2772  C CB   . ILE A 1 53  ? 11.204  6.494   0.929   1.00 0.00 ? 53  ILE A CB   2  
ATOM 2773  C CG1  . ILE A 1 53  ? 10.642  7.561   -0.013  1.00 0.00 ? 53  ILE A CG1  2  
ATOM 2774  C CG2  . ILE A 1 53  ? 10.271  5.294   0.995   1.00 0.00 ? 53  ILE A CG2  2  
ATOM 2775  C CD1  . ILE A 1 53  ? 9.172   7.844   0.202   1.00 0.00 ? 53  ILE A CD1  2  
ATOM 2776  H H    . ILE A 1 53  ? 12.889  8.472   1.709   1.00 0.00 ? 53  ILE A H    2  
ATOM 2777  H HA   . ILE A 1 53  ? 10.453  7.234   2.794   1.00 0.00 ? 53  ILE A HA   2  
ATOM 2778  H HB   . ILE A 1 53  ? 12.158  6.158   0.553   1.00 0.00 ? 53  ILE A HB   2  
ATOM 2779  H HG12 . ILE A 1 53  ? 11.182  8.483   0.134   1.00 0.00 ? 53  ILE A HG12 2  
ATOM 2780  H HG13 . ILE A 1 53  ? 10.772  7.232   -1.034  1.00 0.00 ? 53  ILE A HG13 2  
ATOM 2781  H HG21 . ILE A 1 53  ? 10.809  4.404   0.702   1.00 0.00 ? 53  ILE A HG21 2  
ATOM 2782  H HG22 . ILE A 1 53  ? 9.907   5.177   2.005   1.00 0.00 ? 53  ILE A HG22 2  
ATOM 2783  H HG23 . ILE A 1 53  ? 9.438   5.448   0.326   1.00 0.00 ? 53  ILE A HG23 2  
ATOM 2784  H HD11 . ILE A 1 53  ? 9.027   8.905   0.349   1.00 0.00 ? 53  ILE A HD11 2  
ATOM 2785  H HD12 . ILE A 1 53  ? 8.612   7.522   -0.664  1.00 0.00 ? 53  ILE A HD12 2  
ATOM 2786  H HD13 . ILE A 1 53  ? 8.826   7.310   1.074   1.00 0.00 ? 53  ILE A HD13 2  
ATOM 2787  N N    . LYS A 1 54  ? 11.744  5.844   4.394   1.00 0.00 ? 54  LYS A N    2  
ATOM 2788  C CA   . LYS A 1 54  ? 12.406  4.910   5.297   1.00 0.00 ? 54  LYS A CA   2  
ATOM 2789  C C    . LYS A 1 54  ? 12.591  3.549   4.633   1.00 0.00 ? 54  LYS A C    2  
ATOM 2790  O O    . LYS A 1 54  ? 11.695  3.057   3.948   1.00 0.00 ? 54  LYS A O    2  
ATOM 2791  C CB   . LYS A 1 54  ? 11.597  4.754   6.587   1.00 0.00 ? 54  LYS A CB   2  
ATOM 2792  C CG   . LYS A 1 54  ? 11.112  6.073   7.164   1.00 0.00 ? 54  LYS A CG   2  
ATOM 2793  C CD   . LYS A 1 54  ? 12.204  7.130   7.133   1.00 0.00 ? 54  LYS A CD   2  
ATOM 2794  C CE   . LYS A 1 54  ? 11.851  8.321   8.010   1.00 0.00 ? 54  LYS A CE   2  
ATOM 2795  N NZ   . LYS A 1 54  ? 11.503  7.905   9.397   1.00 0.00 ? 54  LYS A NZ   2  
ATOM 2796  H H    . LYS A 1 54  ? 10.932  6.304   4.694   1.00 0.00 ? 54  LYS A H    2  
ATOM 2797  H HA   . LYS A 1 54  ? 13.378  5.314   5.539   1.00 0.00 ? 54  LYS A HA   2  
ATOM 2798  H HB2  . LYS A 1 54  ? 10.735  4.136   6.384   1.00 0.00 ? 54  LYS A HB2  2  
ATOM 2799  H HB3  . LYS A 1 54  ? 12.213  4.266   7.328   1.00 0.00 ? 54  LYS A HB3  2  
ATOM 2800  H HG2  . LYS A 1 54  ? 10.271  6.423   6.583   1.00 0.00 ? 54  LYS A HG2  2  
ATOM 2801  H HG3  . LYS A 1 54  ? 10.805  5.916   8.188   1.00 0.00 ? 54  LYS A HG3  2  
ATOM 2802  H HD2  . LYS A 1 54  ? 13.125  6.694   7.491   1.00 0.00 ? 54  LYS A HD2  2  
ATOM 2803  H HD3  . LYS A 1 54  ? 12.335  7.469   6.115   1.00 0.00 ? 54  LYS A HD3  2  
ATOM 2804  H HE2  . LYS A 1 54  ? 12.698  8.989   8.046   1.00 0.00 ? 54  LYS A HE2  2  
ATOM 2805  H HE3  . LYS A 1 54  ? 11.007  8.835   7.575   1.00 0.00 ? 54  LYS A HE3  2  
ATOM 2806  H HZ1  . LYS A 1 54  ? 11.551  8.723   10.038  1.00 0.00 ? 54  LYS A HZ1  2  
ATOM 2807  H HZ2  . LYS A 1 54  ? 12.169  7.178   9.729   1.00 0.00 ? 54  LYS A HZ2  2  
ATOM 2808  H HZ3  . LYS A 1 54  ? 10.540  7.515   9.422   1.00 0.00 ? 54  LYS A HZ3  2  
ATOM 2809  N N    . GLU A 1 55  ? 13.757  2.947   4.842   1.00 0.00 ? 55  GLU A N    2  
ATOM 2810  C CA   . GLU A 1 55  ? 14.057  1.643   4.263   1.00 0.00 ? 55  GLU A CA   2  
ATOM 2811  C C    . GLU A 1 55  ? 12.901  0.672   4.481   1.00 0.00 ? 55  GLU A C    2  
ATOM 2812  O O    . GLU A 1 55  ? 12.690  -0.246  3.689   1.00 0.00 ? 55  GLU A O    2  
ATOM 2813  C CB   . GLU A 1 55  ? 15.339  1.072   4.873   1.00 0.00 ? 55  GLU A CB   2  
ATOM 2814  C CG   . GLU A 1 55  ? 15.128  0.411   6.224   1.00 0.00 ? 55  GLU A CG   2  
ATOM 2815  C CD   . GLU A 1 55  ? 14.769  1.405   7.311   1.00 0.00 ? 55  GLU A CD   2  
ATOM 2816  O OE1  . GLU A 1 55  ? 15.272  2.547   7.259   1.00 0.00 ? 55  GLU A OE1  2  
ATOM 2817  O OE2  . GLU A 1 55  ? 13.984  1.043   8.212   1.00 0.00 ? 55  GLU A OE2  2  
ATOM 2818  H H    . GLU A 1 55  ? 14.432  3.390   5.397   1.00 0.00 ? 55  GLU A H    2  
ATOM 2819  H HA   . GLU A 1 55  ? 14.203  1.777   3.202   1.00 0.00 ? 55  GLU A HA   2  
ATOM 2820  H HB2  . GLU A 1 55  ? 15.750  0.338   4.196   1.00 0.00 ? 55  GLU A HB2  2  
ATOM 2821  H HB3  . GLU A 1 55  ? 16.053  1.874   4.996   1.00 0.00 ? 55  GLU A HB3  2  
ATOM 2822  H HG2  . GLU A 1 55  ? 14.328  -0.309  6.138   1.00 0.00 ? 55  GLU A HG2  2  
ATOM 2823  H HG3  . GLU A 1 55  ? 16.038  -0.097  6.509   1.00 0.00 ? 55  GLU A HG3  2  
ATOM 2824  N N    . GLU A 1 56  ? 12.156  0.881   5.562   1.00 0.00 ? 56  GLU A N    2  
ATOM 2825  C CA   . GLU A 1 56  ? 11.022  0.023   5.886   1.00 0.00 ? 56  GLU A CA   2  
ATOM 2826  C C    . GLU A 1 56  ? 9.776   0.855   6.178   1.00 0.00 ? 56  GLU A C    2  
ATOM 2827  O O    . GLU A 1 56  ? 9.057   0.599   7.145   1.00 0.00 ? 56  GLU A O    2  
ATOM 2828  C CB   . GLU A 1 56  ? 11.351  -0.862  7.089   1.00 0.00 ? 56  GLU A CB   2  
ATOM 2829  C CG   . GLU A 1 56  ? 12.107  -2.129  6.724   1.00 0.00 ? 56  GLU A CG   2  
ATOM 2830  C CD   . GLU A 1 56  ? 12.085  -3.162  7.834   1.00 0.00 ? 56  GLU A CD   2  
ATOM 2831  O OE1  . GLU A 1 56  ? 11.065  -3.243  8.549   1.00 0.00 ? 56  GLU A OE1  2  
ATOM 2832  O OE2  . GLU A 1 56  ? 13.088  -3.890  7.986   1.00 0.00 ? 56  GLU A OE2  2  
ATOM 2833  H H    . GLU A 1 56  ? 12.374  1.630   6.156   1.00 0.00 ? 56  GLU A H    2  
ATOM 2834  H HA   . GLU A 1 56  ? 10.827  -0.606  5.030   1.00 0.00 ? 56  GLU A HA   2  
ATOM 2835  H HB2  . GLU A 1 56  ? 11.952  -0.296  7.785   1.00 0.00 ? 56  GLU A HB2  2  
ATOM 2836  H HB3  . GLU A 1 56  ? 10.429  -1.147  7.574   1.00 0.00 ? 56  GLU A HB3  2  
ATOM 2837  H HG2  . GLU A 1 56  ? 11.658  -2.560  5.843   1.00 0.00 ? 56  GLU A HG2  2  
ATOM 2838  H HG3  . GLU A 1 56  ? 13.135  -1.871  6.513   1.00 0.00 ? 56  GLU A HG3  2  
ATOM 2839  N N    . HIS A 1 57  ? 9.528   1.854   5.336   1.00 0.00 ? 57  HIS A N    2  
ATOM 2840  C CA   . HIS A 1 57  ? 8.369   2.724   5.504   1.00 0.00 ? 57  HIS A CA   2  
ATOM 2841  C C    . HIS A 1 57  ? 7.123   1.911   5.840   1.00 0.00 ? 57  HIS A C    2  
ATOM 2842  O O    . HIS A 1 57  ? 6.627   1.955   6.967   1.00 0.00 ? 57  HIS A O    2  
ATOM 2843  C CB   . HIS A 1 57  ? 8.131   3.542   4.234   1.00 0.00 ? 57  HIS A CB   2  
ATOM 2844  C CG   . HIS A 1 57  ? 7.500   4.876   4.490   1.00 0.00 ? 57  HIS A CG   2  
ATOM 2845  N ND1  . HIS A 1 57  ? 8.214   5.977   4.913   1.00 0.00 ? 57  HIS A ND1  2  
ATOM 2846  C CD2  . HIS A 1 57  ? 6.214   5.283   4.378   1.00 0.00 ? 57  HIS A CD2  2  
ATOM 2847  C CE1  . HIS A 1 57  ? 7.394   7.003   5.052   1.00 0.00 ? 57  HIS A CE1  2  
ATOM 2848  N NE2  . HIS A 1 57  ? 6.175   6.608   4.733   1.00 0.00 ? 57  HIS A NE2  2  
ATOM 2849  H H    . HIS A 1 57  ? 10.137  2.008   4.585   1.00 0.00 ? 57  HIS A H    2  
ATOM 2850  H HA   . HIS A 1 57  ? 8.576   3.398   6.321   1.00 0.00 ? 57  HIS A HA   2  
ATOM 2851  H HB2  . HIS A 1 57  ? 9.077   3.711   3.741   1.00 0.00 ? 57  HIS A HB2  2  
ATOM 2852  H HB3  . HIS A 1 57  ? 7.481   2.987   3.573   1.00 0.00 ? 57  HIS A HB3  2  
ATOM 2853  H HD1  . HIS A 1 57  ? 9.178   6.002   5.087   1.00 0.00 ? 57  HIS A HD1  2  
ATOM 2854  H HD2  . HIS A 1 57  ? 5.374   4.677   4.067   1.00 0.00 ? 57  HIS A HD2  2  
ATOM 2855  H HE1  . HIS A 1 57  ? 7.673   7.996   5.372   1.00 0.00 ? 57  HIS A HE1  2  
ATOM 2856  H HE2  . HIS A 1 57  ? 5.363   7.149   4.831   1.00 0.00 ? 57  HIS A HE2  2  
ATOM 2857  N N    . CYS A 1 58  ? 6.622   1.171   4.858   1.00 0.00 ? 58  CYS A N    2  
ATOM 2858  C CA   . CYS A 1 58  ? 5.432   0.349   5.049   1.00 0.00 ? 58  CYS A CA   2  
ATOM 2859  C C    . CYS A 1 58  ? 5.559   -0.973  4.300   1.00 0.00 ? 58  CYS A C    2  
ATOM 2860  O O    . CYS A 1 58  ? 6.596   -1.264  3.705   1.00 0.00 ? 58  CYS A O    2  
ATOM 2861  C CB   . CYS A 1 58  ? 4.187   1.100   4.577   1.00 0.00 ? 58  CYS A CB   2  
ATOM 2862  S SG   . CYS A 1 58  ? 4.143   1.411   2.796   1.00 0.00 ? 58  CYS A SG   2  
ATOM 2863  H H    . CYS A 1 58  ? 7.062   1.177   3.982   1.00 0.00 ? 58  CYS A H    2  
ATOM 2864  H HA   . CYS A 1 58  ? 5.339   0.143   6.105   1.00 0.00 ? 58  CYS A HA   2  
ATOM 2865  H HB2  . CYS A 1 58  ? 3.310   0.523   4.830   1.00 0.00 ? 58  CYS A HB2  2  
ATOM 2866  H HB3  . CYS A 1 58  ? 4.138   2.054   5.080   1.00 0.00 ? 58  CYS A HB3  2  
ATOM 2867  H HG   . CYS A 1 58  ? 3.281   2.391   2.573   1.00 0.00 ? 58  CYS A HG   2  
ATOM 2868  N N    . ILE A 1 59  ? 4.497   -1.771  4.336   1.00 0.00 ? 59  ILE A N    2  
ATOM 2869  C CA   . ILE A 1 59  ? 4.489   -3.063  3.661   1.00 0.00 ? 59  ILE A CA   2  
ATOM 2870  C C    . ILE A 1 59  ? 3.107   -3.383  3.101   1.00 0.00 ? 59  ILE A C    2  
ATOM 2871  O O    . ILE A 1 59  ? 2.102   -2.833  3.550   1.00 0.00 ? 59  ILE A O    2  
ATOM 2872  C CB   . ILE A 1 59  ? 4.922   -4.197  4.609   1.00 0.00 ? 59  ILE A CB   2  
ATOM 2873  C CG1  . ILE A 1 59  ? 6.208   -3.813  5.344   1.00 0.00 ? 59  ILE A CG1  2  
ATOM 2874  C CG2  . ILE A 1 59  ? 5.115   -5.491  3.834   1.00 0.00 ? 59  ILE A CG2  2  
ATOM 2875  C CD1  . ILE A 1 59  ? 6.496   -4.679  6.551   1.00 0.00 ? 59  ILE A CD1  2  
ATOM 2876  H H    . ILE A 1 59  ? 3.699   -1.484  4.827   1.00 0.00 ? 59  ILE A H    2  
ATOM 2877  H HA   . ILE A 1 59  ? 5.195   -3.016  2.843   1.00 0.00 ? 59  ILE A HA   2  
ATOM 2878  H HB   . ILE A 1 59  ? 4.136   -4.351  5.332   1.00 0.00 ? 59  ILE A HB   2  
ATOM 2879  H HG12 . ILE A 1 59  ? 7.043   -3.901  4.667   1.00 0.00 ? 59  ILE A HG12 2  
ATOM 2880  H HG13 . ILE A 1 59  ? 6.129   -2.789  5.681   1.00 0.00 ? 59  ILE A HG13 2  
ATOM 2881  H HG21 . ILE A 1 59  ? 5.737   -6.164  4.406   1.00 0.00 ? 59  ILE A HG21 2  
ATOM 2882  H HG22 . ILE A 1 59  ? 4.155   -5.952  3.658   1.00 0.00 ? 59  ILE A HG22 2  
ATOM 2883  H HG23 . ILE A 1 59  ? 5.591   -5.278  2.889   1.00 0.00 ? 59  ILE A HG23 2  
ATOM 2884  H HD11 . ILE A 1 59  ? 7.237   -4.196  7.172   1.00 0.00 ? 59  ILE A HD11 2  
ATOM 2885  H HD12 . ILE A 1 59  ? 5.588   -4.819  7.119   1.00 0.00 ? 59  ILE A HD12 2  
ATOM 2886  H HD13 . ILE A 1 59  ? 6.870   -5.638  6.225   1.00 0.00 ? 59  ILE A HD13 2  
ATOM 2887  N N    . PHE A 1 60  ? 3.065   -4.279  2.120   1.00 0.00 ? 60  PHE A N    2  
ATOM 2888  C CA   . PHE A 1 60  ? 1.806   -4.674  1.500   1.00 0.00 ? 60  PHE A CA   2  
ATOM 2889  C C    . PHE A 1 60  ? 1.695   -6.193  1.414   1.00 0.00 ? 60  PHE A C    2  
ATOM 2890  O O    . PHE A 1 60  ? 2.387   -6.833  0.622   1.00 0.00 ? 60  PHE A O    2  
ATOM 2891  C CB   . PHE A 1 60  ? 1.688   -4.063  0.102   1.00 0.00 ? 60  PHE A CB   2  
ATOM 2892  C CG   . PHE A 1 60  ? 1.295   -2.613  0.112   1.00 0.00 ? 60  PHE A CG   2  
ATOM 2893  C CD1  . PHE A 1 60  ? 0.061   -2.220  0.603   1.00 0.00 ? 60  PHE A CD1  2  
ATOM 2894  C CD2  . PHE A 1 60  ? 2.160   -1.644  -0.369  1.00 0.00 ? 60  PHE A CD2  2  
ATOM 2895  C CE1  . PHE A 1 60  ? -0.304  -0.887  0.615   1.00 0.00 ? 60  PHE A CE1  2  
ATOM 2896  C CE2  . PHE A 1 60  ? 1.802   -0.309  -0.360  1.00 0.00 ? 60  PHE A CE2  2  
ATOM 2897  C CZ   . PHE A 1 60  ? 0.568   0.070   0.131   1.00 0.00 ? 60  PHE A CZ   2  
ATOM 2898  H H    . PHE A 1 60  ? 3.901   -4.683  1.806   1.00 0.00 ? 60  PHE A H    2  
ATOM 2899  H HA   . PHE A 1 60  ? 1.002   -4.300  2.115   1.00 0.00 ? 60  PHE A HA   2  
ATOM 2900  H HB2  . PHE A 1 60  ? 2.640   -4.144  -0.400  1.00 0.00 ? 60  PHE A HB2  2  
ATOM 2901  H HB3  . PHE A 1 60  ? 0.943   -4.606  -0.459  1.00 0.00 ? 60  PHE A HB3  2  
ATOM 2902  H HD1  . PHE A 1 60  ? -0.622  -2.968  0.981   1.00 0.00 ? 60  PHE A HD1  2  
ATOM 2903  H HD2  . PHE A 1 60  ? 3.125   -1.939  -0.755  1.00 0.00 ? 60  PHE A HD2  2  
ATOM 2904  H HE1  . PHE A 1 60  ? -1.269  -0.594  1.000   1.00 0.00 ? 60  PHE A HE1  2  
ATOM 2905  H HE2  . PHE A 1 60  ? 2.484   0.437   -0.739  1.00 0.00 ? 60  PHE A HE2  2  
ATOM 2906  H HZ   . PHE A 1 60  ? 0.285   1.112   0.140   1.00 0.00 ? 60  PHE A HZ   2  
ATOM 2907  N N    . ARG A 1 61  ? 0.820   -6.764  2.235   1.00 0.00 ? 61  ARG A N    2  
ATOM 2908  C CA   . ARG A 1 61  ? 0.619   -8.208  2.254   1.00 0.00 ? 61  ARG A CA   2  
ATOM 2909  C C    . ARG A 1 61  ? -0.633  -8.593  1.473   1.00 0.00 ? 61  ARG A C    2  
ATOM 2910  O O    . ARG A 1 61  ? -1.678  -7.953  1.600   1.00 0.00 ? 61  ARG A O    2  
ATOM 2911  C CB   . ARG A 1 61  ? 0.509   -8.710  3.695   1.00 0.00 ? 61  ARG A CB   2  
ATOM 2912  C CG   . ARG A 1 61  ? 0.752   -10.203 3.840   1.00 0.00 ? 61  ARG A CG   2  
ATOM 2913  C CD   . ARG A 1 61  ? 0.053   -10.765 5.068   1.00 0.00 ? 61  ARG A CD   2  
ATOM 2914  N NE   . ARG A 1 61  ? 0.648   -12.024 5.508   1.00 0.00 ? 61  ARG A NE   2  
ATOM 2915  C CZ   . ARG A 1 61  ? 0.091   -12.823 6.412   1.00 0.00 ? 61  ARG A CZ   2  
ATOM 2916  N NH1  . ARG A 1 61  ? -1.067  -12.496 6.967   1.00 0.00 ? 61  ARG A NH1  2  
ATOM 2917  N NH2  . ARG A 1 61  ? 0.694   -13.953 6.761   1.00 0.00 ? 61  ARG A NH2  2  
ATOM 2918  H H    . ARG A 1 61  ? 0.297   -6.201  2.844   1.00 0.00 ? 61  ARG A H    2  
ATOM 2919  H HA   . ARG A 1 61  ? 1.477   -8.668  1.787   1.00 0.00 ? 61  ARG A HA   2  
ATOM 2920  H HB2  . ARG A 1 61  ? 1.234   -8.189  4.302   1.00 0.00 ? 61  ARG A HB2  2  
ATOM 2921  H HB3  . ARG A 1 61  ? -0.482  -8.491  4.064   1.00 0.00 ? 61  ARG A HB3  2  
ATOM 2922  H HG2  . ARG A 1 61  ? 0.375   -10.707 2.963   1.00 0.00 ? 61  ARG A HG2  2  
ATOM 2923  H HG3  . ARG A 1 61  ? 1.814   -10.378 3.929   1.00 0.00 ? 61  ARG A HG3  2  
ATOM 2924  H HD2  . ARG A 1 61  ? 0.126   -10.044 5.869   1.00 0.00 ? 61  ARG A HD2  2  
ATOM 2925  H HD3  . ARG A 1 61  ? -0.986  -10.932 4.829   1.00 0.00 ? 61  ARG A HD3  2  
ATOM 2926  H HE   . ARG A 1 61  ? 1.504   -12.285 5.111   1.00 0.00 ? 61  ARG A HE   2  
ATOM 2927  H HH11 . ARG A 1 61  ? -1.524  -11.646 6.706   1.00 0.00 ? 61  ARG A HH11 2  
ATOM 2928  H HH12 . ARG A 1 61  ? -1.485  -13.100 7.647   1.00 0.00 ? 61  ARG A HH12 2  
ATOM 2929  H HH21 . ARG A 1 61  ? 1.567   -14.203 6.344   1.00 0.00 ? 61  ARG A HH21 2  
ATOM 2930  H HH22 . ARG A 1 61  ? 0.274   -14.554 7.441   1.00 0.00 ? 61  ARG A HH22 2  
ATOM 2931  N N    . SER A 1 62  ? -0.521  -9.641  0.664   1.00 0.00 ? 62  SER A N    2  
ATOM 2932  C CA   . SER A 1 62  ? -1.643  -10.109 -0.142  1.00 0.00 ? 62  SER A CA   2  
ATOM 2933  C C    . SER A 1 62  ? -1.823  -11.617 0.001   1.00 0.00 ? 62  SER A C    2  
ATOM 2934  O O    . SER A 1 62  ? -1.015  -12.400 -0.497  1.00 0.00 ? 62  SER A O    2  
ATOM 2935  C CB   . SER A 1 62  ? -1.427  -9.747  -1.613  1.00 0.00 ? 62  SER A CB   2  
ATOM 2936  O OG   . SER A 1 62  ? -2.660  -9.691  -2.310  1.00 0.00 ? 62  SER A OG   2  
ATOM 2937  H H    . SER A 1 62  ? 0.338   -10.110 0.606   1.00 0.00 ? 62  SER A H    2  
ATOM 2938  H HA   . SER A 1 62  ? -2.535  -9.616  0.214   1.00 0.00 ? 62  SER A HA   2  
ATOM 2939  H HB2  . SER A 1 62  ? -0.947  -8.783  -1.677  1.00 0.00 ? 62  SER A HB2  2  
ATOM 2940  H HB3  . SER A 1 62  ? -0.799  -10.495 -2.076  1.00 0.00 ? 62  SER A HB3  2  
ATOM 2941  H HG   . SER A 1 62  ? -2.588  -10.188 -3.128  1.00 0.00 ? 62  SER A HG   2  
ATOM 2942  N N    . GLU A 1 63  ? -2.890  -12.017 0.686   1.00 0.00 ? 63  GLU A N    2  
ATOM 2943  C CA   . GLU A 1 63  ? -3.177  -13.431 0.896   1.00 0.00 ? 63  GLU A CA   2  
ATOM 2944  C C    . GLU A 1 63  ? -4.669  -13.712 0.747   1.00 0.00 ? 63  GLU A C    2  
ATOM 2945  O O    . GLU A 1 63  ? -5.506  -12.867 1.067   1.00 0.00 ? 63  GLU A O    2  
ATOM 2946  C CB   . GLU A 1 63  ? -2.700  -13.870 2.282   1.00 0.00 ? 63  GLU A CB   2  
ATOM 2947  C CG   . GLU A 1 63  ? -3.013  -15.322 2.602   1.00 0.00 ? 63  GLU A CG   2  
ATOM 2948  C CD   . GLU A 1 63  ? -1.971  -16.278 2.056   1.00 0.00 ? 63  GLU A CD   2  
ATOM 2949  O OE1  . GLU A 1 63  ? -0.823  -15.839 1.832   1.00 0.00 ? 63  GLU A OE1  2  
ATOM 2950  O OE2  . GLU A 1 63  ? -2.301  -17.465 1.853   1.00 0.00 ? 63  GLU A OE2  2  
ATOM 2951  H H    . GLU A 1 63  ? -3.498  -11.345 1.059   1.00 0.00 ? 63  GLU A H    2  
ATOM 2952  H HA   . GLU A 1 63  ? -2.641  -13.993 0.147   1.00 0.00 ? 63  GLU A HA   2  
ATOM 2953  H HB2  . GLU A 1 63  ? -1.630  -13.733 2.342   1.00 0.00 ? 63  GLU A HB2  2  
ATOM 2954  H HB3  . GLU A 1 63  ? -3.176  -13.249 3.027   1.00 0.00 ? 63  GLU A HB3  2  
ATOM 2955  H HG2  . GLU A 1 63  ? -3.061  -15.440 3.674   1.00 0.00 ? 63  GLU A HG2  2  
ATOM 2956  H HG3  . GLU A 1 63  ? -3.972  -15.574 2.171   1.00 0.00 ? 63  GLU A HG3  2  
ATOM 2957  N N    . ARG A 1 64  ? -4.995  -14.905 0.260   1.00 0.00 ? 64  ARG A N    2  
ATOM 2958  C CA   . ARG A 1 64  ? -6.386  -15.297 0.067   1.00 0.00 ? 64  ARG A CA   2  
ATOM 2959  C C    . ARG A 1 64  ? -7.009  -15.758 1.381   1.00 0.00 ? 64  ARG A C    2  
ATOM 2960  O O    . ARG A 1 64  ? -6.725  -16.854 1.864   1.00 0.00 ? 64  ARG A O    2  
ATOM 2961  C CB   . ARG A 1 64  ? -6.483  -16.413 -0.975  1.00 0.00 ? 64  ARG A CB   2  
ATOM 2962  C CG   . ARG A 1 64  ? -7.756  -16.362 -1.805  1.00 0.00 ? 64  ARG A CG   2  
ATOM 2963  C CD   . ARG A 1 64  ? -7.746  -17.413 -2.904  1.00 0.00 ? 64  ARG A CD   2  
ATOM 2964  N NE   . ARG A 1 64  ? -6.785  -17.095 -3.957  1.00 0.00 ? 64  ARG A NE   2  
ATOM 2965  C CZ   . ARG A 1 64  ? -6.491  -17.920 -4.956  1.00 0.00 ? 64  ARG A CZ   2  
ATOM 2966  N NH1  . ARG A 1 64  ? -7.080  -19.105 -5.038  1.00 0.00 ? 64  ARG A NH1  2  
ATOM 2967  N NH2  . ARG A 1 64  ? -5.605  -17.559 -5.876  1.00 0.00 ? 64  ARG A NH2  2  
ATOM 2968  H H    . ARG A 1 64  ? -4.284  -15.536 0.024   1.00 0.00 ? 64  ARG A H    2  
ATOM 2969  H HA   . ARG A 1 64  ? -6.928  -14.434 -0.291  1.00 0.00 ? 64  ARG A HA   2  
ATOM 2970  H HB2  . ARG A 1 64  ? -5.640  -16.339 -1.645  1.00 0.00 ? 64  ARG A HB2  2  
ATOM 2971  H HB3  . ARG A 1 64  ? -6.448  -17.365 -0.468  1.00 0.00 ? 64  ARG A HB3  2  
ATOM 2972  H HG2  . ARG A 1 64  ? -8.603  -16.540 -1.159  1.00 0.00 ? 64  ARG A HG2  2  
ATOM 2973  H HG3  . ARG A 1 64  ? -7.843  -15.384 -2.254  1.00 0.00 ? 64  ARG A HG3  2  
ATOM 2974  H HD2  . ARG A 1 64  ? -7.487  -18.367 -2.469  1.00 0.00 ? 64  ARG A HD2  2  
ATOM 2975  H HD3  . ARG A 1 64  ? -8.734  -17.471 -3.336  1.00 0.00 ? 64  ARG A HD3  2  
ATOM 2976  H HE   . ARG A 1 64  ? -6.339  -16.225 -3.915  1.00 0.00 ? 64  ARG A HE   2  
ATOM 2977  H HH11 . ARG A 1 64  ? -7.748  -19.379 -4.346  1.00 0.00 ? 64  ARG A HH11 2  
ATOM 2978  H HH12 . ARG A 1 64  ? -6.857  -19.723 -5.792  1.00 0.00 ? 64  ARG A HH12 2  
ATOM 2979  H HH21 . ARG A 1 64  ? -5.159  -16.666 -5.818  1.00 0.00 ? 64  ARG A HH21 2  
ATOM 2980  H HH22 . ARG A 1 64  ? -5.384  -18.180 -6.627  1.00 0.00 ? 64  ARG A HH22 2  
ATOM 2981  N N    . SER A 1 65  ? -7.858  -14.912 1.956   1.00 0.00 ? 65  SER A N    2  
ATOM 2982  C CA   . SER A 1 65  ? -8.518  -15.231 3.217   1.00 0.00 ? 65  SER A CA   2  
ATOM 2983  C C    . SER A 1 65  ? -8.956  -16.692 3.247   1.00 0.00 ? 65  SER A C    2  
ATOM 2984  O O    . SER A 1 65  ? -9.070  -17.338 2.207   1.00 0.00 ? 65  SER A O    2  
ATOM 2985  C CB   . SER A 1 65  ? -9.728  -14.319 3.428   1.00 0.00 ? 65  SER A CB   2  
ATOM 2986  O OG   . SER A 1 65  ? -10.297 -14.516 4.712   1.00 0.00 ? 65  SER A OG   2  
ATOM 2987  H H    . SER A 1 65  ? -8.044  -14.053 1.523   1.00 0.00 ? 65  SER A H    2  
ATOM 2988  H HA   . SER A 1 65  ? -7.808  -15.063 4.014   1.00 0.00 ? 65  SER A HA   2  
ATOM 2989  H HB2  . SER A 1 65  ? -9.420  -13.289 3.339   1.00 0.00 ? 65  SER A HB2  2  
ATOM 2990  H HB3  . SER A 1 65  ? -10.475 -14.538 2.679   1.00 0.00 ? 65  SER A HB3  2  
ATOM 2991  H HG   . SER A 1 65  ? -10.737 -15.368 4.740   1.00 0.00 ? 65  SER A HG   2  
ATOM 2992  N N    . ASN A 1 66  ? -9.199  -17.206 4.449   1.00 0.00 ? 66  ASN A N    2  
ATOM 2993  C CA   . ASN A 1 66  ? -9.624  -18.591 4.616   1.00 0.00 ? 66  ASN A CA   2  
ATOM 2994  C C    . ASN A 1 66  ? -10.902 -18.866 3.830   1.00 0.00 ? 66  ASN A C    2  
ATOM 2995  O O    . ASN A 1 66  ? -11.227 -20.017 3.538   1.00 0.00 ? 66  ASN A O    2  
ATOM 2996  C CB   . ASN A 1 66  ? -9.846  -18.902 6.098   1.00 0.00 ? 66  ASN A CB   2  
ATOM 2997  C CG   . ASN A 1 66  ? -10.634 -17.817 6.805   1.00 0.00 ? 66  ASN A CG   2  
ATOM 2998  O OD1  . ASN A 1 66  ? -11.865 -17.814 6.783   1.00 0.00 ? 66  ASN A OD1  2  
ATOM 2999  N ND2  . ASN A 1 66  ? -9.926  -16.889 7.438   1.00 0.00 ? 66  ASN A ND2  2  
ATOM 3000  H H    . ASN A 1 66  ? -9.090  -16.640 5.242   1.00 0.00 ? 66  ASN A H    2  
ATOM 3001  H HA   . ASN A 1 66  ? -8.838  -19.226 4.238   1.00 0.00 ? 66  ASN A HA   2  
ATOM 3002  H HB2  . ASN A 1 66  ? -10.390 -19.831 6.186   1.00 0.00 ? 66  ASN A HB2  2  
ATOM 3003  H HB3  . ASN A 1 66  ? -8.888  -19.003 6.586   1.00 0.00 ? 66  ASN A HB3  2  
ATOM 3004  H HD21 . ASN A 1 66  ? -8.949  -16.954 7.413   1.00 0.00 ? 66  ASN A HD21 2  
ATOM 3005  H HD22 . ASN A 1 66  ? -10.411 -16.176 7.904   1.00 0.00 ? 66  ASN A HD22 2  
ATOM 3006  N N    . SER A 1 67  ? -11.622 -17.802 3.491   1.00 0.00 ? 67  SER A N    2  
ATOM 3007  C CA   . SER A 1 67  ? -12.867 -17.929 2.741   1.00 0.00 ? 67  SER A CA   2  
ATOM 3008  C C    . SER A 1 67  ? -12.587 -18.151 1.258   1.00 0.00 ? 67  SER A C    2  
ATOM 3009  O O    . SER A 1 67  ? -13.421 -18.690 0.531   1.00 0.00 ? 67  SER A O    2  
ATOM 3010  C CB   . SER A 1 67  ? -13.729 -16.680 2.928   1.00 0.00 ? 67  SER A CB   2  
ATOM 3011  O OG   . SER A 1 67  ? -15.092 -16.955 2.652   1.00 0.00 ? 67  SER A OG   2  
ATOM 3012  H H    . SER A 1 67  ? -11.311 -16.911 3.753   1.00 0.00 ? 67  SER A H    2  
ATOM 3013  H HA   . SER A 1 67  ? -13.400 -18.786 3.127   1.00 0.00 ? 67  SER A HA   2  
ATOM 3014  H HB2  . SER A 1 67  ? -13.644 -16.336 3.947   1.00 0.00 ? 67  SER A HB2  2  
ATOM 3015  H HB3  . SER A 1 67  ? -13.387 -15.906 2.256   1.00 0.00 ? 67  SER A HB3  2  
ATOM 3016  H HG   . SER A 1 67  ? -15.227 -17.905 2.618   1.00 0.00 ? 67  SER A HG   2  
ATOM 3017  N N    . GLY A 1 68  ? -11.406 -17.729 0.815   1.00 0.00 ? 68  GLY A N    2  
ATOM 3018  C CA   . GLY A 1 68  ? -11.037 -17.890 -0.579  1.00 0.00 ? 68  GLY A CA   2  
ATOM 3019  C C    . GLY A 1 68  ? -11.053 -16.577 -1.338  1.00 0.00 ? 68  GLY A C    2  
ATOM 3020  O O    . GLY A 1 68  ? -11.213 -16.561 -2.558  1.00 0.00 ? 68  GLY A O    2  
ATOM 3021  H H    . GLY A 1 68  ? -10.781 -17.306 1.440   1.00 0.00 ? 68  GLY A H    2  
ATOM 3022  H HA2  . GLY A 1 68  ? -10.044 -18.311 -0.631  1.00 0.00 ? 68  GLY A HA2  2  
ATOM 3023  H HA3  . GLY A 1 68  ? -11.731 -18.571 -1.048  1.00 0.00 ? 68  GLY A HA3  2  
ATOM 3024  N N    . GLU A 1 69  ? -10.888 -15.475 -0.614  1.00 0.00 ? 69  GLU A N    2  
ATOM 3025  C CA   . GLU A 1 69  ? -10.887 -14.152 -1.227  1.00 0.00 ? 69  GLU A CA   2  
ATOM 3026  C C    . GLU A 1 69  ? -9.547  -13.454 -1.014  1.00 0.00 ? 69  GLU A C    2  
ATOM 3027  O O    . GLU A 1 69  ? -8.979  -13.496 0.077   1.00 0.00 ? 69  GLU A O    2  
ATOM 3028  C CB   . GLU A 1 69  ? -12.017 -13.297 -0.650  1.00 0.00 ? 69  GLU A CB   2  
ATOM 3029  C CG   . GLU A 1 69  ? -11.634 -12.563 0.625   1.00 0.00 ? 69  GLU A CG   2  
ATOM 3030  C CD   . GLU A 1 69  ? -12.834 -12.238 1.494   1.00 0.00 ? 69  GLU A CD   2  
ATOM 3031  O OE1  . GLU A 1 69  ? -13.974 -12.350 0.997   1.00 0.00 ? 69  GLU A OE1  2  
ATOM 3032  O OE2  . GLU A 1 69  ? -12.632 -11.873 2.671   1.00 0.00 ? 69  GLU A OE2  2  
ATOM 3033  H H    . GLU A 1 69  ? -10.765 -15.553 0.355   1.00 0.00 ? 69  GLU A H    2  
ATOM 3034  H HA   . GLU A 1 69  ? -11.049 -14.278 -2.287  1.00 0.00 ? 69  GLU A HA   2  
ATOM 3035  H HB2  . GLU A 1 69  ? -12.312 -12.565 -1.387  1.00 0.00 ? 69  GLU A HB2  2  
ATOM 3036  H HB3  . GLU A 1 69  ? -12.860 -13.936 -0.432  1.00 0.00 ? 69  GLU A HB3  2  
ATOM 3037  H HG2  . GLU A 1 69  ? -10.956 -13.182 1.192   1.00 0.00 ? 69  GLU A HG2  2  
ATOM 3038  H HG3  . GLU A 1 69  ? -11.140 -11.640 0.359   1.00 0.00 ? 69  GLU A HG3  2  
ATOM 3039  N N    . VAL A 1 70  ? -9.046  -12.813 -2.066  1.00 0.00 ? 70  VAL A N    2  
ATOM 3040  C CA   . VAL A 1 70  ? -7.774  -12.106 -1.996  1.00 0.00 ? 70  VAL A CA   2  
ATOM 3041  C C    . VAL A 1 70  ? -7.915  -10.795 -1.230  1.00 0.00 ? 70  VAL A C    2  
ATOM 3042  O O    . VAL A 1 70  ? -8.641  -9.894  -1.651  1.00 0.00 ? 70  VAL A O    2  
ATOM 3043  C CB   . VAL A 1 70  ? -7.218  -11.809 -3.401  1.00 0.00 ? 70  VAL A CB   2  
ATOM 3044  C CG1  . VAL A 1 70  ? -5.949  -10.975 -3.309  1.00 0.00 ? 70  VAL A CG1  2  
ATOM 3045  C CG2  . VAL A 1 70  ? -6.960  -13.104 -4.156  1.00 0.00 ? 70  VAL A CG2  2  
ATOM 3046  H H    . VAL A 1 70  ? -9.546  -12.816 -2.909  1.00 0.00 ? 70  VAL A H    2  
ATOM 3047  H HA   . VAL A 1 70  ? -7.068  -12.739 -1.478  1.00 0.00 ? 70  VAL A HA   2  
ATOM 3048  H HB   . VAL A 1 70  ? -7.957  -11.240 -3.946  1.00 0.00 ? 70  VAL A HB   2  
ATOM 3049  H HG11 . VAL A 1 70  ? -5.508  -10.882 -4.290  1.00 0.00 ? 70  VAL A HG11 2  
ATOM 3050  H HG12 . VAL A 1 70  ? -6.190  -9.994  -2.926  1.00 0.00 ? 70  VAL A HG12 2  
ATOM 3051  H HG13 . VAL A 1 70  ? -5.248  -11.459 -2.644  1.00 0.00 ? 70  VAL A HG13 2  
ATOM 3052  H HG21 . VAL A 1 70  ? -7.671  -13.198 -4.963  1.00 0.00 ? 70  VAL A HG21 2  
ATOM 3053  H HG22 . VAL A 1 70  ? -5.958  -13.093 -4.557  1.00 0.00 ? 70  VAL A HG22 2  
ATOM 3054  H HG23 . VAL A 1 70  ? -7.069  -13.942 -3.482  1.00 0.00 ? 70  VAL A HG23 2  
ATOM 3055  N N    . ILE A 1 71  ? -7.216  -10.696 -0.104  1.00 0.00 ? 71  ILE A N    2  
ATOM 3056  C CA   . ILE A 1 71  ? -7.263  -9.494  0.720   1.00 0.00 ? 71  ILE A CA   2  
ATOM 3057  C C    . ILE A 1 71  ? -5.885  -8.852  0.834   1.00 0.00 ? 71  ILE A C    2  
ATOM 3058  O O    . ILE A 1 71  ? -4.862  -9.524  0.698   1.00 0.00 ? 71  ILE A O    2  
ATOM 3059  C CB   . ILE A 1 71  ? -7.792  -9.801  2.134   1.00 0.00 ? 71  ILE A CB   2  
ATOM 3060  C CG1  . ILE A 1 71  ? -9.105  -10.583 2.052   1.00 0.00 ? 71  ILE A CG1  2  
ATOM 3061  C CG2  . ILE A 1 71  ? -7.986  -8.512  2.918   1.00 0.00 ? 71  ILE A CG2  2  
ATOM 3062  C CD1  . ILE A 1 71  ? -10.294 -9.730  1.667   1.00 0.00 ? 71  ILE A CD1  2  
ATOM 3063  H H    . ILE A 1 71  ? -6.656  -11.448 0.179   1.00 0.00 ? 71  ILE A H    2  
ATOM 3064  H HA   . ILE A 1 71  ? -7.937  -8.794  0.249   1.00 0.00 ? 71  ILE A HA   2  
ATOM 3065  H HB   . ILE A 1 71  ? -7.056  -10.400 2.647   1.00 0.00 ? 71  ILE A HB   2  
ATOM 3066  H HG12 . ILE A 1 71  ? -9.006  -11.364 1.314   1.00 0.00 ? 71  ILE A HG12 2  
ATOM 3067  H HG13 . ILE A 1 71  ? -9.311  -11.027 3.015   1.00 0.00 ? 71  ILE A HG13 2  
ATOM 3068  H HG21 . ILE A 1 71  ? -8.654  -8.692  3.747   1.00 0.00 ? 71  ILE A HG21 2  
ATOM 3069  H HG22 . ILE A 1 71  ? -7.032  -8.173  3.293   1.00 0.00 ? 71  ILE A HG22 2  
ATOM 3070  H HG23 . ILE A 1 71  ? -8.409  -7.757  2.272   1.00 0.00 ? 71  ILE A HG23 2  
ATOM 3071  H HD11 . ILE A 1 71  ? -10.250 -9.508  0.611   1.00 0.00 ? 71  ILE A HD11 2  
ATOM 3072  H HD12 . ILE A 1 71  ? -11.206 -10.265 1.884   1.00 0.00 ? 71  ILE A HD12 2  
ATOM 3073  H HD13 . ILE A 1 71  ? -10.273 -8.809  2.229   1.00 0.00 ? 71  ILE A HD13 2  
ATOM 3074  N N    . VAL A 1 72  ? -5.865  -7.548  1.087   1.00 0.00 ? 72  VAL A N    2  
ATOM 3075  C CA   . VAL A 1 72  ? -4.612  -6.814  1.223   1.00 0.00 ? 72  VAL A CA   2  
ATOM 3076  C C    . VAL A 1 72  ? -4.565  -6.045  2.538   1.00 0.00 ? 72  VAL A C    2  
ATOM 3077  O O    . VAL A 1 72  ? -5.493  -5.309  2.874   1.00 0.00 ? 72  VAL A O    2  
ATOM 3078  C CB   . VAL A 1 72  ? -4.410  -5.828  0.057   1.00 0.00 ? 72  VAL A CB   2  
ATOM 3079  C CG1  . VAL A 1 72  ? -3.091  -5.085  0.208   1.00 0.00 ? 72  VAL A CG1  2  
ATOM 3080  C CG2  . VAL A 1 72  ? -4.469  -6.560  -1.276  1.00 0.00 ? 72  VAL A CG2  2  
ATOM 3081  H H    . VAL A 1 72  ? -6.713  -7.067  1.185   1.00 0.00 ? 72  VAL A H    2  
ATOM 3082  H HA   . VAL A 1 72  ? -3.802  -7.530  1.206   1.00 0.00 ? 72  VAL A HA   2  
ATOM 3083  H HB   . VAL A 1 72  ? -5.210  -5.104  0.082   1.00 0.00 ? 72  VAL A HB   2  
ATOM 3084  H HG11 . VAL A 1 72  ? -3.207  -4.071  -0.145  1.00 0.00 ? 72  VAL A HG11 2  
ATOM 3085  H HG12 . VAL A 1 72  ? -2.801  -5.074  1.249   1.00 0.00 ? 72  VAL A HG12 2  
ATOM 3086  H HG13 . VAL A 1 72  ? -2.329  -5.583  -0.373  1.00 0.00 ? 72  VAL A HG13 2  
ATOM 3087  H HG21 . VAL A 1 72  ? -4.053  -5.933  -2.050  1.00 0.00 ? 72  VAL A HG21 2  
ATOM 3088  H HG22 . VAL A 1 72  ? -3.900  -7.475  -1.208  1.00 0.00 ? 72  VAL A HG22 2  
ATOM 3089  H HG23 . VAL A 1 72  ? -5.497  -6.792  -1.514  1.00 0.00 ? 72  VAL A HG23 2  
ATOM 3090  N N    . THR A 1 73  ? -3.476  -6.220  3.281   1.00 0.00 ? 73  THR A N    2  
ATOM 3091  C CA   . THR A 1 73  ? -3.308  -5.543  4.561   1.00 0.00 ? 73  THR A CA   2  
ATOM 3092  C C    . THR A 1 73  ? -2.012  -4.741  4.592   1.00 0.00 ? 73  THR A C    2  
ATOM 3093  O O    . THR A 1 73  ? -0.945  -5.252  4.246   1.00 0.00 ? 73  THR A O    2  
ATOM 3094  C CB   . THR A 1 73  ? -3.307  -6.545  5.730   1.00 0.00 ? 73  THR A CB   2  
ATOM 3095  O OG1  . THR A 1 73  ? -4.220  -7.614  5.460   1.00 0.00 ? 73  THR A OG1  2  
ATOM 3096  C CG2  . THR A 1 73  ? -3.692  -5.858  7.032   1.00 0.00 ? 73  THR A CG2  2  
ATOM 3097  H H    . THR A 1 73  ? -2.771  -6.819  2.960   1.00 0.00 ? 73  THR A H    2  
ATOM 3098  H HA   . THR A 1 73  ? -4.141  -4.868  4.693   1.00 0.00 ? 73  THR A HA   2  
ATOM 3099  H HB   . THR A 1 73  ? -2.310  -6.951  5.836   1.00 0.00 ? 73  THR A HB   2  
ATOM 3100  H HG1  . THR A 1 73  ? -4.944  -7.288  4.920   1.00 0.00 ? 73  THR A HG1  2  
ATOM 3101  H HG21 . THR A 1 73  ? -4.766  -5.758  7.081   1.00 0.00 ? 73  THR A HG21 2  
ATOM 3102  H HG22 . THR A 1 73  ? -3.238  -4.880  7.071   1.00 0.00 ? 73  THR A HG22 2  
ATOM 3103  H HG23 . THR A 1 73  ? -3.347  -6.450  7.867   1.00 0.00 ? 73  THR A HG23 2  
ATOM 3104  N N    . LEU A 1 74  ? -2.109  -3.484  5.010   1.00 0.00 ? 74  LEU A N    2  
ATOM 3105  C CA   . LEU A 1 74  ? -0.943  -2.611  5.088   1.00 0.00 ? 74  LEU A CA   2  
ATOM 3106  C C    . LEU A 1 74  ? -0.288  -2.698  6.463   1.00 0.00 ? 74  LEU A C    2  
ATOM 3107  O O    . LEU A 1 74  ? -0.926  -2.435  7.481   1.00 0.00 ? 74  LEU A O    2  
ATOM 3108  C CB   . LEU A 1 74  ? -1.344  -1.165  4.791   1.00 0.00 ? 74  LEU A CB   2  
ATOM 3109  C CG   . LEU A 1 74  ? -0.235  -0.120  4.925   1.00 0.00 ? 74  LEU A CG   2  
ATOM 3110  C CD1  . LEU A 1 74  ? 0.501   0.048   3.605   1.00 0.00 ? 74  LEU A CD1  2  
ATOM 3111  C CD2  . LEU A 1 74  ? -0.808  1.210   5.391   1.00 0.00 ? 74  LEU A CD2  2  
ATOM 3112  H H    . LEU A 1 74  ? -2.985  -3.134  5.273   1.00 0.00 ? 74  LEU A H    2  
ATOM 3113  H HA   . LEU A 1 74  ? -0.233  -2.939  4.343   1.00 0.00 ? 74  LEU A HA   2  
ATOM 3114  H HB2  . LEU A 1 74  ? -1.715  -1.125  3.779   1.00 0.00 ? 74  LEU A HB2  2  
ATOM 3115  H HB3  . LEU A 1 74  ? -2.137  -0.896  5.474   1.00 0.00 ? 74  LEU A HB3  2  
ATOM 3116  H HG   . LEU A 1 74  ? 0.480   -0.456  5.664   1.00 0.00 ? 74  LEU A HG   2  
ATOM 3117  H HD11 . LEU A 1 74  ? 0.240   -0.761  2.941   1.00 0.00 ? 74  LEU A HD11 2  
ATOM 3118  H HD12 . LEU A 1 74  ? 1.566   0.038   3.783   1.00 0.00 ? 74  LEU A HD12 2  
ATOM 3119  H HD13 . LEU A 1 74  ? 0.221   0.989   3.154   1.00 0.00 ? 74  LEU A HD13 2  
ATOM 3120  H HD21 . LEU A 1 74  ? -1.043  1.821   4.533   1.00 0.00 ? 74  LEU A HD21 2  
ATOM 3121  H HD22 . LEU A 1 74  ? -0.081  1.718   6.008   1.00 0.00 ? 74  LEU A HD22 2  
ATOM 3122  H HD23 . LEU A 1 74  ? -1.706  1.033   5.966   1.00 0.00 ? 74  LEU A HD23 2  
ATOM 3123  N N    . GLU A 1 75  ? 0.989   -3.067  6.482   1.00 0.00 ? 75  GLU A N    2  
ATOM 3124  C CA   . GLU A 1 75  ? 1.730   -3.186  7.732   1.00 0.00 ? 75  GLU A CA   2  
ATOM 3125  C C    . GLU A 1 75  ? 2.766   -2.074  7.859   1.00 0.00 ? 75  GLU A C    2  
ATOM 3126  O O    . GLU A 1 75  ? 3.955   -2.266  7.601   1.00 0.00 ? 75  GLU A O    2  
ATOM 3127  C CB   . GLU A 1 75  ? 2.417   -4.551  7.815   1.00 0.00 ? 75  GLU A CB   2  
ATOM 3128  C CG   . GLU A 1 75  ? 1.665   -5.656  7.093   1.00 0.00 ? 75  GLU A CG   2  
ATOM 3129  C CD   . GLU A 1 75  ? 2.502   -6.907  6.908   1.00 0.00 ? 75  GLU A CD   2  
ATOM 3130  O OE1  . GLU A 1 75  ? 2.497   -7.764  7.816   1.00 0.00 ? 75  GLU A OE1  2  
ATOM 3131  O OE2  . GLU A 1 75  ? 3.161   -7.029  5.855   1.00 0.00 ? 75  GLU A OE2  2  
ATOM 3132  H H    . GLU A 1 75  ? 1.443   -3.264  5.636   1.00 0.00 ? 75  GLU A H    2  
ATOM 3133  H HA   . GLU A 1 75  ? 1.025   -3.099  8.545   1.00 0.00 ? 75  GLU A HA   2  
ATOM 3134  H HB2  . GLU A 1 75  ? 3.403   -4.471  7.381   1.00 0.00 ? 75  GLU A HB2  2  
ATOM 3135  H HB3  . GLU A 1 75  ? 2.512   -4.830  8.854   1.00 0.00 ? 75  GLU A HB3  2  
ATOM 3136  H HG2  . GLU A 1 75  ? 0.786   -5.911  7.667   1.00 0.00 ? 75  GLU A HG2  2  
ATOM 3137  H HG3  . GLU A 1 75  ? 1.365   -5.294  6.120   1.00 0.00 ? 75  GLU A HG3  2  
ATOM 3138  N N    . PRO A 1 76  ? 2.307   -0.881  8.266   1.00 0.00 ? 76  PRO A N    2  
ATOM 3139  C CA   . PRO A 1 76  ? 3.178   0.286   8.436   1.00 0.00 ? 76  PRO A CA   2  
ATOM 3140  C C    . PRO A 1 76  ? 4.123   0.136   9.623   1.00 0.00 ? 76  PRO A C    2  
ATOM 3141  O O    . PRO A 1 76  ? 4.044   -0.838  10.373  1.00 0.00 ? 76  PRO A O    2  
ATOM 3142  C CB   . PRO A 1 76  ? 2.191   1.431   8.680   1.00 0.00 ? 76  PRO A CB   2  
ATOM 3143  C CG   . PRO A 1 76  ? 0.978   0.773   9.242   1.00 0.00 ? 76  PRO A CG   2  
ATOM 3144  C CD   . PRO A 1 76  ? 0.903   -0.580  8.591   1.00 0.00 ? 76  PRO A CD   2  
ATOM 3145  H HA   . PRO A 1 76  ? 3.751   0.487   7.543   1.00 0.00 ? 76  PRO A HA   2  
ATOM 3146  H HB2  . PRO A 1 76  ? 2.620   2.135   9.379   1.00 0.00 ? 76  PRO A HB2  2  
ATOM 3147  H HB3  . PRO A 1 76  ? 1.974   1.929   7.747   1.00 0.00 ? 76  PRO A HB3  2  
ATOM 3148  H HG2  . PRO A 1 76  ? 1.078   0.671   10.311  1.00 0.00 ? 76  PRO A HG2  2  
ATOM 3149  H HG3  . PRO A 1 76  ? 0.101   1.354   8.999   1.00 0.00 ? 76  PRO A HG3  2  
ATOM 3150  H HD2  . PRO A 1 76  ? 0.502   -1.308  9.281   1.00 0.00 ? 76  PRO A HD2  2  
ATOM 3151  H HD3  . PRO A 1 76  ? 0.301   -0.536  7.695   1.00 0.00 ? 76  PRO A HD3  2  
ATOM 3152  N N    . CYS A 1 77  ? 5.017   1.105   9.788   1.00 0.00 ? 77  CYS A N    2  
ATOM 3153  C CA   . CYS A 1 77  ? 5.978   1.079   10.884  1.00 0.00 ? 77  CYS A CA   2  
ATOM 3154  C C    . CYS A 1 77  ? 5.836   2.320   11.761  1.00 0.00 ? 77  CYS A C    2  
ATOM 3155  O O    . CYS A 1 77  ? 5.435   3.382   11.288  1.00 0.00 ? 77  CYS A O    2  
ATOM 3156  C CB   . CYS A 1 77  ? 7.404   0.987   10.338  1.00 0.00 ? 77  CYS A CB   2  
ATOM 3157  S SG   . CYS A 1 77  ? 8.590   0.255   11.489  1.00 0.00 ? 77  CYS A SG   2  
ATOM 3158  H H    . CYS A 1 77  ? 5.031   1.855   9.157   1.00 0.00 ? 77  CYS A H    2  
ATOM 3159  H HA   . CYS A 1 77  ? 5.774   0.205   11.483  1.00 0.00 ? 77  CYS A HA   2  
ATOM 3160  H HB2  . CYS A 1 77  ? 7.400   0.382   9.443   1.00 0.00 ? 77  CYS A HB2  2  
ATOM 3161  H HB3  . CYS A 1 77  ? 7.752   1.979   10.091  1.00 0.00 ? 77  CYS A HB3  2  
ATOM 3162  H HG   . CYS A 1 77  ? 8.410   -1.057  11.482  1.00 0.00 ? 77  CYS A HG   2  
ATOM 3163  N N    . GLU A 1 78  ? 6.167   2.175   13.040  1.00 0.00 ? 78  GLU A N    2  
ATOM 3164  C CA   . GLU A 1 78  ? 6.073   3.283   13.983  1.00 0.00 ? 78  GLU A CA   2  
ATOM 3165  C C    . GLU A 1 78  ? 7.252   4.238   13.818  1.00 0.00 ? 78  GLU A C    2  
ATOM 3166  O O    . GLU A 1 78  ? 7.411   5.184   14.591  1.00 0.00 ? 78  GLU A O    2  
ATOM 3167  C CB   . GLU A 1 78  ? 6.025   2.758   15.419  1.00 0.00 ? 78  GLU A CB   2  
ATOM 3168  C CG   . GLU A 1 78  ? 7.113   1.745   15.733  1.00 0.00 ? 78  GLU A CG   2  
ATOM 3169  C CD   . GLU A 1 78  ? 7.445   1.686   17.212  1.00 0.00 ? 78  GLU A CD   2  
ATOM 3170  O OE1  . GLU A 1 78  ? 7.613   2.760   17.826  1.00 0.00 ? 78  GLU A OE1  2  
ATOM 3171  O OE2  . GLU A 1 78  ? 7.537   0.564   17.754  1.00 0.00 ? 78  GLU A OE2  2  
ATOM 3172  H H    . GLU A 1 78  ? 6.480   1.302   13.357  1.00 0.00 ? 78  GLU A H    2  
ATOM 3173  H HA   . GLU A 1 78  ? 5.160   3.819   13.775  1.00 0.00 ? 78  GLU A HA   2  
ATOM 3174  H HB2  . GLU A 1 78  ? 6.130   3.591   16.098  1.00 0.00 ? 78  GLU A HB2  2  
ATOM 3175  H HB3  . GLU A 1 78  ? 5.067   2.288   15.585  1.00 0.00 ? 78  GLU A HB3  2  
ATOM 3176  H HG2  . GLU A 1 78  ? 6.781   0.768   15.416  1.00 0.00 ? 78  GLU A HG2  2  
ATOM 3177  H HG3  . GLU A 1 78  ? 8.006   2.015   15.189  1.00 0.00 ? 78  GLU A HG3  2  
ATOM 3178  N N    . ARG A 1 79  ? 8.076   3.983   12.807  1.00 0.00 ? 79  ARG A N    2  
ATOM 3179  C CA   . ARG A 1 79  ? 9.241   4.818   12.541  1.00 0.00 ? 79  ARG A CA   2  
ATOM 3180  C C    . ARG A 1 79  ? 9.175   5.414   11.138  1.00 0.00 ? 79  ARG A C    2  
ATOM 3181  O O    . ARG A 1 79  ? 10.181  5.877   10.601  1.00 0.00 ? 79  ARG A O    2  
ATOM 3182  C CB   . ARG A 1 79  ? 10.526  4.004   12.701  1.00 0.00 ? 79  ARG A CB   2  
ATOM 3183  C CG   . ARG A 1 79  ? 10.801  3.575   14.133  1.00 0.00 ? 79  ARG A CG   2  
ATOM 3184  C CD   . ARG A 1 79  ? 11.527  4.662   14.910  1.00 0.00 ? 79  ARG A CD   2  
ATOM 3185  N NE   . ARG A 1 79  ? 11.268  4.575   16.345  1.00 0.00 ? 79  ARG A NE   2  
ATOM 3186  C CZ   . ARG A 1 79  ? 12.080  5.074   17.270  1.00 0.00 ? 79  ARG A CZ   2  
ATOM 3187  N NH1  . ARG A 1 79  ? 13.196  5.693   16.912  1.00 0.00 ? 79  ARG A NH1  2  
ATOM 3188  N NH2  . ARG A 1 79  ? 11.775  4.955   18.556  1.00 0.00 ? 79  ARG A NH2  2  
ATOM 3189  H H    . ARG A 1 79  ? 7.896   3.215   12.226  1.00 0.00 ? 79  ARG A H    2  
ATOM 3190  H HA   . ARG A 1 79  ? 9.244   5.623   13.262  1.00 0.00 ? 79  ARG A HA   2  
ATOM 3191  H HB2  . ARG A 1 79  ? 10.454  3.116   12.090  1.00 0.00 ? 79  ARG A HB2  2  
ATOM 3192  H HB3  . ARG A 1 79  ? 11.360  4.599   12.360  1.00 0.00 ? 79  ARG A HB3  2  
ATOM 3193  H HG2  . ARG A 1 79  ? 9.862   3.364   14.623  1.00 0.00 ? 79  ARG A HG2  2  
ATOM 3194  H HG3  . ARG A 1 79  ? 11.412  2.684   14.121  1.00 0.00 ? 79  ARG A HG3  2  
ATOM 3195  H HD2  . ARG A 1 79  ? 12.588  4.561   14.739  1.00 0.00 ? 79  ARG A HD2  2  
ATOM 3196  H HD3  . ARG A 1 79  ? 11.195  5.625   14.552  1.00 0.00 ? 79  ARG A HD3  2  
ATOM 3197  H HE   . ARG A 1 79  ? 10.448  4.121   16.631  1.00 0.00 ? 79  ARG A HE   2  
ATOM 3198  H HH11 . ARG A 1 79  ? 13.428  5.786   15.944  1.00 0.00 ? 79  ARG A HH11 2  
ATOM 3199  H HH12 . ARG A 1 79  ? 13.805  6.070   17.611  1.00 0.00 ? 79  ARG A HH12 2  
ATOM 3200  H HH21 . ARG A 1 79  ? 10.934  4.489   18.829  1.00 0.00 ? 79  ARG A HH21 2  
ATOM 3201  H HH22 . ARG A 1 79  ? 12.387  5.331   19.251  1.00 0.00 ? 79  ARG A HH22 2  
ATOM 3202  N N    . SER A 1 80  ? 7.983   5.399   10.550  1.00 0.00 ? 80  SER A N    2  
ATOM 3203  C CA   . SER A 1 80  ? 7.786   5.933   9.208   1.00 0.00 ? 80  SER A CA   2  
ATOM 3204  C C    . SER A 1 80  ? 6.602   6.895   9.174   1.00 0.00 ? 80  SER A C    2  
ATOM 3205  O O    . SER A 1 80  ? 5.931   7.105   10.184  1.00 0.00 ? 80  SER A O    2  
ATOM 3206  C CB   . SER A 1 80  ? 7.561   4.795   8.211   1.00 0.00 ? 80  SER A CB   2  
ATOM 3207  O OG   . SER A 1 80  ? 8.303   3.644   8.574   1.00 0.00 ? 80  SER A OG   2  
ATOM 3208  H H    . SER A 1 80  ? 7.218   5.016   11.030  1.00 0.00 ? 80  SER A H    2  
ATOM 3209  H HA   . SER A 1 80  ? 8.680   6.472   8.931   1.00 0.00 ? 80  SER A HA   2  
ATOM 3210  H HB2  . SER A 1 80  ? 6.512   4.541   8.190   1.00 0.00 ? 80  SER A HB2  2  
ATOM 3211  H HB3  . SER A 1 80  ? 7.874   5.115   7.227   1.00 0.00 ? 80  SER A HB3  2  
ATOM 3212  H HG   . SER A 1 80  ? 9.144   3.912   8.953   1.00 0.00 ? 80  SER A HG   2  
ATOM 3213  N N    . GLU A 1 81  ? 6.353   7.477   8.005   1.00 0.00 ? 81  GLU A N    2  
ATOM 3214  C CA   . GLU A 1 81  ? 5.251   8.417   7.840   1.00 0.00 ? 81  GLU A CA   2  
ATOM 3215  C C    . GLU A 1 81  ? 4.223   7.883   6.847   1.00 0.00 ? 81  GLU A C    2  
ATOM 3216  O O    . GLU A 1 81  ? 4.208   8.275   5.679   1.00 0.00 ? 81  GLU A O    2  
ATOM 3217  C CB   . GLU A 1 81  ? 5.776   9.774   7.367   1.00 0.00 ? 81  GLU A CB   2  
ATOM 3218  C CG   . GLU A 1 81  ? 4.933   10.949  7.832   1.00 0.00 ? 81  GLU A CG   2  
ATOM 3219  C CD   . GLU A 1 81  ? 5.001   12.129  6.882   1.00 0.00 ? 81  GLU A CD   2  
ATOM 3220  O OE1  . GLU A 1 81  ? 5.504   11.954  5.753   1.00 0.00 ? 81  GLU A OE1  2  
ATOM 3221  O OE2  . GLU A 1 81  ? 4.550   13.228  7.269   1.00 0.00 ? 81  GLU A OE2  2  
ATOM 3222  H H    . GLU A 1 81  ? 6.924   7.269   7.236   1.00 0.00 ? 81  GLU A H    2  
ATOM 3223  H HA   . GLU A 1 81  ? 4.774   8.542   8.801   1.00 0.00 ? 81  GLU A HA   2  
ATOM 3224  H HB2  . GLU A 1 81  ? 6.781   9.908   7.740   1.00 0.00 ? 81  GLU A HB2  2  
ATOM 3225  H HB3  . GLU A 1 81  ? 5.799   9.781   6.287   1.00 0.00 ? 81  GLU A HB3  2  
ATOM 3226  H HG2  . GLU A 1 81  ? 3.904   10.629  7.911   1.00 0.00 ? 81  GLU A HG2  2  
ATOM 3227  H HG3  . GLU A 1 81  ? 5.285   11.267  8.803   1.00 0.00 ? 81  GLU A HG3  2  
ATOM 3228  N N    . THR A 1 82  ? 3.365   6.983   7.318   1.00 0.00 ? 82  THR A N    2  
ATOM 3229  C CA   . THR A 1 82  ? 2.336   6.392   6.473   1.00 0.00 ? 82  THR A CA   2  
ATOM 3230  C C    . THR A 1 82  ? 0.971   7.011   6.755   1.00 0.00 ? 82  THR A C    2  
ATOM 3231  O O    . THR A 1 82  ? 0.683   7.414   7.882   1.00 0.00 ? 82  THR A O    2  
ATOM 3232  C CB   . THR A 1 82  ? 2.248   4.868   6.676   1.00 0.00 ? 82  THR A CB   2  
ATOM 3233  O OG1  . THR A 1 82  ? 3.553   4.331   6.920   1.00 0.00 ? 82  THR A OG1  2  
ATOM 3234  C CG2  . THR A 1 82  ? 1.637   4.194   5.457   1.00 0.00 ? 82  THR A CG2  2  
ATOM 3235  H H    . THR A 1 82  ? 3.428   6.711   8.257   1.00 0.00 ? 82  THR A H    2  
ATOM 3236  H HA   . THR A 1 82  ? 2.600   6.583   5.443   1.00 0.00 ? 82  THR A HA   2  
ATOM 3237  H HB   . THR A 1 82  ? 1.619   4.670   7.532   1.00 0.00 ? 82  THR A HB   2  
ATOM 3238  H HG1  . THR A 1 82  ? 3.471   3.464   7.326   1.00 0.00 ? 82  THR A HG1  2  
ATOM 3239  H HG21 . THR A 1 82  ? 0.794   4.773   5.111   1.00 0.00 ? 82  THR A HG21 2  
ATOM 3240  H HG22 . THR A 1 82  ? 1.306   3.201   5.723   1.00 0.00 ? 82  THR A HG22 2  
ATOM 3241  H HG23 . THR A 1 82  ? 2.376   4.130   4.673   1.00 0.00 ? 82  THR A HG23 2  
ATOM 3242  N N    . TYR A 1 83  ? 0.135   7.081   5.726   1.00 0.00 ? 83  TYR A N    2  
ATOM 3243  C CA   . TYR A 1 83  ? -1.200  7.652   5.863   1.00 0.00 ? 83  TYR A CA   2  
ATOM 3244  C C    . TYR A 1 83  ? -2.191  6.947   4.943   1.00 0.00 ? 83  TYR A C    2  
ATOM 3245  O O    . TYR A 1 83  ? -2.026  6.938   3.723   1.00 0.00 ? 83  TYR A O    2  
ATOM 3246  C CB   . TYR A 1 83  ? -1.172  9.149   5.550   1.00 0.00 ? 83  TYR A CB   2  
ATOM 3247  C CG   . TYR A 1 83  ? -0.322  9.953   6.508   1.00 0.00 ? 83  TYR A CG   2  
ATOM 3248  C CD1  . TYR A 1 83  ? -0.752  10.207  7.804   1.00 0.00 ? 83  TYR A CD1  2  
ATOM 3249  C CD2  . TYR A 1 83  ? 0.913   10.457  6.117   1.00 0.00 ? 83  TYR A CD2  2  
ATOM 3250  C CE1  . TYR A 1 83  ? 0.021   10.941  8.683   1.00 0.00 ? 83  TYR A CE1  2  
ATOM 3251  C CE2  . TYR A 1 83  ? 1.693   11.191  6.990   1.00 0.00 ? 83  TYR A CE2  2  
ATOM 3252  C CZ   . TYR A 1 83  ? 1.243   11.430  8.271   1.00 0.00 ? 83  TYR A CZ   2  
ATOM 3253  O OH   . TYR A 1 83  ? 2.016   12.161  9.144   1.00 0.00 ? 83  TYR A OH   2  
ATOM 3254  H H    . TYR A 1 83  ? 0.422   6.743   4.852   1.00 0.00 ? 83  TYR A H    2  
ATOM 3255  H HA   . TYR A 1 83  ? -1.516  7.515   6.887   1.00 0.00 ? 83  TYR A HA   2  
ATOM 3256  H HB2  . TYR A 1 83  ? -0.777  9.295   4.556   1.00 0.00 ? 83  TYR A HB2  2  
ATOM 3257  H HB3  . TYR A 1 83  ? -2.179  9.538   5.593   1.00 0.00 ? 83  TYR A HB3  2  
ATOM 3258  H HD1  . TYR A 1 83  ? -1.710  9.821   8.124   1.00 0.00 ? 83  TYR A HD1  2  
ATOM 3259  H HD2  . TYR A 1 83  ? 1.263   10.267  5.113   1.00 0.00 ? 83  TYR A HD2  2  
ATOM 3260  H HE1  . TYR A 1 83  ? -0.332  11.128  9.686   1.00 0.00 ? 83  TYR A HE1  2  
ATOM 3261  H HE2  . TYR A 1 83  ? 2.650   11.574  6.668   1.00 0.00 ? 83  TYR A HE2  2  
ATOM 3262  H HH   . TYR A 1 83  ? 1.849   13.097  9.013   1.00 0.00 ? 83  TYR A HH   2  
ATOM 3263  N N    . VAL A 1 84  ? -3.224  6.358   5.537   1.00 0.00 ? 84  VAL A N    2  
ATOM 3264  C CA   . VAL A 1 84  ? -4.245  5.651   4.772   1.00 0.00 ? 84  VAL A CA   2  
ATOM 3265  C C    . VAL A 1 84  ? -5.629  6.235   5.032   1.00 0.00 ? 84  VAL A C    2  
ATOM 3266  O O    . VAL A 1 84  ? -5.980  6.543   6.170   1.00 0.00 ? 84  VAL A O    2  
ATOM 3267  C CB   . VAL A 1 84  ? -4.261  4.149   5.112   1.00 0.00 ? 84  VAL A CB   2  
ATOM 3268  C CG1  . VAL A 1 84  ? -5.509  3.487   4.547   1.00 0.00 ? 84  VAL A CG1  2  
ATOM 3269  C CG2  . VAL A 1 84  ? -3.004  3.471   4.589   1.00 0.00 ? 84  VAL A CG2  2  
ATOM 3270  H H    . VAL A 1 84  ? -3.302  6.400   6.513   1.00 0.00 ? 84  VAL A H    2  
ATOM 3271  H HA   . VAL A 1 84  ? -4.010  5.759   3.723   1.00 0.00 ? 84  VAL A HA   2  
ATOM 3272  H HB   . VAL A 1 84  ? -4.281  4.044   6.187   1.00 0.00 ? 84  VAL A HB   2  
ATOM 3273  H HG11 . VAL A 1 84  ? -5.356  2.419   4.493   1.00 0.00 ? 84  VAL A HG11 2  
ATOM 3274  H HG12 . VAL A 1 84  ? -6.352  3.700   5.188   1.00 0.00 ? 84  VAL A HG12 2  
ATOM 3275  H HG13 . VAL A 1 84  ? -5.703  3.872   3.556   1.00 0.00 ? 84  VAL A HG13 2  
ATOM 3276  H HG21 . VAL A 1 84  ? -2.758  2.631   5.221   1.00 0.00 ? 84  VAL A HG21 2  
ATOM 3277  H HG22 . VAL A 1 84  ? -3.176  3.125   3.580   1.00 0.00 ? 84  VAL A HG22 2  
ATOM 3278  H HG23 . VAL A 1 84  ? -2.186  4.176   4.593   1.00 0.00 ? 84  VAL A HG23 2  
ATOM 3279  N N    . ASN A 1 85  ? -6.411  6.385   3.968   1.00 0.00 ? 85  ASN A N    2  
ATOM 3280  C CA   . ASN A 1 85  ? -7.758  6.932   4.081   1.00 0.00 ? 85  ASN A CA   2  
ATOM 3281  C C    . ASN A 1 85  ? -7.723  8.357   4.626   1.00 0.00 ? 85  ASN A C    2  
ATOM 3282  O O    . ASN A 1 85  ? -8.631  8.783   5.338   1.00 0.00 ? 85  ASN A O    2  
ATOM 3283  C CB   . ASN A 1 85  ? -8.616  6.048   4.988   1.00 0.00 ? 85  ASN A CB   2  
ATOM 3284  C CG   . ASN A 1 85  ? -9.340  4.960   4.218   1.00 0.00 ? 85  ASN A CG   2  
ATOM 3285  O OD1  . ASN A 1 85  ? -10.567 4.967   4.117   1.00 0.00 ? 85  ASN A OD1  2  
ATOM 3286  N ND2  . ASN A 1 85  ? -8.581  4.017   3.672   1.00 0.00 ? 85  ASN A ND2  2  
ATOM 3287  H H    . ASN A 1 85  ? -6.075  6.121   3.086   1.00 0.00 ? 85  ASN A H    2  
ATOM 3288  H HA   . ASN A 1 85  ? -8.193  6.948   3.093   1.00 0.00 ? 85  ASN A HA   2  
ATOM 3289  H HB2  . ASN A 1 85  ? -7.983  5.579   5.727   1.00 0.00 ? 85  ASN A HB2  2  
ATOM 3290  H HB3  . ASN A 1 85  ? -9.352  6.661   5.487   1.00 0.00 ? 85  ASN A HB3  2  
ATOM 3291  H HD21 . ASN A 1 85  ? -7.610  4.075   3.794   1.00 0.00 ? 85  ASN A HD21 2  
ATOM 3292  H HD22 . ASN A 1 85  ? -9.023  3.302   3.168   1.00 0.00 ? 85  ASN A HD22 2  
ATOM 3293  N N    . GLY A 1 86  ? -6.666  9.089   4.286   1.00 0.00 ? 86  GLY A N    2  
ATOM 3294  C CA   . GLY A 1 86  ? -6.532  10.457  4.749   1.00 0.00 ? 86  GLY A CA   2  
ATOM 3295  C C    . GLY A 1 86  ? -6.128  10.538  6.208   1.00 0.00 ? 86  GLY A C    2  
ATOM 3296  O O    . GLY A 1 86  ? -6.003  11.629  6.767   1.00 0.00 ? 86  GLY A O    2  
ATOM 3297  H H    . GLY A 1 86  ? -5.972  8.696   3.715   1.00 0.00 ? 86  GLY A H    2  
ATOM 3298  H HA2  . GLY A 1 86  ? -5.784  10.957  4.151   1.00 0.00 ? 86  GLY A HA2  2  
ATOM 3299  H HA3  . GLY A 1 86  ? -7.477  10.963  4.621   1.00 0.00 ? 86  GLY A HA3  2  
ATOM 3300  N N    . LYS A 1 87  ? -5.923  9.381   6.829   1.00 0.00 ? 87  LYS A N    2  
ATOM 3301  C CA   . LYS A 1 87  ? -5.531  9.324   8.232   1.00 0.00 ? 87  LYS A CA   2  
ATOM 3302  C C    . LYS A 1 87  ? -4.190  8.616   8.394   1.00 0.00 ? 87  LYS A C    2  
ATOM 3303  O O    . LYS A 1 87  ? -3.618  8.121   7.423   1.00 0.00 ? 87  LYS A O    2  
ATOM 3304  C CB   . LYS A 1 87  ? -6.603  8.603   9.053   1.00 0.00 ? 87  LYS A CB   2  
ATOM 3305  C CG   . LYS A 1 87  ? -6.626  7.100   8.837   1.00 0.00 ? 87  LYS A CG   2  
ATOM 3306  C CD   . LYS A 1 87  ? -7.118  6.367   10.074  1.00 0.00 ? 87  LYS A CD   2  
ATOM 3307  C CE   . LYS A 1 87  ? -7.084  4.859   9.877   1.00 0.00 ? 87  LYS A CE   2  
ATOM 3308  N NZ   . LYS A 1 87  ? -7.648  4.134   11.050  1.00 0.00 ? 87  LYS A NZ   2  
ATOM 3309  H H    . LYS A 1 87  ? -6.038  8.545   6.330   1.00 0.00 ? 87  LYS A H    2  
ATOM 3310  H HA   . LYS A 1 87  ? -5.436  10.338  8.591   1.00 0.00 ? 87  LYS A HA   2  
ATOM 3311  H HB2  . LYS A 1 87  ? -6.424  8.793   10.101  1.00 0.00 ? 87  LYS A HB2  2  
ATOM 3312  H HB3  . LYS A 1 87  ? -7.572  9.000   8.785   1.00 0.00 ? 87  LYS A HB3  2  
ATOM 3313  H HG2  . LYS A 1 87  ? -7.285  6.874   8.012   1.00 0.00 ? 87  LYS A HG2  2  
ATOM 3314  H HG3  . LYS A 1 87  ? -5.626  6.764   8.604   1.00 0.00 ? 87  LYS A HG3  2  
ATOM 3315  H HD2  . LYS A 1 87  ? -6.484  6.623   10.910  1.00 0.00 ? 87  LYS A HD2  2  
ATOM 3316  H HD3  . LYS A 1 87  ? -8.134  6.672   10.282  1.00 0.00 ? 87  LYS A HD3  2  
ATOM 3317  H HE2  . LYS A 1 87  ? -7.662  4.610   9.000   1.00 0.00 ? 87  LYS A HE2  2  
ATOM 3318  H HE3  . LYS A 1 87  ? -6.060  4.550   9.733   1.00 0.00 ? 87  LYS A HE3  2  
ATOM 3319  H HZ1  . LYS A 1 87  ? -8.100  4.806   11.702  1.00 0.00 ? 87  LYS A HZ1  2  
ATOM 3320  H HZ2  . LYS A 1 87  ? -6.892  3.630   11.555  1.00 0.00 ? 87  LYS A HZ2  2  
ATOM 3321  H HZ3  . LYS A 1 87  ? -8.359  3.443   10.735  1.00 0.00 ? 87  LYS A HZ3  2  
ATOM 3322  N N    . ARG A 1 88  ? -3.695  8.571   9.627   1.00 0.00 ? 88  ARG A N    2  
ATOM 3323  C CA   . ARG A 1 88  ? -2.421  7.923   9.915   1.00 0.00 ? 88  ARG A CA   2  
ATOM 3324  C C    . ARG A 1 88  ? -2.616  6.432   10.173  1.00 0.00 ? 88  ARG A C    2  
ATOM 3325  O O    . ARG A 1 88  ? -3.575  6.024   10.830  1.00 0.00 ? 88  ARG A O    2  
ATOM 3326  C CB   . ARG A 1 88  ? -1.754  8.578   11.126  1.00 0.00 ? 88  ARG A CB   2  
ATOM 3327  C CG   . ARG A 1 88  ? -0.450  7.914   11.536  1.00 0.00 ? 88  ARG A CG   2  
ATOM 3328  C CD   . ARG A 1 88  ? 0.739   8.530   10.815  1.00 0.00 ? 88  ARG A CD   2  
ATOM 3329  N NE   . ARG A 1 88  ? 1.861   7.599   10.716  1.00 0.00 ? 88  ARG A NE   2  
ATOM 3330  C CZ   . ARG A 1 88  ? 2.756   7.423   11.681  1.00 0.00 ? 88  ARG A CZ   2  
ATOM 3331  N NH1  . ARG A 1 88  ? 2.662   8.109   12.812  1.00 0.00 ? 88  ARG A NH1  2  
ATOM 3332  N NH2  . ARG A 1 88  ? 3.749   6.558   11.517  1.00 0.00 ? 88  ARG A NH2  2  
ATOM 3333  H H    . ARG A 1 88  ? -4.198  8.984   10.360  1.00 0.00 ? 88  ARG A H    2  
ATOM 3334  H HA   . ARG A 1 88  ? -1.783  8.047   9.053   1.00 0.00 ? 88  ARG A HA   2  
ATOM 3335  H HB2  . ARG A 1 88  ? -1.548  9.613   10.893  1.00 0.00 ? 88  ARG A HB2  2  
ATOM 3336  H HB3  . ARG A 1 88  ? -2.434  8.534   11.963  1.00 0.00 ? 88  ARG A HB3  2  
ATOM 3337  H HG2  . ARG A 1 88  ? -0.314  8.036   12.601  1.00 0.00 ? 88  ARG A HG2  2  
ATOM 3338  H HG3  . ARG A 1 88  ? -0.501  6.863   11.296  1.00 0.00 ? 88  ARG A HG3  2  
ATOM 3339  H HD2  . ARG A 1 88  ? 0.432   8.815   9.820   1.00 0.00 ? 88  ARG A HD2  2  
ATOM 3340  H HD3  . ARG A 1 88  ? 1.058   9.407   11.358  1.00 0.00 ? 88  ARG A HD3  2  
ATOM 3341  H HE   . ARG A 1 88  ? 1.950   7.082   9.889   1.00 0.00 ? 88  ARG A HE   2  
ATOM 3342  H HH11 . ARG A 1 88  ? 1.914   8.761   12.939  1.00 0.00 ? 88  ARG A HH11 2  
ATOM 3343  H HH12 . ARG A 1 88  ? 3.337   7.974   13.537  1.00 0.00 ? 88  ARG A HH12 2  
ATOM 3344  H HH21 . ARG A 1 88  ? 3.823   6.038   10.666  1.00 0.00 ? 88  ARG A HH21 2  
ATOM 3345  H HH22 . ARG A 1 88  ? 4.422   6.426   12.243  1.00 0.00 ? 88  ARG A HH22 2  
ATOM 3346  N N    . VAL A 1 89  ? -1.700  5.622   9.651   1.00 0.00 ? 89  VAL A N    2  
ATOM 3347  C CA   . VAL A 1 89  ? -1.771  4.176   9.825   1.00 0.00 ? 89  VAL A CA   2  
ATOM 3348  C C    . VAL A 1 89  ? -0.500  3.638   10.473  1.00 0.00 ? 89  VAL A C    2  
ATOM 3349  O O    . VAL A 1 89  ? 0.556   3.583   9.841   1.00 0.00 ? 89  VAL A O    2  
ATOM 3350  C CB   . VAL A 1 89  ? -1.992  3.459   8.480   1.00 0.00 ? 89  VAL A CB   2  
ATOM 3351  C CG1  . VAL A 1 89  ? -0.809  3.687   7.552   1.00 0.00 ? 89  VAL A CG1  2  
ATOM 3352  C CG2  . VAL A 1 89  ? -2.227  1.972   8.702   1.00 0.00 ? 89  VAL A CG2  2  
ATOM 3353  H H    . VAL A 1 89  ? -0.960  6.006   9.138   1.00 0.00 ? 89  VAL A H    2  
ATOM 3354  H HA   . VAL A 1 89  ? -2.611  3.957   10.468  1.00 0.00 ? 89  VAL A HA   2  
ATOM 3355  H HB   . VAL A 1 89  ? -2.872  3.875   8.014   1.00 0.00 ? 89  VAL A HB   2  
ATOM 3356  H HG11 . VAL A 1 89  ? -0.034  2.968   7.774   1.00 0.00 ? 89  VAL A HG11 2  
ATOM 3357  H HG12 . VAL A 1 89  ? -1.127  3.570   6.527   1.00 0.00 ? 89  VAL A HG12 2  
ATOM 3358  H HG13 . VAL A 1 89  ? -0.424  4.686   7.699   1.00 0.00 ? 89  VAL A HG13 2  
ATOM 3359  H HG21 . VAL A 1 89  ? -1.912  1.702   9.699   1.00 0.00 ? 89  VAL A HG21 2  
ATOM 3360  H HG22 . VAL A 1 89  ? -3.278  1.753   8.584   1.00 0.00 ? 89  VAL A HG22 2  
ATOM 3361  H HG23 . VAL A 1 89  ? -1.659  1.405   7.979   1.00 0.00 ? 89  VAL A HG23 2  
ATOM 3362  N N    . SER A 1 90  ? -0.608  3.240   11.736  1.00 0.00 ? 90  SER A N    2  
ATOM 3363  C CA   . SER A 1 90  ? 0.534   2.709   12.471  1.00 0.00 ? 90  SER A CA   2  
ATOM 3364  C C    . SER A 1 90  ? 0.359   1.218   12.743  1.00 0.00 ? 90  SER A C    2  
ATOM 3365  O O    . SER A 1 90  ? 1.328   0.507   13.009  1.00 0.00 ? 90  SER A O    2  
ATOM 3366  C CB   . SER A 1 90  ? 0.713   3.461   13.791  1.00 0.00 ? 90  SER A CB   2  
ATOM 3367  O OG   . SER A 1 90  ? 1.964   3.160   14.385  1.00 0.00 ? 90  SER A OG   2  
ATOM 3368  H H    . SER A 1 90  ? -1.477  3.309   12.186  1.00 0.00 ? 90  SER A H    2  
ATOM 3369  H HA   . SER A 1 90  ? 1.415   2.851   11.863  1.00 0.00 ? 90  SER A HA   2  
ATOM 3370  H HB2  . SER A 1 90  ? 0.662   4.524   13.607  1.00 0.00 ? 90  SER A HB2  2  
ATOM 3371  H HB3  . SER A 1 90  ? -0.075  3.177   14.474  1.00 0.00 ? 90  SER A HB3  2  
ATOM 3372  H HG   . SER A 1 90  ? 2.581   3.875   14.212  1.00 0.00 ? 90  SER A HG   2  
ATOM 3373  N N    . GLN A 1 91  ? -0.884  0.752   12.673  1.00 0.00 ? 91  GLN A N    2  
ATOM 3374  C CA   . GLN A 1 91  ? -1.186  -0.655  12.912  1.00 0.00 ? 91  GLN A CA   2  
ATOM 3375  C C    . GLN A 1 91  ? -1.584  -1.354  11.616  1.00 0.00 ? 91  GLN A C    2  
ATOM 3376  O O    . GLN A 1 91  ? -2.010  -0.723  10.648  1.00 0.00 ? 91  GLN A O    2  
ATOM 3377  C CB   . GLN A 1 91  ? -2.308  -0.789  13.943  1.00 0.00 ? 91  GLN A CB   2  
ATOM 3378  C CG   . GLN A 1 91  ? -1.834  -0.643  15.380  1.00 0.00 ? 91  GLN A CG   2  
ATOM 3379  C CD   . GLN A 1 91  ? -1.273  0.735   15.672  1.00 0.00 ? 91  GLN A CD   2  
ATOM 3380  O OE1  . GLN A 1 91  ? -1.709  1.731   15.095  1.00 0.00 ? 91  GLN A OE1  2  
ATOM 3381  N NE2  . GLN A 1 91  ? -0.299  0.799   16.572  1.00 0.00 ? 91  GLN A NE2  2  
ATOM 3382  H H    . GLN A 1 91  ? -1.614  1.368   12.456  1.00 0.00 ? 91  GLN A H    2  
ATOM 3383  H HA   . GLN A 1 91  ? -0.295  -1.124  13.300  1.00 0.00 ? 91  GLN A HA   2  
ATOM 3384  H HB2  . GLN A 1 91  ? -3.050  -0.028  13.751  1.00 0.00 ? 91  GLN A HB2  2  
ATOM 3385  H HB3  . GLN A 1 91  ? -2.766  -1.761  13.835  1.00 0.00 ? 91  GLN A HB3  2  
ATOM 3386  H HG2  . GLN A 1 91  ? -2.670  -0.821  16.041  1.00 0.00 ? 91  GLN A HG2  2  
ATOM 3387  H HG3  . GLN A 1 91  ? -1.065  -1.377  15.568  1.00 0.00 ? 91  GLN A HG3  2  
ATOM 3388  H HE21 . GLN A 1 91  ? -0.001  -0.036  16.991  1.00 0.00 ? 91  GLN A HE21 2  
ATOM 3389  H HE22 . GLN A 1 91  ? 0.083   1.676   16.780  1.00 0.00 ? 91  GLN A HE22 2  
ATOM 3390  N N    . PRO A 1 92  ? -1.443  -2.687  11.595  1.00 0.00 ? 92  PRO A N    2  
ATOM 3391  C CA   . PRO A 1 92  ? -1.782  -3.501  10.424  1.00 0.00 ? 92  PRO A CA   2  
ATOM 3392  C C    . PRO A 1 92  ? -3.285  -3.558  10.173  1.00 0.00 ? 92  PRO A C    2  
ATOM 3393  O O    . PRO A 1 92  ? -4.025  -4.202  10.918  1.00 0.00 ? 92  PRO A O    2  
ATOM 3394  C CB   . PRO A 1 92  ? -1.248  -4.888  10.788  1.00 0.00 ? 92  PRO A CB   2  
ATOM 3395  C CG   . PRO A 1 92  ? -1.241  -4.912  12.278  1.00 0.00 ? 92  PRO A CG   2  
ATOM 3396  C CD   . PRO A 1 92  ? -0.941  -3.504  12.713  1.00 0.00 ? 92  PRO A CD   2  
ATOM 3397  H HA   . PRO A 1 92  ? -1.284  -3.143  9.534   1.00 0.00 ? 92  PRO A HA   2  
ATOM 3398  H HB2  . PRO A 1 92  ? -1.903  -5.647  10.383  1.00 0.00 ? 92  PRO A HB2  2  
ATOM 3399  H HB3  . PRO A 1 92  ? -0.253  -5.011  10.387  1.00 0.00 ? 92  PRO A HB3  2  
ATOM 3400  H HG2  . PRO A 1 92  ? -2.208  -5.220  12.645  1.00 0.00 ? 92  PRO A HG2  2  
ATOM 3401  H HG3  . PRO A 1 92  ? -0.472  -5.584  12.630  1.00 0.00 ? 92  PRO A HG3  2  
ATOM 3402  H HD2  . PRO A 1 92  ? -1.467  -3.271  13.627  1.00 0.00 ? 92  PRO A HD2  2  
ATOM 3403  H HD3  . PRO A 1 92  ? 0.122   -3.367  12.842  1.00 0.00 ? 92  PRO A HD3  2  
ATOM 3404  N N    . VAL A 1 93  ? -3.732  -2.880  9.121   1.00 0.00 ? 93  VAL A N    2  
ATOM 3405  C CA   . VAL A 1 93  ? -5.147  -2.855  8.772   1.00 0.00 ? 93  VAL A CA   2  
ATOM 3406  C C    . VAL A 1 93  ? -5.353  -3.153  7.291   1.00 0.00 ? 93  VAL A C    2  
ATOM 3407  O O    . VAL A 1 93  ? -4.432  -3.016  6.486   1.00 0.00 ? 93  VAL A O    2  
ATOM 3408  C CB   . VAL A 1 93  ? -5.783  -1.492  9.103   1.00 0.00 ? 93  VAL A CB   2  
ATOM 3409  C CG1  . VAL A 1 93  ? -5.686  -1.206  10.594  1.00 0.00 ? 93  VAL A CG1  2  
ATOM 3410  C CG2  . VAL A 1 93  ? -5.122  -0.386  8.295   1.00 0.00 ? 93  VAL A CG2  2  
ATOM 3411  H H    . VAL A 1 93  ? -3.094  -2.386  8.565   1.00 0.00 ? 93  VAL A H    2  
ATOM 3412  H HA   . VAL A 1 93  ? -5.648  -3.614  9.355   1.00 0.00 ? 93  VAL A HA   2  
ATOM 3413  H HB   . VAL A 1 93  ? -6.829  -1.530  8.834   1.00 0.00 ? 93  VAL A HB   2  
ATOM 3414  H HG11 . VAL A 1 93  ? -5.351  -0.190  10.744  1.00 0.00 ? 93  VAL A HG11 2  
ATOM 3415  H HG12 . VAL A 1 93  ? -6.657  -1.337  11.050  1.00 0.00 ? 93  VAL A HG12 2  
ATOM 3416  H HG13 . VAL A 1 93  ? -4.980  -1.887  11.046  1.00 0.00 ? 93  VAL A HG13 2  
ATOM 3417  H HG21 . VAL A 1 93  ? -5.183  -0.622  7.243   1.00 0.00 ? 93  VAL A HG21 2  
ATOM 3418  H HG22 . VAL A 1 93  ? -5.629  0.549   8.485   1.00 0.00 ? 93  VAL A HG22 2  
ATOM 3419  H HG23 . VAL A 1 93  ? -4.085  -0.298  8.585   1.00 0.00 ? 93  VAL A HG23 2  
ATOM 3420  N N    . GLN A 1 94  ? -6.568  -3.561  6.938   1.00 0.00 ? 94  GLN A N    2  
ATOM 3421  C CA   . GLN A 1 94  ? -6.895  -3.879  5.553   1.00 0.00 ? 94  GLN A CA   2  
ATOM 3422  C C    . GLN A 1 94  ? -7.113  -2.607  4.740   1.00 0.00 ? 94  GLN A C    2  
ATOM 3423  O O    . GLN A 1 94  ? -7.658  -1.623  5.242   1.00 0.00 ? 94  GLN A O    2  
ATOM 3424  C CB   . GLN A 1 94  ? -8.144  -4.759  5.491   1.00 0.00 ? 94  GLN A CB   2  
ATOM 3425  C CG   . GLN A 1 94  ? -7.864  -6.232  5.743   1.00 0.00 ? 94  GLN A CG   2  
ATOM 3426  C CD   . GLN A 1 94  ? -9.130  -7.040  5.947   1.00 0.00 ? 94  GLN A CD   2  
ATOM 3427  O OE1  . GLN A 1 94  ? -10.239 -6.527  5.796   1.00 0.00 ? 94  GLN A OE1  2  
ATOM 3428  N NE2  . GLN A 1 94  ? -8.971  -8.313  6.291   1.00 0.00 ? 94  GLN A NE2  2  
ATOM 3429  H H    . GLN A 1 94  ? -7.260  -3.651  7.625   1.00 0.00 ? 94  GLN A H    2  
ATOM 3430  H HA   . GLN A 1 94  ? -6.062  -4.422  5.132   1.00 0.00 ? 94  GLN A HA   2  
ATOM 3431  H HB2  . GLN A 1 94  ? -8.849  -4.417  6.233   1.00 0.00 ? 94  GLN A HB2  2  
ATOM 3432  H HB3  . GLN A 1 94  ? -8.589  -4.663  4.511   1.00 0.00 ? 94  GLN A HB3  2  
ATOM 3433  H HG2  . GLN A 1 94  ? -7.331  -6.635  4.894   1.00 0.00 ? 94  GLN A HG2  2  
ATOM 3434  H HG3  . GLN A 1 94  ? -7.250  -6.322  6.627   1.00 0.00 ? 94  GLN A HG3  2  
ATOM 3435  H HE21 . GLN A 1 94  ? -8.057  -8.654  6.393   1.00 0.00 ? 94  GLN A HE21 2  
ATOM 3436  H HE22 . GLN A 1 94  ? -9.772  -8.859  6.429   1.00 0.00 ? 94  GLN A HE22 2  
ATOM 3437  N N    . LEU A 1 95  ? -6.685  -2.634  3.483   1.00 0.00 ? 95  LEU A N    2  
ATOM 3438  C CA   . LEU A 1 95  ? -6.833  -1.483  2.599   1.00 0.00 ? 95  LEU A CA   2  
ATOM 3439  C C    . LEU A 1 95  ? -8.201  -1.488  1.924   1.00 0.00 ? 95  LEU A C    2  
ATOM 3440  O O    . LEU A 1 95  ? -8.817  -2.540  1.755   1.00 0.00 ? 95  LEU A O    2  
ATOM 3441  C CB   . LEU A 1 95  ? -5.729  -1.482  1.541   1.00 0.00 ? 95  LEU A CB   2  
ATOM 3442  C CG   . LEU A 1 95  ? -4.328  -1.116  2.033   1.00 0.00 ? 95  LEU A CG   2  
ATOM 3443  C CD1  . LEU A 1 95  ? -4.371  0.154   2.868   1.00 0.00 ? 95  LEU A CD1  2  
ATOM 3444  C CD2  . LEU A 1 95  ? -3.728  -2.263  2.832   1.00 0.00 ? 95  LEU A CD2  2  
ATOM 3445  H H    . LEU A 1 95  ? -6.259  -3.447  3.139   1.00 0.00 ? 95  LEU A H    2  
ATOM 3446  H HA   . LEU A 1 95  ? -6.746  -0.590  3.200   1.00 0.00 ? 95  LEU A HA   2  
ATOM 3447  H HB2  . LEU A 1 95  ? -5.681  -2.471  1.112   1.00 0.00 ? 95  LEU A HB2  2  
ATOM 3448  H HB3  . LEU A 1 95  ? -6.008  -0.772  0.774   1.00 0.00 ? 95  LEU A HB3  2  
ATOM 3449  H HG   . LEU A 1 95  ? -3.691  -0.932  1.179   1.00 0.00 ? 95  LEU A HG   2  
ATOM 3450  H HD11 . LEU A 1 95  ? -4.940  0.909   2.347   1.00 0.00 ? 95  LEU A HD11 2  
ATOM 3451  H HD12 . LEU A 1 95  ? -3.365  0.511   3.032   1.00 0.00 ? 95  LEU A HD12 2  
ATOM 3452  H HD13 . LEU A 1 95  ? -4.837  -0.057  3.820   1.00 0.00 ? 95  LEU A HD13 2  
ATOM 3453  H HD21 . LEU A 1 95  ? -2.718  -2.446  2.496   1.00 0.00 ? 95  LEU A HD21 2  
ATOM 3454  H HD22 . LEU A 1 95  ? -4.323  -3.152  2.687   1.00 0.00 ? 95  LEU A HD22 2  
ATOM 3455  H HD23 . LEU A 1 95  ? -3.717  -2.004  3.881   1.00 0.00 ? 95  LEU A HD23 2  
ATOM 3456  N N    . ARG A 1 96  ? -8.668  -0.305  1.537   1.00 0.00 ? 96  ARG A N    2  
ATOM 3457  C CA   . ARG A 1 96  ? -9.963  -0.173  0.879   1.00 0.00 ? 96  ARG A CA   2  
ATOM 3458  C C    . ARG A 1 96  ? -9.790  0.053   -0.620  1.00 0.00 ? 96  ARG A C    2  
ATOM 3459  O O    . ARG A 1 96  ? -9.034  0.927   -1.043  1.00 0.00 ? 96  ARG A O    2  
ATOM 3460  C CB   . ARG A 1 96  ? -10.755 0.983   1.492   1.00 0.00 ? 96  ARG A CB   2  
ATOM 3461  C CG   . ARG A 1 96  ? -12.186 1.074   0.989   1.00 0.00 ? 96  ARG A CG   2  
ATOM 3462  C CD   . ARG A 1 96  ? -12.893 -0.269  1.074   1.00 0.00 ? 96  ARG A CD   2  
ATOM 3463  N NE   . ARG A 1 96  ? -12.809 -0.849  2.411   1.00 0.00 ? 96  ARG A NE   2  
ATOM 3464  C CZ   . ARG A 1 96  ? -13.243 -2.068  2.713   1.00 0.00 ? 96  ARG A CZ   2  
ATOM 3465  N NH1  . ARG A 1 96  ? -13.789 -2.831  1.777   1.00 0.00 ? 96  ARG A NH1  2  
ATOM 3466  N NH2  . ARG A 1 96  ? -13.131 -2.525  3.954   1.00 0.00 ? 96  ARG A NH2  2  
ATOM 3467  H H    . ARG A 1 96  ? -8.131  0.498   1.699   1.00 0.00 ? 96  ARG A H    2  
ATOM 3468  H HA   . ARG A 1 96  ? -10.508 -1.092  1.032   1.00 0.00 ? 96  ARG A HA   2  
ATOM 3469  H HB2  . ARG A 1 96  ? -10.781 0.858   2.564   1.00 0.00 ? 96  ARG A HB2  2  
ATOM 3470  H HB3  . ARG A 1 96  ? -10.254 1.910   1.257   1.00 0.00 ? 96  ARG A HB3  2  
ATOM 3471  H HG2  . ARG A 1 96  ? -12.725 1.790   1.592   1.00 0.00 ? 96  ARG A HG2  2  
ATOM 3472  H HG3  . ARG A 1 96  ? -12.177 1.402   -0.040  1.00 0.00 ? 96  ARG A HG3  2  
ATOM 3473  H HD2  . ARG A 1 96  ? -13.933 -0.131  0.817   1.00 0.00 ? 96  ARG A HD2  2  
ATOM 3474  H HD3  . ARG A 1 96  ? -12.436 -0.947  0.368   1.00 0.00 ? 96  ARG A HD3  2  
ATOM 3475  H HE   . ARG A 1 96  ? -12.409 -0.302  3.119   1.00 0.00 ? 96  ARG A HE   2  
ATOM 3476  H HH11 . ARG A 1 96  ? -13.874 -2.490  0.841   1.00 0.00 ? 96  ARG A HH11 2  
ATOM 3477  H HH12 . ARG A 1 96  ? -14.114 -3.749  2.006   1.00 0.00 ? 96  ARG A HH12 2  
ATOM 3478  H HH21 . ARG A 1 96  ? -12.719 -1.952  4.662   1.00 0.00 ? 96  ARG A HH21 2  
ATOM 3479  H HH22 . ARG A 1 96  ? -13.458 -3.442  4.180   1.00 0.00 ? 96  ARG A HH22 2  
ATOM 3480  N N    . SER A 1 97  ? -10.495 -0.743  -1.419  1.00 0.00 ? 97  SER A N    2  
ATOM 3481  C CA   . SER A 1 97  ? -10.416 -0.632  -2.871  1.00 0.00 ? 97  SER A CA   2  
ATOM 3482  C C    . SER A 1 97  ? -10.495 0.826   -3.310  1.00 0.00 ? 97  SER A C    2  
ATOM 3483  O O    . SER A 1 97  ? -11.580 1.357   -3.546  1.00 0.00 ? 97  SER A O    2  
ATOM 3484  C CB   . SER A 1 97  ? -11.541 -1.436  -3.526  1.00 0.00 ? 97  SER A CB   2  
ATOM 3485  O OG   . SER A 1 97  ? -11.682 -1.094  -4.894  1.00 0.00 ? 97  SER A OG   2  
ATOM 3486  H H    . SER A 1 97  ? -11.080 -1.421  -1.021  1.00 0.00 ? 97  SER A H    2  
ATOM 3487  H HA   . SER A 1 97  ? -9.465  -1.039  -3.183  1.00 0.00 ? 97  SER A HA   2  
ATOM 3488  H HB2  . SER A 1 97  ? -11.317 -2.490  -3.452  1.00 0.00 ? 97  SER A HB2  2  
ATOM 3489  H HB3  . SER A 1 97  ? -12.471 -1.229  -3.017  1.00 0.00 ? 97  SER A HB3  2  
ATOM 3490  H HG   . SER A 1 97  ? -12.611 -0.960  -5.096  1.00 0.00 ? 97  SER A HG   2  
ATOM 3491  N N    . GLY A 1 98  ? -9.337  1.470   -3.418  1.00 0.00 ? 98  GLY A N    2  
ATOM 3492  C CA   . GLY A 1 98  ? -9.296  2.861   -3.828  1.00 0.00 ? 98  GLY A CA   2  
ATOM 3493  C C    . GLY A 1 98  ? -8.997  3.797   -2.674  1.00 0.00 ? 98  GLY A C    2  
ATOM 3494  O O    . GLY A 1 98  ? -9.563  4.886   -2.587  1.00 0.00 ? 98  GLY A O    2  
ATOM 3495  H H    . GLY A 1 98  ? -8.503  0.996   -3.217  1.00 0.00 ? 98  GLY A H    2  
ATOM 3496  H HA2  . GLY A 1 98  ? -8.533  2.980   -4.582  1.00 0.00 ? 98  GLY A HA2  2  
ATOM 3497  H HA3  . GLY A 1 98  ? -10.253 3.127   -4.253  1.00 0.00 ? 98  GLY A HA3  2  
ATOM 3498  N N    . ASN A 1 99  ? -8.105  3.372   -1.785  1.00 0.00 ? 99  ASN A N    2  
ATOM 3499  C CA   . ASN A 1 99  ? -7.734  4.180   -0.629  1.00 0.00 ? 99  ASN A CA   2  
ATOM 3500  C C    . ASN A 1 99  ? -6.435  4.937   -0.889  1.00 0.00 ? 99  ASN A C    2  
ATOM 3501  O O    . ASN A 1 99  ? -5.546  4.445   -1.584  1.00 0.00 ? 99  ASN A O    2  
ATOM 3502  C CB   . ASN A 1 99  ? -7.581  3.295   0.610   1.00 0.00 ? 99  ASN A CB   2  
ATOM 3503  C CG   . ASN A 1 99  ? -6.251  2.568   0.641   1.00 0.00 ? 99  ASN A CG   2  
ATOM 3504  O OD1  . ASN A 1 99  ? -5.269  3.070   1.188   1.00 0.00 ? 99  ASN A OD1  2  
ATOM 3505  N ND2  . ASN A 1 99  ? -6.213  1.378   0.052   1.00 0.00 ? 99  ASN A ND2  2  
ATOM 3506  H H    . ASN A 1 99  ? -7.688  2.494   -1.908  1.00 0.00 ? 99  ASN A H    2  
ATOM 3507  H HA   . ASN A 1 99  ? -8.525  4.893   -0.455  1.00 0.00 ? 99  ASN A HA   2  
ATOM 3508  H HB2  . ASN A 1 99  ? -7.654  3.910   1.495   1.00 0.00 ? 99  ASN A HB2  2  
ATOM 3509  H HB3  . ASN A 1 99  ? -8.373  2.561   0.621   1.00 0.00 ? 99  ASN A HB3  2  
ATOM 3510  H HD21 . ASN A 1 99  ? -7.034  1.040   -0.363  1.00 0.00 ? 99  ASN A HD21 2  
ATOM 3511  H HD22 . ASN A 1 99  ? -5.366  0.886   0.058   1.00 0.00 ? 99  ASN A HD22 2  
ATOM 3512  N N    . ARG A 1 100 ? -6.334  6.137   -0.327  1.00 0.00 ? 100 ARG A N    2  
ATOM 3513  C CA   . ARG A 1 100 ? -5.145  6.963   -0.498  1.00 0.00 ? 100 ARG A CA   2  
ATOM 3514  C C    . ARG A 1 100 ? -4.049  6.548   0.479   1.00 0.00 ? 100 ARG A C    2  
ATOM 3515  O O    . ARG A 1 100 ? -4.241  6.587   1.695   1.00 0.00 ? 100 ARG A O    2  
ATOM 3516  C CB   . ARG A 1 100 ? -5.490  8.440   -0.297  1.00 0.00 ? 100 ARG A CB   2  
ATOM 3517  C CG   . ARG A 1 100 ? -6.036  9.113   -1.546  1.00 0.00 ? 100 ARG A CG   2  
ATOM 3518  C CD   . ARG A 1 100 ? -6.496  10.533  -1.257  1.00 0.00 ? 100 ARG A CD   2  
ATOM 3519  N NE   . ARG A 1 100 ? -5.580  11.234  -0.361  1.00 0.00 ? 100 ARG A NE   2  
ATOM 3520  C CZ   . ARG A 1 100 ? -4.427  11.763  -0.755  1.00 0.00 ? 100 ARG A CZ   2  
ATOM 3521  N NH1  . ARG A 1 100 ? -4.052  11.672  -2.024  1.00 0.00 ? 100 ARG A NH1  2  
ATOM 3522  N NH2  . ARG A 1 100 ? -3.647  12.385  0.120   1.00 0.00 ? 100 ARG A NH2  2  
ATOM 3523  H H    . ARG A 1 100 ? -7.076  6.475   0.216   1.00 0.00 ? 100 ARG A H    2  
ATOM 3524  H HA   . ARG A 1 100 ? -4.784  6.821   -1.506  1.00 0.00 ? 100 ARG A HA   2  
ATOM 3525  H HB2  . ARG A 1 100 ? -6.233  8.521   0.483   1.00 0.00 ? 100 ARG A HB2  2  
ATOM 3526  H HB3  . ARG A 1 100 ? -4.599  8.967   0.009   1.00 0.00 ? 100 ARG A HB3  2  
ATOM 3527  H HG2  . ARG A 1 100 ? -5.260  9.143   -2.296  1.00 0.00 ? 100 ARG A HG2  2  
ATOM 3528  H HG3  . ARG A 1 100 ? -6.875  8.540   -1.914  1.00 0.00 ? 100 ARG A HG3  2  
ATOM 3529  H HD2  . ARG A 1 100 ? -6.556  11.075  -2.189  1.00 0.00 ? 100 ARG A HD2  2  
ATOM 3530  H HD3  . ARG A 1 100 ? -7.473  10.495  -0.799  1.00 0.00 ? 100 ARG A HD3  2  
ATOM 3531  H HE   . ARG A 1 100 ? -5.837  11.312  0.581   1.00 0.00 ? 100 ARG A HE   2  
ATOM 3532  H HH11 . ARG A 1 100 ? -4.638  11.205  -2.686  1.00 0.00 ? 100 ARG A HH11 2  
ATOM 3533  H HH12 . ARG A 1 100 ? -3.184  12.073  -2.319  1.00 0.00 ? 100 ARG A HH12 2  
ATOM 3534  H HH21 . ARG A 1 100 ? -3.926  12.455  1.077   1.00 0.00 ? 100 ARG A HH21 2  
ATOM 3535  H HH22 . ARG A 1 100 ? -2.780  12.782  -0.178  1.00 0.00 ? 100 ARG A HH22 2  
ATOM 3536  N N    . ILE A 1 101 ? -2.901  6.152   -0.060  1.00 0.00 ? 101 ILE A N    2  
ATOM 3537  C CA   . ILE A 1 101 ? -1.775  5.731   0.764   1.00 0.00 ? 101 ILE A CA   2  
ATOM 3538  C C    . ILE A 1 101 ? -0.549  6.599   0.505   1.00 0.00 ? 101 ILE A C    2  
ATOM 3539  O O    . ILE A 1 101 ? -0.070  6.693   -0.626  1.00 0.00 ? 101 ILE A O    2  
ATOM 3540  C CB   . ILE A 1 101 ? -1.410  4.257   0.508   1.00 0.00 ? 101 ILE A CB   2  
ATOM 3541  C CG1  . ILE A 1 101 ? -2.673  3.395   0.469   1.00 0.00 ? 101 ILE A CG1  2  
ATOM 3542  C CG2  . ILE A 1 101 ? -0.452  3.755   1.578   1.00 0.00 ? 101 ILE A CG2  2  
ATOM 3543  C CD1  . ILE A 1 101 ? -2.425  1.980   -0.004  1.00 0.00 ? 101 ILE A CD1  2  
ATOM 3544  H H    . ILE A 1 101 ? -2.809  6.143   -1.035  1.00 0.00 ? 101 ILE A H    2  
ATOM 3545  H HA   . ILE A 1 101 ? -2.064  5.834   1.800   1.00 0.00 ? 101 ILE A HA   2  
ATOM 3546  H HB   . ILE A 1 101 ? -0.910  4.194   -0.447  1.00 0.00 ? 101 ILE A HB   2  
ATOM 3547  H HG12 . ILE A 1 101 ? -3.097  3.343   1.460   1.00 0.00 ? 101 ILE A HG12 2  
ATOM 3548  H HG13 . ILE A 1 101 ? -3.389  3.849   -0.201  1.00 0.00 ? 101 ILE A HG13 2  
ATOM 3549  H HG21 . ILE A 1 101 ? -0.988  3.619   2.506   1.00 0.00 ? 101 ILE A HG21 2  
ATOM 3550  H HG22 . ILE A 1 101 ? -0.028  2.812   1.267   1.00 0.00 ? 101 ILE A HG22 2  
ATOM 3551  H HG23 . ILE A 1 101 ? 0.338   4.476   1.721   1.00 0.00 ? 101 ILE A HG23 2  
ATOM 3552  H HD11 . ILE A 1 101 ? -3.370  1.505   -0.228  1.00 0.00 ? 101 ILE A HD11 2  
ATOM 3553  H HD12 . ILE A 1 101 ? -1.813  1.999   -0.893  1.00 0.00 ? 101 ILE A HD12 2  
ATOM 3554  H HD13 . ILE A 1 101 ? -1.919  1.424   0.771   1.00 0.00 ? 101 ILE A HD13 2  
ATOM 3555  N N    . ILE A 1 102 ? -0.044  7.230   1.560   1.00 0.00 ? 102 ILE A N    2  
ATOM 3556  C CA   . ILE A 1 102 ? 1.129   8.089   1.447   1.00 0.00 ? 102 ILE A CA   2  
ATOM 3557  C C    . ILE A 1 102 ? 2.328   7.478   2.164   1.00 0.00 ? 102 ILE A C    2  
ATOM 3558  O O    . ILE A 1 102 ? 2.211   6.996   3.290   1.00 0.00 ? 102 ILE A O    2  
ATOM 3559  C CB   . ILE A 1 102 ? 0.858   9.490   2.025   1.00 0.00 ? 102 ILE A CB   2  
ATOM 3560  C CG1  . ILE A 1 102 ? -0.340  10.133  1.324   1.00 0.00 ? 102 ILE A CG1  2  
ATOM 3561  C CG2  . ILE A 1 102 ? 2.093   10.368  1.886   1.00 0.00 ? 102 ILE A CG2  2  
ATOM 3562  C CD1  . ILE A 1 102 ? -1.110  11.094  2.202   1.00 0.00 ? 102 ILE A CD1  2  
ATOM 3563  H H    . ILE A 1 102 ? -0.470  7.116   2.435   1.00 0.00 ? 102 ILE A H    2  
ATOM 3564  H HA   . ILE A 1 102 ? 1.365   8.193   0.398   1.00 0.00 ? 102 ILE A HA   2  
ATOM 3565  H HB   . ILE A 1 102 ? 0.638   9.385   3.076   1.00 0.00 ? 102 ILE A HB   2  
ATOM 3566  H HG12 . ILE A 1 102 ? 0.005   10.677  0.460   1.00 0.00 ? 102 ILE A HG12 2  
ATOM 3567  H HG13 . ILE A 1 102 ? -1.021  9.355   1.006   1.00 0.00 ? 102 ILE A HG13 2  
ATOM 3568  H HG21 . ILE A 1 102 ? 1.904   11.330  2.340   1.00 0.00 ? 102 ILE A HG21 2  
ATOM 3569  H HG22 . ILE A 1 102 ? 2.928   9.895   2.380   1.00 0.00 ? 102 ILE A HG22 2  
ATOM 3570  H HG23 . ILE A 1 102 ? 2.323   10.503  0.839   1.00 0.00 ? 102 ILE A HG23 2  
ATOM 3571  H HD11 . ILE A 1 102 ? -0.831  10.941  3.235   1.00 0.00 ? 102 ILE A HD11 2  
ATOM 3572  H HD12 . ILE A 1 102 ? -0.878  12.109  1.915   1.00 0.00 ? 102 ILE A HD12 2  
ATOM 3573  H HD13 . ILE A 1 102 ? -2.169  10.920  2.086   1.00 0.00 ? 102 ILE A HD13 2  
ATOM 3574  N N    . MET A 1 103 ? 3.481   7.504   1.503   1.00 0.00 ? 103 MET A N    2  
ATOM 3575  C CA   . MET A 1 103 ? 4.703   6.955   2.079   1.00 0.00 ? 103 MET A CA   2  
ATOM 3576  C C    . MET A 1 103 ? 5.867   7.927   1.913   1.00 0.00 ? 103 MET A C    2  
ATOM 3577  O O    . MET A 1 103 ? 6.491   7.988   0.854   1.00 0.00 ? 103 MET A O    2  
ATOM 3578  C CB   . MET A 1 103 ? 5.045   5.615   1.424   1.00 0.00 ? 103 MET A CB   2  
ATOM 3579  C CG   . MET A 1 103 ? 3.957   4.566   1.584   1.00 0.00 ? 103 MET A CG   2  
ATOM 3580  S SD   . MET A 1 103 ? 2.581   4.814   0.445   1.00 0.00 ? 103 MET A SD   2  
ATOM 3581  C CE   . MET A 1 103 ? 2.079   3.120   0.147   1.00 0.00 ? 103 MET A CE   2  
ATOM 3582  H H    . MET A 1 103 ? 3.512   7.901   0.608   1.00 0.00 ? 103 MET A H    2  
ATOM 3583  H HA   . MET A 1 103 ? 4.530   6.796   3.133   1.00 0.00 ? 103 MET A HA   2  
ATOM 3584  H HB2  . MET A 1 103 ? 5.208   5.776   0.369   1.00 0.00 ? 103 MET A HB2  2  
ATOM 3585  H HB3  . MET A 1 103 ? 5.952   5.232   1.867   1.00 0.00 ? 103 MET A HB3  2  
ATOM 3586  H HG2  . MET A 1 103 ? 4.385   3.592   1.401   1.00 0.00 ? 103 MET A HG2  2  
ATOM 3587  H HG3  . MET A 1 103 ? 3.582   4.608   2.595   1.00 0.00 ? 103 MET A HG3  2  
ATOM 3588  H HE1  . MET A 1 103 ? 2.836   2.619   -0.438  1.00 0.00 ? 103 MET A HE1  2  
ATOM 3589  H HE2  . MET A 1 103 ? 1.956   2.610   1.091   1.00 0.00 ? 103 MET A HE2  2  
ATOM 3590  H HE3  . MET A 1 103 ? 1.143   3.112   -0.391  1.00 0.00 ? 103 MET A HE3  2  
ATOM 3591  N N    . GLY A 1 104 ? 6.153   8.687   2.966   1.00 0.00 ? 104 GLY A N    2  
ATOM 3592  C CA   . GLY A 1 104 ? 7.241   9.646   2.914   1.00 0.00 ? 104 GLY A CA   2  
ATOM 3593  C C    . GLY A 1 104 ? 6.778   11.025  2.488   1.00 0.00 ? 104 GLY A C    2  
ATOM 3594  O O    . GLY A 1 104 ? 5.999   11.671  3.188   1.00 0.00 ? 104 GLY A O    2  
ATOM 3595  H H    . GLY A 1 104 ? 5.622   8.595   3.784   1.00 0.00 ? 104 GLY A H    2  
ATOM 3596  H HA2  . GLY A 1 104 ? 7.692   9.716   3.893   1.00 0.00 ? 104 GLY A HA2  2  
ATOM 3597  H HA3  . GLY A 1 104 ? 7.983   9.295   2.211   1.00 0.00 ? 104 GLY A HA3  2  
ATOM 3598  N N    . LYS A 1 105 ? 7.260   11.480  1.336   1.00 0.00 ? 105 LYS A N    2  
ATOM 3599  C CA   . LYS A 1 105 ? 6.893   12.791  0.816   1.00 0.00 ? 105 LYS A CA   2  
ATOM 3600  C C    . LYS A 1 105 ? 6.496   12.702  -0.654  1.00 0.00 ? 105 LYS A C    2  
ATOM 3601  O O    . LYS A 1 105 ? 7.201   12.098  -1.461  1.00 0.00 ? 105 LYS A O    2  
ATOM 3602  C CB   . LYS A 1 105 ? 8.054   13.773  0.984   1.00 0.00 ? 105 LYS A CB   2  
ATOM 3603  C CG   . LYS A 1 105 ? 8.383   14.085  2.433   1.00 0.00 ? 105 LYS A CG   2  
ATOM 3604  C CD   . LYS A 1 105 ? 7.381   15.055  3.036   1.00 0.00 ? 105 LYS A CD   2  
ATOM 3605  C CE   . LYS A 1 105 ? 7.525   15.137  4.548   1.00 0.00 ? 105 LYS A CE   2  
ATOM 3606  N NZ   . LYS A 1 105 ? 8.949   15.267  4.964   1.00 0.00 ? 105 LYS A NZ   2  
ATOM 3607  H H    . LYS A 1 105 ? 7.879   10.918  0.822   1.00 0.00 ? 105 LYS A H    2  
ATOM 3608  H HA   . LYS A 1 105 ? 6.047   13.148  1.384   1.00 0.00 ? 105 LYS A HA   2  
ATOM 3609  H HB2  . LYS A 1 105 ? 8.934   13.354  0.519   1.00 0.00 ? 105 LYS A HB2  2  
ATOM 3610  H HB3  . LYS A 1 105 ? 7.802   14.699  0.487   1.00 0.00 ? 105 LYS A HB3  2  
ATOM 3611  H HG2  . LYS A 1 105 ? 8.367   13.168  3.002   1.00 0.00 ? 105 LYS A HG2  2  
ATOM 3612  H HG3  . LYS A 1 105 ? 9.370   14.524  2.483   1.00 0.00 ? 105 LYS A HG3  2  
ATOM 3613  H HD2  . LYS A 1 105 ? 7.545   16.036  2.617   1.00 0.00 ? 105 LYS A HD2  2  
ATOM 3614  H HD3  . LYS A 1 105 ? 6.381   14.721  2.796   1.00 0.00 ? 105 LYS A HD3  2  
ATOM 3615  H HE2  . LYS A 1 105 ? 6.976   15.996  4.903   1.00 0.00 ? 105 LYS A HE2  2  
ATOM 3616  H HE3  . LYS A 1 105 ? 7.111   14.240  4.985   1.00 0.00 ? 105 LYS A HE3  2  
ATOM 3617  H HZ1  . LYS A 1 105 ? 9.370   16.116  4.536   1.00 0.00 ? 105 LYS A HZ1  2  
ATOM 3618  H HZ2  . LYS A 1 105 ? 9.488   14.432  4.655   1.00 0.00 ? 105 LYS A HZ2  2  
ATOM 3619  H HZ3  . LYS A 1 105 ? 9.013   15.344  5.999   1.00 0.00 ? 105 LYS A HZ3  2  
ATOM 3620  N N    . ASN A 1 106 ? 5.364   13.310  -0.995  1.00 0.00 ? 106 ASN A N    2  
ATOM 3621  C CA   . ASN A 1 106 ? 4.875   13.299  -2.368  1.00 0.00 ? 106 ASN A CA   2  
ATOM 3622  C C    . ASN A 1 106 ? 4.901   11.887  -2.945  1.00 0.00 ? 106 ASN A C    2  
ATOM 3623  O O    . ASN A 1 106 ? 5.273   11.684  -4.101  1.00 0.00 ? 106 ASN A O    2  
ATOM 3624  C CB   . ASN A 1 106 ? 5.718   14.234  -3.239  1.00 0.00 ? 106 ASN A CB   2  
ATOM 3625  C CG   . ASN A 1 106 ? 6.283   15.402  -2.454  1.00 0.00 ? 106 ASN A CG   2  
ATOM 3626  O OD1  . ASN A 1 106 ? 7.243   15.249  -1.698  1.00 0.00 ? 106 ASN A OD1  2  
ATOM 3627  N ND2  . ASN A 1 106 ? 5.689   16.576  -2.631  1.00 0.00 ? 106 ASN A ND2  2  
ATOM 3628  H H    . ASN A 1 106 ? 4.845   13.776  -0.306  1.00 0.00 ? 106 ASN A H    2  
ATOM 3629  H HA   . ASN A 1 106 ? 3.855   13.653  -2.359  1.00 0.00 ? 106 ASN A HA   2  
ATOM 3630  H HB2  . ASN A 1 106 ? 6.541   13.676  -3.661  1.00 0.00 ? 106 ASN A HB2  2  
ATOM 3631  H HB3  . ASN A 1 106 ? 5.104   14.623  -4.038  1.00 0.00 ? 106 ASN A HB3  2  
ATOM 3632  H HD21 . ASN A 1 106 ? 4.930   16.623  -3.249  1.00 0.00 ? 106 ASN A HD21 2  
ATOM 3633  H HD22 . ASN A 1 106 ? 6.035   17.348  -2.137  1.00 0.00 ? 106 ASN A HD22 2  
ATOM 3634  N N    . HIS A 1 107 ? 4.503   10.914  -2.131  1.00 0.00 ? 107 HIS A N    2  
ATOM 3635  C CA   . HIS A 1 107 ? 4.480   9.520   -2.560  1.00 0.00 ? 107 HIS A CA   2  
ATOM 3636  C C    . HIS A 1 107 ? 3.112   8.896   -2.304  1.00 0.00 ? 107 HIS A C    2  
ATOM 3637  O O    . HIS A 1 107 ? 3.006   7.847   -1.667  1.00 0.00 ? 107 HIS A O    2  
ATOM 3638  C CB   . HIS A 1 107 ? 5.563   8.722   -1.832  1.00 0.00 ? 107 HIS A CB   2  
ATOM 3639  C CG   . HIS A 1 107 ? 6.879   8.709   -2.546  1.00 0.00 ? 107 HIS A CG   2  
ATOM 3640  N ND1  . HIS A 1 107 ? 7.069   8.091   -3.763  1.00 0.00 ? 107 HIS A ND1  2  
ATOM 3641  C CD2  . HIS A 1 107 ? 8.075   9.245   -2.207  1.00 0.00 ? 107 HIS A CD2  2  
ATOM 3642  C CE1  . HIS A 1 107 ? 8.325   8.245   -4.142  1.00 0.00 ? 107 HIS A CE1  2  
ATOM 3643  N NE2  . HIS A 1 107 ? 8.957   8.943   -3.215  1.00 0.00 ? 107 HIS A NE2  2  
ATOM 3644  H H    . HIS A 1 107 ? 4.218   11.139  -1.221  1.00 0.00 ? 107 HIS A H    2  
ATOM 3645  H HA   . HIS A 1 107 ? 4.680   9.496   -3.621  1.00 0.00 ? 107 HIS A HA   2  
ATOM 3646  H HB2  . HIS A 1 107 ? 5.720   9.152   -0.854  1.00 0.00 ? 107 HIS A HB2  2  
ATOM 3647  H HB3  . HIS A 1 107 ? 5.234   7.699   -1.722  1.00 0.00 ? 107 HIS A HB3  2  
ATOM 3648  H HD2  . HIS A 1 107 ? 8.296   9.807   -1.310  1.00 0.00 ? 107 HIS A HD2  2  
ATOM 3649  H HE1  . HIS A 1 107 ? 8.762   7.866   -5.054  1.00 0.00 ? 107 HIS A HE1  2  
ATOM 3650  H HE2  . HIS A 1 107 ? 9.919   9.126   -3.205  1.00 0.00 ? 107 HIS A HE2  2  
ATOM 3651  N N    . VAL A 1 108 ? 2.067   9.547   -2.804  1.00 0.00 ? 108 VAL A N    2  
ATOM 3652  C CA   . VAL A 1 108 ? 0.705   9.055   -2.630  1.00 0.00 ? 108 VAL A CA   2  
ATOM 3653  C C    . VAL A 1 108 ? 0.262   8.226   -3.831  1.00 0.00 ? 108 VAL A C    2  
ATOM 3654  O O    . VAL A 1 108 ? 0.339   8.679   -4.973  1.00 0.00 ? 108 VAL A O    2  
ATOM 3655  C CB   . VAL A 1 108 ? -0.288  10.214  -2.426  1.00 0.00 ? 108 VAL A CB   2  
ATOM 3656  C CG1  . VAL A 1 108 ? -1.468  9.764   -1.578  1.00 0.00 ? 108 VAL A CG1  2  
ATOM 3657  C CG2  . VAL A 1 108 ? 0.410   11.408  -1.791  1.00 0.00 ? 108 VAL A CG2  2  
ATOM 3658  H H    . VAL A 1 108 ? 2.215   10.377  -3.303  1.00 0.00 ? 108 VAL A H    2  
ATOM 3659  H HA   . VAL A 1 108 ? 0.685   8.432   -1.748  1.00 0.00 ? 108 VAL A HA   2  
ATOM 3660  H HB   . VAL A 1 108 ? -0.663  10.515  -3.393  1.00 0.00 ? 108 VAL A HB   2  
ATOM 3661  H HG11 . VAL A 1 108 ? -1.583  10.432  -0.737  1.00 0.00 ? 108 VAL A HG11 2  
ATOM 3662  H HG12 . VAL A 1 108 ? -2.368  9.777   -2.176  1.00 0.00 ? 108 VAL A HG12 2  
ATOM 3663  H HG13 . VAL A 1 108 ? -1.290  8.761   -1.218  1.00 0.00 ? 108 VAL A HG13 2  
ATOM 3664  H HG21 . VAL A 1 108 ? 0.781   12.062  -2.566  1.00 0.00 ? 108 VAL A HG21 2  
ATOM 3665  H HG22 . VAL A 1 108 ? -0.291  11.945  -1.170  1.00 0.00 ? 108 VAL A HG22 2  
ATOM 3666  H HG23 . VAL A 1 108 ? 1.235   11.063  -1.186  1.00 0.00 ? 108 VAL A HG23 2  
ATOM 3667  N N    . PHE A 1 109 ? -0.202  7.010   -3.564  1.00 0.00 ? 109 PHE A N    2  
ATOM 3668  C CA   . PHE A 1 109 ? -0.658  6.117   -4.623  1.00 0.00 ? 109 PHE A CA   2  
ATOM 3669  C C    . PHE A 1 109 ? -2.091  5.658   -4.368  1.00 0.00 ? 109 PHE A C    2  
ATOM 3670  O O    . PHE A 1 109 ? -2.616  5.811   -3.266  1.00 0.00 ? 109 PHE A O    2  
ATOM 3671  C CB   . PHE A 1 109 ? 0.267   4.903   -4.728  1.00 0.00 ? 109 PHE A CB   2  
ATOM 3672  C CG   . PHE A 1 109 ? 1.701   5.211   -4.401  1.00 0.00 ? 109 PHE A CG   2  
ATOM 3673  C CD1  . PHE A 1 109 ? 2.160   5.134   -3.097  1.00 0.00 ? 109 PHE A CD1  2  
ATOM 3674  C CD2  . PHE A 1 109 ? 2.589   5.577   -5.400  1.00 0.00 ? 109 PHE A CD2  2  
ATOM 3675  C CE1  . PHE A 1 109 ? 3.478   5.418   -2.794  1.00 0.00 ? 109 PHE A CE1  2  
ATOM 3676  C CE2  . PHE A 1 109 ? 3.908   5.862   -5.103  1.00 0.00 ? 109 PHE A CE2  2  
ATOM 3677  C CZ   . PHE A 1 109 ? 4.354   5.781   -3.798  1.00 0.00 ? 109 PHE A CZ   2  
ATOM 3678  H H    . PHE A 1 109 ? -0.239  6.706   -2.633  1.00 0.00 ? 109 PHE A H    2  
ATOM 3679  H HA   . PHE A 1 109 ? -0.627  6.663   -5.552  1.00 0.00 ? 109 PHE A HA   2  
ATOM 3680  H HB2  . PHE A 1 109 ? -0.072  4.140   -4.042  1.00 0.00 ? 109 PHE A HB2  2  
ATOM 3681  H HB3  . PHE A 1 109 ? 0.230   4.517   -5.735  1.00 0.00 ? 109 PHE A HB3  2  
ATOM 3682  H HD1  . PHE A 1 109 ? 1.477   4.849   -2.310  1.00 0.00 ? 109 PHE A HD1  2  
ATOM 3683  H HD2  . PHE A 1 109 ? 2.241   5.641   -6.422  1.00 0.00 ? 109 PHE A HD2  2  
ATOM 3684  H HE1  . PHE A 1 109 ? 3.824   5.354   -1.773  1.00 0.00 ? 109 PHE A HE1  2  
ATOM 3685  H HE2  . PHE A 1 109 ? 4.590   6.146   -5.891  1.00 0.00 ? 109 PHE A HE2  2  
ATOM 3686  H HZ   . PHE A 1 109 ? 5.384   6.004   -3.564  1.00 0.00 ? 109 PHE A HZ   2  
ATOM 3687  N N    . ARG A 1 110 ? -2.717  5.096   -5.397  1.00 0.00 ? 110 ARG A N    2  
ATOM 3688  C CA   . ARG A 1 110 ? -4.090  4.617   -5.286  1.00 0.00 ? 110 ARG A CA   2  
ATOM 3689  C C    . ARG A 1 110 ? -4.135  3.091   -5.294  1.00 0.00 ? 110 ARG A C    2  
ATOM 3690  O O    . ARG A 1 110 ? -3.808  2.455   -6.296  1.00 0.00 ? 110 ARG A O    2  
ATOM 3691  C CB   . ARG A 1 110 ? -4.939  5.168   -6.433  1.00 0.00 ? 110 ARG A CB   2  
ATOM 3692  C CG   . ARG A 1 110 ? -6.282  4.473   -6.585  1.00 0.00 ? 110 ARG A CG   2  
ATOM 3693  C CD   . ARG A 1 110 ? -7.276  4.947   -5.536  1.00 0.00 ? 110 ARG A CD   2  
ATOM 3694  N NE   . ARG A 1 110 ? -8.659  4.752   -5.965  1.00 0.00 ? 110 ARG A NE   2  
ATOM 3695  C CZ   . ARG A 1 110 ? -9.681  5.457   -5.494  1.00 0.00 ? 110 ARG A CZ   2  
ATOM 3696  N NH1  . ARG A 1 110 ? -9.477  6.399   -4.583  1.00 0.00 ? 110 ARG A NH1  2  
ATOM 3697  N NH2  . ARG A 1 110 ? -10.910 5.221   -5.933  1.00 0.00 ? 110 ARG A NH2  2  
ATOM 3698  H H    . ARG A 1 110 ? -2.246  5.002   -6.251  1.00 0.00 ? 110 ARG A H    2  
ATOM 3699  H HA   . ARG A 1 110 ? -4.491  4.972   -4.349  1.00 0.00 ? 110 ARG A HA   2  
ATOM 3700  H HB2  . ARG A 1 110 ? -5.120  6.219   -6.258  1.00 0.00 ? 110 ARG A HB2  2  
ATOM 3701  H HB3  . ARG A 1 110 ? -4.392  5.054   -7.357  1.00 0.00 ? 110 ARG A HB3  2  
ATOM 3702  H HG2  . ARG A 1 110 ? -6.680  4.689   -7.565  1.00 0.00 ? 110 ARG A HG2  2  
ATOM 3703  H HG3  . ARG A 1 110 ? -6.139  3.408   -6.479  1.00 0.00 ? 110 ARG A HG3  2  
ATOM 3704  H HD2  . ARG A 1 110 ? -7.111  4.391   -4.625  1.00 0.00 ? 110 ARG A HD2  2  
ATOM 3705  H HD3  . ARG A 1 110 ? -7.111  5.998   -5.352  1.00 0.00 ? 110 ARG A HD3  2  
ATOM 3706  H HE   . ARG A 1 110 ? -8.832  4.061   -6.637  1.00 0.00 ? 110 ARG A HE   2  
ATOM 3707  H HH11 . ARG A 1 110 ? -8.551  6.580   -4.251  1.00 0.00 ? 110 ARG A HH11 2  
ATOM 3708  H HH12 . ARG A 1 110 ? -10.248 6.929   -4.231  1.00 0.00 ? 110 ARG A HH12 2  
ATOM 3709  H HH21 . ARG A 1 110 ? -11.068 4.512   -6.620  1.00 0.00 ? 110 ARG A HH21 2  
ATOM 3710  H HH22 . ARG A 1 110 ? -11.679 5.752   -5.578  1.00 0.00 ? 110 ARG A HH22 2  
ATOM 3711  N N    . PHE A 1 111 ? -4.542  2.511   -4.169  1.00 0.00 ? 111 PHE A N    2  
ATOM 3712  C CA   . PHE A 1 111 ? -4.628  1.061   -4.046  1.00 0.00 ? 111 PHE A CA   2  
ATOM 3713  C C    . PHE A 1 111 ? -5.905  0.535   -4.695  1.00 0.00 ? 111 PHE A C    2  
ATOM 3714  O O    . PHE A 1 111 ? -6.988  0.621   -4.119  1.00 0.00 ? 111 PHE A O    2  
ATOM 3715  C CB   . PHE A 1 111 ? -4.586  0.650   -2.572  1.00 0.00 ? 111 PHE A CB   2  
ATOM 3716  C CG   . PHE A 1 111 ? -4.917  -0.797  -2.344  1.00 0.00 ? 111 PHE A CG   2  
ATOM 3717  C CD1  . PHE A 1 111 ? -3.966  -1.781  -2.559  1.00 0.00 ? 111 PHE A CD1  2  
ATOM 3718  C CD2  . PHE A 1 111 ? -6.179  -1.173  -1.912  1.00 0.00 ? 111 PHE A CD2  2  
ATOM 3719  C CE1  . PHE A 1 111 ? -4.269  -3.114  -2.350  1.00 0.00 ? 111 PHE A CE1  2  
ATOM 3720  C CE2  . PHE A 1 111 ? -6.488  -2.503  -1.701  1.00 0.00 ? 111 PHE A CE2  2  
ATOM 3721  C CZ   . PHE A 1 111 ? -5.531  -3.475  -1.920  1.00 0.00 ? 111 PHE A CZ   2  
ATOM 3722  H H    . PHE A 1 111 ? -4.789  3.072   -3.404  1.00 0.00 ? 111 PHE A H    2  
ATOM 3723  H HA   . PHE A 1 111 ? -3.778  0.634   -4.554  1.00 0.00 ? 111 PHE A HA   2  
ATOM 3724  H HB2  . PHE A 1 111 ? -3.594  0.828   -2.185  1.00 0.00 ? 111 PHE A HB2  2  
ATOM 3725  H HB3  . PHE A 1 111 ? -5.296  1.246   -2.019  1.00 0.00 ? 111 PHE A HB3  2  
ATOM 3726  H HD1  . PHE A 1 111 ? -2.979  -1.500  -2.895  1.00 0.00 ? 111 PHE A HD1  2  
ATOM 3727  H HD2  . PHE A 1 111 ? -6.929  -0.413  -1.741  1.00 0.00 ? 111 PHE A HD2  2  
ATOM 3728  H HE1  . PHE A 1 111 ? -3.519  -3.871  -2.521  1.00 0.00 ? 111 PHE A HE1  2  
ATOM 3729  H HE2  . PHE A 1 111 ? -7.475  -2.782  -1.364  1.00 0.00 ? 111 PHE A HE2  2  
ATOM 3730  H HZ   . PHE A 1 111 ? -5.770  -4.515  -1.756  1.00 0.00 ? 111 PHE A HZ   2  
ATOM 3731  N N    . ASN A 1 112 ? -5.768  -0.010  -5.900  1.00 0.00 ? 112 ASN A N    2  
ATOM 3732  C CA   . ASN A 1 112 ? -6.910  -0.549  -6.629  1.00 0.00 ? 112 ASN A CA   2  
ATOM 3733  C C    . ASN A 1 112 ? -7.076  -2.040  -6.354  1.00 0.00 ? 112 ASN A C    2  
ATOM 3734  O O    . ASN A 1 112 ? -6.156  -2.700  -5.870  1.00 0.00 ? 112 ASN A O    2  
ATOM 3735  C CB   . ASN A 1 112 ? -6.740  -0.312  -8.131  1.00 0.00 ? 112 ASN A CB   2  
ATOM 3736  C CG   . ASN A 1 112 ? -5.293  -0.418  -8.573  1.00 0.00 ? 112 ASN A CG   2  
ATOM 3737  O OD1  . ASN A 1 112 ? -4.686  -1.486  -8.497  1.00 0.00 ? 112 ASN A OD1  2  
ATOM 3738  N ND2  . ASN A 1 112 ? -4.734  0.693   -9.039  1.00 0.00 ? 112 ASN A ND2  2  
ATOM 3739  H H    . ASN A 1 112 ? -4.878  -0.050  -6.308  1.00 0.00 ? 112 ASN A H    2  
ATOM 3740  H HA   . ASN A 1 112 ? -7.794  -0.031  -6.290  1.00 0.00 ? 112 ASN A HA   2  
ATOM 3741  H HB2  . ASN A 1 112 ? -7.316  -1.047  -8.673  1.00 0.00 ? 112 ASN A HB2  2  
ATOM 3742  H HB3  . ASN A 1 112 ? -7.101  0.675   -8.377  1.00 0.00 ? 112 ASN A HB3  2  
ATOM 3743  H HD21 . ASN A 1 112 ? -5.278  1.508   -9.071  1.00 0.00 ? 112 ASN A HD21 2  
ATOM 3744  H HD22 . ASN A 1 112 ? -3.800  0.653   -9.332  1.00 0.00 ? 112 ASN A HD22 2  
ATOM 3745  N N    . HIS A 1 113 ? -8.256  -2.566  -6.667  1.00 0.00 ? 113 HIS A N    2  
ATOM 3746  C CA   . HIS A 1 113 ? -8.543  -3.980  -6.455  1.00 0.00 ? 113 HIS A CA   2  
ATOM 3747  C C    . HIS A 1 113 ? -9.706  -4.436  -7.331  1.00 0.00 ? 113 HIS A C    2  
ATOM 3748  O O    . HIS A 1 113 ? -10.822 -4.655  -6.860  1.00 0.00 ? 113 HIS A O    2  
ATOM 3749  C CB   . HIS A 1 113 ? -8.866  -4.242  -4.983  1.00 0.00 ? 113 HIS A CB   2  
ATOM 3750  C CG   . HIS A 1 113 ? -8.504  -5.622  -4.527  1.00 0.00 ? 113 HIS A CG   2  
ATOM 3751  N ND1  . HIS A 1 113 ? -9.200  -6.748  -4.912  1.00 0.00 ? 113 HIS A ND1  2  
ATOM 3752  C CD2  . HIS A 1 113 ? -7.512  -6.054  -3.714  1.00 0.00 ? 113 HIS A CD2  2  
ATOM 3753  C CE1  . HIS A 1 113 ? -8.652  -7.813  -4.354  1.00 0.00 ? 113 HIS A CE1  2  
ATOM 3754  N NE2  . HIS A 1 113 ? -7.626  -7.419  -3.623  1.00 0.00 ? 113 HIS A NE2  2  
ATOM 3755  H H    . HIS A 1 113 ? -8.950  -1.990  -7.050  1.00 0.00 ? 113 HIS A H    2  
ATOM 3756  H HA   . HIS A 1 113 ? -7.663  -4.542  -6.726  1.00 0.00 ? 113 HIS A HA   2  
ATOM 3757  H HB2  . HIS A 1 113 ? -8.322  -3.537  -4.372  1.00 0.00 ? 113 HIS A HB2  2  
ATOM 3758  H HB3  . HIS A 1 113 ? -9.926  -4.106  -4.824  1.00 0.00 ? 113 HIS A HB3  2  
ATOM 3759  H HD2  . HIS A 1 113 ? -6.768  -5.439  -3.227  1.00 0.00 ? 113 HIS A HD2  2  
ATOM 3760  H HE1  . HIS A 1 113 ? -8.986  -8.833  -4.476  1.00 0.00 ? 113 HIS A HE1  2  
ATOM 3761  H HE2  . HIS A 1 113 ? -7.097  -7.997  -3.035  1.00 0.00 ? 113 HIS A HE2  2  
ATOM 3762  N N    . PRO A 1 114 ? -9.441  -4.582  -8.638  1.00 0.00 ? 114 PRO A N    2  
ATOM 3763  C CA   . PRO A 1 114 ? -10.453 -5.012  -9.608  1.00 0.00 ? 114 PRO A CA   2  
ATOM 3764  C C    . PRO A 1 114 ? -10.846 -6.474  -9.424  1.00 0.00 ? 114 PRO A C    2  
ATOM 3765  O O    . PRO A 1 114 ? -11.654 -7.008  -10.184 1.00 0.00 ? 114 PRO A O    2  
ATOM 3766  C CB   . PRO A 1 114 ? -9.759  -4.811  -10.957 1.00 0.00 ? 114 PRO A CB   2  
ATOM 3767  C CG   . PRO A 1 114 ? -8.304  -4.903  -10.653 1.00 0.00 ? 114 PRO A CG   2  
ATOM 3768  C CD   . PRO A 1 114 ? -8.133  -4.338  -9.269  1.00 0.00 ? 114 PRO A CD   2  
ATOM 3769  H HA   . PRO A 1 114 ? -11.337 -4.394  -9.560  1.00 0.00 ? 114 PRO A HA   2  
ATOM 3770  H HB2  . PRO A 1 114 ? -10.070 -5.585  -11.644 1.00 0.00 ? 114 PRO A HB2  2  
ATOM 3771  H HB3  . PRO A 1 114 ? -10.018 -3.842  -11.358 1.00 0.00 ? 114 PRO A HB3  2  
ATOM 3772  H HG2  . PRO A 1 114 ? -7.988  -5.935  -10.678 1.00 0.00 ? 114 PRO A HG2  2  
ATOM 3773  H HG3  . PRO A 1 114 ? -7.742  -4.320  -11.367 1.00 0.00 ? 114 PRO A HG3  2  
ATOM 3774  H HD2  . PRO A 1 114 ? -7.348  -4.859  -8.743  1.00 0.00 ? 114 PRO A HD2  2  
ATOM 3775  H HD3  . PRO A 1 114 ? -7.920  -3.280  -9.318  1.00 0.00 ? 114 PRO A HD3  2  
ATOM 3776  N N    . GLU A 1 115 ? -10.271 -7.115  -8.412  1.00 0.00 ? 115 GLU A N    2  
ATOM 3777  C CA   . GLU A 1 115 ? -10.563 -8.515  -8.130  1.00 0.00 ? 115 GLU A CA   2  
ATOM 3778  C C    . GLU A 1 115 ? -11.789 -8.646  -7.231  1.00 0.00 ? 115 GLU A C    2  
ATOM 3779  O O    . GLU A 1 115 ? -12.676 -9.459  -7.489  1.00 0.00 ? 115 GLU A O    2  
ATOM 3780  C CB   . GLU A 1 115 ? -9.358  -9.187  -7.468  1.00 0.00 ? 115 GLU A CB   2  
ATOM 3781  C CG   . GLU A 1 115 ? -8.239  -9.525  -8.439  1.00 0.00 ? 115 GLU A CG   2  
ATOM 3782  C CD   . GLU A 1 115 ? -8.587  -10.689 -9.347  1.00 0.00 ? 115 GLU A CD   2  
ATOM 3783  O OE1  . GLU A 1 115 ? -9.582  -10.583 -10.093 1.00 0.00 ? 115 GLU A OE1  2  
ATOM 3784  O OE2  . GLU A 1 115 ? -7.862  -11.705 -9.311  1.00 0.00 ? 115 GLU A OE2  2  
ATOM 3785  H H    . GLU A 1 115 ? -9.635  -6.634  -7.841  1.00 0.00 ? 115 GLU A H    2  
ATOM 3786  H HA   . GLU A 1 115 ? -10.766 -9.007  -9.069  1.00 0.00 ? 115 GLU A HA   2  
ATOM 3787  H HB2  . GLU A 1 115 ? -8.963  -8.525  -6.711  1.00 0.00 ? 115 GLU A HB2  2  
ATOM 3788  H HB3  . GLU A 1 115 ? -9.686  -10.102 -6.997  1.00 0.00 ? 115 GLU A HB3  2  
ATOM 3789  H HG2  . GLU A 1 115 ? -8.037  -8.659  -9.051  1.00 0.00 ? 115 GLU A HG2  2  
ATOM 3790  H HG3  . GLU A 1 115 ? -7.354  -9.779  -7.874  1.00 0.00 ? 115 GLU A HG3  2  
ATOM 3791  N N    . GLN A 1 116 ? -11.830 -7.839  -6.176  1.00 0.00 ? 116 GLN A N    2  
ATOM 3792  C CA   . GLN A 1 116 ? -12.947 -7.865  -5.238  1.00 0.00 ? 116 GLN A CA   2  
ATOM 3793  C C    . GLN A 1 116 ? -14.082 -6.967  -5.719  1.00 0.00 ? 116 GLN A C    2  
ATOM 3794  O O    . GLN A 1 116 ? -15.256 -7.313  -5.591  1.00 0.00 ? 116 GLN A O    2  
ATOM 3795  C CB   . GLN A 1 116 ? -12.484 -7.422  -3.849  1.00 0.00 ? 116 GLN A CB   2  
ATOM 3796  C CG   . GLN A 1 116 ? -13.502 -7.695  -2.753  1.00 0.00 ? 116 GLN A CG   2  
ATOM 3797  C CD   . GLN A 1 116 ? -13.324 -9.060  -2.118  1.00 0.00 ? 116 GLN A CD   2  
ATOM 3798  O OE1  . GLN A 1 116 ? -13.745 -9.289  -0.984  1.00 0.00 ? 116 GLN A OE1  2  
ATOM 3799  N NE2  . GLN A 1 116 ? -12.699 -9.976  -2.848  1.00 0.00 ? 116 GLN A NE2  2  
ATOM 3800  H H    . GLN A 1 116 ? -11.093 -7.213  -6.024  1.00 0.00 ? 116 GLN A H    2  
ATOM 3801  H HA   . GLN A 1 116 ? -13.307 -8.881  -5.181  1.00 0.00 ? 116 GLN A HA   2  
ATOM 3802  H HB2  . GLN A 1 116 ? -11.572 -7.946  -3.602  1.00 0.00 ? 116 GLN A HB2  2  
ATOM 3803  H HB3  . GLN A 1 116 ? -12.286 -6.361  -3.870  1.00 0.00 ? 116 GLN A HB3  2  
ATOM 3804  H HG2  . GLN A 1 116 ? -13.396 -6.942  -1.986  1.00 0.00 ? 116 GLN A HG2  2  
ATOM 3805  H HG3  . GLN A 1 116 ? -14.493 -7.637  -3.178  1.00 0.00 ? 116 GLN A HG3  2  
ATOM 3806  H HE21 . GLN A 1 116 ? -12.390 -9.722  -3.744  1.00 0.00 ? 116 GLN A HE21 2  
ATOM 3807  H HE22 . GLN A 1 116 ? -12.570 -10.867 -2.462  1.00 0.00 ? 116 GLN A HE22 2  
ATOM 3808  N N    . ALA A 1 117 ? -13.724 -5.813  -6.272  1.00 0.00 ? 117 ALA A N    2  
ATOM 3809  C CA   . ALA A 1 117 ? -14.713 -4.867  -6.773  1.00 0.00 ? 117 ALA A CA   2  
ATOM 3810  C C    . ALA A 1 117 ? -15.695 -5.548  -7.719  1.00 0.00 ? 117 ALA A C    2  
ATOM 3811  O O    . ALA A 1 117 ? -16.823 -5.089  -7.894  1.00 0.00 ? 117 ALA A O    2  
ATOM 3812  C CB   . ALA A 1 117 ? -14.024 -3.704  -7.471  1.00 0.00 ? 117 ALA A CB   2  
ATOM 3813  H H    . ALA A 1 117 ? -12.772 -5.594  -6.345  1.00 0.00 ? 117 ALA A H    2  
ATOM 3814  H HA   . ALA A 1 117 ? -15.258 -4.474  -5.926  1.00 0.00 ? 117 ALA A HA   2  
ATOM 3815  H HB1  . ALA A 1 117 ? -13.483 -3.116  -6.744  1.00 0.00 ? 117 ALA A HB1  2  
ATOM 3816  H HB2  . ALA A 1 117 ? -13.334 -4.087  -8.210  1.00 0.00 ? 117 ALA A HB2  2  
ATOM 3817  H HB3  . ALA A 1 117 ? -14.764 -3.086  -7.956  1.00 0.00 ? 117 ALA A HB3  2  
ATOM 3818  N N    . ARG A 1 118 ? -15.257 -6.646  -8.329  1.00 0.00 ? 118 ARG A N    2  
ATOM 3819  C CA   . ARG A 1 118 ? -16.098 -7.389  -9.259  1.00 0.00 ? 118 ARG A CA   2  
ATOM 3820  C C    . ARG A 1 118 ? -17.351 -7.912  -8.562  1.00 0.00 ? 118 ARG A C    2  
ATOM 3821  O O    . ARG A 1 118 ? -18.440 -7.902  -9.134  1.00 0.00 ? 118 ARG A O    2  
ATOM 3822  C CB   . ARG A 1 118 ? -15.315 -8.555  -9.866  1.00 0.00 ? 118 ARG A CB   2  
ATOM 3823  C CG   . ARG A 1 118 ? -15.400 -9.835  -9.052  1.00 0.00 ? 118 ARG A CG   2  
ATOM 3824  C CD   . ARG A 1 118 ? -14.434 -10.890 -9.569  1.00 0.00 ? 118 ARG A CD   2  
ATOM 3825  N NE   . ARG A 1 118 ? -14.473 -12.109 -8.766  1.00 0.00 ? 118 ARG A NE   2  
ATOM 3826  C CZ   . ARG A 1 118 ? -14.093 -13.299 -9.217  1.00 0.00 ? 118 ARG A CZ   2  
ATOM 3827  N NH1  . ARG A 1 118 ? -13.647 -13.429 -10.459 1.00 0.00 ? 118 ARG A NH1  2  
ATOM 3828  N NH2  . ARG A 1 118 ? -14.158 -14.362 -8.426  1.00 0.00 ? 118 ARG A NH2  2  
ATOM 3829  H H    . ARG A 1 118 ? -14.347 -6.962  -8.149  1.00 0.00 ? 118 ARG A H    2  
ATOM 3830  H HA   . ARG A 1 118 ? -16.394 -6.716  -10.050 1.00 0.00 ? 118 ARG A HA   2  
ATOM 3831  H HB2  . ARG A 1 118 ? -15.702 -8.757  -10.855 1.00 0.00 ? 118 ARG A HB2  2  
ATOM 3832  H HB3  . ARG A 1 118 ? -14.276 -8.273  -9.946  1.00 0.00 ? 118 ARG A HB3  2  
ATOM 3833  H HG2  . ARG A 1 118 ? -15.156 -9.614  -8.023  1.00 0.00 ? 118 ARG A HG2  2  
ATOM 3834  H HG3  . ARG A 1 118 ? -16.407 -10.222 -9.110  1.00 0.00 ? 118 ARG A HG3  2  
ATOM 3835  H HD2  . ARG A 1 118 ? -14.699 -11.133 -10.587 1.00 0.00 ? 118 ARG A HD2  2  
ATOM 3836  H HD3  . ARG A 1 118 ? -13.434 -10.485 -9.545  1.00 0.00 ? 118 ARG A HD3  2  
ATOM 3837  H HE   . ARG A 1 118 ? -14.800 -12.036 -7.845  1.00 0.00 ? 118 ARG A HE   2  
ATOM 3838  H HH11 . ARG A 1 118 ? -13.596 -12.630 -11.057 1.00 0.00 ? 118 ARG A HH11 2  
ATOM 3839  H HH12 . ARG A 1 118 ? -13.360 -14.326 -10.796 1.00 0.00 ? 118 ARG A HH12 2  
ATOM 3840  H HH21 . ARG A 1 118 ? -14.493 -14.268 -7.489  1.00 0.00 ? 118 ARG A HH21 2  
ATOM 3841  H HH22 . ARG A 1 118 ? -13.871 -15.257 -8.766  1.00 0.00 ? 118 ARG A HH22 2  
ATOM 3842  N N    . ALA A 1 119 ? -17.187 -8.367  -7.325  1.00 0.00 ? 119 ALA A N    2  
ATOM 3843  C CA   . ALA A 1 119 ? -18.304 -8.892  -6.550  1.00 0.00 ? 119 ALA A CA   2  
ATOM 3844  C C    . ALA A 1 119 ? -18.995 -7.783  -5.763  1.00 0.00 ? 119 ALA A C    2  
ATOM 3845  O O    . ALA A 1 119 ? -20.197 -7.847  -5.510  1.00 0.00 ? 119 ALA A O    2  
ATOM 3846  C CB   . ALA A 1 119 ? -17.825 -9.989  -5.610  1.00 0.00 ? 119 ALA A CB   2  
ATOM 3847  H H    . ALA A 1 119 ? -16.293 -8.348  -6.923  1.00 0.00 ? 119 ALA A H    2  
ATOM 3848  H HA   . ALA A 1 119 ? -19.013 -9.327  -7.239  1.00 0.00 ? 119 ALA A HA   2  
ATOM 3849  H HB1  . ALA A 1 119 ? -18.066 -10.953 -6.031  1.00 0.00 ? 119 ALA A HB1  2  
ATOM 3850  H HB2  . ALA A 1 119 ? -16.756 -9.909  -5.480  1.00 0.00 ? 119 ALA A HB2  2  
ATOM 3851  H HB3  . ALA A 1 119 ? -18.313 -9.881  -4.653  1.00 0.00 ? 119 ALA A HB3  2  
ATOM 3852  N N    . GLU A 1 120 ? -18.226 -6.769  -5.379  1.00 0.00 ? 120 GLU A N    2  
ATOM 3853  C CA   . GLU A 1 120 ? -18.766 -5.647  -4.619  1.00 0.00 ? 120 GLU A CA   2  
ATOM 3854  C C    . GLU A 1 120 ? -20.008 -5.078  -5.299  1.00 0.00 ? 120 GLU A C    2  
ATOM 3855  O O    . GLU A 1 120 ? -20.917 -4.577  -4.636  1.00 0.00 ? 120 GLU A O    2  
ATOM 3856  C CB   . GLU A 1 120 ? -17.709 -4.552  -4.464  1.00 0.00 ? 120 GLU A CB   2  
ATOM 3857  C CG   . GLU A 1 120 ? -16.634 -4.884  -3.443  1.00 0.00 ? 120 GLU A CG   2  
ATOM 3858  C CD   . GLU A 1 120 ? -15.795 -3.679  -3.066  1.00 0.00 ? 120 GLU A CD   2  
ATOM 3859  O OE1  . GLU A 1 120 ? -16.255 -2.877  -2.226  1.00 0.00 ? 120 GLU A OE1  2  
ATOM 3860  O OE2  . GLU A 1 120 ? -14.680 -3.537  -3.609  1.00 0.00 ? 120 GLU A OE2  2  
ATOM 3861  H H    . GLU A 1 120 ? -17.274 -6.775  -5.611  1.00 0.00 ? 120 GLU A H    2  
ATOM 3862  H HA   . GLU A 1 120 ? -19.041 -6.011  -3.641  1.00 0.00 ? 120 GLU A HA   2  
ATOM 3863  H HB2  . GLU A 1 120 ? -17.233 -4.390  -5.419  1.00 0.00 ? 120 GLU A HB2  2  
ATOM 3864  H HB3  . GLU A 1 120 ? -18.198 -3.639  -4.156  1.00 0.00 ? 120 GLU A HB3  2  
ATOM 3865  H HG2  . GLU A 1 120 ? -17.107 -5.268  -2.552  1.00 0.00 ? 120 GLU A HG2  2  
ATOM 3866  H HG3  . GLU A 1 120 ? -15.984 -5.641  -3.858  1.00 0.00 ? 120 GLU A HG3  2  
ATOM 3867  N N    . ARG A 1 121 ? -20.039 -5.158  -6.625  1.00 0.00 ? 121 ARG A N    2  
ATOM 3868  C CA   . ARG A 1 121 ? -21.168 -4.649  -7.395  1.00 0.00 ? 121 ARG A CA   2  
ATOM 3869  C C    . ARG A 1 121 ? -22.411 -5.505  -7.167  1.00 0.00 ? 121 ARG A C    2  
ATOM 3870  O O    . ARG A 1 121 ? -23.535 -5.007  -7.213  1.00 0.00 ? 121 ARG A O    2  
ATOM 3871  C CB   . ARG A 1 121 ? -20.824 -4.618  -8.885  1.00 0.00 ? 121 ARG A CB   2  
ATOM 3872  C CG   . ARG A 1 121 ? -20.042 -3.383  -9.303  1.00 0.00 ? 121 ARG A CG   2  
ATOM 3873  C CD   . ARG A 1 121 ? -20.934 -2.153  -9.362  1.00 0.00 ? 121 ARG A CD   2  
ATOM 3874  N NE   . ARG A 1 121 ? -22.287 -2.478  -9.806  1.00 0.00 ? 121 ARG A NE   2  
ATOM 3875  C CZ   . ARG A 1 121 ? -22.622 -2.641  -11.081 1.00 0.00 ? 121 ARG A CZ   2  
ATOM 3876  N NH1  . ARG A 1 121 ? -21.708 -2.512  -12.032 1.00 0.00 ? 121 ARG A NH1  2  
ATOM 3877  N NH2  . ARG A 1 121 ? -23.875 -2.936  -11.406 1.00 0.00 ? 121 ARG A NH2  2  
ATOM 3878  H H    . ARG A 1 121 ? -19.285 -5.568  -7.097  1.00 0.00 ? 121 ARG A H    2  
ATOM 3879  H HA   . ARG A 1 121 ? -21.372 -3.643  -7.060  1.00 0.00 ? 121 ARG A HA   2  
ATOM 3880  H HB2  . ARG A 1 121 ? -20.232 -5.489  -9.124  1.00 0.00 ? 121 ARG A HB2  2  
ATOM 3881  H HB3  . ARG A 1 121 ? -21.741 -4.647  -9.454  1.00 0.00 ? 121 ARG A HB3  2  
ATOM 3882  H HG2  . ARG A 1 121 ? -19.253 -3.208  -8.587  1.00 0.00 ? 121 ARG A HG2  2  
ATOM 3883  H HG3  . ARG A 1 121 ? -19.614 -3.554  -10.280 1.00 0.00 ? 121 ARG A HG3  2  
ATOM 3884  H HD2  . ARG A 1 121 ? -20.985 -1.714  -8.376  1.00 0.00 ? 121 ARG A HD2  2  
ATOM 3885  H HD3  . ARG A 1 121 ? -20.500 -1.442  -10.049 1.00 0.00 ? 121 ARG A HD3  2  
ATOM 3886  H HE   . ARG A 1 121 ? -22.978 -2.578  -9.119  1.00 0.00 ? 121 ARG A HE   2  
ATOM 3887  H HH11 . ARG A 1 121 ? -20.764 -2.291  -11.790 1.00 0.00 ? 121 ARG A HH11 2  
ATOM 3888  H HH12 . ARG A 1 121 ? -21.963 -2.637  -12.991 1.00 0.00 ? 121 ARG A HH12 2  
ATOM 3889  H HH21 . ARG A 1 121 ? -24.567 -3.035  -10.691 1.00 0.00 ? 121 ARG A HH21 2  
ATOM 3890  H HH22 . ARG A 1 121 ? -24.126 -3.059  -12.365 1.00 0.00 ? 121 ARG A HH22 2  
ATOM 3891  N N    . GLU A 1 122 ? -22.199 -6.794  -6.922  1.00 0.00 ? 122 GLU A N    2  
ATOM 3892  C CA   . GLU A 1 122 ? -23.303 -7.718  -6.689  1.00 0.00 ? 122 GLU A CA   2  
ATOM 3893  C C    . GLU A 1 122 ? -23.950 -7.461  -5.331  1.00 0.00 ? 122 GLU A C    2  
ATOM 3894  O O    . GLU A 1 122 ? -25.064 -7.913  -5.065  1.00 0.00 ? 122 GLU A O    2  
ATOM 3895  C CB   . GLU A 1 122 ? -22.811 -9.165  -6.766  1.00 0.00 ? 122 GLU A CB   2  
ATOM 3896  C CG   . GLU A 1 122 ? -22.874 -9.755  -8.165  1.00 0.00 ? 122 GLU A CG   2  
ATOM 3897  C CD   . GLU A 1 122 ? -24.271 -10.204 -8.547  1.00 0.00 ? 122 GLU A CD   2  
ATOM 3898  O OE1  . GLU A 1 122 ? -25.043 -10.579 -7.640  1.00 0.00 ? 122 GLU A OE1  2  
ATOM 3899  O OE2  . GLU A 1 122 ? -24.592 -10.180 -9.754  1.00 0.00 ? 122 GLU A OE2  2  
ATOM 3900  H H    . GLU A 1 122 ? -21.280 -7.132  -6.898  1.00 0.00 ? 122 GLU A H    2  
ATOM 3901  H HA   . GLU A 1 122 ? -24.040 -7.556  -7.461  1.00 0.00 ? 122 GLU A HA   2  
ATOM 3902  H HB2  . GLU A 1 122 ? -21.786 -9.203  -6.427  1.00 0.00 ? 122 GLU A HB2  2  
ATOM 3903  H HB3  . GLU A 1 122 ? -23.419 -9.774  -6.114  1.00 0.00 ? 122 GLU A HB3  2  
ATOM 3904  H HG2  . GLU A 1 122 ? -22.547 -9.007  -8.872  1.00 0.00 ? 122 GLU A HG2  2  
ATOM 3905  H HG3  . GLU A 1 122 ? -22.212 -10.607 -8.213  1.00 0.00 ? 122 GLU A HG3  2  
ATOM 3906  N N    . LYS A 1 123 ? -23.242 -6.733  -4.473  1.00 0.00 ? 123 LYS A N    2  
ATOM 3907  C CA   . LYS A 1 123 ? -23.745 -6.415  -3.142  1.00 0.00 ? 123 LYS A CA   2  
ATOM 3908  C C    . LYS A 1 123 ? -24.567 -5.130  -3.165  1.00 0.00 ? 123 LYS A C    2  
ATOM 3909  O O    . LYS A 1 123 ? -24.336 -4.247  -3.991  1.00 0.00 ? 123 LYS A O    2  
ATOM 3910  C CB   . LYS A 1 123 ? -22.584 -6.272  -2.156  1.00 0.00 ? 123 LYS A CB   2  
ATOM 3911  C CG   . LYS A 1 123 ? -22.889 -5.355  -0.985  1.00 0.00 ? 123 LYS A CG   2  
ATOM 3912  C CD   . LYS A 1 123 ? -22.028 -5.686  0.222   1.00 0.00 ? 123 LYS A CD   2  
ATOM 3913  C CE   . LYS A 1 123 ? -22.560 -5.025  1.485   1.00 0.00 ? 123 LYS A CE   2  
ATOM 3914  N NZ   . LYS A 1 123 ? -22.545 -3.539  1.381   1.00 0.00 ? 123 LYS A NZ   2  
ATOM 3915  H H    . LYS A 1 123 ? -22.360 -6.401  -4.743  1.00 0.00 ? 123 LYS A H    2  
ATOM 3916  H HA   . LYS A 1 123 ? -24.379 -7.228  -2.824  1.00 0.00 ? 123 LYS A HA   2  
ATOM 3917  H HB2  . LYS A 1 123 ? -22.336 -7.249  -1.767  1.00 0.00 ? 123 LYS A HB2  2  
ATOM 3918  H HB3  . LYS A 1 123 ? -21.727 -5.876  -2.683  1.00 0.00 ? 123 LYS A HB3  2  
ATOM 3919  H HG2  . LYS A 1 123 ? -22.699 -4.333  -1.280  1.00 0.00 ? 123 LYS A HG2  2  
ATOM 3920  H HG3  . LYS A 1 123 ? -23.930 -5.465  -0.715  1.00 0.00 ? 123 LYS A HG3  2  
ATOM 3921  H HD2  . LYS A 1 123 ? -22.020 -6.756  0.366   1.00 0.00 ? 123 LYS A HD2  2  
ATOM 3922  H HD3  . LYS A 1 123 ? -21.020 -5.338  0.041   1.00 0.00 ? 123 LYS A HD3  2  
ATOM 3923  H HE2  . LYS A 1 123 ? -23.573 -5.356  1.649   1.00 0.00 ? 123 LYS A HE2  2  
ATOM 3924  H HE3  . LYS A 1 123 ? -21.943 -5.325  2.319   1.00 0.00 ? 123 LYS A HE3  2  
ATOM 3925  H HZ1  . LYS A 1 123 ? -23.494 -3.188  1.141   1.00 0.00 ? 123 LYS A HZ1  2  
ATOM 3926  H HZ2  . LYS A 1 123 ? -21.878 -3.239  0.641   1.00 0.00 ? 123 LYS A HZ2  2  
ATOM 3927  H HZ3  . LYS A 1 123 ? -22.251 -3.121  2.287   1.00 0.00 ? 123 LYS A HZ3  2  
ATOM 3928  N N    . THR A 1 124 ? -25.528 -5.031  -2.251  1.00 0.00 ? 124 THR A N    2  
ATOM 3929  C CA   . THR A 1 124 ? -26.383 -3.854  -2.165  1.00 0.00 ? 124 THR A CA   2  
ATOM 3930  C C    . THR A 1 124 ? -25.883 -2.886  -1.099  1.00 0.00 ? 124 THR A C    2  
ATOM 3931  O O    . THR A 1 124 ? -25.314 -3.301  -0.089  1.00 0.00 ? 124 THR A O    2  
ATOM 3932  C CB   . THR A 1 124 ? -27.840 -4.241  -1.848  1.00 0.00 ? 124 THR A CB   2  
ATOM 3933  O OG1  . THR A 1 124 ? -28.733 -3.240  -2.349  1.00 0.00 ? 124 THR A OG1  2  
ATOM 3934  C CG2  . THR A 1 124 ? -28.043 -4.404  -0.349  1.00 0.00 ? 124 THR A CG2  2  
ATOM 3935  H H    . THR A 1 124 ? -25.663 -5.768  -1.619  1.00 0.00 ? 124 THR A H    2  
ATOM 3936  H HA   . THR A 1 124 ? -26.365 -3.359  -3.125  1.00 0.00 ? 124 THR A HA   2  
ATOM 3937  H HB   . THR A 1 124 ? -28.060 -5.183  -2.330  1.00 0.00 ? 124 THR A HB   2  
ATOM 3938  H HG1  . THR A 1 124 ? -29.249 -2.879  -1.624  1.00 0.00 ? 124 THR A HG1  2  
ATOM 3939  H HG21 . THR A 1 124 ? -27.962 -3.440  0.131   1.00 0.00 ? 124 THR A HG21 2  
ATOM 3940  H HG22 . THR A 1 124 ? -27.288 -5.067  0.046   1.00 0.00 ? 124 THR A HG22 2  
ATOM 3941  H HG23 . THR A 1 124 ? -29.022 -4.819  -0.161  1.00 0.00 ? 124 THR A HG23 2  
ATOM 3942  N N    . SER A 1 125 ? -26.099 -1.596  -1.330  1.00 0.00 ? 125 SER A N    2  
ATOM 3943  C CA   . SER A 1 125 ? -25.667 -0.568  -0.390  1.00 0.00 ? 125 SER A CA   2  
ATOM 3944  C C    . SER A 1 125 ? -26.842 -0.066  0.444   1.00 0.00 ? 125 SER A C    2  
ATOM 3945  O O    . SER A 1 125 ? -27.980 -0.495  0.256   1.00 0.00 ? 125 SER A O    2  
ATOM 3946  C CB   . SER A 1 125 ? -25.023 0.600   -1.139  1.00 0.00 ? 125 SER A CB   2  
ATOM 3947  O OG   . SER A 1 125 ? -24.566 1.594   -0.238  1.00 0.00 ? 125 SER A OG   2  
ATOM 3948  H H    . SER A 1 125 ? -26.559 -1.328  -2.154  1.00 0.00 ? 125 SER A H    2  
ATOM 3949  H HA   . SER A 1 125 ? -24.935 -1.009  0.270   1.00 0.00 ? 125 SER A HA   2  
ATOM 3950  H HB2  . SER A 1 125 ? -24.183 0.238   -1.712  1.00 0.00 ? 125 SER A HB2  2  
ATOM 3951  H HB3  . SER A 1 125 ? -25.750 1.042   -1.805  1.00 0.00 ? 125 SER A HB3  2  
ATOM 3952  H HG   . SER A 1 125 ? -23.657 1.821   -0.446  1.00 0.00 ? 125 SER A HG   2  
ATOM 3953  N N    . GLY A 1 126 ? -26.557 0.847   1.368   1.00 0.00 ? 126 GLY A N    2  
ATOM 3954  C CA   . GLY A 1 126 ? -27.598 1.393   2.218   1.00 0.00 ? 126 GLY A CA   2  
ATOM 3955  C C    . GLY A 1 126 ? -27.148 2.634   2.963   1.00 0.00 ? 126 GLY A C    2  
ATOM 3956  O O    . GLY A 1 126 ? -26.865 2.596   4.161   1.00 0.00 ? 126 GLY A O    2  
ATOM 3957  H H    . GLY A 1 126 ? -25.631 1.152   1.473   1.00 0.00 ? 126 GLY A H    2  
ATOM 3958  H HA2  . GLY A 1 126 ? -28.452 1.643   1.606   1.00 0.00 ? 126 GLY A HA2  2  
ATOM 3959  H HA3  . GLY A 1 126 ? -27.891 0.642   2.937   1.00 0.00 ? 126 GLY A HA3  2  
ATOM 3960  N N    . PRO A 1 127 ? -27.074 3.765   2.247   1.00 0.00 ? 127 PRO A N    2  
ATOM 3961  C CA   . PRO A 1 127 ? -26.654 5.044   2.827   1.00 0.00 ? 127 PRO A CA   2  
ATOM 3962  C C    . PRO A 1 127 ? -27.688 5.609   3.796   1.00 0.00 ? 127 PRO A C    2  
ATOM 3963  O O    . PRO A 1 127 ? -27.349 6.039   4.898   1.00 0.00 ? 127 PRO A O    2  
ATOM 3964  C CB   . PRO A 1 127 ? -26.510 5.957   1.607   1.00 0.00 ? 127 PRO A CB   2  
ATOM 3965  C CG   . PRO A 1 127 ? -27.420 5.369   0.584   1.00 0.00 ? 127 PRO A CG   2  
ATOM 3966  C CD   . PRO A 1 127 ? -27.397 3.883   0.815   1.00 0.00 ? 127 PRO A CD   2  
ATOM 3967  H HA   . PRO A 1 127 ? -25.701 4.958   3.329   1.00 0.00 ? 127 PRO A HA   2  
ATOM 3968  H HB2  . PRO A 1 127 ? -26.806 6.963   1.870   1.00 0.00 ? 127 PRO A HB2  2  
ATOM 3969  H HB3  . PRO A 1 127 ? -25.484 5.955   1.270   1.00 0.00 ? 127 PRO A HB3  2  
ATOM 3970  H HG2  . PRO A 1 127 ? -28.419 5.754   0.717   1.00 0.00 ? 127 PRO A HG2  2  
ATOM 3971  H HG3  . PRO A 1 127 ? -27.056 5.600   -0.406  1.00 0.00 ? 127 PRO A HG3  2  
ATOM 3972  H HD2  . PRO A 1 127 ? -28.364 3.453   0.600   1.00 0.00 ? 127 PRO A HD2  2  
ATOM 3973  H HD3  . PRO A 1 127 ? -26.633 3.419   0.209   1.00 0.00 ? 127 PRO A HD3  2  
ATOM 3974  N N    . SER A 1 128 ? -28.949 5.603   3.377   1.00 0.00 ? 128 SER A N    2  
ATOM 3975  C CA   . SER A 1 128 ? -30.032 6.118   4.207   1.00 0.00 ? 128 SER A CA   2  
ATOM 3976  C C    . SER A 1 128 ? -30.561 5.036   5.143   1.00 0.00 ? 128 SER A C    2  
ATOM 3977  O O    . SER A 1 128 ? -30.740 3.886   4.742   1.00 0.00 ? 128 SER A O    2  
ATOM 3978  C CB   . SER A 1 128 ? -31.167 6.649   3.329   1.00 0.00 ? 128 SER A CB   2  
ATOM 3979  O OG   . SER A 1 128 ? -31.927 7.628   4.016   1.00 0.00 ? 128 SER A OG   2  
ATOM 3980  H H    . SER A 1 128 ? -29.156 5.247   2.488   1.00 0.00 ? 128 SER A H    2  
ATOM 3981  H HA   . SER A 1 128 ? -29.638 6.930   4.800   1.00 0.00 ? 128 SER A HA   2  
ATOM 3982  H HB2  . SER A 1 128 ? -30.752 7.093   2.437   1.00 0.00 ? 128 SER A HB2  2  
ATOM 3983  H HB3  . SER A 1 128 ? -31.819 5.832   3.055   1.00 0.00 ? 128 SER A HB3  2  
ATOM 3984  H HG   . SER A 1 128 ? -31.651 8.504   3.734   1.00 0.00 ? 128 SER A HG   2  
ATOM 3985  N N    . SER A 1 129 ? -30.809 5.413   6.393   1.00 0.00 ? 129 SER A N    2  
ATOM 3986  C CA   . SER A 1 129 ? -31.314 4.475   7.389   1.00 0.00 ? 129 SER A CA   2  
ATOM 3987  C C    . SER A 1 129 ? -30.470 3.204   7.415   1.00 0.00 ? 129 SER A C    2  
ATOM 3988  O O    . SER A 1 129 ? -30.993 2.102   7.576   1.00 0.00 ? 129 SER A O    2  
ATOM 3989  C CB   . SER A 1 129 ? -32.775 4.125   7.096   1.00 0.00 ? 129 SER A CB   2  
ATOM 3990  O OG   . SER A 1 129 ? -33.465 3.782   8.285   1.00 0.00 ? 129 SER A OG   2  
ATOM 3991  H H    . SER A 1 129 ? -30.646 6.344   6.652   1.00 0.00 ? 129 SER A H    2  
ATOM 3992  H HA   . SER A 1 129 ? -31.254 4.952   8.355   1.00 0.00 ? 129 SER A HA   2  
ATOM 3993  H HB2  . SER A 1 129 ? -33.262 4.975   6.644   1.00 0.00 ? 129 SER A HB2  2  
ATOM 3994  H HB3  . SER A 1 129 ? -32.812 3.285   6.417   1.00 0.00 ? 129 SER A HB3  2  
ATOM 3995  H HG   . SER A 1 129 ? -33.346 4.478   8.936   1.00 0.00 ? 129 SER A HG   2  
ATOM 3996  N N    . GLY A 1 130 ? -29.161 3.367   7.254   1.00 0.00 ? 130 GLY A N    2  
ATOM 3997  C CA   . GLY A 1 130 ? -28.264 2.226   7.262   1.00 0.00 ? 130 GLY A CA   2  
ATOM 3998  C C    . GLY A 1 130 ? -27.399 2.177   8.506   1.00 0.00 ? 130 GLY A C    2  
ATOM 3999  O O    . GLY A 1 130 ? -27.882 2.402   9.615   1.00 0.00 ? 130 GLY A O    2  
ATOM 4000  H H    . GLY A 1 130 ? -28.800 4.270   7.130   1.00 0.00 ? 130 GLY A H    2  
ATOM 4001  H HA2  . GLY A 1 130 ? -28.851 1.321   7.208   1.00 0.00 ? 130 GLY A HA2  2  
ATOM 4002  H HA3  . GLY A 1 130 ? -27.624 2.280   6.394   1.00 0.00 ? 130 GLY A HA3  2  
ATOM 4003  N N    . GLY A 1 1   ? -0.366  -23.511 -6.724  1.00 0.00 ? 1   GLY A N    3  
ATOM 4004  C CA   . GLY A 1 1   ? -0.374  -22.367 -7.616  1.00 0.00 ? 1   GLY A CA   3  
ATOM 4005  C C    . GLY A 1 1   ? -1.412  -21.334 -7.224  1.00 0.00 ? 1   GLY A C    3  
ATOM 4006  O O    . GLY A 1 1   ? -2.107  -21.491 -6.220  1.00 0.00 ? 1   GLY A O    3  
ATOM 4007  H H1   . GLY A 1 1   ? -0.208  -23.382 -5.765  1.00 0.00 ? 1   GLY A H1   3  
ATOM 4008  H HA2  . GLY A 1 1   ? 0.602   -21.905 -7.601  1.00 0.00 ? 1   GLY A HA2  3  
ATOM 4009  H HA3  . GLY A 1 1   ? -0.584  -22.708 -8.619  1.00 0.00 ? 1   GLY A HA3  3  
ATOM 4010  N N    . SER A 1 2   ? -1.517  -20.272 -8.018  1.00 0.00 ? 2   SER A N    3  
ATOM 4011  C CA   . SER A 1 2   ? -2.474  -19.206 -7.745  1.00 0.00 ? 2   SER A CA   3  
ATOM 4012  C C    . SER A 1 2   ? -3.010  -18.612 -9.045  1.00 0.00 ? 2   SER A C    3  
ATOM 4013  O O    . SER A 1 2   ? -2.317  -18.589 -10.062 1.00 0.00 ? 2   SER A O    3  
ATOM 4014  C CB   . SER A 1 2   ? -1.821  -18.110 -6.901  1.00 0.00 ? 2   SER A CB   3  
ATOM 4015  O OG   . SER A 1 2   ? -2.712  -17.027 -6.694  1.00 0.00 ? 2   SER A OG   3  
ATOM 4016  H H    . SER A 1 2   ? -0.935  -20.204 -8.803  1.00 0.00 ? 2   SER A H    3  
ATOM 4017  H HA   . SER A 1 2   ? -3.297  -19.633 -7.192  1.00 0.00 ? 2   SER A HA   3  
ATOM 4018  H HB2  . SER A 1 2   ? -1.539  -18.517 -5.942  1.00 0.00 ? 2   SER A HB2  3  
ATOM 4019  H HB3  . SER A 1 2   ? -0.941  -17.744 -7.410  1.00 0.00 ? 2   SER A HB3  3  
ATOM 4020  H HG   . SER A 1 2   ? -2.611  -16.389 -7.404  1.00 0.00 ? 2   SER A HG   3  
ATOM 4021  N N    . SER A 1 3   ? -4.249  -18.134 -9.002  1.00 0.00 ? 3   SER A N    3  
ATOM 4022  C CA   . SER A 1 3   ? -4.881  -17.543 -10.176 1.00 0.00 ? 3   SER A CA   3  
ATOM 4023  C C    . SER A 1 3   ? -4.777  -16.021 -10.141 1.00 0.00 ? 3   SER A C    3  
ATOM 4024  O O    . SER A 1 3   ? -4.256  -15.445 -9.188  1.00 0.00 ? 3   SER A O    3  
ATOM 4025  C CB   . SER A 1 3   ? -6.350  -17.963 -10.256 1.00 0.00 ? 3   SER A CB   3  
ATOM 4026  O OG   . SER A 1 3   ? -6.964  -17.918 -8.980  1.00 0.00 ? 3   SER A OG   3  
ATOM 4027  H H    . SER A 1 3   ? -4.751  -18.182 -8.161  1.00 0.00 ? 3   SER A H    3  
ATOM 4028  H HA   . SER A 1 3   ? -4.363  -17.908 -11.050 1.00 0.00 ? 3   SER A HA   3  
ATOM 4029  H HB2  . SER A 1 3   ? -6.877  -17.295 -10.920 1.00 0.00 ? 3   SER A HB2  3  
ATOM 4030  H HB3  . SER A 1 3   ? -6.413  -18.972 -10.637 1.00 0.00 ? 3   SER A HB3  3  
ATOM 4031  H HG   . SER A 1 3   ? -7.769  -18.441 -8.993  1.00 0.00 ? 3   SER A HG   3  
ATOM 4032  N N    . GLY A 1 4   ? -5.277  -15.376 -11.191 1.00 0.00 ? 4   GLY A N    3  
ATOM 4033  C CA   . GLY A 1 4   ? -5.230  -13.927 -11.262 1.00 0.00 ? 4   GLY A CA   3  
ATOM 4034  C C    . GLY A 1 4   ? -5.174  -13.418 -12.689 1.00 0.00 ? 4   GLY A C    3  
ATOM 4035  O O    . GLY A 1 4   ? -4.195  -12.793 -13.094 1.00 0.00 ? 4   GLY A O    3  
ATOM 4036  H H    . GLY A 1 4   ? -5.681  -15.888 -11.923 1.00 0.00 ? 4   GLY A H    3  
ATOM 4037  H HA2  . GLY A 1 4   ? -6.110  -13.526 -10.782 1.00 0.00 ? 4   GLY A HA2  3  
ATOM 4038  H HA3  . GLY A 1 4   ? -4.354  -13.580 -10.734 1.00 0.00 ? 4   GLY A HA3  3  
ATOM 4039  N N    . SER A 1 5   ? -6.227  -13.688 -13.454 1.00 0.00 ? 5   SER A N    3  
ATOM 4040  C CA   . SER A 1 5   ? -6.291  -13.258 -14.846 1.00 0.00 ? 5   SER A CA   3  
ATOM 4041  C C    . SER A 1 5   ? -7.416  -12.247 -15.050 1.00 0.00 ? 5   SER A C    3  
ATOM 4042  O O    . SER A 1 5   ? -7.411  -11.484 -16.016 1.00 0.00 ? 5   SER A O    3  
ATOM 4043  C CB   . SER A 1 5   ? -6.500  -14.463 -15.765 1.00 0.00 ? 5   SER A CB   3  
ATOM 4044  O OG   . SER A 1 5   ? -7.244  -14.104 -16.916 1.00 0.00 ? 5   SER A OG   3  
ATOM 4045  H H    . SER A 1 5   ? -6.978  -14.192 -13.073 1.00 0.00 ? 5   SER A H    3  
ATOM 4046  H HA   . SER A 1 5   ? -5.351  -12.788 -15.091 1.00 0.00 ? 5   SER A HA   3  
ATOM 4047  H HB2  . SER A 1 5   ? -5.540  -14.845 -16.077 1.00 0.00 ? 5   SER A HB2  3  
ATOM 4048  H HB3  . SER A 1 5   ? -7.037  -15.232 -15.229 1.00 0.00 ? 5   SER A HB3  3  
ATOM 4049  H HG   . SER A 1 5   ? -6.831  -13.349 -17.341 1.00 0.00 ? 5   SER A HG   3  
ATOM 4050  N N    . SER A 1 6   ? -8.378  -12.248 -14.133 1.00 0.00 ? 6   SER A N    3  
ATOM 4051  C CA   . SER A 1 6   ? -9.512  -11.335 -14.214 1.00 0.00 ? 6   SER A CA   3  
ATOM 4052  C C    . SER A 1 6   ? -9.358  -10.189 -13.218 1.00 0.00 ? 6   SER A C    3  
ATOM 4053  O O    . SER A 1 6   ? -10.344 -9.626  -12.746 1.00 0.00 ? 6   SER A O    3  
ATOM 4054  C CB   . SER A 1 6   ? -10.818 -12.085 -13.949 1.00 0.00 ? 6   SER A CB   3  
ATOM 4055  O OG   . SER A 1 6   ? -11.087 -13.021 -14.977 1.00 0.00 ? 6   SER A OG   3  
ATOM 4056  H H    . SER A 1 6   ? -8.325  -12.881 -13.386 1.00 0.00 ? 6   SER A H    3  
ATOM 4057  H HA   . SER A 1 6   ? -9.538  -10.926 -15.214 1.00 0.00 ? 6   SER A HA   3  
ATOM 4058  H HB2  . SER A 1 6   ? -10.743 -12.612 -13.010 1.00 0.00 ? 6   SER A HB2  3  
ATOM 4059  H HB3  . SER A 1 6   ? -11.633 -11.377 -13.900 1.00 0.00 ? 6   SER A HB3  3  
ATOM 4060  H HG   . SER A 1 6   ? -11.110 -12.569 -15.824 1.00 0.00 ? 6   SER A HG   3  
ATOM 4061  N N    . GLY A 1 7   ? -8.111  -9.850  -12.903 1.00 0.00 ? 7   GLY A N    3  
ATOM 4062  C CA   . GLY A 1 7   ? -7.850  -8.774  -11.966 1.00 0.00 ? 7   GLY A CA   3  
ATOM 4063  C C    . GLY A 1 7   ? -6.692  -9.083  -11.037 1.00 0.00 ? 7   GLY A C    3  
ATOM 4064  O O    . GLY A 1 7   ? -6.249  -10.228 -10.944 1.00 0.00 ? 7   GLY A O    3  
ATOM 4065  H H    . GLY A 1 7   ? -7.363  -10.335 -13.311 1.00 0.00 ? 7   GLY A H    3  
ATOM 4066  H HA2  . GLY A 1 7   ? -7.623  -7.875  -12.520 1.00 0.00 ? 7   GLY A HA2  3  
ATOM 4067  H HA3  . GLY A 1 7   ? -8.737  -8.605  -11.373 1.00 0.00 ? 7   GLY A HA3  3  
ATOM 4068  N N    . THR A 1 8   ? -6.199  -8.058  -10.348 1.00 0.00 ? 8   THR A N    3  
ATOM 4069  C CA   . THR A 1 8   ? -5.084  -8.225  -9.424  1.00 0.00 ? 8   THR A CA   3  
ATOM 4070  C C    . THR A 1 8   ? -4.772  -6.921  -8.698  1.00 0.00 ? 8   THR A C    3  
ATOM 4071  O O    . THR A 1 8   ? -4.954  -5.827  -9.232  1.00 0.00 ? 8   THR A O    3  
ATOM 4072  C CB   . THR A 1 8   ? -3.817  -8.709  -10.154 1.00 0.00 ? 8   THR A CB   3  
ATOM 4073  O OG1  . THR A 1 8   ? -3.540  -10.070 -9.804  1.00 0.00 ? 8   THR A OG1  3  
ATOM 4074  C CG2  . THR A 1 8   ? -2.622  -7.836  -9.801  1.00 0.00 ? 8   THR A CG2  3  
ATOM 4075  H H    . THR A 1 8   ? -6.595  -7.170  -10.465 1.00 0.00 ? 8   THR A H    3  
ATOM 4076  H HA   . THR A 1 8   ? -5.363  -8.973  -8.696  1.00 0.00 ? 8   THR A HA   3  
ATOM 4077  H HB   . THR A 1 8   ? -3.988  -8.647  -11.219 1.00 0.00 ? 8   THR A HB   3  
ATOM 4078  H HG1  . THR A 1 8   ? -3.360  -10.575 -10.600 1.00 0.00 ? 8   THR A HG1  3  
ATOM 4079  H HG21 . THR A 1 8   ? -1.760  -8.163  -10.363 1.00 0.00 ? 8   THR A HG21 3  
ATOM 4080  H HG22 . THR A 1 8   ? -2.415  -7.919  -8.745  1.00 0.00 ? 8   THR A HG22 3  
ATOM 4081  H HG23 . THR A 1 8   ? -2.843  -6.808  -10.046 1.00 0.00 ? 8   THR A HG23 3  
ATOM 4082  N N    . PRO A 1 9   ? -4.288  -7.038  -7.452  1.00 0.00 ? 9   PRO A N    3  
ATOM 4083  C CA   . PRO A 1 9   ? -3.939  -5.878  -6.627  1.00 0.00 ? 9   PRO A CA   3  
ATOM 4084  C C    . PRO A 1 9   ? -2.703  -5.150  -7.144  1.00 0.00 ? 9   PRO A C    3  
ATOM 4085  O O    . PRO A 1 9   ? -1.657  -5.762  -7.366  1.00 0.00 ? 9   PRO A O    3  
ATOM 4086  C CB   . PRO A 1 9   ? -3.663  -6.491  -5.252  1.00 0.00 ? 9   PRO A CB   3  
ATOM 4087  C CG   . PRO A 1 9   ? -3.264  -7.897  -5.538  1.00 0.00 ? 9   PRO A CG   3  
ATOM 4088  C CD   . PRO A 1 9   ? -4.045  -8.311  -6.754  1.00 0.00 ? 9   PRO A CD   3  
ATOM 4089  H HA   . PRO A 1 9   ? -4.761  -5.181  -6.554  1.00 0.00 ? 9   PRO A HA   3  
ATOM 4090  H HB2  . PRO A 1 9   ? -2.868  -5.944  -4.765  1.00 0.00 ? 9   PRO A HB2  3  
ATOM 4091  H HB3  . PRO A 1 9   ? -4.558  -6.449  -4.649  1.00 0.00 ? 9   PRO A HB3  3  
ATOM 4092  H HG2  . PRO A 1 9   ? -2.204  -7.944  -5.739  1.00 0.00 ? 9   PRO A HG2  3  
ATOM 4093  H HG3  . PRO A 1 9   ? -3.516  -8.528  -4.698  1.00 0.00 ? 9   PRO A HG3  3  
ATOM 4094  H HD2  . PRO A 1 9   ? -3.462  -8.982  -7.367  1.00 0.00 ? 9   PRO A HD2  3  
ATOM 4095  H HD3  . PRO A 1 9   ? -4.977  -8.775  -6.464  1.00 0.00 ? 9   PRO A HD3  3  
ATOM 4096  N N    . HIS A 1 10  ? -2.828  -3.840  -7.334  1.00 0.00 ? 10  HIS A N    3  
ATOM 4097  C CA   . HIS A 1 10  ? -1.720  -3.029  -7.824  1.00 0.00 ? 10  HIS A CA   3  
ATOM 4098  C C    . HIS A 1 10  ? -1.834  -1.593  -7.322  1.00 0.00 ? 10  HIS A C    3  
ATOM 4099  O O    . HIS A 1 10  ? -2.916  -1.141  -6.943  1.00 0.00 ? 10  HIS A O    3  
ATOM 4100  C CB   . HIS A 1 10  ? -1.684  -3.046  -9.352  1.00 0.00 ? 10  HIS A CB   3  
ATOM 4101  C CG   . HIS A 1 10  ? -2.882  -2.409  -9.987  1.00 0.00 ? 10  HIS A CG   3  
ATOM 4102  N ND1  . HIS A 1 10  ? -3.967  -3.129  -10.439 1.00 0.00 ? 10  HIS A ND1  3  
ATOM 4103  C CD2  . HIS A 1 10  ? -3.162  -1.109  -10.241 1.00 0.00 ? 10  HIS A CD2  3  
ATOM 4104  C CE1  . HIS A 1 10  ? -4.862  -2.301  -10.946 1.00 0.00 ? 10  HIS A CE1  3  
ATOM 4105  N NE2  . HIS A 1 10  ? -4.398  -1.069  -10.838 1.00 0.00 ? 10  HIS A NE2  3  
ATOM 4106  H H    . HIS A 1 10  ? -3.687  -3.410  -7.139  1.00 0.00 ? 10  HIS A H    3  
ATOM 4107  H HA   . HIS A 1 10  ? -0.803  -3.457  -7.446  1.00 0.00 ? 10  HIS A HA   3  
ATOM 4108  H HB2  . HIS A 1 10  ? -0.807  -2.514  -9.691  1.00 0.00 ? 10  HIS A HB2  3  
ATOM 4109  H HB3  . HIS A 1 10  ? -1.632  -4.070  -9.693  1.00 0.00 ? 10  HIS A HB3  3  
ATOM 4110  H HD1  . HIS A 1 10  ? -4.065  -4.103  -10.396 1.00 0.00 ? 10  HIS A HD1  3  
ATOM 4111  H HD2  . HIS A 1 10  ? -2.531  -0.260  -10.018 1.00 0.00 ? 10  HIS A HD2  3  
ATOM 4112  H HE1  . HIS A 1 10  ? -5.812  -2.582  -11.376 1.00 0.00 ? 10  HIS A HE1  3  
ATOM 4113  N N    . LEU A 1 11  ? -0.713  -0.880  -7.321  1.00 0.00 ? 11  LEU A N    3  
ATOM 4114  C CA   . LEU A 1 11  ? -0.688  0.506   -6.865  1.00 0.00 ? 11  LEU A CA   3  
ATOM 4115  C C    . LEU A 1 11  ? -0.569  1.465   -8.045  1.00 0.00 ? 11  LEU A C    3  
ATOM 4116  O O    . LEU A 1 11  ? 0.332   1.337   -8.875  1.00 0.00 ? 11  LEU A O    3  
ATOM 4117  C CB   . LEU A 1 11  ? 0.477   0.723   -5.897  1.00 0.00 ? 11  LEU A CB   3  
ATOM 4118  C CG   . LEU A 1 11  ? 0.269   0.212   -4.471  1.00 0.00 ? 11  LEU A CG   3  
ATOM 4119  C CD1  . LEU A 1 11  ? 1.567   0.285   -3.683  1.00 0.00 ? 11  LEU A CD1  3  
ATOM 4120  C CD2  . LEU A 1 11  ? -0.826  1.007   -3.775  1.00 0.00 ? 11  LEU A CD2  3  
ATOM 4121  H H    . LEU A 1 11  ? 0.117   -1.294  -7.635  1.00 0.00 ? 11  LEU A H    3  
ATOM 4122  H HA   . LEU A 1 11  ? -1.615  0.702   -6.349  1.00 0.00 ? 11  LEU A HA   3  
ATOM 4123  H HB2  . LEU A 1 11  ? 1.343   0.223   -6.304  1.00 0.00 ? 11  LEU A HB2  3  
ATOM 4124  H HB3  . LEU A 1 11  ? 0.668   1.785   -5.845  1.00 0.00 ? 11  LEU A HB3  3  
ATOM 4125  H HG   . LEU A 1 11  ? -0.041  -0.824  -4.508  1.00 0.00 ? 11  LEU A HG   3  
ATOM 4126  H HD11 . LEU A 1 11  ? 2.404   0.197   -4.359  1.00 0.00 ? 11  LEU A HD11 3  
ATOM 4127  H HD12 . LEU A 1 11  ? 1.598   -0.521  -2.965  1.00 0.00 ? 11  LEU A HD12 3  
ATOM 4128  H HD13 . LEU A 1 11  ? 1.620   1.231   -3.164  1.00 0.00 ? 11  LEU A HD13 3  
ATOM 4129  H HD21 . LEU A 1 11  ? -1.022  0.576   -2.804  1.00 0.00 ? 11  LEU A HD21 3  
ATOM 4130  H HD22 . LEU A 1 11  ? -1.726  0.978   -4.371  1.00 0.00 ? 11  LEU A HD22 3  
ATOM 4131  H HD23 . LEU A 1 11  ? -0.506  2.032   -3.656  1.00 0.00 ? 11  LEU A HD23 3  
ATOM 4132  N N    . VAL A 1 12  ? -1.483  2.428   -8.112  1.00 0.00 ? 12  VAL A N    3  
ATOM 4133  C CA   . VAL A 1 12  ? -1.479  3.412   -9.188  1.00 0.00 ? 12  VAL A CA   3  
ATOM 4134  C C    . VAL A 1 12  ? -0.834  4.717   -8.737  1.00 0.00 ? 12  VAL A C    3  
ATOM 4135  O O    . VAL A 1 12  ? -1.090  5.199   -7.635  1.00 0.00 ? 12  VAL A O    3  
ATOM 4136  C CB   . VAL A 1 12  ? -2.906  3.703   -9.688  1.00 0.00 ? 12  VAL A CB   3  
ATOM 4137  C CG1  . VAL A 1 12  ? -2.884  4.138   -11.145 1.00 0.00 ? 12  VAL A CG1  3  
ATOM 4138  C CG2  . VAL A 1 12  ? -3.795  2.483   -9.501  1.00 0.00 ? 12  VAL A CG2  3  
ATOM 4139  H H    . VAL A 1 12  ? -2.175  2.479   -7.421  1.00 0.00 ? 12  VAL A H    3  
ATOM 4140  H HA   . VAL A 1 12  ? -0.908  3.005   -10.011 1.00 0.00 ? 12  VAL A HA   3  
ATOM 4141  H HB   . VAL A 1 12  ? -3.313  4.512   -9.100  1.00 0.00 ? 12  VAL A HB   3  
ATOM 4142  H HG11 . VAL A 1 12  ? -2.396  3.379   -11.739 1.00 0.00 ? 12  VAL A HG11 3  
ATOM 4143  H HG12 . VAL A 1 12  ? -3.896  4.276   -11.496 1.00 0.00 ? 12  VAL A HG12 3  
ATOM 4144  H HG13 . VAL A 1 12  ? -2.342  5.068   -11.235 1.00 0.00 ? 12  VAL A HG13 3  
ATOM 4145  H HG21 . VAL A 1 12  ? -4.763  2.671   -9.939  1.00 0.00 ? 12  VAL A HG21 3  
ATOM 4146  H HG22 . VAL A 1 12  ? -3.341  1.630   -9.982  1.00 0.00 ? 12  VAL A HG22 3  
ATOM 4147  H HG23 . VAL A 1 12  ? -3.911  2.280   -8.446  1.00 0.00 ? 12  VAL A HG23 3  
ATOM 4148  N N    . ASN A 1 13  ? 0.005   5.286   -9.598  1.00 0.00 ? 13  ASN A N    3  
ATOM 4149  C CA   . ASN A 1 13  ? 0.687   6.537   -9.288  1.00 0.00 ? 13  ASN A CA   3  
ATOM 4150  C C    . ASN A 1 13  ? -0.213  7.734   -9.578  1.00 0.00 ? 13  ASN A C    3  
ATOM 4151  O O    . ASN A 1 13  ? -0.048  8.418   -10.588 1.00 0.00 ? 13  ASN A O    3  
ATOM 4152  C CB   . ASN A 1 13  ? 1.981   6.650   -10.096 1.00 0.00 ? 13  ASN A CB   3  
ATOM 4153  C CG   . ASN A 1 13  ? 3.022   7.509   -9.404  1.00 0.00 ? 13  ASN A CG   3  
ATOM 4154  O OD1  . ASN A 1 13  ? 2.687   8.444   -8.677  1.00 0.00 ? 13  ASN A OD1  3  
ATOM 4155  N ND2  . ASN A 1 13  ? 4.292   7.195   -9.629  1.00 0.00 ? 13  ASN A ND2  3  
ATOM 4156  H H    . ASN A 1 13  ? 0.168   4.853   -10.462 1.00 0.00 ? 13  ASN A H    3  
ATOM 4157  H HA   . ASN A 1 13  ? 0.930   6.530   -8.236  1.00 0.00 ? 13  ASN A HA   3  
ATOM 4158  H HB2  . ASN A 1 13  ? 2.396   5.662   -10.240 1.00 0.00 ? 13  ASN A HB2  3  
ATOM 4159  H HB3  . ASN A 1 13  ? 1.761   7.087   -11.058 1.00 0.00 ? 13  ASN A HB3  3  
ATOM 4160  H HD21 . ASN A 1 13  ? 4.485   6.437   -10.220 1.00 0.00 ? 13  ASN A HD21 3  
ATOM 4161  H HD22 . ASN A 1 13  ? 4.986   7.733   -9.194  1.00 0.00 ? 13  ASN A HD22 3  
ATOM 4162  N N    . LEU A 1 14  ? -1.165  7.981   -8.685  1.00 0.00 ? 14  LEU A N    3  
ATOM 4163  C CA   . LEU A 1 14  ? -2.092  9.097   -8.843  1.00 0.00 ? 14  LEU A CA   3  
ATOM 4164  C C    . LEU A 1 14  ? -1.419  10.418  -8.487  1.00 0.00 ? 14  LEU A C    3  
ATOM 4165  O O    . LEU A 1 14  ? -2.067  11.463  -8.439  1.00 0.00 ? 14  LEU A O    3  
ATOM 4166  C CB   . LEU A 1 14  ? -3.327  8.887   -7.966  1.00 0.00 ? 14  LEU A CB   3  
ATOM 4167  C CG   . LEU A 1 14  ? -3.075  8.803   -6.460  1.00 0.00 ? 14  LEU A CG   3  
ATOM 4168  C CD1  . LEU A 1 14  ? -4.319  9.214   -5.687  1.00 0.00 ? 14  LEU A CD1  3  
ATOM 4169  C CD2  . LEU A 1 14  ? -2.642  7.398   -6.070  1.00 0.00 ? 14  LEU A CD2  3  
ATOM 4170  H H    . LEU A 1 14  ? -1.247  7.401   -7.900  1.00 0.00 ? 14  LEU A H    3  
ATOM 4171  H HA   . LEU A 1 14  ? -2.396  9.129   -9.879  1.00 0.00 ? 14  LEU A HA   3  
ATOM 4172  H HB2  . LEU A 1 14  ? -4.002  9.711   -8.143  1.00 0.00 ? 14  LEU A HB2  3  
ATOM 4173  H HB3  . LEU A 1 14  ? -3.799  7.965   -8.276  1.00 0.00 ? 14  LEU A HB3  3  
ATOM 4174  H HG   . LEU A 1 14  ? -2.278  9.485   -6.197  1.00 0.00 ? 14  LEU A HG   3  
ATOM 4175  H HD11 . LEU A 1 14  ? -5.077  8.454   -5.795  1.00 0.00 ? 14  LEU A HD11 3  
ATOM 4176  H HD12 . LEU A 1 14  ? -4.690  10.151  -6.075  1.00 0.00 ? 14  LEU A HD12 3  
ATOM 4177  H HD13 . LEU A 1 14  ? -4.071  9.330   -4.642  1.00 0.00 ? 14  LEU A HD13 3  
ATOM 4178  H HD21 . LEU A 1 14  ? -2.742  6.741   -6.921  1.00 0.00 ? 14  LEU A HD21 3  
ATOM 4179  H HD22 . LEU A 1 14  ? -3.266  7.040   -5.263  1.00 0.00 ? 14  LEU A HD22 3  
ATOM 4180  H HD23 . LEU A 1 14  ? -1.611  7.416   -5.746  1.00 0.00 ? 14  LEU A HD23 3  
ATOM 4181  N N    . ASN A 1 15  ? -0.114  10.365  -8.240  1.00 0.00 ? 15  ASN A N    3  
ATOM 4182  C CA   . ASN A 1 15  ? 0.647   11.558  -7.889  1.00 0.00 ? 15  ASN A CA   3  
ATOM 4183  C C    . ASN A 1 15  ? 0.345   12.699  -8.856  1.00 0.00 ? 15  ASN A C    3  
ATOM 4184  O O    . ASN A 1 15  ? -0.413  12.532  -9.811  1.00 0.00 ? 15  ASN A O    3  
ATOM 4185  C CB   . ASN A 1 15  ? 2.146   11.253  -7.895  1.00 0.00 ? 15  ASN A CB   3  
ATOM 4186  C CG   . ASN A 1 15  ? 2.596   10.542  -6.634  1.00 0.00 ? 15  ASN A CG   3  
ATOM 4187  O OD1  . ASN A 1 15  ? 3.770   10.589  -6.267  1.00 0.00 ? 15  ASN A OD1  3  
ATOM 4188  N ND2  . ASN A 1 15  ? 1.662   9.878   -5.963  1.00 0.00 ? 15  ASN A ND2  3  
ATOM 4189  H H    . ASN A 1 15  ? 0.348   9.502   -8.293  1.00 0.00 ? 15  ASN A H    3  
ATOM 4190  H HA   . ASN A 1 15  ? 0.354   11.858  -6.894  1.00 0.00 ? 15  ASN A HA   3  
ATOM 4191  H HB2  . ASN A 1 15  ? 2.375   10.622  -8.742  1.00 0.00 ? 15  ASN A HB2  3  
ATOM 4192  H HB3  . ASN A 1 15  ? 2.696   12.178  -7.982  1.00 0.00 ? 15  ASN A HB3  3  
ATOM 4193  H HD21 . ASN A 1 15  ? 0.747   9.884   -6.315  1.00 0.00 ? 15  ASN A HD21 3  
ATOM 4194  H HD22 . ASN A 1 15  ? 1.925   9.410   -5.144  1.00 0.00 ? 15  ASN A HD22 3  
ATOM 4195  N N    . GLU A 1 16  ? 0.945   13.858  -8.602  1.00 0.00 ? 16  GLU A N    3  
ATOM 4196  C CA   . GLU A 1 16  ? 0.740   15.026  -9.450  1.00 0.00 ? 16  GLU A CA   3  
ATOM 4197  C C    . GLU A 1 16  ? 1.888   15.186  -10.442 1.00 0.00 ? 16  GLU A C    3  
ATOM 4198  O O    . GLU A 1 16  ? 1.969   16.184  -11.159 1.00 0.00 ? 16  GLU A O    3  
ATOM 4199  C CB   . GLU A 1 16  ? 0.610   16.288  -8.595  1.00 0.00 ? 16  GLU A CB   3  
ATOM 4200  C CG   . GLU A 1 16  ? 1.682   16.412  -7.525  1.00 0.00 ? 16  GLU A CG   3  
ATOM 4201  C CD   . GLU A 1 16  ? 1.893   17.844  -7.073  1.00 0.00 ? 16  GLU A CD   3  
ATOM 4202  O OE1  . GLU A 1 16  ? 1.741   18.759  -7.908  1.00 0.00 ? 16  GLU A OE1  3  
ATOM 4203  O OE2  . GLU A 1 16  ? 2.208   18.048  -5.882  1.00 0.00 ? 16  GLU A OE2  3  
ATOM 4204  H H    . GLU A 1 16  ? 1.539   13.929  -7.825  1.00 0.00 ? 16  GLU A H    3  
ATOM 4205  H HA   . GLU A 1 16  ? -0.177  14.880  -10.000 1.00 0.00 ? 16  GLU A HA   3  
ATOM 4206  H HB2  . GLU A 1 16  ? 0.672   17.153  -9.239  1.00 0.00 ? 16  GLU A HB2  3  
ATOM 4207  H HB3  . GLU A 1 16  ? -0.354  16.281  -8.109  1.00 0.00 ? 16  GLU A HB3  3  
ATOM 4208  H HG2  . GLU A 1 16  ? 1.390   15.820  -6.671  1.00 0.00 ? 16  GLU A HG2  3  
ATOM 4209  H HG3  . GLU A 1 16  ? 2.614   16.035  -7.922  1.00 0.00 ? 16  GLU A HG3  3  
ATOM 4210  N N    . ASP A 1 17  ? 2.774   14.197  -10.477 1.00 0.00 ? 17  ASP A N    3  
ATOM 4211  C CA   . ASP A 1 17  ? 3.918   14.227  -11.381 1.00 0.00 ? 17  ASP A CA   3  
ATOM 4212  C C    . ASP A 1 17  ? 3.735   13.232  -12.523 1.00 0.00 ? 17  ASP A C    3  
ATOM 4213  O O    . ASP A 1 17  ? 4.270   12.123  -12.504 1.00 0.00 ? 17  ASP A O    3  
ATOM 4214  C CB   . ASP A 1 17  ? 5.207   13.915  -10.618 1.00 0.00 ? 17  ASP A CB   3  
ATOM 4215  C CG   . ASP A 1 17  ? 5.754   15.126  -9.888  1.00 0.00 ? 17  ASP A CG   3  
ATOM 4216  O OD1  . ASP A 1 17  ? 5.075   16.174  -9.883  1.00 0.00 ? 17  ASP A OD1  3  
ATOM 4217  O OD2  . ASP A 1 17  ? 6.862   15.025  -9.320  1.00 0.00 ? 17  ASP A OD2  3  
ATOM 4218  H H    . ASP A 1 17  ? 2.656   13.428  -9.881  1.00 0.00 ? 17  ASP A H    3  
ATOM 4219  H HA   . ASP A 1 17  ? 3.988   15.222  -11.795 1.00 0.00 ? 17  ASP A HA   3  
ATOM 4220  H HB2  . ASP A 1 17  ? 5.009   13.140  -9.892  1.00 0.00 ? 17  ASP A HB2  3  
ATOM 4221  H HB3  . ASP A 1 17  ? 5.955   13.568  -11.315 1.00 0.00 ? 17  ASP A HB3  3  
ATOM 4222  N N    . PRO A 1 18  ? 2.960   13.635  -13.541 1.00 0.00 ? 18  PRO A N    3  
ATOM 4223  C CA   . PRO A 1 18  ? 2.687   12.793  -14.709 1.00 0.00 ? 18  PRO A CA   3  
ATOM 4224  C C    . PRO A 1 18  ? 3.918   12.608  -15.591 1.00 0.00 ? 18  PRO A C    3  
ATOM 4225  O O    . PRO A 1 18  ? 3.863   11.929  -16.617 1.00 0.00 ? 18  PRO A O    3  
ATOM 4226  C CB   . PRO A 1 18  ? 1.603   13.569  -15.461 1.00 0.00 ? 18  PRO A CB   3  
ATOM 4227  C CG   . PRO A 1 18  ? 1.799   14.988  -15.050 1.00 0.00 ? 18  PRO A CG   3  
ATOM 4228  C CD   . PRO A 1 18  ? 2.290   14.943  -13.629 1.00 0.00 ? 18  PRO A CD   3  
ATOM 4229  H HA   . PRO A 1 18  ? 2.305   11.825  -14.421 1.00 0.00 ? 18  PRO A HA   3  
ATOM 4230  H HB2  . PRO A 1 18  ? 1.739   13.443  -16.526 1.00 0.00 ? 18  PRO A HB2  3  
ATOM 4231  H HB3  . PRO A 1 18  ? 0.629   13.206  -15.171 1.00 0.00 ? 18  PRO A HB3  3  
ATOM 4232  H HG2  . PRO A 1 18  ? 2.535   15.456  -15.686 1.00 0.00 ? 18  PRO A HG2  3  
ATOM 4233  H HG3  . PRO A 1 18  ? 0.861   15.519  -15.105 1.00 0.00 ? 18  PRO A HG3  3  
ATOM 4234  H HD2  . PRO A 1 18  ? 2.988   15.747  -13.446 1.00 0.00 ? 18  PRO A HD2  3  
ATOM 4235  H HD3  . PRO A 1 18  ? 1.460   14.998  -12.941 1.00 0.00 ? 18  PRO A HD3  3  
ATOM 4236  N N    . LEU A 1 19  ? 5.027   13.216  -15.184 1.00 0.00 ? 19  LEU A N    3  
ATOM 4237  C CA   . LEU A 1 19  ? 6.273   13.118  -15.937 1.00 0.00 ? 19  LEU A CA   3  
ATOM 4238  C C    . LEU A 1 19  ? 7.221   12.112  -15.293 1.00 0.00 ? 19  LEU A C    3  
ATOM 4239  O O    . LEU A 1 19  ? 8.192   11.676  -15.911 1.00 0.00 ? 19  LEU A O    3  
ATOM 4240  C CB   . LEU A 1 19  ? 6.948   14.488  -16.024 1.00 0.00 ? 19  LEU A CB   3  
ATOM 4241  C CG   . LEU A 1 19  ? 6.012   15.691  -16.148 1.00 0.00 ? 19  LEU A CG   3  
ATOM 4242  C CD1  . LEU A 1 19  ? 6.785   16.989  -15.973 1.00 0.00 ? 19  LEU A CD1  3  
ATOM 4243  C CD2  . LEU A 1 19  ? 5.294   15.672  -17.489 1.00 0.00 ? 19  LEU A CD2  3  
ATOM 4244  H H    . LEU A 1 19  ? 5.009   13.743  -14.359 1.00 0.00 ? 19  LEU A H    3  
ATOM 4245  H HA   . LEU A 1 19  ? 6.032   12.781  -16.934 1.00 0.00 ? 19  LEU A HA   3  
ATOM 4246  H HB2  . LEU A 1 19  ? 7.541   14.621  -15.133 1.00 0.00 ? 19  LEU A HB2  3  
ATOM 4247  H HB3  . LEU A 1 19  ? 7.597   14.482  -16.888 1.00 0.00 ? 19  LEU A HB3  3  
ATOM 4248  H HG   . LEU A 1 19  ? 5.266   15.640  -15.367 1.00 0.00 ? 19  LEU A HG   3  
ATOM 4249  H HD11 . LEU A 1 19  ? 6.599   17.636  -16.817 1.00 0.00 ? 19  LEU A HD11 3  
ATOM 4250  H HD12 . LEU A 1 19  ? 7.842   16.773  -15.912 1.00 0.00 ? 19  LEU A HD12 3  
ATOM 4251  H HD13 . LEU A 1 19  ? 6.465   17.479  -15.065 1.00 0.00 ? 19  LEU A HD13 3  
ATOM 4252  H HD21 . LEU A 1 19  ? 4.840   16.636  -17.668 1.00 0.00 ? 19  LEU A HD21 3  
ATOM 4253  H HD22 . LEU A 1 19  ? 4.528   14.911  -17.476 1.00 0.00 ? 19  LEU A HD22 3  
ATOM 4254  H HD23 . LEU A 1 19  ? 6.003   15.456  -18.274 1.00 0.00 ? 19  LEU A HD23 3  
ATOM 4255  N N    . MET A 1 20  ? 6.930   11.745  -14.049 1.00 0.00 ? 20  MET A N    3  
ATOM 4256  C CA   . MET A 1 20  ? 7.755   10.787  -13.323 1.00 0.00 ? 20  MET A CA   3  
ATOM 4257  C C    . MET A 1 20  ? 8.320   9.730   -14.268 1.00 0.00 ? 20  MET A C    3  
ATOM 4258  O O    . MET A 1 20  ? 7.573   9.048   -14.969 1.00 0.00 ? 20  MET A O    3  
ATOM 4259  C CB   . MET A 1 20  ? 6.940   10.115  -12.217 1.00 0.00 ? 20  MET A CB   3  
ATOM 4260  C CG   . MET A 1 20  ? 5.745   9.330   -12.733 1.00 0.00 ? 20  MET A CG   3  
ATOM 4261  S SD   . MET A 1 20  ? 4.378   9.292   -11.558 1.00 0.00 ? 20  MET A SD   3  
ATOM 4262  C CE   . MET A 1 20  ? 3.067   8.634   -12.585 1.00 0.00 ? 20  MET A CE   3  
ATOM 4263  H H    . MET A 1 20  ? 6.143   12.127  -13.609 1.00 0.00 ? 20  MET A H    3  
ATOM 4264  H HA   . MET A 1 20  ? 8.575   11.328  -12.875 1.00 0.00 ? 20  MET A HA   3  
ATOM 4265  H HB2  . MET A 1 20  ? 7.581   9.436   -11.675 1.00 0.00 ? 20  MET A HB2  3  
ATOM 4266  H HB3  . MET A 1 20  ? 6.579   10.874  -11.540 1.00 0.00 ? 20  MET A HB3  3  
ATOM 4267  H HG2  . MET A 1 20  ? 5.400   9.787   -13.649 1.00 0.00 ? 20  MET A HG2  3  
ATOM 4268  H HG3  . MET A 1 20  ? 6.057   8.316   -12.935 1.00 0.00 ? 20  MET A HG3  3  
ATOM 4269  H HE1  . MET A 1 20  ? 3.123   7.555   -12.593 1.00 0.00 ? 20  MET A HE1  3  
ATOM 4270  H HE2  . MET A 1 20  ? 2.110   8.941   -12.188 1.00 0.00 ? 20  MET A HE2  3  
ATOM 4271  H HE3  . MET A 1 20  ? 3.176   9.008   -13.592 1.00 0.00 ? 20  MET A HE3  3  
ATOM 4272  N N    . SER A 1 21  ? 9.643   9.601   -14.281 1.00 0.00 ? 21  SER A N    3  
ATOM 4273  C CA   . SER A 1 21  ? 10.308  8.630   -15.142 1.00 0.00 ? 21  SER A CA   3  
ATOM 4274  C C    . SER A 1 21  ? 9.975   7.205   -14.713 1.00 0.00 ? 21  SER A C    3  
ATOM 4275  O O    . SER A 1 21  ? 10.281  6.245   -15.419 1.00 0.00 ? 21  SER A O    3  
ATOM 4276  C CB   . SER A 1 21  ? 11.822  8.843   -15.113 1.00 0.00 ? 21  SER A CB   3  
ATOM 4277  O OG   . SER A 1 21  ? 12.509  7.687   -15.560 1.00 0.00 ? 21  SER A OG   3  
ATOM 4278  H H    . SER A 1 21  ? 10.185  10.174  -13.699 1.00 0.00 ? 21  SER A H    3  
ATOM 4279  H HA   . SER A 1 21  ? 9.951   8.783   -16.150 1.00 0.00 ? 21  SER A HA   3  
ATOM 4280  H HB2  . SER A 1 21  ? 12.080  9.671   -15.756 1.00 0.00 ? 21  SER A HB2  3  
ATOM 4281  H HB3  . SER A 1 21  ? 12.132  9.063   -14.101 1.00 0.00 ? 21  SER A HB3  3  
ATOM 4282  H HG   . SER A 1 21  ? 13.452  7.865   -15.588 1.00 0.00 ? 21  SER A HG   3  
ATOM 4283  N N    . GLU A 1 22  ? 9.345   7.076   -13.549 1.00 0.00 ? 22  GLU A N    3  
ATOM 4284  C CA   . GLU A 1 22  ? 8.971   5.768   -13.025 1.00 0.00 ? 22  GLU A CA   3  
ATOM 4285  C C    . GLU A 1 22  ? 7.716   5.242   -13.717 1.00 0.00 ? 22  GLU A C    3  
ATOM 4286  O O    . GLU A 1 22  ? 7.117   5.930   -14.545 1.00 0.00 ? 22  GLU A O    3  
ATOM 4287  C CB   . GLU A 1 22  ? 8.737   5.847   -11.515 1.00 0.00 ? 22  GLU A CB   3  
ATOM 4288  C CG   . GLU A 1 22  ? 10.004  6.103   -10.716 1.00 0.00 ? 22  GLU A CG   3  
ATOM 4289  C CD   . GLU A 1 22  ? 11.136  5.171   -11.101 1.00 0.00 ? 22  GLU A CD   3  
ATOM 4290  O OE1  . GLU A 1 22  ? 10.878  3.961   -11.267 1.00 0.00 ? 22  GLU A OE1  3  
ATOM 4291  O OE2  . GLU A 1 22  ? 12.280  5.653   -11.238 1.00 0.00 ? 22  GLU A OE2  3  
ATOM 4292  H H    . GLU A 1 22  ? 9.127   7.879   -13.031 1.00 0.00 ? 22  GLU A H    3  
ATOM 4293  H HA   . GLU A 1 22  ? 9.786   5.087   -13.218 1.00 0.00 ? 22  GLU A HA   3  
ATOM 4294  H HB2  . GLU A 1 22  ? 8.040   6.646   -11.311 1.00 0.00 ? 22  GLU A HB2  3  
ATOM 4295  H HB3  . GLU A 1 22  ? 8.309   4.914   -11.180 1.00 0.00 ? 22  GLU A HB3  3  
ATOM 4296  H HG2  . GLU A 1 22  ? 10.322  7.121   -10.886 1.00 0.00 ? 22  GLU A HG2  3  
ATOM 4297  H HG3  . GLU A 1 22  ? 9.787   5.967   -9.666  1.00 0.00 ? 22  GLU A HG3  3  
ATOM 4298  N N    . CYS A 1 23  ? 7.326   4.020   -13.373 1.00 0.00 ? 23  CYS A N    3  
ATOM 4299  C CA   . CYS A 1 23  ? 6.144   3.401   -13.962 1.00 0.00 ? 23  CYS A CA   3  
ATOM 4300  C C    . CYS A 1 23  ? 4.870   4.062   -13.448 1.00 0.00 ? 23  CYS A C    3  
ATOM 4301  O O    . CYS A 1 23  ? 4.839   4.595   -12.337 1.00 0.00 ? 23  CYS A O    3  
ATOM 4302  C CB   . CYS A 1 23  ? 6.118   1.904   -13.650 1.00 0.00 ? 23  CYS A CB   3  
ATOM 4303  S SG   . CYS A 1 23  ? 4.722   1.021   -14.386 1.00 0.00 ? 23  CYS A SG   3  
ATOM 4304  H H    . CYS A 1 23  ? 7.845   3.521   -12.708 1.00 0.00 ? 23  CYS A H    3  
ATOM 4305  H HA   . CYS A 1 23  ? 6.198   3.536   -15.032 1.00 0.00 ? 23  CYS A HA   3  
ATOM 4306  H HB2  . CYS A 1 23  ? 7.025   1.450   -14.022 1.00 0.00 ? 23  CYS A HB2  3  
ATOM 4307  H HB3  . CYS A 1 23  ? 6.068   1.768   -12.580 1.00 0.00 ? 23  CYS A HB3  3  
ATOM 4308  H HG   . CYS A 1 23  ? 4.531   1.502   -15.604 1.00 0.00 ? 23  CYS A HG   3  
ATOM 4309  N N    . LEU A 1 24  ? 3.821   4.026   -14.261 1.00 0.00 ? 24  LEU A N    3  
ATOM 4310  C CA   . LEU A 1 24  ? 2.543   4.624   -13.889 1.00 0.00 ? 24  LEU A CA   3  
ATOM 4311  C C    . LEU A 1 24  ? 1.934   3.905   -12.690 1.00 0.00 ? 24  LEU A C    3  
ATOM 4312  O O    . LEU A 1 24  ? 1.345   4.533   -11.809 1.00 0.00 ? 24  LEU A O    3  
ATOM 4313  C CB   . LEU A 1 24  ? 1.573   4.579   -15.071 1.00 0.00 ? 24  LEU A CB   3  
ATOM 4314  C CG   . LEU A 1 24  ? 1.893   5.513   -16.238 1.00 0.00 ? 24  LEU A CG   3  
ATOM 4315  C CD1  . LEU A 1 24  ? 0.628   5.857   -17.010 1.00 0.00 ? 24  LEU A CD1  3  
ATOM 4316  C CD2  . LEU A 1 24  ? 2.574   6.778   -15.737 1.00 0.00 ? 24  LEU A CD2  3  
ATOM 4317  H H    . LEU A 1 24  ? 3.906   3.588   -15.133 1.00 0.00 ? 24  LEU A H    3  
ATOM 4318  H HA   . LEU A 1 24  ? 2.725   5.654   -13.622 1.00 0.00 ? 24  LEU A HA   3  
ATOM 4319  H HB2  . LEU A 1 24  ? 1.561   3.569   -15.451 1.00 0.00 ? 24  LEU A HB2  3  
ATOM 4320  H HB3  . LEU A 1 24  ? 0.590   4.834   -14.701 1.00 0.00 ? 24  LEU A HB3  3  
ATOM 4321  H HG   . LEU A 1 24  ? 2.571   5.013   -16.916 1.00 0.00 ? 24  LEU A HG   3  
ATOM 4322  H HD11 . LEU A 1 24  ? 0.221   6.785   -16.638 1.00 0.00 ? 24  LEU A HD11 3  
ATOM 4323  H HD12 . LEU A 1 24  ? -0.097  5.067   -16.880 1.00 0.00 ? 24  LEU A HD12 3  
ATOM 4324  H HD13 . LEU A 1 24  ? 0.864   5.961   -18.059 1.00 0.00 ? 24  LEU A HD13 3  
ATOM 4325  H HD21 . LEU A 1 24  ? 2.686   7.475   -16.554 1.00 0.00 ? 24  LEU A HD21 3  
ATOM 4326  H HD22 . LEU A 1 24  ? 3.548   6.530   -15.340 1.00 0.00 ? 24  LEU A HD22 3  
ATOM 4327  H HD23 . LEU A 1 24  ? 1.973   7.227   -14.959 1.00 0.00 ? 24  LEU A HD23 3  
ATOM 4328  N N    . LEU A 1 25  ? 2.083   2.585   -12.660 1.00 0.00 ? 25  LEU A N    3  
ATOM 4329  C CA   . LEU A 1 25  ? 1.550   1.780   -11.566 1.00 0.00 ? 25  LEU A CA   3  
ATOM 4330  C C    . LEU A 1 25  ? 2.450   0.581   -11.284 1.00 0.00 ? 25  LEU A C    3  
ATOM 4331  O O    . LEU A 1 25  ? 3.413   0.330   -12.009 1.00 0.00 ? 25  LEU A O    3  
ATOM 4332  C CB   . LEU A 1 25  ? 0.135   1.303   -11.901 1.00 0.00 ? 25  LEU A CB   3  
ATOM 4333  C CG   . LEU A 1 25  ? 0.034   -0.033  -12.638 1.00 0.00 ? 25  LEU A CG   3  
ATOM 4334  C CD1  . LEU A 1 25  ? -0.079  -1.182  -11.648 1.00 0.00 ? 25  LEU A CD1  3  
ATOM 4335  C CD2  . LEU A 1 25  ? -1.153  -0.028  -13.591 1.00 0.00 ? 25  LEU A CD2  3  
ATOM 4336  H H    . LEU A 1 25  ? 2.562   2.141   -13.390 1.00 0.00 ? 25  LEU A H    3  
ATOM 4337  H HA   . LEU A 1 25  ? 1.512   2.402   -10.685 1.00 0.00 ? 25  LEU A HA   3  
ATOM 4338  H HB2  . LEU A 1 25  ? -0.410  1.210   -10.974 1.00 0.00 ? 25  LEU A HB2  3  
ATOM 4339  H HB3  . LEU A 1 25  ? -0.331  2.058   -12.517 1.00 0.00 ? 25  LEU A HB3  3  
ATOM 4340  H HG   . LEU A 1 25  ? 0.932   -0.184  -13.222 1.00 0.00 ? 25  LEU A HG   3  
ATOM 4341  H HD11 . LEU A 1 25  ? 0.901   -1.595  -11.463 1.00 0.00 ? 25  LEU A HD11 3  
ATOM 4342  H HD12 . LEU A 1 25  ? -0.721  -1.948  -12.058 1.00 0.00 ? 25  LEU A HD12 3  
ATOM 4343  H HD13 . LEU A 1 25  ? -0.499  -0.819  -10.722 1.00 0.00 ? 25  LEU A HD13 3  
ATOM 4344  H HD21 . LEU A 1 25  ? -0.981  0.693   -14.376 1.00 0.00 ? 25  LEU A HD21 3  
ATOM 4345  H HD22 . LEU A 1 25  ? -2.048  0.237   -13.048 1.00 0.00 ? 25  LEU A HD22 3  
ATOM 4346  H HD23 . LEU A 1 25  ? -1.271  -1.011  -14.023 1.00 0.00 ? 25  LEU A HD23 3  
ATOM 4347  N N    . TYR A 1 26  ? 2.128   -0.158  -10.228 1.00 0.00 ? 26  TYR A N    3  
ATOM 4348  C CA   . TYR A 1 26  ? 2.907   -1.331  -9.850  1.00 0.00 ? 26  TYR A CA   3  
ATOM 4349  C C    . TYR A 1 26  ? 1.995   -2.507  -9.515  1.00 0.00 ? 26  TYR A C    3  
ATOM 4350  O O    . TYR A 1 26  ? 1.152   -2.418  -8.622  1.00 0.00 ? 26  TYR A O    3  
ATOM 4351  C CB   . TYR A 1 26  ? 3.803   -1.009  -8.653  1.00 0.00 ? 26  TYR A CB   3  
ATOM 4352  C CG   . TYR A 1 26  ? 4.987   -0.134  -8.999  1.00 0.00 ? 26  TYR A CG   3  
ATOM 4353  C CD1  . TYR A 1 26  ? 5.917   -0.535  -9.951  1.00 0.00 ? 26  TYR A CD1  3  
ATOM 4354  C CD2  . TYR A 1 26  ? 5.174   1.093   -8.376  1.00 0.00 ? 26  TYR A CD2  3  
ATOM 4355  C CE1  . TYR A 1 26  ? 7.000   0.261   -10.270 1.00 0.00 ? 26  TYR A CE1  3  
ATOM 4356  C CE2  . TYR A 1 26  ? 6.254   1.896   -8.690  1.00 0.00 ? 26  TYR A CE2  3  
ATOM 4357  C CZ   . TYR A 1 26  ? 7.164   1.476   -9.637  1.00 0.00 ? 26  TYR A CZ   3  
ATOM 4358  O OH   . TYR A 1 26  ? 8.241   2.272   -9.953  1.00 0.00 ? 26  TYR A OH   3  
ATOM 4359  H H    . TYR A 1 26  ? 1.349   0.092   -9.689  1.00 0.00 ? 26  TYR A H    3  
ATOM 4360  H HA   . TYR A 1 26  ? 3.530   -1.601  -10.691 1.00 0.00 ? 26  TYR A HA   3  
ATOM 4361  H HB2  . TYR A 1 26  ? 3.221   -0.496  -7.903  1.00 0.00 ? 26  TYR A HB2  3  
ATOM 4362  H HB3  . TYR A 1 26  ? 4.183   -1.932  -8.238  1.00 0.00 ? 26  TYR A HB3  3  
ATOM 4363  H HD1  . TYR A 1 26  ? 5.785   -1.487  -10.445 1.00 0.00 ? 26  TYR A HD1  3  
ATOM 4364  H HD2  . TYR A 1 26  ? 4.460   1.420   -7.634  1.00 0.00 ? 26  TYR A HD2  3  
ATOM 4365  H HE1  . TYR A 1 26  ? 7.712   -0.068  -11.012 1.00 0.00 ? 26  TYR A HE1  3  
ATOM 4366  H HE2  . TYR A 1 26  ? 6.383   2.847   -8.195  1.00 0.00 ? 26  TYR A HE2  3  
ATOM 4367  H HH   . TYR A 1 26  ? 8.989   2.033   -9.401  1.00 0.00 ? 26  TYR A HH   3  
ATOM 4368  N N    . TYR A 1 27  ? 2.170   -3.607  -10.238 1.00 0.00 ? 27  TYR A N    3  
ATOM 4369  C CA   . TYR A 1 27  ? 1.362   -4.801  -10.021 1.00 0.00 ? 27  TYR A CA   3  
ATOM 4370  C C    . TYR A 1 27  ? 1.896   -5.614  -8.845  1.00 0.00 ? 27  TYR A C    3  
ATOM 4371  O O    . TYR A 1 27  ? 2.984   -6.187  -8.916  1.00 0.00 ? 27  TYR A O    3  
ATOM 4372  C CB   . TYR A 1 27  ? 1.339   -5.664  -11.283 1.00 0.00 ? 27  TYR A CB   3  
ATOM 4373  C CG   . TYR A 1 27  ? 0.277   -5.254  -12.278 1.00 0.00 ? 27  TYR A CG   3  
ATOM 4374  C CD1  . TYR A 1 27  ? -1.051  -5.618  -12.097 1.00 0.00 ? 27  TYR A CD1  3  
ATOM 4375  C CD2  . TYR A 1 27  ? 0.603   -4.501  -13.400 1.00 0.00 ? 27  TYR A CD2  3  
ATOM 4376  C CE1  . TYR A 1 27  ? -2.024  -5.245  -13.004 1.00 0.00 ? 27  TYR A CE1  3  
ATOM 4377  C CE2  . TYR A 1 27  ? -0.364  -4.123  -14.312 1.00 0.00 ? 27  TYR A CE2  3  
ATOM 4378  C CZ   . TYR A 1 27  ? -1.676  -4.498  -14.109 1.00 0.00 ? 27  TYR A CZ   3  
ATOM 4379  O OH   . TYR A 1 27  ? -2.643  -4.124  -15.014 1.00 0.00 ? 27  TYR A OH   3  
ATOM 4380  H H    . TYR A 1 27  ? 2.858   -3.617  -10.936 1.00 0.00 ? 27  TYR A H    3  
ATOM 4381  H HA   . TYR A 1 27  ? 0.354   -4.483  -9.796  1.00 0.00 ? 27  TYR A HA   3  
ATOM 4382  H HB2  . TYR A 1 27  ? 2.297   -5.596  -11.775 1.00 0.00 ? 27  TYR A HB2  3  
ATOM 4383  H HB3  . TYR A 1 27  ? 1.155   -6.692  -11.006 1.00 0.00 ? 27  TYR A HB3  3  
ATOM 4384  H HD1  . TYR A 1 27  ? -1.320  -6.203  -11.229 1.00 0.00 ? 27  TYR A HD1  3  
ATOM 4385  H HD2  . TYR A 1 27  ? 1.631   -4.209  -13.556 1.00 0.00 ? 27  TYR A HD2  3  
ATOM 4386  H HE1  . TYR A 1 27  ? -3.052  -5.538  -12.845 1.00 0.00 ? 27  TYR A HE1  3  
ATOM 4387  H HE2  . TYR A 1 27  ? -0.092  -3.538  -15.178 1.00 0.00 ? 27  TYR A HE2  3  
ATOM 4388  H HH   . TYR A 1 27  ? -2.417  -3.269  -15.389 1.00 0.00 ? 27  TYR A HH   3  
ATOM 4389  N N    . ILE A 1 28  ? 1.123   -5.658  -7.766  1.00 0.00 ? 28  ILE A N    3  
ATOM 4390  C CA   . ILE A 1 28  ? 1.517   -6.402  -6.575  1.00 0.00 ? 28  ILE A CA   3  
ATOM 4391  C C    . ILE A 1 28  ? 1.218   -7.889  -6.732  1.00 0.00 ? 28  ILE A C    3  
ATOM 4392  O O    . ILE A 1 28  ? 0.069   -8.285  -6.930  1.00 0.00 ? 28  ILE A O    3  
ATOM 4393  C CB   . ILE A 1 28  ? 0.798   -5.874  -5.319  1.00 0.00 ? 28  ILE A CB   3  
ATOM 4394  C CG1  . ILE A 1 28  ? 1.207   -4.426  -5.041  1.00 0.00 ? 28  ILE A CG1  3  
ATOM 4395  C CG2  . ILE A 1 28  ? 1.111   -6.757  -4.120  1.00 0.00 ? 28  ILE A CG2  3  
ATOM 4396  C CD1  . ILE A 1 28  ? 0.849   -3.954  -3.650  1.00 0.00 ? 28  ILE A CD1  3  
ATOM 4397  H H    . ILE A 1 28  ? 0.268   -5.181  -7.770  1.00 0.00 ? 28  ILE A H    3  
ATOM 4398  H HA   . ILE A 1 28  ? 2.581   -6.272  -6.438  1.00 0.00 ? 28  ILE A HA   3  
ATOM 4399  H HB   . ILE A 1 28  ? -0.265  -5.913  -5.497  1.00 0.00 ? 28  ILE A HB   3  
ATOM 4400  H HG12 . ILE A 1 28  ? 2.274   -4.331  -5.160  1.00 0.00 ? 28  ILE A HG12 3  
ATOM 4401  H HG13 . ILE A 1 28  ? 0.711   -3.778  -5.750  1.00 0.00 ? 28  ILE A HG13 3  
ATOM 4402  H HG21 . ILE A 1 28  ? 1.682   -7.615  -4.444  1.00 0.00 ? 28  ILE A HG21 3  
ATOM 4403  H HG22 . ILE A 1 28  ? 1.685   -6.195  -3.399  1.00 0.00 ? 28  ILE A HG22 3  
ATOM 4404  H HG23 . ILE A 1 28  ? 0.189   -7.089  -3.667  1.00 0.00 ? 28  ILE A HG23 3  
ATOM 4405  H HD11 . ILE A 1 28  ? 0.244   -4.703  -3.159  1.00 0.00 ? 28  ILE A HD11 3  
ATOM 4406  H HD12 . ILE A 1 28  ? 1.753   -3.793  -3.080  1.00 0.00 ? 28  ILE A HD12 3  
ATOM 4407  H HD13 . ILE A 1 28  ? 0.294   -3.030  -3.714  1.00 0.00 ? 28  ILE A HD13 3  
ATOM 4408  N N    . LYS A 1 29  ? 2.259   -8.709  -6.639  1.00 0.00 ? 29  LYS A N    3  
ATOM 4409  C CA   . LYS A 1 29  ? 2.109   -10.154 -6.767  1.00 0.00 ? 29  LYS A CA   3  
ATOM 4410  C C    . LYS A 1 29  ? 1.581   -10.763 -5.472  1.00 0.00 ? 29  LYS A C    3  
ATOM 4411  O O    . LYS A 1 29  ? 1.417   -10.067 -4.470  1.00 0.00 ? 29  LYS A O    3  
ATOM 4412  C CB   . LYS A 1 29  ? 3.449   -10.795 -7.136  1.00 0.00 ? 29  LYS A CB   3  
ATOM 4413  C CG   . LYS A 1 29  ? 4.629   -10.222 -6.370  1.00 0.00 ? 29  LYS A CG   3  
ATOM 4414  C CD   . LYS A 1 29  ? 4.344   -10.149 -4.879  1.00 0.00 ? 29  LYS A CD   3  
ATOM 4415  C CE   . LYS A 1 29  ? 5.609   -9.866  -4.084  1.00 0.00 ? 29  LYS A CE   3  
ATOM 4416  N NZ   . LYS A 1 29  ? 5.307   -9.236  -2.768  1.00 0.00 ? 29  LYS A NZ   3  
ATOM 4417  H H    . LYS A 1 29  ? 3.150   -8.333  -6.480  1.00 0.00 ? 29  LYS A H    3  
ATOM 4418  H HA   . LYS A 1 29  ? 1.398   -10.345 -7.557  1.00 0.00 ? 29  LYS A HA   3  
ATOM 4419  H HB2  . LYS A 1 29  ? 3.395   -11.855 -6.932  1.00 0.00 ? 29  LYS A HB2  3  
ATOM 4420  H HB3  . LYS A 1 29  ? 3.626   -10.649 -8.191  1.00 0.00 ? 29  LYS A HB3  3  
ATOM 4421  H HG2  . LYS A 1 29  ? 5.491   -10.852 -6.530  1.00 0.00 ? 29  LYS A HG2  3  
ATOM 4422  H HG3  . LYS A 1 29  ? 4.835   -9.227  -6.737  1.00 0.00 ? 29  LYS A HG3  3  
ATOM 4423  H HD2  . LYS A 1 29  ? 3.632   -9.358  -4.696  1.00 0.00 ? 29  LYS A HD2  3  
ATOM 4424  H HD3  . LYS A 1 29  ? 3.928   -11.092 -4.554  1.00 0.00 ? 29  LYS A HD3  3  
ATOM 4425  H HE2  . LYS A 1 29  ? 6.129   -10.796 -3.917  1.00 0.00 ? 29  LYS A HE2  3  
ATOM 4426  H HE3  . LYS A 1 29  ? 6.237   -9.200  -4.656  1.00 0.00 ? 29  LYS A HE3  3  
ATOM 4427  H HZ1  . LYS A 1 29  ? 6.102   -8.637  -2.468  1.00 0.00 ? 29  LYS A HZ1  3  
ATOM 4428  H HZ2  . LYS A 1 29  ? 5.149   -9.971  -2.049  1.00 0.00 ? 29  LYS A HZ2  3  
ATOM 4429  H HZ3  . LYS A 1 29  ? 4.453   -8.649  -2.841  1.00 0.00 ? 29  LYS A HZ3  3  
ATOM 4430  N N    . ASP A 1 30  ? 1.318   -12.064 -5.500  1.00 0.00 ? 30  ASP A N    3  
ATOM 4431  C CA   . ASP A 1 30  ? 0.810   -12.767 -4.328  1.00 0.00 ? 30  ASP A CA   3  
ATOM 4432  C C    . ASP A 1 30  ? 1.933   -13.046 -3.333  1.00 0.00 ? 30  ASP A C    3  
ATOM 4433  O O    . ASP A 1 30  ? 2.636   -14.050 -3.441  1.00 0.00 ? 30  ASP A O    3  
ATOM 4434  C CB   . ASP A 1 30  ? 0.142   -14.079 -4.742  1.00 0.00 ? 30  ASP A CB   3  
ATOM 4435  C CG   . ASP A 1 30  ? -1.284  -13.878 -5.215  1.00 0.00 ? 30  ASP A CG   3  
ATOM 4436  O OD1  . ASP A 1 30  ? -1.593  -12.778 -5.720  1.00 0.00 ? 30  ASP A OD1  3  
ATOM 4437  O OD2  . ASP A 1 30  ? -2.092  -14.821 -5.082  1.00 0.00 ? 30  ASP A OD2  3  
ATOM 4438  H H    . ASP A 1 30  ? 1.469   -12.565 -6.330  1.00 0.00 ? 30  ASP A H    3  
ATOM 4439  H HA   . ASP A 1 30  ? 0.076   -12.134 -3.853  1.00 0.00 ? 30  ASP A HA   3  
ATOM 4440  H HB2  . ASP A 1 30  ? 0.709   -14.526 -5.547  1.00 0.00 ? 30  ASP A HB2  3  
ATOM 4441  H HB3  . ASP A 1 30  ? 0.131   -14.753 -3.898  1.00 0.00 ? 30  ASP A HB3  3  
ATOM 4442  N N    . GLY A 1 31  ? 2.096   -12.150 -2.365  1.00 0.00 ? 31  GLY A N    3  
ATOM 4443  C CA   . GLY A 1 31  ? 3.136   -12.317 -1.367  1.00 0.00 ? 31  GLY A CA   3  
ATOM 4444  C C    . GLY A 1 31  ? 3.286   -11.099 -0.476  1.00 0.00 ? 31  GLY A C    3  
ATOM 4445  O O    . GLY A 1 31  ? 2.293   -10.495 -0.068  1.00 0.00 ? 31  GLY A O    3  
ATOM 4446  H H    . GLY A 1 31  ? 1.506   -11.368 -2.329  1.00 0.00 ? 31  GLY A H    3  
ATOM 4447  H HA2  . GLY A 1 31  ? 2.896   -13.172 -0.753  1.00 0.00 ? 31  GLY A HA2  3  
ATOM 4448  H HA3  . GLY A 1 31  ? 4.075   -12.499 -1.869  1.00 0.00 ? 31  GLY A HA3  3  
ATOM 4449  N N    . ILE A 1 32  ? 4.528   -10.739 -0.173  1.00 0.00 ? 32  ILE A N    3  
ATOM 4450  C CA   . ILE A 1 32  ? 4.803   -9.586  0.676   1.00 0.00 ? 32  ILE A CA   3  
ATOM 4451  C C    . ILE A 1 32  ? 5.642   -8.548  -0.062  1.00 0.00 ? 32  ILE A C    3  
ATOM 4452  O O    . ILE A 1 32  ? 6.852   -8.711  -0.221  1.00 0.00 ? 32  ILE A O    3  
ATOM 4453  C CB   . ILE A 1 32  ? 5.536   -9.999  1.966   1.00 0.00 ? 32  ILE A CB   3  
ATOM 4454  C CG1  . ILE A 1 32  ? 4.570   -10.694 2.927   1.00 0.00 ? 32  ILE A CG1  3  
ATOM 4455  C CG2  . ILE A 1 32  ? 6.168   -8.784  2.628   1.00 0.00 ? 32  ILE A CG2  3  
ATOM 4456  C CD1  . ILE A 1 32  ? 4.450   -12.183 2.692   1.00 0.00 ? 32  ILE A CD1  3  
ATOM 4457  H H    . ILE A 1 32  ? 5.277   -11.261 -0.529  1.00 0.00 ? 32  ILE A H    3  
ATOM 4458  H HA   . ILE A 1 32  ? 3.858   -9.141  0.949   1.00 0.00 ? 32  ILE A HA   3  
ATOM 4459  H HB   . ILE A 1 32  ? 6.325   -10.686 1.701   1.00 0.00 ? 32  ILE A HB   3  
ATOM 4460  H HG12 . ILE A 1 32  ? 4.909   -10.545 3.940   1.00 0.00 ? 32  ILE A HG12 3  
ATOM 4461  H HG13 . ILE A 1 32  ? 3.587   -10.259 2.814   1.00 0.00 ? 32  ILE A HG13 3  
ATOM 4462  H HG21 . ILE A 1 32  ? 7.231   -8.782  2.437   1.00 0.00 ? 32  ILE A HG21 3  
ATOM 4463  H HG22 . ILE A 1 32  ? 5.729   -7.885  2.222   1.00 0.00 ? 32  ILE A HG22 3  
ATOM 4464  H HG23 . ILE A 1 32  ? 5.993   -8.822  3.693   1.00 0.00 ? 32  ILE A HG23 3  
ATOM 4465  H HD11 . ILE A 1 32  ? 3.539   -12.390 2.149   1.00 0.00 ? 32  ILE A HD11 3  
ATOM 4466  H HD12 . ILE A 1 32  ? 5.297   -12.527 2.116   1.00 0.00 ? 32  ILE A HD12 3  
ATOM 4467  H HD13 . ILE A 1 32  ? 4.426   -12.698 3.641   1.00 0.00 ? 32  ILE A HD13 3  
ATOM 4468  N N    . THR A 1 33  ? 4.991   -7.479  -0.510  1.00 0.00 ? 33  THR A N    3  
ATOM 4469  C CA   . THR A 1 33  ? 5.676   -6.414  -1.231  1.00 0.00 ? 33  THR A CA   3  
ATOM 4470  C C    . THR A 1 33  ? 6.086   -5.288  -0.288  1.00 0.00 ? 33  THR A C    3  
ATOM 4471  O O    . THR A 1 33  ? 5.300   -4.384  -0.006  1.00 0.00 ? 33  THR A O    3  
ATOM 4472  C CB   . THR A 1 33  ? 4.791   -5.833  -2.350  1.00 0.00 ? 33  THR A CB   3  
ATOM 4473  O OG1  . THR A 1 33  ? 4.636   -6.795  -3.400  1.00 0.00 ? 33  THR A OG1  3  
ATOM 4474  C CG2  . THR A 1 33  ? 5.397   -4.556  -2.912  1.00 0.00 ? 33  THR A CG2  3  
ATOM 4475  H H    . THR A 1 33  ? 4.027   -7.407  -0.352  1.00 0.00 ? 33  THR A H    3  
ATOM 4476  H HA   . THR A 1 33  ? 6.563   -6.833  -1.683  1.00 0.00 ? 33  THR A HA   3  
ATOM 4477  H HB   . THR A 1 33  ? 3.820   -5.602  -1.937  1.00 0.00 ? 33  THR A HB   3  
ATOM 4478  H HG1  . THR A 1 33  ? 4.430   -6.342  -4.221  1.00 0.00 ? 33  THR A HG1  3  
ATOM 4479  H HG21 . THR A 1 33  ? 4.764   -3.718  -2.662  1.00 0.00 ? 33  THR A HG21 3  
ATOM 4480  H HG22 . THR A 1 33  ? 5.479   -4.638  -3.985  1.00 0.00 ? 33  THR A HG22 3  
ATOM 4481  H HG23 . THR A 1 33  ? 6.378   -4.406  -2.486  1.00 0.00 ? 33  THR A HG23 3  
ATOM 4482  N N    . ARG A 1 34  ? 7.323   -5.349  0.196   1.00 0.00 ? 34  ARG A N    3  
ATOM 4483  C CA   . ARG A 1 34  ? 7.837   -4.335  1.108   1.00 0.00 ? 34  ARG A CA   3  
ATOM 4484  C C    . ARG A 1 34  ? 7.906   -2.973  0.423   1.00 0.00 ? 34  ARG A C    3  
ATOM 4485  O O    . ARG A 1 34  ? 8.186   -2.881  -0.772  1.00 0.00 ? 34  ARG A O    3  
ATOM 4486  C CB   . ARG A 1 34  ? 9.223   -4.732  1.618   1.00 0.00 ? 34  ARG A CB   3  
ATOM 4487  C CG   . ARG A 1 34  ? 9.198   -5.859  2.637   1.00 0.00 ? 34  ARG A CG   3  
ATOM 4488  C CD   . ARG A 1 34  ? 10.534  -5.998  3.349   1.00 0.00 ? 34  ARG A CD   3  
ATOM 4489  N NE   . ARG A 1 34  ? 10.539  -7.111  4.294   1.00 0.00 ? 34  ARG A NE   3  
ATOM 4490  C CZ   . ARG A 1 34  ? 11.529  -7.347  5.147   1.00 0.00 ? 34  ARG A CZ   3  
ATOM 4491  N NH1  . ARG A 1 34  ? 12.590  -6.552  5.173   1.00 0.00 ? 34  ARG A NH1  3  
ATOM 4492  N NH2  . ARG A 1 34  ? 11.460  -8.380  5.976   1.00 0.00 ? 34  ARG A NH2  3  
ATOM 4493  H H    . ARG A 1 34  ? 7.903   -6.095  -0.065  1.00 0.00 ? 34  ARG A H    3  
ATOM 4494  H HA   . ARG A 1 34  ? 7.160   -4.269  1.947   1.00 0.00 ? 34  ARG A HA   3  
ATOM 4495  H HB2  . ARG A 1 34  ? 9.826   -5.049  0.779   1.00 0.00 ? 34  ARG A HB2  3  
ATOM 4496  H HB3  . ARG A 1 34  ? 9.685   -3.871  2.077   1.00 0.00 ? 34  ARG A HB3  3  
ATOM 4497  H HG2  . ARG A 1 34  ? 8.432   -5.651  3.371   1.00 0.00 ? 34  ARG A HG2  3  
ATOM 4498  H HG3  . ARG A 1 34  ? 8.971   -6.785  2.130   1.00 0.00 ? 34  ARG A HG3  3  
ATOM 4499  H HD2  . ARG A 1 34  ? 11.305  -6.162  2.610   1.00 0.00 ? 34  ARG A HD2  3  
ATOM 4500  H HD3  . ARG A 1 34  ? 10.739  -5.082  3.883   1.00 0.00 ? 34  ARG A HD3  3  
ATOM 4501  H HE   . ARG A 1 34  ? 9.765   -7.711  4.292   1.00 0.00 ? 34  ARG A HE   3  
ATOM 4502  H HH11 . ARG A 1 34  ? 12.644  -5.772  4.550   1.00 0.00 ? 34  ARG A HH11 3  
ATOM 4503  H HH12 . ARG A 1 34  ? 13.334  -6.731  5.817   1.00 0.00 ? 34  ARG A HH12 3  
ATOM 4504  H HH21 . ARG A 1 34  ? 10.662  -8.982  5.960   1.00 0.00 ? 34  ARG A HH21 3  
ATOM 4505  H HH22 . ARG A 1 34  ? 12.206  -8.557  6.618   1.00 0.00 ? 34  ARG A HH22 3  
ATOM 4506  N N    . VAL A 1 35  ? 7.648   -1.917  1.189   1.00 0.00 ? 35  VAL A N    3  
ATOM 4507  C CA   . VAL A 1 35  ? 7.682   -0.560  0.656   1.00 0.00 ? 35  VAL A CA   3  
ATOM 4508  C C    . VAL A 1 35  ? 8.743   0.279   1.358   1.00 0.00 ? 35  VAL A C    3  
ATOM 4509  O O    . VAL A 1 35  ? 8.590   0.645   2.523   1.00 0.00 ? 35  VAL A O    3  
ATOM 4510  C CB   . VAL A 1 35  ? 6.315   0.134   0.802   1.00 0.00 ? 35  VAL A CB   3  
ATOM 4511  C CG1  . VAL A 1 35  ? 6.257   1.386   -0.059  1.00 0.00 ? 35  VAL A CG1  3  
ATOM 4512  C CG2  . VAL A 1 35  ? 5.190   -0.825  0.440   1.00 0.00 ? 35  VAL A CG2  3  
ATOM 4513  H H    . VAL A 1 35  ? 7.431   -2.054  2.134   1.00 0.00 ? 35  VAL A H    3  
ATOM 4514  H HA   . VAL A 1 35  ? 7.922   -0.620  -0.395  1.00 0.00 ? 35  VAL A HA   3  
ATOM 4515  H HB   . VAL A 1 35  ? 6.191   0.427   1.834   1.00 0.00 ? 35  VAL A HB   3  
ATOM 4516  H HG11 . VAL A 1 35  ? 5.226   1.627   -0.275  1.00 0.00 ? 35  VAL A HG11 3  
ATOM 4517  H HG12 . VAL A 1 35  ? 6.717   2.208   0.469   1.00 0.00 ? 35  VAL A HG12 3  
ATOM 4518  H HG13 . VAL A 1 35  ? 6.786   1.211   -0.985  1.00 0.00 ? 35  VAL A HG13 3  
ATOM 4519  H HG21 . VAL A 1 35  ? 4.271   -0.492  0.899   1.00 0.00 ? 35  VAL A HG21 3  
ATOM 4520  H HG22 . VAL A 1 35  ? 5.070   -0.849  -0.632  1.00 0.00 ? 35  VAL A HG22 3  
ATOM 4521  H HG23 . VAL A 1 35  ? 5.432   -1.816  0.797   1.00 0.00 ? 35  VAL A HG23 3  
ATOM 4522  N N    . GLY A 1 36  ? 9.820   0.583   0.641   1.00 0.00 ? 36  GLY A N    3  
ATOM 4523  C CA   . GLY A 1 36  ? 10.892  1.378   1.211   1.00 0.00 ? 36  GLY A CA   3  
ATOM 4524  C C    . GLY A 1 36  ? 11.946  1.751   0.187   1.00 0.00 ? 36  GLY A C    3  
ATOM 4525  O O    . GLY A 1 36  ? 11.629  1.997   -0.976  1.00 0.00 ? 36  GLY A O    3  
ATOM 4526  H H    . GLY A 1 36  ? 9.888   0.264   -0.284  1.00 0.00 ? 36  GLY A H    3  
ATOM 4527  H HA2  . GLY A 1 36  ? 10.473  2.282   1.626   1.00 0.00 ? 36  GLY A HA2  3  
ATOM 4528  H HA3  . GLY A 1 36  ? 11.361  0.814   2.004   1.00 0.00 ? 36  GLY A HA3  3  
ATOM 4529  N N    . GLN A 1 37  ? 13.201  1.794   0.621   1.00 0.00 ? 37  GLN A N    3  
ATOM 4530  C CA   . GLN A 1 37  ? 14.304  2.142   -0.267  1.00 0.00 ? 37  GLN A CA   3  
ATOM 4531  C C    . GLN A 1 37  ? 15.015  0.889   -0.769  1.00 0.00 ? 37  GLN A C    3  
ATOM 4532  O O    . GLN A 1 37  ? 14.889  -0.185  -0.182  1.00 0.00 ? 37  GLN A O    3  
ATOM 4533  C CB   . GLN A 1 37  ? 15.299  3.053   0.454   1.00 0.00 ? 37  GLN A CB   3  
ATOM 4534  C CG   . GLN A 1 37  ? 14.644  4.225   1.168   1.00 0.00 ? 37  GLN A CG   3  
ATOM 4535  C CD   . GLN A 1 37  ? 15.640  5.070   1.937   1.00 0.00 ? 37  GLN A CD   3  
ATOM 4536  O OE1  . GLN A 1 37  ? 16.824  4.739   2.014   1.00 0.00 ? 37  GLN A OE1  3  
ATOM 4537  N NE2  . GLN A 1 37  ? 15.165  6.168   2.513   1.00 0.00 ? 37  GLN A NE2  3  
ATOM 4538  H H    . GLN A 1 37  ? 13.390  1.587   1.559   1.00 0.00 ? 37  GLN A H    3  
ATOM 4539  H HA   . GLN A 1 37  ? 13.894  2.671   -1.113  1.00 0.00 ? 37  GLN A HA   3  
ATOM 4540  H HB2  . GLN A 1 37  ? 15.839  2.470   1.185   1.00 0.00 ? 37  GLN A HB2  3  
ATOM 4541  H HB3  . GLN A 1 37  ? 15.999  3.446   -0.269  1.00 0.00 ? 37  GLN A HB3  3  
ATOM 4542  H HG2  . GLN A 1 37  ? 14.157  4.850   0.434   1.00 0.00 ? 37  GLN A HG2  3  
ATOM 4543  H HG3  . GLN A 1 37  ? 13.908  3.842   1.859   1.00 0.00 ? 37  GLN A HG3  3  
ATOM 4544  H HE21 . GLN A 1 37  ? 14.211  6.368   2.411   1.00 0.00 ? 37  GLN A HE21 3  
ATOM 4545  H HE22 . GLN A 1 37  ? 15.786  6.732   3.017   1.00 0.00 ? 37  GLN A HE22 3  
ATOM 4546  N N    . ALA A 1 38  ? 15.762  1.035   -1.858  1.00 0.00 ? 38  ALA A N    3  
ATOM 4547  C CA   . ALA A 1 38  ? 16.494  -0.084  -2.438  1.00 0.00 ? 38  ALA A CA   3  
ATOM 4548  C C    . ALA A 1 38  ? 17.661  -0.497  -1.547  1.00 0.00 ? 38  ALA A C    3  
ATOM 4549  O O    . ALA A 1 38  ? 17.948  -1.684  -1.395  1.00 0.00 ? 38  ALA A O    3  
ATOM 4550  C CB   . ALA A 1 38  ? 16.992  0.275   -3.830  1.00 0.00 ? 38  ALA A CB   3  
ATOM 4551  H H    . ALA A 1 38  ? 15.823  1.917   -2.281  1.00 0.00 ? 38  ALA A H    3  
ATOM 4552  H HA   . ALA A 1 38  ? 15.812  -0.917  -2.530  1.00 0.00 ? 38  ALA A HA   3  
ATOM 4553  H HB1  . ALA A 1 38  ? 17.779  1.010   -3.752  1.00 0.00 ? 38  ALA A HB1  3  
ATOM 4554  H HB2  . ALA A 1 38  ? 17.374  -0.611  -4.315  1.00 0.00 ? 38  ALA A HB2  3  
ATOM 4555  H HB3  . ALA A 1 38  ? 16.176  0.681   -4.410  1.00 0.00 ? 38  ALA A HB3  3  
ATOM 4556  N N    . ASP A 1 39  ? 18.331  0.490   -0.962  1.00 0.00 ? 39  ASP A N    3  
ATOM 4557  C CA   . ASP A 1 39  ? 19.467  0.229   -0.086  1.00 0.00 ? 39  ASP A CA   3  
ATOM 4558  C C    . ASP A 1 39  ? 19.031  -0.550  1.151   1.00 0.00 ? 39  ASP A C    3  
ATOM 4559  O O    . ASP A 1 39  ? 19.853  -1.163  1.832   1.00 0.00 ? 39  ASP A O    3  
ATOM 4560  C CB   . ASP A 1 39  ? 20.130  1.543   0.330   1.00 0.00 ? 39  ASP A CB   3  
ATOM 4561  C CG   . ASP A 1 39  ? 20.922  2.174   -0.798  1.00 0.00 ? 39  ASP A CG   3  
ATOM 4562  O OD1  . ASP A 1 39  ? 21.306  1.444   -1.735  1.00 0.00 ? 39  ASP A OD1  3  
ATOM 4563  O OD2  . ASP A 1 39  ? 21.158  3.399   -0.743  1.00 0.00 ? 39  ASP A OD2  3  
ATOM 4564  H H    . ASP A 1 39  ? 18.054  1.417   -1.123  1.00 0.00 ? 39  ASP A H    3  
ATOM 4565  H HA   . ASP A 1 39  ? 20.181  -0.365  -0.637  1.00 0.00 ? 39  ASP A HA   3  
ATOM 4566  H HB2  . ASP A 1 39  ? 19.367  2.240   0.643   1.00 0.00 ? 39  ASP A HB2  3  
ATOM 4567  H HB3  . ASP A 1 39  ? 20.800  1.355   1.156   1.00 0.00 ? 39  ASP A HB3  3  
ATOM 4568  N N    . ALA A 1 40  ? 17.734  -0.520  1.436   1.00 0.00 ? 40  ALA A N    3  
ATOM 4569  C CA   . ALA A 1 40  ? 17.189  -1.223  2.591   1.00 0.00 ? 40  ALA A CA   3  
ATOM 4570  C C    . ALA A 1 40  ? 17.763  -2.632  2.697   1.00 0.00 ? 40  ALA A C    3  
ATOM 4571  O O    . ALA A 1 40  ? 17.982  -3.300  1.687   1.00 0.00 ? 40  ALA A O    3  
ATOM 4572  C CB   . ALA A 1 40  ? 15.670  -1.275  2.509   1.00 0.00 ? 40  ALA A CB   3  
ATOM 4573  H H    . ALA A 1 40  ? 17.128  -0.014  0.856   1.00 0.00 ? 40  ALA A H    3  
ATOM 4574  H HA   . ALA A 1 40  ? 17.458  -0.668  3.478   1.00 0.00 ? 40  ALA A HA   3  
ATOM 4575  H HB1  . ALA A 1 40  ? 15.274  -0.272  2.543   1.00 0.00 ? 40  ALA A HB1  3  
ATOM 4576  H HB2  . ALA A 1 40  ? 15.377  -1.747  1.582   1.00 0.00 ? 40  ALA A HB2  3  
ATOM 4577  H HB3  . ALA A 1 40  ? 15.284  -1.844  3.341   1.00 0.00 ? 40  ALA A HB3  3  
ATOM 4578  N N    . GLU A 1 41  ? 18.006  -3.076  3.926   1.00 0.00 ? 41  GLU A N    3  
ATOM 4579  C CA   . GLU A 1 41  ? 18.557  -4.406  4.162   1.00 0.00 ? 41  GLU A CA   3  
ATOM 4580  C C    . GLU A 1 41  ? 18.014  -5.408  3.147   1.00 0.00 ? 41  GLU A C    3  
ATOM 4581  O O    . GLU A 1 41  ? 18.775  -6.030  2.406   1.00 0.00 ? 41  GLU A O    3  
ATOM 4582  C CB   . GLU A 1 41  ? 18.230  -4.873  5.582   1.00 0.00 ? 41  GLU A CB   3  
ATOM 4583  C CG   . GLU A 1 41  ? 18.302  -3.765  6.619   1.00 0.00 ? 41  GLU A CG   3  
ATOM 4584  C CD   . GLU A 1 41  ? 18.346  -4.297  8.038   1.00 0.00 ? 41  GLU A CD   3  
ATOM 4585  O OE1  . GLU A 1 41  ? 19.152  -5.212  8.305   1.00 0.00 ? 41  GLU A OE1  3  
ATOM 4586  O OE2  . GLU A 1 41  ? 17.574  -3.796  8.883   1.00 0.00 ? 41  GLU A OE2  3  
ATOM 4587  H H    . GLU A 1 41  ? 17.811  -2.497  4.691   1.00 0.00 ? 41  GLU A H    3  
ATOM 4588  H HA   . GLU A 1 41  ? 19.629  -4.345  4.051   1.00 0.00 ? 41  GLU A HA   3  
ATOM 4589  H HB2  . GLU A 1 41  ? 17.231  -5.283  5.592   1.00 0.00 ? 41  GLU A HB2  3  
ATOM 4590  H HB3  . GLU A 1 41  ? 18.929  -5.646  5.863   1.00 0.00 ? 41  GLU A HB3  3  
ATOM 4591  H HG2  . GLU A 1 41  ? 19.193  -3.181  6.442   1.00 0.00 ? 41  GLU A HG2  3  
ATOM 4592  H HG3  . GLU A 1 41  ? 17.432  -3.133  6.514   1.00 0.00 ? 41  GLU A HG3  3  
ATOM 4593  N N    . ARG A 1 42  ? 16.694  -5.558  3.121   1.00 0.00 ? 42  ARG A N    3  
ATOM 4594  C CA   . ARG A 1 42  ? 16.049  -6.485  2.199   1.00 0.00 ? 42  ARG A CA   3  
ATOM 4595  C C    . ARG A 1 42  ? 15.796  -5.821  0.849   1.00 0.00 ? 42  ARG A C    3  
ATOM 4596  O O    . ARG A 1 42  ? 16.130  -4.654  0.648   1.00 0.00 ? 42  ARG A O    3  
ATOM 4597  C CB   . ARG A 1 42  ? 14.729  -6.988  2.788   1.00 0.00 ? 42  ARG A CB   3  
ATOM 4598  C CG   . ARG A 1 42  ? 14.897  -8.145  3.759   1.00 0.00 ? 42  ARG A CG   3  
ATOM 4599  C CD   . ARG A 1 42  ? 15.745  -7.749  4.957   1.00 0.00 ? 42  ARG A CD   3  
ATOM 4600  N NE   . ARG A 1 42  ? 17.174  -7.879  4.683   1.00 0.00 ? 42  ARG A NE   3  
ATOM 4601  C CZ   . ARG A 1 42  ? 17.774  -9.041  4.448   1.00 0.00 ? 42  ARG A CZ   3  
ATOM 4602  N NH1  . ARG A 1 42  ? 17.073  -10.166 4.452   1.00 0.00 ? 42  ARG A NH1  3  
ATOM 4603  N NH2  . ARG A 1 42  ? 19.078  -9.078  4.207   1.00 0.00 ? 42  ARG A NH2  3  
ATOM 4604  H H    . ARG A 1 42  ? 16.140  -5.034  3.737   1.00 0.00 ? 42  ARG A H    3  
ATOM 4605  H HA   . ARG A 1 42  ? 16.711  -7.325  2.056   1.00 0.00 ? 42  ARG A HA   3  
ATOM 4606  H HB2  . ARG A 1 42  ? 14.249  -6.174  3.312   1.00 0.00 ? 42  ARG A HB2  3  
ATOM 4607  H HB3  . ARG A 1 42  ? 14.090  -7.312  1.981   1.00 0.00 ? 42  ARG A HB3  3  
ATOM 4608  H HG2  . ARG A 1 42  ? 13.923  -8.454  4.108   1.00 0.00 ? 42  ARG A HG2  3  
ATOM 4609  H HG3  . ARG A 1 42  ? 15.375  -8.966  3.245   1.00 0.00 ? 42  ARG A HG3  3  
ATOM 4610  H HD2  . ARG A 1 42  ? 15.529  -6.722  5.211   1.00 0.00 ? 42  ARG A HD2  3  
ATOM 4611  H HD3  . ARG A 1 42  ? 15.488  -8.387  5.789   1.00 0.00 ? 42  ARG A HD3  3  
ATOM 4612  H HE   . ARG A 1 42  ? 17.711  -7.060  4.676   1.00 0.00 ? 42  ARG A HE   3  
ATOM 4613  H HH11 . ARG A 1 42  ? 16.090  -10.141 4.632   1.00 0.00 ? 42  ARG A HH11 3  
ATOM 4614  H HH12 . ARG A 1 42  ? 17.527  -11.039 4.273   1.00 0.00 ? 42  ARG A HH12 3  
ATOM 4615  H HH21 . ARG A 1 42  ? 19.610  -8.231  4.202   1.00 0.00 ? 42  ARG A HH21 3  
ATOM 4616  H HH22 . ARG A 1 42  ? 19.529  -9.952  4.030   1.00 0.00 ? 42  ARG A HH22 3  
ATOM 4617  N N    . ARG A 1 43  ? 15.204  -6.574  -0.073  1.00 0.00 ? 43  ARG A N    3  
ATOM 4618  C CA   . ARG A 1 43  ? 14.908  -6.060  -1.404  1.00 0.00 ? 43  ARG A CA   3  
ATOM 4619  C C    . ARG A 1 43  ? 13.459  -5.588  -1.495  1.00 0.00 ? 43  ARG A C    3  
ATOM 4620  O O    . ARG A 1 43  ? 12.543  -6.396  -1.648  1.00 0.00 ? 43  ARG A O    3  
ATOM 4621  C CB   . ARG A 1 43  ? 15.173  -7.134  -2.460  1.00 0.00 ? 43  ARG A CB   3  
ATOM 4622  C CG   . ARG A 1 43  ? 14.575  -6.813  -3.820  1.00 0.00 ? 43  ARG A CG   3  
ATOM 4623  C CD   . ARG A 1 43  ? 14.800  -7.945  -4.810  1.00 0.00 ? 43  ARG A CD   3  
ATOM 4624  N NE   . ARG A 1 43  ? 13.899  -9.069  -4.570  1.00 0.00 ? 43  ARG A NE   3  
ATOM 4625  C CZ   . ARG A 1 43  ? 13.992  -10.233 -5.203  1.00 0.00 ? 43  ARG A CZ   3  
ATOM 4626  N NH1  . ARG A 1 43  ? 14.942  -10.426 -6.108  1.00 0.00 ? 43  ARG A NH1  3  
ATOM 4627  N NH2  . ARG A 1 43  ? 13.134  -11.208 -4.930  1.00 0.00 ? 43  ARG A NH2  3  
ATOM 4628  H H    . ARG A 1 43  ? 14.961  -7.498  0.147   1.00 0.00 ? 43  ARG A H    3  
ATOM 4629  H HA   . ARG A 1 43  ? 15.559  -5.219  -1.588  1.00 0.00 ? 43  ARG A HA   3  
ATOM 4630  H HB2  . ARG A 1 43  ? 16.240  -7.250  -2.579  1.00 0.00 ? 43  ARG A HB2  3  
ATOM 4631  H HB3  . ARG A 1 43  ? 14.754  -8.068  -2.119  1.00 0.00 ? 43  ARG A HB3  3  
ATOM 4632  H HG2  . ARG A 1 43  ? 13.512  -6.654  -3.708  1.00 0.00 ? 43  ARG A HG2  3  
ATOM 4633  H HG3  . ARG A 1 43  ? 15.036  -5.914  -4.202  1.00 0.00 ? 43  ARG A HG3  3  
ATOM 4634  H HD2  . ARG A 1 43  ? 14.635  -7.570  -5.809  1.00 0.00 ? 43  ARG A HD2  3  
ATOM 4635  H HD3  . ARG A 1 43  ? 15.820  -8.287  -4.718  1.00 0.00 ? 43  ARG A HD3  3  
ATOM 4636  H HE   . ARG A 1 43  ? 13.189  -8.948  -3.906  1.00 0.00 ? 43  ARG A HE   3  
ATOM 4637  H HH11 . ARG A 1 43  ? 15.590  -9.693  -6.314  1.00 0.00 ? 43  ARG A HH11 3  
ATOM 4638  H HH12 . ARG A 1 43  ? 15.010  -11.304 -6.581  1.00 0.00 ? 43  ARG A HH12 3  
ATOM 4639  H HH21 . ARG A 1 43  ? 12.417  -11.066 -4.249  1.00 0.00 ? 43  ARG A HH21 3  
ATOM 4640  H HH22 . ARG A 1 43  ? 13.204  -12.084 -5.407  1.00 0.00 ? 43  ARG A HH22 3  
ATOM 4641  N N    . GLN A 1 44  ? 13.262  -4.277  -1.400  1.00 0.00 ? 44  GLN A N    3  
ATOM 4642  C CA   . GLN A 1 44  ? 11.925  -3.700  -1.470  1.00 0.00 ? 44  GLN A CA   3  
ATOM 4643  C C    . GLN A 1 44  ? 11.419  -3.670  -2.909  1.00 0.00 ? 44  GLN A C    3  
ATOM 4644  O O    . GLN A 1 44  ? 12.064  -3.104  -3.792  1.00 0.00 ? 44  GLN A O    3  
ATOM 4645  C CB   . GLN A 1 44  ? 11.926  -2.285  -0.889  1.00 0.00 ? 44  GLN A CB   3  
ATOM 4646  C CG   . GLN A 1 44  ? 12.857  -2.118  0.302   1.00 0.00 ? 44  GLN A CG   3  
ATOM 4647  C CD   . GLN A 1 44  ? 12.588  -3.128  1.399   1.00 0.00 ? 44  GLN A CD   3  
ATOM 4648  O OE1  . GLN A 1 44  ? 12.648  -4.337  1.174   1.00 0.00 ? 44  GLN A OE1  3  
ATOM 4649  N NE2  . GLN A 1 44  ? 12.290  -2.637  2.596   1.00 0.00 ? 44  GLN A NE2  3  
ATOM 4650  H H    . GLN A 1 44  ? 14.032  -3.685  -1.279  1.00 0.00 ? 44  GLN A H    3  
ATOM 4651  H HA   . GLN A 1 44  ? 11.265  -4.320  -0.883  1.00 0.00 ? 44  GLN A HA   3  
ATOM 4652  H HB2  . GLN A 1 44  ? 12.233  -1.593  -1.658  1.00 0.00 ? 44  GLN A HB2  3  
ATOM 4653  H HB3  . GLN A 1 44  ? 10.924  -2.038  -0.572  1.00 0.00 ? 44  GLN A HB3  3  
ATOM 4654  H HG2  . GLN A 1 44  ? 13.876  -2.237  -0.034  1.00 0.00 ? 44  GLN A HG2  3  
ATOM 4655  H HG3  . GLN A 1 44  ? 12.727  -1.125  0.707   1.00 0.00 ? 44  GLN A HG3  3  
ATOM 4656  H HE21 . GLN A 1 44  ? 12.259  -1.663  2.702   1.00 0.00 ? 44  GLN A HE21 3  
ATOM 4657  H HE22 . GLN A 1 44  ? 12.110  -3.268  3.324   1.00 0.00 ? 44  GLN A HE22 3  
ATOM 4658  N N    . ASP A 1 45  ? 10.263  -4.284  -3.137  1.00 0.00 ? 45  ASP A N    3  
ATOM 4659  C CA   . ASP A 1 45  ? 9.671   -4.327  -4.469  1.00 0.00 ? 45  ASP A CA   3  
ATOM 4660  C C    . ASP A 1 45  ? 9.522   -2.922  -5.044  1.00 0.00 ? 45  ASP A C    3  
ATOM 4661  O O    . ASP A 1 45  ? 9.925   -2.659  -6.177  1.00 0.00 ? 45  ASP A O    3  
ATOM 4662  C CB   . ASP A 1 45  ? 8.308   -5.020  -4.422  1.00 0.00 ? 45  ASP A CB   3  
ATOM 4663  C CG   . ASP A 1 45  ? 7.933   -5.651  -5.748  1.00 0.00 ? 45  ASP A CG   3  
ATOM 4664  O OD1  . ASP A 1 45  ? 8.107   -4.988  -6.792  1.00 0.00 ? 45  ASP A OD1  3  
ATOM 4665  O OD2  . ASP A 1 45  ? 7.467   -6.810  -5.742  1.00 0.00 ? 45  ASP A OD2  3  
ATOM 4666  H H    . ASP A 1 45  ? 9.797   -4.717  -2.392  1.00 0.00 ? 45  ASP A H    3  
ATOM 4667  H HA   . ASP A 1 45  ? 10.331  -4.895  -5.107  1.00 0.00 ? 45  ASP A HA   3  
ATOM 4668  H HB2  . ASP A 1 45  ? 8.331   -5.794  -3.669  1.00 0.00 ? 45  ASP A HB2  3  
ATOM 4669  H HB3  . ASP A 1 45  ? 7.551   -4.293  -4.163  1.00 0.00 ? 45  ASP A HB3  3  
ATOM 4670  N N    . ILE A 1 46  ? 8.940   -2.025  -4.256  1.00 0.00 ? 46  ILE A N    3  
ATOM 4671  C CA   . ILE A 1 46  ? 8.738   -0.647  -4.686  1.00 0.00 ? 46  ILE A CA   3  
ATOM 4672  C C    . ILE A 1 46  ? 9.739   0.290   -4.019  1.00 0.00 ? 46  ILE A C    3  
ATOM 4673  O O    . ILE A 1 46  ? 9.801   0.378   -2.793  1.00 0.00 ? 46  ILE A O    3  
ATOM 4674  C CB   . ILE A 1 46  ? 7.310   -0.163  -4.372  1.00 0.00 ? 46  ILE A CB   3  
ATOM 4675  C CG1  . ILE A 1 46  ? 6.314   -0.764  -5.366  1.00 0.00 ? 46  ILE A CG1  3  
ATOM 4676  C CG2  . ILE A 1 46  ? 7.247   1.357   -4.405  1.00 0.00 ? 46  ILE A CG2  3  
ATOM 4677  C CD1  . ILE A 1 46  ? 4.919   -0.924  -4.802  1.00 0.00 ? 46  ILE A CD1  3  
ATOM 4678  H H    . ILE A 1 46  ? 8.640   -2.295  -3.363  1.00 0.00 ? 46  ILE A H    3  
ATOM 4679  H HA   . ILE A 1 46  ? 8.882   -0.608  -5.756  1.00 0.00 ? 46  ILE A HA   3  
ATOM 4680  H HB   . ILE A 1 46  ? 7.054   -0.488  -3.376  1.00 0.00 ? 46  ILE A HB   3  
ATOM 4681  H HG12 . ILE A 1 46  ? 6.249   -0.125  -6.232  1.00 0.00 ? 46  ILE A HG12 3  
ATOM 4682  H HG13 . ILE A 1 46  ? 6.664   -1.740  -5.669  1.00 0.00 ? 46  ILE A HG13 3  
ATOM 4683  H HG21 . ILE A 1 46  ? 7.843   1.724   -5.228  1.00 0.00 ? 46  ILE A HG21 3  
ATOM 4684  H HG22 . ILE A 1 46  ? 6.222   1.672   -4.535  1.00 0.00 ? 46  ILE A HG22 3  
ATOM 4685  H HG23 . ILE A 1 46  ? 7.631   1.754   -3.477  1.00 0.00 ? 46  ILE A HG23 3  
ATOM 4686  H HD11 . ILE A 1 46  ? 4.810   -0.294  -3.930  1.00 0.00 ? 46  ILE A HD11 3  
ATOM 4687  H HD12 . ILE A 1 46  ? 4.193   -0.634  -5.547  1.00 0.00 ? 46  ILE A HD12 3  
ATOM 4688  H HD13 . ILE A 1 46  ? 4.759   -1.954  -4.523  1.00 0.00 ? 46  ILE A HD13 3  
ATOM 4689  N N    . VAL A 1 47  ? 10.520  0.991   -4.835  1.00 0.00 ? 47  VAL A N    3  
ATOM 4690  C CA   . VAL A 1 47  ? 11.517  1.924   -4.324  1.00 0.00 ? 47  VAL A CA   3  
ATOM 4691  C C    . VAL A 1 47  ? 11.016  3.362   -4.407  1.00 0.00 ? 47  VAL A C    3  
ATOM 4692  O O    . VAL A 1 47  ? 10.632  3.837   -5.477  1.00 0.00 ? 47  VAL A O    3  
ATOM 4693  C CB   . VAL A 1 47  ? 12.843  1.808   -5.099  1.00 0.00 ? 47  VAL A CB   3  
ATOM 4694  C CG1  . VAL A 1 47  ? 13.907  2.697   -4.472  1.00 0.00 ? 47  VAL A CG1  3  
ATOM 4695  C CG2  . VAL A 1 47  ? 13.307  0.360   -5.147  1.00 0.00 ? 47  VAL A CG2  3  
ATOM 4696  H H    . VAL A 1 47  ? 10.423  0.877   -5.803  1.00 0.00 ? 47  VAL A H    3  
ATOM 4697  H HA   . VAL A 1 47  ? 11.706  1.678   -3.289  1.00 0.00 ? 47  VAL A HA   3  
ATOM 4698  H HB   . VAL A 1 47  ? 12.676  2.144   -6.112  1.00 0.00 ? 47  VAL A HB   3  
ATOM 4699  H HG11 . VAL A 1 47  ? 14.681  2.081   -4.040  1.00 0.00 ? 47  VAL A HG11 3  
ATOM 4700  H HG12 . VAL A 1 47  ? 14.335  3.336   -5.231  1.00 0.00 ? 47  VAL A HG12 3  
ATOM 4701  H HG13 . VAL A 1 47  ? 13.459  3.305   -3.700  1.00 0.00 ? 47  VAL A HG13 3  
ATOM 4702  H HG21 . VAL A 1 47  ? 14.308  0.316   -5.549  1.00 0.00 ? 47  VAL A HG21 3  
ATOM 4703  H HG22 . VAL A 1 47  ? 13.300  -0.052  -4.149  1.00 0.00 ? 47  VAL A HG22 3  
ATOM 4704  H HG23 . VAL A 1 47  ? 12.640  -0.211  -5.776  1.00 0.00 ? 47  VAL A HG23 3  
ATOM 4705  N N    . LEU A 1 48  ? 11.024  4.051   -3.272  1.00 0.00 ? 48  LEU A N    3  
ATOM 4706  C CA   . LEU A 1 48  ? 10.571  5.437   -3.215  1.00 0.00 ? 48  LEU A CA   3  
ATOM 4707  C C    . LEU A 1 48  ? 11.757  6.395   -3.144  1.00 0.00 ? 48  LEU A C    3  
ATOM 4708  O O    . LEU A 1 48  ? 12.906  5.969   -3.030  1.00 0.00 ? 48  LEU A O    3  
ATOM 4709  C CB   . LEU A 1 48  ? 9.659   5.647   -2.005  1.00 0.00 ? 48  LEU A CB   3  
ATOM 4710  C CG   . LEU A 1 48  ? 8.506   4.654   -1.854  1.00 0.00 ? 48  LEU A CG   3  
ATOM 4711  C CD1  . LEU A 1 48  ? 7.748   4.512   -3.165  1.00 0.00 ? 48  LEU A CD1  3  
ATOM 4712  C CD2  . LEU A 1 48  ? 9.025   3.302   -1.387  1.00 0.00 ? 48  LEU A CD2  3  
ATOM 4713  H H    . LEU A 1 48  ? 11.342  3.620   -2.452  1.00 0.00 ? 48  LEU A H    3  
ATOM 4714  H HA   . LEU A 1 48  ? 10.013  5.640   -4.117  1.00 0.00 ? 48  LEU A HA   3  
ATOM 4715  H HB2  . LEU A 1 48  ? 10.268  5.584   -1.117  1.00 0.00 ? 48  LEU A HB2  3  
ATOM 4716  H HB3  . LEU A 1 48  ? 9.235   6.638   -2.080  1.00 0.00 ? 48  LEU A HB3  3  
ATOM 4717  H HG   . LEU A 1 48  ? 7.816   5.024   -1.108  1.00 0.00 ? 48  LEU A HG   3  
ATOM 4718  H HD11 . LEU A 1 48  ? 8.394   4.071   -3.908  1.00 0.00 ? 48  LEU A HD11 3  
ATOM 4719  H HD12 . LEU A 1 48  ? 7.425   5.486   -3.500  1.00 0.00 ? 48  LEU A HD12 3  
ATOM 4720  H HD13 . LEU A 1 48  ? 6.886   3.879   -3.015  1.00 0.00 ? 48  LEU A HD13 3  
ATOM 4721  H HD21 . LEU A 1 48  ? 9.289   2.702   -2.245  1.00 0.00 ? 48  LEU A HD21 3  
ATOM 4722  H HD22 . LEU A 1 48  ? 8.257   2.799   -0.818  1.00 0.00 ? 48  LEU A HD22 3  
ATOM 4723  H HD23 . LEU A 1 48  ? 9.897   3.446   -0.765  1.00 0.00 ? 48  LEU A HD23 3  
ATOM 4724  N N    . SER A 1 49  ? 11.469  7.691   -3.212  1.00 0.00 ? 49  SER A N    3  
ATOM 4725  C CA   . SER A 1 49  ? 12.511  8.709   -3.158  1.00 0.00 ? 49  SER A CA   3  
ATOM 4726  C C    . SER A 1 49  ? 13.354  8.557   -1.895  1.00 0.00 ? 49  SER A C    3  
ATOM 4727  O O    . SER A 1 49  ? 13.039  7.754   -1.018  1.00 0.00 ? 49  SER A O    3  
ATOM 4728  C CB   . SER A 1 49  ? 11.890  10.107  -3.205  1.00 0.00 ? 49  SER A CB   3  
ATOM 4729  O OG   . SER A 1 49  ? 12.830  11.095  -2.821  1.00 0.00 ? 49  SER A OG   3  
ATOM 4730  H H    . SER A 1 49  ? 10.533  7.968   -3.303  1.00 0.00 ? 49  SER A H    3  
ATOM 4731  H HA   . SER A 1 49  ? 13.148  8.578   -4.019  1.00 0.00 ? 49  SER A HA   3  
ATOM 4732  H HB2  . SER A 1 49  ? 11.557  10.316  -4.210  1.00 0.00 ? 49  SER A HB2  3  
ATOM 4733  H HB3  . SER A 1 49  ? 11.048  10.146  -2.530  1.00 0.00 ? 49  SER A HB3  3  
ATOM 4734  H HG   . SER A 1 49  ? 13.282  11.428  -3.600  1.00 0.00 ? 49  SER A HG   3  
ATOM 4735  N N    . GLY A 1 50  ? 14.428  9.335   -1.811  1.00 0.00 ? 50  GLY A N    3  
ATOM 4736  C CA   . GLY A 1 50  ? 15.301  9.272   -0.653  1.00 0.00 ? 50  GLY A CA   3  
ATOM 4737  C C    . GLY A 1 50  ? 15.339  10.578  0.116   1.00 0.00 ? 50  GLY A C    3  
ATOM 4738  O O    . GLY A 1 50  ? 16.411  11.062  0.478   1.00 0.00 ? 50  GLY A O    3  
ATOM 4739  H H    . GLY A 1 50  ? 14.630  9.957   -2.541  1.00 0.00 ? 50  GLY A H    3  
ATOM 4740  H HA2  . GLY A 1 50  ? 14.953  8.490   0.004   1.00 0.00 ? 50  GLY A HA2  3  
ATOM 4741  H HA3  . GLY A 1 50  ? 16.301  9.033   -0.983  1.00 0.00 ? 50  GLY A HA3  3  
ATOM 4742  N N    . ALA A 1 51  ? 14.166  11.152  0.364   1.00 0.00 ? 51  ALA A N    3  
ATOM 4743  C CA   . ALA A 1 51  ? 14.070  12.409  1.095   1.00 0.00 ? 51  ALA A CA   3  
ATOM 4744  C C    . ALA A 1 51  ? 13.501  12.190  2.493   1.00 0.00 ? 51  ALA A C    3  
ATOM 4745  O O    . ALA A 1 51  ? 14.192  12.388  3.493   1.00 0.00 ? 51  ALA A O    3  
ATOM 4746  C CB   . ALA A 1 51  ? 13.213  13.403  0.324   1.00 0.00 ? 51  ALA A CB   3  
ATOM 4747  H H    . ALA A 1 51  ? 13.346  10.718  0.049   1.00 0.00 ? 51  ALA A H    3  
ATOM 4748  H HA   . ALA A 1 51  ? 15.065  12.821  1.182   1.00 0.00 ? 51  ALA A HA   3  
ATOM 4749  H HB1  . ALA A 1 51  ? 13.796  13.838  -0.473  1.00 0.00 ? 51  ALA A HB1  3  
ATOM 4750  H HB2  . ALA A 1 51  ? 12.357  12.892  -0.092  1.00 0.00 ? 51  ALA A HB2  3  
ATOM 4751  H HB3  . ALA A 1 51  ? 12.878  14.182  0.992   1.00 0.00 ? 51  ALA A HB3  3  
ATOM 4752  N N    . HIS A 1 52  ? 12.238  11.780  2.555   1.00 0.00 ? 52  HIS A N    3  
ATOM 4753  C CA   . HIS A 1 52  ? 11.577  11.534  3.832   1.00 0.00 ? 52  HIS A CA   3  
ATOM 4754  C C    . HIS A 1 52  ? 10.990  10.126  3.877   1.00 0.00 ? 52  HIS A C    3  
ATOM 4755  O O    . HIS A 1 52  ? 9.950   9.897   4.495   1.00 0.00 ? 52  HIS A O    3  
ATOM 4756  C CB   . HIS A 1 52  ? 10.474  12.566  4.066   1.00 0.00 ? 52  HIS A CB   3  
ATOM 4757  C CG   . HIS A 1 52  ? 10.993  13.938  4.368   1.00 0.00 ? 52  HIS A CG   3  
ATOM 4758  N ND1  . HIS A 1 52  ? 10.356  15.091  3.959   1.00 0.00 ? 52  HIS A ND1  3  
ATOM 4759  C CD2  . HIS A 1 52  ? 12.095  14.339  5.046   1.00 0.00 ? 52  HIS A CD2  3  
ATOM 4760  C CE1  . HIS A 1 52  ? 11.044  16.141  4.370   1.00 0.00 ? 52  HIS A CE1  3  
ATOM 4761  N NE2  . HIS A 1 52  ? 12.104  15.712  5.033   1.00 0.00 ? 52  HIS A NE2  3  
ATOM 4762  H H    . HIS A 1 52  ? 11.740  11.639  1.723   1.00 0.00 ? 52  HIS A H    3  
ATOM 4763  H HA   . HIS A 1 52  ? 12.317  11.626  4.612   1.00 0.00 ? 52  HIS A HA   3  
ATOM 4764  H HB2  . HIS A 1 52  ? 9.858   12.633  3.182   1.00 0.00 ? 52  HIS A HB2  3  
ATOM 4765  H HB3  . HIS A 1 52  ? 9.865   12.250  4.901   1.00 0.00 ? 52  HIS A HB3  3  
ATOM 4766  H HD2  . HIS A 1 52  ? 12.831  13.698  5.510   1.00 0.00 ? 52  HIS A HD2  3  
ATOM 4767  H HE1  . HIS A 1 52  ? 10.785  17.175  4.196   1.00 0.00 ? 52  HIS A HE1  3  
ATOM 4768  H HE2  . HIS A 1 52  ? 12.826  16.281  5.371   1.00 0.00 ? 52  HIS A HE2  3  
ATOM 4769  N N    . ILE A 1 53  ? 11.663  9.188   3.218   1.00 0.00 ? 53  ILE A N    3  
ATOM 4770  C CA   . ILE A 1 53  ? 11.207  7.804   3.184   1.00 0.00 ? 53  ILE A CA   3  
ATOM 4771  C C    . ILE A 1 53  ? 12.045  6.927   4.108   1.00 0.00 ? 53  ILE A C    3  
ATOM 4772  O O    . ILE A 1 53  ? 13.197  7.242   4.406   1.00 0.00 ? 53  ILE A O    3  
ATOM 4773  C CB   . ILE A 1 53  ? 11.264  7.228   1.757   1.00 0.00 ? 53  ILE A CB   3  
ATOM 4774  C CG1  . ILE A 1 53  ? 10.203  7.889   0.874   1.00 0.00 ? 53  ILE A CG1  3  
ATOM 4775  C CG2  . ILE A 1 53  ? 11.070  5.719   1.786   1.00 0.00 ? 53  ILE A CG2  3  
ATOM 4776  C CD1  . ILE A 1 53  ? 8.840   7.967   1.523   1.00 0.00 ? 53  ILE A CD1  3  
ATOM 4777  H H    . ILE A 1 53  ? 12.485  9.433   2.745   1.00 0.00 ? 53  ILE A H    3  
ATOM 4778  H HA   . ILE A 1 53  ? 10.180  7.783   3.519   1.00 0.00 ? 53  ILE A HA   3  
ATOM 4779  H HB   . ILE A 1 53  ? 12.241  7.433   1.348   1.00 0.00 ? 53  ILE A HB   3  
ATOM 4780  H HG12 . ILE A 1 53  ? 10.516  8.894   0.638   1.00 0.00 ? 53  ILE A HG12 3  
ATOM 4781  H HG13 . ILE A 1 53  ? 10.104  7.324   -0.041  1.00 0.00 ? 53  ILE A HG13 3  
ATOM 4782  H HG21 . ILE A 1 53  ? 11.883  5.263   2.333   1.00 0.00 ? 53  ILE A HG21 3  
ATOM 4783  H HG22 . ILE A 1 53  ? 10.135  5.486   2.273   1.00 0.00 ? 53  ILE A HG22 3  
ATOM 4784  H HG23 . ILE A 1 53  ? 11.056  5.338   0.777   1.00 0.00 ? 53  ILE A HG23 3  
ATOM 4785  H HD11 . ILE A 1 53  ? 8.832   8.769   2.248   1.00 0.00 ? 53  ILE A HD11 3  
ATOM 4786  H HD12 . ILE A 1 53  ? 8.091   8.159   0.769   1.00 0.00 ? 53  ILE A HD12 3  
ATOM 4787  H HD13 . ILE A 1 53  ? 8.622   7.033   2.019   1.00 0.00 ? 53  ILE A HD13 3  
ATOM 4788  N N    . LYS A 1 54  ? 11.460  5.822   4.557   1.00 0.00 ? 54  LYS A N    3  
ATOM 4789  C CA   . LYS A 1 54  ? 12.152  4.896   5.445   1.00 0.00 ? 54  LYS A CA   3  
ATOM 4790  C C    . LYS A 1 54  ? 12.471  3.589   4.726   1.00 0.00 ? 54  LYS A C    3  
ATOM 4791  O O    . LYS A 1 54  ? 11.687  3.115   3.904   1.00 0.00 ? 54  LYS A O    3  
ATOM 4792  C CB   . LYS A 1 54  ? 11.300  4.613   6.685   1.00 0.00 ? 54  LYS A CB   3  
ATOM 4793  C CG   . LYS A 1 54  ? 11.221  5.785   7.648   1.00 0.00 ? 54  LYS A CG   3  
ATOM 4794  C CD   . LYS A 1 54  ? 11.196  7.112   6.910   1.00 0.00 ? 54  LYS A CD   3  
ATOM 4795  C CE   . LYS A 1 54  ? 10.929  8.272   7.858   1.00 0.00 ? 54  LYS A CE   3  
ATOM 4796  N NZ   . LYS A 1 54  ? 10.843  9.571   7.134   1.00 0.00 ? 54  LYS A NZ   3  
ATOM 4797  H H    . LYS A 1 54  ? 10.538  5.625   4.284   1.00 0.00 ? 54  LYS A H    3  
ATOM 4798  H HA   . LYS A 1 54  ? 13.077  5.359   5.752   1.00 0.00 ? 54  LYS A HA   3  
ATOM 4799  H HB2  . LYS A 1 54  ? 10.298  4.364   6.370   1.00 0.00 ? 54  LYS A HB2  3  
ATOM 4800  H HB3  . LYS A 1 54  ? 11.723  3.769   7.212   1.00 0.00 ? 54  LYS A HB3  3  
ATOM 4801  H HG2  . LYS A 1 54  ? 10.319  5.695   8.236   1.00 0.00 ? 54  LYS A HG2  3  
ATOM 4802  H HG3  . LYS A 1 54  ? 12.082  5.761   8.301   1.00 0.00 ? 54  LYS A HG3  3  
ATOM 4803  H HD2  . LYS A 1 54  ? 12.152  7.266   6.431   1.00 0.00 ? 54  LYS A HD2  3  
ATOM 4804  H HD3  . LYS A 1 54  ? 10.417  7.084   6.161   1.00 0.00 ? 54  LYS A HD3  3  
ATOM 4805  H HE2  . LYS A 1 54  ? 9.997   8.093   8.371   1.00 0.00 ? 54  LYS A HE2  3  
ATOM 4806  H HE3  . LYS A 1 54  ? 11.732  8.323   8.578   1.00 0.00 ? 54  LYS A HE3  3  
ATOM 4807  H HZ1  . LYS A 1 54  ? 11.089  9.439   6.133   1.00 0.00 ? 54  LYS A HZ1  3  
ATOM 4808  H HZ2  . LYS A 1 54  ? 11.501  10.258  7.555   1.00 0.00 ? 54  LYS A HZ2  3  
ATOM 4809  H HZ3  . LYS A 1 54  ? 9.877   9.951   7.196   1.00 0.00 ? 54  LYS A HZ3  3  
ATOM 4810  N N    . GLU A 1 55  ? 13.626  3.011   5.043   1.00 0.00 ? 55  GLU A N    3  
ATOM 4811  C CA   . GLU A 1 55  ? 14.047  1.758   4.426   1.00 0.00 ? 55  GLU A CA   3  
ATOM 4812  C C    . GLU A 1 55  ? 12.934  0.717   4.495   1.00 0.00 ? 55  GLU A C    3  
ATOM 4813  O O    . GLU A 1 55  ? 12.732  -0.054  3.558   1.00 0.00 ? 55  GLU A O    3  
ATOM 4814  C CB   . GLU A 1 55  ? 15.304  1.223   5.114   1.00 0.00 ? 55  GLU A CB   3  
ATOM 4815  C CG   . GLU A 1 55  ? 16.567  1.986   4.752   1.00 0.00 ? 55  GLU A CG   3  
ATOM 4816  C CD   . GLU A 1 55  ? 16.771  3.219   5.611   1.00 0.00 ? 55  GLU A CD   3  
ATOM 4817  O OE1  . GLU A 1 55  ? 16.484  3.149   6.825   1.00 0.00 ? 55  GLU A OE1  3  
ATOM 4818  O OE2  . GLU A 1 55  ? 17.217  4.252   5.071   1.00 0.00 ? 55  GLU A OE2  3  
ATOM 4819  H H    . GLU A 1 55  ? 14.208  3.437   5.706   1.00 0.00 ? 55  GLU A H    3  
ATOM 4820  H HA   . GLU A 1 55  ? 14.272  1.958   3.390   1.00 0.00 ? 55  GLU A HA   3  
ATOM 4821  H HB2  . GLU A 1 55  ? 15.167  1.281   6.184   1.00 0.00 ? 55  GLU A HB2  3  
ATOM 4822  H HB3  . GLU A 1 55  ? 15.441  0.189   4.833   1.00 0.00 ? 55  GLU A HB3  3  
ATOM 4823  H HG2  . GLU A 1 55  ? 17.417  1.333   4.880   1.00 0.00 ? 55  GLU A HG2  3  
ATOM 4824  H HG3  . GLU A 1 55  ? 16.504  2.293   3.718   1.00 0.00 ? 55  GLU A HG3  3  
ATOM 4825  N N    . GLU A 1 56  ? 12.215  0.701   5.614   1.00 0.00 ? 56  GLU A N    3  
ATOM 4826  C CA   . GLU A 1 56  ? 11.123  -0.247  5.806   1.00 0.00 ? 56  GLU A CA   3  
ATOM 4827  C C    . GLU A 1 56  ? 9.845   0.473   6.226   1.00 0.00 ? 56  GLU A C    3  
ATOM 4828  O O    . GLU A 1 56  ? 9.100   -0.008  7.080   1.00 0.00 ? 56  GLU A O    3  
ATOM 4829  C CB   . GLU A 1 56  ? 11.503  -1.290  6.859   1.00 0.00 ? 56  GLU A CB   3  
ATOM 4830  C CG   . GLU A 1 56  ? 12.726  -2.112  6.487   1.00 0.00 ? 56  GLU A CG   3  
ATOM 4831  C CD   . GLU A 1 56  ? 12.892  -3.339  7.362   1.00 0.00 ? 56  GLU A CD   3  
ATOM 4832  O OE1  . GLU A 1 56  ? 12.063  -3.534  8.275   1.00 0.00 ? 56  GLU A OE1  3  
ATOM 4833  O OE2  . GLU A 1 56  ? 13.851  -4.105  7.133   1.00 0.00 ? 56  GLU A OE2  3  
ATOM 4834  H H    . GLU A 1 56  ? 12.424  1.341   6.326   1.00 0.00 ? 56  GLU A H    3  
ATOM 4835  H HA   . GLU A 1 56  ? 10.948  -0.746  4.865   1.00 0.00 ? 56  GLU A HA   3  
ATOM 4836  H HB2  . GLU A 1 56  ? 11.704  -0.785  7.792   1.00 0.00 ? 56  GLU A HB2  3  
ATOM 4837  H HB3  . GLU A 1 56  ? 10.671  -1.964  6.996   1.00 0.00 ? 56  GLU A HB3  3  
ATOM 4838  H HG2  . GLU A 1 56  ? 12.632  -2.431  5.460   1.00 0.00 ? 56  GLU A HG2  3  
ATOM 4839  H HG3  . GLU A 1 56  ? 13.605  -1.493  6.591   1.00 0.00 ? 56  GLU A HG3  3  
ATOM 4840  N N    . HIS A 1 57  ? 9.599   1.631   5.621   1.00 0.00 ? 57  HIS A N    3  
ATOM 4841  C CA   . HIS A 1 57  ? 8.411   2.419   5.931   1.00 0.00 ? 57  HIS A CA   3  
ATOM 4842  C C    . HIS A 1 57  ? 7.223   1.512   6.239   1.00 0.00 ? 57  HIS A C    3  
ATOM 4843  O O    . HIS A 1 57  ? 6.780   1.420   7.385   1.00 0.00 ? 57  HIS A O    3  
ATOM 4844  C CB   . HIS A 1 57  ? 8.070   3.347   4.766   1.00 0.00 ? 57  HIS A CB   3  
ATOM 4845  C CG   . HIS A 1 57  ? 7.245   4.532   5.165   1.00 0.00 ? 57  HIS A CG   3  
ATOM 4846  N ND1  . HIS A 1 57  ? 7.794   5.752   5.502   1.00 0.00 ? 57  HIS A ND1  3  
ATOM 4847  C CD2  . HIS A 1 57  ? 5.905   4.680   5.279   1.00 0.00 ? 57  HIS A CD2  3  
ATOM 4848  C CE1  . HIS A 1 57  ? 6.827   6.598   5.808   1.00 0.00 ? 57  HIS A CE1  3  
ATOM 4849  N NE2  . HIS A 1 57  ? 5.670   5.972   5.680   1.00 0.00 ? 57  HIS A NE2  3  
ATOM 4850  H H    . HIS A 1 57  ? 10.230  1.963   4.949   1.00 0.00 ? 57  HIS A H    3  
ATOM 4851  H HA   . HIS A 1 57  ? 8.628   3.015   6.804   1.00 0.00 ? 57  HIS A HA   3  
ATOM 4852  H HB2  . HIS A 1 57  ? 8.986   3.714   4.326   1.00 0.00 ? 57  HIS A HB2  3  
ATOM 4853  H HB3  . HIS A 1 57  ? 7.516   2.793   4.021   1.00 0.00 ? 57  HIS A HB3  3  
ATOM 4854  H HD1  . HIS A 1 57  ? 8.750   5.965   5.517   1.00 0.00 ? 57  HIS A HD1  3  
ATOM 4855  H HD2  . HIS A 1 57  ? 5.157   3.922   5.090   1.00 0.00 ? 57  HIS A HD2  3  
ATOM 4856  H HE1  . HIS A 1 57  ? 6.958   7.626   6.110   1.00 0.00 ? 57  HIS A HE1  3  
ATOM 4857  H HE2  . HIS A 1 57  ? 4.798   6.343   5.928   1.00 0.00 ? 57  HIS A HE2  3  
ATOM 4858  N N    . CYS A 1 58  ? 6.712   0.845   5.210   1.00 0.00 ? 58  CYS A N    3  
ATOM 4859  C CA   . CYS A 1 58  ? 5.574   -0.053  5.370   1.00 0.00 ? 58  CYS A CA   3  
ATOM 4860  C C    . CYS A 1 58  ? 5.722   -1.283  4.480   1.00 0.00 ? 58  CYS A C    3  
ATOM 4861  O O    . CYS A 1 58  ? 6.704   -1.417  3.749   1.00 0.00 ? 58  CYS A O    3  
ATOM 4862  C CB   . CYS A 1 58  ? 4.271   0.676   5.040   1.00 0.00 ? 58  CYS A CB   3  
ATOM 4863  S SG   . CYS A 1 58  ? 4.203   1.341   3.360   1.00 0.00 ? 58  CYS A SG   3  
ATOM 4864  H H    . CYS A 1 58  ? 7.108   0.959   4.321   1.00 0.00 ? 58  CYS A H    3  
ATOM 4865  H HA   . CYS A 1 58  ? 5.547   -0.372  6.401   1.00 0.00 ? 58  CYS A HA   3  
ATOM 4866  H HB2  . CYS A 1 58  ? 3.444   -0.009  5.155   1.00 0.00 ? 58  CYS A HB2  3  
ATOM 4867  H HB3  . CYS A 1 58  ? 4.145   1.500   5.727   1.00 0.00 ? 58  CYS A HB3  3  
ATOM 4868  H HG   . CYS A 1 58  ? 3.221   2.229   3.311   1.00 0.00 ? 58  CYS A HG   3  
ATOM 4869  N N    . ILE A 1 59  ? 4.743   -2.178  4.549   1.00 0.00 ? 59  ILE A N    3  
ATOM 4870  C CA   . ILE A 1 59  ? 4.766   -3.397  3.750   1.00 0.00 ? 59  ILE A CA   3  
ATOM 4871  C C    . ILE A 1 59  ? 3.369   -3.753  3.250   1.00 0.00 ? 59  ILE A C    3  
ATOM 4872  O O    . ILE A 1 59  ? 2.368   -3.413  3.880   1.00 0.00 ? 59  ILE A O    3  
ATOM 4873  C CB   . ILE A 1 59  ? 5.330   -4.585  4.551   1.00 0.00 ? 59  ILE A CB   3  
ATOM 4874  C CG1  . ILE A 1 59  ? 6.649   -4.196  5.222   1.00 0.00 ? 59  ILE A CG1  3  
ATOM 4875  C CG2  . ILE A 1 59  ? 5.527   -5.790  3.643   1.00 0.00 ? 59  ILE A CG2  3  
ATOM 4876  C CD1  . ILE A 1 59  ? 7.012   -5.076  6.397   1.00 0.00 ? 59  ILE A CD1  3  
ATOM 4877  H H    . ILE A 1 59  ? 3.988   -2.015  5.151   1.00 0.00 ? 59  ILE A H    3  
ATOM 4878  H HA   . ILE A 1 59  ? 5.408   -3.225  2.898   1.00 0.00 ? 59  ILE A HA   3  
ATOM 4879  H HB   . ILE A 1 59  ? 4.612   -4.852  5.311   1.00 0.00 ? 59  ILE A HB   3  
ATOM 4880  H HG12 . ILE A 1 59  ? 7.447   -4.262  4.500   1.00 0.00 ? 59  ILE A HG12 3  
ATOM 4881  H HG13 . ILE A 1 59  ? 6.575   -3.178  5.579   1.00 0.00 ? 59  ILE A HG13 3  
ATOM 4882  H HG21 . ILE A 1 59  ? 5.701   -5.454  2.632   1.00 0.00 ? 59  ILE A HG21 3  
ATOM 4883  H HG22 . ILE A 1 59  ? 6.378   -6.361  3.983   1.00 0.00 ? 59  ILE A HG22 3  
ATOM 4884  H HG23 . ILE A 1 59  ? 4.644   -6.410  3.670   1.00 0.00 ? 59  ILE A HG23 3  
ATOM 4885  H HD11 . ILE A 1 59  ? 6.136   -5.237  7.011   1.00 0.00 ? 59  ILE A HD11 3  
ATOM 4886  H HD12 . ILE A 1 59  ? 7.376   -6.027  6.037   1.00 0.00 ? 59  ILE A HD12 3  
ATOM 4887  H HD13 . ILE A 1 59  ? 7.778   -4.595  6.985   1.00 0.00 ? 59  ILE A HD13 3  
ATOM 4888  N N    . PHE A 1 60  ? 3.311   -4.440  2.115   1.00 0.00 ? 60  PHE A N    3  
ATOM 4889  C CA   . PHE A 1 60  ? 2.037   -4.843  1.530   1.00 0.00 ? 60  PHE A CA   3  
ATOM 4890  C C    . PHE A 1 60  ? 1.917   -6.364  1.483   1.00 0.00 ? 60  PHE A C    3  
ATOM 4891  O O    . PHE A 1 60  ? 2.646   -7.032  0.750   1.00 0.00 ? 60  PHE A O    3  
ATOM 4892  C CB   . PHE A 1 60  ? 1.892   -4.265  0.121   1.00 0.00 ? 60  PHE A CB   3  
ATOM 4893  C CG   . PHE A 1 60  ? 1.618   -2.788  0.104   1.00 0.00 ? 60  PHE A CG   3  
ATOM 4894  C CD1  . PHE A 1 60  ? 0.434   -2.284  0.618   1.00 0.00 ? 60  PHE A CD1  3  
ATOM 4895  C CD2  . PHE A 1 60  ? 2.544   -1.904  -0.426  1.00 0.00 ? 60  PHE A CD2  3  
ATOM 4896  C CE1  . PHE A 1 60  ? 0.178   -0.926  0.605   1.00 0.00 ? 60  PHE A CE1  3  
ATOM 4897  C CE2  . PHE A 1 60  ? 2.294   -0.545  -0.442  1.00 0.00 ? 60  PHE A CE2  3  
ATOM 4898  C CZ   . PHE A 1 60  ? 1.109   -0.055  0.073   1.00 0.00 ? 60  PHE A CZ   3  
ATOM 4899  H H    . PHE A 1 60  ? 4.144   -4.682  1.659   1.00 0.00 ? 60  PHE A H    3  
ATOM 4900  H HA   . PHE A 1 60  ? 1.248   -4.451  2.154   1.00 0.00 ? 60  PHE A HA   3  
ATOM 4901  H HB2  . PHE A 1 60  ? 2.806   -4.438  -0.427  1.00 0.00 ? 60  PHE A HB2  3  
ATOM 4902  H HB3  . PHE A 1 60  ? 1.076   -4.761  -0.382  1.00 0.00 ? 60  PHE A HB3  3  
ATOM 4903  H HD1  . PHE A 1 60  ? -0.295  -2.965  1.034   1.00 0.00 ? 60  PHE A HD1  3  
ATOM 4904  H HD2  . PHE A 1 60  ? 3.470   -2.285  -0.830  1.00 0.00 ? 60  PHE A HD2  3  
ATOM 4905  H HE1  . PHE A 1 60  ? -0.749  -0.547  1.008   1.00 0.00 ? 60  PHE A HE1  3  
ATOM 4906  H HE2  . PHE A 1 60  ? 3.023   0.134   -0.858  1.00 0.00 ? 60  PHE A HE2  3  
ATOM 4907  H HZ   . PHE A 1 60  ? 0.912   1.006   0.062   1.00 0.00 ? 60  PHE A HZ   3  
ATOM 4908  N N    . ARG A 1 61  ? 0.993   -6.903  2.271   1.00 0.00 ? 61  ARG A N    3  
ATOM 4909  C CA   . ARG A 1 61  ? 0.778   -8.344  2.321   1.00 0.00 ? 61  ARG A CA   3  
ATOM 4910  C C    . ARG A 1 61  ? -0.515  -8.726  1.606   1.00 0.00 ? 61  ARG A C    3  
ATOM 4911  O O    . ARG A 1 61  ? -1.593  -8.241  1.949   1.00 0.00 ? 61  ARG A O    3  
ATOM 4912  C CB   . ARG A 1 61  ? 0.732   -8.825  3.772   1.00 0.00 ? 61  ARG A CB   3  
ATOM 4913  C CG   . ARG A 1 61  ? 0.809   -10.336 3.917   1.00 0.00 ? 61  ARG A CG   3  
ATOM 4914  C CD   . ARG A 1 61  ? 0.699   -10.763 5.372   1.00 0.00 ? 61  ARG A CD   3  
ATOM 4915  N NE   . ARG A 1 61  ? 1.997   -10.769 6.041   1.00 0.00 ? 61  ARG A NE   3  
ATOM 4916  C CZ   . ARG A 1 61  ? 2.894   -11.738 5.896   1.00 0.00 ? 61  ARG A CZ   3  
ATOM 4917  N NH1  . ARG A 1 61  ? 2.635   -12.773 5.110   1.00 0.00 ? 61  ARG A NH1  3  
ATOM 4918  N NH2  . ARG A 1 61  ? 4.054   -11.672 6.537   1.00 0.00 ? 61  ARG A NH2  3  
ATOM 4919  H H    . ARG A 1 61  ? 0.442   -6.318  2.832   1.00 0.00 ? 61  ARG A H    3  
ATOM 4920  H HA   . ARG A 1 61  ? 1.607   -8.821  1.819   1.00 0.00 ? 61  ARG A HA   3  
ATOM 4921  H HB2  . ARG A 1 61  ? 1.562   -8.391  4.309   1.00 0.00 ? 61  ARG A HB2  3  
ATOM 4922  H HB3  . ARG A 1 61  ? -0.191  -8.489  4.220   1.00 0.00 ? 61  ARG A HB3  3  
ATOM 4923  H HG2  . ARG A 1 61  ? 0.000   -10.783 3.360   1.00 0.00 ? 61  ARG A HG2  3  
ATOM 4924  H HG3  . ARG A 1 61  ? 1.754   -10.677 3.521   1.00 0.00 ? 61  ARG A HG3  3  
ATOM 4925  H HD2  . ARG A 1 61  ? 0.043   -10.076 5.886   1.00 0.00 ? 61  ARG A HD2  3  
ATOM 4926  H HD3  . ARG A 1 61  ? 0.280   -11.757 5.411   1.00 0.00 ? 61  ARG A HD3  3  
ATOM 4927  H HE   . ARG A 1 61  ? 2.210   -10.013 6.626   1.00 0.00 ? 61  ARG A HE   3  
ATOM 4928  H HH11 . ARG A 1 61  ? 1.762   -12.825 4.624   1.00 0.00 ? 61  ARG A HH11 3  
ATOM 4929  H HH12 . ARG A 1 61  ? 3.312   -13.501 5.001   1.00 0.00 ? 61  ARG A HH12 3  
ATOM 4930  H HH21 . ARG A 1 61  ? 4.253   -10.893 7.131   1.00 0.00 ? 61  ARG A HH21 3  
ATOM 4931  H HH22 . ARG A 1 61  ? 4.728   -12.402 6.428   1.00 0.00 ? 61  ARG A HH22 3  
ATOM 4932  N N    . SER A 1 62  ? -0.399  -9.599  0.610   1.00 0.00 ? 62  SER A N    3  
ATOM 4933  C CA   . SER A 1 62  ? -1.557  -10.043 -0.156  1.00 0.00 ? 62  SER A CA   3  
ATOM 4934  C C    . SER A 1 62  ? -1.911  -11.488 0.182   1.00 0.00 ? 62  SER A C    3  
ATOM 4935  O O    . SER A 1 62  ? -1.216  -12.419 -0.222  1.00 0.00 ? 62  SER A O    3  
ATOM 4936  C CB   . SER A 1 62  ? -1.285  -9.911  -1.656  1.00 0.00 ? 62  SER A CB   3  
ATOM 4937  O OG   . SER A 1 62  ? -0.237  -10.775 -2.062  1.00 0.00 ? 62  SER A OG   3  
ATOM 4938  H H    . SER A 1 62  ? 0.488   -9.950  0.383   1.00 0.00 ? 62  SER A H    3  
ATOM 4939  H HA   . SER A 1 62  ? -2.391  -9.409  0.106   1.00 0.00 ? 62  SER A HA   3  
ATOM 4940  H HB2  . SER A 1 62  ? -2.178  -10.166 -2.206  1.00 0.00 ? 62  SER A HB2  3  
ATOM 4941  H HB3  . SER A 1 62  ? -1.002  -8.892  -1.879  1.00 0.00 ? 62  SER A HB3  3  
ATOM 4942  H HG   . SER A 1 62  ? -0.296  -11.600 -1.575  1.00 0.00 ? 62  SER A HG   3  
ATOM 4943  N N    . GLU A 1 63  ? -2.998  -11.665 0.927   1.00 0.00 ? 63  GLU A N    3  
ATOM 4944  C CA   . GLU A 1 63  ? -3.444  -12.996 1.322   1.00 0.00 ? 63  GLU A CA   3  
ATOM 4945  C C    . GLU A 1 63  ? -4.935  -13.174 1.048   1.00 0.00 ? 63  GLU A C    3  
ATOM 4946  O O    . GLU A 1 63  ? -5.743  -12.301 1.366   1.00 0.00 ? 63  GLU A O    3  
ATOM 4947  C CB   . GLU A 1 63  ? -3.154  -13.238 2.804   1.00 0.00 ? 63  GLU A CB   3  
ATOM 4948  C CG   . GLU A 1 63  ? -3.157  -14.706 3.194   1.00 0.00 ? 63  GLU A CG   3  
ATOM 4949  C CD   . GLU A 1 63  ? -3.005  -14.913 4.689   1.00 0.00 ? 63  GLU A CD   3  
ATOM 4950  O OE1  . GLU A 1 63  ? -1.897  -14.671 5.211   1.00 0.00 ? 63  GLU A OE1  3  
ATOM 4951  O OE2  . GLU A 1 63  ? -3.994  -15.318 5.335   1.00 0.00 ? 63  GLU A OE2  3  
ATOM 4952  H H    . GLU A 1 63  ? -3.511  -10.883 1.219   1.00 0.00 ? 63  GLU A H    3  
ATOM 4953  H HA   . GLU A 1 63  ? -2.895  -13.717 0.735   1.00 0.00 ? 63  GLU A HA   3  
ATOM 4954  H HB2  . GLU A 1 63  ? -2.184  -12.825 3.041   1.00 0.00 ? 63  GLU A HB2  3  
ATOM 4955  H HB3  . GLU A 1 63  ? -3.904  -12.730 3.392   1.00 0.00 ? 63  GLU A HB3  3  
ATOM 4956  H HG2  . GLU A 1 63  ? -4.090  -15.148 2.878   1.00 0.00 ? 63  GLU A HG2  3  
ATOM 4957  H HG3  . GLU A 1 63  ? -2.338  -15.200 2.692   1.00 0.00 ? 63  GLU A HG3  3  
ATOM 4958  N N    . ARG A 1 64  ? -5.292  -14.309 0.458   1.00 0.00 ? 64  ARG A N    3  
ATOM 4959  C CA   . ARG A 1 64  ? -6.684  -14.601 0.140   1.00 0.00 ? 64  ARG A CA   3  
ATOM 4960  C C    . ARG A 1 64  ? -7.429  -15.104 1.373   1.00 0.00 ? 64  ARG A C    3  
ATOM 4961  O O    . ARG A 1 64  ? -7.251  -16.246 1.796   1.00 0.00 ? 64  ARG A O    3  
ATOM 4962  C CB   . ARG A 1 64  ? -6.767  -15.641 -0.979  1.00 0.00 ? 64  ARG A CB   3  
ATOM 4963  C CG   . ARG A 1 64  ? -7.976  -15.467 -1.883  1.00 0.00 ? 64  ARG A CG   3  
ATOM 4964  C CD   . ARG A 1 64  ? -7.940  -16.438 -3.054  1.00 0.00 ? 64  ARG A CD   3  
ATOM 4965  N NE   . ARG A 1 64  ? -7.212  -15.891 -4.196  1.00 0.00 ? 64  ARG A NE   3  
ATOM 4966  C CZ   . ARG A 1 64  ? -7.244  -16.425 -5.412  1.00 0.00 ? 64  ARG A CZ   3  
ATOM 4967  N NH1  . ARG A 1 64  ? -7.965  -17.513 -5.643  1.00 0.00 ? 64  ARG A NH1  3  
ATOM 4968  N NH2  . ARG A 1 64  ? -6.554  -15.870 -6.400  1.00 0.00 ? 64  ARG A NH2  3  
ATOM 4969  H H    . ARG A 1 64  ? -4.602  -14.967 0.229   1.00 0.00 ? 64  ARG A H    3  
ATOM 4970  H HA   . ARG A 1 64  ? -7.147  -13.685 -0.197  1.00 0.00 ? 64  ARG A HA   3  
ATOM 4971  H HB2  . ARG A 1 64  ? -5.877  -15.571 -1.587  1.00 0.00 ? 64  ARG A HB2  3  
ATOM 4972  H HB3  . ARG A 1 64  ? -6.815  -16.625 -0.536  1.00 0.00 ? 64  ARG A HB3  3  
ATOM 4973  H HG2  . ARG A 1 64  ? -8.873  -15.647 -1.309  1.00 0.00 ? 64  ARG A HG2  3  
ATOM 4974  H HG3  . ARG A 1 64  ? -7.987  -14.457 -2.264  1.00 0.00 ? 64  ARG A HG3  3  
ATOM 4975  H HD2  . ARG A 1 64  ? -7.457  -17.349 -2.734  1.00 0.00 ? 64  ARG A HD2  3  
ATOM 4976  H HD3  . ARG A 1 64  ? -8.954  -16.655 -3.355  1.00 0.00 ? 64  ARG A HD3  3  
ATOM 4977  H HE   . ARG A 1 64  ? -6.673  -15.087 -4.047  1.00 0.00 ? 64  ARG A HE   3  
ATOM 4978  H HH11 . ARG A 1 64  ? -8.487  -17.933 -4.900  1.00 0.00 ? 64  ARG A HH11 3  
ATOM 4979  H HH12 . ARG A 1 64  ? -7.989  -17.912 -6.560  1.00 0.00 ? 64  ARG A HH12 3  
ATOM 4980  H HH21 . ARG A 1 64  ? -6.010  -15.049 -6.229  1.00 0.00 ? 64  ARG A HH21 3  
ATOM 4981  H HH22 . ARG A 1 64  ? -6.579  -16.272 -7.314  1.00 0.00 ? 64  ARG A HH22 3  
ATOM 4982  N N    . SER A 1 65  ? -8.265  -14.242 1.945   1.00 0.00 ? 65  SER A N    3  
ATOM 4983  C CA   . SER A 1 65  ? -9.034  -14.597 3.132   1.00 0.00 ? 65  SER A CA   3  
ATOM 4984  C C    . SER A 1 65  ? -9.563  -16.025 3.030   1.00 0.00 ? 65  SER A C    3  
ATOM 4985  O O    . SER A 1 65  ? -9.770  -16.544 1.934   1.00 0.00 ? 65  SER A O    3  
ATOM 4986  C CB   . SER A 1 65  ? -10.198 -13.622 3.322   1.00 0.00 ? 65  SER A CB   3  
ATOM 4987  O OG   . SER A 1 65  ? -10.926 -13.920 4.501   1.00 0.00 ? 65  SER A OG   3  
ATOM 4988  H H    . SER A 1 65  ? -8.364  -13.346 1.561   1.00 0.00 ? 65  SER A H    3  
ATOM 4989  H HA   . SER A 1 65  ? -8.376  -14.530 3.986   1.00 0.00 ? 65  SER A HA   3  
ATOM 4990  H HB2  . SER A 1 65  ? -9.813  -12.617 3.395   1.00 0.00 ? 65  SER A HB2  3  
ATOM 4991  H HB3  . SER A 1 65  ? -10.864 -13.692 2.474   1.00 0.00 ? 65  SER A HB3  3  
ATOM 4992  H HG   . SER A 1 65  ? -11.169 -13.103 4.942   1.00 0.00 ? 65  SER A HG   3  
ATOM 4993  N N    . ASN A 1 66  ? -9.779  -16.652 4.181   1.00 0.00 ? 66  ASN A N    3  
ATOM 4994  C CA   . ASN A 1 66  ? -10.284 -18.020 4.223   1.00 0.00 ? 66  ASN A CA   3  
ATOM 4995  C C    . ASN A 1 66  ? -11.491 -18.183 3.304   1.00 0.00 ? 66  ASN A C    3  
ATOM 4996  O O    . ASN A 1 66  ? -11.784 -19.283 2.837   1.00 0.00 ? 66  ASN A O    3  
ATOM 4997  C CB   . ASN A 1 66  ? -10.663 -18.403 5.655   1.00 0.00 ? 66  ASN A CB   3  
ATOM 4998  C CG   . ASN A 1 66  ? -9.570  -18.069 6.652   1.00 0.00 ? 66  ASN A CG   3  
ATOM 4999  O OD1  . ASN A 1 66  ? -9.827  -17.465 7.693   1.00 0.00 ? 66  ASN A OD1  3  
ATOM 5000  N ND2  . ASN A 1 66  ? -8.341  -18.462 6.336   1.00 0.00 ? 66  ASN A ND2  3  
ATOM 5001  H H    . ASN A 1 66  ? -9.595  -16.185 5.023   1.00 0.00 ? 66  ASN A H    3  
ATOM 5002  H HA   . ASN A 1 66  ? -9.495  -18.674 3.882   1.00 0.00 ? 66  ASN A HA   3  
ATOM 5003  H HB2  . ASN A 1 66  ? -11.558 -17.867 5.939   1.00 0.00 ? 66  ASN A HB2  3  
ATOM 5004  H HB3  . ASN A 1 66  ? -10.854 -19.464 5.700   1.00 0.00 ? 66  ASN A HB3  3  
ATOM 5005  H HD21 . ASN A 1 66  ? -8.211  -18.939 5.489   1.00 0.00 ? 66  ASN A HD21 3  
ATOM 5006  H HD22 . ASN A 1 66  ? -7.616  -18.260 6.962   1.00 0.00 ? 66  ASN A HD22 3  
ATOM 5007  N N    . SER A 1 67  ? -12.187 -17.080 3.050   1.00 0.00 ? 67  SER A N    3  
ATOM 5008  C CA   . SER A 1 67  ? -13.364 -17.100 2.190   1.00 0.00 ? 67  SER A CA   3  
ATOM 5009  C C    . SER A 1 67  ? -12.968 -17.314 0.732   1.00 0.00 ? 67  SER A C    3  
ATOM 5010  O O    . SER A 1 67  ? -13.684 -17.964 -0.029  1.00 0.00 ? 67  SER A O    3  
ATOM 5011  C CB   . SER A 1 67  ? -14.148 -15.794 2.331   1.00 0.00 ? 67  SER A CB   3  
ATOM 5012  O OG   . SER A 1 67  ? -13.285 -14.672 2.272   1.00 0.00 ? 67  SER A OG   3  
ATOM 5013  H H    . SER A 1 67  ? -11.903 -16.232 3.452   1.00 0.00 ? 67  SER A H    3  
ATOM 5014  H HA   . SER A 1 67  ? -13.990 -17.922 2.504   1.00 0.00 ? 67  SER A HA   3  
ATOM 5015  H HB2  . SER A 1 67  ? -14.868 -15.721 1.531   1.00 0.00 ? 67  SER A HB2  3  
ATOM 5016  H HB3  . SER A 1 67  ? -14.663 -15.788 3.281   1.00 0.00 ? 67  SER A HB3  3  
ATOM 5017  H HG   . SER A 1 67  ? -13.040 -14.409 3.162   1.00 0.00 ? 67  SER A HG   3  
ATOM 5018  N N    . GLY A 1 68  ? -11.821 -16.760 0.349   1.00 0.00 ? 68  GLY A N    3  
ATOM 5019  C CA   . GLY A 1 68  ? -11.349 -16.900 -1.016  1.00 0.00 ? 68  GLY A CA   3  
ATOM 5020  C C    . GLY A 1 68  ? -11.194 -15.565 -1.715  1.00 0.00 ? 68  GLY A C    3  
ATOM 5021  O O    . GLY A 1 68  ? -11.103 -15.506 -2.941  1.00 0.00 ? 68  GLY A O    3  
ATOM 5022  H H    . GLY A 1 68  ? -11.292 -16.253 0.999   1.00 0.00 ? 68  GLY A H    3  
ATOM 5023  H HA2  . GLY A 1 68  ? -10.393 -17.403 -1.005  1.00 0.00 ? 68  GLY A HA2  3  
ATOM 5024  H HA3  . GLY A 1 68  ? -12.055 -17.503 -1.569  1.00 0.00 ? 68  GLY A HA3  3  
ATOM 5025  N N    . GLU A 1 69  ? -11.164 -14.489 -0.935  1.00 0.00 ? 69  GLU A N    3  
ATOM 5026  C CA   . GLU A 1 69  ? -11.021 -13.148 -1.488  1.00 0.00 ? 69  GLU A CA   3  
ATOM 5027  C C    . GLU A 1 69  ? -9.648  -12.568 -1.162  1.00 0.00 ? 69  GLU A C    3  
ATOM 5028  O O    . GLU A 1 69  ? -9.179  -12.654 -0.027  1.00 0.00 ? 69  GLU A O    3  
ATOM 5029  C CB   . GLU A 1 69  ? -12.117 -12.229 -0.945  1.00 0.00 ? 69  GLU A CB   3  
ATOM 5030  C CG   . GLU A 1 69  ? -11.748 -11.547 0.361   1.00 0.00 ? 69  GLU A CG   3  
ATOM 5031  C CD   . GLU A 1 69  ? -12.936 -10.878 1.026   1.00 0.00 ? 69  GLU A CD   3  
ATOM 5032  O OE1  . GLU A 1 69  ? -13.516 -9.956  0.417   1.00 0.00 ? 69  GLU A OE1  3  
ATOM 5033  O OE2  . GLU A 1 69  ? -13.285 -11.278 2.157   1.00 0.00 ? 69  GLU A OE2  3  
ATOM 5034  H H    . GLU A 1 69  ? -11.241 -14.600 0.036   1.00 0.00 ? 69  GLU A H    3  
ATOM 5035  H HA   . GLU A 1 69  ? -11.123 -13.219 -2.561  1.00 0.00 ? 69  GLU A HA   3  
ATOM 5036  H HB2  . GLU A 1 69  ? -12.326 -11.465 -1.680  1.00 0.00 ? 69  GLU A HB2  3  
ATOM 5037  H HB3  . GLU A 1 69  ? -13.011 -12.812 -0.782  1.00 0.00 ? 69  GLU A HB3  3  
ATOM 5038  H HG2  . GLU A 1 69  ? -11.347 -12.287 1.038   1.00 0.00 ? 69  GLU A HG2  3  
ATOM 5039  H HG3  . GLU A 1 69  ? -10.997 -10.798 0.162   1.00 0.00 ? 69  GLU A HG3  3  
ATOM 5040  N N    . VAL A 1 70  ? -9.008  -11.977 -2.166  1.00 0.00 ? 70  VAL A N    3  
ATOM 5041  C CA   . VAL A 1 70  ? -7.689  -11.382 -1.987  1.00 0.00 ? 70  VAL A CA   3  
ATOM 5042  C C    . VAL A 1 70  ? -7.770  -10.102 -1.164  1.00 0.00 ? 70  VAL A C    3  
ATOM 5043  O O    . VAL A 1 70  ? -8.397  -9.125  -1.577  1.00 0.00 ? 70  VAL A O    3  
ATOM 5044  C CB   . VAL A 1 70  ? -7.027  -11.067 -3.342  1.00 0.00 ? 70  VAL A CB   3  
ATOM 5045  C CG1  . VAL A 1 70  ? -5.730  -10.299 -3.137  1.00 0.00 ? 70  VAL A CG1  3  
ATOM 5046  C CG2  . VAL A 1 70  ? -6.779  -12.348 -4.124  1.00 0.00 ? 70  VAL A CG2  3  
ATOM 5047  H H    . VAL A 1 70  ? -9.433  -11.940 -3.048  1.00 0.00 ? 70  VAL A H    3  
ATOM 5048  H HA   . VAL A 1 70  ? -7.069  -12.096 -1.465  1.00 0.00 ? 70  VAL A HA   3  
ATOM 5049  H HB   . VAL A 1 70  ? -7.701  -10.446 -3.913  1.00 0.00 ? 70  VAL A HB   3  
ATOM 5050  H HG11 . VAL A 1 70  ? -5.154  -10.768 -2.353  1.00 0.00 ? 70  VAL A HG11 3  
ATOM 5051  H HG12 . VAL A 1 70  ? -5.160  -10.302 -4.055  1.00 0.00 ? 70  VAL A HG12 3  
ATOM 5052  H HG13 . VAL A 1 70  ? -5.956  -9.281  -2.857  1.00 0.00 ? 70  VAL A HG13 3  
ATOM 5053  H HG21 . VAL A 1 70  ? -6.965  -13.201 -3.488  1.00 0.00 ? 70  VAL A HG21 3  
ATOM 5054  H HG22 . VAL A 1 70  ? -7.442  -12.383 -4.976  1.00 0.00 ? 70  VAL A HG22 3  
ATOM 5055  H HG23 . VAL A 1 70  ? -5.754  -12.370 -4.464  1.00 0.00 ? 70  VAL A HG23 3  
ATOM 5056  N N    . ILE A 1 71  ? -7.134  -10.113 0.002   1.00 0.00 ? 71  ILE A N    3  
ATOM 5057  C CA   . ILE A 1 71  ? -7.133  -8.952  0.883   1.00 0.00 ? 71  ILE A CA   3  
ATOM 5058  C C    . ILE A 1 71  ? -5.714  -8.455  1.136   1.00 0.00 ? 71  ILE A C    3  
ATOM 5059  O O    . ILE A 1 71  ? -4.811  -9.240  1.425   1.00 0.00 ? 71  ILE A O    3  
ATOM 5060  C CB   . ILE A 1 71  ? -7.802  -9.269  2.233   1.00 0.00 ? 71  ILE A CB   3  
ATOM 5061  C CG1  . ILE A 1 71  ? -9.181  -9.895  2.010   1.00 0.00 ? 71  ILE A CG1  3  
ATOM 5062  C CG2  . ILE A 1 71  ? -7.918  -8.008  3.076   1.00 0.00 ? 71  ILE A CG2  3  
ATOM 5063  C CD1  . ILE A 1 71  ? -10.296 -8.879  1.909   1.00 0.00 ? 71  ILE A CD1  3  
ATOM 5064  H H    . ILE A 1 71  ? -6.652  -10.921 0.276   1.00 0.00 ? 71  ILE A H    3  
ATOM 5065  H HA   . ILE A 1 71  ? -7.697  -8.167  0.400   1.00 0.00 ? 71  ILE A HA   3  
ATOM 5066  H HB   . ILE A 1 71  ? -7.177  -9.972  2.763   1.00 0.00 ? 71  ILE A HB   3  
ATOM 5067  H HG12 . ILE A 1 71  ? -9.167  -10.464 1.093   1.00 0.00 ? 71  ILE A HG12 3  
ATOM 5068  H HG13 . ILE A 1 71  ? -9.406  -10.555 2.835   1.00 0.00 ? 71  ILE A HG13 3  
ATOM 5069  H HG21 . ILE A 1 71  ? -8.533  -8.208  3.941   1.00 0.00 ? 71  ILE A HG21 3  
ATOM 5070  H HG22 . ILE A 1 71  ? -6.935  -7.700  3.399   1.00 0.00 ? 71  ILE A HG22 3  
ATOM 5071  H HG23 . ILE A 1 71  ? -8.367  -7.222  2.489   1.00 0.00 ? 71  ILE A HG23 3  
ATOM 5072  H HD11 . ILE A 1 71  ? -11.220 -9.382  1.659   1.00 0.00 ? 71  ILE A HD11 3  
ATOM 5073  H HD12 . ILE A 1 71  ? -10.409 -8.371  2.855   1.00 0.00 ? 71  ILE A HD12 3  
ATOM 5074  H HD13 . ILE A 1 71  ? -10.060 -8.159  1.139   1.00 0.00 ? 71  ILE A HD13 3  
ATOM 5075  N N    . VAL A 1 72  ? -5.524  -7.143  1.028   1.00 0.00 ? 72  VAL A N    3  
ATOM 5076  C CA   . VAL A 1 72  ? -4.215  -6.540  1.248   1.00 0.00 ? 72  VAL A CA   3  
ATOM 5077  C C    . VAL A 1 72  ? -4.173  -5.786  2.572   1.00 0.00 ? 72  VAL A C    3  
ATOM 5078  O O    . VAL A 1 72  ? -5.119  -5.083  2.930   1.00 0.00 ? 72  VAL A O    3  
ATOM 5079  C CB   . VAL A 1 72  ? -3.844  -5.573  0.107   1.00 0.00 ? 72  VAL A CB   3  
ATOM 5080  C CG1  . VAL A 1 72  ? -2.596  -4.780  0.464   1.00 0.00 ? 72  VAL A CG1  3  
ATOM 5081  C CG2  . VAL A 1 72  ? -3.647  -6.336  -1.194  1.00 0.00 ? 72  VAL A CG2  3  
ATOM 5082  H H    . VAL A 1 72  ? -6.283  -6.568  0.795   1.00 0.00 ? 72  VAL A H    3  
ATOM 5083  H HA   . VAL A 1 72  ? -3.482  -7.333  1.272   1.00 0.00 ? 72  VAL A HA   3  
ATOM 5084  H HB   . VAL A 1 72  ? -4.660  -4.877  -0.027  1.00 0.00 ? 72  VAL A HB   3  
ATOM 5085  H HG11 . VAL A 1 72  ? -2.130  -4.418  -0.440  1.00 0.00 ? 72  VAL A HG11 3  
ATOM 5086  H HG12 . VAL A 1 72  ? -2.868  -3.943  1.091   1.00 0.00 ? 72  VAL A HG12 3  
ATOM 5087  H HG13 . VAL A 1 72  ? -1.905  -5.417  0.995   1.00 0.00 ? 72  VAL A HG13 3  
ATOM 5088  H HG21 . VAL A 1 72  ? -3.202  -7.297  -0.985  1.00 0.00 ? 72  VAL A HG21 3  
ATOM 5089  H HG22 . VAL A 1 72  ? -4.603  -6.478  -1.675  1.00 0.00 ? 72  VAL A HG22 3  
ATOM 5090  H HG23 . VAL A 1 72  ? -2.996  -5.772  -1.847  1.00 0.00 ? 72  VAL A HG23 3  
ATOM 5091  N N    . THR A 1 73  ? -3.070  -5.937  3.298   1.00 0.00 ? 73  THR A N    3  
ATOM 5092  C CA   . THR A 1 73  ? -2.904  -5.271  4.584   1.00 0.00 ? 73  THR A CA   3  
ATOM 5093  C C    . THR A 1 73  ? -1.620  -4.449  4.616   1.00 0.00 ? 73  THR A C    3  
ATOM 5094  O O    . THR A 1 73  ? -0.567  -4.906  4.170   1.00 0.00 ? 73  THR A O    3  
ATOM 5095  C CB   . THR A 1 73  ? -2.879  -6.286  5.742   1.00 0.00 ? 73  THR A CB   3  
ATOM 5096  O OG1  . THR A 1 73  ? -3.695  -7.418  5.420   1.00 0.00 ? 73  THR A OG1  3  
ATOM 5097  C CG2  . THR A 1 73  ? -3.376  -5.647  7.031   1.00 0.00 ? 73  THR A CG2  3  
ATOM 5098  H H    . THR A 1 73  ? -2.351  -6.510  2.959   1.00 0.00 ? 73  THR A H    3  
ATOM 5099  H HA   . THR A 1 73  ? -3.746  -4.611  4.729   1.00 0.00 ? 73  THR A HA   3  
ATOM 5100  H HB   . THR A 1 73  ? -1.861  -6.615  5.891   1.00 0.00 ? 73  THR A HB   3  
ATOM 5101  H HG1  . THR A 1 73  ? -4.345  -7.166  4.759   1.00 0.00 ? 73  THR A HG1  3  
ATOM 5102  H HG21 . THR A 1 73  ? -2.834  -4.731  7.210   1.00 0.00 ? 73  THR A HG21 3  
ATOM 5103  H HG22 . THR A 1 73  ? -3.216  -6.327  7.855   1.00 0.00 ? 73  THR A HG22 3  
ATOM 5104  H HG23 . THR A 1 73  ? -4.430  -5.431  6.942   1.00 0.00 ? 73  THR A HG23 3  
ATOM 5105  N N    . LEU A 1 74  ? -1.714  -3.235  5.146   1.00 0.00 ? 74  LEU A N    3  
ATOM 5106  C CA   . LEU A 1 74  ? -0.559  -2.349  5.237   1.00 0.00 ? 74  LEU A CA   3  
ATOM 5107  C C    . LEU A 1 74  ? 0.117   -2.473  6.599   1.00 0.00 ? 74  LEU A C    3  
ATOM 5108  O O    . LEU A 1 74  ? -0.516  -2.280  7.636   1.00 0.00 ? 74  LEU A O    3  
ATOM 5109  C CB   . LEU A 1 74  ? -0.983  -0.899  4.997   1.00 0.00 ? 74  LEU A CB   3  
ATOM 5110  C CG   . LEU A 1 74  ? 0.126   0.150   5.090   1.00 0.00 ? 74  LEU A CG   3  
ATOM 5111  C CD1  . LEU A 1 74  ? 0.806   0.329   3.742   1.00 0.00 ? 74  LEU A CD1  3  
ATOM 5112  C CD2  . LEU A 1 74  ? -0.433  1.475   5.588   1.00 0.00 ? 74  LEU A CD2  3  
ATOM 5113  H H    . LEU A 1 74  ? -2.580  -2.926  5.484   1.00 0.00 ? 74  LEU A H    3  
ATOM 5114  H HA   . LEU A 1 74  ? 0.144   -2.641  4.472   1.00 0.00 ? 74  LEU A HA   3  
ATOM 5115  H HB2  . LEU A 1 74  ? -1.411  -0.839  4.008   1.00 0.00 ? 74  LEU A HB2  3  
ATOM 5116  H HB3  . LEU A 1 74  ? -1.738  -0.650  5.729   1.00 0.00 ? 74  LEU A HB3  3  
ATOM 5117  H HG   . LEU A 1 74  ? 0.871   -0.186  5.798   1.00 0.00 ? 74  LEU A HG   3  
ATOM 5118  H HD11 . LEU A 1 74  ? 1.522   1.135   3.805   1.00 0.00 ? 74  LEU A HD11 3  
ATOM 5119  H HD12 . LEU A 1 74  ? 0.065   0.563   2.993   1.00 0.00 ? 74  LEU A HD12 3  
ATOM 5120  H HD13 . LEU A 1 74  ? 1.315   -0.585  3.472   1.00 0.00 ? 74  LEU A HD13 3  
ATOM 5121  H HD21 . LEU A 1 74  ? -1.457  1.337   5.904   1.00 0.00 ? 74  LEU A HD21 3  
ATOM 5122  H HD22 . LEU A 1 74  ? -0.397  2.202   4.791   1.00 0.00 ? 74  LEU A HD22 3  
ATOM 5123  H HD23 . LEU A 1 74  ? 0.158   1.825   6.422   1.00 0.00 ? 74  LEU A HD23 3  
ATOM 5124  N N    . GLU A 1 75  ? 1.407   -2.796  6.587   1.00 0.00 ? 75  GLU A N    3  
ATOM 5125  C CA   . GLU A 1 75  ? 2.168   -2.945  7.821   1.00 0.00 ? 75  GLU A CA   3  
ATOM 5126  C C    . GLU A 1 75  ? 3.178   -1.812  7.978   1.00 0.00 ? 75  GLU A C    3  
ATOM 5127  O O    . GLU A 1 75  ? 4.365   -1.959  7.686   1.00 0.00 ? 75  GLU A O    3  
ATOM 5128  C CB   . GLU A 1 75  ? 2.891   -4.293  7.841   1.00 0.00 ? 75  GLU A CB   3  
ATOM 5129  C CG   . GLU A 1 75  ? 2.031   -5.453  7.368   1.00 0.00 ? 75  GLU A CG   3  
ATOM 5130  C CD   . GLU A 1 75  ? 2.601   -6.801  7.762   1.00 0.00 ? 75  GLU A CD   3  
ATOM 5131  O OE1  . GLU A 1 75  ? 3.843   -6.932  7.797   1.00 0.00 ? 75  GLU A OE1  3  
ATOM 5132  O OE2  . GLU A 1 75  ? 1.807   -7.725  8.036   1.00 0.00 ? 75  GLU A OE2  3  
ATOM 5133  H H    . GLU A 1 75  ? 1.856   -2.938  5.727   1.00 0.00 ? 75  GLU A H    3  
ATOM 5134  H HA   . GLU A 1 75  ? 1.473   -2.908  8.646   1.00 0.00 ? 75  GLU A HA   3  
ATOM 5135  H HB2  . GLU A 1 75  ? 3.760   -4.232  7.202   1.00 0.00 ? 75  GLU A HB2  3  
ATOM 5136  H HB3  . GLU A 1 75  ? 3.213   -4.500  8.851   1.00 0.00 ? 75  GLU A HB3  3  
ATOM 5137  H HG2  . GLU A 1 75  ? 1.047   -5.355  7.803   1.00 0.00 ? 75  GLU A HG2  3  
ATOM 5138  H HG3  . GLU A 1 75  ? 1.953   -5.411  6.292   1.00 0.00 ? 75  GLU A HG3  3  
ATOM 5139  N N    . PRO A 1 76  ? 2.696   -0.652  8.449   1.00 0.00 ? 76  PRO A N    3  
ATOM 5140  C CA   . PRO A 1 76  ? 3.539   0.530   8.655   1.00 0.00 ? 76  PRO A CA   3  
ATOM 5141  C C    . PRO A 1 76  ? 4.514   0.351   9.813   1.00 0.00 ? 76  PRO A C    3  
ATOM 5142  O O    . PRO A 1 76  ? 4.276   -0.448  10.720  1.00 0.00 ? 76  PRO A O    3  
ATOM 5143  C CB   . PRO A 1 76  ? 2.529   1.635   8.972   1.00 0.00 ? 76  PRO A CB   3  
ATOM 5144  C CG   . PRO A 1 76  ? 1.346   0.920   9.528   1.00 0.00 ? 76  PRO A CG   3  
ATOM 5145  C CD   . PRO A 1 76  ? 1.292   -0.405  8.817   1.00 0.00 ? 76  PRO A CD   3  
ATOM 5146  H HA   . PRO A 1 76  ? 4.088   0.787   7.761   1.00 0.00 ? 76  PRO A HA   3  
ATOM 5147  H HB2  . PRO A 1 76  ? 2.953   2.318   9.694   1.00 0.00 ? 76  PRO A HB2  3  
ATOM 5148  H HB3  . PRO A 1 76  ? 2.278   2.169   8.068   1.00 0.00 ? 76  PRO A HB3  3  
ATOM 5149  H HG2  . PRO A 1 76  ? 1.472   0.771   10.589  1.00 0.00 ? 76  PRO A HG2  3  
ATOM 5150  H HG3  . PRO A 1 76  ? 0.448   1.487   9.331   1.00 0.00 ? 76  PRO A HG3  3  
ATOM 5151  H HD2  . PRO A 1 76  ? 0.926   -1.174  9.480   1.00 0.00 ? 76  PRO A HD2  3  
ATOM 5152  H HD3  . PRO A 1 76  ? 0.670   -0.335  7.937   1.00 0.00 ? 76  PRO A HD3  3  
ATOM 5153  N N    . CYS A 1 77  ? 5.611   1.100   9.778   1.00 0.00 ? 77  CYS A N    3  
ATOM 5154  C CA   . CYS A 1 77  ? 6.623   1.024   10.826  1.00 0.00 ? 77  CYS A CA   3  
ATOM 5155  C C    . CYS A 1 77  ? 6.249   1.911   12.009  1.00 0.00 ? 77  CYS A C    3  
ATOM 5156  O O    . CYS A 1 77  ? 5.348   2.743   11.911  1.00 0.00 ? 77  CYS A O    3  
ATOM 5157  C CB   . CYS A 1 77  ? 7.989   1.436   10.275  1.00 0.00 ? 77  CYS A CB   3  
ATOM 5158  S SG   . CYS A 1 77  ? 9.391   0.753   11.191  1.00 0.00 ? 77  CYS A SG   3  
ATOM 5159  H H    . CYS A 1 77  ? 5.745   1.718   9.030   1.00 0.00 ? 77  CYS A H    3  
ATOM 5160  H HA   . CYS A 1 77  ? 6.674   -0.001  11.162  1.00 0.00 ? 77  CYS A HA   3  
ATOM 5161  H HB2  . CYS A 1 77  ? 8.072   1.102   9.252   1.00 0.00 ? 77  CYS A HB2  3  
ATOM 5162  H HB3  . CYS A 1 77  ? 8.069   2.513   10.303  1.00 0.00 ? 77  CYS A HB3  3  
ATOM 5163  H HG   . CYS A 1 77  ? 10.129  1.764   11.621  1.00 0.00 ? 77  CYS A HG   3  
ATOM 5164  N N    . GLU A 1 78  ? 6.946   1.724   13.125  1.00 0.00 ? 78  GLU A N    3  
ATOM 5165  C CA   . GLU A 1 78  ? 6.684   2.507   14.328  1.00 0.00 ? 78  GLU A CA   3  
ATOM 5166  C C    . GLU A 1 78  ? 7.532   3.775   14.347  1.00 0.00 ? 78  GLU A C    3  
ATOM 5167  O O    . GLU A 1 78  ? 7.386   4.619   15.231  1.00 0.00 ? 78  GLU A O    3  
ATOM 5168  C CB   . GLU A 1 78  ? 6.967   1.671   15.578  1.00 0.00 ? 78  GLU A CB   3  
ATOM 5169  C CG   . GLU A 1 78  ? 8.071   0.645   15.387  1.00 0.00 ? 78  GLU A CG   3  
ATOM 5170  C CD   . GLU A 1 78  ? 8.595   0.101   16.702  1.00 0.00 ? 78  GLU A CD   3  
ATOM 5171  O OE1  . GLU A 1 78  ? 9.545   0.695   17.252  1.00 0.00 ? 78  GLU A OE1  3  
ATOM 5172  O OE2  . GLU A 1 78  ? 8.056   -0.919  17.180  1.00 0.00 ? 78  GLU A OE2  3  
ATOM 5173  H H    . GLU A 1 78  ? 7.652   1.045   13.141  1.00 0.00 ? 78  GLU A H    3  
ATOM 5174  H HA   . GLU A 1 78  ? 5.641   2.786   14.321  1.00 0.00 ? 78  GLU A HA   3  
ATOM 5175  H HB2  . GLU A 1 78  ? 7.254   2.334   16.382  1.00 0.00 ? 78  GLU A HB2  3  
ATOM 5176  H HB3  . GLU A 1 78  ? 6.064   1.150   15.859  1.00 0.00 ? 78  GLU A HB3  3  
ATOM 5177  H HG2  . GLU A 1 78  ? 7.684   -0.177  14.804  1.00 0.00 ? 78  GLU A HG2  3  
ATOM 5178  H HG3  . GLU A 1 78  ? 8.888   1.109   14.855  1.00 0.00 ? 78  GLU A HG3  3  
ATOM 5179  N N    . ARG A 1 79  ? 8.420   3.901   13.366  1.00 0.00 ? 79  ARG A N    3  
ATOM 5180  C CA   . ARG A 1 79  ? 9.293   5.065   13.271  1.00 0.00 ? 79  ARG A CA   3  
ATOM 5181  C C    . ARG A 1 79  ? 9.176   5.721   11.899  1.00 0.00 ? 79  ARG A C    3  
ATOM 5182  O O    . ARG A 1 79  ? 10.088  6.418   11.453  1.00 0.00 ? 79  ARG A O    3  
ATOM 5183  C CB   . ARG A 1 79  ? 10.746  4.662   13.533  1.00 0.00 ? 79  ARG A CB   3  
ATOM 5184  C CG   . ARG A 1 79  ? 11.149  4.753   14.996  1.00 0.00 ? 79  ARG A CG   3  
ATOM 5185  C CD   . ARG A 1 79  ? 12.591  5.209   15.148  1.00 0.00 ? 79  ARG A CD   3  
ATOM 5186  N NE   . ARG A 1 79  ? 13.429  4.756   14.041  1.00 0.00 ? 79  ARG A NE   3  
ATOM 5187  C CZ   . ARG A 1 79  ? 14.688  5.140   13.867  1.00 0.00 ? 79  ARG A CZ   3  
ATOM 5188  N NH1  . ARG A 1 79  ? 15.253  5.981   14.723  1.00 0.00 ? 79  ARG A NH1  3  
ATOM 5189  N NH2  . ARG A 1 79  ? 15.386  4.684   12.835  1.00 0.00 ? 79  ARG A NH2  3  
ATOM 5190  H H    . ARG A 1 79  ? 8.490   3.194   12.691  1.00 0.00 ? 79  ARG A H    3  
ATOM 5191  H HA   . ARG A 1 79  ? 8.984   5.774   14.024  1.00 0.00 ? 79  ARG A HA   3  
ATOM 5192  H HB2  . ARG A 1 79  ? 10.889  3.642   13.206  1.00 0.00 ? 79  ARG A HB2  3  
ATOM 5193  H HB3  . ARG A 1 79  ? 11.394  5.308   12.962  1.00 0.00 ? 79  ARG A HB3  3  
ATOM 5194  H HG2  . ARG A 1 79  ? 10.504  5.463   15.493  1.00 0.00 ? 79  ARG A HG2  3  
ATOM 5195  H HG3  . ARG A 1 79  ? 11.037  3.781   15.452  1.00 0.00 ? 79  ARG A HG3  3  
ATOM 5196  H HD2  . ARG A 1 79  ? 12.612  6.288   15.184  1.00 0.00 ? 79  ARG A HD2  3  
ATOM 5197  H HD3  . ARG A 1 79  ? 12.984  4.811   16.072  1.00 0.00 ? 79  ARG A HD3  3  
ATOM 5198  H HE   . ARG A 1 79  ? 13.032  4.134   13.397  1.00 0.00 ? 79  ARG A HE   3  
ATOM 5199  H HH11 . ARG A 1 79  ? 14.730  6.326   15.502  1.00 0.00 ? 79  ARG A HH11 3  
ATOM 5200  H HH12 . ARG A 1 79  ? 16.202  6.268   14.590  1.00 0.00 ? 79  ARG A HH12 3  
ATOM 5201  H HH21 . ARG A 1 79  ? 14.964  4.050   12.187  1.00 0.00 ? 79  ARG A HH21 3  
ATOM 5202  H HH22 . ARG A 1 79  ? 16.333  4.974   12.704  1.00 0.00 ? 79  ARG A HH22 3  
ATOM 5203  N N    . SER A 1 80  ? 8.048   5.494   11.234  1.00 0.00 ? 80  SER A N    3  
ATOM 5204  C CA   . SER A 1 80  ? 7.813   6.060   9.911   1.00 0.00 ? 80  SER A CA   3  
ATOM 5205  C C    . SER A 1 80  ? 6.518   6.866   9.886   1.00 0.00 ? 80  SER A C    3  
ATOM 5206  O O    . SER A 1 80  ? 5.721   6.807   10.822  1.00 0.00 ? 80  SER A O    3  
ATOM 5207  C CB   . SER A 1 80  ? 7.755   4.949   8.860   1.00 0.00 ? 80  SER A CB   3  
ATOM 5208  O OG   . SER A 1 80  ? 6.595   4.152   9.024   1.00 0.00 ? 80  SER A OG   3  
ATOM 5209  H H    . SER A 1 80  ? 7.358   4.930   11.642  1.00 0.00 ? 80  SER A H    3  
ATOM 5210  H HA   . SER A 1 80  ? 8.637   6.718   9.681   1.00 0.00 ? 80  SER A HA   3  
ATOM 5211  H HB2  . SER A 1 80  ? 7.739   5.389   7.875   1.00 0.00 ? 80  SER A HB2  3  
ATOM 5212  H HB3  . SER A 1 80  ? 8.627   4.318   8.959   1.00 0.00 ? 80  SER A HB3  3  
ATOM 5213  H HG   . SER A 1 80  ? 6.542   3.846   9.932   1.00 0.00 ? 80  SER A HG   3  
ATOM 5214  N N    . GLU A 1 81  ? 6.316   7.618   8.809   1.00 0.00 ? 81  GLU A N    3  
ATOM 5215  C CA   . GLU A 1 81  ? 5.118   8.436   8.663   1.00 0.00 ? 81  GLU A CA   3  
ATOM 5216  C C    . GLU A 1 81  ? 4.223   7.897   7.551   1.00 0.00 ? 81  GLU A C    3  
ATOM 5217  O O    . GLU A 1 81  ? 4.505   8.078   6.366   1.00 0.00 ? 81  GLU A O    3  
ATOM 5218  C CB   . GLU A 1 81  ? 5.499   9.888   8.366   1.00 0.00 ? 81  GLU A CB   3  
ATOM 5219  C CG   . GLU A 1 81  ? 5.710   10.730  9.614   1.00 0.00 ? 81  GLU A CG   3  
ATOM 5220  C CD   . GLU A 1 81  ? 7.037   10.447  10.291  1.00 0.00 ? 81  GLU A CD   3  
ATOM 5221  O OE1  . GLU A 1 81  ? 8.085   10.603  9.630   1.00 0.00 ? 81  GLU A OE1  3  
ATOM 5222  O OE2  . GLU A 1 81  ? 7.027   10.068  11.481  1.00 0.00 ? 81  GLU A OE2  3  
ATOM 5223  H H    . GLU A 1 81  ? 6.988   7.622   8.096   1.00 0.00 ? 81  GLU A H    3  
ATOM 5224  H HA   . GLU A 1 81  ? 4.576   8.400   9.595   1.00 0.00 ? 81  GLU A HA   3  
ATOM 5225  H HB2  . GLU A 1 81  ? 6.414   9.898   7.791   1.00 0.00 ? 81  GLU A HB2  3  
ATOM 5226  H HB3  . GLU A 1 81  ? 4.713   10.341  7.781   1.00 0.00 ? 81  GLU A HB3  3  
ATOM 5227  H HG2  . GLU A 1 81  ? 5.679   11.773  9.338   1.00 0.00 ? 81  GLU A HG2  3  
ATOM 5228  H HG3  . GLU A 1 81  ? 4.913   10.520  10.313  1.00 0.00 ? 81  GLU A HG3  3  
ATOM 5229  N N    . THR A 1 82  ? 3.140   7.232   7.942   1.00 0.00 ? 82  THR A N    3  
ATOM 5230  C CA   . THR A 1 82  ? 2.203   6.664   6.981   1.00 0.00 ? 82  THR A CA   3  
ATOM 5231  C C    . THR A 1 82  ? 0.784   7.155   7.240   1.00 0.00 ? 82  THR A C    3  
ATOM 5232  O O    . THR A 1 82  ? 0.326   7.185   8.383   1.00 0.00 ? 82  THR A O    3  
ATOM 5233  C CB   . THR A 1 82  ? 2.218   5.124   7.025   1.00 0.00 ? 82  THR A CB   3  
ATOM 5234  O OG1  . THR A 1 82  ? 3.567   4.648   7.080   1.00 0.00 ? 82  THR A OG1  3  
ATOM 5235  C CG2  . THR A 1 82  ? 1.519   4.541   5.806   1.00 0.00 ? 82  THR A CG2  3  
ATOM 5236  H H    . THR A 1 82  ? 2.969   7.120   8.901   1.00 0.00 ? 82  THR A H    3  
ATOM 5237  H HA   . THR A 1 82  ? 2.508   6.978   5.993   1.00 0.00 ? 82  THR A HA   3  
ATOM 5238  H HB   . THR A 1 82  ? 1.693   4.799   7.912   1.00 0.00 ? 82  THR A HB   3  
ATOM 5239  H HG1  . THR A 1 82  ? 3.567   3.706   7.264   1.00 0.00 ? 82  THR A HG1  3  
ATOM 5240  H HG21 . THR A 1 82  ? 1.280   3.505   5.989   1.00 0.00 ? 82  THR A HG21 3  
ATOM 5241  H HG22 . THR A 1 82  ? 2.170   4.614   4.948   1.00 0.00 ? 82  THR A HG22 3  
ATOM 5242  H HG23 . THR A 1 82  ? 0.609   5.092   5.615   1.00 0.00 ? 82  THR A HG23 3  
ATOM 5243  N N    . TYR A 1 83  ? 0.091   7.539   6.174   1.00 0.00 ? 83  TYR A N    3  
ATOM 5244  C CA   . TYR A 1 83  ? -1.277  8.030   6.287   1.00 0.00 ? 83  TYR A CA   3  
ATOM 5245  C C    . TYR A 1 83  ? -2.198  7.307   5.309   1.00 0.00 ? 83  TYR A C    3  
ATOM 5246  O O    . TYR A 1 83  ? -1.973  7.322   4.099   1.00 0.00 ? 83  TYR A O    3  
ATOM 5247  C CB   . TYR A 1 83  ? -1.322  9.537   6.029   1.00 0.00 ? 83  TYR A CB   3  
ATOM 5248  C CG   . TYR A 1 83  ? -0.495  10.344  7.004   1.00 0.00 ? 83  TYR A CG   3  
ATOM 5249  C CD1  . TYR A 1 83  ? -0.975  10.639  8.274   1.00 0.00 ? 83  TYR A CD1  3  
ATOM 5250  C CD2  . TYR A 1 83  ? 0.766   10.812  6.655   1.00 0.00 ? 83  TYR A CD2  3  
ATOM 5251  C CE1  . TYR A 1 83  ? -0.223  11.377  9.168   1.00 0.00 ? 83  TYR A CE1  3  
ATOM 5252  C CE2  . TYR A 1 83  ? 1.526   11.549  7.542   1.00 0.00 ? 83  TYR A CE2  3  
ATOM 5253  C CZ   . TYR A 1 83  ? 1.027   11.829  8.798   1.00 0.00 ? 83  TYR A CZ   3  
ATOM 5254  O OH   . TYR A 1 83  ? 1.780   12.563  9.685   1.00 0.00 ? 83  TYR A OH   3  
ATOM 5255  H H    . TYR A 1 83  ? 0.510   7.492   5.289   1.00 0.00 ? 83  TYR A H    3  
ATOM 5256  H HA   . TYR A 1 83  ? -1.616  7.837   7.294   1.00 0.00 ? 83  TYR A HA   3  
ATOM 5257  H HB2  . TYR A 1 83  ? -0.951  9.737   5.035   1.00 0.00 ? 83  TYR A HB2  3  
ATOM 5258  H HB3  . TYR A 1 83  ? -2.345  9.877   6.100   1.00 0.00 ? 83  TYR A HB3  3  
ATOM 5259  H HD1  . TYR A 1 83  ? -1.954  10.284  8.561   1.00 0.00 ? 83  TYR A HD1  3  
ATOM 5260  H HD2  . TYR A 1 83  ? 1.153   10.591  5.670   1.00 0.00 ? 83  TYR A HD2  3  
ATOM 5261  H HE1  . TYR A 1 83  ? -0.612  11.596  10.151  1.00 0.00 ? 83  TYR A HE1  3  
ATOM 5262  H HE2  . TYR A 1 83  ? 2.504   11.903  7.253   1.00 0.00 ? 83  TYR A HE2  3  
ATOM 5263  H HH   . TYR A 1 83  ? 2.645   12.158  9.782   1.00 0.00 ? 83  TYR A HH   3  
ATOM 5264  N N    . VAL A 1 84  ? -3.238  6.675   5.844   1.00 0.00 ? 84  VAL A N    3  
ATOM 5265  C CA   . VAL A 1 84  ? -4.196  5.947   5.020   1.00 0.00 ? 84  VAL A CA   3  
ATOM 5266  C C    . VAL A 1 84  ? -5.585  6.566   5.116   1.00 0.00 ? 84  VAL A C    3  
ATOM 5267  O O    . VAL A 1 84  ? -6.095  6.806   6.210   1.00 0.00 ? 84  VAL A O    3  
ATOM 5268  C CB   . VAL A 1 84  ? -4.277  4.464   5.431   1.00 0.00 ? 84  VAL A CB   3  
ATOM 5269  C CG1  . VAL A 1 84  ? -5.540  3.824   4.875   1.00 0.00 ? 84  VAL A CG1  3  
ATOM 5270  C CG2  . VAL A 1 84  ? -3.039  3.714   4.963   1.00 0.00 ? 84  VAL A CG2  3  
ATOM 5271  H H    . VAL A 1 84  ? -3.364  6.699   6.815   1.00 0.00 ? 84  VAL A H    3  
ATOM 5272  H HA   . VAL A 1 84  ? -3.860  5.996   3.994   1.00 0.00 ? 84  VAL A HA   3  
ATOM 5273  H HB   . VAL A 1 84  ? -4.318  4.412   6.509   1.00 0.00 ? 84  VAL A HB   3  
ATOM 5274  H HG11 . VAL A 1 84  ? -6.365  4.017   5.545   1.00 0.00 ? 84  VAL A HG11 3  
ATOM 5275  H HG12 . VAL A 1 84  ? -5.758  4.242   3.903   1.00 0.00 ? 84  VAL A HG12 3  
ATOM 5276  H HG13 . VAL A 1 84  ? -5.393  2.758   4.785   1.00 0.00 ? 84  VAL A HG13 3  
ATOM 5277  H HG21 . VAL A 1 84  ? -3.279  3.134   4.085   1.00 0.00 ? 84  VAL A HG21 3  
ATOM 5278  H HG22 . VAL A 1 84  ? -2.258  4.421   4.726   1.00 0.00 ? 84  VAL A HG22 3  
ATOM 5279  H HG23 . VAL A 1 84  ? -2.699  3.054   5.748   1.00 0.00 ? 84  VAL A HG23 3  
ATOM 5280  N N    . ASN A 1 85  ? -6.194  6.822   3.963   1.00 0.00 ? 85  ASN A N    3  
ATOM 5281  C CA   . ASN A 1 85  ? -7.526  7.414   3.917   1.00 0.00 ? 85  ASN A CA   3  
ATOM 5282  C C    . ASN A 1 85  ? -7.551  8.756   4.643   1.00 0.00 ? 85  ASN A C    3  
ATOM 5283  O O    . ASN A 1 85  ? -8.572  9.151   5.203   1.00 0.00 ? 85  ASN A O    3  
ATOM 5284  C CB   . ASN A 1 85  ? -8.551  6.465   4.541   1.00 0.00 ? 85  ASN A CB   3  
ATOM 5285  C CG   . ASN A 1 85  ? -9.147  5.509   3.525   1.00 0.00 ? 85  ASN A CG   3  
ATOM 5286  O OD1  . ASN A 1 85  ? -10.010 5.887   2.733   1.00 0.00 ? 85  ASN A OD1  3  
ATOM 5287  N ND2  . ASN A 1 85  ? -8.688  4.263   3.545   1.00 0.00 ? 85  ASN A ND2  3  
ATOM 5288  H H    . ASN A 1 85  ? -5.737  6.609   3.123   1.00 0.00 ? 85  ASN A H    3  
ATOM 5289  H HA   . ASN A 1 85  ? -7.782  7.574   2.880   1.00 0.00 ? 85  ASN A HA   3  
ATOM 5290  H HB2  . ASN A 1 85  ? -8.070  5.883   5.314   1.00 0.00 ? 85  ASN A HB2  3  
ATOM 5291  H HB3  . ASN A 1 85  ? -9.351  7.043   4.977   1.00 0.00 ? 85  ASN A HB3  3  
ATOM 5292  H HD21 . ASN A 1 85  ? -8.000  4.033   4.204   1.00 0.00 ? 85  ASN A HD21 3  
ATOM 5293  H HD22 . ASN A 1 85  ? -9.056  3.624   2.899   1.00 0.00 ? 85  ASN A HD22 3  
ATOM 5294  N N    . GLY A 1 86  ? -6.418  9.452   4.628   1.00 0.00 ? 86  GLY A N    3  
ATOM 5295  C CA   . GLY A 1 86  ? -6.331  10.741  5.288   1.00 0.00 ? 86  GLY A CA   3  
ATOM 5296  C C    . GLY A 1 86  ? -5.838  10.629  6.717   1.00 0.00 ? 86  GLY A C    3  
ATOM 5297  O O    . GLY A 1 86  ? -5.158  11.524  7.220   1.00 0.00 ? 86  GLY A O    3  
ATOM 5298  H H    . GLY A 1 86  ? -5.635  9.086   4.166   1.00 0.00 ? 86  GLY A H    3  
ATOM 5299  H HA2  . GLY A 1 86  ? -5.654  11.372  4.733   1.00 0.00 ? 86  GLY A HA2  3  
ATOM 5300  H HA3  . GLY A 1 86  ? -7.310  11.197  5.293   1.00 0.00 ? 86  GLY A HA3  3  
ATOM 5301  N N    . LYS A 1 87  ? -6.182  9.527   7.375   1.00 0.00 ? 87  LYS A N    3  
ATOM 5302  C CA   . LYS A 1 87  ? -5.770  9.300   8.756   1.00 0.00 ? 87  LYS A CA   3  
ATOM 5303  C C    . LYS A 1 87  ? -4.369  8.701   8.814   1.00 0.00 ? 87  LYS A C    3  
ATOM 5304  O O    . LYS A 1 87  ? -3.770  8.397   7.783   1.00 0.00 ? 87  LYS A O    3  
ATOM 5305  C CB   . LYS A 1 87  ? -6.763  8.372   9.459   1.00 0.00 ? 87  LYS A CB   3  
ATOM 5306  C CG   . LYS A 1 87  ? -6.749  6.950   8.927   1.00 0.00 ? 87  LYS A CG   3  
ATOM 5307  C CD   . LYS A 1 87  ? -7.318  5.970   9.938   1.00 0.00 ? 87  LYS A CD   3  
ATOM 5308  C CE   . LYS A 1 87  ? -7.014  4.530   9.552   1.00 0.00 ? 87  LYS A CE   3  
ATOM 5309  N NZ   . LYS A 1 87  ? -7.706  4.136   8.293   1.00 0.00 ? 87  LYS A NZ   3  
ATOM 5310  H H    . LYS A 1 87  ? -6.725  8.849   6.921   1.00 0.00 ? 87  LYS A H    3  
ATOM 5311  H HA   . LYS A 1 87  ? -5.762  10.254  9.261   1.00 0.00 ? 87  LYS A HA   3  
ATOM 5312  H HB2  . LYS A 1 87  ? -6.526  8.342   10.513  1.00 0.00 ? 87  LYS A HB2  3  
ATOM 5313  H HB3  . LYS A 1 87  ? -7.760  8.771   9.335   1.00 0.00 ? 87  LYS A HB3  3  
ATOM 5314  H HG2  . LYS A 1 87  ? -7.343  6.907   8.026   1.00 0.00 ? 87  LYS A HG2  3  
ATOM 5315  H HG3  . LYS A 1 87  ? -5.730  6.670   8.701   1.00 0.00 ? 87  LYS A HG3  3  
ATOM 5316  H HD2  . LYS A 1 87  ? -6.882  6.170   10.906  1.00 0.00 ? 87  LYS A HD2  3  
ATOM 5317  H HD3  . LYS A 1 87  ? -8.390  6.101   9.990   1.00 0.00 ? 87  LYS A HD3  3  
ATOM 5318  H HE2  . LYS A 1 87  ? -5.949  4.425   9.415   1.00 0.00 ? 87  LYS A HE2  3  
ATOM 5319  H HE3  . LYS A 1 87  ? -7.341  3.881   10.351  1.00 0.00 ? 87  LYS A HE3  3  
ATOM 5320  H HZ1  . LYS A 1 87  ? -7.027  4.106   7.506   1.00 0.00 ? 87  LYS A HZ1  3  
ATOM 5321  H HZ2  . LYS A 1 87  ? -8.453  4.823   8.066   1.00 0.00 ? 87  LYS A HZ2  3  
ATOM 5322  H HZ3  . LYS A 1 87  ? -8.137  3.196   8.402   1.00 0.00 ? 87  LYS A HZ3  3  
ATOM 5323  N N    . ARG A 1 88  ? -3.853  8.532   10.027  1.00 0.00 ? 88  ARG A N    3  
ATOM 5324  C CA   . ARG A 1 88  ? -2.522  7.968   10.220  1.00 0.00 ? 88  ARG A CA   3  
ATOM 5325  C C    . ARG A 1 88  ? -2.601  6.468   10.487  1.00 0.00 ? 88  ARG A C    3  
ATOM 5326  O O    . ARG A 1 88  ? -3.395  6.014   11.312  1.00 0.00 ? 88  ARG A O    3  
ATOM 5327  C CB   . ARG A 1 88  ? -1.812  8.668   11.380  1.00 0.00 ? 88  ARG A CB   3  
ATOM 5328  C CG   . ARG A 1 88  ? -0.501  8.009   11.778  1.00 0.00 ? 88  ARG A CG   3  
ATOM 5329  C CD   . ARG A 1 88  ? 0.695   8.842   11.346  1.00 0.00 ? 88  ARG A CD   3  
ATOM 5330  N NE   . ARG A 1 88  ? 1.391   9.432   12.485  1.00 0.00 ? 88  ARG A NE   3  
ATOM 5331  C CZ   . ARG A 1 88  ? 2.109   8.728   13.354  1.00 0.00 ? 88  ARG A CZ   3  
ATOM 5332  N NH1  . ARG A 1 88  ? 2.224   7.415   13.212  1.00 0.00 ? 88  ARG A NH1  3  
ATOM 5333  N NH2  . ARG A 1 88  ? 2.713   9.338   14.366  1.00 0.00 ? 88  ARG A NH2  3  
ATOM 5334  H H    . ARG A 1 88  ? -4.379  8.793   10.812  1.00 0.00 ? 88  ARG A H    3  
ATOM 5335  H HA   . ARG A 1 88  ? -1.959  8.131   9.313   1.00 0.00 ? 88  ARG A HA   3  
ATOM 5336  H HB2  . ARG A 1 88  ? -1.604  9.689   11.097  1.00 0.00 ? 88  ARG A HB2  3  
ATOM 5337  H HB3  . ARG A 1 88  ? -2.465  8.667   12.239  1.00 0.00 ? 88  ARG A HB3  3  
ATOM 5338  H HG2  . ARG A 1 88  ? -0.477  7.895   12.852  1.00 0.00 ? 88  ARG A HG2  3  
ATOM 5339  H HG3  . ARG A 1 88  ? -0.441  7.037   11.309  1.00 0.00 ? 88  ARG A HG3  3  
ATOM 5340  H HD2  . ARG A 1 88  ? 1.382   8.208   10.805  1.00 0.00 ? 88  ARG A HD2  3  
ATOM 5341  H HD3  . ARG A 1 88  ? 0.350   9.633   10.697  1.00 0.00 ? 88  ARG A HD3  3  
ATOM 5342  H HE   . ARG A 1 88  ? 1.319   10.401  12.609  1.00 0.00 ? 88  ARG A HE   3  
ATOM 5343  H HH11 . ARG A 1 88  ? 1.771   6.953   12.450  1.00 0.00 ? 88  ARG A HH11 3  
ATOM 5344  H HH12 . ARG A 1 88  ? 2.766   6.887   13.867  1.00 0.00 ? 88  ARG A HH12 3  
ATOM 5345  H HH21 . ARG A 1 88  ? 2.629   10.327  14.475  1.00 0.00 ? 88  ARG A HH21 3  
ATOM 5346  H HH22 . ARG A 1 88  ? 3.253   8.807   15.018  1.00 0.00 ? 88  ARG A HH22 3  
ATOM 5347  N N    . VAL A 1 89  ? -1.772  5.702   9.784   1.00 0.00 ? 89  VAL A N    3  
ATOM 5348  C CA   . VAL A 1 89  ? -1.746  4.254   9.946   1.00 0.00 ? 89  VAL A CA   3  
ATOM 5349  C C    . VAL A 1 89  ? -0.457  3.798   10.619  1.00 0.00 ? 89  VAL A C    3  
ATOM 5350  O O    . VAL A 1 89  ? 0.636   3.993   10.087  1.00 0.00 ? 89  VAL A O    3  
ATOM 5351  C CB   . VAL A 1 89  ? -1.887  3.535   8.591   1.00 0.00 ? 89  VAL A CB   3  
ATOM 5352  C CG1  . VAL A 1 89  ? -0.720  3.884   7.679   1.00 0.00 ? 89  VAL A CG1  3  
ATOM 5353  C CG2  . VAL A 1 89  ? -1.985  2.031   8.794   1.00 0.00 ? 89  VAL A CG2  3  
ATOM 5354  H H    . VAL A 1 89  ? -1.162  6.122   9.142   1.00 0.00 ? 89  VAL A H    3  
ATOM 5355  H HA   . VAL A 1 89  ? -2.584  3.972   10.567  1.00 0.00 ? 89  VAL A HA   3  
ATOM 5356  H HB   . VAL A 1 89  ? -2.797  3.874   8.119   1.00 0.00 ? 89  VAL A HB   3  
ATOM 5357  H HG11 . VAL A 1 89  ? 0.105   3.215   7.879   1.00 0.00 ? 89  VAL A HG11 3  
ATOM 5358  H HG12 . VAL A 1 89  ? -1.026  3.782   6.648   1.00 0.00 ? 89  VAL A HG12 3  
ATOM 5359  H HG13 . VAL A 1 89  ? -0.411  4.902   7.864   1.00 0.00 ? 89  VAL A HG13 3  
ATOM 5360  H HG21 . VAL A 1 89  ? -1.251  1.535   8.176   1.00 0.00 ? 89  VAL A HG21 3  
ATOM 5361  H HG22 . VAL A 1 89  ? -1.801  1.795   9.831   1.00 0.00 ? 89  VAL A HG22 3  
ATOM 5362  H HG23 . VAL A 1 89  ? -2.974  1.694   8.518   1.00 0.00 ? 89  VAL A HG23 3  
ATOM 5363  N N    . SER A 1 90  ? -0.591  3.190   11.793  1.00 0.00 ? 90  SER A N    3  
ATOM 5364  C CA   . SER A 1 90  ? 0.564   2.709   12.542  1.00 0.00 ? 90  SER A CA   3  
ATOM 5365  C C    . SER A 1 90  ? 0.442   1.215   12.828  1.00 0.00 ? 90  SER A C    3  
ATOM 5366  O O    . SER A 1 90  ? 1.417   0.563   13.202  1.00 0.00 ? 90  SER A O    3  
ATOM 5367  C CB   . SER A 1 90  ? 0.705   3.481   13.855  1.00 0.00 ? 90  SER A CB   3  
ATOM 5368  O OG   . SER A 1 90  ? -0.551  3.632   14.495  1.00 0.00 ? 90  SER A OG   3  
ATOM 5369  H H    . SER A 1 90  ? -1.489  3.064   12.166  1.00 0.00 ? 90  SER A H    3  
ATOM 5370  H HA   . SER A 1 90  ? 1.443   2.878   11.939  1.00 0.00 ? 90  SER A HA   3  
ATOM 5371  H HB2  . SER A 1 90  ? 1.370   2.946   14.515  1.00 0.00 ? 90  SER A HB2  3  
ATOM 5372  H HB3  . SER A 1 90  ? 1.112   4.461   13.651  1.00 0.00 ? 90  SER A HB3  3  
ATOM 5373  H HG   . SER A 1 90  ? -0.425  3.648   15.447  1.00 0.00 ? 90  SER A HG   3  
ATOM 5374  N N    . GLN A 1 91  ? -0.761  0.681   12.649  1.00 0.00 ? 91  GLN A N    3  
ATOM 5375  C CA   . GLN A 1 91  ? -1.011  -0.736  12.888  1.00 0.00 ? 91  GLN A CA   3  
ATOM 5376  C C    . GLN A 1 91  ? -1.376  -1.451  11.591  1.00 0.00 ? 91  GLN A C    3  
ATOM 5377  O O    . GLN A 1 91  ? -1.775  -0.833  10.604  1.00 0.00 ? 91  GLN A O    3  
ATOM 5378  C CB   . GLN A 1 91  ? -2.132  -0.912  13.914  1.00 0.00 ? 91  GLN A CB   3  
ATOM 5379  C CG   . GLN A 1 91  ? -1.639  -0.964  15.351  1.00 0.00 ? 91  GLN A CG   3  
ATOM 5380  C CD   . GLN A 1 91  ? -2.758  -1.209  16.343  1.00 0.00 ? 91  GLN A CD   3  
ATOM 5381  O OE1  . GLN A 1 91  ? -3.032  -2.350  16.718  1.00 0.00 ? 91  GLN A OE1  3  
ATOM 5382  N NE2  . GLN A 1 91  ? -3.412  -0.137  16.775  1.00 0.00 ? 91  GLN A NE2  3  
ATOM 5383  H H    . GLN A 1 91  ? -1.498  1.252   12.349  1.00 0.00 ? 91  GLN A H    3  
ATOM 5384  H HA   . GLN A 1 91  ? -0.104  -1.170  13.281  1.00 0.00 ? 91  GLN A HA   3  
ATOM 5385  H HB2  . GLN A 1 91  ? -2.821  -0.085  13.822  1.00 0.00 ? 91  GLN A HB2  3  
ATOM 5386  H HB3  . GLN A 1 91  ? -2.656  -1.832  13.702  1.00 0.00 ? 91  GLN A HB3  3  
ATOM 5387  H HG2  . GLN A 1 91  ? -0.917  -1.763  15.441  1.00 0.00 ? 91  GLN A HG2  3  
ATOM 5388  H HG3  . GLN A 1 91  ? -1.165  -0.024  15.589  1.00 0.00 ? 91  GLN A HG3  3  
ATOM 5389  H HE21 . GLN A 1 91  ? -3.139  0.740   16.432  1.00 0.00 ? 91  GLN A HE21 3  
ATOM 5390  H HE22 . GLN A 1 91  ? -4.140  -0.266  17.416  1.00 0.00 ? 91  GLN A HE22 3  
ATOM 5391  N N    . PRO A 1 92  ? -1.236  -2.785  11.591  1.00 0.00 ? 92  PRO A N    3  
ATOM 5392  C CA   . PRO A 1 92  ? -1.545  -3.613  10.421  1.00 0.00 ? 92  PRO A CA   3  
ATOM 5393  C C    . PRO A 1 92  ? -3.041  -3.672  10.133  1.00 0.00 ? 92  PRO A C    3  
ATOM 5394  O O    . PRO A 1 92  ? -3.765  -4.481  10.715  1.00 0.00 ? 92  PRO A O    3  
ATOM 5395  C CB   . PRO A 1 92  ? -1.022  -4.996  10.818  1.00 0.00 ? 92  PRO A CB   3  
ATOM 5396  C CG   . PRO A 1 92  ? -1.054  -5.001  12.307  1.00 0.00 ? 92  PRO A CG   3  
ATOM 5397  C CD   . PRO A 1 92  ? -0.764  -3.587  12.732  1.00 0.00 ? 92  PRO A CD   3  
ATOM 5398  H HA   . PRO A 1 92  ? -1.023  -3.268  9.541   1.00 0.00 ? 92  PRO A HA   3  
ATOM 5399  H HB2  . PRO A 1 92  ? -1.667  -5.759  10.406  1.00 0.00 ? 92  PRO A HB2  3  
ATOM 5400  H HB3  . PRO A 1 92  ? -0.017  -5.125  10.444  1.00 0.00 ? 92  PRO A HB3  3  
ATOM 5401  H HG2  . PRO A 1 92  ? -2.030  -5.303  12.653  1.00 0.00 ? 92  PRO A HG2  3  
ATOM 5402  H HG3  . PRO A 1 92  ? -0.296  -5.669  12.688  1.00 0.00 ? 92  PRO A HG3  3  
ATOM 5403  H HD2  . PRO A 1 92  ? -1.314  -3.343  13.629  1.00 0.00 ? 92  PRO A HD2  3  
ATOM 5404  H HD3  . PRO A 1 92  ? 0.296   -3.450  12.887  1.00 0.00 ? 92  PRO A HD3  3  
ATOM 5405  N N    . VAL A 1 93  ? -3.500  -2.811  9.230   1.00 0.00 ? 93  VAL A N    3  
ATOM 5406  C CA   . VAL A 1 93  ? -4.910  -2.766  8.863   1.00 0.00 ? 93  VAL A CA   3  
ATOM 5407  C C    . VAL A 1 93  ? -5.107  -3.119  7.393   1.00 0.00 ? 93  VAL A C    3  
ATOM 5408  O O    . VAL A 1 93  ? -4.179  -3.016  6.591   1.00 0.00 ? 93  VAL A O    3  
ATOM 5409  C CB   . VAL A 1 93  ? -5.516  -1.376  9.132   1.00 0.00 ? 93  VAL A CB   3  
ATOM 5410  C CG1  . VAL A 1 93  ? -5.399  -1.017  10.605  1.00 0.00 ? 93  VAL A CG1  3  
ATOM 5411  C CG2  . VAL A 1 93  ? -4.842  -0.324  8.264   1.00 0.00 ? 93  VAL A CG2  3  
ATOM 5412  H H    . VAL A 1 93  ? -2.874  -2.191  8.801   1.00 0.00 ? 93  VAL A H    3  
ATOM 5413  H HA   . VAL A 1 93  ? -5.436  -3.488  9.471   1.00 0.00 ? 93  VAL A HA   3  
ATOM 5414  H HB   . VAL A 1 93  ? -6.565  -1.407  8.874   1.00 0.00 ? 93  VAL A HB   3  
ATOM 5415  H HG11 . VAL A 1 93  ? -4.450  -1.365  10.985  1.00 0.00 ? 93  VAL A HG11 3  
ATOM 5416  H HG12 . VAL A 1 93  ? -5.464  0.054   10.722  1.00 0.00 ? 93  VAL A HG12 3  
ATOM 5417  H HG13 . VAL A 1 93  ? -6.201  -1.489  11.155  1.00 0.00 ? 93  VAL A HG13 3  
ATOM 5418  H HG21 . VAL A 1 93  ? -5.023  0.656   8.679   1.00 0.00 ? 93  VAL A HG21 3  
ATOM 5419  H HG22 . VAL A 1 93  ? -3.779  -0.512  8.232   1.00 0.00 ? 93  VAL A HG22 3  
ATOM 5420  H HG23 . VAL A 1 93  ? -5.245  -0.371  7.262   1.00 0.00 ? 93  VAL A HG23 3  
ATOM 5421  N N    . GLN A 1 94  ? -6.321  -3.535  7.048   1.00 0.00 ? 94  GLN A N    3  
ATOM 5422  C CA   . GLN A 1 94  ? -6.639  -3.904  5.673   1.00 0.00 ? 94  GLN A CA   3  
ATOM 5423  C C    . GLN A 1 94  ? -6.942  -2.667  4.834   1.00 0.00 ? 94  GLN A C    3  
ATOM 5424  O O    . GLN A 1 94  ? -7.667  -1.771  5.269   1.00 0.00 ? 94  GLN A O    3  
ATOM 5425  C CB   . GLN A 1 94  ? -7.833  -4.860  5.642   1.00 0.00 ? 94  GLN A CB   3  
ATOM 5426  C CG   . GLN A 1 94  ? -7.479  -6.287  6.030   1.00 0.00 ? 94  GLN A CG   3  
ATOM 5427  C CD   . GLN A 1 94  ? -8.703  -7.136  6.308   1.00 0.00 ? 94  GLN A CD   3  
ATOM 5428  O OE1  . GLN A 1 94  ? -9.831  -6.642  6.300   1.00 0.00 ? 94  GLN A OE1  3  
ATOM 5429  N NE2  . GLN A 1 94  ? -8.488  -8.423  6.556   1.00 0.00 ? 94  GLN A NE2  3  
ATOM 5430  H H    . GLN A 1 94  ? -7.018  -3.596  7.733   1.00 0.00 ? 94  GLN A H    3  
ATOM 5431  H HA   . GLN A 1 94  ? -5.778  -4.404  5.256   1.00 0.00 ? 94  GLN A HA   3  
ATOM 5432  H HB2  . GLN A 1 94  ? -8.585  -4.499  6.328   1.00 0.00 ? 94  GLN A HB2  3  
ATOM 5433  H HB3  . GLN A 1 94  ? -8.243  -4.872  4.643   1.00 0.00 ? 94  GLN A HB3  3  
ATOM 5434  H HG2  . GLN A 1 94  ? -6.923  -6.738  5.221   1.00 0.00 ? 94  GLN A HG2  3  
ATOM 5435  H HG3  . GLN A 1 94  ? -6.865  -6.263  6.918   1.00 0.00 ? 94  GLN A HG3  3  
ATOM 5436  H HE21 . GLN A 1 94  ? -7.562  -8.747  6.547   1.00 0.00 ? 94  GLN A HE21 3  
ATOM 5437  H HE22 . GLN A 1 94  ? -9.261  -8.995  6.740   1.00 0.00 ? 94  GLN A HE22 3  
ATOM 5438  N N    . LEU A 1 95  ? -6.382  -2.623  3.630   1.00 0.00 ? 95  LEU A N    3  
ATOM 5439  C CA   . LEU A 1 95  ? -6.591  -1.495  2.729   1.00 0.00 ? 95  LEU A CA   3  
ATOM 5440  C C    . LEU A 1 95  ? -7.918  -1.628  1.989   1.00 0.00 ? 95  LEU A C    3  
ATOM 5441  O O    . LEU A 1 95  ? -8.359  -2.736  1.681   1.00 0.00 ? 95  LEU A O    3  
ATOM 5442  C CB   . LEU A 1 95  ? -5.441  -1.398  1.725   1.00 0.00 ? 95  LEU A CB   3  
ATOM 5443  C CG   . LEU A 1 95  ? -4.107  -0.898  2.279   1.00 0.00 ? 95  LEU A CG   3  
ATOM 5444  C CD1  . LEU A 1 95  ? -4.325  0.279   3.217   1.00 0.00 ? 95  LEU A CD1  3  
ATOM 5445  C CD2  . LEU A 1 95  ? -3.371  -2.022  2.994   1.00 0.00 ? 95  LEU A CD2  3  
ATOM 5446  H H    . LEU A 1 95  ? -5.813  -3.366  3.340   1.00 0.00 ? 95  LEU A H    3  
ATOM 5447  H HA   . LEU A 1 95  ? -6.615  -0.595  3.326   1.00 0.00 ? 95  LEU A HA   3  
ATOM 5448  H HB2  . LEU A 1 95  ? -5.280  -2.382  1.312   1.00 0.00 ? 95  LEU A HB2  3  
ATOM 5449  H HB3  . LEU A 1 95  ? -5.747  -0.724  0.938   1.00 0.00 ? 95  LEU A HB3  3  
ATOM 5450  H HG   . LEU A 1 95  ? -3.488  -0.560  1.460   1.00 0.00 ? 95  LEU A HG   3  
ATOM 5451  H HD11 . LEU A 1 95  ? -4.429  -0.081  4.229   1.00 0.00 ? 95  LEU A HD11 3  
ATOM 5452  H HD12 . LEU A 1 95  ? -5.222  0.807   2.929   1.00 0.00 ? 95  LEU A HD12 3  
ATOM 5453  H HD13 . LEU A 1 95  ? -3.480  0.949   3.158   1.00 0.00 ? 95  LEU A HD13 3  
ATOM 5454  H HD21 . LEU A 1 95  ? -3.325  -1.807  4.051   1.00 0.00 ? 95  LEU A HD21 3  
ATOM 5455  H HD22 . LEU A 1 95  ? -2.370  -2.105  2.599   1.00 0.00 ? 95  LEU A HD22 3  
ATOM 5456  H HD23 . LEU A 1 95  ? -3.898  -2.953  2.838   1.00 0.00 ? 95  LEU A HD23 3  
ATOM 5457  N N    . ARG A 1 96  ? -8.548  -0.493  1.705   1.00 0.00 ? 96  ARG A N    3  
ATOM 5458  C CA   . ARG A 1 96  ? -9.824  -0.484  0.999   1.00 0.00 ? 96  ARG A CA   3  
ATOM 5459  C C    . ARG A 1 96  ? -9.624  -0.180  -0.483  1.00 0.00 ? 96  ARG A C    3  
ATOM 5460  O O    . ARG A 1 96  ? -9.020  0.830   -0.844  1.00 0.00 ? 96  ARG A O    3  
ATOM 5461  C CB   . ARG A 1 96  ? -10.766 0.550   1.620   1.00 0.00 ? 96  ARG A CB   3  
ATOM 5462  C CG   . ARG A 1 96  ? -12.231 0.315   1.288   1.00 0.00 ? 96  ARG A CG   3  
ATOM 5463  C CD   . ARG A 1 96  ? -12.640 -1.124  1.562   1.00 0.00 ? 96  ARG A CD   3  
ATOM 5464  N NE   . ARG A 1 96  ? -12.171 -1.588  2.865   1.00 0.00 ? 96  ARG A NE   3  
ATOM 5465  C CZ   . ARG A 1 96  ? -12.093 -2.870  3.204   1.00 0.00 ? 96  ARG A CZ   3  
ATOM 5466  N NH1  . ARG A 1 96  ? -12.450 -3.810  2.341   1.00 0.00 ? 96  ARG A NH1  3  
ATOM 5467  N NH2  . ARG A 1 96  ? -11.656 -3.213  4.409   1.00 0.00 ? 96  ARG A NH2  3  
ATOM 5468  H H    . ARG A 1 96  ? -8.146  0.358   1.976   1.00 0.00 ? 96  ARG A H    3  
ATOM 5469  H HA   . ARG A 1 96  ? -10.265 -1.464  1.098   1.00 0.00 ? 96  ARG A HA   3  
ATOM 5470  H HB2  . ARG A 1 96  ? -10.654 0.523   2.694   1.00 0.00 ? 96  ARG A HB2  3  
ATOM 5471  H HB3  . ARG A 1 96  ? -10.491 1.530   1.261   1.00 0.00 ? 96  ARG A HB3  3  
ATOM 5472  H HG2  . ARG A 1 96  ? -12.837 0.972   1.894   1.00 0.00 ? 96  ARG A HG2  3  
ATOM 5473  H HG3  . ARG A 1 96  ? -12.393 0.534   0.243   1.00 0.00 ? 96  ARG A HG3  3  
ATOM 5474  H HD2  . ARG A 1 96  ? -13.718 -1.189  1.534   1.00 0.00 ? 96  ARG A HD2  3  
ATOM 5475  H HD3  . ARG A 1 96  ? -12.221 -1.755  0.793   1.00 0.00 ? 96  ARG A HD3  3  
ATOM 5476  H HE   . ARG A 1 96  ? -11.902 -0.909  3.518   1.00 0.00 ? 96  ARG A HE   3  
ATOM 5477  H HH11 . ARG A 1 96  ? -12.779 -3.554  1.431   1.00 0.00 ? 96  ARG A HH11 3  
ATOM 5478  H HH12 . ARG A 1 96  ? -12.389 -4.775  2.598   1.00 0.00 ? 96  ARG A HH12 3  
ATOM 5479  H HH21 . ARG A 1 96  ? -11.386 -2.507  5.062   1.00 0.00 ? 96  ARG A HH21 3  
ATOM 5480  H HH22 . ARG A 1 96  ? -11.598 -4.178  4.663   1.00 0.00 ? 96  ARG A HH22 3  
ATOM 5481  N N    . SER A 1 97  ? -10.134 -1.062  -1.336  1.00 0.00 ? 97  SER A N    3  
ATOM 5482  C CA   . SER A 1 97  ? -10.007 -0.891  -2.779  1.00 0.00 ? 97  SER A CA   3  
ATOM 5483  C C    . SER A 1 97  ? -10.102 0.582   -3.162  1.00 0.00 ? 97  SER A C    3  
ATOM 5484  O O    . SER A 1 97  ? -11.193 1.141   -3.259  1.00 0.00 ? 97  SER A O    3  
ATOM 5485  C CB   . SER A 1 97  ? -11.092 -1.689  -3.505  1.00 0.00 ? 97  SER A CB   3  
ATOM 5486  O OG   . SER A 1 97  ? -10.964 -1.561  -4.911  1.00 0.00 ? 97  SER A OG   3  
ATOM 5487  H H    . SER A 1 97  ? -10.605 -1.848  -0.987  1.00 0.00 ? 97  SER A H    3  
ATOM 5488  H HA   . SER A 1 97  ? -9.039  -1.266  -3.073  1.00 0.00 ? 97  SER A HA   3  
ATOM 5489  H HB2  . SER A 1 97  ? -11.006 -2.732  -3.242  1.00 0.00 ? 97  SER A HB2  3  
ATOM 5490  H HB3  . SER A 1 97  ? -12.064 -1.322  -3.209  1.00 0.00 ? 97  SER A HB3  3  
ATOM 5491  H HG   . SER A 1 97  ? -11.466 -2.256  -5.343  1.00 0.00 ? 97  SER A HG   3  
ATOM 5492  N N    . GLY A 1 98  ? -8.948  1.207   -3.378  1.00 0.00 ? 98  GLY A N    3  
ATOM 5493  C CA   . GLY A 1 98  ? -8.921  2.610   -3.747  1.00 0.00 ? 98  GLY A CA   3  
ATOM 5494  C C    . GLY A 1 98  ? -8.692  3.519   -2.556  1.00 0.00 ? 98  GLY A C    3  
ATOM 5495  O O    . GLY A 1 98  ? -9.344  4.553   -2.422  1.00 0.00 ? 98  GLY A O    3  
ATOM 5496  H H    . GLY A 1 98  ? -8.108  0.710   -3.285  1.00 0.00 ? 98  GLY A H    3  
ATOM 5497  H HA2  . GLY A 1 98  ? -8.129  2.767   -4.464  1.00 0.00 ? 98  GLY A HA2  3  
ATOM 5498  H HA3  . GLY A 1 98  ? -9.864  2.867   -4.206  1.00 0.00 ? 98  GLY A HA3  3  
ATOM 5499  N N    . ASN A 1 99  ? -7.764  3.131   -1.687  1.00 0.00 ? 99  ASN A N    3  
ATOM 5500  C CA   . ASN A 1 99  ? -7.453  3.918   -0.499  1.00 0.00 ? 99  ASN A CA   3  
ATOM 5501  C C    . ASN A 1 99  ? -6.214  4.778   -0.726  1.00 0.00 ? 99  ASN A C    3  
ATOM 5502  O O    . ASN A 1 99  ? -5.227  4.324   -1.305  1.00 0.00 ? 99  ASN A O    3  
ATOM 5503  C CB   . ASN A 1 99  ? -7.236  2.998   0.705   1.00 0.00 ? 99  ASN A CB   3  
ATOM 5504  C CG   . ASN A 1 99  ? -6.300  1.847   0.391   1.00 0.00 ? 99  ASN A CG   3  
ATOM 5505  O OD1  . ASN A 1 99  ? -6.691  0.872   -0.251  1.00 0.00 ? 99  ASN A OD1  3  
ATOM 5506  N ND2  . ASN A 1 99  ? -5.057  1.955   0.844   1.00 0.00 ? 99  ASN A ND2  3  
ATOM 5507  H H    . ASN A 1 99  ? -7.277  2.296   -1.848  1.00 0.00 ? 99  ASN A H    3  
ATOM 5508  H HA   . ASN A 1 99  ? -8.295  4.564   -0.300  1.00 0.00 ? 99  ASN A HA   3  
ATOM 5509  H HB2  . ASN A 1 99  ? -6.810  3.571   1.515   1.00 0.00 ? 99  ASN A HB2  3  
ATOM 5510  H HB3  . ASN A 1 99  ? -8.186  2.592   1.016   1.00 0.00 ? 99  ASN A HB3  3  
ATOM 5511  H HD21 . ASN A 1 99  ? -4.815  2.760   1.348   1.00 0.00 ? 99  ASN A HD21 3  
ATOM 5512  H HD22 . ASN A 1 99  ? -4.430  1.225   0.655   1.00 0.00 ? 99  ASN A HD22 3  
ATOM 5513  N N    . ARG A 1 100 ? -6.273  6.023   -0.265  1.00 0.00 ? 100 ARG A N    3  
ATOM 5514  C CA   . ARG A 1 100 ? -5.156  6.948   -0.418  1.00 0.00 ? 100 ARG A CA   3  
ATOM 5515  C C    . ARG A 1 100 ? -4.113  6.726   0.673   1.00 0.00 ? 100 ARG A C    3  
ATOM 5516  O O    . ARG A 1 100 ? -4.363  6.994   1.849   1.00 0.00 ? 100 ARG A O    3  
ATOM 5517  C CB   . ARG A 1 100 ? -5.654  8.394   -0.375  1.00 0.00 ? 100 ARG A CB   3  
ATOM 5518  C CG   . ARG A 1 100 ? -4.820  9.350   -1.212  1.00 0.00 ? 100 ARG A CG   3  
ATOM 5519  C CD   . ARG A 1 100 ? -5.526  10.684  -1.404  1.00 0.00 ? 100 ARG A CD   3  
ATOM 5520  N NE   . ARG A 1 100 ? -5.295  11.591  -0.283  1.00 0.00 ? 100 ARG A NE   3  
ATOM 5521  C CZ   . ARG A 1 100 ? -5.911  12.760  -0.145  1.00 0.00 ? 100 ARG A CZ   3  
ATOM 5522  N NH1  . ARG A 1 100 ? -6.790  13.161  -1.053  1.00 0.00 ? 100 ARG A NH1  3  
ATOM 5523  N NH2  . ARG A 1 100 ? -5.648  13.530  0.903   1.00 0.00 ? 100 ARG A NH2  3  
ATOM 5524  H H    . ARG A 1 100 ? -7.087  6.328   0.189   1.00 0.00 ? 100 ARG A H    3  
ATOM 5525  H HA   . ARG A 1 100 ? -4.700  6.762   -1.379  1.00 0.00 ? 100 ARG A HA   3  
ATOM 5526  H HB2  . ARG A 1 100 ? -6.670  8.424   -0.740  1.00 0.00 ? 100 ARG A HB2  3  
ATOM 5527  H HB3  . ARG A 1 100 ? -5.638  8.737   0.648   1.00 0.00 ? 100 ARG A HB3  3  
ATOM 5528  H HG2  . ARG A 1 100 ? -3.878  9.523   -0.713  1.00 0.00 ? 100 ARG A HG2  3  
ATOM 5529  H HG3  . ARG A 1 100 ? -4.641  8.905   -2.179  1.00 0.00 ? 100 ARG A HG3  3  
ATOM 5530  H HD2  . ARG A 1 100 ? -5.158  11.144  -2.308  1.00 0.00 ? 100 ARG A HD2  3  
ATOM 5531  H HD3  . ARG A 1 100 ? -6.586  10.504  -1.497  1.00 0.00 ? 100 ARG A HD3  3  
ATOM 5532  H HE   . ARG A 1 100 ? -4.650  11.314  0.400   1.00 0.00 ? 100 ARG A HE   3  
ATOM 5533  H HH11 . ARG A 1 100 ? -6.990  12.583  -1.843  1.00 0.00 ? 100 ARG A HH11 3  
ATOM 5534  H HH12 . ARG A 1 100 ? -7.253  14.042  -0.947  1.00 0.00 ? 100 ARG A HH12 3  
ATOM 5535  H HH21 . ARG A 1 100 ? -4.986  13.231  1.590   1.00 0.00 ? 100 ARG A HH21 3  
ATOM 5536  H HH22 . ARG A 1 100 ? -6.111  14.410  1.005   1.00 0.00 ? 100 ARG A HH22 3  
ATOM 5537  N N    . ILE A 1 101 ? -2.944  6.234   0.276   1.00 0.00 ? 101 ILE A N    3  
ATOM 5538  C CA   . ILE A 1 101 ? -1.863  5.977   1.219   1.00 0.00 ? 101 ILE A CA   3  
ATOM 5539  C C    . ILE A 1 101 ? -0.655  6.859   0.925   1.00 0.00 ? 101 ILE A C    3  
ATOM 5540  O O    . ILE A 1 101 ? -0.132  6.860   -0.190  1.00 0.00 ? 101 ILE A O    3  
ATOM 5541  C CB   . ILE A 1 101 ? -1.427  4.500   1.187   1.00 0.00 ? 101 ILE A CB   3  
ATOM 5542  C CG1  . ILE A 1 101 ? -2.652  3.585   1.126   1.00 0.00 ? 101 ILE A CG1  3  
ATOM 5543  C CG2  . ILE A 1 101 ? -0.575  4.173   2.404   1.00 0.00 ? 101 ILE A CG2  3  
ATOM 5544  C CD1  . ILE A 1 101 ? -2.352  2.210   0.572   1.00 0.00 ? 101 ILE A CD1  3  
ATOM 5545  H H    . ILE A 1 101 ? -2.805  6.041   -0.675  1.00 0.00 ? 101 ILE A H    3  
ATOM 5546  H HA   . ILE A 1 101 ? -2.227  6.202   2.212   1.00 0.00 ? 101 ILE A HA   3  
ATOM 5547  H HB   . ILE A 1 101 ? -0.826  4.345   0.304   1.00 0.00 ? 101 ILE A HB   3  
ATOM 5548  H HG12 . ILE A 1 101 ? -3.052  3.462   2.120   1.00 0.00 ? 101 ILE A HG12 3  
ATOM 5549  H HG13 . ILE A 1 101 ? -3.402  4.042   0.495   1.00 0.00 ? 101 ILE A HG13 3  
ATOM 5550  H HG21 . ILE A 1 101 ? 0.458   4.076   2.104   1.00 0.00 ? 101 ILE A HG21 3  
ATOM 5551  H HG22 . ILE A 1 101 ? -0.665  4.966   3.130   1.00 0.00 ? 101 ILE A HG22 3  
ATOM 5552  H HG23 . ILE A 1 101 ? -0.911  3.244   2.840   1.00 0.00 ? 101 ILE A HG23 3  
ATOM 5553  H HD11 . ILE A 1 101 ? -1.292  2.121   0.384   1.00 0.00 ? 101 ILE A HD11 3  
ATOM 5554  H HD12 . ILE A 1 101 ? -2.654  1.460   1.288   1.00 0.00 ? 101 ILE A HD12 3  
ATOM 5555  H HD13 . ILE A 1 101 ? -2.894  2.067   -0.351  1.00 0.00 ? 101 ILE A HD13 3  
ATOM 5556  N N    . ILE A 1 102 ? -0.215  7.606   1.932   1.00 0.00 ? 102 ILE A N    3  
ATOM 5557  C CA   . ILE A 1 102 ? 0.934   8.490   1.782   1.00 0.00 ? 102 ILE A CA   3  
ATOM 5558  C C    . ILE A 1 102 ? 2.068   8.081   2.716   1.00 0.00 ? 102 ILE A C    3  
ATOM 5559  O O    . ILE A 1 102 ? 1.877   7.961   3.925   1.00 0.00 ? 102 ILE A O    3  
ATOM 5560  C CB   . ILE A 1 102 ? 0.557   9.957   2.063   1.00 0.00 ? 102 ILE A CB   3  
ATOM 5561  C CG1  . ILE A 1 102 ? -0.550  10.413  1.109   1.00 0.00 ? 102 ILE A CG1  3  
ATOM 5562  C CG2  . ILE A 1 102 ? 1.779   10.852  1.931   1.00 0.00 ? 102 ILE A CG2  3  
ATOM 5563  C CD1  . ILE A 1 102 ? -1.460  11.466  1.700   1.00 0.00 ? 102 ILE A CD1  3  
ATOM 5564  H H    . ILE A 1 102 ? -0.674  7.561   2.796   1.00 0.00 ? 102 ILE A H    3  
ATOM 5565  H HA   . ILE A 1 102 ? 1.279   8.417   0.760   1.00 0.00 ? 102 ILE A HA   3  
ATOM 5566  H HB   . ILE A 1 102 ? 0.198   10.025  3.078   1.00 0.00 ? 102 ILE A HB   3  
ATOM 5567  H HG12 . ILE A 1 102 ? -0.102  10.824  0.218   1.00 0.00 ? 102 ILE A HG12 3  
ATOM 5568  H HG13 . ILE A 1 102 ? -1.157  9.560   0.841   1.00 0.00 ? 102 ILE A HG13 3  
ATOM 5569  H HG21 . ILE A 1 102 ? 1.892   11.159  0.902   1.00 0.00 ? 102 ILE A HG21 3  
ATOM 5570  H HG22 . ILE A 1 102 ? 1.654   11.725  2.554   1.00 0.00 ? 102 ILE A HG22 3  
ATOM 5571  H HG23 . ILE A 1 102 ? 2.659   10.310  2.243   1.00 0.00 ? 102 ILE A HG23 3  
ATOM 5572  H HD11 . ILE A 1 102 ? -1.380  12.376  1.123   1.00 0.00 ? 102 ILE A HD11 3  
ATOM 5573  H HD12 . ILE A 1 102 ? -2.481  11.115  1.676   1.00 0.00 ? 102 ILE A HD12 3  
ATOM 5574  H HD13 . ILE A 1 102 ? -1.169  11.662  2.721   1.00 0.00 ? 102 ILE A HD13 3  
ATOM 5575  N N    . MET A 1 103 ? 3.250   7.870   2.145   1.00 0.00 ? 103 MET A N    3  
ATOM 5576  C CA   . MET A 1 103 ? 4.416   7.477   2.928   1.00 0.00 ? 103 MET A CA   3  
ATOM 5577  C C    . MET A 1 103 ? 5.396   8.639   3.063   1.00 0.00 ? 103 MET A C    3  
ATOM 5578  O O    . MET A 1 103 ? 6.199   8.894   2.166   1.00 0.00 ? 103 MET A O    3  
ATOM 5579  C CB   . MET A 1 103 ? 5.113   6.280   2.279   1.00 0.00 ? 103 MET A CB   3  
ATOM 5580  C CG   . MET A 1 103 ? 4.259   5.023   2.248   1.00 0.00 ? 103 MET A CG   3  
ATOM 5581  S SD   . MET A 1 103 ? 4.662   3.943   0.862   1.00 0.00 ? 103 MET A SD   3  
ATOM 5582  C CE   . MET A 1 103 ? 3.030   3.375   0.390   1.00 0.00 ? 103 MET A CE   3  
ATOM 5583  H H    . MET A 1 103 ? 3.341   7.982   1.176   1.00 0.00 ? 103 MET A H    3  
ATOM 5584  H HA   . MET A 1 103 ? 4.075   7.194   3.912   1.00 0.00 ? 103 MET A HA   3  
ATOM 5585  H HB2  . MET A 1 103 ? 5.373   6.537   1.263   1.00 0.00 ? 103 MET A HB2  3  
ATOM 5586  H HB3  . MET A 1 103 ? 6.016   6.062   2.829   1.00 0.00 ? 103 MET A HB3  3  
ATOM 5587  H HG2  . MET A 1 103 ? 4.412   4.477   3.167   1.00 0.00 ? 103 MET A HG2  3  
ATOM 5588  H HG3  . MET A 1 103 ? 3.221   5.312   2.172   1.00 0.00 ? 103 MET A HG3  3  
ATOM 5589  H HE1  . MET A 1 103 ? 2.300   3.755   1.090   1.00 0.00 ? 103 MET A HE1  3  
ATOM 5590  H HE2  . MET A 1 103 ? 2.797   3.732   -0.602  1.00 0.00 ? 103 MET A HE2  3  
ATOM 5591  H HE3  . MET A 1 103 ? 3.009   2.295   0.398   1.00 0.00 ? 103 MET A HE3  3  
ATOM 5592  N N    . GLY A 1 104 ? 5.324   9.340   4.191   1.00 0.00 ? 104 GLY A N    3  
ATOM 5593  C CA   . GLY A 1 104 ? 6.210   10.466  4.422   1.00 0.00 ? 104 GLY A CA   3  
ATOM 5594  C C    . GLY A 1 104 ? 6.005   11.581  3.416   1.00 0.00 ? 104 GLY A C    3  
ATOM 5595  O O    . GLY A 1 104 ? 5.422   12.617  3.736   1.00 0.00 ? 104 GLY A O    3  
ATOM 5596  H H    . GLY A 1 104 ? 4.664   9.090   4.871   1.00 0.00 ? 104 GLY A H    3  
ATOM 5597  H HA2  . GLY A 1 104 ? 6.032   10.852  5.414   1.00 0.00 ? 104 GLY A HA2  3  
ATOM 5598  H HA3  . GLY A 1 104 ? 7.233   10.123  4.358   1.00 0.00 ? 104 GLY A HA3  3  
ATOM 5599  N N    . LYS A 1 105 ? 6.487   11.371  2.195   1.00 0.00 ? 105 LYS A N    3  
ATOM 5600  C CA   . LYS A 1 105 ? 6.355   12.366  1.138   1.00 0.00 ? 105 LYS A CA   3  
ATOM 5601  C C    . LYS A 1 105 ? 4.968   12.307  0.506   1.00 0.00 ? 105 LYS A C    3  
ATOM 5602  O O    . LYS A 1 105 ? 4.090   11.587  0.979   1.00 0.00 ? 105 LYS A O    3  
ATOM 5603  C CB   . LYS A 1 105 ? 7.425   12.147  0.066   1.00 0.00 ? 105 LYS A CB   3  
ATOM 5604  C CG   . LYS A 1 105 ? 8.724   12.882  0.345   1.00 0.00 ? 105 LYS A CG   3  
ATOM 5605  C CD   . LYS A 1 105 ? 8.636   14.344  -0.059  1.00 0.00 ? 105 LYS A CD   3  
ATOM 5606  C CE   . LYS A 1 105 ? 10.001  15.013  -0.032  1.00 0.00 ? 105 LYS A CE   3  
ATOM 5607  N NZ   . LYS A 1 105 ? 10.360  15.486  1.334   1.00 0.00 ? 105 LYS A NZ   3  
ATOM 5608  H H    . LYS A 1 105 ? 6.943   10.524  2.001   1.00 0.00 ? 105 LYS A H    3  
ATOM 5609  H HA   . LYS A 1 105 ? 6.495   13.341  1.580   1.00 0.00 ? 105 LYS A HA   3  
ATOM 5610  H HB2  . LYS A 1 105 ? 7.640   11.090  0.000   1.00 0.00 ? 105 LYS A HB2  3  
ATOM 5611  H HB3  . LYS A 1 105 ? 7.040   12.487  -0.884  1.00 0.00 ? 105 LYS A HB3  3  
ATOM 5612  H HG2  . LYS A 1 105 ? 8.941   12.823  1.401   1.00 0.00 ? 105 LYS A HG2  3  
ATOM 5613  H HG3  . LYS A 1 105 ? 9.520   12.411  -0.215  1.00 0.00 ? 105 LYS A HG3  3  
ATOM 5614  H HD2  . LYS A 1 105 ? 8.235   14.409  -1.059  1.00 0.00 ? 105 LYS A HD2  3  
ATOM 5615  H HD3  . LYS A 1 105 ? 7.978   14.859  0.628   1.00 0.00 ? 105 LYS A HD3  3  
ATOM 5616  H HE2  . LYS A 1 105 ? 10.742  14.303  -0.364  1.00 0.00 ? 105 LYS A HE2  3  
ATOM 5617  H HE3  . LYS A 1 105 ? 9.986   15.859  -0.704  1.00 0.00 ? 105 LYS A HE3  3  
ATOM 5618  H HZ1  . LYS A 1 105 ? 10.176  16.506  1.419   1.00 0.00 ? 105 LYS A HZ1  3  
ATOM 5619  H HZ2  . LYS A 1 105 ? 11.369  15.310  1.519   1.00 0.00 ? 105 LYS A HZ2  3  
ATOM 5620  H HZ3  . LYS A 1 105 ? 9.796   14.982  2.046   1.00 0.00 ? 105 LYS A HZ3  3  
ATOM 5621  N N    . ASN A 1 106 ? 4.778   13.070  -0.566  1.00 0.00 ? 106 ASN A N    3  
ATOM 5622  C CA   . ASN A 1 106 ? 3.497   13.103  -1.263  1.00 0.00 ? 106 ASN A CA   3  
ATOM 5623  C C    . ASN A 1 106 ? 3.330   11.875  -2.152  1.00 0.00 ? 106 ASN A C    3  
ATOM 5624  O O    . ASN A 1 106 ? 2.398   11.798  -2.954  1.00 0.00 ? 106 ASN A O    3  
ATOM 5625  C CB   . ASN A 1 106 ? 3.384   14.376  -2.105  1.00 0.00 ? 106 ASN A CB   3  
ATOM 5626  C CG   . ASN A 1 106 ? 4.581   14.574  -3.015  1.00 0.00 ? 106 ASN A CG   3  
ATOM 5627  O OD1  . ASN A 1 106 ? 5.718   14.299  -2.633  1.00 0.00 ? 106 ASN A OD1  3  
ATOM 5628  N ND2  . ASN A 1 106 ? 4.328   15.055  -4.227  1.00 0.00 ? 106 ASN A ND2  3  
ATOM 5629  H H    . ASN A 1 106 ? 5.516   13.623  -0.896  1.00 0.00 ? 106 ASN A H    3  
ATOM 5630  H HA   . ASN A 1 106 ? 2.715   13.104  -0.519  1.00 0.00 ? 106 ASN A HA   3  
ATOM 5631  H HB2  . ASN A 1 106 ? 2.496   14.317  -2.717  1.00 0.00 ? 106 ASN A HB2  3  
ATOM 5632  H HB3  . ASN A 1 106 ? 3.309   15.230  -1.448  1.00 0.00 ? 106 ASN A HB3  3  
ATOM 5633  H HD21 . ASN A 1 106 ? 3.397   15.252  -4.463  1.00 0.00 ? 106 ASN A HD21 3  
ATOM 5634  H HD22 . ASN A 1 106 ? 5.083   15.193  -4.837  1.00 0.00 ? 106 ASN A HD22 3  
ATOM 5635  N N    . HIS A 1 107 ? 4.238   10.916  -2.004  1.00 0.00 ? 107 HIS A N    3  
ATOM 5636  C CA   . HIS A 1 107 ? 4.190   9.690   -2.793  1.00 0.00 ? 107 HIS A CA   3  
ATOM 5637  C C    . HIS A 1 107 ? 2.928   8.891   -2.481  1.00 0.00 ? 107 HIS A C    3  
ATOM 5638  O O    . HIS A 1 107 ? 2.982   7.866   -1.801  1.00 0.00 ? 107 HIS A O    3  
ATOM 5639  C CB   . HIS A 1 107 ? 5.429   8.835   -2.522  1.00 0.00 ? 107 HIS A CB   3  
ATOM 5640  C CG   . HIS A 1 107 ? 6.646   9.292   -3.266  1.00 0.00 ? 107 HIS A CG   3  
ATOM 5641  N ND1  . HIS A 1 107 ? 6.637   9.597   -4.610  1.00 0.00 ? 107 HIS A ND1  3  
ATOM 5642  C CD2  . HIS A 1 107 ? 7.916   9.498   -2.844  1.00 0.00 ? 107 HIS A CD2  3  
ATOM 5643  C CE1  . HIS A 1 107 ? 7.848   9.968   -4.984  1.00 0.00 ? 107 HIS A CE1  3  
ATOM 5644  N NE2  . HIS A 1 107 ? 8.643   9.917   -3.931  1.00 0.00 ? 107 HIS A NE2  3  
ATOM 5645  H H    . HIS A 1 107 ? 4.956   11.035  -1.349  1.00 0.00 ? 107 HIS A H    3  
ATOM 5646  H HA   . HIS A 1 107 ? 4.176   9.967   -3.836  1.00 0.00 ? 107 HIS A HA   3  
ATOM 5647  H HB2  . HIS A 1 107 ? 5.655   8.866   -1.466  1.00 0.00 ? 107 HIS A HB2  3  
ATOM 5648  H HB3  . HIS A 1 107 ? 5.225   7.815   -2.813  1.00 0.00 ? 107 HIS A HB3  3  
ATOM 5649  H HD2  . HIS A 1 107 ? 8.289   9.358   -1.839  1.00 0.00 ? 107 HIS A HD2  3  
ATOM 5650  H HE1  . HIS A 1 107 ? 8.140   10.263  -5.981  1.00 0.00 ? 107 HIS A HE1  3  
ATOM 5651  H HE2  . HIS A 1 107 ? 9.612   10.059  -3.948  1.00 0.00 ? 107 HIS A HE2  3  
ATOM 5652  N N    . VAL A 1 108 ? 1.793   9.368   -2.981  1.00 0.00 ? 108 VAL A N    3  
ATOM 5653  C CA   . VAL A 1 108 ? 0.517   8.699   -2.755  1.00 0.00 ? 108 VAL A CA   3  
ATOM 5654  C C    . VAL A 1 108 ? 0.221   7.694   -3.862  1.00 0.00 ? 108 VAL A C    3  
ATOM 5655  O O    . VAL A 1 108 ? 0.394   7.989   -5.045  1.00 0.00 ? 108 VAL A O    3  
ATOM 5656  C CB   . VAL A 1 108 ? -0.641  9.711   -2.671  1.00 0.00 ? 108 VAL A CB   3  
ATOM 5657  C CG1  . VAL A 1 108 ? -1.732  9.199   -1.743  1.00 0.00 ? 108 VAL A CG1  3  
ATOM 5658  C CG2  . VAL A 1 108 ? -0.130  11.068  -2.210  1.00 0.00 ? 108 VAL A CG2  3  
ATOM 5659  H H    . VAL A 1 108 ? 1.814   10.190  -3.514  1.00 0.00 ? 108 VAL A H    3  
ATOM 5660  H HA   . VAL A 1 108 ? 0.578   8.174   -1.813  1.00 0.00 ? 108 VAL A HA   3  
ATOM 5661  H HB   . VAL A 1 108 ? -1.063  9.826   -3.658  1.00 0.00 ? 108 VAL A HB   3  
ATOM 5662  H HG11 . VAL A 1 108 ? -1.412  8.273   -1.289  1.00 0.00 ? 108 VAL A HG11 3  
ATOM 5663  H HG12 . VAL A 1 108 ? -1.923  9.932   -0.973  1.00 0.00 ? 108 VAL A HG12 3  
ATOM 5664  H HG13 . VAL A 1 108 ? -2.635  9.029   -2.310  1.00 0.00 ? 108 VAL A HG13 3  
ATOM 5665  H HG21 . VAL A 1 108 ? 0.803   10.941  -1.680  1.00 0.00 ? 108 VAL A HG21 3  
ATOM 5666  H HG22 . VAL A 1 108 ? 0.026   11.704  -3.068  1.00 0.00 ? 108 VAL A HG22 3  
ATOM 5667  H HG23 . VAL A 1 108 ? -0.857  11.522  -1.553  1.00 0.00 ? 108 VAL A HG23 3  
ATOM 5668  N N    . PHE A 1 109 ? -0.229  6.506   -3.471  1.00 0.00 ? 109 PHE A N    3  
ATOM 5669  C CA   . PHE A 1 109 ? -0.550  5.457   -4.431  1.00 0.00 ? 109 PHE A CA   3  
ATOM 5670  C C    . PHE A 1 109 ? -2.005  5.019   -4.292  1.00 0.00 ? 109 PHE A C    3  
ATOM 5671  O O    . PHE A 1 109 ? -2.591  5.110   -3.213  1.00 0.00 ? 109 PHE A O    3  
ATOM 5672  C CB   . PHE A 1 109 ? 0.377   4.255   -4.234  1.00 0.00 ? 109 PHE A CB   3  
ATOM 5673  C CG   . PHE A 1 109 ? 1.827   4.572   -4.467  1.00 0.00 ? 109 PHE A CG   3  
ATOM 5674  C CD1  . PHE A 1 109 ? 2.342   4.615   -5.752  1.00 0.00 ? 109 PHE A CD1  3  
ATOM 5675  C CD2  . PHE A 1 109 ? 2.674   4.827   -3.400  1.00 0.00 ? 109 PHE A CD2  3  
ATOM 5676  C CE1  . PHE A 1 109 ? 3.676   4.906   -5.969  1.00 0.00 ? 109 PHE A CE1  3  
ATOM 5677  C CE2  . PHE A 1 109 ? 4.008   5.119   -3.611  1.00 0.00 ? 109 PHE A CE2  3  
ATOM 5678  C CZ   . PHE A 1 109 ? 4.510   5.158   -4.898  1.00 0.00 ? 109 PHE A CZ   3  
ATOM 5679  H H    . PHE A 1 109 ? -0.347  6.332   -2.514  1.00 0.00 ? 109 PHE A H    3  
ATOM 5680  H HA   . PHE A 1 109 ? -0.400  5.857   -5.422  1.00 0.00 ? 109 PHE A HA   3  
ATOM 5681  H HB2  . PHE A 1 109 ? 0.275   3.893   -3.222  1.00 0.00 ? 109 PHE A HB2  3  
ATOM 5682  H HB3  . PHE A 1 109 ? 0.092   3.474   -4.922  1.00 0.00 ? 109 PHE A HB3  3  
ATOM 5683  H HD1  . PHE A 1 109 ? 1.691   4.417   -6.591  1.00 0.00 ? 109 PHE A HD1  3  
ATOM 5684  H HD2  . PHE A 1 109 ? 2.283   4.796   -2.394  1.00 0.00 ? 109 PHE A HD2  3  
ATOM 5685  H HE1  . PHE A 1 109 ? 4.065   4.935   -6.976  1.00 0.00 ? 109 PHE A HE1  3  
ATOM 5686  H HE2  . PHE A 1 109 ? 4.657   5.315   -2.772  1.00 0.00 ? 109 PHE A HE2  3  
ATOM 5687  H HZ   . PHE A 1 109 ? 5.552   5.386   -5.065  1.00 0.00 ? 109 PHE A HZ   3  
ATOM 5688  N N    . ARG A 1 110 ? -2.582  4.545   -5.391  1.00 0.00 ? 110 ARG A N    3  
ATOM 5689  C CA   . ARG A 1 110 ? -3.968  4.095   -5.393  1.00 0.00 ? 110 ARG A CA   3  
ATOM 5690  C C    . ARG A 1 110 ? -4.046  2.573   -5.315  1.00 0.00 ? 110 ARG A C    3  
ATOM 5691  O O    . ARG A 1 110 ? -3.495  1.868   -6.161  1.00 0.00 ? 110 ARG A O    3  
ATOM 5692  C CB   . ARG A 1 110 ? -4.686  4.588   -6.651  1.00 0.00 ? 110 ARG A CB   3  
ATOM 5693  C CG   . ARG A 1 110 ? -6.201  4.537   -6.548  1.00 0.00 ? 110 ARG A CG   3  
ATOM 5694  C CD   . ARG A 1 110 ? -6.861  5.418   -7.597  1.00 0.00 ? 110 ARG A CD   3  
ATOM 5695  N NE   . ARG A 1 110 ? -6.631  4.923   -8.951  1.00 0.00 ? 110 ARG A NE   3  
ATOM 5696  C CZ   . ARG A 1 110 ? -6.718  5.684   -10.037 1.00 0.00 ? 110 ARG A CZ   3  
ATOM 5697  N NH1  . ARG A 1 110 ? -7.027  6.969   -9.927  1.00 0.00 ? 110 ARG A NH1  3  
ATOM 5698  N NH2  . ARG A 1 110 ? -6.494  5.161   -11.235 1.00 0.00 ? 110 ARG A NH2  3  
ATOM 5699  H H    . ARG A 1 110 ? -2.063  4.497   -6.221  1.00 0.00 ? 110 ARG A H    3  
ATOM 5700  H HA   . ARG A 1 110 ? -4.455  4.513   -4.525  1.00 0.00 ? 110 ARG A HA   3  
ATOM 5701  H HB2  . ARG A 1 110 ? -4.395  5.612   -6.839  1.00 0.00 ? 110 ARG A HB2  3  
ATOM 5702  H HB3  . ARG A 1 110 ? -4.382  3.977   -7.487  1.00 0.00 ? 110 ARG A HB3  3  
ATOM 5703  H HG2  . ARG A 1 110 ? -6.528  3.517   -6.693  1.00 0.00 ? 110 ARG A HG2  3  
ATOM 5704  H HG3  . ARG A 1 110 ? -6.498  4.876   -5.567  1.00 0.00 ? 110 ARG A HG3  3  
ATOM 5705  H HD2  . ARG A 1 110 ? -7.924  5.444   -7.409  1.00 0.00 ? 110 ARG A HD2  3  
ATOM 5706  H HD3  . ARG A 1 110 ? -6.457  6.416   -7.515  1.00 0.00 ? 110 ARG A HD3  3  
ATOM 5707  H HE   . ARG A 1 110 ? -6.401  3.977   -9.056  1.00 0.00 ? 110 ARG A HE   3  
ATOM 5708  H HH11 . ARG A 1 110 ? -7.196  7.366   -9.025  1.00 0.00 ? 110 ARG A HH11 3  
ATOM 5709  H HH12 . ARG A 1 110 ? -7.091  7.540   -10.745 1.00 0.00 ? 110 ARG A HH12 3  
ATOM 5710  H HH21 . ARG A 1 110 ? -6.260  4.193   -11.322 1.00 0.00 ? 110 ARG A HH21 3  
ATOM 5711  H HH22 . ARG A 1 110 ? -6.560  5.734   -12.051 1.00 0.00 ? 110 ARG A HH22 3  
ATOM 5712  N N    . PHE A 1 111 ? -4.733  2.072   -4.293  1.00 0.00 ? 111 PHE A N    3  
ATOM 5713  C CA   . PHE A 1 111 ? -4.882  0.634   -4.103  1.00 0.00 ? 111 PHE A CA   3  
ATOM 5714  C C    . PHE A 1 111 ? -5.964  0.073   -5.021  1.00 0.00 ? 111 PHE A C    3  
ATOM 5715  O O    . PHE A 1 111 ? -7.153  0.145   -4.712  1.00 0.00 ? 111 PHE A O    3  
ATOM 5716  C CB   . PHE A 1 111 ? -5.223  0.324   -2.644  1.00 0.00 ? 111 PHE A CB   3  
ATOM 5717  C CG   . PHE A 1 111 ? -5.397  -1.143  -2.369  1.00 0.00 ? 111 PHE A CG   3  
ATOM 5718  C CD1  . PHE A 1 111 ? -4.388  -2.043  -2.669  1.00 0.00 ? 111 PHE A CD1  3  
ATOM 5719  C CD2  . PHE A 1 111 ? -6.572  -1.621  -1.810  1.00 0.00 ? 111 PHE A CD2  3  
ATOM 5720  C CE1  . PHE A 1 111 ? -4.545  -3.392  -2.416  1.00 0.00 ? 111 PHE A CE1  3  
ATOM 5721  C CE2  . PHE A 1 111 ? -6.735  -2.969  -1.555  1.00 0.00 ? 111 PHE A CE2  3  
ATOM 5722  C CZ   . PHE A 1 111 ? -5.721  -3.856  -1.859  1.00 0.00 ? 111 PHE A CZ   3  
ATOM 5723  H H    . PHE A 1 111 ? -5.150  2.685   -3.651  1.00 0.00 ? 111 PHE A H    3  
ATOM 5724  H HA   . PHE A 1 111 ? -3.940  0.169   -4.351  1.00 0.00 ? 111 PHE A HA   3  
ATOM 5725  H HB2  . PHE A 1 111 ? -4.428  0.687   -2.011  1.00 0.00 ? 111 PHE A HB2  3  
ATOM 5726  H HB3  . PHE A 1 111 ? -6.143  0.824   -2.383  1.00 0.00 ? 111 PHE A HB3  3  
ATOM 5727  H HD1  . PHE A 1 111 ? -3.467  -1.680  -3.105  1.00 0.00 ? 111 PHE A HD1  3  
ATOM 5728  H HD2  . PHE A 1 111 ? -7.366  -0.929  -1.573  1.00 0.00 ? 111 PHE A HD2  3  
ATOM 5729  H HE1  . PHE A 1 111 ? -3.750  -4.083  -2.655  1.00 0.00 ? 111 PHE A HE1  3  
ATOM 5730  H HE2  . PHE A 1 111 ? -7.655  -3.329  -1.120  1.00 0.00 ? 111 PHE A HE2  3  
ATOM 5731  H HZ   . PHE A 1 111 ? -5.845  -4.910  -1.660  1.00 0.00 ? 111 PHE A HZ   3  
ATOM 5732  N N    . ASN A 1 112 ? -5.543  -0.485  -6.151  1.00 0.00 ? 112 ASN A N    3  
ATOM 5733  C CA   . ASN A 1 112 ? -6.476  -1.057  -7.115  1.00 0.00 ? 112 ASN A CA   3  
ATOM 5734  C C    . ASN A 1 112 ? -6.829  -2.494  -6.743  1.00 0.00 ? 112 ASN A C    3  
ATOM 5735  O O    . ASN A 1 112 ? -5.957  -3.285  -6.381  1.00 0.00 ? 112 ASN A O    3  
ATOM 5736  C CB   . ASN A 1 112 ? -5.877  -1.015  -8.523  1.00 0.00 ? 112 ASN A CB   3  
ATOM 5737  C CG   . ASN A 1 112 ? -6.159  0.295   -9.232  1.00 0.00 ? 112 ASN A CG   3  
ATOM 5738  O OD1  . ASN A 1 112 ? -5.993  1.372   -8.659  1.00 0.00 ? 112 ASN A OD1  3  
ATOM 5739  N ND2  . ASN A 1 112 ? -6.589  0.209   -10.485 1.00 0.00 ? 112 ASN A ND2  3  
ATOM 5740  H H    . ASN A 1 112 ? -4.582  -0.512  -6.342  1.00 0.00 ? 112 ASN A H    3  
ATOM 5741  H HA   . ASN A 1 112 ? -7.376  -0.462  -7.099  1.00 0.00 ? 112 ASN A HA   3  
ATOM 5742  H HB2  . ASN A 1 112 ? -4.806  -1.142  -8.455  1.00 0.00 ? 112 ASN A HB2  3  
ATOM 5743  H HB3  . ASN A 1 112 ? -6.295  -1.819  -9.110  1.00 0.00 ? 112 ASN A HB3  3  
ATOM 5744  H HD21 . ASN A 1 112 ? -6.698  -0.683  -10.877 1.00 0.00 ? 112 ASN A HD21 3  
ATOM 5745  H HD22 . ASN A 1 112 ? -6.778  1.040   -10.968 1.00 0.00 ? 112 ASN A HD22 3  
ATOM 5746  N N    . HIS A 1 113 ? -8.113  -2.826  -6.836  1.00 0.00 ? 113 HIS A N    3  
ATOM 5747  C CA   . HIS A 1 113 ? -8.581  -4.168  -6.510  1.00 0.00 ? 113 HIS A CA   3  
ATOM 5748  C C    . HIS A 1 113 ? -9.811  -4.529  -7.337  1.00 0.00 ? 113 HIS A C    3  
ATOM 5749  O O    . HIS A 1 113 ? -10.934 -4.583  -6.834  1.00 0.00 ? 113 HIS A O    3  
ATOM 5750  C CB   . HIS A 1 113 ? -8.907  -4.270  -5.020  1.00 0.00 ? 113 HIS A CB   3  
ATOM 5751  C CG   . HIS A 1 113 ? -8.776  -5.658  -4.472  1.00 0.00 ? 113 HIS A CG   3  
ATOM 5752  N ND1  . HIS A 1 113 ? -9.849  -6.511  -4.321  1.00 0.00 ? 113 HIS A ND1  3  
ATOM 5753  C CD2  . HIS A 1 113 ? -7.690  -6.341  -4.040  1.00 0.00 ? 113 HIS A CD2  3  
ATOM 5754  C CE1  . HIS A 1 113 ? -9.429  -7.658  -3.818  1.00 0.00 ? 113 HIS A CE1  3  
ATOM 5755  N NE2  . HIS A 1 113 ? -8.122  -7.581  -3.639  1.00 0.00 ? 113 HIS A NE2  3  
ATOM 5756  H H    . HIS A 1 113 ? -8.760  -2.151  -7.130  1.00 0.00 ? 113 HIS A H    3  
ATOM 5757  H HA   . HIS A 1 113 ? -7.789  -4.862  -6.745  1.00 0.00 ? 113 HIS A HA   3  
ATOM 5758  H HB2  . HIS A 1 113 ? -8.234  -3.631  -4.467  1.00 0.00 ? 113 HIS A HB2  3  
ATOM 5759  H HB3  . HIS A 1 113 ? -9.923  -3.942  -4.856  1.00 0.00 ? 113 HIS A HB3  3  
ATOM 5760  H HD2  . HIS A 1 113 ? -6.672  -5.978  -4.015  1.00 0.00 ? 113 HIS A HD2  3  
ATOM 5761  H HE1  . HIS A 1 113 ? -10.047 -8.514  -3.592  1.00 0.00 ? 113 HIS A HE1  3  
ATOM 5762  H HE2  . HIS A 1 113 ? -7.572  -8.262  -3.199  1.00 0.00 ? 113 HIS A HE2  3  
ATOM 5763  N N    . PRO A 1 114 ? -9.598  -4.782  -8.637  1.00 0.00 ? 114 PRO A N    3  
ATOM 5764  C CA   . PRO A 1 114 ? -10.677 -5.142  -9.561  1.00 0.00 ? 114 PRO A CA   3  
ATOM 5765  C C    . PRO A 1 114 ? -11.239 -6.532  -9.283  1.00 0.00 ? 114 PRO A C    3  
ATOM 5766  O O    . PRO A 1 114 ? -12.150 -6.992  -9.971  1.00 0.00 ? 114 PRO A O    3  
ATOM 5767  C CB   . PRO A 1 114 ? -9.997  -5.106  -10.932 1.00 0.00 ? 114 PRO A CB   3  
ATOM 5768  C CG   . PRO A 1 114 ? -8.557  -5.356  -10.648 1.00 0.00 ? 114 PRO A CG   3  
ATOM 5769  C CD   . PRO A 1 114 ? -8.286  -4.737  -9.305  1.00 0.00 ? 114 PRO A CD   3  
ATOM 5770  H HA   . PRO A 1 114 ? -11.479 -4.419  -9.536  1.00 0.00 ? 114 PRO A HA   3  
ATOM 5771  H HB2  . PRO A 1 114 ? -10.416 -5.876  -11.565 1.00 0.00 ? 114 PRO A HB2  3  
ATOM 5772  H HB3  . PRO A 1 114 ? -10.147 -4.138  -11.387 1.00 0.00 ? 114 PRO A HB3  3  
ATOM 5773  H HG2  . PRO A 1 114 ? -8.368  -6.419  -10.615 1.00 0.00 ? 114 PRO A HG2  3  
ATOM 5774  H HG3  . PRO A 1 114 ? -7.946  -4.889  -11.406 1.00 0.00 ? 114 PRO A HG3  3  
ATOM 5775  H HD2  . PRO A 1 114 ? -7.556  -5.318  -8.761  1.00 0.00 ? 114 PRO A HD2  3  
ATOM 5776  H HD3  . PRO A 1 114 ? -7.949  -3.717  -9.421  1.00 0.00 ? 114 PRO A HD3  3  
ATOM 5777  N N    . GLU A 1 115 ? -10.691 -7.195  -8.269  1.00 0.00 ? 115 GLU A N    3  
ATOM 5778  C CA   . GLU A 1 115 ? -11.139 -8.533  -7.901  1.00 0.00 ? 115 GLU A CA   3  
ATOM 5779  C C    . GLU A 1 115 ? -12.383 -8.467  -7.020  1.00 0.00 ? 115 GLU A C    3  
ATOM 5780  O O    . GLU A 1 115 ? -13.358 -9.181  -7.251  1.00 0.00 ? 115 GLU A O    3  
ATOM 5781  C CB   . GLU A 1 115 ? -10.024 -9.286  -7.172  1.00 0.00 ? 115 GLU A CB   3  
ATOM 5782  C CG   . GLU A 1 115 ? -8.883  -9.713  -8.081  1.00 0.00 ? 115 GLU A CG   3  
ATOM 5783  C CD   . GLU A 1 115 ? -8.028  -10.806 -7.469  1.00 0.00 ? 115 GLU A CD   3  
ATOM 5784  O OE1  . GLU A 1 115 ? -7.047  -10.471 -6.773  1.00 0.00 ? 115 GLU A OE1  3  
ATOM 5785  O OE2  . GLU A 1 115 ? -8.340  -11.995 -7.686  1.00 0.00 ? 115 GLU A OE2  3  
ATOM 5786  H H    . GLU A 1 115 ? -9.968  -6.775  -7.758  1.00 0.00 ? 115 GLU A H    3  
ATOM 5787  H HA   . GLU A 1 115 ? -11.384 -9.062  -8.809  1.00 0.00 ? 115 GLU A HA   3  
ATOM 5788  H HB2  . GLU A 1 115 ? -9.622  -8.648  -6.398  1.00 0.00 ? 115 GLU A HB2  3  
ATOM 5789  H HB3  . GLU A 1 115 ? -10.443 -10.170 -6.715  1.00 0.00 ? 115 GLU A HB3  3  
ATOM 5790  H HG2  . GLU A 1 115 ? -9.297  -10.078 -9.009  1.00 0.00 ? 115 GLU A HG2  3  
ATOM 5791  H HG3  . GLU A 1 115 ? -8.258  -8.855  -8.279  1.00 0.00 ? 115 GLU A HG3  3  
ATOM 5792  N N    . GLN A 1 116 ? -12.340 -7.605  -6.009  1.00 0.00 ? 116 GLN A N    3  
ATOM 5793  C CA   . GLN A 1 116 ? -13.463 -7.446  -5.092  1.00 0.00 ? 116 GLN A CA   3  
ATOM 5794  C C    . GLN A 1 116 ? -14.499 -6.484  -5.663  1.00 0.00 ? 116 GLN A C    3  
ATOM 5795  O O    . GLN A 1 116 ? -15.699 -6.757  -5.628  1.00 0.00 ? 116 GLN A O    3  
ATOM 5796  C CB   . GLN A 1 116 ? -12.973 -6.940  -3.735  1.00 0.00 ? 116 GLN A CB   3  
ATOM 5797  C CG   . GLN A 1 116 ? -14.094 -6.678  -2.742  1.00 0.00 ? 116 GLN A CG   3  
ATOM 5798  C CD   . GLN A 1 116 ? -15.006 -7.876  -2.563  1.00 0.00 ? 116 GLN A CD   3  
ATOM 5799  O OE1  . GLN A 1 116 ? -16.157 -7.737  -2.148  1.00 0.00 ? 116 GLN A OE1  3  
ATOM 5800  N NE2  . GLN A 1 116 ? -14.496 -9.061  -2.875  1.00 0.00 ? 116 GLN A NE2  3  
ATOM 5801  H H    . GLN A 1 116 ? -11.534 -7.064  -5.876  1.00 0.00 ? 116 GLN A H    3  
ATOM 5802  H HA   . GLN A 1 116 ? -13.922 -8.414  -4.961  1.00 0.00 ? 116 GLN A HA   3  
ATOM 5803  H HB2  . GLN A 1 116 ? -12.307 -7.676  -3.308  1.00 0.00 ? 116 GLN A HB2  3  
ATOM 5804  H HB3  . GLN A 1 116 ? -12.429 -6.018  -3.882  1.00 0.00 ? 116 GLN A HB3  3  
ATOM 5805  H HG2  . GLN A 1 116 ? -13.659 -6.430  -1.785  1.00 0.00 ? 116 GLN A HG2  3  
ATOM 5806  H HG3  . GLN A 1 116 ? -14.682 -5.845  -3.096  1.00 0.00 ? 116 GLN A HG3  3  
ATOM 5807  H HE21 . GLN A 1 116 ? -13.570 -9.096  -3.198  1.00 0.00 ? 116 GLN A HE21 3  
ATOM 5808  H HE22 . GLN A 1 116 ? -15.063 -9.852  -2.768  1.00 0.00 ? 116 GLN A HE22 3  
ATOM 5809  N N    . ALA A 1 117 ? -14.028 -5.358  -6.187  1.00 0.00 ? 117 ALA A N    3  
ATOM 5810  C CA   . ALA A 1 117 ? -14.915 -4.356  -6.767  1.00 0.00 ? 117 ALA A CA   3  
ATOM 5811  C C    . ALA A 1 117 ? -15.894 -4.991  -7.748  1.00 0.00 ? 117 ALA A C    3  
ATOM 5812  O O    . ALA A 1 117 ? -17.013 -4.508  -7.922  1.00 0.00 ? 117 ALA A O    3  
ATOM 5813  C CB   . ALA A 1 117 ? -14.103 -3.269  -7.457  1.00 0.00 ? 117 ALA A CB   3  
ATOM 5814  H H    . ALA A 1 117 ? -13.062 -5.197  -6.186  1.00 0.00 ? 117 ALA A H    3  
ATOM 5815  H HA   . ALA A 1 117 ? -15.472 -3.898  -5.962  1.00 0.00 ? 117 ALA A HA   3  
ATOM 5816  H HB1  . ALA A 1 117 ? -14.730 -2.407  -7.628  1.00 0.00 ? 117 ALA A HB1  3  
ATOM 5817  H HB2  . ALA A 1 117 ? -13.269 -2.990  -6.829  1.00 0.00 ? 117 ALA A HB2  3  
ATOM 5818  H HB3  . ALA A 1 117 ? -13.735 -3.641  -8.402  1.00 0.00 ? 117 ALA A HB3  3  
ATOM 5819  N N    . ARG A 1 118 ? -15.466 -6.075  -8.386  1.00 0.00 ? 118 ARG A N    3  
ATOM 5820  C CA   . ARG A 1 118 ? -16.305 -6.775  -9.351  1.00 0.00 ? 118 ARG A CA   3  
ATOM 5821  C C    . ARG A 1 118 ? -17.622 -7.207  -8.714  1.00 0.00 ? 118 ARG A C    3  
ATOM 5822  O O    . ARG A 1 118 ? -18.667 -7.209  -9.364  1.00 0.00 ? 118 ARG A O    3  
ATOM 5823  C CB   . ARG A 1 118 ? -15.570 -7.996  -9.907  1.00 0.00 ? 118 ARG A CB   3  
ATOM 5824  C CG   . ARG A 1 118 ? -15.775 -9.257  -9.083  1.00 0.00 ? 118 ARG A CG   3  
ATOM 5825  C CD   . ARG A 1 118 ? -14.683 -10.281 -9.352  1.00 0.00 ? 118 ARG A CD   3  
ATOM 5826  N NE   . ARG A 1 118 ? -15.033 -11.180 -10.448 1.00 0.00 ? 118 ARG A NE   3  
ATOM 5827  C CZ   . ARG A 1 118 ? -14.828 -10.891 -11.729 1.00 0.00 ? 118 ARG A CZ   3  
ATOM 5828  N NH1  . ARG A 1 118 ? -14.279 -9.735  -12.071 1.00 0.00 ? 118 ARG A NH1  3  
ATOM 5829  N NH2  . ARG A 1 118 ? -15.174 -11.761 -12.669 1.00 0.00 ? 118 ARG A NH2  3  
ATOM 5830  H H    . ARG A 1 118 ? -14.564 -6.412  -8.205  1.00 0.00 ? 118 ARG A H    3  
ATOM 5831  H HA   . ARG A 1 118 ? -16.518 -6.094  -10.162 1.00 0.00 ? 118 ARG A HA   3  
ATOM 5832  H HB2  . ARG A 1 118 ? -15.922 -8.187  -10.911 1.00 0.00 ? 118 ARG A HB2  3  
ATOM 5833  H HB3  . ARG A 1 118 ? -14.513 -7.781  -9.940  1.00 0.00 ? 118 ARG A HB3  3  
ATOM 5834  H HG2  . ARG A 1 118 ? -15.760 -8.997  -8.035  1.00 0.00 ? 118 ARG A HG2  3  
ATOM 5835  H HG3  . ARG A 1 118 ? -16.732 -9.689  -9.336  1.00 0.00 ? 118 ARG A HG3  3  
ATOM 5836  H HD2  . ARG A 1 118 ? -13.772 -9.758  -9.604  1.00 0.00 ? 118 ARG A HD2  3  
ATOM 5837  H HD3  . ARG A 1 118 ? -14.527 -10.863 -8.456  1.00 0.00 ? 118 ARG A HD3  3  
ATOM 5838  H HE   . ARG A 1 118 ? -15.440 -12.040 -10.217 1.00 0.00 ? 118 ARG A HE   3  
ATOM 5839  H HH11 . ARG A 1 118 ? -14.016 -9.078  -11.365 1.00 0.00 ? 118 ARG A HH11 3  
ATOM 5840  H HH12 . ARG A 1 118 ? -14.124 -9.521  -13.036 1.00 0.00 ? 118 ARG A HH12 3  
ATOM 5841  H HH21 . ARG A 1 118 ? -15.588 -12.635 -12.414 1.00 0.00 ? 118 ARG A HH21 3  
ATOM 5842  H HH22 . ARG A 1 118 ? -15.020 -11.544 -13.632 1.00 0.00 ? 118 ARG A HH22 3  
ATOM 5843  N N    . ALA A 1 119 ? -17.564 -7.573  -7.438  1.00 0.00 ? 119 ALA A N    3  
ATOM 5844  C CA   . ALA A 1 119 ? -18.752 -8.006  -6.712  1.00 0.00 ? 119 ALA A CA   3  
ATOM 5845  C C    . ALA A 1 119 ? -19.861 -6.963  -6.804  1.00 0.00 ? 119 ALA A C    3  
ATOM 5846  O O    . ALA A 1 119 ? -21.038 -7.281  -6.637  1.00 0.00 ? 119 ALA A O    3  
ATOM 5847  C CB   . ALA A 1 119 ? -18.408 -8.287  -5.257  1.00 0.00 ? 119 ALA A CB   3  
ATOM 5848  H H    . ALA A 1 119 ? -16.702 -7.550  -6.973  1.00 0.00 ? 119 ALA A H    3  
ATOM 5849  H HA   . ALA A 1 119 ? -19.099 -8.926  -7.159  1.00 0.00 ? 119 ALA A HA   3  
ATOM 5850  H HB1  . ALA A 1 119 ? -18.962 -9.149  -4.917  1.00 0.00 ? 119 ALA A HB1  3  
ATOM 5851  H HB2  . ALA A 1 119 ? -17.349 -8.482  -5.169  1.00 0.00 ? 119 ALA A HB2  3  
ATOM 5852  H HB3  . ALA A 1 119 ? -18.668 -7.430  -4.654  1.00 0.00 ? 119 ALA A HB3  3  
ATOM 5853  N N    . GLU A 1 120 ? -19.477 -5.718  -7.069  1.00 0.00 ? 120 GLU A N    3  
ATOM 5854  C CA   . GLU A 1 120 ? -20.440 -4.630  -7.180  1.00 0.00 ? 120 GLU A CA   3  
ATOM 5855  C C    . GLU A 1 120 ? -21.487 -4.937  -8.247  1.00 0.00 ? 120 GLU A C    3  
ATOM 5856  O O    . GLU A 1 120 ? -22.659 -4.589  -8.101  1.00 0.00 ? 120 GLU A O    3  
ATOM 5857  C CB   . GLU A 1 120 ? -19.726 -3.319  -7.514  1.00 0.00 ? 120 GLU A CB   3  
ATOM 5858  C CG   . GLU A 1 120 ? -19.438 -3.142  -8.996  1.00 0.00 ? 120 GLU A CG   3  
ATOM 5859  C CD   . GLU A 1 120 ? -18.850 -1.782  -9.318  1.00 0.00 ? 120 GLU A CD   3  
ATOM 5860  O OE1  . GLU A 1 120 ? -18.812 -0.923  -8.412  1.00 0.00 ? 120 GLU A OE1  3  
ATOM 5861  O OE2  . GLU A 1 120 ? -18.429 -1.576  -10.475 1.00 0.00 ? 120 GLU A OE2  3  
ATOM 5862  H H    . GLU A 1 120 ? -18.524 -5.528  -7.191  1.00 0.00 ? 120 GLU A H    3  
ATOM 5863  H HA   . GLU A 1 120 ? -20.936 -4.526  -6.227  1.00 0.00 ? 120 GLU A HA   3  
ATOM 5864  H HB2  . GLU A 1 120 ? -20.341 -2.494  -7.187  1.00 0.00 ? 120 GLU A HB2  3  
ATOM 5865  H HB3  . GLU A 1 120 ? -18.787 -3.289  -6.981  1.00 0.00 ? 120 GLU A HB3  3  
ATOM 5866  H HG2  . GLU A 1 120 ? -18.737 -3.903  -9.306  1.00 0.00 ? 120 GLU A HG2  3  
ATOM 5867  H HG3  . GLU A 1 120 ? -20.361 -3.258  -9.545  1.00 0.00 ? 120 GLU A HG3  3  
ATOM 5868  N N    . ARG A 1 121 ? -21.055 -5.591  -9.321  1.00 0.00 ? 121 ARG A N    3  
ATOM 5869  C CA   . ARG A 1 121 ? -21.954 -5.943  -10.414 1.00 0.00 ? 121 ARG A CA   3  
ATOM 5870  C C    . ARG A 1 121 ? -22.938 -7.025  -9.980  1.00 0.00 ? 121 ARG A C    3  
ATOM 5871  O O    . ARG A 1 121 ? -24.145 -6.897  -10.184 1.00 0.00 ? 121 ARG A O    3  
ATOM 5872  C CB   . ARG A 1 121 ? -21.153 -6.423  -11.626 1.00 0.00 ? 121 ARG A CB   3  
ATOM 5873  C CG   . ARG A 1 121 ? -20.331 -5.328  -12.285 1.00 0.00 ? 121 ARG A CG   3  
ATOM 5874  C CD   . ARG A 1 121 ? -21.210 -4.368  -13.071 1.00 0.00 ? 121 ARG A CD   3  
ATOM 5875  N NE   . ARG A 1 121 ? -20.439 -3.578  -14.027 1.00 0.00 ? 121 ARG A NE   3  
ATOM 5876  C CZ   . ARG A 1 121 ? -20.020 -4.045  -15.198 1.00 0.00 ? 121 ARG A CZ   3  
ATOM 5877  N NH1  . ARG A 1 121 ? -20.297 -5.291  -15.556 1.00 0.00 ? 121 ARG A NH1  3  
ATOM 5878  N NH2  . ARG A 1 121 ? -19.323 -3.264  -16.014 1.00 0.00 ? 121 ARG A NH2  3  
ATOM 5879  H H    . ARG A 1 121 ? -20.110 -5.841  -9.380  1.00 0.00 ? 121 ARG A H    3  
ATOM 5880  H HA   . ARG A 1 121 ? -22.507 -5.058  -10.687 1.00 0.00 ? 121 ARG A HA   3  
ATOM 5881  H HB2  . ARG A 1 121 ? -20.480 -7.208  -11.311 1.00 0.00 ? 121 ARG A HB2  3  
ATOM 5882  H HB3  . ARG A 1 121 ? -21.838 -6.821  -12.359 1.00 0.00 ? 121 ARG A HB3  3  
ATOM 5883  H HG2  . ARG A 1 121 ? -19.807 -4.774  -11.520 1.00 0.00 ? 121 ARG A HG2  3  
ATOM 5884  H HG3  . ARG A 1 121 ? -19.617 -5.782  -12.957 1.00 0.00 ? 121 ARG A HG3  3  
ATOM 5885  H HD2  . ARG A 1 121 ? -21.953 -4.939  -13.607 1.00 0.00 ? 121 ARG A HD2  3  
ATOM 5886  H HD3  . ARG A 1 121 ? -21.700 -3.701  -12.378 1.00 0.00 ? 121 ARG A HD3  3  
ATOM 5887  H HE   . ARG A 1 121 ? -20.223 -2.654  -13.783 1.00 0.00 ? 121 ARG A HE   3  
ATOM 5888  H HH11 . ARG A 1 121 ? -20.823 -5.881  -14.943 1.00 0.00 ? 121 ARG A HH11 3  
ATOM 5889  H HH12 . ARG A 1 121 ? -19.981 -5.640  -16.439 1.00 0.00 ? 121 ARG A HH12 3  
ATOM 5890  H HH21 . ARG A 1 121 ? -19.113 -2.324  -15.748 1.00 0.00 ? 121 ARG A HH21 3  
ATOM 5891  H HH22 . ARG A 1 121 ? -19.008 -3.617  -16.895 1.00 0.00 ? 121 ARG A HH22 3  
ATOM 5892  N N    . GLU A 1 122 ? -22.414 -8.090  -9.381  1.00 0.00 ? 122 GLU A N    3  
ATOM 5893  C CA   . GLU A 1 122 ? -23.248 -9.194  -8.921  1.00 0.00 ? 122 GLU A CA   3  
ATOM 5894  C C    . GLU A 1 122 ? -24.393 -8.685  -8.050  1.00 0.00 ? 122 GLU A C    3  
ATOM 5895  O O    . GLU A 1 122 ? -25.523 -9.165  -8.147  1.00 0.00 ? 122 GLU A O    3  
ATOM 5896  C CB   . GLU A 1 122 ? -22.407 -10.205 -8.138  1.00 0.00 ? 122 GLU A CB   3  
ATOM 5897  C CG   . GLU A 1 122 ? -21.581 -11.124 -9.021  1.00 0.00 ? 122 GLU A CG   3  
ATOM 5898  C CD   . GLU A 1 122 ? -21.005 -12.302 -8.260  1.00 0.00 ? 122 GLU A CD   3  
ATOM 5899  O OE1  . GLU A 1 122 ? -20.858 -12.197 -7.024  1.00 0.00 ? 122 GLU A OE1  3  
ATOM 5900  O OE2  . GLU A 1 122 ? -20.700 -13.330 -8.901  1.00 0.00 ? 122 GLU A OE2  3  
ATOM 5901  H H    . GLU A 1 122 ? -21.444 -8.134  -9.247  1.00 0.00 ? 122 GLU A H    3  
ATOM 5902  H HA   . GLU A 1 122 ? -23.662 -9.682  -9.790  1.00 0.00 ? 122 GLU A HA   3  
ATOM 5903  H HB2  . GLU A 1 122 ? -21.735 -9.667  -7.485  1.00 0.00 ? 122 GLU A HB2  3  
ATOM 5904  H HB3  . GLU A 1 122 ? -23.066 -10.814 -7.537  1.00 0.00 ? 122 GLU A HB3  3  
ATOM 5905  H HG2  . GLU A 1 122 ? -22.209 -11.501 -9.814  1.00 0.00 ? 122 GLU A HG2  3  
ATOM 5906  H HG3  . GLU A 1 122 ? -20.767 -10.557 -9.448  1.00 0.00 ? 122 GLU A HG3  3  
ATOM 5907  N N    . LYS A 1 123 ? -24.092 -7.711  -7.198  1.00 0.00 ? 123 LYS A N    3  
ATOM 5908  C CA   . LYS A 1 123 ? -25.094 -7.135  -6.310  1.00 0.00 ? 123 LYS A CA   3  
ATOM 5909  C C    . LYS A 1 123 ? -26.175 -6.409  -7.106  1.00 0.00 ? 123 LYS A C    3  
ATOM 5910  O O    . LYS A 1 123 ? -25.910 -5.861  -8.176  1.00 0.00 ? 123 LYS A O    3  
ATOM 5911  C CB   . LYS A 1 123 ? -24.436 -6.167  -5.324  1.00 0.00 ? 123 LYS A CB   3  
ATOM 5912  C CG   . LYS A 1 123 ? -25.366 -5.069  -4.836  1.00 0.00 ? 123 LYS A CG   3  
ATOM 5913  C CD   . LYS A 1 123 ? -24.690 -4.185  -3.802  1.00 0.00 ? 123 LYS A CD   3  
ATOM 5914  C CE   . LYS A 1 123 ? -25.431 -2.868  -3.625  1.00 0.00 ? 123 LYS A CE   3  
ATOM 5915  N NZ   . LYS A 1 123 ? -25.817 -2.268  -4.932  1.00 0.00 ? 123 LYS A NZ   3  
ATOM 5916  H H    . LYS A 1 123 ? -23.173 -7.370  -7.167  1.00 0.00 ? 123 LYS A H    3  
ATOM 5917  H HA   . LYS A 1 123 ? -25.552 -7.942  -5.758  1.00 0.00 ? 123 LYS A HA   3  
ATOM 5918  H HB2  . LYS A 1 123 ? -24.090 -6.725  -4.467  1.00 0.00 ? 123 LYS A HB2  3  
ATOM 5919  H HB3  . LYS A 1 123 ? -23.588 -5.702  -5.807  1.00 0.00 ? 123 LYS A HB3  3  
ATOM 5920  H HG2  . LYS A 1 123 ? -25.662 -4.460  -5.677  1.00 0.00 ? 123 LYS A HG2  3  
ATOM 5921  H HG3  . LYS A 1 123 ? -26.241 -5.523  -4.392  1.00 0.00 ? 123 LYS A HG3  3  
ATOM 5922  H HD2  . LYS A 1 123 ? -24.669 -4.703  -2.855  1.00 0.00 ? 123 LYS A HD2  3  
ATOM 5923  H HD3  . LYS A 1 123 ? -23.679 -3.978  -4.124  1.00 0.00 ? 123 LYS A HD3  3  
ATOM 5924  H HE2  . LYS A 1 123 ? -26.322 -3.048  -3.044  1.00 0.00 ? 123 LYS A HE2  3  
ATOM 5925  H HE3  . LYS A 1 123 ? -24.790 -2.178  -3.097  1.00 0.00 ? 123 LYS A HE3  3  
ATOM 5926  H HZ1  . LYS A 1 123 ? -26.594 -2.812  -5.359  1.00 0.00 ? 123 LYS A HZ1  3  
ATOM 5927  H HZ2  . LYS A 1 123 ? -25.004 -2.275  -5.582  1.00 0.00 ? 123 LYS A HZ2  3  
ATOM 5928  H HZ3  . LYS A 1 123 ? -26.129 -1.286  -4.796  1.00 0.00 ? 123 LYS A HZ3  3  
ATOM 5929  N N    . THR A 1 124 ? -27.394 -6.408  -6.576  1.00 0.00 ? 124 THR A N    3  
ATOM 5930  C CA   . THR A 1 124 ? -28.514 -5.750  -7.236  1.00 0.00 ? 124 THR A CA   3  
ATOM 5931  C C    . THR A 1 124 ? -28.178 -4.303  -7.576  1.00 0.00 ? 124 THR A C    3  
ATOM 5932  O O    . THR A 1 124 ? -27.062 -3.842  -7.339  1.00 0.00 ? 124 THR A O    3  
ATOM 5933  C CB   . THR A 1 124 ? -29.780 -5.780  -6.359  1.00 0.00 ? 124 THR A CB   3  
ATOM 5934  O OG1  . THR A 1 124 ? -30.929 -5.449  -7.146  1.00 0.00 ? 124 THR A OG1  3  
ATOM 5935  C CG2  . THR A 1 124 ? -29.656 -4.804  -5.198  1.00 0.00 ? 124 THR A CG2  3  
ATOM 5936  H H    . THR A 1 124 ? -27.542 -6.862  -5.720  1.00 0.00 ? 124 THR A H    3  
ATOM 5937  H HA   . THR A 1 124 ? -28.723 -6.286  -8.151  1.00 0.00 ? 124 THR A HA   3  
ATOM 5938  H HB   . THR A 1 124 ? -29.900 -6.777  -5.960  1.00 0.00 ? 124 THR A HB   3  
ATOM 5939  H HG1  . THR A 1 124 ? -31.598 -5.050  -6.585  1.00 0.00 ? 124 THR A HG1  3  
ATOM 5940  H HG21 . THR A 1 124 ? -30.522 -4.894  -4.560  1.00 0.00 ? 124 THR A HG21 3  
ATOM 5941  H HG22 . THR A 1 124 ? -29.595 -3.796  -5.581  1.00 0.00 ? 124 THR A HG22 3  
ATOM 5942  H HG23 . THR A 1 124 ? -28.765 -5.030  -4.632  1.00 0.00 ? 124 THR A HG23 3  
ATOM 5943  N N    . SER A 1 125 ? -29.152 -3.589  -8.133  1.00 0.00 ? 125 SER A N    3  
ATOM 5944  C CA   . SER A 1 125 ? -28.958 -2.194  -8.508  1.00 0.00 ? 125 SER A CA   3  
ATOM 5945  C C    . SER A 1 125 ? -30.277 -1.559  -8.941  1.00 0.00 ? 125 SER A C    3  
ATOM 5946  O O    . SER A 1 125 ? -31.246 -2.257  -9.239  1.00 0.00 ? 125 SER A O    3  
ATOM 5947  C CB   . SER A 1 125 ? -27.932 -2.085  -9.638  1.00 0.00 ? 125 SER A CB   3  
ATOM 5948  O OG   . SER A 1 125 ? -27.713 -0.733  -10.000 1.00 0.00 ? 125 SER A OG   3  
ATOM 5949  H H    . SER A 1 125 ? -30.021 -4.013  -8.297  1.00 0.00 ? 125 SER A H    3  
ATOM 5950  H HA   . SER A 1 125 ? -28.586 -1.666  -7.643  1.00 0.00 ? 125 SER A HA   3  
ATOM 5951  H HB2  . SER A 1 125 ? -26.997 -2.514  -9.314  1.00 0.00 ? 125 SER A HB2  3  
ATOM 5952  H HB3  . SER A 1 125 ? -28.295 -2.623  -10.503 1.00 0.00 ? 125 SER A HB3  3  
ATOM 5953  H HG   . SER A 1 125 ? -27.859 -0.625  -10.943 1.00 0.00 ? 125 SER A HG   3  
ATOM 5954  N N    . GLY A 1 126 ? -30.305 -0.231  -8.972  1.00 0.00 ? 126 GLY A N    3  
ATOM 5955  C CA   . GLY A 1 126 ? -31.509 0.477   -9.369  1.00 0.00 ? 126 GLY A CA   3  
ATOM 5956  C C    . GLY A 1 126 ? -31.473 1.943   -8.985  1.00 0.00 ? 126 GLY A C    3  
ATOM 5957  O O    . GLY A 1 126 ? -31.518 2.831   -9.837  1.00 0.00 ? 126 GLY A O    3  
ATOM 5958  H H    . GLY A 1 126 ? -29.502 0.274   -8.724  1.00 0.00 ? 126 GLY A H    3  
ATOM 5959  H HA2  . GLY A 1 126 ? -31.623 0.398   -10.440 1.00 0.00 ? 126 GLY A HA2  3  
ATOM 5960  H HA3  . GLY A 1 126 ? -32.359 0.012   -8.892  1.00 0.00 ? 126 GLY A HA3  3  
ATOM 5961  N N    . PRO A 1 127 ? -31.392 2.213   -7.674  1.00 0.00 ? 127 PRO A N    3  
ATOM 5962  C CA   . PRO A 1 127 ? -31.349 3.581   -7.149  1.00 0.00 ? 127 PRO A CA   3  
ATOM 5963  C C    . PRO A 1 127 ? -30.038 4.287   -7.476  1.00 0.00 ? 127 PRO A C    3  
ATOM 5964  O O    . PRO A 1 127 ? -28.976 3.665   -7.497  1.00 0.00 ? 127 PRO A O    3  
ATOM 5965  C CB   . PRO A 1 127 ? -31.489 3.386   -5.637  1.00 0.00 ? 127 PRO A CB   3  
ATOM 5966  C CG   . PRO A 1 127 ? -30.977 2.010   -5.384  1.00 0.00 ? 127 PRO A CG   3  
ATOM 5967  C CD   . PRO A 1 127 ? -31.334 1.204   -6.603  1.00 0.00 ? 127 PRO A CD   3  
ATOM 5968  H HA   . PRO A 1 127 ? -32.176 4.172   -7.515  1.00 0.00 ? 127 PRO A HA   3  
ATOM 5969  H HB2  . PRO A 1 127 ? -30.899 4.129   -5.119  1.00 0.00 ? 127 PRO A HB2  3  
ATOM 5970  H HB3  . PRO A 1 127 ? -32.526 3.479   -5.353  1.00 0.00 ? 127 PRO A HB3  3  
ATOM 5971  H HG2  . PRO A 1 127 ? -29.906 2.035   -5.252  1.00 0.00 ? 127 PRO A HG2  3  
ATOM 5972  H HG3  . PRO A 1 127 ? -31.454 1.596   -4.509  1.00 0.00 ? 127 PRO A HG3  3  
ATOM 5973  H HD2  . PRO A 1 127 ? -30.570 0.469   -6.806  1.00 0.00 ? 127 PRO A HD2  3  
ATOM 5974  H HD3  . PRO A 1 127 ? -32.294 0.727   -6.471  1.00 0.00 ? 127 PRO A HD3  3  
ATOM 5975  N N    . SER A 1 128 ? -30.119 5.590   -7.729  1.00 0.00 ? 128 SER A N    3  
ATOM 5976  C CA   . SER A 1 128 ? -28.939 6.380   -8.058  1.00 0.00 ? 128 SER A CA   3  
ATOM 5977  C C    . SER A 1 128 ? -28.002 6.483   -6.857  1.00 0.00 ? 128 SER A C    3  
ATOM 5978  O O    . SER A 1 128 ? -28.362 7.043   -5.822  1.00 0.00 ? 128 SER A O    3  
ATOM 5979  C CB   . SER A 1 128 ? -29.348 7.779   -8.522  1.00 0.00 ? 128 SER A CB   3  
ATOM 5980  O OG   . SER A 1 128 ? -30.500 8.229   -7.829  1.00 0.00 ? 128 SER A OG   3  
ATOM 5981  H H    . SER A 1 128 ? -30.995 6.029   -7.696  1.00 0.00 ? 128 SER A H    3  
ATOM 5982  H HA   . SER A 1 128 ? -28.419 5.881   -8.862  1.00 0.00 ? 128 SER A HA   3  
ATOM 5983  H HB2  . SER A 1 128 ? -28.539 8.468   -8.336  1.00 0.00 ? 128 SER A HB2  3  
ATOM 5984  H HB3  . SER A 1 128 ? -29.565 7.755   -9.580  1.00 0.00 ? 128 SER A HB3  3  
ATOM 5985  H HG   . SER A 1 128 ? -30.250 8.913   -7.203  1.00 0.00 ? 128 SER A HG   3  
ATOM 5986  N N    . SER A 1 129 ? -26.799 5.939   -7.005  1.00 0.00 ? 129 SER A N    3  
ATOM 5987  C CA   . SER A 1 129 ? -25.811 5.966   -5.933  1.00 0.00 ? 129 SER A CA   3  
ATOM 5988  C C    . SER A 1 129 ? -24.532 6.662   -6.389  1.00 0.00 ? 129 SER A C    3  
ATOM 5989  O O    . SER A 1 129 ? -24.029 6.405   -7.482  1.00 0.00 ? 129 SER A O    3  
ATOM 5990  C CB   . SER A 1 129 ? -25.493 4.543   -5.468  1.00 0.00 ? 129 SER A CB   3  
ATOM 5991  O OG   . SER A 1 129 ? -25.372 3.662   -6.571  1.00 0.00 ? 129 SER A OG   3  
ATOM 5992  H H    . SER A 1 129 ? -26.571 5.507   -7.855  1.00 0.00 ? 129 SER A H    3  
ATOM 5993  H HA   . SER A 1 129 ? -26.233 6.519   -5.107  1.00 0.00 ? 129 SER A HA   3  
ATOM 5994  H HB2  . SER A 1 129 ? -24.562 4.546   -4.922  1.00 0.00 ? 129 SER A HB2  3  
ATOM 5995  H HB3  . SER A 1 129 ? -26.287 4.191   -4.826  1.00 0.00 ? 129 SER A HB3  3  
ATOM 5996  H HG   . SER A 1 129 ? -25.025 2.818   -6.271  1.00 0.00 ? 129 SER A HG   3  
ATOM 5997  N N    . GLY A 1 130 ? -24.013 7.546   -5.543  1.00 0.00 ? 130 GLY A N    3  
ATOM 5998  C CA   . GLY A 1 130 ? -22.798 8.266   -5.876  1.00 0.00 ? 130 GLY A CA   3  
ATOM 5999  C C    . GLY A 1 130 ? -23.076 9.663   -6.395  1.00 0.00 ? 130 GLY A C    3  
ATOM 6000  O O    . GLY A 1 130 ? -22.322 10.190  -7.213  1.00 0.00 ? 130 GLY A O    3  
ATOM 6001  H H    . GLY A 1 130 ? -24.458 7.710   -4.685  1.00 0.00 ? 130 GLY A H    3  
ATOM 6002  H HA2  . GLY A 1 130 ? -22.181 8.338   -4.993  1.00 0.00 ? 130 GLY A HA2  3  
ATOM 6003  H HA3  . GLY A 1 130 ? -22.262 7.714   -6.634  1.00 0.00 ? 130 GLY A HA3  3  
ATOM 6004  N N    . GLY A 1 1   ? 5.833   -12.659 -22.863 1.00 0.00 ? 1   GLY A N    4  
ATOM 6005  C CA   . GLY A 1 1   ? 4.925   -11.760 -22.174 1.00 0.00 ? 1   GLY A CA   4  
ATOM 6006  C C    . GLY A 1 1   ? 3.497   -12.267 -22.173 1.00 0.00 ? 1   GLY A C    4  
ATOM 6007  O O    . GLY A 1 1   ? 2.744   -12.025 -23.117 1.00 0.00 ? 1   GLY A O    4  
ATOM 6008  H H1   . GLY A 1 1   ? 5.561   -13.584 -23.043 1.00 0.00 ? 1   GLY A H1   4  
ATOM 6009  H HA2  . GLY A 1 1   ? 5.256   -11.645 -21.153 1.00 0.00 ? 1   GLY A HA2  4  
ATOM 6010  H HA3  . GLY A 1 1   ? 4.952   -10.797 -22.661 1.00 0.00 ? 1   GLY A HA3  4  
ATOM 6011  N N    . SER A 1 2   ? 3.122   -12.974 -21.112 1.00 0.00 ? 2   SER A N    4  
ATOM 6012  C CA   . SER A 1 2   ? 1.775   -13.522 -20.995 1.00 0.00 ? 2   SER A CA   4  
ATOM 6013  C C    . SER A 1 2   ? 0.727   -12.435 -21.210 1.00 0.00 ? 2   SER A C    4  
ATOM 6014  O O    . SER A 1 2   ? 1.057   -11.258 -21.352 1.00 0.00 ? 2   SER A O    4  
ATOM 6015  C CB   . SER A 1 2   ? 1.582   -14.167 -19.621 1.00 0.00 ? 2   SER A CB   4  
ATOM 6016  O OG   . SER A 1 2   ? 2.400   -15.316 -19.478 1.00 0.00 ? 2   SER A OG   4  
ATOM 6017  H H    . SER A 1 2   ? 3.768   -13.134 -20.392 1.00 0.00 ? 2   SER A H    4  
ATOM 6018  H HA   . SER A 1 2   ? 1.657   -14.277 -21.757 1.00 0.00 ? 2   SER A HA   4  
ATOM 6019  H HB2  . SER A 1 2   ? 1.843   -13.456 -18.852 1.00 0.00 ? 2   SER A HB2  4  
ATOM 6020  H HB3  . SER A 1 2   ? 0.548   -14.459 -19.506 1.00 0.00 ? 2   SER A HB3  4  
ATOM 6021  H HG   . SER A 1 2   ? 2.125   -15.810 -18.702 1.00 0.00 ? 2   SER A HG   4  
ATOM 6022  N N    . SER A 1 3   ? -0.539  -12.840 -21.234 1.00 0.00 ? 3   SER A N    4  
ATOM 6023  C CA   . SER A 1 3   ? -1.638  -11.902 -21.436 1.00 0.00 ? 3   SER A CA   4  
ATOM 6024  C C    . SER A 1 3   ? -2.951  -12.484 -20.921 1.00 0.00 ? 3   SER A C    4  
ATOM 6025  O O    . SER A 1 3   ? -3.502  -13.415 -21.506 1.00 0.00 ? 3   SER A O    4  
ATOM 6026  C CB   . SER A 1 3   ? -1.770  -11.551 -22.920 1.00 0.00 ? 3   SER A CB   4  
ATOM 6027  O OG   . SER A 1 3   ? -2.280  -12.647 -23.660 1.00 0.00 ? 3   SER A OG   4  
ATOM 6028  H H    . SER A 1 3   ? -0.739  -13.792 -21.115 1.00 0.00 ? 3   SER A H    4  
ATOM 6029  H HA   . SER A 1 3   ? -1.413  -11.004 -20.881 1.00 0.00 ? 3   SER A HA   4  
ATOM 6030  H HB2  . SER A 1 3   ? -2.442  -10.714 -23.030 1.00 0.00 ? 3   SER A HB2  4  
ATOM 6031  H HB3  . SER A 1 3   ? -0.798  -11.288 -23.312 1.00 0.00 ? 3   SER A HB3  4  
ATOM 6032  H HG   . SER A 1 3   ? -1.809  -13.446 -23.414 1.00 0.00 ? 3   SER A HG   4  
ATOM 6033  N N    . GLY A 1 4   ? -3.446  -11.927 -19.820 1.00 0.00 ? 4   GLY A N    4  
ATOM 6034  C CA   . GLY A 1 4   ? -4.690  -12.403 -19.243 1.00 0.00 ? 4   GLY A CA   4  
ATOM 6035  C C    . GLY A 1 4   ? -4.778  -12.136 -17.754 1.00 0.00 ? 4   GLY A C    4  
ATOM 6036  O O    . GLY A 1 4   ? -4.391  -12.976 -16.941 1.00 0.00 ? 4   GLY A O    4  
ATOM 6037  H H    . GLY A 1 4   ? -2.963  -11.188 -19.396 1.00 0.00 ? 4   GLY A H    4  
ATOM 6038  H HA2  . GLY A 1 4   ? -5.514  -11.911 -19.736 1.00 0.00 ? 4   GLY A HA2  4  
ATOM 6039  H HA3  . GLY A 1 4   ? -4.767  -13.467 -19.411 1.00 0.00 ? 4   GLY A HA3  4  
ATOM 6040  N N    . SER A 1 5   ? -5.286  -10.961 -17.394 1.00 0.00 ? 5   SER A N    4  
ATOM 6041  C CA   . SER A 1 5   ? -5.418  -10.583 -15.992 1.00 0.00 ? 5   SER A CA   4  
ATOM 6042  C C    . SER A 1 5   ? -6.866  -10.713 -15.528 1.00 0.00 ? 5   SER A C    4  
ATOM 6043  O O    . SER A 1 5   ? -7.775  -10.140 -16.128 1.00 0.00 ? 5   SER A O    4  
ATOM 6044  C CB   . SER A 1 5   ? -4.930  -9.148  -15.781 1.00 0.00 ? 5   SER A CB   4  
ATOM 6045  O OG   . SER A 1 5   ? -4.902  -8.817  -14.403 1.00 0.00 ? 5   SER A OG   4  
ATOM 6046  H H    . SER A 1 5   ? -5.576  -10.334 -18.088 1.00 0.00 ? 5   SER A H    4  
ATOM 6047  H HA   . SER A 1 5   ? -4.804  -11.252 -15.408 1.00 0.00 ? 5   SER A HA   4  
ATOM 6048  H HB2  . SER A 1 5   ? -3.934  -9.047  -16.183 1.00 0.00 ? 5   SER A HB2  4  
ATOM 6049  H HB3  . SER A 1 5   ? -5.596  -8.466  -16.290 1.00 0.00 ? 5   SER A HB3  4  
ATOM 6050  H HG   . SER A 1 5   ? -5.301  -9.526  -13.895 1.00 0.00 ? 5   SER A HG   4  
ATOM 6051  N N    . SER A 1 6   ? -7.071  -11.471 -14.456 1.00 0.00 ? 6   SER A N    4  
ATOM 6052  C CA   . SER A 1 6   ? -8.408  -11.681 -13.913 1.00 0.00 ? 6   SER A CA   4  
ATOM 6053  C C    . SER A 1 6   ? -8.576  -10.950 -12.585 1.00 0.00 ? 6   SER A C    4  
ATOM 6054  O O    . SER A 1 6   ? -9.207  -11.458 -11.659 1.00 0.00 ? 6   SER A O    4  
ATOM 6055  C CB   . SER A 1 6   ? -8.676  -13.175 -13.723 1.00 0.00 ? 6   SER A CB   4  
ATOM 6056  O OG   . SER A 1 6   ? -9.100  -13.776 -14.935 1.00 0.00 ? 6   SER A OG   4  
ATOM 6057  H H    . SER A 1 6   ? -6.305  -11.902 -14.022 1.00 0.00 ? 6   SER A H    4  
ATOM 6058  H HA   . SER A 1 6   ? -9.120  -11.284 -14.622 1.00 0.00 ? 6   SER A HA   4  
ATOM 6059  H HB2  . SER A 1 6   ? -7.771  -13.661 -13.392 1.00 0.00 ? 6   SER A HB2  4  
ATOM 6060  H HB3  . SER A 1 6   ? -9.449  -13.308 -12.980 1.00 0.00 ? 6   SER A HB3  4  
ATOM 6061  H HG   . SER A 1 6   ? -9.848  -13.290 -15.289 1.00 0.00 ? 6   SER A HG   4  
ATOM 6062  N N    . GLY A 1 7   ? -8.005  -9.752  -12.499 1.00 0.00 ? 7   GLY A N    4  
ATOM 6063  C CA   . GLY A 1 7   ? -8.102  -8.969  -11.281 1.00 0.00 ? 7   GLY A CA   4  
ATOM 6064  C C    . GLY A 1 7   ? -6.884  -9.126  -10.393 1.00 0.00 ? 7   GLY A C    4  
ATOM 6065  O O    . GLY A 1 7   ? -6.770  -10.099 -9.647  1.00 0.00 ? 7   GLY A O    4  
ATOM 6066  H H    . GLY A 1 7   ? -7.515  -9.397  -13.270 1.00 0.00 ? 7   GLY A H    4  
ATOM 6067  H HA2  . GLY A 1 7   ? -8.212  -7.928  -11.543 1.00 0.00 ? 7   GLY A HA2  4  
ATOM 6068  H HA3  . GLY A 1 7   ? -8.976  -9.286  -10.732 1.00 0.00 ? 7   GLY A HA3  4  
ATOM 6069  N N    . THR A 1 8   ? -5.967  -8.167  -10.473 1.00 0.00 ? 8   THR A N    4  
ATOM 6070  C CA   . THR A 1 8   ? -4.749  -8.204  -9.673  1.00 0.00 ? 8   THR A CA   4  
ATOM 6071  C C    . THR A 1 8   ? -4.578  -6.918  -8.873  1.00 0.00 ? 8   THR A C    4  
ATOM 6072  O O    . THR A 1 8   ? -4.830  -5.816  -9.362  1.00 0.00 ? 8   THR A O    4  
ATOM 6073  C CB   . THR A 1 8   ? -3.504  -8.418  -10.554 1.00 0.00 ? 8   THR A CB   4  
ATOM 6074  O OG1  . THR A 1 8   ? -3.584  -9.684  -11.217 1.00 0.00 ? 8   THR A OG1  4  
ATOM 6075  C CG2  . THR A 1 8   ? -2.234  -8.356  -9.720  1.00 0.00 ? 8   THR A CG2  4  
ATOM 6076  H H    . THR A 1 8   ? -6.114  -7.417  -11.087 1.00 0.00 ? 8   THR A H    4  
ATOM 6077  H HA   . THR A 1 8   ? -4.826  -9.036  -8.987  1.00 0.00 ? 8   THR A HA   4  
ATOM 6078  H HB   . THR A 1 8   ? -3.468  -7.633  -11.296 1.00 0.00 ? 8   THR A HB   4  
ATOM 6079  H HG1  . THR A 1 8   ? -3.902  -10.349 -10.601 1.00 0.00 ? 8   THR A HG1  4  
ATOM 6080  H HG21 . THR A 1 8   ? -2.328  -7.577  -8.978  1.00 0.00 ? 8   THR A HG21 4  
ATOM 6081  H HG22 . THR A 1 8   ? -1.392  -8.142  -10.361 1.00 0.00 ? 8   THR A HG22 4  
ATOM 6082  H HG23 . THR A 1 8   ? -2.080  -9.305  -9.228  1.00 0.00 ? 8   THR A HG23 4  
ATOM 6083  N N    . PRO A 1 9   ? -4.137  -7.057  -7.614  1.00 0.00 ? 9   PRO A N    4  
ATOM 6084  C CA   . PRO A 1 9   ? -3.920  -5.916  -6.720  1.00 0.00 ? 9   PRO A CA   4  
ATOM 6085  C C    . PRO A 1 9   ? -2.730  -5.063  -7.147  1.00 0.00 ? 9   PRO A C    4  
ATOM 6086  O O    . PRO A 1 9   ? -1.583  -5.510  -7.094  1.00 0.00 ? 9   PRO A O    4  
ATOM 6087  C CB   . PRO A 1 9   ? -3.649  -6.573  -5.365  1.00 0.00 ? 9   PRO A CB   4  
ATOM 6088  C CG   . PRO A 1 9   ? -3.121  -7.926  -5.699  1.00 0.00 ? 9   PRO A CG   4  
ATOM 6089  C CD   . PRO A 1 9   ? -3.815  -8.340  -6.966  1.00 0.00 ? 9   PRO A CD   4  
ATOM 6090  H HA   . PRO A 1 9   ? -4.800  -5.294  -6.651  1.00 0.00 ? 9   PRO A HA   4  
ATOM 6091  H HB2  . PRO A 1 9   ? -2.923  -5.989  -4.817  1.00 0.00 ? 9   PRO A HB2  4  
ATOM 6092  H HB3  . PRO A 1 9   ? -4.567  -6.636  -4.801  1.00 0.00 ? 9   PRO A HB3  4  
ATOM 6093  H HG2  . PRO A 1 9   ? -2.054  -7.875  -5.855  1.00 0.00 ? 9   PRO A HG2  4  
ATOM 6094  H HG3  . PRO A 1 9   ? -3.353  -8.617  -4.902  1.00 0.00 ? 9   PRO A HG3  4  
ATOM 6095  H HD2  . PRO A 1 9   ? -3.154  -8.929  -7.584  1.00 0.00 ? 9   PRO A HD2  4  
ATOM 6096  H HD3  . PRO A 1 9   ? -4.715  -8.893  -6.740  1.00 0.00 ? 9   PRO A HD3  4  
ATOM 6097  N N    . HIS A 1 10  ? -3.009  -3.834  -7.568  1.00 0.00 ? 10  HIS A N    4  
ATOM 6098  C CA   . HIS A 1 10  ? -1.960  -2.918  -8.003  1.00 0.00 ? 10  HIS A CA   4  
ATOM 6099  C C    . HIS A 1 10  ? -2.239  -1.501  -7.514  1.00 0.00 ? 10  HIS A C    4  
ATOM 6100  O O    . HIS A 1 10  ? -3.394  -1.109  -7.340  1.00 0.00 ? 10  HIS A O    4  
ATOM 6101  C CB   . HIS A 1 10  ? -1.842  -2.931  -9.527  1.00 0.00 ? 10  HIS A CB   4  
ATOM 6102  C CG   . HIS A 1 10  ? -3.079  -2.457  -10.227 1.00 0.00 ? 10  HIS A CG   4  
ATOM 6103  N ND1  . HIS A 1 10  ? -4.141  -3.286  -10.522 1.00 0.00 ? 10  HIS A ND1  4  
ATOM 6104  C CD2  . HIS A 1 10  ? -3.421  -1.232  -10.690 1.00 0.00 ? 10  HIS A CD2  4  
ATOM 6105  C CE1  . HIS A 1 10  ? -5.081  -2.592  -11.137 1.00 0.00 ? 10  HIS A CE1  4  
ATOM 6106  N NE2  . HIS A 1 10  ? -4.669  -1.342  -11.251 1.00 0.00 ? 10  HIS A NE2  4  
ATOM 6107  H H    . HIS A 1 10  ? -3.942  -3.536  -7.587  1.00 0.00 ? 10  HIS A H    4  
ATOM 6108  H HA   . HIS A 1 10  ? -1.027  -3.256  -7.576  1.00 0.00 ? 10  HIS A HA   4  
ATOM 6109  H HB2  . HIS A 1 10  ? -1.027  -2.287  -9.824  1.00 0.00 ? 10  HIS A HB2  4  
ATOM 6110  H HB3  . HIS A 1 10  ? -1.638  -3.939  -9.858  1.00 0.00 ? 10  HIS A HB3  4  
ATOM 6111  H HD1  . HIS A 1 10  ? -4.196  -4.242  -10.312 1.00 0.00 ? 10  HIS A HD1  4  
ATOM 6112  H HD2  . HIS A 1 10  ? -2.822  -0.334  -10.630 1.00 0.00 ? 10  HIS A HD2  4  
ATOM 6113  H HE1  . HIS A 1 10  ? -6.027  -2.979  -11.487 1.00 0.00 ? 10  HIS A HE1  4  
ATOM 6114  N N    . LEU A 1 11  ? -1.176  -0.736  -7.292  1.00 0.00 ? 11  LEU A N    4  
ATOM 6115  C CA   . LEU A 1 11  ? -1.306  0.639   -6.822  1.00 0.00 ? 11  LEU A CA   4  
ATOM 6116  C C    . LEU A 1 11  ? -1.051  1.628   -7.955  1.00 0.00 ? 11  LEU A C    4  
ATOM 6117  O O    . LEU A 1 11  ? -0.108  1.470   -8.730  1.00 0.00 ? 11  LEU A O    4  
ATOM 6118  C CB   . LEU A 1 11  ? -0.333  0.900   -5.672  1.00 0.00 ? 11  LEU A CB   4  
ATOM 6119  C CG   . LEU A 1 11  ? -0.297  -0.159  -4.569  1.00 0.00 ? 11  LEU A CG   4  
ATOM 6120  C CD1  . LEU A 1 11  ? 1.078   -0.207  -3.920  1.00 0.00 ? 11  LEU A CD1  4  
ATOM 6121  C CD2  . LEU A 1 11  ? -1.371  0.118   -3.528  1.00 0.00 ? 11  LEU A CD2  4  
ATOM 6122  H H    . LEU A 1 11  ? -0.281  -1.103  -7.449  1.00 0.00 ? 11  LEU A H    4  
ATOM 6123  H HA   . LEU A 1 11  ? -2.317  0.772   -6.465  1.00 0.00 ? 11  LEU A HA   4  
ATOM 6124  H HB2  . LEU A 1 11  ? 0.659   0.976   -6.090  1.00 0.00 ? 11  LEU A HB2  4  
ATOM 6125  H HB3  . LEU A 1 11  ? -0.603  1.843   -5.218  1.00 0.00 ? 11  LEU A HB3  4  
ATOM 6126  H HG   . LEU A 1 11  ? -0.493  -1.129  -5.004  1.00 0.00 ? 11  LEU A HG   4  
ATOM 6127  H HD11 . LEU A 1 11  ? 1.019   -0.756  -2.993  1.00 0.00 ? 11  LEU A HD11 4  
ATOM 6128  H HD12 . LEU A 1 11  ? 1.417   0.799   -3.722  1.00 0.00 ? 11  LEU A HD12 4  
ATOM 6129  H HD13 . LEU A 1 11  ? 1.774   -0.696  -4.586  1.00 0.00 ? 11  LEU A HD13 4  
ATOM 6130  H HD21 . LEU A 1 11  ? -1.039  0.907   -2.870  1.00 0.00 ? 11  LEU A HD21 4  
ATOM 6131  H HD22 . LEU A 1 11  ? -1.555  -0.778  -2.954  1.00 0.00 ? 11  LEU A HD22 4  
ATOM 6132  H HD23 . LEU A 1 11  ? -2.282  0.421   -4.023  1.00 0.00 ? 11  LEU A HD23 4  
ATOM 6133  N N    . VAL A 1 12  ? -1.896  2.651   -8.042  1.00 0.00 ? 12  VAL A N    4  
ATOM 6134  C CA   . VAL A 1 12  ? -1.760  3.668   -9.078  1.00 0.00 ? 12  VAL A CA   4  
ATOM 6135  C C    . VAL A 1 12  ? -1.047  4.905   -8.542  1.00 0.00 ? 12  VAL A C    4  
ATOM 6136  O O    . VAL A 1 12  ? -1.286  5.332   -7.414  1.00 0.00 ? 12  VAL A O    4  
ATOM 6137  C CB   . VAL A 1 12  ? -3.132  4.084   -9.640  1.00 0.00 ? 12  VAL A CB   4  
ATOM 6138  C CG1  . VAL A 1 12  ? -2.970  4.788   -10.979 1.00 0.00 ? 12  VAL A CG1  4  
ATOM 6139  C CG2  . VAL A 1 12  ? -4.042  2.872   -9.772  1.00 0.00 ? 12  VAL A CG2  4  
ATOM 6140  H H    . VAL A 1 12  ? -2.628  2.723   -7.395  1.00 0.00 ? 12  VAL A H    4  
ATOM 6141  H HA   . VAL A 1 12  ? -1.176  3.249   -9.884  1.00 0.00 ? 12  VAL A HA   4  
ATOM 6142  H HB   . VAL A 1 12  ? -3.588  4.776   -8.948  1.00 0.00 ? 12  VAL A HB   4  
ATOM 6143  H HG11 . VAL A 1 12  ? -2.465  5.731   -10.830 1.00 0.00 ? 12  VAL A HG11 4  
ATOM 6144  H HG12 . VAL A 1 12  ? -2.387  4.167   -11.644 1.00 0.00 ? 12  VAL A HG12 4  
ATOM 6145  H HG13 . VAL A 1 12  ? -3.943  4.965   -11.412 1.00 0.00 ? 12  VAL A HG13 4  
ATOM 6146  H HG21 . VAL A 1 12  ? -4.520  2.675   -8.824  1.00 0.00 ? 12  VAL A HG21 4  
ATOM 6147  H HG22 . VAL A 1 12  ? -4.795  3.068   -10.522 1.00 0.00 ? 12  VAL A HG22 4  
ATOM 6148  H HG23 . VAL A 1 12  ? -3.457  2.012   -10.066 1.00 0.00 ? 12  VAL A HG23 4  
ATOM 6149  N N    . ASN A 1 13  ? -0.170  5.476   -9.361  1.00 0.00 ? 13  ASN A N    4  
ATOM 6150  C CA   . ASN A 1 13  ? 0.579   6.665   -8.970  1.00 0.00 ? 13  ASN A CA   4  
ATOM 6151  C C    . ASN A 1 13  ? -0.156  7.934   -9.391  1.00 0.00 ? 13  ASN A C    4  
ATOM 6152  O O    . ASN A 1 13  ? -0.119  8.328   -10.558 1.00 0.00 ? 13  ASN A O    4  
ATOM 6153  C CB   . ASN A 1 13  ? 1.977   6.641   -9.592  1.00 0.00 ? 13  ASN A CB   4  
ATOM 6154  C CG   . ASN A 1 13  ? 2.960   7.517   -8.840  1.00 0.00 ? 13  ASN A CG   4  
ATOM 6155  O OD1  . ASN A 1 13  ? 2.601   8.580   -8.334  1.00 0.00 ? 13  ASN A OD1  4  
ATOM 6156  N ND2  . ASN A 1 13  ? 4.209   7.072   -8.763  1.00 0.00 ? 13  ASN A ND2  4  
ATOM 6157  H H    . ASN A 1 13  ? -0.022  5.090   -10.249 1.00 0.00 ? 13  ASN A H    4  
ATOM 6158  H HA   . ASN A 1 13  ? 0.674   6.658   -7.894  1.00 0.00 ? 13  ASN A HA   4  
ATOM 6159  H HB2  . ASN A 1 13  ? 2.349   5.627   -9.586  1.00 0.00 ? 13  ASN A HB2  4  
ATOM 6160  H HB3  . ASN A 1 13  ? 1.917   6.992   -10.612 1.00 0.00 ? 13  ASN A HB3  4  
ATOM 6161  H HD21 . ASN A 1 13  ? 4.423   6.216   -9.190  1.00 0.00 ? 13  ASN A HD21 4  
ATOM 6162  H HD22 . ASN A 1 13  ? 4.865   7.618   -8.282  1.00 0.00 ? 13  ASN A HD22 4  
ATOM 6163  N N    . LEU A 1 14  ? -0.822  8.571   -8.434  1.00 0.00 ? 14  LEU A N    4  
ATOM 6164  C CA   . LEU A 1 14  ? -1.565  9.796   -8.705  1.00 0.00 ? 14  LEU A CA   4  
ATOM 6165  C C    . LEU A 1 14  ? -0.830  11.013  -8.152  1.00 0.00 ? 14  LEU A C    4  
ATOM 6166  O O    . LEU A 1 14  ? -1.353  12.126  -8.167  1.00 0.00 ? 14  LEU A O    4  
ATOM 6167  C CB   . LEU A 1 14  ? -2.965  9.712   -8.095  1.00 0.00 ? 14  LEU A CB   4  
ATOM 6168  C CG   . LEU A 1 14  ? -3.027  9.458   -6.588  1.00 0.00 ? 14  LEU A CG   4  
ATOM 6169  C CD1  . LEU A 1 14  ? -4.375  9.887   -6.029  1.00 0.00 ? 14  LEU A CD1  4  
ATOM 6170  C CD2  . LEU A 1 14  ? -2.764  7.991   -6.283  1.00 0.00 ? 14  LEU A CD2  4  
ATOM 6171  H H    . LEU A 1 14  ? -0.814  8.209   -7.524  1.00 0.00 ? 14  LEU A H    4  
ATOM 6172  H HA   . LEU A 1 14  ? -1.654  9.900   -9.776  1.00 0.00 ? 14  LEU A HA   4  
ATOM 6173  H HB2  . LEU A 1 14  ? -3.469  10.645  -8.293  1.00 0.00 ? 14  LEU A HB2  4  
ATOM 6174  H HB3  . LEU A 1 14  ? -3.493  8.908   -8.589  1.00 0.00 ? 14  LEU A HB3  4  
ATOM 6175  H HG   . LEU A 1 14  ? -2.262  10.045  -6.099  1.00 0.00 ? 14  LEU A HG   4  
ATOM 6176  H HD11 . LEU A 1 14  ? -4.844  10.579  -6.712  1.00 0.00 ? 14  LEU A HD11 4  
ATOM 6177  H HD12 . LEU A 1 14  ? -4.231  10.366  -5.072  1.00 0.00 ? 14  LEU A HD12 4  
ATOM 6178  H HD13 . LEU A 1 14  ? -5.006  9.019   -5.906  1.00 0.00 ? 14  LEU A HD13 4  
ATOM 6179  H HD21 . LEU A 1 14  ? -1.812  7.893   -5.782  1.00 0.00 ? 14  LEU A HD21 4  
ATOM 6180  H HD22 . LEU A 1 14  ? -2.744  7.430   -7.206  1.00 0.00 ? 14  LEU A HD22 4  
ATOM 6181  H HD23 . LEU A 1 14  ? -3.548  7.609   -5.646  1.00 0.00 ? 14  LEU A HD23 4  
ATOM 6182  N N    . ASN A 1 15  ? 0.388   10.792  -7.667  1.00 0.00 ? 15  ASN A N    4  
ATOM 6183  C CA   . ASN A 1 15  ? 1.196   11.870  -7.110  1.00 0.00 ? 15  ASN A CA   4  
ATOM 6184  C C    . ASN A 1 15  ? 1.135   13.110  -7.998  1.00 0.00 ? 15  ASN A C    4  
ATOM 6185  O O    . ASN A 1 15  ? 0.651   13.052  -9.128  1.00 0.00 ? 15  ASN A O    4  
ATOM 6186  C CB   . ASN A 1 15  ? 2.649   11.416  -6.949  1.00 0.00 ? 15  ASN A CB   4  
ATOM 6187  C CG   . ASN A 1 15  ? 2.767   10.124  -6.164  1.00 0.00 ? 15  ASN A CG   4  
ATOM 6188  O OD1  . ASN A 1 15  ? 1.852   9.743   -5.434  1.00 0.00 ? 15  ASN A OD1  4  
ATOM 6189  N ND2  . ASN A 1 15  ? 3.897   9.444   -6.311  1.00 0.00 ? 15  ASN A ND2  4  
ATOM 6190  H H    . ASN A 1 15  ? 0.751   9.882   -7.682  1.00 0.00 ? 15  ASN A H    4  
ATOM 6191  H HA   . ASN A 1 15  ? 0.796   12.118  -6.139  1.00 0.00 ? 15  ASN A HA   4  
ATOM 6192  H HB2  . ASN A 1 15  ? 3.082   11.261  -7.927  1.00 0.00 ? 15  ASN A HB2  4  
ATOM 6193  H HB3  . ASN A 1 15  ? 3.204   12.183  -6.431  1.00 0.00 ? 15  ASN A HB3  4  
ATOM 6194  H HD21 . ASN A 1 15  ? 4.583   9.808   -6.910  1.00 0.00 ? 15  ASN A HD21 4  
ATOM 6195  H HD22 . ASN A 1 15  ? 4.000   8.604   -5.816  1.00 0.00 ? 15  ASN A HD22 4  
ATOM 6196  N N    . GLU A 1 16  ? 1.630   14.229  -7.478  1.00 0.00 ? 16  GLU A N    4  
ATOM 6197  C CA   . GLU A 1 16  ? 1.630   15.482  -8.224  1.00 0.00 ? 16  GLU A CA   4  
ATOM 6198  C C    . GLU A 1 16  ? 2.792   15.526  -9.212  1.00 0.00 ? 16  GLU A C    4  
ATOM 6199  O O    . GLU A 1 16  ? 3.041   16.550  -9.849  1.00 0.00 ? 16  GLU A O    4  
ATOM 6200  C CB   . GLU A 1 16  ? 1.716   16.671  -7.266  1.00 0.00 ? 16  GLU A CB   4  
ATOM 6201  C CG   . GLU A 1 16  ? 3.137   17.028  -6.863  1.00 0.00 ? 16  GLU A CG   4  
ATOM 6202  C CD   . GLU A 1 16  ? 3.194   18.193  -5.894  1.00 0.00 ? 16  GLU A CD   4  
ATOM 6203  O OE1  . GLU A 1 16  ? 3.036   19.347  -6.344  1.00 0.00 ? 16  GLU A OE1  4  
ATOM 6204  O OE2  . GLU A 1 16  ? 3.397   17.951  -4.686  1.00 0.00 ? 16  GLU A OE2  4  
ATOM 6205  H H    . GLU A 1 16  ? 2.002   14.211  -6.572  1.00 0.00 ? 16  GLU A H    4  
ATOM 6206  H HA   . GLU A 1 16  ? 0.704   15.541  -8.774  1.00 0.00 ? 16  GLU A HA   4  
ATOM 6207  H HB2  . GLU A 1 16  ? 1.270   17.533  -7.740  1.00 0.00 ? 16  GLU A HB2  4  
ATOM 6208  H HB3  . GLU A 1 16  ? 1.159   16.437  -6.370  1.00 0.00 ? 16  GLU A HB3  4  
ATOM 6209  H HG2  . GLU A 1 16  ? 3.592   16.168  -6.395  1.00 0.00 ? 16  GLU A HG2  4  
ATOM 6210  H HG3  . GLU A 1 16  ? 3.694   17.290  -7.751  1.00 0.00 ? 16  GLU A HG3  4  
ATOM 6211  N N    . ASP A 1 17  ? 3.501   14.409  -9.334  1.00 0.00 ? 17  ASP A N    4  
ATOM 6212  C CA   . ASP A 1 17  ? 4.636   14.318  -10.244 1.00 0.00 ? 17  ASP A CA   4  
ATOM 6213  C C    . ASP A 1 17  ? 4.296   13.454  -11.454 1.00 0.00 ? 17  ASP A C    4  
ATOM 6214  O O    . ASP A 1 17  ? 4.652   12.277  -11.526 1.00 0.00 ? 17  ASP A O    4  
ATOM 6215  C CB   . ASP A 1 17  ? 5.855   13.745  -9.518  1.00 0.00 ? 17  ASP A CB   4  
ATOM 6216  C CG   . ASP A 1 17  ? 6.628   14.805  -8.759  1.00 0.00 ? 17  ASP A CG   4  
ATOM 6217  O OD1  . ASP A 1 17  ? 6.079   15.352  -7.779  1.00 0.00 ? 17  ASP A OD1  4  
ATOM 6218  O OD2  . ASP A 1 17  ? 7.782   15.089  -9.145  1.00 0.00 ? 17  ASP A OD2  4  
ATOM 6219  H H    . ASP A 1 17  ? 3.253   13.625  -8.799  1.00 0.00 ? 17  ASP A H    4  
ATOM 6220  H HA   . ASP A 1 17  ? 4.868   15.316  -10.584 1.00 0.00 ? 17  ASP A HA   4  
ATOM 6221  H HB2  . ASP A 1 17  ? 5.526   12.993  -8.815  1.00 0.00 ? 17  ASP A HB2  4  
ATOM 6222  H HB3  . ASP A 1 17  ? 6.516   13.291  -10.241 1.00 0.00 ? 17  ASP A HB3  4  
ATOM 6223  N N    . PRO A 1 18  ? 3.589   14.048  -12.426 1.00 0.00 ? 18  PRO A N    4  
ATOM 6224  C CA   . PRO A 1 18  ? 3.185   13.350  -13.650 1.00 0.00 ? 18  PRO A CA   4  
ATOM 6225  C C    . PRO A 1 18  ? 4.368   13.045  -14.562 1.00 0.00 ? 18  PRO A C    4  
ATOM 6226  O O    . PRO A 1 18  ? 4.223   12.364  -15.578 1.00 0.00 ? 18  PRO A O    4  
ATOM 6227  C CB   . PRO A 1 18  ? 2.231   14.340  -14.324 1.00 0.00 ? 18  PRO A CB   4  
ATOM 6228  C CG   . PRO A 1 18  ? 2.647   15.676  -13.812 1.00 0.00 ? 18  PRO A CG   4  
ATOM 6229  C CD   . PRO A 1 18  ? 3.131   15.447  -12.406 1.00 0.00 ? 18  PRO A CD   4  
ATOM 6230  H HA   . PRO A 1 18  ? 2.657   12.434  -13.429 1.00 0.00 ? 18  PRO A HA   4  
ATOM 6231  H HB2  . PRO A 1 18  ? 2.342   14.276  -15.398 1.00 0.00 ? 18  PRO A HB2  4  
ATOM 6232  H HB3  . PRO A 1 18  ? 1.213   14.111  -14.047 1.00 0.00 ? 18  PRO A HB3  4  
ATOM 6233  H HG2  . PRO A 1 18  ? 3.444   16.072  -14.423 1.00 0.00 ? 18  PRO A HG2  4  
ATOM 6234  H HG3  . PRO A 1 18  ? 1.802   16.348  -13.812 1.00 0.00 ? 18  PRO A HG3  4  
ATOM 6235  H HD2  . PRO A 1 18  ? 3.946   16.117  -12.174 1.00 0.00 ? 18  PRO A HD2  4  
ATOM 6236  H HD3  . PRO A 1 18  ? 2.322   15.577  -11.703 1.00 0.00 ? 18  PRO A HD3  4  
ATOM 6237  N N    . LEU A 1 19  ? 5.539   13.553  -14.193 1.00 0.00 ? 19  LEU A N    4  
ATOM 6238  C CA   . LEU A 1 19  ? 6.749   13.334  -14.978 1.00 0.00 ? 19  LEU A CA   4  
ATOM 6239  C C    . LEU A 1 19  ? 7.633   12.272  -14.332 1.00 0.00 ? 19  LEU A C    4  
ATOM 6240  O O    . LEU A 1 19  ? 8.682   11.914  -14.867 1.00 0.00 ? 19  LEU A O    4  
ATOM 6241  C CB   . LEU A 1 19  ? 7.529   14.642  -15.125 1.00 0.00 ? 19  LEU A CB   4  
ATOM 6242  C CG   . LEU A 1 19  ? 6.689   15.917  -15.223 1.00 0.00 ? 19  LEU A CG   4  
ATOM 6243  C CD1  . LEU A 1 19  ? 7.586   17.144  -15.264 1.00 0.00 ? 19  LEU A CD1  4  
ATOM 6244  C CD2  . LEU A 1 19  ? 5.790   15.870  -16.449 1.00 0.00 ? 19  LEU A CD2  4  
ATOM 6245  H H    . LEU A 1 19  ? 5.592   14.088  -13.374 1.00 0.00 ? 19  LEU A H    4  
ATOM 6246  H HA   . LEU A 1 19  ? 6.451   12.990  -15.957 1.00 0.00 ? 19  LEU A HA   4  
ATOM 6247  H HB2  . LEU A 1 19  ? 8.177   14.739  -14.268 1.00 0.00 ? 19  LEU A HB2  4  
ATOM 6248  H HB3  . LEU A 1 19  ? 8.128   14.570  -16.021 1.00 0.00 ? 19  LEU A HB3  4  
ATOM 6249  H HG   . LEU A 1 19  ? 6.059   15.993  -14.348 1.00 0.00 ? 19  LEU A HG   4  
ATOM 6250  H HD11 . LEU A 1 19  ? 8.514   16.896  -15.755 1.00 0.00 ? 19  LEU A HD11 4  
ATOM 6251  H HD12 . LEU A 1 19  ? 7.789   17.475  -14.256 1.00 0.00 ? 19  LEU A HD12 4  
ATOM 6252  H HD13 . LEU A 1 19  ? 7.089   17.934  -15.808 1.00 0.00 ? 19  LEU A HD13 4  
ATOM 6253  H HD21 . LEU A 1 19  ? 4.817   16.265  -16.198 1.00 0.00 ? 19  LEU A HD21 4  
ATOM 6254  H HD22 . LEU A 1 19  ? 5.689   14.847  -16.782 1.00 0.00 ? 19  LEU A HD22 4  
ATOM 6255  H HD23 . LEU A 1 19  ? 6.227   16.464  -17.239 1.00 0.00 ? 19  LEU A HD23 4  
ATOM 6256  N N    . MET A 1 20  ? 7.200   11.770  -13.180 1.00 0.00 ? 20  MET A N    4  
ATOM 6257  C CA   . MET A 1 20  ? 7.950   10.746  -12.463 1.00 0.00 ? 20  MET A CA   4  
ATOM 6258  C C    . MET A 1 20  ? 8.626   9.785   -13.436 1.00 0.00 ? 20  MET A C    4  
ATOM 6259  O O    . MET A 1 20  ? 7.956   9.052   -14.164 1.00 0.00 ? 20  MET A O    4  
ATOM 6260  C CB   . MET A 1 20  ? 7.026   9.971   -11.522 1.00 0.00 ? 20  MET A CB   4  
ATOM 6261  C CG   . MET A 1 20  ? 5.875   9.279   -12.234 1.00 0.00 ? 20  MET A CG   4  
ATOM 6262  S SD   . MET A 1 20  ? 4.589   8.723   -11.099 1.00 0.00 ? 20  MET A SD   4  
ATOM 6263  C CE   . MET A 1 20  ? 3.143   8.820   -12.151 1.00 0.00 ? 20  MET A CE   4  
ATOM 6264  H H    . MET A 1 20  ? 6.356   12.096  -12.803 1.00 0.00 ? 20  MET A H    4  
ATOM 6265  H HA   . MET A 1 20  ? 8.711   11.242  -11.878 1.00 0.00 ? 20  MET A HA   4  
ATOM 6266  H HB2  . MET A 1 20  ? 7.605   9.220   -11.005 1.00 0.00 ? 20  MET A HB2  4  
ATOM 6267  H HB3  . MET A 1 20  ? 6.612   10.657  -10.797 1.00 0.00 ? 20  MET A HB3  4  
ATOM 6268  H HG2  . MET A 1 20  ? 5.438   9.970   -12.939 1.00 0.00 ? 20  MET A HG2  4  
ATOM 6269  H HG3  . MET A 1 20  ? 6.262   8.423   -12.766 1.00 0.00 ? 20  MET A HG3  4  
ATOM 6270  H HE1  . MET A 1 20  ? 3.419   9.254   -13.102 1.00 0.00 ? 20  MET A HE1  4  
ATOM 6271  H HE2  . MET A 1 20  ? 2.746   7.829   -12.310 1.00 0.00 ? 20  MET A HE2  4  
ATOM 6272  H HE3  . MET A 1 20  ? 2.394   9.437   -11.677 1.00 0.00 ? 20  MET A HE3  4  
ATOM 6273  N N    . SER A 1 21  ? 9.955   9.795   -13.445 1.00 0.00 ? 21  SER A N    4  
ATOM 6274  C CA   . SER A 1 21  ? 10.720  8.927   -14.332 1.00 0.00 ? 21  SER A CA   4  
ATOM 6275  C C    . SER A 1 21  ? 10.424  7.459   -14.044 1.00 0.00 ? 21  SER A C    4  
ATOM 6276  O O    . SER A 1 21  ? 10.822  6.575   -14.802 1.00 0.00 ? 21  SER A O    4  
ATOM 6277  C CB   . SER A 1 21  ? 12.218  9.197   -14.177 1.00 0.00 ? 21  SER A CB   4  
ATOM 6278  O OG   . SER A 1 21  ? 12.551  10.499  -14.625 1.00 0.00 ? 21  SER A OG   4  
ATOM 6279  H H    . SER A 1 21  ? 10.432  10.403  -12.841 1.00 0.00 ? 21  SER A H    4  
ATOM 6280  H HA   . SER A 1 21  ? 10.426  9.149   -15.347 1.00 0.00 ? 21  SER A HA   4  
ATOM 6281  H HB2  . SER A 1 21  ? 12.491  9.107   -13.136 1.00 0.00 ? 21  SER A HB2  4  
ATOM 6282  H HB3  . SER A 1 21  ? 12.773  8.475   -14.759 1.00 0.00 ? 21  SER A HB3  4  
ATOM 6283  H HG   . SER A 1 21  ? 11.852  11.110  -14.382 1.00 0.00 ? 21  SER A HG   4  
ATOM 6284  N N    . GLU A 1 22  ? 9.721   7.208   -12.944 1.00 0.00 ? 22  GLU A N    4  
ATOM 6285  C CA   . GLU A 1 22  ? 9.372   5.847   -12.555 1.00 0.00 ? 22  GLU A CA   4  
ATOM 6286  C C    . GLU A 1 22  ? 8.069   5.409   -13.219 1.00 0.00 ? 22  GLU A C    4  
ATOM 6287  O O    . GLU A 1 22  ? 7.439   6.180   -13.943 1.00 0.00 ? 22  GLU A O    4  
ATOM 6288  C CB   . GLU A 1 22  ? 9.241   5.745   -11.034 1.00 0.00 ? 22  GLU A CB   4  
ATOM 6289  C CG   . GLU A 1 22  ? 10.443  6.292   -10.282 1.00 0.00 ? 22  GLU A CG   4  
ATOM 6290  C CD   . GLU A 1 22  ? 11.688  5.450   -10.481 1.00 0.00 ? 22  GLU A CD   4  
ATOM 6291  O OE1  . GLU A 1 22  ? 11.706  4.295   -10.006 1.00 0.00 ? 22  GLU A OE1  4  
ATOM 6292  O OE2  . GLU A 1 22  ? 12.645  5.946   -11.112 1.00 0.00 ? 22  GLU A OE2  4  
ATOM 6293  H H    . GLU A 1 22  ? 9.432   7.956   -12.380 1.00 0.00 ? 22  GLU A H    4  
ATOM 6294  H HA   . GLU A 1 22  ? 10.166  5.194   -12.883 1.00 0.00 ? 22  GLU A HA   4  
ATOM 6295  H HB2  . GLU A 1 22  ? 8.366   6.295   -10.722 1.00 0.00 ? 22  GLU A HB2  4  
ATOM 6296  H HB3  . GLU A 1 22  ? 9.117   4.706   -10.765 1.00 0.00 ? 22  GLU A HB3  4  
ATOM 6297  H HG2  . GLU A 1 22  ? 10.645  7.293   -10.631 1.00 0.00 ? 22  GLU A HG2  4  
ATOM 6298  H HG3  . GLU A 1 22  ? 10.209  6.320   -9.227  1.00 0.00 ? 22  GLU A HG3  4  
ATOM 6299  N N    . CYS A 1 23  ? 7.673   4.166   -12.967 1.00 0.00 ? 23  CYS A N    4  
ATOM 6300  C CA   . CYS A 1 23  ? 6.446   3.624   -13.540 1.00 0.00 ? 23  CYS A CA   4  
ATOM 6301  C C    . CYS A 1 23  ? 5.231   4.423   -13.081 1.00 0.00 ? 23  CYS A C    4  
ATOM 6302  O O    . CYS A 1 23  ? 5.317   5.223   -12.148 1.00 0.00 ? 23  CYS A O    4  
ATOM 6303  C CB   . CYS A 1 23  ? 6.282   2.154   -13.150 1.00 0.00 ? 23  CYS A CB   4  
ATOM 6304  S SG   . CYS A 1 23  ? 5.642   1.902   -11.478 1.00 0.00 ? 23  CYS A SG   4  
ATOM 6305  H H    . CYS A 1 23  ? 8.217   3.599   -12.381 1.00 0.00 ? 23  CYS A H    4  
ATOM 6306  H HA   . CYS A 1 23  ? 6.524   3.695   -14.615 1.00 0.00 ? 23  CYS A HA   4  
ATOM 6307  H HB2  . CYS A 1 23  ? 5.597   1.681   -13.838 1.00 0.00 ? 23  CYS A HB2  4  
ATOM 6308  H HB3  . CYS A 1 23  ? 7.242   1.664   -13.213 1.00 0.00 ? 23  CYS A HB3  4  
ATOM 6309  H HG   . CYS A 1 23  ? 5.417   0.607   -11.317 1.00 0.00 ? 23  CYS A HG   4  
ATOM 6310  N N    . LEU A 1 24  ? 4.101   4.204   -13.743 1.00 0.00 ? 24  LEU A N    4  
ATOM 6311  C CA   . LEU A 1 24  ? 2.867   4.905   -13.404 1.00 0.00 ? 24  LEU A CA   4  
ATOM 6312  C C    . LEU A 1 24  ? 2.113   4.175   -12.297 1.00 0.00 ? 24  LEU A C    4  
ATOM 6313  O O    . LEU A 1 24  ? 1.449   4.799   -11.468 1.00 0.00 ? 24  LEU A O    4  
ATOM 6314  C CB   . LEU A 1 24  ? 1.977   5.039   -14.641 1.00 0.00 ? 24  LEU A CB   4  
ATOM 6315  C CG   . LEU A 1 24  ? 2.361   6.143   -15.627 1.00 0.00 ? 24  LEU A CG   4  
ATOM 6316  C CD1  . LEU A 1 24  ? 1.926   7.502   -15.102 1.00 0.00 ? 24  LEU A CD1  4  
ATOM 6317  C CD2  . LEU A 1 24  ? 3.860   6.125   -15.891 1.00 0.00 ? 24  LEU A CD2  4  
ATOM 6318  H H    . LEU A 1 24  ? 4.094   3.555   -14.477 1.00 0.00 ? 24  LEU A H    4  
ATOM 6319  H HA   . LEU A 1 24  ? 3.133   5.891   -13.053 1.00 0.00 ? 24  LEU A HA   4  
ATOM 6320  H HB2  . LEU A 1 24  ? 2.003   4.099   -15.171 1.00 0.00 ? 24  LEU A HB2  4  
ATOM 6321  H HB3  . LEU A 1 24  ? 0.969   5.232   -14.303 1.00 0.00 ? 24  LEU A HB3  4  
ATOM 6322  H HG   . LEU A 1 24  ? 1.853   5.970   -16.566 1.00 0.00 ? 24  LEU A HG   4  
ATOM 6323  H HD11 . LEU A 1 24  ? 0.997   7.788   -15.570 1.00 0.00 ? 24  LEU A HD11 4  
ATOM 6324  H HD12 . LEU A 1 24  ? 2.685   8.236   -15.331 1.00 0.00 ? 24  LEU A HD12 4  
ATOM 6325  H HD13 . LEU A 1 24  ? 1.790   7.448   -14.032 1.00 0.00 ? 24  LEU A HD13 4  
ATOM 6326  H HD21 . LEU A 1 24  ? 4.090   6.801   -16.701 1.00 0.00 ? 24  LEU A HD21 4  
ATOM 6327  H HD22 . LEU A 1 24  ? 4.166   5.124   -16.159 1.00 0.00 ? 24  LEU A HD22 4  
ATOM 6328  H HD23 . LEU A 1 24  ? 4.386   6.436   -15.000 1.00 0.00 ? 24  LEU A HD23 4  
ATOM 6329  N N    . LEU A 1 25  ? 2.220   2.851   -12.289 1.00 0.00 ? 25  LEU A N    4  
ATOM 6330  C CA   . LEU A 1 25  ? 1.549   2.036   -11.282 1.00 0.00 ? 25  LEU A CA   4  
ATOM 6331  C C    . LEU A 1 25  ? 2.381   0.805   -10.937 1.00 0.00 ? 25  LEU A C    4  
ATOM 6332  O O    . LEU A 1 25  ? 3.276   0.417   -11.688 1.00 0.00 ? 25  LEU A O    4  
ATOM 6333  C CB   . LEU A 1 25  ? 0.168   1.609   -11.781 1.00 0.00 ? 25  LEU A CB   4  
ATOM 6334  C CG   . LEU A 1 25  ? 0.110   0.288   -12.549 1.00 0.00 ? 25  LEU A CG   4  
ATOM 6335  C CD1  . LEU A 1 25  ? -0.133  -0.873  -11.597 1.00 0.00 ? 25  LEU A CD1  4  
ATOM 6336  C CD2  . LEU A 1 25  ? -0.972  0.339   -13.617 1.00 0.00 ? 25  LEU A CD2  4  
ATOM 6337  H H    . LEU A 1 25  ? 2.762   2.411   -12.975 1.00 0.00 ? 25  LEU A H    4  
ATOM 6338  H HA   . LEU A 1 25  ? 1.432   2.637   -10.393 1.00 0.00 ? 25  LEU A HA   4  
ATOM 6339  H HB2  . LEU A 1 25  ? -0.481  1.521   -10.923 1.00 0.00 ? 25  LEU A HB2  4  
ATOM 6340  H HB3  . LEU A 1 25  ? -0.203  2.388   -12.432 1.00 0.00 ? 25  LEU A HB3  4  
ATOM 6341  H HG   . LEU A 1 25  ? 1.059   0.122   -13.040 1.00 0.00 ? 25  LEU A HG   4  
ATOM 6342  H HD11 . LEU A 1 25  ? 0.806   -1.188  -11.167 1.00 0.00 ? 25  LEU A HD11 4  
ATOM 6343  H HD12 . LEU A 1 25  ? -0.576  -1.696  -12.138 1.00 0.00 ? 25  LEU A HD12 4  
ATOM 6344  H HD13 . LEU A 1 25  ? -0.803  -0.559  -10.809 1.00 0.00 ? 25  LEU A HD13 4  
ATOM 6345  H HD21 . LEU A 1 25  ? -0.785  1.171   -14.279 1.00 0.00 ? 25  LEU A HD21 4  
ATOM 6346  H HD22 . LEU A 1 25  ? -1.937  0.462   -13.147 1.00 0.00 ? 25  LEU A HD22 4  
ATOM 6347  H HD23 . LEU A 1 25  ? -0.963  -0.582  -14.183 1.00 0.00 ? 25  LEU A HD23 4  
ATOM 6348  N N    . TYR A 1 26  ? 2.078   0.193   -9.797  1.00 0.00 ? 26  TYR A N    4  
ATOM 6349  C CA   . TYR A 1 26  ? 2.797   -0.994  -9.352  1.00 0.00 ? 26  TYR A CA   4  
ATOM 6350  C C    . TYR A 1 26  ? 1.855   -2.189  -9.233  1.00 0.00 ? 26  TYR A C    4  
ATOM 6351  O O    . TYR A 1 26  ? 0.818   -2.113  -8.574  1.00 0.00 ? 26  TYR A O    4  
ATOM 6352  C CB   . TYR A 1 26  ? 3.477   -0.730  -8.007  1.00 0.00 ? 26  TYR A CB   4  
ATOM 6353  C CG   . TYR A 1 26  ? 4.754   0.071   -8.121  1.00 0.00 ? 26  TYR A CG   4  
ATOM 6354  C CD1  . TYR A 1 26  ? 5.705   -0.235  -9.087  1.00 0.00 ? 26  TYR A CD1  4  
ATOM 6355  C CD2  . TYR A 1 26  ? 5.010   1.134   -7.263  1.00 0.00 ? 26  TYR A CD2  4  
ATOM 6356  C CE1  . TYR A 1 26  ? 6.874   0.494   -9.194  1.00 0.00 ? 26  TYR A CE1  4  
ATOM 6357  C CE2  . TYR A 1 26  ? 6.175   1.869   -7.364  1.00 0.00 ? 26  TYR A CE2  4  
ATOM 6358  C CZ   . TYR A 1 26  ? 7.104   1.545   -8.331  1.00 0.00 ? 26  TYR A CZ   4  
ATOM 6359  O OH   . TYR A 1 26  ? 8.266   2.274   -8.434  1.00 0.00 ? 26  TYR A OH   4  
ATOM 6360  H H    . TYR A 1 26  ? 1.354   0.550   -9.241  1.00 0.00 ? 26  TYR A H    4  
ATOM 6361  H HA   . TYR A 1 26  ? 3.554   -1.219  -10.089 1.00 0.00 ? 26  TYR A HA   4  
ATOM 6362  H HB2  . TYR A 1 26  ? 2.799   -0.183  -7.370  1.00 0.00 ? 26  TYR A HB2  4  
ATOM 6363  H HB3  . TYR A 1 26  ? 3.718   -1.675  -7.542  1.00 0.00 ? 26  TYR A HB3  4  
ATOM 6364  H HD1  . TYR A 1 26  ? 5.522   -1.059  -9.761  1.00 0.00 ? 26  TYR A HD1  4  
ATOM 6365  H HD2  . TYR A 1 26  ? 4.280   1.384   -6.507  1.00 0.00 ? 26  TYR A HD2  4  
ATOM 6366  H HE1  . TYR A 1 26  ? 7.601   0.241   -9.951  1.00 0.00 ? 26  TYR A HE1  4  
ATOM 6367  H HE2  . TYR A 1 26  ? 6.356   2.691   -6.688  1.00 0.00 ? 26  TYR A HE2  4  
ATOM 6368  H HH   . TYR A 1 26  ? 8.958   1.846   -7.924  1.00 0.00 ? 26  TYR A HH   4  
ATOM 6369  N N    . TYR A 1 27  ? 2.226   -3.291  -9.874  1.00 0.00 ? 27  TYR A N    4  
ATOM 6370  C CA   . TYR A 1 27  ? 1.415   -4.503  -9.842  1.00 0.00 ? 27  TYR A CA   4  
ATOM 6371  C C    . TYR A 1 27  ? 1.895   -5.452  -8.749  1.00 0.00 ? 27  TYR A C    4  
ATOM 6372  O O    . TYR A 1 27  ? 2.862   -6.191  -8.934  1.00 0.00 ? 27  TYR A O    4  
ATOM 6373  C CB   . TYR A 1 27  ? 1.459   -5.207  -11.200 1.00 0.00 ? 27  TYR A CB   4  
ATOM 6374  C CG   . TYR A 1 27  ? 0.390   -4.738  -12.160 1.00 0.00 ? 27  TYR A CG   4  
ATOM 6375  C CD1  . TYR A 1 27  ? -0.910  -5.222  -12.073 1.00 0.00 ? 27  TYR A CD1  4  
ATOM 6376  C CD2  . TYR A 1 27  ? 0.679   -3.813  -13.156 1.00 0.00 ? 27  TYR A CD2  4  
ATOM 6377  C CE1  . TYR A 1 27  ? -1.891  -4.797  -12.948 1.00 0.00 ? 27  TYR A CE1  4  
ATOM 6378  C CE2  . TYR A 1 27  ? -0.296  -3.382  -14.035 1.00 0.00 ? 27  TYR A CE2  4  
ATOM 6379  C CZ   . TYR A 1 27  ? -1.579  -3.877  -13.927 1.00 0.00 ? 27  TYR A CZ   4  
ATOM 6380  O OH   . TYR A 1 27  ? -2.552  -3.451  -14.802 1.00 0.00 ? 27  TYR A OH   4  
ATOM 6381  H H    . TYR A 1 27  ? 3.063   -3.291  -10.382 1.00 0.00 ? 27  TYR A H    4  
ATOM 6382  H HA   . TYR A 1 27  ? 0.396   -4.214  -9.631  1.00 0.00 ? 27  TYR A HA   4  
ATOM 6383  H HB2  . TYR A 1 27  ? 2.419   -5.027  -11.660 1.00 0.00 ? 27  TYR A HB2  4  
ATOM 6384  H HB3  . TYR A 1 27  ? 1.330   -6.269  -11.051 1.00 0.00 ? 27  TYR A HB3  4  
ATOM 6385  H HD1  . TYR A 1 27  ? -1.151  -5.943  -11.305 1.00 0.00 ? 27  TYR A HD1  4  
ATOM 6386  H HD2  . TYR A 1 27  ? 1.685   -3.428  -13.237 1.00 0.00 ? 27  TYR A HD2  4  
ATOM 6387  H HE1  . TYR A 1 27  ? -2.896  -5.185  -12.865 1.00 0.00 ? 27  TYR A HE1  4  
ATOM 6388  H HE2  . TYR A 1 27  ? -0.052  -2.662  -14.802 1.00 0.00 ? 27  TYR A HE2  4  
ATOM 6389  H HH   . TYR A 1 27  ? -2.253  -2.657  -15.251 1.00 0.00 ? 27  TYR A HH   4  
ATOM 6390  N N    . ILE A 1 28  ? 1.212   -5.425  -7.609  1.00 0.00 ? 28  ILE A N    4  
ATOM 6391  C CA   . ILE A 1 28  ? 1.567   -6.283  -6.486  1.00 0.00 ? 28  ILE A CA   4  
ATOM 6392  C C    . ILE A 1 28  ? 1.329   -7.752  -6.820  1.00 0.00 ? 28  ILE A C    4  
ATOM 6393  O O    . ILE A 1 28  ? 0.582   -8.077  -7.743  1.00 0.00 ? 28  ILE A O    4  
ATOM 6394  C CB   . ILE A 1 28  ? 0.764   -5.919  -5.223  1.00 0.00 ? 28  ILE A CB   4  
ATOM 6395  C CG1  . ILE A 1 28  ? 0.827   -4.411  -4.970  1.00 0.00 ? 28  ILE A CG1  4  
ATOM 6396  C CG2  . ILE A 1 28  ? 1.291   -6.686  -4.020  1.00 0.00 ? 28  ILE A CG2  4  
ATOM 6397  C CD1  . ILE A 1 28  ? 0.286   -4.003  -3.618  1.00 0.00 ? 28  ILE A CD1  4  
ATOM 6398  H H    . ILE A 1 28  ? 0.451   -4.814  -7.523  1.00 0.00 ? 28  ILE A H    4  
ATOM 6399  H HA   . ILE A 1 28  ? 2.616   -6.138  -6.275  1.00 0.00 ? 28  ILE A HA   4  
ATOM 6400  H HB   . ILE A 1 28  ? -0.264  -6.207  -5.382  1.00 0.00 ? 28  ILE A HB   4  
ATOM 6401  H HG12 . ILE A 1 28  ? 1.854   -4.085  -5.028  1.00 0.00 ? 28  ILE A HG12 4  
ATOM 6402  H HG13 . ILE A 1 28  ? 0.249   -3.902  -5.727  1.00 0.00 ? 28  ILE A HG13 4  
ATOM 6403  H HG21 . ILE A 1 28  ? 1.046   -7.733  -4.126  1.00 0.00 ? 28  ILE A HG21 4  
ATOM 6404  H HG22 . ILE A 1 28  ? 2.363   -6.572  -3.963  1.00 0.00 ? 28  ILE A HG22 4  
ATOM 6405  H HG23 . ILE A 1 28  ? 0.838   -6.300  -3.120  1.00 0.00 ? 28  ILE A HG23 4  
ATOM 6406  H HD11 . ILE A 1 28  ? 0.101   -2.938  -3.611  1.00 0.00 ? 28  ILE A HD11 4  
ATOM 6407  H HD12 . ILE A 1 28  ? -0.638  -4.528  -3.425  1.00 0.00 ? 28  ILE A HD12 4  
ATOM 6408  H HD13 . ILE A 1 28  ? 1.007   -4.246  -2.852  1.00 0.00 ? 28  ILE A HD13 4  
ATOM 6409  N N    . LYS A 1 29  ? 1.967   -8.636  -6.061  1.00 0.00 ? 29  LYS A N    4  
ATOM 6410  C CA   . LYS A 1 29  ? 1.823   -10.072 -6.273  1.00 0.00 ? 29  LYS A CA   4  
ATOM 6411  C C    . LYS A 1 29  ? 1.448   -10.778 -4.974  1.00 0.00 ? 29  LYS A C    4  
ATOM 6412  O O    . LYS A 1 29  ? 1.206   -10.134 -3.953  1.00 0.00 ? 29  LYS A O    4  
ATOM 6413  C CB   . LYS A 1 29  ? 3.123   -10.659 -6.828  1.00 0.00 ? 29  LYS A CB   4  
ATOM 6414  C CG   . LYS A 1 29  ? 4.369   -10.153 -6.121  1.00 0.00 ? 29  LYS A CG   4  
ATOM 6415  C CD   . LYS A 1 29  ? 4.687   -10.984 -4.889  1.00 0.00 ? 29  LYS A CD   4  
ATOM 6416  C CE   . LYS A 1 29  ? 4.139   -10.339 -3.626  1.00 0.00 ? 29  LYS A CE   4  
ATOM 6417  N NZ   . LYS A 1 29  ? 5.117   -10.395 -2.504  1.00 0.00 ? 29  LYS A NZ   4  
ATOM 6418  H H    . LYS A 1 29  ? 2.549   -8.315  -5.340  1.00 0.00 ? 29  LYS A H    4  
ATOM 6419  H HA   . LYS A 1 29  ? 1.033   -10.224 -6.993  1.00 0.00 ? 29  LYS A HA   4  
ATOM 6420  H HB2  . LYS A 1 29  ? 3.090   -11.734 -6.729  1.00 0.00 ? 29  LYS A HB2  4  
ATOM 6421  H HB3  . LYS A 1 29  ? 3.201   -10.404 -7.875  1.00 0.00 ? 29  LYS A HB3  4  
ATOM 6422  H HG2  . LYS A 1 29  ? 5.205   -10.206 -6.803  1.00 0.00 ? 29  LYS A HG2  4  
ATOM 6423  H HG3  . LYS A 1 29  ? 4.211   -9.127  -5.822  1.00 0.00 ? 29  LYS A HG3  4  
ATOM 6424  H HD2  . LYS A 1 29  ? 4.244   -11.963 -5.001  1.00 0.00 ? 29  LYS A HD2  4  
ATOM 6425  H HD3  . LYS A 1 29  ? 5.760   -11.080 -4.798  1.00 0.00 ? 29  LYS A HD3  4  
ATOM 6426  H HE2  . LYS A 1 29  ? 3.905   -9.306  -3.836  1.00 0.00 ? 29  LYS A HE2  4  
ATOM 6427  H HE3  . LYS A 1 29  ? 3.238   -10.859 -3.333  1.00 0.00 ? 29  LYS A HE3  4  
ATOM 6428  H HZ1  . LYS A 1 29  ? 6.081   -10.517 -2.876  1.00 0.00 ? 29  LYS A HZ1  4  
ATOM 6429  H HZ2  . LYS A 1 29  ? 4.896   -11.195 -1.877  1.00 0.00 ? 29  LYS A HZ2  4  
ATOM 6430  H HZ3  . LYS A 1 29  ? 5.079   -9.515  -1.952  1.00 0.00 ? 29  LYS A HZ3  4  
ATOM 6431  N N    . ASP A 1 30  ? 1.403   -12.105 -5.020  1.00 0.00 ? 30  ASP A N    4  
ATOM 6432  C CA   . ASP A 1 30  ? 1.060   -12.899 -3.846  1.00 0.00 ? 30  ASP A CA   4  
ATOM 6433  C C    . ASP A 1 30  ? 2.275   -13.091 -2.945  1.00 0.00 ? 30  ASP A C    4  
ATOM 6434  O O    . ASP A 1 30  ? 3.313   -13.586 -3.382  1.00 0.00 ? 30  ASP A O    4  
ATOM 6435  C CB   . ASP A 1 30  ? 0.503   -14.260 -4.269  1.00 0.00 ? 30  ASP A CB   4  
ATOM 6436  C CG   . ASP A 1 30  ? -0.253  -14.194 -5.581  1.00 0.00 ? 30  ASP A CG   4  
ATOM 6437  O OD1  . ASP A 1 30  ? -0.890  -13.153 -5.847  1.00 0.00 ? 30  ASP A OD1  4  
ATOM 6438  O OD2  . ASP A 1 30  ? -0.206  -15.182 -6.343  1.00 0.00 ? 30  ASP A OD2  4  
ATOM 6439  H H    . ASP A 1 30  ? 1.606   -12.562 -5.863  1.00 0.00 ? 30  ASP A H    4  
ATOM 6440  H HA   . ASP A 1 30  ? 0.300   -12.366 -3.295  1.00 0.00 ? 30  ASP A HA   4  
ATOM 6441  H HB2  . ASP A 1 30  ? 1.321   -14.957 -4.381  1.00 0.00 ? 30  ASP A HB2  4  
ATOM 6442  H HB3  . ASP A 1 30  ? -0.169  -14.620 -3.504  1.00 0.00 ? 30  ASP A HB3  4  
ATOM 6443  N N    . GLY A 1 31  ? 2.139   -12.694 -1.683  1.00 0.00 ? 31  GLY A N    4  
ATOM 6444  C CA   . GLY A 1 31  ? 3.235   -12.830 -0.740  1.00 0.00 ? 31  GLY A CA   4  
ATOM 6445  C C    . GLY A 1 31  ? 3.433   -11.584 0.100   1.00 0.00 ? 31  GLY A C    4  
ATOM 6446  O O    . GLY A 1 31  ? 2.466   -10.978 0.562   1.00 0.00 ? 31  GLY A O    4  
ATOM 6447  H H    . GLY A 1 31  ? 1.288   -12.307 -1.390  1.00 0.00 ? 31  GLY A H    4  
ATOM 6448  H HA2  . GLY A 1 31  ? 3.031   -13.664 -0.086  1.00 0.00 ? 31  GLY A HA2  4  
ATOM 6449  H HA3  . GLY A 1 31  ? 4.144   -13.028 -1.289  1.00 0.00 ? 31  GLY A HA3  4  
ATOM 6450  N N    . ILE A 1 32  ? 4.690   -11.201 0.299   1.00 0.00 ? 32  ILE A N    4  
ATOM 6451  C CA   . ILE A 1 32  ? 5.012   -10.019 1.090   1.00 0.00 ? 32  ILE A CA   4  
ATOM 6452  C C    . ILE A 1 32  ? 5.797   -9.004  0.267   1.00 0.00 ? 32  ILE A C    4  
ATOM 6453  O O    . ILE A 1 32  ? 6.933   -9.258  -0.136  1.00 0.00 ? 32  ILE A O    4  
ATOM 6454  C CB   . ILE A 1 32  ? 5.827   -10.387 2.344   1.00 0.00 ? 32  ILE A CB   4  
ATOM 6455  C CG1  . ILE A 1 32  ? 4.893   -10.814 3.478   1.00 0.00 ? 32  ILE A CG1  4  
ATOM 6456  C CG2  . ILE A 1 32  ? 6.692   -9.212  2.776   1.00 0.00 ? 32  ILE A CG2  4  
ATOM 6457  C CD1  . ILE A 1 32  ? 4.101   -9.670  4.072   1.00 0.00 ? 32  ILE A CD1  4  
ATOM 6458  H H    . ILE A 1 32  ? 5.418   -11.724 -0.096  1.00 0.00 ? 32  ILE A H    4  
ATOM 6459  H HA   . ILE A 1 32  ? 4.083   -9.568  1.408   1.00 0.00 ? 32  ILE A HA   4  
ATOM 6460  H HB   . ILE A 1 32  ? 6.479   -11.210 2.094   1.00 0.00 ? 32  ILE A HB   4  
ATOM 6461  H HG12 . ILE A 1 32  ? 4.193   -11.543 3.104   1.00 0.00 ? 32  ILE A HG12 4  
ATOM 6462  H HG13 . ILE A 1 32  ? 5.481   -11.257 4.270   1.00 0.00 ? 32  ILE A HG13 4  
ATOM 6463  H HG21 . ILE A 1 32  ? 6.069   -8.342  2.923   1.00 0.00 ? 32  ILE A HG21 4  
ATOM 6464  H HG22 . ILE A 1 32  ? 7.192   -9.455  3.701   1.00 0.00 ? 32  ILE A HG22 4  
ATOM 6465  H HG23 . ILE A 1 32  ? 7.426   -9.005  2.012   1.00 0.00 ? 32  ILE A HG23 4  
ATOM 6466  H HD11 . ILE A 1 32  ? 3.469   -10.044 4.865   1.00 0.00 ? 32  ILE A HD11 4  
ATOM 6467  H HD12 . ILE A 1 32  ? 4.779   -8.931  4.472   1.00 0.00 ? 32  ILE A HD12 4  
ATOM 6468  H HD13 . ILE A 1 32  ? 3.487   -9.221  3.305   1.00 0.00 ? 32  ILE A HD13 4  
ATOM 6469  N N    . THR A 1 33  ? 5.184   -7.850  0.020   1.00 0.00 ? 33  THR A N    4  
ATOM 6470  C CA   . THR A 1 33  ? 5.825   -6.794  -0.754  1.00 0.00 ? 33  THR A CA   4  
ATOM 6471  C C    . THR A 1 33  ? 6.311   -5.667  0.149   1.00 0.00 ? 33  THR A C    4  
ATOM 6472  O O    . THR A 1 33  ? 5.535   -4.797  0.544   1.00 0.00 ? 33  THR A O    4  
ATOM 6473  C CB   . THR A 1 33  ? 4.868   -6.213  -1.811  1.00 0.00 ? 33  THR A CB   4  
ATOM 6474  O OG1  . THR A 1 33  ? 4.589   -7.197  -2.814  1.00 0.00 ? 33  THR A OG1  4  
ATOM 6475  C CG2  . THR A 1 33  ? 5.467   -4.975  -2.462  1.00 0.00 ? 33  THR A CG2  4  
ATOM 6476  H H    . THR A 1 33  ? 4.280   -7.706  0.368   1.00 0.00 ? 33  THR A H    4  
ATOM 6477  H HA   . THR A 1 33  ? 6.674   -7.225  -1.266  1.00 0.00 ? 33  THR A HA   4  
ATOM 6478  H HB   . THR A 1 33  ? 3.944   -5.934  -1.324  1.00 0.00 ? 33  THR A HB   4  
ATOM 6479  H HG1  . THR A 1 33  ? 5.373   -7.341  -3.348  1.00 0.00 ? 33  THR A HG1  4  
ATOM 6480  H HG21 . THR A 1 33  ? 4.818   -4.130  -2.292  1.00 0.00 ? 33  THR A HG21 4  
ATOM 6481  H HG22 . THR A 1 33  ? 5.571   -5.141  -3.524  1.00 0.00 ? 33  THR A HG22 4  
ATOM 6482  H HG23 . THR A 1 33  ? 6.437   -4.776  -2.032  1.00 0.00 ? 33  THR A HG23 4  
ATOM 6483  N N    . ARG A 1 34  ? 7.600   -5.688  0.473   1.00 0.00 ? 34  ARG A N    4  
ATOM 6484  C CA   . ARG A 1 34  ? 8.190   -4.667  1.330   1.00 0.00 ? 34  ARG A CA   4  
ATOM 6485  C C    . ARG A 1 34  ? 8.394   -3.364  0.563   1.00 0.00 ? 34  ARG A C    4  
ATOM 6486  O O    . ARG A 1 34  ? 8.893   -3.365  -0.562  1.00 0.00 ? 34  ARG A O    4  
ATOM 6487  C CB   . ARG A 1 34  ? 9.526   -5.154  1.895   1.00 0.00 ? 34  ARG A CB   4  
ATOM 6488  C CG   . ARG A 1 34  ? 9.385   -6.000  3.149   1.00 0.00 ? 34  ARG A CG   4  
ATOM 6489  C CD   . ARG A 1 34  ? 10.574  -6.932  3.329   1.00 0.00 ? 34  ARG A CD   4  
ATOM 6490  N NE   . ARG A 1 34  ? 10.534  -8.057  2.399   1.00 0.00 ? 34  ARG A NE   4  
ATOM 6491  C CZ   . ARG A 1 34  ? 11.188  -9.196  2.595   1.00 0.00 ? 34  ARG A CZ   4  
ATOM 6492  N NH1  . ARG A 1 34  ? 11.929  -9.360  3.682   1.00 0.00 ? 34  ARG A NH1  4  
ATOM 6493  N NH2  . ARG A 1 34  ? 11.102  -10.174 1.702   1.00 0.00 ? 34  ARG A NH2  4  
ATOM 6494  H H    . ARG A 1 34  ? 8.169   -6.408  0.126   1.00 0.00 ? 34  ARG A H    4  
ATOM 6495  H HA   . ARG A 1 34  ? 7.508   -4.487  2.148   1.00 0.00 ? 34  ARG A HA   4  
ATOM 6496  H HB2  . ARG A 1 34  ? 10.027  -5.745  1.142   1.00 0.00 ? 34  ARG A HB2  4  
ATOM 6497  H HB3  . ARG A 1 34  ? 10.136  -4.296  2.132   1.00 0.00 ? 34  ARG A HB3  4  
ATOM 6498  H HG2  . ARG A 1 34  ? 9.320   -5.348  4.007   1.00 0.00 ? 34  ARG A HG2  4  
ATOM 6499  H HG3  . ARG A 1 34  ? 8.484   -6.591  3.074   1.00 0.00 ? 34  ARG A HG3  4  
ATOM 6500  H HD2  . ARG A 1 34  ? 11.482  -6.371  3.162   1.00 0.00 ? 34  ARG A HD2  4  
ATOM 6501  H HD3  . ARG A 1 34  ? 10.566  -7.311  4.340   1.00 0.00 ? 34  ARG A HD3  4  
ATOM 6502  H HE   . ARG A 1 34  ? 9.992   -7.957  1.589   1.00 0.00 ? 34  ARG A HE   4  
ATOM 6503  H HH11 . ARG A 1 34  ? 11.995  -8.626  4.357   1.00 0.00 ? 34  ARG A HH11 4  
ATOM 6504  H HH12 . ARG A 1 34  ? 12.419  -10.220 3.828   1.00 0.00 ? 34  ARG A HH12 4  
ATOM 6505  H HH21 . ARG A 1 34  ? 10.544  -10.054 0.881   1.00 0.00 ? 34  ARG A HH21 4  
ATOM 6506  H HH22 . ARG A 1 34  ? 11.594  -11.031 1.850   1.00 0.00 ? 34  ARG A HH22 4  
ATOM 6507  N N    . VAL A 1 35  ? 8.003   -2.253  1.180   1.00 0.00 ? 35  VAL A N    4  
ATOM 6508  C CA   . VAL A 1 35  ? 8.143   -0.943  0.556   1.00 0.00 ? 35  VAL A CA   4  
ATOM 6509  C C    . VAL A 1 35  ? 9.170   -0.090  1.293   1.00 0.00 ? 35  VAL A C    4  
ATOM 6510  O O    . VAL A 1 35  ? 9.138   0.017   2.518   1.00 0.00 ? 35  VAL A O    4  
ATOM 6511  C CB   . VAL A 1 35  ? 6.799   -0.191  0.520   1.00 0.00 ? 35  VAL A CB   4  
ATOM 6512  C CG1  . VAL A 1 35  ? 6.843   0.934   -0.502  1.00 0.00 ? 35  VAL A CG1  4  
ATOM 6513  C CG2  . VAL A 1 35  ? 5.660   -1.153  0.217   1.00 0.00 ? 35  VAL A CG2  4  
ATOM 6514  H H    . VAL A 1 35  ? 7.612   -2.316  2.076   1.00 0.00 ? 35  VAL A H    4  
ATOM 6515  H HA   . VAL A 1 35  ? 8.476   -1.091  -0.461  1.00 0.00 ? 35  VAL A HA   4  
ATOM 6516  H HB   . VAL A 1 35  ? 6.627   0.243   1.494   1.00 0.00 ? 35  VAL A HB   4  
ATOM 6517  H HG11 . VAL A 1 35  ? 7.872   1.156   -0.749  1.00 0.00 ? 35  VAL A HG11 4  
ATOM 6518  H HG12 . VAL A 1 35  ? 6.315   0.632   -1.394  1.00 0.00 ? 35  VAL A HG12 4  
ATOM 6519  H HG13 . VAL A 1 35  ? 6.376   1.815   -0.087  1.00 0.00 ? 35  VAL A HG13 4  
ATOM 6520  H HG21 . VAL A 1 35  ? 5.017   -1.233  1.081   1.00 0.00 ? 35  VAL A HG21 4  
ATOM 6521  H HG22 . VAL A 1 35  ? 5.091   -0.782  -0.622  1.00 0.00 ? 35  VAL A HG22 4  
ATOM 6522  H HG23 . VAL A 1 35  ? 6.063   -2.126  -0.022  1.00 0.00 ? 35  VAL A HG23 4  
ATOM 6523  N N    . GLY A 1 36  ? 10.081  0.515   0.537   1.00 0.00 ? 36  GLY A N    4  
ATOM 6524  C CA   . GLY A 1 36  ? 11.105  1.351   1.135   1.00 0.00 ? 36  GLY A CA   4  
ATOM 6525  C C    . GLY A 1 36  ? 12.122  1.837   0.122   1.00 0.00 ? 36  GLY A C    4  
ATOM 6526  O O    . GLY A 1 36  ? 11.759  2.280   -0.967  1.00 0.00 ? 36  GLY A O    4  
ATOM 6527  H H    . GLY A 1 36  ? 10.057  0.393   -0.436  1.00 0.00 ? 36  GLY A H    4  
ATOM 6528  H HA2  . GLY A 1 36  ? 10.633  2.207   1.595   1.00 0.00 ? 36  GLY A HA2  4  
ATOM 6529  H HA3  . GLY A 1 36  ? 11.617  0.783   1.898   1.00 0.00 ? 36  GLY A HA3  4  
ATOM 6530  N N    . GLN A 1 37  ? 13.399  1.756   0.482   1.00 0.00 ? 37  GLN A N    4  
ATOM 6531  C CA   . GLN A 1 37  ? 14.471  2.193   -0.404  1.00 0.00 ? 37  GLN A CA   4  
ATOM 6532  C C    . GLN A 1 37  ? 15.100  1.006   -1.126  1.00 0.00 ? 37  GLN A C    4  
ATOM 6533  O O    . GLN A 1 37  ? 14.845  -0.148  -0.781  1.00 0.00 ? 37  GLN A O    4  
ATOM 6534  C CB   . GLN A 1 37  ? 15.540  2.948   0.388   1.00 0.00 ? 37  GLN A CB   4  
ATOM 6535  C CG   . GLN A 1 37  ? 15.127  4.358   0.777   1.00 0.00 ? 37  GLN A CG   4  
ATOM 6536  C CD   . GLN A 1 37  ? 15.157  5.320   -0.394  1.00 0.00 ? 37  GLN A CD   4  
ATOM 6537  O OE1  . GLN A 1 37  ? 15.537  4.950   -1.506  1.00 0.00 ? 37  GLN A OE1  4  
ATOM 6538  N NE2  . GLN A 1 37  ? 14.757  6.562   -0.152  1.00 0.00 ? 37  GLN A NE2  4  
ATOM 6539  H H    . GLN A 1 37  ? 13.625  1.393   1.363   1.00 0.00 ? 37  GLN A H    4  
ATOM 6540  H HA   . GLN A 1 37  ? 14.043  2.859   -1.138  1.00 0.00 ? 37  GLN A HA   4  
ATOM 6541  H HB2  . GLN A 1 37  ? 15.758  2.397   1.291   1.00 0.00 ? 37  GLN A HB2  4  
ATOM 6542  H HB3  . GLN A 1 37  ? 16.437  3.012   -0.210  1.00 0.00 ? 37  GLN A HB3  4  
ATOM 6543  H HG2  . GLN A 1 37  ? 14.122  4.329   1.172   1.00 0.00 ? 37  GLN A HG2  4  
ATOM 6544  H HG3  . GLN A 1 37  ? 15.801  4.720   1.539   1.00 0.00 ? 37  GLN A HG3  4  
ATOM 6545  H HE21 . GLN A 1 37  ? 14.469  6.786   0.759   1.00 0.00 ? 37  GLN A HE21 4  
ATOM 6546  H HE22 . GLN A 1 37  ? 14.767  7.204   -0.891  1.00 0.00 ? 37  GLN A HE22 4  
ATOM 6547  N N    . ALA A 1 38  ? 15.922  1.297   -2.128  1.00 0.00 ? 38  ALA A N    4  
ATOM 6548  C CA   . ALA A 1 38  ? 16.588  0.253   -2.897  1.00 0.00 ? 38  ALA A CA   4  
ATOM 6549  C C    . ALA A 1 38  ? 17.850  -0.229  -2.190  1.00 0.00 ? 38  ALA A C    4  
ATOM 6550  O O    . ALA A 1 38  ? 18.358  -1.313  -2.477  1.00 0.00 ? 38  ALA A O    4  
ATOM 6551  C CB   . ALA A 1 38  ? 16.924  0.759   -4.293  1.00 0.00 ? 38  ALA A CB   4  
ATOM 6552  H H    . ALA A 1 38  ? 16.085  2.236   -2.356  1.00 0.00 ? 38  ALA A H    4  
ATOM 6553  H HA   . ALA A 1 38  ? 15.904  -0.577  -2.997  1.00 0.00 ? 38  ALA A HA   4  
ATOM 6554  H HB1  . ALA A 1 38  ? 16.010  0.942   -4.838  1.00 0.00 ? 38  ALA A HB1  4  
ATOM 6555  H HB2  . ALA A 1 38  ? 17.489  1.677   -4.216  1.00 0.00 ? 38  ALA A HB2  4  
ATOM 6556  H HB3  . ALA A 1 38  ? 17.511  0.016   -4.813  1.00 0.00 ? 38  ALA A HB3  4  
ATOM 6557  N N    . ASP A 1 39  ? 18.351  0.582   -1.265  1.00 0.00 ? 39  ASP A N    4  
ATOM 6558  C CA   . ASP A 1 39  ? 19.554  0.238   -0.516  1.00 0.00 ? 39  ASP A CA   4  
ATOM 6559  C C    . ASP A 1 39  ? 19.217  -0.662  0.669   1.00 0.00 ? 39  ASP A C    4  
ATOM 6560  O O    . ASP A 1 39  ? 20.063  -1.415  1.150   1.00 0.00 ? 39  ASP A O    4  
ATOM 6561  C CB   . ASP A 1 39  ? 20.256  1.505   -0.027  1.00 0.00 ? 39  ASP A CB   4  
ATOM 6562  C CG   . ASP A 1 39  ? 19.376  2.342   0.880   1.00 0.00 ? 39  ASP A CG   4  
ATOM 6563  O OD1  . ASP A 1 39  ? 19.393  2.107   2.107   1.00 0.00 ? 39  ASP A OD1  4  
ATOM 6564  O OD2  . ASP A 1 39  ? 18.670  3.233   0.363   1.00 0.00 ? 39  ASP A OD2  4  
ATOM 6565  H H    . ASP A 1 39  ? 17.900  1.433   -1.081  1.00 0.00 ? 39  ASP A H    4  
ATOM 6566  H HA   . ASP A 1 39  ? 20.216  -0.297  -1.180  1.00 0.00 ? 39  ASP A HA   4  
ATOM 6567  H HB2  . ASP A 1 39  ? 21.145  1.228   0.522   1.00 0.00 ? 39  ASP A HB2  4  
ATOM 6568  H HB3  . ASP A 1 39  ? 20.537  2.105   -0.880  1.00 0.00 ? 39  ASP A HB3  4  
ATOM 6569  N N    . ALA A 1 40  ? 17.975  -0.577  1.136   1.00 0.00 ? 40  ALA A N    4  
ATOM 6570  C CA   . ALA A 1 40  ? 17.526  -1.383  2.264   1.00 0.00 ? 40  ALA A CA   4  
ATOM 6571  C C    . ALA A 1 40  ? 18.073  -2.804  2.175   1.00 0.00 ? 40  ALA A C    4  
ATOM 6572  O O    . ALA A 1 40  ? 18.066  -3.415  1.108   1.00 0.00 ? 40  ALA A O    4  
ATOM 6573  C CB   . ALA A 1 40  ? 16.006  -1.404  2.326   1.00 0.00 ? 40  ALA A CB   4  
ATOM 6574  H H    . ALA A 1 40  ? 17.346  0.042   0.710   1.00 0.00 ? 40  ALA A H    4  
ATOM 6575  H HA   . ALA A 1 40  ? 17.893  -0.923  3.170   1.00 0.00 ? 40  ALA A HA   4  
ATOM 6576  H HB1  . ALA A 1 40  ? 15.641  -0.409  2.533   1.00 0.00 ? 40  ALA A HB1  4  
ATOM 6577  H HB2  . ALA A 1 40  ? 15.613  -1.742  1.379   1.00 0.00 ? 40  ALA A HB2  4  
ATOM 6578  H HB3  . ALA A 1 40  ? 15.687  -2.075  3.110   1.00 0.00 ? 40  ALA A HB3  4  
ATOM 6579  N N    . GLU A 1 41  ? 18.547  -3.322  3.304   1.00 0.00 ? 41  GLU A N    4  
ATOM 6580  C CA   . GLU A 1 41  ? 19.100  -4.671  3.352   1.00 0.00 ? 41  GLU A CA   4  
ATOM 6581  C C    . GLU A 1 41  ? 18.345  -5.601  2.406   1.00 0.00 ? 41  GLU A C    4  
ATOM 6582  O O    . GLU A 1 41  ? 18.934  -6.196  1.503   1.00 0.00 ? 41  GLU A O    4  
ATOM 6583  C CB   . GLU A 1 41  ? 19.041  -5.220  4.779   1.00 0.00 ? 41  GLU A CB   4  
ATOM 6584  C CG   . GLU A 1 41  ? 19.276  -4.164  5.847   1.00 0.00 ? 41  GLU A CG   4  
ATOM 6585  C CD   . GLU A 1 41  ? 20.482  -3.294  5.552   1.00 0.00 ? 41  GLU A CD   4  
ATOM 6586  O OE1  . GLU A 1 41  ? 21.309  -3.692  4.705   1.00 0.00 ? 41  GLU A OE1  4  
ATOM 6587  O OE2  . GLU A 1 41  ? 20.598  -2.214  6.168   1.00 0.00 ? 41  GLU A OE2  4  
ATOM 6588  H H    . GLU A 1 41  ? 18.526  -2.785  4.123   1.00 0.00 ? 41  GLU A H    4  
ATOM 6589  H HA   . GLU A 1 41  ? 20.131  -4.618  3.038   1.00 0.00 ? 41  GLU A HA   4  
ATOM 6590  H HB2  . GLU A 1 41  ? 18.069  -5.659  4.943   1.00 0.00 ? 41  GLU A HB2  4  
ATOM 6591  H HB3  . GLU A 1 41  ? 19.795  -5.985  4.888   1.00 0.00 ? 41  GLU A HB3  4  
ATOM 6592  H HG2  . GLU A 1 41  ? 18.402  -3.533  5.909   1.00 0.00 ? 41  GLU A HG2  4  
ATOM 6593  H HG3  . GLU A 1 41  ? 19.430  -4.658  6.795   1.00 0.00 ? 41  GLU A HG3  4  
ATOM 6594  N N    . ARG A 1 42  ? 17.039  -5.722  2.621   1.00 0.00 ? 42  ARG A N    4  
ATOM 6595  C CA   . ARG A 1 42  ? 16.204  -6.581  1.790   1.00 0.00 ? 42  ARG A CA   4  
ATOM 6596  C C    . ARG A 1 42  ? 15.617  -5.799  0.619   1.00 0.00 ? 42  ARG A C    4  
ATOM 6597  O O    . ARG A 1 42  ? 14.723  -4.972  0.798   1.00 0.00 ? 42  ARG A O    4  
ATOM 6598  C CB   . ARG A 1 42  ? 15.078  -7.194  2.624   1.00 0.00 ? 42  ARG A CB   4  
ATOM 6599  C CG   . ARG A 1 42  ? 15.468  -8.490  3.316   1.00 0.00 ? 42  ARG A CG   4  
ATOM 6600  C CD   . ARG A 1 42  ? 16.770  -8.339  4.088   1.00 0.00 ? 42  ARG A CD   4  
ATOM 6601  N NE   . ARG A 1 42  ? 17.337  -9.631  4.464   1.00 0.00 ? 42  ARG A NE   4  
ATOM 6602  C CZ   . ARG A 1 42  ? 18.268  -9.781  5.399   1.00 0.00 ? 42  ARG A CZ   4  
ATOM 6603  N NH1  . ARG A 1 42  ? 18.735  -8.725  6.050   1.00 0.00 ? 42  ARG A NH1  4  
ATOM 6604  N NH2  . ARG A 1 42  ? 18.735  -10.990 5.684   1.00 0.00 ? 42  ARG A NH2  4  
ATOM 6605  H H    . ARG A 1 42  ? 16.627  -5.222  3.357   1.00 0.00 ? 42  ARG A H    4  
ATOM 6606  H HA   . ARG A 1 42  ? 16.826  -7.374  1.403   1.00 0.00 ? 42  ARG A HA   4  
ATOM 6607  H HB2  . ARG A 1 42  ? 14.778  -6.484  3.381   1.00 0.00 ? 42  ARG A HB2  4  
ATOM 6608  H HB3  . ARG A 1 42  ? 14.237  -7.396  1.978   1.00 0.00 ? 42  ARG A HB3  4  
ATOM 6609  H HG2  . ARG A 1 42  ? 14.685  -8.770  4.004   1.00 0.00 ? 42  ARG A HG2  4  
ATOM 6610  H HG3  . ARG A 1 42  ? 15.589  -9.262  2.571   1.00 0.00 ? 42  ARG A HG3  4  
ATOM 6611  H HD2  . ARG A 1 42  ? 17.480  -7.810  3.470   1.00 0.00 ? 42  ARG A HD2  4  
ATOM 6612  H HD3  . ARG A 1 42  ? 16.576  -7.767  4.984   1.00 0.00 ? 42  ARG A HD3  4  
ATOM 6613  H HE   . ARG A 1 42  ? 17.006  -10.425 3.995   1.00 0.00 ? 42  ARG A HE   4  
ATOM 6614  H HH11 . ARG A 1 42  ? 18.385  -7.813  5.837   1.00 0.00 ? 42  ARG A HH11 4  
ATOM 6615  H HH12 . ARG A 1 42  ? 19.436  -8.840  6.754   1.00 0.00 ? 42  ARG A HH12 4  
ATOM 6616  H HH21 . ARG A 1 42  ? 18.385  -11.789 5.196   1.00 0.00 ? 42  ARG A HH21 4  
ATOM 6617  H HH22 . ARG A 1 42  ? 19.436  -11.102 6.388   1.00 0.00 ? 42  ARG A HH22 4  
ATOM 6618  N N    . ARG A 1 43  ? 16.126  -6.067  -0.579  1.00 0.00 ? 43  ARG A N    4  
ATOM 6619  C CA   . ARG A 1 43  ? 15.653  -5.387  -1.779  1.00 0.00 ? 43  ARG A CA   4  
ATOM 6620  C C    . ARG A 1 43  ? 14.144  -5.171  -1.723  1.00 0.00 ? 43  ARG A C    4  
ATOM 6621  O O    . ARG A 1 43  ? 13.366  -6.109  -1.892  1.00 0.00 ? 43  ARG A O    4  
ATOM 6622  C CB   . ARG A 1 43  ? 16.016  -6.196  -3.026  1.00 0.00 ? 43  ARG A CB   4  
ATOM 6623  C CG   . ARG A 1 43  ? 15.162  -5.864  -4.238  1.00 0.00 ? 43  ARG A CG   4  
ATOM 6624  C CD   . ARG A 1 43  ? 15.719  -6.498  -5.503  1.00 0.00 ? 43  ARG A CD   4  
ATOM 6625  N NE   . ARG A 1 43  ? 16.106  -7.890  -5.293  1.00 0.00 ? 43  ARG A NE   4  
ATOM 6626  C CZ   . ARG A 1 43  ? 16.735  -8.624  -6.205  1.00 0.00 ? 43  ARG A CZ   4  
ATOM 6627  N NH1  . ARG A 1 43  ? 17.046  -8.100  -7.383  1.00 0.00 ? 43  ARG A NH1  4  
ATOM 6628  N NH2  . ARG A 1 43  ? 17.054  -9.884  -5.940  1.00 0.00 ? 43  ARG A NH2  4  
ATOM 6629  H H    . ARG A 1 43  ? 16.837  -6.736  -0.658  1.00 0.00 ? 43  ARG A H    4  
ATOM 6630  H HA   . ARG A 1 43  ? 16.141  -4.426  -1.830  1.00 0.00 ? 43  ARG A HA   4  
ATOM 6631  H HB2  . ARG A 1 43  ? 17.049  -6.004  -3.278  1.00 0.00 ? 43  ARG A HB2  4  
ATOM 6632  H HB3  . ARG A 1 43  ? 15.898  -7.246  -2.805  1.00 0.00 ? 43  ARG A HB3  4  
ATOM 6633  H HG2  . ARG A 1 43  ? 14.161  -6.236  -4.074  1.00 0.00 ? 43  ARG A HG2  4  
ATOM 6634  H HG3  . ARG A 1 43  ? 15.134  -4.792  -4.364  1.00 0.00 ? 43  ARG A HG3  4  
ATOM 6635  H HD2  . ARG A 1 43  ? 14.964  -6.457  -6.273  1.00 0.00 ? 43  ARG A HD2  4  
ATOM 6636  H HD3  . ARG A 1 43  ? 16.586  -5.936  -5.819  1.00 0.00 ? 43  ARG A HD3  4  
ATOM 6637  H HE   . ARG A 1 43  ? 15.886  -8.297  -4.430  1.00 0.00 ? 43  ARG A HE   4  
ATOM 6638  H HH11 . ARG A 1 43  ? 16.807  -7.150  -7.585  1.00 0.00 ? 43  ARG A HH11 4  
ATOM 6639  H HH12 . ARG A 1 43  ? 17.520  -8.654  -8.067  1.00 0.00 ? 43  ARG A HH12 4  
ATOM 6640  H HH21 . ARG A 1 43  ? 16.821  -10.282 -5.053  1.00 0.00 ? 43  ARG A HH21 4  
ATOM 6641  H HH22 . ARG A 1 43  ? 17.527  -10.435 -6.626  1.00 0.00 ? 43  ARG A HH22 4  
ATOM 6642  N N    . GLN A 1 44  ? 13.738  -3.928  -1.483  1.00 0.00 ? 44  GLN A N    4  
ATOM 6643  C CA   . GLN A 1 44  ? 12.322  -3.589  -1.402  1.00 0.00 ? 44  GLN A CA   4  
ATOM 6644  C C    . GLN A 1 44  ? 11.649  -3.736  -2.763  1.00 0.00 ? 44  GLN A C    4  
ATOM 6645  O O    . GLN A 1 44  ? 12.075  -3.130  -3.746  1.00 0.00 ? 44  GLN A O    4  
ATOM 6646  C CB   . GLN A 1 44  ? 12.146  -2.160  -0.885  1.00 0.00 ? 44  GLN A CB   4  
ATOM 6647  C CG   . GLN A 1 44  ? 12.844  -1.903  0.441   1.00 0.00 ? 44  GLN A CG   4  
ATOM 6648  C CD   . GLN A 1 44  ? 12.032  -2.379  1.630   1.00 0.00 ? 44  GLN A CD   4  
ATOM 6649  O OE1  . GLN A 1 44  ? 10.908  -1.926  1.849   1.00 0.00 ? 44  GLN A OE1  4  
ATOM 6650  N NE2  . GLN A 1 44  ? 12.598  -3.297  2.404   1.00 0.00 ? 44  GLN A NE2  4  
ATOM 6651  H H    . GLN A 1 44  ? 14.406  -3.223  -1.356  1.00 0.00 ? 44  GLN A H    4  
ATOM 6652  H HA   . GLN A 1 44  ? 11.857  -4.273  -0.709  1.00 0.00 ? 44  GLN A HA   4  
ATOM 6653  H HB2  . GLN A 1 44  ? 12.545  -1.474  -1.616  1.00 0.00 ? 44  GLN A HB2  4  
ATOM 6654  H HB3  . GLN A 1 44  ? 11.092  -1.964  -0.756  1.00 0.00 ? 44  GLN A HB3  4  
ATOM 6655  H HG2  . GLN A 1 44  ? 13.791  -2.422  0.442   1.00 0.00 ? 44  GLN A HG2  4  
ATOM 6656  H HG3  . GLN A 1 44  ? 13.016  -0.842  0.542   1.00 0.00 ? 44  GLN A HG3  4  
ATOM 6657  H HE21 . GLN A 1 44  ? 13.496  -3.611  2.168   1.00 0.00 ? 44  GLN A HE21 4  
ATOM 6658  H HE22 . GLN A 1 44  ? 12.096  -3.622  3.180   1.00 0.00 ? 44  GLN A HE22 4  
ATOM 6659  N N    . ASP A 1 45  ? 10.597  -4.545  -2.812  1.00 0.00 ? 45  ASP A N    4  
ATOM 6660  C CA   . ASP A 1 45  ? 9.864   -4.772  -4.053  1.00 0.00 ? 45  ASP A CA   4  
ATOM 6661  C C    . ASP A 1 45  ? 9.524   -3.449  -4.732  1.00 0.00 ? 45  ASP A C    4  
ATOM 6662  O O    . ASP A 1 45  ? 9.685   -3.304  -5.944  1.00 0.00 ? 45  ASP A O    4  
ATOM 6663  C CB   . ASP A 1 45  ? 8.583   -5.561  -3.777  1.00 0.00 ? 45  ASP A CB   4  
ATOM 6664  C CG   . ASP A 1 45  ? 8.163   -6.415  -4.958  1.00 0.00 ? 45  ASP A CG   4  
ATOM 6665  O OD1  . ASP A 1 45  ? 7.885   -5.844  -6.033  1.00 0.00 ? 45  ASP A OD1  4  
ATOM 6666  O OD2  . ASP A 1 45  ? 8.114   -7.653  -4.806  1.00 0.00 ? 45  ASP A OD2  4  
ATOM 6667  H H    . ASP A 1 45  ? 10.305  -5.001  -1.995  1.00 0.00 ? 45  ASP A H    4  
ATOM 6668  H HA   . ASP A 1 45  ? 10.496  -5.348  -4.711  1.00 0.00 ? 45  ASP A HA   4  
ATOM 6669  H HB2  . ASP A 1 45  ? 8.744   -6.210  -2.927  1.00 0.00 ? 45  ASP A HB2  4  
ATOM 6670  H HB3  . ASP A 1 45  ? 7.784   -4.871  -3.552  1.00 0.00 ? 45  ASP A HB3  4  
ATOM 6671  N N    . ILE A 1 46  ? 9.053   -2.489  -3.944  1.00 0.00 ? 46  ILE A N    4  
ATOM 6672  C CA   . ILE A 1 46  ? 8.690   -1.179  -4.470  1.00 0.00 ? 46  ILE A CA   4  
ATOM 6673  C C    . ILE A 1 46  ? 9.525   -0.077  -3.825  1.00 0.00 ? 46  ILE A C    4  
ATOM 6674  O O    . ILE A 1 46  ? 9.438   0.157   -2.620  1.00 0.00 ? 46  ILE A O    4  
ATOM 6675  C CB   . ILE A 1 46  ? 7.197   -0.875  -4.245  1.00 0.00 ? 46  ILE A CB   4  
ATOM 6676  C CG1  . ILE A 1 46  ? 6.350   -1.531  -5.337  1.00 0.00 ? 46  ILE A CG1  4  
ATOM 6677  C CG2  . ILE A 1 46  ? 6.961   0.628   -4.216  1.00 0.00 ? 46  ILE A CG2  4  
ATOM 6678  C CD1  . ILE A 1 46  ? 4.920   -1.792  -4.918  1.00 0.00 ? 46  ILE A CD1  4  
ATOM 6679  H H    . ILE A 1 46  ? 8.947   -2.666  -2.987  1.00 0.00 ? 46  ILE A H    4  
ATOM 6680  H HA   . ILE A 1 46  ? 8.879   -1.183  -5.534  1.00 0.00 ? 46  ILE A HA   4  
ATOM 6681  H HB   . ILE A 1 46  ? 6.911   -1.279  -3.286  1.00 0.00 ? 46  ILE A HB   4  
ATOM 6682  H HG12 . ILE A 1 46  ? 6.330   -0.889  -6.203  1.00 0.00 ? 46  ILE A HG12 4  
ATOM 6683  H HG13 . ILE A 1 46  ? 6.795   -2.478  -5.606  1.00 0.00 ? 46  ILE A HG13 4  
ATOM 6684  H HG21 . ILE A 1 46  ? 7.401   1.044   -3.321  1.00 0.00 ? 46  ILE A HG21 4  
ATOM 6685  H HG22 . ILE A 1 46  ? 7.417   1.080   -5.083  1.00 0.00 ? 46  ILE A HG22 4  
ATOM 6686  H HG23 . ILE A 1 46  ? 5.900   0.826   -4.221  1.00 0.00 ? 46  ILE A HG23 4  
ATOM 6687  H HD11 . ILE A 1 46  ? 4.543   -2.658  -5.442  1.00 0.00 ? 46  ILE A HD11 4  
ATOM 6688  H HD12 . ILE A 1 46  ? 4.884   -1.973  -3.854  1.00 0.00 ? 46  ILE A HD12 4  
ATOM 6689  H HD13 . ILE A 1 46  ? 4.312   -0.933  -5.159  1.00 0.00 ? 46  ILE A HD13 4  
ATOM 6690  N N    . VAL A 1 47  ? 10.333  0.598   -4.637  1.00 0.00 ? 47  VAL A N    4  
ATOM 6691  C CA   . VAL A 1 47  ? 11.181  1.677   -4.147  1.00 0.00 ? 47  VAL A CA   4  
ATOM 6692  C C    . VAL A 1 47  ? 10.579  3.040   -4.470  1.00 0.00 ? 47  VAL A C    4  
ATOM 6693  O O    . VAL A 1 47  ? 10.248  3.327   -5.621  1.00 0.00 ? 47  VAL A O    4  
ATOM 6694  C CB   . VAL A 1 47  ? 12.596  1.597   -4.750  1.00 0.00 ? 47  VAL A CB   4  
ATOM 6695  C CG1  . VAL A 1 47  ? 13.525  2.588   -4.066  1.00 0.00 ? 47  VAL A CG1  4  
ATOM 6696  C CG2  . VAL A 1 47  ? 13.141  0.181   -4.642  1.00 0.00 ? 47  VAL A CG2  4  
ATOM 6697  H H    . VAL A 1 47  ? 10.358  0.364   -5.588  1.00 0.00 ? 47  VAL A H    4  
ATOM 6698  H HA   . VAL A 1 47  ? 11.264  1.576   -3.074  1.00 0.00 ? 47  VAL A HA   4  
ATOM 6699  H HB   . VAL A 1 47  ? 12.534  1.858   -5.796  1.00 0.00 ? 47  VAL A HB   4  
ATOM 6700  H HG11 . VAL A 1 47  ? 13.923  2.145   -3.165  1.00 0.00 ? 47  VAL A HG11 4  
ATOM 6701  H HG12 . VAL A 1 47  ? 14.336  2.841   -4.733  1.00 0.00 ? 47  VAL A HG12 4  
ATOM 6702  H HG13 . VAL A 1 47  ? 12.974  3.482   -3.814  1.00 0.00 ? 47  VAL A HG13 4  
ATOM 6703  H HG21 . VAL A 1 47  ? 12.338  -0.526  -4.786  1.00 0.00 ? 47  VAL A HG21 4  
ATOM 6704  H HG22 . VAL A 1 47  ? 13.896  0.028   -5.399  1.00 0.00 ? 47  VAL A HG22 4  
ATOM 6705  H HG23 . VAL A 1 47  ? 13.578  0.036   -3.665  1.00 0.00 ? 47  VAL A HG23 4  
ATOM 6706  N N    . LEU A 1 48  ? 10.439  3.876   -3.448  1.00 0.00 ? 48  LEU A N    4  
ATOM 6707  C CA   . LEU A 1 48  ? 9.877   5.211   -3.622  1.00 0.00 ? 48  LEU A CA   4  
ATOM 6708  C C    . LEU A 1 48  ? 10.979  6.240   -3.851  1.00 0.00 ? 48  LEU A C    4  
ATOM 6709  O O    . LEU A 1 48  ? 12.122  6.043   -3.439  1.00 0.00 ? 48  LEU A O    4  
ATOM 6710  C CB   . LEU A 1 48  ? 9.046   5.600   -2.398  1.00 0.00 ? 48  LEU A CB   4  
ATOM 6711  C CG   . LEU A 1 48  ? 8.015   4.571   -1.932  1.00 0.00 ? 48  LEU A CG   4  
ATOM 6712  C CD1  . LEU A 1 48  ? 7.319   3.935   -3.125  1.00 0.00 ? 48  LEU A CD1  4  
ATOM 6713  C CD2  . LEU A 1 48  ? 8.677   3.507   -1.069  1.00 0.00 ? 48  LEU A CD2  4  
ATOM 6714  H H    . LEU A 1 48  ? 10.721  3.591   -2.554  1.00 0.00 ? 48  LEU A H    4  
ATOM 6715  H HA   . LEU A 1 48  ? 9.235   5.189   -4.491  1.00 0.00 ? 48  LEU A HA   4  
ATOM 6716  H HB2  . LEU A 1 48  ? 9.727   5.780   -1.580  1.00 0.00 ? 48  LEU A HB2  4  
ATOM 6717  H HB3  . LEU A 1 48  ? 8.520   6.514   -2.634  1.00 0.00 ? 48  LEU A HB3  4  
ATOM 6718  H HG   . LEU A 1 48  ? 7.264   5.069   -1.334  1.00 0.00 ? 48  LEU A HG   4  
ATOM 6719  H HD11 . LEU A 1 48  ? 6.296   3.709   -2.866  1.00 0.00 ? 48  LEU A HD11 4  
ATOM 6720  H HD12 . LEU A 1 48  ? 7.831   3.025   -3.397  1.00 0.00 ? 48  LEU A HD12 4  
ATOM 6721  H HD13 . LEU A 1 48  ? 7.336   4.621   -3.960  1.00 0.00 ? 48  LEU A HD13 4  
ATOM 6722  H HD21 . LEU A 1 48  ? 9.587   3.903   -0.644  1.00 0.00 ? 48  LEU A HD21 4  
ATOM 6723  H HD22 . LEU A 1 48  ? 8.908   2.644   -1.676  1.00 0.00 ? 48  LEU A HD22 4  
ATOM 6724  H HD23 . LEU A 1 48  ? 8.004   3.218   -0.274  1.00 0.00 ? 48  LEU A HD23 4  
ATOM 6725  N N    . SER A 1 49  ? 10.627  7.340   -4.510  1.00 0.00 ? 49  SER A N    4  
ATOM 6726  C CA   . SER A 1 49  ? 11.586  8.401   -4.795  1.00 0.00 ? 49  SER A CA   4  
ATOM 6727  C C    . SER A 1 49  ? 11.305  9.632   -3.939  1.00 0.00 ? 49  SER A C    4  
ATOM 6728  O O    . SER A 1 49  ? 10.887  10.672  -4.446  1.00 0.00 ? 49  SER A O    4  
ATOM 6729  C CB   . SER A 1 49  ? 11.539  8.774   -6.278  1.00 0.00 ? 49  SER A CB   4  
ATOM 6730  O OG   . SER A 1 49  ? 12.793  9.266   -6.720  1.00 0.00 ? 49  SER A OG   4  
ATOM 6731  H H    . SER A 1 49  ? 9.700   7.439   -4.813  1.00 0.00 ? 49  SER A H    4  
ATOM 6732  H HA   . SER A 1 49  ? 12.572  8.029   -4.557  1.00 0.00 ? 49  SER A HA   4  
ATOM 6733  H HB2  . SER A 1 49  ? 11.284  7.901   -6.859  1.00 0.00 ? 49  SER A HB2  4  
ATOM 6734  H HB3  . SER A 1 49  ? 10.792  9.540   -6.430  1.00 0.00 ? 49  SER A HB3  4  
ATOM 6735  H HG   . SER A 1 49  ? 13.194  8.630   -7.317  1.00 0.00 ? 49  SER A HG   4  
ATOM 6736  N N    . GLY A 1 50  ? 11.538  9.506   -2.636  1.00 0.00 ? 50  GLY A N    4  
ATOM 6737  C CA   . GLY A 1 50  ? 11.305  10.615  -1.730  1.00 0.00 ? 50  GLY A CA   4  
ATOM 6738  C C    . GLY A 1 50  ? 12.505  10.909  -0.853  1.00 0.00 ? 50  GLY A C    4  
ATOM 6739  O O    . GLY A 1 50  ? 13.621  10.486  -1.154  1.00 0.00 ? 50  GLY A O    4  
ATOM 6740  H H    . GLY A 1 50  ? 11.871  8.652   -2.288  1.00 0.00 ? 50  GLY A H    4  
ATOM 6741  H HA2  . GLY A 1 50  ? 11.070  11.495  -2.309  1.00 0.00 ? 50  GLY A HA2  4  
ATOM 6742  H HA3  . GLY A 1 50  ? 10.462  10.377  -1.098  1.00 0.00 ? 50  GLY A HA3  4  
ATOM 6743  N N    . ALA A 1 51  ? 12.277  11.637  0.235   1.00 0.00 ? 51  ALA A N    4  
ATOM 6744  C CA   . ALA A 1 51  ? 13.348  11.987  1.159   1.00 0.00 ? 51  ALA A CA   4  
ATOM 6745  C C    . ALA A 1 51  ? 13.080  11.424  2.550   1.00 0.00 ? 51  ALA A C    4  
ATOM 6746  O O    . ALA A 1 51  ? 14.006  11.030  3.261   1.00 0.00 ? 51  ALA A O    4  
ATOM 6747  C CB   . ALA A 1 51  ? 13.518  13.498  1.223   1.00 0.00 ? 51  ALA A CB   4  
ATOM 6748  H H    . ALA A 1 51  ? 11.366  11.945  0.422   1.00 0.00 ? 51  ALA A H    4  
ATOM 6749  H HA   . ALA A 1 51  ? 14.267  11.563  0.781   1.00 0.00 ? 51  ALA A HA   4  
ATOM 6750  H HB1  . ALA A 1 51  ? 13.825  13.784  2.218   1.00 0.00 ? 51  ALA A HB1  4  
ATOM 6751  H HB2  . ALA A 1 51  ? 14.269  13.806  0.511   1.00 0.00 ? 51  ALA A HB2  4  
ATOM 6752  H HB3  . ALA A 1 51  ? 12.579  13.975  0.985   1.00 0.00 ? 51  ALA A HB3  4  
ATOM 6753  N N    . HIS A 1 52  ? 11.808  11.388  2.934   1.00 0.00 ? 52  HIS A N    4  
ATOM 6754  C CA   . HIS A 1 52  ? 11.418  10.873  4.242   1.00 0.00 ? 52  HIS A CA   4  
ATOM 6755  C C    . HIS A 1 52  ? 11.212  9.362   4.190   1.00 0.00 ? 52  HIS A C    4  
ATOM 6756  O O    . HIS A 1 52  ? 10.809  8.747   5.178   1.00 0.00 ? 52  HIS A O    4  
ATOM 6757  C CB   . HIS A 1 52  ? 10.138  11.558  4.723   1.00 0.00 ? 52  HIS A CB   4  
ATOM 6758  C CG   . HIS A 1 52  ? 10.375  12.900  5.343   1.00 0.00 ? 52  HIS A CG   4  
ATOM 6759  N ND1  . HIS A 1 52  ? 11.088  13.902  4.720   1.00 0.00 ? 52  HIS A ND1  4  
ATOM 6760  C CD2  . HIS A 1 52  ? 9.986   13.405  6.538   1.00 0.00 ? 52  HIS A CD2  4  
ATOM 6761  C CE1  . HIS A 1 52  ? 11.130  14.964  5.504   1.00 0.00 ? 52  HIS A CE1  4  
ATOM 6762  N NE2  . HIS A 1 52  ? 10.468  14.688  6.614   1.00 0.00 ? 52  HIS A NE2  4  
ATOM 6763  H H    . HIS A 1 52  ? 11.115  11.716  2.324   1.00 0.00 ? 52  HIS A H    4  
ATOM 6764  H HA   . HIS A 1 52  ? 12.215  11.091  4.936   1.00 0.00 ? 52  HIS A HA   4  
ATOM 6765  H HB2  . HIS A 1 52  ? 9.473   11.693  3.883   1.00 0.00 ? 52  HIS A HB2  4  
ATOM 6766  H HB3  . HIS A 1 52  ? 9.657   10.931  5.460   1.00 0.00 ? 52  HIS A HB3  4  
ATOM 6767  H HD2  . HIS A 1 52  ? 9.405   12.893  7.292   1.00 0.00 ? 52  HIS A HD2  4  
ATOM 6768  H HE1  . HIS A 1 52  ? 11.620  15.899  5.278   1.00 0.00 ? 52  HIS A HE1  4  
ATOM 6769  H HE2  . HIS A 1 52  ? 10.417  15.271  7.400   1.00 0.00 ? 52  HIS A HE2  4  
ATOM 6770  N N    . ILE A 1 53  ? 11.489  8.771   3.033   1.00 0.00 ? 53  ILE A N    4  
ATOM 6771  C CA   . ILE A 1 53  ? 11.334  7.332   2.854   1.00 0.00 ? 53  ILE A CA   4  
ATOM 6772  C C    . ILE A 1 53  ? 12.347  6.561   3.695   1.00 0.00 ? 53  ILE A C    4  
ATOM 6773  O O    . ILE A 1 53  ? 13.477  7.009   3.891   1.00 0.00 ? 53  ILE A O    4  
ATOM 6774  C CB   . ILE A 1 53  ? 11.497  6.928   1.377   1.00 0.00 ? 53  ILE A CB   4  
ATOM 6775  C CG1  . ILE A 1 53  ? 10.640  7.827   0.483   1.00 0.00 ? 53  ILE A CG1  4  
ATOM 6776  C CG2  . ILE A 1 53  ? 11.121  5.467   1.183   1.00 0.00 ? 53  ILE A CG2  4  
ATOM 6777  C CD1  . ILE A 1 53  ? 9.192   7.904   0.913   1.00 0.00 ? 53  ILE A CD1  4  
ATOM 6778  H H    . ILE A 1 53  ? 11.807  9.314   2.283   1.00 0.00 ? 53  ILE A H    4  
ATOM 6779  H HA   . ILE A 1 53  ? 10.338  7.063   3.173   1.00 0.00 ? 53  ILE A HA   4  
ATOM 6780  H HB   . ILE A 1 53  ? 12.535  7.047   1.106   1.00 0.00 ? 53  ILE A HB   4  
ATOM 6781  H HG12 . ILE A 1 53  ? 11.043  8.827   0.497   1.00 0.00 ? 53  ILE A HG12 4  
ATOM 6782  H HG13 . ILE A 1 53  ? 10.668  7.447   -0.528  1.00 0.00 ? 53  ILE A HG13 4  
ATOM 6783  H HG21 . ILE A 1 53  ? 10.989  5.265   0.131   1.00 0.00 ? 53  ILE A HG21 4  
ATOM 6784  H HG22 . ILE A 1 53  ? 11.907  4.839   1.573   1.00 0.00 ? 53  ILE A HG22 4  
ATOM 6785  H HG23 . ILE A 1 53  ? 10.200  5.259   1.708   1.00 0.00 ? 53  ILE A HG23 4  
ATOM 6786  H HD11 . ILE A 1 53  ? 8.690   8.678   0.350   1.00 0.00 ? 53  ILE A HD11 4  
ATOM 6787  H HD12 . ILE A 1 53  ? 8.710   6.956   0.726   1.00 0.00 ? 53  ILE A HD12 4  
ATOM 6788  H HD13 . ILE A 1 53  ? 9.141   8.134   1.966   1.00 0.00 ? 53  ILE A HD13 4  
ATOM 6789  N N    . LYS A 1 54  ? 11.935  5.398   4.188   1.00 0.00 ? 54  LYS A N    4  
ATOM 6790  C CA   . LYS A 1 54  ? 12.805  4.562   5.005   1.00 0.00 ? 54  LYS A CA   4  
ATOM 6791  C C    . LYS A 1 54  ? 13.014  3.197   4.356   1.00 0.00 ? 54  LYS A C    4  
ATOM 6792  O O    . LYS A 1 54  ? 12.201  2.755   3.545   1.00 0.00 ? 54  LYS A O    4  
ATOM 6793  C CB   . LYS A 1 54  ? 12.213  4.387   6.405   1.00 0.00 ? 54  LYS A CB   4  
ATOM 6794  C CG   . LYS A 1 54  ? 11.796  5.695   7.056   1.00 0.00 ? 54  LYS A CG   4  
ATOM 6795  C CD   . LYS A 1 54  ? 12.975  6.389   7.717   1.00 0.00 ? 54  LYS A CD   4  
ATOM 6796  C CE   . LYS A 1 54  ? 13.230  5.845   9.115   1.00 0.00 ? 54  LYS A CE   4  
ATOM 6797  N NZ   . LYS A 1 54  ? 14.068  4.614   9.087   1.00 0.00 ? 54  LYS A NZ   4  
ATOM 6798  H H    . LYS A 1 54  ? 11.022  5.095   3.996   1.00 0.00 ? 54  LYS A H    4  
ATOM 6799  H HA   . LYS A 1 54  ? 13.761  5.057   5.087   1.00 0.00 ? 54  LYS A HA   4  
ATOM 6800  H HB2  . LYS A 1 54  ? 11.343  3.750   6.338   1.00 0.00 ? 54  LYS A HB2  4  
ATOM 6801  H HB3  . LYS A 1 54  ? 12.949  3.913   7.038   1.00 0.00 ? 54  LYS A HB3  4  
ATOM 6802  H HG2  . LYS A 1 54  ? 11.385  6.348   6.301   1.00 0.00 ? 54  LYS A HG2  4  
ATOM 6803  H HG3  . LYS A 1 54  ? 11.044  5.490   7.805   1.00 0.00 ? 54  LYS A HG3  4  
ATOM 6804  H HD2  . LYS A 1 54  ? 13.858  6.232   7.116   1.00 0.00 ? 54  LYS A HD2  4  
ATOM 6805  H HD3  . LYS A 1 54  ? 12.767  7.448   7.784   1.00 0.00 ? 54  LYS A HD3  4  
ATOM 6806  H HE2  . LYS A 1 54  ? 13.736  6.602   9.694   1.00 0.00 ? 54  LYS A HE2  4  
ATOM 6807  H HE3  . LYS A 1 54  ? 12.281  5.614   9.575   1.00 0.00 ? 54  LYS A HE3  4  
ATOM 6808  H HZ1  . LYS A 1 54  ? 14.857  4.704   9.758   1.00 0.00 ? 54  LYS A HZ1  4  
ATOM 6809  H HZ2  . LYS A 1 54  ? 14.454  4.467   8.132   1.00 0.00 ? 54  LYS A HZ2  4  
ATOM 6810  H HZ3  . LYS A 1 54  ? 13.495  3.787   9.348   1.00 0.00 ? 54  LYS A HZ3  4  
ATOM 6811  N N    . GLU A 1 55  ? 14.107  2.534   4.720   1.00 0.00 ? 55  GLU A N    4  
ATOM 6812  C CA   . GLU A 1 55  ? 14.420  1.219   4.173   1.00 0.00 ? 55  GLU A CA   4  
ATOM 6813  C C    . GLU A 1 55  ? 13.203  0.301   4.232   1.00 0.00 ? 55  GLU A C    4  
ATOM 6814  O O    . GLU A 1 55  ? 12.904  -0.413  3.276   1.00 0.00 ? 55  GLU A O    4  
ATOM 6815  C CB   . GLU A 1 55  ? 15.586  0.589   4.938   1.00 0.00 ? 55  GLU A CB   4  
ATOM 6816  C CG   . GLU A 1 55  ? 16.945  1.139   4.539   1.00 0.00 ? 55  GLU A CG   4  
ATOM 6817  C CD   . GLU A 1 55  ? 18.074  0.567   5.372   1.00 0.00 ? 55  GLU A CD   4  
ATOM 6818  O OE1  . GLU A 1 55  ? 17.995  -0.625  5.739   1.00 0.00 ? 55  GLU A OE1  4  
ATOM 6819  O OE2  . GLU A 1 55  ? 19.037  1.309   5.659   1.00 0.00 ? 55  GLU A OE2  4  
ATOM 6820  H H    . GLU A 1 55  ? 14.717  2.939   5.371   1.00 0.00 ? 55  GLU A H    4  
ATOM 6821  H HA   . GLU A 1 55  ? 14.708  1.349   3.141   1.00 0.00 ? 55  GLU A HA   4  
ATOM 6822  H HB2  . GLU A 1 55  ? 15.445  0.764   5.994   1.00 0.00 ? 55  GLU A HB2  4  
ATOM 6823  H HB3  . GLU A 1 55  ? 15.585  -0.476  4.756   1.00 0.00 ? 55  GLU A HB3  4  
ATOM 6824  H HG2  . GLU A 1 55  ? 17.126  0.899   3.502   1.00 0.00 ? 55  GLU A HG2  4  
ATOM 6825  H HG3  . GLU A 1 55  ? 16.934  2.212   4.662   1.00 0.00 ? 55  GLU A HG3  4  
ATOM 6826  N N    . GLU A 1 56  ? 12.505  0.326   5.364   1.00 0.00 ? 56  GLU A N    4  
ATOM 6827  C CA   . GLU A 1 56  ? 11.321  -0.505  5.548   1.00 0.00 ? 56  GLU A CA   4  
ATOM 6828  C C    . GLU A 1 56  ? 10.100  0.351   5.871   1.00 0.00 ? 56  GLU A C    4  
ATOM 6829  O O    . GLU A 1 56  ? 9.299   0.008   6.741   1.00 0.00 ? 56  GLU A O    4  
ATOM 6830  C CB   . GLU A 1 56  ? 11.554  -1.522  6.667   1.00 0.00 ? 56  GLU A CB   4  
ATOM 6831  C CG   . GLU A 1 56  ? 12.388  -2.718  6.239   1.00 0.00 ? 56  GLU A CG   4  
ATOM 6832  C CD   . GLU A 1 56  ? 12.680  -3.666  7.386   1.00 0.00 ? 56  GLU A CD   4  
ATOM 6833  O OE1  . GLU A 1 56  ? 12.066  -3.505  8.461   1.00 0.00 ? 56  GLU A OE1  4  
ATOM 6834  O OE2  . GLU A 1 56  ? 13.524  -4.570  7.207   1.00 0.00 ? 56  GLU A OE2  4  
ATOM 6835  H H    . GLU A 1 56  ? 12.793  0.916   6.091   1.00 0.00 ? 56  GLU A H    4  
ATOM 6836  H HA   . GLU A 1 56  ? 11.141  -1.035  4.625   1.00 0.00 ? 56  GLU A HA   4  
ATOM 6837  H HB2  . GLU A 1 56  ? 12.060  -1.030  7.485   1.00 0.00 ? 56  GLU A HB2  4  
ATOM 6838  H HB3  . GLU A 1 56  ? 10.597  -1.883  7.014   1.00 0.00 ? 56  GLU A HB3  4  
ATOM 6839  H HG2  . GLU A 1 56  ? 11.852  -3.259  5.473   1.00 0.00 ? 56  GLU A HG2  4  
ATOM 6840  H HG3  . GLU A 1 56  ? 13.325  -2.362  5.837   1.00 0.00 ? 56  GLU A HG3  4  
ATOM 6841  N N    . HIS A 1 57  ? 9.965   1.469   5.163   1.00 0.00 ? 57  HIS A N    4  
ATOM 6842  C CA   . HIS A 1 57  ? 8.842   2.375   5.374   1.00 0.00 ? 57  HIS A CA   4  
ATOM 6843  C C    . HIS A 1 57  ? 7.578   1.600   5.735   1.00 0.00 ? 57  HIS A C    4  
ATOM 6844  O O    . HIS A 1 57  ? 7.094   1.675   6.865   1.00 0.00 ? 57  HIS A O    4  
ATOM 6845  C CB   . HIS A 1 57  ? 8.597   3.217   4.121   1.00 0.00 ? 57  HIS A CB   4  
ATOM 6846  C CG   . HIS A 1 57  ? 8.010   4.565   4.410   1.00 0.00 ? 57  HIS A CG   4  
ATOM 6847  N ND1  . HIS A 1 57  ? 8.711   5.572   5.039   1.00 0.00 ? 57  HIS A ND1  4  
ATOM 6848  C CD2  . HIS A 1 57  ? 6.781   5.069   4.150   1.00 0.00 ? 57  HIS A CD2  4  
ATOM 6849  C CE1  . HIS A 1 57  ? 7.937   6.637   5.155   1.00 0.00 ? 57  HIS A CE1  4  
ATOM 6850  N NE2  . HIS A 1 57  ? 6.761   6.357   4.624   1.00 0.00 ? 57  HIS A NE2  4  
ATOM 6851  H H    . HIS A 1 57  ? 10.636  1.688   4.484   1.00 0.00 ? 57  HIS A H    4  
ATOM 6852  H HA   . HIS A 1 57  ? 9.094   3.031   6.194   1.00 0.00 ? 57  HIS A HA   4  
ATOM 6853  H HB2  . HIS A 1 57  ? 9.536   3.368   3.608   1.00 0.00 ? 57  HIS A HB2  4  
ATOM 6854  H HB3  . HIS A 1 57  ? 7.916   2.691   3.468   1.00 0.00 ? 57  HIS A HB3  4  
ATOM 6855  H HD1  . HIS A 1 57  ? 9.636   5.514   5.354   1.00 0.00 ? 57  HIS A HD1  4  
ATOM 6856  H HD2  . HIS A 1 57  ? 5.966   4.553   3.662   1.00 0.00 ? 57  HIS A HD2  4  
ATOM 6857  H HE1  . HIS A 1 57  ? 8.218   7.576   5.608   1.00 0.00 ? 57  HIS A HE1  4  
ATOM 6858  H HE2  . HIS A 1 57  ? 5.975   6.942   4.653   1.00 0.00 ? 57  HIS A HE2  4  
ATOM 6859  N N    . CYS A 1 58  ? 7.049   0.858   4.768   1.00 0.00 ? 58  CYS A N    4  
ATOM 6860  C CA   . CYS A 1 58  ? 5.840   0.071   4.984   1.00 0.00 ? 58  CYS A CA   4  
ATOM 6861  C C    . CYS A 1 58  ? 5.916   -1.257  4.238   1.00 0.00 ? 58  CYS A C    4  
ATOM 6862  O O    . CYS A 1 58  ? 6.895   -1.536  3.545   1.00 0.00 ? 58  CYS A O    4  
ATOM 6863  C CB   . CYS A 1 58  ? 4.608   0.855   4.530   1.00 0.00 ? 58  CYS A CB   4  
ATOM 6864  S SG   . CYS A 1 58  ? 4.475   1.048   2.737   1.00 0.00 ? 58  CYS A SG   4  
ATOM 6865  H H    . CYS A 1 58  ? 7.480   0.840   3.888   1.00 0.00 ? 58  CYS A H    4  
ATOM 6866  H HA   . CYS A 1 58  ? 5.760   -0.129  6.042   1.00 0.00 ? 58  CYS A HA   4  
ATOM 6867  H HB2  . CYS A 1 58  ? 3.720   0.344   4.872   1.00 0.00 ? 58  CYS A HB2  4  
ATOM 6868  H HB3  . CYS A 1 58  ? 4.637   1.842   4.967   1.00 0.00 ? 58  CYS A HB3  4  
ATOM 6869  H HG   . CYS A 1 58  ? 3.426   1.816   2.486   1.00 0.00 ? 58  CYS A HG   4  
ATOM 6870  N N    . ILE A 1 59  ? 4.878   -2.073  4.386   1.00 0.00 ? 59  ILE A N    4  
ATOM 6871  C CA   . ILE A 1 59  ? 4.828   -3.372  3.726   1.00 0.00 ? 59  ILE A CA   4  
ATOM 6872  C C    . ILE A 1 59  ? 3.428   -3.666  3.197   1.00 0.00 ? 59  ILE A C    4  
ATOM 6873  O O    . ILE A 1 59  ? 2.435   -3.168  3.727   1.00 0.00 ? 59  ILE A O    4  
ATOM 6874  C CB   . ILE A 1 59  ? 5.253   -4.504  4.680   1.00 0.00 ? 59  ILE A CB   4  
ATOM 6875  C CG1  . ILE A 1 59  ? 6.547   -4.131  5.406   1.00 0.00 ? 59  ILE A CG1  4  
ATOM 6876  C CG2  . ILE A 1 59  ? 5.427   -5.806  3.912   1.00 0.00 ? 59  ILE A CG2  4  
ATOM 6877  C CD1  . ILE A 1 59  ? 6.768   -4.908  6.685   1.00 0.00 ? 59  ILE A CD1  4  
ATOM 6878  H H    . ILE A 1 59  ? 4.128   -1.795  4.951   1.00 0.00 ? 59  ILE A H    4  
ATOM 6879  H HA   . ILE A 1 59  ? 5.518   -3.350  2.895   1.00 0.00 ? 59  ILE A HA   4  
ATOM 6880  H HB   . ILE A 1 59  ? 4.468   -4.646  5.407   1.00 0.00 ? 59  ILE A HB   4  
ATOM 6881  H HG12 . ILE A 1 59  ? 7.385   -4.319  4.754   1.00 0.00 ? 59  ILE A HG12 4  
ATOM 6882  H HG13 . ILE A 1 59  ? 6.519   -3.080  5.656   1.00 0.00 ? 59  ILE A HG13 4  
ATOM 6883  H HG21 . ILE A 1 59  ? 6.084   -6.463  4.462   1.00 0.00 ? 59  ILE A HG21 4  
ATOM 6884  H HG22 . ILE A 1 59  ? 4.466   -6.281  3.787   1.00 0.00 ? 59  ILE A HG22 4  
ATOM 6885  H HG23 . ILE A 1 59  ? 5.855   -5.598  2.943   1.00 0.00 ? 59  ILE A HG23 4  
ATOM 6886  H HD11 . ILE A 1 59  ? 7.282   -5.831  6.460   1.00 0.00 ? 59  ILE A HD11 4  
ATOM 6887  H HD12 . ILE A 1 59  ? 7.367   -4.320  7.364   1.00 0.00 ? 59  ILE A HD12 4  
ATOM 6888  H HD13 . ILE A 1 59  ? 5.815   -5.128  7.142   1.00 0.00 ? 59  ILE A HD13 4  
ATOM 6889  N N    . PHE A 1 60  ? 3.357   -4.481  2.150   1.00 0.00 ? 60  PHE A N    4  
ATOM 6890  C CA   . PHE A 1 60  ? 2.079   -4.843  1.548   1.00 0.00 ? 60  PHE A CA   4  
ATOM 6891  C C    . PHE A 1 60  ? 1.939   -6.359  1.439   1.00 0.00 ? 60  PHE A C    4  
ATOM 6892  O O    . PHE A 1 60  ? 2.608   -6.997  0.625   1.00 0.00 ? 60  PHE A O    4  
ATOM 6893  C CB   . PHE A 1 60  ? 1.943   -4.205  0.164   1.00 0.00 ? 60  PHE A CB   4  
ATOM 6894  C CG   . PHE A 1 60  ? 1.522   -2.764  0.207   1.00 0.00 ? 60  PHE A CG   4  
ATOM 6895  C CD1  . PHE A 1 60  ? 0.306   -2.400  0.761   1.00 0.00 ? 60  PHE A CD1  4  
ATOM 6896  C CD2  . PHE A 1 60  ? 2.344   -1.774  -0.306  1.00 0.00 ? 60  PHE A CD2  4  
ATOM 6897  C CE1  . PHE A 1 60  ? -0.084  -1.074  0.801   1.00 0.00 ? 60  PHE A CE1  4  
ATOM 6898  C CE2  . PHE A 1 60  ? 1.960   -0.446  -0.269  1.00 0.00 ? 60  PHE A CE2  4  
ATOM 6899  C CZ   . PHE A 1 60  ? 0.745   -0.096  0.286   1.00 0.00 ? 60  PHE A CZ   4  
ATOM 6900  H H    . PHE A 1 60  ? 4.184   -4.847  1.771   1.00 0.00 ? 60  PHE A H    4  
ATOM 6901  H HA   . PHE A 1 60  ? 1.295   -4.467  2.187   1.00 0.00 ? 60  PHE A HA   4  
ATOM 6902  H HB2  . PHE A 1 60  ? 2.894   -4.258  -0.343  1.00 0.00 ? 60  PHE A HB2  4  
ATOM 6903  H HB3  . PHE A 1 60  ? 1.205   -4.751  -0.404  1.00 0.00 ? 60  PHE A HB3  4  
ATOM 6904  H HD1  . PHE A 1 60  ? -0.343  -3.163  1.165   1.00 0.00 ? 60  PHE A HD1  4  
ATOM 6905  H HD2  . PHE A 1 60  ? 3.295   -2.046  -0.741  1.00 0.00 ? 60  PHE A HD2  4  
ATOM 6906  H HE1  . PHE A 1 60  ? -1.034  -0.803  1.236   1.00 0.00 ? 60  PHE A HE1  4  
ATOM 6907  H HE2  . PHE A 1 60  ? 2.610   0.316   -0.672  1.00 0.00 ? 60  PHE A HE2  4  
ATOM 6908  H HZ   . PHE A 1 60  ? 0.442   0.940   0.316   1.00 0.00 ? 60  PHE A HZ   4  
ATOM 6909  N N    . ARG A 1 61  ? 1.067   -6.928  2.264   1.00 0.00 ? 61  ARG A N    4  
ATOM 6910  C CA   . ARG A 1 61  ? 0.841   -8.368  2.261   1.00 0.00 ? 61  ARG A CA   4  
ATOM 6911  C C    . ARG A 1 61  ? -0.433  -8.718  1.497   1.00 0.00 ? 61  ARG A C    4  
ATOM 6912  O O    . ARG A 1 61  ? -1.461  -8.059  1.651   1.00 0.00 ? 61  ARG A O    4  
ATOM 6913  C CB   . ARG A 1 61  ? 0.749   -8.894  3.695   1.00 0.00 ? 61  ARG A CB   4  
ATOM 6914  C CG   . ARG A 1 61  ? 0.932   -10.399 3.805   1.00 0.00 ? 61  ARG A CG   4  
ATOM 6915  C CD   . ARG A 1 61  ? 0.886   -10.862 5.253   1.00 0.00 ? 61  ARG A CD   4  
ATOM 6916  N NE   . ARG A 1 61  ? 1.520   -12.165 5.431   1.00 0.00 ? 61  ARG A NE   4  
ATOM 6917  C CZ   . ARG A 1 61  ? 1.413   -12.889 6.540   1.00 0.00 ? 61  ARG A CZ   4  
ATOM 6918  N NH1  . ARG A 1 61  ? 0.700   -12.439 7.563   1.00 0.00 ? 61  ARG A NH1  4  
ATOM 6919  N NH2  . ARG A 1 61  ? 2.020   -14.066 6.626   1.00 0.00 ? 61  ARG A NH2  4  
ATOM 6920  H H    . ARG A 1 61  ? 0.564   -6.367  2.890   1.00 0.00 ? 61  ARG A H    4  
ATOM 6921  H HA   . ARG A 1 61  ? 1.681   -8.835  1.769   1.00 0.00 ? 61  ARG A HA   4  
ATOM 6922  H HB2  . ARG A 1 61  ? 1.513   -8.417  4.291   1.00 0.00 ? 61  ARG A HB2  4  
ATOM 6923  H HB3  . ARG A 1 61  ? -0.221  -8.641  4.096   1.00 0.00 ? 61  ARG A HB3  4  
ATOM 6924  H HG2  . ARG A 1 61  ? 0.141   -10.890 3.257   1.00 0.00 ? 61  ARG A HG2  4  
ATOM 6925  H HG3  . ARG A 1 61  ? 1.887   -10.668 3.380   1.00 0.00 ? 61  ARG A HG3  4  
ATOM 6926  H HD2  . ARG A 1 61  ? 1.399   -10.136 5.865   1.00 0.00 ? 61  ARG A HD2  4  
ATOM 6927  H HD3  . ARG A 1 61  ? -0.146  -10.929 5.562   1.00 0.00 ? 61  ARG A HD3  4  
ATOM 6928  H HE   . ARG A 1 61  ? 2.052   -12.516 4.688   1.00 0.00 ? 61  ARG A HE   4  
ATOM 6929  H HH11 . ARG A 1 61  ? 0.241   -11.553 7.500   1.00 0.00 ? 61  ARG A HH11 4  
ATOM 6930  H HH12 . ARG A 1 61  ? 0.620   -12.987 8.396   1.00 0.00 ? 61  ARG A HH12 4  
ATOM 6931  H HH21 . ARG A 1 61  ? 2.559   -14.408 5.857   1.00 0.00 ? 61  ARG A HH21 4  
ATOM 6932  H HH22 . ARG A 1 61  ? 1.939   -14.609 7.461   1.00 0.00 ? 61  ARG A HH22 4  
ATOM 6933  N N    . SER A 1 62  ? -0.356  -9.758  0.673   1.00 0.00 ? 62  SER A N    4  
ATOM 6934  C CA   . SER A 1 62  ? -1.501  -10.191 -0.119  1.00 0.00 ? 62  SER A CA   4  
ATOM 6935  C C    . SER A 1 62  ? -1.805  -11.666 0.129   1.00 0.00 ? 62  SER A C    4  
ATOM 6936  O O    . SER A 1 62  ? -1.065  -12.545 -0.310  1.00 0.00 ? 62  SER A O    4  
ATOM 6937  C CB   . SER A 1 62  ? -1.238  -9.956  -1.607  1.00 0.00 ? 62  SER A CB   4  
ATOM 6938  O OG   . SER A 1 62  ? -2.415  -10.152 -2.371  1.00 0.00 ? 62  SER A OG   4  
ATOM 6939  H H    . SER A 1 62  ? 0.492   -10.243 0.594   1.00 0.00 ? 62  SER A H    4  
ATOM 6940  H HA   . SER A 1 62  ? -2.355  -9.604  0.184   1.00 0.00 ? 62  SER A HA   4  
ATOM 6941  H HB2  . SER A 1 62  ? -0.892  -8.944  -1.754  1.00 0.00 ? 62  SER A HB2  4  
ATOM 6942  H HB3  . SER A 1 62  ? -0.482  -10.648 -1.950  1.00 0.00 ? 62  SER A HB3  4  
ATOM 6943  H HG   . SER A 1 62  ? -2.437  -11.053 -2.701  1.00 0.00 ? 62  SER A HG   4  
ATOM 6944  N N    . GLU A 1 63  ? -2.901  -11.927 0.835   1.00 0.00 ? 63  GLU A N    4  
ATOM 6945  C CA   . GLU A 1 63  ? -3.303  -13.295 1.142   1.00 0.00 ? 63  GLU A CA   4  
ATOM 6946  C C    . GLU A 1 63  ? -4.795  -13.493 0.888   1.00 0.00 ? 63  GLU A C    4  
ATOM 6947  O O    . GLU A 1 63  ? -5.600  -12.591 1.118   1.00 0.00 ? 63  GLU A O    4  
ATOM 6948  C CB   . GLU A 1 63  ? -2.973  -13.632 2.598   1.00 0.00 ? 63  GLU A CB   4  
ATOM 6949  C CG   . GLU A 1 63  ? -3.200  -15.093 2.950   1.00 0.00 ? 63  GLU A CG   4  
ATOM 6950  C CD   . GLU A 1 63  ? -2.423  -15.524 4.178   1.00 0.00 ? 63  GLU A CD   4  
ATOM 6951  O OE1  . GLU A 1 63  ? -1.201  -15.267 4.227   1.00 0.00 ? 63  GLU A OE1  4  
ATOM 6952  O OE2  . GLU A 1 63  ? -3.034  -16.119 5.090   1.00 0.00 ? 63  GLU A OE2  4  
ATOM 6953  H H    . GLU A 1 63  ? -3.451  -11.183 1.158   1.00 0.00 ? 63  GLU A H    4  
ATOM 6954  H HA   . GLU A 1 63  ? -2.749  -13.957 0.494   1.00 0.00 ? 63  GLU A HA   4  
ATOM 6955  H HB2  . GLU A 1 63  ? -1.936  -13.395 2.783   1.00 0.00 ? 63  GLU A HB2  4  
ATOM 6956  H HB3  . GLU A 1 63  ? -3.592  -13.027 3.244   1.00 0.00 ? 63  GLU A HB3  4  
ATOM 6957  H HG2  . GLU A 1 63  ? -4.253  -15.245 3.138   1.00 0.00 ? 63  GLU A HG2  4  
ATOM 6958  H HG3  . GLU A 1 63  ? -2.893  -15.704 2.114   1.00 0.00 ? 63  GLU A HG3  4  
ATOM 6959  N N    . ARG A 1 64  ? -5.155  -14.681 0.412   1.00 0.00 ? 64  ARG A N    4  
ATOM 6960  C CA   . ARG A 1 64  ? -6.548  -14.998 0.124   1.00 0.00 ? 64  ARG A CA   4  
ATOM 6961  C C    . ARG A 1 64  ? -7.294  -15.376 1.401   1.00 0.00 ? 64  ARG A C    4  
ATOM 6962  O O    . ARG A 1 64  ? -7.100  -16.462 1.946   1.00 0.00 ? 64  ARG A O    4  
ATOM 6963  C CB   . ARG A 1 64  ? -6.635  -16.142 -0.888  1.00 0.00 ? 64  ARG A CB   4  
ATOM 6964  C CG   . ARG A 1 64  ? -7.837  -16.047 -1.813  1.00 0.00 ? 64  ARG A CG   4  
ATOM 6965  C CD   . ARG A 1 64  ? -7.808  -17.132 -2.878  1.00 0.00 ? 64  ARG A CD   4  
ATOM 6966  N NE   . ARG A 1 64  ? -6.949  -16.771 -4.003  1.00 0.00 ? 64  ARG A NE   4  
ATOM 6967  C CZ   . ARG A 1 64  ? -7.240  -15.808 -4.870  1.00 0.00 ? 64  ARG A CZ   4  
ATOM 6968  N NH1  . ARG A 1 64  ? -8.361  -15.113 -4.742  1.00 0.00 ? 64  ARG A NH1  4  
ATOM 6969  N NH2  . ARG A 1 64  ? -6.408  -15.539 -5.868  1.00 0.00 ? 64  ARG A NH2  4  
ATOM 6970  H H    . ARG A 1 64  ? -4.467  -15.359 0.249   1.00 0.00 ? 64  ARG A H    4  
ATOM 6971  H HA   . ARG A 1 64  ? -7.008  -14.118 -0.300  1.00 0.00 ? 64  ARG A HA   4  
ATOM 6972  H HB2  . ARG A 1 64  ? -5.741  -16.139 -1.494  1.00 0.00 ? 64  ARG A HB2  4  
ATOM 6973  H HB3  . ARG A 1 64  ? -6.694  -17.077 -0.351  1.00 0.00 ? 64  ARG A HB3  4  
ATOM 6974  H HG2  . ARG A 1 64  ? -8.739  -16.156 -1.228  1.00 0.00 ? 64  ARG A HG2  4  
ATOM 6975  H HG3  . ARG A 1 64  ? -7.833  -15.081 -2.295  1.00 0.00 ? 64  ARG A HG3  4  
ATOM 6976  H HD2  . ARG A 1 64  ? -7.438  -18.044 -2.433  1.00 0.00 ? 64  ARG A HD2  4  
ATOM 6977  H HD3  . ARG A 1 64  ? -8.813  -17.289 -3.240  1.00 0.00 ? 64  ARG A HD3  4  
ATOM 6978  H HE   . ARG A 1 64  ? -6.115  -17.273 -4.116  1.00 0.00 ? 64  ARG A HE   4  
ATOM 6979  H HH11 . ARG A 1 64  ? -8.990  -15.313 -3.991  1.00 0.00 ? 64  ARG A HH11 4  
ATOM 6980  H HH12 . ARG A 1 64  ? -8.577  -14.387 -5.396  1.00 0.00 ? 64  ARG A HH12 4  
ATOM 6981  H HH21 . ARG A 1 64  ? -5.561  -16.061 -5.967  1.00 0.00 ? 64  ARG A HH21 4  
ATOM 6982  H HH22 . ARG A 1 64  ? -6.627  -14.814 -6.520  1.00 0.00 ? 64  ARG A HH22 4  
ATOM 6983  N N    . SER A 1 65  ? -8.147  -14.472 1.871   1.00 0.00 ? 65  SER A N    4  
ATOM 6984  C CA   . SER A 1 65  ? -8.919  -14.709 3.086   1.00 0.00 ? 65  SER A CA   4  
ATOM 6985  C C    . SER A 1 65  ? -9.443  -16.141 3.126   1.00 0.00 ? 65  SER A C    4  
ATOM 6986  O O    . SER A 1 65  ? -9.566  -16.798 2.093   1.00 0.00 ? 65  SER A O    4  
ATOM 6987  C CB   . SER A 1 65  ? -10.086 -13.724 3.174   1.00 0.00 ? 65  SER A CB   4  
ATOM 6988  O OG   . SER A 1 65  ? -10.799 -13.885 4.388   1.00 0.00 ? 65  SER A OG   4  
ATOM 6989  H H    . SER A 1 65  ? -8.258  -13.625 1.392   1.00 0.00 ? 65  SER A H    4  
ATOM 6990  H HA   . SER A 1 65  ? -8.264  -14.554 3.930   1.00 0.00 ? 65  SER A HA   4  
ATOM 6991  H HB2  . SER A 1 65  ? -9.707  -12.715 3.124   1.00 0.00 ? 65  SER A HB2  4  
ATOM 6992  H HB3  . SER A 1 65  ? -10.762 -13.896 2.348   1.00 0.00 ? 65  SER A HB3  4  
ATOM 6993  H HG   . SER A 1 65  ? -11.606 -14.378 4.223   1.00 0.00 ? 65  SER A HG   4  
ATOM 6994  N N    . ASN A 1 66  ? -9.750  -16.619 4.328   1.00 0.00 ? 66  ASN A N    4  
ATOM 6995  C CA   . ASN A 1 66  ? -10.260 -17.973 4.504   1.00 0.00 ? 66  ASN A CA   4  
ATOM 6996  C C    . ASN A 1 66  ? -11.502 -18.203 3.648   1.00 0.00 ? 66  ASN A C    4  
ATOM 6997  O O    . ASN A 1 66  ? -11.882 -19.343 3.381   1.00 0.00 ? 66  ASN A O    4  
ATOM 6998  C CB   . ASN A 1 66  ? -10.588 -18.230 5.977   1.00 0.00 ? 66  ASN A CB   4  
ATOM 6999  C CG   . ASN A 1 66  ? -11.498 -17.166 6.560   1.00 0.00 ? 66  ASN A CG   4  
ATOM 7000  O OD1  . ASN A 1 66  ? -11.225 -15.970 6.448   1.00 0.00 ? 66  ASN A OD1  4  
ATOM 7001  N ND2  . ASN A 1 66  ? -12.586 -17.597 7.187   1.00 0.00 ? 66  ASN A ND2  4  
ATOM 7002  H H    . ASN A 1 66  ? -9.630  -16.047 5.115   1.00 0.00 ? 66  ASN A H    4  
ATOM 7003  H HA   . ASN A 1 66  ? -9.489  -18.661 4.192   1.00 0.00 ? 66  ASN A HA   4  
ATOM 7004  H HB2  . ASN A 1 66  ? -11.081 -19.186 6.068   1.00 0.00 ? 66  ASN A HB2  4  
ATOM 7005  H HB3  . ASN A 1 66  ? -9.671  -18.246 6.546   1.00 0.00 ? 66  ASN A HB3  4  
ATOM 7006  H HD21 . ASN A 1 66  ? -12.739 -18.563 7.238   1.00 0.00 ? 66  ASN A HD21 4  
ATOM 7007  H HD22 . ASN A 1 66  ? -13.191 -16.930 7.573   1.00 0.00 ? 66  ASN A HD22 4  
ATOM 7008  N N    . SER A 1 67  ? -12.128 -17.112 3.220   1.00 0.00 ? 67  SER A N    4  
ATOM 7009  C CA   . SER A 1 67  ? -13.329 -17.194 2.396   1.00 0.00 ? 67  SER A CA   4  
ATOM 7010  C C    . SER A 1 67  ? -12.971 -17.478 0.940   1.00 0.00 ? 67  SER A C    4  
ATOM 7011  O O    . SER A 1 67  ? -13.786 -17.996 0.179   1.00 0.00 ? 67  SER A O    4  
ATOM 7012  C CB   . SER A 1 67  ? -14.128 -15.893 2.492   1.00 0.00 ? 67  SER A CB   4  
ATOM 7013  O OG   . SER A 1 67  ? -15.502 -16.117 2.226   1.00 0.00 ? 67  SER A OG   4  
ATOM 7014  H H    . SER A 1 67  ? -11.776 -16.231 3.466   1.00 0.00 ? 67  SER A H    4  
ATOM 7015  H HA   . SER A 1 67  ? -13.933 -18.006 2.771   1.00 0.00 ? 67  SER A HA   4  
ATOM 7016  H HB2  . SER A 1 67  ? -14.028 -15.484 3.486   1.00 0.00 ? 67  SER A HB2  4  
ATOM 7017  H HB3  . SER A 1 67  ? -13.745 -15.184 1.771   1.00 0.00 ? 67  SER A HB3  4  
ATOM 7018  H HG   . SER A 1 67  ? -15.662 -17.060 2.143   1.00 0.00 ? 67  SER A HG   4  
ATOM 7019  N N    . GLY A 1 68  ? -11.743 -17.134 0.561   1.00 0.00 ? 68  GLY A N    4  
ATOM 7020  C CA   . GLY A 1 68  ? -11.297 -17.360 -0.801  1.00 0.00 ? 68  GLY A CA   4  
ATOM 7021  C C    . GLY A 1 68  ? -11.186 -16.073 -1.595  1.00 0.00 ? 68  GLY A C    4  
ATOM 7022  O O    . GLY A 1 68  ? -11.165 -16.095 -2.825  1.00 0.00 ? 68  GLY A O    4  
ATOM 7023  H H    . GLY A 1 68  ? -11.136 -16.725 1.212   1.00 0.00 ? 68  GLY A H    4  
ATOM 7024  H HA2  . GLY A 1 68  ? -10.331 -17.841 -0.777  1.00 0.00 ? 68  GLY A HA2  4  
ATOM 7025  H HA3  . GLY A 1 68  ? -12.002 -18.013 -1.295  1.00 0.00 ? 68  GLY A HA3  4  
ATOM 7026  N N    . GLU A 1 69  ? -11.115 -14.948 -0.889  1.00 0.00 ? 69  GLU A N    4  
ATOM 7027  C CA   . GLU A 1 69  ? -11.008 -13.646 -1.537  1.00 0.00 ? 69  GLU A CA   4  
ATOM 7028  C C    . GLU A 1 69  ? -9.657  -13.002 -1.241  1.00 0.00 ? 69  GLU A C    4  
ATOM 7029  O O    . GLU A 1 69  ? -9.216  -12.955 -0.093  1.00 0.00 ? 69  GLU A O    4  
ATOM 7030  C CB   . GLU A 1 69  ? -12.137 -12.725 -1.071  1.00 0.00 ? 69  GLU A CB   4  
ATOM 7031  C CG   . GLU A 1 69  ? -11.806 -11.946 0.190   1.00 0.00 ? 69  GLU A CG   4  
ATOM 7032  C CD   . GLU A 1 69  ? -13.039 -11.376 0.865   1.00 0.00 ? 69  GLU A CD   4  
ATOM 7033  O OE1  . GLU A 1 69  ? -13.842 -10.717 0.173   1.00 0.00 ? 69  GLU A OE1  4  
ATOM 7034  O OE2  . GLU A 1 69  ? -13.200 -11.590 2.085   1.00 0.00 ? 69  GLU A OE2  4  
ATOM 7035  H H    . GLU A 1 69  ? -11.137 -14.995 0.089   1.00 0.00 ? 69  GLU A H    4  
ATOM 7036  H HA   . GLU A 1 69  ? -11.095 -13.798 -2.602  1.00 0.00 ? 69  GLU A HA   4  
ATOM 7037  H HB2  . GLU A 1 69  ? -12.358 -12.020 -1.859  1.00 0.00 ? 69  GLU A HB2  4  
ATOM 7038  H HB3  . GLU A 1 69  ? -13.016 -13.323 -0.879  1.00 0.00 ? 69  GLU A HB3  4  
ATOM 7039  H HG2  . GLU A 1 69  ? -11.306 -12.604 0.885   1.00 0.00 ? 69  GLU A HG2  4  
ATOM 7040  H HG3  . GLU A 1 69  ? -11.146 -11.130 -0.069  1.00 0.00 ? 69  GLU A HG3  4  
ATOM 7041  N N    . VAL A 1 70  ? -9.003  -12.506 -2.287  1.00 0.00 ? 70  VAL A N    4  
ATOM 7042  C CA   . VAL A 1 70  ? -7.702  -11.863 -2.141  1.00 0.00 ? 70  VAL A CA   4  
ATOM 7043  C C    . VAL A 1 70  ? -7.825  -10.535 -1.403  1.00 0.00 ? 70  VAL A C    4  
ATOM 7044  O O    . VAL A 1 70  ? -8.615  -9.672  -1.786  1.00 0.00 ? 70  VAL A O    4  
ATOM 7045  C CB   . VAL A 1 70  ? -7.040  -11.618 -3.510  1.00 0.00 ? 70  VAL A CB   4  
ATOM 7046  C CG1  . VAL A 1 70  ? -5.802  -10.747 -3.357  1.00 0.00 ? 70  VAL A CG1  4  
ATOM 7047  C CG2  . VAL A 1 70  ? -6.693  -12.940 -4.179  1.00 0.00 ? 70  VAL A CG2  4  
ATOM 7048  H H    . VAL A 1 70  ? -9.405  -12.573 -3.178  1.00 0.00 ? 70  VAL A H    4  
ATOM 7049  H HA   . VAL A 1 70  ? -7.065  -12.524 -1.571  1.00 0.00 ? 70  VAL A HA   4  
ATOM 7050  H HB   . VAL A 1 70  ? -7.745  -11.095 -4.140  1.00 0.00 ? 70  VAL A HB   4  
ATOM 7051  H HG11 . VAL A 1 70  ? -6.085  -9.707  -3.417  1.00 0.00 ? 70  VAL A HG11 4  
ATOM 7052  H HG12 . VAL A 1 70  ? -5.342  -10.942 -2.400  1.00 0.00 ? 70  VAL A HG12 4  
ATOM 7053  H HG13 . VAL A 1 70  ? -5.102  -10.976 -4.147  1.00 0.00 ? 70  VAL A HG13 4  
ATOM 7054  H HG21 . VAL A 1 70  ? -5.638  -12.962 -4.407  1.00 0.00 ? 70  VAL A HG21 4  
ATOM 7055  H HG22 . VAL A 1 70  ? -6.936  -13.754 -3.512  1.00 0.00 ? 70  VAL A HG22 4  
ATOM 7056  H HG23 . VAL A 1 70  ? -7.261  -13.042 -5.092  1.00 0.00 ? 70  VAL A HG23 4  
ATOM 7057  N N    . ILE A 1 71  ? -7.039  -10.378 -0.344  1.00 0.00 ? 71  ILE A N    4  
ATOM 7058  C CA   . ILE A 1 71  ? -7.058  -9.154  0.447   1.00 0.00 ? 71  ILE A CA   4  
ATOM 7059  C C    . ILE A 1 71  ? -5.649  -8.612  0.657   1.00 0.00 ? 71  ILE A C    4  
ATOM 7060  O O    . ILE A 1 71  ? -4.674  -9.364  0.638   1.00 0.00 ? 71  ILE A O    4  
ATOM 7061  C CB   . ILE A 1 71  ? -7.719  -9.382  1.820   1.00 0.00 ? 71  ILE A CB   4  
ATOM 7062  C CG1  . ILE A 1 71  ? -9.065  -10.088 1.652   1.00 0.00 ? 71  ILE A CG1  4  
ATOM 7063  C CG2  . ILE A 1 71  ? -7.896  -8.058  2.548   1.00 0.00 ? 71  ILE A CG2  4  
ATOM 7064  C CD1  . ILE A 1 71  ? -10.219 -9.141  1.413   1.00 0.00 ? 71  ILE A CD1  4  
ATOM 7065  H H    . ILE A 1 71  ? -6.430  -11.103 -0.088  1.00 0.00 ? 71  ILE A H    4  
ATOM 7066  H HA   . ILE A 1 71  ? -7.639  -8.419  -0.091  1.00 0.00 ? 71  ILE A HA   4  
ATOM 7067  H HB   . ILE A 1 71  ? -7.064  -10.004 2.411   1.00 0.00 ? 71  ILE A HB   4  
ATOM 7068  H HG12 . ILE A 1 71  ? -9.009  -10.761 0.811   1.00 0.00 ? 71  ILE A HG12 4  
ATOM 7069  H HG13 . ILE A 1 71  ? -9.280  -10.655 2.547   1.00 0.00 ? 71  ILE A HG13 4  
ATOM 7070  H HG21 . ILE A 1 71  ? -6.928  -7.661  2.816   1.00 0.00 ? 71  ILE A HG21 4  
ATOM 7071  H HG22 . ILE A 1 71  ? -8.404  -7.357  1.902   1.00 0.00 ? 71  ILE A HG22 4  
ATOM 7072  H HG23 . ILE A 1 71  ? -8.482  -8.213  3.442   1.00 0.00 ? 71  ILE A HG23 4  
ATOM 7073  H HD11 . ILE A 1 71  ? -11.146 -9.697  1.406   1.00 0.00 ? 71  ILE A HD11 4  
ATOM 7074  H HD12 . ILE A 1 71  ? -10.249 -8.403  2.200   1.00 0.00 ? 71  ILE A HD12 4  
ATOM 7075  H HD13 . ILE A 1 71  ? -10.090 -8.648  0.461   1.00 0.00 ? 71  ILE A HD13 4  
ATOM 7076  N N    . VAL A 1 72  ? -5.548  -7.302  0.860   1.00 0.00 ? 72  VAL A N    4  
ATOM 7077  C CA   . VAL A 1 72  ? -4.257  -6.659  1.077   1.00 0.00 ? 72  VAL A CA   4  
ATOM 7078  C C    . VAL A 1 72  ? -4.232  -5.912  2.405   1.00 0.00 ? 72  VAL A C    4  
ATOM 7079  O O    . VAL A 1 72  ? -5.213  -5.275  2.791   1.00 0.00 ? 72  VAL A O    4  
ATOM 7080  C CB   . VAL A 1 72  ? -3.923  -5.676  -0.060  1.00 0.00 ? 72  VAL A CB   4  
ATOM 7081  C CG1  . VAL A 1 72  ? -2.637  -4.922  0.247   1.00 0.00 ? 72  VAL A CG1  4  
ATOM 7082  C CG2  . VAL A 1 72  ? -3.815  -6.412  -1.387  1.00 0.00 ? 72  VAL A CG2  4  
ATOM 7083  H H    . VAL A 1 72  ? -6.361  -6.756  0.864   1.00 0.00 ? 72  VAL A H    4  
ATOM 7084  H HA   . VAL A 1 72  ? -3.499  -7.429  1.093   1.00 0.00 ? 72  VAL A HA   4  
ATOM 7085  H HB   . VAL A 1 72  ? -4.726  -4.957  -0.135  1.00 0.00 ? 72  VAL A HB   4  
ATOM 7086  H HG11 . VAL A 1 72  ? -2.878  -3.942  0.633   1.00 0.00 ? 72  VAL A HG11 4  
ATOM 7087  H HG12 . VAL A 1 72  ? -2.066  -5.469  0.982   1.00 0.00 ? 72  VAL A HG12 4  
ATOM 7088  H HG13 . VAL A 1 72  ? -2.056  -4.819  -0.658  1.00 0.00 ? 72  VAL A HG13 4  
ATOM 7089  H HG21 . VAL A 1 72  ? -4.794  -6.747  -1.694  1.00 0.00 ? 72  VAL A HG21 4  
ATOM 7090  H HG22 . VAL A 1 72  ? -3.411  -5.746  -2.135  1.00 0.00 ? 72  VAL A HG22 4  
ATOM 7091  H HG23 . VAL A 1 72  ? -3.161  -7.265  -1.274  1.00 0.00 ? 72  VAL A HG23 4  
ATOM 7092  N N    . THR A 1 73  ? -3.103  -5.992  3.102   1.00 0.00 ? 73  THR A N    4  
ATOM 7093  C CA   . THR A 1 73  ? -2.950  -5.324  4.388   1.00 0.00 ? 73  THR A CA   4  
ATOM 7094  C C    . THR A 1 73  ? -1.682  -4.478  4.420   1.00 0.00 ? 73  THR A C    4  
ATOM 7095  O O    . THR A 1 73  ? -0.633  -4.894  3.928   1.00 0.00 ? 73  THR A O    4  
ATOM 7096  C CB   . THR A 1 73  ? -2.905  -6.339  5.547   1.00 0.00 ? 73  THR A CB   4  
ATOM 7097  O OG1  . THR A 1 73  ? -3.713  -7.478  5.231   1.00 0.00 ? 73  THR A OG1  4  
ATOM 7098  C CG2  . THR A 1 73  ? -3.397  -5.705  6.839   1.00 0.00 ? 73  THR A CG2  4  
ATOM 7099  H H    . THR A 1 73  ? -2.357  -6.515  2.742   1.00 0.00 ? 73  THR A H    4  
ATOM 7100  H HA   . THR A 1 73  ? -3.805  -4.680  4.534   1.00 0.00 ? 73  THR A HA   4  
ATOM 7101  H HB   . THR A 1 73  ? -1.883  -6.659  5.686   1.00 0.00 ? 73  THR A HB   4  
ATOM 7102  H HG1  . THR A 1 73  ? -3.175  -8.273  5.272   1.00 0.00 ? 73  THR A HG1  4  
ATOM 7103  H HG21 . THR A 1 73  ? -2.829  -4.809  7.039   1.00 0.00 ? 73  THR A HG21 4  
ATOM 7104  H HG22 . THR A 1 73  ? -3.267  -6.402  7.654   1.00 0.00 ? 73  THR A HG22 4  
ATOM 7105  H HG23 . THR A 1 73  ? -4.443  -5.455  6.743   1.00 0.00 ? 73  THR A HG23 4  
ATOM 7106  N N    . LEU A 1 74  ? -1.785  -3.289  5.003   1.00 0.00 ? 74  LEU A N    4  
ATOM 7107  C CA   . LEU A 1 74  ? -0.646  -2.383  5.100   1.00 0.00 ? 74  LEU A CA   4  
ATOM 7108  C C    . LEU A 1 74  ? 0.027   -2.498  6.464   1.00 0.00 ? 74  LEU A C    4  
ATOM 7109  O O    . LEU A 1 74  ? -0.577  -2.193  7.492   1.00 0.00 ? 74  LEU A O    4  
ATOM 7110  C CB   . LEU A 1 74  ? -1.094  -0.940  4.859   1.00 0.00 ? 74  LEU A CB   4  
ATOM 7111  C CG   . LEU A 1 74  ? 0.013   0.115   4.860   1.00 0.00 ? 74  LEU A CG   4  
ATOM 7112  C CD1  . LEU A 1 74  ? 0.581   0.294   3.461   1.00 0.00 ? 74  LEU A CD1  4  
ATOM 7113  C CD2  . LEU A 1 74  ? -0.513  1.438   5.397   1.00 0.00 ? 74  LEU A CD2  4  
ATOM 7114  H H    . LEU A 1 74  ? -2.647  -3.012  5.377   1.00 0.00 ? 74  LEU A H    4  
ATOM 7115  H HA   . LEU A 1 74  ? 0.065   -2.662  4.337   1.00 0.00 ? 74  LEU A HA   4  
ATOM 7116  H HB2  . LEU A 1 74  ? -1.586  -0.902  3.900   1.00 0.00 ? 74  LEU A HB2  4  
ATOM 7117  H HB3  . LEU A 1 74  ? -1.800  -0.681  5.635   1.00 0.00 ? 74  LEU A HB3  4  
ATOM 7118  H HG   . LEU A 1 74  ? 0.815   -0.214  5.506   1.00 0.00 ? 74  LEU A HG   4  
ATOM 7119  H HD11 . LEU A 1 74  ? 0.778   -0.674  3.026   1.00 0.00 ? 74  LEU A HD11 4  
ATOM 7120  H HD12 . LEU A 1 74  ? 1.499   0.859   3.514   1.00 0.00 ? 74  LEU A HD12 4  
ATOM 7121  H HD13 . LEU A 1 74  ? -0.133  0.826   2.848   1.00 0.00 ? 74  LEU A HD13 4  
ATOM 7122  H HD21 . LEU A 1 74  ? -0.576  2.155   4.592   1.00 0.00 ? 74  LEU A HD21 4  
ATOM 7123  H HD22 . LEU A 1 74  ? 0.159   1.810   6.158   1.00 0.00 ? 74  LEU A HD22 4  
ATOM 7124  H HD23 . LEU A 1 74  ? -1.494  1.289   5.825   1.00 0.00 ? 74  LEU A HD23 4  
ATOM 7125  N N    . GLU A 1 75  ? 1.281   -2.938  6.465   1.00 0.00 ? 75  GLU A N    4  
ATOM 7126  C CA   . GLU A 1 75  ? 2.035   -3.092  7.703   1.00 0.00 ? 75  GLU A CA   4  
ATOM 7127  C C    . GLU A 1 75  ? 3.131   -2.035  7.807   1.00 0.00 ? 75  GLU A C    4  
ATOM 7128  O O    . GLU A 1 75  ? 4.304   -2.292  7.536   1.00 0.00 ? 75  GLU A O    4  
ATOM 7129  C CB   . GLU A 1 75  ? 2.651   -4.490  7.781   1.00 0.00 ? 75  GLU A CB   4  
ATOM 7130  C CG   . GLU A 1 75  ? 1.755   -5.582  7.222   1.00 0.00 ? 75  GLU A CG   4  
ATOM 7131  C CD   . GLU A 1 75  ? 0.701   -6.036  8.213   1.00 0.00 ? 75  GLU A CD   4  
ATOM 7132  O OE1  . GLU A 1 75  ? 1.052   -6.781  9.152   1.00 0.00 ? 75  GLU A OE1  4  
ATOM 7133  O OE2  . GLU A 1 75  ? -0.475  -5.647  8.049   1.00 0.00 ? 75  GLU A OE2  4  
ATOM 7134  H H    . GLU A 1 75  ? 1.709   -3.166  5.613   1.00 0.00 ? 75  GLU A H    4  
ATOM 7135  H HA   . GLU A 1 75  ? 1.350   -2.965  8.527   1.00 0.00 ? 75  GLU A HA   4  
ATOM 7136  H HB2  . GLU A 1 75  ? 3.578   -4.494  7.226   1.00 0.00 ? 75  GLU A HB2  4  
ATOM 7137  H HB3  . GLU A 1 75  ? 2.861   -4.721  8.815   1.00 0.00 ? 75  GLU A HB3  4  
ATOM 7138  H HG2  . GLU A 1 75  ? 1.259   -5.207  6.339   1.00 0.00 ? 75  GLU A HG2  4  
ATOM 7139  H HG3  . GLU A 1 75  ? 2.367   -6.432  6.956   1.00 0.00 ? 75  GLU A HG3  4  
ATOM 7140  N N    . PRO A 1 76  ? 2.741   -0.817  8.210   1.00 0.00 ? 76  PRO A N    4  
ATOM 7141  C CA   . PRO A 1 76  ? 3.674   0.304   8.359   1.00 0.00 ? 76  PRO A CA   4  
ATOM 7142  C C    . PRO A 1 76  ? 4.626   0.113   9.535   1.00 0.00 ? 76  PRO A C    4  
ATOM 7143  O O    . PRO A 1 76  ? 4.513   -0.857  10.286  1.00 0.00 ? 76  PRO A O    4  
ATOM 7144  C CB   . PRO A 1 76  ? 2.753   1.502   8.606   1.00 0.00 ? 76  PRO A CB   4  
ATOM 7145  C CG   . PRO A 1 76  ? 1.514   0.914   9.188   1.00 0.00 ? 76  PRO A CG   4  
ATOM 7146  C CD   . PRO A 1 76  ? 1.359   -0.439  8.551   1.00 0.00 ? 76  PRO A CD   4  
ATOM 7147  H HA   . PRO A 1 76  ? 4.246   0.467   7.458   1.00 0.00 ? 76  PRO A HA   4  
ATOM 7148  H HB2  . PRO A 1 76  ? 3.227   2.188   9.294   1.00 0.00 ? 76  PRO A HB2  4  
ATOM 7149  H HB3  . PRO A 1 76  ? 2.550   2.003   7.672   1.00 0.00 ? 76  PRO A HB3  4  
ATOM 7150  H HG2  . PRO A 1 76  ? 1.622   0.814   10.258  1.00 0.00 ? 76  PRO A HG2  4  
ATOM 7151  H HG3  . PRO A 1 76  ? 0.665   1.538   8.952   1.00 0.00 ? 76  PRO A HG3  4  
ATOM 7152  H HD2  . PRO A 1 76  ? 0.929   -1.140  9.251   1.00 0.00 ? 76  PRO A HD2  4  
ATOM 7153  H HD3  . PRO A 1 76  ? 0.749   -0.370  7.662   1.00 0.00 ? 76  PRO A HD3  4  
ATOM 7154  N N    . CYS A 1 77  ? 5.561   1.043   9.690   1.00 0.00 ? 77  CYS A N    4  
ATOM 7155  C CA   . CYS A 1 77  ? 6.534   0.977   10.775  1.00 0.00 ? 77  CYS A CA   4  
ATOM 7156  C C    . CYS A 1 77  ? 6.320   2.116   11.767  1.00 0.00 ? 77  CYS A C    4  
ATOM 7157  O O    . CYS A 1 77  ? 5.787   3.166   11.414  1.00 0.00 ? 77  CYS A O    4  
ATOM 7158  C CB   . CYS A 1 77  ? 7.956   1.030   10.217  1.00 0.00 ? 77  CYS A CB   4  
ATOM 7159  S SG   . CYS A 1 77  ? 9.243   0.691   11.442  1.00 0.00 ? 77  CYS A SG   4  
ATOM 7160  H H    . CYS A 1 77  ? 5.600   1.792   9.059   1.00 0.00 ? 77  CYS A H    4  
ATOM 7161  H HA   . CYS A 1 77  ? 6.392   0.038   11.289  1.00 0.00 ? 77  CYS A HA   4  
ATOM 7162  H HB2  . CYS A 1 77  ? 8.054   0.298   9.429   1.00 0.00 ? 77  CYS A HB2  4  
ATOM 7163  H HB3  . CYS A 1 77  ? 8.139   2.014   9.811   1.00 0.00 ? 77  CYS A HB3  4  
ATOM 7164  H HG   . CYS A 1 77  ? 10.408  1.041   10.918  1.00 0.00 ? 77  CYS A HG   4  
ATOM 7165  N N    . GLU A 1 78  ? 6.739   1.898   13.010  1.00 0.00 ? 78  GLU A N    4  
ATOM 7166  C CA   . GLU A 1 78  ? 6.591   2.906   14.053  1.00 0.00 ? 78  GLU A CA   4  
ATOM 7167  C C    . GLU A 1 78  ? 7.556   4.066   13.829  1.00 0.00 ? 78  GLU A C    4  
ATOM 7168  O O    . GLU A 1 78  ? 7.278   5.202   14.215  1.00 0.00 ? 78  GLU A O    4  
ATOM 7169  C CB   . GLU A 1 78  ? 6.833   2.285   15.431  1.00 0.00 ? 78  GLU A CB   4  
ATOM 7170  C CG   . GLU A 1 78  ? 7.048   3.311   16.531  1.00 0.00 ? 78  GLU A CG   4  
ATOM 7171  C CD   . GLU A 1 78  ? 6.676   2.782   17.902  1.00 0.00 ? 78  GLU A CD   4  
ATOM 7172  O OE1  . GLU A 1 78  ? 5.469   2.591   18.156  1.00 0.00 ? 78  GLU A OE1  4  
ATOM 7173  O OE2  . GLU A 1 78  ? 7.592   2.560   18.721  1.00 0.00 ? 78  GLU A OE2  4  
ATOM 7174  H H    . GLU A 1 78  ? 7.157   1.039   13.230  1.00 0.00 ? 78  GLU A H    4  
ATOM 7175  H HA   . GLU A 1 78  ? 5.580   3.281   14.010  1.00 0.00 ? 78  GLU A HA   4  
ATOM 7176  H HB2  . GLU A 1 78  ? 5.979   1.678   15.694  1.00 0.00 ? 78  GLU A HB2  4  
ATOM 7177  H HB3  . GLU A 1 78  ? 7.709   1.655   15.379  1.00 0.00 ? 78  GLU A HB3  4  
ATOM 7178  H HG2  . GLU A 1 78  ? 8.089   3.596   16.542  1.00 0.00 ? 78  GLU A HG2  4  
ATOM 7179  H HG3  . GLU A 1 78  ? 6.441   4.180   16.319  1.00 0.00 ? 78  GLU A HG3  4  
ATOM 7180  N N    . ARG A 1 79  ? 8.691   3.772   13.203  1.00 0.00 ? 79  ARG A N    4  
ATOM 7181  C CA   . ARG A 1 79  ? 9.698   4.790   12.929  1.00 0.00 ? 79  ARG A CA   4  
ATOM 7182  C C    . ARG A 1 79  ? 9.509   5.380   11.535  1.00 0.00 ? 79  ARG A C    4  
ATOM 7183  O O    . ARG A 1 79  ? 10.352  6.135   11.050  1.00 0.00 ? 79  ARG A O    4  
ATOM 7184  C CB   . ARG A 1 79  ? 11.102  4.195   13.056  1.00 0.00 ? 79  ARG A CB   4  
ATOM 7185  C CG   . ARG A 1 79  ? 11.381  3.579   14.417  1.00 0.00 ? 79  ARG A CG   4  
ATOM 7186  C CD   . ARG A 1 79  ? 11.732  4.640   15.448  1.00 0.00 ? 79  ARG A CD   4  
ATOM 7187  N NE   . ARG A 1 79  ? 11.672  4.120   16.812  1.00 0.00 ? 79  ARG A NE   4  
ATOM 7188  C CZ   . ARG A 1 79  ? 11.638  4.892   17.892  1.00 0.00 ? 79  ARG A CZ   4  
ATOM 7189  N NH1  . ARG A 1 79  ? 11.659  6.212   17.768  1.00 0.00 ? 79  ARG A NH1  4  
ATOM 7190  N NH2  . ARG A 1 79  ? 11.583  4.345   19.099  1.00 0.00 ? 79  ARG A NH2  4  
ATOM 7191  H H    . ARG A 1 79  ? 8.855   2.848   12.919  1.00 0.00 ? 79  ARG A H    4  
ATOM 7192  H HA   . ARG A 1 79  ? 9.582   5.577   13.659  1.00 0.00 ? 79  ARG A HA   4  
ATOM 7193  H HB2  . ARG A 1 79  ? 11.225  3.428   12.306  1.00 0.00 ? 79  ARG A HB2  4  
ATOM 7194  H HB3  . ARG A 1 79  ? 11.827  4.976   12.884  1.00 0.00 ? 79  ARG A HB3  4  
ATOM 7195  H HG2  . ARG A 1 79  ? 10.501  3.048   14.749  1.00 0.00 ? 79  ARG A HG2  4  
ATOM 7196  H HG3  . ARG A 1 79  ? 12.207  2.889   14.327  1.00 0.00 ? 79  ARG A HG3  4  
ATOM 7197  H HD2  . ARG A 1 79  ? 12.733  4.996   15.253  1.00 0.00 ? 79  ARG A HD2  4  
ATOM 7198  H HD3  . ARG A 1 79  ? 11.035  5.459   15.354  1.00 0.00 ? 79  ARG A HD3  4  
ATOM 7199  H HE   . ARG A 1 79  ? 11.655  3.148   16.926  1.00 0.00 ? 79  ARG A HE   4  
ATOM 7200  H HH11 . ARG A 1 79  ? 11.699  6.628   16.860  1.00 0.00 ? 79  ARG A HH11 4  
ATOM 7201  H HH12 . ARG A 1 79  ? 11.633  6.792   18.583  1.00 0.00 ? 79  ARG A HH12 4  
ATOM 7202  H HH21 . ARG A 1 79  ? 11.567  3.350   19.196  1.00 0.00 ? 79  ARG A HH21 4  
ATOM 7203  H HH22 . ARG A 1 79  ? 11.559  4.926   19.911  1.00 0.00 ? 79  ARG A HH22 4  
ATOM 7204  N N    . SER A 1 80  ? 8.398   5.031   10.895  1.00 0.00 ? 80  SER A N    4  
ATOM 7205  C CA   . SER A 1 80  ? 8.100   5.522   9.555   1.00 0.00 ? 80  SER A CA   4  
ATOM 7206  C C    . SER A 1 80  ? 6.908   6.475   9.578   1.00 0.00 ? 80  SER A C    4  
ATOM 7207  O O    . SER A 1 80  ? 6.357   6.769   10.638  1.00 0.00 ? 80  SER A O    4  
ATOM 7208  C CB   . SER A 1 80  ? 7.814   4.353   8.611   1.00 0.00 ? 80  SER A CB   4  
ATOM 7209  O OG   . SER A 1 80  ? 6.624   3.677   8.982   1.00 0.00 ? 80  SER A OG   4  
ATOM 7210  H H    . SER A 1 80  ? 7.764   4.425   11.334  1.00 0.00 ? 80  SER A H    4  
ATOM 7211  H HA   . SER A 1 80  ? 8.967   6.058   9.198   1.00 0.00 ? 80  SER A HA   4  
ATOM 7212  H HB2  . SER A 1 80  ? 7.703   4.725   7.604   1.00 0.00 ? 80  SER A HB2  4  
ATOM 7213  H HB3  . SER A 1 80  ? 8.637   3.654   8.649   1.00 0.00 ? 80  SER A HB3  4  
ATOM 7214  H HG   . SER A 1 80  ? 6.228   4.118   9.738   1.00 0.00 ? 80  SER A HG   4  
ATOM 7215  N N    . GLU A 1 81  ? 6.518   6.953   8.401   1.00 0.00 ? 81  GLU A N    4  
ATOM 7216  C CA   . GLU A 1 81  ? 5.392   7.873   8.286   1.00 0.00 ? 81  GLU A CA   4  
ATOM 7217  C C    . GLU A 1 81  ? 4.463   7.457   7.149   1.00 0.00 ? 81  GLU A C    4  
ATOM 7218  O O    . GLU A 1 81  ? 4.837   7.506   5.977   1.00 0.00 ? 81  GLU A O    4  
ATOM 7219  C CB   . GLU A 1 81  ? 5.893   9.300   8.054   1.00 0.00 ? 81  GLU A CB   4  
ATOM 7220  C CG   . GLU A 1 81  ? 4.956   10.369  8.591   1.00 0.00 ? 81  GLU A CG   4  
ATOM 7221  C CD   . GLU A 1 81  ? 5.121   10.595  10.081  1.00 0.00 ? 81  GLU A CD   4  
ATOM 7222  O OE1  . GLU A 1 81  ? 5.946   9.890   10.699  1.00 0.00 ? 81  GLU A OE1  4  
ATOM 7223  O OE2  . GLU A 1 81  ? 4.425   11.475  10.629  1.00 0.00 ? 81  GLU A OE2  4  
ATOM 7224  H H    . GLU A 1 81  ? 6.998   6.681   7.591   1.00 0.00 ? 81  GLU A H    4  
ATOM 7225  H HA   . GLU A 1 81  ? 4.842   7.841   9.214   1.00 0.00 ? 81  GLU A HA   4  
ATOM 7226  H HB2  . GLU A 1 81  ? 6.852   9.415   8.537   1.00 0.00 ? 81  GLU A HB2  4  
ATOM 7227  H HB3  . GLU A 1 81  ? 6.014   9.457   6.992   1.00 0.00 ? 81  GLU A HB3  4  
ATOM 7228  H HG2  . GLU A 1 81  ? 5.158   11.297  8.077   1.00 0.00 ? 81  GLU A HG2  4  
ATOM 7229  H HG3  . GLU A 1 81  ? 3.937   10.066  8.398   1.00 0.00 ? 81  GLU A HG3  4  
ATOM 7230  N N    . THR A 1 82  ? 3.250   7.047   7.505   1.00 0.00 ? 82  THR A N    4  
ATOM 7231  C CA   . THR A 1 82  ? 2.267   6.621   6.516   1.00 0.00 ? 82  THR A CA   4  
ATOM 7232  C C    . THR A 1 82  ? 0.878   7.146   6.860   1.00 0.00 ? 82  THR A C    4  
ATOM 7233  O O    . THR A 1 82  ? 0.549   7.339   8.031   1.00 0.00 ? 82  THR A O    4  
ATOM 7234  C CB   . THR A 1 82  ? 2.211   5.085   6.406   1.00 0.00 ? 82  THR A CB   4  
ATOM 7235  O OG1  . THR A 1 82  ? 3.537   4.549   6.354   1.00 0.00 ? 82  THR A OG1  4  
ATOM 7236  C CG2  . THR A 1 82  ? 1.437   4.660   5.168   1.00 0.00 ? 82  THR A CG2  4  
ATOM 7237  H H    . THR A 1 82  ? 3.011   7.031   8.455   1.00 0.00 ? 82  THR A H    4  
ATOM 7238  H HA   . THR A 1 82  ? 2.564   7.019   5.557   1.00 0.00 ? 82  THR A HA   4  
ATOM 7239  H HB   . THR A 1 82  ? 1.707   4.695   7.279   1.00 0.00 ? 82  THR A HB   4  
ATOM 7240  H HG1  . THR A 1 82  ? 3.536   3.742   5.833   1.00 0.00 ? 82  THR A HG1  4  
ATOM 7241  H HG21 . THR A 1 82  ? 2.063   4.773   4.296   1.00 0.00 ? 82  THR A HG21 4  
ATOM 7242  H HG22 . THR A 1 82  ? 0.558   5.278   5.062   1.00 0.00 ? 82  THR A HG22 4  
ATOM 7243  H HG23 . THR A 1 82  ? 1.140   3.626   5.267   1.00 0.00 ? 82  THR A HG23 4  
ATOM 7244  N N    . TYR A 1 83  ? 0.066   7.373   5.834   1.00 0.00 ? 83  TYR A N    4  
ATOM 7245  C CA   . TYR A 1 83  ? -1.289  7.877   6.028   1.00 0.00 ? 83  TYR A CA   4  
ATOM 7246  C C    . TYR A 1 83  ? -2.254  7.245   5.030   1.00 0.00 ? 83  TYR A C    4  
ATOM 7247  O O    . TYR A 1 83  ? -2.060  7.336   3.818   1.00 0.00 ? 83  TYR A O    4  
ATOM 7248  C CB   . TYR A 1 83  ? -1.314  9.400   5.884   1.00 0.00 ? 83  TYR A CB   4  
ATOM 7249  C CG   . TYR A 1 83  ? -0.464  10.119  6.907   1.00 0.00 ? 83  TYR A CG   4  
ATOM 7250  C CD1  . TYR A 1 83  ? -0.941  10.358  8.190   1.00 0.00 ? 83  TYR A CD1  4  
ATOM 7251  C CD2  . TYR A 1 83  ? 0.815   10.558  6.591   1.00 0.00 ? 83  TYR A CD2  4  
ATOM 7252  C CE1  . TYR A 1 83  ? -0.169  11.016  9.128   1.00 0.00 ? 83  TYR A CE1  4  
ATOM 7253  C CE2  . TYR A 1 83  ? 1.596   11.215  7.523   1.00 0.00 ? 83  TYR A CE2  4  
ATOM 7254  C CZ   . TYR A 1 83  ? 1.099   11.442  8.790   1.00 0.00 ? 83  TYR A CZ   4  
ATOM 7255  O OH   . TYR A 1 83  ? 1.872   12.096  9.722   1.00 0.00 ? 83  TYR A OH   4  
ATOM 7256  H H    . TYR A 1 83  ? 0.385   7.199   4.924   1.00 0.00 ? 83  TYR A H    4  
ATOM 7257  H HA   . TYR A 1 83  ? -1.600  7.615   7.028   1.00 0.00 ? 83  TYR A HA   4  
ATOM 7258  H HB2  . TYR A 1 83  ? -0.950  9.668   4.904   1.00 0.00 ? 83  TYR A HB2  4  
ATOM 7259  H HB3  . TYR A 1 83  ? -2.331  9.748   5.992   1.00 0.00 ? 83  TYR A HB3  4  
ATOM 7260  H HD1  . TYR A 1 83  ? -1.934  10.023  8.452   1.00 0.00 ? 83  TYR A HD1  4  
ATOM 7261  H HD2  . TYR A 1 83  ? 1.202   10.379  5.598   1.00 0.00 ? 83  TYR A HD2  4  
ATOM 7262  H HE1  . TYR A 1 83  ? -0.557  11.193  10.120  1.00 0.00 ? 83  TYR A HE1  4  
ATOM 7263  H HE2  . TYR A 1 83  ? 2.588   11.550  7.259   1.00 0.00 ? 83  TYR A HE2  4  
ATOM 7264  H HH   . TYR A 1 83  ? 1.617   11.814  10.603  1.00 0.00 ? 83  TYR A HH   4  
ATOM 7265  N N    . VAL A 1 84  ? -3.295  6.603   5.549   1.00 0.00 ? 84  VAL A N    4  
ATOM 7266  C CA   . VAL A 1 84  ? -4.293  5.956   4.706   1.00 0.00 ? 84  VAL A CA   4  
ATOM 7267  C C    . VAL A 1 84  ? -5.640  6.664   4.805   1.00 0.00 ? 84  VAL A C    4  
ATOM 7268  O O    . VAL A 1 84  ? -6.197  6.810   5.892   1.00 0.00 ? 84  VAL A O    4  
ATOM 7269  C CB   . VAL A 1 84  ? -4.475  4.475   5.087   1.00 0.00 ? 84  VAL A CB   4  
ATOM 7270  C CG1  . VAL A 1 84  ? -5.818  3.957   4.593   1.00 0.00 ? 84  VAL A CG1  4  
ATOM 7271  C CG2  . VAL A 1 84  ? -3.334  3.637   4.530   1.00 0.00 ? 84  VAL A CG2  4  
ATOM 7272  H H    . VAL A 1 84  ? -3.396  6.564   6.524   1.00 0.00 ? 84  VAL A H    4  
ATOM 7273  H HA   . VAL A 1 84  ? -3.947  6.003   3.683   1.00 0.00 ? 84  VAL A HA   4  
ATOM 7274  H HB   . VAL A 1 84  ? -4.459  4.397   6.164   1.00 0.00 ? 84  VAL A HB   4  
ATOM 7275  H HG11 . VAL A 1 84  ? -5.982  4.293   3.580   1.00 0.00 ? 84  VAL A HG11 4  
ATOM 7276  H HG12 . VAL A 1 84  ? -5.820  2.877   4.620   1.00 0.00 ? 84  VAL A HG12 4  
ATOM 7277  H HG13 . VAL A 1 84  ? -6.605  4.335   5.228   1.00 0.00 ? 84  VAL A HG13 4  
ATOM 7278  H HG21 . VAL A 1 84  ? -2.824  3.139   5.341   1.00 0.00 ? 84  VAL A HG21 4  
ATOM 7279  H HG22 . VAL A 1 84  ? -3.729  2.901   3.846   1.00 0.00 ? 84  VAL A HG22 4  
ATOM 7280  H HG23 . VAL A 1 84  ? -2.639  4.278   4.007   1.00 0.00 ? 84  VAL A HG23 4  
ATOM 7281  N N    . ASN A 1 85  ? -6.157  7.103   3.662   1.00 0.00 ? 85  ASN A N    4  
ATOM 7282  C CA   . ASN A 1 85  ? -7.439  7.797   3.620   1.00 0.00 ? 85  ASN A CA   4  
ATOM 7283  C C    . ASN A 1 85  ? -7.388  9.084   4.437   1.00 0.00 ? 85  ASN A C    4  
ATOM 7284  O O    . ASN A 1 85  ? -8.367  9.466   5.076   1.00 0.00 ? 85  ASN A O    4  
ATOM 7285  C CB   . ASN A 1 85  ? -8.551  6.889   4.148   1.00 0.00 ? 85  ASN A CB   4  
ATOM 7286  C CG   . ASN A 1 85  ? -8.931  5.805   3.158   1.00 0.00 ? 85  ASN A CG   4  
ATOM 7287  O OD1  . ASN A 1 85  ? -8.937  4.619   3.490   1.00 0.00 ? 85  ASN A OD1  4  
ATOM 7288  N ND2  . ASN A 1 85  ? -9.251  6.208   1.933   1.00 0.00 ? 85  ASN A ND2  4  
ATOM 7289  H H    . ASN A 1 85  ? -5.665  6.957   2.827   1.00 0.00 ? 85  ASN A H    4  
ATOM 7290  H HA   . ASN A 1 85  ? -7.647  8.045   2.590   1.00 0.00 ? 85  ASN A HA   4  
ATOM 7291  H HB2  . ASN A 1 85  ? -8.219  6.415   5.060   1.00 0.00 ? 85  ASN A HB2  4  
ATOM 7292  H HB3  . ASN A 1 85  ? -9.427  7.485   4.355   1.00 0.00 ? 85  ASN A HB3  4  
ATOM 7293  H HD21 . ASN A 1 85  ? -9.224  7.168   1.740   1.00 0.00 ? 85  ASN A HD21 4  
ATOM 7294  H HD22 . ASN A 1 85  ? -9.501  5.528   1.273   1.00 0.00 ? 85  ASN A HD22 4  
ATOM 7295  N N    . GLY A 1 86  ? -6.237  9.751   4.410   1.00 0.00 ? 86  GLY A N    4  
ATOM 7296  C CA   . GLY A 1 86  ? -6.079  10.988  5.151   1.00 0.00 ? 86  GLY A CA   4  
ATOM 7297  C C    . GLY A 1 86  ? -5.646  10.754  6.585   1.00 0.00 ? 86  GLY A C    4  
ATOM 7298  O O    . GLY A 1 86  ? -4.833  11.504  7.126   1.00 0.00 ? 86  GLY A O    4  
ATOM 7299  H H    . GLY A 1 86  ? -5.489  9.399   3.883   1.00 0.00 ? 86  GLY A H    4  
ATOM 7300  H HA2  . GLY A 1 86  ? -5.338  11.599  4.657   1.00 0.00 ? 86  GLY A HA2  4  
ATOM 7301  H HA3  . GLY A 1 86  ? -7.022  11.516  5.154   1.00 0.00 ? 86  GLY A HA3  4  
ATOM 7302  N N    . LYS A 1 87  ? -6.192  9.713   7.204   1.00 0.00 ? 87  LYS A N    4  
ATOM 7303  C CA   . LYS A 1 87  ? -5.858  9.381   8.584   1.00 0.00 ? 87  LYS A CA   4  
ATOM 7304  C C    . LYS A 1 87  ? -4.442  8.824   8.683   1.00 0.00 ? 87  LYS A C    4  
ATOM 7305  O O    . LYS A 1 87  ? -3.717  8.767   7.689   1.00 0.00 ? 87  LYS A O    4  
ATOM 7306  C CB   . LYS A 1 87  ? -6.858  8.365   9.142   1.00 0.00 ? 87  LYS A CB   4  
ATOM 7307  C CG   . LYS A 1 87  ? -8.267  8.914   9.286   1.00 0.00 ? 87  LYS A CG   4  
ATOM 7308  C CD   . LYS A 1 87  ? -9.271  7.807   9.558   1.00 0.00 ? 87  LYS A CD   4  
ATOM 7309  C CE   . LYS A 1 87  ? -9.578  7.011   8.299   1.00 0.00 ? 87  LYS A CE   4  
ATOM 7310  N NZ   . LYS A 1 87  ? -10.820 6.202   8.443   1.00 0.00 ? 87  LYS A NZ   4  
ATOM 7311  H H    . LYS A 1 87  ? -6.834  9.152   6.719   1.00 0.00 ? 87  LYS A H    4  
ATOM 7312  H HA   . LYS A 1 87  ? -5.917  10.288  9.166   1.00 0.00 ? 87  LYS A HA   4  
ATOM 7313  H HB2  . LYS A 1 87  ? -6.892  7.512   8.480   1.00 0.00 ? 87  LYS A HB2  4  
ATOM 7314  H HB3  . LYS A 1 87  ? -6.518  8.042   10.115  1.00 0.00 ? 87  LYS A HB3  4  
ATOM 7315  H HG2  . LYS A 1 87  ? -8.288  9.615   10.108  1.00 0.00 ? 87  LYS A HG2  4  
ATOM 7316  H HG3  . LYS A 1 87  ? -8.541  9.421   8.372   1.00 0.00 ? 87  LYS A HG3  4  
ATOM 7317  H HD2  . LYS A 1 87  ? -8.865  7.139   10.303  1.00 0.00 ? 87  LYS A HD2  4  
ATOM 7318  H HD3  . LYS A 1 87  ? -10.187 8.247   9.928   1.00 0.00 ? 87  LYS A HD3  4  
ATOM 7319  H HE2  . LYS A 1 87  ? -9.699  7.698   7.476   1.00 0.00 ? 87  LYS A HE2  4  
ATOM 7320  H HE3  . LYS A 1 87  ? -8.748  6.349   8.097   1.00 0.00 ? 87  LYS A HE3  4  
ATOM 7321  H HZ1  . LYS A 1 87  ? -10.587 5.188   8.456   1.00 0.00 ? 87  LYS A HZ1  4  
ATOM 7322  H HZ2  . LYS A 1 87  ? -11.462 6.389   7.647   1.00 0.00 ? 87  LYS A HZ2  4  
ATOM 7323  H HZ3  . LYS A 1 87  ? -11.304 6.446   9.330   1.00 0.00 ? 87  LYS A HZ3  4  
ATOM 7324  N N    . ARG A 1 88  ? -4.055  8.414   9.886   1.00 0.00 ? 88  ARG A N    4  
ATOM 7325  C CA   . ARG A 1 88  ? -2.725  7.861   10.114  1.00 0.00 ? 88  ARG A CA   4  
ATOM 7326  C C    . ARG A 1 88  ? -2.788  6.345   10.275  1.00 0.00 ? 88  ARG A C    4  
ATOM 7327  O O    . ARG A 1 88  ? -3.686  5.816   10.930  1.00 0.00 ? 88  ARG A O    4  
ATOM 7328  C CB   . ARG A 1 88  ? -2.093  8.491   11.355  1.00 0.00 ? 88  ARG A CB   4  
ATOM 7329  C CG   . ARG A 1 88  ? -0.578  8.592   11.283  1.00 0.00 ? 88  ARG A CG   4  
ATOM 7330  C CD   . ARG A 1 88  ? 0.079   7.232   11.458  1.00 0.00 ? 88  ARG A CD   4  
ATOM 7331  N NE   . ARG A 1 88  ? -0.776  6.300   12.187  1.00 0.00 ? 88  ARG A NE   4  
ATOM 7332  C CZ   . ARG A 1 88  ? -1.002  6.378   13.494  1.00 0.00 ? 88  ARG A CZ   4  
ATOM 7333  N NH1  . ARG A 1 88  ? -0.438  7.340   14.211  1.00 0.00 ? 88  ARG A NH1  4  
ATOM 7334  N NH2  . ARG A 1 88  ? -1.793  5.492   14.086  1.00 0.00 ? 88  ARG A NH2  4  
ATOM 7335  H H    . ARG A 1 88  ? -4.678  8.485   10.639  1.00 0.00 ? 88  ARG A H    4  
ATOM 7336  H HA   . ARG A 1 88  ? -2.117  8.094   9.253   1.00 0.00 ? 88  ARG A HA   4  
ATOM 7337  H HB2  . ARG A 1 88  ? -2.492  9.487   11.482  1.00 0.00 ? 88  ARG A HB2  4  
ATOM 7338  H HB3  . ARG A 1 88  ? -2.352  7.896   12.218  1.00 0.00 ? 88  ARG A HB3  4  
ATOM 7339  H HG2  . ARG A 1 88  ? -0.299  8.993   10.320  1.00 0.00 ? 88  ARG A HG2  4  
ATOM 7340  H HG3  . ARG A 1 88  ? -0.233  9.252   12.065  1.00 0.00 ? 88  ARG A HG3  4  
ATOM 7341  H HD2  . ARG A 1 88  ? 0.292   6.822   10.482  1.00 0.00 ? 88  ARG A HD2  4  
ATOM 7342  H HD3  . ARG A 1 88  ? 1.002   7.361   12.003  1.00 0.00 ? 88  ARG A HD3  4  
ATOM 7343  H HE   . ARG A 1 88  ? -1.203  5.581   11.677  1.00 0.00 ? 88  ARG A HE   4  
ATOM 7344  H HH11 . ARG A 1 88  ? 0.158   8.009   13.768  1.00 0.00 ? 88  ARG A HH11 4  
ATOM 7345  H HH12 . ARG A 1 88  ? -0.611  7.397   15.195  1.00 0.00 ? 88  ARG A HH12 4  
ATOM 7346  H HH21 . ARG A 1 88  ? -2.220  4.766   13.549  1.00 0.00 ? 88  ARG A HH21 4  
ATOM 7347  H HH22 . ARG A 1 88  ? -1.962  5.552   15.069  1.00 0.00 ? 88  ARG A HH22 4  
ATOM 7348  N N    . VAL A 1 89  ? -1.826  5.650   9.675   1.00 0.00 ? 89  VAL A N    4  
ATOM 7349  C CA   . VAL A 1 89  ? -1.771  4.196   9.752   1.00 0.00 ? 89  VAL A CA   4  
ATOM 7350  C C    . VAL A 1 89  ? -0.505  3.731   10.463  1.00 0.00 ? 89  VAL A C    4  
ATOM 7351  O O    . VAL A 1 89  ? 0.589   3.783   9.902   1.00 0.00 ? 89  VAL A O    4  
ATOM 7352  C CB   . VAL A 1 89  ? -1.824  3.556   8.352   1.00 0.00 ? 89  VAL A CB   4  
ATOM 7353  C CG1  . VAL A 1 89  ? -0.619  3.979   7.526   1.00 0.00 ? 89  VAL A CG1  4  
ATOM 7354  C CG2  . VAL A 1 89  ? -1.902  2.041   8.461   1.00 0.00 ? 89  VAL A CG2  4  
ATOM 7355  H H    . VAL A 1 89  ? -1.137  6.128   9.168   1.00 0.00 ? 89  VAL A H    4  
ATOM 7356  H HA   . VAL A 1 89  ? -2.631  3.858   10.312  1.00 0.00 ? 89  VAL A HA   4  
ATOM 7357  H HB   . VAL A 1 89  ? -2.716  3.906   7.853   1.00 0.00 ? 89  VAL A HB   4  
ATOM 7358  H HG11 . VAL A 1 89  ? -0.303  4.966   7.829   1.00 0.00 ? 89  VAL A HG11 4  
ATOM 7359  H HG12 . VAL A 1 89  ? 0.188   3.278   7.681   1.00 0.00 ? 89  VAL A HG12 4  
ATOM 7360  H HG13 . VAL A 1 89  ? -0.887  3.993   6.480   1.00 0.00 ? 89  VAL A HG13 4  
ATOM 7361  H HG21 . VAL A 1 89  ? -1.839  1.751   9.499   1.00 0.00 ? 89  VAL A HG21 4  
ATOM 7362  H HG22 . VAL A 1 89  ? -2.838  1.698   8.047   1.00 0.00 ? 89  VAL A HG22 4  
ATOM 7363  H HG23 . VAL A 1 89  ? -1.082  1.598   7.914   1.00 0.00 ? 89  VAL A HG23 4  
ATOM 7364  N N    . SER A 1 90  ? -0.662  3.276   11.702  1.00 0.00 ? 90  SER A N    4  
ATOM 7365  C CA   . SER A 1 90  ? 0.470   2.805   12.493  1.00 0.00 ? 90  SER A CA   4  
ATOM 7366  C C    . SER A 1 90  ? 0.311   1.328   12.841  1.00 0.00 ? 90  SER A C    4  
ATOM 7367  O O    . SER A 1 90  ? 1.184   0.732   13.471  1.00 0.00 ? 90  SER A O    4  
ATOM 7368  C CB   . SER A 1 90  ? 0.605   3.631   13.773  1.00 0.00 ? 90  SER A CB   4  
ATOM 7369  O OG   . SER A 1 90  ? 1.650   3.137   14.591  1.00 0.00 ? 90  SER A OG   4  
ATOM 7370  H H    . SER A 1 90  ? -1.560  3.260   12.095  1.00 0.00 ? 90  SER A H    4  
ATOM 7371  H HA   . SER A 1 90  ? 1.363   2.929   11.899  1.00 0.00 ? 90  SER A HA   4  
ATOM 7372  H HB2  . SER A 1 90  ? 0.820   4.657   13.515  1.00 0.00 ? 90  SER A HB2  4  
ATOM 7373  H HB3  . SER A 1 90  ? -0.322  3.586   14.326  1.00 0.00 ? 90  SER A HB3  4  
ATOM 7374  H HG   . SER A 1 90  ? 2.001   3.851   15.130  1.00 0.00 ? 90  SER A HG   4  
ATOM 7375  N N    . GLN A 1 91  ? -0.810  0.746   12.428  1.00 0.00 ? 91  GLN A N    4  
ATOM 7376  C CA   . GLN A 1 91  ? -1.084  -0.661  12.697  1.00 0.00 ? 91  GLN A CA   4  
ATOM 7377  C C    . GLN A 1 91  ? -1.429  -1.404  11.410  1.00 0.00 ? 91  GLN A C    4  
ATOM 7378  O O    . GLN A 1 91  ? -1.843  -0.811  10.414  1.00 0.00 ? 91  GLN A O    4  
ATOM 7379  C CB   . GLN A 1 91  ? -2.230  -0.796  13.701  1.00 0.00 ? 91  GLN A CB   4  
ATOM 7380  C CG   . GLN A 1 91  ? -1.775  -0.771  15.151  1.00 0.00 ? 91  GLN A CG   4  
ATOM 7381  C CD   . GLN A 1 91  ? -2.720  -1.517  16.072  1.00 0.00 ? 91  GLN A CD   4  
ATOM 7382  O OE1  . GLN A 1 91  ? -3.042  -2.682  15.838  1.00 0.00 ? 91  GLN A OE1  4  
ATOM 7383  N NE2  . GLN A 1 91  ? -3.169  -0.849  17.127  1.00 0.00 ? 91  GLN A NE2  4  
ATOM 7384  H H    . GLN A 1 91  ? -1.467  1.275   11.930  1.00 0.00 ? 91  GLN A H    4  
ATOM 7385  H HA   . GLN A 1 91  ? -0.192  -1.096  13.122  1.00 0.00 ? 91  GLN A HA   4  
ATOM 7386  H HB2  . GLN A 1 91  ? -2.923  0.018   13.549  1.00 0.00 ? 91  GLN A HB2  4  
ATOM 7387  H HB3  . GLN A 1 91  ? -2.740  -1.731  13.522  1.00 0.00 ? 91  GLN A HB3  4  
ATOM 7388  H HG2  . GLN A 1 91  ? -0.798  -1.228  15.216  1.00 0.00 ? 91  GLN A HG2  4  
ATOM 7389  H HG3  . GLN A 1 91  ? -1.713  0.256   15.478  1.00 0.00 ? 91  GLN A HG3  4  
ATOM 7390  H HE21 . GLN A 1 91  ? -2.871  0.077   17.249  1.00 0.00 ? 91  GLN A HE21 4  
ATOM 7391  H HE22 . GLN A 1 91  ? -3.782  -1.306  17.739  1.00 0.00 ? 91  GLN A HE22 4  
ATOM 7392  N N    . PRO A 1 92  ? -1.254  -2.734  11.430  1.00 0.00 ? 92  PRO A N    4  
ATOM 7393  C CA   . PRO A 1 92  ? -1.541  -3.587  10.273  1.00 0.00 ? 92  PRO A CA   4  
ATOM 7394  C C    . PRO A 1 92  ? -3.035  -3.688  9.984   1.00 0.00 ? 92  PRO A C    4  
ATOM 7395  O O    . PRO A 1 92  ? -3.736  -4.513  10.571  1.00 0.00 ? 92  PRO A O    4  
ATOM 7396  C CB   . PRO A 1 92  ? -0.983  -4.950  10.690  1.00 0.00 ? 92  PRO A CB   4  
ATOM 7397  C CG   . PRO A 1 92  ? -1.017  -4.933  12.179  1.00 0.00 ? 92  PRO A CG   4  
ATOM 7398  C CD   . PRO A 1 92  ? -0.764  -3.507  12.583  1.00 0.00 ? 92  PRO A CD   4  
ATOM 7399  H HA   . PRO A 1 92  ? -1.027  -3.241  9.388   1.00 0.00 ? 92  PRO A HA   4  
ATOM 7400  H HB2  . PRO A 1 92  ? -1.608  -5.735  10.289  1.00 0.00 ? 92  PRO A HB2  4  
ATOM 7401  H HB3  . PRO A 1 92  ? 0.025   -5.059  10.319  1.00 0.00 ? 92  PRO A HB3  4  
ATOM 7402  H HG2  . PRO A 1 92  ? -1.986  -5.256  12.528  1.00 0.00 ? 92  PRO A HG2  4  
ATOM 7403  H HG3  . PRO A 1 92  ? -0.242  -5.576  12.571  1.00 0.00 ? 92  PRO A HG3  4  
ATOM 7404  H HD2  . PRO A 1 92  ? -1.321  -3.263  13.476  1.00 0.00 ? 92  PRO A HD2  4  
ATOM 7405  H HD3  . PRO A 1 92  ? 0.292   -3.340  12.738  1.00 0.00 ? 92  PRO A HD3  4  
ATOM 7406  N N    . VAL A 1 93  ? -3.516  -2.846  9.075   1.00 0.00 ? 93  VAL A N    4  
ATOM 7407  C CA   . VAL A 1 93  ? -4.927  -2.842  8.707   1.00 0.00 ? 93  VAL A CA   4  
ATOM 7408  C C    . VAL A 1 93  ? -5.108  -3.134  7.222   1.00 0.00 ? 93  VAL A C    4  
ATOM 7409  O O    . VAL A 1 93  ? -4.171  -3.001  6.435   1.00 0.00 ? 93  VAL A O    4  
ATOM 7410  C CB   . VAL A 1 93  ? -5.590  -1.491  9.038   1.00 0.00 ? 93  VAL A CB   4  
ATOM 7411  C CG1  . VAL A 1 93  ? -5.491  -1.199  10.528  1.00 0.00 ? 93  VAL A CG1  4  
ATOM 7412  C CG2  . VAL A 1 93  ? -4.956  -0.374  8.224   1.00 0.00 ? 93  VAL A CG2  4  
ATOM 7413  H H    . VAL A 1 93  ? -2.907  -2.212  8.642   1.00 0.00 ? 93  VAL A H    4  
ATOM 7414  H HA   . VAL A 1 93  ? -5.423  -3.613  9.279   1.00 0.00 ? 93  VAL A HA   4  
ATOM 7415  H HB   . VAL A 1 93  ? -6.635  -1.553  8.774   1.00 0.00 ? 93  VAL A HB   4  
ATOM 7416  H HG11 . VAL A 1 93  ? -6.352  -1.612  11.033  1.00 0.00 ? 93  VAL A HG11 4  
ATOM 7417  H HG12 . VAL A 1 93  ? -4.591  -1.645  10.924  1.00 0.00 ? 93  VAL A HG12 4  
ATOM 7418  H HG13 . VAL A 1 93  ? -5.462  -0.130  10.683  1.00 0.00 ? 93  VAL A HG13 4  
ATOM 7419  H HG21 . VAL A 1 93  ? -5.386  -0.361  7.233   1.00 0.00 ? 93  VAL A HG21 4  
ATOM 7420  H HG22 . VAL A 1 93  ? -5.140  0.573   8.709   1.00 0.00 ? 93  VAL A HG22 4  
ATOM 7421  H HG23 . VAL A 1 93  ? -3.891  -0.540  8.151   1.00 0.00 ? 93  VAL A HG23 4  
ATOM 7422  N N    . GLN A 1 94  ? -6.319  -3.532  6.846   1.00 0.00 ? 94  GLN A N    4  
ATOM 7423  C CA   . GLN A 1 94  ? -6.623  -3.844  5.455   1.00 0.00 ? 94  GLN A CA   4  
ATOM 7424  C C    . GLN A 1 94  ? -6.905  -2.572  4.661   1.00 0.00 ? 94  GLN A C    4  
ATOM 7425  O O    . GLN A 1 94  ? -7.529  -1.638  5.167   1.00 0.00 ? 94  GLN A O    4  
ATOM 7426  C CB   . GLN A 1 94  ? -7.824  -4.788  5.372   1.00 0.00 ? 94  GLN A CB   4  
ATOM 7427  C CG   . GLN A 1 94  ? -7.456  -6.255  5.522   1.00 0.00 ? 94  GLN A CG   4  
ATOM 7428  C CD   . GLN A 1 94  ? -8.664  -7.139  5.759   1.00 0.00 ? 94  GLN A CD   4  
ATOM 7429  O OE1  . GLN A 1 94  ? -9.802  -6.667  5.758   1.00 0.00 ? 94  GLN A OE1  4  
ATOM 7430  N NE2  . GLN A 1 94  ? -8.424  -8.428  5.964   1.00 0.00 ? 94  GLN A NE2  4  
ATOM 7431  H H    . GLN A 1 94  ? -7.024  -3.619  7.520   1.00 0.00 ? 94  GLN A H    4  
ATOM 7432  H HA   . GLN A 1 94  ? -5.761  -4.335  5.029   1.00 0.00 ? 94  GLN A HA   4  
ATOM 7433  H HB2  . GLN A 1 94  ? -8.522  -4.532  6.154   1.00 0.00 ? 94  GLN A HB2  4  
ATOM 7434  H HB3  . GLN A 1 94  ? -8.304  -4.656  4.413   1.00 0.00 ? 94  GLN A HB3  4  
ATOM 7435  H HG2  . GLN A 1 94  ? -6.961  -6.583  4.620   1.00 0.00 ? 94  GLN A HG2  4  
ATOM 7436  H HG3  . GLN A 1 94  ? -6.781  -6.360  6.359   1.00 0.00 ? 94  GLN A HG3  4  
ATOM 7437  H HE21 . GLN A 1 94  ? -7.492  -8.733  5.952   1.00 0.00 ? 94  GLN A HE21 4  
ATOM 7438  H HE22 . GLN A 1 94  ? -9.187  -9.022  6.120   1.00 0.00 ? 94  GLN A HE22 4  
ATOM 7439  N N    . LEU A 1 95  ? -6.441  -2.542  3.417   1.00 0.00 ? 95  LEU A N    4  
ATOM 7440  C CA   . LEU A 1 95  ? -6.643  -1.384  2.553   1.00 0.00 ? 95  LEU A CA   4  
ATOM 7441  C C    . LEU A 1 95  ? -7.979  -1.477  1.822   1.00 0.00 ? 95  LEU A C    4  
ATOM 7442  O O    . LEU A 1 95  ? -8.499  -2.569  1.595   1.00 0.00 ? 95  LEU A O    4  
ATOM 7443  C CB   . LEU A 1 95  ? -5.502  -1.273  1.541   1.00 0.00 ? 95  LEU A CB   4  
ATOM 7444  C CG   . LEU A 1 95  ? -4.118  -0.973  2.119   1.00 0.00 ? 95  LEU A CG   4  
ATOM 7445  C CD1  . LEU A 1 95  ? -4.176  0.236   3.040   1.00 0.00 ? 95  LEU A CD1  4  
ATOM 7446  C CD2  . LEU A 1 95  ? -3.576  -2.186  2.862   1.00 0.00 ? 95  LEU A CD2  4  
ATOM 7447  H H    . LEU A 1 95  ? -5.951  -3.316  3.070   1.00 0.00 ? 95  LEU A H    4  
ATOM 7448  H HA   . LEU A 1 95  ? -6.648  -0.503  3.176   1.00 0.00 ? 95  LEU A HA   4  
ATOM 7449  H HB2  . LEU A 1 95  ? -5.441  -2.209  1.007   1.00 0.00 ? 95  LEU A HB2  4  
ATOM 7450  H HB3  . LEU A 1 95  ? -5.751  -0.482  0.848   1.00 0.00 ? 95  LEU A HB3  4  
ATOM 7451  H HG   . LEU A 1 95  ? -3.439  -0.744  1.310   1.00 0.00 ? 95  LEU A HG   4  
ATOM 7452  H HD11 . LEU A 1 95  ? -4.624  -0.048  3.980   1.00 0.00 ? 95  LEU A HD11 4  
ATOM 7453  H HD12 . LEU A 1 95  ? -4.769  1.012   2.578   1.00 0.00 ? 95  LEU A HD12 4  
ATOM 7454  H HD13 . LEU A 1 95  ? -3.175  0.604   3.214   1.00 0.00 ? 95  LEU A HD13 4  
ATOM 7455  H HD21 . LEU A 1 95  ? -4.054  -3.079  2.489   1.00 0.00 ? 95  LEU A HD21 4  
ATOM 7456  H HD22 . LEU A 1 95  ? -3.780  -2.081  3.917   1.00 0.00 ? 95  LEU A HD22 4  
ATOM 7457  H HD23 . LEU A 1 95  ? -2.509  -2.255  2.706   1.00 0.00 ? 95  LEU A HD23 4  
ATOM 7458  N N    . ARG A 1 96  ? -8.528  -0.323  1.455   1.00 0.00 ? 96  ARG A N    4  
ATOM 7459  C CA   . ARG A 1 96  ? -9.802  -0.274  0.749   1.00 0.00 ? 96  ARG A CA   4  
ATOM 7460  C C    . ARG A 1 96  ? -9.597  0.094   -0.718  1.00 0.00 ? 96  ARG A C    4  
ATOM 7461  O O    . ARG A 1 96  ? -9.039  1.145   -1.033  1.00 0.00 ? 96  ARG A O    4  
ATOM 7462  C CB   . ARG A 1 96  ? -10.739 0.737   1.413   1.00 0.00 ? 96  ARG A CB   4  
ATOM 7463  C CG   . ARG A 1 96  ? -12.211 0.389   1.268   1.00 0.00 ? 96  ARG A CG   4  
ATOM 7464  C CD   . ARG A 1 96  ? -12.690 0.577   -0.163  1.00 0.00 ? 96  ARG A CD   4  
ATOM 7465  N NE   . ARG A 1 96  ? -12.099 1.758   -0.787  1.00 0.00 ? 96  ARG A NE   4  
ATOM 7466  C CZ   . ARG A 1 96  ? -12.499 2.999   -0.536  1.00 0.00 ? 96  ARG A CZ   4  
ATOM 7467  N NH1  . ARG A 1 96  ? -13.485 3.221   0.322   1.00 0.00 ? 96  ARG A NH1  4  
ATOM 7468  N NH2  . ARG A 1 96  ? -11.912 4.022   -1.144  1.00 0.00 ? 96  ARG A NH2  4  
ATOM 7469  H H    . ARG A 1 96  ? -8.065  0.515   1.665   1.00 0.00 ? 96  ARG A H    4  
ATOM 7470  H HA   . ARG A 1 96  ? -10.249 -1.255  0.802   1.00 0.00 ? 96  ARG A HA   4  
ATOM 7471  H HB2  . ARG A 1 96  ? -10.506 0.788   2.466   1.00 0.00 ? 96  ARG A HB2  4  
ATOM 7472  H HB3  . ARG A 1 96  ? -10.575 1.707   0.969   1.00 0.00 ? 96  ARG A HB3  4  
ATOM 7473  H HG2  . ARG A 1 96  ? -12.358 -0.643  1.552   1.00 0.00 ? 96  ARG A HG2  4  
ATOM 7474  H HG3  . ARG A 1 96  ? -12.788 1.029   1.919   1.00 0.00 ? 96  ARG A HG3  4  
ATOM 7475  H HD2  . ARG A 1 96  ? -12.417 -0.296  -0.737  1.00 0.00 ? 96  ARG A HD2  4  
ATOM 7476  H HD3  . ARG A 1 96  ? -13.764 0.683   -0.158  1.00 0.00 ? 96  ARG A HD3  4  
ATOM 7477  H HE   . ARG A 1 96  ? -11.369 1.617   -1.425  1.00 0.00 ? 96  ARG A HE   4  
ATOM 7478  H HH11 . ARG A 1 96  ? -13.929 2.452   0.782   1.00 0.00 ? 96  ARG A HH11 4  
ATOM 7479  H HH12 . ARG A 1 96  ? -13.784 4.157   0.510   1.00 0.00 ? 96  ARG A HH12 4  
ATOM 7480  H HH21 . ARG A 1 96  ? -11.168 3.859   -1.791  1.00 0.00 ? 96  ARG A HH21 4  
ATOM 7481  H HH22 . ARG A 1 96  ? -12.214 4.956   -0.955  1.00 0.00 ? 96  ARG A HH22 4  
ATOM 7482  N N    . SER A 1 97  ? -10.052 -0.779  -1.611  1.00 0.00 ? 97  SER A N    4  
ATOM 7483  C CA   . SER A 1 97  ? -9.915  -0.549  -3.044  1.00 0.00 ? 97  SER A CA   4  
ATOM 7484  C C    . SER A 1 97  ? -10.225 0.904   -3.393  1.00 0.00 ? 97  SER A C    4  
ATOM 7485  O O    . SER A 1 97  ? -11.381 1.273   -3.595  1.00 0.00 ? 97  SER A O    4  
ATOM 7486  C CB   . SER A 1 97  ? -10.844 -1.481  -3.824  1.00 0.00 ? 97  SER A CB   4  
ATOM 7487  O OG   . SER A 1 97  ? -11.217 -0.909  -5.065  1.00 0.00 ? 97  SER A OG   4  
ATOM 7488  H H    . SER A 1 97  ? -10.488 -1.599  -1.298  1.00 0.00 ? 97  SER A H    4  
ATOM 7489  H HA   . SER A 1 97  ? -8.893  -0.762  -3.318  1.00 0.00 ? 97  SER A HA   4  
ATOM 7490  H HB2  . SER A 1 97  ? -10.338 -2.416  -4.009  1.00 0.00 ? 97  SER A HB2  4  
ATOM 7491  H HB3  . SER A 1 97  ? -11.736 -1.664  -3.242  1.00 0.00 ? 97  SER A HB3  4  
ATOM 7492  H HG   . SER A 1 97  ? -12.172 -0.937  -5.157  1.00 0.00 ? 97  SER A HG   4  
ATOM 7493  N N    . GLY A 1 98  ? -9.181  1.725   -3.461  1.00 0.00 ? 98  GLY A N    4  
ATOM 7494  C CA   . GLY A 1 98  ? -9.362  3.128   -3.785  1.00 0.00 ? 98  GLY A CA   4  
ATOM 7495  C C    . GLY A 1 98  ? -9.049  4.039   -2.614  1.00 0.00 ? 98  GLY A C    4  
ATOM 7496  O O    . GLY A 1 98  ? -9.695  5.069   -2.430  1.00 0.00 ? 98  GLY A O    4  
ATOM 7497  H H    . GLY A 1 98  ? -8.282  1.376   -3.290  1.00 0.00 ? 98  GLY A H    4  
ATOM 7498  H HA2  . GLY A 1 98  ? -8.712  3.383   -4.609  1.00 0.00 ? 98  GLY A HA2  4  
ATOM 7499  H HA3  . GLY A 1 98  ? -10.387 3.288   -4.086  1.00 0.00 ? 98  GLY A HA3  4  
ATOM 7500  N N    . ASN A 1 99  ? -8.054  3.657   -1.819  1.00 0.00 ? 99  ASN A N    4  
ATOM 7501  C CA   . ASN A 1 99  ? -7.658  4.445   -0.658  1.00 0.00 ? 99  ASN A CA   4  
ATOM 7502  C C    . ASN A 1 99  ? -6.324  5.144   -0.904  1.00 0.00 ? 99  ASN A C    4  
ATOM 7503  O O    . ASN A 1 99  ? -5.436  4.595   -1.556  1.00 0.00 ? 99  ASN A O    4  
ATOM 7504  C CB   . ASN A 1 99  ? -7.558  3.552   0.581   1.00 0.00 ? 99  ASN A CB   4  
ATOM 7505  C CG   . ASN A 1 99  ? -6.326  2.668   0.558   1.00 0.00 ? 99  ASN A CG   4  
ATOM 7506  O OD1  . ASN A 1 99  ? -5.363  2.907   1.287   1.00 0.00 ? 99  ASN A OD1  4  
ATOM 7507  N ND2  . ASN A 1 99  ? -6.352  1.640   -0.282  1.00 0.00 ? 99  ASN A ND2  4  
ATOM 7508  H H    . ASN A 1 99  ? -7.576  2.825   -2.018  1.00 0.00 ? 99  ASN A H    4  
ATOM 7509  H HA   . ASN A 1 99  ? -8.418  5.194   -0.491  1.00 0.00 ? 99  ASN A HA   4  
ATOM 7510  H HB2  . ASN A 1 99  ? -7.515  4.175   1.463   1.00 0.00 ? 99  ASN A HB2  4  
ATOM 7511  H HB3  . ASN A 1 99  ? -8.432  2.921   0.634   1.00 0.00 ? 99  ASN A HB3  4  
ATOM 7512  H HD21 . ASN A 1 99  ? -7.153  1.511   -0.832  1.00 0.00 ? 99  ASN A HD21 4  
ATOM 7513  H HD22 . ASN A 1 99  ? -5.569  1.051   -0.316  1.00 0.00 ? 99  ASN A HD22 4  
ATOM 7514  N N    . ARG A 1 100 ? -6.192  6.357   -0.378  1.00 0.00 ? 100 ARG A N    4  
ATOM 7515  C CA   . ARG A 1 100 ? -4.968  7.131   -0.541  1.00 0.00 ? 100 ARG A CA   4  
ATOM 7516  C C    . ARG A 1 100 ? -3.947  6.765   0.532   1.00 0.00 ? 100 ARG A C    4  
ATOM 7517  O O    . ARG A 1 100 ? -4.167  7.005   1.720   1.00 0.00 ? 100 ARG A O    4  
ATOM 7518  C CB   . ARG A 1 100 ? -5.274  8.629   -0.479  1.00 0.00 ? 100 ARG A CB   4  
ATOM 7519  C CG   . ARG A 1 100 ? -5.622  9.235   -1.829  1.00 0.00 ? 100 ARG A CG   4  
ATOM 7520  C CD   . ARG A 1 100 ? -5.764  10.747  -1.741  1.00 0.00 ? 100 ARG A CD   4  
ATOM 7521  N NE   . ARG A 1 100 ? -4.848  11.326  -0.761  1.00 0.00 ? 100 ARG A NE   4  
ATOM 7522  C CZ   . ARG A 1 100 ? -5.112  11.399  0.538   1.00 0.00 ? 100 ARG A CZ   4  
ATOM 7523  N NH1  . ARG A 1 100 ? -6.258  10.931  1.013   1.00 0.00 ? 100 ARG A NH1  4  
ATOM 7524  N NH2  . ARG A 1 100 ? -4.228  11.940  1.367   1.00 0.00 ? 100 ARG A NH2  4  
ATOM 7525  H H    . ARG A 1 100 ? -6.936  6.741   0.131   1.00 0.00 ? 100 ARG A H    4  
ATOM 7526  H HA   . ARG A 1 100 ? -4.553  6.897   -1.510  1.00 0.00 ? 100 ARG A HA   4  
ATOM 7527  H HB2  . ARG A 1 100 ? -6.109  8.787   0.188   1.00 0.00 ? 100 ARG A HB2  4  
ATOM 7528  H HB3  . ARG A 1 100 ? -4.409  9.145   -0.090  1.00 0.00 ? 100 ARG A HB3  4  
ATOM 7529  H HG2  . ARG A 1 100 ? -4.838  8.999   -2.533  1.00 0.00 ? 100 ARG A HG2  4  
ATOM 7530  H HG3  . ARG A 1 100 ? -6.555  8.814   -2.172  1.00 0.00 ? 100 ARG A HG3  4  
ATOM 7531  H HD2  . ARG A 1 100 ? -5.554  11.172  -2.711  1.00 0.00 ? 100 ARG A HD2  4  
ATOM 7532  H HD3  . ARG A 1 100 ? -6.778  10.984  -1.456  1.00 0.00 ? 100 ARG A HD3  4  
ATOM 7533  H HE   . ARG A 1 100 ? -3.995  11.678  -1.090  1.00 0.00 ? 100 ARG A HE   4  
ATOM 7534  H HH11 . ARG A 1 100 ? -6.926  10.522  0.391   1.00 0.00 ? 100 ARG A HH11 4  
ATOM 7535  H HH12 . ARG A 1 100 ? -6.454  10.986  1.992   1.00 0.00 ? 100 ARG A HH12 4  
ATOM 7536  H HH21 . ARG A 1 100 ? -3.363  12.294  1.013   1.00 0.00 ? 100 ARG A HH21 4  
ATOM 7537  H HH22 . ARG A 1 100 ? -4.428  11.995  2.345   1.00 0.00 ? 100 ARG A HH22 4  
ATOM 7538  N N    . ILE A 1 101 ? -2.830  6.184   0.106   1.00 0.00 ? 101 ILE A N    4  
ATOM 7539  C CA   . ILE A 1 101 ? -1.776  5.786   1.030   1.00 0.00 ? 101 ILE A CA   4  
ATOM 7540  C C    . ILE A 1 101 ? -0.502  6.590   0.790   1.00 0.00 ? 101 ILE A C    4  
ATOM 7541  O O    . ILE A 1 101 ? 0.198   6.381   -0.201  1.00 0.00 ? 101 ILE A O    4  
ATOM 7542  C CB   . ILE A 1 101 ? -1.453  4.286   0.904   1.00 0.00 ? 101 ILE A CB   4  
ATOM 7543  C CG1  . ILE A 1 101 ? -2.744  3.464   0.891   1.00 0.00 ? 101 ILE A CG1  4  
ATOM 7544  C CG2  . ILE A 1 101 ? -0.547  3.841   2.042   1.00 0.00 ? 101 ILE A CG2  4  
ATOM 7545  C CD1  . ILE A 1 101 ? -2.599  2.122   0.206   1.00 0.00 ? 101 ILE A CD1  4  
ATOM 7546  H H    . ILE A 1 101 ? -2.713  6.020   -0.853  1.00 0.00 ? 101 ILE A H    4  
ATOM 7547  H HA   . ILE A 1 101 ? -2.125  5.976   2.035   1.00 0.00 ? 101 ILE A HA   4  
ATOM 7548  H HB   . ILE A 1 101 ? -0.927  4.130   -0.025  1.00 0.00 ? 101 ILE A HB   4  
ATOM 7549  H HG12 . ILE A 1 101 ? -3.060  3.285   1.906   1.00 0.00 ? 101 ILE A HG12 4  
ATOM 7550  H HG13 . ILE A 1 101 ? -3.511  4.021   0.372   1.00 0.00 ? 101 ILE A HG13 4  
ATOM 7551  H HG21 . ILE A 1 101 ? -0.906  4.258   2.971   1.00 0.00 ? 101 ILE A HG21 4  
ATOM 7552  H HG22 . ILE A 1 101 ? -0.553  2.763   2.106   1.00 0.00 ? 101 ILE A HG22 4  
ATOM 7553  H HG23 . ILE A 1 101 ? 0.459   4.186   1.857   1.00 0.00 ? 101 ILE A HG23 4  
ATOM 7554  H HD11 . ILE A 1 101 ? -3.042  1.354   0.824   1.00 0.00 ? 101 ILE A HD11 4  
ATOM 7555  H HD12 . ILE A 1 101 ? -3.103  2.149   -0.749  1.00 0.00 ? 101 ILE A HD12 4  
ATOM 7556  H HD13 . ILE A 1 101 ? -1.552  1.905   0.057   1.00 0.00 ? 101 ILE A HD13 4  
ATOM 7557  N N    . ILE A 1 102 ? -0.208  7.509   1.704   1.00 0.00 ? 102 ILE A N    4  
ATOM 7558  C CA   . ILE A 1 102 ? 0.983   8.342   1.594   1.00 0.00 ? 102 ILE A CA   4  
ATOM 7559  C C    . ILE A 1 102 ? 2.158   7.723   2.343   1.00 0.00 ? 102 ILE A C    4  
ATOM 7560  O O    . ILE A 1 102 ? 1.983   7.117   3.400   1.00 0.00 ? 102 ILE A O    4  
ATOM 7561  C CB   . ILE A 1 102 ? 0.730   9.760   2.138   1.00 0.00 ? 102 ILE A CB   4  
ATOM 7562  C CG1  . ILE A 1 102 ? -0.332  10.471  1.297   1.00 0.00 ? 102 ILE A CG1  4  
ATOM 7563  C CG2  . ILE A 1 102 ? 2.024   10.560  2.154   1.00 0.00 ? 102 ILE A CG2  4  
ATOM 7564  C CD1  . ILE A 1 102 ? -1.743  10.255  1.797   1.00 0.00 ? 102 ILE A CD1  4  
ATOM 7565  H H    . ILE A 1 102 ? -0.805  7.628   2.471   1.00 0.00 ? 102 ILE A H    4  
ATOM 7566  H HA   . ILE A 1 102 ? 1.238   8.420   0.547   1.00 0.00 ? 102 ILE A HA   4  
ATOM 7567  H HB   . ILE A 1 102 ? 0.376   9.674   3.154   1.00 0.00 ? 102 ILE A HB   4  
ATOM 7568  H HG12 . ILE A 1 102 ? -0.137  11.532  1.304   1.00 0.00 ? 102 ILE A HG12 4  
ATOM 7569  H HG13 . ILE A 1 102 ? -0.279  10.106  0.281   1.00 0.00 ? 102 ILE A HG13 4  
ATOM 7570  H HG21 . ILE A 1 102 ? 1.837   11.554  1.777   1.00 0.00 ? 102 ILE A HG21 4  
ATOM 7571  H HG22 . ILE A 1 102 ? 2.395   10.623  3.166   1.00 0.00 ? 102 ILE A HG22 4  
ATOM 7572  H HG23 . ILE A 1 102 ? 2.758   10.070  1.531   1.00 0.00 ? 102 ILE A HG23 4  
ATOM 7573  H HD11 . ILE A 1 102 ? -1.931  10.910  2.636   1.00 0.00 ? 102 ILE A HD11 4  
ATOM 7574  H HD12 . ILE A 1 102 ? -2.444  10.476  1.005   1.00 0.00 ? 102 ILE A HD12 4  
ATOM 7575  H HD13 . ILE A 1 102 ? -1.862  9.229   2.109   1.00 0.00 ? 102 ILE A HD13 4  
ATOM 7576  N N    . MET A 1 103 ? 3.356   7.883   1.790   1.00 0.00 ? 103 MET A N    4  
ATOM 7577  C CA   . MET A 1 103 ? 4.561   7.342   2.408   1.00 0.00 ? 103 MET A CA   4  
ATOM 7578  C C    . MET A 1 103 ? 5.612   8.432   2.593   1.00 0.00 ? 103 MET A C    4  
ATOM 7579  O O    . MET A 1 103 ? 6.331   8.779   1.657   1.00 0.00 ? 103 MET A O    4  
ATOM 7580  C CB   . MET A 1 103 ? 5.131   6.206   1.556   1.00 0.00 ? 103 MET A CB   4  
ATOM 7581  C CG   . MET A 1 103 ? 4.146   5.074   1.315   1.00 0.00 ? 103 MET A CG   4  
ATOM 7582  S SD   . MET A 1 103 ? 3.146   5.327   -0.164  1.00 0.00 ? 103 MET A SD   4  
ATOM 7583  C CE   . MET A 1 103 ? 2.150   3.839   -0.158  1.00 0.00 ? 103 MET A CE   4  
ATOM 7584  H H    . MET A 1 103 ? 3.432   8.376   0.946   1.00 0.00 ? 103 MET A H    4  
ATOM 7585  H HA   . MET A 1 103 ? 4.289   6.952   3.377   1.00 0.00 ? 103 MET A HA   4  
ATOM 7586  H HB2  . MET A 1 103 ? 5.430   6.605   0.599   1.00 0.00 ? 103 MET A HB2  4  
ATOM 7587  H HB3  . MET A 1 103 ? 5.999   5.799   2.054   1.00 0.00 ? 103 MET A HB3  4  
ATOM 7588  H HG2  . MET A 1 103 ? 4.697   4.152   1.205   1.00 0.00 ? 103 MET A HG2  4  
ATOM 7589  H HG3  . MET A 1 103 ? 3.489   4.999   2.169   1.00 0.00 ? 103 MET A HG3  4  
ATOM 7590  H HE1  . MET A 1 103 ? 1.133   4.085   -0.428  1.00 0.00 ? 103 MET A HE1  4  
ATOM 7591  H HE2  . MET A 1 103 ? 2.551   3.134   -0.871  1.00 0.00 ? 103 MET A HE2  4  
ATOM 7592  H HE3  . MET A 1 103 ? 2.164   3.400   0.829   1.00 0.00 ? 103 MET A HE3  4  
ATOM 7593  N N    . GLY A 1 104 ? 5.695   8.968   3.807   1.00 0.00 ? 104 GLY A N    4  
ATOM 7594  C CA   . GLY A 1 104 ? 6.661   10.013  4.092   1.00 0.00 ? 104 GLY A CA   4  
ATOM 7595  C C    . GLY A 1 104 ? 6.359   11.300  3.350   1.00 0.00 ? 104 GLY A C    4  
ATOM 7596  O O    . GLY A 1 104 ? 5.840   12.253  3.931   1.00 0.00 ? 104 GLY A O    4  
ATOM 7597  H H    . GLY A 1 104 ? 5.096   8.651   4.515   1.00 0.00 ? 104 GLY A H    4  
ATOM 7598  H HA2  . GLY A 1 104 ? 6.658   10.212  5.153   1.00 0.00 ? 104 GLY A HA2  4  
ATOM 7599  H HA3  . GLY A 1 104 ? 7.644   9.667   3.804   1.00 0.00 ? 104 GLY A HA3  4  
ATOM 7600  N N    . LYS A 1 105 ? 6.687   11.329  2.063   1.00 0.00 ? 105 LYS A N    4  
ATOM 7601  C CA   . LYS A 1 105 ? 6.448   12.509  1.239   1.00 0.00 ? 105 LYS A CA   4  
ATOM 7602  C C    . LYS A 1 105 ? 5.042   12.484  0.648   1.00 0.00 ? 105 LYS A C    4  
ATOM 7603  O O    . LYS A 1 105 ? 4.247   11.595  0.950   1.00 0.00 ? 105 LYS A O    4  
ATOM 7604  C CB   . LYS A 1 105 ? 7.484   12.589  0.115   1.00 0.00 ? 105 LYS A CB   4  
ATOM 7605  C CG   . LYS A 1 105 ? 8.799   13.217  0.543   1.00 0.00 ? 105 LYS A CG   4  
ATOM 7606  C CD   . LYS A 1 105 ? 8.768   14.729  0.397   1.00 0.00 ? 105 LYS A CD   4  
ATOM 7607  C CE   . LYS A 1 105 ? 8.093   15.391  1.589   1.00 0.00 ? 105 LYS A CE   4  
ATOM 7608  N NZ   . LYS A 1 105 ? 8.466   16.827  1.711   1.00 0.00 ? 105 LYS A NZ   4  
ATOM 7609  H H    . LYS A 1 105 ? 7.098   10.538  1.656   1.00 0.00 ? 105 LYS A H    4  
ATOM 7610  H HA   . LYS A 1 105 ? 6.545   13.379  1.870   1.00 0.00 ? 105 LYS A HA   4  
ATOM 7611  H HB2  . LYS A 1 105 ? 7.685   11.591  -0.245  1.00 0.00 ? 105 LYS A HB2  4  
ATOM 7612  H HB3  . LYS A 1 105 ? 7.074   13.178  -0.694  1.00 0.00 ? 105 LYS A HB3  4  
ATOM 7613  H HG2  . LYS A 1 105 ? 8.985   12.970  1.578   1.00 0.00 ? 105 LYS A HG2  4  
ATOM 7614  H HG3  . LYS A 1 105 ? 9.594   12.821  -0.072  1.00 0.00 ? 105 LYS A HG3  4  
ATOM 7615  H HD2  . LYS A 1 105 ? 9.781   15.095  0.323   1.00 0.00 ? 105 LYS A HD2  4  
ATOM 7616  H HD3  . LYS A 1 105 ? 8.224   14.984  -0.501  1.00 0.00 ? 105 LYS A HD3  4  
ATOM 7617  H HE2  . LYS A 1 105 ? 7.024   15.314  1.468   1.00 0.00 ? 105 LYS A HE2  4  
ATOM 7618  H HE3  . LYS A 1 105 ? 8.392   14.872  2.488   1.00 0.00 ? 105 LYS A HE3  4  
ATOM 7619  H HZ1  . LYS A 1 105 ? 9.293   17.033  1.115   1.00 0.00 ? 105 LYS A HZ1  4  
ATOM 7620  H HZ2  . LYS A 1 105 ? 8.699   17.053  2.699   1.00 0.00 ? 105 LYS A HZ2  4  
ATOM 7621  H HZ3  . LYS A 1 105 ? 7.675   17.429  1.407   1.00 0.00 ? 105 LYS A HZ3  4  
ATOM 7622  N N    . ASN A 1 106 ? 4.743   13.466  -0.197  1.00 0.00 ? 106 ASN A N    4  
ATOM 7623  C CA   . ASN A 1 106 ? 3.432   13.556  -0.831  1.00 0.00 ? 106 ASN A CA   4  
ATOM 7624  C C    . ASN A 1 106 ? 3.304   12.538  -1.960  1.00 0.00 ? 106 ASN A C    4  
ATOM 7625  O O    . ASN A 1 106 ? 2.902   12.878  -3.074  1.00 0.00 ? 106 ASN A O    4  
ATOM 7626  C CB   . ASN A 1 106 ? 3.201   14.968  -1.372  1.00 0.00 ? 106 ASN A CB   4  
ATOM 7627  C CG   . ASN A 1 106 ? 3.382   16.032  -0.308  1.00 0.00 ? 106 ASN A CG   4  
ATOM 7628  O OD1  . ASN A 1 106 ? 4.125   16.995  -0.498  1.00 0.00 ? 106 ASN A OD1  4  
ATOM 7629  N ND2  . ASN A 1 106 ? 2.702   15.863  0.820   1.00 0.00 ? 106 ASN A ND2  4  
ATOM 7630  H H    . ASN A 1 106 ? 5.419   14.146  -0.399  1.00 0.00 ? 106 ASN A H    4  
ATOM 7631  H HA   . ASN A 1 106 ? 2.686   13.340  -0.081  1.00 0.00 ? 106 ASN A HA   4  
ATOM 7632  H HB2  . ASN A 1 106 ? 3.904   15.160  -2.170  1.00 0.00 ? 106 ASN A HB2  4  
ATOM 7633  H HB3  . ASN A 1 106 ? 2.195   15.038  -1.759  1.00 0.00 ? 106 ASN A HB3  4  
ATOM 7634  H HD21 . ASN A 1 106 ? 2.130   15.071  0.902   1.00 0.00 ? 106 ASN A HD21 4  
ATOM 7635  H HD22 . ASN A 1 106 ? 2.801   16.536  1.525   1.00 0.00 ? 106 ASN A HD22 4  
ATOM 7636  N N    . HIS A 1 107 ? 3.646   11.288  -1.665  1.00 0.00 ? 107 HIS A N    4  
ATOM 7637  C CA   . HIS A 1 107 ? 3.568   10.220  -2.655  1.00 0.00 ? 107 HIS A CA   4  
ATOM 7638  C C    . HIS A 1 107 ? 2.392   9.293   -2.363  1.00 0.00 ? 107 HIS A C    4  
ATOM 7639  O O    . HIS A 1 107 ? 2.563   8.218   -1.788  1.00 0.00 ? 107 HIS A O    4  
ATOM 7640  C CB   . HIS A 1 107 ? 4.870   9.419   -2.677  1.00 0.00 ? 107 HIS A CB   4  
ATOM 7641  C CG   . HIS A 1 107 ? 6.017   10.157  -3.295  1.00 0.00 ? 107 HIS A CG   4  
ATOM 7642  N ND1  . HIS A 1 107 ? 5.900   10.897  -4.453  1.00 0.00 ? 107 HIS A ND1  4  
ATOM 7643  C CD2  . HIS A 1 107 ? 7.310   10.269  -2.908  1.00 0.00 ? 107 HIS A CD2  4  
ATOM 7644  C CE1  . HIS A 1 107 ? 7.071   11.430  -4.753  1.00 0.00 ? 107 HIS A CE1  4  
ATOM 7645  N NE2  . HIS A 1 107 ? 7.944   11.064  -3.831  1.00 0.00 ? 107 HIS A NE2  4  
ATOM 7646  H H    . HIS A 1 107 ? 3.959   11.079  -0.761  1.00 0.00 ? 107 HIS A H    4  
ATOM 7647  H HA   . HIS A 1 107 ? 3.420   10.675  -3.623  1.00 0.00 ? 107 HIS A HA   4  
ATOM 7648  H HB2  . HIS A 1 107 ? 5.146   9.166   -1.664  1.00 0.00 ? 107 HIS A HB2  4  
ATOM 7649  H HB3  . HIS A 1 107 ? 4.717   8.510   -3.241  1.00 0.00 ? 107 HIS A HB3  4  
ATOM 7650  H HD2  . HIS A 1 107 ? 7.760   9.816   -2.036  1.00 0.00 ? 107 HIS A HD2  4  
ATOM 7651  H HE1  . HIS A 1 107 ? 7.281   12.058  -5.606  1.00 0.00 ? 107 HIS A HE1  4  
ATOM 7652  H HE2  . HIS A 1 107 ? 8.905   11.250  -3.859  1.00 0.00 ? 107 HIS A HE2  4  
ATOM 7653  N N    . VAL A 1 108 ? 1.197   9.718   -2.761  1.00 0.00 ? 108 VAL A N    4  
ATOM 7654  C CA   . VAL A 1 108 ? -0.008  8.926   -2.542  1.00 0.00 ? 108 VAL A CA   4  
ATOM 7655  C C    . VAL A 1 108 ? -0.192  7.889   -3.645  1.00 0.00 ? 108 VAL A C    4  
ATOM 7656  O O    . VAL A 1 108 ? 0.224   8.098   -4.784  1.00 0.00 ? 108 VAL A O    4  
ATOM 7657  C CB   . VAL A 1 108 ? -1.262  9.818   -2.478  1.00 0.00 ? 108 VAL A CB   4  
ATOM 7658  C CG1  . VAL A 1 108 ? -2.326  9.181   -1.598  1.00 0.00 ? 108 VAL A CG1  4  
ATOM 7659  C CG2  . VAL A 1 108 ? -0.901  11.207  -1.972  1.00 0.00 ? 108 VAL A CG2  4  
ATOM 7660  H H    . VAL A 1 108 ? 1.124   10.584  -3.214  1.00 0.00 ? 108 VAL A H    4  
ATOM 7661  H HA   . VAL A 1 108 ? 0.095   8.417   -1.595  1.00 0.00 ? 108 VAL A HA   4  
ATOM 7662  H HB   . VAL A 1 108 ? -1.662  9.914   -3.476  1.00 0.00 ? 108 VAL A HB   4  
ATOM 7663  H HG11 . VAL A 1 108 ? -3.209  9.803   -1.593  1.00 0.00 ? 108 VAL A HG11 4  
ATOM 7664  H HG12 . VAL A 1 108 ? -2.575  8.203   -1.983  1.00 0.00 ? 108 VAL A HG12 4  
ATOM 7665  H HG13 . VAL A 1 108 ? -1.949  9.085   -0.590  1.00 0.00 ? 108 VAL A HG13 4  
ATOM 7666  H HG21 . VAL A 1 108 ? -1.696  11.579  -1.343  1.00 0.00 ? 108 VAL A HG21 4  
ATOM 7667  H HG22 . VAL A 1 108 ? 0.015   11.156  -1.403  1.00 0.00 ? 108 VAL A HG22 4  
ATOM 7668  H HG23 . VAL A 1 108 ? -0.766  11.873  -2.812  1.00 0.00 ? 108 VAL A HG23 4  
ATOM 7669  N N    . PHE A 1 109 ? -0.819  6.770   -3.298  1.00 0.00 ? 109 PHE A N    4  
ATOM 7670  C CA   . PHE A 1 109 ? -1.058  5.698   -4.258  1.00 0.00 ? 109 PHE A CA   4  
ATOM 7671  C C    . PHE A 1 109 ? -2.496  5.196   -4.165  1.00 0.00 ? 109 PHE A C    4  
ATOM 7672  O O    . PHE A 1 109 ? -3.065  5.108   -3.076  1.00 0.00 ? 109 PHE A O    4  
ATOM 7673  C CB   . PHE A 1 109 ? -0.085  4.542   -4.016  1.00 0.00 ? 109 PHE A CB   4  
ATOM 7674  C CG   . PHE A 1 109 ? 1.359   4.937   -4.141  1.00 0.00 ? 109 PHE A CG   4  
ATOM 7675  C CD1  . PHE A 1 109 ? 2.003   5.594   -3.105  1.00 0.00 ? 109 PHE A CD1  4  
ATOM 7676  C CD2  . PHE A 1 109 ? 2.072   4.652   -5.294  1.00 0.00 ? 109 PHE A CD2  4  
ATOM 7677  C CE1  . PHE A 1 109 ? 3.331   5.959   -3.217  1.00 0.00 ? 109 PHE A CE1  4  
ATOM 7678  C CE2  . PHE A 1 109 ? 3.400   5.015   -5.412  1.00 0.00 ? 109 PHE A CE2  4  
ATOM 7679  C CZ   . PHE A 1 109 ? 4.031   5.668   -4.372  1.00 0.00 ? 109 PHE A CZ   4  
ATOM 7680  H H    . PHE A 1 109 ? -1.127  6.661   -2.373  1.00 0.00 ? 109 PHE A H    4  
ATOM 7681  H HA   . PHE A 1 109 ? -0.892  6.097   -5.246  1.00 0.00 ? 109 PHE A HA   4  
ATOM 7682  H HB2  . PHE A 1 109 ? -0.238  4.155   -3.020  1.00 0.00 ? 109 PHE A HB2  4  
ATOM 7683  H HB3  . PHE A 1 109 ? -0.280  3.761   -4.736  1.00 0.00 ? 109 PHE A HB3  4  
ATOM 7684  H HD1  . PHE A 1 109 ? 1.457   5.821   -2.201  1.00 0.00 ? 109 PHE A HD1  4  
ATOM 7685  H HD2  . PHE A 1 109 ? 1.579   4.140   -6.109  1.00 0.00 ? 109 PHE A HD2  4  
ATOM 7686  H HE1  . PHE A 1 109 ? 3.822   6.470   -2.402  1.00 0.00 ? 109 PHE A HE1  4  
ATOM 7687  H HE2  . PHE A 1 109 ? 3.944   4.786   -6.317  1.00 0.00 ? 109 PHE A HE2  4  
ATOM 7688  H HZ   . PHE A 1 109 ? 5.068   5.953   -4.462  1.00 0.00 ? 109 PHE A HZ   4  
ATOM 7689  N N    . ARG A 1 110 ? -3.077  4.868   -5.314  1.00 0.00 ? 110 ARG A N    4  
ATOM 7690  C CA   . ARG A 1 110 ? -4.449  4.377   -5.363  1.00 0.00 ? 110 ARG A CA   4  
ATOM 7691  C C    . ARG A 1 110 ? -4.478  2.852   -5.416  1.00 0.00 ? 110 ARG A C    4  
ATOM 7692  O O    . ARG A 1 110 ? -4.066  2.247   -6.406  1.00 0.00 ? 110 ARG A O    4  
ATOM 7693  C CB   . ARG A 1 110 ? -5.176  4.954   -6.579  1.00 0.00 ? 110 ARG A CB   4  
ATOM 7694  C CG   . ARG A 1 110 ? -6.685  5.021   -6.410  1.00 0.00 ? 110 ARG A CG   4  
ATOM 7695  C CD   . ARG A 1 110 ? -7.287  6.157   -7.223  1.00 0.00 ? 110 ARG A CD   4  
ATOM 7696  N NE   . ARG A 1 110 ? -7.495  5.781   -8.619  1.00 0.00 ? 110 ARG A NE   4  
ATOM 7697  C CZ   . ARG A 1 110 ? -8.444  4.944   -9.020  1.00 0.00 ? 110 ARG A CZ   4  
ATOM 7698  N NH1  . ARG A 1 110 ? -9.270  4.399   -8.137  1.00 0.00 ? 110 ARG A NH1  4  
ATOM 7699  N NH2  . ARG A 1 110 ? -8.571  4.651   -10.308 1.00 0.00 ? 110 ARG A NH2  4  
ATOM 7700  H H    . ARG A 1 110 ? -2.572  4.960   -6.149  1.00 0.00 ? 110 ARG A H    4  
ATOM 7701  H HA   . ARG A 1 110 ? -4.951  4.704   -4.466  1.00 0.00 ? 110 ARG A HA   4  
ATOM 7702  H HB2  . ARG A 1 110 ? -4.812  5.954   -6.761  1.00 0.00 ? 110 ARG A HB2  4  
ATOM 7703  H HB3  . ARG A 1 110 ? -4.959  4.338   -7.439  1.00 0.00 ? 110 ARG A HB3  4  
ATOM 7704  H HG2  . ARG A 1 110 ? -7.118  4.089   -6.741  1.00 0.00 ? 110 ARG A HG2  4  
ATOM 7705  H HG3  . ARG A 1 110 ? -6.915  5.176   -5.366  1.00 0.00 ? 110 ARG A HG3  4  
ATOM 7706  H HD2  . ARG A 1 110 ? -8.237  6.430   -6.788  1.00 0.00 ? 110 ARG A HD2  4  
ATOM 7707  H HD3  . ARG A 1 110 ? -6.617  7.004   -7.183  1.00 0.00 ? 110 ARG A HD3  4  
ATOM 7708  H HE   . ARG A 1 110 ? -6.896  6.172   -9.288  1.00 0.00 ? 110 ARG A HE   4  
ATOM 7709  H HH11 . ARG A 1 110 ? -9.177  4.619   -7.166  1.00 0.00 ? 110 ARG A HH11 4  
ATOM 7710  H HH12 . ARG A 1 110 ? -9.985  3.770   -8.443  1.00 0.00 ? 110 ARG A HH12 4  
ATOM 7711  H HH21 . ARG A 1 110 ? -7.951  5.060   -10.977 1.00 0.00 ? 110 ARG A HH21 4  
ATOM 7712  H HH22 . ARG A 1 110 ? -9.286  4.021   -10.610 1.00 0.00 ? 110 ARG A HH22 4  
ATOM 7713  N N    . PHE A 1 111 ? -4.967  2.237   -4.344  1.00 0.00 ? 111 PHE A N    4  
ATOM 7714  C CA   . PHE A 1 111 ? -5.049  0.783   -4.268  1.00 0.00 ? 111 PHE A CA   4  
ATOM 7715  C C    . PHE A 1 111 ? -6.268  0.266   -5.025  1.00 0.00 ? 111 PHE A C    4  
ATOM 7716  O O    . PHE A 1 111 ? -7.407  0.494   -4.619  1.00 0.00 ? 111 PHE A O    4  
ATOM 7717  C CB   . PHE A 1 111 ? -5.112  0.331   -2.807  1.00 0.00 ? 111 PHE A CB   4  
ATOM 7718  C CG   . PHE A 1 111 ? -5.241  -1.157  -2.646  1.00 0.00 ? 111 PHE A CG   4  
ATOM 7719  C CD1  . PHE A 1 111 ? -4.228  -2.003  -3.066  1.00 0.00 ? 111 PHE A CD1  4  
ATOM 7720  C CD2  . PHE A 1 111 ? -6.376  -1.709  -2.074  1.00 0.00 ? 111 PHE A CD2  4  
ATOM 7721  C CE1  . PHE A 1 111 ? -4.343  -3.372  -2.918  1.00 0.00 ? 111 PHE A CE1  4  
ATOM 7722  C CE2  . PHE A 1 111 ? -6.496  -3.077  -1.923  1.00 0.00 ? 111 PHE A CE2  4  
ATOM 7723  C CZ   . PHE A 1 111 ? -5.479  -3.910  -2.347  1.00 0.00 ? 111 PHE A CZ   4  
ATOM 7724  H H    . PHE A 1 111 ? -5.280  2.775   -3.586  1.00 0.00 ? 111 PHE A H    4  
ATOM 7725  H HA   . PHE A 1 111 ? -4.158  0.378   -4.723  1.00 0.00 ? 111 PHE A HA   4  
ATOM 7726  H HB2  . PHE A 1 111 ? -4.210  0.642   -2.302  1.00 0.00 ? 111 PHE A HB2  4  
ATOM 7727  H HB3  . PHE A 1 111 ? -5.964  0.793   -2.332  1.00 0.00 ? 111 PHE A HB3  4  
ATOM 7728  H HD1  . PHE A 1 111 ? -3.338  -1.583  -3.513  1.00 0.00 ? 111 PHE A HD1  4  
ATOM 7729  H HD2  . PHE A 1 111 ? -7.173  -1.059  -1.743  1.00 0.00 ? 111 PHE A HD2  4  
ATOM 7730  H HE1  . PHE A 1 111 ? -3.545  -4.020  -3.250  1.00 0.00 ? 111 PHE A HE1  4  
ATOM 7731  H HE2  . PHE A 1 111 ? -7.386  -3.495  -1.476  1.00 0.00 ? 111 PHE A HE2  4  
ATOM 7732  H HZ   . PHE A 1 111 ? -5.571  -4.980  -2.230  1.00 0.00 ? 111 PHE A HZ   4  
ATOM 7733  N N    . ASN A 1 112 ? -6.020  -0.430  -6.130  1.00 0.00 ? 112 ASN A N    4  
ATOM 7734  C CA   . ASN A 1 112 ? -7.097  -0.979  -6.946  1.00 0.00 ? 112 ASN A CA   4  
ATOM 7735  C C    . ASN A 1 112 ? -7.252  -2.477  -6.705  1.00 0.00 ? 112 ASN A C    4  
ATOM 7736  O O    . ASN A 1 112 ? -6.330  -3.256  -6.949  1.00 0.00 ? 112 ASN A O    4  
ATOM 7737  C CB   . ASN A 1 112 ? -6.826  -0.715  -8.429  1.00 0.00 ? 112 ASN A CB   4  
ATOM 7738  C CG   . ASN A 1 112 ? -7.371  0.624   -8.886  1.00 0.00 ? 112 ASN A CG   4  
ATOM 7739  O OD1  . ASN A 1 112 ? -7.544  1.543   -8.085  1.00 0.00 ? 112 ASN A OD1  4  
ATOM 7740  N ND2  . ASN A 1 112 ? -7.646  0.740   -10.180 1.00 0.00 ? 112 ASN A ND2  4  
ATOM 7741  H H    . ASN A 1 112 ? -5.090  -0.579  -6.403  1.00 0.00 ? 112 ASN A H    4  
ATOM 7742  H HA   . ASN A 1 112 ? -8.013  -0.483  -6.662  1.00 0.00 ? 112 ASN A HA   4  
ATOM 7743  H HB2  . ASN A 1 112 ? -5.760  -0.725  -8.601  1.00 0.00 ? 112 ASN A HB2  4  
ATOM 7744  H HB3  . ASN A 1 112 ? -7.290  -1.492  -9.017  1.00 0.00 ? 112 ASN A HB3  4  
ATOM 7745  H HD21 . ASN A 1 112 ? -7.483  -0.033  -10.759 1.00 0.00 ? 112 ASN A HD21 4  
ATOM 7746  H HD22 . ASN A 1 112 ? -7.999  1.596   -10.503 1.00 0.00 ? 112 ASN A HD22 4  
ATOM 7747  N N    . HIS A 1 113 ? -8.427  -2.875  -6.225  1.00 0.00 ? 113 HIS A N    4  
ATOM 7748  C CA   . HIS A 1 113 ? -8.704  -4.280  -5.952  1.00 0.00 ? 113 HIS A CA   4  
ATOM 7749  C C    . HIS A 1 113 ? -9.950  -4.744  -6.701  1.00 0.00 ? 113 HIS A C    4  
ATOM 7750  O O    . HIS A 1 113 ? -11.038 -4.855  -6.137  1.00 0.00 ? 113 HIS A O    4  
ATOM 7751  C CB   . HIS A 1 113 ? -8.886  -4.504  -4.450  1.00 0.00 ? 113 HIS A CB   4  
ATOM 7752  C CG   . HIS A 1 113 ? -8.474  -5.870  -3.994  1.00 0.00 ? 113 HIS A CG   4  
ATOM 7753  N ND1  . HIS A 1 113 ? -8.717  -7.013  -4.726  1.00 0.00 ? 113 HIS A ND1  4  
ATOM 7754  C CD2  . HIS A 1 113 ? -7.831  -6.272  -2.873  1.00 0.00 ? 113 HIS A CD2  4  
ATOM 7755  C CE1  . HIS A 1 113 ? -8.243  -8.059  -4.074  1.00 0.00 ? 113 HIS A CE1  4  
ATOM 7756  N NE2  . HIS A 1 113 ? -7.700  -7.637  -2.947  1.00 0.00 ? 113 HIS A NE2  4  
ATOM 7757  H H    . HIS A 1 113 ? -9.122  -2.207  -6.050  1.00 0.00 ? 113 HIS A H    4  
ATOM 7758  H HA   . HIS A 1 113 ? -7.859  -4.858  -6.293  1.00 0.00 ? 113 HIS A HA   4  
ATOM 7759  H HB2  . HIS A 1 113 ? -8.291  -3.781  -3.911  1.00 0.00 ? 113 HIS A HB2  4  
ATOM 7760  H HB3  . HIS A 1 113 ? -9.927  -4.368  -4.196  1.00 0.00 ? 113 HIS A HB3  4  
ATOM 7761  H HD2  . HIS A 1 113 ? -7.485  -5.638  -2.068  1.00 0.00 ? 113 HIS A HD2  4  
ATOM 7762  H HE1  . HIS A 1 113 ? -8.290  -9.086  -4.406  1.00 0.00 ? 113 HIS A HE1  4  
ATOM 7763  H HE2  . HIS A 1 113 ? -7.351  -8.215  -2.237  1.00 0.00 ? 113 HIS A HE2  4  
ATOM 7764  N N    . PRO A 1 114 ? -9.789  -5.020  -8.004  1.00 0.00 ? 114 PRO A N    4  
ATOM 7765  C CA   . PRO A 1 114 ? -10.890 -5.475  -8.858  1.00 0.00 ? 114 PRO A CA   4  
ATOM 7766  C C    . PRO A 1 114 ? -11.344 -6.889  -8.515  1.00 0.00 ? 114 PRO A C    4  
ATOM 7767  O O    . PRO A 1 114 ? -12.535 -7.195  -8.556  1.00 0.00 ? 114 PRO A O    4  
ATOM 7768  C CB   . PRO A 1 114 ? -10.287 -5.434  -10.265 1.00 0.00 ? 114 PRO A CB   4  
ATOM 7769  C CG   . PRO A 1 114 ? -8.820  -5.583  -10.053 1.00 0.00 ? 114 PRO A CG   4  
ATOM 7770  C CD   . PRO A 1 114 ? -8.520  -4.909  -8.743  1.00 0.00 ? 114 PRO A CD   4  
ATOM 7771  H HA   . PRO A 1 114 ? -11.735 -4.804  -8.808  1.00 0.00 ? 114 PRO A HA   4  
ATOM 7772  H HB2  . PRO A 1 114 ? -10.687 -6.247  -10.854 1.00 0.00 ? 114 PRO A HB2  4  
ATOM 7773  H HB3  . PRO A 1 114 ? -10.524 -4.491  -10.735 1.00 0.00 ? 114 PRO A HB3  4  
ATOM 7774  H HG2  . PRO A 1 114 ? -8.561  -6.630  -10.004 1.00 0.00 ? 114 PRO A HG2  4  
ATOM 7775  H HG3  . PRO A 1 114 ? -8.282  -5.099  -10.855 1.00 0.00 ? 114 PRO A HG3  4  
ATOM 7776  H HD2  . PRO A 1 114 ? -7.726  -5.427  -8.225  1.00 0.00 ? 114 PRO A HD2  4  
ATOM 7777  H HD3  . PRO A 1 114 ? -8.257  -3.874  -8.903  1.00 0.00 ? 114 PRO A HD3  4  
ATOM 7778  N N    . GLU A 1 115 ? -10.387 -7.747  -8.175  1.00 0.00 ? 115 GLU A N    4  
ATOM 7779  C CA   . GLU A 1 115 ? -10.691 -9.129  -7.824  1.00 0.00 ? 115 GLU A CA   4  
ATOM 7780  C C    . GLU A 1 115 ? -11.721 -9.192  -6.700  1.00 0.00 ? 115 GLU A C    4  
ATOM 7781  O O    . GLU A 1 115 ? -12.798 -9.763  -6.864  1.00 0.00 ? 115 GLU A O    4  
ATOM 7782  C CB   . GLU A 1 115 ? -9.416  -9.864  -7.404  1.00 0.00 ? 115 GLU A CB   4  
ATOM 7783  C CG   . GLU A 1 115 ? -9.446  -11.354 -7.702  1.00 0.00 ? 115 GLU A CG   4  
ATOM 7784  C CD   . GLU A 1 115 ? -10.071 -12.161 -6.580  1.00 0.00 ? 115 GLU A CD   4  
ATOM 7785  O OE1  . GLU A 1 115 ? -10.924 -11.608 -5.856  1.00 0.00 ? 115 GLU A OE1  4  
ATOM 7786  O OE2  . GLU A 1 115 ? -9.706  -13.345 -6.428  1.00 0.00 ? 115 GLU A OE2  4  
ATOM 7787  H H    . GLU A 1 115 ? -9.456  -7.444  -8.161  1.00 0.00 ? 115 GLU A H    4  
ATOM 7788  H HA   . GLU A 1 115 ? -11.101 -9.611  -8.699  1.00 0.00 ? 115 GLU A HA   4  
ATOM 7789  H HB2  . GLU A 1 115 ? -8.576  -9.430  -7.927  1.00 0.00 ? 115 GLU A HB2  4  
ATOM 7790  H HB3  . GLU A 1 115 ? -9.274  -9.734  -6.342  1.00 0.00 ? 115 GLU A HB3  4  
ATOM 7791  H HG2  . GLU A 1 115 ? -10.018 -11.517 -8.603  1.00 0.00 ? 115 GLU A HG2  4  
ATOM 7792  H HG3  . GLU A 1 115 ? -8.434  -11.698 -7.853  1.00 0.00 ? 115 GLU A HG3  4  
ATOM 7793  N N    . GLN A 1 116 ? -11.380 -8.601  -5.560  1.00 0.00 ? 116 GLN A N    4  
ATOM 7794  C CA   . GLN A 1 116 ? -12.274 -8.590  -4.408  1.00 0.00 ? 116 GLN A CA   4  
ATOM 7795  C C    . GLN A 1 116 ? -13.540 -7.795  -4.709  1.00 0.00 ? 116 GLN A C    4  
ATOM 7796  O O    . GLN A 1 116 ? -14.638 -8.186  -4.316  1.00 0.00 ? 116 GLN A O    4  
ATOM 7797  C CB   . GLN A 1 116 ? -11.563 -7.999  -3.189  1.00 0.00 ? 116 GLN A CB   4  
ATOM 7798  C CG   . GLN A 1 116 ? -12.491 -7.730  -2.015  1.00 0.00 ? 116 GLN A CG   4  
ATOM 7799  C CD   . GLN A 1 116 ? -11.740 -7.352  -0.753  1.00 0.00 ? 116 GLN A CD   4  
ATOM 7800  O OE1  . GLN A 1 116 ? -12.237 -7.539  0.358   1.00 0.00 ? 116 GLN A OE1  4  
ATOM 7801  N NE2  . GLN A 1 116 ? -10.536 -6.817  -0.918  1.00 0.00 ? 116 GLN A NE2  4  
ATOM 7802  H H    . GLN A 1 116 ? -10.507 -8.162  -5.491  1.00 0.00 ? 116 GLN A H    4  
ATOM 7803  H HA   . GLN A 1 116 ? -12.548 -9.612  -4.192  1.00 0.00 ? 116 GLN A HA   4  
ATOM 7804  H HB2  . GLN A 1 116 ? -10.797 -8.687  -2.865  1.00 0.00 ? 116 GLN A HB2  4  
ATOM 7805  H HB3  . GLN A 1 116 ? -11.100 -7.066  -3.475  1.00 0.00 ? 116 GLN A HB3  4  
ATOM 7806  H HG2  . GLN A 1 116 ? -13.155 -6.920  -2.276  1.00 0.00 ? 116 GLN A HG2  4  
ATOM 7807  H HG3  . GLN A 1 116 ? -13.070 -8.620  -1.820  1.00 0.00 ? 116 GLN A HG3  4  
ATOM 7808  H HE21 . GLN A 1 116 ? -10.205 -6.696  -1.833  1.00 0.00 ? 116 GLN A HE21 4  
ATOM 7809  H HE22 . GLN A 1 116 ? -10.030 -6.563  -0.120  1.00 0.00 ? 116 GLN A HE22 4  
ATOM 7810  N N    . ALA A 1 117 ? -13.377 -6.676  -5.408  1.00 0.00 ? 117 ALA A N    4  
ATOM 7811  C CA   . ALA A 1 117 ? -14.507 -5.826  -5.762  1.00 0.00 ? 117 ALA A CA   4  
ATOM 7812  C C    . ALA A 1 117 ? -15.571 -6.615  -6.519  1.00 0.00 ? 117 ALA A C    4  
ATOM 7813  O O    . ALA A 1 117 ? -16.754 -6.277  -6.478  1.00 0.00 ? 117 ALA A O    4  
ATOM 7814  C CB   . ALA A 1 117 ? -14.036 -4.641  -6.592  1.00 0.00 ? 117 ALA A CB   4  
ATOM 7815  H H    . ALA A 1 117 ? -12.477 -6.417  -5.692  1.00 0.00 ? 117 ALA A H    4  
ATOM 7816  H HA   . ALA A 1 117 ? -14.939 -5.445  -4.848  1.00 0.00 ? 117 ALA A HA   4  
ATOM 7817  H HB1  . ALA A 1 117 ? -13.163 -4.924  -7.159  1.00 0.00 ? 117 ALA A HB1  4  
ATOM 7818  H HB2  . ALA A 1 117 ? -14.824 -4.340  -7.268  1.00 0.00 ? 117 ALA A HB2  4  
ATOM 7819  H HB3  . ALA A 1 117 ? -13.790 -3.818  -5.937  1.00 0.00 ? 117 ALA A HB3  4  
ATOM 7820  N N    . ARG A 1 118 ? -15.142 -7.666  -7.210  1.00 0.00 ? 118 ARG A N    4  
ATOM 7821  C CA   . ARG A 1 118 ? -16.057 -8.501  -7.978  1.00 0.00 ? 118 ARG A CA   4  
ATOM 7822  C C    . ARG A 1 118 ? -17.157 -9.066  -7.084  1.00 0.00 ? 118 ARG A C    4  
ATOM 7823  O O    . ARG A 1 118 ? -18.244 -9.398  -7.555  1.00 0.00 ? 118 ARG A O    4  
ATOM 7824  C CB   . ARG A 1 118 ? -15.296 -9.644  -8.652  1.00 0.00 ? 118 ARG A CB   4  
ATOM 7825  C CG   . ARG A 1 118 ? -15.187 -10.893 -7.793  1.00 0.00 ? 118 ARG A CG   4  
ATOM 7826  C CD   . ARG A 1 118 ? -14.187 -11.882 -8.372  1.00 0.00 ? 118 ARG A CD   4  
ATOM 7827  N NE   . ARG A 1 118 ? -14.328 -13.210 -7.782  1.00 0.00 ? 118 ARG A NE   4  
ATOM 7828  C CZ   . ARG A 1 118 ? -13.456 -14.195 -7.972  1.00 0.00 ? 118 ARG A CZ   4  
ATOM 7829  N NH1  . ARG A 1 118 ? -12.386 -14.000 -8.731  1.00 0.00 ? 118 ARG A NH1  4  
ATOM 7830  N NH2  . ARG A 1 118 ? -13.653 -15.376 -7.402  1.00 0.00 ? 118 ARG A NH2  4  
ATOM 7831  H H    . ARG A 1 118 ? -14.186 -7.884  -7.204  1.00 0.00 ? 118 ARG A H    4  
ATOM 7832  H HA   . ARG A 1 118 ? -16.510 -7.884  -8.739  1.00 0.00 ? 118 ARG A HA   4  
ATOM 7833  H HB2  . ARG A 1 118 ? -15.802 -9.907  -9.569  1.00 0.00 ? 118 ARG A HB2  4  
ATOM 7834  H HB3  . ARG A 1 118 ? -14.298 -9.306  -8.886  1.00 0.00 ? 118 ARG A HB3  4  
ATOM 7835  H HG2  . ARG A 1 118 ? -14.864 -10.610 -6.802  1.00 0.00 ? 118 ARG A HG2  4  
ATOM 7836  H HG3  . ARG A 1 118 ? -16.156 -11.365 -7.737  1.00 0.00 ? 118 ARG A HG3  4  
ATOM 7837  H HD2  . ARG A 1 118 ? -14.347 -11.952 -9.437  1.00 0.00 ? 118 ARG A HD2  4  
ATOM 7838  H HD3  . ARG A 1 118 ? -13.189 -11.517 -8.181  1.00 0.00 ? 118 ARG A HD3  4  
ATOM 7839  H HE   . ARG A 1 118 ? -15.111 -13.376 -7.218  1.00 0.00 ? 118 ARG A HE   4  
ATOM 7840  H HH11 . ARG A 1 118 ? -12.235 -13.110 -9.162  1.00 0.00 ? 118 ARG A HH11 4  
ATOM 7841  H HH12 . ARG A 1 118 ? -11.731 -14.742 -8.872  1.00 0.00 ? 118 ARG A HH12 4  
ATOM 7842  H HH21 . ARG A 1 118 ? -14.458 -15.527 -6.829  1.00 0.00 ? 118 ARG A HH21 4  
ATOM 7843  H HH22 . ARG A 1 118 ? -12.996 -16.116 -7.546  1.00 0.00 ? 118 ARG A HH22 4  
ATOM 7844  N N    . ALA A 1 119 ? -16.866 -9.172  -5.792  1.00 0.00 ? 119 ALA A N    4  
ATOM 7845  C CA   . ALA A 1 119 ? -17.830 -9.695  -4.832  1.00 0.00 ? 119 ALA A CA   4  
ATOM 7846  C C    . ALA A 1 119 ? -18.657 -8.571  -4.216  1.00 0.00 ? 119 ALA A C    4  
ATOM 7847  O O    . ALA A 1 119 ? -19.858 -8.722  -3.996  1.00 0.00 ? 119 ALA A O    4  
ATOM 7848  C CB   . ALA A 1 119 ? -17.117 -10.484 -3.744  1.00 0.00 ? 119 ALA A CB   4  
ATOM 7849  H H    . ALA A 1 119 ? -15.982 -8.890  -5.476  1.00 0.00 ? 119 ALA A H    4  
ATOM 7850  H HA   . ALA A 1 119 ? -18.492 -10.369 -5.357  1.00 0.00 ? 119 ALA A HA   4  
ATOM 7851  H HB1  . ALA A 1 119 ? -17.276 -11.540 -3.903  1.00 0.00 ? 119 ALA A HB1  4  
ATOM 7852  H HB2  . ALA A 1 119 ? -16.059 -10.270 -3.780  1.00 0.00 ? 119 ALA A HB2  4  
ATOM 7853  H HB3  . ALA A 1 119 ? -17.510 -10.202 -2.779  1.00 0.00 ? 119 ALA A HB3  4  
ATOM 7854  N N    . GLU A 1 120 ? -18.006 -7.445  -3.942  1.00 0.00 ? 120 GLU A N    4  
ATOM 7855  C CA   . GLU A 1 120 ? -18.682 -6.297  -3.350  1.00 0.00 ? 120 GLU A CA   4  
ATOM 7856  C C    . GLU A 1 120 ? -19.955 -5.959  -4.121  1.00 0.00 ? 120 GLU A C    4  
ATOM 7857  O O    . GLU A 1 120 ? -21.011 -5.733  -3.529  1.00 0.00 ? 120 GLU A O    4  
ATOM 7858  C CB   . GLU A 1 120 ? -17.750 -5.084  -3.326  1.00 0.00 ? 120 GLU A CB   4  
ATOM 7859  C CG   . GLU A 1 120 ? -16.622 -5.203  -2.315  1.00 0.00 ? 120 GLU A CG   4  
ATOM 7860  C CD   . GLU A 1 120 ? -17.111 -5.111  -0.882  1.00 0.00 ? 120 GLU A CD   4  
ATOM 7861  O OE1  . GLU A 1 120 ? -17.308 -3.978  -0.396  1.00 0.00 ? 120 GLU A OE1  4  
ATOM 7862  O OE2  . GLU A 1 120 ? -17.296 -6.171  -0.248  1.00 0.00 ? 120 GLU A OE2  4  
ATOM 7863  H H    . GLU A 1 120 ? -17.048 -7.386  -4.141  1.00 0.00 ? 120 GLU A H    4  
ATOM 7864  H HA   . GLU A 1 120 ? -18.948 -6.555  -2.336  1.00 0.00 ? 120 GLU A HA   4  
ATOM 7865  H HB2  . GLU A 1 120 ? -17.315 -4.960  -4.307  1.00 0.00 ? 120 GLU A HB2  4  
ATOM 7866  H HB3  . GLU A 1 120 ? -18.329 -4.205  -3.085  1.00 0.00 ? 120 GLU A HB3  4  
ATOM 7867  H HG2  . GLU A 1 120 ? -16.133 -6.156  -2.451  1.00 0.00 ? 120 GLU A HG2  4  
ATOM 7868  H HG3  . GLU A 1 120 ? -15.913 -4.408  -2.490  1.00 0.00 ? 120 GLU A HG3  4  
ATOM 7869  N N    . ARG A 1 121 ? -19.846 -5.925  -5.445  1.00 0.00 ? 121 ARG A N    4  
ATOM 7870  C CA   . ARG A 1 121 ? -20.987 -5.613  -6.298  1.00 0.00 ? 121 ARG A CA   4  
ATOM 7871  C C    . ARG A 1 121 ? -22.130 -6.595  -6.059  1.00 0.00 ? 121 ARG A C    4  
ATOM 7872  O O    . ARG A 1 121 ? -23.302 -6.235  -6.160  1.00 0.00 ? 121 ARG A O    4  
ATOM 7873  C CB   . ARG A 1 121 ? -20.574 -5.643  -7.770  1.00 0.00 ? 121 ARG A CB   4  
ATOM 7874  C CG   . ARG A 1 121 ? -20.256 -7.037  -8.285  1.00 0.00 ? 121 ARG A CG   4  
ATOM 7875  C CD   . ARG A 1 121 ? -19.847 -7.010  -9.750  1.00 0.00 ? 121 ARG A CD   4  
ATOM 7876  N NE   . ARG A 1 121 ? -19.916 -8.334  -10.362 1.00 0.00 ? 121 ARG A NE   4  
ATOM 7877  C CZ   . ARG A 1 121 ? -19.679 -8.562  -11.649 1.00 0.00 ? 121 ARG A CZ   4  
ATOM 7878  N NH1  . ARG A 1 121 ? -19.357 -7.560  -12.455 1.00 0.00 ? 121 ARG A NH1  4  
ATOM 7879  N NH2  . ARG A 1 121 ? -19.762 -9.795  -12.132 1.00 0.00 ? 121 ARG A NH2  4  
ATOM 7880  H H    . ARG A 1 121 ? -18.978 -6.114  -5.859  1.00 0.00 ? 121 ARG A H    4  
ATOM 7881  H HA   . ARG A 1 121 ? -21.325 -4.618  -6.048  1.00 0.00 ? 121 ARG A HA   4  
ATOM 7882  H HB2  . ARG A 1 121 ? -21.378 -5.237  -8.366  1.00 0.00 ? 121 ARG A HB2  4  
ATOM 7883  H HB3  . ARG A 1 121 ? -19.696 -5.027  -7.898  1.00 0.00 ? 121 ARG A HB3  4  
ATOM 7884  H HG2  . ARG A 1 121 ? -19.445 -7.450  -7.704  1.00 0.00 ? 121 ARG A HG2  4  
ATOM 7885  H HG3  . ARG A 1 121 ? -21.132 -7.659  -8.177  1.00 0.00 ? 121 ARG A HG3  4  
ATOM 7886  H HD2  . ARG A 1 121 ? -20.508 -6.343  -10.282 1.00 0.00 ? 121 ARG A HD2  4  
ATOM 7887  H HD3  . ARG A 1 121 ? -18.833 -6.644  -9.819  1.00 0.00 ? 121 ARG A HD3  4  
ATOM 7888  H HE   . ARG A 1 121 ? -20.153 -9.089  -9.784  1.00 0.00 ? 121 ARG A HE   4  
ATOM 7889  H HH11 . ARG A 1 121 ? -19.292 -6.630  -12.093 1.00 0.00 ? 121 ARG A HH11 4  
ATOM 7890  H HH12 . ARG A 1 121 ? -19.177 -7.734  -13.423 1.00 0.00 ? 121 ARG A HH12 4  
ATOM 7891  H HH21 . ARG A 1 121 ? -20.004 -10.554 -11.527 1.00 0.00 ? 121 ARG A HH21 4  
ATOM 7892  H HH22 . ARG A 1 121 ? -19.583 -9.966  -13.100 1.00 0.00 ? 121 ARG A HH22 4  
ATOM 7893  N N    . GLU A 1 122 ? -21.778 -7.838  -5.742  1.00 0.00 ? 122 GLU A N    4  
ATOM 7894  C CA   . GLU A 1 122 ? -22.775 -8.872  -5.491  1.00 0.00 ? 122 GLU A CA   4  
ATOM 7895  C C    . GLU A 1 122 ? -23.314 -8.773  -4.066  1.00 0.00 ? 122 GLU A C    4  
ATOM 7896  O O    . GLU A 1 122 ? -24.096 -9.617  -3.626  1.00 0.00 ? 122 GLU A O    4  
ATOM 7897  C CB   . GLU A 1 122 ? -22.173 -10.259 -5.724  1.00 0.00 ? 122 GLU A CB   4  
ATOM 7898  C CG   . GLU A 1 122 ? -21.977 -10.598 -7.193  1.00 0.00 ? 122 GLU A CG   4  
ATOM 7899  C CD   . GLU A 1 122 ? -23.287 -10.864 -7.910  1.00 0.00 ? 122 GLU A CD   4  
ATOM 7900  O OE1  . GLU A 1 122 ? -24.327 -10.963 -7.226  1.00 0.00 ? 122 GLU A OE1  4  
ATOM 7901  O OE2  . GLU A 1 122 ? -23.271 -10.974 -9.153  1.00 0.00 ? 122 GLU A OE2  4  
ATOM 7902  H H    . GLU A 1 122 ? -20.827 -8.064  -5.677  1.00 0.00 ? 122 GLU A H    4  
ATOM 7903  H HA   . GLU A 1 122 ? -23.590 -8.723  -6.182  1.00 0.00 ? 122 GLU A HA   4  
ATOM 7904  H HB2  . GLU A 1 122 ? -21.212 -10.309 -5.233  1.00 0.00 ? 122 GLU A HB2  4  
ATOM 7905  H HB3  . GLU A 1 122 ? -22.828 -11.000 -5.290  1.00 0.00 ? 122 GLU A HB3  4  
ATOM 7906  H HG2  . GLU A 1 122 ? -21.481 -9.770  -7.677  1.00 0.00 ? 122 GLU A HG2  4  
ATOM 7907  H HG3  . GLU A 1 122 ? -21.358 -11.480 -7.266  1.00 0.00 ? 122 GLU A HG3  4  
ATOM 7908  N N    . LYS A 1 123 ? -22.891 -7.737  -3.350  1.00 0.00 ? 123 LYS A N    4  
ATOM 7909  C CA   . LYS A 1 123 ? -23.330 -7.526  -1.976  1.00 0.00 ? 123 LYS A CA   4  
ATOM 7910  C C    . LYS A 1 123 ? -24.826 -7.786  -1.837  1.00 0.00 ? 123 LYS A C    4  
ATOM 7911  O O    . LYS A 1 123 ? -25.252 -8.598  -1.015  1.00 0.00 ? 123 LYS A O    4  
ATOM 7912  C CB   . LYS A 1 123 ? -23.006 -6.098  -1.530  1.00 0.00 ? 123 LYS A CB   4  
ATOM 7913  C CG   . LYS A 1 123 ? -23.520 -5.032  -2.482  1.00 0.00 ? 123 LYS A CG   4  
ATOM 7914  C CD   . LYS A 1 123 ? -22.816 -3.703  -2.263  1.00 0.00 ? 123 LYS A CD   4  
ATOM 7915  C CE   . LYS A 1 123 ? -23.286 -3.026  -0.985  1.00 0.00 ? 123 LYS A CE   4  
ATOM 7916  N NZ   . LYS A 1 123 ? -23.138 -1.546  -1.055  1.00 0.00 ? 123 LYS A NZ   4  
ATOM 7917  H H    . LYS A 1 123 ? -22.267 -7.098  -3.757  1.00 0.00 ? 123 LYS A H    4  
ATOM 7918  H HA   . LYS A 1 123 ? -22.796 -8.220  -1.346  1.00 0.00 ? 123 LYS A HA   4  
ATOM 7919  H HB2  . LYS A 1 123 ? -23.448 -5.928  -0.559  1.00 0.00 ? 123 LYS A HB2  4  
ATOM 7920  H HB3  . LYS A 1 123 ? -21.934 -5.993  -1.451  1.00 0.00 ? 123 LYS A HB3  4  
ATOM 7921  H HG2  . LYS A 1 123 ? -23.349 -5.355  -3.497  1.00 0.00 ? 123 LYS A HG2  4  
ATOM 7922  H HG3  . LYS A 1 123 ? -24.580 -4.898  -2.319  1.00 0.00 ? 123 LYS A HG3  4  
ATOM 7923  H HD2  . LYS A 1 123 ? -21.752 -3.876  -2.195  1.00 0.00 ? 123 LYS A HD2  4  
ATOM 7924  H HD3  . LYS A 1 123 ? -23.024 -3.054  -3.102  1.00 0.00 ? 123 LYS A HD3  4  
ATOM 7925  H HE2  . LYS A 1 123 ? -24.326 -3.268  -0.827  1.00 0.00 ? 123 LYS A HE2  4  
ATOM 7926  H HE3  . LYS A 1 123 ? -22.700 -3.400  -0.159  1.00 0.00 ? 123 LYS A HE3  4  
ATOM 7927  H HZ1  . LYS A 1 123 ? -24.015 -1.115  -1.408  1.00 0.00 ? 123 LYS A HZ1  4  
ATOM 7928  H HZ2  . LYS A 1 123 ? -22.358 -1.295  -1.696  1.00 0.00 ? 123 LYS A HZ2  4  
ATOM 7929  H HZ3  . LYS A 1 123 ? -22.931 -1.163  -0.110  1.00 0.00 ? 123 LYS A HZ3  4  
ATOM 7930  N N    . THR A 1 124 ? -25.621 -7.093  -2.647  1.00 0.00 ? 124 THR A N    4  
ATOM 7931  C CA   . THR A 1 124 ? -27.069 -7.249  -2.614  1.00 0.00 ? 124 THR A CA   4  
ATOM 7932  C C    . THR A 1 124 ? -27.533 -8.291  -3.625  1.00 0.00 ? 124 THR A C    4  
ATOM 7933  O O    . THR A 1 124 ? -27.537 -8.042  -4.831  1.00 0.00 ? 124 THR A O    4  
ATOM 7934  C CB   . THR A 1 124 ? -27.785 -5.916  -2.903  1.00 0.00 ? 124 THR A CB   4  
ATOM 7935  O OG1  . THR A 1 124 ? -27.138 -5.237  -3.986  1.00 0.00 ? 124 THR A OG1  4  
ATOM 7936  C CG2  . THR A 1 124 ? -27.790 -5.026  -1.670  1.00 0.00 ? 124 THR A CG2  4  
ATOM 7937  H H    . THR A 1 124 ? -25.222 -6.460  -3.280  1.00 0.00 ? 124 THR A H    4  
ATOM 7938  H HA   . THR A 1 124 ? -27.347 -7.575  -1.622  1.00 0.00 ? 124 THR A HA   4  
ATOM 7939  H HB   . THR A 1 124 ? -28.808 -6.127  -3.181  1.00 0.00 ? 124 THR A HB   4  
ATOM 7940  H HG1  . THR A 1 124 ? -27.419 -4.319  -4.001  1.00 0.00 ? 124 THR A HG1  4  
ATOM 7941  H HG21 . THR A 1 124 ? -27.420 -4.046  -1.933  1.00 0.00 ? 124 THR A HG21 4  
ATOM 7942  H HG22 . THR A 1 124 ? -27.154 -5.458  -0.911  1.00 0.00 ? 124 THR A HG22 4  
ATOM 7943  H HG23 . THR A 1 124 ? -28.797 -4.941  -1.291  1.00 0.00 ? 124 THR A HG23 4  
ATOM 7944  N N    . SER A 1 125 ? -27.924 -9.460  -3.127  1.00 0.00 ? 125 SER A N    4  
ATOM 7945  C CA   . SER A 1 125 ? -28.386 -10.542 -3.988  1.00 0.00 ? 125 SER A CA   4  
ATOM 7946  C C    . SER A 1 125 ? -29.910 -10.561 -4.066  1.00 0.00 ? 125 SER A C    4  
ATOM 7947  O O    . SER A 1 125 ? -30.585 -10.992 -3.133  1.00 0.00 ? 125 SER A O    4  
ATOM 7948  C CB   . SER A 1 125 ? -27.874 -11.888 -3.472  1.00 0.00 ? 125 SER A CB   4  
ATOM 7949  O OG   . SER A 1 125 ? -28.583 -12.292 -2.313  1.00 0.00 ? 125 SER A OG   4  
ATOM 7950  H H    . SER A 1 125 ? -27.897 -9.598  -2.157  1.00 0.00 ? 125 SER A H    4  
ATOM 7951  H HA   . SER A 1 125 ? -27.989 -10.371 -4.978  1.00 0.00 ? 125 SER A HA   4  
ATOM 7952  H HB2  . SER A 1 125 ? -28.003 -12.637 -4.238  1.00 0.00 ? 125 SER A HB2  4  
ATOM 7953  H HB3  . SER A 1 125 ? -26.826 -11.801 -3.226  1.00 0.00 ? 125 SER A HB3  4  
ATOM 7954  H HG   . SER A 1 125 ? -28.119 -11.986 -1.531  1.00 0.00 ? 125 SER A HG   4  
ATOM 7955  N N    . GLY A 1 126 ? -30.445 -10.089 -5.188  1.00 0.00 ? 126 GLY A N    4  
ATOM 7956  C CA   . GLY A 1 126 ? -31.885 -10.059 -5.368  1.00 0.00 ? 126 GLY A CA   4  
ATOM 7957  C C    . GLY A 1 126 ? -32.298 -10.397 -6.787  1.00 0.00 ? 126 GLY A C    4  
ATOM 7958  O O    . GLY A 1 126 ? -33.152 -9.738  -7.381  1.00 0.00 ? 126 GLY A O    4  
ATOM 7959  H H    . GLY A 1 126 ? -29.857 -9.758  -5.899  1.00 0.00 ? 126 GLY A H    4  
ATOM 7960  H HA2  . GLY A 1 126 ? -32.336 -10.771 -4.694  1.00 0.00 ? 126 GLY A HA2  4  
ATOM 7961  H HA3  . GLY A 1 126 ? -32.246 -9.070  -5.126  1.00 0.00 ? 126 GLY A HA3  4  
ATOM 7962  N N    . PRO A 1 127 ? -31.684 -11.446 -7.353  1.00 0.00 ? 127 PRO A N    4  
ATOM 7963  C CA   . PRO A 1 127 ? -31.976 -11.894 -8.718  1.00 0.00 ? 127 PRO A CA   4  
ATOM 7964  C C    . PRO A 1 127 ? -33.363 -12.516 -8.839  1.00 0.00 ? 127 PRO A C    4  
ATOM 7965  O O    . PRO A 1 127 ? -33.778 -12.922 -9.925  1.00 0.00 ? 127 PRO A O    4  
ATOM 7966  C CB   . PRO A 1 127 ? -30.894 -12.942 -8.987  1.00 0.00 ? 127 PRO A CB   4  
ATOM 7967  C CG   . PRO A 1 127 ? -30.511 -13.446 -7.638  1.00 0.00 ? 127 PRO A CG   4  
ATOM 7968  C CD   . PRO A 1 127 ? -30.656 -12.278 -6.703  1.00 0.00 ? 127 PRO A CD   4  
ATOM 7969  H HA   . PRO A 1 127 ? -31.882 -11.086 -9.429  1.00 0.00 ? 127 PRO A HA   4  
ATOM 7970  H HB2  . PRO A 1 127 ? -31.300 -13.732 -9.604  1.00 0.00 ? 127 PRO A HB2  4  
ATOM 7971  H HB3  . PRO A 1 127 ? -30.057 -12.481 -9.488  1.00 0.00 ? 127 PRO A HB3  4  
ATOM 7972  H HG2  . PRO A 1 127 ? -31.172 -14.247 -7.344  1.00 0.00 ? 127 PRO A HG2  4  
ATOM 7973  H HG3  . PRO A 1 127 ? -29.487 -13.789 -7.652  1.00 0.00 ? 127 PRO A HG3  4  
ATOM 7974  H HD2  . PRO A 1 127 ? -30.988 -12.611 -5.731  1.00 0.00 ? 127 PRO A HD2  4  
ATOM 7975  H HD3  . PRO A 1 127 ? -29.722 -11.741 -6.622  1.00 0.00 ? 127 PRO A HD3  4  
ATOM 7976  N N    . SER A 1 128 ? -34.075 -12.587 -7.719  1.00 0.00 ? 128 SER A N    4  
ATOM 7977  C CA   . SER A 1 128 ? -35.414 -13.163 -7.700  1.00 0.00 ? 128 SER A CA   4  
ATOM 7978  C C    . SER A 1 128 ? -35.451 -14.480 -8.470  1.00 0.00 ? 128 SER A C    4  
ATOM 7979  O O    . SER A 1 128 ? -36.392 -14.750 -9.215  1.00 0.00 ? 128 SER A O    4  
ATOM 7980  C CB   . SER A 1 128 ? -36.423 -12.181 -8.299  1.00 0.00 ? 128 SER A CB   4  
ATOM 7981  O OG   . SER A 1 128 ? -37.743 -12.493 -7.889  1.00 0.00 ? 128 SER A OG   4  
ATOM 7982  H H    . SER A 1 128 ? -33.688 -12.246 -6.885  1.00 0.00 ? 128 SER A H    4  
ATOM 7983  H HA   . SER A 1 128 ? -35.678 -13.355 -6.671  1.00 0.00 ? 128 SER A HA   4  
ATOM 7984  H HB2  . SER A 1 128 ? -36.185 -11.180 -7.972  1.00 0.00 ? 128 SER A HB2  4  
ATOM 7985  H HB3  . SER A 1 128 ? -36.372 -12.229 -9.377  1.00 0.00 ? 128 SER A HB3  4  
ATOM 7986  H HG   . SER A 1 128 ? -37.722 -12.893 -7.017  1.00 0.00 ? 128 SER A HG   4  
ATOM 7987  N N    . SER A 1 129 ? -34.418 -15.295 -8.285  1.00 0.00 ? 129 SER A N    4  
ATOM 7988  C CA   . SER A 1 129 ? -34.328 -16.582 -8.965  1.00 0.00 ? 129 SER A CA   4  
ATOM 7989  C C    . SER A 1 129 ? -35.334 -17.573 -8.387  1.00 0.00 ? 129 SER A C    4  
ATOM 7990  O O    . SER A 1 129 ? -34.974 -18.467 -7.623  1.00 0.00 ? 129 SER A O    4  
ATOM 7991  C CB   . SER A 1 129 ? -32.912 -17.148 -8.845  1.00 0.00 ? 129 SER A CB   4  
ATOM 7992  O OG   . SER A 1 129 ? -31.941 -16.124 -8.968  1.00 0.00 ? 129 SER A OG   4  
ATOM 7993  H H    . SER A 1 129 ? -33.697 -15.023 -7.678  1.00 0.00 ? 129 SER A H    4  
ATOM 7994  H HA   . SER A 1 129 ? -34.556 -16.423 -10.008 1.00 0.00 ? 129 SER A HA   4  
ATOM 7995  H HB2  . SER A 1 129 ? -32.797 -17.623 -7.883  1.00 0.00 ? 129 SER A HB2  4  
ATOM 7996  H HB3  . SER A 1 129 ? -32.751 -17.876 -9.627  1.00 0.00 ? 129 SER A HB3  4  
ATOM 7997  H HG   . SER A 1 129 ? -31.376 -16.123 -8.191  1.00 0.00 ? 129 SER A HG   4  
ATOM 7998  N N    . GLY A 1 130 ? -36.600 -17.405 -8.758  1.00 0.00 ? 130 GLY A N    4  
ATOM 7999  C CA   . GLY A 1 130 ? -37.640 -18.291 -8.268  1.00 0.00 ? 130 GLY A CA   4  
ATOM 8000  C C    . GLY A 1 130 ? -38.534 -17.623 -7.242  1.00 0.00 ? 130 GLY A C    4  
ATOM 8001  O O    . GLY A 1 130 ? -39.522 -18.207 -6.796  1.00 0.00 ? 130 GLY A O    4  
ATOM 8002  H H    . GLY A 1 130 ? -36.829 -16.674 -9.369  1.00 0.00 ? 130 GLY A H    4  
ATOM 8003  H HA2  . GLY A 1 130 ? -38.245 -18.613 -9.102  1.00 0.00 ? 130 GLY A HA2  4  
ATOM 8004  H HA3  . GLY A 1 130 ? -37.177 -19.156 -7.816  1.00 0.00 ? 130 GLY A HA3  4  
ATOM 8005  N N    . GLY A 1 1   ? 0.596   -16.009 -24.171 1.00 0.00 ? 1   GLY A N    5  
ATOM 8006  C CA   . GLY A 1 1   ? 0.337   -17.358 -23.704 1.00 0.00 ? 1   GLY A CA   5  
ATOM 8007  C C    . GLY A 1 1   ? -0.966  -17.467 -22.938 1.00 0.00 ? 1   GLY A C    5  
ATOM 8008  O O    . GLY A 1 1   ? -1.948  -18.009 -23.445 1.00 0.00 ? 1   GLY A O    5  
ATOM 8009  H H1   . GLY A 1 1   ? 1.414   -15.545 -23.895 1.00 0.00 ? 1   GLY A H1   5  
ATOM 8010  H HA2  . GLY A 1 1   ? 0.299   -18.021 -24.556 1.00 0.00 ? 1   GLY A HA2  5  
ATOM 8011  H HA3  . GLY A 1 1   ? 1.147   -17.665 -23.058 1.00 0.00 ? 1   GLY A HA3  5  
ATOM 8012  N N    . SER A 1 2   ? -0.976  -16.952 -21.713 1.00 0.00 ? 2   SER A N    5  
ATOM 8013  C CA   . SER A 1 2   ? -2.167  -16.998 -20.874 1.00 0.00 ? 2   SER A CA   5  
ATOM 8014  C C    . SER A 1 2   ? -2.249  -15.766 -19.978 1.00 0.00 ? 2   SER A C    5  
ATOM 8015  O O    . SER A 1 2   ? -1.443  -15.595 -19.064 1.00 0.00 ? 2   SER A O    5  
ATOM 8016  C CB   . SER A 1 2   ? -2.164  -18.266 -20.017 1.00 0.00 ? 2   SER A CB   5  
ATOM 8017  O OG   . SER A 1 2   ? -2.458  -19.411 -20.799 1.00 0.00 ? 2   SER A OG   5  
ATOM 8018  H H    . SER A 1 2   ? -0.161  -16.533 -21.365 1.00 0.00 ? 2   SER A H    5  
ATOM 8019  H HA   . SER A 1 2   ? -3.030  -17.015 -21.523 1.00 0.00 ? 2   SER A HA   5  
ATOM 8020  H HB2  . SER A 1 2   ? -1.191  -18.392 -19.569 1.00 0.00 ? 2   SER A HB2  5  
ATOM 8021  H HB3  . SER A 1 2   ? -2.910  -18.174 -19.240 1.00 0.00 ? 2   SER A HB3  5  
ATOM 8022  H HG   . SER A 1 2   ? -1.643  -19.871 -21.012 1.00 0.00 ? 2   SER A HG   5  
ATOM 8023  N N    . SER A 1 3   ? -3.230  -14.910 -20.248 1.00 0.00 ? 3   SER A N    5  
ATOM 8024  C CA   . SER A 1 3   ? -3.416  -13.691 -19.470 1.00 0.00 ? 3   SER A CA   5  
ATOM 8025  C C    . SER A 1 3   ? -4.472  -13.894 -18.387 1.00 0.00 ? 3   SER A C    5  
ATOM 8026  O O    . SER A 1 3   ? -5.652  -13.616 -18.595 1.00 0.00 ? 3   SER A O    5  
ATOM 8027  C CB   . SER A 1 3   ? -3.823  -12.534 -20.385 1.00 0.00 ? 3   SER A CB   5  
ATOM 8028  O OG   . SER A 1 3   ? -5.150  -12.698 -20.855 1.00 0.00 ? 3   SER A OG   5  
ATOM 8029  H H    . SER A 1 3   ? -3.841  -15.102 -20.990 1.00 0.00 ? 3   SER A H    5  
ATOM 8030  H HA   . SER A 1 3   ? -2.475  -13.452 -18.998 1.00 0.00 ? 3   SER A HA   5  
ATOM 8031  H HB2  . SER A 1 3   ? -3.761  -11.606 -19.837 1.00 0.00 ? 3   SER A HB2  5  
ATOM 8032  H HB3  . SER A 1 3   ? -3.155  -12.498 -21.233 1.00 0.00 ? 3   SER A HB3  5  
ATOM 8033  H HG   . SER A 1 3   ? -5.371  -11.978 -21.450 1.00 0.00 ? 3   SER A HG   5  
ATOM 8034  N N    . GLY A 1 4   ? -4.036  -14.381 -17.229 1.00 0.00 ? 4   GLY A N    5  
ATOM 8035  C CA   . GLY A 1 4   ? -4.955  -14.613 -16.130 1.00 0.00 ? 4   GLY A CA   5  
ATOM 8036  C C    . GLY A 1 4   ? -4.945  -13.485 -15.117 1.00 0.00 ? 4   GLY A C    5  
ATOM 8037  O O    . GLY A 1 4   ? -4.628  -13.695 -13.946 1.00 0.00 ? 4   GLY A O    5  
ATOM 8038  H H    . GLY A 1 4   ? -3.084  -14.584 -17.120 1.00 0.00 ? 4   GLY A H    5  
ATOM 8039  H HA2  . GLY A 1 4   ? -5.954  -14.719 -16.526 1.00 0.00 ? 4   GLY A HA2  5  
ATOM 8040  H HA3  . GLY A 1 4   ? -4.677  -15.531 -15.631 1.00 0.00 ? 4   GLY A HA3  5  
ATOM 8041  N N    . SER A 1 5   ? -5.291  -12.284 -15.569 1.00 0.00 ? 5   SER A N    5  
ATOM 8042  C CA   . SER A 1 5   ? -5.315  -11.117 -14.695 1.00 0.00 ? 5   SER A CA   5  
ATOM 8043  C C    . SER A 1 5   ? -6.560  -11.125 -13.812 1.00 0.00 ? 5   SER A C    5  
ATOM 8044  O O    . SER A 1 5   ? -7.540  -10.437 -14.097 1.00 0.00 ? 5   SER A O    5  
ATOM 8045  C CB   . SER A 1 5   ? -5.272  -9.832  -15.524 1.00 0.00 ? 5   SER A CB   5  
ATOM 8046  O OG   . SER A 1 5   ? -3.951  -9.540  -15.944 1.00 0.00 ? 5   SER A OG   5  
ATOM 8047  H H    . SER A 1 5   ? -5.534  -12.180 -16.513 1.00 0.00 ? 5   SER A H    5  
ATOM 8048  H HA   . SER A 1 5   ? -4.440  -11.157 -14.063 1.00 0.00 ? 5   SER A HA   5  
ATOM 8049  H HB2  . SER A 1 5   ? -5.897  -9.948  -16.396 1.00 0.00 ? 5   SER A HB2  5  
ATOM 8050  H HB3  . SER A 1 5   ? -5.638  -9.009  -14.926 1.00 0.00 ? 5   SER A HB3  5  
ATOM 8051  H HG   . SER A 1 5   ? -3.583  -10.302 -16.396 1.00 0.00 ? 5   SER A HG   5  
ATOM 8052  N N    . SER A 1 6   ? -6.512  -11.908 -12.739 1.00 0.00 ? 6   SER A N    5  
ATOM 8053  C CA   . SER A 1 6   ? -7.636  -12.009 -11.816 1.00 0.00 ? 6   SER A CA   5  
ATOM 8054  C C    . SER A 1 6   ? -7.724  -10.771 -10.930 1.00 0.00 ? 6   SER A C    5  
ATOM 8055  O O    . SER A 1 6   ? -7.340  -10.802 -9.761  1.00 0.00 ? 6   SER A O    5  
ATOM 8056  C CB   . SER A 1 6   ? -7.500  -13.263 -10.949 1.00 0.00 ? 6   SER A CB   5  
ATOM 8057  O OG   . SER A 1 6   ? -7.614  -14.439 -11.731 1.00 0.00 ? 6   SER A OG   5  
ATOM 8058  H H    . SER A 1 6   ? -5.702  -12.432 -12.566 1.00 0.00 ? 6   SER A H    5  
ATOM 8059  H HA   . SER A 1 6   ? -8.540  -12.084 -12.402 1.00 0.00 ? 6   SER A HA   5  
ATOM 8060  H HB2  . SER A 1 6   ? -6.535  -13.259 -10.465 1.00 0.00 ? 6   SER A HB2  5  
ATOM 8061  H HB3  . SER A 1 6   ? -8.278  -13.265 -10.200 1.00 0.00 ? 6   SER A HB3  5  
ATOM 8062  H HG   . SER A 1 6   ? -7.242  -15.181 -11.250 1.00 0.00 ? 6   SER A HG   5  
ATOM 8063  N N    . GLY A 1 7   ? -8.234  -9.681  -11.495 1.00 0.00 ? 7   GLY A N    5  
ATOM 8064  C CA   . GLY A 1 7   ? -8.364  -8.447  -10.743 1.00 0.00 ? 7   GLY A CA   5  
ATOM 8065  C C    . GLY A 1 7   ? -7.222  -8.238  -9.769  1.00 0.00 ? 7   GLY A C    5  
ATOM 8066  O O    . GLY A 1 7   ? -7.440  -7.891  -8.608  1.00 0.00 ? 7   GLY A O    5  
ATOM 8067  H H    . GLY A 1 7   ? -8.525  -9.715  -12.430 1.00 0.00 ? 7   GLY A H    5  
ATOM 8068  H HA2  . GLY A 1 7   ? -8.390  -7.618  -11.434 1.00 0.00 ? 7   GLY A HA2  5  
ATOM 8069  H HA3  . GLY A 1 7   ? -9.292  -8.471  -10.191 1.00 0.00 ? 7   GLY A HA3  5  
ATOM 8070  N N    . THR A 1 8   ? -5.997  -8.452  -10.241 1.00 0.00 ? 8   THR A N    5  
ATOM 8071  C CA   . THR A 1 8   ? -4.816  -8.288  -9.403  1.00 0.00 ? 8   THR A CA   5  
ATOM 8072  C C    . THR A 1 8   ? -4.691  -6.854  -8.903  1.00 0.00 ? 8   THR A C    5  
ATOM 8073  O O    . THR A 1 8   ? -4.932  -5.893  -9.635  1.00 0.00 ? 8   THR A O    5  
ATOM 8074  C CB   . THR A 1 8   ? -3.531  -8.669  -10.163 1.00 0.00 ? 8   THR A CB   5  
ATOM 8075  O OG1  . THR A 1 8   ? -3.571  -10.052 -10.530 1.00 0.00 ? 8   THR A OG1  5  
ATOM 8076  C CG2  . THR A 1 8   ? -2.299  -8.400  -9.312  1.00 0.00 ? 8   THR A CG2  5  
ATOM 8077  H H    . THR A 1 8   ? -5.888  -8.727  -11.175 1.00 0.00 ? 8   THR A H    5  
ATOM 8078  H HA   . THR A 1 8   ? -4.915  -8.948  -8.554  1.00 0.00 ? 8   THR A HA   5  
ATOM 8079  H HB   . THR A 1 8   ? -3.470  -8.068  -11.059 1.00 0.00 ? 8   THR A HB   5  
ATOM 8080  H HG1  . THR A 1 8   ? -2.704  -10.326 -10.840 1.00 0.00 ? 8   THR A HG1  5  
ATOM 8081  H HG21 . THR A 1 8   ? -1.432  -8.319  -9.950  1.00 0.00 ? 8   THR A HG21 5  
ATOM 8082  H HG22 . THR A 1 8   ? -2.158  -9.213  -8.616  1.00 0.00 ? 8   THR A HG22 5  
ATOM 8083  H HG23 . THR A 1 8   ? -2.433  -7.478  -8.767  1.00 0.00 ? 8   THR A HG23 5  
ATOM 8084  N N    . PRO A 1 9   ? -4.304  -6.702  -7.628  1.00 0.00 ? 9   PRO A N    5  
ATOM 8085  C CA   . PRO A 1 9   ? -4.137  -5.387  -7.002  1.00 0.00 ? 9   PRO A CA   5  
ATOM 8086  C C    . PRO A 1 9   ? -2.937  -4.629  -7.559  1.00 0.00 ? 9   PRO A C    5  
ATOM 8087  O O    . PRO A 1 9   ? -1.968  -5.232  -8.019  1.00 0.00 ? 9   PRO A O    5  
ATOM 8088  C CB   . PRO A 1 9   ? -3.920  -5.722  -5.525  1.00 0.00 ? 9   PRO A CB   5  
ATOM 8089  C CG   . PRO A 1 9   ? -3.366  -7.105  -5.527  1.00 0.00 ? 9   PRO A CG   5  
ATOM 8090  C CD   . PRO A 1 9   ? -4.000  -7.803  -6.698  1.00 0.00 ? 9   PRO A CD   5  
ATOM 8091  H HA   . PRO A 1 9   ? -5.025  -4.781  -7.109  1.00 0.00 ? 9   PRO A HA   5  
ATOM 8092  H HB2  . PRO A 1 9   ? -3.224  -5.017  -5.092  1.00 0.00 ? 9   PRO A HB2  5  
ATOM 8093  H HB3  . PRO A 1 9   ? -4.862  -5.675  -4.999  1.00 0.00 ? 9   PRO A HB3  5  
ATOM 8094  H HG2  . PRO A 1 9   ? -2.294  -7.071  -5.647  1.00 0.00 ? 9   PRO A HG2  5  
ATOM 8095  H HG3  . PRO A 1 9   ? -3.626  -7.606  -4.607  1.00 0.00 ? 9   PRO A HG3  5  
ATOM 8096  H HD2  . PRO A 1 9   ? -3.307  -8.502  -7.142  1.00 0.00 ? 9   PRO A HD2  5  
ATOM 8097  H HD3  . PRO A 1 9   ? -4.904  -8.308  -6.392  1.00 0.00 ? 9   PRO A HD3  5  
ATOM 8098  N N    . HIS A 1 10  ? -3.008  -3.302  -7.513  1.00 0.00 ? 10  HIS A N    5  
ATOM 8099  C CA   . HIS A 1 10  ? -1.926  -2.461  -8.012  1.00 0.00 ? 10  HIS A CA   5  
ATOM 8100  C C    . HIS A 1 10  ? -2.015  -1.055  -7.425  1.00 0.00 ? 10  HIS A C    5  
ATOM 8101  O O    . HIS A 1 10  ? -3.093  -0.599  -7.041  1.00 0.00 ? 10  HIS A O    5  
ATOM 8102  C CB   . HIS A 1 10  ? -1.968  -2.392  -9.539  1.00 0.00 ? 10  HIS A CB   5  
ATOM 8103  C CG   . HIS A 1 10  ? -3.321  -2.056  -10.087 1.00 0.00 ? 10  HIS A CG   5  
ATOM 8104  N ND1  . HIS A 1 10  ? -4.373  -2.947  -10.090 1.00 0.00 ? 10  HIS A ND1  5  
ATOM 8105  C CD2  . HIS A 1 10  ? -3.790  -0.918  -10.650 1.00 0.00 ? 10  HIS A CD2  5  
ATOM 8106  C CE1  . HIS A 1 10  ? -5.432  -2.372  -10.633 1.00 0.00 ? 10  HIS A CE1  5  
ATOM 8107  N NE2  . HIS A 1 10  ? -5.104  -1.140  -10.981 1.00 0.00 ? 10  HIS A NE2  5  
ATOM 8108  H H    . HIS A 1 10  ? -3.807  -2.879  -7.135  1.00 0.00 ? 10  HIS A H    5  
ATOM 8109  H HA   . HIS A 1 10  ? -0.992  -2.906  -7.706  1.00 0.00 ? 10  HIS A HA   5  
ATOM 8110  H HB2  . HIS A 1 10  ? -1.276  -1.635  -9.878  1.00 0.00 ? 10  HIS A HB2  5  
ATOM 8111  H HB3  . HIS A 1 10  ? -1.673  -3.349  -9.945  1.00 0.00 ? 10  HIS A HB3  5  
ATOM 8112  H HD1  . HIS A 1 10  ? -4.348  -3.864  -9.747  1.00 0.00 ? 10  HIS A HD1  5  
ATOM 8113  H HD2  . HIS A 1 10  ? -3.235  -0.005  -10.810 1.00 0.00 ? 10  HIS A HD2  5  
ATOM 8114  H HE1  . HIS A 1 10  ? -6.400  -2.830  -10.769 1.00 0.00 ? 10  HIS A HE1  5  
ATOM 8115  N N    . LEU A 1 11  ? -0.877  -0.374  -7.358  1.00 0.00 ? 11  LEU A N    5  
ATOM 8116  C CA   . LEU A 1 11  ? -0.826  0.979   -6.816  1.00 0.00 ? 11  LEU A CA   5  
ATOM 8117  C C    . LEU A 1 11  ? -0.748  2.011   -7.937  1.00 0.00 ? 11  LEU A C    5  
ATOM 8118  O O    . LEU A 1 11  ? 0.127   1.941   -8.800  1.00 0.00 ? 11  LEU A O    5  
ATOM 8119  C CB   . LEU A 1 11  ? 0.376   1.132   -5.883  1.00 0.00 ? 11  LEU A CB   5  
ATOM 8120  C CG   . LEU A 1 11  ? 0.273   0.420   -4.533  1.00 0.00 ? 11  LEU A CG   5  
ATOM 8121  C CD1  . LEU A 1 11  ? 1.619   0.417   -3.827  1.00 0.00 ? 11  LEU A CD1  5  
ATOM 8122  C CD2  . LEU A 1 11  ? -0.787  1.080   -3.663  1.00 0.00 ? 11  LEU A CD2  5  
ATOM 8123  H H    . LEU A 1 11  ? -0.050  -0.791  -7.679  1.00 0.00 ? 11  LEU A H    5  
ATOM 8124  H HA   . LEU A 1 11  ? -1.732  1.145   -6.253  1.00 0.00 ? 11  LEU A HA   5  
ATOM 8125  H HB2  . LEU A 1 11  ? 1.244   0.744   -6.395  1.00 0.00 ? 11  LEU A HB2  5  
ATOM 8126  H HB3  . LEU A 1 11  ? 0.514   2.187   -5.692  1.00 0.00 ? 11  LEU A HB3  5  
ATOM 8127  H HG   . LEU A 1 11  ? -0.020  -0.608  -4.697  1.00 0.00 ? 11  LEU A HG   5  
ATOM 8128  H HD11 . LEU A 1 11  ? 1.579   -0.249  -2.978  1.00 0.00 ? 11  LEU A HD11 5  
ATOM 8129  H HD12 . LEU A 1 11  ? 1.852   1.416   -3.490  1.00 0.00 ? 11  LEU A HD12 5  
ATOM 8130  H HD13 . LEU A 1 11  ? 2.384   0.081   -4.512  1.00 0.00 ? 11  LEU A HD13 5  
ATOM 8131  H HD21 . LEU A 1 11  ? -1.673  1.265   -4.251  1.00 0.00 ? 11  LEU A HD21 5  
ATOM 8132  H HD22 . LEU A 1 11  ? -0.406  2.016   -3.281  1.00 0.00 ? 11  LEU A HD22 5  
ATOM 8133  H HD23 . LEU A 1 11  ? -1.031  0.428   -2.837  1.00 0.00 ? 11  LEU A HD23 5  
ATOM 8134  N N    . VAL A 1 12  ? -1.668  2.970   -7.917  1.00 0.00 ? 12  VAL A N    5  
ATOM 8135  C CA   . VAL A 1 12  ? -1.702  4.019   -8.929  1.00 0.00 ? 12  VAL A CA   5  
ATOM 8136  C C    . VAL A 1 12  ? -1.113  5.319   -8.393  1.00 0.00 ? 12  VAL A C    5  
ATOM 8137  O O    . VAL A 1 12  ? -1.457  5.764   -7.299  1.00 0.00 ? 12  VAL A O    5  
ATOM 8138  C CB   . VAL A 1 12  ? -3.139  4.282   -9.416  1.00 0.00 ? 12  VAL A CB   5  
ATOM 8139  C CG1  . VAL A 1 12  ? -3.126  4.952   -10.782 1.00 0.00 ? 12  VAL A CG1  5  
ATOM 8140  C CG2  . VAL A 1 12  ? -3.934  2.985   -9.458  1.00 0.00 ? 12  VAL A CG2  5  
ATOM 8141  H H    . VAL A 1 12  ? -2.340  2.973   -7.203  1.00 0.00 ? 12  VAL A H    5  
ATOM 8142  H HA   . VAL A 1 12  ? -1.113  3.688   -9.772  1.00 0.00 ? 12  VAL A HA   5  
ATOM 8143  H HB   . VAL A 1 12  ? -3.618  4.951   -8.717  1.00 0.00 ? 12  VAL A HB   5  
ATOM 8144  H HG11 . VAL A 1 12  ? -2.622  5.905   -10.710 1.00 0.00 ? 12  VAL A HG11 5  
ATOM 8145  H HG12 . VAL A 1 12  ? -2.606  4.321   -11.488 1.00 0.00 ? 12  VAL A HG12 5  
ATOM 8146  H HG13 . VAL A 1 12  ? -4.141  5.107   -11.117 1.00 0.00 ? 12  VAL A HG13 5  
ATOM 8147  H HG21 . VAL A 1 12  ? -4.761  3.091   -10.144 1.00 0.00 ? 12  VAL A HG21 5  
ATOM 8148  H HG22 . VAL A 1 12  ? -3.292  2.182   -9.787  1.00 0.00 ? 12  VAL A HG22 5  
ATOM 8149  H HG23 . VAL A 1 12  ? -4.311  2.763   -8.470  1.00 0.00 ? 12  VAL A HG23 5  
ATOM 8150  N N    . ASN A 1 13  ? -0.222  5.924   -9.173  1.00 0.00 ? 13  ASN A N    5  
ATOM 8151  C CA   . ASN A 1 13  ? 0.416   7.174   -8.776  1.00 0.00 ? 13  ASN A CA   5  
ATOM 8152  C C    . ASN A 1 13  ? -0.533  8.354   -8.968  1.00 0.00 ? 13  ASN A C    5  
ATOM 8153  O O    . ASN A 1 13  ? -0.757  8.807   -10.091 1.00 0.00 ? 13  ASN A O    5  
ATOM 8154  C CB   . ASN A 1 13  ? 1.695   7.397   -9.586  1.00 0.00 ? 13  ASN A CB   5  
ATOM 8155  C CG   . ASN A 1 13  ? 2.522   8.551   -9.054  1.00 0.00 ? 13  ASN A CG   5  
ATOM 8156  O OD1  . ASN A 1 13  ? 1.988   9.494   -8.468  1.00 0.00 ? 13  ASN A OD1  5  
ATOM 8157  N ND2  . ASN A 1 13  ? 3.833   8.483   -9.256  1.00 0.00 ? 13  ASN A ND2  5  
ATOM 8158  H H    . ASN A 1 13  ? 0.012   5.520   -10.034 1.00 0.00 ? 13  ASN A H    5  
ATOM 8159  H HA   . ASN A 1 13  ? 0.671   7.099   -7.730  1.00 0.00 ? 13  ASN A HA   5  
ATOM 8160  H HB2  . ASN A 1 13  ? 2.298   6.501   -9.548  1.00 0.00 ? 13  ASN A HB2  5  
ATOM 8161  H HB3  . ASN A 1 13  ? 1.433   7.607   -10.612 1.00 0.00 ? 13  ASN A HB3  5  
ATOM 8162  H HD21 . ASN A 1 13  ? 4.188   7.702   -9.731  1.00 0.00 ? 13  ASN A HD21 5  
ATOM 8163  H HD22 . ASN A 1 13  ? 4.391   9.215   -8.922  1.00 0.00 ? 13  ASN A HD22 5  
ATOM 8164  N N    . LEU A 1 14  ? -1.086  8.847   -7.866  1.00 0.00 ? 14  LEU A N    5  
ATOM 8165  C CA   . LEU A 1 14  ? -2.010  9.974   -7.912  1.00 0.00 ? 14  LEU A CA   5  
ATOM 8166  C C    . LEU A 1 14  ? -1.372  11.225  -7.316  1.00 0.00 ? 14  LEU A C    5  
ATOM 8167  O O    . LEU A 1 14  ? -2.005  12.277  -7.233  1.00 0.00 ? 14  LEU A O    5  
ATOM 8168  C CB   . LEU A 1 14  ? -3.297  9.636   -7.158  1.00 0.00 ? 14  LEU A CB   5  
ATOM 8169  C CG   . LEU A 1 14  ? -3.139  9.315   -5.671  1.00 0.00 ? 14  LEU A CG   5  
ATOM 8170  C CD1  . LEU A 1 14  ? -4.455  9.523   -4.937  1.00 0.00 ? 14  LEU A CD1  5  
ATOM 8171  C CD2  . LEU A 1 14  ? -2.641  7.889   -5.483  1.00 0.00 ? 14  LEU A CD2  5  
ATOM 8172  H H    . LEU A 1 14  ? -0.868  8.443   -7.000  1.00 0.00 ? 14  LEU A H    5  
ATOM 8173  H HA   . LEU A 1 14  ? -2.249  10.165  -8.948  1.00 0.00 ? 14  LEU A HA   5  
ATOM 8174  H HB2  . LEU A 1 14  ? -3.963  10.480  -7.245  1.00 0.00 ? 14  LEU A HB2  5  
ATOM 8175  H HB3  . LEU A 1 14  ? -3.744  8.776   -7.637  1.00 0.00 ? 14  LEU A HB3  5  
ATOM 8176  H HG   . LEU A 1 14  ? -2.408  9.985   -5.240  1.00 0.00 ? 14  LEU A HG   5  
ATOM 8177  H HD11 . LEU A 1 14  ? -4.955  10.393  -5.335  1.00 0.00 ? 14  LEU A HD11 5  
ATOM 8178  H HD12 . LEU A 1 14  ? -4.261  9.669   -3.885  1.00 0.00 ? 14  LEU A HD12 5  
ATOM 8179  H HD13 . LEU A 1 14  ? -5.082  8.654   -5.071  1.00 0.00 ? 14  LEU A HD13 5  
ATOM 8180  H HD21 . LEU A 1 14  ? -2.807  7.328   -6.390  1.00 0.00 ? 14  LEU A HD21 5  
ATOM 8181  H HD22 . LEU A 1 14  ? -3.178  7.425   -4.669  1.00 0.00 ? 14  LEU A HD22 5  
ATOM 8182  H HD23 . LEU A 1 14  ? -1.585  7.904   -5.255  1.00 0.00 ? 14  LEU A HD23 5  
ATOM 8183  N N    . ASN A 1 15  ? -0.114  11.103  -6.904  1.00 0.00 ? 15  ASN A N    5  
ATOM 8184  C CA   . ASN A 1 15  ? 0.610   12.225  -6.318  1.00 0.00 ? 15  ASN A CA   5  
ATOM 8185  C C    . ASN A 1 15  ? 0.417   13.491  -7.147  1.00 0.00 ? 15  ASN A C    5  
ATOM 8186  O O    . ASN A 1 15  ? -0.049  13.434  -8.284  1.00 0.00 ? 15  ASN A O    5  
ATOM 8187  C CB   . ASN A 1 15  ? 2.100   11.896  -6.209  1.00 0.00 ? 15  ASN A CB   5  
ATOM 8188  C CG   . ASN A 1 15  ? 2.789   11.883  -7.560  1.00 0.00 ? 15  ASN A CG   5  
ATOM 8189  O OD1  . ASN A 1 15  ? 2.188   12.220  -8.580  1.00 0.00 ? 15  ASN A OD1  5  
ATOM 8190  N ND2  . ASN A 1 15  ? 4.058   11.492  -7.573  1.00 0.00 ? 15  ASN A ND2  5  
ATOM 8191  H H    . ASN A 1 15  ? 0.338   10.239  -6.997  1.00 0.00 ? 15  ASN A H    5  
ATOM 8192  H HA   . ASN A 1 15  ? 0.215   12.393  -5.327  1.00 0.00 ? 15  ASN A HA   5  
ATOM 8193  H HB2  . ASN A 1 15  ? 2.582   12.637  -5.588  1.00 0.00 ? 15  ASN A HB2  5  
ATOM 8194  H HB3  . ASN A 1 15  ? 2.216   10.923  -5.756  1.00 0.00 ? 15  ASN A HB3  5  
ATOM 8195  H HD21 . ASN A 1 15  ? 4.473   11.237  -6.722  1.00 0.00 ? 15  ASN A HD21 5  
ATOM 8196  H HD22 . ASN A 1 15  ? 4.528   11.474  -8.433  1.00 0.00 ? 15  ASN A HD22 5  
ATOM 8197  N N    . GLU A 1 16  ? 0.778   14.632  -6.568  1.00 0.00 ? 16  GLU A N    5  
ATOM 8198  C CA   . GLU A 1 16  ? 0.644   15.912  -7.254  1.00 0.00 ? 16  GLU A CA   5  
ATOM 8199  C C    . GLU A 1 16  ? 1.773   16.110  -8.261  1.00 0.00 ? 16  GLU A C    5  
ATOM 8200  O O    . GLU A 1 16  ? 1.912   17.182  -8.851  1.00 0.00 ? 16  GLU A O    5  
ATOM 8201  C CB   . GLU A 1 16  ? 0.639   17.060  -6.243  1.00 0.00 ? 16  GLU A CB   5  
ATOM 8202  C CG   . GLU A 1 16  ? 2.030   17.527  -5.846  1.00 0.00 ? 16  GLU A CG   5  
ATOM 8203  C CD   . GLU A 1 16  ? 2.025   18.365  -4.583  1.00 0.00 ? 16  GLU A CD   5  
ATOM 8204  O OE1  . GLU A 1 16  ? 1.455   19.476  -4.611  1.00 0.00 ? 16  GLU A OE1  5  
ATOM 8205  O OE2  . GLU A 1 16  ? 2.592   17.912  -3.567  1.00 0.00 ? 16  GLU A OE2  5  
ATOM 8206  H H    . GLU A 1 16  ? 1.143   14.613  -5.659  1.00 0.00 ? 16  GLU A H    5  
ATOM 8207  H HA   . GLU A 1 16  ? -0.297  15.907  -7.783  1.00 0.00 ? 16  GLU A HA   5  
ATOM 8208  H HB2  . GLU A 1 16  ? 0.109   17.898  -6.670  1.00 0.00 ? 16  GLU A HB2  5  
ATOM 8209  H HB3  . GLU A 1 16  ? 0.124   16.735  -5.351  1.00 0.00 ? 16  GLU A HB3  5  
ATOM 8210  H HG2  . GLU A 1 16  ? 2.653   16.661  -5.682  1.00 0.00 ? 16  GLU A HG2  5  
ATOM 8211  H HG3  . GLU A 1 16  ? 2.441   18.117  -6.652  1.00 0.00 ? 16  GLU A HG3  5  
ATOM 8212  N N    . ASP A 1 17  ? 2.578   15.071  -8.451  1.00 0.00 ? 17  ASP A N    5  
ATOM 8213  C CA   . ASP A 1 17  ? 3.695   15.130  -9.387  1.00 0.00 ? 17  ASP A CA   5  
ATOM 8214  C C    . ASP A 1 17  ? 3.403   14.302  -10.635 1.00 0.00 ? 17  ASP A C    5  
ATOM 8215  O O    . ASP A 1 17  ? 3.857   13.166  -10.776 1.00 0.00 ? 17  ASP A O    5  
ATOM 8216  C CB   . ASP A 1 17  ? 4.976   14.630  -8.716  1.00 0.00 ? 17  ASP A CB   5  
ATOM 8217  C CG   . ASP A 1 17  ? 5.715   15.733  -7.985  1.00 0.00 ? 17  ASP A CG   5  
ATOM 8218  O OD1  . ASP A 1 17  ? 5.206   16.198  -6.944  1.00 0.00 ? 17  ASP A OD1  5  
ATOM 8219  O OD2  . ASP A 1 17  ? 6.801   16.132  -8.453  1.00 0.00 ? 17  ASP A OD2  5  
ATOM 8220  H H    . ASP A 1 17  ? 2.416   14.243  -7.951  1.00 0.00 ? 17  ASP A H    5  
ATOM 8221  H HA   . ASP A 1 17  ? 3.830   16.160  -9.677  1.00 0.00 ? 17  ASP A HA   5  
ATOM 8222  H HB2  . ASP A 1 17  ? 4.724   13.857  -8.004  1.00 0.00 ? 17  ASP A HB2  5  
ATOM 8223  H HB3  . ASP A 1 17  ? 5.632   14.220  -9.470  1.00 0.00 ? 17  ASP A HB3  5  
ATOM 8224  N N    . PRO A 1 18  ? 2.627   14.883  -11.562 1.00 0.00 ? 18  PRO A N    5  
ATOM 8225  C CA   . PRO A 1 18  ? 2.257   14.217  -12.814 1.00 0.00 ? 18  PRO A CA   5  
ATOM 8226  C C    . PRO A 1 18  ? 3.441   14.063  -13.761 1.00 0.00 ? 18  PRO A C    5  
ATOM 8227  O O    . PRO A 1 18  ? 3.297   13.559  -14.876 1.00 0.00 ? 18  PRO A O    5  
ATOM 8228  C CB   . PRO A 1 18  ? 1.208   15.154  -13.417 1.00 0.00 ? 18  PRO A CB   5  
ATOM 8229  C CG   . PRO A 1 18  ? 1.519   16.492  -12.842 1.00 0.00 ? 18  PRO A CG   5  
ATOM 8230  C CD   . PRO A 1 18  ? 2.051   16.234  -11.459 1.00 0.00 ? 18  PRO A CD   5  
ATOM 8231  H HA   . PRO A 1 18  ? 1.814   13.248  -12.632 1.00 0.00 ? 18  PRO A HA   5  
ATOM 8232  H HB2  . PRO A 1 18  ? 1.299   15.155  -14.495 1.00 0.00 ? 18  PRO A HB2  5  
ATOM 8233  H HB3  . PRO A 1 18  ? 0.219   14.824  -13.135 1.00 0.00 ? 18  PRO A HB3  5  
ATOM 8234  H HG2  . PRO A 1 18  ? 2.265   16.987  -13.445 1.00 0.00 ? 18  PRO A HG2  5  
ATOM 8235  H HG3  . PRO A 1 18  ? 0.620   17.088  -12.791 1.00 0.00 ? 18  PRO A HG3  5  
ATOM 8236  H HD2  . PRO A 1 18  ? 2.811   16.959  -11.206 1.00 0.00 ? 18  PRO A HD2  5  
ATOM 8237  H HD3  . PRO A 1 18  ? 1.250   16.257  -10.736 1.00 0.00 ? 18  PRO A HD3  5  
ATOM 8238  N N    . LEU A 1 19  ? 4.613   14.500  -13.312 1.00 0.00 ? 19  LEU A N    5  
ATOM 8239  C CA   . LEU A 1 19  ? 5.824   14.410  -14.120 1.00 0.00 ? 19  LEU A CA   5  
ATOM 8240  C C    . LEU A 1 19  ? 6.774   13.355  -13.562 1.00 0.00 ? 19  LEU A C    5  
ATOM 8241  O O    . LEU A 1 19  ? 7.731   12.955  -14.224 1.00 0.00 ? 19  LEU A O    5  
ATOM 8242  C CB   . LEU A 1 19  ? 6.527   15.768  -14.174 1.00 0.00 ? 19  LEU A CB   5  
ATOM 8243  C CG   . LEU A 1 19  ? 5.614   16.994  -14.223 1.00 0.00 ? 19  LEU A CG   5  
ATOM 8244  C CD1  . LEU A 1 19  ? 6.405   18.260  -13.935 1.00 0.00 ? 19  LEU A CD1  5  
ATOM 8245  C CD2  . LEU A 1 19  ? 4.924   17.090  -15.576 1.00 0.00 ? 19  LEU A CD2  5  
ATOM 8246  H H    . LEU A 1 19  ? 4.666   14.891  -12.415 1.00 0.00 ? 19  LEU A H    5  
ATOM 8247  H HA   . LEU A 1 19  ? 5.535   14.123  -15.120 1.00 0.00 ? 19  LEU A HA   5  
ATOM 8248  H HB2  . LEU A 1 19  ? 7.148   15.854  -13.295 1.00 0.00 ? 19  LEU A HB2  5  
ATOM 8249  H HB3  . LEU A 1 19  ? 7.150   15.782  -15.056 1.00 0.00 ? 19  LEU A HB3  5  
ATOM 8250  H HG   . LEU A 1 19  ? 4.851   16.898  -13.464 1.00 0.00 ? 19  LEU A HG   5  
ATOM 8251  H HD11 . LEU A 1 19  ? 7.393   18.173  -14.362 1.00 0.00 ? 19  LEU A HD11 5  
ATOM 8252  H HD12 . LEU A 1 19  ? 6.487   18.398  -12.867 1.00 0.00 ? 19  LEU A HD12 5  
ATOM 8253  H HD13 . LEU A 1 19  ? 5.898   19.109  -14.370 1.00 0.00 ? 19  LEU A HD13 5  
ATOM 8254  H HD21 . LEU A 1 19  ? 4.624   18.112  -15.755 1.00 0.00 ? 19  LEU A HD21 5  
ATOM 8255  H HD22 . LEU A 1 19  ? 4.053   16.452  -15.582 1.00 0.00 ? 19  LEU A HD22 5  
ATOM 8256  H HD23 . LEU A 1 19  ? 5.607   16.774  -16.352 1.00 0.00 ? 19  LEU A HD23 5  
ATOM 8257  N N    . MET A 1 20  ? 6.501   12.907  -12.340 1.00 0.00 ? 20  MET A N    5  
ATOM 8258  C CA   . MET A 1 20  ? 7.330   11.896  -11.695 1.00 0.00 ? 20  MET A CA   5  
ATOM 8259  C C    . MET A 1 20  ? 7.849   10.886  -12.714 1.00 0.00 ? 20  MET A C    5  
ATOM 8260  O O    . MET A 1 20  ? 7.069   10.249  -13.423 1.00 0.00 ? 20  MET A O    5  
ATOM 8261  C CB   . MET A 1 20  ? 6.535   11.174  -10.604 1.00 0.00 ? 20  MET A CB   5  
ATOM 8262  C CG   . MET A 1 20  ? 5.147   10.743  -11.049 1.00 0.00 ? 20  MET A CG   5  
ATOM 8263  S SD   . MET A 1 20  ? 5.131   9.088   -11.766 1.00 0.00 ? 20  MET A SD   5  
ATOM 8264  C CE   . MET A 1 20  ? 3.947   9.306   -13.092 1.00 0.00 ? 20  MET A CE   5  
ATOM 8265  H H    . MET A 1 20  ? 5.724   13.264  -11.862 1.00 0.00 ? 20  MET A H    5  
ATOM 8266  H HA   . MET A 1 20  ? 8.172   12.397  -11.242 1.00 0.00 ? 20  MET A HA   5  
ATOM 8267  H HB2  . MET A 1 20  ? 7.082   10.295  -10.299 1.00 0.00 ? 20  MET A HB2  5  
ATOM 8268  H HB3  . MET A 1 20  ? 6.429   11.835  -9.757  1.00 0.00 ? 20  MET A HB3  5  
ATOM 8269  H HG2  . MET A 1 20  ? 4.489   10.754  -10.193 1.00 0.00 ? 20  MET A HG2  5  
ATOM 8270  H HG3  . MET A 1 20  ? 4.787   11.444  -11.787 1.00 0.00 ? 20  MET A HG3  5  
ATOM 8271  H HE1  . MET A 1 20  ? 3.505   10.289  -13.022 1.00 0.00 ? 20  MET A HE1  5  
ATOM 8272  H HE2  . MET A 1 20  ? 4.449   9.205   -14.043 1.00 0.00 ? 20  MET A HE2  5  
ATOM 8273  H HE3  . MET A 1 20  ? 3.174   8.556   -13.012 1.00 0.00 ? 20  MET A HE3  5  
ATOM 8274  N N    . SER A 1 21  ? 9.168   10.746  -12.783 1.00 0.00 ? 21  SER A N    5  
ATOM 8275  C CA   . SER A 1 21  ? 9.791   9.817   -13.719 1.00 0.00 ? 21  SER A CA   5  
ATOM 8276  C C    . SER A 1 21  ? 9.523   8.372   -13.309 1.00 0.00 ? 21  SER A C    5  
ATOM 8277  O O    . SER A 1 21  ? 9.923   7.435   -14.000 1.00 0.00 ? 21  SER A O    5  
ATOM 8278  C CB   . SER A 1 21  ? 11.298  10.066  -13.792 1.00 0.00 ? 21  SER A CB   5  
ATOM 8279  O OG   . SER A 1 21  ? 11.954  9.027   -14.497 1.00 0.00 ? 21  SER A OG   5  
ATOM 8280  H H    . SER A 1 21  ? 9.737   11.282  -12.191 1.00 0.00 ? 21  SER A H    5  
ATOM 8281  H HA   . SER A 1 21  ? 9.358   9.988   -14.693 1.00 0.00 ? 21  SER A HA   5  
ATOM 8282  H HB2  . SER A 1 21  ? 11.481  11.001  -14.300 1.00 0.00 ? 21  SER A HB2  5  
ATOM 8283  H HB3  . SER A 1 21  ? 11.701  10.116  -12.790 1.00 0.00 ? 21  SER A HB3  5  
ATOM 8284  H HG   . SER A 1 21  ? 11.626  8.996   -15.399 1.00 0.00 ? 21  SER A HG   5  
ATOM 8285  N N    . GLU A 1 22  ? 8.842   8.200   -12.180 1.00 0.00 ? 22  GLU A N    5  
ATOM 8286  C CA   . GLU A 1 22  ? 8.521   6.869   -11.677 1.00 0.00 ? 22  GLU A CA   5  
ATOM 8287  C C    . GLU A 1 22  ? 7.424   6.221   -12.515 1.00 0.00 ? 22  GLU A C    5  
ATOM 8288  O O    . GLU A 1 22  ? 6.772   6.884   -13.323 1.00 0.00 ? 22  GLU A O    5  
ATOM 8289  C CB   . GLU A 1 22  ? 8.083   6.945   -10.213 1.00 0.00 ? 22  GLU A CB   5  
ATOM 8290  C CG   . GLU A 1 22  ? 9.101   7.615   -9.306  1.00 0.00 ? 22  GLU A CG   5  
ATOM 8291  C CD   . GLU A 1 22  ? 10.515  7.125   -9.554  1.00 0.00 ? 22  GLU A CD   5  
ATOM 8292  O OE1  . GLU A 1 22  ? 10.710  5.895   -9.639  1.00 0.00 ? 22  GLU A OE1  5  
ATOM 8293  O OE2  . GLU A 1 22  ? 11.426  7.973   -9.663  1.00 0.00 ? 22  GLU A OE2  5  
ATOM 8294  H H    . GLU A 1 22  ? 8.550   8.986   -11.673 1.00 0.00 ? 22  GLU A H    5  
ATOM 8295  H HA   . GLU A 1 22  ? 9.413   6.265   -11.745 1.00 0.00 ? 22  GLU A HA   5  
ATOM 8296  H HB2  . GLU A 1 22  ? 7.159   7.501   -10.155 1.00 0.00 ? 22  GLU A HB2  5  
ATOM 8297  H HB3  . GLU A 1 22  ? 7.913   5.943   -9.849  1.00 0.00 ? 22  GLU A HB3  5  
ATOM 8298  H HG2  . GLU A 1 22  ? 9.071   8.681   -9.478  1.00 0.00 ? 22  GLU A HG2  5  
ATOM 8299  H HG3  . GLU A 1 22  ? 8.840   7.410   -8.279  1.00 0.00 ? 22  GLU A HG3  5  
ATOM 8300  N N    . CYS A 1 23  ? 7.225   4.923   -12.318 1.00 0.00 ? 23  CYS A N    5  
ATOM 8301  C CA   . CYS A 1 23  ? 6.208   4.183   -13.056 1.00 0.00 ? 23  CYS A CA   5  
ATOM 8302  C C    . CYS A 1 23  ? 4.808   4.630   -12.648 1.00 0.00 ? 23  CYS A C    5  
ATOM 8303  O O    . CYS A 1 23  ? 4.476   4.665   -11.462 1.00 0.00 ? 23  CYS A O    5  
ATOM 8304  C CB   . CYS A 1 23  ? 6.366   2.681   -12.819 1.00 0.00 ? 23  CYS A CB   5  
ATOM 8305  S SG   . CYS A 1 23  ? 8.076   2.098   -12.893 1.00 0.00 ? 23  CYS A SG   5  
ATOM 8306  H H    . CYS A 1 23  ? 7.777   4.449   -11.660 1.00 0.00 ? 23  CYS A H    5  
ATOM 8307  H HA   . CYS A 1 23  ? 6.346   4.390   -14.106 1.00 0.00 ? 23  CYS A HA   5  
ATOM 8308  H HB2  . CYS A 1 23  ? 5.979   2.436   -11.841 1.00 0.00 ? 23  CYS A HB2  5  
ATOM 8309  H HB3  . CYS A 1 23  ? 5.801   2.144   -13.567 1.00 0.00 ? 23  CYS A HB3  5  
ATOM 8310  H HG   . CYS A 1 23  ? 8.585   2.166   -11.672 1.00 0.00 ? 23  CYS A HG   5  
ATOM 8311  N N    . LEU A 1 24  ? 3.990   4.973   -13.637 1.00 0.00 ? 24  LEU A N    5  
ATOM 8312  C CA   . LEU A 1 24  ? 2.625   5.420   -13.381 1.00 0.00 ? 24  LEU A CA   5  
ATOM 8313  C C    . LEU A 1 24  ? 1.985   4.603   -12.263 1.00 0.00 ? 24  LEU A C    5  
ATOM 8314  O O    . LEU A 1 24  ? 1.474   5.157   -11.289 1.00 0.00 ? 24  LEU A O    5  
ATOM 8315  C CB   . LEU A 1 24  ? 1.785   5.311   -14.654 1.00 0.00 ? 24  LEU A CB   5  
ATOM 8316  C CG   . LEU A 1 24  ? 2.107   6.316   -15.760 1.00 0.00 ? 24  LEU A CG   5  
ATOM 8317  C CD1  . LEU A 1 24  ? 0.898   6.529   -16.658 1.00 0.00 ? 24  LEU A CD1  5  
ATOM 8318  C CD2  . LEU A 1 24  ? 2.568   7.637   -15.162 1.00 0.00 ? 24  LEU A CD2  5  
ATOM 8319  H H    . LEU A 1 24  ? 4.311   4.925   -14.561 1.00 0.00 ? 24  LEU A H    5  
ATOM 8320  H HA   . LEU A 1 24  ? 2.667   6.455   -13.075 1.00 0.00 ? 24  LEU A HA   5  
ATOM 8321  H HB2  . LEU A 1 24  ? 1.924   4.320   -15.058 1.00 0.00 ? 24  LEU A HB2  5  
ATOM 8322  H HB3  . LEU A 1 24  ? 0.748   5.443   -14.378 1.00 0.00 ? 24  LEU A HB3  5  
ATOM 8323  H HG   . LEU A 1 24  ? 2.910   5.926   -16.370 1.00 0.00 ? 24  LEU A HG   5  
ATOM 8324  H HD11 . LEU A 1 24  ? 1.056   7.401   -17.273 1.00 0.00 ? 24  LEU A HD11 5  
ATOM 8325  H HD12 . LEU A 1 24  ? 0.018   6.673   -16.048 1.00 0.00 ? 24  LEU A HD12 5  
ATOM 8326  H HD13 . LEU A 1 24  ? 0.761   5.662   -17.288 1.00 0.00 ? 24  LEU A HD13 5  
ATOM 8327  H HD21 . LEU A 1 24  ? 3.523   7.499   -14.676 1.00 0.00 ? 24  LEU A HD21 5  
ATOM 8328  H HD22 . LEU A 1 24  ? 1.842   7.977   -14.438 1.00 0.00 ? 24  LEU A HD22 5  
ATOM 8329  H HD23 . LEU A 1 24  ? 2.666   8.373   -15.947 1.00 0.00 ? 24  LEU A HD23 5  
ATOM 8330  N N    . LEU A 1 25  ? 2.018   3.283   -12.410 1.00 0.00 ? 25  LEU A N    5  
ATOM 8331  C CA   . LEU A 1 25  ? 1.443   2.388   -11.412 1.00 0.00 ? 25  LEU A CA   5  
ATOM 8332  C C    . LEU A 1 25  ? 2.291   1.130   -11.254 1.00 0.00 ? 25  LEU A C    5  
ATOM 8333  O O    . LEU A 1 25  ? 3.173   0.858   -12.069 1.00 0.00 ? 25  LEU A O    5  
ATOM 8334  C CB   . LEU A 1 25  ? 0.014   2.007   -11.802 1.00 0.00 ? 25  LEU A CB   5  
ATOM 8335  C CG   . LEU A 1 25  ? -0.134  0.758   -12.673 1.00 0.00 ? 25  LEU A CG   5  
ATOM 8336  C CD1  . LEU A 1 25  ? -0.269  -0.484  -11.806 1.00 0.00 ? 25  LEU A CD1  5  
ATOM 8337  C CD2  . LEU A 1 25  ? -1.331  0.895   -13.603 1.00 0.00 ? 25  LEU A CD2  5  
ATOM 8338  H H    . LEU A 1 25  ? 2.438   2.900   -13.207 1.00 0.00 ? 25  LEU A H    5  
ATOM 8339  H HA   . LEU A 1 25  ? 1.421   2.914   -10.469 1.00 0.00 ? 25  LEU A HA   5  
ATOM 8340  H HB2  . LEU A 1 25  ? -0.545  1.844   -10.894 1.00 0.00 ? 25  LEU A HB2  5  
ATOM 8341  H HB3  . LEU A 1 25  ? -0.414  2.840   -12.342 1.00 0.00 ? 25  LEU A HB3  5  
ATOM 8342  H HG   . LEU A 1 25  ? 0.753   0.645   -13.282 1.00 0.00 ? 25  LEU A HG   5  
ATOM 8343  H HD11 . LEU A 1 25  ? -1.235  -0.936  -11.973 1.00 0.00 ? 25  LEU A HD11 5  
ATOM 8344  H HD12 . LEU A 1 25  ? -0.175  -0.209  -10.766 1.00 0.00 ? 25  LEU A HD12 5  
ATOM 8345  H HD13 . LEU A 1 25  ? 0.509   -1.188  -12.063 1.00 0.00 ? 25  LEU A HD13 5  
ATOM 8346  H HD21 . LEU A 1 25  ? -2.239  0.710   -13.050 1.00 0.00 ? 25  LEU A HD21 5  
ATOM 8347  H HD22 . LEU A 1 25  ? -1.245  0.177   -14.406 1.00 0.00 ? 25  LEU A HD22 5  
ATOM 8348  H HD23 . LEU A 1 25  ? -1.355  1.894   -14.014 1.00 0.00 ? 25  LEU A HD23 5  
ATOM 8349  N N    . TYR A 1 26  ? 2.018   0.366   -10.203 1.00 0.00 ? 26  TYR A N    5  
ATOM 8350  C CA   . TYR A 1 26  ? 2.757   -0.863  -9.938  1.00 0.00 ? 26  TYR A CA   5  
ATOM 8351  C C    . TYR A 1 26  ? 1.805   -2.013  -9.624  1.00 0.00 ? 26  TYR A C    5  
ATOM 8352  O O    . TYR A 1 26  ? 0.783   -1.826  -8.964  1.00 0.00 ? 26  TYR A O    5  
ATOM 8353  C CB   . TYR A 1 26  ? 3.729   -0.658  -8.775  1.00 0.00 ? 26  TYR A CB   5  
ATOM 8354  C CG   . TYR A 1 26  ? 4.795   0.378   -9.052  1.00 0.00 ? 26  TYR A CG   5  
ATOM 8355  C CD1  . TYR A 1 26  ? 4.489   1.734   -9.054  1.00 0.00 ? 26  TYR A CD1  5  
ATOM 8356  C CD2  . TYR A 1 26  ? 6.106   0.002   -9.313  1.00 0.00 ? 26  TYR A CD2  5  
ATOM 8357  C CE1  . TYR A 1 26  ? 5.459   2.684   -9.307  1.00 0.00 ? 26  TYR A CE1  5  
ATOM 8358  C CE2  . TYR A 1 26  ? 7.083   0.945   -9.565  1.00 0.00 ? 26  TYR A CE2  5  
ATOM 8359  C CZ   . TYR A 1 26  ? 6.755   2.285   -9.561  1.00 0.00 ? 26  TYR A CZ   5  
ATOM 8360  O OH   . TYR A 1 26  ? 7.725   3.228   -9.814  1.00 0.00 ? 26  TYR A OH   5  
ATOM 8361  H H    . TYR A 1 26  ? 1.303   0.635   -9.589  1.00 0.00 ? 26  TYR A H    5  
ATOM 8362  H HA   . TYR A 1 26  ? 3.320   -1.109  -10.827 1.00 0.00 ? 26  TYR A HA   5  
ATOM 8363  H HB2  . TYR A 1 26  ? 3.176   -0.340  -7.905  1.00 0.00 ? 26  TYR A HB2  5  
ATOM 8364  H HB3  . TYR A 1 26  ? 4.223   -1.594  -8.560  1.00 0.00 ? 26  TYR A HB3  5  
ATOM 8365  H HD1  . TYR A 1 26  ? 3.473   2.043   -8.854  1.00 0.00 ? 26  TYR A HD1  5  
ATOM 8366  H HD2  . TYR A 1 26  ? 6.360   -1.048  -9.315  1.00 0.00 ? 26  TYR A HD2  5  
ATOM 8367  H HE1  . TYR A 1 26  ? 5.203   3.733   -9.304  1.00 0.00 ? 26  TYR A HE1  5  
ATOM 8368  H HE2  . TYR A 1 26  ? 8.098   0.633   -9.765  1.00 0.00 ? 26  TYR A HE2  5  
ATOM 8369  H HH   . TYR A 1 26  ? 7.711   3.894   -9.123  1.00 0.00 ? 26  TYR A HH   5  
ATOM 8370  N N    . TYR A 1 27  ? 2.150   -3.204  -10.101 1.00 0.00 ? 27  TYR A N    5  
ATOM 8371  C CA   . TYR A 1 27  ? 1.327   -4.386  -9.874  1.00 0.00 ? 27  TYR A CA   5  
ATOM 8372  C C    . TYR A 1 27  ? 1.881   -5.223  -8.725  1.00 0.00 ? 27  TYR A C    5  
ATOM 8373  O O    . TYR A 1 27  ? 2.908   -5.888  -8.866  1.00 0.00 ? 27  TYR A O    5  
ATOM 8374  C CB   . TYR A 1 27  ? 1.251   -5.233  -11.146 1.00 0.00 ? 27  TYR A CB   5  
ATOM 8375  C CG   . TYR A 1 27  ? 0.180   -4.779  -12.112 1.00 0.00 ? 27  TYR A CG   5  
ATOM 8376  C CD1  . TYR A 1 27  ? 0.439   -3.790  -13.053 1.00 0.00 ? 27  TYR A CD1  5  
ATOM 8377  C CD2  . TYR A 1 27  ? -1.092  -5.339  -12.082 1.00 0.00 ? 27  TYR A CD2  5  
ATOM 8378  C CE1  . TYR A 1 27  ? -0.537  -3.372  -13.937 1.00 0.00 ? 27  TYR A CE1  5  
ATOM 8379  C CE2  . TYR A 1 27  ? -2.073  -4.928  -12.964 1.00 0.00 ? 27  TYR A CE2  5  
ATOM 8380  C CZ   . TYR A 1 27  ? -1.791  -3.944  -13.889 1.00 0.00 ? 27  TYR A CZ   5  
ATOM 8381  O OH   . TYR A 1 27  ? -2.766  -3.532  -14.767 1.00 0.00 ? 27  TYR A OH   5  
ATOM 8382  H H    . TYR A 1 27  ? 2.977   -3.291  -10.620 1.00 0.00 ? 27  TYR A H    5  
ATOM 8383  H HA   . TYR A 1 27  ? 0.333   -4.053  -9.615  1.00 0.00 ? 27  TYR A HA   5  
ATOM 8384  H HB2  . TYR A 1 27  ? 2.199   -5.187  -11.658 1.00 0.00 ? 27  TYR A HB2  5  
ATOM 8385  H HB3  . TYR A 1 27  ? 1.042   -6.258  -10.876 1.00 0.00 ? 27  TYR A HB3  5  
ATOM 8386  H HD1  . TYR A 1 27  ? 1.422   -3.344  -13.088 1.00 0.00 ? 27  TYR A HD1  5  
ATOM 8387  H HD2  . TYR A 1 27  ? -1.310  -6.108  -11.356 1.00 0.00 ? 27  TYR A HD2  5  
ATOM 8388  H HE1  . TYR A 1 27  ? -0.316  -2.603  -14.662 1.00 0.00 ? 27  TYR A HE1  5  
ATOM 8389  H HE2  . TYR A 1 27  ? -3.055  -5.375  -12.926 1.00 0.00 ? 27  TYR A HE2  5  
ATOM 8390  H HH   . TYR A 1 27  ? -2.354  -3.176  -15.559 1.00 0.00 ? 27  TYR A HH   5  
ATOM 8391  N N    . ILE A 1 28  ? 1.193   -5.185  -7.589  1.00 0.00 ? 28  ILE A N    5  
ATOM 8392  C CA   . ILE A 1 28  ? 1.614   -5.941  -6.416  1.00 0.00 ? 28  ILE A CA   5  
ATOM 8393  C C    . ILE A 1 28  ? 1.446   -7.440  -6.638  1.00 0.00 ? 28  ILE A C    5  
ATOM 8394  O O    . ILE A 1 28  ? 0.369   -7.906  -7.010  1.00 0.00 ? 28  ILE A O    5  
ATOM 8395  C CB   . ILE A 1 28  ? 0.819   -5.526  -5.163  1.00 0.00 ? 28  ILE A CB   5  
ATOM 8396  C CG1  . ILE A 1 28  ? 1.166   -4.089  -4.766  1.00 0.00 ? 28  ILE A CG1  5  
ATOM 8397  C CG2  . ILE A 1 28  ? 1.103   -6.482  -4.015  1.00 0.00 ? 28  ILE A CG2  5  
ATOM 8398  C CD1  . ILE A 1 28  ? 0.662   -3.705  -3.392  1.00 0.00 ? 28  ILE A CD1  5  
ATOM 8399  H H    . ILE A 1 28  ? 0.383   -4.637  -7.539  1.00 0.00 ? 28  ILE A H    5  
ATOM 8400  H HA   . ILE A 1 28  ? 2.659   -5.729  -6.241  1.00 0.00 ? 28  ILE A HA   5  
ATOM 8401  H HB   . ILE A 1 28  ? -0.233  -5.584  -5.397  1.00 0.00 ? 28  ILE A HB   5  
ATOM 8402  H HG12 . ILE A 1 28  ? 2.237   -3.969  -4.771  1.00 0.00 ? 28  ILE A HG12 5  
ATOM 8403  H HG13 . ILE A 1 28  ? 0.728   -3.410  -5.482  1.00 0.00 ? 28  ILE A HG13 5  
ATOM 8404  H HG21 . ILE A 1 28  ? 0.902   -7.495  -4.332  1.00 0.00 ? 28  ILE A HG21 5  
ATOM 8405  H HG22 . ILE A 1 28  ? 2.139   -6.397  -3.723  1.00 0.00 ? 28  ILE A HG22 5  
ATOM 8406  H HG23 . ILE A 1 28  ? 0.471   -6.235  -3.176  1.00 0.00 ? 28  ILE A HG23 5  
ATOM 8407  H HD11 . ILE A 1 28  ? -0.410  -3.837  -3.351  1.00 0.00 ? 28  ILE A HD11 5  
ATOM 8408  H HD12 . ILE A 1 28  ? 1.129   -4.334  -2.648  1.00 0.00 ? 28  ILE A HD12 5  
ATOM 8409  H HD13 . ILE A 1 28  ? 0.905   -2.672  -3.195  1.00 0.00 ? 28  ILE A HD13 5  
ATOM 8410  N N    . LYS A 1 29  ? 2.517   -8.191  -6.404  1.00 0.00 ? 29  LYS A N    5  
ATOM 8411  C CA   . LYS A 1 29  ? 2.488   -9.639  -6.575  1.00 0.00 ? 29  LYS A CA   5  
ATOM 8412  C C    . LYS A 1 29  ? 1.944   -10.323 -5.326  1.00 0.00 ? 29  LYS A C    5  
ATOM 8413  O O    . LYS A 1 29  ? 1.661   -9.670  -4.322  1.00 0.00 ? 29  LYS A O    5  
ATOM 8414  C CB   . LYS A 1 29  ? 3.891   -10.164 -6.887  1.00 0.00 ? 29  LYS A CB   5  
ATOM 8415  C CG   . LYS A 1 29  ? 5.002   -9.353  -6.241  1.00 0.00 ? 29  LYS A CG   5  
ATOM 8416  C CD   . LYS A 1 29  ? 4.754   -9.153  -4.755  1.00 0.00 ? 29  LYS A CD   5  
ATOM 8417  C CE   . LYS A 1 29  ? 5.038   -10.423 -3.968  1.00 0.00 ? 29  LYS A CE   5  
ATOM 8418  N NZ   . LYS A 1 29  ? 4.934   -10.200 -2.499  1.00 0.00 ? 29  LYS A NZ   5  
ATOM 8419  H H    . LYS A 1 29  ? 3.347   -7.761  -6.109  1.00 0.00 ? 29  LYS A H    5  
ATOM 8420  H HA   . LYS A 1 29  ? 1.837   -9.862  -7.406  1.00 0.00 ? 29  LYS A HA   5  
ATOM 8421  H HB2  . LYS A 1 29  ? 3.968   -11.183 -6.537  1.00 0.00 ? 29  LYS A HB2  5  
ATOM 8422  H HB3  . LYS A 1 29  ? 4.039   -10.148 -7.957  1.00 0.00 ? 29  LYS A HB3  5  
ATOM 8423  H HG2  . LYS A 1 29  ? 5.939   -9.873  -6.372  1.00 0.00 ? 29  LYS A HG2  5  
ATOM 8424  H HG3  . LYS A 1 29  ? 5.055   -8.386  -6.721  1.00 0.00 ? 29  LYS A HG3  5  
ATOM 8425  H HD2  . LYS A 1 29  ? 5.401   -8.367  -4.394  1.00 0.00 ? 29  LYS A HD2  5  
ATOM 8426  H HD3  . LYS A 1 29  ? 3.722   -8.870  -4.606  1.00 0.00 ? 29  LYS A HD3  5  
ATOM 8427  H HE2  . LYS A 1 29  ? 4.325   -11.179 -4.259  1.00 0.00 ? 29  LYS A HE2  5  
ATOM 8428  H HE3  . LYS A 1 29  ? 6.037   -10.761 -4.202  1.00 0.00 ? 29  LYS A HE3  5  
ATOM 8429  H HZ1  . LYS A 1 29  ? 4.346   -10.939 -2.065  1.00 0.00 ? 29  LYS A HZ1  5  
ATOM 8430  H HZ2  . LYS A 1 29  ? 4.504   -9.272  -2.309  1.00 0.00 ? 29  LYS A HZ2  5  
ATOM 8431  H HZ3  . LYS A 1 29  ? 5.880   -10.225 -2.066  1.00 0.00 ? 29  LYS A HZ3  5  
ATOM 8432  N N    . ASP A 1 30  ? 1.800   -11.642 -5.394  1.00 0.00 ? 30  ASP A N    5  
ATOM 8433  C CA   . ASP A 1 30  ? 1.292   -12.416 -4.268  1.00 0.00 ? 30  ASP A CA   5  
ATOM 8434  C C    . ASP A 1 30  ? 2.410   -12.735 -3.280  1.00 0.00 ? 30  ASP A C    5  
ATOM 8435  O O    . ASP A 1 30  ? 3.461   -13.249 -3.661  1.00 0.00 ? 30  ASP A O    5  
ATOM 8436  C CB   . ASP A 1 30  ? 0.645   -13.711 -4.761  1.00 0.00 ? 30  ASP A CB   5  
ATOM 8437  C CG   . ASP A 1 30  ? -0.639  -13.461 -5.527  1.00 0.00 ? 30  ASP A CG   5  
ATOM 8438  O OD1  . ASP A 1 30  ? -0.828  -12.327 -6.016  1.00 0.00 ? 30  ASP A OD1  5  
ATOM 8439  O OD2  . ASP A 1 30  ? -1.455  -14.400 -5.639  1.00 0.00 ? 30  ASP A OD2  5  
ATOM 8440  H H    . ASP A 1 30  ? 2.043   -12.107 -6.223  1.00 0.00 ? 30  ASP A H    5  
ATOM 8441  H HA   . ASP A 1 30  ? 0.545   -11.820 -3.766  1.00 0.00 ? 30  ASP A HA   5  
ATOM 8442  H HB2  . ASP A 1 30  ? 1.336   -14.226 -5.412  1.00 0.00 ? 30  ASP A HB2  5  
ATOM 8443  H HB3  . ASP A 1 30  ? 0.421   -14.340 -3.912  1.00 0.00 ? 30  ASP A HB3  5  
ATOM 8444  N N    . GLY A 1 31  ? 2.175   -12.427 -2.008  1.00 0.00 ? 31  GLY A N    5  
ATOM 8445  C CA   . GLY A 1 31  ? 3.171   -12.687 -0.985  1.00 0.00 ? 31  GLY A CA   5  
ATOM 8446  C C    . GLY A 1 31  ? 3.401   -11.491 -0.082  1.00 0.00 ? 31  GLY A C    5  
ATOM 8447  O O    . GLY A 1 31  ? 2.478   -11.023 0.585   1.00 0.00 ? 31  GLY A O    5  
ATOM 8448  H H    . GLY A 1 31  ? 1.318   -12.019 -1.762  1.00 0.00 ? 31  GLY A H    5  
ATOM 8449  H HA2  . GLY A 1 31  ? 2.844   -13.522 -0.384  1.00 0.00 ? 31  GLY A HA2  5  
ATOM 8450  H HA3  . GLY A 1 31  ? 4.104   -12.945 -1.465  1.00 0.00 ? 31  GLY A HA3  5  
ATOM 8451  N N    . ILE A 1 32  ? 4.634   -10.997 -0.059  1.00 0.00 ? 32  ILE A N    5  
ATOM 8452  C CA   . ILE A 1 32  ? 4.981   -9.850  0.770   1.00 0.00 ? 32  ILE A CA   5  
ATOM 8453  C C    . ILE A 1 32  ? 5.672   -8.767  -0.052  1.00 0.00 ? 32  ILE A C    5  
ATOM 8454  O O    . ILE A 1 32  ? 6.704   -9.010  -0.678  1.00 0.00 ? 32  ILE A O    5  
ATOM 8455  C CB   . ILE A 1 32  ? 5.899   -10.256 1.938   1.00 0.00 ? 32  ILE A CB   5  
ATOM 8456  C CG1  . ILE A 1 32  ? 5.087   -10.938 3.041   1.00 0.00 ? 32  ILE A CG1  5  
ATOM 8457  C CG2  . ILE A 1 32  ? 6.630   -9.039  2.486   1.00 0.00 ? 32  ILE A CG2  5  
ATOM 8458  C CD1  . ILE A 1 32  ? 4.367   -9.966  3.950   1.00 0.00 ? 32  ILE A CD1  5  
ATOM 8459  H H    . ILE A 1 32  ? 5.326   -11.414 -0.613  1.00 0.00 ? 32  ILE A H    5  
ATOM 8460  H HA   . ILE A 1 32  ? 4.067   -9.447  1.181   1.00 0.00 ? 32  ILE A HA   5  
ATOM 8461  H HB   . ILE A 1 32  ? 6.636   -10.950 1.563   1.00 0.00 ? 32  ILE A HB   5  
ATOM 8462  H HG12 . ILE A 1 32  ? 4.346   -11.579 2.590   1.00 0.00 ? 32  ILE A HG12 5  
ATOM 8463  H HG13 . ILE A 1 32  ? 5.750   -11.534 3.650   1.00 0.00 ? 32  ILE A HG13 5  
ATOM 8464  H HG21 . ILE A 1 32  ? 7.078   -9.286  3.437   1.00 0.00 ? 32  ILE A HG21 5  
ATOM 8465  H HG22 . ILE A 1 32  ? 7.401   -8.740  1.792   1.00 0.00 ? 32  ILE A HG22 5  
ATOM 8466  H HG23 . ILE A 1 32  ? 5.930   -8.228  2.618   1.00 0.00 ? 32  ILE A HG23 5  
ATOM 8467  H HD11 . ILE A 1 32  ? 3.648   -9.400  3.375   1.00 0.00 ? 32  ILE A HD11 5  
ATOM 8468  H HD12 . ILE A 1 32  ? 3.855   -10.512 4.728   1.00 0.00 ? 32  ILE A HD12 5  
ATOM 8469  H HD13 . ILE A 1 32  ? 5.083   -9.290  4.394   1.00 0.00 ? 32  ILE A HD13 5  
ATOM 8470  N N    . THR A 1 33  ? 5.097   -7.568  -0.044  1.00 0.00 ? 33  THR A N    5  
ATOM 8471  C CA   . THR A 1 33  ? 5.657   -6.447  -0.788  1.00 0.00 ? 33  THR A CA   5  
ATOM 8472  C C    . THR A 1 33  ? 6.028   -5.299  0.144   1.00 0.00 ? 33  THR A C    5  
ATOM 8473  O O    . THR A 1 33  ? 5.189   -4.462  0.477   1.00 0.00 ? 33  THR A O    5  
ATOM 8474  C CB   . THR A 1 33  ? 4.671   -5.931  -1.853  1.00 0.00 ? 33  THR A CB   5  
ATOM 8475  O OG1  . THR A 1 33  ? 4.432   -6.947  -2.833  1.00 0.00 ? 33  THR A OG1  5  
ATOM 8476  C CG2  . THR A 1 33  ? 5.212   -4.681  -2.531  1.00 0.00 ? 33  THR A CG2  5  
ATOM 8477  H H    . THR A 1 33  ? 4.276   -7.437  0.474   1.00 0.00 ? 33  THR A H    5  
ATOM 8478  H HA   . THR A 1 33  ? 6.549   -6.793  -1.291  1.00 0.00 ? 33  THR A HA   5  
ATOM 8479  H HB   . THR A 1 33  ? 3.738   -5.683  -1.367  1.00 0.00 ? 33  THR A HB   5  
ATOM 8480  H HG1  . THR A 1 33  ? 4.205   -6.536  -3.671  1.00 0.00 ? 33  THR A HG1  5  
ATOM 8481  H HG21 . THR A 1 33  ? 5.357   -4.878  -3.583  1.00 0.00 ? 33  THR A HG21 5  
ATOM 8482  H HG22 . THR A 1 33  ? 6.156   -4.409  -2.083  1.00 0.00 ? 33  THR A HG22 5  
ATOM 8483  H HG23 . THR A 1 33  ? 4.508   -3.872  -2.409  1.00 0.00 ? 33  THR A HG23 5  
ATOM 8484  N N    . ARG A 1 34  ? 7.289   -5.267  0.562   1.00 0.00 ? 34  ARG A N    5  
ATOM 8485  C CA   . ARG A 1 34  ? 7.770   -4.221  1.457   1.00 0.00 ? 34  ARG A CA   5  
ATOM 8486  C C    . ARG A 1 34  ? 8.034   -2.928  0.690   1.00 0.00 ? 34  ARG A C    5  
ATOM 8487  O O    . ARG A 1 34  ? 8.742   -2.924  -0.317  1.00 0.00 ? 34  ARG A O    5  
ATOM 8488  C CB   . ARG A 1 34  ? 9.048   -4.675  2.166   1.00 0.00 ? 34  ARG A CB   5  
ATOM 8489  C CG   . ARG A 1 34  ? 8.951   -6.071  2.760   1.00 0.00 ? 34  ARG A CG   5  
ATOM 8490  C CD   . ARG A 1 34  ? 10.045  -6.315  3.788   1.00 0.00 ? 34  ARG A CD   5  
ATOM 8491  N NE   . ARG A 1 34  ? 9.926   -7.631  4.410   1.00 0.00 ? 34  ARG A NE   5  
ATOM 8492  C CZ   . ARG A 1 34  ? 10.382  -8.750  3.857   1.00 0.00 ? 34  ARG A CZ   5  
ATOM 8493  N NH1  . ARG A 1 34  ? 10.983  -8.712  2.676   1.00 0.00 ? 34  ARG A NH1  5  
ATOM 8494  N NH2  . ARG A 1 34  ? 10.236  -9.909  4.486   1.00 0.00 ? 34  ARG A NH2  5  
ATOM 8495  H H    . ARG A 1 34  ? 7.911   -5.962  0.262   1.00 0.00 ? 34  ARG A H    5  
ATOM 8496  H HA   . ARG A 1 34  ? 7.005   -4.038  2.196   1.00 0.00 ? 34  ARG A HA   5  
ATOM 8497  H HB2  . ARG A 1 34  ? 9.862   -4.666  1.457   1.00 0.00 ? 34  ARG A HB2  5  
ATOM 8498  H HB3  . ARG A 1 34  ? 9.268   -3.982  2.964   1.00 0.00 ? 34  ARG A HB3  5  
ATOM 8499  H HG2  . ARG A 1 34  ? 7.990   -6.182  3.241   1.00 0.00 ? 34  ARG A HG2  5  
ATOM 8500  H HG3  . ARG A 1 34  ? 9.045   -6.797  1.966   1.00 0.00 ? 34  ARG A HG3  5  
ATOM 8501  H HD2  . ARG A 1 34  ? 11.004  -6.246  3.296   1.00 0.00 ? 34  ARG A HD2  5  
ATOM 8502  H HD3  . ARG A 1 34  ? 9.977   -5.557  4.553   1.00 0.00 ? 34  ARG A HD3  5  
ATOM 8503  H HE   . ARG A 1 34  ? 9.485   -7.682  5.283   1.00 0.00 ? 34  ARG A HE   5  
ATOM 8504  H HH11 . ARG A 1 34  ? 11.095  -7.840  2.201   1.00 0.00 ? 34  ARG A HH11 5  
ATOM 8505  H HH12 . ARG A 1 34  ? 11.326  -9.556  2.262   1.00 0.00 ? 34  ARG A HH12 5  
ATOM 8506  H HH21 . ARG A 1 34  ? 9.783   -9.941  5.376   1.00 0.00 ? 34  ARG A HH21 5  
ATOM 8507  H HH22 . ARG A 1 34  ? 10.579  -10.750 4.069   1.00 0.00 ? 34  ARG A HH22 5  
ATOM 8508  N N    . VAL A 1 35  ? 7.458   -1.832  1.174   1.00 0.00 ? 35  VAL A N    5  
ATOM 8509  C CA   . VAL A 1 35  ? 7.631   -0.532  0.535   1.00 0.00 ? 35  VAL A CA   5  
ATOM 8510  C C    . VAL A 1 35  ? 8.691   0.296   1.252   1.00 0.00 ? 35  VAL A C    5  
ATOM 8511  O O    . VAL A 1 35  ? 8.426   0.895   2.293   1.00 0.00 ? 35  VAL A O    5  
ATOM 8512  C CB   . VAL A 1 35  ? 6.310   0.259   0.506   1.00 0.00 ? 35  VAL A CB   5  
ATOM 8513  C CG1  . VAL A 1 35  ? 6.379   1.376   -0.525  1.00 0.00 ? 35  VAL A CG1  5  
ATOM 8514  C CG2  . VAL A 1 35  ? 5.139   -0.670  0.220   1.00 0.00 ? 35  VAL A CG2  5  
ATOM 8515  H H    . VAL A 1 35  ? 6.906   -1.898  1.980   1.00 0.00 ? 35  VAL A H    5  
ATOM 8516  H HA   . VAL A 1 35  ? 7.948   -0.701  -0.484  1.00 0.00 ? 35  VAL A HA   5  
ATOM 8517  H HB   . VAL A 1 35  ? 6.159   0.705   1.478   1.00 0.00 ? 35  VAL A HB   5  
ATOM 8518  H HG11 . VAL A 1 35  ? 6.210   0.967   -1.510  1.00 0.00 ? 35  VAL A HG11 5  
ATOM 8519  H HG12 . VAL A 1 35  ? 5.622   2.115   -0.306  1.00 0.00 ? 35  VAL A HG12 5  
ATOM 8520  H HG13 . VAL A 1 35  ? 7.355   1.837   -0.490  1.00 0.00 ? 35  VAL A HG13 5  
ATOM 8521  H HG21 . VAL A 1 35  ? 4.580   -0.835  1.128   1.00 0.00 ? 35  VAL A HG21 5  
ATOM 8522  H HG22 . VAL A 1 35  ? 4.497   -0.221  -0.523  1.00 0.00 ? 35  VAL A HG22 5  
ATOM 8523  H HG23 . VAL A 1 35  ? 5.511   -1.615  -0.150  1.00 0.00 ? 35  VAL A HG23 5  
ATOM 8524  N N    . GLY A 1 36  ? 9.894   0.326   0.686   1.00 0.00 ? 36  GLY A N    5  
ATOM 8525  C CA   . GLY A 1 36  ? 10.977  1.085   1.285   1.00 0.00 ? 36  GLY A CA   5  
ATOM 8526  C C    . GLY A 1 36  ? 12.011  1.521   0.266   1.00 0.00 ? 36  GLY A C    5  
ATOM 8527  O O    . GLY A 1 36  ? 11.666  1.909   -0.850  1.00 0.00 ? 36  GLY A O    5  
ATOM 8528  H H    . GLY A 1 36  ? 10.048  -0.171  -0.145  1.00 0.00 ? 36  GLY A H    5  
ATOM 8529  H HA2  . GLY A 1 36  ? 10.566  1.961   1.764   1.00 0.00 ? 36  GLY A HA2  5  
ATOM 8530  H HA3  . GLY A 1 36  ? 11.460  0.472   2.031   1.00 0.00 ? 36  GLY A HA3  5  
ATOM 8531  N N    . GLN A 1 37  ? 13.282  1.460   0.652   1.00 0.00 ? 37  GLN A N    5  
ATOM 8532  C CA   . GLN A 1 37  ? 14.369  1.855   -0.236  1.00 0.00 ? 37  GLN A CA   5  
ATOM 8533  C C    . GLN A 1 37  ? 15.031  0.632   -0.862  1.00 0.00 ? 37  GLN A C    5  
ATOM 8534  O O    . GLN A 1 37  ? 14.761  -0.502  -0.469  1.00 0.00 ? 37  GLN A O    5  
ATOM 8535  C CB   . GLN A 1 37  ? 15.407  2.677   0.529   1.00 0.00 ? 37  GLN A CB   5  
ATOM 8536  C CG   . GLN A 1 37  ? 15.035  4.144   0.674   1.00 0.00 ? 37  GLN A CG   5  
ATOM 8537  C CD   . GLN A 1 37  ? 15.157  4.908   -0.629  1.00 0.00 ? 37  GLN A CD   5  
ATOM 8538  O OE1  . GLN A 1 37  ? 16.245  5.342   -1.008  1.00 0.00 ? 37  GLN A OE1  5  
ATOM 8539  N NE2  . GLN A 1 37  ? 14.037  5.077   -1.324  1.00 0.00 ? 37  GLN A NE2  5  
ATOM 8540  H H    . GLN A 1 37  ? 13.492  1.142   1.554   1.00 0.00 ? 37  GLN A H    5  
ATOM 8541  H HA   . GLN A 1 37  ? 13.949  2.464   -1.023  1.00 0.00 ? 37  GLN A HA   5  
ATOM 8542  H HB2  . GLN A 1 37  ? 15.524  2.258   1.517   1.00 0.00 ? 37  GLN A HB2  5  
ATOM 8543  H HB3  . GLN A 1 37  ? 16.351  2.617   0.008   1.00 0.00 ? 37  GLN A HB3  5  
ATOM 8544  H HG2  . GLN A 1 37  ? 14.014  4.211   1.018   1.00 0.00 ? 37  GLN A HG2  5  
ATOM 8545  H HG3  . GLN A 1 37  ? 15.690  4.597   1.403   1.00 0.00 ? 37  GLN A HG3  5  
ATOM 8546  H HE21 . GLN A 1 37  ? 13.207  4.705   -0.959  1.00 0.00 ? 37  GLN A HE21 5  
ATOM 8547  H HE22 . GLN A 1 37  ? 14.087  5.568   -2.169  1.00 0.00 ? 37  GLN A HE22 5  
ATOM 8548  N N    . ALA A 1 38  ? 15.900  0.872   -1.839  1.00 0.00 ? 38  ALA A N    5  
ATOM 8549  C CA   . ALA A 1 38  ? 16.603  -0.210  -2.519  1.00 0.00 ? 38  ALA A CA   5  
ATOM 8550  C C    . ALA A 1 38  ? 17.860  -0.613  -1.755  1.00 0.00 ? 38  ALA A C    5  
ATOM 8551  O O    . ALA A 1 38  ? 18.472  -1.640  -2.047  1.00 0.00 ? 38  ALA A O    5  
ATOM 8552  C CB   . ALA A 1 38  ? 16.956  0.202   -3.940  1.00 0.00 ? 38  ALA A CB   5  
ATOM 8553  H H    . ALA A 1 38  ? 16.074  1.798   -2.108  1.00 0.00 ? 38  ALA A H    5  
ATOM 8554  H HA   . ALA A 1 38  ? 15.937  -1.059  -2.571  1.00 0.00 ? 38  ALA A HA   5  
ATOM 8555  H HB1  . ALA A 1 38  ? 17.960  -0.122  -4.169  1.00 0.00 ? 38  ALA A HB1  5  
ATOM 8556  H HB2  . ALA A 1 38  ? 16.263  -0.258  -4.630  1.00 0.00 ? 38  ALA A HB2  5  
ATOM 8557  H HB3  . ALA A 1 38  ? 16.894  1.276   -4.030  1.00 0.00 ? 38  ALA A HB3  5  
ATOM 8558  N N    . ASP A 1 39  ? 18.239  0.202   -0.777  1.00 0.00 ? 39  ASP A N    5  
ATOM 8559  C CA   . ASP A 1 39  ? 19.423  -0.070  0.029   1.00 0.00 ? 39  ASP A CA   5  
ATOM 8560  C C    . ASP A 1 39  ? 19.059  -0.866  1.278   1.00 0.00 ? 39  ASP A C    5  
ATOM 8561  O O    . ASP A 1 39  ? 19.891  -1.582  1.835   1.00 0.00 ? 39  ASP A O    5  
ATOM 8562  C CB   . ASP A 1 39  ? 20.109  1.239   0.425   1.00 0.00 ? 39  ASP A CB   5  
ATOM 8563  C CG   . ASP A 1 39  ? 21.577  1.048   0.751   1.00 0.00 ? 39  ASP A CG   5  
ATOM 8564  O OD1  . ASP A 1 39  ? 22.113  -0.043  0.461   1.00 0.00 ? 39  ASP A OD1  5  
ATOM 8565  O OD2  . ASP A 1 39  ? 22.190  1.989   1.296   1.00 0.00 ? 39  ASP A OD2  5  
ATOM 8566  H H    . ASP A 1 39  ? 17.709  1.006   -0.592  1.00 0.00 ? 39  ASP A H    5  
ATOM 8567  H HA   . ASP A 1 39  ? 20.104  -0.656  -0.569  1.00 0.00 ? 39  ASP A HA   5  
ATOM 8568  H HB2  . ASP A 1 39  ? 20.029  1.941   -0.392  1.00 0.00 ? 39  ASP A HB2  5  
ATOM 8569  H HB3  . ASP A 1 39  ? 19.615  1.647   1.295   1.00 0.00 ? 39  ASP A HB3  5  
ATOM 8570  N N    . ALA A 1 40  ? 17.810  -0.736  1.714   1.00 0.00 ? 40  ALA A N    5  
ATOM 8571  C CA   . ALA A 1 40  ? 17.336  -1.443  2.897   1.00 0.00 ? 40  ALA A CA   5  
ATOM 8572  C C    . ALA A 1 40  ? 17.950  -2.836  2.986   1.00 0.00 ? 40  ALA A C    5  
ATOM 8573  O O    . ALA A 1 40  ? 18.157  -3.499  1.970   1.00 0.00 ? 40  ALA A O    5  
ATOM 8574  C CB   . ALA A 1 40  ? 15.817  -1.534  2.883   1.00 0.00 ? 40  ALA A CB   5  
ATOM 8575  H H    . ALA A 1 40  ? 17.193  -0.150  1.228   1.00 0.00 ? 40  ALA A H    5  
ATOM 8576  H HA   . ALA A 1 40  ? 17.630  -0.874  3.767   1.00 0.00 ? 40  ALA A HA   5  
ATOM 8577  H HB1  . ALA A 1 40  ? 15.493  -2.018  1.975   1.00 0.00 ? 40  ALA A HB1  5  
ATOM 8578  H HB2  . ALA A 1 40  ? 15.484  -2.108  3.736   1.00 0.00 ? 40  ALA A HB2  5  
ATOM 8579  H HB3  . ALA A 1 40  ? 15.397  -0.540  2.932   1.00 0.00 ? 40  ALA A HB3  5  
ATOM 8580  N N    . GLU A 1 41  ? 18.239  -3.273  4.208   1.00 0.00 ? 41  GLU A N    5  
ATOM 8581  C CA   . GLU A 1 41  ? 18.831  -4.588  4.428   1.00 0.00 ? 41  GLU A CA   5  
ATOM 8582  C C    . GLU A 1 41  ? 18.258  -5.612  3.453   1.00 0.00 ? 41  GLU A C    5  
ATOM 8583  O O    . GLU A 1 41  ? 18.995  -6.241  2.693   1.00 0.00 ? 41  GLU A O    5  
ATOM 8584  C CB   . GLU A 1 41  ? 18.589  -5.046  5.868   1.00 0.00 ? 41  GLU A CB   5  
ATOM 8585  C CG   . GLU A 1 41  ? 18.668  -3.921  6.886   1.00 0.00 ? 41  GLU A CG   5  
ATOM 8586  C CD   . GLU A 1 41  ? 19.039  -4.413  8.271   1.00 0.00 ? 41  GLU A CD   5  
ATOM 8587  O OE1  . GLU A 1 41  ? 20.214  -4.785  8.475   1.00 0.00 ? 41  GLU A OE1  5  
ATOM 8588  O OE2  . GLU A 1 41  ? 18.154  -4.426  9.153   1.00 0.00 ? 41  GLU A OE2  5  
ATOM 8589  H H    . GLU A 1 41  ? 18.050  -2.698  4.979   1.00 0.00 ? 41  GLU A H    5  
ATOM 8590  H HA   . GLU A 1 41  ? 19.894  -4.504  4.261   1.00 0.00 ? 41  GLU A HA   5  
ATOM 8591  H HB2  . GLU A 1 41  ? 17.607  -5.492  5.930   1.00 0.00 ? 41  GLU A HB2  5  
ATOM 8592  H HB3  . GLU A 1 41  ? 19.329  -5.789  6.125   1.00 0.00 ? 41  GLU A HB3  5  
ATOM 8593  H HG2  . GLU A 1 41  ? 19.414  -3.211  6.562   1.00 0.00 ? 41  GLU A HG2  5  
ATOM 8594  H HG3  . GLU A 1 41  ? 17.706  -3.432  6.939   1.00 0.00 ? 41  GLU A HG3  5  
ATOM 8595  N N    . ARG A 1 42  ? 16.940  -5.776  3.482   1.00 0.00 ? 42  ARG A N    5  
ATOM 8596  C CA   . ARG A 1 42  ? 16.268  -6.725  2.603   1.00 0.00 ? 42  ARG A CA   5  
ATOM 8597  C C    . ARG A 1 42  ? 15.809  -6.044  1.317   1.00 0.00 ? 42  ARG A C    5  
ATOM 8598  O O    . ARG A 1 42  ? 15.409  -4.880  1.328   1.00 0.00 ? 42  ARG A O    5  
ATOM 8599  C CB   . ARG A 1 42  ? 15.069  -7.353  3.317   1.00 0.00 ? 42  ARG A CB   5  
ATOM 8600  C CG   . ARG A 1 42  ? 15.405  -7.924  4.685   1.00 0.00 ? 42  ARG A CG   5  
ATOM 8601  C CD   . ARG A 1 42  ? 15.997  -9.321  4.576   1.00 0.00 ? 42  ARG A CD   5  
ATOM 8602  N NE   . ARG A 1 42  ? 17.346  -9.301  4.018   1.00 0.00 ? 42  ARG A NE   5  
ATOM 8603  C CZ   . ARG A 1 42  ? 18.432  -9.023  4.730   1.00 0.00 ? 42  ARG A CZ   5  
ATOM 8604  N NH1  . ARG A 1 42  ? 18.328  -8.741  6.022   1.00 0.00 ? 42  ARG A NH1  5  
ATOM 8605  N NH2  . ARG A 1 42  ? 19.626  -9.025  4.151   1.00 0.00 ? 42  ARG A NH2  5  
ATOM 8606  H H    . ARG A 1 42  ? 16.406  -5.246  4.110   1.00 0.00 ? 42  ARG A H    5  
ATOM 8607  H HA   . ARG A 1 42  ? 16.974  -7.502  2.353   1.00 0.00 ? 42  ARG A HA   5  
ATOM 8608  H HB2  . ARG A 1 42  ? 14.305  -6.600  3.443   1.00 0.00 ? 42  ARG A HB2  5  
ATOM 8609  H HB3  . ARG A 1 42  ? 14.679  -8.151  2.704   1.00 0.00 ? 42  ARG A HB3  5  
ATOM 8610  H HG2  . ARG A 1 42  ? 16.124  -7.278  5.168   1.00 0.00 ? 42  ARG A HG2  5  
ATOM 8611  H HG3  . ARG A 1 42  ? 14.504  -7.969  5.277   1.00 0.00 ? 42  ARG A HG3  5  
ATOM 8612  H HD2  . ARG A 1 42  ? 16.032  -9.760  5.561   1.00 0.00 ? 42  ARG A HD2  5  
ATOM 8613  H HD3  . ARG A 1 42  ? 15.362  -9.917  3.938   1.00 0.00 ? 42  ARG A HD3  5  
ATOM 8614  H HE   . ARG A 1 42  ? 17.447  -9.507  3.065   1.00 0.00 ? 42  ARG A HE   5  
ATOM 8615  H HH11 . ARG A 1 42  ? 17.430  -8.739  6.461   1.00 0.00 ? 42  ARG A HH11 5  
ATOM 8616  H HH12 . ARG A 1 42  ? 19.147  -8.533  6.556   1.00 0.00 ? 42  ARG A HH12 5  
ATOM 8617  H HH21 . ARG A 1 42  ? 19.709  -9.237  3.177   1.00 0.00 ? 42  ARG A HH21 5  
ATOM 8618  H HH22 . ARG A 1 42  ? 20.442  -8.815  4.688   1.00 0.00 ? 42  ARG A HH22 5  
ATOM 8619  N N    . ARG A 1 43  ? 15.869  -6.778  0.211   1.00 0.00 ? 43  ARG A N    5  
ATOM 8620  C CA   . ARG A 1 43  ? 15.461  -6.245  -1.083  1.00 0.00 ? 43  ARG A CA   5  
ATOM 8621  C C    . ARG A 1 43  ? 13.983  -5.865  -1.073  1.00 0.00 ? 43  ARG A C    5  
ATOM 8622  O O    . ARG A 1 43  ? 13.114  -6.713  -1.270  1.00 0.00 ? 43  ARG A O    5  
ATOM 8623  C CB   . ARG A 1 43  ? 15.728  -7.269  -2.188  1.00 0.00 ? 43  ARG A CB   5  
ATOM 8624  C CG   . ARG A 1 43  ? 15.504  -6.726  -3.589  1.00 0.00 ? 43  ARG A CG   5  
ATOM 8625  C CD   . ARG A 1 43  ? 15.673  -7.810  -4.641  1.00 0.00 ? 43  ARG A CD   5  
ATOM 8626  N NE   . ARG A 1 43  ? 15.088  -7.426  -5.923  1.00 0.00 ? 43  ARG A NE   5  
ATOM 8627  C CZ   . ARG A 1 43  ? 15.584  -6.468  -6.699  1.00 0.00 ? 43  ARG A CZ   5  
ATOM 8628  N NH1  . ARG A 1 43  ? 16.667  -5.802  -6.325  1.00 0.00 ? 43  ARG A NH1  5  
ATOM 8629  N NH2  . ARG A 1 43  ? 14.996  -6.176  -7.852  1.00 0.00 ? 43  ARG A NH2  5  
ATOM 8630  H H    . ARG A 1 43  ? 16.197  -7.700  0.266   1.00 0.00 ? 43  ARG A H    5  
ATOM 8631  H HA   . ARG A 1 43  ? 16.047  -5.359  -1.277  1.00 0.00 ? 43  ARG A HA   5  
ATOM 8632  H HB2  . ARG A 1 43  ? 16.753  -7.602  -2.114  1.00 0.00 ? 43  ARG A HB2  5  
ATOM 8633  H HB3  . ARG A 1 43  ? 15.072  -8.115  -2.044  1.00 0.00 ? 43  ARG A HB3  5  
ATOM 8634  H HG2  . ARG A 1 43  ? 14.501  -6.329  -3.656  1.00 0.00 ? 43  ARG A HG2  5  
ATOM 8635  H HG3  . ARG A 1 43  ? 16.218  -5.938  -3.778  1.00 0.00 ? 43  ARG A HG3  5  
ATOM 8636  H HD2  . ARG A 1 43  ? 16.727  -7.998  -4.779  1.00 0.00 ? 43  ARG A HD2  5  
ATOM 8637  H HD3  . ARG A 1 43  ? 15.190  -8.711  -4.291  1.00 0.00 ? 43  ARG A HD3  5  
ATOM 8638  H HE   . ARG A 1 43  ? 14.287  -7.906  -6.219  1.00 0.00 ? 43  ARG A HE   5  
ATOM 8639  H HH11 . ARG A 1 43  ? 17.113  -6.020  -5.458  1.00 0.00 ? 43  ARG A HH11 5  
ATOM 8640  H HH12 . ARG A 1 43  ? 17.039  -5.082  -6.912  1.00 0.00 ? 43  ARG A HH12 5  
ATOM 8641  H HH21 . ARG A 1 43  ? 14.179  -6.676  -8.137  1.00 0.00 ? 43  ARG A HH21 5  
ATOM 8642  H HH22 . ARG A 1 43  ? 15.369  -5.455  -8.435  1.00 0.00 ? 43  ARG A HH22 5  
ATOM 8643  N N    . GLN A 1 44  ? 13.708  -4.585  -0.842  1.00 0.00 ? 44  GLN A N    5  
ATOM 8644  C CA   . GLN A 1 44  ? 12.336  -4.094  -0.805  1.00 0.00 ? 44  GLN A CA   5  
ATOM 8645  C C    . GLN A 1 44  ? 11.643  -4.314  -2.146  1.00 0.00 ? 44  GLN A C    5  
ATOM 8646  O O    . GLN A 1 44  ? 12.144  -3.897  -3.190  1.00 0.00 ? 44  GLN A O    5  
ATOM 8647  C CB   . GLN A 1 44  ? 12.314  -2.608  -0.444  1.00 0.00 ? 44  GLN A CB   5  
ATOM 8648  C CG   . GLN A 1 44  ? 12.758  -2.321  0.982   1.00 0.00 ? 44  GLN A CG   5  
ATOM 8649  C CD   . GLN A 1 44  ? 11.647  -2.528  1.992   1.00 0.00 ? 44  GLN A CD   5  
ATOM 8650  O OE1  . GLN A 1 44  ? 10.529  -2.046  1.810   1.00 0.00 ? 44  GLN A OE1  5  
ATOM 8651  N NE2  . GLN A 1 44  ? 11.950  -3.248  3.066   1.00 0.00 ? 44  GLN A NE2  5  
ATOM 8652  H H    . GLN A 1 44  ? 14.445  -3.957  -0.693  1.00 0.00 ? 44  GLN A H    5  
ATOM 8653  H HA   . GLN A 1 44  ? 11.806  -4.648  -0.045  1.00 0.00 ? 44  GLN A HA   5  
ATOM 8654  H HB2  . GLN A 1 44  ? 12.970  -2.076  -1.117  1.00 0.00 ? 44  GLN A HB2  5  
ATOM 8655  H HB3  . GLN A 1 44  ? 11.307  -2.235  -0.565  1.00 0.00 ? 44  GLN A HB3  5  
ATOM 8656  H HG2  . GLN A 1 44  ? 13.576  -2.981  1.229   1.00 0.00 ? 44  GLN A HG2  5  
ATOM 8657  H HG3  . GLN A 1 44  ? 13.094  -1.296  1.041   1.00 0.00 ? 44  GLN A HG3  5  
ATOM 8658  H HE21 . GLN A 1 44  ? 12.862  -3.600  3.145   1.00 0.00 ? 44  GLN A HE21 5  
ATOM 8659  H HE22 . GLN A 1 44  ? 11.251  -3.397  3.735   1.00 0.00 ? 44  GLN A HE22 5  
ATOM 8660  N N    . ASP A 1 45  ? 10.489  -4.971  -2.109  1.00 0.00 ? 45  ASP A N    5  
ATOM 8661  C CA   . ASP A 1 45  ? 9.727   -5.246  -3.321  1.00 0.00 ? 45  ASP A CA   5  
ATOM 8662  C C    . ASP A 1 45  ? 9.605   -3.993  -4.182  1.00 0.00 ? 45  ASP A C    5  
ATOM 8663  O O    . ASP A 1 45  ? 9.962   -4.002  -5.361  1.00 0.00 ? 45  ASP A O    5  
ATOM 8664  C CB   . ASP A 1 45  ? 8.335   -5.772  -2.965  1.00 0.00 ? 45  ASP A CB   5  
ATOM 8665  C CG   . ASP A 1 45  ? 8.308   -7.281  -2.813  1.00 0.00 ? 45  ASP A CG   5  
ATOM 8666  O OD1  . ASP A 1 45  ? 8.921   -7.791  -1.852  1.00 0.00 ? 45  ASP A OD1  5  
ATOM 8667  O OD2  . ASP A 1 45  ? 7.673   -7.950  -3.654  1.00 0.00 ? 45  ASP A OD2  5  
ATOM 8668  H H    . ASP A 1 45  ? 10.142  -5.279  -1.245  1.00 0.00 ? 45  ASP A H    5  
ATOM 8669  H HA   . ASP A 1 45  ? 10.255  -6.003  -3.881  1.00 0.00 ? 45  ASP A HA   5  
ATOM 8670  H HB2  . ASP A 1 45  ? 8.017   -5.330  -2.032  1.00 0.00 ? 45  ASP A HB2  5  
ATOM 8671  H HB3  . ASP A 1 45  ? 7.642   -5.494  -3.746  1.00 0.00 ? 45  ASP A HB3  5  
ATOM 8672  N N    . ILE A 1 46  ? 9.099   -2.919  -3.587  1.00 0.00 ? 46  ILE A N    5  
ATOM 8673  C CA   . ILE A 1 46  ? 8.931   -1.659  -4.300  1.00 0.00 ? 46  ILE A CA   5  
ATOM 8674  C C    . ILE A 1 46  ? 9.858   -0.583  -3.743  1.00 0.00 ? 46  ILE A C    5  
ATOM 8675  O O    . ILE A 1 46  ? 9.788   -0.240  -2.562  1.00 0.00 ? 46  ILE A O    5  
ATOM 8676  C CB   . ILE A 1 46  ? 7.477   -1.158  -4.223  1.00 0.00 ? 46  ILE A CB   5  
ATOM 8677  C CG1  . ILE A 1 46  ? 6.657   -1.724  -5.384  1.00 0.00 ? 46  ILE A CG1  5  
ATOM 8678  C CG2  . ILE A 1 46  ? 7.439   0.363   -4.233  1.00 0.00 ? 46  ILE A CG2  5  
ATOM 8679  C CD1  . ILE A 1 46  ? 5.163   -1.666  -5.154  1.00 0.00 ? 46  ILE A CD1  5  
ATOM 8680  H H    . ILE A 1 46  ? 8.834   -2.974  -2.646  1.00 0.00 ? 46  ILE A H    5  
ATOM 8681  H HA   . ILE A 1 46  ? 9.178   -1.828  -5.338  1.00 0.00 ? 46  ILE A HA   5  
ATOM 8682  H HB   . ILE A 1 46  ? 7.051   -1.498  -3.291  1.00 0.00 ? 46  ILE A HB   5  
ATOM 8683  H HG12 . ILE A 1 46  ? 6.876   -1.163  -6.278  1.00 0.00 ? 46  ILE A HG12 5  
ATOM 8684  H HG13 . ILE A 1 46  ? 6.930   -2.758  -5.537  1.00 0.00 ? 46  ILE A HG13 5  
ATOM 8685  H HG21 . ILE A 1 46  ? 6.423   0.697   -4.386  1.00 0.00 ? 46  ILE A HG21 5  
ATOM 8686  H HG22 . ILE A 1 46  ? 7.802   0.738   -3.287  1.00 0.00 ? 46  ILE A HG22 5  
ATOM 8687  H HG23 . ILE A 1 46  ? 8.064   0.734   -5.031  1.00 0.00 ? 46  ILE A HG23 5  
ATOM 8688  H HD11 . ILE A 1 46  ? 4.968   -1.361  -4.135  1.00 0.00 ? 46  ILE A HD11 5  
ATOM 8689  H HD12 . ILE A 1 46  ? 4.721   -0.952  -5.832  1.00 0.00 ? 46  ILE A HD12 5  
ATOM 8690  H HD13 . ILE A 1 46  ? 4.734   -2.641  -5.326  1.00 0.00 ? 46  ILE A HD13 5  
ATOM 8691  N N    . VAL A 1 47  ? 10.724  -0.054  -4.600  1.00 0.00 ? 47  VAL A N    5  
ATOM 8692  C CA   . VAL A 1 47  ? 11.663  0.985   -4.195  1.00 0.00 ? 47  VAL A CA   5  
ATOM 8693  C C    . VAL A 1 47  ? 11.189  2.361   -4.647  1.00 0.00 ? 47  VAL A C    5  
ATOM 8694  O O    . VAL A 1 47  ? 11.169  2.662   -5.841  1.00 0.00 ? 47  VAL A O    5  
ATOM 8695  C CB   . VAL A 1 47  ? 13.070  0.725   -4.767  1.00 0.00 ? 47  VAL A CB   5  
ATOM 8696  C CG1  . VAL A 1 47  ? 14.047  1.786   -4.284  1.00 0.00 ? 47  VAL A CG1  5  
ATOM 8697  C CG2  . VAL A 1 47  ? 13.550  -0.667  -4.386  1.00 0.00 ? 47  VAL A CG2  5  
ATOM 8698  H H    . VAL A 1 47  ? 10.732  -0.369  -5.528  1.00 0.00 ? 47  VAL A H    5  
ATOM 8699  H HA   . VAL A 1 47  ? 11.729  0.974   -3.116  1.00 0.00 ? 47  VAL A HA   5  
ATOM 8700  H HB   . VAL A 1 47  ? 13.014  0.782   -5.844  1.00 0.00 ? 47  VAL A HB   5  
ATOM 8701  H HG11 . VAL A 1 47  ? 13.666  2.766   -4.532  1.00 0.00 ? 47  VAL A HG11 5  
ATOM 8702  H HG12 . VAL A 1 47  ? 14.168  1.705   -3.214  1.00 0.00 ? 47  VAL A HG12 5  
ATOM 8703  H HG13 . VAL A 1 47  ? 15.003  1.640   -4.766  1.00 0.00 ? 47  VAL A HG13 5  
ATOM 8704  H HG21 . VAL A 1 47  ? 14.164  -0.607  -3.499  1.00 0.00 ? 47  VAL A HG21 5  
ATOM 8705  H HG22 . VAL A 1 47  ? 12.698  -1.301  -4.192  1.00 0.00 ? 47  VAL A HG22 5  
ATOM 8706  H HG23 . VAL A 1 47  ? 14.130  -1.083  -5.197  1.00 0.00 ? 47  VAL A HG23 5  
ATOM 8707  N N    . LEU A 1 48  ? 10.809  3.196   -3.685  1.00 0.00 ? 48  LEU A N    5  
ATOM 8708  C CA   . LEU A 1 48  ? 10.335  4.542   -3.984  1.00 0.00 ? 48  LEU A CA   5  
ATOM 8709  C C    . LEU A 1 48  ? 11.501  5.472   -4.303  1.00 0.00 ? 48  LEU A C    5  
ATOM 8710  O O    . LEU A 1 48  ? 12.663  5.119   -4.100  1.00 0.00 ? 48  LEU A O    5  
ATOM 8711  C CB   . LEU A 1 48  ? 9.535   5.096   -2.804  1.00 0.00 ? 48  LEU A CB   5  
ATOM 8712  C CG   . LEU A 1 48  ? 8.072   4.658   -2.720  1.00 0.00 ? 48  LEU A CG   5  
ATOM 8713  C CD1  . LEU A 1 48  ? 7.278   5.224   -3.887  1.00 0.00 ? 48  LEU A CD1  5  
ATOM 8714  C CD2  . LEU A 1 48  ? 7.971   3.140   -2.690  1.00 0.00 ? 48  LEU A CD2  5  
ATOM 8715  H H    . LEU A 1 48  ? 10.848  2.900   -2.752  1.00 0.00 ? 48  LEU A H    5  
ATOM 8716  H HA   . LEU A 1 48  ? 9.691   4.483   -4.849  1.00 0.00 ? 48  LEU A HA   5  
ATOM 8717  H HB2  . LEU A 1 48  ? 10.026  4.783   -1.896  1.00 0.00 ? 48  LEU A HB2  5  
ATOM 8718  H HB3  . LEU A 1 48  ? 9.555   6.175   -2.869  1.00 0.00 ? 48  LEU A HB3  5  
ATOM 8719  H HG   . LEU A 1 48  ? 7.640   5.041   -1.806  1.00 0.00 ? 48  LEU A HG   5  
ATOM 8720  H HD11 . LEU A 1 48  ? 6.722   6.089   -3.558  1.00 0.00 ? 48  LEU A HD11 5  
ATOM 8721  H HD12 . LEU A 1 48  ? 6.593   4.474   -4.253  1.00 0.00 ? 48  LEU A HD12 5  
ATOM 8722  H HD13 . LEU A 1 48  ? 7.955   5.510   -4.678  1.00 0.00 ? 48  LEU A HD13 5  
ATOM 8723  H HD21 . LEU A 1 48  ? 8.576   2.755   -1.883  1.00 0.00 ? 48  LEU A HD21 5  
ATOM 8724  H HD22 . LEU A 1 48  ? 8.324   2.738   -3.629  1.00 0.00 ? 48  LEU A HD22 5  
ATOM 8725  H HD23 . LEU A 1 48  ? 6.941   2.851   -2.540  1.00 0.00 ? 48  LEU A HD23 5  
ATOM 8726  N N    . SER A 1 49  ? 11.184  6.662   -4.802  1.00 0.00 ? 49  SER A N    5  
ATOM 8727  C CA   . SER A 1 49  ? 12.205  7.643   -5.151  1.00 0.00 ? 49  SER A CA   5  
ATOM 8728  C C    . SER A 1 49  ? 12.168  8.830   -4.194  1.00 0.00 ? 49  SER A C    5  
ATOM 8729  O O    . SER A 1 49  ? 11.310  9.705   -4.306  1.00 0.00 ? 49  SER A O    5  
ATOM 8730  C CB   . SER A 1 49  ? 12.009  8.126   -6.589  1.00 0.00 ? 49  SER A CB   5  
ATOM 8731  O OG   . SER A 1 49  ? 12.448  7.151   -7.519  1.00 0.00 ? 49  SER A OG   5  
ATOM 8732  H H    . SER A 1 49  ? 10.239  6.885   -4.942  1.00 0.00 ? 49  SER A H    5  
ATOM 8733  H HA   . SER A 1 49  ? 13.168  7.161   -5.071  1.00 0.00 ? 49  SER A HA   5  
ATOM 8734  H HB2  . SER A 1 49  ? 10.962  8.323   -6.760  1.00 0.00 ? 49  SER A HB2  5  
ATOM 8735  H HB3  . SER A 1 49  ? 12.576  9.033   -6.742  1.00 0.00 ? 49  SER A HB3  5  
ATOM 8736  H HG   . SER A 1 49  ? 13.102  6.583   -7.104  1.00 0.00 ? 49  SER A HG   5  
ATOM 8737  N N    . GLY A 1 50  ? 13.105  8.853   -3.251  1.00 0.00 ? 50  GLY A N    5  
ATOM 8738  C CA   . GLY A 1 50  ? 13.162  9.936   -2.288  1.00 0.00 ? 50  GLY A CA   5  
ATOM 8739  C C    . GLY A 1 50  ? 13.871  9.538   -1.008  1.00 0.00 ? 50  GLY A C    5  
ATOM 8740  O O    . GLY A 1 50  ? 13.522  8.537   -0.383  1.00 0.00 ? 50  GLY A O    5  
ATOM 8741  H H    . GLY A 1 50  ? 13.763  8.127   -3.210  1.00 0.00 ? 50  GLY A H    5  
ATOM 8742  H HA2  . GLY A 1 50  ? 13.684  10.771  -2.731  1.00 0.00 ? 50  GLY A HA2  5  
ATOM 8743  H HA3  . GLY A 1 50  ? 12.154  10.242  -2.047  1.00 0.00 ? 50  GLY A HA3  5  
ATOM 8744  N N    . ALA A 1 51  ? 14.871  10.322  -0.619  1.00 0.00 ? 51  ALA A N    5  
ATOM 8745  C CA   . ALA A 1 51  ? 15.630  10.045  0.594   1.00 0.00 ? 51  ALA A CA   5  
ATOM 8746  C C    . ALA A 1 51  ? 14.708  9.911   1.801   1.00 0.00 ? 51  ALA A C    5  
ATOM 8747  O O    . ALA A 1 51  ? 15.005  9.176   2.744   1.00 0.00 ? 51  ALA A O    5  
ATOM 8748  C CB   . ALA A 1 51  ? 16.659  11.141  0.834   1.00 0.00 ? 51  ALA A CB   5  
ATOM 8749  H H    . ALA A 1 51  ? 15.102  11.106  -1.159  1.00 0.00 ? 51  ALA A H    5  
ATOM 8750  H HA   . ALA A 1 51  ? 16.159  9.114   0.452   1.00 0.00 ? 51  ALA A HA   5  
ATOM 8751  H HB1  . ALA A 1 51  ? 16.562  11.898  0.070   1.00 0.00 ? 51  ALA A HB1  5  
ATOM 8752  H HB2  . ALA A 1 51  ? 16.492  11.584  1.805   1.00 0.00 ? 51  ALA A HB2  5  
ATOM 8753  H HB3  . ALA A 1 51  ? 17.651  10.716  0.797   1.00 0.00 ? 51  ALA A HB3  5  
ATOM 8754  N N    . HIS A 1 52  ? 13.587  10.624  1.766   1.00 0.00 ? 52  HIS A N    5  
ATOM 8755  C CA   . HIS A 1 52  ? 12.620  10.584  2.857   1.00 0.00 ? 52  HIS A CA   5  
ATOM 8756  C C    . HIS A 1 52  ? 12.160  9.154   3.123   1.00 0.00 ? 52  HIS A C    5  
ATOM 8757  O O    . HIS A 1 52  ? 12.151  8.697   4.266   1.00 0.00 ? 52  HIS A O    5  
ATOM 8758  C CB   . HIS A 1 52  ? 11.416  11.468  2.533   1.00 0.00 ? 52  HIS A CB   5  
ATOM 8759  C CG   . HIS A 1 52  ? 11.756  12.659  1.691   1.00 0.00 ? 52  HIS A CG   5  
ATOM 8760  N ND1  . HIS A 1 52  ? 11.579  12.689  0.324   1.00 0.00 ? 52  HIS A ND1  5  
ATOM 8761  C CD2  . HIS A 1 52  ? 12.265  13.867  2.030   1.00 0.00 ? 52  HIS A CD2  5  
ATOM 8762  C CE1  . HIS A 1 52  ? 11.965  13.863  -0.142  1.00 0.00 ? 52  HIS A CE1  5  
ATOM 8763  N NE2  . HIS A 1 52  ? 12.385  14.597  0.873   1.00 0.00 ? 52  HIS A NE2  5  
ATOM 8764  H H    . HIS A 1 52  ? 13.406  11.191  0.987   1.00 0.00 ? 52  HIS A H    5  
ATOM 8765  H HA   . HIS A 1 52  ? 13.106  10.963  3.744   1.00 0.00 ? 52  HIS A HA   5  
ATOM 8766  H HB2  . HIS A 1 52  ? 10.682  10.883  1.999   1.00 0.00 ? 52  HIS A HB2  5  
ATOM 8767  H HB3  . HIS A 1 52  ? 10.982  11.826  3.456   1.00 0.00 ? 52  HIS A HB3  5  
ATOM 8768  H HD2  . HIS A 1 52  ? 12.528  14.196  3.025   1.00 0.00 ? 52  HIS A HD2  5  
ATOM 8769  H HE1  . HIS A 1 52  ? 11.941  14.172  -1.177  1.00 0.00 ? 52  HIS A HE1  5  
ATOM 8770  H HE2  . HIS A 1 52  ? 12.806  15.478  0.796   1.00 0.00 ? 52  HIS A HE2  5  
ATOM 8771  N N    . ILE A 1 53  ? 11.778  8.454   2.060   1.00 0.00 ? 53  ILE A N    5  
ATOM 8772  C CA   . ILE A 1 53  ? 11.316  7.076   2.179   1.00 0.00 ? 53  ILE A CA   5  
ATOM 8773  C C    . ILE A 1 53  ? 12.204  6.279   3.129   1.00 0.00 ? 53  ILE A C    5  
ATOM 8774  O O    . ILE A 1 53  ? 13.389  6.075   2.864   1.00 0.00 ? 53  ILE A O    5  
ATOM 8775  C CB   . ILE A 1 53  ? 11.286  6.372   0.810   1.00 0.00 ? 53  ILE A CB   5  
ATOM 8776  C CG1  . ILE A 1 53  ? 10.317  7.087   -0.134  1.00 0.00 ? 53  ILE A CG1  5  
ATOM 8777  C CG2  . ILE A 1 53  ? 10.895  4.911   0.974   1.00 0.00 ? 53  ILE A CG2  5  
ATOM 8778  C CD1  . ILE A 1 53  ? 8.864   6.919   0.251   1.00 0.00 ? 53  ILE A CD1  5  
ATOM 8779  H H    . ILE A 1 53  ? 11.807  8.873   1.175   1.00 0.00 ? 53  ILE A H    5  
ATOM 8780  H HA   . ILE A 1 53  ? 10.311  7.095   2.574   1.00 0.00 ? 53  ILE A HA   5  
ATOM 8781  H HB   . ILE A 1 53  ? 12.280  6.409   0.389   1.00 0.00 ? 53  ILE A HB   5  
ATOM 8782  H HG12 . ILE A 1 53  ? 10.539  8.142   -0.137  1.00 0.00 ? 53  ILE A HG12 5  
ATOM 8783  H HG13 . ILE A 1 53  ? 10.444  6.694   -1.133  1.00 0.00 ? 53  ILE A HG13 5  
ATOM 8784  H HG21 . ILE A 1 53  ? 10.262  4.614   0.150   1.00 0.00 ? 53  ILE A HG21 5  
ATOM 8785  H HG22 . ILE A 1 53  ? 11.784  4.300   0.982   1.00 0.00 ? 53  ILE A HG22 5  
ATOM 8786  H HG23 . ILE A 1 53  ? 10.360  4.784   1.903   1.00 0.00 ? 53  ILE A HG23 5  
ATOM 8787  H HD11 . ILE A 1 53  ? 8.732   7.196   1.287   1.00 0.00 ? 53  ILE A HD11 5  
ATOM 8788  H HD12 . ILE A 1 53  ? 8.251   7.553   -0.372  1.00 0.00 ? 53  ILE A HD12 5  
ATOM 8789  H HD13 . ILE A 1 53  ? 8.572   5.888   0.115   1.00 0.00 ? 53  ILE A HD13 5  
ATOM 8790  N N    . LYS A 1 54  ? 11.624  5.829   4.236   1.00 0.00 ? 54  LYS A N    5  
ATOM 8791  C CA   . LYS A 1 54  ? 12.360  5.051   5.225   1.00 0.00 ? 54  LYS A CA   5  
ATOM 8792  C C    . LYS A 1 54  ? 12.653  3.648   4.704   1.00 0.00 ? 54  LYS A C    5  
ATOM 8793  O O    . LYS A 1 54  ? 11.825  3.042   4.025   1.00 0.00 ? 54  LYS A O    5  
ATOM 8794  C CB   . LYS A 1 54  ? 11.567  4.966   6.531   1.00 0.00 ? 54  LYS A CB   5  
ATOM 8795  C CG   . LYS A 1 54  ? 11.045  6.309   7.013   1.00 0.00 ? 54  LYS A CG   5  
ATOM 8796  C CD   . LYS A 1 54  ? 12.151  7.148   7.631   1.00 0.00 ? 54  LYS A CD   5  
ATOM 8797  C CE   . LYS A 1 54  ? 11.600  8.130   8.654   1.00 0.00 ? 54  LYS A CE   5  
ATOM 8798  N NZ   . LYS A 1 54  ? 10.648  9.096   8.039   1.00 0.00 ? 54  LYS A NZ   5  
ATOM 8799  H H    . LYS A 1 54  ? 10.675  6.025   4.391   1.00 0.00 ? 54  LYS A H    5  
ATOM 8800  H HA   . LYS A 1 54  ? 13.296  5.555   5.413   1.00 0.00 ? 54  LYS A HA   5  
ATOM 8801  H HB2  . LYS A 1 54  ? 10.724  4.307   6.384   1.00 0.00 ? 54  LYS A HB2  5  
ATOM 8802  H HB3  . LYS A 1 54  ? 12.205  4.555   7.299   1.00 0.00 ? 54  LYS A HB3  5  
ATOM 8803  H HG2  . LYS A 1 54  ? 10.627  6.845   6.174   1.00 0.00 ? 54  LYS A HG2  5  
ATOM 8804  H HG3  . LYS A 1 54  ? 10.276  6.140   7.754   1.00 0.00 ? 54  LYS A HG3  5  
ATOM 8805  H HD2  . LYS A 1 54  ? 12.856  6.493   8.121   1.00 0.00 ? 54  LYS A HD2  5  
ATOM 8806  H HD3  . LYS A 1 54  ? 12.652  7.699   6.849   1.00 0.00 ? 54  LYS A HD3  5  
ATOM 8807  H HE2  . LYS A 1 54  ? 11.089  7.576   9.426   1.00 0.00 ? 54  LYS A HE2  5  
ATOM 8808  H HE3  . LYS A 1 54  ? 12.424  8.676   9.088   1.00 0.00 ? 54  LYS A HE3  5  
ATOM 8809  H HZ1  . LYS A 1 54  ? 10.947  10.071  8.241   1.00 0.00 ? 54  LYS A HZ1  5  
ATOM 8810  H HZ2  . LYS A 1 54  ? 9.693   8.950   8.424   1.00 0.00 ? 54  LYS A HZ2  5  
ATOM 8811  H HZ3  . LYS A 1 54  ? 10.618  8.960   7.008   1.00 0.00 ? 54  LYS A HZ3  5  
ATOM 8812  N N    . GLU A 1 55  ? 13.837  3.136   5.028   1.00 0.00 ? 55  GLU A N    5  
ATOM 8813  C CA   . GLU A 1 55  ? 14.238  1.804   4.593   1.00 0.00 ? 55  GLU A CA   5  
ATOM 8814  C C    . GLU A 1 55  ? 13.103  0.803   4.789   1.00 0.00 ? 55  GLU A C    5  
ATOM 8815  O O    . GLU A 1 55  ? 12.940  -0.128  4.001   1.00 0.00 ? 55  GLU A O    5  
ATOM 8816  C CB   . GLU A 1 55  ? 15.477  1.343   5.362   1.00 0.00 ? 55  GLU A CB   5  
ATOM 8817  C CG   . GLU A 1 55  ? 16.777  1.917   4.823   1.00 0.00 ? 55  GLU A CG   5  
ATOM 8818  C CD   . GLU A 1 55  ? 17.074  3.300   5.368   1.00 0.00 ? 55  GLU A CD   5  
ATOM 8819  O OE1  . GLU A 1 55  ? 16.721  3.566   6.536   1.00 0.00 ? 55  GLU A OE1  5  
ATOM 8820  O OE2  . GLU A 1 55  ? 17.660  4.117   4.627   1.00 0.00 ? 55  GLU A OE2  5  
ATOM 8821  H H    . GLU A 1 55  ? 14.455  3.668   5.572   1.00 0.00 ? 55  GLU A H    5  
ATOM 8822  H HA   . GLU A 1 55  ? 14.478  1.856   3.541   1.00 0.00 ? 55  GLU A HA   5  
ATOM 8823  H HB2  . GLU A 1 55  ? 15.377  1.642   6.395   1.00 0.00 ? 55  GLU A HB2  5  
ATOM 8824  H HB3  . GLU A 1 55  ? 15.537  0.266   5.313   1.00 0.00 ? 55  GLU A HB3  5  
ATOM 8825  H HG2  . GLU A 1 55  ? 17.587  1.258   5.096   1.00 0.00 ? 55  GLU A HG2  5  
ATOM 8826  H HG3  . GLU A 1 55  ? 16.710  1.976   3.747   1.00 0.00 ? 55  GLU A HG3  5  
ATOM 8827  N N    . GLU A 1 56  ? 12.322  1.003   5.846   1.00 0.00 ? 56  GLU A N    5  
ATOM 8828  C CA   . GLU A 1 56  ? 11.203  0.117   6.146   1.00 0.00 ? 56  GLU A CA   5  
ATOM 8829  C C    . GLU A 1 56  ? 9.937   0.918   6.435   1.00 0.00 ? 56  GLU A C    5  
ATOM 8830  O O    . GLU A 1 56  ? 9.303   0.744   7.477   1.00 0.00 ? 56  GLU A O    5  
ATOM 8831  C CB   . GLU A 1 56  ? 11.538  -0.777  7.342   1.00 0.00 ? 56  GLU A CB   5  
ATOM 8832  C CG   . GLU A 1 56  ? 12.565  -1.852  7.029   1.00 0.00 ? 56  GLU A CG   5  
ATOM 8833  C CD   . GLU A 1 56  ? 13.062  -2.564  8.272   1.00 0.00 ? 56  GLU A CD   5  
ATOM 8834  O OE1  . GLU A 1 56  ? 12.248  -3.247  8.929   1.00 0.00 ? 56  GLU A OE1  5  
ATOM 8835  O OE2  . GLU A 1 56  ? 14.263  -2.438  8.589   1.00 0.00 ? 56  GLU A OE2  5  
ATOM 8836  H H    . GLU A 1 56  ? 12.502  1.763   6.437   1.00 0.00 ? 56  GLU A H    5  
ATOM 8837  H HA   . GLU A 1 56  ? 11.031  -0.505  5.281   1.00 0.00 ? 56  GLU A HA   5  
ATOM 8838  H HB2  . GLU A 1 56  ? 11.924  -0.160  8.140   1.00 0.00 ? 56  GLU A HB2  5  
ATOM 8839  H HB3  . GLU A 1 56  ? 10.633  -1.261  7.679   1.00 0.00 ? 56  GLU A HB3  5  
ATOM 8840  H HG2  . GLU A 1 56  ? 12.115  -2.581  6.371   1.00 0.00 ? 56  GLU A HG2  5  
ATOM 8841  H HG3  . GLU A 1 56  ? 13.408  -1.394  6.533   1.00 0.00 ? 56  GLU A HG3  5  
ATOM 8842  N N    . HIS A 1 57  ? 9.575   1.798   5.507   1.00 0.00 ? 57  HIS A N    5  
ATOM 8843  C CA   . HIS A 1 57  ? 8.385   2.627   5.661   1.00 0.00 ? 57  HIS A CA   5  
ATOM 8844  C C    . HIS A 1 57  ? 7.169   1.773   6.007   1.00 0.00 ? 57  HIS A C    5  
ATOM 8845  O O    . HIS A 1 57  ? 6.670   1.813   7.132   1.00 0.00 ? 57  HIS A O    5  
ATOM 8846  C CB   . HIS A 1 57  ? 8.119   3.418   4.380   1.00 0.00 ? 57  HIS A CB   5  
ATOM 8847  C CG   . HIS A 1 57  ? 7.436   4.730   4.617   1.00 0.00 ? 57  HIS A CG   5  
ATOM 8848  N ND1  . HIS A 1 57  ? 8.099   5.856   5.055   1.00 0.00 ? 57  HIS A ND1  5  
ATOM 8849  C CD2  . HIS A 1 57  ? 6.139   5.091   4.473   1.00 0.00 ? 57  HIS A CD2  5  
ATOM 8850  C CE1  . HIS A 1 57  ? 7.240   6.853   5.172   1.00 0.00 ? 57  HIS A CE1  5  
ATOM 8851  N NE2  . HIS A 1 57  ? 6.044   6.415   4.824   1.00 0.00 ? 57  HIS A NE2  5  
ATOM 8852  H H    . HIS A 1 57  ? 10.121  1.891   4.699   1.00 0.00 ? 57  HIS A H    5  
ATOM 8853  H HA   . HIS A 1 57  ? 8.565   3.319   6.470   1.00 0.00 ? 57  HIS A HA   5  
ATOM 8854  H HB2  . HIS A 1 57  ? 9.059   3.619   3.888   1.00 0.00 ? 57  HIS A HB2  5  
ATOM 8855  H HB3  . HIS A 1 57  ? 7.493   2.830   3.725   1.00 0.00 ? 57  HIS A HB3  5  
ATOM 8856  H HD1  . HIS A 1 57  ? 9.057   5.916   5.252   1.00 0.00 ? 57  HIS A HD1  5  
ATOM 8857  H HD2  . HIS A 1 57  ? 5.329   4.456   4.144   1.00 0.00 ? 57  HIS A HD2  5  
ATOM 8858  H HE1  . HIS A 1 57  ? 7.475   7.856   5.495   1.00 0.00 ? 57  HIS A HE1  5  
ATOM 8859  H HE2  . HIS A 1 57  ? 5.211   6.926   4.901   1.00 0.00 ? 57  HIS A HE2  5  
ATOM 8860  N N    . CYS A 1 58  ? 6.698   1.002   5.033   1.00 0.00 ? 58  CYS A N    5  
ATOM 8861  C CA   . CYS A 1 58  ? 5.539   0.139   5.234   1.00 0.00 ? 58  CYS A CA   5  
ATOM 8862  C C    . CYS A 1 58  ? 5.663   -1.139  4.412   1.00 0.00 ? 58  CYS A C    5  
ATOM 8863  O O    . CYS A 1 58  ? 6.658   -1.346  3.716   1.00 0.00 ? 58  CYS A O    5  
ATOM 8864  C CB   . CYS A 1 58  ? 4.254   0.879   4.858   1.00 0.00 ? 58  CYS A CB   5  
ATOM 8865  S SG   . CYS A 1 58  ? 4.251   1.543   3.176   1.00 0.00 ? 58  CYS A SG   5  
ATOM 8866  H H    . CYS A 1 58  ? 7.138   1.013   4.158   1.00 0.00 ? 58  CYS A H    5  
ATOM 8867  H HA   . CYS A 1 58  ? 5.500   -0.123  6.281   1.00 0.00 ? 58  CYS A HA   5  
ATOM 8868  H HB2  . CYS A 1 58  ? 3.418   0.201   4.945   1.00 0.00 ? 58  CYS A HB2  5  
ATOM 8869  H HB3  . CYS A 1 58  ? 4.111   1.705   5.539   1.00 0.00 ? 58  CYS A HB3  5  
ATOM 8870  H HG   . CYS A 1 58  ? 3.471   0.771   2.434   1.00 0.00 ? 58  CYS A HG   5  
ATOM 8871  N N    . ILE A 1 59  ? 4.649   -1.993  4.498   1.00 0.00 ? 59  ILE A N    5  
ATOM 8872  C CA   . ILE A 1 59  ? 4.646   -3.251  3.762   1.00 0.00 ? 59  ILE A CA   5  
ATOM 8873  C C    . ILE A 1 59  ? 3.252   -3.577  3.237   1.00 0.00 ? 59  ILE A C    5  
ATOM 8874  O O    . ILE A 1 59  ? 2.251   -3.076  3.749   1.00 0.00 ? 59  ILE A O    5  
ATOM 8875  C CB   . ILE A 1 59  ? 5.138   -4.417  4.639   1.00 0.00 ? 59  ILE A CB   5  
ATOM 8876  C CG1  . ILE A 1 59  ? 6.480   -4.068  5.285   1.00 0.00 ? 59  ILE A CG1  5  
ATOM 8877  C CG2  . ILE A 1 59  ? 5.257   -5.688  3.811   1.00 0.00 ? 59  ILE A CG2  5  
ATOM 8878  C CD1  . ILE A 1 59  ? 6.849   -4.973  6.439   1.00 0.00 ? 59  ILE A CD1  5  
ATOM 8879  H H    . ILE A 1 59  ? 3.885   -1.771  5.069   1.00 0.00 ? 59  ILE A H    5  
ATOM 8880  H HA   . ILE A 1 59  ? 5.320   -3.148  2.923   1.00 0.00 ? 59  ILE A HA   5  
ATOM 8881  H HB   . ILE A 1 59  ? 4.407   -4.589  5.414   1.00 0.00 ? 59  ILE A HB   5  
ATOM 8882  H HG12 . ILE A 1 59  ? 7.260   -4.142  4.543   1.00 0.00 ? 59  ILE A HG12 5  
ATOM 8883  H HG13 . ILE A 1 59  ? 6.438   -3.054  5.657   1.00 0.00 ? 59  ILE A HG13 5  
ATOM 8884  H HG21 . ILE A 1 59  ? 5.890   -6.396  4.327   1.00 0.00 ? 59  ILE A HG21 5  
ATOM 8885  H HG22 . ILE A 1 59  ? 4.277   -6.119  3.671   1.00 0.00 ? 59  ILE A HG22 5  
ATOM 8886  H HG23 . ILE A 1 59  ? 5.689   -5.453  2.850   1.00 0.00 ? 59  ILE A HG23 5  
ATOM 8887  H HD11 . ILE A 1 59  ? 5.950   -5.376  6.882   1.00 0.00 ? 59  ILE A HD11 5  
ATOM 8888  H HD12 . ILE A 1 59  ? 7.466   -5.783  6.078   1.00 0.00 ? 59  ILE A HD12 5  
ATOM 8889  H HD13 . ILE A 1 59  ? 7.393   -4.408  7.180   1.00 0.00 ? 59  ILE A HD13 5  
ATOM 8890  N N    . PHE A 1 60  ? 3.194   -4.422  2.213   1.00 0.00 ? 60  PHE A N    5  
ATOM 8891  C CA   . PHE A 1 60  ? 1.922   -4.817  1.618   1.00 0.00 ? 60  PHE A CA   5  
ATOM 8892  C C    . PHE A 1 60  ? 1.815   -6.336  1.522   1.00 0.00 ? 60  PHE A C    5  
ATOM 8893  O O    . PHE A 1 60  ? 2.481   -6.965  0.701   1.00 0.00 ? 60  PHE A O    5  
ATOM 8894  C CB   . PHE A 1 60  ? 1.769   -4.195  0.229   1.00 0.00 ? 60  PHE A CB   5  
ATOM 8895  C CG   . PHE A 1 60  ? 1.366   -2.748  0.260   1.00 0.00 ? 60  PHE A CG   5  
ATOM 8896  C CD1  . PHE A 1 60  ? 0.106   -2.377  0.702   1.00 0.00 ? 60  PHE A CD1  5  
ATOM 8897  C CD2  . PHE A 1 60  ? 2.246   -1.760  -0.151  1.00 0.00 ? 60  PHE A CD2  5  
ATOM 8898  C CE1  . PHE A 1 60  ? -0.268  -1.047  0.732   1.00 0.00 ? 60  PHE A CE1  5  
ATOM 8899  C CE2  . PHE A 1 60  ? 1.877   -0.429  -0.123  1.00 0.00 ? 60  PHE A CE2  5  
ATOM 8900  C CZ   . PHE A 1 60  ? 0.619   -0.071  0.320   1.00 0.00 ? 60  PHE A CZ   5  
ATOM 8901  H H    . PHE A 1 60  ? 4.027   -4.789  1.848   1.00 0.00 ? 60  PHE A H    5  
ATOM 8902  H HA   . PHE A 1 60  ? 1.132   -4.452  2.256   1.00 0.00 ? 60  PHE A HA   5  
ATOM 8903  H HB2  . PHE A 1 60  ? 2.711   -4.264  -0.294  1.00 0.00 ? 60  PHE A HB2  5  
ATOM 8904  H HB3  . PHE A 1 60  ? 1.016   -4.739  -0.320  1.00 0.00 ? 60  PHE A HB3  5  
ATOM 8905  H HD1  . PHE A 1 60  ? -0.588  -3.138  1.026   1.00 0.00 ? 60  PHE A HD1  5  
ATOM 8906  H HD2  . PHE A 1 60  ? 3.231   -2.039  -0.497  1.00 0.00 ? 60  PHE A HD2  5  
ATOM 8907  H HE1  . PHE A 1 60  ? -1.253  -0.770  1.078   1.00 0.00 ? 60  PHE A HE1  5  
ATOM 8908  H HE2  . PHE A 1 60  ? 2.573   0.331   -0.446  1.00 0.00 ? 60  PHE A HE2  5  
ATOM 8909  H HZ   . PHE A 1 60  ? 0.329   0.969   0.341   1.00 0.00 ? 60  PHE A HZ   5  
ATOM 8910  N N    . ARG A 1 61  ? 0.971   -6.918  2.368   1.00 0.00 ? 61  ARG A N    5  
ATOM 8911  C CA   . ARG A 1 61  ? 0.777   -8.363  2.381   1.00 0.00 ? 61  ARG A CA   5  
ATOM 8912  C C    . ARG A 1 61  ? -0.486  -8.749  1.616   1.00 0.00 ? 61  ARG A C    5  
ATOM 8913  O O    . ARG A 1 61  ? -1.565  -8.216  1.872   1.00 0.00 ? 61  ARG A O    5  
ATOM 8914  C CB   . ARG A 1 61  ? 0.691   -8.875  3.820   1.00 0.00 ? 61  ARG A CB   5  
ATOM 8915  C CG   . ARG A 1 61  ? 0.834   -10.383 3.940   1.00 0.00 ? 61  ARG A CG   5  
ATOM 8916  C CD   . ARG A 1 61  ? 0.312   -10.888 5.275   1.00 0.00 ? 61  ARG A CD   5  
ATOM 8917  N NE   . ARG A 1 61  ? 1.204   -10.541 6.378   1.00 0.00 ? 61  ARG A NE   5  
ATOM 8918  C CZ   . ARG A 1 61  ? 0.972   -10.873 7.644   1.00 0.00 ? 61  ARG A CZ   5  
ATOM 8919  N NH1  . ARG A 1 61  ? -0.118  -11.557 7.964   1.00 0.00 ? 61  ARG A NH1  5  
ATOM 8920  N NH2  . ARG A 1 61  ? 1.831   -10.521 8.591   1.00 0.00 ? 61  ARG A NH2  5  
ATOM 8921  H H    . ARG A 1 61  ? 0.468   -6.363  3.000   1.00 0.00 ? 61  ARG A H    5  
ATOM 8922  H HA   . ARG A 1 61  ? 1.629   -8.816  1.897   1.00 0.00 ? 61  ARG A HA   5  
ATOM 8923  H HB2  . ARG A 1 61  ? 1.476   -8.414  4.402   1.00 0.00 ? 61  ARG A HB2  5  
ATOM 8924  H HB3  . ARG A 1 61  ? -0.265  -8.592  4.233   1.00 0.00 ? 61  ARG A HB3  5  
ATOM 8925  H HG2  . ARG A 1 61  ? 0.272   -10.853 3.145   1.00 0.00 ? 61  ARG A HG2  5  
ATOM 8926  H HG3  . ARG A 1 61  ? 1.878   -10.645 3.848   1.00 0.00 ? 61  ARG A HG3  5  
ATOM 8927  H HD2  . ARG A 1 61  ? -0.658  -10.449 5.457   1.00 0.00 ? 61  ARG A HD2  5  
ATOM 8928  H HD3  . ARG A 1 61  ? 0.216   -11.963 5.226   1.00 0.00 ? 61  ARG A HD3  5  
ATOM 8929  H HE   . ARG A 1 61  ? 2.015   -10.036 6.164   1.00 0.00 ? 61  ARG A HE   5  
ATOM 8930  H HH11 . ARG A 1 61  ? -0.766  -11.824 7.252   1.00 0.00 ? 61  ARG A HH11 5  
ATOM 8931  H HH12 . ARG A 1 61  ? -0.290  -11.806 8.917   1.00 0.00 ? 61  ARG A HH12 5  
ATOM 8932  H HH21 . ARG A 1 61  ? 2.654   -10.005 8.354   1.00 0.00 ? 61  ARG A HH21 5  
ATOM 8933  H HH22 . ARG A 1 61  ? 1.656   -10.770 9.543   1.00 0.00 ? 61  ARG A HH22 5  
ATOM 8934  N N    . SER A 1 62  ? -0.342  -9.677  0.677   1.00 0.00 ? 62  SER A N    5  
ATOM 8935  C CA   . SER A 1 62  ? -1.469  -10.132 -0.129  1.00 0.00 ? 62  SER A CA   5  
ATOM 8936  C C    . SER A 1 62  ? -1.731  -11.618 0.093   1.00 0.00 ? 62  SER A C    5  
ATOM 8937  O O    . SER A 1 62  ? -0.998  -12.469 -0.410  1.00 0.00 ? 62  SER A O    5  
ATOM 8938  C CB   . SER A 1 62  ? -1.205  -9.864  -1.611  1.00 0.00 ? 62  SER A CB   5  
ATOM 8939  O OG   . SER A 1 62  ? -2.308  -10.265 -2.406  1.00 0.00 ? 62  SER A OG   5  
ATOM 8940  H H    . SER A 1 62  ? 0.545   -10.065 0.519   1.00 0.00 ? 62  SER A H    5  
ATOM 8941  H HA   . SER A 1 62  ? -2.342  -9.575  0.179   1.00 0.00 ? 62  SER A HA   5  
ATOM 8942  H HB2  . SER A 1 62  ? -1.035  -8.808  -1.759  1.00 0.00 ? 62  SER A HB2  5  
ATOM 8943  H HB3  . SER A 1 62  ? -0.331  -10.416 -1.924  1.00 0.00 ? 62  SER A HB3  5  
ATOM 8944  H HG   . SER A 1 62  ? -2.222  -9.888  -3.286  1.00 0.00 ? 62  SER A HG   5  
ATOM 8945  N N    . GLU A 1 63  ? -2.782  -11.922 0.848   1.00 0.00 ? 63  GLU A N    5  
ATOM 8946  C CA   . GLU A 1 63  ? -3.140  -13.305 1.137   1.00 0.00 ? 63  GLU A CA   5  
ATOM 8947  C C    . GLU A 1 63  ? -4.637  -13.531 0.944   1.00 0.00 ? 63  GLU A C    5  
ATOM 8948  O O    . GLU A 1 63  ? -5.453  -12.671 1.275   1.00 0.00 ? 63  GLU A O    5  
ATOM 8949  C CB   . GLU A 1 63  ? -2.738  -13.672 2.567   1.00 0.00 ? 63  GLU A CB   5  
ATOM 8950  C CG   . GLU A 1 63  ? -2.797  -15.163 2.853   1.00 0.00 ? 63  GLU A CG   5  
ATOM 8951  C CD   . GLU A 1 63  ? -2.471  -15.494 4.296   1.00 0.00 ? 63  GLU A CD   5  
ATOM 8952  O OE1  . GLU A 1 63  ? -3.318  -15.225 5.173   1.00 0.00 ? 63  GLU A OE1  5  
ATOM 8953  O OE2  . GLU A 1 63  ? -1.368  -16.023 4.548   1.00 0.00 ? 63  GLU A OE2  5  
ATOM 8954  H H    . GLU A 1 63  ? -3.328  -11.199 1.221   1.00 0.00 ? 63  GLU A H    5  
ATOM 8955  H HA   . GLU A 1 63  ? -2.601  -13.938 0.448   1.00 0.00 ? 63  GLU A HA   5  
ATOM 8956  H HB2  . GLU A 1 63  ? -1.728  -13.332 2.743   1.00 0.00 ? 63  GLU A HB2  5  
ATOM 8957  H HB3  . GLU A 1 63  ? -3.402  -13.169 3.255   1.00 0.00 ? 63  GLU A HB3  5  
ATOM 8958  H HG2  . GLU A 1 63  ? -3.793  -15.520 2.634   1.00 0.00 ? 63  GLU A HG2  5  
ATOM 8959  H HG3  . GLU A 1 63  ? -2.087  -15.668 2.214   1.00 0.00 ? 63  GLU A HG3  5  
ATOM 8960  N N    . ARG A 1 64  ? -4.989  -14.695 0.407   1.00 0.00 ? 64  ARG A N    5  
ATOM 8961  C CA   . ARG A 1 64  ? -6.387  -15.034 0.168   1.00 0.00 ? 64  ARG A CA   5  
ATOM 8962  C C    . ARG A 1 64  ? -7.055  -15.520 1.450   1.00 0.00 ? 64  ARG A C    5  
ATOM 8963  O O    . ARG A 1 64  ? -6.603  -16.482 2.071   1.00 0.00 ? 64  ARG A O    5  
ATOM 8964  C CB   . ARG A 1 64  ? -6.495  -16.108 -0.916  1.00 0.00 ? 64  ARG A CB   5  
ATOM 8965  C CG   . ARG A 1 64  ? -7.753  -15.996 -1.761  1.00 0.00 ? 64  ARG A CG   5  
ATOM 8966  C CD   . ARG A 1 64  ? -7.763  -17.021 -2.885  1.00 0.00 ? 64  ARG A CD   5  
ATOM 8967  N NE   . ARG A 1 64  ? -7.548  -18.378 -2.390  1.00 0.00 ? 64  ARG A NE   5  
ATOM 8968  C CZ   . ARG A 1 64  ? -7.308  -19.419 -3.179  1.00 0.00 ? 64  ARG A CZ   5  
ATOM 8969  N NH1  . ARG A 1 64  ? -7.253  -19.259 -4.494  1.00 0.00 ? 64  ARG A NH1  5  
ATOM 8970  N NH2  . ARG A 1 64  ? -7.122  -20.623 -2.653  1.00 0.00 ? 64  ARG A NH2  5  
ATOM 8971  H H    . ARG A 1 64  ? -4.293  -15.340 0.164   1.00 0.00 ? 64  ARG A H    5  
ATOM 8972  H HA   . ARG A 1 64  ? -6.892  -14.141 -0.171  1.00 0.00 ? 64  ARG A HA   5  
ATOM 8973  H HB2  . ARG A 1 64  ? -5.640  -16.030 -1.571  1.00 0.00 ? 64  ARG A HB2  5  
ATOM 8974  H HB3  . ARG A 1 64  ? -6.490  -17.079 -0.444  1.00 0.00 ? 64  ARG A HB3  5  
ATOM 8975  H HG2  . ARG A 1 64  ? -8.615  -16.161 -1.131  1.00 0.00 ? 64  ARG A HG2  5  
ATOM 8976  H HG3  . ARG A 1 64  ? -7.801  -15.005 -2.188  1.00 0.00 ? 64  ARG A HG3  5  
ATOM 8977  H HD2  . ARG A 1 64  ? -8.719  -16.978 -3.385  1.00 0.00 ? 64  ARG A HD2  5  
ATOM 8978  H HD3  . ARG A 1 64  ? -6.979  -16.774 -3.585  1.00 0.00 ? 64  ARG A HD3  5  
ATOM 8979  H HE   . ARG A 1 64  ? -7.584  -18.519 -1.421  1.00 0.00 ? 64  ARG A HE   5  
ATOM 8980  H HH11 . ARG A 1 64  ? -7.391  -18.352 -4.893  1.00 0.00 ? 64  ARG A HH11 5  
ATOM 8981  H HH12 . ARG A 1 64  ? -7.071  -20.044 -5.086  1.00 0.00 ? 64  ARG A HH12 5  
ATOM 8982  H HH21 . ARG A 1 64  ? -7.163  -20.747 -1.663  1.00 0.00 ? 64  ARG A HH21 5  
ATOM 8983  H HH22 . ARG A 1 64  ? -6.942  -21.406 -3.248  1.00 0.00 ? 64  ARG A HH22 5  
ATOM 8984  N N    . SER A 1 65  ? -8.134  -14.849 1.841   1.00 0.00 ? 65  SER A N    5  
ATOM 8985  C CA   . SER A 1 65  ? -8.862  -15.210 3.052   1.00 0.00 ? 65  SER A CA   5  
ATOM 8986  C C    . SER A 1 65  ? -9.430  -16.621 2.944   1.00 0.00 ? 65  SER A C    5  
ATOM 8987  O O    . SER A 1 65  ? -9.184  -17.328 1.968   1.00 0.00 ? 65  SER A O    5  
ATOM 8988  C CB   . SER A 1 65  ? -9.992  -14.211 3.310   1.00 0.00 ? 65  SER A CB   5  
ATOM 8989  O OG   . SER A 1 65  ? -10.610 -14.452 4.562   1.00 0.00 ? 65  SER A OG   5  
ATOM 8990  H H    . SER A 1 65  ? -8.445  -14.090 1.304   1.00 0.00 ? 65  SER A H    5  
ATOM 8991  H HA   . SER A 1 65  ? -8.168  -15.175 3.879   1.00 0.00 ? 65  SER A HA   5  
ATOM 8992  H HB2  . SER A 1 65  ? -9.592  -13.209 3.307   1.00 0.00 ? 65  SER A HB2  5  
ATOM 8993  H HB3  . SER A 1 65  ? -10.735 -14.305 2.531   1.00 0.00 ? 65  SER A HB3  5  
ATOM 8994  H HG   . SER A 1 65  ? -9.949  -14.420 5.257   1.00 0.00 ? 65  SER A HG   5  
ATOM 8995  N N    . ASN A 1 66  ? -10.191 -17.025 3.956   1.00 0.00 ? 66  ASN A N    5  
ATOM 8996  C CA   . ASN A 1 66  ? -10.794 -18.353 3.976   1.00 0.00 ? 66  ASN A CA   5  
ATOM 8997  C C    . ASN A 1 66  ? -11.926 -18.452 2.959   1.00 0.00 ? 66  ASN A C    5  
ATOM 8998  O O    . ASN A 1 66  ? -12.388 -19.545 2.632   1.00 0.00 ? 66  ASN A O    5  
ATOM 8999  C CB   . ASN A 1 66  ? -11.321 -18.675 5.376   1.00 0.00 ? 66  ASN A CB   5  
ATOM 9000  C CG   . ASN A 1 66  ? -10.245 -18.563 6.439   1.00 0.00 ? 66  ASN A CG   5  
ATOM 9001  O OD1  . ASN A 1 66  ? -9.112  -18.176 6.153   1.00 0.00 ? 66  ASN A OD1  5  
ATOM 9002  N ND2  . ASN A 1 66  ? -10.597 -18.903 7.674   1.00 0.00 ? 66  ASN A ND2  5  
ATOM 9003  H H    . ASN A 1 66  ? -10.351 -16.416 4.707   1.00 0.00 ? 66  ASN A H    5  
ATOM 9004  H HA   . ASN A 1 66  ? -10.029 -19.069 3.716   1.00 0.00 ? 66  ASN A HA   5  
ATOM 9005  H HB2  . ASN A 1 66  ? -12.116 -17.986 5.622   1.00 0.00 ? 66  ASN A HB2  5  
ATOM 9006  H HB3  . ASN A 1 66  ? -11.708 -19.683 5.386   1.00 0.00 ? 66  ASN A HB3  5  
ATOM 9007  H HD21 . ASN A 1 66  ? -11.517 -19.202 7.828   1.00 0.00 ? 66  ASN A HD21 5  
ATOM 9008  H HD22 . ASN A 1 66  ? -9.921  -18.839 8.381   1.00 0.00 ? 66  ASN A HD22 5  
ATOM 9009  N N    . SER A 1 67  ? -12.370 -17.302 2.461   1.00 0.00 ? 67  SER A N    5  
ATOM 9010  C CA   . SER A 1 67  ? -13.450 -17.257 1.483   1.00 0.00 ? 67  SER A CA   5  
ATOM 9011  C C    . SER A 1 67  ? -12.896 -17.186 0.064   1.00 0.00 ? 67  SER A C    5  
ATOM 9012  O O    . SER A 1 67  ? -13.645 -17.039 -0.901  1.00 0.00 ? 67  SER A O    5  
ATOM 9013  C CB   . SER A 1 67  ? -14.359 -16.056 1.749   1.00 0.00 ? 67  SER A CB   5  
ATOM 9014  O OG   . SER A 1 67  ? -15.619 -16.220 1.123   1.00 0.00 ? 67  SER A OG   5  
ATOM 9015  H H    . SER A 1 67  ? -11.961 -16.462 2.761   1.00 0.00 ? 67  SER A H    5  
ATOM 9016  H HA   . SER A 1 67  ? -14.028 -18.164 1.586   1.00 0.00 ? 67  SER A HA   5  
ATOM 9017  H HB2  . SER A 1 67  ? -14.510 -15.950 2.813   1.00 0.00 ? 67  SER A HB2  5  
ATOM 9018  H HB3  . SER A 1 67  ? -13.891 -15.162 1.362   1.00 0.00 ? 67  SER A HB3  5  
ATOM 9019  H HG   . SER A 1 67  ? -15.833 -15.430 0.621   1.00 0.00 ? 67  SER A HG   5  
ATOM 9020  N N    . GLY A 1 68  ? -11.575 -17.290 -0.055  1.00 0.00 ? 68  GLY A N    5  
ATOM 9021  C CA   . GLY A 1 68  ? -10.941 -17.234 -1.359  1.00 0.00 ? 68  GLY A CA   5  
ATOM 9022  C C    . GLY A 1 68  ? -10.825 -15.818 -1.888  1.00 0.00 ? 68  GLY A C    5  
ATOM 9023  O O    . GLY A 1 68  ? -10.546 -15.611 -3.068  1.00 0.00 ? 68  GLY A O    5  
ATOM 9024  H H    . GLY A 1 68  ? -11.027 -17.405 0.749   1.00 0.00 ? 68  GLY A H    5  
ATOM 9025  H HA2  . GLY A 1 68  ? -9.953  -17.662 -1.286  1.00 0.00 ? 68  GLY A HA2  5  
ATOM 9026  H HA3  . GLY A 1 68  ? -11.525 -17.819 -2.056  1.00 0.00 ? 68  GLY A HA3  5  
ATOM 9027  N N    . GLU A 1 69  ? -11.042 -14.842 -1.012  1.00 0.00 ? 69  GLU A N    5  
ATOM 9028  C CA   . GLU A 1 69  ? -10.962 -13.438 -1.399  1.00 0.00 ? 69  GLU A CA   5  
ATOM 9029  C C    . GLU A 1 69  ? -9.594  -12.856 -1.055  1.00 0.00 ? 69  GLU A C    5  
ATOM 9030  O O    . GLU A 1 69  ? -9.177  -12.865 0.104   1.00 0.00 ? 69  GLU A O    5  
ATOM 9031  C CB   . GLU A 1 69  ? -12.062 -12.632 -0.706  1.00 0.00 ? 69  GLU A CB   5  
ATOM 9032  C CG   . GLU A 1 69  ? -11.646 -12.070 0.643   1.00 0.00 ? 69  GLU A CG   5  
ATOM 9033  C CD   . GLU A 1 69  ? -12.829 -11.614 1.476   1.00 0.00 ? 69  GLU A CD   5  
ATOM 9034  O OE1  . GLU A 1 69  ? -13.562 -10.712 1.019   1.00 0.00 ? 69  GLU A OE1  5  
ATOM 9035  O OE2  . GLU A 1 69  ? -13.021 -12.159 2.583   1.00 0.00 ? 69  GLU A OE2  5  
ATOM 9036  H H    . GLU A 1 69  ? -11.260 -15.071 -0.085  1.00 0.00 ? 69  GLU A H    5  
ATOM 9037  H HA   . GLU A 1 69  ? -11.105 -13.380 -2.468  1.00 0.00 ? 69  GLU A HA   5  
ATOM 9038  H HB2  . GLU A 1 69  ? -12.345 -11.808 -1.344  1.00 0.00 ? 69  GLU A HB2  5  
ATOM 9039  H HB3  . GLU A 1 69  ? -12.920 -13.271 -0.556  1.00 0.00 ? 69  GLU A HB3  5  
ATOM 9040  H HG2  . GLU A 1 69  ? -11.114 -12.835 1.189   1.00 0.00 ? 69  GLU A HG2  5  
ATOM 9041  H HG3  . GLU A 1 69  ? -10.992 -11.225 0.481   1.00 0.00 ? 69  GLU A HG3  5  
ATOM 9042  N N    . VAL A 1 70  ? -8.901  -12.349 -2.069  1.00 0.00 ? 70  VAL A N    5  
ATOM 9043  C CA   . VAL A 1 70  ? -7.580  -11.761 -1.875  1.00 0.00 ? 70  VAL A CA   5  
ATOM 9044  C C    . VAL A 1 70  ? -7.668  -10.467 -1.073  1.00 0.00 ? 70  VAL A C    5  
ATOM 9045  O O    . VAL A 1 70  ? -8.228  -9.474  -1.537  1.00 0.00 ? 70  VAL A O    5  
ATOM 9046  C CB   . VAL A 1 70  ? -6.891  -11.473 -3.221  1.00 0.00 ? 70  VAL A CB   5  
ATOM 9047  C CG1  . VAL A 1 70  ? -5.523  -10.846 -2.997  1.00 0.00 ? 70  VAL A CG1  5  
ATOM 9048  C CG2  . VAL A 1 70  ? -6.774  -12.747 -4.043  1.00 0.00 ? 70  VAL A CG2  5  
ATOM 9049  H H    . VAL A 1 70  ? -9.286  -12.370 -2.970  1.00 0.00 ? 70  VAL A H    5  
ATOM 9050  H HA   . VAL A 1 70  ? -6.976  -12.471 -1.329  1.00 0.00 ? 70  VAL A HA   5  
ATOM 9051  H HB   . VAL A 1 70  ? -7.499  -10.770 -3.771  1.00 0.00 ? 70  VAL A HB   5  
ATOM 9052  H HG11 . VAL A 1 70  ? -5.540  -9.818  -3.330  1.00 0.00 ? 70  VAL A HG11 5  
ATOM 9053  H HG12 . VAL A 1 70  ? -5.278  -10.882 -1.946  1.00 0.00 ? 70  VAL A HG12 5  
ATOM 9054  H HG13 . VAL A 1 70  ? -4.780  -11.393 -3.559  1.00 0.00 ? 70  VAL A HG13 5  
ATOM 9055  H HG21 . VAL A 1 70  ? -5.841  -12.741 -4.587  1.00 0.00 ? 70  VAL A HG21 5  
ATOM 9056  H HG22 . VAL A 1 70  ? -6.802  -13.603 -3.385  1.00 0.00 ? 70  VAL A HG22 5  
ATOM 9057  H HG23 . VAL A 1 70  ? -7.597  -12.803 -4.741  1.00 0.00 ? 70  VAL A HG23 5  
ATOM 9058  N N    . ILE A 1 71  ? -7.109  -10.486 0.132   1.00 0.00 ? 71  ILE A N    5  
ATOM 9059  C CA   . ILE A 1 71  ? -7.122  -9.313  0.998   1.00 0.00 ? 71  ILE A CA   5  
ATOM 9060  C C    . ILE A 1 71  ? -5.724  -8.722  1.144   1.00 0.00 ? 71  ILE A C    5  
ATOM 9061  O O    . ILE A 1 71  ? -4.737  -9.451  1.244   1.00 0.00 ? 71  ILE A O    5  
ATOM 9062  C CB   . ILE A 1 71  ? -7.672  -9.651  2.396   1.00 0.00 ? 71  ILE A CB   5  
ATOM 9063  C CG1  . ILE A 1 71  ? -9.030  -10.347 2.279   1.00 0.00 ? 71  ILE A CG1  5  
ATOM 9064  C CG2  . ILE A 1 71  ? -7.788  -8.390  3.239   1.00 0.00 ? 71  ILE A CG2  5  
ATOM 9065  C CD1  . ILE A 1 71  ? -10.200 -9.389  2.265   1.00 0.00 ? 71  ILE A CD1  5  
ATOM 9066  H H    . ILE A 1 71  ? -6.677  -11.307 0.446   1.00 0.00 ? 71  ILE A H    5  
ATOM 9067  H HA   . ILE A 1 71  ? -7.769  -8.574  0.547   1.00 0.00 ? 71  ILE A HA   5  
ATOM 9068  H HB   . ILE A 1 71  ? -6.975  -10.317 2.881   1.00 0.00 ? 71  ILE A HB   5  
ATOM 9069  H HG12 . ILE A 1 71  ? -9.058  -10.917 1.364   1.00 0.00 ? 71  ILE A HG12 5  
ATOM 9070  H HG13 . ILE A 1 71  ? -9.157  -11.015 3.118   1.00 0.00 ? 71  ILE A HG13 5  
ATOM 9071  H HG21 . ILE A 1 71  ? -8.280  -8.625  4.171   1.00 0.00 ? 71  ILE A HG21 5  
ATOM 9072  H HG22 . ILE A 1 71  ? -6.801  -8.002  3.442   1.00 0.00 ? 71  ILE A HG22 5  
ATOM 9073  H HG23 . ILE A 1 71  ? -8.363  -7.650  2.704   1.00 0.00 ? 71  ILE A HG23 5  
ATOM 9074  H HD11 . ILE A 1 71  ? -10.022 -8.614  1.533   1.00 0.00 ? 71  ILE A HD11 5  
ATOM 9075  H HD12 . ILE A 1 71  ? -11.102 -9.925  2.006   1.00 0.00 ? 71  ILE A HD12 5  
ATOM 9076  H HD13 . ILE A 1 71  ? -10.313 -8.942  3.241   1.00 0.00 ? 71  ILE A HD13 5  
ATOM 9077  N N    . VAL A 1 72  ? -5.647  -7.395  1.156   1.00 0.00 ? 72  VAL A N    5  
ATOM 9078  C CA   . VAL A 1 72  ? -4.370  -6.704  1.293   1.00 0.00 ? 72  VAL A CA   5  
ATOM 9079  C C    . VAL A 1 72  ? -4.310  -5.913  2.595   1.00 0.00 ? 72  VAL A C    5  
ATOM 9080  O O    . VAL A 1 72  ? -5.253  -5.205  2.949   1.00 0.00 ? 72  VAL A O    5  
ATOM 9081  C CB   . VAL A 1 72  ? -4.120  -5.748  0.112   1.00 0.00 ? 72  VAL A CB   5  
ATOM 9082  C CG1  . VAL A 1 72  ? -2.856  -4.934  0.342   1.00 0.00 ? 72  VAL A CG1  5  
ATOM 9083  C CG2  . VAL A 1 72  ? -4.033  -6.525  -1.193  1.00 0.00 ? 72  VAL A CG2  5  
ATOM 9084  H H    . VAL A 1 72  ? -6.469  -6.868  1.072   1.00 0.00 ? 72  VAL A H    5  
ATOM 9085  H HA   . VAL A 1 72  ? -3.587  -7.448  1.298   1.00 0.00 ? 72  VAL A HA   5  
ATOM 9086  H HB   . VAL A 1 72  ? -4.954  -5.065  0.045   1.00 0.00 ? 72  VAL A HB   5  
ATOM 9087  H HG11 . VAL A 1 72  ? -2.289  -5.370  1.152   1.00 0.00 ? 72  VAL A HG11 5  
ATOM 9088  H HG12 . VAL A 1 72  ? -2.259  -4.933  -0.558  1.00 0.00 ? 72  VAL A HG12 5  
ATOM 9089  H HG13 . VAL A 1 72  ? -3.123  -3.919  0.598   1.00 0.00 ? 72  VAL A HG13 5  
ATOM 9090  H HG21 . VAL A 1 72  ? -3.329  -7.337  -1.083  1.00 0.00 ? 72  VAL A HG21 5  
ATOM 9091  H HG22 . VAL A 1 72  ? -5.006  -6.922  -1.441  1.00 0.00 ? 72  VAL A HG22 5  
ATOM 9092  H HG23 . VAL A 1 72  ? -3.701  -5.867  -1.983  1.00 0.00 ? 72  VAL A HG23 5  
ATOM 9093  N N    . THR A 1 73  ? -3.193  -6.038  3.305   1.00 0.00 ? 73  THR A N    5  
ATOM 9094  C CA   . THR A 1 73  ? -3.009  -5.335  4.569   1.00 0.00 ? 73  THR A CA   5  
ATOM 9095  C C    . THR A 1 73  ? -1.710  -4.538  4.570   1.00 0.00 ? 73  THR A C    5  
ATOM 9096  O O    . THR A 1 73  ? -0.686  -4.999  4.064   1.00 0.00 ? 73  THR A O    5  
ATOM 9097  C CB   . THR A 1 73  ? -2.999  -6.313  5.759   1.00 0.00 ? 73  THR A CB   5  
ATOM 9098  O OG1  . THR A 1 73  ? -3.849  -7.432  5.481   1.00 0.00 ? 73  THR A OG1  5  
ATOM 9099  C CG2  . THR A 1 73  ? -3.464  -5.621  7.031   1.00 0.00 ? 73  THR A CG2  5  
ATOM 9100  H H    . THR A 1 73  ? -2.477  -6.617  2.971   1.00 0.00 ? 73  THR A H    5  
ATOM 9101  H HA   . THR A 1 73  ? -3.838  -4.654  4.696   1.00 0.00 ? 73  THR A HA   5  
ATOM 9102  H HB   . THR A 1 73  ? -1.989  -6.665  5.907   1.00 0.00 ? 73  THR A HB   5  
ATOM 9103  H HG1  . THR A 1 73  ? -3.835  -7.617  4.539   1.00 0.00 ? 73  THR A HG1  5  
ATOM 9104  H HG21 . THR A 1 73  ? -2.980  -4.660  7.116   1.00 0.00 ? 73  THR A HG21 5  
ATOM 9105  H HG22 . THR A 1 73  ? -3.208  -6.229  7.886   1.00 0.00 ? 73  THR A HG22 5  
ATOM 9106  H HG23 . THR A 1 73  ? -4.535  -5.483  6.995   1.00 0.00 ? 73  THR A HG23 5  
ATOM 9107  N N    . LEU A 1 74  ? -1.757  -3.340  5.143   1.00 0.00 ? 74  LEU A N    5  
ATOM 9108  C CA   . LEU A 1 74  ? -0.582  -2.478  5.211   1.00 0.00 ? 74  LEU A CA   5  
ATOM 9109  C C    . LEU A 1 74  ? 0.047   -2.523  6.601   1.00 0.00 ? 74  LEU A C    5  
ATOM 9110  O O    . LEU A 1 74  ? -0.631  -2.308  7.605   1.00 0.00 ? 74  LEU A O    5  
ATOM 9111  C CB   . LEU A 1 74  ? -0.959  -1.039  4.856   1.00 0.00 ? 74  LEU A CB   5  
ATOM 9112  C CG   . LEU A 1 74  ? 0.174   -0.014  4.912   1.00 0.00 ? 74  LEU A CG   5  
ATOM 9113  C CD1  . LEU A 1 74  ? 0.883   0.071   3.569   1.00 0.00 ? 74  LEU A CD1  5  
ATOM 9114  C CD2  . LEU A 1 74  ? -0.360  1.350   5.323   1.00 0.00 ? 74  LEU A CD2  5  
ATOM 9115  H H    . LEU A 1 74  ? -2.601  -3.027  5.529   1.00 0.00 ? 74  LEU A H    5  
ATOM 9116  H HA   . LEU A 1 74  ? 0.137   -2.841  4.492   1.00 0.00 ? 74  LEU A HA   5  
ATOM 9117  H HB2  . LEU A 1 74  ? -1.356  -1.039  3.853   1.00 0.00 ? 74  LEU A HB2  5  
ATOM 9118  H HB3  . LEU A 1 74  ? -1.729  -0.720  5.545   1.00 0.00 ? 74  LEU A HB3  5  
ATOM 9119  H HG   . LEU A 1 74  ? 0.898   -0.327  5.651   1.00 0.00 ? 74  LEU A HG   5  
ATOM 9120  H HD11 . LEU A 1 74  ? 1.418   -0.848  3.385   1.00 0.00 ? 74  LEU A HD11 5  
ATOM 9121  H HD12 . LEU A 1 74  ? 1.578   0.897   3.581   1.00 0.00 ? 74  LEU A HD12 5  
ATOM 9122  H HD13 . LEU A 1 74  ? 0.154   0.226   2.787   1.00 0.00 ? 74  LEU A HD13 5  
ATOM 9123  H HD21 . LEU A 1 74  ? -0.169  2.064   4.535   1.00 0.00 ? 74  LEU A HD21 5  
ATOM 9124  H HD22 . LEU A 1 74  ? 0.134   1.672   6.228   1.00 0.00 ? 74  LEU A HD22 5  
ATOM 9125  H HD23 . LEU A 1 74  ? -1.424  1.282   5.499   1.00 0.00 ? 74  LEU A HD23 5  
ATOM 9126  N N    . GLU A 1 75  ? 1.346   -2.801  6.648   1.00 0.00 ? 75  GLU A N    5  
ATOM 9127  C CA   . GLU A 1 75  ? 2.065   -2.873  7.915   1.00 0.00 ? 75  GLU A CA   5  
ATOM 9128  C C    . GLU A 1 75  ? 3.091   -1.749  8.021   1.00 0.00 ? 75  GLU A C    5  
ATOM 9129  O O    . GLU A 1 75  ? 4.284   -1.938  7.780   1.00 0.00 ? 75  GLU A O    5  
ATOM 9130  C CB   . GLU A 1 75  ? 2.760   -4.228  8.056   1.00 0.00 ? 75  GLU A CB   5  
ATOM 9131  C CG   . GLU A 1 75  ? 1.963   -5.385  7.476   1.00 0.00 ? 75  GLU A CG   5  
ATOM 9132  C CD   . GLU A 1 75  ? 2.520   -6.737  7.879   1.00 0.00 ? 75  GLU A CD   5  
ATOM 9133  O OE1  . GLU A 1 75  ? 3.501   -6.768  8.650   1.00 0.00 ? 75  GLU A OE1  5  
ATOM 9134  O OE2  . GLU A 1 75  ? 1.974   -7.763  7.423   1.00 0.00 ? 75  GLU A OE2  5  
ATOM 9135  H H    . GLU A 1 75  ? 1.831   -2.963  5.813   1.00 0.00 ? 75  GLU A H    5  
ATOM 9136  H HA   . GLU A 1 75  ? 1.345   -2.763  8.712   1.00 0.00 ? 75  GLU A HA   5  
ATOM 9137  H HB2  . GLU A 1 75  ? 3.714   -4.185  7.551   1.00 0.00 ? 75  GLU A HB2  5  
ATOM 9138  H HB3  . GLU A 1 75  ? 2.928   -4.425  9.105   1.00 0.00 ? 75  GLU A HB3  5  
ATOM 9139  H HG2  . GLU A 1 75  ? 0.944   -5.314  7.825   1.00 0.00 ? 75  GLU A HG2  5  
ATOM 9140  H HG3  . GLU A 1 75  ? 1.980   -5.312  6.398   1.00 0.00 ? 75  GLU A HG3  5  
ATOM 9141  N N    . PRO A 1 76  ? 2.618   -0.549  8.392   1.00 0.00 ? 76  PRO A N    5  
ATOM 9142  C CA   . PRO A 1 76  ? 3.478   0.629   8.539   1.00 0.00 ? 76  PRO A CA   5  
ATOM 9143  C C    . PRO A 1 76  ? 4.413   0.519   9.738   1.00 0.00 ? 76  PRO A C    5  
ATOM 9144  O O    . PRO A 1 76  ? 4.288   -0.397  10.552  1.00 0.00 ? 76  PRO A O    5  
ATOM 9145  C CB   . PRO A 1 76  ? 2.480   1.772   8.743   1.00 0.00 ? 76  PRO A CB   5  
ATOM 9146  C CG   . PRO A 1 76  ? 1.267   1.120   9.310   1.00 0.00 ? 76  PRO A CG   5  
ATOM 9147  C CD   . PRO A 1 76  ? 1.209   -0.252  8.696   1.00 0.00 ? 76  PRO A CD   5  
ATOM 9148  H HA   . PRO A 1 76  ? 4.058   0.811   7.647   1.00 0.00 ? 76  PRO A HA   5  
ATOM 9149  H HB2  . PRO A 1 76  ? 2.896   2.498   9.427   1.00 0.00 ? 76  PRO A HB2  5  
ATOM 9150  H HB3  . PRO A 1 76  ? 2.268   2.243   7.794   1.00 0.00 ? 76  PRO A HB3  5  
ATOM 9151  H HG2  . PRO A 1 76  ? 1.357   1.046   10.383  1.00 0.00 ? 76  PRO A HG2  5  
ATOM 9152  H HG3  . PRO A 1 76  ? 0.387   1.687   9.044   1.00 0.00 ? 76  PRO A HG3  5  
ATOM 9153  H HD2  . PRO A 1 76  ? 0.807   -0.964  9.401   1.00 0.00 ? 76  PRO A HD2  5  
ATOM 9154  H HD3  . PRO A 1 76  ? 0.615   -0.236  7.793   1.00 0.00 ? 76  PRO A HD3  5  
ATOM 9155  N N    . CYS A 1 77  ? 5.348   1.456   9.842   1.00 0.00 ? 77  CYS A N    5  
ATOM 9156  C CA   . CYS A 1 77  ? 6.305   1.463   10.942  1.00 0.00 ? 77  CYS A CA   5  
ATOM 9157  C C    . CYS A 1 77  ? 5.794   2.312   12.102  1.00 0.00 ? 77  CYS A C    5  
ATOM 9158  O O    . CYS A 1 77  ? 4.711   2.892   12.028  1.00 0.00 ? 77  CYS A O    5  
ATOM 9159  C CB   . CYS A 1 77  ? 7.659   1.992   10.465  1.00 0.00 ? 77  CYS A CB   5  
ATOM 9160  S SG   . CYS A 1 77  ? 9.075   1.295   11.346  1.00 0.00 ? 77  CYS A SG   5  
ATOM 9161  H H    . CYS A 1 77  ? 5.397   2.160   9.162   1.00 0.00 ? 77  CYS A H    5  
ATOM 9162  H HA   . CYS A 1 77  ? 6.425   0.446   11.283  1.00 0.00 ? 77  CYS A HA   5  
ATOM 9163  H HB2  . CYS A 1 77  ? 7.778   1.761   9.417   1.00 0.00 ? 77  CYS A HB2  5  
ATOM 9164  H HB3  . CYS A 1 77  ? 7.684   3.064   10.595  1.00 0.00 ? 77  CYS A HB3  5  
ATOM 9165  H HG   . CYS A 1 77  ? 8.620   0.401   12.210  1.00 0.00 ? 77  CYS A HG   5  
ATOM 9166  N N    . GLU A 1 78  ? 6.580   2.379   13.172  1.00 0.00 ? 78  GLU A N    5  
ATOM 9167  C CA   . GLU A 1 78  ? 6.205   3.155   14.348  1.00 0.00 ? 78  GLU A CA   5  
ATOM 9168  C C    . GLU A 1 78  ? 6.781   4.566   14.275  1.00 0.00 ? 78  GLU A C    5  
ATOM 9169  O O    . GLU A 1 78  ? 6.224   5.506   14.842  1.00 0.00 ? 78  GLU A O    5  
ATOM 9170  C CB   . GLU A 1 78  ? 6.690   2.459   15.621  1.00 0.00 ? 78  GLU A CB   5  
ATOM 9171  C CG   . GLU A 1 78  ? 7.989   1.692   15.439  1.00 0.00 ? 78  GLU A CG   5  
ATOM 9172  C CD   . GLU A 1 78  ? 8.640   1.326   16.759  1.00 0.00 ? 78  GLU A CD   5  
ATOM 9173  O OE1  . GLU A 1 78  ? 7.902   1.024   17.720  1.00 0.00 ? 78  GLU A OE1  5  
ATOM 9174  O OE2  . GLU A 1 78  ? 9.886   1.342   16.830  1.00 0.00 ? 78  GLU A OE2  5  
ATOM 9175  H H    . GLU A 1 78  ? 7.432   1.895   13.170  1.00 0.00 ? 78  GLU A H    5  
ATOM 9176  H HA   . GLU A 1 78  ? 5.128   3.220   14.372  1.00 0.00 ? 78  GLU A HA   5  
ATOM 9177  H HB2  . GLU A 1 78  ? 6.839   3.204   16.389  1.00 0.00 ? 78  GLU A HB2  5  
ATOM 9178  H HB3  . GLU A 1 78  ? 5.930   1.766   15.949  1.00 0.00 ? 78  GLU A HB3  5  
ATOM 9179  H HG2  . GLU A 1 78  ? 7.782   0.784   14.894  1.00 0.00 ? 78  GLU A HG2  5  
ATOM 9180  H HG3  . GLU A 1 78  ? 8.676   2.303   14.872  1.00 0.00 ? 78  GLU A HG3  5  
ATOM 9181  N N    . ARG A 1 79  ? 7.901   4.706   13.573  1.00 0.00 ? 79  ARG A N    5  
ATOM 9182  C CA   . ARG A 1 79  ? 8.555   6.001   13.427  1.00 0.00 ? 79  ARG A CA   5  
ATOM 9183  C C    . ARG A 1 79  ? 8.686   6.381   11.955  1.00 0.00 ? 79  ARG A C    5  
ATOM 9184  O O    . ARG A 1 79  ? 9.711   6.915   11.531  1.00 0.00 ? 79  ARG A O    5  
ATOM 9185  C CB   . ARG A 1 79  ? 9.936   5.976   14.084  1.00 0.00 ? 79  ARG A CB   5  
ATOM 9186  C CG   . ARG A 1 79  ? 9.932   6.446   15.529  1.00 0.00 ? 79  ARG A CG   5  
ATOM 9187  C CD   . ARG A 1 79  ? 11.201  7.213   15.869  1.00 0.00 ? 79  ARG A CD   5  
ATOM 9188  N NE   . ARG A 1 79  ? 12.352  6.727   15.114  1.00 0.00 ? 79  ARG A NE   5  
ATOM 9189  C CZ   . ARG A 1 79  ? 13.525  7.349   15.082  1.00 0.00 ? 79  ARG A CZ   5  
ATOM 9190  N NH1  . ARG A 1 79  ? 13.701  8.476   15.759  1.00 0.00 ? 79  ARG A NH1  5  
ATOM 9191  N NH2  . ARG A 1 79  ? 14.526  6.845   14.371  1.00 0.00 ? 79  ARG A NH2  5  
ATOM 9192  H H    . ARG A 1 79  ? 8.298   3.920   13.144  1.00 0.00 ? 79  ARG A H    5  
ATOM 9193  H HA   . ARG A 1 79  ? 7.943   6.739   13.924  1.00 0.00 ? 79  ARG A HA   5  
ATOM 9194  H HB2  . ARG A 1 79  ? 10.316  4.965   14.059  1.00 0.00 ? 79  ARG A HB2  5  
ATOM 9195  H HB3  . ARG A 1 79  ? 10.600  6.615   13.522  1.00 0.00 ? 79  ARG A HB3  5  
ATOM 9196  H HG2  . ARG A 1 79  ? 9.081   7.093   15.685  1.00 0.00 ? 79  ARG A HG2  5  
ATOM 9197  H HG3  . ARG A 1 79  ? 9.856   5.586   16.178  1.00 0.00 ? 79  ARG A HG3  5  
ATOM 9198  H HD2  . ARG A 1 79  ? 11.047  8.257   15.641  1.00 0.00 ? 79  ARG A HD2  5  
ATOM 9199  H HD3  . ARG A 1 79  ? 11.401  7.101   16.925  1.00 0.00 ? 79  ARG A HD3  5  
ATOM 9200  H HE   . ARG A 1 79  ? 12.245  5.896   14.606  1.00 0.00 ? 79  ARG A HE   5  
ATOM 9201  H HH11 . ARG A 1 79  ? 12.949  8.857   16.296  1.00 0.00 ? 79  ARG A HH11 5  
ATOM 9202  H HH12 . ARG A 1 79  ? 14.586  8.942   15.734  1.00 0.00 ? 79  ARG A HH12 5  
ATOM 9203  H HH21 . ARG A 1 79  ? 14.398  5.996   13.859  1.00 0.00 ? 79  ARG A HH21 5  
ATOM 9204  H HH22 . ARG A 1 79  ? 15.408  7.314   14.347  1.00 0.00 ? 79  ARG A HH22 5  
ATOM 9205  N N    . SER A 1 80  ? 7.642   6.101   11.182  1.00 0.00 ? 80  SER A N    5  
ATOM 9206  C CA   . SER A 1 80  ? 7.642   6.410   9.756   1.00 0.00 ? 80  SER A CA   5  
ATOM 9207  C C    . SER A 1 80  ? 6.500   7.359   9.406   1.00 0.00 ? 80  SER A C    5  
ATOM 9208  O O    . SER A 1 80  ? 5.554   7.519   10.176  1.00 0.00 ? 80  SER A O    5  
ATOM 9209  C CB   . SER A 1 80  ? 7.523   5.125   8.935   1.00 0.00 ? 80  SER A CB   5  
ATOM 9210  O OG   . SER A 1 80  ? 6.373   4.386   9.308   1.00 0.00 ? 80  SER A OG   5  
ATOM 9211  H H    . SER A 1 80  ? 6.854   5.675   11.579  1.00 0.00 ? 80  SER A H    5  
ATOM 9212  H HA   . SER A 1 80  ? 8.580   6.891   9.522   1.00 0.00 ? 80  SER A HA   5  
ATOM 9213  H HB2  . SER A 1 80  ? 7.452   5.375   7.888   1.00 0.00 ? 80  SER A HB2  5  
ATOM 9214  H HB3  . SER A 1 80  ? 8.398   4.513   9.100   1.00 0.00 ? 80  SER A HB3  5  
ATOM 9215  H HG   . SER A 1 80  ? 5.587   4.911   9.139   1.00 0.00 ? 80  SER A HG   5  
ATOM 9216  N N    . GLU A 1 81  ? 6.598   7.985   8.237   1.00 0.00 ? 81  GLU A N    5  
ATOM 9217  C CA   . GLU A 1 81  ? 5.573   8.919   7.784   1.00 0.00 ? 81  GLU A CA   5  
ATOM 9218  C C    . GLU A 1 81  ? 4.615   8.244   6.807   1.00 0.00 ? 81  GLU A C    5  
ATOM 9219  O O    . GLU A 1 81  ? 4.662   8.491   5.602   1.00 0.00 ? 81  GLU A O    5  
ATOM 9220  C CB   . GLU A 1 81  ? 6.220   10.138  7.122   1.00 0.00 ? 81  GLU A CB   5  
ATOM 9221  C CG   . GLU A 1 81  ? 5.248   11.278  6.865   1.00 0.00 ? 81  GLU A CG   5  
ATOM 9222  C CD   . GLU A 1 81  ? 5.934   12.518  6.327   1.00 0.00 ? 81  GLU A CD   5  
ATOM 9223  O OE1  . GLU A 1 81  ? 7.182   12.530  6.274   1.00 0.00 ? 81  GLU A OE1  5  
ATOM 9224  O OE2  . GLU A 1 81  ? 5.224   13.477  5.958   1.00 0.00 ? 81  GLU A OE2  5  
ATOM 9225  H H    . GLU A 1 81  ? 7.376   7.816   7.667   1.00 0.00 ? 81  GLU A H    5  
ATOM 9226  H HA   . GLU A 1 81  ? 5.016   9.245   8.649   1.00 0.00 ? 81  GLU A HA   5  
ATOM 9227  H HB2  . GLU A 1 81  ? 7.011   10.502  7.760   1.00 0.00 ? 81  GLU A HB2  5  
ATOM 9228  H HB3  . GLU A 1 81  ? 6.644   9.835   6.176   1.00 0.00 ? 81  GLU A HB3  5  
ATOM 9229  H HG2  . GLU A 1 81  ? 4.512   10.951  6.146   1.00 0.00 ? 81  GLU A HG2  5  
ATOM 9230  H HG3  . GLU A 1 81  ? 4.756   11.530  7.793   1.00 0.00 ? 81  GLU A HG3  5  
ATOM 9231  N N    . THR A 1 82  ? 3.746   7.388   7.336   1.00 0.00 ? 82  THR A N    5  
ATOM 9232  C CA   . THR A 1 82  ? 2.777   6.675   6.513   1.00 0.00 ? 82  THR A CA   5  
ATOM 9233  C C    . THR A 1 82  ? 1.355   7.134   6.815   1.00 0.00 ? 82  THR A C    5  
ATOM 9234  O O    . THR A 1 82  ? 1.056   7.569   7.927   1.00 0.00 ? 82  THR A O    5  
ATOM 9235  C CB   . THR A 1 82  ? 2.870   5.153   6.727   1.00 0.00 ? 82  THR A CB   5  
ATOM 9236  O OG1  . THR A 1 82  ? 4.220   4.782   7.031   1.00 0.00 ? 82  THR A OG1  5  
ATOM 9237  C CG2  . THR A 1 82  ? 2.399   4.402   5.491   1.00 0.00 ? 82  THR A CG2  5  
ATOM 9238  H H    . THR A 1 82  ? 3.758   7.233   8.304   1.00 0.00 ? 82  THR A H    5  
ATOM 9239  H HA   . THR A 1 82  ? 3.001   6.886   5.477   1.00 0.00 ? 82  THR A HA   5  
ATOM 9240  H HB   . THR A 1 82  ? 2.235   4.882   7.559   1.00 0.00 ? 82  THR A HB   5  
ATOM 9241  H HG1  . THR A 1 82  ? 4.231   3.904   7.419   1.00 0.00 ? 82  THR A HG1  5  
ATOM 9242  H HG21 . THR A 1 82  ? 2.245   5.102   4.683   1.00 0.00 ? 82  THR A HG21 5  
ATOM 9243  H HG22 . THR A 1 82  ? 1.471   3.895   5.709   1.00 0.00 ? 82  THR A HG22 5  
ATOM 9244  H HG23 . THR A 1 82  ? 3.146   3.678   5.203   1.00 0.00 ? 82  THR A HG23 5  
ATOM 9245  N N    . TYR A 1 83  ? 0.482   7.033   5.819   1.00 0.00 ? 83  TYR A N    5  
ATOM 9246  C CA   . TYR A 1 83  ? -0.909  7.440   5.978   1.00 0.00 ? 83  TYR A CA   5  
ATOM 9247  C C    . TYR A 1 83  ? -1.810  6.693   4.999   1.00 0.00 ? 83  TYR A C    5  
ATOM 9248  O O    . TYR A 1 83  ? -1.567  6.690   3.792   1.00 0.00 ? 83  TYR A O    5  
ATOM 9249  C CB   . TYR A 1 83  ? -1.049  8.948   5.768   1.00 0.00 ? 83  TYR A CB   5  
ATOM 9250  C CG   . TYR A 1 83  ? -0.274  9.773   6.771   1.00 0.00 ? 83  TYR A CG   5  
ATOM 9251  C CD1  . TYR A 1 83  ? 1.101   9.936   6.651   1.00 0.00 ? 83  TYR A CD1  5  
ATOM 9252  C CD2  . TYR A 1 83  ? -0.916  10.389  7.838   1.00 0.00 ? 83  TYR A CD2  5  
ATOM 9253  C CE1  . TYR A 1 83  ? 1.813   10.689  7.565   1.00 0.00 ? 83  TYR A CE1  5  
ATOM 9254  C CE2  . TYR A 1 83  ? -0.212  11.144  8.756   1.00 0.00 ? 83  TYR A CE2  5  
ATOM 9255  C CZ   . TYR A 1 83  ? 1.152   11.291  8.615   1.00 0.00 ? 83  TYR A CZ   5  
ATOM 9256  O OH   . TYR A 1 83  ? 1.857   12.042  9.528   1.00 0.00 ? 83  TYR A OH   5  
ATOM 9257  H H    . TYR A 1 83  ? 0.780   6.679   4.955   1.00 0.00 ? 83  TYR A H    5  
ATOM 9258  H HA   . TYR A 1 83  ? -1.212  7.197   6.986   1.00 0.00 ? 83  TYR A HA   5  
ATOM 9259  H HB2  . TYR A 1 83  ? -0.690  9.203   4.783   1.00 0.00 ? 83  TYR A HB2  5  
ATOM 9260  H HB3  . TYR A 1 83  ? -2.091  9.221   5.848   1.00 0.00 ? 83  TYR A HB3  5  
ATOM 9261  H HD1  . TYR A 1 83  ? 1.616   9.463   5.828   1.00 0.00 ? 83  TYR A HD1  5  
ATOM 9262  H HD2  . TYR A 1 83  ? -1.985  10.272  7.945   1.00 0.00 ? 83  TYR A HD2  5  
ATOM 9263  H HE1  . TYR A 1 83  ? 2.882   10.804  7.456   1.00 0.00 ? 83  TYR A HE1  5  
ATOM 9264  H HE2  . TYR A 1 83  ? -0.729  11.616  9.578   1.00 0.00 ? 83  TYR A HE2  5  
ATOM 9265  H HH   . TYR A 1 83  ? 1.256   12.379  10.197  1.00 0.00 ? 83  TYR A HH   5  
ATOM 9266  N N    . VAL A 1 84  ? -2.853  6.061   5.529   1.00 0.00 ? 84  VAL A N    5  
ATOM 9267  C CA   . VAL A 1 84  ? -3.792  5.312   4.703   1.00 0.00 ? 84  VAL A CA   5  
ATOM 9268  C C    . VAL A 1 84  ? -5.233  5.679   5.040   1.00 0.00 ? 84  VAL A C    5  
ATOM 9269  O O    . VAL A 1 84  ? -5.565  5.935   6.197   1.00 0.00 ? 84  VAL A O    5  
ATOM 9270  C CB   . VAL A 1 84  ? -3.606  3.793   4.878   1.00 0.00 ? 84  VAL A CB   5  
ATOM 9271  C CG1  . VAL A 1 84  ? -4.891  3.054   4.535   1.00 0.00 ? 84  VAL A CG1  5  
ATOM 9272  C CG2  . VAL A 1 84  ? -2.451  3.297   4.022   1.00 0.00 ? 84  VAL A CG2  5  
ATOM 9273  H H    . VAL A 1 84  ? -2.994  6.100   6.498   1.00 0.00 ? 84  VAL A H    5  
ATOM 9274  H HA   . VAL A 1 84  ? -3.600  5.560   3.669   1.00 0.00 ? 84  VAL A HA   5  
ATOM 9275  H HB   . VAL A 1 84  ? -3.370  3.597   5.914   1.00 0.00 ? 84  VAL A HB   5  
ATOM 9276  H HG11 . VAL A 1 84  ? -5.175  3.281   3.517   1.00 0.00 ? 84  VAL A HG11 5  
ATOM 9277  H HG12 . VAL A 1 84  ? -4.733  1.991   4.637   1.00 0.00 ? 84  VAL A HG12 5  
ATOM 9278  H HG13 . VAL A 1 84  ? -5.677  3.369   5.205   1.00 0.00 ? 84  VAL A HG13 5  
ATOM 9279  H HG21 . VAL A 1 84  ? -2.494  3.766   3.051   1.00 0.00 ? 84  VAL A HG21 5  
ATOM 9280  H HG22 . VAL A 1 84  ? -1.516  3.546   4.502   1.00 0.00 ? 84  VAL A HG22 5  
ATOM 9281  H HG23 . VAL A 1 84  ? -2.522  2.225   3.907   1.00 0.00 ? 84  VAL A HG23 5  
ATOM 9282  N N    . ASN A 1 85  ? -6.087  5.700   4.022   1.00 0.00 ? 85  ASN A N    5  
ATOM 9283  C CA   . ASN A 1 85  ? -7.493  6.036   4.210   1.00 0.00 ? 85  ASN A CA   5  
ATOM 9284  C C    . ASN A 1 85  ? -7.667  7.529   4.468   1.00 0.00 ? 85  ASN A C    5  
ATOM 9285  O O    . ASN A 1 85  ? -8.606  7.948   5.143   1.00 0.00 ? 85  ASN A O    5  
ATOM 9286  C CB   . ASN A 1 85  ? -8.079  5.234   5.374   1.00 0.00 ? 85  ASN A CB   5  
ATOM 9287  C CG   . ASN A 1 85  ? -9.557  4.946   5.193   1.00 0.00 ? 85  ASN A CG   5  
ATOM 9288  O OD1  . ASN A 1 85  ? -10.409 5.700   5.663   1.00 0.00 ? 85  ASN A OD1  5  
ATOM 9289  N ND2  . ASN A 1 85  ? -9.867  3.851   4.510   1.00 0.00 ? 85  ASN A ND2  5  
ATOM 9290  H H    . ASN A 1 85  ? -5.763  5.487   3.122   1.00 0.00 ? 85  ASN A H    5  
ATOM 9291  H HA   . ASN A 1 85  ? -8.020  5.775   3.304   1.00 0.00 ? 85  ASN A HA   5  
ATOM 9292  H HB2  . ASN A 1 85  ? -7.556  4.292   5.454   1.00 0.00 ? 85  ASN A HB2  5  
ATOM 9293  H HB3  . ASN A 1 85  ? -7.948  5.792   6.290   1.00 0.00 ? 85  ASN A HB3  5  
ATOM 9294  H HD21 . ASN A 1 85  ? -9.135  3.297   4.165   1.00 0.00 ? 85  ASN A HD21 5  
ATOM 9295  H HD22 . ASN A 1 85  ? -10.815 3.641   4.377   1.00 0.00 ? 85  ASN A HD22 5  
ATOM 9296  N N    . GLY A 1 86  ? -6.753  8.328   3.925   1.00 0.00 ? 86  GLY A N    5  
ATOM 9297  C CA   . GLY A 1 86  ? -6.823  9.766   4.107   1.00 0.00 ? 86  GLY A CA   5  
ATOM 9298  C C    . GLY A 1 86  ? -6.376  10.198  5.489   1.00 0.00 ? 86  GLY A C    5  
ATOM 9299  O O    . GLY A 1 86  ? -6.406  11.384  5.818   1.00 0.00 ? 86  GLY A O    5  
ATOM 9300  H H    . GLY A 1 86  ? -6.026  7.938   3.396   1.00 0.00 ? 86  GLY A H    5  
ATOM 9301  H HA2  . GLY A 1 86  ? -6.193  10.243  3.371   1.00 0.00 ? 86  GLY A HA2  5  
ATOM 9302  H HA3  . GLY A 1 86  ? -7.843  10.088  3.955   1.00 0.00 ? 86  GLY A HA3  5  
ATOM 9303  N N    . LYS A 1 87  ? -5.960  9.234   6.303   1.00 0.00 ? 87  LYS A N    5  
ATOM 9304  C CA   . LYS A 1 87  ? -5.504  9.519   7.658   1.00 0.00 ? 87  LYS A CA   5  
ATOM 9305  C C    . LYS A 1 87  ? -4.190  8.803   7.952   1.00 0.00 ? 87  LYS A C    5  
ATOM 9306  O O    . LYS A 1 87  ? -3.607  8.169   7.072   1.00 0.00 ? 87  LYS A O    5  
ATOM 9307  C CB   . LYS A 1 87  ? -6.566  9.095   8.675   1.00 0.00 ? 87  LYS A CB   5  
ATOM 9308  C CG   . LYS A 1 87  ? -7.865  9.873   8.558   1.00 0.00 ? 87  LYS A CG   5  
ATOM 9309  C CD   . LYS A 1 87  ? -8.913  9.358   9.531   1.00 0.00 ? 87  LYS A CD   5  
ATOM 9310  C CE   . LYS A 1 87  ? -8.763  9.999   10.902  1.00 0.00 ? 87  LYS A CE   5  
ATOM 9311  N NZ   . LYS A 1 87  ? -9.307  9.130   11.982  1.00 0.00 ? 87  LYS A NZ   5  
ATOM 9312  H H    . LYS A 1 87  ? -5.958  8.306   5.984   1.00 0.00 ? 87  LYS A H    5  
ATOM 9313  H HA   . LYS A 1 87  ? -5.346  10.583  7.738   1.00 0.00 ? 87  LYS A HA   5  
ATOM 9314  H HB2  . LYS A 1 87  ? -6.785  8.047   8.534   1.00 0.00 ? 87  LYS A HB2  5  
ATOM 9315  H HB3  . LYS A 1 87  ? -6.173  9.241   9.671   1.00 0.00 ? 87  LYS A HB3  5  
ATOM 9316  H HG2  . LYS A 1 87  ? -7.672  10.914  8.772   1.00 0.00 ? 87  LYS A HG2  5  
ATOM 9317  H HG3  . LYS A 1 87  ? -8.243  9.775   7.550   1.00 0.00 ? 87  LYS A HG3  5  
ATOM 9318  H HD2  . LYS A 1 87  ? -9.895  9.589   9.144   1.00 0.00 ? 87  LYS A HD2  5  
ATOM 9319  H HD3  . LYS A 1 87  ? -8.806  8.287   9.629   1.00 0.00 ? 87  LYS A HD3  5  
ATOM 9320  H HE2  . LYS A 1 87  ? -7.715  10.177  11.089  1.00 0.00 ? 87  LYS A HE2  5  
ATOM 9321  H HE3  . LYS A 1 87  ? -9.295  10.939  10.906  1.00 0.00 ? 87  LYS A HE3  5  
ATOM 9322  H HZ1  . LYS A 1 87  ? -10.242 8.765   11.711  1.00 0.00 ? 87  LYS A HZ1  5  
ATOM 9323  H HZ2  . LYS A 1 87  ? -9.401  9.673   12.864  1.00 0.00 ? 87  LYS A HZ2  5  
ATOM 9324  H HZ3  . LYS A 1 87  ? -8.668  8.326   12.150  1.00 0.00 ? 87  LYS A HZ3  5  
ATOM 9325  N N    . ARG A 1 88  ? -3.729  8.907   9.195   1.00 0.00 ? 88  ARG A N    5  
ATOM 9326  C CA   . ARG A 1 88  ? -2.483  8.270   9.604   1.00 0.00 ? 88  ARG A CA   5  
ATOM 9327  C C    . ARG A 1 88  ? -2.680  6.769   9.801   1.00 0.00 ? 88  ARG A C    5  
ATOM 9328  O O    . ARG A 1 88  ? -3.757  6.320   10.193  1.00 0.00 ? 88  ARG A O    5  
ATOM 9329  C CB   . ARG A 1 88  ? -1.963  8.901   10.896  1.00 0.00 ? 88  ARG A CB   5  
ATOM 9330  C CG   . ARG A 1 88  ? -0.739  8.202   11.466  1.00 0.00 ? 88  ARG A CG   5  
ATOM 9331  C CD   . ARG A 1 88  ? 0.080   9.138   12.341  1.00 0.00 ? 88  ARG A CD   5  
ATOM 9332  N NE   . ARG A 1 88  ? -0.465  9.242   13.692  1.00 0.00 ? 88  ARG A NE   5  
ATOM 9333  C CZ   . ARG A 1 88  ? 0.212   9.736   14.722  1.00 0.00 ? 88  ARG A CZ   5  
ATOM 9334  N NH1  . ARG A 1 88  ? 1.454   10.171  14.556  1.00 0.00 ? 88  ARG A NH1  5  
ATOM 9335  N NH2  . ARG A 1 88  ? -0.352  9.798   15.921  1.00 0.00 ? 88  ARG A NH2  5  
ATOM 9336  H H    . ARG A 1 88  ? -4.238  9.427   9.852   1.00 0.00 ? 88  ARG A H    5  
ATOM 9337  H HA   . ARG A 1 88  ? -1.758  8.426   8.820   1.00 0.00 ? 88  ARG A HA   5  
ATOM 9338  H HB2  . ARG A 1 88  ? -1.704  9.931   10.701  1.00 0.00 ? 88  ARG A HB2  5  
ATOM 9339  H HB3  . ARG A 1 88  ? -2.747  8.870   11.639  1.00 0.00 ? 88  ARG A HB3  5  
ATOM 9340  H HG2  . ARG A 1 88  ? -1.061  7.361   12.061  1.00 0.00 ? 88  ARG A HG2  5  
ATOM 9341  H HG3  . ARG A 1 88  ? -0.123  7.854   10.650  1.00 0.00 ? 88  ARG A HG3  5  
ATOM 9342  H HD2  . ARG A 1 88  ? 1.090   8.763   12.399  1.00 0.00 ? 88  ARG A HD2  5  
ATOM 9343  H HD3  . ARG A 1 88  ? 0.086   10.119  11.889  1.00 0.00 ? 88  ARG A HD3  5  
ATOM 9344  H HE   . ARG A 1 88  ? -1.381  8.927   13.837  1.00 0.00 ? 88  ARG A HE   5  
ATOM 9345  H HH11 . ARG A 1 88  ? 1.881   10.127  13.653  1.00 0.00 ? 88  ARG A HH11 5  
ATOM 9346  H HH12 . ARG A 1 88  ? 1.961   10.544  15.333  1.00 0.00 ? 88  ARG A HH12 5  
ATOM 9347  H HH21 . ARG A 1 88  ? -1.288  9.472   16.050  1.00 0.00 ? 88  ARG A HH21 5  
ATOM 9348  H HH22 . ARG A 1 88  ? 0.158   10.170  16.695  1.00 0.00 ? 88  ARG A HH22 5  
ATOM 9349  N N    . VAL A 1 89  ? -1.632  5.999   9.526   1.00 0.00 ? 89  VAL A N    5  
ATOM 9350  C CA   . VAL A 1 89  ? -1.689  4.550   9.674   1.00 0.00 ? 89  VAL A CA   5  
ATOM 9351  C C    . VAL A 1 89  ? -0.542  4.040   10.540  1.00 0.00 ? 89  VAL A C    5  
ATOM 9352  O O    . VAL A 1 89  ? 0.583   3.879   10.067  1.00 0.00 ? 89  VAL A O    5  
ATOM 9353  C CB   . VAL A 1 89  ? -1.638  3.844   8.306   1.00 0.00 ? 89  VAL A CB   5  
ATOM 9354  C CG1  . VAL A 1 89  ? -0.312  4.120   7.612   1.00 0.00 ? 89  VAL A CG1  5  
ATOM 9355  C CG2  . VAL A 1 89  ? -1.862  2.348   8.470   1.00 0.00 ? 89  VAL A CG2  5  
ATOM 9356  H H    . VAL A 1 89  ? -0.801  6.416   9.218   1.00 0.00 ? 89  VAL A H    5  
ATOM 9357  H HA   . VAL A 1 89  ? -2.626  4.299   10.150  1.00 0.00 ? 89  VAL A HA   5  
ATOM 9358  H HB   . VAL A 1 89  ? -2.431  4.240   7.689   1.00 0.00 ? 89  VAL A HB   5  
ATOM 9359  H HG11 . VAL A 1 89  ? 0.304   3.234   7.649   1.00 0.00 ? 89  VAL A HG11 5  
ATOM 9360  H HG12 . VAL A 1 89  ? -0.495  4.391   6.582   1.00 0.00 ? 89  VAL A HG12 5  
ATOM 9361  H HG13 . VAL A 1 89  ? 0.194   4.931   8.114   1.00 0.00 ? 89  VAL A HG13 5  
ATOM 9362  H HG21 . VAL A 1 89  ? -1.220  1.811   7.788   1.00 0.00 ? 89  VAL A HG21 5  
ATOM 9363  H HG22 . VAL A 1 89  ? -1.632  2.060   9.485   1.00 0.00 ? 89  VAL A HG22 5  
ATOM 9364  H HG23 . VAL A 1 89  ? -2.894  2.113   8.254   1.00 0.00 ? 89  VAL A HG23 5  
ATOM 9365  N N    . SER A 1 90  ? -0.835  3.788   11.812  1.00 0.00 ? 90  SER A N    5  
ATOM 9366  C CA   . SER A 1 90  ? 0.172   3.299   12.746  1.00 0.00 ? 90  SER A CA   5  
ATOM 9367  C C    . SER A 1 90  ? -0.153  1.880   13.202  1.00 0.00 ? 90  SER A C    5  
ATOM 9368  O O    . SER A 1 90  ? 0.399   1.393   14.188  1.00 0.00 ? 90  SER A O    5  
ATOM 9369  C CB   . SER A 1 90  ? 0.267   4.228   13.958  1.00 0.00 ? 90  SER A CB   5  
ATOM 9370  O OG   . SER A 1 90  ? 0.360   5.583   13.556  1.00 0.00 ? 90  SER A OG   5  
ATOM 9371  H H    . SER A 1 90  ? -1.751  3.936   12.130  1.00 0.00 ? 90  SER A H    5  
ATOM 9372  H HA   . SER A 1 90  ? 1.123   3.292   12.234  1.00 0.00 ? 90  SER A HA   5  
ATOM 9373  H HB2  . SER A 1 90  ? -0.613  4.106   14.571  1.00 0.00 ? 90  SER A HB2  5  
ATOM 9374  H HB3  . SER A 1 90  ? 1.146   3.974   14.534  1.00 0.00 ? 90  SER A HB3  5  
ATOM 9375  H HG   . SER A 1 90  ? 1.240   5.757   13.215  1.00 0.00 ? 90  SER A HG   5  
ATOM 9376  N N    . GLN A 1 91  ? -1.051  1.223   12.476  1.00 0.00 ? 91  GLN A N    5  
ATOM 9377  C CA   . GLN A 1 91  ? -1.451  -0.140  12.806  1.00 0.00 ? 91  GLN A CA   5  
ATOM 9378  C C    . GLN A 1 91  ? -1.776  -0.932  11.544  1.00 0.00 ? 91  GLN A C    5  
ATOM 9379  O O    . GLN A 1 91  ? -2.159  -0.377  10.514  1.00 0.00 ? 91  GLN A O    5  
ATOM 9380  C CB   . GLN A 1 91  ? -2.661  -0.127  13.741  1.00 0.00 ? 91  GLN A CB   5  
ATOM 9381  C CG   . GLN A 1 91  ? -2.322  0.260   15.171  1.00 0.00 ? 91  GLN A CG   5  
ATOM 9382  C CD   . GLN A 1 91  ? -1.845  -0.918  15.997  1.00 0.00 ? 91  GLN A CD   5  
ATOM 9383  O OE1  . GLN A 1 91  ? -0.843  -1.555  15.672  1.00 0.00 ? 91  GLN A OE1  5  
ATOM 9384  N NE2  . GLN A 1 91  ? -2.563  -1.215  17.074  1.00 0.00 ? 91  GLN A NE2  5  
ATOM 9385  H H    . GLN A 1 91  ? -1.455  1.665   11.701  1.00 0.00 ? 91  GLN A H    5  
ATOM 9386  H HA   . GLN A 1 91  ? -0.623  -0.615  13.310  1.00 0.00 ? 91  GLN A HA   5  
ATOM 9387  H HB2  . GLN A 1 91  ? -3.386  0.578   13.362  1.00 0.00 ? 91  GLN A HB2  5  
ATOM 9388  H HB3  . GLN A 1 91  ? -3.102  -1.113  13.753  1.00 0.00 ? 91  GLN A HB3  5  
ATOM 9389  H HG2  . GLN A 1 91  ? -1.541  1.006   15.153  1.00 0.00 ? 91  GLN A HG2  5  
ATOM 9390  H HG3  . GLN A 1 91  ? -3.203  0.675   15.637  1.00 0.00 ? 91  GLN A HG3  5  
ATOM 9391  H HE21 . GLN A 1 91  ? -3.351  -0.665  17.271  1.00 0.00 ? 91  GLN A HE21 5  
ATOM 9392  H HE22 . GLN A 1 91  ? -2.279  -1.972  17.625  1.00 0.00 ? 91  GLN A HE22 5  
ATOM 9393  N N    . PRO A 1 92  ? -1.620  -2.262  11.624  1.00 0.00 ? 92  PRO A N    5  
ATOM 9394  C CA   . PRO A 1 92  ? -1.892  -3.160  10.497  1.00 0.00 ? 92  PRO A CA   5  
ATOM 9395  C C    . PRO A 1 92  ? -3.380  -3.255  10.178  1.00 0.00 ? 92  PRO A C    5  
ATOM 9396  O O    . PRO A 1 92  ? -4.134  -3.931  10.878  1.00 0.00 ? 92  PRO A O    5  
ATOM 9397  C CB   . PRO A 1 92  ? -1.363  -4.511  10.984  1.00 0.00 ? 92  PRO A CB   5  
ATOM 9398  C CG   . PRO A 1 92  ? -1.430  -4.431  12.470  1.00 0.00 ? 92  PRO A CG   5  
ATOM 9399  C CD   . PRO A 1 92  ? -1.167  -2.992  12.819  1.00 0.00 ? 92  PRO A CD   5  
ATOM 9400  H HA   . PRO A 1 92  ? -1.354  -2.858  9.610   1.00 0.00 ? 92  PRO A HA   5  
ATOM 9401  H HB2  . PRO A 1 92  ? -1.989  -5.305  10.601  1.00 0.00 ? 92  PRO A HB2  5  
ATOM 9402  H HB3  . PRO A 1 92  ? -0.348  -4.648  10.641  1.00 0.00 ? 92  PRO A HB3  5  
ATOM 9403  H HG2  . PRO A 1 92  ? -2.411  -4.726  12.810  1.00 0.00 ? 92  PRO A HG2  5  
ATOM 9404  H HG3  . PRO A 1 92  ? -0.673  -5.066  12.906  1.00 0.00 ? 92  PRO A HG3  5  
ATOM 9405  H HD2  . PRO A 1 92  ? -1.741  -2.704  13.688  1.00 0.00 ? 92  PRO A HD2  5  
ATOM 9406  H HD3  . PRO A 1 92  ? -0.113  -2.832  12.991  1.00 0.00 ? 92  PRO A HD3  5  
ATOM 9407  N N    . VAL A 1 93  ? -3.798  -2.573  9.116   1.00 0.00 ? 93  VAL A N    5  
ATOM 9408  C CA   . VAL A 1 93  ? -5.196  -2.582  8.703   1.00 0.00 ? 93  VAL A CA   5  
ATOM 9409  C C    . VAL A 1 93  ? -5.351  -3.159  7.300   1.00 0.00 ? 93  VAL A C    5  
ATOM 9410  O O    . VAL A 1 93  ? -4.421  -3.115  6.495   1.00 0.00 ? 93  VAL A O    5  
ATOM 9411  C CB   . VAL A 1 93  ? -5.799  -1.165  8.733   1.00 0.00 ? 93  VAL A CB   5  
ATOM 9412  C CG1  . VAL A 1 93  ? -5.716  -0.579  10.134  1.00 0.00 ? 93  VAL A CG1  5  
ATOM 9413  C CG2  . VAL A 1 93  ? -5.097  -0.266  7.727   1.00 0.00 ? 93  VAL A CG2  5  
ATOM 9414  H H    . VAL A 1 93  ? -3.150  -2.052  8.597   1.00 0.00 ? 93  VAL A H    5  
ATOM 9415  H HA   . VAL A 1 93  ? -5.746  -3.200  9.398   1.00 0.00 ? 93  VAL A HA   5  
ATOM 9416  H HB   . VAL A 1 93  ? -6.841  -1.234  8.457   1.00 0.00 ? 93  VAL A HB   5  
ATOM 9417  H HG11 . VAL A 1 93  ? -5.832  0.494   10.082  1.00 0.00 ? 93  VAL A HG11 5  
ATOM 9418  H HG12 . VAL A 1 93  ? -6.499  -0.998  10.748  1.00 0.00 ? 93  VAL A HG12 5  
ATOM 9419  H HG13 . VAL A 1 93  ? -4.754  -0.815  10.566  1.00 0.00 ? 93  VAL A HG13 5  
ATOM 9420  H HG21 . VAL A 1 93  ? -4.984  -0.792  6.791   1.00 0.00 ? 93  VAL A HG21 5  
ATOM 9421  H HG22 . VAL A 1 93  ? -5.685  0.626   7.570   1.00 0.00 ? 93  VAL A HG22 5  
ATOM 9422  H HG23 . VAL A 1 93  ? -4.123  0.008   8.106   1.00 0.00 ? 93  VAL A HG23 5  
ATOM 9423  N N    . GLN A 1 94  ? -6.532  -3.698  7.015   1.00 0.00 ? 94  GLN A N    5  
ATOM 9424  C CA   . GLN A 1 94  ? -6.809  -4.283  5.708   1.00 0.00 ? 94  GLN A CA   5  
ATOM 9425  C C    . GLN A 1 94  ? -7.210  -3.208  4.704   1.00 0.00 ? 94  GLN A C    5  
ATOM 9426  O O    . GLN A 1 94  ? -8.360  -2.767  4.677   1.00 0.00 ? 94  GLN A O    5  
ATOM 9427  C CB   . GLN A 1 94  ? -7.916  -5.333  5.820   1.00 0.00 ? 94  GLN A CB   5  
ATOM 9428  C CG   . GLN A 1 94  ? -7.409  -6.715  6.200   1.00 0.00 ? 94  GLN A CG   5  
ATOM 9429  C CD   . GLN A 1 94  ? -8.496  -7.596  6.782   1.00 0.00 ? 94  GLN A CD   5  
ATOM 9430  O OE1  . GLN A 1 94  ? -9.581  -7.121  7.120   1.00 0.00 ? 94  GLN A OE1  5  
ATOM 9431  N NE2  . GLN A 1 94  ? -8.211  -8.887  6.903   1.00 0.00 ? 94  GLN A NE2  5  
ATOM 9432  H H    . GLN A 1 94  ? -7.233  -3.702  7.699   1.00 0.00 ? 94  GLN A H    5  
ATOM 9433  H HA   . GLN A 1 94  ? -5.905  -4.762  5.362   1.00 0.00 ? 94  GLN A HA   5  
ATOM 9434  H HB2  . GLN A 1 94  ? -8.623  -5.013  6.571   1.00 0.00 ? 94  GLN A HB2  5  
ATOM 9435  H HB3  . GLN A 1 94  ? -8.422  -5.407  4.869   1.00 0.00 ? 94  GLN A HB3  5  
ATOM 9436  H HG2  . GLN A 1 94  ? -7.014  -7.194  5.316   1.00 0.00 ? 94  GLN A HG2  5  
ATOM 9437  H HG3  . GLN A 1 94  ? -6.622  -6.607  6.932   1.00 0.00 ? 94  GLN A HG3  5  
ATOM 9438  H HE21 . GLN A 1 94  ? -7.325  -9.194  6.614   1.00 0.00 ? 94  GLN A HE21 5  
ATOM 9439  H HE22 . GLN A 1 94  ? -8.895  -9.479  7.277   1.00 0.00 ? 94  GLN A HE22 5  
ATOM 9440  N N    . LEU A 1 95  ? -6.256  -2.790  3.880   1.00 0.00 ? 95  LEU A N    5  
ATOM 9441  C CA   . LEU A 1 95  ? -6.510  -1.766  2.873   1.00 0.00 ? 95  LEU A CA   5  
ATOM 9442  C C    . LEU A 1 95  ? -7.890  -1.946  2.248   1.00 0.00 ? 95  LEU A C    5  
ATOM 9443  O O    . LEU A 1 95  ? -8.337  -3.070  2.022   1.00 0.00 ? 95  LEU A O    5  
ATOM 9444  C CB   . LEU A 1 95  ? -5.435  -1.814  1.785   1.00 0.00 ? 95  LEU A CB   5  
ATOM 9445  C CG   . LEU A 1 95  ? -4.057  -1.280  2.179   1.00 0.00 ? 95  LEU A CG   5  
ATOM 9446  C CD1  . LEU A 1 95  ? -4.194  -0.029  3.033   1.00 0.00 ? 95  LEU A CD1  5  
ATOM 9447  C CD2  . LEU A 1 95  ? -3.263  -2.348  2.917   1.00 0.00 ? 95  LEU A CD2  5  
ATOM 9448  H H    . LEU A 1 95  ? -5.359  -3.179  3.949   1.00 0.00 ? 95  LEU A H    5  
ATOM 9449  H HA   . LEU A 1 95  ? -6.472  -0.804  3.362   1.00 0.00 ? 95  LEU A HA   5  
ATOM 9450  H HB2  . LEU A 1 95  ? -5.316  -2.843  1.483   1.00 0.00 ? 95  LEU A HB2  5  
ATOM 9451  H HB3  . LEU A 1 95  ? -5.789  -1.233  0.946   1.00 0.00 ? 95  LEU A HB3  5  
ATOM 9452  H HG   . LEU A 1 95  ? -3.512  -1.015  1.284   1.00 0.00 ? 95  LEU A HG   5  
ATOM 9453  H HD11 . LEU A 1 95  ? -3.291  0.558   2.957   1.00 0.00 ? 95  LEU A HD11 5  
ATOM 9454  H HD12 . LEU A 1 95  ? -4.355  -0.312  4.062   1.00 0.00 ? 95  LEU A HD12 5  
ATOM 9455  H HD13 . LEU A 1 95  ? -5.034  0.554   2.684   1.00 0.00 ? 95  LEU A HD13 5  
ATOM 9456  H HD21 . LEU A 1 95  ? -2.246  -2.355  2.554   1.00 0.00 ? 95  LEU A HD21 5  
ATOM 9457  H HD22 . LEU A 1 95  ? -3.713  -3.314  2.746   1.00 0.00 ? 95  LEU A HD22 5  
ATOM 9458  H HD23 . LEU A 1 95  ? -3.266  -2.131  3.976   1.00 0.00 ? 95  LEU A HD23 5  
ATOM 9459  N N    . ARG A 1 96  ? -8.558  -0.832  1.969   1.00 0.00 ? 96  ARG A N    5  
ATOM 9460  C CA   . ARG A 1 96  ? -9.886  -0.867  1.370   1.00 0.00 ? 96  ARG A CA   5  
ATOM 9461  C C    . ARG A 1 96  ? -9.824  -0.503  -0.111  1.00 0.00 ? 96  ARG A C    5  
ATOM 9462  O O    . ARG A 1 96  ? -9.196  0.484   -0.492  1.00 0.00 ? 96  ARG A O    5  
ATOM 9463  C CB   . ARG A 1 96  ? -10.825 0.093   2.103   1.00 0.00 ? 96  ARG A CB   5  
ATOM 9464  C CG   . ARG A 1 96  ? -12.152 0.308   1.393   1.00 0.00 ? 96  ARG A CG   5  
ATOM 9465  C CD   . ARG A 1 96  ? -12.939 -0.988  1.278   1.00 0.00 ? 96  ARG A CD   5  
ATOM 9466  N NE   . ARG A 1 96  ? -13.115 -1.638  2.573   1.00 0.00 ? 96  ARG A NE   5  
ATOM 9467  C CZ   . ARG A 1 96  ? -13.839 -2.737  2.752   1.00 0.00 ? 96  ARG A CZ   5  
ATOM 9468  N NH1  . ARG A 1 96  ? -14.450 -3.307  1.722   1.00 0.00 ? 96  ARG A NH1  5  
ATOM 9469  N NH2  . ARG A 1 96  ? -13.952 -3.270  3.962   1.00 0.00 ? 96  ARG A NH2  5  
ATOM 9470  H H    . ARG A 1 96  ? -8.148  0.035   2.173   1.00 0.00 ? 96  ARG A H    5  
ATOM 9471  H HA   . ARG A 1 96  ? -10.267 -1.872  1.466   1.00 0.00 ? 96  ARG A HA   5  
ATOM 9472  H HB2  . ARG A 1 96  ? -11.029 -0.303  3.087   1.00 0.00 ? 96  ARG A HB2  5  
ATOM 9473  H HB3  . ARG A 1 96  ? -10.336 1.050   2.203   1.00 0.00 ? 96  ARG A HB3  5  
ATOM 9474  H HG2  . ARG A 1 96  ? -12.737 1.023   1.952   1.00 0.00 ? 96  ARG A HG2  5  
ATOM 9475  H HG3  . ARG A 1 96  ? -11.961 0.693   0.402   1.00 0.00 ? 96  ARG A HG3  5  
ATOM 9476  H HD2  . ARG A 1 96  ? -13.910 -0.768  0.861   1.00 0.00 ? 96  ARG A HD2  5  
ATOM 9477  H HD3  . ARG A 1 96  ? -12.408 -1.658  0.618   1.00 0.00 ? 96  ARG A HD3  5  
ATOM 9478  H HE   . ARG A 1 96  ? -12.672 -1.234  3.348   1.00 0.00 ? 96  ARG A HE   5  
ATOM 9479  H HH11 . ARG A 1 96  ? -14.366 -2.909  0.809   1.00 0.00 ? 96  ARG A HH11 5  
ATOM 9480  H HH12 . ARG A 1 96  ? -14.994 -4.136  1.859   1.00 0.00 ? 96  ARG A HH12 5  
ATOM 9481  H HH21 . ARG A 1 96  ? -13.493 -2.844  4.740   1.00 0.00 ? 96  ARG A HH21 5  
ATOM 9482  H HH22 . ARG A 1 96  ? -14.497 -4.097  4.095   1.00 0.00 ? 96  ARG A HH22 5  
ATOM 9483  N N    . SER A 1 97  ? -10.480 -1.308  -0.941  1.00 0.00 ? 97  SER A N    5  
ATOM 9484  C CA   . SER A 1 97  ? -10.496 -1.074  -2.380  1.00 0.00 ? 97  SER A CA   5  
ATOM 9485  C C    . SER A 1 97  ? -10.698 0.407   -2.687  1.00 0.00 ? 97  SER A C    5  
ATOM 9486  O O    . SER A 1 97  ? -11.806 0.930   -2.575  1.00 0.00 ? 97  SER A O    5  
ATOM 9487  C CB   . SER A 1 97  ? -11.602 -1.899  -3.040  1.00 0.00 ? 97  SER A CB   5  
ATOM 9488  O OG   . SER A 1 97  ? -11.675 -1.634  -4.430  1.00 0.00 ? 97  SER A OG   5  
ATOM 9489  H H    . SER A 1 97  ? -10.962 -2.080  -0.576  1.00 0.00 ? 97  SER A H    5  
ATOM 9490  H HA   . SER A 1 97  ? -9.541  -1.384  -2.777  1.00 0.00 ? 97  SER A HA   5  
ATOM 9491  H HB2  . SER A 1 97  ? -11.398 -2.950  -2.896  1.00 0.00 ? 97  SER A HB2  5  
ATOM 9492  H HB3  . SER A 1 97  ? -12.551 -1.651  -2.587  1.00 0.00 ? 97  SER A HB3  5  
ATOM 9493  H HG   . SER A 1 97  ? -11.653 -0.686  -4.577  1.00 0.00 ? 97  SER A HG   5  
ATOM 9494  N N    . GLY A 1 98  ? -9.618  1.078   -3.075  1.00 0.00 ? 98  GLY A N    5  
ATOM 9495  C CA   . GLY A 1 98  ? -9.697  2.492   -3.393  1.00 0.00 ? 98  GLY A CA   5  
ATOM 9496  C C    . GLY A 1 98  ? -9.285  3.371   -2.229  1.00 0.00 ? 98  GLY A C    5  
ATOM 9497  O O    . GLY A 1 98  ? -9.723  4.515   -2.121  1.00 0.00 ? 98  GLY A O    5  
ATOM 9498  H H    . GLY A 1 98  ? -8.760  0.609   -3.147  1.00 0.00 ? 98  GLY A H    5  
ATOM 9499  H HA2  . GLY A 1 98  ? -9.051  2.697   -4.233  1.00 0.00 ? 98  GLY A HA2  5  
ATOM 9500  H HA3  . GLY A 1 98  ? -10.714 2.731   -3.667  1.00 0.00 ? 98  GLY A HA3  5  
ATOM 9501  N N    . ASN A 1 99  ? -8.440  2.835   -1.354  1.00 0.00 ? 99  ASN A N    5  
ATOM 9502  C CA   . ASN A 1 99  ? -7.970  3.578   -0.191  1.00 0.00 ? 99  ASN A CA   5  
ATOM 9503  C C    . ASN A 1 99  ? -6.833  4.522   -0.571  1.00 0.00 ? 99  ASN A C    5  
ATOM 9504  O O    . ASN A 1 99  ? -6.021  4.212   -1.443  1.00 0.00 ? 99  ASN A O    5  
ATOM 9505  C CB   . ASN A 1 99  ? -7.504  2.614   0.902   1.00 0.00 ? 99  ASN A CB   5  
ATOM 9506  C CG   . ASN A 1 99  ? -6.267  1.836   0.498   1.00 0.00 ? 99  ASN A CG   5  
ATOM 9507  O OD1  . ASN A 1 99  ? -6.363  0.764   -0.100  1.00 0.00 ? 99  ASN A OD1  5  
ATOM 9508  N ND2  . ASN A 1 99  ? -5.097  2.373   0.824   1.00 0.00 ? 99  ASN A ND2  5  
ATOM 9509  H H    . ASN A 1 99  ? -8.125  1.917   -1.494  1.00 0.00 ? 99  ASN A H    5  
ATOM 9510  H HA   . ASN A 1 99  ? -8.797  4.162   0.185   1.00 0.00 ? 99  ASN A HA   5  
ATOM 9511  H HB2  . ASN A 1 99  ? -7.276  3.176   1.796   1.00 0.00 ? 99  ASN A HB2  5  
ATOM 9512  H HB3  . ASN A 1 99  ? -8.296  1.912   1.117   1.00 0.00 ? 99  ASN A HB3  5  
ATOM 9513  H HD21 . ASN A 1 99  ? -5.098  3.230   1.300   1.00 0.00 ? 99  ASN A HD21 5  
ATOM 9514  H HD22 . ASN A 1 99  ? -4.282  1.891   0.574   1.00 0.00 ? 99  ASN A HD22 5  
ATOM 9515  N N    . ARG A 1 100 ? -6.781  5.673   0.090   1.00 0.00 ? 100 ARG A N    5  
ATOM 9516  C CA   . ARG A 1 100 ? -5.744  6.662   -0.179  1.00 0.00 ? 100 ARG A CA   5  
ATOM 9517  C C    . ARG A 1 100 ? -4.527  6.429   0.711   1.00 0.00 ? 100 ARG A C    5  
ATOM 9518  O O    . ARG A 1 100 ? -4.627  6.460   1.938   1.00 0.00 ? 100 ARG A O    5  
ATOM 9519  C CB   . ARG A 1 100 ? -6.288  8.075   0.042   1.00 0.00 ? 100 ARG A CB   5  
ATOM 9520  C CG   . ARG A 1 100 ? -5.376  9.169   -0.490  1.00 0.00 ? 100 ARG A CG   5  
ATOM 9521  C CD   . ARG A 1 100 ? -5.710  10.520  0.123   1.00 0.00 ? 100 ARG A CD   5  
ATOM 9522  N NE   . ARG A 1 100 ? -6.709  11.243  -0.658  1.00 0.00 ? 100 ARG A NE   5  
ATOM 9523  C CZ   . ARG A 1 100 ? -6.465  11.774  -1.851  1.00 0.00 ? 100 ARG A CZ   5  
ATOM 9524  N NH1  . ARG A 1 100 ? -5.263  11.662  -2.398  1.00 0.00 ? 100 ARG A NH1  5  
ATOM 9525  N NH2  . ARG A 1 100 ? -7.427  12.418  -2.501  1.00 0.00 ? 100 ARG A NH2  5  
ATOM 9526  H H    . ARG A 1 100 ? -7.457  5.863   0.774   1.00 0.00 ? 100 ARG A H    5  
ATOM 9527  H HA   . ARG A 1 100 ? -5.446  6.559   -1.211  1.00 0.00 ? 100 ARG A HA   5  
ATOM 9528  H HB2  . ARG A 1 100 ? -7.244  8.162   -0.452  1.00 0.00 ? 100 ARG A HB2  5  
ATOM 9529  H HB3  . ARG A 1 100 ? -6.424  8.234   1.102   1.00 0.00 ? 100 ARG A HB3  5  
ATOM 9530  H HG2  . ARG A 1 100 ? -4.353  8.920   -0.249  1.00 0.00 ? 100 ARG A HG2  5  
ATOM 9531  H HG3  . ARG A 1 100 ? -5.491  9.231   -1.561  1.00 0.00 ? 100 ARG A HG3  5  
ATOM 9532  H HD2  . ARG A 1 100 ? -6.092  10.363  1.121   1.00 0.00 ? 100 ARG A HD2  5  
ATOM 9533  H HD3  . ARG A 1 100 ? -4.807  11.110  0.173   1.00 0.00 ? 100 ARG A HD3  5  
ATOM 9534  H HE   . ARG A 1 100 ? -7.605  11.338  -0.273  1.00 0.00 ? 100 ARG A HE   5  
ATOM 9535  H HH11 . ARG A 1 100 ? -4.537  11.176  -1.911  1.00 0.00 ? 100 ARG A HH11 5  
ATOM 9536  H HH12 . ARG A 1 100 ? -5.082  12.061  -3.297  1.00 0.00 ? 100 ARG A HH12 5  
ATOM 9537  H HH21 . ARG A 1 100 ? -8.335  12.504  -2.093  1.00 0.00 ? 100 ARG A HH21 5  
ATOM 9538  H HH22 . ARG A 1 100 ? -7.242  12.817  -3.399  1.00 0.00 ? 100 ARG A HH22 5  
ATOM 9539  N N    . ILE A 1 101 ? -3.379  6.195   0.084   1.00 0.00 ? 101 ILE A N    5  
ATOM 9540  C CA   . ILE A 1 101 ? -2.143  5.957   0.819   1.00 0.00 ? 101 ILE A CA   5  
ATOM 9541  C C    . ILE A 1 101 ? -1.117  7.050   0.538   1.00 0.00 ? 101 ILE A C    5  
ATOM 9542  O O    . ILE A 1 101 ? -1.043  7.575   -0.573  1.00 0.00 ? 101 ILE A O    5  
ATOM 9543  C CB   . ILE A 1 101 ? -1.530  4.590   0.461   1.00 0.00 ? 101 ILE A CB   5  
ATOM 9544  C CG1  . ILE A 1 101 ? -2.634  3.555   0.234   1.00 0.00 ? 101 ILE A CG1  5  
ATOM 9545  C CG2  . ILE A 1 101 ? -0.583  4.130   1.560   1.00 0.00 ? 101 ILE A CG2  5  
ATOM 9546  C CD1  . ILE A 1 101 ? -2.149  2.293   -0.445  1.00 0.00 ? 101 ILE A CD1  5  
ATOM 9547  H H    . ILE A 1 101 ? -3.363  6.183   -0.895  1.00 0.00 ? 101 ILE A H    5  
ATOM 9548  H HA   . ILE A 1 101 ? -2.377  5.959   1.874   1.00 0.00 ? 101 ILE A HA   5  
ATOM 9549  H HB   . ILE A 1 101 ? -0.959  4.703   -0.448  1.00 0.00 ? 101 ILE A HB   5  
ATOM 9550  H HG12 . ILE A 1 101 ? -3.059  3.277   1.186   1.00 0.00 ? 101 ILE A HG12 5  
ATOM 9551  H HG13 . ILE A 1 101 ? -3.403  3.992   -0.386  1.00 0.00 ? 101 ILE A HG13 5  
ATOM 9552  H HG21 . ILE A 1 101 ? 0.438   4.256   1.232   1.00 0.00 ? 101 ILE A HG21 5  
ATOM 9553  H HG22 . ILE A 1 101 ? -0.750  4.721   2.449   1.00 0.00 ? 101 ILE A HG22 5  
ATOM 9554  H HG23 . ILE A 1 101 ? -0.765  3.089   1.780   1.00 0.00 ? 101 ILE A HG23 5  
ATOM 9555  H HD11 . ILE A 1 101 ? -2.955  1.863   -1.021  1.00 0.00 ? 101 ILE A HD11 5  
ATOM 9556  H HD12 . ILE A 1 101 ? -1.325  2.531   -1.102  1.00 0.00 ? 101 ILE A HD12 5  
ATOM 9557  H HD13 . ILE A 1 101 ? -1.822  1.585   0.301   1.00 0.00 ? 101 ILE A HD13 5  
ATOM 9558  N N    . ILE A 1 102 ? -0.328  7.387   1.552   1.00 0.00 ? 102 ILE A N    5  
ATOM 9559  C CA   . ILE A 1 102 ? 0.696   8.416   1.414   1.00 0.00 ? 102 ILE A CA   5  
ATOM 9560  C C    . ILE A 1 102 ? 1.952   8.051   2.198   1.00 0.00 ? 102 ILE A C    5  
ATOM 9561  O O    . ILE A 1 102 ? 1.872   7.516   3.303   1.00 0.00 ? 102 ILE A O    5  
ATOM 9562  C CB   . ILE A 1 102 ? 0.184   9.787   1.895   1.00 0.00 ? 102 ILE A CB   5  
ATOM 9563  C CG1  . ILE A 1 102 ? -0.942  10.283  0.986   1.00 0.00 ? 102 ILE A CG1  5  
ATOM 9564  C CG2  . ILE A 1 102 ? 1.324   10.794  1.932   1.00 0.00 ? 102 ILE A CG2  5  
ATOM 9565  C CD1  . ILE A 1 102 ? -1.947  11.163  1.695   1.00 0.00 ? 102 ILE A CD1  5  
ATOM 9566  H H    . ILE A 1 102 ? -0.435  6.933   2.413   1.00 0.00 ? 102 ILE A H    5  
ATOM 9567  H HA   . ILE A 1 102 ? 0.948   8.495   0.366   1.00 0.00 ? 102 ILE A HA   5  
ATOM 9568  H HB   . ILE A 1 102 ? -0.196  9.672   2.898   1.00 0.00 ? 102 ILE A HB   5  
ATOM 9569  H HG12 . ILE A 1 102 ? -0.517  10.853  0.174   1.00 0.00 ? 102 ILE A HG12 5  
ATOM 9570  H HG13 . ILE A 1 102 ? -1.471  9.431   0.583   1.00 0.00 ? 102 ILE A HG13 5  
ATOM 9571  H HG21 . ILE A 1 102 ? 2.063   10.529  1.190   1.00 0.00 ? 102 ILE A HG21 5  
ATOM 9572  H HG22 . ILE A 1 102 ? 0.940   11.780  1.720   1.00 0.00 ? 102 ILE A HG22 5  
ATOM 9573  H HG23 . ILE A 1 102 ? 1.779   10.787  2.912   1.00 0.00 ? 102 ILE A HG23 5  
ATOM 9574  H HD11 . ILE A 1 102 ? -1.751  11.149  2.757   1.00 0.00 ? 102 ILE A HD11 5  
ATOM 9575  H HD12 . ILE A 1 102 ? -1.862  12.176  1.328   1.00 0.00 ? 102 ILE A HD12 5  
ATOM 9576  H HD13 . ILE A 1 102 ? -2.944  10.794  1.508   1.00 0.00 ? 102 ILE A HD13 5  
ATOM 9577  N N    . MET A 1 103 ? 3.111   8.346   1.618   1.00 0.00 ? 103 MET A N    5  
ATOM 9578  C CA   . MET A 1 103 ? 4.385   8.051   2.264   1.00 0.00 ? 103 MET A CA   5  
ATOM 9579  C C    . MET A 1 103 ? 5.351   9.223   2.120   1.00 0.00 ? 103 MET A C    5  
ATOM 9580  O O    . MET A 1 103 ? 5.280   9.984   1.156   1.00 0.00 ? 103 MET A O    5  
ATOM 9581  C CB   . MET A 1 103 ? 5.005   6.787   1.665   1.00 0.00 ? 103 MET A CB   5  
ATOM 9582  C CG   . MET A 1 103 ? 4.095   5.571   1.737   1.00 0.00 ? 103 MET A CG   5  
ATOM 9583  S SD   . MET A 1 103 ? 2.813   5.587   0.469   1.00 0.00 ? 103 MET A SD   5  
ATOM 9584  C CE   . MET A 1 103 ? 2.751   3.852   0.029   1.00 0.00 ? 103 MET A CE   5  
ATOM 9585  H H    . MET A 1 103 ? 3.110   8.772   0.735   1.00 0.00 ? 103 MET A H    5  
ATOM 9586  H HA   . MET A 1 103 ? 4.193   7.884   3.313   1.00 0.00 ? 103 MET A HA   5  
ATOM 9587  H HB2  . MET A 1 103 ? 5.240   6.973   0.628   1.00 0.00 ? 103 MET A HB2  5  
ATOM 9588  H HB3  . MET A 1 103 ? 5.916   6.560   2.198   1.00 0.00 ? 103 MET A HB3  5  
ATOM 9589  H HG2  . MET A 1 103 ? 4.694   4.682   1.611   1.00 0.00 ? 103 MET A HG2  5  
ATOM 9590  H HG3  . MET A 1 103 ? 3.622   5.550   2.707   1.00 0.00 ? 103 MET A HG3  5  
ATOM 9591  H HE1  . MET A 1 103 ? 3.570   3.620   -0.637  1.00 0.00 ? 103 MET A HE1  5  
ATOM 9592  H HE2  . MET A 1 103 ? 2.832   3.251   0.923   1.00 0.00 ? 103 MET A HE2  5  
ATOM 9593  H HE3  . MET A 1 103 ? 1.814   3.639   -0.464  1.00 0.00 ? 103 MET A HE3  5  
ATOM 9594  N N    . GLY A 1 104 ? 6.254   9.362   3.087   1.00 0.00 ? 104 GLY A N    5  
ATOM 9595  C CA   . GLY A 1 104 ? 7.220   10.443  3.049   1.00 0.00 ? 104 GLY A CA   5  
ATOM 9596  C C    . GLY A 1 104 ? 6.645   11.715  2.457   1.00 0.00 ? 104 GLY A C    5  
ATOM 9597  O O    . GLY A 1 104 ? 5.888   12.428  3.116   1.00 0.00 ? 104 GLY A O    5  
ATOM 9598  H H    . GLY A 1 104 ? 6.263   8.724   3.831   1.00 0.00 ? 104 GLY A H    5  
ATOM 9599  H HA2  . GLY A 1 104 ? 7.557   10.646  4.054   1.00 0.00 ? 104 GLY A HA2  5  
ATOM 9600  H HA3  . GLY A 1 104 ? 8.066   10.134  2.453   1.00 0.00 ? 104 GLY A HA3  5  
ATOM 9601  N N    . LYS A 1 105 ? 7.005   12.001  1.210   1.00 0.00 ? 105 LYS A N    5  
ATOM 9602  C CA   . LYS A 1 105 ? 6.520   13.195  0.529   1.00 0.00 ? 105 LYS A CA   5  
ATOM 9603  C C    . LYS A 1 105 ? 6.360   12.941  -0.967  1.00 0.00 ? 105 LYS A C    5  
ATOM 9604  O O    . LYS A 1 105 ? 7.212   12.313  -1.594  1.00 0.00 ? 105 LYS A O    5  
ATOM 9605  C CB   . LYS A 1 105 ? 7.482   14.364  0.758   1.00 0.00 ? 105 LYS A CB   5  
ATOM 9606  C CG   . LYS A 1 105 ? 7.421   14.934  2.164   1.00 0.00 ? 105 LYS A CG   5  
ATOM 9607  C CD   . LYS A 1 105 ? 8.391   14.226  3.096   1.00 0.00 ? 105 LYS A CD   5  
ATOM 9608  C CE   . LYS A 1 105 ? 8.887   15.153  4.194   1.00 0.00 ? 105 LYS A CE   5  
ATOM 9609  N NZ   . LYS A 1 105 ? 9.902   14.493  5.061   1.00 0.00 ? 105 LYS A NZ   5  
ATOM 9610  H H    . LYS A 1 105 ? 7.611   11.393  0.737   1.00 0.00 ? 105 LYS A H    5  
ATOM 9611  H HA   . LYS A 1 105 ? 5.556   13.446  0.944   1.00 0.00 ? 105 LYS A HA   5  
ATOM 9612  H HB2  . LYS A 1 105 ? 8.491   14.026  0.572   1.00 0.00 ? 105 LYS A HB2  5  
ATOM 9613  H HB3  . LYS A 1 105 ? 7.241   15.154  0.061   1.00 0.00 ? 105 LYS A HB3  5  
ATOM 9614  H HG2  . LYS A 1 105 ? 7.675   15.983  2.129   1.00 0.00 ? 105 LYS A HG2  5  
ATOM 9615  H HG3  . LYS A 1 105 ? 6.417   14.817  2.548   1.00 0.00 ? 105 LYS A HG3  5  
ATOM 9616  H HD2  . LYS A 1 105 ? 7.890   13.384  3.550   1.00 0.00 ? 105 LYS A HD2  5  
ATOM 9617  H HD3  . LYS A 1 105 ? 9.237   13.877  2.522   1.00 0.00 ? 105 LYS A HD3  5  
ATOM 9618  H HE2  . LYS A 1 105 ? 9.328   16.026  3.739   1.00 0.00 ? 105 LYS A HE2  5  
ATOM 9619  H HE3  . LYS A 1 105 ? 8.045   15.451  4.803   1.00 0.00 ? 105 LYS A HE3  5  
ATOM 9620  H HZ1  . LYS A 1 105 ? 9.432   13.925  5.794   1.00 0.00 ? 105 LYS A HZ1  5  
ATOM 9621  H HZ2  . LYS A 1 105 ? 10.498  15.210  5.522   1.00 0.00 ? 105 LYS A HZ2  5  
ATOM 9622  H HZ3  . LYS A 1 105 ? 10.508  13.871  4.490   1.00 0.00 ? 105 LYS A HZ3  5  
ATOM 9623  N N    . ASN A 1 106 ? 5.263   13.434  -1.532  1.00 0.00 ? 106 ASN A N    5  
ATOM 9624  C CA   . ASN A 1 106 ? 4.992   13.261  -2.955  1.00 0.00 ? 106 ASN A CA   5  
ATOM 9625  C C    . ASN A 1 106 ? 5.038   11.785  -3.341  1.00 0.00 ? 106 ASN A C    5  
ATOM 9626  O O    . ASN A 1 106 ? 5.336   11.441  -4.486  1.00 0.00 ? 106 ASN A O    5  
ATOM 9627  C CB   . ASN A 1 106 ? 6.004   14.050  -3.788  1.00 0.00 ? 106 ASN A CB   5  
ATOM 9628  C CG   . ASN A 1 106 ? 6.328   15.400  -3.177  1.00 0.00 ? 106 ASN A CG   5  
ATOM 9629  O OD1  . ASN A 1 106 ? 5.620   15.879  -2.291  1.00 0.00 ? 106 ASN A OD1  5  
ATOM 9630  N ND2  . ASN A 1 106 ? 7.403   16.020  -3.650  1.00 0.00 ? 106 ASN A ND2  5  
ATOM 9631  H H    . ASN A 1 106 ? 4.620   13.926  -0.980  1.00 0.00 ? 106 ASN A H    5  
ATOM 9632  H HA   . ASN A 1 106 ? 4.002   13.642  -3.152  1.00 0.00 ? 106 ASN A HA   5  
ATOM 9633  H HB2  . ASN A 1 106 ? 6.920   13.482  -3.863  1.00 0.00 ? 106 ASN A HB2  5  
ATOM 9634  H HB3  . ASN A 1 106 ? 5.602   14.209  -4.777  1.00 0.00 ? 106 ASN A HB3  5  
ATOM 9635  H HD21 . ASN A 1 106 ? 7.920   15.578  -4.356  1.00 0.00 ? 106 ASN A HD21 5  
ATOM 9636  H HD22 . ASN A 1 106 ? 7.636   16.894  -3.273  1.00 0.00 ? 106 ASN A HD22 5  
ATOM 9637  N N    . HIS A 1 107 ? 4.741   10.917  -2.379  1.00 0.00 ? 107 HIS A N    5  
ATOM 9638  C CA   . HIS A 1 107 ? 4.748   9.479   -2.619  1.00 0.00 ? 107 HIS A CA   5  
ATOM 9639  C C    . HIS A 1 107 ? 3.365   8.881   -2.375  1.00 0.00 ? 107 HIS A C    5  
ATOM 9640  O O    . HIS A 1 107 ? 3.222   7.895   -1.653  1.00 0.00 ? 107 HIS A O    5  
ATOM 9641  C CB   . HIS A 1 107 ? 5.777   8.795   -1.719  1.00 0.00 ? 107 HIS A CB   5  
ATOM 9642  C CG   . HIS A 1 107 ? 7.122   9.454   -1.739  1.00 0.00 ? 107 HIS A CG   5  
ATOM 9643  N ND1  . HIS A 1 107 ? 7.721   9.976   -0.612  1.00 0.00 ? 107 HIS A ND1  5  
ATOM 9644  C CD2  . HIS A 1 107 ? 7.985   9.674   -2.758  1.00 0.00 ? 107 HIS A CD2  5  
ATOM 9645  C CE1  . HIS A 1 107 ? 8.894   10.490  -0.937  1.00 0.00 ? 107 HIS A CE1  5  
ATOM 9646  N NE2  . HIS A 1 107 ? 9.079   10.319  -2.234  1.00 0.00 ? 107 HIS A NE2  5  
ATOM 9647  H H    . HIS A 1 107 ? 4.512   11.253  -1.488  1.00 0.00 ? 107 HIS A H    5  
ATOM 9648  H HA   . HIS A 1 107 ? 5.019   9.316   -3.651  1.00 0.00 ? 107 HIS A HA   5  
ATOM 9649  H HB2  . HIS A 1 107 ? 5.419   8.805   -0.700  1.00 0.00 ? 107 HIS A HB2  5  
ATOM 9650  H HB3  . HIS A 1 107 ? 5.904   7.771   -2.041  1.00 0.00 ? 107 HIS A HB3  5  
ATOM 9651  H HD2  . HIS A 1 107 ? 7.842   9.394   -3.792  1.00 0.00 ? 107 HIS A HD2  5  
ATOM 9652  H HE1  . HIS A 1 107 ? 9.585   10.968  -0.259  1.00 0.00 ? 107 HIS A HE1  5  
ATOM 9653  H HE2  . HIS A 1 107 ? 9.828   10.682  -2.750  1.00 0.00 ? 107 HIS A HE2  5  
ATOM 9654  N N    . VAL A 1 108 ? 2.349   9.486   -2.982  1.00 0.00 ? 108 VAL A N    5  
ATOM 9655  C CA   . VAL A 1 108 ? 0.978   9.014   -2.831  1.00 0.00 ? 108 VAL A CA   5  
ATOM 9656  C C    . VAL A 1 108 ? 0.681   7.870   -3.795  1.00 0.00 ? 108 VAL A C    5  
ATOM 9657  O O    . VAL A 1 108 ? 1.285   7.772   -4.864  1.00 0.00 ? 108 VAL A O    5  
ATOM 9658  C CB   . VAL A 1 108 ? -0.036  10.148  -3.072  1.00 0.00 ? 108 VAL A CB   5  
ATOM 9659  C CG1  . VAL A 1 108 ? -1.422  9.735   -2.599  1.00 0.00 ? 108 VAL A CG1  5  
ATOM 9660  C CG2  . VAL A 1 108 ? 0.416   11.423  -2.375  1.00 0.00 ? 108 VAL A CG2  5  
ATOM 9661  H H    . VAL A 1 108 ? 2.526   10.268  -3.545  1.00 0.00 ? 108 VAL A H    5  
ATOM 9662  H HA   . VAL A 1 108 ? 0.856   8.659   -1.818  1.00 0.00 ? 108 VAL A HA   5  
ATOM 9663  H HB   . VAL A 1 108 ? -0.085  10.341  -4.133  1.00 0.00 ? 108 VAL A HB   5  
ATOM 9664  H HG11 . VAL A 1 108 ? -1.731  8.845   -3.126  1.00 0.00 ? 108 VAL A HG11 5  
ATOM 9665  H HG12 . VAL A 1 108 ? -1.396  9.536   -1.537  1.00 0.00 ? 108 VAL A HG12 5  
ATOM 9666  H HG13 . VAL A 1 108 ? -2.122  10.533  -2.799  1.00 0.00 ? 108 VAL A HG13 5  
ATOM 9667  H HG21 . VAL A 1 108 ? 1.093   11.174  -1.572  1.00 0.00 ? 108 VAL A HG21 5  
ATOM 9668  H HG22 . VAL A 1 108 ? 0.919   12.062  -3.086  1.00 0.00 ? 108 VAL A HG22 5  
ATOM 9669  H HG23 . VAL A 1 108 ? -0.444  11.939  -1.974  1.00 0.00 ? 108 VAL A HG23 5  
ATOM 9670  N N    . PHE A 1 109 ? -0.252  7.006   -3.409  1.00 0.00 ? 109 PHE A N    5  
ATOM 9671  C CA   . PHE A 1 109 ? -0.629  5.867   -4.239  1.00 0.00 ? 109 PHE A CA   5  
ATOM 9672  C C    . PHE A 1 109 ? -2.068  5.445   -3.960  1.00 0.00 ? 109 PHE A C    5  
ATOM 9673  O O    . PHE A 1 109 ? -2.540  5.520   -2.826  1.00 0.00 ? 109 PHE A O    5  
ATOM 9674  C CB   . PHE A 1 109 ? 0.318   4.691   -3.988  1.00 0.00 ? 109 PHE A CB   5  
ATOM 9675  C CG   . PHE A 1 109 ? 1.744   4.981   -4.358  1.00 0.00 ? 109 PHE A CG   5  
ATOM 9676  C CD1  . PHE A 1 109 ? 2.192   4.778   -5.653  1.00 0.00 ? 109 PHE A CD1  5  
ATOM 9677  C CD2  . PHE A 1 109 ? 2.637   5.455   -3.411  1.00 0.00 ? 109 PHE A CD2  5  
ATOM 9678  C CE1  . PHE A 1 109 ? 3.505   5.043   -5.998  1.00 0.00 ? 109 PHE A CE1  5  
ATOM 9679  C CE2  . PHE A 1 109 ? 3.950   5.722   -3.749  1.00 0.00 ? 109 PHE A CE2  5  
ATOM 9680  C CZ   . PHE A 1 109 ? 4.385   5.515   -5.044  1.00 0.00 ? 109 PHE A CZ   5  
ATOM 9681  H H    . PHE A 1 109 ? -0.697  7.137   -2.546  1.00 0.00 ? 109 PHE A H    5  
ATOM 9682  H HA   . PHE A 1 109 ? -0.548  6.169   -5.271  1.00 0.00 ? 109 PHE A HA   5  
ATOM 9683  H HB2  . PHE A 1 109 ? 0.293   4.436   -2.939  1.00 0.00 ? 109 PHE A HB2  5  
ATOM 9684  H HB3  . PHE A 1 109 ? -0.012  3.843   -4.569  1.00 0.00 ? 109 PHE A HB3  5  
ATOM 9685  H HD1  . PHE A 1 109 ? 1.504   4.408   -6.401  1.00 0.00 ? 109 PHE A HD1  5  
ATOM 9686  H HD2  . PHE A 1 109 ? 2.300   5.616   -2.398  1.00 0.00 ? 109 PHE A HD2  5  
ATOM 9687  H HE1  . PHE A 1 109 ? 3.841   4.880   -7.011  1.00 0.00 ? 109 PHE A HE1  5  
ATOM 9688  H HE2  . PHE A 1 109 ? 4.637   6.091   -3.002  1.00 0.00 ? 109 PHE A HE2  5  
ATOM 9689  H HZ   . PHE A 1 109 ? 5.410   5.724   -5.311  1.00 0.00 ? 109 PHE A HZ   5  
ATOM 9690  N N    . ARG A 1 110 ? -2.760  5.000   -5.004  1.00 0.00 ? 110 ARG A N    5  
ATOM 9691  C CA   . ARG A 1 110 ? -4.146  4.566   -4.873  1.00 0.00 ? 110 ARG A CA   5  
ATOM 9692  C C    . ARG A 1 110 ? -4.249  3.046   -4.946  1.00 0.00 ? 110 ARG A C    5  
ATOM 9693  O O    . ARG A 1 110 ? -3.614  2.409   -5.786  1.00 0.00 ? 110 ARG A O    5  
ATOM 9694  C CB   . ARG A 1 110 ? -5.006  5.199   -5.969  1.00 0.00 ? 110 ARG A CB   5  
ATOM 9695  C CG   . ARG A 1 110 ? -6.311  4.462   -6.221  1.00 0.00 ? 110 ARG A CG   5  
ATOM 9696  C CD   . ARG A 1 110 ? -7.213  5.235   -7.170  1.00 0.00 ? 110 ARG A CD   5  
ATOM 9697  N NE   . ARG A 1 110 ? -6.754  5.149   -8.554  1.00 0.00 ? 110 ARG A NE   5  
ATOM 9698  C CZ   . ARG A 1 110 ? -7.334  5.790   -9.562  1.00 0.00 ? 110 ARG A CZ   5  
ATOM 9699  N NH1  . ARG A 1 110 ? -8.390  6.560   -9.342  1.00 0.00 ? 110 ARG A NH1  5  
ATOM 9700  N NH2  . ARG A 1 110 ? -6.857  5.662   -10.794 1.00 0.00 ? 110 ARG A NH2  5  
ATOM 9701  H H    . ARG A 1 110 ? -2.329  4.962   -5.883  1.00 0.00 ? 110 ARG A H    5  
ATOM 9702  H HA   . ARG A 1 110 ? -4.507  4.894   -3.910  1.00 0.00 ? 110 ARG A HA   5  
ATOM 9703  H HB2  . ARG A 1 110 ? -5.241  6.215   -5.684  1.00 0.00 ? 110 ARG A HB2  5  
ATOM 9704  H HB3  . ARG A 1 110 ? -4.442  5.214   -6.889  1.00 0.00 ? 110 ARG A HB3  5  
ATOM 9705  H HG2  . ARG A 1 110 ? -6.091  3.498   -6.656  1.00 0.00 ? 110 ARG A HG2  5  
ATOM 9706  H HG3  . ARG A 1 110 ? -6.824  4.327   -5.280  1.00 0.00 ? 110 ARG A HG3  5  
ATOM 9707  H HD2  . ARG A 1 110 ? -8.212  4.829   -7.107  1.00 0.00 ? 110 ARG A HD2  5  
ATOM 9708  H HD3  . ARG A 1 110 ? -7.226  6.272   -6.868  1.00 0.00 ? 110 ARG A HD3  5  
ATOM 9709  H HE   . ARG A 1 110 ? -5.974  4.585   -8.739  1.00 0.00 ? 110 ARG A HE   5  
ATOM 9710  H HH11 . ARG A 1 110 ? -8.751  6.660   -8.415  1.00 0.00 ? 110 ARG A HH11 5  
ATOM 9711  H HH12 . ARG A 1 110 ? -8.825  7.043   -10.103 1.00 0.00 ? 110 ARG A HH12 5  
ATOM 9712  H HH21 . ARG A 1 110 ? -6.061  5.082   -10.963 1.00 0.00 ? 110 ARG A HH21 5  
ATOM 9713  H HH22 . ARG A 1 110 ? -7.294  6.144   -11.552 1.00 0.00 ? 110 ARG A HH22 5  
ATOM 9714  N N    . PHE A 1 111 ? -5.054  2.470   -4.059  1.00 0.00 ? 111 PHE A N    5  
ATOM 9715  C CA   . PHE A 1 111 ? -5.240  1.024   -4.022  1.00 0.00 ? 111 PHE A CA   5  
ATOM 9716  C C    . PHE A 1 111 ? -6.378  0.597   -4.944  1.00 0.00 ? 111 PHE A C    5  
ATOM 9717  O O    . PHE A 1 111 ? -7.500  1.088   -4.832  1.00 0.00 ? 111 PHE A O    5  
ATOM 9718  C CB   . PHE A 1 111 ? -5.528  0.562   -2.591  1.00 0.00 ? 111 PHE A CB   5  
ATOM 9719  C CG   . PHE A 1 111 ? -5.527  -0.931  -2.432  1.00 0.00 ? 111 PHE A CG   5  
ATOM 9720  C CD1  . PHE A 1 111 ? -4.387  -1.670  -2.706  1.00 0.00 ? 111 PHE A CD1  5  
ATOM 9721  C CD2  . PHE A 1 111 ? -6.666  -1.596  -2.008  1.00 0.00 ? 111 PHE A CD2  5  
ATOM 9722  C CE1  . PHE A 1 111 ? -4.383  -3.044  -2.559  1.00 0.00 ? 111 PHE A CE1  5  
ATOM 9723  C CE2  . PHE A 1 111 ? -6.668  -2.971  -1.859  1.00 0.00 ? 111 PHE A CE2  5  
ATOM 9724  C CZ   . PHE A 1 111 ? -5.525  -3.695  -2.137  1.00 0.00 ? 111 PHE A CZ   5  
ATOM 9725  H H    . PHE A 1 111 ? -5.535  3.030   -3.414  1.00 0.00 ? 111 PHE A H    5  
ATOM 9726  H HA   . PHE A 1 111 ? -4.325  0.564   -4.361  1.00 0.00 ? 111 PHE A HA   5  
ATOM 9727  H HB2  . PHE A 1 111 ? -4.775  0.966   -1.932  1.00 0.00 ? 111 PHE A HB2  5  
ATOM 9728  H HB3  . PHE A 1 111 ? -6.498  0.929   -2.291  1.00 0.00 ? 111 PHE A HB3  5  
ATOM 9729  H HD1  . PHE A 1 111 ? -3.493  -1.161  -3.037  1.00 0.00 ? 111 PHE A HD1  5  
ATOM 9730  H HD2  . PHE A 1 111 ? -7.561  -1.031  -1.792  1.00 0.00 ? 111 PHE A HD2  5  
ATOM 9731  H HE1  . PHE A 1 111 ? -3.488  -3.608  -2.777  1.00 0.00 ? 111 PHE A HE1  5  
ATOM 9732  H HE2  . PHE A 1 111 ? -7.562  -3.477  -1.529  1.00 0.00 ? 111 PHE A HE2  5  
ATOM 9733  H HZ   . PHE A 1 111 ? -5.524  -4.769  -2.021  1.00 0.00 ? 111 PHE A HZ   5  
ATOM 9734  N N    . ASN A 1 112 ? -6.078  -0.321  -5.858  1.00 0.00 ? 112 ASN A N    5  
ATOM 9735  C CA   . ASN A 1 112 ? -7.075  -0.813  -6.802  1.00 0.00 ? 112 ASN A CA   5  
ATOM 9736  C C    . ASN A 1 112 ? -7.336  -2.301  -6.590  1.00 0.00 ? 112 ASN A C    5  
ATOM 9737  O O    . ASN A 1 112 ? -6.538  -3.147  -6.996  1.00 0.00 ? 112 ASN A O    5  
ATOM 9738  C CB   . ASN A 1 112 ? -6.613  -0.565  -8.239  1.00 0.00 ? 112 ASN A CB   5  
ATOM 9739  C CG   . ASN A 1 112 ? -7.775  -0.439  -9.206  1.00 0.00 ? 112 ASN A CG   5  
ATOM 9740  O OD1  . ASN A 1 112 ? -8.547  -1.379  -9.391  1.00 0.00 ? 112 ASN A OD1  5  
ATOM 9741  N ND2  . ASN A 1 112 ? -7.902  0.727   -9.829  1.00 0.00 ? 112 ASN A ND2  5  
ATOM 9742  H H    . ASN A 1 112 ? -5.165  -0.675  -5.899  1.00 0.00 ? 112 ASN A H    5  
ATOM 9743  H HA   . ASN A 1 112 ? -7.992  -0.270  -6.629  1.00 0.00 ? 112 ASN A HA   5  
ATOM 9744  H HB2  . ASN A 1 112 ? -6.041  0.351   -8.274  1.00 0.00 ? 112 ASN A HB2  5  
ATOM 9745  H HB3  . ASN A 1 112 ? -5.990  -1.386  -8.558  1.00 0.00 ? 112 ASN A HB3  5  
ATOM 9746  H HD21 . ASN A 1 112 ? -7.249  1.431   -9.632  1.00 0.00 ? 112 ASN A HD21 5  
ATOM 9747  H HD22 . ASN A 1 112 ? -8.645  0.836   -10.459 1.00 0.00 ? 112 ASN A HD22 5  
ATOM 9748  N N    . HIS A 1 113 ? -8.460  -2.614  -5.952  1.00 0.00 ? 113 HIS A N    5  
ATOM 9749  C CA   . HIS A 1 113 ? -8.827  -4.001  -5.688  1.00 0.00 ? 113 HIS A CA   5  
ATOM 9750  C C    . HIS A 1 113 ? -10.157 -4.347  -6.352  1.00 0.00 ? 113 HIS A C    5  
ATOM 9751  O O    . HIS A 1 113 ? -11.206 -4.391  -5.709  1.00 0.00 ? 113 HIS A O    5  
ATOM 9752  C CB   . HIS A 1 113 ? -8.917  -4.248  -4.181  1.00 0.00 ? 113 HIS A CB   5  
ATOM 9753  C CG   . HIS A 1 113 ? -8.636  -5.666  -3.789  1.00 0.00 ? 113 HIS A CG   5  
ATOM 9754  N ND1  . HIS A 1 113 ? -9.626  -6.611  -3.625  1.00 0.00 ? 113 HIS A ND1  5  
ATOM 9755  C CD2  . HIS A 1 113 ? -7.467  -6.298  -3.531  1.00 0.00 ? 113 HIS A CD2  5  
ATOM 9756  C CE1  . HIS A 1 113 ? -9.079  -7.763  -3.280  1.00 0.00 ? 113 HIS A CE1  5  
ATOM 9757  N NE2  . HIS A 1 113 ? -7.770  -7.600  -3.216  1.00 0.00 ? 113 HIS A NE2  5  
ATOM 9758  H H    . HIS A 1 113 ? -9.055  -1.896  -5.654  1.00 0.00 ? 113 HIS A H    5  
ATOM 9759  H HA   . HIS A 1 113 ? -8.057  -4.633  -6.102  1.00 0.00 ? 113 HIS A HA   5  
ATOM 9760  H HB2  . HIS A 1 113 ? -8.201  -3.617  -3.677  1.00 0.00 ? 113 HIS A HB2  5  
ATOM 9761  H HB3  . HIS A 1 113 ? -9.912  -3.999  -3.841  1.00 0.00 ? 113 HIS A HB3  5  
ATOM 9762  H HD2  . HIS A 1 113 ? -6.480  -5.860  -3.564  1.00 0.00 ? 113 HIS A HD2  5  
ATOM 9763  H HE1  . HIS A 1 113 ? -9.611  -8.682  -3.084  1.00 0.00 ? 113 HIS A HE1  5  
ATOM 9764  H HE2  . HIS A 1 113 ? -7.132  -8.273  -2.900  1.00 0.00 ? 113 HIS A HE2  5  
ATOM 9765  N N    . PRO A 1 114 ? -10.114 -4.597  -7.669  1.00 0.00 ? 114 PRO A N    5  
ATOM 9766  C CA   . PRO A 1 114 ? -11.306 -4.943  -8.448  1.00 0.00 ? 114 PRO A CA   5  
ATOM 9767  C C    . PRO A 1 114 ? -11.843 -6.328  -8.103  1.00 0.00 ? 114 PRO A C    5  
ATOM 9768  O O    . PRO A 1 114 ? -12.837 -6.777  -8.671  1.00 0.00 ? 114 PRO A O    5  
ATOM 9769  C CB   . PRO A 1 114 ? -10.806 -4.909  -9.895  1.00 0.00 ? 114 PRO A CB   5  
ATOM 9770  C CG   . PRO A 1 114 ? -9.344  -5.175  -9.797  1.00 0.00 ? 114 PRO A CG   5  
ATOM 9771  C CD   . PRO A 1 114 ? -8.897  -4.563  -8.498  1.00 0.00 ? 114 PRO A CD   5  
ATOM 9772  H HA   . PRO A 1 114 ? -12.090 -4.212  -8.319  1.00 0.00 ? 114 PRO A HA   5  
ATOM 9773  H HB2  . PRO A 1 114 ? -11.310 -5.672  -10.470 1.00 0.00 ? 114 PRO A HB2  5  
ATOM 9774  H HB3  . PRO A 1 114 ? -11.003 -3.938  -10.324 1.00 0.00 ? 114 PRO A HB3  5  
ATOM 9775  H HG2  . PRO A 1 114 ? -9.164  -6.239  -9.791  1.00 0.00 ? 114 PRO A HG2  5  
ATOM 9776  H HG3  . PRO A 1 114 ? -8.830  -4.711  -10.626 1.00 0.00 ? 114 PRO A HG3  5  
ATOM 9777  H HD2  . PRO A 1 114 ? -8.110  -5.153  -8.053  1.00 0.00 ? 114 PRO A HD2  5  
ATOM 9778  H HD3  . PRO A 1 114 ? -8.567  -3.546  -8.654  1.00 0.00 ? 114 PRO A HD3  5  
ATOM 9779  N N    . GLU A 1 115 ? -11.178 -6.999  -7.168  1.00 0.00 ? 115 GLU A N    5  
ATOM 9780  C CA   . GLU A 1 115 ? -11.589 -8.334  -6.748  1.00 0.00 ? 115 GLU A CA   5  
ATOM 9781  C C    . GLU A 1 115 ? -12.646 -8.257  -5.650  1.00 0.00 ? 115 GLU A C    5  
ATOM 9782  O O    . GLU A 1 115 ? -13.668 -8.940  -5.710  1.00 0.00 ? 115 GLU A O    5  
ATOM 9783  C CB   . GLU A 1 115 ? -10.381 -9.132  -6.253  1.00 0.00 ? 115 GLU A CB   5  
ATOM 9784  C CG   . GLU A 1 115 ? -10.743 -10.249 -5.289  1.00 0.00 ? 115 GLU A CG   5  
ATOM 9785  C CD   . GLU A 1 115 ? -9.779  -11.417 -5.360  1.00 0.00 ? 115 GLU A CD   5  
ATOM 9786  O OE1  . GLU A 1 115 ? -8.733  -11.282 -6.029  1.00 0.00 ? 115 GLU A OE1  5  
ATOM 9787  O OE2  . GLU A 1 115 ? -10.071 -12.466 -4.749  1.00 0.00 ? 115 GLU A OE2  5  
ATOM 9788  H H    . GLU A 1 115 ? -10.392 -6.588  -6.751  1.00 0.00 ? 115 GLU A H    5  
ATOM 9789  H HA   . GLU A 1 115 ? -12.014 -8.835  -7.605  1.00 0.00 ? 115 GLU A HA   5  
ATOM 9790  H HB2  . GLU A 1 115 ? -9.880  -9.568  -7.105  1.00 0.00 ? 115 GLU A HB2  5  
ATOM 9791  H HB3  . GLU A 1 115 ? -9.701  -8.459  -5.752  1.00 0.00 ? 115 GLU A HB3  5  
ATOM 9792  H HG2  . GLU A 1 115 ? -10.734 -9.856  -4.283  1.00 0.00 ? 115 GLU A HG2  5  
ATOM 9793  H HG3  . GLU A 1 115 ? -11.735 -10.605 -5.526  1.00 0.00 ? 115 GLU A HG3  5  
ATOM 9794  N N    . GLN A 1 116 ? -12.391 -7.421  -4.649  1.00 0.00 ? 116 GLN A N    5  
ATOM 9795  C CA   . GLN A 1 116 ? -13.319 -7.256  -3.536  1.00 0.00 ? 116 GLN A CA   5  
ATOM 9796  C C    . GLN A 1 116 ? -14.509 -6.392  -3.944  1.00 0.00 ? 116 GLN A C    5  
ATOM 9797  O O    . GLN A 1 116 ? -15.638 -6.633  -3.517  1.00 0.00 ? 116 GLN A O    5  
ATOM 9798  C CB   . GLN A 1 116 ? -12.606 -6.628  -2.338  1.00 0.00 ? 116 GLN A CB   5  
ATOM 9799  C CG   . GLN A 1 116 ? -13.554 -6.052  -1.298  1.00 0.00 ? 116 GLN A CG   5  
ATOM 9800  C CD   . GLN A 1 116 ? -12.841 -5.628  -0.029  1.00 0.00 ? 116 GLN A CD   5  
ATOM 9801  O OE1  . GLN A 1 116 ? -13.448 -5.546  1.039   1.00 0.00 ? 116 GLN A OE1  5  
ATOM 9802  N NE2  . GLN A 1 116 ? -11.546 -5.355  -0.140  1.00 0.00 ? 116 GLN A NE2  5  
ATOM 9803  H H    . GLN A 1 116 ? -11.559 -6.904  -4.658  1.00 0.00 ? 116 GLN A H    5  
ATOM 9804  H HA   . GLN A 1 116 ? -13.680 -8.234  -3.257  1.00 0.00 ? 116 GLN A HA   5  
ATOM 9805  H HB2  . GLN A 1 116 ? -11.998 -7.382  -1.861  1.00 0.00 ? 116 GLN A HB2  5  
ATOM 9806  H HB3  . GLN A 1 116 ? -11.967 -5.832  -2.690  1.00 0.00 ? 116 GLN A HB3  5  
ATOM 9807  H HG2  . GLN A 1 116 ? -14.049 -5.190  -1.720  1.00 0.00 ? 116 GLN A HG2  5  
ATOM 9808  H HG3  . GLN A 1 116 ? -14.290 -6.802  -1.047  1.00 0.00 ? 116 GLN A HG3  5  
ATOM 9809  H HE21 . GLN A 1 116 ? -11.130 -5.441  -1.024  1.00 0.00 ? 116 GLN A HE21 5  
ATOM 9810  H HE22 . GLN A 1 116 ? -11.061 -5.078  0.663   1.00 0.00 ? 116 GLN A HE22 5  
ATOM 9811  N N    . ALA A 1 117 ? -14.247 -5.386  -4.772  1.00 0.00 ? 117 ALA A N    5  
ATOM 9812  C CA   . ALA A 1 117 ? -15.297 -4.488  -5.238  1.00 0.00 ? 117 ALA A CA   5  
ATOM 9813  C C    . ALA A 1 117 ? -16.410 -5.261  -5.938  1.00 0.00 ? 117 ALA A C    5  
ATOM 9814  O O    . ALA A 1 117 ? -17.495 -4.730  -6.171  1.00 0.00 ? 117 ALA A O    5  
ATOM 9815  C CB   . ALA A 1 117 ? -14.715 -3.436  -6.171  1.00 0.00 ? 117 ALA A CB   5  
ATOM 9816  H H    . ALA A 1 117 ? -13.327 -5.246  -5.078  1.00 0.00 ? 117 ALA A H    5  
ATOM 9817  H HA   . ALA A 1 117 ? -15.710 -3.982  -4.378  1.00 0.00 ? 117 ALA A HA   5  
ATOM 9818  H HB1  . ALA A 1 117 ? -15.468 -3.128  -6.880  1.00 0.00 ? 117 ALA A HB1  5  
ATOM 9819  H HB2  . ALA A 1 117 ? -14.394 -2.582  -5.593  1.00 0.00 ? 117 ALA A HB2  5  
ATOM 9820  H HB3  . ALA A 1 117 ? -13.870 -3.852  -6.700  1.00 0.00 ? 117 ALA A HB3  5  
ATOM 9821  N N    . ARG A 1 118 ? -16.132 -6.517  -6.271  1.00 0.00 ? 118 ARG A N    5  
ATOM 9822  C CA   . ARG A 1 118 ? -17.110 -7.363  -6.946  1.00 0.00 ? 118 ARG A CA   5  
ATOM 9823  C C    . ARG A 1 118 ? -18.215 -7.791  -5.985  1.00 0.00 ? 118 ARG A C    5  
ATOM 9824  O O    . ARG A 1 118 ? -19.310 -8.160  -6.407  1.00 0.00 ? 118 ARG A O    5  
ATOM 9825  C CB   . ARG A 1 118 ? -16.427 -8.597  -7.537  1.00 0.00 ? 118 ARG A CB   5  
ATOM 9826  C CG   . ARG A 1 118 ? -16.184 -9.703  -6.523  1.00 0.00 ? 118 ARG A CG   5  
ATOM 9827  C CD   . ARG A 1 118 ? -15.124 -10.680 -7.007  1.00 0.00 ? 118 ARG A CD   5  
ATOM 9828  N NE   . ARG A 1 118 ? -15.700 -11.764 -7.799  1.00 0.00 ? 118 ARG A NE   5  
ATOM 9829  C CZ   . ARG A 1 118 ? -15.970 -11.663 -9.096  1.00 0.00 ? 118 ARG A CZ   5  
ATOM 9830  N NH1  . ARG A 1 118 ? -15.718 -10.534 -9.743  1.00 0.00 ? 118 ARG A NH1  5  
ATOM 9831  N NH2  . ARG A 1 118 ? -16.494 -12.694 -9.748  1.00 0.00 ? 118 ARG A NH2  5  
ATOM 9832  H H    . ARG A 1 118 ? -15.249 -6.885  -6.059  1.00 0.00 ? 118 ARG A H    5  
ATOM 9833  H HA   . ARG A 1 118 ? -17.549 -6.787  -7.747  1.00 0.00 ? 118 ARG A HA   5  
ATOM 9834  H HB2  . ARG A 1 118 ? -17.047 -8.994  -8.328  1.00 0.00 ? 118 ARG A HB2  5  
ATOM 9835  H HB3  . ARG A 1 118 ? -15.474 -8.303  -7.951  1.00 0.00 ? 118 ARG A HB3  5  
ATOM 9836  H HG2  . ARG A 1 118 ? -15.853 -9.261  -5.595  1.00 0.00 ? 118 ARG A HG2  5  
ATOM 9837  H HG3  . ARG A 1 118 ? -17.108 -10.238 -6.360  1.00 0.00 ? 118 ARG A HG3  5  
ATOM 9838  H HD2  . ARG A 1 118 ? -14.410 -10.144 -7.614  1.00 0.00 ? 118 ARG A HD2  5  
ATOM 9839  H HD3  . ARG A 1 118 ? -14.623 -11.101 -6.149  1.00 0.00 ? 118 ARG A HD3  5  
ATOM 9840  H HE   . ARG A 1 118 ? -15.894 -12.607 -7.341  1.00 0.00 ? 118 ARG A HE   5  
ATOM 9841  H HH11 . ARG A 1 118 ? -15.323 -9.756  -9.255  1.00 0.00 ? 118 ARG A HH11 5  
ATOM 9842  H HH12 . ARG A 1 118 ? -15.922 -10.461 -10.720 1.00 0.00 ? 118 ARG A HH12 5  
ATOM 9843  H HH21 . ARG A 1 118 ? -16.685 -13.547 -9.263  1.00 0.00 ? 118 ARG A HH21 5  
ATOM 9844  H HH22 . ARG A 1 118 ? -16.697 -12.617 -10.723 1.00 0.00 ? 118 ARG A HH22 5  
ATOM 9845  N N    . ALA A 1 119 ? -17.919 -7.738  -4.690  1.00 0.00 ? 119 ALA A N    5  
ATOM 9846  C CA   . ALA A 1 119 ? -18.887 -8.119  -3.669  1.00 0.00 ? 119 ALA A CA   5  
ATOM 9847  C C    . ALA A 1 119 ? -19.836 -6.967  -3.356  1.00 0.00 ? 119 ALA A C    5  
ATOM 9848  O O    . ALA A 1 119 ? -20.934 -7.178  -2.843  1.00 0.00 ? 119 ALA A O    5  
ATOM 9849  C CB   . ALA A 1 119 ? -18.170 -8.573  -2.406  1.00 0.00 ? 119 ALA A CB   5  
ATOM 9850  H H    . ALA A 1 119 ? -17.028 -7.435  -4.416  1.00 0.00 ? 119 ALA A H    5  
ATOM 9851  H HA   . ALA A 1 119 ? -19.461 -8.952  -4.048  1.00 0.00 ? 119 ALA A HA   5  
ATOM 9852  H HB1  . ALA A 1 119 ? -18.779 -9.300  -1.889  1.00 0.00 ? 119 ALA A HB1  5  
ATOM 9853  H HB2  . ALA A 1 119 ? -17.223 -9.019  -2.672  1.00 0.00 ? 119 ALA A HB2  5  
ATOM 9854  H HB3  . ALA A 1 119 ? -18.001 -7.723  -1.763  1.00 0.00 ? 119 ALA A HB3  5  
ATOM 9855  N N    . GLU A 1 120 ? -19.404 -5.749  -3.668  1.00 0.00 ? 120 GLU A N    5  
ATOM 9856  C CA   . GLU A 1 120 ? -20.216 -4.564  -3.417  1.00 0.00 ? 120 GLU A CA   5  
ATOM 9857  C C    . GLU A 1 120 ? -21.678 -4.821  -3.772  1.00 0.00 ? 120 GLU A C    5  
ATOM 9858  O O    . GLU A 1 120 ? -22.580 -4.171  -3.243  1.00 0.00 ? 120 GLU A O    5  
ATOM 9859  C CB   . GLU A 1 120 ? -19.686 -3.376  -4.223  1.00 0.00 ? 120 GLU A CB   5  
ATOM 9860  C CG   . GLU A 1 120 ? -18.276 -2.961  -3.839  1.00 0.00 ? 120 GLU A CG   5  
ATOM 9861  C CD   . GLU A 1 120 ? -18.253 -1.923  -2.734  1.00 0.00 ? 120 GLU A CD   5  
ATOM 9862  O OE1  . GLU A 1 120 ? -19.015 -0.938  -2.829  1.00 0.00 ? 120 GLU A OE1  5  
ATOM 9863  O OE2  . GLU A 1 120 ? -17.473 -2.096  -1.774  1.00 0.00 ? 120 GLU A OE2  5  
ATOM 9864  H H    . GLU A 1 120 ? -18.519 -5.645  -4.075  1.00 0.00 ? 120 GLU A H    5  
ATOM 9865  H HA   . GLU A 1 120 ? -20.149 -4.332  -2.365  1.00 0.00 ? 120 GLU A HA   5  
ATOM 9866  H HB2  . GLU A 1 120 ? -19.691 -3.636  -5.271  1.00 0.00 ? 120 GLU A HB2  5  
ATOM 9867  H HB3  . GLU A 1 120 ? -20.342 -2.531  -4.068  1.00 0.00 ? 120 GLU A HB3  5  
ATOM 9868  H HG2  . GLU A 1 120 ? -17.736 -3.834  -3.502  1.00 0.00 ? 120 GLU A HG2  5  
ATOM 9869  H HG3  . GLU A 1 120 ? -17.786 -2.550  -4.709  1.00 0.00 ? 120 GLU A HG3  5  
ATOM 9870  N N    . ARG A 1 121 ? -21.904 -5.774  -4.671  1.00 0.00 ? 121 ARG A N    5  
ATOM 9871  C CA   . ARG A 1 121 ? -23.255 -6.116  -5.098  1.00 0.00 ? 121 ARG A CA   5  
ATOM 9872  C C    . ARG A 1 121 ? -23.941 -7.009  -4.068  1.00 0.00 ? 121 ARG A C    5  
ATOM 9873  O O    . ARG A 1 121 ? -25.073 -6.749  -3.663  1.00 0.00 ? 121 ARG A O    5  
ATOM 9874  C CB   . ARG A 1 121 ? -23.220 -6.820  -6.456  1.00 0.00 ? 121 ARG A CB   5  
ATOM 9875  C CG   . ARG A 1 121 ? -22.973 -8.317  -6.361  1.00 0.00 ? 121 ARG A CG   5  
ATOM 9876  C CD   . ARG A 1 121 ? -22.983 -8.971  -7.733  1.00 0.00 ? 121 ARG A CD   5  
ATOM 9877  N NE   . ARG A 1 121 ? -22.292 -10.258 -7.731  1.00 0.00 ? 121 ARG A NE   5  
ATOM 9878  C CZ   . ARG A 1 121 ? -22.791 -11.359 -7.181  1.00 0.00 ? 121 ARG A CZ   5  
ATOM 9879  N NH1  . ARG A 1 121 ? -23.979 -11.331 -6.592  1.00 0.00 ? 121 ARG A NH1  5  
ATOM 9880  N NH2  . ARG A 1 121 ? -22.101 -12.492 -7.219  1.00 0.00 ? 121 ARG A NH2  5  
ATOM 9881  H H    . ARG A 1 121 ? -21.143 -6.257  -5.057  1.00 0.00 ? 121 ARG A H    5  
ATOM 9882  H HA   . ARG A 1 121 ? -23.816 -5.199  -5.192  1.00 0.00 ? 121 ARG A HA   5  
ATOM 9883  H HB2  . ARG A 1 121 ? -24.167 -6.665  -6.953  1.00 0.00 ? 121 ARG A HB2  5  
ATOM 9884  H HB3  . ARG A 1 121 ? -22.434 -6.384  -7.053  1.00 0.00 ? 121 ARG A HB3  5  
ATOM 9885  H HG2  . ARG A 1 121 ? -22.010 -8.484  -5.901  1.00 0.00 ? 121 ARG A HG2  5  
ATOM 9886  H HG3  . ARG A 1 121 ? -23.747 -8.762  -5.753  1.00 0.00 ? 121 ARG A HG3  5  
ATOM 9887  H HD2  . ARG A 1 121 ? -24.008 -9.125  -8.036  1.00 0.00 ? 121 ARG A HD2  5  
ATOM 9888  H HD3  . ARG A 1 121 ? -22.496 -8.312  -8.435  1.00 0.00 ? 121 ARG A HD3  5  
ATOM 9889  H HE   . ARG A 1 121 ? -21.413 -10.301 -8.161  1.00 0.00 ? 121 ARG A HE   5  
ATOM 9890  H HH11 . ARG A 1 121 ? -24.501 -10.479 -6.563  1.00 0.00 ? 121 ARG A HH11 5  
ATOM 9891  H HH12 . ARG A 1 121 ? -24.352 -12.162 -6.180  1.00 0.00 ? 121 ARG A HH12 5  
ATOM 9892  H HH21 . ARG A 1 121 ? -21.206 -12.518 -7.663  1.00 0.00 ? 121 ARG A HH21 5  
ATOM 9893  H HH22 . ARG A 1 121 ? -22.477 -13.321 -6.805  1.00 0.00 ? 121 ARG A HH22 5  
ATOM 9894  N N    . GLU A 1 122 ? -23.246 -8.063  -3.649  1.00 0.00 ? 122 GLU A N    5  
ATOM 9895  C CA   . GLU A 1 122 ? -23.790 -8.994  -2.668  1.00 0.00 ? 122 GLU A CA   5  
ATOM 9896  C C    . GLU A 1 122 ? -24.114 -8.278  -1.360  1.00 0.00 ? 122 GLU A C    5  
ATOM 9897  O O    . GLU A 1 122 ? -25.158 -8.514  -0.752  1.00 0.00 ? 122 GLU A O    5  
ATOM 9898  C CB   . GLU A 1 122 ? -22.799 -10.131 -2.408  1.00 0.00 ? 122 GLU A CB   5  
ATOM 9899  C CG   . GLU A 1 122 ? -21.809 -9.833  -1.295  1.00 0.00 ? 122 GLU A CG   5  
ATOM 9900  C CD   . GLU A 1 122 ? -20.950 -11.032 -0.942  1.00 0.00 ? 122 GLU A CD   5  
ATOM 9901  O OE1  . GLU A 1 122 ? -20.265 -11.557 -1.845  1.00 0.00 ? 122 GLU A OE1  5  
ATOM 9902  O OE2  . GLU A 1 122 ? -20.963 -11.446 0.236   1.00 0.00 ? 122 GLU A OE2  5  
ATOM 9903  H H    . GLU A 1 122 ? -22.348 -8.217  -4.009  1.00 0.00 ? 122 GLU A H    5  
ATOM 9904  H HA   . GLU A 1 122 ? -24.701 -9.408  -3.073  1.00 0.00 ? 122 GLU A HA   5  
ATOM 9905  H HB2  . GLU A 1 122 ? -23.352 -11.020 -2.142  1.00 0.00 ? 122 GLU A HB2  5  
ATOM 9906  H HB3  . GLU A 1 122 ? -22.243 -10.322 -3.314  1.00 0.00 ? 122 GLU A HB3  5  
ATOM 9907  H HG2  . GLU A 1 122 ? -21.163 -9.028  -1.611  1.00 0.00 ? 122 GLU A HG2  5  
ATOM 9908  H HG3  . GLU A 1 122 ? -22.357 -9.530  -0.415  1.00 0.00 ? 122 GLU A HG3  5  
ATOM 9909  N N    . LYS A 1 123 ? -23.210 -7.403  -0.932  1.00 0.00 ? 123 LYS A N    5  
ATOM 9910  C CA   . LYS A 1 123 ? -23.398 -6.651  0.303   1.00 0.00 ? 123 LYS A CA   5  
ATOM 9911  C C    . LYS A 1 123 ? -24.481 -5.590  0.135   1.00 0.00 ? 123 LYS A C    5  
ATOM 9912  O O    . LYS A 1 123 ? -24.991 -5.377  -0.965  1.00 0.00 ? 123 LYS A O    5  
ATOM 9913  C CB   . LYS A 1 123 ? -22.084 -5.990  0.727   1.00 0.00 ? 123 LYS A CB   5  
ATOM 9914  C CG   . LYS A 1 123 ? -21.830 -4.654  0.052   1.00 0.00 ? 123 LYS A CG   5  
ATOM 9915  C CD   . LYS A 1 123 ? -20.440 -4.126  0.365   1.00 0.00 ? 123 LYS A CD   5  
ATOM 9916  C CE   . LYS A 1 123 ? -20.329 -2.638  0.072   1.00 0.00 ? 123 LYS A CE   5  
ATOM 9917  N NZ   . LYS A 1 123 ? -20.706 -1.810  1.251   1.00 0.00 ? 123 LYS A NZ   5  
ATOM 9918  H H    . LYS A 1 123 ? -22.397 -7.258  -1.461  1.00 0.00 ? 123 LYS A H    5  
ATOM 9919  H HA   . LYS A 1 123 ? -23.706 -7.345  1.070   1.00 0.00 ? 123 LYS A HA   5  
ATOM 9920  H HB2  . LYS A 1 123 ? -22.103 -5.833  1.795   1.00 0.00 ? 123 LYS A HB2  5  
ATOM 9921  H HB3  . LYS A 1 123 ? -21.267 -6.654  0.484   1.00 0.00 ? 123 LYS A HB3  5  
ATOM 9922  H HG2  . LYS A 1 123 ? -21.924 -4.777  -1.017  1.00 0.00 ? 123 LYS A HG2  5  
ATOM 9923  H HG3  . LYS A 1 123 ? -22.563 -3.940  0.400   1.00 0.00 ? 123 LYS A HG3  5  
ATOM 9924  H HD2  . LYS A 1 123 ? -20.229 -4.292  1.411   1.00 0.00 ? 123 LYS A HD2  5  
ATOM 9925  H HD3  . LYS A 1 123 ? -19.718 -4.658  -0.238  1.00 0.00 ? 123 LYS A HD3  5  
ATOM 9926  H HE2  . LYS A 1 123 ? -19.310 -2.414  -0.204  1.00 0.00 ? 123 LYS A HE2  5  
ATOM 9927  H HE3  . LYS A 1 123 ? -20.986 -2.397  -0.751  1.00 0.00 ? 123 LYS A HE3  5  
ATOM 9928  H HZ1  . LYS A 1 123 ? -20.190 -2.133  2.094   1.00 0.00 ? 123 LYS A HZ1  5  
ATOM 9929  H HZ2  . LYS A 1 123 ? -21.727 -1.890  1.431   1.00 0.00 ? 123 LYS A HZ2  5  
ATOM 9930  H HZ3  . LYS A 1 123 ? -20.473 -0.812  1.076   1.00 0.00 ? 123 LYS A HZ3  5  
ATOM 9931  N N    . THR A 1 124 ? -24.829 -4.926  1.233   1.00 0.00 ? 124 THR A N    5  
ATOM 9932  C CA   . THR A 1 124 ? -25.851 -3.888  1.207   1.00 0.00 ? 124 THR A CA   5  
ATOM 9933  C C    . THR A 1 124 ? -25.247 -2.530  0.867   1.00 0.00 ? 124 THR A C    5  
ATOM 9934  O O    . THR A 1 124 ? -24.101 -2.245  1.216   1.00 0.00 ? 124 THR A O    5  
ATOM 9935  C CB   . THR A 1 124 ? -26.584 -3.787  2.558   1.00 0.00 ? 124 THR A CB   5  
ATOM 9936  O OG1  . THR A 1 124 ? -27.343 -4.978  2.794   1.00 0.00 ? 124 THR A OG1  5  
ATOM 9937  C CG2  . THR A 1 124 ? -27.507 -2.578  2.585   1.00 0.00 ? 124 THR A CG2  5  
ATOM 9938  H H    . THR A 1 124 ? -24.386 -5.142  2.081   1.00 0.00 ? 124 THR A H    5  
ATOM 9939  H HA   . THR A 1 124 ? -26.574 -4.150  0.448   1.00 0.00 ? 124 THR A HA   5  
ATOM 9940  H HB   . THR A 1 124 ? -25.848 -3.677  3.342   1.00 0.00 ? 124 THR A HB   5  
ATOM 9941  H HG1  . THR A 1 124 ? -28.154 -4.948  2.281   1.00 0.00 ? 124 THR A HG1  5  
ATOM 9942  H HG21 . THR A 1 124 ? -28.311 -2.724  1.879   1.00 0.00 ? 124 THR A HG21 5  
ATOM 9943  H HG22 . THR A 1 124 ? -26.949 -1.693  2.316   1.00 0.00 ? 124 THR A HG22 5  
ATOM 9944  H HG23 . THR A 1 124 ? -27.916 -2.459  3.577   1.00 0.00 ? 124 THR A HG23 5  
ATOM 9945  N N    . SER A 1 125 ? -26.025 -1.696  0.185   1.00 0.00 ? 125 SER A N    5  
ATOM 9946  C CA   . SER A 1 125 ? -25.564 -0.368  -0.205  1.00 0.00 ? 125 SER A CA   5  
ATOM 9947  C C    . SER A 1 125 ? -26.733 0.498   -0.666  1.00 0.00 ? 125 SER A C    5  
ATOM 9948  O O    . SER A 1 125 ? -27.428 0.164   -1.624  1.00 0.00 ? 125 SER A O    5  
ATOM 9949  C CB   . SER A 1 125 ? -24.522 -0.473  -1.320  1.00 0.00 ? 125 SER A CB   5  
ATOM 9950  O OG   . SER A 1 125 ? -23.753 -1.656  -1.189  1.00 0.00 ? 125 SER A OG   5  
ATOM 9951  H H    . SER A 1 125 ? -26.929 -1.981  -0.064  1.00 0.00 ? 125 SER A H    5  
ATOM 9952  H HA   . SER A 1 125 ? -25.109 0.092   0.659   1.00 0.00 ? 125 SER A HA   5  
ATOM 9953  H HB2  . SER A 1 125 ? -25.022 -0.488  -2.277  1.00 0.00 ? 125 SER A HB2  5  
ATOM 9954  H HB3  . SER A 1 125 ? -23.861 0.380   -1.272  1.00 0.00 ? 125 SER A HB3  5  
ATOM 9955  H HG   . SER A 1 125 ? -23.779 -2.148  -2.013  1.00 0.00 ? 125 SER A HG   5  
ATOM 9956  N N    . GLY A 1 126 ? -26.942 1.615   0.026   1.00 0.00 ? 126 GLY A N    5  
ATOM 9957  C CA   . GLY A 1 126 ? -28.027 2.513   -0.326  1.00 0.00 ? 126 GLY A CA   5  
ATOM 9958  C C    . GLY A 1 126 ? -27.694 3.964   -0.041  1.00 0.00 ? 126 GLY A C    5  
ATOM 9959  O O    . GLY A 1 126 ? -26.557 4.310   0.280   1.00 0.00 ? 126 GLY A O    5  
ATOM 9960  H H    . GLY A 1 126 ? -26.355 1.830   0.781   1.00 0.00 ? 126 GLY A H    5  
ATOM 9961  H HA2  . GLY A 1 126 ? -28.243 2.404   -1.378  1.00 0.00 ? 126 GLY A HA2  5  
ATOM 9962  H HA3  . GLY A 1 126 ? -28.904 2.239   0.241   1.00 0.00 ? 126 GLY A HA3  5  
ATOM 9963  N N    . PRO A 1 127 ? -28.702 4.840   -0.159  1.00 0.00 ? 127 PRO A N    5  
ATOM 9964  C CA   . PRO A 1 127 ? -28.535 6.276   0.083   1.00 0.00 ? 127 PRO A CA   5  
ATOM 9965  C C    . PRO A 1 127 ? -28.303 6.593   1.556   1.00 0.00 ? 127 PRO A C    5  
ATOM 9966  O O    . PRO A 1 127 ? -28.731 5.846   2.436   1.00 0.00 ? 127 PRO A O    5  
ATOM 9967  C CB   . PRO A 1 127 ? -29.863 6.873   -0.390  1.00 0.00 ? 127 PRO A CB   5  
ATOM 9968  C CG   . PRO A 1 127 ? -30.846 5.762   -0.256  1.00 0.00 ? 127 PRO A CG   5  
ATOM 9969  C CD   . PRO A 1 127 ? -30.083 4.497   -0.538  1.00 0.00 ? 127 PRO A CD   5  
ATOM 9970  H HA   . PRO A 1 127 ? -27.725 6.686   -0.504  1.00 0.00 ? 127 PRO A HA   5  
ATOM 9971  H HB2  . PRO A 1 127 ? -30.127 7.713   0.238   1.00 0.00 ? 127 PRO A HB2  5  
ATOM 9972  H HB3  . PRO A 1 127 ? -29.771 7.197   -1.415  1.00 0.00 ? 127 PRO A HB3  5  
ATOM 9973  H HG2  . PRO A 1 127 ? -31.245 5.743   0.747   1.00 0.00 ? 127 PRO A HG2  5  
ATOM 9974  H HG3  . PRO A 1 127 ? -31.642 5.888   -0.975  1.00 0.00 ? 127 PRO A HG3  5  
ATOM 9975  H HD2  . PRO A 1 127 ? -30.459 3.686   0.068   1.00 0.00 ? 127 PRO A HD2  5  
ATOM 9976  H HD3  . PRO A 1 127 ? -30.143 4.247   -1.587  1.00 0.00 ? 127 PRO A HD3  5  
ATOM 9977  N N    . SER A 1 128 ? -27.623 7.704   1.819   1.00 0.00 ? 128 SER A N    5  
ATOM 9978  C CA   . SER A 1 128 ? -27.332 8.118   3.186   1.00 0.00 ? 128 SER A CA   5  
ATOM 9979  C C    . SER A 1 128 ? -28.374 9.112   3.687   1.00 0.00 ? 128 SER A C    5  
ATOM 9980  O O    . SER A 1 128 ? -29.289 9.491   2.955   1.00 0.00 ? 128 SER A O    5  
ATOM 9981  C CB   . SER A 1 128 ? -25.936 8.740   3.267   1.00 0.00 ? 128 SER A CB   5  
ATOM 9982  O OG   . SER A 1 128 ? -25.774 9.755   2.293   1.00 0.00 ? 128 SER A OG   5  
ATOM 9983  H H    . SER A 1 128 ? -27.308 8.258   1.074   1.00 0.00 ? 128 SER A H    5  
ATOM 9984  H HA   . SER A 1 128 ? -27.361 7.238   3.812   1.00 0.00 ? 128 SER A HA   5  
ATOM 9985  H HB2  . SER A 1 128 ? -25.794 9.171   4.246   1.00 0.00 ? 128 SER A HB2  5  
ATOM 9986  H HB3  . SER A 1 128 ? -25.193 7.973   3.100   1.00 0.00 ? 128 SER A HB3  5  
ATOM 9987  H HG   . SER A 1 128 ? -25.654 9.354   1.429   1.00 0.00 ? 128 SER A HG   5  
ATOM 9988  N N    . SER A 1 129 ? -28.229 9.532   4.940   1.00 0.00 ? 129 SER A N    5  
ATOM 9989  C CA   . SER A 1 129 ? -29.160 10.480  5.542   1.00 0.00 ? 129 SER A CA   5  
ATOM 9990  C C    . SER A 1 129 ? -28.468 11.807  5.838   1.00 0.00 ? 129 SER A C    5  
ATOM 9991  O O    . SER A 1 129 ? -27.790 11.953  6.853   1.00 0.00 ? 129 SER A O    5  
ATOM 9992  C CB   . SER A 1 129 ? -29.750 9.901   6.829   1.00 0.00 ? 129 SER A CB   5  
ATOM 9993  O OG   . SER A 1 129 ? -28.727 9.508   7.727   1.00 0.00 ? 129 SER A OG   5  
ATOM 9994  H H    . SER A 1 129 ? -27.480 9.193   5.473   1.00 0.00 ? 129 SER A H    5  
ATOM 9995  H HA   . SER A 1 129 ? -29.959 10.653  4.836   1.00 0.00 ? 129 SER A HA   5  
ATOM 9996  H HB2  . SER A 1 129 ? -30.366 10.647  7.307   1.00 0.00 ? 129 SER A HB2  5  
ATOM 9997  H HB3  . SER A 1 129 ? -30.353 9.037   6.589   1.00 0.00 ? 129 SER A HB3  5  
ATOM 9998  H HG   . SER A 1 129 ? -28.412 8.633   7.491   1.00 0.00 ? 129 SER A HG   5  
ATOM 9999  N N    . GLY A 1 130 ? -28.645 12.773  4.941   1.00 0.00 ? 130 GLY A N    5  
ATOM 10000 C CA   . GLY A 1 130 ? -28.032 14.075  5.123   1.00 0.00 ? 130 GLY A CA   5  
ATOM 10001 C C    . GLY A 1 130 ? -28.998 15.096  5.691   1.00 0.00 ? 130 GLY A C    5  
ATOM 10002 O O    . GLY A 1 130 ? -29.703 14.820  6.662   1.00 0.00 ? 130 GLY A O    5  
ATOM 10003 H H    . GLY A 1 130 ? -29.197 12.599  4.150   1.00 0.00 ? 130 GLY A H    5  
ATOM 10004 H HA2  . GLY A 1 130 ? -27.193 13.976  5.795   1.00 0.00 ? 130 GLY A HA2  5  
ATOM 10005 H HA3  . GLY A 1 130 ? -27.675 14.429  4.167   1.00 0.00 ? 130 GLY A HA3  5  
ATOM 10006 N N    . GLY A 1 1   ? -7.856  -10.889 -31.204 1.00 0.00 ? 1   GLY A N    6  
ATOM 10007 C CA   . GLY A 1 1   ? -8.924  -11.138 -30.253 1.00 0.00 ? 1   GLY A CA   6  
ATOM 10008 C C    . GLY A 1 1   ? -8.556  -12.197 -29.233 1.00 0.00 ? 1   GLY A C    6  
ATOM 10009 O O    . GLY A 1 1   ? -8.107  -13.285 -29.592 1.00 0.00 ? 1   GLY A O    6  
ATOM 10010 H H1   . GLY A 1 1   ? -8.070  -10.729 -32.147 1.00 0.00 ? 1   GLY A H1   6  
ATOM 10011 H HA2  . GLY A 1 1   ? -9.151  -10.218 -29.735 1.00 0.00 ? 1   GLY A HA2  6  
ATOM 10012 H HA3  . GLY A 1 1   ? -9.802  -11.463 -30.792 1.00 0.00 ? 1   GLY A HA3  6  
ATOM 10013 N N    . SER A 1 2   ? -8.747  -11.879 -27.956 1.00 0.00 ? 2   SER A N    6  
ATOM 10014 C CA   . SER A 1 2   ? -8.427  -12.810 -26.881 1.00 0.00 ? 2   SER A CA   6  
ATOM 10015 C C    . SER A 1 2   ? -9.205  -12.465 -25.614 1.00 0.00 ? 2   SER A C    6  
ATOM 10016 O O    . SER A 1 2   ? -9.460  -11.295 -25.329 1.00 0.00 ? 2   SER A O    6  
ATOM 10017 C CB   . SER A 1 2   ? -6.925  -12.791 -26.591 1.00 0.00 ? 2   SER A CB   6  
ATOM 10018 O OG   . SER A 1 2   ? -6.206  -13.511 -27.578 1.00 0.00 ? 2   SER A OG   6  
ATOM 10019 H H    . SER A 1 2   ? -9.108  -10.996 -27.733 1.00 0.00 ? 2   SER A H    6  
ATOM 10020 H HA   . SER A 1 2   ? -8.710  -13.800 -27.204 1.00 0.00 ? 2   SER A HA   6  
ATOM 10021 H HB2  . SER A 1 2   ? -6.575  -11.770 -26.581 1.00 0.00 ? 2   SER A HB2  6  
ATOM 10022 H HB3  . SER A 1 2   ? -6.741  -13.244 -25.627 1.00 0.00 ? 2   SER A HB3  6  
ATOM 10023 H HG   . SER A 1 2   ? -5.896  -12.904 -28.254 1.00 0.00 ? 2   SER A HG   6  
ATOM 10024 N N    . SER A 1 3   ? -9.579  -13.492 -24.859 1.00 0.00 ? 3   SER A N    6  
ATOM 10025 C CA   . SER A 1 3   ? -10.332 -13.300 -23.625 1.00 0.00 ? 3   SER A CA   6  
ATOM 10026 C C    . SER A 1 3   ? -9.422  -13.433 -22.407 1.00 0.00 ? 3   SER A C    6  
ATOM 10027 O O    . SER A 1 3   ? -8.241  -13.755 -22.533 1.00 0.00 ? 3   SER A O    6  
ATOM 10028 C CB   . SER A 1 3   ? -11.474 -14.313 -23.535 1.00 0.00 ? 3   SER A CB   6  
ATOM 10029 O OG   . SER A 1 3   ? -12.263 -14.092 -22.380 1.00 0.00 ? 3   SER A OG   6  
ATOM 10030 H H    . SER A 1 3   ? -9.346  -14.402 -25.140 1.00 0.00 ? 3   SER A H    6  
ATOM 10031 H HA   . SER A 1 3   ? -10.747 -12.303 -23.642 1.00 0.00 ? 3   SER A HA   6  
ATOM 10032 H HB2  . SER A 1 3   ? -12.102 -14.222 -24.408 1.00 0.00 ? 3   SER A HB2  6  
ATOM 10033 H HB3  . SER A 1 3   ? -11.063 -15.311 -23.491 1.00 0.00 ? 3   SER A HB3  6  
ATOM 10034 H HG   . SER A 1 3   ? -13.193 -14.099 -22.620 1.00 0.00 ? 3   SER A HG   6  
ATOM 10035 N N    . GLY A 1 4   ? -9.982  -13.183 -21.227 1.00 0.00 ? 4   GLY A N    6  
ATOM 10036 C CA   . GLY A 1 4   ? -9.208  -13.279 -20.004 1.00 0.00 ? 4   GLY A CA   6  
ATOM 10037 C C    . GLY A 1 4   ? -9.336  -12.043 -19.137 1.00 0.00 ? 4   GLY A C    6  
ATOM 10038 O O    . GLY A 1 4   ? -8.666  -11.038 -19.374 1.00 0.00 ? 4   GLY A O    6  
ATOM 10039 H H    . GLY A 1 4   ? -10.928 -12.930 -21.188 1.00 0.00 ? 4   GLY A H    6  
ATOM 10040 H HA2  . GLY A 1 4   ? -9.548  -14.137 -19.442 1.00 0.00 ? 4   GLY A HA2  6  
ATOM 10041 H HA3  . GLY A 1 4   ? -8.168  -13.419 -20.259 1.00 0.00 ? 4   GLY A HA3  6  
ATOM 10042 N N    . SER A 1 5   ? -10.202 -12.114 -18.131 1.00 0.00 ? 5   SER A N    6  
ATOM 10043 C CA   . SER A 1 5   ? -10.420 -10.989 -17.229 1.00 0.00 ? 5   SER A CA   6  
ATOM 10044 C C    . SER A 1 5   ? -10.203 -11.406 -15.777 1.00 0.00 ? 5   SER A C    6  
ATOM 10045 O O    . SER A 1 5   ? -10.982 -12.178 -15.218 1.00 0.00 ? 5   SER A O    6  
ATOM 10046 C CB   . SER A 1 5   ? -11.835 -10.434 -17.405 1.00 0.00 ? 5   SER A CB   6  
ATOM 10047 O OG   . SER A 1 5   ? -12.107 -10.155 -18.767 1.00 0.00 ? 5   SER A OG   6  
ATOM 10048 H H    . SER A 1 5   ? -10.707 -12.943 -17.993 1.00 0.00 ? 5   SER A H    6  
ATOM 10049 H HA   . SER A 1 5   ? -9.707  -10.219 -17.481 1.00 0.00 ? 5   SER A HA   6  
ATOM 10050 H HB2  . SER A 1 5   ? -12.550 -11.160 -17.049 1.00 0.00 ? 5   SER A HB2  6  
ATOM 10051 H HB3  . SER A 1 5   ? -11.934 -9.521  -16.836 1.00 0.00 ? 5   SER A HB3  6  
ATOM 10052 H HG   . SER A 1 5   ? -13.019 -10.383 -18.965 1.00 0.00 ? 5   SER A HG   6  
ATOM 10053 N N    . SER A 1 6   ? -9.137  -10.891 -15.174 1.00 0.00 ? 6   SER A N    6  
ATOM 10054 C CA   . SER A 1 6   ? -8.813  -11.212 -13.789 1.00 0.00 ? 6   SER A CA   6  
ATOM 10055 C C    . SER A 1 6   ? -8.480  -9.948  -13.002 1.00 0.00 ? 6   SER A C    6  
ATOM 10056 O O    . SER A 1 6   ? -7.941  -8.986  -13.548 1.00 0.00 ? 6   SER A O    6  
ATOM 10057 C CB   . SER A 1 6   ? -7.635  -12.187 -13.731 1.00 0.00 ? 6   SER A CB   6  
ATOM 10058 O OG   . SER A 1 6   ? -6.457  -11.595 -14.249 1.00 0.00 ? 6   SER A OG   6  
ATOM 10059 H H    . SER A 1 6   ? -8.553  -10.282 -15.673 1.00 0.00 ? 6   SER A H    6  
ATOM 10060 H HA   . SER A 1 6   ? -9.679  -11.680 -13.346 1.00 0.00 ? 6   SER A HA   6  
ATOM 10061 H HB2  . SER A 1 6   ? -7.459  -12.474 -12.706 1.00 0.00 ? 6   SER A HB2  6  
ATOM 10062 H HB3  . SER A 1 6   ? -7.870  -13.065 -14.316 1.00 0.00 ? 6   SER A HB3  6  
ATOM 10063 H HG   . SER A 1 6   ? -6.371  -11.812 -15.180 1.00 0.00 ? 6   SER A HG   6  
ATOM 10064 N N    . GLY A 1 7   ? -8.805  -9.958  -11.713 1.00 0.00 ? 7   GLY A N    6  
ATOM 10065 C CA   . GLY A 1 7   ? -8.534  -8.808  -10.870 1.00 0.00 ? 7   GLY A CA   6  
ATOM 10066 C C    . GLY A 1 7   ? -7.304  -8.999  -10.006 1.00 0.00 ? 7   GLY A C    6  
ATOM 10067 O O    . GLY A 1 7   ? -7.124  -10.050 -9.391  1.00 0.00 ? 7   GLY A O    6  
ATOM 10068 H H    . GLY A 1 7   ? -9.233  -10.752 -11.331 1.00 0.00 ? 7   GLY A H    6  
ATOM 10069 H HA2  . GLY A 1 7   ? -8.390  -7.941  -11.498 1.00 0.00 ? 7   GLY A HA2  6  
ATOM 10070 H HA3  . GLY A 1 7   ? -9.387  -8.637  -10.229 1.00 0.00 ? 7   GLY A HA3  6  
ATOM 10071 N N    . THR A 1 8   ? -6.450  -7.980  -9.960  1.00 0.00 ? 8   THR A N    6  
ATOM 10072 C CA   . THR A 1 8   ? -5.229  -8.042  -9.168  1.00 0.00 ? 8   THR A CA   6  
ATOM 10073 C C    . THR A 1 8   ? -4.925  -6.696  -8.520  1.00 0.00 ? 8   THR A C    6  
ATOM 10074 O O    . THR A 1 8   ? -5.083  -5.637  -9.129  1.00 0.00 ? 8   THR A O    6  
ATOM 10075 C CB   . THR A 1 8   ? -4.023  -8.469  -10.027 1.00 0.00 ? 8   THR A CB   6  
ATOM 10076 O OG1  . THR A 1 8   ? -4.232  -9.789  -10.542 1.00 0.00 ? 8   THR A OG1  6  
ATOM 10077 C CG2  . THR A 1 8   ? -2.739  -8.434  -9.212  1.00 0.00 ? 8   THR A CG2  6  
ATOM 10078 H H    . THR A 1 8   ? -6.648  -7.169  -10.473 1.00 0.00 ? 8   THR A H    6  
ATOM 10079 H HA   . THR A 1 8   ? -5.371  -8.780  -8.392  1.00 0.00 ? 8   THR A HA   6  
ATOM 10080 H HB   . THR A 1 8   ? -3.927  -7.779  -10.853 1.00 0.00 ? 8   THR A HB   6  
ATOM 10081 H HG1  . THR A 1 8   ? -3.614  -9.954  -11.258 1.00 0.00 ? 8   THR A HG1  6  
ATOM 10082 H HG21 . THR A 1 8   ? -2.666  -9.332  -8.618  1.00 0.00 ? 8   THR A HG21 6  
ATOM 10083 H HG22 . THR A 1 8   ? -2.748  -7.572  -8.562  1.00 0.00 ? 8   THR A HG22 6  
ATOM 10084 H HG23 . THR A 1 8   ? -1.891  -8.373  -9.879  1.00 0.00 ? 8   THR A HG23 6  
ATOM 10085 N N    . PRO A 1 9   ? -4.478  -6.734  -7.256  1.00 0.00 ? 9   PRO A N    6  
ATOM 10086 C CA   . PRO A 1 9   ? -4.142  -5.525  -6.498  1.00 0.00 ? 9   PRO A CA   6  
ATOM 10087 C C    . PRO A 1 9   ? -2.885  -4.842  -7.025  1.00 0.00 ? 9   PRO A C    6  
ATOM 10088 O O    . PRO A 1 9   ? -1.844  -5.478  -7.195  1.00 0.00 ? 9   PRO A O    6  
ATOM 10089 C CB   . PRO A 1 9   ? -3.910  -6.049  -5.079  1.00 0.00 ? 9   PRO A CB   6  
ATOM 10090 C CG   . PRO A 1 9   ? -3.516  -7.474  -5.261  1.00 0.00 ? 9   PRO A CG   6  
ATOM 10091 C CD   . PRO A 1 9   ? -4.266  -7.961  -6.469  1.00 0.00 ? 9   PRO A CD   6  
ATOM 10092 H HA   . PRO A 1 9   ? -4.959  -4.819  -6.494  1.00 0.00 ? 9   PRO A HA   6  
ATOM 10093 H HB2  . PRO A 1 9   ? -3.124  -5.478  -4.605  1.00 0.00 ? 9   PRO A HB2  6  
ATOM 10094 H HB3  . PRO A 1 9   ? -4.821  -5.962  -4.506  1.00 0.00 ? 9   PRO A HB3  6  
ATOM 10095 H HG2  . PRO A 1 9   ? -2.452  -7.542  -5.428  1.00 0.00 ? 9   PRO A HG2  6  
ATOM 10096 H HG3  . PRO A 1 9   ? -3.797  -8.047  -4.389  1.00 0.00 ? 9   PRO A HG3  6  
ATOM 10097 H HD2  . PRO A 1 9   ? -3.672  -8.675  -7.020  1.00 0.00 ? 9   PRO A HD2  6  
ATOM 10098 H HD3  . PRO A 1 9   ? -5.210  -8.398  -6.177  1.00 0.00 ? 9   PRO A HD3  6  
ATOM 10099 N N    . HIS A 1 10  ? -2.987  -3.542  -7.283  1.00 0.00 ? 10  HIS A N    6  
ATOM 10100 C CA   . HIS A 1 10  ? -1.857  -2.771  -7.791  1.00 0.00 ? 10  HIS A CA   6  
ATOM 10101 C C    . HIS A 1 10  ? -1.938  -1.319  -7.329  1.00 0.00 ? 10  HIS A C    6  
ATOM 10102 O O    . HIS A 1 10  ? -3.027  -0.790  -7.100  1.00 0.00 ? 10  HIS A O    6  
ATOM 10103 C CB   . HIS A 1 10  ? -1.817  -2.832  -9.318  1.00 0.00 ? 10  HIS A CB   6  
ATOM 10104 C CG   . HIS A 1 10  ? -3.081  -2.365  -9.970  1.00 0.00 ? 10  HIS A CG   6  
ATOM 10105 N ND1  . HIS A 1 10  ? -4.256  -3.087  -9.938  1.00 0.00 ? 10  HIS A ND1  6  
ATOM 10106 C CD2  . HIS A 1 10  ? -3.352  -1.240  -10.672 1.00 0.00 ? 10  HIS A CD2  6  
ATOM 10107 C CE1  . HIS A 1 10  ? -5.194  -2.428  -10.594 1.00 0.00 ? 10  HIS A CE1  6  
ATOM 10108 N NE2  . HIS A 1 10  ? -4.671  -1.303  -11.049 1.00 0.00 ? 10  HIS A NE2  6  
ATOM 10109 H H    . HIS A 1 10  ? -3.843  -3.090  -7.128  1.00 0.00 ? 10  HIS A H    6  
ATOM 10110 H HA   . HIS A 1 10  ? -0.953  -3.211  -7.398  1.00 0.00 ? 10  HIS A HA   6  
ATOM 10111 H HB2  . HIS A 1 10  ? -1.010  -2.208  -9.675  1.00 0.00 ? 10  HIS A HB2  6  
ATOM 10112 H HB3  . HIS A 1 10  ? -1.640  -3.852  -9.627  1.00 0.00 ? 10  HIS A HB3  6  
ATOM 10113 H HD1  . HIS A 1 10  ? -4.382  -3.954  -9.501  1.00 0.00 ? 10  HIS A HD1  6  
ATOM 10114 H HD2  . HIS A 1 10  ? -2.660  -0.440  -10.896 1.00 0.00 ? 10  HIS A HD2  6  
ATOM 10115 H HE1  . HIS A 1 10  ? -6.214  -2.752  -10.734 1.00 0.00 ? 10  HIS A HE1  6  
ATOM 10116 N N    . LEU A 1 11  ? -0.781  -0.681  -7.194  1.00 0.00 ? 11  LEU A N    6  
ATOM 10117 C CA   . LEU A 1 11  ? -0.721  0.710   -6.759  1.00 0.00 ? 11  LEU A CA   6  
ATOM 10118 C C    . LEU A 1 11  ? -0.498  1.642   -7.945  1.00 0.00 ? 11  LEU A C    6  
ATOM 10119 O O    . LEU A 1 11  ? 0.322   1.366   -8.820  1.00 0.00 ? 11  LEU A O    6  
ATOM 10120 C CB   . LEU A 1 11  ? 0.398   0.896   -5.732  1.00 0.00 ? 11  LEU A CB   6  
ATOM 10121 C CG   . LEU A 1 11  ? 0.278   0.069   -4.451  1.00 0.00 ? 11  LEU A CG   6  
ATOM 10122 C CD1  . LEU A 1 11  ? 1.584   0.097   -3.673  1.00 0.00 ? 11  LEU A CD1  6  
ATOM 10123 C CD2  . LEU A 1 11  ? -0.868  0.582   -3.591  1.00 0.00 ? 11  LEU A CD2  6  
ATOM 10124 H H    . LEU A 1 11  ? 0.053   -1.156  -7.391  1.00 0.00 ? 11  LEU A H    6  
ATOM 10125 H HA   . LEU A 1 11  ? -1.666  0.954   -6.297  1.00 0.00 ? 11  LEU A HA   6  
ATOM 10126 H HB2  . LEU A 1 11  ? 1.330   0.633   -6.208  1.00 0.00 ? 11  LEU A HB2  6  
ATOM 10127 H HB3  . LEU A 1 11  ? 0.419   1.939   -5.453  1.00 0.00 ? 11  LEU A HB3  6  
ATOM 10128 H HG   . LEU A 1 11  ? 0.067   -0.959  -4.712  1.00 0.00 ? 11  LEU A HG   6  
ATOM 10129 H HD11 . LEU A 1 11  ? 1.528   0.851   -2.903  1.00 0.00 ? 11  LEU A HD11 6  
ATOM 10130 H HD12 . LEU A 1 11  ? 2.398   0.328   -4.345  1.00 0.00 ? 11  LEU A HD12 6  
ATOM 10131 H HD13 . LEU A 1 11  ? 1.754   -0.869  -3.221  1.00 0.00 ? 11  LEU A HD13 6  
ATOM 10132 H HD21 . LEU A 1 11  ? -1.039  -0.103  -2.773  1.00 0.00 ? 11  LEU A HD21 6  
ATOM 10133 H HD22 . LEU A 1 11  ? -1.763  0.656   -4.192  1.00 0.00 ? 11  LEU A HD22 6  
ATOM 10134 H HD23 . LEU A 1 11  ? -0.616  1.557   -3.200  1.00 0.00 ? 11  LEU A HD23 6  
ATOM 10135 N N    . VAL A 1 12  ? -1.233  2.750   -7.966  1.00 0.00 ? 12  VAL A N    6  
ATOM 10136 C CA   . VAL A 1 12  ? -1.113  3.726   -9.043  1.00 0.00 ? 12  VAL A CA   6  
ATOM 10137 C C    . VAL A 1 12  ? -0.447  5.006   -8.553  1.00 0.00 ? 12  VAL A C    6  
ATOM 10138 O O    . VAL A 1 12  ? -0.555  5.365   -7.381  1.00 0.00 ? 12  VAL A O    6  
ATOM 10139 C CB   . VAL A 1 12  ? -2.490  4.073   -9.641  1.00 0.00 ? 12  VAL A CB   6  
ATOM 10140 C CG1  . VAL A 1 12  ? -2.331  4.705   -11.015 1.00 0.00 ? 12  VAL A CG1  6  
ATOM 10141 C CG2  . VAL A 1 12  ? -3.367  2.832   -9.714  1.00 0.00 ? 12  VAL A CG2  6  
ATOM 10142 H H    . VAL A 1 12  ? -1.870  2.915   -7.240  1.00 0.00 ? 12  VAL A H    6  
ATOM 10143 H HA   . VAL A 1 12  ? -0.505  3.290   -9.822  1.00 0.00 ? 12  VAL A HA   6  
ATOM 10144 H HB   . VAL A 1 12  ? -2.971  4.791   -8.992  1.00 0.00 ? 12  VAL A HB   6  
ATOM 10145 H HG11 . VAL A 1 12  ? -1.751  5.612   -10.929 1.00 0.00 ? 12  VAL A HG11 6  
ATOM 10146 H HG12 . VAL A 1 12  ? -1.826  4.014   -11.674 1.00 0.00 ? 12  VAL A HG12 6  
ATOM 10147 H HG13 . VAL A 1 12  ? -3.305  4.940   -11.418 1.00 0.00 ? 12  VAL A HG13 6  
ATOM 10148 H HG21 . VAL A 1 12  ? -4.203  3.020   -10.370 1.00 0.00 ? 12  VAL A HG21 6  
ATOM 10149 H HG22 . VAL A 1 12  ? -2.788  2.005   -10.095 1.00 0.00 ? 12  VAL A HG22 6  
ATOM 10150 H HG23 . VAL A 1 12  ? -3.732  2.591   -8.726  1.00 0.00 ? 12  VAL A HG23 6  
ATOM 10151 N N    . ASN A 1 13  ? 0.243   5.692   -9.459  1.00 0.00 ? 13  ASN A N    6  
ATOM 10152 C CA   . ASN A 1 13  ? 0.928   6.934   -9.119  1.00 0.00 ? 13  ASN A CA   6  
ATOM 10153 C C    . ASN A 1 13  ? 0.014   8.136   -9.336  1.00 0.00 ? 13  ASN A C    6  
ATOM 10154 O O    . ASN A 1 13  ? 0.162   8.875   -10.310 1.00 0.00 ? 13  ASN A O    6  
ATOM 10155 C CB   . ASN A 1 13  ? 2.198   7.086   -9.958  1.00 0.00 ? 13  ASN A CB   6  
ATOM 10156 C CG   . ASN A 1 13  ? 3.369   6.316   -9.379  1.00 0.00 ? 13  ASN A CG   6  
ATOM 10157 O OD1  . ASN A 1 13  ? 3.554   5.134   -9.670  1.00 0.00 ? 13  ASN A OD1  6  
ATOM 10158 N ND2  . ASN A 1 13  ? 4.167   6.985   -8.555  1.00 0.00 ? 13  ASN A ND2  6  
ATOM 10159 H H    . ASN A 1 13  ? 0.293   5.355   -10.378 1.00 0.00 ? 13  ASN A H    6  
ATOM 10160 H HA   . ASN A 1 13  ? 1.200   6.887   -8.075  1.00 0.00 ? 13  ASN A HA   6  
ATOM 10161 H HB2  . ASN A 1 13  ? 2.009   6.719   -10.956 1.00 0.00 ? 13  ASN A HB2  6  
ATOM 10162 H HB3  . ASN A 1 13  ? 2.467   8.131   -10.008 1.00 0.00 ? 13  ASN A HB3  6  
ATOM 10163 H HD21 . ASN A 1 13  ? 3.959   7.924   -8.368  1.00 0.00 ? 13  ASN A HD21 6  
ATOM 10164 H HD22 . ASN A 1 13  ? 4.933   6.512   -8.167  1.00 0.00 ? 13  ASN A HD22 6  
ATOM 10165 N N    . LEU A 1 14  ? -0.930  8.327   -8.421  1.00 0.00 ? 14  LEU A N    6  
ATOM 10166 C CA   . LEU A 1 14  ? -1.868  9.441   -8.511  1.00 0.00 ? 14  LEU A CA   6  
ATOM 10167 C C    . LEU A 1 14  ? -1.219  10.739  -8.043  1.00 0.00 ? 14  LEU A C    6  
ATOM 10168 O O    . LEU A 1 14  ? -1.881  11.770  -7.928  1.00 0.00 ? 14  LEU A O    6  
ATOM 10169 C CB   . LEU A 1 14  ? -3.116  9.151   -7.674  1.00 0.00 ? 14  LEU A CB   6  
ATOM 10170 C CG   . LEU A 1 14  ? -2.891  8.978   -6.172  1.00 0.00 ? 14  LEU A CG   6  
ATOM 10171 C CD1  . LEU A 1 14  ? -4.163  9.297   -5.401  1.00 0.00 ? 14  LEU A CD1  6  
ATOM 10172 C CD2  . LEU A 1 14  ? -2.418  7.564   -5.863  1.00 0.00 ? 14  LEU A CD2  6  
ATOM 10173 H H    . LEU A 1 14  ? -0.999  7.706   -7.667  1.00 0.00 ? 14  LEU A H    6  
ATOM 10174 H HA   . LEU A 1 14  ? -2.156  9.549   -9.546  1.00 0.00 ? 14  LEU A HA   6  
ATOM 10175 H HB2  . LEU A 1 14  ? -3.804  9.970   -7.813  1.00 0.00 ? 14  LEU A HB2  6  
ATOM 10176 H HB3  . LEU A 1 14  ? -3.561  8.241   -8.051  1.00 0.00 ? 14  LEU A HB3  6  
ATOM 10177 H HG   . LEU A 1 14  ? -2.123  9.666   -5.847  1.00 0.00 ? 14  LEU A HG   6  
ATOM 10178 H HD11 . LEU A 1 14  ? -5.006  8.836   -5.893  1.00 0.00 ? 14  LEU A HD11 6  
ATOM 10179 H HD12 . LEU A 1 14  ? -4.305  10.367  -5.369  1.00 0.00 ? 14  LEU A HD12 6  
ATOM 10180 H HD13 . LEU A 1 14  ? -4.079  8.914   -4.395  1.00 0.00 ? 14  LEU A HD13 6  
ATOM 10181 H HD21 . LEU A 1 14  ? -3.002  7.159   -5.050  1.00 0.00 ? 14  LEU A HD21 6  
ATOM 10182 H HD22 . LEU A 1 14  ? -1.376  7.587   -5.582  1.00 0.00 ? 14  LEU A HD22 6  
ATOM 10183 H HD23 . LEU A 1 14  ? -2.541  6.944   -6.739  1.00 0.00 ? 14  LEU A HD23 6  
ATOM 10184 N N    . ASN A 1 15  ? 0.082   10.682  -7.777  1.00 0.00 ? 15  ASN A N    6  
ATOM 10185 C CA   . ASN A 1 15  ? 0.822   11.854  -7.323  1.00 0.00 ? 15  ASN A CA   6  
ATOM 10186 C C    . ASN A 1 15  ? 0.528   13.060  -8.210  1.00 0.00 ? 15  ASN A C    6  
ATOM 10187 O O    . ASN A 1 15  ? -0.215  12.958  -9.186  1.00 0.00 ? 15  ASN A O    6  
ATOM 10188 C CB   . ASN A 1 15  ? 2.325   11.564  -7.319  1.00 0.00 ? 15  ASN A CB   6  
ATOM 10189 C CG   . ASN A 1 15  ? 2.631   10.102  -7.058  1.00 0.00 ? 15  ASN A CG   6  
ATOM 10190 O OD1  . ASN A 1 15  ? 3.627   9.568   -7.546  1.00 0.00 ? 15  ASN A OD1  6  
ATOM 10191 N ND2  . ASN A 1 15  ? 1.773   9.447   -6.285  1.00 0.00 ? 15  ASN A ND2  6  
ATOM 10192 H H    . ASN A 1 15  ? 0.556   9.831   -7.888  1.00 0.00 ? 15  ASN A H    6  
ATOM 10193 H HA   . ASN A 1 15  ? 0.505   12.077  -6.316  1.00 0.00 ? 15  ASN A HA   6  
ATOM 10194 H HB2  . ASN A 1 15  ? 2.739   11.833  -8.280  1.00 0.00 ? 15  ASN A HB2  6  
ATOM 10195 H HB3  . ASN A 1 15  ? 2.797   12.156  -6.550  1.00 0.00 ? 15  ASN A HB3  6  
ATOM 10196 H HD21 . ASN A 1 15  ? 1.001   9.937   -5.931  1.00 0.00 ? 15  ASN A HD21 6  
ATOM 10197 H HD22 . ASN A 1 15  ? 1.947   8.501   -6.099  1.00 0.00 ? 15  ASN A HD22 6  
ATOM 10198 N N    . GLU A 1 16  ? 1.116   14.200  -7.864  1.00 0.00 ? 16  GLU A N    6  
ATOM 10199 C CA   . GLU A 1 16  ? 0.917   15.425  -8.629  1.00 0.00 ? 16  GLU A CA   6  
ATOM 10200 C C    . GLU A 1 16  ? 1.932   15.530  -9.764  1.00 0.00 ? 16  GLU A C    6  
ATOM 10201 O O    . GLU A 1 16  ? 1.996   16.542  -10.462 1.00 0.00 ? 16  GLU A O    6  
ATOM 10202 C CB   . GLU A 1 16  ? 1.029   16.648  -7.715  1.00 0.00 ? 16  GLU A CB   6  
ATOM 10203 C CG   . GLU A 1 16  ? 2.453   17.148  -7.540  1.00 0.00 ? 16  GLU A CG   6  
ATOM 10204 C CD   . GLU A 1 16  ? 2.600   18.086  -6.358  1.00 0.00 ? 16  GLU A CD   6  
ATOM 10205 O OE1  . GLU A 1 16  ? 1.632   18.810  -6.050  1.00 0.00 ? 16  GLU A OE1  6  
ATOM 10206 O OE2  . GLU A 1 16  ? 3.686   18.094  -5.740  1.00 0.00 ? 16  GLU A OE2  6  
ATOM 10207 H H    . GLU A 1 16  ? 1.698   14.218  -7.075  1.00 0.00 ? 16  GLU A H    6  
ATOM 10208 H HA   . GLU A 1 16  ? -0.076  15.394  -9.052  1.00 0.00 ? 16  GLU A HA   6  
ATOM 10209 H HB2  . GLU A 1 16  ? 0.436   17.449  -8.131  1.00 0.00 ? 16  GLU A HB2  6  
ATOM 10210 H HB3  . GLU A 1 16  ? 0.638   16.391  -6.742  1.00 0.00 ? 16  GLU A HB3  6  
ATOM 10211 H HG2  . GLU A 1 16  ? 3.103   16.299  -7.390  1.00 0.00 ? 16  GLU A HG2  6  
ATOM 10212 H HG3  . GLU A 1 16  ? 2.749   17.673  -8.436  1.00 0.00 ? 16  GLU A HG3  6  
ATOM 10213 N N    . ASP A 1 17  ? 2.723   14.477  -9.941  1.00 0.00 ? 17  ASP A N    6  
ATOM 10214 C CA   . ASP A 1 17  ? 3.735   14.449  -10.990 1.00 0.00 ? 17  ASP A CA   6  
ATOM 10215 C C    . ASP A 1 17  ? 3.322   13.509  -12.118 1.00 0.00 ? 17  ASP A C    6  
ATOM 10216 O O    . ASP A 1 17  ? 3.767   12.364  -12.200 1.00 0.00 ? 17  ASP A O    6  
ATOM 10217 C CB   . ASP A 1 17  ? 5.084   14.015  -10.416 1.00 0.00 ? 17  ASP A CB   6  
ATOM 10218 C CG   . ASP A 1 17  ? 6.251   14.473  -11.268 1.00 0.00 ? 17  ASP A CG   6  
ATOM 10219 O OD1  . ASP A 1 17  ? 6.008   15.130  -12.303 1.00 0.00 ? 17  ASP A OD1  6  
ATOM 10220 O OD2  . ASP A 1 17  ? 7.406   14.175  -10.901 1.00 0.00 ? 17  ASP A OD2  6  
ATOM 10221 H H    . ASP A 1 17  ? 2.623   13.700  -9.351  1.00 0.00 ? 17  ASP A H    6  
ATOM 10222 H HA   . ASP A 1 17  ? 3.828   15.449  -11.388 1.00 0.00 ? 17  ASP A HA   6  
ATOM 10223 H HB2  . ASP A 1 17  ? 5.199   14.435  -9.427  1.00 0.00 ? 17  ASP A HB2  6  
ATOM 10224 H HB3  . ASP A 1 17  ? 5.110   12.937  -10.350 1.00 0.00 ? 17  ASP A HB3  6  
ATOM 10225 N N    . PRO A 1 18  ? 2.449   14.001  -13.010 1.00 0.00 ? 18  PRO A N    6  
ATOM 10226 C CA   . PRO A 1 18  ? 1.956   13.221  -14.149 1.00 0.00 ? 18  PRO A CA   6  
ATOM 10227 C C    . PRO A 1 18  ? 3.037   12.977  -15.196 1.00 0.00 ? 18  PRO A C    6  
ATOM 10228 O O    . PRO A 1 18  ? 2.830   12.235  -16.156 1.00 0.00 ? 18  PRO A O    6  
ATOM 10229 C CB   . PRO A 1 18  ? 0.842   14.099  -14.725 1.00 0.00 ? 18  PRO A CB   6  
ATOM 10230 C CG   . PRO A 1 18  ? 1.201   15.485  -14.312 1.00 0.00 ? 18  PRO A CG   6  
ATOM 10231 C CD   . PRO A 1 18  ? 1.876   15.357  -12.974 1.00 0.00 ? 18  PRO A CD   6  
ATOM 10232 H HA   . PRO A 1 18  ? 1.543   12.274  -13.832 1.00 0.00 ? 18  PRO A HA   6  
ATOM 10233 H HB2  . PRO A 1 18  ? 0.822   13.999  -15.801 1.00 0.00 ? 18  PRO A HB2  6  
ATOM 10234 H HB3  . PRO A 1 18  ? -0.109  13.798  -14.312 1.00 0.00 ? 18  PRO A HB3  6  
ATOM 10235 H HG2  . PRO A 1 18  ? 1.876   15.920  -15.033 1.00 0.00 ? 18  PRO A HG2  6  
ATOM 10236 H HG3  . PRO A 1 18  ? 0.307   16.084  -14.224 1.00 0.00 ? 18  PRO A HG3  6  
ATOM 10237 H HD2  . PRO A 1 18  ? 2.652   16.101  -12.871 1.00 0.00 ? 18  PRO A HD2  6  
ATOM 10238 H HD3  . PRO A 1 18  ? 1.153   15.449  -12.177 1.00 0.00 ? 18  PRO A HD3  6  
ATOM 10239 N N    . LEU A 1 19  ? 4.192   13.606  -15.004 1.00 0.00 ? 19  LEU A N    6  
ATOM 10240 C CA   . LEU A 1 19  ? 5.307   13.457  -15.933 1.00 0.00 ? 19  LEU A CA   6  
ATOM 10241 C C    . LEU A 1 19  ? 6.427   12.631  -15.309 1.00 0.00 ? 19  LEU A C    6  
ATOM 10242 O O    . LEU A 1 19  ? 7.377   12.241  -15.989 1.00 0.00 ? 19  LEU A O    6  
ATOM 10243 C CB   . LEU A 1 19  ? 5.840   14.830  -16.346 1.00 0.00 ? 19  LEU A CB   6  
ATOM 10244 C CG   . LEU A 1 19  ? 4.803   15.950  -16.444 1.00 0.00 ? 19  LEU A CG   6  
ATOM 10245 C CD1  . LEU A 1 19  ? 5.481   17.280  -16.737 1.00 0.00 ? 19  LEU A CD1  6  
ATOM 10246 C CD2  . LEU A 1 19  ? 3.770   15.629  -17.514 1.00 0.00 ? 19  LEU A CD2  6  
ATOM 10247 H H    . LEU A 1 19  ? 4.298   14.185  -14.221 1.00 0.00 ? 19  LEU A H    6  
ATOM 10248 H HA   . LEU A 1 19  ? 4.942   12.943  -16.809 1.00 0.00 ? 19  LEU A HA   6  
ATOM 10249 H HB2  . LEU A 1 19  ? 6.581   15.129  -15.621 1.00 0.00 ? 19  LEU A HB2  6  
ATOM 10250 H HB3  . LEU A 1 19  ? 6.308   14.725  -17.314 1.00 0.00 ? 19  LEU A HB3  6  
ATOM 10251 H HG   . LEU A 1 19  ? 4.289   16.040  -15.497 1.00 0.00 ? 19  LEU A HG   6  
ATOM 10252 H HD11 . LEU A 1 19  ? 4.841   17.879  -17.366 1.00 0.00 ? 19  LEU A HD11 6  
ATOM 10253 H HD12 . LEU A 1 19  ? 6.419   17.103  -17.241 1.00 0.00 ? 19  LEU A HD12 6  
ATOM 10254 H HD13 . LEU A 1 19  ? 5.665   17.802  -15.809 1.00 0.00 ? 19  LEU A HD13 6  
ATOM 10255 H HD21 . LEU A 1 19  ? 4.268   15.240  -18.390 1.00 0.00 ? 19  LEU A HD21 6  
ATOM 10256 H HD22 . LEU A 1 19  ? 3.232   16.528  -17.775 1.00 0.00 ? 19  LEU A HD22 6  
ATOM 10257 H HD23 . LEU A 1 19  ? 3.078   14.891  -17.135 1.00 0.00 ? 19  LEU A HD23 6  
ATOM 10258 N N    . MET A 1 20  ? 6.309   12.366  -14.012 1.00 0.00 ? 20  MET A N    6  
ATOM 10259 C CA   . MET A 1 20  ? 7.310   11.582  -13.298 1.00 0.00 ? 20  MET A CA   6  
ATOM 10260 C C    . MET A 1 20  ? 7.896   10.499  -14.198 1.00 0.00 ? 20  MET A C    6  
ATOM 10261 O O    . MET A 1 20  ? 7.169   9.660   -14.729 1.00 0.00 ? 20  MET A O    6  
ATOM 10262 C CB   . MET A 1 20  ? 6.697   10.947  -12.049 1.00 0.00 ? 20  MET A CB   6  
ATOM 10263 C CG   . MET A 1 20  ? 5.924   9.669   -12.334 1.00 0.00 ? 20  MET A CG   6  
ATOM 10264 S SD   . MET A 1 20  ? 4.624   9.359   -11.124 1.00 0.00 ? 20  MET A SD   6  
ATOM 10265 C CE   . MET A 1 20  ? 3.231   9.030   -12.200 1.00 0.00 ? 20  MET A CE   6  
ATOM 10266 H H    . MET A 1 20  ? 5.530   12.704  -13.524 1.00 0.00 ? 20  MET A H    6  
ATOM 10267 H HA   . MET A 1 20  ? 8.102   12.252  -12.998 1.00 0.00 ? 20  MET A HA   6  
ATOM 10268 H HB2  . MET A 1 20  ? 7.488   10.716  -11.351 1.00 0.00 ? 20  MET A HB2  6  
ATOM 10269 H HB3  . MET A 1 20  ? 6.021   11.656  -11.594 1.00 0.00 ? 20  MET A HB3  6  
ATOM 10270 H HG2  . MET A 1 20  ? 5.474   9.747   -13.312 1.00 0.00 ? 20  MET A HG2  6  
ATOM 10271 H HG3  . MET A 1 20  ? 6.614   8.839   -12.323 1.00 0.00 ? 20  MET A HG3  6  
ATOM 10272 H HE1  . MET A 1 20  ? 3.130   7.964   -12.341 1.00 0.00 ? 20  MET A HE1  6  
ATOM 10273 H HE2  . MET A 1 20  ? 2.330   9.421   -11.752 1.00 0.00 ? 20  MET A HE2  6  
ATOM 10274 H HE3  . MET A 1 20  ? 3.394   9.507   -13.155 1.00 0.00 ? 20  MET A HE3  6  
ATOM 10275 N N    . SER A 1 21  ? 9.215   10.524  -14.365 1.00 0.00 ? 21  SER A N    6  
ATOM 10276 C CA   . SER A 1 21  ? 9.897   9.546   -15.204 1.00 0.00 ? 21  SER A CA   6  
ATOM 10277 C C    . SER A 1 21  ? 9.912   8.174   -14.538 1.00 0.00 ? 21  SER A C    6  
ATOM 10278 O O    . SER A 1 21  ? 10.414  7.203   -15.103 1.00 0.00 ? 21  SER A O    6  
ATOM 10279 C CB   . SER A 1 21  ? 11.329  10.001  -15.492 1.00 0.00 ? 21  SER A CB   6  
ATOM 10280 O OG   . SER A 1 21  ? 12.157  9.831   -14.355 1.00 0.00 ? 21  SER A OG   6  
ATOM 10281 H H    . SER A 1 21  ? 9.740   11.218  -13.915 1.00 0.00 ? 21  SER A H    6  
ATOM 10282 H HA   . SER A 1 21  ? 9.357   9.474   -16.137 1.00 0.00 ? 21  SER A HA   6  
ATOM 10283 H HB2  . SER A 1 21  ? 11.733  9.418   -16.306 1.00 0.00 ? 21  SER A HB2  6  
ATOM 10284 H HB3  . SER A 1 21  ? 11.324  11.046  -15.766 1.00 0.00 ? 21  SER A HB3  6  
ATOM 10285 H HG   . SER A 1 21  ? 12.791  10.551  -14.309 1.00 0.00 ? 21  SER A HG   6  
ATOM 10286 N N    . GLU A 1 22  ? 9.358   8.103   -13.331 1.00 0.00 ? 22  GLU A N    6  
ATOM 10287 C CA   . GLU A 1 22  ? 9.308   6.850   -12.587 1.00 0.00 ? 22  GLU A CA   6  
ATOM 10288 C C    . GLU A 1 22  ? 8.084   6.030   -12.983 1.00 0.00 ? 22  GLU A C    6  
ATOM 10289 O O    . GLU A 1 22  ? 7.197   6.518   -13.686 1.00 0.00 ? 22  GLU A O    6  
ATOM 10290 C CB   . GLU A 1 22  ? 9.285   7.126   -11.082 1.00 0.00 ? 22  GLU A CB   6  
ATOM 10291 C CG   . GLU A 1 22  ? 10.567  7.750   -10.558 1.00 0.00 ? 22  GLU A CG   6  
ATOM 10292 C CD   . GLU A 1 22  ? 11.755  6.813   -10.660 1.00 0.00 ? 22  GLU A CD   6  
ATOM 10293 O OE1  . GLU A 1 22  ? 11.846  5.876   -9.839  1.00 0.00 ? 22  GLU A OE1  6  
ATOM 10294 O OE2  . GLU A 1 22  ? 12.595  7.017   -11.561 1.00 0.00 ? 22  GLU A OE2  6  
ATOM 10295 H H    . GLU A 1 22  ? 8.974   8.912   -12.933 1.00 0.00 ? 22  GLU A H    6  
ATOM 10296 H HA   . GLU A 1 22  ? 10.197  6.286   -12.826 1.00 0.00 ? 22  GLU A HA   6  
ATOM 10297 H HB2  . GLU A 1 22  ? 8.467   7.797   -10.863 1.00 0.00 ? 22  GLU A HB2  6  
ATOM 10298 H HB3  . GLU A 1 22  ? 9.123   6.195   -10.560 1.00 0.00 ? 22  GLU A HB3  6  
ATOM 10299 H HG2  . GLU A 1 22  ? 10.780  8.640   -11.130 1.00 0.00 ? 22  GLU A HG2  6  
ATOM 10300 H HG3  . GLU A 1 22  ? 10.425  8.016   -9.520  1.00 0.00 ? 22  GLU A HG3  6  
ATOM 10301 N N    . CYS A 1 23  ? 8.042   4.783   -12.529 1.00 0.00 ? 23  CYS A N    6  
ATOM 10302 C CA   . CYS A 1 23  ? 6.928   3.893   -12.837 1.00 0.00 ? 23  CYS A CA   6  
ATOM 10303 C C    . CYS A 1 23  ? 5.595   4.563   -12.523 1.00 0.00 ? 23  CYS A C    6  
ATOM 10304 O O    . CYS A 1 23  ? 5.498   5.380   -11.606 1.00 0.00 ? 23  CYS A O    6  
ATOM 10305 C CB   . CYS A 1 23  ? 7.056   2.590   -12.047 1.00 0.00 ? 23  CYS A CB   6  
ATOM 10306 S SG   . CYS A 1 23  ? 8.467   1.568   -12.531 1.00 0.00 ? 23  CYS A SG   6  
ATOM 10307 H H    . CYS A 1 23  ? 8.779   4.451   -11.973 1.00 0.00 ? 23  CYS A H    6  
ATOM 10308 H HA   . CYS A 1 23  ? 6.965   3.670   -13.892 1.00 0.00 ? 23  CYS A HA   6  
ATOM 10309 H HB2  . CYS A 1 23  ? 7.164   2.822   -10.998 1.00 0.00 ? 23  CYS A HB2  6  
ATOM 10310 H HB3  . CYS A 1 23  ? 6.160   2.003   -12.188 1.00 0.00 ? 23  CYS A HB3  6  
ATOM 10311 H HG   . CYS A 1 23  ? 8.544   0.551   -11.687 1.00 0.00 ? 23  CYS A HG   6  
ATOM 10312 N N    . LEU A 1 24  ? 4.568   4.215   -13.291 1.00 0.00 ? 24  LEU A N    6  
ATOM 10313 C CA   . LEU A 1 24  ? 3.239   4.784   -13.096 1.00 0.00 ? 24  LEU A CA   6  
ATOM 10314 C C    . LEU A 1 24  ? 2.447   3.980   -12.071 1.00 0.00 ? 24  LEU A C    6  
ATOM 10315 O O    . LEU A 1 24  ? 1.766   4.545   -11.214 1.00 0.00 ? 24  LEU A O    6  
ATOM 10316 C CB   . LEU A 1 24  ? 2.481   4.825   -14.425 1.00 0.00 ? 24  LEU A CB   6  
ATOM 10317 C CG   . LEU A 1 24  ? 2.672   6.087   -15.267 1.00 0.00 ? 24  LEU A CG   6  
ATOM 10318 C CD1  . LEU A 1 24  ? 1.726   7.185   -14.806 1.00 0.00 ? 24  LEU A CD1  6  
ATOM 10319 C CD2  . LEU A 1 24  ? 4.116   6.562   -15.197 1.00 0.00 ? 24  LEU A CD2  6  
ATOM 10320 H H    . LEU A 1 24  ? 4.706   3.559   -14.006 1.00 0.00 ? 24  LEU A H    6  
ATOM 10321 H HA   . LEU A 1 24  ? 3.361   5.792   -12.729 1.00 0.00 ? 24  LEU A HA   6  
ATOM 10322 H HB2  . LEU A 1 24  ? 2.803   3.982   -15.015 1.00 0.00 ? 24  LEU A HB2  6  
ATOM 10323 H HB3  . LEU A 1 24  ? 1.427   4.729   -14.206 1.00 0.00 ? 24  LEU A HB3  6  
ATOM 10324 H HG   . LEU A 1 24  ? 2.443   5.861   -16.299 1.00 0.00 ? 24  LEU A HG   6  
ATOM 10325 H HD11 . LEU A 1 24  ? 0.721   6.950   -15.123 1.00 0.00 ? 24  LEU A HD11 6  
ATOM 10326 H HD12 . LEU A 1 24  ? 2.029   8.127   -15.240 1.00 0.00 ? 24  LEU A HD12 6  
ATOM 10327 H HD13 . LEU A 1 24  ? 1.757   7.258   -13.729 1.00 0.00 ? 24  LEU A HD13 6  
ATOM 10328 H HD21 . LEU A 1 24  ? 4.351   6.853   -14.185 1.00 0.00 ? 24  LEU A HD21 6  
ATOM 10329 H HD22 . LEU A 1 24  ? 4.249   7.407   -15.856 1.00 0.00 ? 24  LEU A HD22 6  
ATOM 10330 H HD23 . LEU A 1 24  ? 4.774   5.760   -15.503 1.00 0.00 ? 24  LEU A HD23 6  
ATOM 10331 N N    . LEU A 1 25  ? 2.542   2.658   -12.162 1.00 0.00 ? 25  LEU A N    6  
ATOM 10332 C CA   . LEU A 1 25  ? 1.836   1.774   -11.241 1.00 0.00 ? 25  LEU A CA   6  
ATOM 10333 C C    . LEU A 1 25  ? 2.646   0.511   -10.969 1.00 0.00 ? 25  LEU A C    6  
ATOM 10334 O O    . LEU A 1 25  ? 3.562   0.175   -11.721 1.00 0.00 ? 25  LEU A O    6  
ATOM 10335 C CB   . LEU A 1 25  ? 0.465   1.402   -11.809 1.00 0.00 ? 25  LEU A CB   6  
ATOM 10336 C CG   . LEU A 1 25  ? 0.420   0.153   -12.690 1.00 0.00 ? 25  LEU A CG   6  
ATOM 10337 C CD1  . LEU A 1 25  ? 0.157   -1.085  -11.848 1.00 0.00 ? 25  LEU A CD1  6  
ATOM 10338 C CD2  . LEU A 1 25  ? -0.641  0.301   -13.771 1.00 0.00 ? 25  LEU A CD2  6  
ATOM 10339 H H    . LEU A 1 25  ? 3.099   2.265   -12.866 1.00 0.00 ? 25  LEU A H    6  
ATOM 10340 H HA   . LEU A 1 25  ? 1.699   2.306   -10.311 1.00 0.00 ? 25  LEU A HA   6  
ATOM 10341 H HB2  . LEU A 1 25  ? -0.206  1.245   -10.978 1.00 0.00 ? 25  LEU A HB2  6  
ATOM 10342 H HB3  . LEU A 1 25  ? 0.115   2.238   -12.399 1.00 0.00 ? 25  LEU A HB3  6  
ATOM 10343 H HG   . LEU A 1 25  ? 1.378   0.029   -13.176 1.00 0.00 ? 25  LEU A HG   6  
ATOM 10344 H HD11 . LEU A 1 25  ? -0.356  -0.801  -10.941 1.00 0.00 ? 25  LEU A HD11 6  
ATOM 10345 H HD12 . LEU A 1 25  ? 1.096   -1.556  -11.598 1.00 0.00 ? 25  LEU A HD12 6  
ATOM 10346 H HD13 . LEU A 1 25  ? -0.455  -1.777  -12.407 1.00 0.00 ? 25  LEU A HD13 6  
ATOM 10347 H HD21 . LEU A 1 25  ? -0.839  1.349   -13.941 1.00 0.00 ? 25  LEU A HD21 6  
ATOM 10348 H HD22 . LEU A 1 25  ? -1.549  -0.190  -13.452 1.00 0.00 ? 25  LEU A HD22 6  
ATOM 10349 H HD23 . LEU A 1 25  ? -0.289  -0.153  -14.686 1.00 0.00 ? 25  LEU A HD23 6  
ATOM 10350 N N    . TYR A 1 26  ? 2.302   -0.186  -9.892  1.00 0.00 ? 26  TYR A N    6  
ATOM 10351 C CA   . TYR A 1 26  ? 2.997   -1.413  -9.521  1.00 0.00 ? 26  TYR A CA   6  
ATOM 10352 C C    . TYR A 1 26  ? 2.005   -2.527  -9.202  1.00 0.00 ? 26  TYR A C    6  
ATOM 10353 O O    . TYR A 1 26  ? 1.127   -2.367  -8.354  1.00 0.00 ? 26  TYR A O    6  
ATOM 10354 C CB   . TYR A 1 26  ? 3.906   -1.164  -8.316  1.00 0.00 ? 26  TYR A CB   6  
ATOM 10355 C CG   . TYR A 1 26  ? 5.181   -0.428  -8.661  1.00 0.00 ? 26  TYR A CG   6  
ATOM 10356 C CD1  . TYR A 1 26  ? 5.211   0.960   -8.721  1.00 0.00 ? 26  TYR A CD1  6  
ATOM 10357 C CD2  . TYR A 1 26  ? 6.356   -1.121  -8.927  1.00 0.00 ? 26  TYR A CD2  6  
ATOM 10358 C CE1  . TYR A 1 26  ? 6.374   1.636   -9.036  1.00 0.00 ? 26  TYR A CE1  6  
ATOM 10359 C CE2  . TYR A 1 26  ? 7.523   -0.452  -9.242  1.00 0.00 ? 26  TYR A CE2  6  
ATOM 10360 C CZ   . TYR A 1 26  ? 7.527   0.926   -9.296  1.00 0.00 ? 26  TYR A CZ   6  
ATOM 10361 O OH   . TYR A 1 26  ? 8.687   1.596   -9.609  1.00 0.00 ? 26  TYR A OH   6  
ATOM 10362 H H    . TYR A 1 26  ? 1.563   0.132   -9.332  1.00 0.00 ? 26  TYR A H    6  
ATOM 10363 H HA   . TYR A 1 26  ? 3.605   -1.717  -10.361 1.00 0.00 ? 26  TYR A HA   6  
ATOM 10364 H HB2  . TYR A 1 26  ? 3.372   -0.576  -7.586  1.00 0.00 ? 26  TYR A HB2  6  
ATOM 10365 H HB3  . TYR A 1 26  ? 4.179   -2.113  -7.878  1.00 0.00 ? 26  TYR A HB3  6  
ATOM 10366 H HD1  . TYR A 1 26  ? 4.306   1.513   -8.516  1.00 0.00 ? 26  TYR A HD1  6  
ATOM 10367 H HD2  . TYR A 1 26  ? 6.350   -2.200  -8.885  1.00 0.00 ? 26  TYR A HD2  6  
ATOM 10368 H HE1  . TYR A 1 26  ? 6.377   2.715   -9.078  1.00 0.00 ? 26  TYR A HE1  6  
ATOM 10369 H HE2  . TYR A 1 26  ? 8.427   -1.008  -9.446  1.00 0.00 ? 26  TYR A HE2  6  
ATOM 10370 H HH   . TYR A 1 26  ? 9.440   1.020   -9.458  1.00 0.00 ? 26  TYR A HH   6  
ATOM 10371 N N    . TYR A 1 27  ? 2.151   -3.655  -9.888  1.00 0.00 ? 27  TYR A N    6  
ATOM 10372 C CA   . TYR A 1 27  ? 1.268   -4.796  -9.680  1.00 0.00 ? 27  TYR A CA   6  
ATOM 10373 C C    . TYR A 1 27  ? 1.720   -5.624  -8.482  1.00 0.00 ? 27  TYR A C    6  
ATOM 10374 O O    . TYR A 1 27  ? 2.723   -6.336  -8.549  1.00 0.00 ? 27  TYR A O    6  
ATOM 10375 C CB   . TYR A 1 27  ? 1.228   -5.671  -10.934 1.00 0.00 ? 27  TYR A CB   6  
ATOM 10376 C CG   . TYR A 1 27  ? 0.335   -5.126  -12.026 1.00 0.00 ? 27  TYR A CG   6  
ATOM 10377 C CD1  . TYR A 1 27  ? -1.044  -5.279  -11.964 1.00 0.00 ? 27  TYR A CD1  6  
ATOM 10378 C CD2  . TYR A 1 27  ? 0.871   -4.456  -13.118 1.00 0.00 ? 27  TYR A CD2  6  
ATOM 10379 C CE1  . TYR A 1 27  ? -1.864  -4.783  -12.959 1.00 0.00 ? 27  TYR A CE1  6  
ATOM 10380 C CE2  . TYR A 1 27  ? 0.060   -3.955  -14.118 1.00 0.00 ? 27  TYR A CE2  6  
ATOM 10381 C CZ   . TYR A 1 27  ? -1.307  -4.121  -14.034 1.00 0.00 ? 27  TYR A CZ   6  
ATOM 10382 O OH   . TYR A 1 27  ? -2.120  -3.624  -15.027 1.00 0.00 ? 27  TYR A OH   6  
ATOM 10383 H H    . TYR A 1 27  ? 2.870   -3.722  -10.551 1.00 0.00 ? 27  TYR A H    6  
ATOM 10384 H HA   . TYR A 1 27  ? 0.275   -4.416  -9.487  1.00 0.00 ? 27  TYR A HA   6  
ATOM 10385 H HB2  . TYR A 1 27  ? 2.225   -5.759  -11.336 1.00 0.00 ? 27  TYR A HB2  6  
ATOM 10386 H HB3  . TYR A 1 27  ? 0.864   -6.653  -10.668 1.00 0.00 ? 27  TYR A HB3  6  
ATOM 10387 H HD1  . TYR A 1 27  ? -1.477  -5.797  -11.120 1.00 0.00 ? 27  TYR A HD1  6  
ATOM 10388 H HD2  . TYR A 1 27  ? 1.942   -4.327  -13.181 1.00 0.00 ? 27  TYR A HD2  6  
ATOM 10389 H HE1  . TYR A 1 27  ? -2.934  -4.913  -12.894 1.00 0.00 ? 27  TYR A HE1  6  
ATOM 10390 H HE2  . TYR A 1 27  ? 0.495   -3.437  -14.960 1.00 0.00 ? 27  TYR A HE2  6  
ATOM 10391 H HH   . TYR A 1 27  ? -2.721  -4.312  -15.323 1.00 0.00 ? 27  TYR A HH   6  
ATOM 10392 N N    . ILE A 1 28  ? 0.973   -5.527  -7.388  1.00 0.00 ? 28  ILE A N    6  
ATOM 10393 C CA   . ILE A 1 28  ? 1.295   -6.268  -6.175  1.00 0.00 ? 28  ILE A CA   6  
ATOM 10394 C C    . ILE A 1 28  ? 1.072   -7.764  -6.369  1.00 0.00 ? 28  ILE A C    6  
ATOM 10395 O O    . ILE A 1 28  ? -0.028  -8.200  -6.710  1.00 0.00 ? 28  ILE A O    6  
ATOM 10396 C CB   . ILE A 1 28  ? 0.453   -5.785  -4.979  1.00 0.00 ? 28  ILE A CB   6  
ATOM 10397 C CG1  . ILE A 1 28  ? 0.697   -4.296  -4.723  1.00 0.00 ? 28  ILE A CG1  6  
ATOM 10398 C CG2  . ILE A 1 28  ? 0.778   -6.602  -3.738  1.00 0.00 ? 28  ILE A CG2  6  
ATOM 10399 C CD1  . ILE A 1 28  ? 0.328   -3.855  -3.324  1.00 0.00 ? 28  ILE A CD1  6  
ATOM 10400 H H    . ILE A 1 28  ? 0.186   -4.943  -7.396  1.00 0.00 ? 28  ILE A H    6  
ATOM 10401 H HA   . ILE A 1 28  ? 2.338   -6.097  -5.947  1.00 0.00 ? 28  ILE A HA   6  
ATOM 10402 H HB   . ILE A 1 28  ? -0.589  -5.936  -5.217  1.00 0.00 ? 28  ILE A HB   6  
ATOM 10403 H HG12 . ILE A 1 28  ? 1.742   -4.078  -4.874  1.00 0.00 ? 28  ILE A HG12 6  
ATOM 10404 H HG13 . ILE A 1 28  ? 0.108   -3.718  -5.421  1.00 0.00 ? 28  ILE A HG13 6  
ATOM 10405 H HG21 . ILE A 1 28  ? -0.127  -6.775  -3.174  1.00 0.00 ? 28  ILE A HG21 6  
ATOM 10406 H HG22 . ILE A 1 28  ? 1.205   -7.549  -4.032  1.00 0.00 ? 28  ILE A HG22 6  
ATOM 10407 H HG23 . ILE A 1 28  ? 1.485   -6.062  -3.126  1.00 0.00 ? 28  ILE A HG23 6  
ATOM 10408 H HD11 . ILE A 1 28  ? -0.120  -2.873  -3.363  1.00 0.00 ? 28  ILE A HD11 6  
ATOM 10409 H HD12 . ILE A 1 28  ? -0.378  -4.554  -2.900  1.00 0.00 ? 28  ILE A HD12 6  
ATOM 10410 H HD13 . ILE A 1 28  ? 1.215   -3.822  -2.711  1.00 0.00 ? 28  ILE A HD13 6  
ATOM 10411 N N    . LYS A 1 29  ? 2.122   -8.547  -6.147  1.00 0.00 ? 29  LYS A N    6  
ATOM 10412 C CA   . LYS A 1 29  ? 2.042   -9.995  -6.294  1.00 0.00 ? 29  LYS A CA   6  
ATOM 10413 C C    . LYS A 1 29  ? 1.546   -10.646 -5.006  1.00 0.00 ? 29  LYS A C    6  
ATOM 10414 O O    . LYS A 1 29  ? 1.630   -10.056 -3.929  1.00 0.00 ? 29  LYS A O    6  
ATOM 10415 C CB   . LYS A 1 29  ? 3.410   -10.567 -6.673  1.00 0.00 ? 29  LYS A CB   6  
ATOM 10416 C CG   . LYS A 1 29  ? 4.577   -9.771  -6.114  1.00 0.00 ? 29  LYS A CG   6  
ATOM 10417 C CD   . LYS A 1 29  ? 5.008   -8.669  -7.068  1.00 0.00 ? 29  LYS A CD   6  
ATOM 10418 C CE   . LYS A 1 29  ? 5.991   -7.714  -6.408  1.00 0.00 ? 29  LYS A CE   6  
ATOM 10419 N NZ   . LYS A 1 29  ? 5.337   -6.881  -5.361  1.00 0.00 ? 29  LYS A NZ   6  
ATOM 10420 H H    . LYS A 1 29  ? 2.973   -8.140  -5.877  1.00 0.00 ? 29  LYS A H    6  
ATOM 10421 H HA   . LYS A 1 29  ? 1.340   -10.210 -7.085  1.00 0.00 ? 29  LYS A HA   6  
ATOM 10422 H HB2  . LYS A 1 29  ? 3.480   -11.578 -6.300  1.00 0.00 ? 29  LYS A HB2  6  
ATOM 10423 H HB3  . LYS A 1 29  ? 3.494   -10.582 -7.750  1.00 0.00 ? 29  LYS A HB3  6  
ATOM 10424 H HG2  . LYS A 1 29  ? 4.282   -9.326  -5.176  1.00 0.00 ? 29  LYS A HG2  6  
ATOM 10425 H HG3  . LYS A 1 29  ? 5.411   -10.439 -5.951  1.00 0.00 ? 29  LYS A HG3  6  
ATOM 10426 H HD2  . LYS A 1 29  ? 5.480   -9.115  -7.930  1.00 0.00 ? 29  LYS A HD2  6  
ATOM 10427 H HD3  . LYS A 1 29  ? 4.134   -8.114  -7.380  1.00 0.00 ? 29  LYS A HD3  6  
ATOM 10428 H HE2  . LYS A 1 29  ? 6.783   -8.290  -5.955  1.00 0.00 ? 29  LYS A HE2  6  
ATOM 10429 H HE3  . LYS A 1 29  ? 6.405   -7.065  -7.165  1.00 0.00 ? 29  LYS A HE3  6  
ATOM 10430 H HZ1  . LYS A 1 29  ? 5.951   -6.082  -5.105  1.00 0.00 ? 29  LYS A HZ1  6  
ATOM 10431 H HZ2  . LYS A 1 29  ? 5.158   -7.453  -4.510  1.00 0.00 ? 29  LYS A HZ2  6  
ATOM 10432 H HZ3  . LYS A 1 29  ? 4.431   -6.511  -5.712  1.00 0.00 ? 29  LYS A HZ3  6  
ATOM 10433 N N    . ASP A 1 30  ? 1.031   -11.865 -5.125  1.00 0.00 ? 30  ASP A N    6  
ATOM 10434 C CA   . ASP A 1 30  ? 0.524   -12.597 -3.970  1.00 0.00 ? 30  ASP A CA   6  
ATOM 10435 C C    . ASP A 1 30  ? 1.644   -12.885 -2.975  1.00 0.00 ? 30  ASP A C    6  
ATOM 10436 O O    . ASP A 1 30  ? 2.142   -14.006 -2.893  1.00 0.00 ? 30  ASP A O    6  
ATOM 10437 C CB   . ASP A 1 30  ? -0.129  -13.906 -4.416  1.00 0.00 ? 30  ASP A CB   6  
ATOM 10438 C CG   . ASP A 1 30  ? 0.507   -14.472 -5.670  1.00 0.00 ? 30  ASP A CG   6  
ATOM 10439 O OD1  . ASP A 1 30  ? 0.316   -13.879 -6.752  1.00 0.00 ? 30  ASP A OD1  6  
ATOM 10440 O OD2  . ASP A 1 30  ? 1.196   -15.510 -5.570  1.00 0.00 ? 30  ASP A OD2  6  
ATOM 10441 H H    . ASP A 1 30  ? 0.991   -12.282 -6.011  1.00 0.00 ? 30  ASP A H    6  
ATOM 10442 H HA   . ASP A 1 30  ? -0.220  -11.981 -3.487  1.00 0.00 ? 30  ASP A HA   6  
ATOM 10443 H HB2  . ASP A 1 30  ? -0.033  -14.636 -3.625  1.00 0.00 ? 30  ASP A HB2  6  
ATOM 10444 H HB3  . ASP A 1 30  ? -1.176  -13.730 -4.612  1.00 0.00 ? 30  ASP A HB3  6  
ATOM 10445 N N    . GLY A 1 31  ? 2.036   -11.862 -2.221  1.00 0.00 ? 31  GLY A N    6  
ATOM 10446 C CA   . GLY A 1 31  ? 3.095   -12.026 -1.242  1.00 0.00 ? 31  GLY A CA   6  
ATOM 10447 C C    . GLY A 1 31  ? 3.261   -10.806 -0.358  1.00 0.00 ? 31  GLY A C    6  
ATOM 10448 O O    . GLY A 1 31  ? 2.306   -10.355 0.275   1.00 0.00 ? 31  GLY A O    6  
ATOM 10449 H H    . GLY A 1 31  ? 1.603   -10.990 -2.330  1.00 0.00 ? 31  GLY A H    6  
ATOM 10450 H HA2  . GLY A 1 31  ? 2.868   -12.880 -0.622  1.00 0.00 ? 31  GLY A HA2  6  
ATOM 10451 H HA3  . GLY A 1 31  ? 4.025   -12.208 -1.762  1.00 0.00 ? 31  GLY A HA3  6  
ATOM 10452 N N    . ILE A 1 32  ? 4.477   -10.271 -0.312  1.00 0.00 ? 32  ILE A N    6  
ATOM 10453 C CA   . ILE A 1 32  ? 4.764   -9.097  0.502   1.00 0.00 ? 32  ILE A CA   6  
ATOM 10454 C C    . ILE A 1 32  ? 5.532   -8.049  -0.296  1.00 0.00 ? 32  ILE A C    6  
ATOM 10455 O O    . ILE A 1 32  ? 6.688   -8.259  -0.667  1.00 0.00 ? 32  ILE A O    6  
ATOM 10456 C CB   . ILE A 1 32  ? 5.576   -9.467  1.757   1.00 0.00 ? 32  ILE A CB   6  
ATOM 10457 C CG1  . ILE A 1 32  ? 4.640   -9.902  2.887   1.00 0.00 ? 32  ILE A CG1  6  
ATOM 10458 C CG2  . ILE A 1 32  ? 6.436   -8.292  2.198   1.00 0.00 ? 32  ILE A CG2  6  
ATOM 10459 C CD1  . ILE A 1 32  ? 3.872   -8.757  3.510   1.00 0.00 ? 32  ILE A CD1  6  
ATOM 10460 H H    . ILE A 1 32  ? 5.197   -10.676 -0.839  1.00 0.00 ? 32  ILE A H    6  
ATOM 10461 H HA   . ILE A 1 32  ? 3.822   -8.673  0.819   1.00 0.00 ? 32  ILE A HA   6  
ATOM 10462 H HB   . ILE A 1 32  ? 6.231   -10.287 1.506   1.00 0.00 ? 32  ILE A HB   6  
ATOM 10463 H HG12 . ILE A 1 32  ? 3.923   -10.609 2.500   1.00 0.00 ? 32  ILE A HG12 6  
ATOM 10464 H HG13 . ILE A 1 32  ? 5.222   -10.375 3.665   1.00 0.00 ? 32  ILE A HG13 6  
ATOM 10465 H HG21 . ILE A 1 32  ? 6.886   -8.513  3.154   1.00 0.00 ? 32  ILE A HG21 6  
ATOM 10466 H HG22 . ILE A 1 32  ? 7.212   -8.120  1.467   1.00 0.00 ? 32  ILE A HG22 6  
ATOM 10467 H HG23 . ILE A 1 32  ? 5.821   -7.408  2.285   1.00 0.00 ? 32  ILE A HG23 6  
ATOM 10468 H HD11 . ILE A 1 32  ? 4.568   -8.025  3.896   1.00 0.00 ? 32  ILE A HD11 6  
ATOM 10469 H HD12 . ILE A 1 32  ? 3.244   -8.296  2.763   1.00 0.00 ? 32  ILE A HD12 6  
ATOM 10470 H HD13 . ILE A 1 32  ? 3.260   -9.131  4.317   1.00 0.00 ? 32  ILE A HD13 6  
ATOM 10471 N N    . THR A 1 33  ? 4.884   -6.918  -0.557  1.00 0.00 ? 33  THR A N    6  
ATOM 10472 C CA   . THR A 1 33  ? 5.506   -5.837  -1.310  1.00 0.00 ? 33  THR A CA   6  
ATOM 10473 C C    . THR A 1 33  ? 6.084   -4.779  -0.377  1.00 0.00 ? 33  THR A C    6  
ATOM 10474 O O    . THR A 1 33  ? 5.381   -3.865  0.053   1.00 0.00 ? 33  THR A O    6  
ATOM 10475 C CB   . THR A 1 33  ? 4.500   -5.167  -2.266  1.00 0.00 ? 33  THR A CB   6  
ATOM 10476 O OG1  . THR A 1 33  ? 4.087   -6.098  -3.273  1.00 0.00 ? 33  THR A OG1  6  
ATOM 10477 C CG2  . THR A 1 33  ? 5.113   -3.940  -2.923  1.00 0.00 ? 33  THR A CG2  6  
ATOM 10478 H H    . THR A 1 33  ? 3.965   -6.811  -0.234  1.00 0.00 ? 33  THR A H    6  
ATOM 10479 H HA   . THR A 1 33  ? 6.306   -6.259  -1.901  1.00 0.00 ? 33  THR A HA   6  
ATOM 10480 H HB   . THR A 1 33  ? 3.636   -4.858  -1.695  1.00 0.00 ? 33  THR A HB   6  
ATOM 10481 H HG1  . THR A 1 33  ? 4.165   -6.993  -2.933  1.00 0.00 ? 33  THR A HG1  6  
ATOM 10482 H HG21 . THR A 1 33  ? 5.854   -4.250  -3.643  1.00 0.00 ? 33  THR A HG21 6  
ATOM 10483 H HG22 . THR A 1 33  ? 5.579   -3.323  -2.169  1.00 0.00 ? 33  THR A HG22 6  
ATOM 10484 H HG23 . THR A 1 33  ? 4.340   -3.375  -3.423  1.00 0.00 ? 33  THR A HG23 6  
ATOM 10485 N N    . ARG A 1 34  ? 7.371   -4.909  -0.069  1.00 0.00 ? 34  ARG A N    6  
ATOM 10486 C CA   . ARG A 1 34  ? 8.044   -3.964  0.814   1.00 0.00 ? 34  ARG A CA   6  
ATOM 10487 C C    . ARG A 1 34  ? 8.110   -2.578  0.178   1.00 0.00 ? 34  ARG A C    6  
ATOM 10488 O O    . ARG A 1 34  ? 8.584   -2.422  -0.948  1.00 0.00 ? 34  ARG A O    6  
ATOM 10489 C CB   . ARG A 1 34  ? 9.456   -4.454  1.140   1.00 0.00 ? 34  ARG A CB   6  
ATOM 10490 C CG   . ARG A 1 34  ? 9.483   -5.789  1.867   1.00 0.00 ? 34  ARG A CG   6  
ATOM 10491 C CD   . ARG A 1 34  ? 10.902  -6.320  2.002   1.00 0.00 ? 34  ARG A CD   6  
ATOM 10492 N NE   . ARG A 1 34  ? 10.939  -7.780  2.027   1.00 0.00 ? 34  ARG A NE   6  
ATOM 10493 C CZ   . ARG A 1 34  ? 10.748  -8.539  0.954   1.00 0.00 ? 34  ARG A CZ   6  
ATOM 10494 N NH1  . ARG A 1 34  ? 10.508  -7.979  -0.224  1.00 0.00 ? 34  ARG A NH1  6  
ATOM 10495 N NH2  . ARG A 1 34  ? 10.797  -9.861  1.057   1.00 0.00 ? 34  ARG A NH2  6  
ATOM 10496 H H    . ARG A 1 34  ? 7.879   -5.659  -0.443  1.00 0.00 ? 34  ARG A H    6  
ATOM 10497 H HA   . ARG A 1 34  ? 7.474   -3.900  1.728   1.00 0.00 ? 34  ARG A HA   6  
ATOM 10498 H HB2  . ARG A 1 34  ? 10.010  -4.560  0.219   1.00 0.00 ? 34  ARG A HB2  6  
ATOM 10499 H HB3  . ARG A 1 34  ? 9.944   -3.720  1.762   1.00 0.00 ? 34  ARG A HB3  6  
ATOM 10500 H HG2  . ARG A 1 34  ? 9.064   -5.659  2.854   1.00 0.00 ? 34  ARG A HG2  6  
ATOM 10501 H HG3  . ARG A 1 34  ? 8.892   -6.502  1.313   1.00 0.00 ? 34  ARG A HG3  6  
ATOM 10502 H HD2  . ARG A 1 34  ? 11.484  -5.970  1.163   1.00 0.00 ? 34  ARG A HD2  6  
ATOM 10503 H HD3  . ARG A 1 34  ? 11.328  -5.942  2.919   1.00 0.00 ? 34  ARG A HD3  6  
ATOM 10504 H HE   . ARG A 1 34  ? 11.115  -8.215  2.887   1.00 0.00 ? 34  ARG A HE   6  
ATOM 10505 H HH11 . ARG A 1 34  ? 10.471  -6.983  -0.305  1.00 0.00 ? 34  ARG A HH11 6  
ATOM 10506 H HH12 . ARG A 1 34  ? 10.365  -8.553  -1.031  1.00 0.00 ? 34  ARG A HH12 6  
ATOM 10507 H HH21 . ARG A 1 34  ? 10.978  -10.287 1.943   1.00 0.00 ? 34  ARG A HH21 6  
ATOM 10508 H HH22 . ARG A 1 34  ? 10.653  -10.431 0.249   1.00 0.00 ? 34  ARG A HH22 6  
ATOM 10509 N N    . VAL A 1 35  ? 7.630   -1.575  0.906   1.00 0.00 ? 35  VAL A N    6  
ATOM 10510 C CA   . VAL A 1 35  ? 7.635   -0.202  0.414   1.00 0.00 ? 35  VAL A CA   6  
ATOM 10511 C C    . VAL A 1 35  ? 8.608   0.662   1.207   1.00 0.00 ? 35  VAL A C    6  
ATOM 10512 O O    . VAL A 1 35  ? 8.257   1.216   2.248   1.00 0.00 ? 35  VAL A O    6  
ATOM 10513 C CB   . VAL A 1 35  ? 6.231   0.425   0.487   1.00 0.00 ? 35  VAL A CB   6  
ATOM 10514 C CG1  . VAL A 1 35  ? 6.216   1.784   -0.196  1.00 0.00 ? 35  VAL A CG1  6  
ATOM 10515 C CG2  . VAL A 1 35  ? 5.199   -0.504  -0.135  1.00 0.00 ? 35  VAL A CG2  6  
ATOM 10516 H H    . VAL A 1 35  ? 7.265   -1.762  1.796   1.00 0.00 ? 35  VAL A H    6  
ATOM 10517 H HA   . VAL A 1 35  ? 7.945   -0.220  -0.621  1.00 0.00 ? 35  VAL A HA   6  
ATOM 10518 H HB   . VAL A 1 35  ? 5.976   0.567   1.527   1.00 0.00 ? 35  VAL A HB   6  
ATOM 10519 H HG11 . VAL A 1 35  ? 6.502   2.546   0.515   1.00 0.00 ? 35  VAL A HG11 6  
ATOM 10520 H HG12 . VAL A 1 35  ? 6.913   1.780   -1.021  1.00 0.00 ? 35  VAL A HG12 6  
ATOM 10521 H HG13 . VAL A 1 35  ? 5.222   1.992   -0.564  1.00 0.00 ? 35  VAL A HG13 6  
ATOM 10522 H HG21 . VAL A 1 35  ? 5.571   -0.874  -1.079  1.00 0.00 ? 35  VAL A HG21 6  
ATOM 10523 H HG22 . VAL A 1 35  ? 5.015   -1.334  0.531   1.00 0.00 ? 35  VAL A HG22 6  
ATOM 10524 H HG23 . VAL A 1 35  ? 4.278   0.037   -0.299  1.00 0.00 ? 35  VAL A HG23 6  
ATOM 10525 N N    . GLY A 1 36  ? 9.835   0.775   0.707   1.00 0.00 ? 36  GLY A N    6  
ATOM 10526 C CA   . GLY A 1 36  ? 10.841  1.575   1.381   1.00 0.00 ? 36  GLY A CA   6  
ATOM 10527 C C    . GLY A 1 36  ? 12.045  1.852   0.503   1.00 0.00 ? 36  GLY A C    6  
ATOM 10528 O O    . GLY A 1 36  ? 11.901  2.140   -0.684  1.00 0.00 ? 36  GLY A O    6  
ATOM 10529 H H    . GLY A 1 36  ? 10.059  0.311   -0.127  1.00 0.00 ? 36  GLY A H    6  
ATOM 10530 H HA2  . GLY A 1 36  ? 10.399  2.515   1.677   1.00 0.00 ? 36  GLY A HA2  6  
ATOM 10531 H HA3  . GLY A 1 36  ? 11.169  1.049   2.266   1.00 0.00 ? 36  GLY A HA3  6  
ATOM 10532 N N    . GLN A 1 37  ? 13.235  1.768   1.090   1.00 0.00 ? 37  GLN A N    6  
ATOM 10533 C CA   . GLN A 1 37  ? 14.469  2.015   0.353   1.00 0.00 ? 37  GLN A CA   6  
ATOM 10534 C C    . GLN A 1 37  ? 15.017  0.722   -0.240  1.00 0.00 ? 37  GLN A C    6  
ATOM 10535 O O    . GLN A 1 37  ? 14.629  -0.373  0.168   1.00 0.00 ? 37  GLN A O    6  
ATOM 10536 C CB   . GLN A 1 37  ? 15.514  2.655   1.267   1.00 0.00 ? 37  GLN A CB   6  
ATOM 10537 C CG   . GLN A 1 37  ? 15.301  4.144   1.487   1.00 0.00 ? 37  GLN A CG   6  
ATOM 10538 C CD   . GLN A 1 37  ? 15.138  4.908   0.187   1.00 0.00 ? 37  GLN A CD   6  
ATOM 10539 O OE1  . GLN A 1 37  ? 16.120  5.298   -0.444  1.00 0.00 ? 37  GLN A OE1  6  
ATOM 10540 N NE2  . GLN A 1 37  ? 13.893  5.126   -0.219  1.00 0.00 ? 37  GLN A NE2  6  
ATOM 10541 H H    . GLN A 1 37  ? 13.284  1.535   2.040   1.00 0.00 ? 37  GLN A H    6  
ATOM 10542 H HA   . GLN A 1 37  ? 14.242  2.698   -0.453  1.00 0.00 ? 37  GLN A HA   6  
ATOM 10543 H HB2  . GLN A 1 37  ? 15.484  2.163   2.228   1.00 0.00 ? 37  GLN A HB2  6  
ATOM 10544 H HB3  . GLN A 1 37  ? 16.492  2.514   0.830   1.00 0.00 ? 37  GLN A HB3  6  
ATOM 10545 H HG2  . GLN A 1 37  ? 14.411  4.284   2.082   1.00 0.00 ? 37  GLN A HG2  6  
ATOM 10546 H HG3  . GLN A 1 37  ? 16.154  4.542   2.017   1.00 0.00 ? 37  GLN A HG3  6  
ATOM 10547 H HE21 . GLN A 1 37  ? 13.159  4.787   0.336   1.00 0.00 ? 37  GLN A HE21 6  
ATOM 10548 H HE22 . GLN A 1 37  ? 13.758  5.618   -1.055  1.00 0.00 ? 37  GLN A HE22 6  
ATOM 10549 N N    . ALA A 1 38  ? 15.922  0.855   -1.204  1.00 0.00 ? 38  ALA A N    6  
ATOM 10550 C CA   . ALA A 1 38  ? 16.525  -0.303  -1.851  1.00 0.00 ? 38  ALA A CA   6  
ATOM 10551 C C    . ALA A 1 38  ? 17.773  -0.762  -1.104  1.00 0.00 ? 38  ALA A C    6  
ATOM 10552 O O    . ALA A 1 38  ? 18.161  -1.928  -1.181  1.00 0.00 ? 38  ALA A O    6  
ATOM 10553 C CB   . ALA A 1 38  ? 16.863  0.018   -3.299  1.00 0.00 ? 38  ALA A CB   6  
ATOM 10554 H H    . ALA A 1 38  ? 16.192  1.754   -1.485  1.00 0.00 ? 38  ALA A H    6  
ATOM 10555 H HA   . ALA A 1 38  ? 15.800  -1.104  -1.846  1.00 0.00 ? 38  ALA A HA   6  
ATOM 10556 H HB1  . ALA A 1 38  ? 16.036  -0.264  -3.933  1.00 0.00 ? 38  ALA A HB1  6  
ATOM 10557 H HB2  . ALA A 1 38  ? 17.048  1.078   -3.398  1.00 0.00 ? 38  ALA A HB2  6  
ATOM 10558 H HB3  . ALA A 1 38  ? 17.746  -0.530  -3.593  1.00 0.00 ? 38  ALA A HB3  6  
ATOM 10559 N N    . ASP A 1 39  ? 18.398  0.162   -0.382  1.00 0.00 ? 39  ASP A N    6  
ATOM 10560 C CA   . ASP A 1 39  ? 19.602  -0.148  0.380   1.00 0.00 ? 39  ASP A CA   6  
ATOM 10561 C C    . ASP A 1 39  ? 19.260  -0.934  1.641   1.00 0.00 ? 39  ASP A C    6  
ATOM 10562 O O    . ASP A 1 39  ? 20.116  -1.601  2.220   1.00 0.00 ? 39  ASP A O    6  
ATOM 10563 C CB   . ASP A 1 39  ? 20.342  1.138   0.750   1.00 0.00 ? 39  ASP A CB   6  
ATOM 10564 C CG   . ASP A 1 39  ? 21.176  1.677   -0.395  1.00 0.00 ? 39  ASP A CG   6  
ATOM 10565 O OD1  . ASP A 1 39  ? 21.144  1.073   -1.487  1.00 0.00 ? 39  ASP A OD1  6  
ATOM 10566 O OD2  . ASP A 1 39  ? 21.862  2.703   -0.199  1.00 0.00 ? 39  ASP A OD2  6  
ATOM 10567 H H    . ASP A 1 39  ? 18.040  1.074   -0.360  1.00 0.00 ? 39  ASP A H    6  
ATOM 10568 H HA   . ASP A 1 39  ? 20.242  -0.753  -0.244  1.00 0.00 ? 39  ASP A HA   6  
ATOM 10569 H HB2  . ASP A 1 39  ? 19.621  1.892   1.032   1.00 0.00 ? 39  ASP A HB2  6  
ATOM 10570 H HB3  . ASP A 1 39  ? 20.995  0.941   1.587   1.00 0.00 ? 39  ASP A HB3  6  
ATOM 10571 N N    . ALA A 1 40  ? 18.002  -0.850  2.062   1.00 0.00 ? 40  ALA A N    6  
ATOM 10572 C CA   . ALA A 1 40  ? 17.546  -1.554  3.254   1.00 0.00 ? 40  ALA A CA   6  
ATOM 10573 C C    . ALA A 1 40  ? 18.244  -2.903  3.396   1.00 0.00 ? 40  ALA A C    6  
ATOM 10574 O O    . ALA A 1 40  ? 18.657  -3.505  2.405   1.00 0.00 ? 40  ALA A O    6  
ATOM 10575 C CB   . ALA A 1 40  ? 16.037  -1.741  3.212   1.00 0.00 ? 40  ALA A CB   6  
ATOM 10576 H H    . ALA A 1 40  ? 17.365  -0.302  1.557   1.00 0.00 ? 40  ALA A H    6  
ATOM 10577 H HA   . ALA A 1 40  ? 17.785  -0.945  4.113   1.00 0.00 ? 40  ALA A HA   6  
ATOM 10578 H HB1  . ALA A 1 40  ? 15.554  -0.776  3.233   1.00 0.00 ? 40  ALA A HB1  6  
ATOM 10579 H HB2  . ALA A 1 40  ? 15.764  -2.260  2.304   1.00 0.00 ? 40  ALA A HB2  6  
ATOM 10580 H HB3  . ALA A 1 40  ? 15.722  -2.321  4.067   1.00 0.00 ? 40  ALA A HB3  6  
ATOM 10581 N N    . GLU A 1 41  ? 18.373  -3.370  4.633   1.00 0.00 ? 41  GLU A N    6  
ATOM 10582 C CA   . GLU A 1 41  ? 19.023  -4.647  4.903   1.00 0.00 ? 41  GLU A CA   6  
ATOM 10583 C C    . GLU A 1 41  ? 18.743  -5.647  3.785   1.00 0.00 ? 41  GLU A C    6  
ATOM 10584 O O    . GLU A 1 41  ? 19.629  -6.394  3.369   1.00 0.00 ? 41  GLU A O    6  
ATOM 10585 C CB   . GLU A 1 41  ? 18.546  -5.215  6.241   1.00 0.00 ? 41  GLU A CB   6  
ATOM 10586 C CG   . GLU A 1 41  ? 17.126  -4.813  6.602   1.00 0.00 ? 41  GLU A CG   6  
ATOM 10587 C CD   . GLU A 1 41  ? 16.473  -5.782  7.568   1.00 0.00 ? 41  GLU A CD   6  
ATOM 10588 O OE1  . GLU A 1 41  ? 16.919  -5.852  8.732   1.00 0.00 ? 41  GLU A OE1  6  
ATOM 10589 O OE2  . GLU A 1 41  ? 15.514  -6.471  7.159   1.00 0.00 ? 41  GLU A OE2  6  
ATOM 10590 H H    . GLU A 1 41  ? 18.023  -2.844  5.382   1.00 0.00 ? 41  GLU A H    6  
ATOM 10591 H HA   . GLU A 1 41  ? 20.087  -4.473  4.955   1.00 0.00 ? 41  GLU A HA   6  
ATOM 10592 H HB2  . GLU A 1 41  ? 18.594  -6.293  6.199   1.00 0.00 ? 41  GLU A HB2  6  
ATOM 10593 H HB3  . GLU A 1 41  ? 19.206  -4.865  7.022   1.00 0.00 ? 41  GLU A HB3  6  
ATOM 10594 H HG2  . GLU A 1 41  ? 17.147  -3.834  7.057   1.00 0.00 ? 41  GLU A HG2  6  
ATOM 10595 H HG3  . GLU A 1 41  ? 16.536  -4.776  5.698   1.00 0.00 ? 41  GLU A HG3  6  
ATOM 10596 N N    . ARG A 1 42  ? 17.504  -5.656  3.304   1.00 0.00 ? 42  ARG A N    6  
ATOM 10597 C CA   . ARG A 1 42  ? 17.106  -6.565  2.236   1.00 0.00 ? 42  ARG A CA   6  
ATOM 10598 C C    . ARG A 1 42  ? 16.582  -5.790  1.030   1.00 0.00 ? 42  ARG A C    6  
ATOM 10599 O O    . ARG A 1 42  ? 16.511  -4.561  1.052   1.00 0.00 ? 42  ARG A O    6  
ATOM 10600 C CB   . ARG A 1 42  ? 16.034  -7.535  2.736   1.00 0.00 ? 42  ARG A CB   6  
ATOM 10601 C CG   . ARG A 1 42  ? 16.552  -8.547  3.746   1.00 0.00 ? 42  ARG A CG   6  
ATOM 10602 C CD   . ARG A 1 42  ? 17.180  -9.749  3.058   1.00 0.00 ? 42  ARG A CD   6  
ATOM 10603 N NE   . ARG A 1 42  ? 18.463  -9.420  2.443   1.00 0.00 ? 42  ARG A NE   6  
ATOM 10604 C CZ   . ARG A 1 42  ? 19.598  -9.311  3.124   1.00 0.00 ? 42  ARG A CZ   6  
ATOM 10605 N NH1  . ARG A 1 42  ? 19.609  -9.504  4.436   1.00 0.00 ? 42  ARG A NH1  6  
ATOM 10606 N NH2  . ARG A 1 42  ? 20.725  -9.009  2.493   1.00 0.00 ? 42  ARG A NH2  6  
ATOM 10607 H H    . ARG A 1 42  ? 16.842  -5.037  3.676   1.00 0.00 ? 42  ARG A H    6  
ATOM 10608 H HA   . ARG A 1 42  ? 17.977  -7.128  1.936   1.00 0.00 ? 42  ARG A HA   6  
ATOM 10609 H HB2  . ARG A 1 42  ? 15.241  -6.969  3.202   1.00 0.00 ? 42  ARG A HB2  6  
ATOM 10610 H HB3  . ARG A 1 42  ? 15.633  -8.075  1.892   1.00 0.00 ? 42  ARG A HB3  6  
ATOM 10611 H HG2  . ARG A 1 42  ? 17.298  -8.072  4.367   1.00 0.00 ? 42  ARG A HG2  6  
ATOM 10612 H HG3  . ARG A 1 42  ? 15.730  -8.882  4.360   1.00 0.00 ? 42  ARG A HG3  6  
ATOM 10613 H HD2  . ARG A 1 42  ? 17.332  -10.527 3.791   1.00 0.00 ? 42  ARG A HD2  6  
ATOM 10614 H HD3  . ARG A 1 42  ? 16.504  -10.102 2.293   1.00 0.00 ? 42  ARG A HD3  6  
ATOM 10615 H HE   . ARG A 1 42  ? 18.478  -9.274  1.474   1.00 0.00 ? 42  ARG A HE   6  
ATOM 10616 H HH11 . ARG A 1 42  ? 18.761  -9.732  4.914   1.00 0.00 ? 42  ARG A HH11 6  
ATOM 10617 H HH12 . ARG A 1 42  ? 20.465  -9.422  4.946   1.00 0.00 ? 42  ARG A HH12 6  
ATOM 10618 H HH21 . ARG A 1 42  ? 20.721  -8.863  1.504   1.00 0.00 ? 42  ARG A HH21 6  
ATOM 10619 H HH22 . ARG A 1 42  ? 21.579  -8.926  3.006   1.00 0.00 ? 42  ARG A HH22 6  
ATOM 10620 N N    . ARG A 1 43  ? 16.218  -6.517  -0.021  1.00 0.00 ? 43  ARG A N    6  
ATOM 10621 C CA   . ARG A 1 43  ? 15.702  -5.899  -1.237  1.00 0.00 ? 43  ARG A CA   6  
ATOM 10622 C C    . ARG A 1 43  ? 14.190  -5.711  -1.153  1.00 0.00 ? 43  ARG A C    6  
ATOM 10623 O O    . ARG A 1 43  ? 13.439  -6.682  -1.068  1.00 0.00 ? 43  ARG A O    6  
ATOM 10624 C CB   . ARG A 1 43  ? 16.054  -6.752  -2.457  1.00 0.00 ? 43  ARG A CB   6  
ATOM 10625 C CG   . ARG A 1 43  ? 15.408  -6.268  -3.745  1.00 0.00 ? 43  ARG A CG   6  
ATOM 10626 C CD   . ARG A 1 43  ? 15.377  -7.364  -4.799  1.00 0.00 ? 43  ARG A CD   6  
ATOM 10627 N NE   . ARG A 1 43  ? 15.367  -6.819  -6.154  1.00 0.00 ? 43  ARG A NE   6  
ATOM 10628 C CZ   . ARG A 1 43  ? 16.452  -6.365  -6.772  1.00 0.00 ? 43  ARG A CZ   6  
ATOM 10629 N NH1  . ARG A 1 43  ? 17.627  -6.391  -6.159  1.00 0.00 ? 43  ARG A NH1  6  
ATOM 10630 N NH2  . ARG A 1 43  ? 16.362  -5.885  -8.006  1.00 0.00 ? 43  ARG A NH2  6  
ATOM 10631 H H    . ARG A 1 43  ? 16.298  -7.493  0.021   1.00 0.00 ? 43  ARG A H    6  
ATOM 10632 H HA   . ARG A 1 43  ? 16.168  -4.930  -1.339  1.00 0.00 ? 43  ARG A HA   6  
ATOM 10633 H HB2  . ARG A 1 43  ? 17.126  -6.742  -2.592  1.00 0.00 ? 43  ARG A HB2  6  
ATOM 10634 H HB3  . ARG A 1 43  ? 15.731  -7.766  -2.277  1.00 0.00 ? 43  ARG A HB3  6  
ATOM 10635 H HG2  . ARG A 1 43  ? 14.395  -5.958  -3.534  1.00 0.00 ? 43  ARG A HG2  6  
ATOM 10636 H HG3  . ARG A 1 43  ? 15.971  -5.429  -4.126  1.00 0.00 ? 43  ARG A HG3  6  
ATOM 10637 H HD2  . ARG A 1 43  ? 16.251  -7.986  -4.678  1.00 0.00 ? 43  ARG A HD2  6  
ATOM 10638 H HD3  . ARG A 1 43  ? 14.489  -7.959  -4.653  1.00 0.00 ? 43  ARG A HD3  6  
ATOM 10639 H HE   . ARG A 1 43  ? 14.509  -6.791  -6.626  1.00 0.00 ? 43  ARG A HE   6  
ATOM 10640 H HH11 . ARG A 1 43  ? 17.698  -6.753  -5.230  1.00 0.00 ? 43  ARG A HH11 6  
ATOM 10641 H HH12 . ARG A 1 43  ? 18.443  -6.049  -6.627  1.00 0.00 ? 43  ARG A HH12 6  
ATOM 10642 H HH21 . ARG A 1 43  ? 15.478  -5.865  -8.471  1.00 0.00 ? 43  ARG A HH21 6  
ATOM 10643 H HH22 . ARG A 1 43  ? 17.179  -5.544  -8.470  1.00 0.00 ? 43  ARG A HH22 6  
ATOM 10644 N N    . GLN A 1 44  ? 13.753  -4.456  -1.176  1.00 0.00 ? 44  GLN A N    6  
ATOM 10645 C CA   . GLN A 1 44  ? 12.331  -4.142  -1.101  1.00 0.00 ? 44  GLN A CA   6  
ATOM 10646 C C    . GLN A 1 44  ? 11.694  -4.166  -2.487  1.00 0.00 ? 44  GLN A C    6  
ATOM 10647 O O    . GLN A 1 44  ? 12.381  -4.026  -3.499  1.00 0.00 ? 44  GLN A O    6  
ATOM 10648 C CB   . GLN A 1 44  ? 12.124  -2.771  -0.455  1.00 0.00 ? 44  GLN A CB   6  
ATOM 10649 C CG   . GLN A 1 44  ? 12.954  -2.558  0.800   1.00 0.00 ? 44  GLN A CG   6  
ATOM 10650 C CD   . GLN A 1 44  ? 12.833  -3.706  1.782   1.00 0.00 ? 44  GLN A CD   6  
ATOM 10651 O OE1  . GLN A 1 44  ? 13.408  -4.776  1.579   1.00 0.00 ? 44  GLN A OE1  6  
ATOM 10652 N NE2  . GLN A 1 44  ? 12.082  -3.490  2.856   1.00 0.00 ? 44  GLN A NE2  6  
ATOM 10653 H H    . GLN A 1 44  ? 14.401  -3.725  -1.245  1.00 0.00 ? 44  GLN A H    6  
ATOM 10654 H HA   . GLN A 1 44  ? 11.858  -4.894  -0.488  1.00 0.00 ? 44  GLN A HA   6  
ATOM 10655 H HB2  . GLN A 1 44  ? 12.387  -2.006  -1.170  1.00 0.00 ? 44  GLN A HB2  6  
ATOM 10656 H HB3  . GLN A 1 44  ? 11.081  -2.664  -0.193  1.00 0.00 ? 44  GLN A HB3  6  
ATOM 10657 H HG2  . GLN A 1 44  ? 13.992  -2.455  0.517   1.00 0.00 ? 44  GLN A HG2  6  
ATOM 10658 H HG3  . GLN A 1 44  ? 12.624  -1.651  1.285   1.00 0.00 ? 44  GLN A HG3  6  
ATOM 10659 H HE21 . GLN A 1 44  ? 11.653  -2.613  2.952   1.00 0.00 ? 44  GLN A HE21 6  
ATOM 10660 H HE22 . GLN A 1 44  ? 11.986  -4.215  3.507   1.00 0.00 ? 44  GLN A HE22 6  
ATOM 10661 N N    . ASP A 1 45  ? 10.379  -4.345  -2.524  1.00 0.00 ? 45  ASP A N    6  
ATOM 10662 C CA   . ASP A 1 45  ? 9.649   -4.386  -3.786  1.00 0.00 ? 45  ASP A CA   6  
ATOM 10663 C C    . ASP A 1 45  ? 9.597   -3.004  -4.430  1.00 0.00 ? 45  ASP A C    6  
ATOM 10664 O O    . ASP A 1 45  ? 10.129  -2.797  -5.521  1.00 0.00 ? 45  ASP A O    6  
ATOM 10665 C CB   . ASP A 1 45  ? 8.230   -4.912  -3.562  1.00 0.00 ? 45  ASP A CB   6  
ATOM 10666 C CG   . ASP A 1 45  ? 8.201   -6.402  -3.286  1.00 0.00 ? 45  ASP A CG   6  
ATOM 10667 O OD1  . ASP A 1 45  ? 9.088   -6.887  -2.552  1.00 0.00 ? 45  ASP A OD1  6  
ATOM 10668 O OD2  . ASP A 1 45  ? 7.292   -7.084  -3.804  1.00 0.00 ? 45  ASP A OD2  6  
ATOM 10669 H H    . ASP A 1 45  ? 9.886   -4.450  -1.683  1.00 0.00 ? 45  ASP A H    6  
ATOM 10670 H HA   . ASP A 1 45  ? 10.171  -5.059  -4.449  1.00 0.00 ? 45  ASP A HA   6  
ATOM 10671 H HB2  . ASP A 1 45  ? 7.793   -4.400  -2.717  1.00 0.00 ? 45  ASP A HB2  6  
ATOM 10672 H HB3  . ASP A 1 45  ? 7.637   -4.715  -4.443  1.00 0.00 ? 45  ASP A HB3  6  
ATOM 10673 N N    . ILE A 1 46  ? 8.952   -2.064  -3.748  1.00 0.00 ? 46  ILE A N    6  
ATOM 10674 C CA   . ILE A 1 46  ? 8.831   -0.702  -4.254  1.00 0.00 ? 46  ILE A CA   6  
ATOM 10675 C C    . ILE A 1 46  ? 9.849   0.222   -3.594  1.00 0.00 ? 46  ILE A C    6  
ATOM 10676 O O    . ILE A 1 46  ? 9.728   0.555   -2.415  1.00 0.00 ? 46  ILE A O    6  
ATOM 10677 C CB   . ILE A 1 46  ? 7.417   -0.139  -4.021  1.00 0.00 ? 46  ILE A CB   6  
ATOM 10678 C CG1  . ILE A 1 46  ? 6.433   -0.738  -5.029  1.00 0.00 ? 46  ILE A CG1  6  
ATOM 10679 C CG2  . ILE A 1 46  ? 7.428   1.379   -4.122  1.00 0.00 ? 46  ILE A CG2  6  
ATOM 10680 C CD1  . ILE A 1 46  ? 4.995   -0.704  -4.562  1.00 0.00 ? 46  ILE A CD1  6  
ATOM 10681 H H    . ILE A 1 46  ? 8.549   -2.290  -2.885  1.00 0.00 ? 46  ILE A H    6  
ATOM 10682 H HA   . ILE A 1 46  ? 9.018   -0.724  -5.318  1.00 0.00 ? 46  ILE A HA   6  
ATOM 10683 H HB   . ILE A 1 46  ? 7.106   -0.407  -3.023  1.00 0.00 ? 46  ILE A HB   6  
ATOM 10684 H HG12 . ILE A 1 46  ? 6.495   -0.187  -5.954  1.00 0.00 ? 46  ILE A HG12 6  
ATOM 10685 H HG13 . ILE A 1 46  ? 6.700   -1.769  -5.210  1.00 0.00 ? 46  ILE A HG13 6  
ATOM 10686 H HG21 . ILE A 1 46  ? 6.417   1.739   -4.243  1.00 0.00 ? 46  ILE A HG21 6  
ATOM 10687 H HG22 . ILE A 1 46  ? 7.853   1.797   -3.222  1.00 0.00 ? 46  ILE A HG22 6  
ATOM 10688 H HG23 . ILE A 1 46  ? 8.021   1.679   -4.973  1.00 0.00 ? 46  ILE A HG23 6  
ATOM 10689 H HD11 . ILE A 1 46  ? 4.711   0.316   -4.345  1.00 0.00 ? 46  ILE A HD11 6  
ATOM 10690 H HD12 . ILE A 1 46  ? 4.355   -1.096  -5.339  1.00 0.00 ? 46  ILE A HD12 6  
ATOM 10691 H HD13 . ILE A 1 46  ? 4.890   -1.304  -3.671  1.00 0.00 ? 46  ILE A HD13 6  
ATOM 10692 N N    . VAL A 1 47  ? 10.852  0.635   -4.364  1.00 0.00 ? 47  VAL A N    6  
ATOM 10693 C CA   . VAL A 1 47  ? 11.890  1.523   -3.855  1.00 0.00 ? 47  VAL A CA   6  
ATOM 10694 C C    . VAL A 1 47  ? 11.540  2.984   -4.118  1.00 0.00 ? 47  VAL A C    6  
ATOM 10695 O O    . VAL A 1 47  ? 11.327  3.386   -5.263  1.00 0.00 ? 47  VAL A O    6  
ATOM 10696 C CB   . VAL A 1 47  ? 13.257  1.211   -4.492  1.00 0.00 ? 47  VAL A CB   6  
ATOM 10697 C CG1  . VAL A 1 47  ? 14.369  1.943   -3.755  1.00 0.00 ? 47  VAL A CG1  6  
ATOM 10698 C CG2  . VAL A 1 47  ? 13.510  -0.289  -4.501  1.00 0.00 ? 47  VAL A CG2  6  
ATOM 10699 H H    . VAL A 1 47  ? 10.894  0.335   -5.295  1.00 0.00 ? 47  VAL A H    6  
ATOM 10700 H HA   . VAL A 1 47  ? 11.969  1.368   -2.789  1.00 0.00 ? 47  VAL A HA   6  
ATOM 10701 H HB   . VAL A 1 47  ? 13.243  1.559   -5.514  1.00 0.00 ? 47  VAL A HB   6  
ATOM 10702 H HG11 . VAL A 1 47  ? 14.372  1.642   -2.718  1.00 0.00 ? 47  VAL A HG11 6  
ATOM 10703 H HG12 . VAL A 1 47  ? 15.320  1.699   -4.205  1.00 0.00 ? 47  VAL A HG12 6  
ATOM 10704 H HG13 . VAL A 1 47  ? 14.203  3.008   -3.820  1.00 0.00 ? 47  VAL A HG13 6  
ATOM 10705 H HG21 . VAL A 1 47  ? 14.044  -0.570  -3.606  1.00 0.00 ? 47  VAL A HG21 6  
ATOM 10706 H HG22 . VAL A 1 47  ? 12.566  -0.812  -4.538  1.00 0.00 ? 47  VAL A HG22 6  
ATOM 10707 H HG23 . VAL A 1 47  ? 14.099  -0.550  -5.369  1.00 0.00 ? 47  VAL A HG23 6  
ATOM 10708 N N    . LEU A 1 48  ? 11.484  3.774   -3.052  1.00 0.00 ? 48  LEU A N    6  
ATOM 10709 C CA   . LEU A 1 48  ? 11.161  5.192   -3.167  1.00 0.00 ? 48  LEU A CA   6  
ATOM 10710 C C    . LEU A 1 48  ? 12.427  6.042   -3.143  1.00 0.00 ? 48  LEU A C    6  
ATOM 10711 O O    . LEU A 1 48  ? 13.535  5.522   -3.007  1.00 0.00 ? 48  LEU A O    6  
ATOM 10712 C CB   . LEU A 1 48  ? 10.227  5.616   -2.033  1.00 0.00 ? 48  LEU A CB   6  
ATOM 10713 C CG   . LEU A 1 48  ? 8.997   4.735   -1.812  1.00 0.00 ? 48  LEU A CG   6  
ATOM 10714 C CD1  . LEU A 1 48  ? 8.432   4.263   -3.143  1.00 0.00 ? 48  LEU A CD1  6  
ATOM 10715 C CD2  . LEU A 1 48  ? 9.344   3.546   -0.927  1.00 0.00 ? 48  LEU A CD2  6  
ATOM 10716 H H    . LEU A 1 48  ? 11.664  3.396   -2.166  1.00 0.00 ? 48  LEU A H    6  
ATOM 10717 H HA   . LEU A 1 48  ? 10.660  5.342   -4.111  1.00 0.00 ? 48  LEU A HA   6  
ATOM 10718 H HB2  . LEU A 1 48  ? 10.799  5.620   -1.117  1.00 0.00 ? 48  LEU A HB2  6  
ATOM 10719 H HB3  . LEU A 1 48  ? 9.883   6.618   -2.245  1.00 0.00 ? 48  LEU A HB3  6  
ATOM 10720 H HG   . LEU A 1 48  ? 8.232   5.313   -1.311  1.00 0.00 ? 48  LEU A HG   6  
ATOM 10721 H HD11 . LEU A 1 48  ? 8.301   5.111   -3.798  1.00 0.00 ? 48  LEU A HD11 6  
ATOM 10722 H HD12 . LEU A 1 48  ? 7.478   3.784   -2.979  1.00 0.00 ? 48  LEU A HD12 6  
ATOM 10723 H HD13 . LEU A 1 48  ? 9.115   3.559   -3.594  1.00 0.00 ? 48  LEU A HD13 6  
ATOM 10724 H HD21 . LEU A 1 48  ? 9.485   2.669   -1.541  1.00 0.00 ? 48  LEU A HD21 6  
ATOM 10725 H HD22 . LEU A 1 48  ? 8.540   3.371   -0.228  1.00 0.00 ? 48  LEU A HD22 6  
ATOM 10726 H HD23 . LEU A 1 48  ? 10.254  3.756   -0.383  1.00 0.00 ? 48  LEU A HD23 6  
ATOM 10727 N N    . SER A 1 49  ? 12.256  7.354   -3.272  1.00 0.00 ? 49  SER A N    6  
ATOM 10728 C CA   . SER A 1 49  ? 13.384  8.277   -3.267  1.00 0.00 ? 49  SER A CA   6  
ATOM 10729 C C    . SER A 1 49  ? 13.251  9.292   -2.135  1.00 0.00 ? 49  SER A C    6  
ATOM 10730 O O    . SER A 1 49  ? 12.279  9.274   -1.382  1.00 0.00 ? 49  SER A O    6  
ATOM 10731 C CB   . SER A 1 49  ? 13.482  9.004   -4.609  1.00 0.00 ? 49  SER A CB   6  
ATOM 10732 O OG   . SER A 1 49  ? 14.573  9.909   -4.621  1.00 0.00 ? 49  SER A OG   6  
ATOM 10733 H H    . SER A 1 49  ? 11.348  7.709   -3.377  1.00 0.00 ? 49  SER A H    6  
ATOM 10734 H HA   . SER A 1 49  ? 14.284  7.700   -3.113  1.00 0.00 ? 49  SER A HA   6  
ATOM 10735 H HB2  . SER A 1 49  ? 13.623  8.281   -5.398  1.00 0.00 ? 49  SER A HB2  6  
ATOM 10736 H HB3  . SER A 1 49  ? 12.570  9.556   -4.784  1.00 0.00 ? 49  SER A HB3  6  
ATOM 10737 H HG   . SER A 1 49  ? 14.883  10.026  -5.522  1.00 0.00 ? 49  SER A HG   6  
ATOM 10738 N N    . GLY A 1 50  ? 14.238  10.176  -2.022  1.00 0.00 ? 50  GLY A N    6  
ATOM 10739 C CA   . GLY A 1 50  ? 14.213  11.186  -0.980  1.00 0.00 ? 50  GLY A CA   6  
ATOM 10740 C C    . GLY A 1 50  ? 14.921  10.735  0.281   1.00 0.00 ? 50  GLY A C    6  
ATOM 10741 O O    . GLY A 1 50  ? 15.542  9.673   0.307   1.00 0.00 ? 50  GLY A O    6  
ATOM 10742 H H    . GLY A 1 50  ? 14.988  10.142  -2.651  1.00 0.00 ? 50  GLY A H    6  
ATOM 10743 H HA2  . GLY A 1 50  ? 14.692  12.080  -1.350  1.00 0.00 ? 50  GLY A HA2  6  
ATOM 10744 H HA3  . GLY A 1 50  ? 13.184  11.413  -0.740  1.00 0.00 ? 50  GLY A HA3  6  
ATOM 10745 N N    . ALA A 1 51  ? 14.830  11.545  1.331   1.00 0.00 ? 51  ALA A N    6  
ATOM 10746 C CA   . ALA A 1 51  ? 15.467  11.223  2.602   1.00 0.00 ? 51  ALA A CA   6  
ATOM 10747 C C    . ALA A 1 51  ? 14.433  11.080  3.714   1.00 0.00 ? 51  ALA A C    6  
ATOM 10748 O O    . ALA A 1 51  ? 14.757  10.663  4.827   1.00 0.00 ? 51  ALA A O    6  
ATOM 10749 C CB   . ALA A 1 51  ? 16.491  12.289  2.964   1.00 0.00 ? 51  ALA A CB   6  
ATOM 10750 H H    . ALA A 1 51  ? 14.321  12.378  1.249   1.00 0.00 ? 51  ALA A H    6  
ATOM 10751 H HA   . ALA A 1 51  ? 15.988  10.283  2.486   1.00 0.00 ? 51  ALA A HA   6  
ATOM 10752 H HB1  . ALA A 1 51  ? 16.625  12.309  4.035   1.00 0.00 ? 51  ALA A HB1  6  
ATOM 10753 H HB2  . ALA A 1 51  ? 17.432  12.059  2.487   1.00 0.00 ? 51  ALA A HB2  6  
ATOM 10754 H HB3  . ALA A 1 51  ? 16.141  13.253  2.627   1.00 0.00 ? 51  ALA A HB3  6  
ATOM 10755 N N    . HIS A 1 52  ? 13.188  11.429  3.406   1.00 0.00 ? 52  HIS A N    6  
ATOM 10756 C CA   . HIS A 1 52  ? 12.106  11.339  4.381   1.00 0.00 ? 52  HIS A CA   6  
ATOM 10757 C C    . HIS A 1 52  ? 11.440  9.968   4.328   1.00 0.00 ? 52  HIS A C    6  
ATOM 10758 O O    . HIS A 1 52  ? 10.219  9.855   4.445   1.00 0.00 ? 52  HIS A O    6  
ATOM 10759 C CB   . HIS A 1 52  ? 11.069  12.433  4.124   1.00 0.00 ? 52  HIS A CB   6  
ATOM 10760 C CG   . HIS A 1 52  ? 11.570  13.814  4.417   1.00 0.00 ? 52  HIS A CG   6  
ATOM 10761 N ND1  . HIS A 1 52  ? 11.905  14.240  5.685   1.00 0.00 ? 52  HIS A ND1  6  
ATOM 10762 C CD2  . HIS A 1 52  ? 11.794  14.867  3.596   1.00 0.00 ? 52  HIS A CD2  6  
ATOM 10763 C CE1  . HIS A 1 52  ? 12.311  15.496  5.632   1.00 0.00 ? 52  HIS A CE1  6  
ATOM 10764 N NE2  . HIS A 1 52  ? 12.254  15.900  4.376   1.00 0.00 ? 52  HIS A NE2  6  
ATOM 10765 H H    . HIS A 1 52  ? 12.992  11.754  2.503   1.00 0.00 ? 52  HIS A H    6  
ATOM 10766 H HA   . HIS A 1 52  ? 12.532  11.482  5.362   1.00 0.00 ? 52  HIS A HA   6  
ATOM 10767 H HB2  . HIS A 1 52  ? 10.771  12.402  3.087   1.00 0.00 ? 52  HIS A HB2  6  
ATOM 10768 H HB3  . HIS A 1 52  ? 10.205  12.254  4.747   1.00 0.00 ? 52  HIS A HB3  6  
ATOM 10769 H HD2  . HIS A 1 52  ? 11.639  14.891  2.527   1.00 0.00 ? 52  HIS A HD2  6  
ATOM 10770 H HE1  . HIS A 1 52  ? 12.636  16.091  6.472   1.00 0.00 ? 52  HIS A HE1  6  
ATOM 10771 H HE2  . HIS A 1 52  ? 12.418  16.816  4.070   1.00 0.00 ? 52  HIS A HE2  6  
ATOM 10772 N N    . ILE A 1 53  ? 12.249  8.929   4.151   1.00 0.00 ? 53  ILE A N    6  
ATOM 10773 C CA   . ILE A 1 53  ? 11.738  7.566   4.084   1.00 0.00 ? 53  ILE A CA   6  
ATOM 10774 C C    . ILE A 1 53  ? 12.579  6.620   4.934   1.00 0.00 ? 53  ILE A C    6  
ATOM 10775 O O    . ILE A 1 53  ? 13.713  6.935   5.296   1.00 0.00 ? 53  ILE A O    6  
ATOM 10776 C CB   . ILE A 1 53  ? 11.709  7.046   2.634   1.00 0.00 ? 53  ILE A CB   6  
ATOM 10777 C CG1  . ILE A 1 53  ? 10.953  8.026   1.733   1.00 0.00 ? 53  ILE A CG1  6  
ATOM 10778 C CG2  . ILE A 1 53  ? 11.070  5.667   2.579   1.00 0.00 ? 53  ILE A CG2  6  
ATOM 10779 C CD1  . ILE A 1 53  ? 9.462   7.774   1.684   1.00 0.00 ? 53  ILE A CD1  6  
ATOM 10780 H H    . ILE A 1 53  ? 13.213  9.083   4.065   1.00 0.00 ? 53  ILE A H    6  
ATOM 10781 H HA   . ILE A 1 53  ? 10.726  7.571   4.464   1.00 0.00 ? 53  ILE A HA   6  
ATOM 10782 H HB   . ILE A 1 53  ? 12.727  6.960   2.286   1.00 0.00 ? 53  ILE A HB   6  
ATOM 10783 H HG12 . ILE A 1 53  ? 11.108  9.030   2.095   1.00 0.00 ? 53  ILE A HG12 6  
ATOM 10784 H HG13 . ILE A 1 53  ? 11.338  7.946   0.727   1.00 0.00 ? 53  ILE A HG13 6  
ATOM 10785 H HG21 . ILE A 1 53  ? 11.733  4.945   3.033   1.00 0.00 ? 53  ILE A HG21 6  
ATOM 10786 H HG22 . ILE A 1 53  ? 10.134  5.682   3.116   1.00 0.00 ? 53  ILE A HG22 6  
ATOM 10787 H HG23 . ILE A 1 53  ? 10.891  5.393   1.550   1.00 0.00 ? 53  ILE A HG23 6  
ATOM 10788 H HD11 . ILE A 1 53  ? 9.076   7.706   2.691   1.00 0.00 ? 53  ILE A HD11 6  
ATOM 10789 H HD12 . ILE A 1 53  ? 8.977   8.589   1.168   1.00 0.00 ? 53  ILE A HD12 6  
ATOM 10790 H HD13 . ILE A 1 53  ? 9.270   6.849   1.162   1.00 0.00 ? 53  ILE A HD13 6  
ATOM 10791 N N    . LYS A 1 54  ? 12.017  5.458   5.249   1.00 0.00 ? 54  LYS A N    6  
ATOM 10792 C CA   . LYS A 1 54  ? 12.715  4.463   6.054   1.00 0.00 ? 54  LYS A CA   6  
ATOM 10793 C C    . LYS A 1 54  ? 12.830  3.139   5.305   1.00 0.00 ? 54  LYS A C    6  
ATOM 10794 O O    . LYS A 1 54  ? 11.988  2.816   4.467   1.00 0.00 ? 54  LYS A O    6  
ATOM 10795 C CB   . LYS A 1 54  ? 11.986  4.248   7.382   1.00 0.00 ? 54  LYS A CB   6  
ATOM 10796 C CG   . LYS A 1 54  ? 11.444  5.529   7.993   1.00 0.00 ? 54  LYS A CG   6  
ATOM 10797 C CD   . LYS A 1 54  ? 12.563  6.417   8.511   1.00 0.00 ? 54  LYS A CD   6  
ATOM 10798 C CE   . LYS A 1 54  ? 12.058  7.395   9.560   1.00 0.00 ? 54  LYS A CE   6  
ATOM 10799 N NZ   . LYS A 1 54  ? 13.160  8.226   10.120  1.00 0.00 ? 54  LYS A NZ   6  
ATOM 10800 H H    . LYS A 1 54  ? 11.110  5.264   4.931   1.00 0.00 ? 54  LYS A H    6  
ATOM 10801 H HA   . LYS A 1 54  ? 13.708  4.836   6.255   1.00 0.00 ? 54  LYS A HA   6  
ATOM 10802 H HB2  . LYS A 1 54  ? 11.158  3.573   7.220   1.00 0.00 ? 54  LYS A HB2  6  
ATOM 10803 H HB3  . LYS A 1 54  ? 12.671  3.800   8.087   1.00 0.00 ? 54  LYS A HB3  6  
ATOM 10804 H HG2  . LYS A 1 54  ? 10.890  6.070   7.240   1.00 0.00 ? 54  LYS A HG2  6  
ATOM 10805 H HG3  . LYS A 1 54  ? 10.788  5.277   8.813   1.00 0.00 ? 54  LYS A HG3  6  
ATOM 10806 H HD2  . LYS A 1 54  ? 13.328  5.796   8.953   1.00 0.00 ? 54  LYS A HD2  6  
ATOM 10807 H HD3  . LYS A 1 54  ? 12.982  6.973   7.684   1.00 0.00 ? 54  LYS A HD3  6  
ATOM 10808 H HE2  . LYS A 1 54  ? 11.325  8.044   9.105   1.00 0.00 ? 54  LYS A HE2  6  
ATOM 10809 H HE3  . LYS A 1 54  ? 11.597  6.837   10.361  1.00 0.00 ? 54  LYS A HE3  6  
ATOM 10810 H HZ1  . LYS A 1 54  ? 13.142  9.176   9.697   1.00 0.00 ? 54  LYS A HZ1  6  
ATOM 10811 H HZ2  . LYS A 1 54  ? 14.079  7.784   9.915   1.00 0.00 ? 54  LYS A HZ2  6  
ATOM 10812 H HZ3  . LYS A 1 54  ? 13.053  8.314   11.150  1.00 0.00 ? 54  LYS A HZ3  6  
ATOM 10813 N N    . GLU A 1 55  ? 13.875  2.378   5.613   1.00 0.00 ? 55  GLU A N    6  
ATOM 10814 C CA   . GLU A 1 55  ? 14.097  1.089   4.969   1.00 0.00 ? 55  GLU A CA   6  
ATOM 10815 C C    . GLU A 1 55  ? 12.779  0.346   4.770   1.00 0.00 ? 55  GLU A C    6  
ATOM 10816 O O    . GLU A 1 55  ? 12.523  -0.210  3.703   1.00 0.00 ? 55  GLU A O    6  
ATOM 10817 C CB   . GLU A 1 55  ? 15.056  0.236   5.801   1.00 0.00 ? 55  GLU A CB   6  
ATOM 10818 C CG   . GLU A 1 55  ? 16.511  0.654   5.671   1.00 0.00 ? 55  GLU A CG   6  
ATOM 10819 C CD   . GLU A 1 55  ? 16.796  1.991   6.327   1.00 0.00 ? 55  GLU A CD   6  
ATOM 10820 O OE1  . GLU A 1 55  ? 16.947  2.024   7.566   1.00 0.00 ? 55  GLU A OE1  6  
ATOM 10821 O OE2  . GLU A 1 55  ? 16.867  3.004   5.600   1.00 0.00 ? 55  GLU A OE2  6  
ATOM 10822 H H    . GLU A 1 55  ? 14.511  2.690   6.290   1.00 0.00 ? 55  GLU A H    6  
ATOM 10823 H HA   . GLU A 1 55  ? 14.541  1.274   4.002   1.00 0.00 ? 55  GLU A HA   6  
ATOM 10824 H HB2  . GLU A 1 55  ? 14.774  0.309   6.841   1.00 0.00 ? 55  GLU A HB2  6  
ATOM 10825 H HB3  . GLU A 1 55  ? 14.970  -0.793  5.485   1.00 0.00 ? 55  GLU A HB3  6  
ATOM 10826 H HG2  . GLU A 1 55  ? 17.131  -0.097  6.137   1.00 0.00 ? 55  GLU A HG2  6  
ATOM 10827 H HG3  . GLU A 1 55  ? 16.760  0.724   4.622   1.00 0.00 ? 55  GLU A HG3  6  
ATOM 10828 N N    . GLU A 1 56  ? 11.948  0.340   5.808   1.00 0.00 ? 56  GLU A N    6  
ATOM 10829 C CA   . GLU A 1 56  ? 10.657  -0.336  5.748   1.00 0.00 ? 56  GLU A CA   6  
ATOM 10830 C C    . GLU A 1 56  ? 9.519   0.638   6.037   1.00 0.00 ? 56  GLU A C    6  
ATOM 10831 O O    . GLU A 1 56  ? 8.553   0.296   6.720   1.00 0.00 ? 56  GLU A O    6  
ATOM 10832 C CB   . GLU A 1 56  ? 10.617  -1.496  6.746   1.00 0.00 ? 56  GLU A CB   6  
ATOM 10833 C CG   . GLU A 1 56  ? 11.947  -2.216  6.896   1.00 0.00 ? 56  GLU A CG   6  
ATOM 10834 C CD   . GLU A 1 56  ? 12.249  -3.132  5.726   1.00 0.00 ? 56  GLU A CD   6  
ATOM 10835 O OE1  . GLU A 1 56  ? 11.444  -4.052  5.470   1.00 0.00 ? 56  GLU A OE1  6  
ATOM 10836 O OE2  . GLU A 1 56  ? 13.290  -2.929  5.066   1.00 0.00 ? 56  GLU A OE2  6  
ATOM 10837 H H    . GLU A 1 56  ? 12.208  0.801   6.632   1.00 0.00 ? 56  GLU A H    6  
ATOM 10838 H HA   . GLU A 1 56  ? 10.534  -0.729  4.750   1.00 0.00 ? 56  GLU A HA   6  
ATOM 10839 H HB2  . GLU A 1 56  ? 10.327  -1.112  7.713   1.00 0.00 ? 56  GLU A HB2  6  
ATOM 10840 H HB3  . GLU A 1 56  ? 9.879   -2.212  6.417   1.00 0.00 ? 56  GLU A HB3  6  
ATOM 10841 H HG2  . GLU A 1 56  ? 12.734  -1.480  6.970   1.00 0.00 ? 56  GLU A HG2  6  
ATOM 10842 H HG3  . GLU A 1 56  ? 11.922  -2.807  7.800   1.00 0.00 ? 56  GLU A HG3  6  
ATOM 10843 N N    . HIS A 1 57  ? 9.640   1.853   5.512   1.00 0.00 ? 57  HIS A N    6  
ATOM 10844 C CA   . HIS A 1 57  ? 8.621   2.878   5.714   1.00 0.00 ? 57  HIS A CA   6  
ATOM 10845 C C    . HIS A 1 57  ? 7.229   2.256   5.767   1.00 0.00 ? 57  HIS A C    6  
ATOM 10846 O O    . HIS A 1 57  ? 6.364   2.711   6.517   1.00 0.00 ? 57  HIS A O    6  
ATOM 10847 C CB   . HIS A 1 57  ? 8.686   3.917   4.595   1.00 0.00 ? 57  HIS A CB   6  
ATOM 10848 C CG   . HIS A 1 57  ? 8.082   5.236   4.967   1.00 0.00 ? 57  HIS A CG   6  
ATOM 10849 N ND1  . HIS A 1 57  ? 8.812   6.272   5.512   1.00 0.00 ? 57  HIS A ND1  6  
ATOM 10850 C CD2  . HIS A 1 57  ? 6.809   5.686   4.869   1.00 0.00 ? 57  HIS A CD2  6  
ATOM 10851 C CE1  . HIS A 1 57  ? 8.014   7.301   5.734   1.00 0.00 ? 57  HIS A CE1  6  
ATOM 10852 N NE2  . HIS A 1 57  ? 6.793   6.972   5.352   1.00 0.00 ? 57  HIS A NE2  6  
ATOM 10853 H H    . HIS A 1 57  ? 10.433  2.066   4.977   1.00 0.00 ? 57  HIS A H    6  
ATOM 10854 H HA   . HIS A 1 57  ? 8.821   3.363   6.657   1.00 0.00 ? 57  HIS A HA   6  
ATOM 10855 H HB2  . HIS A 1 57  ? 9.719   4.089   4.331   1.00 0.00 ? 57  HIS A HB2  6  
ATOM 10856 H HB3  . HIS A 1 57  ? 8.156   3.541   3.731   1.00 0.00 ? 57  HIS A HB3  6  
ATOM 10857 H HD1  . HIS A 1 57  ? 9.771   6.254   5.707   1.00 0.00 ? 57  HIS A HD1  6  
ATOM 10858 H HD2  . HIS A 1 57  ? 5.962   5.137   4.483   1.00 0.00 ? 57  HIS A HD2  6  
ATOM 10859 H HE1  . HIS A 1 57  ? 8.309   8.250   6.155   1.00 0.00 ? 57  HIS A HE1  6  
ATOM 10860 H HE2  . HIS A 1 57  ? 5.993   7.521   5.486   1.00 0.00 ? 57  HIS A HE2  6  
ATOM 10861 N N    . CYS A 1 58  ? 7.019   1.216   4.968   1.00 0.00 ? 58  CYS A N    6  
ATOM 10862 C CA   . CYS A 1 58  ? 5.731   0.533   4.924   1.00 0.00 ? 58  CYS A CA   6  
ATOM 10863 C C    . CYS A 1 58  ? 5.816   -0.732  4.076   1.00 0.00 ? 58  CYS A C    6  
ATOM 10864 O O    . CYS A 1 58  ? 6.874   -1.062  3.540   1.00 0.00 ? 58  CYS A O    6  
ATOM 10865 C CB   . CYS A 1 58  ? 4.655   1.466   4.365   1.00 0.00 ? 58  CYS A CB   6  
ATOM 10866 S SG   . CYS A 1 58  ? 2.994   1.138   4.997   1.00 0.00 ? 58  CYS A SG   6  
ATOM 10867 H H    . CYS A 1 58  ? 7.748   0.899   4.394   1.00 0.00 ? 58  CYS A H    6  
ATOM 10868 H HA   . CYS A 1 58  ? 5.468   0.258   5.934   1.00 0.00 ? 58  CYS A HA   6  
ATOM 10869 H HB2  . CYS A 1 58  ? 4.907   2.485   4.617   1.00 0.00 ? 58  CYS A HB2  6  
ATOM 10870 H HB3  . CYS A 1 58  ? 4.625   1.365   3.290   1.00 0.00 ? 58  CYS A HB3  6  
ATOM 10871 H HG   . CYS A 1 58  ? 2.591   2.210   5.663   1.00 0.00 ? 58  CYS A HG   6  
ATOM 10872 N N    . ILE A 1 59  ? 4.695   -1.436  3.960   1.00 0.00 ? 59  ILE A N    6  
ATOM 10873 C CA   . ILE A 1 59  ? 4.642   -2.665  3.178   1.00 0.00 ? 59  ILE A CA   6  
ATOM 10874 C C    . ILE A 1 59  ? 3.220   -2.963  2.718   1.00 0.00 ? 59  ILE A C    6  
ATOM 10875 O O    . ILE A 1 59  ? 2.263   -2.337  3.175   1.00 0.00 ? 59  ILE A O    6  
ATOM 10876 C CB   . ILE A 1 59  ? 5.172   -3.867  3.982   1.00 0.00 ? 59  ILE A CB   6  
ATOM 10877 C CG1  . ILE A 1 59  ? 6.450   -3.483  4.731   1.00 0.00 ? 59  ILE A CG1  6  
ATOM 10878 C CG2  . ILE A 1 59  ? 5.427   -5.050  3.060   1.00 0.00 ? 59  ILE A CG2  6  
ATOM 10879 C CD1  . ILE A 1 59  ? 7.006   -4.599  5.589   1.00 0.00 ? 59  ILE A CD1  6  
ATOM 10880 H H    . ILE A 1 59  ? 3.883   -1.121  4.410   1.00 0.00 ? 59  ILE A H    6  
ATOM 10881 H HA   . ILE A 1 59  ? 5.271   -2.533  2.309   1.00 0.00 ? 59  ILE A HA   6  
ATOM 10882 H HB   . ILE A 1 59  ? 4.417   -4.154  4.697   1.00 0.00 ? 59  ILE A HB   6  
ATOM 10883 H HG12 . ILE A 1 59  ? 7.209   -3.205  4.017   1.00 0.00 ? 59  ILE A HG12 6  
ATOM 10884 H HG13 . ILE A 1 59  ? 6.242   -2.641  5.375   1.00 0.00 ? 59  ILE A HG13 6  
ATOM 10885 H HG21 . ILE A 1 59  ? 6.251   -5.633  3.443   1.00 0.00 ? 59  ILE A HG21 6  
ATOM 10886 H HG22 . ILE A 1 59  ? 4.542   -5.666  3.013   1.00 0.00 ? 59  ILE A HG22 6  
ATOM 10887 H HG23 . ILE A 1 59  ? 5.669   -4.690  2.071   1.00 0.00 ? 59  ILE A HG23 6  
ATOM 10888 H HD11 . ILE A 1 59  ? 7.686   -4.186  6.320   1.00 0.00 ? 59  ILE A HD11 6  
ATOM 10889 H HD12 . ILE A 1 59  ? 6.196   -5.101  6.096   1.00 0.00 ? 59  ILE A HD12 6  
ATOM 10890 H HD13 . ILE A 1 59  ? 7.534   -5.304  4.965   1.00 0.00 ? 59  ILE A HD13 6  
ATOM 10891 N N    . PHE A 1 60  ? 3.087   -3.925  1.810   1.00 0.00 ? 60  PHE A N    6  
ATOM 10892 C CA   . PHE A 1 60  ? 1.780   -4.308  1.288   1.00 0.00 ? 60  PHE A CA   6  
ATOM 10893 C C    . PHE A 1 60  ? 1.676   -5.823  1.141   1.00 0.00 ? 60  PHE A C    6  
ATOM 10894 O O    . PHE A 1 60  ? 2.275   -6.413  0.242   1.00 0.00 ? 60  PHE A O    6  
ATOM 10895 C CB   . PHE A 1 60  ? 1.531   -3.635  -0.064  1.00 0.00 ? 60  PHE A CB   6  
ATOM 10896 C CG   . PHE A 1 60  ? 1.080   -2.207  0.052   1.00 0.00 ? 60  PHE A CG   6  
ATOM 10897 C CD1  . PHE A 1 60  ? 1.971   -1.214  0.427   1.00 0.00 ? 60  PHE A CD1  6  
ATOM 10898 C CD2  . PHE A 1 60  ? -0.233  -1.857  -0.216  1.00 0.00 ? 60  PHE A CD2  6  
ATOM 10899 C CE1  . PHE A 1 60  ? 1.559   0.101   0.535   1.00 0.00 ? 60  PHE A CE1  6  
ATOM 10900 C CE2  . PHE A 1 60  ? -0.651  -0.544  -0.110  1.00 0.00 ? 60  PHE A CE2  6  
ATOM 10901 C CZ   . PHE A 1 60  ? 0.247   0.436   0.265   1.00 0.00 ? 60  PHE A CZ   6  
ATOM 10902 H H    . PHE A 1 60  ? 3.887   -4.388  1.484   1.00 0.00 ? 60  PHE A H    6  
ATOM 10903 H HA   . PHE A 1 60  ? 1.032   -3.974  1.990   1.00 0.00 ? 60  PHE A HA   6  
ATOM 10904 H HB2  . PHE A 1 60  ? 2.444   -3.649  -0.639  1.00 0.00 ? 60  PHE A HB2  6  
ATOM 10905 H HB3  . PHE A 1 60  ? 0.767   -4.183  -0.595  1.00 0.00 ? 60  PHE A HB3  6  
ATOM 10906 H HD1  . PHE A 1 60  ? 2.998   -1.475  0.638   1.00 0.00 ? 60  PHE A HD1  6  
ATOM 10907 H HD2  . PHE A 1 60  ? -0.937  -2.624  -0.510  1.00 0.00 ? 60  PHE A HD2  6  
ATOM 10908 H HE1  . PHE A 1 60  ? 2.263   0.865   0.828   1.00 0.00 ? 60  PHE A HE1  6  
ATOM 10909 H HE2  . PHE A 1 60  ? -1.678  -0.285  -0.322  1.00 0.00 ? 60  PHE A HE2  6  
ATOM 10910 H HZ   . PHE A 1 60  ? -0.078  1.463   0.349   1.00 0.00 ? 60  PHE A HZ   6  
ATOM 10911 N N    . ARG A 1 61  ? 0.912   -6.447  2.032   1.00 0.00 ? 61  ARG A N    6  
ATOM 10912 C CA   . ARG A 1 61  ? 0.730   -7.893  2.004   1.00 0.00 ? 61  ARG A CA   6  
ATOM 10913 C C    . ARG A 1 61  ? -0.593  -8.262  1.338   1.00 0.00 ? 61  ARG A C    6  
ATOM 10914 O O    . ARG A 1 61  ? -1.625  -7.646  1.602   1.00 0.00 ? 61  ARG A O    6  
ATOM 10915 C CB   . ARG A 1 61  ? 0.774   -8.462  3.423   1.00 0.00 ? 61  ARG A CB   6  
ATOM 10916 C CG   . ARG A 1 61  ? 0.896   -9.976  3.469   1.00 0.00 ? 61  ARG A CG   6  
ATOM 10917 C CD   . ARG A 1 61  ? 0.558   -10.521 4.848   1.00 0.00 ? 61  ARG A CD   6  
ATOM 10918 N NE   . ARG A 1 61  ? 1.204   -11.805 5.103   1.00 0.00 ? 61  ARG A NE   6  
ATOM 10919 C CZ   . ARG A 1 61  ? 0.725   -12.967 4.675   1.00 0.00 ? 61  ARG A CZ   6  
ATOM 10920 N NH1  . ARG A 1 61  ? -0.400  -13.006 3.974   1.00 0.00 ? 61  ARG A NH1  6  
ATOM 10921 N NH2  . ARG A 1 61  ? 1.371   -14.094 4.947   1.00 0.00 ? 61  ARG A NH2  6  
ATOM 10922 H H    . ARG A 1 61  ? 0.460   -5.922  2.725   1.00 0.00 ? 61  ARG A H    6  
ATOM 10923 H HA   . ARG A 1 61  ? 1.539   -8.318  1.430   1.00 0.00 ? 61  ARG A HA   6  
ATOM 10924 H HB2  . ARG A 1 61  ? 1.622   -8.039  3.942   1.00 0.00 ? 61  ARG A HB2  6  
ATOM 10925 H HB3  . ARG A 1 61  ? -0.130  -8.179  3.940   1.00 0.00 ? 61  ARG A HB3  6  
ATOM 10926 H HG2  . ARG A 1 61  ? 0.215   -10.405 2.748   1.00 0.00 ? 61  ARG A HG2  6  
ATOM 10927 H HG3  . ARG A 1 61  ? 1.909   -10.254 3.220   1.00 0.00 ? 61  ARG A HG3  6  
ATOM 10928 H HD2  . ARG A 1 61  ? 0.885   -9.810  5.592   1.00 0.00 ? 61  ARG A HD2  6  
ATOM 10929 H HD3  . ARG A 1 61  ? -0.513  -10.647 4.918   1.00 0.00 ? 61  ARG A HD3  6  
ATOM 10930 H HE   . ARG A 1 61  ? 2.037   -11.799 5.619   1.00 0.00 ? 61  ARG A HE   6  
ATOM 10931 H HH11 . ARG A 1 61  ? -0.888  -12.159 3.766   1.00 0.00 ? 61  ARG A HH11 6  
ATOM 10932 H HH12 . ARG A 1 61  ? -0.758  -13.883 3.651   1.00 0.00 ? 61  ARG A HH12 6  
ATOM 10933 H HH21 . ARG A 1 61  ? 2.219   -14.068 5.475   1.00 0.00 ? 61  ARG A HH21 6  
ATOM 10934 H HH22 . ARG A 1 61  ? 1.009   -14.968 4.624   1.00 0.00 ? 61  ARG A HH22 6  
ATOM 10935 N N    . SER A 1 62  ? -0.553  -9.270  0.473   1.00 0.00 ? 62  SER A N    6  
ATOM 10936 C CA   . SER A 1 62  ? -1.746  -9.718  -0.235  1.00 0.00 ? 62  SER A CA   6  
ATOM 10937 C C    . SER A 1 62  ? -1.926  -11.227 -0.096  1.00 0.00 ? 62  SER A C    6  
ATOM 10938 O O    . SER A 1 62  ? -1.015  -12.000 -0.393  1.00 0.00 ? 62  SER A O    6  
ATOM 10939 C CB   . SER A 1 62  ? -1.662  -9.337  -1.714  1.00 0.00 ? 62  SER A CB   6  
ATOM 10940 O OG   . SER A 1 62  ? -2.050  -7.989  -1.916  1.00 0.00 ? 62  SER A OG   6  
ATOM 10941 H H    . SER A 1 62  ? 0.301   -9.722  0.304   1.00 0.00 ? 62  SER A H    6  
ATOM 10942 H HA   . SER A 1 62  ? -2.599  -9.224  0.208   1.00 0.00 ? 62  SER A HA   6  
ATOM 10943 H HB2  . SER A 1 62  ? -0.647  -9.462  -2.058  1.00 0.00 ? 62  SER A HB2  6  
ATOM 10944 H HB3  . SER A 1 62  ? -2.318  -9.977  -2.286  1.00 0.00 ? 62  SER A HB3  6  
ATOM 10945 H HG   . SER A 1 62  ? -2.406  -7.887  -2.801  1.00 0.00 ? 62  SER A HG   6  
ATOM 10946 N N    . GLU A 1 63  ? -3.106  -11.637 0.357   1.00 0.00 ? 63  GLU A N    6  
ATOM 10947 C CA   . GLU A 1 63  ? -3.405  -13.053 0.535   1.00 0.00 ? 63  GLU A CA   6  
ATOM 10948 C C    . GLU A 1 63  ? -4.911  -13.297 0.528   1.00 0.00 ? 63  GLU A C    6  
ATOM 10949 O O    . GLU A 1 63  ? -5.684  -12.485 1.037   1.00 0.00 ? 63  GLU A O    6  
ATOM 10950 C CB   . GLU A 1 63  ? -2.801  -13.563 1.845   1.00 0.00 ? 63  GLU A CB   6  
ATOM 10951 C CG   . GLU A 1 63  ? -3.116  -15.021 2.134   1.00 0.00 ? 63  GLU A CG   6  
ATOM 10952 C CD   . GLU A 1 63  ? -2.254  -15.975 1.331   1.00 0.00 ? 63  GLU A CD   6  
ATOM 10953 O OE1  . GLU A 1 63  ? -1.037  -15.722 1.216   1.00 0.00 ? 63  GLU A OE1  6  
ATOM 10954 O OE2  . GLU A 1 63  ? -2.797  -16.975 0.817   1.00 0.00 ? 63  GLU A OE2  6  
ATOM 10955 H H    . GLU A 1 63  ? -3.792  -10.973 0.576   1.00 0.00 ? 63  GLU A H    6  
ATOM 10956 H HA   . GLU A 1 63  ? -2.961  -13.592 -0.288  1.00 0.00 ? 63  GLU A HA   6  
ATOM 10957 H HB2  . GLU A 1 63  ? -1.728  -13.450 1.801   1.00 0.00 ? 63  GLU A HB2  6  
ATOM 10958 H HB3  . GLU A 1 63  ? -3.183  -12.966 2.660   1.00 0.00 ? 63  GLU A HB3  6  
ATOM 10959 H HG2  . GLU A 1 63  ? -2.953  -15.211 3.185   1.00 0.00 ? 63  GLU A HG2  6  
ATOM 10960 H HG3  . GLU A 1 63  ? -4.153  -15.207 1.894   1.00 0.00 ? 63  GLU A HG3  6  
ATOM 10961 N N    . ARG A 1 64  ? -5.320  -14.420 -0.053  1.00 0.00 ? 64  ARG A N    6  
ATOM 10962 C CA   . ARG A 1 64  ? -6.733  -14.770 -0.128  1.00 0.00 ? 64  ARG A CA   6  
ATOM 10963 C C    . ARG A 1 64  ? -7.215  -15.374 1.188   1.00 0.00 ? 64  ARG A C    6  
ATOM 10964 O O    . ARG A 1 64  ? -6.585  -16.279 1.735   1.00 0.00 ? 64  ARG A O    6  
ATOM 10965 C CB   . ARG A 1 64  ? -6.976  -15.756 -1.273  1.00 0.00 ? 64  ARG A CB   6  
ATOM 10966 C CG   . ARG A 1 64  ? -8.348  -15.620 -1.913  1.00 0.00 ? 64  ARG A CG   6  
ATOM 10967 C CD   . ARG A 1 64  ? -8.501  -16.553 -3.104  1.00 0.00 ? 64  ARG A CD   6  
ATOM 10968 N NE   . ARG A 1 64  ? -8.202  -17.939 -2.756  1.00 0.00 ? 64  ARG A NE   6  
ATOM 10969 C CZ   . ARG A 1 64  ? -8.450  -18.968 -3.559  1.00 0.00 ? 64  ARG A CZ   6  
ATOM 10970 N NH1  . ARG A 1 64  ? -8.998  -18.768 -4.749  1.00 0.00 ? 64  ARG A NH1  6  
ATOM 10971 N NH2  . ARG A 1 64  ? -8.150  -20.201 -3.171  1.00 0.00 ? 64  ARG A NH2  6  
ATOM 10972 H H    . ARG A 1 64  ? -4.656  -15.028 -0.440  1.00 0.00 ? 64  ARG A H    6  
ATOM 10973 H HA   . ARG A 1 64  ? -7.290  -13.865 -0.320  1.00 0.00 ? 64  ARG A HA   6  
ATOM 10974 H HB2  . ARG A 1 64  ? -6.229  -15.595 -2.036  1.00 0.00 ? 64  ARG A HB2  6  
ATOM 10975 H HB3  . ARG A 1 64  ? -6.878  -16.762 -0.892  1.00 0.00 ? 64  ARG A HB3  6  
ATOM 10976 H HG2  . ARG A 1 64  ? -9.103  -15.864 -1.180  1.00 0.00 ? 64  ARG A HG2  6  
ATOM 10977 H HG3  . ARG A 1 64  ? -8.480  -14.601 -2.245  1.00 0.00 ? 64  ARG A HG3  6  
ATOM 10978 H HD2  . ARG A 1 64  ? -9.518  -16.493 -3.463  1.00 0.00 ? 64  ARG A HD2  6  
ATOM 10979 H HD3  . ARG A 1 64  ? -7.826  -16.233 -3.884  1.00 0.00 ? 64  ARG A HD3  6  
ATOM 10980 H HE   . ARG A 1 64  ? -7.797  -18.110 -1.881  1.00 0.00 ? 64  ARG A HE   6  
ATOM 10981 H HH11 . ARG A 1 64  ? -9.225  -17.840 -5.044  1.00 0.00 ? 64  ARG A HH11 6  
ATOM 10982 H HH12 . ARG A 1 64  ? -9.183  -19.545 -5.352  1.00 0.00 ? 64  ARG A HH12 6  
ATOM 10983 H HH21 . ARG A 1 64  ? -7.737  -20.356 -2.274  1.00 0.00 ? 64  ARG A HH21 6  
ATOM 10984 H HH22 . ARG A 1 64  ? -8.337  -20.975 -3.775  1.00 0.00 ? 64  ARG A HH22 6  
ATOM 10985 N N    . SER A 1 65  ? -8.336  -14.866 1.691   1.00 0.00 ? 65  SER A N    6  
ATOM 10986 C CA   . SER A 1 65  ? -8.899  -15.351 2.945   1.00 0.00 ? 65  SER A CA   6  
ATOM 10987 C C    . SER A 1 65  ? -9.460  -16.761 2.779   1.00 0.00 ? 65  SER A C    6  
ATOM 10988 O O    . SER A 1 65  ? -9.440  -17.323 1.685   1.00 0.00 ? 65  SER A O    6  
ATOM 10989 C CB   . SER A 1 65  ? -10.000 -14.407 3.434   1.00 0.00 ? 65  SER A CB   6  
ATOM 10990 O OG   . SER A 1 65  ? -10.390 -14.721 4.759   1.00 0.00 ? 65  SER A OG   6  
ATOM 10991 H H    . SER A 1 65  ? -8.792  -14.145 1.208   1.00 0.00 ? 65  SER A H    6  
ATOM 10992 H HA   . SER A 1 65  ? -8.107  -15.376 3.678   1.00 0.00 ? 65  SER A HA   6  
ATOM 10993 H HB2  . SER A 1 65  ? -9.636  -13.392 3.409   1.00 0.00 ? 65  SER A HB2  6  
ATOM 10994 H HB3  . SER A 1 65  ? -10.860 -14.497 2.787   1.00 0.00 ? 65  SER A HB3  6  
ATOM 10995 H HG   . SER A 1 65  ? -10.780 -13.946 5.170   1.00 0.00 ? 65  SER A HG   6  
ATOM 10996 N N    . ASN A 1 66  ? -9.959  -17.325 3.874   1.00 0.00 ? 66  ASN A N    6  
ATOM 10997 C CA   . ASN A 1 66  ? -10.524 -18.669 3.851   1.00 0.00 ? 66  ASN A CA   6  
ATOM 10998 C C    . ASN A 1 66  ? -11.808 -18.705 3.028   1.00 0.00 ? 66  ASN A C    6  
ATOM 10999 O O    . ASN A 1 66  ? -12.348 -19.775 2.748   1.00 0.00 ? 66  ASN A O    6  
ATOM 11000 C CB   . ASN A 1 66  ? -10.805 -19.151 5.276   1.00 0.00 ? 66  ASN A CB   6  
ATOM 11001 C CG   . ASN A 1 66  ? -11.301 -20.584 5.315   1.00 0.00 ? 66  ASN A CG   6  
ATOM 11002 O OD1  . ASN A 1 66  ? -10.867 -21.424 4.526   1.00 0.00 ? 66  ASN A OD1  6  
ATOM 11003 N ND2  . ASN A 1 66  ? -12.214 -20.869 6.235   1.00 0.00 ? 66  ASN A ND2  6  
ATOM 11004 H H    . ASN A 1 66  ? -9.946  -16.826 4.718   1.00 0.00 ? 66  ASN A H    6  
ATOM 11005 H HA   . ASN A 1 66  ? -9.799  -19.326 3.395   1.00 0.00 ? 66  ASN A HA   6  
ATOM 11006 H HB2  . ASN A 1 66  ? -9.896  -19.089 5.856   1.00 0.00 ? 66  ASN A HB2  6  
ATOM 11007 H HB3  . ASN A 1 66  ? -11.557 -18.517 5.723   1.00 0.00 ? 66  ASN A HB3  6  
ATOM 11008 H HD21 . ASN A 1 66  ? -12.514 -20.149 6.829   1.00 0.00 ? 66  ASN A HD21 6  
ATOM 11009 H HD22 . ASN A 1 66  ? -12.552 -21.788 6.283   1.00 0.00 ? 66  ASN A HD22 6  
ATOM 11010 N N    . SER A 1 67  ? -12.291 -17.528 2.642   1.00 0.00 ? 67  SER A N    6  
ATOM 11011 C CA   . SER A 1 67  ? -13.513 -17.425 1.853   1.00 0.00 ? 67  SER A CA   6  
ATOM 11012 C C    . SER A 1 67  ? -13.190 -17.204 0.378   1.00 0.00 ? 67  SER A C    6  
ATOM 11013 O O    . SER A 1 67  ? -14.088 -17.085 -0.454  1.00 0.00 ? 67  SER A O    6  
ATOM 11014 C CB   . SER A 1 67  ? -14.385 -16.280 2.373   1.00 0.00 ? 67  SER A CB   6  
ATOM 11015 O OG   . SER A 1 67  ? -13.705 -15.040 2.282   1.00 0.00 ? 67  SER A OG   6  
ATOM 11016 H H    . SER A 1 67  ? -11.814 -16.710 2.897   1.00 0.00 ? 67  SER A H    6  
ATOM 11017 H HA   . SER A 1 67  ? -14.053 -18.353 1.956   1.00 0.00 ? 67  SER A HA   6  
ATOM 11018 H HB2  . SER A 1 67  ? -15.289 -16.225 1.786   1.00 0.00 ? 67  SER A HB2  6  
ATOM 11019 H HB3  . SER A 1 67  ? -14.637 -16.465 3.407   1.00 0.00 ? 67  SER A HB3  6  
ATOM 11020 H HG   . SER A 1 67  ? -13.029 -14.994 2.963   1.00 0.00 ? 67  SER A HG   6  
ATOM 11021 N N    . GLY A 1 68  ? -11.899 -17.151 0.063   1.00 0.00 ? 68  GLY A N    6  
ATOM 11022 C CA   . GLY A 1 68  ? -11.480 -16.945 -1.311  1.00 0.00 ? 68  GLY A CA   6  
ATOM 11023 C C    . GLY A 1 68  ? -11.407 -15.477 -1.681  1.00 0.00 ? 68  GLY A C    6  
ATOM 11024 O O    . GLY A 1 68  ? -11.129 -15.133 -2.829  1.00 0.00 ? 68  GLY A O    6  
ATOM 11025 H H    . GLY A 1 68  ? -11.227 -17.253 0.769   1.00 0.00 ? 68  GLY A H    6  
ATOM 11026 H HA2  . GLY A 1 68  ? -10.505 -17.388 -1.449  1.00 0.00 ? 68  GLY A HA2  6  
ATOM 11027 H HA3  . GLY A 1 68  ? -12.183 -17.435 -1.968  1.00 0.00 ? 68  GLY A HA3  6  
ATOM 11028 N N    . GLU A 1 69  ? -11.661 -14.609 -0.706  1.00 0.00 ? 69  GLU A N    6  
ATOM 11029 C CA   . GLU A 1 69  ? -11.626 -13.170 -0.937  1.00 0.00 ? 69  GLU A CA   6  
ATOM 11030 C C    . GLU A 1 69  ? -10.212 -12.624 -0.755  1.00 0.00 ? 69  GLU A C    6  
ATOM 11031 O O    . GLU A 1 69  ? -9.625  -12.736 0.321   1.00 0.00 ? 69  GLU A O    6  
ATOM 11032 C CB   . GLU A 1 69  ? -12.587 -12.454 0.014   1.00 0.00 ? 69  GLU A CB   6  
ATOM 11033 C CG   . GLU A 1 69  ? -11.954 -12.066 1.340   1.00 0.00 ? 69  GLU A CG   6  
ATOM 11034 C CD   . GLU A 1 69  ? -12.984 -11.745 2.406   1.00 0.00 ? 69  GLU A CD   6  
ATOM 11035 O OE1  . GLU A 1 69  ? -13.800 -10.827 2.184   1.00 0.00 ? 69  GLU A OE1  6  
ATOM 11036 O OE2  . GLU A 1 69  ? -12.973 -12.411 3.462   1.00 0.00 ? 69  GLU A OE2  6  
ATOM 11037 H H    . GLU A 1 69  ? -11.877 -14.945 0.189   1.00 0.00 ? 69  GLU A H    6  
ATOM 11038 H HA   . GLU A 1 69  ? -11.940 -12.989 -1.954  1.00 0.00 ? 69  GLU A HA   6  
ATOM 11039 H HB2  . GLU A 1 69  ? -12.948 -11.557 -0.466  1.00 0.00 ? 69  GLU A HB2  6  
ATOM 11040 H HB3  . GLU A 1 69  ? -13.424 -13.105 0.217   1.00 0.00 ? 69  GLU A HB3  6  
ATOM 11041 H HG2  . GLU A 1 69  ? -11.343 -12.886 1.687   1.00 0.00 ? 69  GLU A HG2  6  
ATOM 11042 H HG3  . GLU A 1 69  ? -11.333 -11.196 1.187   1.00 0.00 ? 69  GLU A HG3  6  
ATOM 11043 N N    . VAL A 1 70  ? -9.671  -12.034 -1.816  1.00 0.00 ? 70  VAL A N    6  
ATOM 11044 C CA   . VAL A 1 70  ? -8.327  -11.470 -1.775  1.00 0.00 ? 70  VAL A CA   6  
ATOM 11045 C C    . VAL A 1 70  ? -8.260  -10.279 -0.826  1.00 0.00 ? 70  VAL A C    6  
ATOM 11046 O O    . VAL A 1 70  ? -8.789  -9.207  -1.121  1.00 0.00 ? 70  VAL A O    6  
ATOM 11047 C CB   . VAL A 1 70  ? -7.862  -11.024 -3.174  1.00 0.00 ? 70  VAL A CB   6  
ATOM 11048 C CG1  . VAL A 1 70  ? -6.537  -10.283 -3.086  1.00 0.00 ? 70  VAL A CG1  6  
ATOM 11049 C CG2  . VAL A 1 70  ? -7.751  -12.222 -4.105  1.00 0.00 ? 70  VAL A CG2  6  
ATOM 11050 H H    . VAL A 1 70  ? -10.189 -11.975 -2.647  1.00 0.00 ? 70  VAL A H    6  
ATOM 11051 H HA   . VAL A 1 70  ? -7.654  -12.237 -1.422  1.00 0.00 ? 70  VAL A HA   6  
ATOM 11052 H HB   . VAL A 1 70  ? -8.601  -10.348 -3.578  1.00 0.00 ? 70  VAL A HB   6  
ATOM 11053 H HG11 . VAL A 1 70  ? -6.644  -9.301  -3.522  1.00 0.00 ? 70  VAL A HG11 6  
ATOM 11054 H HG12 . VAL A 1 70  ? -6.245  -10.188 -2.050  1.00 0.00 ? 70  VAL A HG12 6  
ATOM 11055 H HG13 . VAL A 1 70  ? -5.780  -10.834 -3.624  1.00 0.00 ? 70  VAL A HG13 6  
ATOM 11056 H HG21 . VAL A 1 70  ? -6.872  -12.119 -4.722  1.00 0.00 ? 70  VAL A HG21 6  
ATOM 11057 H HG22 . VAL A 1 70  ? -7.677  -13.126 -3.519  1.00 0.00 ? 70  VAL A HG22 6  
ATOM 11058 H HG23 . VAL A 1 70  ? -8.628  -12.272 -4.734  1.00 0.00 ? 70  VAL A HG23 6  
ATOM 11059 N N    . ILE A 1 71  ? -7.606  -10.474 0.314   1.00 0.00 ? 71  ILE A N    6  
ATOM 11060 C CA   . ILE A 1 71  ? -7.468  -9.415  1.306   1.00 0.00 ? 71  ILE A CA   6  
ATOM 11061 C C    . ILE A 1 71  ? -6.031  -8.907  1.373   1.00 0.00 ? 71  ILE A C    6  
ATOM 11062 O O    . ILE A 1 71  ? -5.083  -9.674  1.209   1.00 0.00 ? 71  ILE A O    6  
ATOM 11063 C CB   . ILE A 1 71  ? -7.897  -9.895  2.705   1.00 0.00 ? 71  ILE A CB   6  
ATOM 11064 C CG1  . ILE A 1 71  ? -9.277  -10.550 2.642   1.00 0.00 ? 71  ILE A CG1  6  
ATOM 11065 C CG2  . ILE A 1 71  ? -7.900  -8.732  3.686   1.00 0.00 ? 71  ILE A CG2  6  
ATOM 11066 C CD1  . ILE A 1 71  ? -10.418 -9.576  2.836   1.00 0.00 ? 71  ILE A CD1  6  
ATOM 11067 H H    . ILE A 1 71  ? -7.206  -11.350 0.492   1.00 0.00 ? 71  ILE A H    6  
ATOM 11068 H HA   . ILE A 1 71  ? -8.113  -8.599  1.014   1.00 0.00 ? 71  ILE A HA   6  
ATOM 11069 H HB   . ILE A 1 71  ? -7.176  -10.621 3.048   1.00 0.00 ? 71  ILE A HB   6  
ATOM 11070 H HG12 . ILE A 1 71  ? -9.403  -11.020 1.680   1.00 0.00 ? 71  ILE A HG12 6  
ATOM 11071 H HG13 . ILE A 1 71  ? -9.346  -11.301 3.416   1.00 0.00 ? 71  ILE A HG13 6  
ATOM 11072 H HG21 . ILE A 1 71  ? -8.431  -9.018  4.582   1.00 0.00 ? 71  ILE A HG21 6  
ATOM 11073 H HG22 . ILE A 1 71  ? -6.884  -8.471  3.939   1.00 0.00 ? 71  ILE A HG22 6  
ATOM 11074 H HG23 . ILE A 1 71  ? -8.389  -7.881  3.234   1.00 0.00 ? 71  ILE A HG23 6  
ATOM 11075 H HD11 . ILE A 1 71  ? -11.353 -10.118 2.872   1.00 0.00 ? 71  ILE A HD11 6  
ATOM 11076 H HD12 . ILE A 1 71  ? -10.280 -9.038  3.762   1.00 0.00 ? 71  ILE A HD12 6  
ATOM 11077 H HD13 . ILE A 1 71  ? -10.440 -8.878  2.013   1.00 0.00 ? 71  ILE A HD13 6  
ATOM 11078 N N    . VAL A 1 72  ? -5.878  -7.610  1.617   1.00 0.00 ? 72  VAL A N    6  
ATOM 11079 C CA   . VAL A 1 72  ? -4.557  -7.000  1.709   1.00 0.00 ? 72  VAL A CA   6  
ATOM 11080 C C    . VAL A 1 72  ? -4.375  -6.283  3.042   1.00 0.00 ? 72  VAL A C    6  
ATOM 11081 O O    . VAL A 1 72  ? -5.321  -5.718  3.591   1.00 0.00 ? 72  VAL A O    6  
ATOM 11082 C CB   . VAL A 1 72  ? -4.321  -5.998  0.563   1.00 0.00 ? 72  VAL A CB   6  
ATOM 11083 C CG1  . VAL A 1 72  ? -2.865  -5.561  0.527   1.00 0.00 ? 72  VAL A CG1  6  
ATOM 11084 C CG2  . VAL A 1 72  ? -4.737  -6.604  -0.769  1.00 0.00 ? 72  VAL A CG2  6  
ATOM 11085 H H    . VAL A 1 72  ? -6.673  -7.049  1.739   1.00 0.00 ? 72  VAL A H    6  
ATOM 11086 H HA   . VAL A 1 72  ? -3.820  -7.785  1.629   1.00 0.00 ? 72  VAL A HA   6  
ATOM 11087 H HB   . VAL A 1 72  ? -4.931  -5.125  0.743   1.00 0.00 ? 72  VAL A HB   6  
ATOM 11088 H HG11 . VAL A 1 72  ? -2.304  -6.230  -0.108  1.00 0.00 ? 72  VAL A HG11 6  
ATOM 11089 H HG12 . VAL A 1 72  ? -2.799  -4.555  0.139   1.00 0.00 ? 72  VAL A HG12 6  
ATOM 11090 H HG13 . VAL A 1 72  ? -2.456  -5.588  1.527   1.00 0.00 ? 72  VAL A HG13 6  
ATOM 11091 H HG21 . VAL A 1 72  ? -4.753  -7.680  -0.686  1.00 0.00 ? 72  VAL A HG21 6  
ATOM 11092 H HG22 . VAL A 1 72  ? -5.721  -6.248  -1.034  1.00 0.00 ? 72  VAL A HG22 6  
ATOM 11093 H HG23 . VAL A 1 72  ? -4.031  -6.313  -1.534  1.00 0.00 ? 72  VAL A HG23 6  
ATOM 11094 N N    . THR A 1 73  ? -3.150  -6.309  3.558   1.00 0.00 ? 73  THR A N    6  
ATOM 11095 C CA   . THR A 1 73  ? -2.842  -5.662  4.827   1.00 0.00 ? 73  THR A CA   6  
ATOM 11096 C C    . THR A 1 73  ? -1.555  -4.851  4.733   1.00 0.00 ? 73  THR A C    6  
ATOM 11097 O O    . THR A 1 73  ? -0.542  -5.331  4.222   1.00 0.00 ? 73  THR A O    6  
ATOM 11098 C CB   . THR A 1 73  ? -2.704  -6.693  5.964   1.00 0.00 ? 73  THR A CB   6  
ATOM 11099 O OG1  . THR A 1 73  ? -3.542  -7.824  5.704   1.00 0.00 ? 73  THR A OG1  6  
ATOM 11100 C CG2  . THR A 1 73  ? -3.079  -6.075  7.303   1.00 0.00 ? 73  THR A CG2  6  
ATOM 11101 H H    . THR A 1 73  ? -2.438  -6.775  3.073   1.00 0.00 ? 73  THR A H    6  
ATOM 11102 H HA   . THR A 1 73  ? -3.658  -4.997  5.070   1.00 0.00 ? 73  THR A HA   6  
ATOM 11103 H HB   . THR A 1 73  ? -1.675  -7.019  6.010   1.00 0.00 ? 73  THR A HB   6  
ATOM 11104 H HG1  . THR A 1 73  ? -4.455  -7.596  5.892   1.00 0.00 ? 73  THR A HG1  6  
ATOM 11105 H HG21 . THR A 1 73  ? -4.120  -5.791  7.289   1.00 0.00 ? 73  THR A HG21 6  
ATOM 11106 H HG22 . THR A 1 73  ? -2.469  -5.201  7.479   1.00 0.00 ? 73  THR A HG22 6  
ATOM 11107 H HG23 . THR A 1 73  ? -2.912  -6.795  8.090   1.00 0.00 ? 73  THR A HG23 6  
ATOM 11108 N N    . LEU A 1 74  ? -1.600  -3.619  5.230   1.00 0.00 ? 74  LEU A N    6  
ATOM 11109 C CA   . LEU A 1 74  ? -0.436  -2.740  5.202   1.00 0.00 ? 74  LEU A CA   6  
ATOM 11110 C C    . LEU A 1 74  ? 0.311   -2.784  6.532   1.00 0.00 ? 74  LEU A C    6  
ATOM 11111 O O    . LEU A 1 74  ? -0.303  -2.834  7.597   1.00 0.00 ? 74  LEU A O    6  
ATOM 11112 C CB   . LEU A 1 74  ? -0.863  -1.305  4.891   1.00 0.00 ? 74  LEU A CB   6  
ATOM 11113 C CG   . LEU A 1 74  ? 0.266   -0.282  4.760   1.00 0.00 ? 74  LEU A CG   6  
ATOM 11114 C CD1  . LEU A 1 74  ? 0.645   -0.090  3.300   1.00 0.00 ? 74  LEU A CD1  6  
ATOM 11115 C CD2  . LEU A 1 74  ? -0.140  1.044   5.386   1.00 0.00 ? 74  LEU A CD2  6  
ATOM 11116 H H    . LEU A 1 74  ? -2.435  -3.292  5.624   1.00 0.00 ? 74  LEU A H    6  
ATOM 11117 H HA   . LEU A 1 74  ? 0.224   -3.089  4.421   1.00 0.00 ? 74  LEU A HA   6  
ATOM 11118 H HB2  . LEU A 1 74  ? -1.408  -1.317  3.959   1.00 0.00 ? 74  LEU A HB2  6  
ATOM 11119 H HB3  . LEU A 1 74  ? -1.518  -0.976  5.685   1.00 0.00 ? 74  LEU A HB3  6  
ATOM 11120 H HG   . LEU A 1 74  ? 1.138   -0.648  5.285   1.00 0.00 ? 74  LEU A HG   6  
ATOM 11121 H HD11 . LEU A 1 74  ? 1.712   -0.210  3.186   1.00 0.00 ? 74  LEU A HD11 6  
ATOM 11122 H HD12 . LEU A 1 74  ? 0.358   0.902   2.981   1.00 0.00 ? 74  LEU A HD12 6  
ATOM 11123 H HD13 . LEU A 1 74  ? 0.133   -0.824  2.695   1.00 0.00 ? 74  LEU A HD13 6  
ATOM 11124 H HD21 . LEU A 1 74  ? -0.028  0.984   6.459   1.00 0.00 ? 74  LEU A HD21 6  
ATOM 11125 H HD22 . LEU A 1 74  ? -1.171  1.256   5.143   1.00 0.00 ? 74  LEU A HD22 6  
ATOM 11126 H HD23 . LEU A 1 74  ? 0.490   1.832   5.001   1.00 0.00 ? 74  LEU A HD23 6  
ATOM 11127 N N    . GLU A 1 75  ? 1.638   -2.761  6.461   1.00 0.00 ? 75  GLU A N    6  
ATOM 11128 C CA   . GLU A 1 75  ? 2.467   -2.797  7.659   1.00 0.00 ? 75  GLU A CA   6  
ATOM 11129 C C    . GLU A 1 75  ? 3.432   -1.615  7.689   1.00 0.00 ? 75  GLU A C    6  
ATOM 11130 O O    . GLU A 1 75  ? 4.602   -1.726  7.321   1.00 0.00 ? 75  GLU A O    6  
ATOM 11131 C CB   . GLU A 1 75  ? 3.250   -4.110  7.726   1.00 0.00 ? 75  GLU A CB   6  
ATOM 11132 C CG   . GLU A 1 75  ? 2.563   -5.265  7.017   1.00 0.00 ? 75  GLU A CG   6  
ATOM 11133 C CD   . GLU A 1 75  ? 3.265   -6.589  7.244   1.00 0.00 ? 75  GLU A CD   6  
ATOM 11134 O OE1  . GLU A 1 75  ? 3.244   -7.082  8.392   1.00 0.00 ? 75  GLU A OE1  6  
ATOM 11135 O OE2  . GLU A 1 75  ? 3.836   -7.133  6.276   1.00 0.00 ? 75  GLU A OE2  6  
ATOM 11136 H H    . GLU A 1 75  ? 2.069   -2.721  5.582   1.00 0.00 ? 75  GLU A H    6  
ATOM 11137 H HA   . GLU A 1 75  ? 1.814   -2.734  8.516   1.00 0.00 ? 75  GLU A HA   6  
ATOM 11138 H HB2  . GLU A 1 75  ? 4.219   -3.961  7.273   1.00 0.00 ? 75  GLU A HB2  6  
ATOM 11139 H HB3  . GLU A 1 75  ? 3.385   -4.381  8.763   1.00 0.00 ? 75  GLU A HB3  6  
ATOM 11140 H HG2  . GLU A 1 75  ? 1.551   -5.344  7.383   1.00 0.00 ? 75  GLU A HG2  6  
ATOM 11141 H HG3  . GLU A 1 75  ? 2.546   -5.060  5.957   1.00 0.00 ? 75  GLU A HG3  6  
ATOM 11142 N N    . PRO A 1 76  ? 2.931   -0.454  8.136   1.00 0.00 ? 76  PRO A N    6  
ATOM 11143 C CA   . PRO A 1 76  ? 3.731   0.772   8.224   1.00 0.00 ? 76  PRO A CA   6  
ATOM 11144 C C    . PRO A 1 76  ? 4.790   0.695   9.318   1.00 0.00 ? 76  PRO A C    6  
ATOM 11145 O O    . PRO A 1 76  ? 4.583   0.061   10.353  1.00 0.00 ? 76  PRO A O    6  
ATOM 11146 C CB   . PRO A 1 76  ? 2.694   1.848   8.558   1.00 0.00 ? 76  PRO A CB   6  
ATOM 11147 C CG   . PRO A 1 76  ? 1.587   1.112   9.230   1.00 0.00 ? 76  PRO A CG   6  
ATOM 11148 C CD   . PRO A 1 76  ? 1.545   -0.248  8.590   1.00 0.00 ? 76  PRO A CD   6  
ATOM 11149 H HA   . PRO A 1 76  ? 4.204   1.005   7.282   1.00 0.00 ? 76  PRO A HA   6  
ATOM 11150 H HB2  . PRO A 1 76  ? 3.136   2.585   9.214   1.00 0.00 ? 76  PRO A HB2  6  
ATOM 11151 H HB3  . PRO A 1 76  ? 2.358   2.323   7.649   1.00 0.00 ? 76  PRO A HB3  6  
ATOM 11152 H HG2  . PRO A 1 76  ? 1.793   1.024   10.286  1.00 0.00 ? 76  PRO A HG2  6  
ATOM 11153 H HG3  . PRO A 1 76  ? 0.653   1.630   9.070   1.00 0.00 ? 76  PRO A HG3  6  
ATOM 11154 H HD2  . PRO A 1 76  ? 1.262   -0.997  9.315   1.00 0.00 ? 76  PRO A HD2  6  
ATOM 11155 H HD3  . PRO A 1 76  ? 0.862   -0.251  7.754   1.00 0.00 ? 76  PRO A HD3  6  
ATOM 11156 N N    . CYS A 1 77  ? 5.925   1.344   9.082   1.00 0.00 ? 77  CYS A N    6  
ATOM 11157 C CA   . CYS A 1 77  ? 7.018   1.349   10.048  1.00 0.00 ? 77  CYS A CA   6  
ATOM 11158 C C    . CYS A 1 77  ? 6.627   2.116   11.307  1.00 0.00 ? 77  CYS A C    6  
ATOM 11159 O O    . CYS A 1 77  ? 5.510   2.619   11.417  1.00 0.00 ? 77  CYS A O    6  
ATOM 11160 C CB   . CYS A 1 77  ? 8.272   1.968   9.428   1.00 0.00 ? 77  CYS A CB   6  
ATOM 11161 S SG   . CYS A 1 77  ? 9.822   1.298   10.074  1.00 0.00 ? 77  CYS A SG   6  
ATOM 11162 H H    . CYS A 1 77  ? 6.031   1.832   8.238   1.00 0.00 ? 77  CYS A H    6  
ATOM 11163 H HA   . CYS A 1 77  ? 7.227   0.325   10.316  1.00 0.00 ? 77  CYS A HA   6  
ATOM 11164 H HB2  . CYS A 1 77  ? 8.259   1.795   8.361   1.00 0.00 ? 77  CYS A HB2  6  
ATOM 11165 H HB3  . CYS A 1 77  ? 8.268   3.031   9.613   1.00 0.00 ? 77  CYS A HB3  6  
ATOM 11166 H HG   . CYS A 1 77  ? 10.503  2.296   10.615  1.00 0.00 ? 77  CYS A HG   6  
ATOM 11167 N N    . GLU A 1 78  ? 7.556   2.199   12.255  1.00 0.00 ? 78  GLU A N    6  
ATOM 11168 C CA   . GLU A 1 78  ? 7.307   2.902   13.508  1.00 0.00 ? 78  GLU A CA   6  
ATOM 11169 C C    . GLU A 1 78  ? 7.735   4.363   13.406  1.00 0.00 ? 78  GLU A C    6  
ATOM 11170 O O    . GLU A 1 78  ? 8.880   4.663   13.068  1.00 0.00 ? 78  GLU A O    6  
ATOM 11171 C CB   . GLU A 1 78  ? 8.050   2.220   14.658  1.00 0.00 ? 78  GLU A CB   6  
ATOM 11172 C CG   . GLU A 1 78  ? 7.473   2.535   16.028  1.00 0.00 ? 78  GLU A CG   6  
ATOM 11173 C CD   . GLU A 1 78  ? 8.513   2.470   17.129  1.00 0.00 ? 78  GLU A CD   6  
ATOM 11174 O OE1  . GLU A 1 78  ? 9.642   2.012   16.851  1.00 0.00 ? 78  GLU A OE1  6  
ATOM 11175 O OE2  . GLU A 1 78  ? 8.200   2.877   18.267  1.00 0.00 ? 78  GLU A OE2  6  
ATOM 11176 H H    . GLU A 1 78  ? 8.428   1.777   12.109  1.00 0.00 ? 78  GLU A H    6  
ATOM 11177 H HA   . GLU A 1 78  ? 6.246   2.864   13.704  1.00 0.00 ? 78  GLU A HA   6  
ATOM 11178 H HB2  . GLU A 1 78  ? 8.013   1.151   14.511  1.00 0.00 ? 78  GLU A HB2  6  
ATOM 11179 H HB3  . GLU A 1 78  ? 9.081   2.541   14.644  1.00 0.00 ? 78  GLU A HB3  6  
ATOM 11180 H HG2  . GLU A 1 78  ? 7.054   3.530   16.008  1.00 0.00 ? 78  GLU A HG2  6  
ATOM 11181 H HG3  . GLU A 1 78  ? 6.692   1.822   16.248  1.00 0.00 ? 78  GLU A HG3  6  
ATOM 11182 N N    . ARG A 1 79  ? 6.807   5.268   13.699  1.00 0.00 ? 79  ARG A N    6  
ATOM 11183 C CA   . ARG A 1 79  ? 7.087   6.697   13.639  1.00 0.00 ? 79  ARG A CA   6  
ATOM 11184 C C    . ARG A 1 79  ? 7.367   7.137   12.205  1.00 0.00 ? 79  ARG A C    6  
ATOM 11185 O O    . ARG A 1 79  ? 8.080   8.112   11.972  1.00 0.00 ? 79  ARG A O    6  
ATOM 11186 C CB   . ARG A 1 79  ? 8.280   7.043   14.531  1.00 0.00 ? 79  ARG A CB   6  
ATOM 11187 C CG   . ARG A 1 79  ? 8.114   6.590   15.973  1.00 0.00 ? 79  ARG A CG   6  
ATOM 11188 C CD   . ARG A 1 79  ? 7.356   7.620   16.796  1.00 0.00 ? 79  ARG A CD   6  
ATOM 11189 N NE   . ARG A 1 79  ? 6.936   7.086   18.089  1.00 0.00 ? 79  ARG A NE   6  
ATOM 11190 C CZ   . ARG A 1 79  ? 6.244   7.784   18.982  1.00 0.00 ? 79  ARG A CZ   6  
ATOM 11191 N NH1  . ARG A 1 79  ? 5.896   9.037   18.725  1.00 0.00 ? 79  ARG A NH1  6  
ATOM 11192 N NH2  . ARG A 1 79  ? 5.898   7.228   20.137  1.00 0.00 ? 79  ARG A NH2  6  
ATOM 11193 H H    . ARG A 1 79  ? 5.912   4.967   13.962  1.00 0.00 ? 79  ARG A H    6  
ATOM 11194 H HA   . ARG A 1 79  ? 6.215   7.222   14.000  1.00 0.00 ? 79  ARG A HA   6  
ATOM 11195 H HB2  . ARG A 1 79  ? 9.165   6.571   14.129  1.00 0.00 ? 79  ARG A HB2  6  
ATOM 11196 H HB3  . ARG A 1 79  ? 8.420   8.113   14.527  1.00 0.00 ? 79  ARG A HB3  6  
ATOM 11197 H HG2  . ARG A 1 79  ? 7.566   5.660   15.988  1.00 0.00 ? 79  ARG A HG2  6  
ATOM 11198 H HG3  . ARG A 1 79  ? 9.091   6.442   16.409  1.00 0.00 ? 79  ARG A HG3  6  
ATOM 11199 H HD2  . ARG A 1 79  ? 7.998   8.473   16.961  1.00 0.00 ? 79  ARG A HD2  6  
ATOM 11200 H HD3  . ARG A 1 79  ? 6.482   7.930   16.243  1.00 0.00 ? 79  ARG A HD3  6  
ATOM 11201 H HE   . ARG A 1 79  ? 7.183   6.162   18.300  1.00 0.00 ? 79  ARG A HE   6  
ATOM 11202 H HH11 . ARG A 1 79  ? 6.154   9.458   17.855  1.00 0.00 ? 79  ARG A HH11 6  
ATOM 11203 H HH12 . ARG A 1 79  ? 5.374   9.560   19.399  1.00 0.00 ? 79  ARG A HH12 6  
ATOM 11204 H HH21 . ARG A 1 79  ? 6.159   6.283   20.334  1.00 0.00 ? 79  ARG A HH21 6  
ATOM 11205 H HH22 . ARG A 1 79  ? 5.378   7.754   20.809  1.00 0.00 ? 79  ARG A HH22 6  
ATOM 11206 N N    . SER A 1 80  ? 6.800   6.409   11.247  1.00 0.00 ? 80  SER A N    6  
ATOM 11207 C CA   . SER A 1 80  ? 6.992   6.721   9.836   1.00 0.00 ? 80  SER A CA   6  
ATOM 11208 C C    . SER A 1 80  ? 5.926   7.696   9.345   1.00 0.00 ? 80  SER A C    6  
ATOM 11209 O O    . SER A 1 80  ? 5.117   8.193   10.128  1.00 0.00 ? 80  SER A O    6  
ATOM 11210 C CB   . SER A 1 80  ? 6.952   5.441   8.999   1.00 0.00 ? 80  SER A CB   6  
ATOM 11211 O OG   . SER A 1 80  ? 5.921   4.574   9.441   1.00 0.00 ? 80  SER A OG   6  
ATOM 11212 H H    . SER A 1 80  ? 6.242   5.643   11.497  1.00 0.00 ? 80  SER A H    6  
ATOM 11213 H HA   . SER A 1 80  ? 7.962   7.182   9.727   1.00 0.00 ? 80  SER A HA   6  
ATOM 11214 H HB2  . SER A 1 80  ? 6.774   5.695   7.965   1.00 0.00 ? 80  SER A HB2  6  
ATOM 11215 H HB3  . SER A 1 80  ? 7.899   4.928   9.086   1.00 0.00 ? 80  SER A HB3  6  
ATOM 11216 H HG   . SER A 1 80  ? 6.170   4.183   10.282  1.00 0.00 ? 80  SER A HG   6  
ATOM 11217 N N    . GLU A 1 81  ? 5.933   7.965   8.043   1.00 0.00 ? 81  GLU A N    6  
ATOM 11218 C CA   . GLU A 1 81  ? 4.967   8.881   7.448   1.00 0.00 ? 81  GLU A CA   6  
ATOM 11219 C C    . GLU A 1 81  ? 4.055   8.149   6.468   1.00 0.00 ? 81  GLU A C    6  
ATOM 11220 O O    . GLU A 1 81  ? 4.237   8.229   5.253   1.00 0.00 ? 81  GLU A O    6  
ATOM 11221 C CB   . GLU A 1 81  ? 5.690   10.024  6.732   1.00 0.00 ? 81  GLU A CB   6  
ATOM 11222 C CG   . GLU A 1 81  ? 4.825   11.256  6.525   1.00 0.00 ? 81  GLU A CG   6  
ATOM 11223 C CD   . GLU A 1 81  ? 4.795   12.159  7.743   1.00 0.00 ? 81  GLU A CD   6  
ATOM 11224 O OE1  . GLU A 1 81  ? 4.064   11.835  8.703   1.00 0.00 ? 81  GLU A OE1  6  
ATOM 11225 O OE2  . GLU A 1 81  ? 5.501   13.189  7.736   1.00 0.00 ? 81  GLU A OE2  6  
ATOM 11226 H H    . GLU A 1 81  ? 6.603   7.537   7.470   1.00 0.00 ? 81  GLU A H    6  
ATOM 11227 H HA   . GLU A 1 81  ? 4.365   9.291   8.244   1.00 0.00 ? 81  GLU A HA   6  
ATOM 11228 H HB2  . GLU A 1 81  ? 6.553   10.309  7.314   1.00 0.00 ? 81  GLU A HB2  6  
ATOM 11229 H HB3  . GLU A 1 81  ? 6.019   9.675   5.764   1.00 0.00 ? 81  GLU A HB3  6  
ATOM 11230 H HG2  . GLU A 1 81  ? 5.214   11.818  5.689   1.00 0.00 ? 81  GLU A HG2  6  
ATOM 11231 H HG3  . GLU A 1 81  ? 3.816   10.939  6.305   1.00 0.00 ? 81  GLU A HG3  6  
ATOM 11232 N N    . THR A 1 82  ? 3.071   7.433   7.006   1.00 0.00 ? 82  THR A N    6  
ATOM 11233 C CA   . THR A 1 82  ? 2.131   6.685   6.181   1.00 0.00 ? 82  THR A CA   6  
ATOM 11234 C C    . THR A 1 82  ? 0.693   6.942   6.616   1.00 0.00 ? 82  THR A C    6  
ATOM 11235 O O    . THR A 1 82  ? 0.334   6.717   7.772   1.00 0.00 ? 82  THR A O    6  
ATOM 11236 C CB   . THR A 1 82  ? 2.412   5.172   6.242   1.00 0.00 ? 82  THR A CB   6  
ATOM 11237 O OG1  . THR A 1 82  ? 3.820   4.938   6.358   1.00 0.00 ? 82  THR A OG1  6  
ATOM 11238 C CG2  . THR A 1 82  ? 1.877   4.472   5.001   1.00 0.00 ? 82  THR A CG2  6  
ATOM 11239 H H    . THR A 1 82  ? 2.978   7.409   7.981   1.00 0.00 ? 82  THR A H    6  
ATOM 11240 H HA   . THR A 1 82  ? 2.252   7.011   5.158   1.00 0.00 ? 82  THR A HA   6  
ATOM 11241 H HB   . THR A 1 82  ? 1.914   4.763   7.110   1.00 0.00 ? 82  THR A HB   6  
ATOM 11242 H HG1  . THR A 1 82  ? 3.970   4.098   6.797   1.00 0.00 ? 82  THR A HG1  6  
ATOM 11243 H HG21 . THR A 1 82  ? 2.677   3.930   4.521   1.00 0.00 ? 82  THR A HG21 6  
ATOM 11244 H HG22 . THR A 1 82  ? 1.479   5.206   4.317   1.00 0.00 ? 82  THR A HG22 6  
ATOM 11245 H HG23 . THR A 1 82  ? 1.095   3.783   5.285   1.00 0.00 ? 82  THR A HG23 6  
ATOM 11246 N N    . TYR A 1 83  ? -0.127  7.412   5.683   1.00 0.00 ? 83  TYR A N    6  
ATOM 11247 C CA   . TYR A 1 83  ? -1.527  7.701   5.971   1.00 0.00 ? 83  TYR A CA   6  
ATOM 11248 C C    . TYR A 1 83  ? -2.447  6.922   5.037   1.00 0.00 ? 83  TYR A C    6  
ATOM 11249 O O    . TYR A 1 83  ? -2.260  6.922   3.820   1.00 0.00 ? 83  TYR A O    6  
ATOM 11250 C CB   . TYR A 1 83  ? -1.798  9.201   5.839   1.00 0.00 ? 83  TYR A CB   6  
ATOM 11251 C CG   . TYR A 1 83  ? -1.006  10.047  6.810   1.00 0.00 ? 83  TYR A CG   6  
ATOM 11252 C CD1  . TYR A 1 83  ? 0.330   10.347  6.572   1.00 0.00 ? 83  TYR A CD1  6  
ATOM 11253 C CD2  . TYR A 1 83  ? -1.594  10.548  7.965   1.00 0.00 ? 83  TYR A CD2  6  
ATOM 11254 C CE1  . TYR A 1 83  ? 1.057   11.119  7.457   1.00 0.00 ? 83  TYR A CE1  6  
ATOM 11255 C CE2  . TYR A 1 83  ? -0.875  11.323  8.855   1.00 0.00 ? 83  TYR A CE2  6  
ATOM 11256 C CZ   . TYR A 1 83  ? 0.450   11.605  8.597   1.00 0.00 ? 83  TYR A CZ   6  
ATOM 11257 O OH   . TYR A 1 83  ? 1.171   12.375  9.480   1.00 0.00 ? 83  TYR A OH   6  
ATOM 11258 H H    . TYR A 1 83  ? 0.217   7.571   4.780   1.00 0.00 ? 83  TYR A H    6  
ATOM 11259 H HA   . TYR A 1 83  ? -1.726  7.398   6.989   1.00 0.00 ? 83  TYR A HA   6  
ATOM 11260 H HB2  . TYR A 1 83  ? -1.544  9.519   4.840   1.00 0.00 ? 83  TYR A HB2  6  
ATOM 11261 H HB3  . TYR A 1 83  ? -2.847  9.387   6.015   1.00 0.00 ? 83  TYR A HB3  6  
ATOM 11262 H HD1  . TYR A 1 83  ? 0.802   9.965   5.679   1.00 0.00 ? 83  TYR A HD1  6  
ATOM 11263 H HD2  . TYR A 1 83  ? -2.632  10.326  8.164   1.00 0.00 ? 83  TYR A HD2  6  
ATOM 11264 H HE1  . TYR A 1 83  ? 2.095   11.340  7.255   1.00 0.00 ? 83  TYR A HE1  6  
ATOM 11265 H HE2  . TYR A 1 83  ? -1.349  11.703  9.747   1.00 0.00 ? 83  TYR A HE2  6  
ATOM 11266 H HH   . TYR A 1 83  ? 0.573   12.948  9.966   1.00 0.00 ? 83  TYR A HH   6  
ATOM 11267 N N    . VAL A 1 84  ? -3.444  6.259   5.615   1.00 0.00 ? 84  VAL A N    6  
ATOM 11268 C CA   . VAL A 1 84  ? -4.396  5.477   4.836   1.00 0.00 ? 84  VAL A CA   6  
ATOM 11269 C C    . VAL A 1 84  ? -5.807  6.041   4.966   1.00 0.00 ? 84  VAL A C    6  
ATOM 11270 O O    . VAL A 1 84  ? -6.298  6.262   6.071   1.00 0.00 ? 84  VAL A O    6  
ATOM 11271 C CB   . VAL A 1 84  ? -4.402  4.001   5.275   1.00 0.00 ? 84  VAL A CB   6  
ATOM 11272 C CG1  . VAL A 1 84  ? -5.552  3.253   4.618   1.00 0.00 ? 84  VAL A CG1  6  
ATOM 11273 C CG2  . VAL A 1 84  ? -3.071  3.343   4.947   1.00 0.00 ? 84  VAL A CG2  6  
ATOM 11274 H H    . VAL A 1 84  ? -3.541  6.298   6.590   1.00 0.00 ? 84  VAL A H    6  
ATOM 11275 H HA   . VAL A 1 84  ? -4.095  5.522   3.799   1.00 0.00 ? 84  VAL A HA   6  
ATOM 11276 H HB   . VAL A 1 84  ? -4.544  3.965   6.345   1.00 0.00 ? 84  VAL A HB   6  
ATOM 11277 H HG11 . VAL A 1 84  ? -6.324  3.066   5.349   1.00 0.00 ? 84  VAL A HG11 6  
ATOM 11278 H HG12 . VAL A 1 84  ? -5.955  3.848   3.811   1.00 0.00 ? 84  VAL A HG12 6  
ATOM 11279 H HG13 . VAL A 1 84  ? -5.193  2.313   4.226   1.00 0.00 ? 84  VAL A HG13 6  
ATOM 11280 H HG21 . VAL A 1 84  ? -3.203  2.650   4.129   1.00 0.00 ? 84  VAL A HG21 6  
ATOM 11281 H HG22 . VAL A 1 84  ? -2.355  4.100   4.666   1.00 0.00 ? 84  VAL A HG22 6  
ATOM 11282 H HG23 . VAL A 1 84  ? -2.709  2.810   5.815   1.00 0.00 ? 84  VAL A HG23 6  
ATOM 11283 N N    . ASN A 1 85  ? -6.453  6.271   3.827   1.00 0.00 ? 85  ASN A N    6  
ATOM 11284 C CA   . ASN A 1 85  ? -7.808  6.809   3.813   1.00 0.00 ? 85  ASN A CA   6  
ATOM 11285 C C    . ASN A 1 85  ? -7.844  8.209   4.419   1.00 0.00 ? 85  ASN A C    6  
ATOM 11286 O O    . ASN A 1 85  ? -8.877  8.654   4.919   1.00 0.00 ? 85  ASN A O    6  
ATOM 11287 C CB   . ASN A 1 85  ? -8.755  5.884   4.582   1.00 0.00 ? 85  ASN A CB   6  
ATOM 11288 C CG   . ASN A 1 85  ? -9.374  4.823   3.693   1.00 0.00 ? 85  ASN A CG   6  
ATOM 11289 O OD1  . ASN A 1 85  ? -10.234 5.117   2.862   1.00 0.00 ? 85  ASN A OD1  6  
ATOM 11290 N ND2  . ASN A 1 85  ? -8.939  3.580   3.864   1.00 0.00 ? 85  ASN A ND2  6  
ATOM 11291 H H    . ASN A 1 85  ? -6.008  6.075   2.976   1.00 0.00 ? 85  ASN A H    6  
ATOM 11292 H HA   . ASN A 1 85  ? -8.132  6.866   2.785   1.00 0.00 ? 85  ASN A HA   6  
ATOM 11293 H HB2  . ASN A 1 85  ? -8.204  5.390   5.369   1.00 0.00 ? 85  ASN A HB2  6  
ATOM 11294 H HB3  . ASN A 1 85  ? -9.549  6.472   5.017   1.00 0.00 ? 85  ASN A HB3  6  
ATOM 11295 H HD21 . ASN A 1 85  ? -8.252  3.420   4.545   1.00 0.00 ? 85  ASN A HD21 6  
ATOM 11296 H HD22 . ASN A 1 85  ? -9.321  2.875   3.302   1.00 0.00 ? 85  ASN A HD22 6  
ATOM 11297 N N    . GLY A 1 86  ? -6.708  8.898   4.371   1.00 0.00 ? 86  GLY A N    6  
ATOM 11298 C CA   . GLY A 1 86  ? -6.631  10.240  4.918   1.00 0.00 ? 86  GLY A CA   6  
ATOM 11299 C C    . GLY A 1 86  ? -6.071  10.261  6.326   1.00 0.00 ? 86  GLY A C    6  
ATOM 11300 O O    . GLY A 1 86  ? -5.465  11.246  6.747   1.00 0.00 ? 86  GLY A O    6  
ATOM 11301 H H    . GLY A 1 86  ? -5.916  8.492   3.960   1.00 0.00 ? 86  GLY A H    6  
ATOM 11302 H HA2  . GLY A 1 86  ? -5.998  10.841  4.281   1.00 0.00 ? 86  GLY A HA2  6  
ATOM 11303 H HA3  . GLY A 1 86  ? -7.622  10.669  4.931   1.00 0.00 ? 86  GLY A HA3  6  
ATOM 11304 N N    . LYS A 1 87  ? -6.276  9.171   7.059   1.00 0.00 ? 87  LYS A N    6  
ATOM 11305 C CA   . LYS A 1 87  ? -5.788  9.067   8.429   1.00 0.00 ? 87  LYS A CA   6  
ATOM 11306 C C    . LYS A 1 87  ? -4.409  8.416   8.467   1.00 0.00 ? 87  LYS A C    6  
ATOM 11307 O O    . LYS A 1 87  ? -3.922  7.913   7.455   1.00 0.00 ? 87  LYS A O    6  
ATOM 11308 C CB   . LYS A 1 87  ? -6.769  8.258   9.281   1.00 0.00 ? 87  LYS A CB   6  
ATOM 11309 C CG   . LYS A 1 87  ? -6.860  6.796   8.881   1.00 0.00 ? 87  LYS A CG   6  
ATOM 11310 C CD   . LYS A 1 87  ? -7.221  5.915   10.065  1.00 0.00 ? 87  LYS A CD   6  
ATOM 11311 C CE   . LYS A 1 87  ? -6.698  4.498   9.885   1.00 0.00 ? 87  LYS A CE   6  
ATOM 11312 N NZ   . LYS A 1 87  ? -7.311  3.553   10.859  1.00 0.00 ? 87  LYS A NZ   6  
ATOM 11313 H H    . LYS A 1 87  ? -6.767  8.418   6.667   1.00 0.00 ? 87  LYS A H    6  
ATOM 11314 H HA   . LYS A 1 87  ? -5.714  10.066  8.831   1.00 0.00 ? 87  LYS A HA   6  
ATOM 11315 H HB2  . LYS A 1 87  ? -6.457  8.308   10.314  1.00 0.00 ? 87  LYS A HB2  6  
ATOM 11316 H HB3  . LYS A 1 87  ? -7.753  8.697   9.190   1.00 0.00 ? 87  LYS A HB3  6  
ATOM 11317 H HG2  . LYS A 1 87  ? -7.620  6.687   8.120   1.00 0.00 ? 87  LYS A HG2  6  
ATOM 11318 H HG3  . LYS A 1 87  ? -5.905  6.480   8.486   1.00 0.00 ? 87  LYS A HG3  6  
ATOM 11319 H HD2  . LYS A 1 87  ? -6.788  6.335   10.960  1.00 0.00 ? 87  LYS A HD2  6  
ATOM 11320 H HD3  . LYS A 1 87  ? -8.297  5.883   10.164  1.00 0.00 ? 87  LYS A HD3  6  
ATOM 11321 H HE2  . LYS A 1 87  ? -6.928  4.168   8.883   1.00 0.00 ? 87  LYS A HE2  6  
ATOM 11322 H HE3  . LYS A 1 87  ? -5.628  4.503   10.026  1.00 0.00 ? 87  LYS A HE3  6  
ATOM 11323 H HZ1  . LYS A 1 87  ? -8.241  3.238   10.515  1.00 0.00 ? 87  LYS A HZ1  6  
ATOM 11324 H HZ2  . LYS A 1 87  ? -7.434  4.019   11.780  1.00 0.00 ? 87  LYS A HZ2  6  
ATOM 11325 H HZ3  . LYS A 1 87  ? -6.700  2.721   10.983  1.00 0.00 ? 87  LYS A HZ3  6  
ATOM 11326 N N    . ARG A 1 88  ? -3.786  8.430   9.641   1.00 0.00 ? 88  ARG A N    6  
ATOM 11327 C CA   . ARG A 1 88  ? -2.463  7.841   9.811   1.00 0.00 ? 88  ARG A CA   6  
ATOM 11328 C C    . ARG A 1 88  ? -2.565  6.342   10.077  1.00 0.00 ? 88  ARG A C    6  
ATOM 11329 O O    . ARG A 1 88  ? -3.521  5.874   10.696  1.00 0.00 ? 88  ARG A O    6  
ATOM 11330 C CB   . ARG A 1 88  ? -1.721  8.524   10.961  1.00 0.00 ? 88  ARG A CB   6  
ATOM 11331 C CG   . ARG A 1 88  ? -0.329  7.964   11.205  1.00 0.00 ? 88  ARG A CG   6  
ATOM 11332 C CD   . ARG A 1 88  ? 0.719   8.700   10.386  1.00 0.00 ? 88  ARG A CD   6  
ATOM 11333 N NE   . ARG A 1 88  ? 2.074   8.421   10.854  1.00 0.00 ? 88  ARG A NE   6  
ATOM 11334 C CZ   . ARG A 1 88  ? 2.574   8.902   11.986  1.00 0.00 ? 88  ARG A CZ   6  
ATOM 11335 N NH1  . ARG A 1 88  ? 1.834   9.681   12.763  1.00 0.00 ? 88  ARG A NH1  6  
ATOM 11336 N NH2  . ARG A 1 88  ? 3.816   8.604   12.345  1.00 0.00 ? 88  ARG A NH2  6  
ATOM 11337 H H    . ARG A 1 88  ? -4.226  8.846   10.411  1.00 0.00 ? 88  ARG A H    6  
ATOM 11338 H HA   . ARG A 1 88  ? -1.911  7.995   8.896   1.00 0.00 ? 88  ARG A HA   6  
ATOM 11339 H HB2  . ARG A 1 88  ? -1.627  9.577   10.738  1.00 0.00 ? 88  ARG A HB2  6  
ATOM 11340 H HB3  . ARG A 1 88  ? -2.297  8.406   11.866  1.00 0.00 ? 88  ARG A HB3  6  
ATOM 11341 H HG2  . ARG A 1 88  ? -0.089  8.068   12.253  1.00 0.00 ? 88  ARG A HG2  6  
ATOM 11342 H HG3  . ARG A 1 88  ? -0.319  6.919   10.933  1.00 0.00 ? 88  ARG A HG3  6  
ATOM 11343 H HD2  . ARG A 1 88  ? 0.634   8.389   9.355   1.00 0.00 ? 88  ARG A HD2  6  
ATOM 11344 H HD3  . ARG A 1 88  ? 0.534   9.761   10.458  1.00 0.00 ? 88  ARG A HD3  6  
ATOM 11345 H HE   . ARG A 1 88  ? 2.638   7.847   10.295  1.00 0.00 ? 88  ARG A HE   6  
ATOM 11346 H HH11 . ARG A 1 88  ? 0.897   9.907   12.496  1.00 0.00 ? 88  ARG A HH11 6  
ATOM 11347 H HH12 . ARG A 1 88  ? 2.212   10.042  13.616  1.00 0.00 ? 88  ARG A HH12 6  
ATOM 11348 H HH21 . ARG A 1 88  ? 4.377   8.016   11.762  1.00 0.00 ? 88  ARG A HH21 6  
ATOM 11349 H HH22 . ARG A 1 88  ? 4.192   8.966   13.197  1.00 0.00 ? 88  ARG A HH22 6  
ATOM 11350 N N    . VAL A 1 89  ? -1.574  5.593   9.603   1.00 0.00 ? 89  VAL A N    6  
ATOM 11351 C CA   . VAL A 1 89  ? -1.552  4.147   9.790   1.00 0.00 ? 89  VAL A CA   6  
ATOM 11352 C C    . VAL A 1 89  ? -0.256  3.699   10.456  1.00 0.00 ? 89  VAL A C    6  
ATOM 11353 O O    . VAL A 1 89  ? 0.804   3.690   9.830   1.00 0.00 ? 89  VAL A O    6  
ATOM 11354 C CB   . VAL A 1 89  ? -1.711  3.406   8.449   1.00 0.00 ? 89  VAL A CB   6  
ATOM 11355 C CG1  . VAL A 1 89  ? -0.517  3.673   7.546   1.00 0.00 ? 89  VAL A CG1  6  
ATOM 11356 C CG2  . VAL A 1 89  ? -1.888  1.913   8.685   1.00 0.00 ? 89  VAL A CG2  6  
ATOM 11357 H H    . VAL A 1 89  ? -0.840  6.024   9.117   1.00 0.00 ? 89  VAL A H    6  
ATOM 11358 H HA   . VAL A 1 89  ? -2.383  3.880   10.426  1.00 0.00 ? 89  VAL A HA   6  
ATOM 11359 H HB   . VAL A 1 89  ? -2.597  3.779   7.958   1.00 0.00 ? 89  VAL A HB   6  
ATOM 11360 H HG11 . VAL A 1 89  ? 0.131   2.809   7.541   1.00 0.00 ? 89  VAL A HG11 6  
ATOM 11361 H HG12 . VAL A 1 89  ? -0.862  3.872   6.542   1.00 0.00 ? 89  VAL A HG12 6  
ATOM 11362 H HG13 . VAL A 1 89  ? 0.029   4.529   7.916   1.00 0.00 ? 89  VAL A HG13 6  
ATOM 11363 H HG21 . VAL A 1 89  ? -1.112  1.372   8.165   1.00 0.00 ? 89  VAL A HG21 6  
ATOM 11364 H HG22 . VAL A 1 89  ? -1.826  1.706   9.743   1.00 0.00 ? 89  VAL A HG22 6  
ATOM 11365 H HG23 . VAL A 1 89  ? -2.854  1.602   8.313   1.00 0.00 ? 89  VAL A HG23 6  
ATOM 11366 N N    . SER A 1 90  ? -0.348  3.327   11.728  1.00 0.00 ? 90  SER A N    6  
ATOM 11367 C CA   . SER A 1 90  ? 0.818   2.880   12.481  1.00 0.00 ? 90  SER A CA   6  
ATOM 11368 C C    . SER A 1 90  ? 0.625   1.453   12.985  1.00 0.00 ? 90  SER A C    6  
ATOM 11369 O O    . SER A 1 90  ? 1.340   0.998   13.878  1.00 0.00 ? 90  SER A O    6  
ATOM 11370 C CB   . SER A 1 90  ? 1.080   3.819   13.660  1.00 0.00 ? 90  SER A CB   6  
ATOM 11371 O OG   . SER A 1 90  ? 2.342   3.556   14.250  1.00 0.00 ? 90  SER A OG   6  
ATOM 11372 H H    . SER A 1 90  ? -1.222  3.356   12.172  1.00 0.00 ? 90  SER A H    6  
ATOM 11373 H HA   . SER A 1 90  ? 1.669   2.903   11.817  1.00 0.00 ? 90  SER A HA   6  
ATOM 11374 H HB2  . SER A 1 90  ? 1.064   4.841   13.314  1.00 0.00 ? 90  SER A HB2  6  
ATOM 11375 H HB3  . SER A 1 90  ? 0.311   3.679   14.406  1.00 0.00 ? 90  SER A HB3  6  
ATOM 11376 H HG   . SER A 1 90  ? 2.708   4.372   14.600  1.00 0.00 ? 90  SER A HG   6  
ATOM 11377 N N    . GLN A 1 91  ? -0.345  0.754   12.406  1.00 0.00 ? 91  GLN A N    6  
ATOM 11378 C CA   . GLN A 1 91  ? -0.633  -0.621  12.797  1.00 0.00 ? 91  GLN A CA   6  
ATOM 11379 C C    . GLN A 1 91  ? -1.011  -1.464  11.583  1.00 0.00 ? 91  GLN A C    6  
ATOM 11380 O O    . GLN A 1 91  ? -1.479  -0.955  10.565  1.00 0.00 ? 91  GLN A O    6  
ATOM 11381 C CB   . GLN A 1 91  ? -1.763  -0.655  13.828  1.00 0.00 ? 91  GLN A CB   6  
ATOM 11382 C CG   . GLN A 1 91  ? -3.146  -0.791  13.210  1.00 0.00 ? 91  GLN A CG   6  
ATOM 11383 C CD   . GLN A 1 91  ? -4.226  -0.136  14.049  1.00 0.00 ? 91  GLN A CD   6  
ATOM 11384 O OE1  . GLN A 1 91  ? -4.415  1.080   13.999  1.00 0.00 ? 91  GLN A OE1  6  
ATOM 11385 N NE2  . GLN A 1 91  ? -4.941  -0.940  14.826  1.00 0.00 ? 91  GLN A NE2  6  
ATOM 11386 H H    . GLN A 1 91  ? -0.881  1.172   11.701  1.00 0.00 ? 91  GLN A H    6  
ATOM 11387 H HA   . GLN A 1 91  ? 0.260   -1.033  13.242  1.00 0.00 ? 91  GLN A HA   6  
ATOM 11388 H HB2  . GLN A 1 91  ? -1.604  -1.492  14.491  1.00 0.00 ? 91  GLN A HB2  6  
ATOM 11389 H HB3  . GLN A 1 91  ? -1.737  0.259   14.402  1.00 0.00 ? 91  GLN A HB3  6  
ATOM 11390 H HG2  . GLN A 1 91  ? -3.138  -0.327  12.235  1.00 0.00 ? 91  GLN A HG2  6  
ATOM 11391 H HG3  . GLN A 1 91  ? -3.377  -1.840  13.107  1.00 0.00 ? 91  GLN A HG3  6  
ATOM 11392 H HE21 . GLN A 1 91  ? -4.734  -1.899  14.816  1.00 0.00 ? 91  GLN A HE21 6  
ATOM 11393 H HE22 . GLN A 1 91  ? -5.645  -0.544  15.379  1.00 0.00 ? 91  GLN A HE22 6  
ATOM 11394 N N    . PRO A 1 92  ? -0.803  -2.785  11.692  1.00 0.00 ? 92  PRO A N    6  
ATOM 11395 C CA   . PRO A 1 92  ? -1.114  -3.727  10.613  1.00 0.00 ? 92  PRO A CA   6  
ATOM 11396 C C    . PRO A 1 92  ? -2.616  -3.882  10.395  1.00 0.00 ? 92  PRO A C    6  
ATOM 11397 O O    . PRO A 1 92  ? -3.270  -4.685  11.059  1.00 0.00 ? 92  PRO A O    6  
ATOM 11398 C CB   . PRO A 1 92  ? -0.506  -5.043  11.104  1.00 0.00 ? 92  PRO A CB   6  
ATOM 11399 C CG   . PRO A 1 92  ? -0.481  -4.917  12.588  1.00 0.00 ? 92  PRO A CG   6  
ATOM 11400 C CD   . PRO A 1 92  ? -0.247  -3.460  12.877  1.00 0.00 ? 92  PRO A CD   6  
ATOM 11401 H HA   . PRO A 1 92  ? -0.645  -3.435  9.684   1.00 0.00 ? 92  PRO A HA   6  
ATOM 11402 H HB2  . PRO A 1 92  ? -1.127  -5.869  10.787  1.00 0.00 ? 92  PRO A HB2  6  
ATOM 11403 H HB3  . PRO A 1 92  ? 0.488   -5.157  10.700  1.00 0.00 ? 92  PRO A HB3  6  
ATOM 11404 H HG2  . PRO A 1 92  ? -1.426  -5.235  13.000  1.00 0.00 ? 92  PRO A HG2  6  
ATOM 11405 H HG3  . PRO A 1 92  ? 0.325   -5.513  12.992  1.00 0.00 ? 92  PRO A HG3  6  
ATOM 11406 H HD2  . PRO A 1 92  ? -0.774  -3.164  13.772  1.00 0.00 ? 92  PRO A HD2  6  
ATOM 11407 H HD3  . PRO A 1 92  ? 0.809   -3.259  12.974  1.00 0.00 ? 92  PRO A HD3  6  
ATOM 11408 N N    . VAL A 1 93  ? -3.156  -3.108  9.459   1.00 0.00 ? 93  VAL A N    6  
ATOM 11409 C CA   . VAL A 1 93  ? -4.581  -3.161  9.152   1.00 0.00 ? 93  VAL A CA   6  
ATOM 11410 C C    . VAL A 1 93  ? -4.816  -3.584  7.706   1.00 0.00 ? 93  VAL A C    6  
ATOM 11411 O O    . VAL A 1 93  ? -3.886  -3.617  6.900   1.00 0.00 ? 93  VAL A O    6  
ATOM 11412 C CB   . VAL A 1 93  ? -5.258  -1.799  9.393   1.00 0.00 ? 93  VAL A CB   6  
ATOM 11413 C CG1  . VAL A 1 93  ? -5.098  -1.373  10.845  1.00 0.00 ? 93  VAL A CG1  6  
ATOM 11414 C CG2  . VAL A 1 93  ? -4.687  -0.747  8.455   1.00 0.00 ? 93  VAL A CG2  6  
ATOM 11415 H H    . VAL A 1 93  ? -2.583  -2.487  8.962   1.00 0.00 ? 93  VAL A H    6  
ATOM 11416 H HA   . VAL A 1 93  ? -5.037  -3.887  9.808   1.00 0.00 ? 93  VAL A HA   6  
ATOM 11417 H HB   . VAL A 1 93  ? -6.313  -1.902  9.186   1.00 0.00 ? 93  VAL A HB   6  
ATOM 11418 H HG11 . VAL A 1 93  ? -5.122  -0.295  10.908  1.00 0.00 ? 93  VAL A HG11 6  
ATOM 11419 H HG12 . VAL A 1 93  ? -5.904  -1.787  11.433  1.00 0.00 ? 93  VAL A HG12 6  
ATOM 11420 H HG13 . VAL A 1 93  ? -4.153  -1.734  11.224  1.00 0.00 ? 93  VAL A HG13 6  
ATOM 11421 H HG21 . VAL A 1 93  ? -5.134  -0.855  7.478   1.00 0.00 ? 93  VAL A HG21 6  
ATOM 11422 H HG22 . VAL A 1 93  ? -4.904  0.237   8.843   1.00 0.00 ? 93  VAL A HG22 6  
ATOM 11423 H HG23 . VAL A 1 93  ? -3.617  -0.875  8.377   1.00 0.00 ? 93  VAL A HG23 6  
ATOM 11424 N N    . GLN A 1 94  ? -6.065  -3.906  7.385   1.00 0.00 ? 94  GLN A N    6  
ATOM 11425 C CA   . GLN A 1 94  ? -6.422  -4.327  6.036   1.00 0.00 ? 94  GLN A CA   6  
ATOM 11426 C C    . GLN A 1 94  ? -6.734  -3.122  5.154   1.00 0.00 ? 94  GLN A C    6  
ATOM 11427 O O    . GLN A 1 94  ? -7.348  -2.153  5.604   1.00 0.00 ? 94  GLN A O    6  
ATOM 11428 C CB   . GLN A 1 94  ? -7.626  -5.270  6.075   1.00 0.00 ? 94  GLN A CB   6  
ATOM 11429 C CG   . GLN A 1 94  ? -7.286  -6.669  6.565   1.00 0.00 ? 94  GLN A CG   6  
ATOM 11430 C CD   . GLN A 1 94  ? -8.507  -7.436  7.034   1.00 0.00 ? 94  GLN A CD   6  
ATOM 11431 O OE1  . GLN A 1 94  ? -9.609  -6.889  7.103   1.00 0.00 ? 94  GLN A OE1  6  
ATOM 11432 N NE2  . GLN A 1 94  ? -8.318  -8.709  7.359   1.00 0.00 ? 94  GLN A NE2  6  
ATOM 11433 H H    . GLN A 1 94  ? -6.762  -3.859  8.072   1.00 0.00 ? 94  GLN A H    6  
ATOM 11434 H HA   . GLN A 1 94  ? -5.577  -4.853  5.619   1.00 0.00 ? 94  GLN A HA   6  
ATOM 11435 H HB2  . GLN A 1 94  ? -8.374  -4.854  6.733   1.00 0.00 ? 94  GLN A HB2  6  
ATOM 11436 H HB3  . GLN A 1 94  ? -8.037  -5.351  5.080   1.00 0.00 ? 94  GLN A HB3  6  
ATOM 11437 H HG2  . GLN A 1 94  ? -6.825  -7.217  5.757   1.00 0.00 ? 94  GLN A HG2  6  
ATOM 11438 H HG3  . GLN A 1 94  ? -6.591  -6.590  7.387   1.00 0.00 ? 94  GLN A HG3  6  
ATOM 11439 H HE21 . GLN A 1 94  ? -7.413  -9.077  7.280   1.00 0.00 ? 94  GLN A HE21 6  
ATOM 11440 H HE22 . GLN A 1 94  ? -9.090  -9.228  7.666   1.00 0.00 ? 94  GLN A HE22 6  
ATOM 11441 N N    . LEU A 1 95  ? -6.308  -3.188  3.898   1.00 0.00 ? 95  LEU A N    6  
ATOM 11442 C CA   . LEU A 1 95  ? -6.542  -2.103  2.952   1.00 0.00 ? 95  LEU A CA   6  
ATOM 11443 C C    . LEU A 1 95  ? -7.889  -2.267  2.257   1.00 0.00 ? 95  LEU A C    6  
ATOM 11444 O O    . LEU A 1 95  ? -8.466  -3.354  2.249   1.00 0.00 ? 95  LEU A O    6  
ATOM 11445 C CB   . LEU A 1 95  ? -5.421  -2.055  1.913   1.00 0.00 ? 95  LEU A CB   6  
ATOM 11446 C CG   . LEU A 1 95  ? -4.068  -1.543  2.407   1.00 0.00 ? 95  LEU A CG   6  
ATOM 11447 C CD1  . LEU A 1 95  ? -4.235  -0.228  3.154   1.00 0.00 ? 95  LEU A CD1  6  
ATOM 11448 C CD2  . LEU A 1 95  ? -3.396  -2.580  3.294   1.00 0.00 ? 95  LEU A CD2  6  
ATOM 11449 H H    . LEU A 1 95  ? -5.825  -3.986  3.598   1.00 0.00 ? 95  LEU A H    6  
ATOM 11450 H HA   . LEU A 1 95  ? -6.546  -1.176  3.507   1.00 0.00 ? 95  LEU A HA   6  
ATOM 11451 H HB2  . LEU A 1 95  ? -5.277  -3.056  1.536   1.00 0.00 ? 95  LEU A HB2  6  
ATOM 11452 H HB3  . LEU A 1 95  ? -5.745  -1.413  1.107   1.00 0.00 ? 95  LEU A HB3  6  
ATOM 11453 H HG   . LEU A 1 95  ? -3.425  -1.362  1.556   1.00 0.00 ? 95  LEU A HG   6  
ATOM 11454 H HD11 . LEU A 1 95  ? -4.822  0.453   2.556   1.00 0.00 ? 95  LEU A HD11 6  
ATOM 11455 H HD12 . LEU A 1 95  ? -3.264  0.204   3.344   1.00 0.00 ? 95  LEU A HD12 6  
ATOM 11456 H HD13 . LEU A 1 95  ? -4.739  -0.410  4.092   1.00 0.00 ? 95  LEU A HD13 6  
ATOM 11457 H HD21 . LEU A 1 95  ? -3.315  -2.196  4.300   1.00 0.00 ? 95  LEU A HD21 6  
ATOM 11458 H HD22 . LEU A 1 95  ? -2.409  -2.797  2.910   1.00 0.00 ? 95  LEU A HD22 6  
ATOM 11459 H HD23 . LEU A 1 95  ? -3.986  -3.485  3.300   1.00 0.00 ? 95  LEU A HD23 6  
ATOM 11460 N N    . ARG A 1 96  ? -8.384  -1.180  1.673   1.00 0.00 ? 96  ARG A N    6  
ATOM 11461 C CA   . ARG A 1 96  ? -9.663  -1.204  0.974   1.00 0.00 ? 96  ARG A CA   6  
ATOM 11462 C C    . ARG A 1 96  ? -9.485  -0.842  -0.498  1.00 0.00 ? 96  ARG A C    6  
ATOM 11463 O O    . ARG A 1 96  ? -8.453  -0.301  -0.894  1.00 0.00 ? 96  ARG A O    6  
ATOM 11464 C CB   . ARG A 1 96  ? -10.647 -0.235  1.633   1.00 0.00 ? 96  ARG A CB   6  
ATOM 11465 C CG   . ARG A 1 96  ? -11.420 -0.846  2.790   1.00 0.00 ? 96  ARG A CG   6  
ATOM 11466 C CD   . ARG A 1 96  ? -12.662 -1.578  2.306   1.00 0.00 ? 96  ARG A CD   6  
ATOM 11467 N NE   . ARG A 1 96  ? -12.380 -2.970  1.966   1.00 0.00 ? 96  ARG A NE   6  
ATOM 11468 C CZ   . ARG A 1 96  ? -13.263 -3.780  1.394   1.00 0.00 ? 96  ARG A CZ   6  
ATOM 11469 N NH1  . ARG A 1 96  ? -14.478 -3.339  1.098   1.00 0.00 ? 96  ARG A NH1  6  
ATOM 11470 N NH2  . ARG A 1 96  ? -12.931 -5.035  1.116   1.00 0.00 ? 96  ARG A NH2  6  
ATOM 11471 H H    . ARG A 1 96  ? -7.877  -0.342  1.713   1.00 0.00 ? 96  ARG A H    6  
ATOM 11472 H HA   . ARG A 1 96  ? -10.059 -2.206  1.040   1.00 0.00 ? 96  ARG A HA   6  
ATOM 11473 H HB2  . ARG A 1 96  ? -10.099 0.618   2.006   1.00 0.00 ? 96  ARG A HB2  6  
ATOM 11474 H HB3  . ARG A 1 96  ? -11.356 0.099   0.891   1.00 0.00 ? 96  ARG A HB3  6  
ATOM 11475 H HG2  . ARG A 1 96  ? -10.782 -1.547  3.307   1.00 0.00 ? 96  ARG A HG2  6  
ATOM 11476 H HG3  . ARG A 1 96  ? -11.717 -0.059  3.467   1.00 0.00 ? 96  ARG A HG3  6  
ATOM 11477 H HD2  . ARG A 1 96  ? -13.407 -1.552  3.087   1.00 0.00 ? 96  ARG A HD2  6  
ATOM 11478 H HD3  . ARG A 1 96  ? -13.042 -1.073  1.430   1.00 0.00 ? 96  ARG A HD3  6  
ATOM 11479 H HE   . ARG A 1 96  ? -11.488 -3.316  2.176   1.00 0.00 ? 96  ARG A HE   6  
ATOM 11480 H HH11 . ARG A 1 96  ? -14.730 -2.395  1.306   1.00 0.00 ? 96  ARG A HH11 6  
ATOM 11481 H HH12 . ARG A 1 96  ? -15.141 -3.952  0.666   1.00 0.00 ? 96  ARG A HH12 6  
ATOM 11482 H HH21 . ARG A 1 96  ? -12.016 -5.371  1.337   1.00 0.00 ? 96  ARG A HH21 6  
ATOM 11483 H HH22 . ARG A 1 96  ? -13.597 -5.644  0.685   1.00 0.00 ? 96  ARG A HH22 6  
ATOM 11484 N N    . SER A 1 97  ? -10.498 -1.145  -1.303  1.00 0.00 ? 97  SER A N    6  
ATOM 11485 C CA   . SER A 1 97  ? -10.452 -0.856  -2.732  1.00 0.00 ? 97  SER A CA   6  
ATOM 11486 C C    . SER A 1 97  ? -10.584 0.642   -2.987  1.00 0.00 ? 97  SER A C    6  
ATOM 11487 O O    . SER A 1 97  ? -11.651 1.224   -2.796  1.00 0.00 ? 97  SER A O    6  
ATOM 11488 C CB   . SER A 1 97  ? -11.565 -1.610  -3.462  1.00 0.00 ? 97  SER A CB   6  
ATOM 11489 O OG   . SER A 1 97  ? -11.359 -1.590  -4.864  1.00 0.00 ? 97  SER A OG   6  
ATOM 11490 H H    . SER A 1 97  ? -11.294 -1.576  -0.928  1.00 0.00 ? 97  SER A H    6  
ATOM 11491 H HA   . SER A 1 97  ? -9.496  -1.190  -3.107  1.00 0.00 ? 97  SER A HA   6  
ATOM 11492 H HB2  . SER A 1 97  ? -11.581 -2.636  -3.128  1.00 0.00 ? 97  SER A HB2  6  
ATOM 11493 H HB3  . SER A 1 97  ? -12.515 -1.144  -3.243  1.00 0.00 ? 97  SER A HB3  6  
ATOM 11494 H HG   . SER A 1 97  ? -12.030 -1.042  -5.279  1.00 0.00 ? 97  SER A HG   6  
ATOM 11495 N N    . GLY A 1 98  ? -9.491  1.261   -3.421  1.00 0.00 ? 98  GLY A N    6  
ATOM 11496 C CA   . GLY A 1 98  ? -9.504  2.686   -3.696  1.00 0.00 ? 98  GLY A CA   6  
ATOM 11497 C C    . GLY A 1 98  ? -9.021  3.508   -2.518  1.00 0.00 ? 98  GLY A C    6  
ATOM 11498 O O    . GLY A 1 98  ? -9.151  4.732   -2.512  1.00 0.00 ? 98  GLY A O    6  
ATOM 11499 H H    . GLY A 1 98  ? -8.668  0.746   -3.556  1.00 0.00 ? 98  GLY A H    6  
ATOM 11500 H HA2  . GLY A 1 98  ? -8.868  2.884   -4.546  1.00 0.00 ? 98  GLY A HA2  6  
ATOM 11501 H HA3  . GLY A 1 98  ? -10.514 2.985   -3.939  1.00 0.00 ? 98  GLY A HA3  6  
ATOM 11502 N N    . ASN A 1 99  ? -8.464  2.835   -1.517  1.00 0.00 ? 99  ASN A N    6  
ATOM 11503 C CA   . ASN A 1 99  ? -7.961  3.511   -0.327  1.00 0.00 ? 99  ASN A CA   6  
ATOM 11504 C C    . ASN A 1 99  ? -6.749  4.374   -0.662  1.00 0.00 ? 99  ASN A C    6  
ATOM 11505 O O    . ASN A 1 99  ? -5.809  3.916   -1.311  1.00 0.00 ? 99  ASN A O    6  
ATOM 11506 C CB   . ASN A 1 99  ? -7.591  2.488   0.749   1.00 0.00 ? 99  ASN A CB   6  
ATOM 11507 C CG   . ASN A 1 99  ? -6.181  1.956   0.580   1.00 0.00 ? 99  ASN A CG   6  
ATOM 11508 O OD1  . ASN A 1 99  ? -5.242  2.447   1.206   1.00 0.00 ? 99  ASN A OD1  6  
ATOM 11509 N ND2  . ASN A 1 99  ? -6.028  0.947   -0.269  1.00 0.00 ? 99  ASN A ND2  6  
ATOM 11510 H H    . ASN A 1 99  ? -8.388  1.860   -1.580  1.00 0.00 ? 99  ASN A H    6  
ATOM 11511 H HA   . ASN A 1 99  ? -8.748  4.147   0.050   1.00 0.00 ? 99  ASN A HA   6  
ATOM 11512 H HB2  . ASN A 1 99  ? -7.665  2.954   1.721   1.00 0.00 ? 99  ASN A HB2  6  
ATOM 11513 H HB3  . ASN A 1 99  ? -8.279  1.657   0.699   1.00 0.00 ? 99  ASN A HB3  6  
ATOM 11514 H HD21 . ASN A 1 99  ? -6.822  0.607   -0.733  1.00 0.00 ? 99  ASN A HD21 6  
ATOM 11515 H HD22 . ASN A 1 99  ? -5.127  0.583   -0.397  1.00 0.00 ? 99  ASN A HD22 6  
ATOM 11516 N N    . ARG A 1 100 ? -6.778  5.625   -0.215  1.00 0.00 ? 100 ARG A N    6  
ATOM 11517 C CA   . ARG A 1 100 ? -5.681  6.552   -0.468  1.00 0.00 ? 100 ARG A CA   6  
ATOM 11518 C C    . ARG A 1 100 ? -4.551  6.345   0.536   1.00 0.00 ? 100 ARG A C    6  
ATOM 11519 O O    . ARG A 1 100 ? -4.736  6.526   1.740   1.00 0.00 ? 100 ARG A O    6  
ATOM 11520 C CB   . ARG A 1 100 ? -6.181  7.997   -0.398  1.00 0.00 ? 100 ARG A CB   6  
ATOM 11521 C CG   . ARG A 1 100 ? -5.513  8.921   -1.403  1.00 0.00 ? 100 ARG A CG   6  
ATOM 11522 C CD   . ARG A 1 100 ? -6.052  8.700   -2.808  1.00 0.00 ? 100 ARG A CD   6  
ATOM 11523 N NE   . ARG A 1 100 ? -7.500  8.508   -2.814  1.00 0.00 ? 100 ARG A NE   6  
ATOM 11524 C CZ   . ARG A 1 100 ? -8.374  9.501   -2.691  1.00 0.00 ? 100 ARG A CZ   6  
ATOM 11525 N NH1  . ARG A 1 100 ? -7.948  10.750  -2.554  1.00 0.00 ? 100 ARG A NH1  6  
ATOM 11526 N NH2  . ARG A 1 100 ? -9.676  9.247   -2.706  1.00 0.00 ? 100 ARG A NH2  6  
ATOM 11527 H H    . ARG A 1 100 ? -7.555  5.932   0.297   1.00 0.00 ? 100 ARG A H    6  
ATOM 11528 H HA   . ARG A 1 100 ? -5.305  6.358   -1.461  1.00 0.00 ? 100 ARG A HA   6  
ATOM 11529 H HB2  . ARG A 1 100 ? -7.245  8.007   -0.585  1.00 0.00 ? 100 ARG A HB2  6  
ATOM 11530 H HB3  . ARG A 1 100 ? -5.993  8.382   0.593   1.00 0.00 ? 100 ARG A HB3  6  
ATOM 11531 H HG2  . ARG A 1 100 ? -5.699  9.945   -1.115  1.00 0.00 ? 100 ARG A HG2  6  
ATOM 11532 H HG3  . ARG A 1 100 ? -4.450  8.732   -1.401  1.00 0.00 ? 100 ARG A HG3  6  
ATOM 11533 H HD2  . ARG A 1 100 ? -5.811  9.562   -3.411  1.00 0.00 ? 100 ARG A HD2  6  
ATOM 11534 H HD3  . ARG A 1 100 ? -5.580  7.824