data_2EMG
# 
_entry.id   2EMG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2EMG         
RCSB  RCSB026845   
WWPDB D_1000026845 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hso003006001.3 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        2EMG 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2007-03-28 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tomizawa, T.'                                           1  
'Tochio, N.'                                             2  
'Abe, H.'                                                3  
'Saito, K.'                                              4  
'Li, H.'                                                 5  
'Sato, M.'                                               6  
'Koshiba, S.'                                            7  
'Kobayashi, N.'                                          8  
'Kigawa, T.'                                             9  
'Yokoyama, S.'                                           10 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 11 
# 
_citation.id                        primary 
_citation.title                     
'Solution structure of the C2H2 type zinc finger (region 463-495) of human Zinc finger protein 484' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Tochio, N.'    1  
primary 'Tomizawa, T.'  2  
primary 'Abe, H.'       3  
primary 'Saito, K.'     4  
primary 'Li, H.'        5  
primary 'Sato, M.'      6  
primary 'Koshiba, S.'   7  
primary 'Kobayashi, N.' 8  
primary 'Kigawa, T.'    9  
primary 'Yokoyama, S.'  10 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Zinc finger protein 484' 4735.213 1 ? ? zf-C2H2 ? 
2 non-polymer syn 'ZINC ION'                65.409   1 ? ? ?       ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       GSSGSSGTGENPFICSECGKVFTHKTNLIIHQKIHTGERPSGPSSG 
_entity_poly.pdbx_seq_one_letter_code_can   GSSGSSGTGENPFICSECGKVFTHKTNLIIHQKIHTGERPSGPSSG 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hso003006001.3 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  SER n 
1 4  GLY n 
1 5  SER n 
1 6  SER n 
1 7  GLY n 
1 8  THR n 
1 9  GLY n 
1 10 GLU n 
1 11 ASN n 
1 12 PRO n 
1 13 PHE n 
1 14 ILE n 
1 15 CYS n 
1 16 SER n 
1 17 GLU n 
1 18 CYS n 
1 19 GLY n 
1 20 LYS n 
1 21 VAL n 
1 22 PHE n 
1 23 THR n 
1 24 HIS n 
1 25 LYS n 
1 26 THR n 
1 27 ASN n 
1 28 LEU n 
1 29 ILE n 
1 30 ILE n 
1 31 HIS n 
1 32 GLN n 
1 33 LYS n 
1 34 ILE n 
1 35 HIS n 
1 36 THR n 
1 37 GLY n 
1 38 GLU n 
1 39 ARG n 
1 40 PRO n 
1 41 SER n 
1 42 GLY n 
1 43 PRO n 
1 44 SER n 
1 45 SER n 
1 46 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ZNF484 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P070115-41 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ZN484_HUMAN 
_struct_ref.pdbx_db_accession          Q5JVG2 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   TGENPFICSECGKVFTHKTNLIIHQKIHTGERP 
_struct_ref.pdbx_align_begin           463 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2EMG 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 40 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q5JVG2 
_struct_ref_seq.db_align_beg                  463 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  495 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       40 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2EMG GLY A 1  ? UNP Q5JVG2 ? ? 'EXPRESSION TAG' 1  1  
1 2EMG SER A 2  ? UNP Q5JVG2 ? ? 'EXPRESSION TAG' 2  2  
1 2EMG SER A 3  ? UNP Q5JVG2 ? ? 'EXPRESSION TAG' 3  3  
1 2EMG GLY A 4  ? UNP Q5JVG2 ? ? 'EXPRESSION TAG' 4  4  
1 2EMG SER A 5  ? UNP Q5JVG2 ? ? 'EXPRESSION TAG' 5  5  
1 2EMG SER A 6  ? UNP Q5JVG2 ? ? 'EXPRESSION TAG' 6  6  
1 2EMG GLY A 7  ? UNP Q5JVG2 ? ? 'EXPRESSION TAG' 7  7  
1 2EMG SER A 41 ? UNP Q5JVG2 ? ? 'EXPRESSION TAG' 41 8  
1 2EMG GLY A 42 ? UNP Q5JVG2 ? ? 'EXPRESSION TAG' 42 9  
1 2EMG PRO A 43 ? UNP Q5JVG2 ? ? 'EXPRESSION TAG' 43 10 
1 2EMG SER A 44 ? UNP Q5JVG2 ? ? 'EXPRESSION TAG' 44 11 
1 2EMG SER A 45 ? UNP Q5JVG2 ? ? 'EXPRESSION TAG' 45 12 
1 2EMG GLY A 46 ? UNP Q5JVG2 ? ? 'EXPRESSION TAG' 46 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_13C-separated_NOESY 
2 1 1 3D_15N-separated_NOESY 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'about 1.0mM sample U-15N,13C; 20mM d-Tris-HCl; 100mM NaCl; 0.05mM ZnCl2; 1mM IDA; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.entry_id           2EMG 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the least restraint violations, target function' 
_pdbx_nmr_ensemble.entry_id                                      2EMG 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
_pdbx_nmr_representative.entry_id             2EMG 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           XWINNMR 3.5      Bruker          1 
processing           NMRPipe 20030801 'Delaglio, F.'  2 
'data analysis'      NMRVIEW 5.0.4    'Johnson, B.A.' 3 
'data analysis'      Kujira  0.9820   'Kobayashi, N.' 4 
'structure solution' CYANA   2.0.17   'Guntert, P.'   5 
refinement           CYANA   2.0.17   'Guntert, P.'   6 
# 
_exptl.method            'SOLUTION NMR' 
_exptl.entry_id          2EMG 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2EMG 
_struct.title                     
'Solution structure of the C2H2 type zinc finger (region 463-495) of human Zinc finger protein 484' 
_struct.pdbx_descriptor           'Zinc finger protein 484' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2EMG 
_struct_keywords.text            
;zf-C2H2, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
;
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       HIS 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        24 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       LYS 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        33 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        HIS 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         24 
_struct_conf.end_auth_comp_id        LYS 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         33 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A CYS 15 SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 15 A ZN 201 1_555 ? ? ? ? ? ? ? 2.363 ? 
metalc2 metalc ? ? A CYS 18 SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 18 A ZN 201 1_555 ? ? ? ? ? ? ? 2.190 ? 
metalc3 metalc ? ? A HIS 31 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 31 A ZN 201 1_555 ? ? ? ? ? ? ? 2.048 ? 
metalc4 metalc ? ? A HIS 35 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 35 A ZN 201 1_555 ? ? ? ? ? ? ? 1.941 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_atom_sites.entry_id                    2EMG 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . GLY A 1 1  ? 5.836   -33.862 1.859   1.00 0.00 ? 1   GLY A N    1  
ATOM   2     C  CA   . GLY A 1 1  ? 5.520   -33.131 0.646   1.00 0.00 ? 1   GLY A CA   1  
ATOM   3     C  C    . GLY A 1 1  ? 4.337   -32.200 0.820   1.00 0.00 ? 1   GLY A C    1  
ATOM   4     O  O    . GLY A 1 1  ? 3.205   -32.556 0.490   1.00 0.00 ? 1   GLY A O    1  
ATOM   5     H  H1   . GLY A 1 1  ? 5.152   -33.973 2.553   1.00 0.00 ? 1   GLY A H1   1  
ATOM   6     H  HA2  . GLY A 1 1  ? 6.382   -32.549 0.354   1.00 0.00 ? 1   GLY A HA2  1  
ATOM   7     H  HA3  . GLY A 1 1  ? 5.294   -33.839 -0.138  1.00 0.00 ? 1   GLY A HA3  1  
ATOM   8     N  N    . SER A 1 2  ? 4.597   -31.006 1.342   1.00 0.00 ? 2   SER A N    1  
ATOM   9     C  CA   . SER A 1 2  ? 3.543   -30.023 1.566   1.00 0.00 ? 2   SER A CA   1  
ATOM   10    C  C    . SER A 1 2  ? 4.054   -28.609 1.308   1.00 0.00 ? 2   SER A C    1  
ATOM   11    O  O    . SER A 1 2  ? 5.014   -28.161 1.935   1.00 0.00 ? 2   SER A O    1  
ATOM   12    C  CB   . SER A 1 2  ? 3.009   -30.132 2.996   1.00 0.00 ? 2   SER A CB   1  
ATOM   13    O  OG   . SER A 1 2  ? 4.021   -29.831 3.941   1.00 0.00 ? 2   SER A OG   1  
ATOM   14    H  H    . SER A 1 2  ? 5.519   -30.781 1.585   1.00 0.00 ? 2   SER A H    1  
ATOM   15    H  HA   . SER A 1 2  ? 2.740   -30.235 0.874   1.00 0.00 ? 2   SER A HA   1  
ATOM   16    H  HB2  . SER A 1 2  ? 2.193   -29.438 3.126   1.00 0.00 ? 2   SER A HB2  1  
ATOM   17    H  HB3  . SER A 1 2  ? 2.658   -31.139 3.170   1.00 0.00 ? 2   SER A HB3  1  
ATOM   18    H  HG   . SER A 1 2  ? 4.607   -29.161 3.581   1.00 0.00 ? 2   SER A HG   1  
ATOM   19    N  N    . SER A 1 3  ? 3.407   -27.912 0.380   1.00 0.00 ? 3   SER A N    1  
ATOM   20    C  CA   . SER A 1 3  ? 3.798   -26.551 0.035   1.00 0.00 ? 3   SER A CA   1  
ATOM   21    C  C    . SER A 1 3  ? 3.850   -25.669 1.279   1.00 0.00 ? 3   SER A C    1  
ATOM   22    O  O    . SER A 1 3  ? 4.788   -24.895 1.467   1.00 0.00 ? 3   SER A O    1  
ATOM   23    C  CB   . SER A 1 3  ? 2.821   -25.959 -0.983  1.00 0.00 ? 3   SER A CB   1  
ATOM   24    O  OG   . SER A 1 3  ? 3.062   -24.576 -1.178  1.00 0.00 ? 3   SER A OG   1  
ATOM   25    H  H    . SER A 1 3  ? 2.650   -28.325 -0.086  1.00 0.00 ? 3   SER A H    1  
ATOM   26    H  HA   . SER A 1 3  ? 4.783   -26.590 -0.405  1.00 0.00 ? 3   SER A HA   1  
ATOM   27    H  HB2  . SER A 1 3  ? 2.937   -26.469 -1.928  1.00 0.00 ? 3   SER A HB2  1  
ATOM   28    H  HB3  . SER A 1 3  ? 1.810   -26.090 -0.625  1.00 0.00 ? 3   SER A HB3  1  
ATOM   29    H  HG   . SER A 1 3  ? 3.089   -24.385 -2.118  1.00 0.00 ? 3   SER A HG   1  
ATOM   30    N  N    . GLY A 1 4  ? 2.833   -25.792 2.127   1.00 0.00 ? 4   GLY A N    1  
ATOM   31    C  CA   . GLY A 1 4  ? 2.781   -25.001 3.342   1.00 0.00 ? 4   GLY A CA   1  
ATOM   32    C  C    . GLY A 1 4  ? 2.559   -23.527 3.066   1.00 0.00 ? 4   GLY A C    1  
ATOM   33    O  O    . GLY A 1 4  ? 3.207   -22.671 3.668   1.00 0.00 ? 4   GLY A O    1  
ATOM   34    H  H    . GLY A 1 4  ? 2.112   -26.425 1.925   1.00 0.00 ? 4   GLY A H    1  
ATOM   35    H  HA2  . GLY A 1 4  ? 1.975   -25.365 3.962   1.00 0.00 ? 4   GLY A HA2  1  
ATOM   36    H  HA3  . GLY A 1 4  ? 3.713   -25.119 3.875   1.00 0.00 ? 4   GLY A HA3  1  
ATOM   37    N  N    . SER A 1 5  ? 1.643   -23.229 2.150   1.00 0.00 ? 5   SER A N    1  
ATOM   38    C  CA   . SER A 1 5  ? 1.342   -21.849 1.790   1.00 0.00 ? 5   SER A CA   1  
ATOM   39    C  C    . SER A 1 5  ? 0.017   -21.404 2.403   1.00 0.00 ? 5   SER A C    1  
ATOM   40    O  O    . SER A 1 5  ? -0.694  -22.200 3.015   1.00 0.00 ? 5   SER A O    1  
ATOM   41    C  CB   . SER A 1 5  ? 1.291   -21.695 0.269   1.00 0.00 ? 5   SER A CB   1  
ATOM   42    O  OG   . SER A 1 5  ? 2.593   -21.564 -0.274  1.00 0.00 ? 5   SER A OG   1  
ATOM   43    H  H    . SER A 1 5  ? 1.160   -23.956 1.704   1.00 0.00 ? 5   SER A H    1  
ATOM   44    H  HA   . SER A 1 5  ? 2.133   -21.225 2.180   1.00 0.00 ? 5   SER A HA   1  
ATOM   45    H  HB2  . SER A 1 5  ? 0.820   -22.565 -0.162  1.00 0.00 ? 5   SER A HB2  1  
ATOM   46    H  HB3  . SER A 1 5  ? 0.719   -20.813 0.018   1.00 0.00 ? 5   SER A HB3  1  
ATOM   47    H  HG   . SER A 1 5  ? 2.967   -20.721 -0.010  1.00 0.00 ? 5   SER A HG   1  
ATOM   48    N  N    . SER A 1 6  ? -0.307  -20.127 2.232   1.00 0.00 ? 6   SER A N    1  
ATOM   49    C  CA   . SER A 1 6  ? -1.545  -19.574 2.770   1.00 0.00 ? 6   SER A CA   1  
ATOM   50    C  C    . SER A 1 6  ? -2.025  -18.396 1.928   1.00 0.00 ? 6   SER A C    1  
ATOM   51    O  O    . SER A 1 6  ? -1.265  -17.827 1.145   1.00 0.00 ? 6   SER A O    1  
ATOM   52    C  CB   . SER A 1 6  ? -1.341  -19.130 4.220   1.00 0.00 ? 6   SER A CB   1  
ATOM   53    O  OG   . SER A 1 6  ? -2.553  -18.659 4.784   1.00 0.00 ? 6   SER A OG   1  
ATOM   54    H  H    . SER A 1 6  ? 0.301   -19.542 1.734   1.00 0.00 ? 6   SER A H    1  
ATOM   55    H  HA   . SER A 1 6  ? -2.294  -20.350 2.742   1.00 0.00 ? 6   SER A HA   1  
ATOM   56    H  HB2  . SER A 1 6  ? -0.988  -19.966 4.804   1.00 0.00 ? 6   SER A HB2  1  
ATOM   57    H  HB3  . SER A 1 6  ? -0.610  -18.335 4.251   1.00 0.00 ? 6   SER A HB3  1  
ATOM   58    H  HG   . SER A 1 6  ? -2.606  -18.931 5.703   1.00 0.00 ? 6   SER A HG   1  
ATOM   59    N  N    . GLY A 1 7  ? -3.293  -18.034 2.096   1.00 0.00 ? 7   GLY A N    1  
ATOM   60    C  CA   . GLY A 1 7  ? -3.854  -16.926 1.346   1.00 0.00 ? 7   GLY A CA   1  
ATOM   61    C  C    . GLY A 1 7  ? -5.356  -17.043 1.175   1.00 0.00 ? 7   GLY A C    1  
ATOM   62    O  O    . GLY A 1 7  ? -5.849  -17.242 0.064   1.00 0.00 ? 7   GLY A O    1  
ATOM   63    H  H    . GLY A 1 7  ? -3.852  -18.523 2.735   1.00 0.00 ? 7   GLY A H    1  
ATOM   64    H  HA2  . GLY A 1 7  ? -3.632  -16.005 1.864   1.00 0.00 ? 7   GLY A HA2  1  
ATOM   65    H  HA3  . GLY A 1 7  ? -3.394  -16.897 0.369   1.00 0.00 ? 7   GLY A HA3  1  
ATOM   66    N  N    . THR A 1 8  ? -6.087  -16.921 2.278   1.00 0.00 ? 8   THR A N    1  
ATOM   67    C  CA   . THR A 1 8  ? -7.541  -17.017 2.246   1.00 0.00 ? 8   THR A CA   1  
ATOM   68    C  C    . THR A 1 8  ? -8.184  -15.896 3.056   1.00 0.00 ? 8   THR A C    1  
ATOM   69    O  O    . THR A 1 8  ? -8.430  -16.044 4.252   1.00 0.00 ? 8   THR A O    1  
ATOM   70    C  CB   . THR A 1 8  ? -8.027  -18.373 2.792   1.00 0.00 ? 8   THR A CB   1  
ATOM   71    O  OG1  . THR A 1 8  ? -7.464  -19.441 2.022   1.00 0.00 ? 8   THR A OG1  1  
ATOM   72    C  CG2  . THR A 1 8  ? -9.545  -18.459 2.755   1.00 0.00 ? 8   THR A CG2  1  
ATOM   73    H  H    . THR A 1 8  ? -5.636  -16.763 3.134   1.00 0.00 ? 8   THR A H    1  
ATOM   74    H  HA   . THR A 1 8  ? -7.858  -16.932 1.217   1.00 0.00 ? 8   THR A HA   1  
ATOM   75    H  HB   . THR A 1 8  ? -7.701  -18.468 3.818   1.00 0.00 ? 8   THR A HB   1  
ATOM   76    H  HG1  . THR A 1 8  ? -7.165  -20.138 2.612   1.00 0.00 ? 8   THR A HG1  1  
ATOM   77    H  HG21 . THR A 1 8  ? -9.960  -17.465 2.685   1.00 0.00 ? 8   THR A HG21 1  
ATOM   78    H  HG22 . THR A 1 8  ? -9.901  -18.935 3.656   1.00 0.00 ? 8   THR A HG22 1  
ATOM   79    H  HG23 . THR A 1 8  ? -9.851  -19.038 1.896   1.00 0.00 ? 8   THR A HG23 1  
ATOM   80    N  N    . GLY A 1 9  ? -8.455  -14.775 2.394   1.00 0.00 ? 9   GLY A N    1  
ATOM   81    C  CA   . GLY A 1 9  ? -9.069  -13.646 3.069   1.00 0.00 ? 9   GLY A CA   1  
ATOM   82    C  C    . GLY A 1 9  ? -8.840  -12.339 2.335   1.00 0.00 ? 9   GLY A C    1  
ATOM   83    O  O    . GLY A 1 9  ? -7.886  -11.618 2.623   1.00 0.00 ? 9   GLY A O    1  
ATOM   84    H  H    . GLY A 1 9  ? -8.237  -14.714 1.440   1.00 0.00 ? 9   GLY A H    1  
ATOM   85    H  HA2  . GLY A 1 9  ? -10.131 -13.821 3.148   1.00 0.00 ? 9   GLY A HA2  1  
ATOM   86    H  HA3  . GLY A 1 9  ? -8.652  -13.565 4.062   1.00 0.00 ? 9   GLY A HA3  1  
ATOM   87    N  N    . GLU A 1 10 ? -9.718  -12.035 1.384   1.00 0.00 ? 10  GLU A N    1  
ATOM   88    C  CA   . GLU A 1 10 ? -9.604  -10.807 0.606   1.00 0.00 ? 10  GLU A CA   1  
ATOM   89    C  C    . GLU A 1 10 ? -9.163  -9.642  1.488   1.00 0.00 ? 10  GLU A C    1  
ATOM   90    O  O    . GLU A 1 10 ? -9.473  -9.600  2.678   1.00 0.00 ? 10  GLU A O    1  
ATOM   91    C  CB   . GLU A 1 10 ? -10.940 -10.476 -0.064  1.00 0.00 ? 10  GLU A CB   1  
ATOM   92    C  CG   . GLU A 1 10 ? -12.029 -10.074 0.916   1.00 0.00 ? 10  GLU A CG   1  
ATOM   93    C  CD   . GLU A 1 10 ? -12.037 -8.584  1.201   1.00 0.00 ? 10  GLU A CD   1  
ATOM   94    O  OE1  . GLU A 1 10 ? -11.008 -7.925  0.943   1.00 0.00 ? 10  GLU A OE1  1  
ATOM   95    O  OE2  . GLU A 1 10 ? -13.072 -8.078  1.681   1.00 0.00 ? 10  GLU A OE2  1  
ATOM   96    H  H    . GLU A 1 10 ? -10.457 -12.650 1.201   1.00 0.00 ? 10  GLU A H    1  
ATOM   97    H  HA   . GLU A 1 10 ? -8.859  -10.966 -0.158  1.00 0.00 ? 10  GLU A HA   1  
ATOM   98    H  HB2  . GLU A 1 10 ? -10.789 -9.662  -0.758  1.00 0.00 ? 10  GLU A HB2  1  
ATOM   99    H  HB3  . GLU A 1 10 ? -11.279 -11.344 -0.610  1.00 0.00 ? 10  GLU A HB3  1  
ATOM   100   H  HG2  . GLU A 1 10 ? -12.988 -10.350 0.503   1.00 0.00 ? 10  GLU A HG2  1  
ATOM   101   H  HG3  . GLU A 1 10 ? -11.873 -10.602 1.845   1.00 0.00 ? 10  GLU A HG3  1  
ATOM   102   N  N    . ASN A 1 11 ? -8.438  -8.699  0.895   1.00 0.00 ? 11  ASN A N    1  
ATOM   103   C  CA   . ASN A 1 11 ? -7.953  -7.535  1.627   1.00 0.00 ? 11  ASN A CA   1  
ATOM   104   C  C    . ASN A 1 11 ? -8.292  -6.246  0.883   1.00 0.00 ? 11  ASN A C    1  
ATOM   105   O  O    . ASN A 1 11 ? -8.272  -6.185  -0.346  1.00 0.00 ? 11  ASN A O    1  
ATOM   106   C  CB   . ASN A 1 11 ? -6.441  -7.633  1.838   1.00 0.00 ? 11  ASN A CB   1  
ATOM   107   C  CG   . ASN A 1 11 ? -6.077  -8.548  2.991   1.00 0.00 ? 11  ASN A CG   1  
ATOM   108   O  OD1  . ASN A 1 11 ? -6.245  -8.193  4.157   1.00 0.00 ? 11  ASN A OD1  1  
ATOM   109   N  ND2  . ASN A 1 11 ? -5.575  -9.735  2.668   1.00 0.00 ? 11  ASN A ND2  1  
ATOM   110   H  H    . ASN A 1 11 ? -8.224  -8.789  -0.057  1.00 0.00 ? 11  ASN A H    1  
ATOM   111   H  HA   . ASN A 1 11 ? -8.442  -7.521  2.589   1.00 0.00 ? 11  ASN A HA   1  
ATOM   112   H  HB2  . ASN A 1 11 ? -5.982  -8.018  0.939   1.00 0.00 ? 11  ASN A HB2  1  
ATOM   113   H  HB3  . ASN A 1 11 ? -6.048  -6.649  2.045   1.00 0.00 ? 11  ASN A HB3  1  
ATOM   114   H  HD21 . ASN A 1 11 ? -5.469  -9.950  1.717   1.00 0.00 ? 11  ASN A HD21 1  
ATOM   115   H  HD22 . ASN A 1 11 ? -5.331  -10.347 3.393   1.00 0.00 ? 11  ASN A HD22 1  
ATOM   116   N  N    . PRO A 1 12 ? -8.609  -5.189  1.646   1.00 0.00 ? 12  PRO A N    1  
ATOM   117   C  CA   . PRO A 1 12 ? -8.957  -3.882  1.082   1.00 0.00 ? 12  PRO A CA   1  
ATOM   118   C  C    . PRO A 1 12 ? -7.757  -3.187  0.447   1.00 0.00 ? 12  PRO A C    1  
ATOM   119   O  O    . PRO A 1 12 ? -7.831  -2.710  -0.686  1.00 0.00 ? 12  PRO A O    1  
ATOM   120   C  CB   . PRO A 1 12 ? -9.452  -3.091  2.296   1.00 0.00 ? 12  PRO A CB   1  
ATOM   121   C  CG   . PRO A 1 12 ? -8.782  -3.731  3.463   1.00 0.00 ? 12  PRO A CG   1  
ATOM   122   C  CD   . PRO A 1 12 ? -8.653  -5.189  3.118   1.00 0.00 ? 12  PRO A CD   1  
ATOM   123   H  HA   . PRO A 1 12 ? -9.751  -3.962  0.354   1.00 0.00 ? 12  PRO A HA   1  
ATOM   124   H  HB2  . PRO A 1 12 ? -9.165  -2.054  2.194   1.00 0.00 ? 12  PRO A HB2  1  
ATOM   125   H  HB3  . PRO A 1 12 ? -10.526 -3.168  2.366   1.00 0.00 ? 12  PRO A HB3  1  
ATOM   126   H  HG2  . PRO A 1 12 ? -7.807  -3.293  3.612   1.00 0.00 ? 12  PRO A HG2  1  
ATOM   127   H  HG3  . PRO A 1 12 ? -9.390  -3.608  4.347   1.00 0.00 ? 12  PRO A HG3  1  
ATOM   128   H  HD2  . PRO A 1 12 ? -7.742  -5.595  3.531   1.00 0.00 ? 12  PRO A HD2  1  
ATOM   129   H  HD3  . PRO A 1 12 ? -9.510  -5.739  3.477   1.00 0.00 ? 12  PRO A HD3  1  
ATOM   130   N  N    . PHE A 1 13 ? -6.652  -3.133  1.183   1.00 0.00 ? 13  PHE A N    1  
ATOM   131   C  CA   . PHE A 1 13 ? -5.436  -2.496  0.692   1.00 0.00 ? 13  PHE A CA   1  
ATOM   132   C  C    . PHE A 1 13 ? -4.222  -2.948  1.497   1.00 0.00 ? 13  PHE A C    1  
ATOM   133   O  O    . PHE A 1 13 ? -4.346  -3.348  2.656   1.00 0.00 ? 13  PHE A O    1  
ATOM   134   C  CB   . PHE A 1 13 ? -5.570  -0.973  0.760   1.00 0.00 ? 13  PHE A CB   1  
ATOM   135   C  CG   . PHE A 1 13 ? -6.850  -0.457  0.169   1.00 0.00 ? 13  PHE A CG   1  
ATOM   136   C  CD1  . PHE A 1 13 ? -6.995  -0.334  -1.204  1.00 0.00 ? 13  PHE A CD1  1  
ATOM   137   C  CD2  . PHE A 1 13 ? -7.909  -0.095  0.985   1.00 0.00 ? 13  PHE A CD2  1  
ATOM   138   C  CE1  . PHE A 1 13 ? -8.172  0.141   -1.751  1.00 0.00 ? 13  PHE A CE1  1  
ATOM   139   C  CE2  . PHE A 1 13 ? -9.089  0.381   0.444   1.00 0.00 ? 13  PHE A CE2  1  
ATOM   140   C  CZ   . PHE A 1 13 ? -9.221  0.498   -0.925  1.00 0.00 ? 13  PHE A CZ   1  
ATOM   141   H  H    . PHE A 1 13 ? -6.655  -3.532  2.079   1.00 0.00 ? 13  PHE A H    1  
ATOM   142   H  HA   . PHE A 1 13 ? -5.301  -2.791  -0.337  1.00 0.00 ? 13  PHE A HA   1  
ATOM   143   H  HB2  . PHE A 1 13 ? -5.533  -0.662  1.793   1.00 0.00 ? 13  PHE A HB2  1  
ATOM   144   H  HB3  . PHE A 1 13 ? -4.749  -0.523  0.222   1.00 0.00 ? 13  PHE A HB3  1  
ATOM   145   H  HD1  . PHE A 1 13 ? -6.176  -0.614  -1.851  1.00 0.00 ? 13  PHE A HD1  1  
ATOM   146   H  HD2  . PHE A 1 13 ? -7.807  -0.187  2.057   1.00 0.00 ? 13  PHE A HD2  1  
ATOM   147   H  HE1  . PHE A 1 13 ? -8.272  0.232   -2.822  1.00 0.00 ? 13  PHE A HE1  1  
ATOM   148   H  HE2  . PHE A 1 13 ? -9.907  0.659   1.092   1.00 0.00 ? 13  PHE A HE2  1  
ATOM   149   H  HZ   . PHE A 1 13 ? -10.141 0.871   -1.350  1.00 0.00 ? 13  PHE A HZ   1  
ATOM   150   N  N    . ILE A 1 14 ? -3.049  -2.882  0.876   1.00 0.00 ? 14  ILE A N    1  
ATOM   151   C  CA   . ILE A 1 14 ? -1.812  -3.283  1.535   1.00 0.00 ? 14  ILE A CA   1  
ATOM   152   C  C    . ILE A 1 14 ? -0.632  -2.452  1.042   1.00 0.00 ? 14  ILE A C    1  
ATOM   153   O  O    . ILE A 1 14 ? -0.485  -2.213  -0.157  1.00 0.00 ? 14  ILE A O    1  
ATOM   154   C  CB   . ILE A 1 14 ? -1.508  -4.775  1.301   1.00 0.00 ? 14  ILE A CB   1  
ATOM   155   C  CG1  . ILE A 1 14 ? -2.639  -5.642  1.858   1.00 0.00 ? 14  ILE A CG1  1  
ATOM   156   C  CG2  . ILE A 1 14 ? -0.181  -5.151  1.941   1.00 0.00 ? 14  ILE A CG2  1  
ATOM   157   C  CD1  . ILE A 1 14 ? -2.553  -7.092  1.437   1.00 0.00 ? 14  ILE A CD1  1  
ATOM   158   H  H    . ILE A 1 14 ? -3.015  -2.555  -0.047  1.00 0.00 ? 14  ILE A H    1  
ATOM   159   H  HA   . ILE A 1 14 ? -1.933  -3.123  2.597   1.00 0.00 ? 14  ILE A HA   1  
ATOM   160   H  HB   . ILE A 1 14 ? -1.428  -4.940  0.238   1.00 0.00 ? 14  ILE A HB   1  
ATOM   161   H  HG12 . ILE A 1 14 ? -2.613  -5.608  2.936   1.00 0.00 ? 14  ILE A HG12 1  
ATOM   162   H  HG13 . ILE A 1 14 ? -3.586  -5.251  1.513   1.00 0.00 ? 14  ILE A HG13 1  
ATOM   163   H  HG21 . ILE A 1 14 ? 0.622   -4.638  1.433   1.00 0.00 ? 14  ILE A HG21 1  
ATOM   164   H  HG22 . ILE A 1 14 ? -0.189  -4.864  2.981   1.00 0.00 ? 14  ILE A HG22 1  
ATOM   165   H  HG23 . ILE A 1 14 ? -0.033  -6.218  1.863   1.00 0.00 ? 14  ILE A HG23 1  
ATOM   166   H  HD11 . ILE A 1 14 ? -2.708  -7.166  0.370   1.00 0.00 ? 14  ILE A HD11 1  
ATOM   167   H  HD12 . ILE A 1 14 ? -1.577  -7.482  1.686   1.00 0.00 ? 14  ILE A HD12 1  
ATOM   168   H  HD13 . ILE A 1 14 ? -3.312  -7.662  1.951   1.00 0.00 ? 14  ILE A HD13 1  
ATOM   169   N  N    . CYS A 1 15 ? 0.207   -2.016  1.975   1.00 0.00 ? 15  CYS A N    1  
ATOM   170   C  CA   . CYS A 1 15 ? 1.376   -1.213  1.637   1.00 0.00 ? 15  CYS A CA   1  
ATOM   171   C  C    . CYS A 1 15 ? 2.473   -2.079  1.025   1.00 0.00 ? 15  CYS A C    1  
ATOM   172   O  O    . CYS A 1 15 ? 3.331   -2.606  1.734   1.00 0.00 ? 15  CYS A O    1  
ATOM   173   C  CB   . CYS A 1 15 ? 1.909   -0.501  2.883   1.00 0.00 ? 15  CYS A CB   1  
ATOM   174   S  SG   . CYS A 1 15 ? 3.014   0.902   2.522   1.00 0.00 ? 15  CYS A SG   1  
ATOM   175   H  H    . CYS A 1 15 ? 0.037   -2.240  2.915   1.00 0.00 ? 15  CYS A H    1  
ATOM   176   H  HA   . CYS A 1 15 ? 1.073   -0.473  0.913   1.00 0.00 ? 15  CYS A HA   1  
ATOM   177   H  HB2  . CYS A 1 15 ? 1.075   -0.123  3.456   1.00 0.00 ? 15  CYS A HB2  1  
ATOM   178   H  HB3  . CYS A 1 15 ? 2.461   -1.209  3.484   1.00 0.00 ? 15  CYS A HB3  1  
ATOM   179   N  N    . SER A 1 16 ? 2.439   -2.222  -0.296  1.00 0.00 ? 16  SER A N    1  
ATOM   180   C  CA   . SER A 1 16 ? 3.427   -3.026  -1.005  1.00 0.00 ? 16  SER A CA   1  
ATOM   181   C  C    . SER A 1 16 ? 4.823   -2.800  -0.432  1.00 0.00 ? 16  SER A C    1  
ATOM   182   O  O    . SER A 1 16 ? 5.682   -3.678  -0.500  1.00 0.00 ? 16  SER A O    1  
ATOM   183   C  CB   . SER A 1 16 ? 3.415   -2.690  -2.497  1.00 0.00 ? 16  SER A CB   1  
ATOM   184   O  OG   . SER A 1 16 ? 2.113   -2.828  -3.040  1.00 0.00 ? 16  SER A OG   1  
ATOM   185   H  H    . SER A 1 16 ? 1.730   -1.776  -0.806  1.00 0.00 ? 16  SER A H    1  
ATOM   186   H  HA   . SER A 1 16 ? 3.162   -4.065  -0.876  1.00 0.00 ? 16  SER A HA   1  
ATOM   187   H  HB2  . SER A 1 16 ? 3.744   -1.672  -2.637  1.00 0.00 ? 16  SER A HB2  1  
ATOM   188   H  HB3  . SER A 1 16 ? 4.083   -3.360  -3.019  1.00 0.00 ? 16  SER A HB3  1  
ATOM   189   H  HG   . SER A 1 16 ? 2.176   -3.108  -3.956  1.00 0.00 ? 16  SER A HG   1  
ATOM   190   N  N    . GLU A 1 17 ? 5.040   -1.616  0.132   1.00 0.00 ? 17  GLU A N    1  
ATOM   191   C  CA   . GLU A 1 17 ? 6.331   -1.273  0.715   1.00 0.00 ? 17  GLU A CA   1  
ATOM   192   C  C    . GLU A 1 17 ? 6.645   -2.172  1.908   1.00 0.00 ? 17  GLU A C    1  
ATOM   193   O  O    . GLU A 1 17 ? 7.583   -2.968  1.870   1.00 0.00 ? 17  GLU A O    1  
ATOM   194   C  CB   . GLU A 1 17 ? 6.347   0.194   1.150   1.00 0.00 ? 17  GLU A CB   1  
ATOM   195   C  CG   . GLU A 1 17 ? 6.433   1.171   -0.010  1.00 0.00 ? 17  GLU A CG   1  
ATOM   196   C  CD   . GLU A 1 17 ? 7.690   0.986   -0.838  1.00 0.00 ? 17  GLU A CD   1  
ATOM   197   O  OE1  . GLU A 1 17 ? 8.723   0.582   -0.265  1.00 0.00 ? 17  GLU A OE1  1  
ATOM   198   O  OE2  . GLU A 1 17 ? 7.639   1.245   -2.058  1.00 0.00 ? 17  GLU A OE2  1  
ATOM   199   H  H    . GLU A 1 17 ? 4.315   -0.957  0.155   1.00 0.00 ? 17  GLU A H    1  
ATOM   200   H  HA   . GLU A 1 17 ? 7.087   -1.423  -0.041  1.00 0.00 ? 17  GLU A HA   1  
ATOM   201   H  HB2  . GLU A 1 17 ? 5.443   0.402   1.704   1.00 0.00 ? 17  GLU A HB2  1  
ATOM   202   H  HB3  . GLU A 1 17 ? 7.199   0.357   1.794   1.00 0.00 ? 17  GLU A HB3  1  
ATOM   203   H  HG2  . GLU A 1 17 ? 5.575   1.027   -0.650  1.00 0.00 ? 17  GLU A HG2  1  
ATOM   204   H  HG3  . GLU A 1 17 ? 6.423   2.178   0.382   1.00 0.00 ? 17  GLU A HG3  1  
ATOM   205   N  N    . CYS A 1 18 ? 5.853   -2.037  2.967   1.00 0.00 ? 18  CYS A N    1  
ATOM   206   C  CA   . CYS A 1 18 ? 6.045   -2.835  4.172   1.00 0.00 ? 18  CYS A CA   1  
ATOM   207   C  C    . CYS A 1 18 ? 5.040   -3.982  4.231   1.00 0.00 ? 18  CYS A C    1  
ATOM   208   O  O    . CYS A 1 18 ? 5.391   -5.113  4.565   1.00 0.00 ? 18  CYS A O    1  
ATOM   209   C  CB   . CYS A 1 18 ? 5.907   -1.957  5.417   1.00 0.00 ? 18  CYS A CB   1  
ATOM   210   S  SG   . CYS A 1 18 ? 4.394   -0.942  5.447   1.00 0.00 ? 18  CYS A SG   1  
ATOM   211   H  H    . CYS A 1 18 ? 5.121   -1.385  2.937   1.00 0.00 ? 18  CYS A H    1  
ATOM   212   H  HA   . CYS A 1 18 ? 7.042   -3.247  4.142   1.00 0.00 ? 18  CYS A HA   1  
ATOM   213   H  HB2  . CYS A 1 18 ? 5.896   -2.588  6.294   1.00 0.00 ? 18  CYS A HB2  1  
ATOM   214   H  HB3  . CYS A 1 18 ? 6.753   -1.288  5.472   1.00 0.00 ? 18  CYS A HB3  1  
ATOM   215   N  N    . GLY A 1 19 ? 3.787   -3.681  3.903   1.00 0.00 ? 19  GLY A N    1  
ATOM   216   C  CA   . GLY A 1 19 ? 2.750   -4.696  3.925   1.00 0.00 ? 19  GLY A CA   1  
ATOM   217   C  C    . GLY A 1 19 ? 1.739   -4.469  5.031   1.00 0.00 ? 19  GLY A C    1  
ATOM   218   O  O    . GLY A 1 19 ? 1.367   -5.402  5.743   1.00 0.00 ? 19  GLY A O    1  
ATOM   219   H  H    . GLY A 1 19 ? 3.565   -2.762  3.644   1.00 0.00 ? 19  GLY A H    1  
ATOM   220   H  HA2  . GLY A 1 19 ? 2.237   -4.691  2.975   1.00 0.00 ? 19  GLY A HA2  1  
ATOM   221   H  HA3  . GLY A 1 19 ? 3.212   -5.663  4.068   1.00 0.00 ? 19  GLY A HA3  1  
ATOM   222   N  N    . LYS A 1 20 ? 1.295   -3.226  5.178   1.00 0.00 ? 20  LYS A N    1  
ATOM   223   C  CA   . LYS A 1 20 ? 0.321   -2.877  6.206   1.00 0.00 ? 20  LYS A CA   1  
ATOM   224   C  C    . LYS A 1 20 ? -1.067  -2.693  5.600   1.00 0.00 ? 20  LYS A C    1  
ATOM   225   O  O    . LYS A 1 20 ? -1.239  -1.953  4.631   1.00 0.00 ? 20  LYS A O    1  
ATOM   226   C  CB   . LYS A 1 20 ? 0.748   -1.598  6.929   1.00 0.00 ? 20  LYS A CB   1  
ATOM   227   C  CG   . LYS A 1 20 ? -0.263  -1.112  7.954   1.00 0.00 ? 20  LYS A CG   1  
ATOM   228   C  CD   . LYS A 1 20 ? 0.404   -0.305  9.055   1.00 0.00 ? 20  LYS A CD   1  
ATOM   229   C  CE   . LYS A 1 20 ? -0.367  -0.403  10.363  1.00 0.00 ? 20  LYS A CE   1  
ATOM   230   N  NZ   . LYS A 1 20 ? -0.367  -1.791  10.903  1.00 0.00 ? 20  LYS A NZ   1  
ATOM   231   H  H    . LYS A 1 20 ? 1.629   -2.525  4.579   1.00 0.00 ? 20  LYS A H    1  
ATOM   232   H  HA   . LYS A 1 20 ? 0.285   -3.688  6.917   1.00 0.00 ? 20  LYS A HA   1  
ATOM   233   H  HB2  . LYS A 1 20 ? 1.684   -1.780  7.435   1.00 0.00 ? 20  LYS A HB2  1  
ATOM   234   H  HB3  . LYS A 1 20 ? 0.890   -0.816  6.197   1.00 0.00 ? 20  LYS A HB3  1  
ATOM   235   H  HG2  . LYS A 1 20 ? -0.994  -0.491  7.459   1.00 0.00 ? 20  LYS A HG2  1  
ATOM   236   H  HG3  . LYS A 1 20 ? -0.754  -1.968  8.394   1.00 0.00 ? 20  LYS A HG3  1  
ATOM   237   H  HD2  . LYS A 1 20 ? 1.404   -0.682  9.211   1.00 0.00 ? 20  LYS A HD2  1  
ATOM   238   H  HD3  . LYS A 1 20 ? 0.451   0.731   8.752   1.00 0.00 ? 20  LYS A HD3  1  
ATOM   239   H  HE2  . LYS A 1 20 ? 0.091   0.255   11.085  1.00 0.00 ? 20  LYS A HE2  1  
ATOM   240   H  HE3  . LYS A 1 20 ? -1.386  -0.093  10.188  1.00 0.00 ? 20  LYS A HE3  1  
ATOM   241   H  HZ1  . LYS A 1 20 ? -0.156  -2.470  10.145  1.00 0.00 ? 20  LYS A HZ1  1  
ATOM   242   H  HZ2  . LYS A 1 20 ? -1.299  -2.016  11.307  1.00 0.00 ? 20  LYS A HZ2  1  
ATOM   243   H  HZ3  . LYS A 1 20 ? 0.352   -1.884  11.648  1.00 0.00 ? 20  LYS A HZ3  1  
ATOM   244   N  N    . VAL A 1 21 ? -2.055  -3.369  6.178   1.00 0.00 ? 21  VAL A N    1  
ATOM   245   C  CA   . VAL A 1 21 ? -3.428  -3.277  5.697   1.00 0.00 ? 21  VAL A CA   1  
ATOM   246   C  C    . VAL A 1 21 ? -4.164  -2.114  6.353   1.00 0.00 ? 21  VAL A C    1  
ATOM   247   O  O    . VAL A 1 21 ? -4.080  -1.917  7.566   1.00 0.00 ? 21  VAL A O    1  
ATOM   248   C  CB   . VAL A 1 21 ? -4.205  -4.579  5.967   1.00 0.00 ? 21  VAL A CB   1  
ATOM   249   C  CG1  . VAL A 1 21 ? -4.286  -4.854  7.461   1.00 0.00 ? 21  VAL A CG1  1  
ATOM   250   C  CG2  . VAL A 1 21 ? -5.595  -4.506  5.353   1.00 0.00 ? 21  VAL A CG2  1  
ATOM   251   H  H    . VAL A 1 21 ? -1.855  -3.942  6.947   1.00 0.00 ? 21  VAL A H    1  
ATOM   252   H  HA   . VAL A 1 21 ? -3.397  -3.115  4.629   1.00 0.00 ? 21  VAL A HA   1  
ATOM   253   H  HB   . VAL A 1 21 ? -3.672  -5.396  5.502   1.00 0.00 ? 21  VAL A HB   1  
ATOM   254   H  HG11 . VAL A 1 21 ? -4.546  -5.889  7.622   1.00 0.00 ? 21  VAL A HG11 1  
ATOM   255   H  HG12 . VAL A 1 21 ? -3.330  -4.645  7.918   1.00 0.00 ? 21  VAL A HG12 1  
ATOM   256   H  HG13 . VAL A 1 21 ? -5.042  -4.220  7.902   1.00 0.00 ? 21  VAL A HG13 1  
ATOM   257   H  HG21 . VAL A 1 21 ? -5.876  -5.480  4.980   1.00 0.00 ? 21  VAL A HG21 1  
ATOM   258   H  HG22 . VAL A 1 21 ? -6.303  -4.190  6.105   1.00 0.00 ? 21  VAL A HG22 1  
ATOM   259   H  HG23 . VAL A 1 21 ? -5.593  -3.796  4.539   1.00 0.00 ? 21  VAL A HG23 1  
ATOM   260   N  N    . PHE A 1 22 ? -4.885  -1.346  5.544   1.00 0.00 ? 22  PHE A N    1  
ATOM   261   C  CA   . PHE A 1 22 ? -5.636  -0.201  6.045   1.00 0.00 ? 22  PHE A CA   1  
ATOM   262   C  C    . PHE A 1 22 ? -7.114  -0.320  5.686   1.00 0.00 ? 22  PHE A C    1  
ATOM   263   O  O    . PHE A 1 22 ? -7.470  -0.877  4.647   1.00 0.00 ? 22  PHE A O    1  
ATOM   264   C  CB   . PHE A 1 22 ? -5.065  1.100   5.475   1.00 0.00 ? 22  PHE A CB   1  
ATOM   265   C  CG   . PHE A 1 22 ? -3.633  1.345   5.858   1.00 0.00 ? 22  PHE A CG   1  
ATOM   266   C  CD1  . PHE A 1 22 ? -2.604  0.707   5.185   1.00 0.00 ? 22  PHE A CD1  1  
ATOM   267   C  CD2  . PHE A 1 22 ? -3.317  2.213   6.891   1.00 0.00 ? 22  PHE A CD2  1  
ATOM   268   C  CE1  . PHE A 1 22 ? -1.286  0.930   5.536   1.00 0.00 ? 22  PHE A CE1  1  
ATOM   269   C  CE2  . PHE A 1 22 ? -2.001  2.440   7.246   1.00 0.00 ? 22  PHE A CE2  1  
ATOM   270   C  CZ   . PHE A 1 22 ? -0.984  1.798   6.567   1.00 0.00 ? 22  PHE A CZ   1  
ATOM   271   H  H    . PHE A 1 22 ? -4.912  -1.553  4.586   1.00 0.00 ? 22  PHE A H    1  
ATOM   272   H  HA   . PHE A 1 22 ? -5.538  -0.186  7.120   1.00 0.00 ? 22  PHE A HA   1  
ATOM   273   H  HB2  . PHE A 1 22 ? -5.118  1.066   4.398   1.00 0.00 ? 22  PHE A HB2  1  
ATOM   274   H  HB3  . PHE A 1 22 ? -5.653  1.930   5.835   1.00 0.00 ? 22  PHE A HB3  1  
ATOM   275   H  HD1  . PHE A 1 22 ? -2.838  0.028   4.378   1.00 0.00 ? 22  PHE A HD1  1  
ATOM   276   H  HD2  . PHE A 1 22 ? -4.113  2.715   7.423   1.00 0.00 ? 22  PHE A HD2  1  
ATOM   277   H  HE1  . PHE A 1 22 ? -0.492  0.427   5.004   1.00 0.00 ? 22  PHE A HE1  1  
ATOM   278   H  HE2  . PHE A 1 22 ? -1.769  3.119   8.053   1.00 0.00 ? 22  PHE A HE2  1  
ATOM   279   H  HZ   . PHE A 1 22 ? 0.045   1.974   6.844   1.00 0.00 ? 22  PHE A HZ   1  
ATOM   280   N  N    . THR A 1 23 ? -7.972  0.206   6.554   1.00 0.00 ? 23  THR A N    1  
ATOM   281   C  CA   . THR A 1 23 ? -9.412  0.157   6.332   1.00 0.00 ? 23  THR A CA   1  
ATOM   282   C  C    . THR A 1 23 ? -9.820  1.059   5.172   1.00 0.00 ? 23  THR A C    1  
ATOM   283   O  O    . THR A 1 23 ? -10.602 0.661   4.308   1.00 0.00 ? 23  THR A O    1  
ATOM   284   C  CB   . THR A 1 23 ? -10.190 0.578   7.593   1.00 0.00 ? 23  THR A CB   1  
ATOM   285   O  OG1  . THR A 1 23 ? -9.609  -0.029  8.752   1.00 0.00 ? 23  THR A OG1  1  
ATOM   286   C  CG2  . THR A 1 23 ? -11.654 0.178   7.483   1.00 0.00 ? 23  THR A CG2  1  
ATOM   287   H  H    . THR A 1 23 ? -7.628  0.637   7.364   1.00 0.00 ? 23  THR A H    1  
ATOM   288   H  HA   . THR A 1 23 ? -9.678  -0.862  6.093   1.00 0.00 ? 23  THR A HA   1  
ATOM   289   H  HB   . THR A 1 23 ? -10.132 1.653   7.691   1.00 0.00 ? 23  THR A HB   1  
ATOM   290   H  HG1  . THR A 1 23 ? -9.986  0.365   9.543   1.00 0.00 ? 23  THR A HG1  1  
ATOM   291   H  HG21 . THR A 1 23 ? -11.745 -0.680  6.835   1.00 0.00 ? 23  THR A HG21 1  
ATOM   292   H  HG22 . THR A 1 23 ? -12.222 1.000   7.073   1.00 0.00 ? 23  THR A HG22 1  
ATOM   293   H  HG23 . THR A 1 23 ? -12.033 -0.069  8.464   1.00 0.00 ? 23  THR A HG23 1  
ATOM   294   N  N    . HIS A 1 24 ? -9.284  2.276   5.158   1.00 0.00 ? 24  HIS A N    1  
ATOM   295   C  CA   . HIS A 1 24 ? -9.592  3.234   4.102   1.00 0.00 ? 24  HIS A CA   1  
ATOM   296   C  C    . HIS A 1 24 ? -8.368  3.491   3.228   1.00 0.00 ? 24  HIS A C    1  
ATOM   297   O  O    . HIS A 1 24 ? -7.242  3.552   3.721   1.00 0.00 ? 24  HIS A O    1  
ATOM   298   C  CB   . HIS A 1 24 ? -10.086 4.549   4.707   1.00 0.00 ? 24  HIS A CB   1  
ATOM   299   C  CG   . HIS A 1 24 ? -11.060 5.280   3.835   1.00 0.00 ? 24  HIS A CG   1  
ATOM   300   N  ND1  . HIS A 1 24 ? -10.706 6.356   3.048   1.00 0.00 ? 24  HIS A ND1  1  
ATOM   301   C  CD2  . HIS A 1 24 ? -12.383 5.083   3.627   1.00 0.00 ? 24  HIS A CD2  1  
ATOM   302   C  CE1  . HIS A 1 24 ? -11.770 6.790   2.396   1.00 0.00 ? 24  HIS A CE1  1  
ATOM   303   N  NE2  . HIS A 1 24 ? -12.800 6.034   2.729   1.00 0.00 ? 24  HIS A NE2  1  
ATOM   304   H  H    . HIS A 1 24 ? -8.668  2.535   5.874   1.00 0.00 ? 24  HIS A H    1  
ATOM   305   H  HA   . HIS A 1 24 ? -10.375 2.813   3.490   1.00 0.00 ? 24  HIS A HA   1  
ATOM   306   H  HB2  . HIS A 1 24 ? -10.574 4.344   5.648   1.00 0.00 ? 24  HIS A HB2  1  
ATOM   307   H  HB3  . HIS A 1 24 ? -9.241  5.199   4.878   1.00 0.00 ? 24  HIS A HB3  1  
ATOM   308   H  HD1  . HIS A 1 24 ? -9.810  6.744   2.980   1.00 0.00 ? 24  HIS A HD1  1  
ATOM   309   H  HD2  . HIS A 1 24 ? -12.998 4.319   4.083   1.00 0.00 ? 24  HIS A HD2  1  
ATOM   310   H  HE1  . HIS A 1 24 ? -11.793 7.621   1.707   1.00 0.00 ? 24  HIS A HE1  1  
ATOM   311   N  N    . LYS A 1 25 ? -8.597  3.639   1.928   1.00 0.00 ? 25  LYS A N    1  
ATOM   312   C  CA   . LYS A 1 25 ? -7.515  3.889   0.983   1.00 0.00 ? 25  LYS A CA   1  
ATOM   313   C  C    . LYS A 1 25 ? -6.772  5.175   1.335   1.00 0.00 ? 25  LYS A C    1  
ATOM   314   O  O    . LYS A 1 25 ? -5.596  5.335   1.007   1.00 0.00 ? 25  LYS A O    1  
ATOM   315   C  CB   . LYS A 1 25 ? -8.064  3.979   -0.442  1.00 0.00 ? 25  LYS A CB   1  
ATOM   316   C  CG   . LYS A 1 25 ? -6.984  4.050   -1.507  1.00 0.00 ? 25  LYS A CG   1  
ATOM   317   C  CD   . LYS A 1 25 ? -7.578  4.234   -2.893  1.00 0.00 ? 25  LYS A CD   1  
ATOM   318   C  CE   . LYS A 1 25 ? -6.496  4.456   -3.939  1.00 0.00 ? 25  LYS A CE   1  
ATOM   319   N  NZ   . LYS A 1 25 ? -7.044  5.062   -5.184  1.00 0.00 ? 25  LYS A NZ   1  
ATOM   320   H  H    . LYS A 1 25 ? -9.518  3.579   1.595   1.00 0.00 ? 25  LYS A H    1  
ATOM   321   H  HA   . LYS A 1 25 ? -6.824  3.062   1.043   1.00 0.00 ? 25  LYS A HA   1  
ATOM   322   H  HB2  . LYS A 1 25 ? -8.674  3.109   -0.635  1.00 0.00 ? 25  LYS A HB2  1  
ATOM   323   H  HB3  . LYS A 1 25 ? -8.679  4.864   -0.523  1.00 0.00 ? 25  LYS A HB3  1  
ATOM   324   H  HG2  . LYS A 1 25 ? -6.333  4.885   -1.293  1.00 0.00 ? 25  LYS A HG2  1  
ATOM   325   H  HG3  . LYS A 1 25 ? -6.412  3.133   -1.489  1.00 0.00 ? 25  LYS A HG3  1  
ATOM   326   H  HD2  . LYS A 1 25 ? -8.139  3.349   -3.155  1.00 0.00 ? 25  LYS A HD2  1  
ATOM   327   H  HD3  . LYS A 1 25 ? -8.237  5.090   -2.882  1.00 0.00 ? 25  LYS A HD3  1  
ATOM   328   H  HE2  . LYS A 1 25 ? -5.747  5.115   -3.528  1.00 0.00 ? 25  LYS A HE2  1  
ATOM   329   H  HE3  . LYS A 1 25 ? -6.045  3.504   -4.179  1.00 0.00 ? 25  LYS A HE3  1  
ATOM   330   H  HZ1  . LYS A 1 25 ? -6.268  5.379   -5.799  1.00 0.00 ? 25  LYS A HZ1  1  
ATOM   331   H  HZ2  . LYS A 1 25 ? -7.643  5.879   -4.950  1.00 0.00 ? 25  LYS A HZ2  1  
ATOM   332   H  HZ3  . LYS A 1 25 ? -7.617  4.363   -5.699  1.00 0.00 ? 25  LYS A HZ3  1  
ATOM   333   N  N    . THR A 1 26 ? -7.466  6.089   2.006   1.00 0.00 ? 26  THR A N    1  
ATOM   334   C  CA   . THR A 1 26 ? -6.873  7.360   2.402   1.00 0.00 ? 26  THR A CA   1  
ATOM   335   C  C    . THR A 1 26 ? -5.861  7.167   3.526   1.00 0.00 ? 26  THR A C    1  
ATOM   336   O  O    . THR A 1 26 ? -4.803  7.796   3.536   1.00 0.00 ? 26  THR A O    1  
ATOM   337   C  CB   . THR A 1 26 ? -7.948  8.363   2.861   1.00 0.00 ? 26  THR A CB   1  
ATOM   338   O  OG1  . THR A 1 26 ? -7.481  9.703   2.672   1.00 0.00 ? 26  THR A OG1  1  
ATOM   339   C  CG2  . THR A 1 26 ? -8.302  8.146   4.325   1.00 0.00 ? 26  THR A CG2  1  
ATOM   340   H  H    . THR A 1 26 ? -8.400  5.903   2.239   1.00 0.00 ? 26  THR A H    1  
ATOM   341   H  HA   . THR A 1 26 ? -6.367  7.774   1.542   1.00 0.00 ? 26  THR A HA   1  
ATOM   342   H  HB   . THR A 1 26 ? -8.837  8.212   2.266   1.00 0.00 ? 26  THR A HB   1  
ATOM   343   H  HG1  . THR A 1 26 ? -6.925  9.956   3.413   1.00 0.00 ? 26  THR A HG1  1  
ATOM   344   H  HG21 . THR A 1 26 ? -7.456  8.411   4.942   1.00 0.00 ? 26  THR A HG21 1  
ATOM   345   H  HG22 . THR A 1 26 ? -8.552  7.107   4.485   1.00 0.00 ? 26  THR A HG22 1  
ATOM   346   H  HG23 . THR A 1 26 ? -9.147  8.764   4.587   1.00 0.00 ? 26  THR A HG23 1  
ATOM   347   N  N    . ASN A 1 27 ? -6.193  6.294   4.472   1.00 0.00 ? 27  ASN A N    1  
ATOM   348   C  CA   . ASN A 1 27 ? -5.312  6.019   5.601   1.00 0.00 ? 27  ASN A CA   1  
ATOM   349   C  C    . ASN A 1 27 ? -4.003  5.393   5.130   1.00 0.00 ? 27  ASN A C    1  
ATOM   350   O  O    . ASN A 1 27 ? -2.935  5.676   5.674   1.00 0.00 ? 27  ASN A O    1  
ATOM   351   C  CB   . ASN A 1 27 ? -6.004  5.090   6.600   1.00 0.00 ? 27  ASN A CB   1  
ATOM   352   C  CG   . ASN A 1 27 ? -5.438  5.223   8.001   1.00 0.00 ? 27  ASN A CG   1  
ATOM   353   O  OD1  . ASN A 1 27 ? -4.435  5.904   8.215   1.00 0.00 ? 27  ASN A OD1  1  
ATOM   354   N  ND2  . ASN A 1 27 ? -6.080  4.570   8.962   1.00 0.00 ? 27  ASN A ND2  1  
ATOM   355   H  H    . ASN A 1 27 ? -7.050  5.824   4.409   1.00 0.00 ? 27  ASN A H    1  
ATOM   356   H  HA   . ASN A 1 27 ? -5.094  6.958   6.087   1.00 0.00 ? 27  ASN A HA   1  
ATOM   357   H  HB2  . ASN A 1 27 ? -7.057  5.329   6.634   1.00 0.00 ? 27  ASN A HB2  1  
ATOM   358   H  HB3  . ASN A 1 27 ? -5.881  4.067   6.277   1.00 0.00 ? 27  ASN A HB3  1  
ATOM   359   H  HD21 . ASN A 1 27 ? -6.872  4.046   8.718   1.00 0.00 ? 27  ASN A HD21 1  
ATOM   360   H  HD22 . ASN A 1 27 ? -5.736  4.638   9.877   1.00 0.00 ? 27  ASN A HD22 1  
ATOM   361   N  N    . LEU A 1 28 ? -4.093  4.541   4.114   1.00 0.00 ? 28  LEU A N    1  
ATOM   362   C  CA   . LEU A 1 28 ? -2.916  3.875   3.568   1.00 0.00 ? 28  LEU A CA   1  
ATOM   363   C  C    . LEU A 1 28 ? -2.001  4.873   2.866   1.00 0.00 ? 28  LEU A C    1  
ATOM   364   O  O    . LEU A 1 28 ? -0.801  4.926   3.135   1.00 0.00 ? 28  LEU A O    1  
ATOM   365   C  CB   . LEU A 1 28 ? -3.336  2.776   2.590   1.00 0.00 ? 28  LEU A CB   1  
ATOM   366   C  CG   . LEU A 1 28 ? -2.259  2.299   1.614   1.00 0.00 ? 28  LEU A CG   1  
ATOM   367   C  CD1  . LEU A 1 28 ? -1.217  1.459   2.337   1.00 0.00 ? 28  LEU A CD1  1  
ATOM   368   C  CD2  . LEU A 1 28 ? -2.886  1.509   0.474   1.00 0.00 ? 28  LEU A CD2  1  
ATOM   369   H  H    . LEU A 1 28 ? -4.971  4.356   3.722   1.00 0.00 ? 28  LEU A H    1  
ATOM   370   H  HA   . LEU A 1 28 ? -2.377  3.428   4.390   1.00 0.00 ? 28  LEU A HA   1  
ATOM   371   H  HB2  . LEU A 1 28 ? -3.657  1.924   3.169   1.00 0.00 ? 28  LEU A HB2  1  
ATOM   372   H  HB3  . LEU A 1 28 ? -4.167  3.150   2.010   1.00 0.00 ? 28  LEU A HB3  1  
ATOM   373   H  HG   . LEU A 1 28 ? -1.759  3.159   1.191   1.00 0.00 ? 28  LEU A HG   1  
ATOM   374   H  HD11 . LEU A 1 28 ? -0.360  1.319   1.696   1.00 0.00 ? 28  LEU A HD11 1  
ATOM   375   H  HD12 . LEU A 1 28 ? -1.641  0.498   2.587   1.00 0.00 ? 28  LEU A HD12 1  
ATOM   376   H  HD13 . LEU A 1 28 ? -0.912  1.965   3.241   1.00 0.00 ? 28  LEU A HD13 1  
ATOM   377   H  HD21 . LEU A 1 28 ? -3.155  0.524   0.823   1.00 0.00 ? 28  LEU A HD21 1  
ATOM   378   H  HD22 . LEU A 1 28 ? -2.176  1.423   -0.336  1.00 0.00 ? 28  LEU A HD22 1  
ATOM   379   H  HD23 . LEU A 1 28 ? -3.770  2.022   0.124   1.00 0.00 ? 28  LEU A HD23 1  
ATOM   380   N  N    . ILE A 1 29 ? -2.577  5.665   1.968   1.00 0.00 ? 29  ILE A N    1  
ATOM   381   C  CA   . ILE A 1 29 ? -1.814  6.665   1.230   1.00 0.00 ? 29  ILE A CA   1  
ATOM   382   C  C    . ILE A 1 29 ? -1.051  7.584   2.178   1.00 0.00 ? 29  ILE A C    1  
ATOM   383   O  O    . ILE A 1 29 ? 0.113   7.908   1.941   1.00 0.00 ? 29  ILE A O    1  
ATOM   384   C  CB   . ILE A 1 29 ? -2.727  7.518   0.330   1.00 0.00 ? 29  ILE A CB   1  
ATOM   385   C  CG1  . ILE A 1 29 ? -3.442  6.633   -0.694  1.00 0.00 ? 29  ILE A CG1  1  
ATOM   386   C  CG2  . ILE A 1 29 ? -1.918  8.600   -0.371  1.00 0.00 ? 29  ILE A CG2  1  
ATOM   387   C  CD1  . ILE A 1 29 ? -4.624  7.308   -1.354  1.00 0.00 ? 29  ILE A CD1  1  
ATOM   388   H  H    . ILE A 1 29 ? -3.538  5.576   1.798   1.00 0.00 ? 29  ILE A H    1  
ATOM   389   H  HA   . ILE A 1 29 ? -1.105  6.145   0.601   1.00 0.00 ? 29  ILE A HA   1  
ATOM   390   H  HB   . ILE A 1 29 ? -3.463  8.000   0.955   1.00 0.00 ? 29  ILE A HB   1  
ATOM   391   H  HG12 . ILE A 1 29 ? -2.745  6.354   -1.468  1.00 0.00 ? 29  ILE A HG12 1  
ATOM   392   H  HG13 . ILE A 1 29 ? -3.801  5.742   -0.199  1.00 0.00 ? 29  ILE A HG13 1  
ATOM   393   H  HG21 . ILE A 1 29 ? -1.203  9.020   0.322   1.00 0.00 ? 29  ILE A HG21 1  
ATOM   394   H  HG22 . ILE A 1 29 ? -1.394  8.170   -1.211  1.00 0.00 ? 29  ILE A HG22 1  
ATOM   395   H  HG23 . ILE A 1 29 ? -2.581  9.377   -0.719  1.00 0.00 ? 29  ILE A HG23 1  
ATOM   396   H  HD11 . ILE A 1 29 ? -4.269  8.066   -2.038  1.00 0.00 ? 29  ILE A HD11 1  
ATOM   397   H  HD12 . ILE A 1 29 ? -5.199  6.574   -1.899  1.00 0.00 ? 29  ILE A HD12 1  
ATOM   398   H  HD13 . ILE A 1 29 ? -5.245  7.766   -0.600  1.00 0.00 ? 29  ILE A HD13 1  
ATOM   399   N  N    . ILE A 1 30 ? -1.714  7.998   3.253   1.00 0.00 ? 30  ILE A N    1  
ATOM   400   C  CA   . ILE A 1 30 ? -1.097  8.877   4.238   1.00 0.00 ? 30  ILE A CA   1  
ATOM   401   C  C    . ILE A 1 30 ? 0.082   8.194   4.922   1.00 0.00 ? 30  ILE A C    1  
ATOM   402   O  O    . ILE A 1 30 ? 1.060   8.844   5.294   1.00 0.00 ? 30  ILE A O    1  
ATOM   403   C  CB   . ILE A 1 30 ? -2.110  9.321   5.309   1.00 0.00 ? 30  ILE A CB   1  
ATOM   404   C  CG1  . ILE A 1 30 ? -3.304  10.020  4.655   1.00 0.00 ? 30  ILE A CG1  1  
ATOM   405   C  CG2  . ILE A 1 30 ? -1.442  10.239  6.323   1.00 0.00 ? 30  ILE A CG2  1  
ATOM   406   C  CD1  . ILE A 1 30 ? -4.578  9.927   5.465   1.00 0.00 ? 30  ILE A CD1  1  
ATOM   407   H  H    . ILE A 1 30 ? -2.639  7.705   3.386   1.00 0.00 ? 30  ILE A H    1  
ATOM   408   H  HA   . ILE A 1 30 ? -0.740  9.757   3.722   1.00 0.00 ? 30  ILE A HA   1  
ATOM   409   H  HB   . ILE A 1 30 ? -2.458  8.442   5.830   1.00 0.00 ? 30  ILE A HB   1  
ATOM   410   H  HG12 . ILE A 1 30 ? -3.072  11.065  4.521   1.00 0.00 ? 30  ILE A HG12 1  
ATOM   411   H  HG13 . ILE A 1 30 ? -3.490  9.570   3.690   1.00 0.00 ? 30  ILE A HG13 1  
ATOM   412   H  HG21 . ILE A 1 30 ? -0.562  9.755   6.721   1.00 0.00 ? 30  ILE A HG21 1  
ATOM   413   H  HG22 . ILE A 1 30 ? -1.158  11.161  5.839   1.00 0.00 ? 30  ILE A HG22 1  
ATOM   414   H  HG23 . ILE A 1 30 ? -2.132  10.451  7.126   1.00 0.00 ? 30  ILE A HG23 1  
ATOM   415   H  HD11 . ILE A 1 30 ? -5.358  10.493  4.976   1.00 0.00 ? 30  ILE A HD11 1  
ATOM   416   H  HD12 . ILE A 1 30 ? -4.880  8.893   5.545   1.00 0.00 ? 30  ILE A HD12 1  
ATOM   417   H  HD13 . ILE A 1 30 ? -4.407  10.330  6.452   1.00 0.00 ? 30  ILE A HD13 1  
ATOM   418   N  N    . HIS A 1 31 ? -0.016  6.878   5.085   1.00 0.00 ? 31  HIS A N    1  
ATOM   419   C  CA   . HIS A 1 31 ? 1.044   6.105   5.723   1.00 0.00 ? 31  HIS A CA   1  
ATOM   420   C  C    . HIS A 1 31 ? 2.255   5.982   4.803   1.00 0.00 ? 31  HIS A C    1  
ATOM   421   O  O    . HIS A 1 31 ? 3.379   6.291   5.197   1.00 0.00 ? 31  HIS A O    1  
ATOM   422   C  CB   . HIS A 1 31 ? 0.534   4.715   6.101   1.00 0.00 ? 31  HIS A CB   1  
ATOM   423   C  CG   . HIS A 1 31 ? 1.610   3.674   6.151   1.00 0.00 ? 31  HIS A CG   1  
ATOM   424   N  ND1  . HIS A 1 31 ? 2.158   3.215   7.330   1.00 0.00 ? 31  HIS A ND1  1  
ATOM   425   C  CD2  . HIS A 1 31 ? 2.238   3.002   5.158   1.00 0.00 ? 31  HIS A CD2  1  
ATOM   426   C  CE1  . HIS A 1 31 ? 3.078   2.306   7.059   1.00 0.00 ? 31  HIS A CE1  1  
ATOM   427   N  NE2  . HIS A 1 31 ? 3.146   2.158   5.749   1.00 0.00 ? 31  HIS A NE2  1  
ATOM   428   H  H    . HIS A 1 31 ? -0.820  6.416   4.768   1.00 0.00 ? 31  HIS A H    1  
ATOM   429   H  HA   . HIS A 1 31 ? 1.341   6.627   6.620   1.00 0.00 ? 31  HIS A HA   1  
ATOM   430   H  HB2  . HIS A 1 31 ? 0.073   4.762   7.077   1.00 0.00 ? 31  HIS A HB2  1  
ATOM   431   H  HB3  . HIS A 1 31 ? -0.202  4.399   5.376   1.00 0.00 ? 31  HIS A HB3  1  
ATOM   432   H  HD1  . HIS A 1 31 ? 1.911   3.512   8.230   1.00 0.00 ? 31  HIS A HD1  1  
ATOM   433   H  HD2  . HIS A 1 31 ? 2.059   3.110   4.097   1.00 0.00 ? 31  HIS A HD2  1  
ATOM   434   H  HE1  . HIS A 1 31 ? 3.674   1.774   7.786   1.00 0.00 ? 31  HIS A HE1  1  
ATOM   435   N  N    . GLN A 1 32 ? 2.017   5.528   3.577   1.00 0.00 ? 32  GLN A N    1  
ATOM   436   C  CA   . GLN A 1 32 ? 3.089   5.363   2.602   1.00 0.00 ? 32  GLN A CA   1  
ATOM   437   C  C    . GLN A 1 32 ? 4.046   6.551   2.638   1.00 0.00 ? 32  GLN A C    1  
ATOM   438   O  O    . GLN A 1 32 ? 5.207   6.439   2.246   1.00 0.00 ? 32  GLN A O    1  
ATOM   439   C  CB   . GLN A 1 32 ? 2.509   5.203   1.196   1.00 0.00 ? 32  GLN A CB   1  
ATOM   440   C  CG   . GLN A 1 32 ? 1.901   3.833   0.941   1.00 0.00 ? 32  GLN A CG   1  
ATOM   441   C  CD   . GLN A 1 32 ? 1.343   3.695   -0.462  1.00 0.00 ? 32  GLN A CD   1  
ATOM   442   O  OE1  . GLN A 1 32 ? 0.723   4.618   -0.990  1.00 0.00 ? 32  GLN A OE1  1  
ATOM   443   N  NE2  . GLN A 1 32 ? 1.561   2.537   -1.074  1.00 0.00 ? 32  GLN A NE2  1  
ATOM   444   H  H    . GLN A 1 32 ? 1.100   5.299   3.321   1.00 0.00 ? 32  GLN A H    1  
ATOM   445   H  HA   . GLN A 1 32 ? 3.636   4.469   2.860   1.00 0.00 ? 32  GLN A HA   1  
ATOM   446   H  HB2  . GLN A 1 32 ? 1.740   5.947   1.050   1.00 0.00 ? 32  GLN A HB2  1  
ATOM   447   H  HB3  . GLN A 1 32 ? 3.296   5.364   0.474   1.00 0.00 ? 32  GLN A HB3  1  
ATOM   448   H  HG2  . GLN A 1 32 ? 2.665   3.083   1.083   1.00 0.00 ? 32  GLN A HG2  1  
ATOM   449   H  HG3  . GLN A 1 32 ? 1.102   3.671   1.649   1.00 0.00 ? 32  GLN A HG3  1  
ATOM   450   H  HE21 . GLN A 1 32 ? 2.062   1.846   -0.592  1.00 0.00 ? 32  GLN A HE21 1  
ATOM   451   H  HE22 . GLN A 1 32 ? 1.211   2.419   -1.981  1.00 0.00 ? 32  GLN A HE22 1  
ATOM   452   N  N    . LYS A 1 33 ? 3.550   7.689   3.111   1.00 0.00 ? 33  LYS A N    1  
ATOM   453   C  CA   . LYS A 1 33 ? 4.359   8.899   3.200   1.00 0.00 ? 33  LYS A CA   1  
ATOM   454   C  C    . LYS A 1 33 ? 5.699   8.609   3.869   1.00 0.00 ? 33  LYS A C    1  
ATOM   455   O  O    . LYS A 1 33 ? 6.736   9.127   3.453   1.00 0.00 ? 33  LYS A O    1  
ATOM   456   C  CB   . LYS A 1 33 ? 3.611   9.981   3.981   1.00 0.00 ? 33  LYS A CB   1  
ATOM   457   C  CG   . LYS A 1 33 ? 2.309   10.412  3.329   1.00 0.00 ? 33  LYS A CG   1  
ATOM   458   C  CD   . LYS A 1 33 ? 2.523   11.569  2.367   1.00 0.00 ? 33  LYS A CD   1  
ATOM   459   C  CE   . LYS A 1 33 ? 1.211   12.256  2.020   1.00 0.00 ? 33  LYS A CE   1  
ATOM   460   N  NZ   . LYS A 1 33 ? 1.339   13.119  0.813   1.00 0.00 ? 33  LYS A NZ   1  
ATOM   461   H  H    . LYS A 1 33 ? 2.616   7.716   3.409   1.00 0.00 ? 33  LYS A H    1  
ATOM   462   H  HA   . LYS A 1 33 ? 4.540   9.251   2.196   1.00 0.00 ? 33  LYS A HA   1  
ATOM   463   H  HB2  . LYS A 1 33 ? 3.387   9.606   4.969   1.00 0.00 ? 33  LYS A HB2  1  
ATOM   464   H  HB3  . LYS A 1 33 ? 4.249   10.849  4.071   1.00 0.00 ? 33  LYS A HB3  1  
ATOM   465   H  HG2  . LYS A 1 33 ? 1.896   9.577   2.783   1.00 0.00 ? 33  LYS A HG2  1  
ATOM   466   H  HG3  . LYS A 1 33 ? 1.615   10.720  4.098   1.00 0.00 ? 33  LYS A HG3  1  
ATOM   467   H  HD2  . LYS A 1 33 ? 3.183   12.290  2.826   1.00 0.00 ? 33  LYS A HD2  1  
ATOM   468   H  HD3  . LYS A 1 33 ? 2.974   11.193  1.460   1.00 0.00 ? 33  LYS A HD3  1  
ATOM   469   H  HE2  . LYS A 1 33 ? 0.463   11.501  1.835   1.00 0.00 ? 33  LYS A HE2  1  
ATOM   470   H  HE3  . LYS A 1 33 ? 0.907   12.866  2.858   1.00 0.00 ? 33  LYS A HE3  1  
ATOM   471   H  HZ1  . LYS A 1 33 ? 0.804   12.708  0.021   1.00 0.00 ? 33  LYS A HZ1  1  
ATOM   472   H  HZ2  . LYS A 1 33 ? 2.339   13.200  0.536   1.00 0.00 ? 33  LYS A HZ2  1  
ATOM   473   H  HZ3  . LYS A 1 33 ? 0.968   14.069  1.012   1.00 0.00 ? 33  LYS A HZ3  1  
ATOM   474   N  N    . ILE A 1 34 ? 5.670   7.777   4.905   1.00 0.00 ? 34  ILE A N    1  
ATOM   475   C  CA   . ILE A 1 34 ? 6.883   7.417   5.628   1.00 0.00 ? 34  ILE A CA   1  
ATOM   476   C  C    . ILE A 1 34 ? 7.891   6.736   4.708   1.00 0.00 ? 34  ILE A C    1  
ATOM   477   O  O    . ILE A 1 34 ? 9.099   6.797   4.939   1.00 0.00 ? 34  ILE A O    1  
ATOM   478   C  CB   . ILE A 1 34 ? 6.575   6.483   6.814   1.00 0.00 ? 34  ILE A CB   1  
ATOM   479   C  CG1  . ILE A 1 34 ? 6.141   5.107   6.308   1.00 0.00 ? 34  ILE A CG1  1  
ATOM   480   C  CG2  . ILE A 1 34 ? 5.500   7.091   7.702   1.00 0.00 ? 34  ILE A CG2  1  
ATOM   481   C  CD1  . ILE A 1 34 ? 6.086   4.053   7.392   1.00 0.00 ? 34  ILE A CD1  1  
ATOM   482   H  H    . ILE A 1 34 ? 4.814   7.396   5.189   1.00 0.00 ? 34  ILE A H    1  
ATOM   483   H  HA   . ILE A 1 34 ? 7.322   8.325   6.016   1.00 0.00 ? 34  ILE A HA   1  
ATOM   484   H  HB   . ILE A 1 34 ? 7.474   6.376   7.401   1.00 0.00 ? 34  ILE A HB   1  
ATOM   485   H  HG12 . ILE A 1 34 ? 5.157   5.184   5.872   1.00 0.00 ? 34  ILE A HG12 1  
ATOM   486   H  HG13 . ILE A 1 34 ? 6.838   4.772   5.553   1.00 0.00 ? 34  ILE A HG13 1  
ATOM   487   H  HG21 . ILE A 1 34 ? 5.927   7.890   8.289   1.00 0.00 ? 34  ILE A HG21 1  
ATOM   488   H  HG22 . ILE A 1 34 ? 4.705   7.485   7.085   1.00 0.00 ? 34  ILE A HG22 1  
ATOM   489   H  HG23 . ILE A 1 34 ? 5.104   6.332   8.359   1.00 0.00 ? 34  ILE A HG23 1  
ATOM   490   H  HD11 . ILE A 1 34 ? 6.280   4.513   8.350   1.00 0.00 ? 34  ILE A HD11 1  
ATOM   491   H  HD12 . ILE A 1 34 ? 5.107   3.598   7.404   1.00 0.00 ? 34  ILE A HD12 1  
ATOM   492   H  HD13 . ILE A 1 34 ? 6.833   3.298   7.199   1.00 0.00 ? 34  ILE A HD13 1  
ATOM   493   N  N    . HIS A 1 35 ? 7.386   6.089   3.662   1.00 0.00 ? 35  HIS A N    1  
ATOM   494   C  CA   . HIS A 1 35 ? 8.242   5.399   2.704   1.00 0.00 ? 35  HIS A CA   1  
ATOM   495   C  C    . HIS A 1 35 ? 8.871   6.387   1.727   1.00 0.00 ? 35  HIS A C    1  
ATOM   496   O  O    . HIS A 1 35 ? 10.010  6.210   1.295   1.00 0.00 ? 35  HIS A O    1  
ATOM   497   C  CB   . HIS A 1 35 ? 7.441   4.346   1.939   1.00 0.00 ? 35  HIS A CB   1  
ATOM   498   C  CG   . HIS A 1 35 ? 7.055   3.163   2.773   1.00 0.00 ? 35  HIS A CG   1  
ATOM   499   N  ND1  . HIS A 1 35 ? 7.943   2.498   3.592   1.00 0.00 ? 35  HIS A ND1  1  
ATOM   500   C  CD2  . HIS A 1 35 ? 5.868   2.528   2.913   1.00 0.00 ? 35  HIS A CD2  1  
ATOM   501   C  CE1  . HIS A 1 35 ? 7.319   1.504   4.198   1.00 0.00 ? 35  HIS A CE1  1  
ATOM   502   N  NE2  . HIS A 1 35 ? 6.058   1.500   3.804   1.00 0.00 ? 35  HIS A NE2  1  
ATOM   503   H  H    . HIS A 1 35 ? 6.415   6.077   3.532   1.00 0.00 ? 35  HIS A H    1  
ATOM   504   H  HA   . HIS A 1 35 ? 9.029   4.908   3.257   1.00 0.00 ? 35  HIS A HA   1  
ATOM   505   H  HB2  . HIS A 1 35 ? 6.533   4.796   1.563   1.00 0.00 ? 35  HIS A HB2  1  
ATOM   506   H  HB3  . HIS A 1 35 ? 8.030   3.988   1.107   1.00 0.00 ? 35  HIS A HB3  1  
ATOM   507   H  HD1  . HIS A 1 35 ? 8.889   2.721   3.710   1.00 0.00 ? 35  HIS A HD1  1  
ATOM   508   H  HD2  . HIS A 1 35 ? 4.942   2.781   2.416   1.00 0.00 ? 35  HIS A HD2  1  
ATOM   509   H  HE1  . HIS A 1 35 ? 7.763   0.812   4.898   1.00 0.00 ? 35  HIS A HE1  1  
ATOM   510   N  N    . THR A 1 36 ? 8.120   7.428   1.380   1.00 0.00 ? 36  THR A N    1  
ATOM   511   C  CA   . THR A 1 36 ? 8.603   8.443   0.452   1.00 0.00 ? 36  THR A CA   1  
ATOM   512   C  C    . THR A 1 36 ? 9.071   9.689   1.195   1.00 0.00 ? 36  THR A C    1  
ATOM   513   O  O    . THR A 1 36 ? 8.347   10.680  1.283   1.00 0.00 ? 36  THR A O    1  
ATOM   514   C  CB   . THR A 1 36 ? 7.513   8.842   -0.561  1.00 0.00 ? 36  THR A CB   1  
ATOM   515   O  OG1  . THR A 1 36 ? 7.776   10.153  -1.073  1.00 0.00 ? 36  THR A OG1  1  
ATOM   516   C  CG2  . THR A 1 36 ? 6.136   8.811   0.086   1.00 0.00 ? 36  THR A CG2  1  
ATOM   517   H  H    . THR A 1 36 ? 7.220   7.514   1.758   1.00 0.00 ? 36  THR A H    1  
ATOM   518   H  HA   . THR A 1 36 ? 9.437   8.026   -0.094  1.00 0.00 ? 36  THR A HA   1  
ATOM   519   H  HB   . THR A 1 36 ? 7.526   8.135   -1.378  1.00 0.00 ? 36  THR A HB   1  
ATOM   520   H  HG1  . THR A 1 36 ? 8.688   10.204  -1.369  1.00 0.00 ? 36  THR A HG1  1  
ATOM   521   H  HG21 . THR A 1 36 ? 5.428   9.321   -0.551  1.00 0.00 ? 36  THR A HG21 1  
ATOM   522   H  HG22 . THR A 1 36 ? 6.178   9.305   1.045   1.00 0.00 ? 36  THR A HG22 1  
ATOM   523   H  HG23 . THR A 1 36 ? 5.825   7.786   0.222   1.00 0.00 ? 36  THR A HG23 1  
ATOM   524   N  N    . GLY A 1 37 ? 10.287  9.633   1.728   1.00 0.00 ? 37  GLY A N    1  
ATOM   525   C  CA   . GLY A 1 37 ? 10.831  10.764  2.457   1.00 0.00 ? 37  GLY A CA   1  
ATOM   526   C  C    . GLY A 1 37 ? 12.265  10.538  2.892   1.00 0.00 ? 37  GLY A C    1  
ATOM   527   O  O    . GLY A 1 37 ? 12.599  10.713  4.063   1.00 0.00 ? 37  GLY A O    1  
ATOM   528   H  H    . GLY A 1 37 ? 10.820  8.816   1.627   1.00 0.00 ? 37  GLY A H    1  
ATOM   529   H  HA2  . GLY A 1 37 ? 10.791  11.638  1.824   1.00 0.00 ? 37  GLY A HA2  1  
ATOM   530   H  HA3  . GLY A 1 37 ? 10.224  10.939  3.333   1.00 0.00 ? 37  GLY A HA3  1  
ATOM   531   N  N    . GLU A 1 38 ? 13.114  10.146  1.947   1.00 0.00 ? 38  GLU A N    1  
ATOM   532   C  CA   . GLU A 1 38 ? 14.520  9.893   2.242   1.00 0.00 ? 38  GLU A CA   1  
ATOM   533   C  C    . GLU A 1 38 ? 15.424  10.666  1.285   1.00 0.00 ? 38  GLU A C    1  
ATOM   534   O  O    . GLU A 1 38 ? 15.121  10.799  0.099   1.00 0.00 ? 38  GLU A O    1  
ATOM   535   C  CB   . GLU A 1 38 ? 14.822  8.396   2.149   1.00 0.00 ? 38  GLU A CB   1  
ATOM   536   C  CG   . GLU A 1 38 ? 14.694  7.835   0.742   1.00 0.00 ? 38  GLU A CG   1  
ATOM   537   C  CD   . GLU A 1 38 ? 13.251  7.712   0.293   1.00 0.00 ? 38  GLU A CD   1  
ATOM   538   O  OE1  . GLU A 1 38 ? 12.518  6.882   0.870   1.00 0.00 ? 38  GLU A OE1  1  
ATOM   539   O  OE2  . GLU A 1 38 ? 12.854  8.446   -0.636  1.00 0.00 ? 38  GLU A OE2  1  
ATOM   540   H  H    . GLU A 1 38 ? 12.788  10.023  1.032   1.00 0.00 ? 38  GLU A H    1  
ATOM   541   H  HA   . GLU A 1 38 ? 14.713  10.228  3.250   1.00 0.00 ? 38  GLU A HA   1  
ATOM   542   H  HB2  . GLU A 1 38 ? 15.831  8.222   2.493   1.00 0.00 ? 38  GLU A HB2  1  
ATOM   543   H  HB3  . GLU A 1 38 ? 14.136  7.862   2.790   1.00 0.00 ? 38  GLU A HB3  1  
ATOM   544   H  HG2  . GLU A 1 38 ? 15.212  8.490   0.058   1.00 0.00 ? 38  GLU A HG2  1  
ATOM   545   H  HG3  . GLU A 1 38 ? 15.149  6.856   0.716   1.00 0.00 ? 38  GLU A HG3  1  
ATOM   546   N  N    . ARG A 1 39 ? 16.534  11.174  1.810   1.00 0.00 ? 39  ARG A N    1  
ATOM   547   C  CA   . ARG A 1 39 ? 17.481  11.935  1.004   1.00 0.00 ? 39  ARG A CA   1  
ATOM   548   C  C    . ARG A 1 39 ? 18.487  11.008  0.327   1.00 0.00 ? 39  ARG A C    1  
ATOM   549   O  O    . ARG A 1 39 ? 18.911  9.997   0.887   1.00 0.00 ? 39  ARG A O    1  
ATOM   550   C  CB   . ARG A 1 39 ? 18.217  12.956  1.873   1.00 0.00 ? 39  ARG A CB   1  
ATOM   551   C  CG   . ARG A 1 39 ? 19.098  12.326  2.940   1.00 0.00 ? 39  ARG A CG   1  
ATOM   552   C  CD   . ARG A 1 39 ? 19.524  13.346  3.985   1.00 0.00 ? 39  ARG A CD   1  
ATOM   553   N  NE   . ARG A 1 39 ? 20.308  14.431  3.403   1.00 0.00 ? 39  ARG A NE   1  
ATOM   554   C  CZ   . ARG A 1 39 ? 20.590  15.560  4.044   1.00 0.00 ? 39  ARG A CZ   1  
ATOM   555   N  NH1  . ARG A 1 39 ? 20.154  15.750  5.282   1.00 0.00 ? 39  ARG A NH1  1  
ATOM   556   N  NH2  . ARG A 1 39 ? 21.310  16.502  3.448   1.00 0.00 ? 39  ARG A NH2  1  
ATOM   557   H  H    . ARG A 1 39 ? 16.720  11.034  2.762   1.00 0.00 ? 39  ARG A H    1  
ATOM   558   H  HA   . ARG A 1 39 ? 16.923  12.459  0.243   1.00 0.00 ? 39  ARG A HA   1  
ATOM   559   H  HB2  . ARG A 1 39 ? 18.841  13.569  1.239   1.00 0.00 ? 39  ARG A HB2  1  
ATOM   560   H  HB3  . ARG A 1 39 ? 17.489  13.585  2.364   1.00 0.00 ? 39  ARG A HB3  1  
ATOM   561   H  HG2  . ARG A 1 39 ? 18.548  11.536  3.428   1.00 0.00 ? 39  ARG A HG2  1  
ATOM   562   H  HG3  . ARG A 1 39 ? 19.979  11.917  2.469   1.00 0.00 ? 39  ARG A HG3  1  
ATOM   563   H  HD2  . ARG A 1 39 ? 18.639  13.760  4.445   1.00 0.00 ? 39  ARG A HD2  1  
ATOM   564   H  HD3  . ARG A 1 39 ? 20.118  12.846  4.735   1.00 0.00 ? 39  ARG A HD3  1  
ATOM   565   H  HE   . ARG A 1 39 ? 20.641  14.312  2.489   1.00 0.00 ? 39  ARG A HE   1  
ATOM   566   H  HH11 . ARG A 1 39 ? 19.612  15.042  5.734   1.00 0.00 ? 39  ARG A HH11 1  
ATOM   567   H  HH12 . ARG A 1 39 ? 20.368  16.600  5.763   1.00 0.00 ? 39  ARG A HH12 1  
ATOM   568   H  HH21 . ARG A 1 39 ? 21.641  16.362  2.515   1.00 0.00 ? 39  ARG A HH21 1  
ATOM   569   H  HH22 . ARG A 1 39 ? 21.521  17.351  3.931   1.00 0.00 ? 39  ARG A HH22 1  
ATOM   570   N  N    . PRO A 1 40 ? 18.878  11.360  -0.907  1.00 0.00 ? 40  PRO A N    1  
ATOM   571   C  CA   . PRO A 1 40 ? 19.838  10.573  -1.687  1.00 0.00 ? 40  PRO A CA   1  
ATOM   572   C  C    . PRO A 1 40 ? 21.249  10.646  -1.112  1.00 0.00 ? 40  PRO A C    1  
ATOM   573   O  O    . PRO A 1 40 ? 21.550  11.507  -0.286  1.00 0.00 ? 40  PRO A O    1  
ATOM   574   C  CB   . PRO A 1 40 ? 19.790  11.226  -3.070  1.00 0.00 ? 40  PRO A CB   1  
ATOM   575   C  CG   . PRO A 1 40 ? 19.344  12.624  -2.815  1.00 0.00 ? 40  PRO A CG   1  
ATOM   576   C  CD   . PRO A 1 40 ? 18.414  12.553  -1.635  1.00 0.00 ? 40  PRO A CD   1  
ATOM   577   H  HA   . PRO A 1 40 ? 19.535  9.540   -1.763  1.00 0.00 ? 40  PRO A HA   1  
ATOM   578   H  HB2  . PRO A 1 40 ? 20.774  11.200  -3.518  1.00 0.00 ? 40  PRO A HB2  1  
ATOM   579   H  HB3  . PRO A 1 40 ? 19.089  10.696  -3.698  1.00 0.00 ? 40  PRO A HB3  1  
ATOM   580   H  HG2  . PRO A 1 40 ? 20.195  13.245  -2.584  1.00 0.00 ? 40  PRO A HG2  1  
ATOM   581   H  HG3  . PRO A 1 40 ? 18.822  13.006  -3.680  1.00 0.00 ? 40  PRO A HG3  1  
ATOM   582   H  HD2  . PRO A 1 40 ? 18.510  13.439  -1.025  1.00 0.00 ? 40  PRO A HD2  1  
ATOM   583   H  HD3  . PRO A 1 40 ? 17.393  12.428  -1.966  1.00 0.00 ? 40  PRO A HD3  1  
ATOM   584   N  N    . SER A 1 41 ? 22.111  9.736   -1.556  1.00 0.00 ? 41  SER A N    1  
ATOM   585   C  CA   . SER A 1 41 ? 23.490  9.695   -1.083  1.00 0.00 ? 41  SER A CA   1  
ATOM   586   C  C    . SER A 1 41 ? 24.070  11.102  -0.978  1.00 0.00 ? 41  SER A C    1  
ATOM   587   O  O    . SER A 1 41 ? 24.488  11.534  0.095   1.00 0.00 ? 41  SER A O    1  
ATOM   588   C  CB   . SER A 1 41 ? 24.348  8.846   -2.023  1.00 0.00 ? 41  SER A CB   1  
ATOM   589   O  OG   . SER A 1 41 ? 23.696  7.631   -2.351  1.00 0.00 ? 41  SER A OG   1  
ATOM   590   H  H    . SER A 1 41 ? 21.811  9.075   -2.215  1.00 0.00 ? 41  SER A H    1  
ATOM   591   H  HA   . SER A 1 41 ? 23.490  9.243   -0.102  1.00 0.00 ? 41  SER A HA   1  
ATOM   592   H  HB2  . SER A 1 41 ? 24.535  9.397   -2.932  1.00 0.00 ? 41  SER A HB2  1  
ATOM   593   H  HB3  . SER A 1 41 ? 25.287  8.618   -1.540  1.00 0.00 ? 41  SER A HB3  1  
ATOM   594   H  HG   . SER A 1 41 ? 23.050  7.421   -1.673  1.00 0.00 ? 41  SER A HG   1  
ATOM   595   N  N    . GLY A 1 42 ? 24.091  11.812  -2.102  1.00 0.00 ? 42  GLY A N    1  
ATOM   596   C  CA   . GLY A 1 42 ? 24.622  13.163  -2.115  1.00 0.00 ? 42  GLY A CA   1  
ATOM   597   C  C    . GLY A 1 42 ? 24.960  13.639  -3.514  1.00 0.00 ? 42  GLY A C    1  
ATOM   598   O  O    . GLY A 1 42 ? 24.439  13.132  -4.508  1.00 0.00 ? 42  GLY A O    1  
ATOM   599   H  H    . GLY A 1 42 ? 23.744  11.416  -2.928  1.00 0.00 ? 42  GLY A H    1  
ATOM   600   H  HA2  . GLY A 1 42 ? 23.890  13.830  -1.687  1.00 0.00 ? 42  GLY A HA2  1  
ATOM   601   H  HA3  . GLY A 1 42 ? 25.518  13.192  -1.512  1.00 0.00 ? 42  GLY A HA3  1  
ATOM   602   N  N    . PRO A 1 43 ? 25.852  14.637  -3.605  1.00 0.00 ? 43  PRO A N    1  
ATOM   603   C  CA   . PRO A 1 43 ? 26.278  15.204  -4.888  1.00 0.00 ? 43  PRO A CA   1  
ATOM   604   C  C    . PRO A 1 43 ? 27.135  14.234  -5.694  1.00 0.00 ? 43  PRO A C    1  
ATOM   605   O  O    . PRO A 1 43 ? 27.353  14.430  -6.890  1.00 0.00 ? 43  PRO A O    1  
ATOM   606   C  CB   . PRO A 1 43 ? 27.098  16.430  -4.479  1.00 0.00 ? 43  PRO A CB   1  
ATOM   607   C  CG   . PRO A 1 43 ? 27.589  16.117  -3.107  1.00 0.00 ? 43  PRO A CG   1  
ATOM   608   C  CD   . PRO A 1 43 ? 26.513  15.288  -2.462  1.00 0.00 ? 43  PRO A CD   1  
ATOM   609   H  HA   . PRO A 1 43 ? 25.433  15.517  -5.483  1.00 0.00 ? 43  PRO A HA   1  
ATOM   610   H  HB2  . PRO A 1 43 ? 27.917  16.565  -5.171  1.00 0.00 ? 43  PRO A HB2  1  
ATOM   611   H  HB3  . PRO A 1 43 ? 26.468  17.306  -4.482  1.00 0.00 ? 43  PRO A HB3  1  
ATOM   612   H  HG2  . PRO A 1 43 ? 28.510  15.557  -3.166  1.00 0.00 ? 43  PRO A HG2  1  
ATOM   613   H  HG3  . PRO A 1 43 ? 27.739  17.032  -2.554  1.00 0.00 ? 43  PRO A HG3  1  
ATOM   614   H  HD2  . PRO A 1 43 ? 26.948  14.555  -1.799  1.00 0.00 ? 43  PRO A HD2  1  
ATOM   615   H  HD3  . PRO A 1 43 ? 25.820  15.920  -1.926  1.00 0.00 ? 43  PRO A HD3  1  
ATOM   616   N  N    . SER A 1 44 ? 27.617  13.187  -5.033  1.00 0.00 ? 44  SER A N    1  
ATOM   617   C  CA   . SER A 1 44 ? 28.454  12.188  -5.688  1.00 0.00 ? 44  SER A CA   1  
ATOM   618   C  C    . SER A 1 44 ? 27.969  11.922  -7.110  1.00 0.00 ? 44  SER A C    1  
ATOM   619   O  O    . SER A 1 44 ? 26.991  11.205  -7.321  1.00 0.00 ? 44  SER A O    1  
ATOM   620   C  CB   . SER A 1 44 ? 28.453  10.886  -4.885  1.00 0.00 ? 44  SER A CB   1  
ATOM   621   O  OG   . SER A 1 44 ? 29.187  11.029  -3.681  1.00 0.00 ? 44  SER A OG   1  
ATOM   622   H  H    . SER A 1 44 ? 27.408  13.086  -4.080  1.00 0.00 ? 44  SER A H    1  
ATOM   623   H  HA   . SER A 1 44 ? 29.461  12.575  -5.730  1.00 0.00 ? 44  SER A HA   1  
ATOM   624   H  HB2  . SER A 1 44 ? 27.436  10.616  -4.643  1.00 0.00 ? 44  SER A HB2  1  
ATOM   625   H  HB3  . SER A 1 44 ? 28.903  10.102  -5.476  1.00 0.00 ? 44  SER A HB3  1  
ATOM   626   H  HG   . SER A 1 44 ? 28.623  10.814  -2.935  1.00 0.00 ? 44  SER A HG   1  
ATOM   627   N  N    . SER A 1 45 ? 28.661  12.507  -8.083  1.00 0.00 ? 45  SER A N    1  
ATOM   628   C  CA   . SER A 1 45 ? 28.300  12.337  -9.486  1.00 0.00 ? 45  SER A CA   1  
ATOM   629   C  C    . SER A 1 45 ? 29.534  12.038  -10.331 1.00 0.00 ? 45  SER A C    1  
ATOM   630   O  O    . SER A 1 45 ? 29.477  11.253  -11.277 1.00 0.00 ? 45  SER A O    1  
ATOM   631   C  CB   . SER A 1 45 ? 27.602  13.593  -10.010 1.00 0.00 ? 45  SER A CB   1  
ATOM   632   O  OG   . SER A 1 45 ? 28.331  14.761  -9.673  1.00 0.00 ? 45  SER A OG   1  
ATOM   633   H  H    . SER A 1 45 ? 29.431  13.067  -7.851  1.00 0.00 ? 45  SER A H    1  
ATOM   634   H  HA   . SER A 1 45 ? 27.620  11.502  -9.554  1.00 0.00 ? 45  SER A HA   1  
ATOM   635   H  HB2  . SER A 1 45 ? 27.518  13.534  -11.084 1.00 0.00 ? 45  SER A HB2  1  
ATOM   636   H  HB3  . SER A 1 45 ? 26.615  13.661  -9.575  1.00 0.00 ? 45  SER A HB3  1  
ATOM   637   H  HG   . SER A 1 45 ? 27.931  15.178  -8.906  1.00 0.00 ? 45  SER A HG   1  
ATOM   638   N  N    . GLY A 1 46 ? 30.651  12.669  -9.983  1.00 0.00 ? 46  GLY A N    1  
ATOM   639   C  CA   . GLY A 1 46 ? 31.884  12.458  -10.719 1.00 0.00 ? 46  GLY A CA   1  
ATOM   640   C  C    . GLY A 1 46 ? 32.978  13.423  -10.307 1.00 0.00 ? 46  GLY A C    1  
ATOM   641   O  O    . GLY A 1 46 ? 33.394  13.398  -9.150  1.00 0.00 ? 46  GLY A O    1  
ATOM   642   H  H    . GLY A 1 46 ? 30.638  13.284  -9.219  1.00 0.00 ? 46  GLY A H    1  
ATOM   643   H  HA2  . GLY A 1 46 ? 32.225  11.448  -10.546 1.00 0.00 ? 46  GLY A HA2  1  
ATOM   644   H  HA3  . GLY A 1 46 ? 31.686  12.586  -11.773 1.00 0.00 ? 46  GLY A HA3  1  
HETATM 645   ZN ZN   . ZN  B 2 .  ? 4.307   1.029   4.496   1.00 0.00 ? 201 ZN  A ZN   1  
ATOM   646   N  N    . GLY A 1 1  ? 5.278   -20.175 -12.576 1.00 0.00 ? 1   GLY A N    2  
ATOM   647   C  CA   . GLY A 1 1  ? 4.848   -21.433 -11.994 1.00 0.00 ? 1   GLY A CA   2  
ATOM   648   C  C    . GLY A 1 1  ? 3.685   -21.262 -11.037 1.00 0.00 ? 1   GLY A C    2  
ATOM   649   O  O    . GLY A 1 1  ? 2.525   -21.386 -11.431 1.00 0.00 ? 1   GLY A O    2  
ATOM   650   H  H1   . GLY A 1 1  ? 4.696   -19.707 -13.210 1.00 0.00 ? 1   GLY A H1   2  
ATOM   651   H  HA2  . GLY A 1 1  ? 4.552   -22.102 -12.788 1.00 0.00 ? 1   GLY A HA2  2  
ATOM   652   H  HA3  . GLY A 1 1  ? 5.678   -21.871 -11.459 1.00 0.00 ? 1   GLY A HA3  2  
ATOM   653   N  N    . SER A 1 2  ? 3.995   -20.976 -9.777  1.00 0.00 ? 2   SER A N    2  
ATOM   654   C  CA   . SER A 1 2  ? 2.966   -20.793 -8.759  1.00 0.00 ? 2   SER A CA   2  
ATOM   655   C  C    . SER A 1 2  ? 2.232   -19.471 -8.961  1.00 0.00 ? 2   SER A C    2  
ATOM   656   O  O    . SER A 1 2  ? 2.531   -18.475 -8.303  1.00 0.00 ? 2   SER A O    2  
ATOM   657   C  CB   . SER A 1 2  ? 3.587   -20.836 -7.362  1.00 0.00 ? 2   SER A CB   2  
ATOM   658   O  OG   . SER A 1 2  ? 3.778   -22.172 -6.929  1.00 0.00 ? 2   SER A OG   2  
ATOM   659   H  H    . SER A 1 2  ? 4.938   -20.890 -9.524  1.00 0.00 ? 2   SER A H    2  
ATOM   660   H  HA   . SER A 1 2  ? 2.258   -21.603 -8.854  1.00 0.00 ? 2   SER A HA   2  
ATOM   661   H  HB2  . SER A 1 2  ? 4.544   -20.337 -7.381  1.00 0.00 ? 2   SER A HB2  2  
ATOM   662   H  HB3  . SER A 1 2  ? 2.933   -20.334 -6.664  1.00 0.00 ? 2   SER A HB3  2  
ATOM   663   H  HG   . SER A 1 2  ? 3.256   -22.763 -7.477  1.00 0.00 ? 2   SER A HG   2  
ATOM   664   N  N    . SER A 1 3  ? 1.268   -19.470 -9.877  1.00 0.00 ? 3   SER A N    2  
ATOM   665   C  CA   . SER A 1 3  ? 0.493   -18.271 -10.170 1.00 0.00 ? 3   SER A CA   2  
ATOM   666   C  C    . SER A 1 3  ? -0.741  -18.190 -9.276  1.00 0.00 ? 3   SER A C    2  
ATOM   667   O  O    . SER A 1 3  ? -1.822  -18.643 -9.648  1.00 0.00 ? 3   SER A O    2  
ATOM   668   C  CB   . SER A 1 3  ? 0.072   -18.256 -11.641 1.00 0.00 ? 3   SER A CB   2  
ATOM   669   O  OG   . SER A 1 3  ? -0.841  -19.303 -11.921 1.00 0.00 ? 3   SER A OG   2  
ATOM   670   H  H    . SER A 1 3  ? 1.077   -20.296 -10.370 1.00 0.00 ? 3   SER A H    2  
ATOM   671   H  HA   . SER A 1 3  ? 1.121   -17.414 -9.976  1.00 0.00 ? 3   SER A HA   2  
ATOM   672   H  HB2  . SER A 1 3  ? -0.400  -17.313 -11.868 1.00 0.00 ? 3   SER A HB2  2  
ATOM   673   H  HB3  . SER A 1 3  ? 0.946   -18.381 -12.264 1.00 0.00 ? 3   SER A HB3  2  
ATOM   674   H  HG   . SER A 1 3  ? -0.469  -20.139 -11.630 1.00 0.00 ? 3   SER A HG   2  
ATOM   675   N  N    . GLY A 1 4  ? -0.569  -17.608 -8.093  1.00 0.00 ? 4   GLY A N    2  
ATOM   676   C  CA   . GLY A 1 4  ? -1.675  -17.477 -7.163  1.00 0.00 ? 4   GLY A CA   2  
ATOM   677   C  C    . GLY A 1 4  ? -2.345  -16.120 -7.245  1.00 0.00 ? 4   GLY A C    2  
ATOM   678   O  O    . GLY A 1 4  ? -2.676  -15.520 -6.222  1.00 0.00 ? 4   GLY A O    2  
ATOM   679   H  H    . GLY A 1 4  ? 0.316   -17.264 -7.849  1.00 0.00 ? 4   GLY A H    2  
ATOM   680   H  HA2  . GLY A 1 4  ? -2.406  -18.242 -7.380  1.00 0.00 ? 4   GLY A HA2  2  
ATOM   681   H  HA3  . GLY A 1 4  ? -1.305  -17.622 -6.158  1.00 0.00 ? 4   GLY A HA3  2  
ATOM   682   N  N    . SER A 1 5  ? -2.544  -15.633 -8.466  1.00 0.00 ? 5   SER A N    2  
ATOM   683   C  CA   . SER A 1 5  ? -3.173  -14.335 -8.678  1.00 0.00 ? 5   SER A CA   2  
ATOM   684   C  C    . SER A 1 5  ? -4.667  -14.399 -8.374  1.00 0.00 ? 5   SER A C    2  
ATOM   685   O  O    . SER A 1 5  ? -5.491  -14.524 -9.280  1.00 0.00 ? 5   SER A O    2  
ATOM   686   C  CB   . SER A 1 5  ? -2.954  -13.867 -10.118 1.00 0.00 ? 5   SER A CB   2  
ATOM   687   O  OG   . SER A 1 5  ? -3.153  -12.469 -10.236 1.00 0.00 ? 5   SER A OG   2  
ATOM   688   H  H    . SER A 1 5  ? -2.257  -16.158 -9.242  1.00 0.00 ? 5   SER A H    2  
ATOM   689   H  HA   . SER A 1 5  ? -2.711  -13.628 -8.005  1.00 0.00 ? 5   SER A HA   2  
ATOM   690   H  HB2  . SER A 1 5  ? -1.944  -14.101 -10.420 1.00 0.00 ? 5   SER A HB2  2  
ATOM   691   H  HB3  . SER A 1 5  ? -3.651  -14.375 -10.769 1.00 0.00 ? 5   SER A HB3  2  
ATOM   692   H  HG   . SER A 1 5  ? -3.739  -12.169 -9.537  1.00 0.00 ? 5   SER A HG   2  
ATOM   693   N  N    . SER A 1 6  ? -5.008  -14.313 -7.092  1.00 0.00 ? 6   SER A N    2  
ATOM   694   C  CA   . SER A 1 6  ? -6.402  -14.365 -6.667  1.00 0.00 ? 6   SER A CA   2  
ATOM   695   C  C    . SER A 1 6  ? -6.590  -13.650 -5.333  1.00 0.00 ? 6   SER A C    2  
ATOM   696   O  O    . SER A 1 6  ? -5.645  -13.496 -4.560  1.00 0.00 ? 6   SER A O    2  
ATOM   697   C  CB   . SER A 1 6  ? -6.867  -15.818 -6.550  1.00 0.00 ? 6   SER A CB   2  
ATOM   698   O  OG   . SER A 1 6  ? -8.262  -15.889 -6.309  1.00 0.00 ? 6   SER A OG   2  
ATOM   699   H  H    . SER A 1 6  ? -4.305  -14.214 -6.417  1.00 0.00 ? 6   SER A H    2  
ATOM   700   H  HA   . SER A 1 6  ? -6.996  -13.865 -7.417  1.00 0.00 ? 6   SER A HA   2  
ATOM   701   H  HB2  . SER A 1 6  ? -6.646  -16.339 -7.468  1.00 0.00 ? 6   SER A HB2  2  
ATOM   702   H  HB3  . SER A 1 6  ? -6.347  -16.294 -5.731  1.00 0.00 ? 6   SER A HB3  2  
ATOM   703   H  HG   . SER A 1 6  ? -8.697  -15.139 -6.723  1.00 0.00 ? 6   SER A HG   2  
ATOM   704   N  N    . GLY A 1 7  ? -7.818  -13.214 -5.070  1.00 0.00 ? 7   GLY A N    2  
ATOM   705   C  CA   . GLY A 1 7  ? -8.109  -12.520 -3.829  1.00 0.00 ? 7   GLY A CA   2  
ATOM   706   C  C    . GLY A 1 7  ? -8.331  -13.472 -2.670  1.00 0.00 ? 7   GLY A C    2  
ATOM   707   O  O    . GLY A 1 7  ? -9.271  -13.306 -1.891  1.00 0.00 ? 7   GLY A O    2  
ATOM   708   H  H    . GLY A 1 7  ? -8.533  -13.365 -5.724  1.00 0.00 ? 7   GLY A H    2  
ATOM   709   H  HA2  . GLY A 1 7  ? -7.283  -11.867 -3.592  1.00 0.00 ? 7   GLY A HA2  2  
ATOM   710   H  HA3  . GLY A 1 7  ? -8.999  -11.923 -3.965  1.00 0.00 ? 7   GLY A HA3  2  
ATOM   711   N  N    . THR A 1 8  ? -7.465  -14.474 -2.555  1.00 0.00 ? 8   THR A N    2  
ATOM   712   C  CA   . THR A 1 8  ? -7.572  -15.457 -1.486  1.00 0.00 ? 8   THR A CA   2  
ATOM   713   C  C    . THR A 1 8  ? -7.378  -14.808 -0.120  1.00 0.00 ? 8   THR A C    2  
ATOM   714   O  O    . THR A 1 8  ? -7.913  -15.277 0.883   1.00 0.00 ? 8   THR A O    2  
ATOM   715   C  CB   . THR A 1 8  ? -6.538  -16.587 -1.656  1.00 0.00 ? 8   THR A CB   2  
ATOM   716   O  OG1  . THR A 1 8  ? -6.623  -17.133 -2.976  1.00 0.00 ? 8   THR A OG1  2  
ATOM   717   C  CG2  . THR A 1 8  ? -6.766  -17.687 -0.630  1.00 0.00 ? 8   THR A CG2  2  
ATOM   718   H  H    . THR A 1 8  ? -6.737  -14.552 -3.207  1.00 0.00 ? 8   THR A H    2  
ATOM   719   H  HA   . THR A 1 8  ? -8.560  -15.892 -1.530  1.00 0.00 ? 8   THR A HA   2  
ATOM   720   H  HB   . THR A 1 8  ? -5.550  -16.175 -1.507  1.00 0.00 ? 8   THR A HB   2  
ATOM   721   H  HG1  . THR A 1 8  ? -7.506  -16.992 -3.325  1.00 0.00 ? 8   THR A HG1  2  
ATOM   722   H  HG21 . THR A 1 8  ? -7.724  -17.542 -0.154  1.00 0.00 ? 8   THR A HG21 2  
ATOM   723   H  HG22 . THR A 1 8  ? -5.985  -17.653 0.114   1.00 0.00 ? 8   THR A HG22 2  
ATOM   724   H  HG23 . THR A 1 8  ? -6.751  -18.648 -1.124  1.00 0.00 ? 8   THR A HG23 2  
ATOM   725   N  N    . GLY A 1 9  ? -6.608  -13.724 -0.089  1.00 0.00 ? 9   GLY A N    2  
ATOM   726   C  CA   . GLY A 1 9  ? -6.358  -13.027 1.159   1.00 0.00 ? 9   GLY A CA   2  
ATOM   727   C  C    . GLY A 1 9  ? -7.568  -12.254 1.644   1.00 0.00 ? 9   GLY A C    2  
ATOM   728   O  O    . GLY A 1 9  ? -7.761  -12.083 2.847   1.00 0.00 ? 9   GLY A O    2  
ATOM   729   H  H    . GLY A 1 9  ? -6.207  -13.395 -0.921  1.00 0.00 ? 9   GLY A H    2  
ATOM   730   H  HA2  . GLY A 1 9  ? -6.079  -13.750 1.912   1.00 0.00 ? 9   GLY A HA2  2  
ATOM   731   H  HA3  . GLY A 1 9  ? -5.539  -12.338 1.015   1.00 0.00 ? 9   GLY A HA3  2  
ATOM   732   N  N    . GLU A 1 10 ? -8.383  -11.784 0.705   1.00 0.00 ? 10  GLU A N    2  
ATOM   733   C  CA   . GLU A 1 10 ? -9.579  -11.022 1.045   1.00 0.00 ? 10  GLU A CA   2  
ATOM   734   C  C    . GLU A 1 10 ? -9.217  -9.760  1.824   1.00 0.00 ? 10  GLU A C    2  
ATOM   735   O  O    . GLU A 1 10 ? -9.844  -9.441  2.833   1.00 0.00 ? 10  GLU A O    2  
ATOM   736   C  CB   . GLU A 1 10 ? -10.543 -11.882 1.864   1.00 0.00 ? 10  GLU A CB   2  
ATOM   737   C  CG   . GLU A 1 10 ? -11.183 -13.006 1.068   1.00 0.00 ? 10  GLU A CG   2  
ATOM   738   C  CD   . GLU A 1 10 ? -11.989 -13.952 1.937   1.00 0.00 ? 10  GLU A CD   2  
ATOM   739   O  OE1  . GLU A 1 10 ? -12.674 -13.468 2.863   1.00 0.00 ? 10  GLU A OE1  2  
ATOM   740   O  OE2  . GLU A 1 10 ? -11.934 -15.175 1.693   1.00 0.00 ? 10  GLU A OE2  2  
ATOM   741   H  H    . GLU A 1 10 ? -8.175  -11.953 -0.237  1.00 0.00 ? 10  GLU A H    2  
ATOM   742   H  HA   . GLU A 1 10 ? -10.062 -10.735 0.123   1.00 0.00 ? 10  GLU A HA   2  
ATOM   743   H  HB2  . GLU A 1 10 ? -10.004 -12.316 2.693   1.00 0.00 ? 10  GLU A HB2  2  
ATOM   744   H  HB3  . GLU A 1 10 ? -11.330 -11.250 2.251   1.00 0.00 ? 10  GLU A HB3  2  
ATOM   745   H  HG2  . GLU A 1 10 ? -11.839 -12.577 0.326   1.00 0.00 ? 10  GLU A HG2  2  
ATOM   746   H  HG3  . GLU A 1 10 ? -10.404 -13.569 0.575   1.00 0.00 ? 10  GLU A HG3  2  
ATOM   747   N  N    . ASN A 1 11 ? -8.202  -9.048  1.347   1.00 0.00 ? 11  ASN A N    2  
ATOM   748   C  CA   . ASN A 1 11 ? -7.755  -7.822  1.998   1.00 0.00 ? 11  ASN A CA   2  
ATOM   749   C  C    . ASN A 1 11 ? -8.176  -6.595  1.196   1.00 0.00 ? 11  ASN A C    2  
ATOM   750   O  O    . ASN A 1 11 ? -8.191  -6.602  -0.036  1.00 0.00 ? 11  ASN A O    2  
ATOM   751   C  CB   . ASN A 1 11 ? -6.235  -7.836  2.171   1.00 0.00 ? 11  ASN A CB   2  
ATOM   752   C  CG   . ASN A 1 11 ? -5.503  -7.654  0.855   1.00 0.00 ? 11  ASN A CG   2  
ATOM   753   O  OD1  . ASN A 1 11 ? -5.084  -8.625  0.225   1.00 0.00 ? 11  ASN A OD1  2  
ATOM   754   N  ND2  . ASN A 1 11 ? -5.344  -6.404  0.435   1.00 0.00 ? 11  ASN A ND2  2  
ATOM   755   H  H    . ASN A 1 11 ? -7.742  -9.354  0.537   1.00 0.00 ? 11  ASN A H    2  
ATOM   756   H  HA   . ASN A 1 11 ? -8.219  -7.777  2.972   1.00 0.00 ? 11  ASN A HA   2  
ATOM   757   H  HB2  . ASN A 1 11 ? -5.947  -7.034  2.835   1.00 0.00 ? 11  ASN A HB2  2  
ATOM   758   H  HB3  . ASN A 1 11 ? -5.936  -8.779  2.601   1.00 0.00 ? 11  ASN A HB3  2  
ATOM   759   H  HD21 . ASN A 1 11 ? -5.704  -5.680  0.988   1.00 0.00 ? 11  ASN A HD21 2  
ATOM   760   H  HD22 . ASN A 1 11 ? -4.875  -6.257  -0.413  1.00 0.00 ? 11  ASN A HD22 2  
ATOM   761   N  N    . PRO A 1 12 ? -8.527  -5.513  1.908   1.00 0.00 ? 12  PRO A N    2  
ATOM   762   C  CA   . PRO A 1 12 ? -8.953  -4.258  1.282   1.00 0.00 ? 12  PRO A CA   2  
ATOM   763   C  C    . PRO A 1 12 ? -7.806  -3.543  0.577   1.00 0.00 ? 12  PRO A C    2  
ATOM   764   O  O    . PRO A 1 12 ? -7.924  -3.156  -0.586  1.00 0.00 ? 12  PRO A O    2  
ATOM   765   C  CB   . PRO A 1 12 ? -9.456  -3.426  2.465   1.00 0.00 ? 12  PRO A CB   2  
ATOM   766   C  CG   . PRO A 1 12 ? -8.726  -3.966  3.646   1.00 0.00 ? 12  PRO A CG   2  
ATOM   767   C  CD   . PRO A 1 12 ? -8.533  -5.433  3.378   1.00 0.00 ? 12  PRO A CD   2  
ATOM   768   H  HA   . PRO A 1 12 ? -9.761  -4.417  0.583   1.00 0.00 ? 12  PRO A HA   2  
ATOM   769   H  HB2  . PRO A 1 12 ? -9.224  -2.383  2.299   1.00 0.00 ? 12  PRO A HB2  2  
ATOM   770   H  HB3  . PRO A 1 12 ? -10.523 -3.551  2.570   1.00 0.00 ? 12  PRO A HB3  2  
ATOM   771   H  HG2  . PRO A 1 12 ? -7.770  -3.474  3.744   1.00 0.00 ? 12  PRO A HG2  2  
ATOM   772   H  HG3  . PRO A 1 12 ? -9.316  -3.823  4.539   1.00 0.00 ? 12  PRO A HG3  2  
ATOM   773   H  HD2  . PRO A 1 12 ? -7.593  -5.771  3.787   1.00 0.00 ? 12  PRO A HD2  2  
ATOM   774   H  HD3  . PRO A 1 12 ? -9.353  -6.003  3.791   1.00 0.00 ? 12  PRO A HD3  2  
ATOM   775   N  N    . PHE A 1 13 ? -6.697  -3.369  1.288   1.00 0.00 ? 13  PHE A N    2  
ATOM   776   C  CA   . PHE A 1 13 ? -5.528  -2.700  0.730   1.00 0.00 ? 13  PHE A CA   2  
ATOM   777   C  C    . PHE A 1 13 ? -4.274  -3.033  1.534   1.00 0.00 ? 13  PHE A C    2  
ATOM   778   O  O    . PHE A 1 13 ? -4.336  -3.224  2.749   1.00 0.00 ? 13  PHE A O    2  
ATOM   779   C  CB   . PHE A 1 13 ? -5.744  -1.185  0.706   1.00 0.00 ? 13  PHE A CB   2  
ATOM   780   C  CG   . PHE A 1 13 ? -7.142  -0.785  0.328   1.00 0.00 ? 13  PHE A CG   2  
ATOM   781   C  CD1  . PHE A 1 13 ? -7.509  -0.676  -1.004  1.00 0.00 ? 13  PHE A CD1  2  
ATOM   782   C  CD2  . PHE A 1 13 ? -8.089  -0.520  1.303   1.00 0.00 ? 13  PHE A CD2  2  
ATOM   783   C  CE1  . PHE A 1 13 ? -8.794  -0.307  -1.355  1.00 0.00 ? 13  PHE A CE1  2  
ATOM   784   C  CE2  . PHE A 1 13 ? -9.375  -0.151  0.959   1.00 0.00 ? 13  PHE A CE2  2  
ATOM   785   C  CZ   . PHE A 1 13 ? -9.729  -0.046  -0.372  1.00 0.00 ? 13  PHE A CZ   2  
ATOM   786   H  H    . PHE A 1 13 ? -6.664  -3.700  2.211   1.00 0.00 ? 13  PHE A H    2  
ATOM   787   H  HA   . PHE A 1 13 ? -5.396  -3.052  -0.282  1.00 0.00 ? 13  PHE A HA   2  
ATOM   788   H  HB2  . PHE A 1 13 ? -5.539  -0.784  1.687   1.00 0.00 ? 13  PHE A HB2  2  
ATOM   789   H  HB3  . PHE A 1 13 ? -5.066  -0.743  -0.009  1.00 0.00 ? 13  PHE A HB3  2  
ATOM   790   H  HD1  . PHE A 1 13 ? -6.779  -0.881  -1.774  1.00 0.00 ? 13  PHE A HD1  2  
ATOM   791   H  HD2  . PHE A 1 13 ? -7.813  -0.602  2.346   1.00 0.00 ? 13  PHE A HD2  2  
ATOM   792   H  HE1  . PHE A 1 13 ? -9.067  -0.226  -2.396  1.00 0.00 ? 13  PHE A HE1  2  
ATOM   793   H  HE2  . PHE A 1 13 ? -10.104 0.053   1.730   1.00 0.00 ? 13  PHE A HE2  2  
ATOM   794   H  HZ   . PHE A 1 13 ? -10.733 0.243   -0.644  1.00 0.00 ? 13  PHE A HZ   2  
ATOM   795   N  N    . ILE A 1 14 ? -3.139  -3.102  0.847   1.00 0.00 ? 14  ILE A N    2  
ATOM   796   C  CA   . ILE A 1 14 ? -1.871  -3.411  1.496   1.00 0.00 ? 14  ILE A CA   2  
ATOM   797   C  C    . ILE A 1 14 ? -0.764  -2.481  1.012   1.00 0.00 ? 14  ILE A C    2  
ATOM   798   O  O    . ILE A 1 14 ? -0.582  -2.287  -0.190  1.00 0.00 ? 14  ILE A O    2  
ATOM   799   C  CB   . ILE A 1 14 ? -1.449  -4.870  1.240   1.00 0.00 ? 14  ILE A CB   2  
ATOM   800   C  CG1  . ILE A 1 14 ? -2.490  -5.833  1.814   1.00 0.00 ? 14  ILE A CG1  2  
ATOM   801   C  CG2  . ILE A 1 14 ? -0.079  -5.139  1.845   1.00 0.00 ? 14  ILE A CG2  2  
ATOM   802   C  CD1  . ILE A 1 14 ? -2.243  -7.279  1.445   1.00 0.00 ? 14  ILE A CD1  2  
ATOM   803   H  H    . ILE A 1 14 ? -3.154  -2.939  -0.119  1.00 0.00 ? 14  ILE A H    2  
ATOM   804   H  HA   . ILE A 1 14 ? -2.001  -3.276  2.560   1.00 0.00 ? 14  ILE A HA   2  
ATOM   805   H  HB   . ILE A 1 14 ? -1.380  -5.019  0.173   1.00 0.00 ? 14  ILE A HB   2  
ATOM   806   H  HG12 . ILE A 1 14 ? -2.483  -5.761  2.890   1.00 0.00 ? 14  ILE A HG12 2  
ATOM   807   H  HG13 . ILE A 1 14 ? -3.467  -5.558  1.444   1.00 0.00 ? 14  ILE A HG13 2  
ATOM   808   H  HG21 . ILE A 1 14 ? 0.577   -4.308  1.632   1.00 0.00 ? 14  ILE A HG21 2  
ATOM   809   H  HG22 . ILE A 1 14 ? -0.175  -5.256  2.914   1.00 0.00 ? 14  ILE A HG22 2  
ATOM   810   H  HG23 . ILE A 1 14 ? 0.332   -6.041  1.419   1.00 0.00 ? 14  ILE A HG23 2  
ATOM   811   H  HD11 . ILE A 1 14 ? -1.443  -7.334  0.721   1.00 0.00 ? 14  ILE A HD11 2  
ATOM   812   H  HD12 . ILE A 1 14 ? -1.966  -7.835  2.328   1.00 0.00 ? 14  ILE A HD12 2  
ATOM   813   H  HD13 . ILE A 1 14 ? -3.141  -7.701  1.020   1.00 0.00 ? 14  ILE A HD13 2  
ATOM   814   N  N    . CYS A 1 15 ? -0.025  -1.908  1.957   1.00 0.00 ? 15  CYS A N    2  
ATOM   815   C  CA   . CYS A 1 15 ? 1.066   -0.999  1.628   1.00 0.00 ? 15  CYS A CA   2  
ATOM   816   C  C    . CYS A 1 15 ? 2.102   -1.689  0.745   1.00 0.00 ? 15  CYS A C    2  
ATOM   817   O  O    . CYS A 1 15 ? 2.585   -2.773  1.070   1.00 0.00 ? 15  CYS A O    2  
ATOM   818   C  CB   . CYS A 1 15 ? 1.731   -0.484  2.906   1.00 0.00 ? 15  CYS A CB   2  
ATOM   819   S  SG   . CYS A 1 15 ? 2.909   0.879   2.635   1.00 0.00 ? 15  CYS A SG   2  
ATOM   820   H  H    . CYS A 1 15 ? -0.219  -2.102  2.899   1.00 0.00 ? 15  CYS A H    2  
ATOM   821   H  HA   . CYS A 1 15 ? 0.650   -0.163  1.087   1.00 0.00 ? 15  CYS A HA   2  
ATOM   822   H  HB2  . CYS A 1 15 ? 0.966   -0.127  3.581   1.00 0.00 ? 15  CYS A HB2  2  
ATOM   823   H  HB3  . CYS A 1 15 ? 2.267   -1.295  3.376   1.00 0.00 ? 15  CYS A HB3  2  
ATOM   824   N  N    . SER A 1 16 ? 2.438   -1.051  -0.371  1.00 0.00 ? 16  SER A N    2  
ATOM   825   C  CA   . SER A 1 16 ? 3.414   -1.605  -1.303  1.00 0.00 ? 16  SER A CA   2  
ATOM   826   C  C    . SER A 1 16 ? 4.835   -1.245  -0.879  1.00 0.00 ? 16  SER A C    2  
ATOM   827   O  O    . SER A 1 16 ? 5.733   -1.133  -1.713  1.00 0.00 ? 16  SER A O    2  
ATOM   828   C  CB   . SER A 1 16 ? 3.147   -1.091  -2.719  1.00 0.00 ? 16  SER A CB   2  
ATOM   829   O  OG   . SER A 1 16 ? 3.869   -1.843  -3.679  1.00 0.00 ? 16  SER A OG   2  
ATOM   830   H  H    . SER A 1 16 ? 2.018   -0.190  -0.575  1.00 0.00 ? 16  SER A H    2  
ATOM   831   H  HA   . SER A 1 16 ? 3.309   -2.679  -1.294  1.00 0.00 ? 16  SER A HA   2  
ATOM   832   H  HB2  . SER A 1 16 ? 2.093   -1.171  -2.936  1.00 0.00 ? 16  SER A HB2  2  
ATOM   833   H  HB3  . SER A 1 16 ? 3.451   -0.056  -2.787  1.00 0.00 ? 16  SER A HB3  2  
ATOM   834   H  HG   . SER A 1 16 ? 3.989   -2.740  -3.359  1.00 0.00 ? 16  SER A HG   2  
ATOM   835   N  N    . GLU A 1 17 ? 5.029   -1.067  0.424   1.00 0.00 ? 17  GLU A N    2  
ATOM   836   C  CA   . GLU A 1 17 ? 6.340   -0.719  0.959   1.00 0.00 ? 17  GLU A CA   2  
ATOM   837   C  C    . GLU A 1 17 ? 6.724   -1.650  2.106   1.00 0.00 ? 17  GLU A C    2  
ATOM   838   O  O    . GLU A 1 17 ? 7.816   -2.218  2.121   1.00 0.00 ? 17  GLU A O    2  
ATOM   839   C  CB   . GLU A 1 17 ? 6.350   0.733   1.441   1.00 0.00 ? 17  GLU A CB   2  
ATOM   840   C  CG   . GLU A 1 17 ? 6.363   1.749   0.312   1.00 0.00 ? 17  GLU A CG   2  
ATOM   841   C  CD   . GLU A 1 17 ? 7.668   1.748   -0.460  1.00 0.00 ? 17  GLU A CD   2  
ATOM   842   O  OE1  . GLU A 1 17 ? 7.865   0.835   -1.290  1.00 0.00 ? 17  GLU A OE1  2  
ATOM   843   O  OE2  . GLU A 1 17 ? 8.492   2.658   -0.235  1.00 0.00 ? 17  GLU A OE2  2  
ATOM   844   H  H    . GLU A 1 17 ? 4.273   -1.170  1.039   1.00 0.00 ? 17  GLU A H    2  
ATOM   845   H  HA   . GLU A 1 17 ? 7.063   -0.830  0.165   1.00 0.00 ? 17  GLU A HA   2  
ATOM   846   H  HB2  . GLU A 1 17 ? 5.471   0.906   2.044   1.00 0.00 ? 17  GLU A HB2  2  
ATOM   847   H  HB3  . GLU A 1 17 ? 7.229   0.892   2.049   1.00 0.00 ? 17  GLU A HB3  2  
ATOM   848   H  HG2  . GLU A 1 17 ? 5.559   1.520   -0.371  1.00 0.00 ? 17  GLU A HG2  2  
ATOM   849   H  HG3  . GLU A 1 17 ? 6.209   2.734   0.729   1.00 0.00 ? 17  GLU A HG3  2  
ATOM   850   N  N    . CYS A 1 18 ? 5.818   -1.800  3.067   1.00 0.00 ? 18  CYS A N    2  
ATOM   851   C  CA   . CYS A 1 18 ? 6.059   -2.660  4.219   1.00 0.00 ? 18  CYS A CA   2  
ATOM   852   C  C    . CYS A 1 18 ? 5.123   -3.865  4.204   1.00 0.00 ? 18  CYS A C    2  
ATOM   853   O  O    . CYS A 1 18 ? 5.561   -5.006  4.340   1.00 0.00 ? 18  CYS A O    2  
ATOM   854   C  CB   . CYS A 1 18 ? 5.874   -1.872  5.517   1.00 0.00 ? 18  CYS A CB   2  
ATOM   855   S  SG   . CYS A 1 18 ? 4.287   -0.984  5.628   1.00 0.00 ? 18  CYS A SG   2  
ATOM   856   H  H    . CYS A 1 18 ? 4.965   -1.320  2.999   1.00 0.00 ? 18  CYS A H    2  
ATOM   857   H  HA   . CYS A 1 18 ? 7.078   -3.011  4.163   1.00 0.00 ? 18  CYS A HA   2  
ATOM   858   H  HB2  . CYS A 1 18 ? 5.927   -2.554  6.354   1.00 0.00 ? 18  CYS A HB2  2  
ATOM   859   H  HB3  . CYS A 1 18 ? 6.666   -1.143  5.603   1.00 0.00 ? 18  CYS A HB3  2  
ATOM   860   N  N    . GLY A 1 19 ? 3.830   -3.601  4.038   1.00 0.00 ? 19  GLY A N    2  
ATOM   861   C  CA   . GLY A 1 19 ? 2.852   -4.673  4.008   1.00 0.00 ? 19  GLY A CA   2  
ATOM   862   C  C    . GLY A 1 19 ? 1.821   -4.547  5.112   1.00 0.00 ? 19  GLY A C    2  
ATOM   863   O  O    . GLY A 1 19 ? 1.483   -5.530  5.772   1.00 0.00 ? 19  GLY A O    2  
ATOM   864   H  H    . GLY A 1 19 ? 3.538   -2.671  3.935   1.00 0.00 ? 19  GLY A H    2  
ATOM   865   H  HA2  . GLY A 1 19 ? 2.348   -4.659  3.054   1.00 0.00 ? 19  GLY A HA2  2  
ATOM   866   H  HA3  . GLY A 1 19 ? 3.366   -5.617  4.118   1.00 0.00 ? 19  GLY A HA3  2  
ATOM   867   N  N    . LYS A 1 20 ? 1.318   -3.334  5.314   1.00 0.00 ? 20  LYS A N    2  
ATOM   868   C  CA   . LYS A 1 20 ? 0.319   -3.081  6.345   1.00 0.00 ? 20  LYS A CA   2  
ATOM   869   C  C    . LYS A 1 20 ? -1.065  -2.901  5.729   1.00 0.00 ? 20  LYS A C    2  
ATOM   870   O  O    . LYS A 1 20 ? -1.210  -2.286  4.673   1.00 0.00 ? 20  LYS A O    2  
ATOM   871   C  CB   . LYS A 1 20 ? 0.694   -1.838  7.154   1.00 0.00 ? 20  LYS A CB   2  
ATOM   872   C  CG   . LYS A 1 20 ? 0.072   -1.802  8.539   1.00 0.00 ? 20  LYS A CG   2  
ATOM   873   C  CD   . LYS A 1 20 ? 0.252   -0.445  9.198   1.00 0.00 ? 20  LYS A CD   2  
ATOM   874   C  CE   . LYS A 1 20 ? -0.581  -0.324  10.464  1.00 0.00 ? 20  LYS A CE   2  
ATOM   875   N  NZ   . LYS A 1 20 ? -0.072  -1.208  11.550  1.00 0.00 ? 20  LYS A NZ   2  
ATOM   876   H  H    . LYS A 1 20 ? 1.627   -2.589  4.755   1.00 0.00 ? 20  LYS A H    2  
ATOM   877   H  HA   . LYS A 1 20 ? 0.298   -3.936  7.004   1.00 0.00 ? 20  LYS A HA   2  
ATOM   878   H  HB2  . LYS A 1 20 ? 1.768   -1.805  7.264   1.00 0.00 ? 20  LYS A HB2  2  
ATOM   879   H  HB3  . LYS A 1 20 ? 0.369   -0.960  6.614   1.00 0.00 ? 20  LYS A HB3  2  
ATOM   880   H  HG2  . LYS A 1 20 ? -0.984  -2.012  8.455   1.00 0.00 ? 20  LYS A HG2  2  
ATOM   881   H  HG3  . LYS A 1 20 ? 0.542   -2.556  9.155   1.00 0.00 ? 20  LYS A HG3  2  
ATOM   882   H  HD2  . LYS A 1 20 ? 1.294   -0.313  9.452   1.00 0.00 ? 20  LYS A HD2  2  
ATOM   883   H  HD3  . LYS A 1 20 ? -0.050  0.326   8.503   1.00 0.00 ? 20  LYS A HD3  2  
ATOM   884   H  HE2  . LYS A 1 20 ? -0.552  0.700   10.802  1.00 0.00 ? 20  LYS A HE2  2  
ATOM   885   H  HE3  . LYS A 1 20 ? -1.600  -0.599  10.236  1.00 0.00 ? 20  LYS A HE3  2  
ATOM   886   H  HZ1  . LYS A 1 20 ? 0.933   -1.010  11.730  1.00 0.00 ? 20  LYS A HZ1  2  
ATOM   887   H  HZ2  . LYS A 1 20 ? -0.175  -2.206  11.275  1.00 0.00 ? 20  LYS A HZ2  2  
ATOM   888   H  HZ3  . LYS A 1 20 ? -0.609  -1.044  12.425  1.00 0.00 ? 20  LYS A HZ3  2  
ATOM   889   N  N    . VAL A 1 21 ? -2.080  -3.441  6.397   1.00 0.00 ? 21  VAL A N    2  
ATOM   890   C  CA   . VAL A 1 21 ? -3.452  -3.338  5.916   1.00 0.00 ? 21  VAL A CA   2  
ATOM   891   C  C    . VAL A 1 21 ? -4.152  -2.119  6.508   1.00 0.00 ? 21  VAL A C    2  
ATOM   892   O  O    . VAL A 1 21 ? -3.986  -1.807  7.688   1.00 0.00 ? 21  VAL A O    2  
ATOM   893   C  CB   . VAL A 1 21 ? -4.264  -4.600  6.262   1.00 0.00 ? 21  VAL A CB   2  
ATOM   894   C  CG1  . VAL A 1 21 ? -5.701  -4.458  5.784   1.00 0.00 ? 21  VAL A CG1  2  
ATOM   895   C  CG2  . VAL A 1 21 ? -3.612  -5.835  5.657   1.00 0.00 ? 21  VAL A CG2  2  
ATOM   896   H  H    . VAL A 1 21 ? -1.901  -3.920  7.233   1.00 0.00 ? 21  VAL A H    2  
ATOM   897   H  HA   . VAL A 1 21 ? -3.423  -3.237  4.841   1.00 0.00 ? 21  VAL A HA   2  
ATOM   898   H  HB   . VAL A 1 21 ? -4.275  -4.714  7.336   1.00 0.00 ? 21  VAL A HB   2  
ATOM   899   H  HG11 . VAL A 1 21 ? -6.112  -5.437  5.584   1.00 0.00 ? 21  VAL A HG11 2  
ATOM   900   H  HG12 . VAL A 1 21 ? -6.288  -3.969  6.547   1.00 0.00 ? 21  VAL A HG12 2  
ATOM   901   H  HG13 . VAL A 1 21 ? -5.723  -3.868  4.879   1.00 0.00 ? 21  VAL A HG13 2  
ATOM   902   H  HG21 . VAL A 1 21 ? -3.562  -5.727  4.584   1.00 0.00 ? 21  VAL A HG21 2  
ATOM   903   H  HG22 . VAL A 1 21 ? -2.615  -5.946  6.056   1.00 0.00 ? 21  VAL A HG22 2  
ATOM   904   H  HG23 . VAL A 1 21 ? -4.198  -6.709  5.904   1.00 0.00 ? 21  VAL A HG23 2  
ATOM   905   N  N    . PHE A 1 22 ? -4.935  -1.434  5.682   1.00 0.00 ? 22  PHE A N    2  
ATOM   906   C  CA   . PHE A 1 22 ? -5.660  -0.248  6.123   1.00 0.00 ? 22  PHE A CA   2  
ATOM   907   C  C    . PHE A 1 22 ? -7.132  -0.334  5.732   1.00 0.00 ? 22  PHE A C    2  
ATOM   908   O  O    . PHE A 1 22 ? -7.477  -0.872  4.679   1.00 0.00 ? 22  PHE A O    2  
ATOM   909   C  CB   . PHE A 1 22 ? -5.034  1.012   5.522   1.00 0.00 ? 22  PHE A CB   2  
ATOM   910   C  CG   . PHE A 1 22 ? -3.576  1.170   5.847   1.00 0.00 ? 22  PHE A CG   2  
ATOM   911   C  CD1  . PHE A 1 22 ? -2.624  0.375   5.229   1.00 0.00 ? 22  PHE A CD1  2  
ATOM   912   C  CD2  . PHE A 1 22 ? -3.157  2.115   6.770   1.00 0.00 ? 22  PHE A CD2  2  
ATOM   913   C  CE1  . PHE A 1 22 ? -1.282  0.518   5.527   1.00 0.00 ? 22  PHE A CE1  2  
ATOM   914   C  CE2  . PHE A 1 22 ? -1.816  2.263   7.071   1.00 0.00 ? 22  PHE A CE2  2  
ATOM   915   C  CZ   . PHE A 1 22 ? -0.878  1.464   6.448   1.00 0.00 ? 22  PHE A CZ   2  
ATOM   916   H  H    . PHE A 1 22 ? -5.027  -1.733  4.753   1.00 0.00 ? 22  PHE A H    2  
ATOM   917   H  HA   . PHE A 1 22 ? -5.588  -0.198  7.199   1.00 0.00 ? 22  PHE A HA   2  
ATOM   918   H  HB2  . PHE A 1 22 ? -5.132  0.976   4.447   1.00 0.00 ? 22  PHE A HB2  2  
ATOM   919   H  HB3  . PHE A 1 22 ? -5.555  1.879   5.898   1.00 0.00 ? 22  PHE A HB3  2  
ATOM   920   H  HD1  . PHE A 1 22 ? -2.939  -0.365  4.507   1.00 0.00 ? 22  PHE A HD1  2  
ATOM   921   H  HD2  . PHE A 1 22 ? -3.891  2.741   7.258   1.00 0.00 ? 22  PHE A HD2  2  
ATOM   922   H  HE1  . PHE A 1 22 ? -0.550  -0.107  5.038   1.00 0.00 ? 22  PHE A HE1  2  
ATOM   923   H  HE2  . PHE A 1 22 ? -1.503  3.004   7.792   1.00 0.00 ? 22  PHE A HE2  2  
ATOM   924   H  HZ   . PHE A 1 22 ? 0.170   1.578   6.683   1.00 0.00 ? 22  PHE A HZ   2  
ATOM   925   N  N    . THR A 1 23 ? -7.998  0.199   6.589   1.00 0.00 ? 23  THR A N    2  
ATOM   926   C  CA   . THR A 1 23 ? -9.433  0.182   6.335   1.00 0.00 ? 23  THR A CA   2  
ATOM   927   C  C    . THR A 1 23 ? -9.814  1.196   5.263   1.00 0.00 ? 23  THR A C    2  
ATOM   928   O  O    . THR A 1 23 ? -10.602 0.898   4.364   1.00 0.00 ? 23  THR A O    2  
ATOM   929   C  CB   . THR A 1 23 ? -10.234 0.481   7.617   1.00 0.00 ? 23  THR A CB   2  
ATOM   930   O  OG1  . THR A 1 23 ? -9.751  -0.327  8.696   1.00 0.00 ? 23  THR A OG1  2  
ATOM   931   C  CG2  . THR A 1 23 ? -11.717 0.217   7.402   1.00 0.00 ? 23  THR A CG2  2  
ATOM   932   H  H    . THR A 1 23 ? -7.662  0.613   7.411   1.00 0.00 ? 23  THR A H    2  
ATOM   933   H  HA   . THR A 1 23 ? -9.699  -0.808  5.992   1.00 0.00 ? 23  THR A HA   2  
ATOM   934   H  HB   . THR A 1 23 ? -10.101 1.523   7.870   1.00 0.00 ? 23  THR A HB   2  
ATOM   935   H  HG1  . THR A 1 23 ? -9.481  -1.184  8.358   1.00 0.00 ? 23  THR A HG1  2  
ATOM   936   H  HG21 . THR A 1 23 ? -12.273 1.123   7.590   1.00 0.00 ? 23  THR A HG21 2  
ATOM   937   H  HG22 . THR A 1 23 ? -12.047 -0.555  8.081   1.00 0.00 ? 23  THR A HG22 2  
ATOM   938   H  HG23 . THR A 1 23 ? -11.882 -0.103  6.385   1.00 0.00 ? 23  THR A HG23 2  
ATOM   939   N  N    . HIS A 1 24 ? -9.251  2.396   5.363   1.00 0.00 ? 24  HIS A N    2  
ATOM   940   C  CA   . HIS A 1 24 ? -9.531  3.454   4.399   1.00 0.00 ? 24  HIS A CA   2  
ATOM   941   C  C    . HIS A 1 24 ? -8.391  3.591   3.395   1.00 0.00 ? 24  HIS A C    2  
ATOM   942   O  O    . HIS A 1 24 ? -7.217  3.560   3.764   1.00 0.00 ? 24  HIS A O    2  
ATOM   943   C  CB   . HIS A 1 24 ? -9.753  4.784   5.121   1.00 0.00 ? 24  HIS A CB   2  
ATOM   944   C  CG   . HIS A 1 24 ? -10.692 5.705   4.405   1.00 0.00 ? 24  HIS A CG   2  
ATOM   945   N  ND1  . HIS A 1 24 ? -10.269 6.656   3.500   1.00 0.00 ? 24  HIS A ND1  2  
ATOM   946   C  CD2  . HIS A 1 24 ? -12.040 5.816   4.463   1.00 0.00 ? 24  HIS A CD2  2  
ATOM   947   C  CE1  . HIS A 1 24 ? -11.316 7.313   3.033   1.00 0.00 ? 24  HIS A CE1  2  
ATOM   948   N  NE2  . HIS A 1 24 ? -12.403 6.822   3.602   1.00 0.00 ? 24  HIS A NE2  2  
ATOM   949   H  H    . HIS A 1 24 ? -8.632  2.573   6.101   1.00 0.00 ? 24  HIS A H    2  
ATOM   950   H  HA   . HIS A 1 24 ? -10.433 3.189   3.868   1.00 0.00 ? 24  HIS A HA   2  
ATOM   951   H  HB2  . HIS A 1 24 ? -10.163 4.590   6.101   1.00 0.00 ? 24  HIS A HB2  2  
ATOM   952   H  HB3  . HIS A 1 24 ? -8.805  5.291   5.226   1.00 0.00 ? 24  HIS A HB3  2  
ATOM   953   H  HD1  . HIS A 1 24 ? -9.340  6.825   3.239   1.00 0.00 ? 24  HIS A HD1  2  
ATOM   954   H  HD2  . HIS A 1 24 ? -12.707 5.224   5.074   1.00 0.00 ? 24  HIS A HD2  2  
ATOM   955   H  HE1  . HIS A 1 24 ? -11.289 8.114   2.310   1.00 0.00 ? 24  HIS A HE1  2  
ATOM   956   N  N    . LYS A 1 25 ? -8.744  3.742   2.123   1.00 0.00 ? 25  LYS A N    2  
ATOM   957   C  CA   . LYS A 1 25 ? -7.752  3.884   1.064   1.00 0.00 ? 25  LYS A CA   2  
ATOM   958   C  C    . LYS A 1 25 ? -6.849  5.086   1.323   1.00 0.00 ? 25  LYS A C    2  
ATOM   959   O  O    . LYS A 1 25 ? -5.629  5.001   1.181   1.00 0.00 ? 25  LYS A O    2  
ATOM   960   C  CB   . LYS A 1 25 ? -8.442  4.034   -0.293  1.00 0.00 ? 25  LYS A CB   2  
ATOM   961   C  CG   . LYS A 1 25 ? -7.490  3.939   -1.473  1.00 0.00 ? 25  LYS A CG   2  
ATOM   962   C  CD   . LYS A 1 25 ? -7.228  2.493   -1.863  1.00 0.00 ? 25  LYS A CD   2  
ATOM   963   C  CE   . LYS A 1 25 ? -6.759  2.381   -3.305  1.00 0.00 ? 25  LYS A CE   2  
ATOM   964   N  NZ   . LYS A 1 25 ? -5.297  2.632   -3.435  1.00 0.00 ? 25  LYS A NZ   2  
ATOM   965   H  H    . LYS A 1 25 ? -9.697  3.759   1.890   1.00 0.00 ? 25  LYS A H    2  
ATOM   966   H  HA   . LYS A 1 25 ? -7.147  2.990   1.054   1.00 0.00 ? 25  LYS A HA   2  
ATOM   967   H  HB2  . LYS A 1 25 ? -9.186  3.257   -0.393  1.00 0.00 ? 25  LYS A HB2  2  
ATOM   968   H  HB3  . LYS A 1 25 ? -8.932  4.996   -0.330  1.00 0.00 ? 25  LYS A HB3  2  
ATOM   969   H  HG2  . LYS A 1 25 ? -7.924  4.454   -2.317  1.00 0.00 ? 25  LYS A HG2  2  
ATOM   970   H  HG3  . LYS A 1 25 ? -6.553  4.406   -1.207  1.00 0.00 ? 25  LYS A HG3  2  
ATOM   971   H  HD2  . LYS A 1 25 ? -6.465  2.088   -1.216  1.00 0.00 ? 25  LYS A HD2  2  
ATOM   972   H  HD3  . LYS A 1 25 ? -8.141  1.927   -1.745  1.00 0.00 ? 25  LYS A HD3  2  
ATOM   973   H  HE2  . LYS A 1 25 ? -6.978  1.388   -3.665  1.00 0.00 ? 25  LYS A HE2  2  
ATOM   974   H  HE3  . LYS A 1 25 ? -7.295  3.106   -3.901  1.00 0.00 ? 25  LYS A HE3  2  
ATOM   975   H  HZ1  . LYS A 1 25 ? -4.798  2.276   -2.595  1.00 0.00 ? 25  LYS A HZ1  2  
ATOM   976   H  HZ2  . LYS A 1 25 ? -5.117  3.653   -3.526  1.00 0.00 ? 25  LYS A HZ2  2  
ATOM   977   H  HZ3  . LYS A 1 25 ? -4.925  2.150   -4.277  1.00 0.00 ? 25  LYS A HZ3  2  
ATOM   978   N  N    . THR A 1 26 ? -7.456  6.206   1.705   1.00 0.00 ? 26  THR A N    2  
ATOM   979   C  CA   . THR A 1 26 ? -6.707  7.424   1.983   1.00 0.00 ? 26  THR A CA   2  
ATOM   980   C  C    . THR A 1 26 ? -5.715  7.212   3.121   1.00 0.00 ? 26  THR A C    2  
ATOM   981   O  O    . THR A 1 26 ? -4.587  7.700   3.073   1.00 0.00 ? 26  THR A O    2  
ATOM   982   C  CB   . THR A 1 26 ? -7.646  8.590   2.347   1.00 0.00 ? 26  THR A CB   2  
ATOM   983   O  OG1  . THR A 1 26 ? -8.640  8.754   1.329   1.00 0.00 ? 26  THR A OG1  2  
ATOM   984   C  CG2  . THR A 1 26 ? -6.863  9.884   2.511   1.00 0.00 ? 26  THR A CG2  2  
ATOM   985   H  H    . THR A 1 26 ? -8.431  6.210   1.800   1.00 0.00 ? 26  THR A H    2  
ATOM   986   H  HA   . THR A 1 26 ? -6.163  7.693   1.090   1.00 0.00 ? 26  THR A HA   2  
ATOM   987   H  HB   . THR A 1 26 ? -8.135  8.361   3.283   1.00 0.00 ? 26  THR A HB   2  
ATOM   988   H  HG1  . THR A 1 26 ? -9.057  7.907   1.150   1.00 0.00 ? 26  THR A HG1  2  
ATOM   989   H  HG21 . THR A 1 26 ? -5.899  9.668   2.946   1.00 0.00 ? 26  THR A HG21 2  
ATOM   990   H  HG22 . THR A 1 26 ? -7.408  10.555  3.159   1.00 0.00 ? 26  THR A HG22 2  
ATOM   991   H  HG23 . THR A 1 26 ? -6.727  10.348  1.545   1.00 0.00 ? 26  THR A HG23 2  
ATOM   992   N  N    . ASN A 1 27 ? -6.144  6.480   4.145   1.00 0.00 ? 27  ASN A N    2  
ATOM   993   C  CA   . ASN A 1 27 ? -5.292  6.203   5.296   1.00 0.00 ? 27  ASN A CA   2  
ATOM   994   C  C    . ASN A 1 27 ? -4.017  5.483   4.869   1.00 0.00 ? 27  ASN A C    2  
ATOM   995   O  O    . ASN A 1 27 ? -2.923  5.804   5.336   1.00 0.00 ? 27  ASN A O    2  
ATOM   996   C  CB   . ASN A 1 27 ? -6.048  5.359   6.324   1.00 0.00 ? 27  ASN A CB   2  
ATOM   997   C  CG   . ASN A 1 27 ? -7.277  6.066   6.862   1.00 0.00 ? 27  ASN A CG   2  
ATOM   998   O  OD1  . ASN A 1 27 ? -7.561  7.207   6.495   1.00 0.00 ? 27  ASN A OD1  2  
ATOM   999   N  ND2  . ASN A 1 27 ? -8.014  5.390   7.736   1.00 0.00 ? 27  ASN A ND2  2  
ATOM   1000  H  H    . ASN A 1 27 ? -7.054  6.118   4.126   1.00 0.00 ? 27  ASN A H    2  
ATOM   1001  H  HA   . ASN A 1 27 ? -5.025  7.148   5.745   1.00 0.00 ? 27  ASN A HA   2  
ATOM   1002  H  HB2  . ASN A 1 27 ? -6.362  4.435   5.861   1.00 0.00 ? 27  ASN A HB2  2  
ATOM   1003  H  HB3  . ASN A 1 27 ? -5.391  5.138   7.152   1.00 0.00 ? 27  ASN A HB3  2  
ATOM   1004  H  HD21 . ASN A 1 27 ? -7.727  4.486   7.982   1.00 0.00 ? 27  ASN A HD21 2  
ATOM   1005  H  HD22 . ASN A 1 27 ? -8.814  5.823   8.099   1.00 0.00 ? 27  ASN A HD22 2  
ATOM   1006  N  N    . LEU A 1 28 ? -4.165  4.509   3.977   1.00 0.00 ? 28  LEU A N    2  
ATOM   1007  C  CA   . LEU A 1 28 ? -3.025  3.743   3.485   1.00 0.00 ? 28  LEU A CA   2  
ATOM   1008  C  C    . LEU A 1 28 ? -2.045  4.643   2.739   1.00 0.00 ? 28  LEU A C    2  
ATOM   1009  O  O    . LEU A 1 28 ? -0.834  4.568   2.949   1.00 0.00 ? 28  LEU A O    2  
ATOM   1010  C  CB   . LEU A 1 28 ? -3.501  2.616   2.567   1.00 0.00 ? 28  LEU A CB   2  
ATOM   1011  C  CG   . LEU A 1 28 ? -2.478  2.095   1.558   1.00 0.00 ? 28  LEU A CG   2  
ATOM   1012  C  CD1  . LEU A 1 28 ? -1.334  1.391   2.272   1.00 0.00 ? 28  LEU A CD1  2  
ATOM   1013  C  CD2  . LEU A 1 28 ? -3.142  1.159   0.559   1.00 0.00 ? 28  LEU A CD2  2  
ATOM   1014  H  H    . LEU A 1 28 ? -5.061  4.300   3.641   1.00 0.00 ? 28  LEU A H    2  
ATOM   1015  H  HA   . LEU A 1 28 ? -2.522  3.313   4.338   1.00 0.00 ? 28  LEU A HA   2  
ATOM   1016  H  HB2  . LEU A 1 28 ? -3.803  1.788   3.189   1.00 0.00 ? 28  LEU A HB2  2  
ATOM   1017  H  HB3  . LEU A 1 28 ? -4.356  2.980   2.015   1.00 0.00 ? 28  LEU A HB3  2  
ATOM   1018  H  HG   . LEU A 1 28 ? -2.064  2.931   1.010   1.00 0.00 ? 28  LEU A HG   2  
ATOM   1019  H  HD11 . LEU A 1 28 ? -1.584  1.266   3.315   1.00 0.00 ? 28  LEU A HD11 2  
ATOM   1020  H  HD12 . LEU A 1 28 ? -0.436  1.985   2.185   1.00 0.00 ? 28  LEU A HD12 2  
ATOM   1021  H  HD13 . LEU A 1 28 ? -1.170  0.423   1.821   1.00 0.00 ? 28  LEU A HD13 2  
ATOM   1022  H  HD21 . LEU A 1 28 ? -3.867  0.543   1.070   1.00 0.00 ? 28  LEU A HD21 2  
ATOM   1023  H  HD22 . LEU A 1 28 ? -2.393  0.529   0.103   1.00 0.00 ? 28  LEU A HD22 2  
ATOM   1024  H  HD23 . LEU A 1 28 ? -3.637  1.740   -0.205  1.00 0.00 ? 28  LEU A HD23 2  
ATOM   1025  N  N    . ILE A 1 29 ? -2.577  5.494   1.868   1.00 0.00 ? 29  ILE A N    2  
ATOM   1026  C  CA   . ILE A 1 29 ? -1.750  6.411   1.094   1.00 0.00 ? 29  ILE A CA   2  
ATOM   1027  C  C    . ILE A 1 29 ? -0.939  7.324   2.006   1.00 0.00 ? 29  ILE A C    2  
ATOM   1028  O  O    . ILE A 1 29 ? 0.268   7.487   1.824   1.00 0.00 ? 29  ILE A O    2  
ATOM   1029  C  CB   . ILE A 1 29 ? -2.603  7.276   0.147   1.00 0.00 ? 29  ILE A CB   2  
ATOM   1030  C  CG1  . ILE A 1 29 ? -3.357  6.391   -0.848  1.00 0.00 ? 29  ILE A CG1  2  
ATOM   1031  C  CG2  . ILE A 1 29 ? -1.726  8.280   -0.587  1.00 0.00 ? 29  ILE A CG2  2  
ATOM   1032  C  CD1  . ILE A 1 29 ? -4.639  7.011   -1.357  1.00 0.00 ? 29  ILE A CD1  2  
ATOM   1033  H  H    . ILE A 1 29 ? -3.549  5.507   1.745   1.00 0.00 ? 29  ILE A H    2  
ATOM   1034  H  HA   . ILE A 1 29 ? -1.070  5.821   0.496   1.00 0.00 ? 29  ILE A HA   2  
ATOM   1035  H  HB   . ILE A 1 29 ? -3.316  7.825   0.742   1.00 0.00 ? 29  ILE A HB   2  
ATOM   1036  H  HG12 . ILE A 1 29 ? -2.723  6.195   -1.698  1.00 0.00 ? 29  ILE A HG12 2  
ATOM   1037  H  HG13 . ILE A 1 29 ? -3.608  5.456   -0.368  1.00 0.00 ? 29  ILE A HG13 2  
ATOM   1038  H  HG21 . ILE A 1 29 ? -1.666  8.009   -1.631  1.00 0.00 ? 29  ILE A HG21 2  
ATOM   1039  H  HG22 . ILE A 1 29 ? -2.156  9.266   -0.496  1.00 0.00 ? 29  ILE A HG22 2  
ATOM   1040  H  HG23 . ILE A 1 29 ? -0.736  8.276   -0.156  1.00 0.00 ? 29  ILE A HG23 2  
ATOM   1041  H  HD11 . ILE A 1 29 ? -5.032  7.689   -0.612  1.00 0.00 ? 29  ILE A HD11 2  
ATOM   1042  H  HD12 . ILE A 1 29 ? -4.439  7.557   -2.267  1.00 0.00 ? 29  ILE A HD12 2  
ATOM   1043  H  HD13 . ILE A 1 29 ? -5.362  6.235   -1.553  1.00 0.00 ? 29  ILE A HD13 2  
ATOM   1044  N  N    . ILE A 1 30 ? -1.609  7.915   2.990   1.00 0.00 ? 30  ILE A N    2  
ATOM   1045  C  CA   . ILE A 1 30 ? -0.949  8.810   3.933   1.00 0.00 ? 30  ILE A CA   2  
ATOM   1046  C  C    . ILE A 1 30 ? 0.176   8.095   4.674   1.00 0.00 ? 30  ILE A C    2  
ATOM   1047  O  O    . ILE A 1 30 ? 1.220   8.683   4.956   1.00 0.00 ? 30  ILE A O    2  
ATOM   1048  C  CB   . ILE A 1 30 ? -1.945  9.378   4.960   1.00 0.00 ? 30  ILE A CB   2  
ATOM   1049  C  CG1  . ILE A 1 30 ? -3.077  10.122  4.248   1.00 0.00 ? 30  ILE A CG1  2  
ATOM   1050  C  CG2  . ILE A 1 30 ? -1.231  10.300  5.937   1.00 0.00 ? 30  ILE A CG2  2  
ATOM   1051  C  CD1  . ILE A 1 30 ? -4.276  10.386  5.132   1.00 0.00 ? 30  ILE A CD1  2  
ATOM   1052  H  H    . ILE A 1 30 ? -2.569  7.746   3.083   1.00 0.00 ? 30  ILE A H    2  
ATOM   1053  H  HA   . ILE A 1 30 ? -0.530  9.634   3.373   1.00 0.00 ? 30  ILE A HA   2  
ATOM   1054  H  HB   . ILE A 1 30 ? -2.361  8.554   5.520   1.00 0.00 ? 30  ILE A HB   2  
ATOM   1055  H  HG12 . ILE A 1 30 ? -2.710  11.072  3.896   1.00 0.00 ? 30  ILE A HG12 2  
ATOM   1056  H  HG13 . ILE A 1 30 ? -3.409  9.534   3.405   1.00 0.00 ? 30  ILE A HG13 2  
ATOM   1057  H  HG21 . ILE A 1 30 ? -0.398  9.777   6.383   1.00 0.00 ? 30  ILE A HG21 2  
ATOM   1058  H  HG22 . ILE A 1 30 ? -0.867  11.170  5.410   1.00 0.00 ? 30  ILE A HG22 2  
ATOM   1059  H  HG23 . ILE A 1 30 ? -1.918  10.609  6.710   1.00 0.00 ? 30  ILE A HG23 2  
ATOM   1060  H  HD11 . ILE A 1 30 ? -5.063  9.686   4.890   1.00 0.00 ? 30  ILE A HD11 2  
ATOM   1061  H  HD12 . ILE A 1 30 ? -3.995  10.265  6.168   1.00 0.00 ? 30  ILE A HD12 2  
ATOM   1062  H  HD13 . ILE A 1 30 ? -4.629  11.393  4.969   1.00 0.00 ? 30  ILE A HD13 2  
ATOM   1063  N  N    . HIS A 1 31 ? -0.044  6.821   4.985   1.00 0.00 ? 31  HIS A N    2  
ATOM   1064  C  CA   . HIS A 1 31 ? 0.952   6.024   5.691   1.00 0.00 ? 31  HIS A CA   2  
ATOM   1065  C  C    . HIS A 1 31 ? 2.199   5.828   4.834   1.00 0.00 ? 31  HIS A C    2  
ATOM   1066  O  O    . HIS A 1 31 ? 3.323   5.969   5.316   1.00 0.00 ? 31  HIS A O    2  
ATOM   1067  C  CB   . HIS A 1 31 ? 0.368   4.665   6.079   1.00 0.00 ? 31  HIS A CB   2  
ATOM   1068  C  CG   . HIS A 1 31 ? 1.399   3.589   6.225   1.00 0.00 ? 31  HIS A CG   2  
ATOM   1069  N  ND1  . HIS A 1 31 ? 1.788   3.079   7.445   1.00 0.00 ? 31  HIS A ND1  2  
ATOM   1070  C  CD2  . HIS A 1 31 ? 2.121   2.923   5.293   1.00 0.00 ? 31  HIS A CD2  2  
ATOM   1071  C  CE1  . HIS A 1 31 ? 2.707   2.148   7.259   1.00 0.00 ? 31  HIS A CE1  2  
ATOM   1072  N  NE2  . HIS A 1 31 ? 2.927   2.034   5.961   1.00 0.00 ? 31  HIS A NE2  2  
ATOM   1073  H  H    . HIS A 1 31 ? -0.896  6.408   4.733   1.00 0.00 ? 31  HIS A H    2  
ATOM   1074  H  HA   . HIS A 1 31 ? 1.228   6.557   6.589   1.00 0.00 ? 31  HIS A HA   2  
ATOM   1075  H  HB2  . HIS A 1 31 ? -0.148  4.759   7.024   1.00 0.00 ? 31  HIS A HB2  2  
ATOM   1076  H  HB3  . HIS A 1 31 ? -0.335  4.353   5.320   1.00 0.00 ? 31  HIS A HB3  2  
ATOM   1077  H  HD1  . HIS A 1 31 ? 1.444   3.360   8.318   1.00 0.00 ? 31  HIS A HD1  2  
ATOM   1078  H  HD2  . HIS A 1 31 ? 2.074   3.065   4.222   1.00 0.00 ? 31  HIS A HD2  2  
ATOM   1079  H  HE1  . HIS A 1 31 ? 3.195   1.577   8.034   1.00 0.00 ? 31  HIS A HE1  2  
ATOM   1080  N  N    . GLN A 1 32 ? 1.992   5.502   3.562   1.00 0.00 ? 32  GLN A N    2  
ATOM   1081  C  CA   . GLN A 1 32 ? 3.099   5.286   2.639   1.00 0.00 ? 32  GLN A CA   2  
ATOM   1082  C  C    . GLN A 1 32 ? 4.109   6.426   2.723   1.00 0.00 ? 32  GLN A C    2  
ATOM   1083  O  O    . GLN A 1 32 ? 5.271   6.270   2.350   1.00 0.00 ? 32  GLN A O    2  
ATOM   1084  C  CB   . GLN A 1 32 ? 2.579   5.154   1.207   1.00 0.00 ? 32  GLN A CB   2  
ATOM   1085  C  CG   . GLN A 1 32 ? 1.778   3.885   0.965   1.00 0.00 ? 32  GLN A CG   2  
ATOM   1086  C  CD   . GLN A 1 32 ? 1.395   3.705   -0.491  1.00 0.00 ? 32  GLN A CD   2  
ATOM   1087  O  OE1  . GLN A 1 32 ? 2.240   3.796   -1.382  1.00 0.00 ? 32  GLN A OE1  2  
ATOM   1088  N  NE2  . GLN A 1 32 ? 0.117   3.447   -0.740  1.00 0.00 ? 32  GLN A NE2  2  
ATOM   1089  H  H    . GLN A 1 32 ? 1.073   5.404   3.238   1.00 0.00 ? 32  GLN A H    2  
ATOM   1090  H  HA   . GLN A 1 32 ? 3.590   4.366   2.920   1.00 0.00 ? 32  GLN A HA   2  
ATOM   1091  H  HB2  . GLN A 1 32 ? 1.947   6.001   0.987   1.00 0.00 ? 32  GLN A HB2  2  
ATOM   1092  H  HB3  . GLN A 1 32 ? 3.420   5.157   0.529   1.00 0.00 ? 32  GLN A HB3  2  
ATOM   1093  H  HG2  . GLN A 1 32 ? 2.371   3.036   1.273   1.00 0.00 ? 32  GLN A HG2  2  
ATOM   1094  H  HG3  . GLN A 1 32 ? 0.876   3.926   1.557   1.00 0.00 ? 32  GLN A HG3  2  
ATOM   1095  H  HE21 . GLN A 1 32 ? -0.500  3.390   0.021   1.00 0.00 ? 32  GLN A HE21 2  
ATOM   1096  H  HE22 . GLN A 1 32 ? -0.158  3.327   -1.672  1.00 0.00 ? 32  GLN A HE22 2  
ATOM   1097  N  N    . LYS A 1 33 ? 3.657   7.574   3.216   1.00 0.00 ? 33  LYS A N    2  
ATOM   1098  C  CA   . LYS A 1 33 ? 4.519   8.742   3.350   1.00 0.00 ? 33  LYS A CA   2  
ATOM   1099  C  C    . LYS A 1 33 ? 5.724   8.430   4.233   1.00 0.00 ? 33  LYS A C    2  
ATOM   1100  O  O    . LYS A 1 33 ? 6.679   9.205   4.291   1.00 0.00 ? 33  LYS A O    2  
ATOM   1101  C  CB   . LYS A 1 33 ? 3.734   9.917   3.937   1.00 0.00 ? 33  LYS A CB   2  
ATOM   1102  C  CG   . LYS A 1 33 ? 2.428   10.199  3.214   1.00 0.00 ? 33  LYS A CG   2  
ATOM   1103  C  CD   . LYS A 1 33 ? 2.621   11.197  2.084   1.00 0.00 ? 33  LYS A CD   2  
ATOM   1104  C  CE   . LYS A 1 33 ? 2.942   10.498  0.772   1.00 0.00 ? 33  LYS A CE   2  
ATOM   1105  N  NZ   . LYS A 1 33 ? 1.819   9.634   0.314   1.00 0.00 ? 33  LYS A NZ   2  
ATOM   1106  H  H    . LYS A 1 33 ? 2.719   7.638   3.497   1.00 0.00 ? 33  LYS A H    2  
ATOM   1107  H  HA   . LYS A 1 33 ? 4.870   9.011   2.365   1.00 0.00 ? 33  LYS A HA   2  
ATOM   1108  H  HB2  . LYS A 1 33 ? 3.509   9.703   4.972   1.00 0.00 ? 33  LYS A HB2  2  
ATOM   1109  H  HB3  . LYS A 1 33 ? 4.347   10.805  3.888   1.00 0.00 ? 33  LYS A HB3  2  
ATOM   1110  H  HG2  . LYS A 1 33 ? 2.049   9.275   2.803   1.00 0.00 ? 33  LYS A HG2  2  
ATOM   1111  H  HG3  . LYS A 1 33 ? 1.716   10.601  3.920   1.00 0.00 ? 33  LYS A HG3  2  
ATOM   1112  H  HD2  . LYS A 1 33 ? 1.713   11.768  1.962   1.00 0.00 ? 33  LYS A HD2  2  
ATOM   1113  H  HD3  . LYS A 1 33 ? 3.436   11.861  2.337   1.00 0.00 ? 33  LYS A HD3  2  
ATOM   1114  H  HE2  . LYS A 1 33 ? 3.138   11.246  0.019   1.00 0.00 ? 33  LYS A HE2  2  
ATOM   1115  H  HE3  . LYS A 1 33 ? 3.822   9.887   0.910   1.00 0.00 ? 33  LYS A HE3  2  
ATOM   1116  H  HZ1  . LYS A 1 33 ? 1.269   10.121  -0.421  1.00 0.00 ? 33  LYS A HZ1  2  
ATOM   1117  H  HZ2  . LYS A 1 33 ? 1.191   9.412   1.113   1.00 0.00 ? 33  LYS A HZ2  2  
ATOM   1118  H  HZ3  . LYS A 1 33 ? 2.190   8.744   -0.077  1.00 0.00 ? 33  LYS A HZ3  2  
ATOM   1119  N  N    . ILE A 1 34 ? 5.672   7.292   4.916   1.00 0.00 ? 34  ILE A N    2  
ATOM   1120  C  CA   . ILE A 1 34 ? 6.760   6.878   5.793   1.00 0.00 ? 34  ILE A CA   2  
ATOM   1121  C  C    . ILE A 1 34 ? 7.883   6.217   5.001   1.00 0.00 ? 34  ILE A C    2  
ATOM   1122  O  O    . ILE A 1 34 ? 8.939   5.899   5.548   1.00 0.00 ? 34  ILE A O    2  
ATOM   1123  C  CB   . ILE A 1 34 ? 6.268   5.900   6.877   1.00 0.00 ? 34  ILE A CB   2  
ATOM   1124  C  CG1  . ILE A 1 34 ? 5.934   4.542   6.257   1.00 0.00 ? 34  ILE A CG1  2  
ATOM   1125  C  CG2  . ILE A 1 34 ? 5.056   6.473   7.596   1.00 0.00 ? 34  ILE A CG2  2  
ATOM   1126  C  CD1  . ILE A 1 34 ? 5.766   3.437   7.276   1.00 0.00 ? 34  ILE A CD1  2  
ATOM   1127  H  H    . ILE A 1 34 ? 4.883   6.717   4.828   1.00 0.00 ? 34  ILE A H    2  
ATOM   1128  H  HA   . ILE A 1 34 ? 7.148   7.760   6.281   1.00 0.00 ? 34  ILE A HA   2  
ATOM   1129  H  HB   . ILE A 1 34 ? 7.059   5.773   7.600   1.00 0.00 ? 34  ILE A HB   2  
ATOM   1130  H  HG12 . ILE A 1 34 ? 5.013   4.624   5.702   1.00 0.00 ? 34  ILE A HG12 2  
ATOM   1131  H  HG13 . ILE A 1 34 ? 6.730   4.257   5.584   1.00 0.00 ? 34  ILE A HG13 2  
ATOM   1132  H  HG21 . ILE A 1 34 ? 4.474   5.667   8.018   1.00 0.00 ? 34  ILE A HG21 2  
ATOM   1133  H  HG22 . ILE A 1 34 ? 5.384   7.131   8.387   1.00 0.00 ? 34  ILE A HG22 2  
ATOM   1134  H  HG23 . ILE A 1 34 ? 4.449   7.027   6.895   1.00 0.00 ? 34  ILE A HG23 2  
ATOM   1135  H  HD11 . ILE A 1 34 ? 5.497   3.866   8.231   1.00 0.00 ? 34  ILE A HD11 2  
ATOM   1136  H  HD12 . ILE A 1 34 ? 4.986   2.764   6.953   1.00 0.00 ? 34  ILE A HD12 2  
ATOM   1137  H  HD13 . ILE A 1 34 ? 6.694   2.894   7.375   1.00 0.00 ? 34  ILE A HD13 2  
ATOM   1138  N  N    . HIS A 1 35 ? 7.649   6.015   3.708   1.00 0.00 ? 35  HIS A N    2  
ATOM   1139  C  CA   . HIS A 1 35 ? 8.642   5.395   2.838   1.00 0.00 ? 35  HIS A CA   2  
ATOM   1140  C  C    . HIS A 1 35 ? 9.101   6.368   1.757   1.00 0.00 ? 35  HIS A C    2  
ATOM   1141  O  O    . HIS A 1 35 ? 10.243  6.311   1.299   1.00 0.00 ? 35  HIS A O    2  
ATOM   1142  C  CB   . HIS A 1 35 ? 8.069   4.132   2.195   1.00 0.00 ? 35  HIS A CB   2  
ATOM   1143  C  CG   . HIS A 1 35 ? 7.373   3.228   3.165   1.00 0.00 ? 35  HIS A CG   2  
ATOM   1144  N  ND1  . HIS A 1 35 ? 8.029   2.563   4.179   1.00 0.00 ? 35  HIS A ND1  2  
ATOM   1145  C  CD2  . HIS A 1 35 ? 6.069   2.882   3.273   1.00 0.00 ? 35  HIS A CD2  2  
ATOM   1146  C  CE1  . HIS A 1 35 ? 7.160   1.846   4.868   1.00 0.00 ? 35  HIS A CE1  2  
ATOM   1147  N  NE2  . HIS A 1 35 ? 5.962   2.022   4.338   1.00 0.00 ? 35  HIS A NE2  2  
ATOM   1148  H  H    . HIS A 1 35 ? 6.788   6.291   3.330   1.00 0.00 ? 35  HIS A H    2  
ATOM   1149  H  HA   . HIS A 1 35 ? 9.492   5.125   3.446   1.00 0.00 ? 35  HIS A HA   2  
ATOM   1150  H  HB2  . HIS A 1 35 ? 7.356   4.415   1.435   1.00 0.00 ? 35  HIS A HB2  2  
ATOM   1151  H  HB3  . HIS A 1 35 ? 8.873   3.573   1.737   1.00 0.00 ? 35  HIS A HB3  2  
ATOM   1152  H  HD1  . HIS A 1 35 ? 8.990   2.609   4.365   1.00 0.00 ? 35  HIS A HD1  2  
ATOM   1153  H  HD2  . HIS A 1 35 ? 5.261   3.218   2.638   1.00 0.00 ? 35  HIS A HD2  2  
ATOM   1154  H  HE1  . HIS A 1 35 ? 7.388   1.222   5.719   1.00 0.00 ? 35  HIS A HE1  2  
ATOM   1155  N  N    . THR A 1 36 ? 8.204   7.261   1.351   1.00 0.00 ? 36  THR A N    2  
ATOM   1156  C  CA   . THR A 1 36 ? 8.515   8.245   0.322   1.00 0.00 ? 36  THR A CA   2  
ATOM   1157  C  C    . THR A 1 36 ? 9.148   9.493   0.929   1.00 0.00 ? 36  THR A C    2  
ATOM   1158  O  O    . THR A 1 36 ? 8.796   9.905   2.033   1.00 0.00 ? 36  THR A O    2  
ATOM   1159  C  CB   . THR A 1 36 ? 7.256   8.653   -0.465  1.00 0.00 ? 36  THR A CB   2  
ATOM   1160  O  OG1  . THR A 1 36 ? 6.197   8.983   0.440   1.00 0.00 ? 36  THR A OG1  2  
ATOM   1161  C  CG2  . THR A 1 36 ? 6.808   7.529   -1.389  1.00 0.00 ? 36  THR A CG2  2  
ATOM   1162  H  H    . THR A 1 36 ? 7.310   7.256   1.754   1.00 0.00 ? 36  THR A H    2  
ATOM   1163  H  HA   . THR A 1 36 ? 9.216   7.797   -0.367  1.00 0.00 ? 36  THR A HA   2  
ATOM   1164  H  HB   . THR A 1 36 ? 7.491   9.520   -1.066  1.00 0.00 ? 36  THR A HB   2  
ATOM   1165  H  HG1  . THR A 1 36 ? 5.818   8.177   0.798   1.00 0.00 ? 36  THR A HG1  2  
ATOM   1166  H  HG21 . THR A 1 36 ? 6.411   6.717   -0.799  1.00 0.00 ? 36  THR A HG21 2  
ATOM   1167  H  HG22 . THR A 1 36 ? 7.652   7.178   -1.963  1.00 0.00 ? 36  THR A HG22 2  
ATOM   1168  H  HG23 . THR A 1 36 ? 6.045   7.897   -2.058  1.00 0.00 ? 36  THR A HG23 2  
ATOM   1169  N  N    . GLY A 1 37 ? 10.083  10.091  0.198   1.00 0.00 ? 37  GLY A N    2  
ATOM   1170  C  CA   . GLY A 1 37 ? 10.749  11.287  0.680   1.00 0.00 ? 37  GLY A CA   2  
ATOM   1171  C  C    . GLY A 1 37 ? 12.050  11.561  -0.049  1.00 0.00 ? 37  GLY A C    2  
ATOM   1172  O  O    . GLY A 1 37 ? 12.176  12.567  -0.747  1.00 0.00 ? 37  GLY A O    2  
ATOM   1173  H  H    . GLY A 1 37 ? 10.324  9.718   -0.676  1.00 0.00 ? 37  GLY A H    2  
ATOM   1174  H  HA2  . GLY A 1 37 ? 10.090  12.131  0.548   1.00 0.00 ? 37  GLY A HA2  2  
ATOM   1175  H  HA3  . GLY A 1 37 ? 10.960  11.168  1.733   1.00 0.00 ? 37  GLY A HA3  2  
ATOM   1176  N  N    . GLU A 1 38 ? 13.018  10.665  0.113   1.00 0.00 ? 38  GLU A N    2  
ATOM   1177  C  CA   . GLU A 1 38 ? 14.316  10.818  -0.534  1.00 0.00 ? 38  GLU A CA   2  
ATOM   1178  C  C    . GLU A 1 38 ? 14.196  10.631  -2.044  1.00 0.00 ? 38  GLU A C    2  
ATOM   1179  O  O    . GLU A 1 38 ? 13.301  9.936   -2.525  1.00 0.00 ? 38  GLU A O    2  
ATOM   1180  C  CB   . GLU A 1 38 ? 15.317  9.812   0.037   1.00 0.00 ? 38  GLU A CB   2  
ATOM   1181  C  CG   . GLU A 1 38 ? 15.013  8.371   -0.338  1.00 0.00 ? 38  GLU A CG   2  
ATOM   1182  C  CD   . GLU A 1 38 ? 15.747  7.373   0.537   1.00 0.00 ? 38  GLU A CD   2  
ATOM   1183  O  OE1  . GLU A 1 38 ? 16.821  7.726   1.068   1.00 0.00 ? 38  GLU A OE1  2  
ATOM   1184  O  OE2  . GLU A 1 38 ? 15.247  6.239   0.691   1.00 0.00 ? 38  GLU A OE2  2  
ATOM   1185  H  H    . GLU A 1 38 ? 12.856  9.884   0.682   1.00 0.00 ? 38  GLU A H    2  
ATOM   1186  H  HA   . GLU A 1 38 ? 14.670  11.817  -0.334  1.00 0.00 ? 38  GLU A HA   2  
ATOM   1187  H  HB2  . GLU A 1 38 ? 16.303  10.057  -0.328  1.00 0.00 ? 38  GLU A HB2  2  
ATOM   1188  H  HB3  . GLU A 1 38 ? 15.312  9.890   1.114   1.00 0.00 ? 38  GLU A HB3  2  
ATOM   1189  H  HG2  . GLU A 1 38 ? 13.952  8.202   -0.237  1.00 0.00 ? 38  GLU A HG2  2  
ATOM   1190  H  HG3  . GLU A 1 38 ? 15.306  8.210   -1.365  1.00 0.00 ? 38  GLU A HG3  2  
ATOM   1191  N  N    . ARG A 1 39 ? 15.103  11.258  -2.786  1.00 0.00 ? 39  ARG A N    2  
ATOM   1192  C  CA   . ARG A 1 39 ? 15.098  11.163  -4.241  1.00 0.00 ? 39  ARG A CA   2  
ATOM   1193  C  C    . ARG A 1 39 ? 16.522  11.132  -4.788  1.00 0.00 ? 39  ARG A C    2  
ATOM   1194  O  O    . ARG A 1 39 ? 17.394  11.890  -4.362  1.00 0.00 ? 39  ARG A O    2  
ATOM   1195  C  CB   . ARG A 1 39 ? 14.333  12.341  -4.847  1.00 0.00 ? 39  ARG A CB   2  
ATOM   1196  C  CG   . ARG A 1 39 ? 13.736  12.041  -6.213  1.00 0.00 ? 39  ARG A CG   2  
ATOM   1197  C  CD   . ARG A 1 39 ? 12.613  13.008  -6.554  1.00 0.00 ? 39  ARG A CD   2  
ATOM   1198  N  NE   . ARG A 1 39 ? 12.237  12.935  -7.963  1.00 0.00 ? 39  ARG A NE   2  
ATOM   1199  C  CZ   . ARG A 1 39 ? 11.513  13.862  -8.580  1.00 0.00 ? 39  ARG A CZ   2  
ATOM   1200  N  NH1  . ARG A 1 39 ? 11.090  14.929  -7.915  1.00 0.00 ? 39  ARG A NH1  2  
ATOM   1201  N  NH2  . ARG A 1 39 ? 11.212  13.725  -9.865  1.00 0.00 ? 39  ARG A NH2  2  
ATOM   1202  H  H    . ARG A 1 39 ? 15.791  11.798  -2.344  1.00 0.00 ? 39  ARG A H    2  
ATOM   1203  H  HA   . ARG A 1 39 ? 14.600  10.244  -4.512  1.00 0.00 ? 39  ARG A HA   2  
ATOM   1204  H  HB2  . ARG A 1 39 ? 13.530  12.616  -4.180  1.00 0.00 ? 39  ARG A HB2  2  
ATOM   1205  H  HB3  . ARG A 1 39 ? 15.007  13.178  -4.949  1.00 0.00 ? 39  ARG A HB3  2  
ATOM   1206  H  HG2  . ARG A 1 39 ? 14.510  12.128  -6.961  1.00 0.00 ? 39  ARG A HG2  2  
ATOM   1207  H  HG3  . ARG A 1 39 ? 13.346  11.035  -6.211  1.00 0.00 ? 39  ARG A HG3  2  
ATOM   1208  H  HD2  . ARG A 1 39 ? 11.752  12.766  -5.949  1.00 0.00 ? 39  ARG A HD2  2  
ATOM   1209  H  HD3  . ARG A 1 39 ? 12.940  14.012  -6.329  1.00 0.00 ? 39  ARG A HD3  2  
ATOM   1210  H  HE   . ARG A 1 39 ? 12.540  12.155  -8.473  1.00 0.00 ? 39  ARG A HE   2  
ATOM   1211  H  HH11 . ARG A 1 39 ? 11.317  15.035  -6.947  1.00 0.00 ? 39  ARG A HH11 2  
ATOM   1212  H  HH12 . ARG A 1 39 ? 10.547  15.626  -8.382  1.00 0.00 ? 39  ARG A HH12 2  
ATOM   1213  H  HH21 . ARG A 1 39 ? 11.530  12.923  -10.369 1.00 0.00 ? 39  ARG A HH21 2  
ATOM   1214  H  HH22 . ARG A 1 39 ? 10.668  14.423  -10.328 1.00 0.00 ? 39  ARG A HH22 2  
ATOM   1215  N  N    . PRO A 1 40 ? 16.765  10.234  -5.754  1.00 0.00 ? 40  PRO A N    2  
ATOM   1216  C  CA   . PRO A 1 40 ? 18.082  10.081  -6.380  1.00 0.00 ? 40  PRO A CA   2  
ATOM   1217  C  C    . PRO A 1 40 ? 18.447  11.272  -7.260  1.00 0.00 ? 40  PRO A C    2  
ATOM   1218  O  O    . PRO A 1 40 ? 19.538  11.829  -7.146  1.00 0.00 ? 40  PRO A O    2  
ATOM   1219  C  CB   . PRO A 1 40 ? 17.927  8.817   -7.229  1.00 0.00 ? 40  PRO A CB   2  
ATOM   1220  C  CG   . PRO A 1 40 ? 16.468  8.730   -7.517  1.00 0.00 ? 40  PRO A CG   2  
ATOM   1221  C  CD   . PRO A 1 40 ? 15.773  9.298   -6.310  1.00 0.00 ? 40  PRO A CD   2  
ATOM   1222  H  HA   . PRO A 1 40 ? 18.857  9.929   -5.643  1.00 0.00 ? 40  PRO A HA   2  
ATOM   1223  H  HB2  . PRO A 1 40 ? 18.504  8.917   -8.137  1.00 0.00 ? 40  PRO A HB2  2  
ATOM   1224  H  HB3  . PRO A 1 40 ? 18.270  7.959   -6.670  1.00 0.00 ? 40  PRO A HB3  2  
ATOM   1225  H  HG2  . PRO A 1 40 ? 16.231  9.313   -8.394  1.00 0.00 ? 40  PRO A HG2  2  
ATOM   1226  H  HG3  . PRO A 1 40 ? 16.183  7.699   -7.662  1.00 0.00 ? 40  PRO A HG3  2  
ATOM   1227  H  HD2  . PRO A 1 40 ? 14.873  9.819   -6.602  1.00 0.00 ? 40  PRO A HD2  2  
ATOM   1228  H  HD3  . PRO A 1 40 ? 15.545  8.514   -5.603  1.00 0.00 ? 40  PRO A HD3  2  
ATOM   1229  N  N    . SER A 1 41 ? 17.525  11.658  -8.137  1.00 0.00 ? 41  SER A N    2  
ATOM   1230  C  CA   . SER A 1 41 ? 17.752  12.781  -9.039  1.00 0.00 ? 41  SER A CA   2  
ATOM   1231  C  C    . SER A 1 41 ? 16.496  13.090  -9.848  1.00 0.00 ? 41  SER A C    2  
ATOM   1232  O  O    . SER A 1 41 ? 15.862  12.191  -10.400 1.00 0.00 ? 41  SER A O    2  
ATOM   1233  C  CB   . SER A 1 41 ? 18.918  12.479  -9.982  1.00 0.00 ? 41  SER A CB   2  
ATOM   1234  O  OG   . SER A 1 41 ? 18.624  11.373  -10.818 1.00 0.00 ? 41  SER A OG   2  
ATOM   1235  H  H    . SER A 1 41 ? 16.674  11.174  -8.180  1.00 0.00 ? 41  SER A H    2  
ATOM   1236  H  HA   . SER A 1 41 ? 18.000  13.644  -8.438  1.00 0.00 ? 41  SER A HA   2  
ATOM   1237  H  HB2  . SER A 1 41 ? 19.110  13.342  -10.601 1.00 0.00 ? 41  SER A HB2  2  
ATOM   1238  H  HB3  . SER A 1 41 ? 19.799  12.250  -9.399  1.00 0.00 ? 41  SER A HB3  2  
ATOM   1239  H  HG   . SER A 1 41 ? 18.817  11.601  -11.730 1.00 0.00 ? 41  SER A HG   2  
ATOM   1240  N  N    . GLY A 1 42 ? 16.141  14.370  -9.913  1.00 0.00 ? 42  GLY A N    2  
ATOM   1241  C  CA   . GLY A 1 42 ? 14.963  14.776  -10.656 1.00 0.00 ? 42  GLY A CA   2  
ATOM   1242  C  C    . GLY A 1 42 ? 15.302  15.643  -11.853 1.00 0.00 ? 42  GLY A C    2  
ATOM   1243  O  O    . GLY A 1 42 ? 16.428  16.118  -12.004 1.00 0.00 ? 42  GLY A O    2  
ATOM   1244  H  H    . GLY A 1 42 ? 16.684  15.044  -9.453  1.00 0.00 ? 42  GLY A H    2  
ATOM   1245  H  HA2  . GLY A 1 42 ? 14.445  13.893  -11.000 1.00 0.00 ? 42  GLY A HA2  2  
ATOM   1246  H  HA3  . GLY A 1 42 ? 14.310  15.331  -9.998  1.00 0.00 ? 42  GLY A HA3  2  
ATOM   1247  N  N    . PRO A 1 43 ? 14.311  15.859  -12.731 1.00 0.00 ? 43  PRO A N    2  
ATOM   1248  C  CA   . PRO A 1 43 ? 14.487  16.675  -13.937 1.00 0.00 ? 43  PRO A CA   2  
ATOM   1249  C  C    . PRO A 1 43 ? 14.657  18.155  -13.615 1.00 0.00 ? 43  PRO A C    2  
ATOM   1250  O  O    . PRO A 1 43 ? 14.947  18.963  -14.498 1.00 0.00 ? 43  PRO A O    2  
ATOM   1251  C  CB   . PRO A 1 43 ? 13.189  16.442  -14.714 1.00 0.00 ? 43  PRO A CB   2  
ATOM   1252  C  CG   . PRO A 1 43 ? 12.186  16.074  -13.676 1.00 0.00 ? 43  PRO A CG   2  
ATOM   1253  C  CD   . PRO A 1 43 ? 12.944  15.325  -12.615 1.00 0.00 ? 43  PRO A CD   2  
ATOM   1254  H  HA   . PRO A 1 43 ? 15.327  16.336  -14.526 1.00 0.00 ? 43  PRO A HA   2  
ATOM   1255  H  HB2  . PRO A 1 43 ? 12.909  17.349  -15.231 1.00 0.00 ? 43  PRO A HB2  2  
ATOM   1256  H  HB3  . PRO A 1 43 ? 13.330  15.644  -15.427 1.00 0.00 ? 43  PRO A HB3  2  
ATOM   1257  H  HG2  . PRO A 1 43 ? 11.743  16.967  -13.260 1.00 0.00 ? 43  PRO A HG2  2  
ATOM   1258  H  HG3  . PRO A 1 43 ? 11.425  15.442  -14.109 1.00 0.00 ? 43  PRO A HG3  2  
ATOM   1259  H  HD2  . PRO A 1 43 ? 12.531  15.532  -11.639 1.00 0.00 ? 43  PRO A HD2  2  
ATOM   1260  H  HD3  . PRO A 1 43 ? 12.927  14.264  -12.817 1.00 0.00 ? 43  PRO A HD3  2  
ATOM   1261  N  N    . SER A 1 44 ? 14.476  18.505  -12.346 1.00 0.00 ? 44  SER A N    2  
ATOM   1262  C  CA   . SER A 1 44 ? 14.607  19.891  -11.909 1.00 0.00 ? 44  SER A CA   2  
ATOM   1263  C  C    . SER A 1 44 ? 15.811  20.557  -12.567 1.00 0.00 ? 44  SER A C    2  
ATOM   1264  O  O    . SER A 1 44 ? 15.730  21.696  -13.026 1.00 0.00 ? 44  SER A O    2  
ATOM   1265  C  CB   . SER A 1 44 ? 14.742  19.956  -10.386 1.00 0.00 ? 44  SER A CB   2  
ATOM   1266  O  OG   . SER A 1 44 ? 15.136  21.251  -9.965  1.00 0.00 ? 44  SER A OG   2  
ATOM   1267  H  H    . SER A 1 44 ? 14.246  17.816  -11.688 1.00 0.00 ? 44  SER A H    2  
ATOM   1268  H  HA   . SER A 1 44 ? 13.712  20.417  -12.205 1.00 0.00 ? 44  SER A HA   2  
ATOM   1269  H  HB2  . SER A 1 44 ? 13.793  19.716  -9.932  1.00 0.00 ? 44  SER A HB2  2  
ATOM   1270  H  HB3  . SER A 1 44 ? 15.487  19.243  -10.063 1.00 0.00 ? 44  SER A HB3  2  
ATOM   1271  H  HG   . SER A 1 44 ? 14.444  21.881  -10.179 1.00 0.00 ? 44  SER A HG   2  
ATOM   1272  N  N    . SER A 1 45 ? 16.928  19.837  -12.610 1.00 0.00 ? 45  SER A N    2  
ATOM   1273  C  CA   . SER A 1 45 ? 18.151  20.359  -13.208 1.00 0.00 ? 45  SER A CA   2  
ATOM   1274  C  C    . SER A 1 45 ? 18.785  19.326  -14.135 1.00 0.00 ? 45  SER A C    2  
ATOM   1275  O  O    . SER A 1 45 ? 18.343  18.180  -14.201 1.00 0.00 ? 45  SER A O    2  
ATOM   1276  C  CB   . SER A 1 45 ? 19.145  20.762  -12.118 1.00 0.00 ? 45  SER A CB   2  
ATOM   1277  O  OG   . SER A 1 45 ? 18.613  21.786  -11.296 1.00 0.00 ? 45  SER A OG   2  
ATOM   1278  H  H    . SER A 1 45 ? 16.929  18.935  -12.227 1.00 0.00 ? 45  SER A H    2  
ATOM   1279  H  HA   . SER A 1 45 ? 17.890  21.232  -13.787 1.00 0.00 ? 45  SER A HA   2  
ATOM   1280  H  HB2  . SER A 1 45 ? 19.369  19.904  -11.503 1.00 0.00 ? 45  SER A HB2  2  
ATOM   1281  H  HB3  . SER A 1 45 ? 20.054  21.122  -12.579 1.00 0.00 ? 45  SER A HB3  2  
ATOM   1282  H  HG   . SER A 1 45 ? 18.876  22.643  -11.641 1.00 0.00 ? 45  SER A HG   2  
ATOM   1283  N  N    . GLY A 1 46 ? 19.827  19.742  -14.850 1.00 0.00 ? 46  GLY A N    2  
ATOM   1284  C  CA   . GLY A 1 46 ? 20.506  18.842  -15.763 1.00 0.00 ? 46  GLY A CA   2  
ATOM   1285  C  C    . GLY A 1 46 ? 21.109  17.644  -15.056 1.00 0.00 ? 46  GLY A C    2  
ATOM   1286  O  O    . GLY A 1 46 ? 20.612  17.261  -13.997 1.00 0.00 ? 46  GLY A O    2  
ATOM   1287  H  H    . GLY A 1 46 ? 20.136  20.667  -14.756 1.00 0.00 ? 46  GLY A H    2  
ATOM   1288  H  HA2  . GLY A 1 46 ? 19.799  18.493  -16.501 1.00 0.00 ? 46  GLY A HA2  2  
ATOM   1289  H  HA3  . GLY A 1 46 ? 21.295  19.384  -16.264 1.00 0.00 ? 46  GLY A HA3  2  
HETATM 1290  ZN ZN   . ZN  B 2 .  ? 4.146   1.019   4.589   1.00 0.00 ? 201 ZN  A ZN   2  
ATOM   1291  N  N    . GLY A 1 1  ? 9.215   -15.115 -17.249 1.00 0.00 ? 1   GLY A N    3  
ATOM   1292  C  CA   . GLY A 1 1  ? 9.957   -16.251 -16.736 1.00 0.00 ? 1   GLY A CA   3  
ATOM   1293  C  C    . GLY A 1 1  ? 9.255   -16.926 -15.574 1.00 0.00 ? 1   GLY A C    3  
ATOM   1294  O  O    . GLY A 1 1  ? 8.484   -17.867 -15.768 1.00 0.00 ? 1   GLY A O    3  
ATOM   1295  H  H1   . GLY A 1 1  ? 9.212   -14.269 -16.752 1.00 0.00 ? 1   GLY A H1   3  
ATOM   1296  H  HA2  . GLY A 1 1  ? 10.088  -16.970 -17.531 1.00 0.00 ? 1   GLY A HA2  3  
ATOM   1297  H  HA3  . GLY A 1 1  ? 10.929  -15.913 -16.407 1.00 0.00 ? 1   GLY A HA3  3  
ATOM   1298  N  N    . SER A 1 2  ? 9.522   -16.447 -14.364 1.00 0.00 ? 2   SER A N    3  
ATOM   1299  C  CA   . SER A 1 2  ? 8.915   -17.014 -13.166 1.00 0.00 ? 2   SER A CA   3  
ATOM   1300  C  C    . SER A 1 2  ? 7.724   -16.175 -12.712 1.00 0.00 ? 2   SER A C    3  
ATOM   1301  O  O    . SER A 1 2  ? 7.849   -15.323 -11.832 1.00 0.00 ? 2   SER A O    3  
ATOM   1302  C  CB   . SER A 1 2  ? 9.946   -17.107 -12.040 1.00 0.00 ? 2   SER A CB   3  
ATOM   1303  O  OG   . SER A 1 2  ? 10.447  -15.825 -11.700 1.00 0.00 ? 2   SER A OG   3  
ATOM   1304  H  H    . SER A 1 2  ? 10.146  -15.696 -14.275 1.00 0.00 ? 2   SER A H    3  
ATOM   1305  H  HA   . SER A 1 2  ? 8.569   -18.008 -13.408 1.00 0.00 ? 2   SER A HA   3  
ATOM   1306  H  HB2  . SER A 1 2  ? 9.484   -17.542 -11.167 1.00 0.00 ? 2   SER A HB2  3  
ATOM   1307  H  HB3  . SER A 1 2  ? 10.769  -17.729 -12.360 1.00 0.00 ? 2   SER A HB3  3  
ATOM   1308  H  HG   . SER A 1 2  ? 9.714   -15.232 -11.519 1.00 0.00 ? 2   SER A HG   3  
ATOM   1309  N  N    . SER A 1 3  ? 6.567   -16.424 -13.319 1.00 0.00 ? 3   SER A N    3  
ATOM   1310  C  CA   . SER A 1 3  ? 5.354   -15.690 -12.981 1.00 0.00 ? 3   SER A CA   3  
ATOM   1311  C  C    . SER A 1 3  ? 4.246   -16.643 -12.544 1.00 0.00 ? 3   SER A C    3  
ATOM   1312  O  O    . SER A 1 3  ? 3.387   -17.022 -13.339 1.00 0.00 ? 3   SER A O    3  
ATOM   1313  C  CB   . SER A 1 3  ? 4.884   -14.860 -14.178 1.00 0.00 ? 3   SER A CB   3  
ATOM   1314  O  OG   . SER A 1 3  ? 4.715   -15.672 -15.327 1.00 0.00 ? 3   SER A OG   3  
ATOM   1315  H  H    . SER A 1 3  ? 6.531   -17.116 -14.013 1.00 0.00 ? 3   SER A H    3  
ATOM   1316  H  HA   . SER A 1 3  ? 5.585   -15.025 -12.162 1.00 0.00 ? 3   SER A HA   3  
ATOM   1317  H  HB2  . SER A 1 3  ? 3.941   -14.392 -13.941 1.00 0.00 ? 3   SER A HB2  3  
ATOM   1318  H  HB3  . SER A 1 3  ? 5.620   -14.099 -14.395 1.00 0.00 ? 3   SER A HB3  3  
ATOM   1319  H  HG   . SER A 1 3  ? 5.574   -15.942 -15.658 1.00 0.00 ? 3   SER A HG   3  
ATOM   1320  N  N    . GLY A 1 4  ? 4.273   -17.028 -11.271 1.00 0.00 ? 4   GLY A N    3  
ATOM   1321  C  CA   . GLY A 1 4  ? 3.268   -17.934 -10.748 1.00 0.00 ? 4   GLY A CA   3  
ATOM   1322  C  C    . GLY A 1 4  ? 2.922   -17.645 -9.301  1.00 0.00 ? 4   GLY A C    3  
ATOM   1323  O  O    . GLY A 1 4  ? 1.791   -17.272 -8.988  1.00 0.00 ? 4   GLY A O    3  
ATOM   1324  H  H    . GLY A 1 4  ? 4.983   -16.694 -10.683 1.00 0.00 ? 4   GLY A H    3  
ATOM   1325  H  HA2  . GLY A 1 4  ? 2.373   -17.845 -11.346 1.00 0.00 ? 4   GLY A HA2  3  
ATOM   1326  H  HA3  . GLY A 1 4  ? 3.639   -18.946 -10.822 1.00 0.00 ? 4   GLY A HA3  3  
ATOM   1327  N  N    . SER A 1 5  ? 3.898   -17.817 -8.415  1.00 0.00 ? 5   SER A N    3  
ATOM   1328  C  CA   . SER A 1 5  ? 3.690   -17.576 -6.992  1.00 0.00 ? 5   SER A CA   3  
ATOM   1329  C  C    . SER A 1 5  ? 2.992   -16.239 -6.764  1.00 0.00 ? 5   SER A C    3  
ATOM   1330  O  O    . SER A 1 5  ? 3.318   -15.239 -7.402  1.00 0.00 ? 5   SER A O    3  
ATOM   1331  C  CB   . SER A 1 5  ? 5.027   -17.600 -6.248  1.00 0.00 ? 5   SER A CB   3  
ATOM   1332  O  OG   . SER A 1 5  ? 4.835   -17.461 -4.851  1.00 0.00 ? 5   SER A OG   3  
ATOM   1333  H  H    . SER A 1 5  ? 4.778   -18.115 -8.727  1.00 0.00 ? 5   SER A H    3  
ATOM   1334  H  HA   . SER A 1 5  ? 3.061   -18.367 -6.611  1.00 0.00 ? 5   SER A HA   3  
ATOM   1335  H  HB2  . SER A 1 5  ? 5.525   -18.538 -6.440  1.00 0.00 ? 5   SER A HB2  3  
ATOM   1336  H  HB3  . SER A 1 5  ? 5.645   -16.786 -6.598  1.00 0.00 ? 5   SER A HB3  3  
ATOM   1337  H  HG   . SER A 1 5  ? 4.334   -16.662 -4.675  1.00 0.00 ? 5   SER A HG   3  
ATOM   1338  N  N    . SER A 1 6  ? 2.028   -16.231 -5.848  1.00 0.00 ? 6   SER A N    3  
ATOM   1339  C  CA   . SER A 1 6  ? 1.280   -15.019 -5.537  1.00 0.00 ? 6   SER A CA   3  
ATOM   1340  C  C    . SER A 1 6  ? 0.973   -14.938 -4.044  1.00 0.00 ? 6   SER A C    3  
ATOM   1341  O  O    . SER A 1 6  ? 1.033   -15.939 -3.332  1.00 0.00 ? 6   SER A O    3  
ATOM   1342  C  CB   . SER A 1 6  ? -0.022  -14.977 -6.339  1.00 0.00 ? 6   SER A CB   3  
ATOM   1343  O  OG   . SER A 1 6  ? -0.798  -13.843 -5.994  1.00 0.00 ? 6   SER A OG   3  
ATOM   1344  H  H    . SER A 1 6  ? 1.814   -17.061 -5.373  1.00 0.00 ? 6   SER A H    3  
ATOM   1345  H  HA   . SER A 1 6  ? 1.891   -14.172 -5.813  1.00 0.00 ? 6   SER A HA   3  
ATOM   1346  H  HB2  . SER A 1 6  ? 0.209   -14.933 -7.393  1.00 0.00 ? 6   SER A HB2  3  
ATOM   1347  H  HB3  . SER A 1 6  ? -0.597  -15.868 -6.134  1.00 0.00 ? 6   SER A HB3  3  
ATOM   1348  H  HG   . SER A 1 6  ? -0.896  -13.800 -5.040  1.00 0.00 ? 6   SER A HG   3  
ATOM   1349  N  N    . GLY A 1 7  ? 0.644   -13.737 -3.578  1.00 0.00 ? 7   GLY A N    3  
ATOM   1350  C  CA   . GLY A 1 7  ? 0.333   -13.546 -2.174  1.00 0.00 ? 7   GLY A CA   3  
ATOM   1351  C  C    . GLY A 1 7  ? -0.544  -12.333 -1.934  1.00 0.00 ? 7   GLY A C    3  
ATOM   1352  O  O    . GLY A 1 7  ? -0.238  -11.494 -1.086  1.00 0.00 ? 7   GLY A O    3  
ATOM   1353  H  H    . GLY A 1 7  ? 0.613   -12.974 -4.193  1.00 0.00 ? 7   GLY A H    3  
ATOM   1354  H  HA2  . GLY A 1 7  ? -0.177  -14.424 -1.807  1.00 0.00 ? 7   GLY A HA2  3  
ATOM   1355  H  HA3  . GLY A 1 7  ? 1.256   -13.422 -1.626  1.00 0.00 ? 7   GLY A HA3  3  
ATOM   1356  N  N    . THR A 1 8  ? -1.637  -12.237 -2.684  1.00 0.00 ? 8   THR A N    3  
ATOM   1357  C  CA   . THR A 1 8  ? -2.560  -11.117 -2.551  1.00 0.00 ? 8   THR A CA   3  
ATOM   1358  C  C    . THR A 1 8  ? -3.682  -11.442 -1.572  1.00 0.00 ? 8   THR A C    3  
ATOM   1359  O  O    . THR A 1 8  ? -4.331  -10.544 -1.036  1.00 0.00 ? 8   THR A O    3  
ATOM   1360  C  CB   . THR A 1 8  ? -3.174  -10.731 -3.910  1.00 0.00 ? 8   THR A CB   3  
ATOM   1361  O  OG1  . THR A 1 8  ? -4.232  -9.785  -3.718  1.00 0.00 ? 8   THR A OG1  3  
ATOM   1362  C  CG2  . THR A 1 8  ? -3.709  -11.959 -4.630  1.00 0.00 ? 8   THR A CG2  3  
ATOM   1363  H  H    . THR A 1 8  ? -1.826  -12.938 -3.343  1.00 0.00 ? 8   THR A H    3  
ATOM   1364  H  HA   . THR A 1 8  ? -2.003  -10.269 -2.177  1.00 0.00 ? 8   THR A HA   3  
ATOM   1365  H  HB   . THR A 1 8  ? -2.405  -10.280 -4.520  1.00 0.00 ? 8   THR A HB   3  
ATOM   1366  H  HG1  . THR A 1 8  ? -3.921  -9.063  -3.167  1.00 0.00 ? 8   THR A HG1  3  
ATOM   1367  H  HG21 . THR A 1 8  ? -4.353  -11.649 -5.439  1.00 0.00 ? 8   THR A HG21 3  
ATOM   1368  H  HG22 . THR A 1 8  ? -4.271  -12.568 -3.936  1.00 0.00 ? 8   THR A HG22 3  
ATOM   1369  H  HG23 . THR A 1 8  ? -2.884  -12.532 -5.026  1.00 0.00 ? 8   THR A HG23 3  
ATOM   1370  N  N    . GLY A 1 9  ? -3.906  -12.732 -1.343  1.00 0.00 ? 9   GLY A N    3  
ATOM   1371  C  CA   . GLY A 1 9  ? -4.951  -13.152 -0.427  1.00 0.00 ? 9   GLY A CA   3  
ATOM   1372  C  C    . GLY A 1 9  ? -6.219  -12.336 -0.581  1.00 0.00 ? 9   GLY A C    3  
ATOM   1373  O  O    . GLY A 1 9  ? -6.638  -12.034 -1.697  1.00 0.00 ? 9   GLY A O    3  
ATOM   1374  H  H    . GLY A 1 9  ? -3.357  -13.404 -1.798  1.00 0.00 ? 9   GLY A H    3  
ATOM   1375  H  HA2  . GLY A 1 9  ? -5.179  -14.192 -0.612  1.00 0.00 ? 9   GLY A HA2  3  
ATOM   1376  H  HA3  . GLY A 1 9  ? -4.590  -13.048 0.585   1.00 0.00 ? 9   GLY A HA3  3  
ATOM   1377  N  N    . GLU A 1 10 ? -6.831  -11.980 0.544   1.00 0.00 ? 10  GLU A N    3  
ATOM   1378  C  CA   . GLU A 1 10 ? -8.061  -11.196 0.528   1.00 0.00 ? 10  GLU A CA   3  
ATOM   1379  C  C    . GLU A 1 10 ? -7.965  -10.015 1.490   1.00 0.00 ? 10  GLU A C    3  
ATOM   1380  O  O    . GLU A 1 10 ? -8.084  -10.179 2.704   1.00 0.00 ? 10  GLU A O    3  
ATOM   1381  C  CB   . GLU A 1 10 ? -9.257  -12.075 0.900   1.00 0.00 ? 10  GLU A CB   3  
ATOM   1382  C  CG   . GLU A 1 10 ? -10.570 -11.314 0.977   1.00 0.00 ? 10  GLU A CG   3  
ATOM   1383  C  CD   . GLU A 1 10 ? -10.935 -10.646 -0.334  1.00 0.00 ? 10  GLU A CD   3  
ATOM   1384  O  OE1  . GLU A 1 10 ? -10.334 -9.600  -0.656  1.00 0.00 ? 10  GLU A OE1  3  
ATOM   1385  O  OE2  . GLU A 1 10 ? -11.823 -11.170 -1.040  1.00 0.00 ? 10  GLU A OE2  3  
ATOM   1386  H  H    . GLU A 1 10 ? -6.448  -12.252 1.404   1.00 0.00 ? 10  GLU A H    3  
ATOM   1387  H  HA   . GLU A 1 10 ? -8.201  -10.819 -0.473  1.00 0.00 ? 10  GLU A HA   3  
ATOM   1388  H  HB2  . GLU A 1 10 ? -9.359  -12.855 0.160   1.00 0.00 ? 10  GLU A HB2  3  
ATOM   1389  H  HB3  . GLU A 1 10 ? -9.071  -12.527 1.863   1.00 0.00 ? 10  GLU A HB3  3  
ATOM   1390  H  HG2  . GLU A 1 10 ? -11.357 -12.005 1.242   1.00 0.00 ? 10  GLU A HG2  3  
ATOM   1391  H  HG3  . GLU A 1 10 ? -10.487 -10.554 1.740   1.00 0.00 ? 10  GLU A HG3  3  
ATOM   1392  N  N    . ASN A 1 11 ? -7.749  -8.826  0.938   1.00 0.00 ? 11  ASN A N    3  
ATOM   1393  C  CA   . ASN A 1 11 ? -7.636  -7.617  1.746   1.00 0.00 ? 11  ASN A CA   3  
ATOM   1394  C  C    . ASN A 1 11 ? -8.060  -6.388  0.948   1.00 0.00 ? 11  ASN A C    3  
ATOM   1395  O  O    . ASN A 1 11 ? -8.024  -6.373  -0.282  1.00 0.00 ? 11  ASN A O    3  
ATOM   1396  C  CB   . ASN A 1 11 ? -6.200  -7.445  2.246   1.00 0.00 ? 11  ASN A CB   3  
ATOM   1397  C  CG   . ASN A 1 11 ? -5.879  -8.363  3.409   1.00 0.00 ? 11  ASN A CG   3  
ATOM   1398  O  OD1  . ASN A 1 11 ? -6.170  -8.047  4.563   1.00 0.00 ? 11  ASN A OD1  3  
ATOM   1399  N  ND2  . ASN A 1 11 ? -5.274  -9.507  3.110   1.00 0.00 ? 11  ASN A ND2  3  
ATOM   1400  H  H    . ASN A 1 11 ? -7.663  -8.759  -0.036  1.00 0.00 ? 11  ASN A H    3  
ATOM   1401  H  HA   . ASN A 1 11 ? -8.293  -7.724  2.596   1.00 0.00 ? 11  ASN A HA   3  
ATOM   1402  H  HB2  . ASN A 1 11 ? -5.516  -7.665  1.439   1.00 0.00 ? 11  ASN A HB2  3  
ATOM   1403  H  HB3  . ASN A 1 11 ? -6.056  -6.424  2.565   1.00 0.00 ? 11  ASN A HB3  3  
ATOM   1404  H  HD21 . ASN A 1 11 ? -5.072  -9.692  2.169   1.00 0.00 ? 11  ASN A HD21 3  
ATOM   1405  H  HD22 . ASN A 1 11 ? -5.056  -10.119 3.843   1.00 0.00 ? 11  ASN A HD22 3  
ATOM   1406  N  N    . PRO A 1 12 ? -8.470  -5.330  1.664   1.00 0.00 ? 12  PRO A N    3  
ATOM   1407  C  CA   . PRO A 1 12 ? -8.907  -4.076  1.044   1.00 0.00 ? 12  PRO A CA   3  
ATOM   1408  C  C    . PRO A 1 12 ? -7.754  -3.315  0.398   1.00 0.00 ? 12  PRO A C    3  
ATOM   1409  O  O    . PRO A 1 12 ? -7.844  -2.891  -0.754  1.00 0.00 ? 12  PRO A O    3  
ATOM   1410  C  CB   . PRO A 1 12 ? -9.481  -3.280  2.219   1.00 0.00 ? 12  PRO A CB   3  
ATOM   1411  C  CG   . PRO A 1 12 ? -8.784  -3.821  3.419   1.00 0.00 ? 12  PRO A CG   3  
ATOM   1412  C  CD   . PRO A 1 12 ? -8.538  -5.277  3.134   1.00 0.00 ? 12  PRO A CD   3  
ATOM   1413  H  HA   . PRO A 1 12 ? -9.681  -4.245  0.309   1.00 0.00 ? 12  PRO A HA   3  
ATOM   1414  H  HB2  . PRO A 1 12 ? -9.273  -2.229  2.080   1.00 0.00 ? 12  PRO A HB2  3  
ATOM   1415  H  HB3  . PRO A 1 12 ? -10.548 -3.437  2.278   1.00 0.00 ? 12  PRO A HB3  3  
ATOM   1416  H  HG2  . PRO A 1 12 ? -7.848  -3.304  3.564   1.00 0.00 ? 12  PRO A HG2  3  
ATOM   1417  H  HG3  . PRO A 1 12 ? -9.414  -3.712  4.289   1.00 0.00 ? 12  PRO A HG3  3  
ATOM   1418  H  HD2  . PRO A 1 12 ? -7.605  -5.596  3.575   1.00 0.00 ? 12  PRO A HD2  3  
ATOM   1419  H  HD3  . PRO A 1 12 ? -9.357  -5.878  3.503   1.00 0.00 ? 12  PRO A HD3  3  
ATOM   1420  N  N    . PHE A 1 13 ? -6.669  -3.147  1.148   1.00 0.00 ? 13  PHE A N    3  
ATOM   1421  C  CA   . PHE A 1 13 ? -5.498  -2.437  0.649   1.00 0.00 ? 13  PHE A CA   3  
ATOM   1422  C  C    . PHE A 1 13 ? -4.235  -2.892  1.375   1.00 0.00 ? 13  PHE A C    3  
ATOM   1423  O  O    . PHE A 1 13 ? -4.244  -3.092  2.590   1.00 0.00 ? 13  PHE A O    3  
ATOM   1424  C  CB   . PHE A 1 13 ? -5.680  -0.927  0.817   1.00 0.00 ? 13  PHE A CB   3  
ATOM   1425  C  CG   . PHE A 1 13 ? -7.019  -0.429  0.351   1.00 0.00 ? 13  PHE A CG   3  
ATOM   1426  C  CD1  . PHE A 1 13 ? -7.332  -0.402  -0.998  1.00 0.00 ? 13  PHE A CD1  3  
ATOM   1427  C  CD2  . PHE A 1 13 ? -7.965  0.010   1.263   1.00 0.00 ? 13  PHE A CD2  3  
ATOM   1428  C  CE1  . PHE A 1 13 ? -8.562  0.056   -1.429  1.00 0.00 ? 13  PHE A CE1  3  
ATOM   1429  C  CE2  . PHE A 1 13 ? -9.197  0.469   0.839   1.00 0.00 ? 13  PHE A CE2  3  
ATOM   1430  C  CZ   . PHE A 1 13 ? -9.497  0.491   -0.509  1.00 0.00 ? 13  PHE A CZ   3  
ATOM   1431  H  H    . PHE A 1 13 ? -6.657  -3.509  2.059   1.00 0.00 ? 13  PHE A H    3  
ATOM   1432  H  HA   . PHE A 1 13 ? -5.396  -2.664  -0.401  1.00 0.00 ? 13  PHE A HA   3  
ATOM   1433  H  HB2  . PHE A 1 13 ? -5.577  -0.673  1.861   1.00 0.00 ? 13  PHE A HB2  3  
ATOM   1434  H  HB3  . PHE A 1 13 ? -4.918  -0.414  0.249   1.00 0.00 ? 13  PHE A HB3  3  
ATOM   1435  H  HD1  . PHE A 1 13 ? -6.602  -0.742  -1.719  1.00 0.00 ? 13  PHE A HD1  3  
ATOM   1436  H  HD2  . PHE A 1 13 ? -7.731  -0.007  2.319   1.00 0.00 ? 13  PHE A HD2  3  
ATOM   1437  H  HE1  . PHE A 1 13 ? -8.794  0.072   -2.484  1.00 0.00 ? 13  PHE A HE1  3  
ATOM   1438  H  HE2  . PHE A 1 13 ? -9.926  0.808   1.560   1.00 0.00 ? 13  PHE A HE2  3  
ATOM   1439  H  HZ   . PHE A 1 13 ? -10.459 0.850   -0.844  1.00 0.00 ? 13  PHE A HZ   3  
ATOM   1440  N  N    . ILE A 1 14 ? -3.153  -3.053  0.622   1.00 0.00 ? 14  ILE A N    3  
ATOM   1441  C  CA   . ILE A 1 14 ? -1.883  -3.484  1.194   1.00 0.00 ? 14  ILE A CA   3  
ATOM   1442  C  C    . ILE A 1 14 ? -0.758  -2.523  0.822   1.00 0.00 ? 14  ILE A C    3  
ATOM   1443  O  O    . ILE A 1 14 ? -0.716  -2.001  -0.293  1.00 0.00 ? 14  ILE A O    3  
ATOM   1444  C  CB   . ILE A 1 14 ? -1.507  -4.902  0.725   1.00 0.00 ? 14  ILE A CB   3  
ATOM   1445  C  CG1  . ILE A 1 14 ? -2.374  -5.944  1.435   1.00 0.00 ? 14  ILE A CG1  3  
ATOM   1446  C  CG2  . ILE A 1 14 ? -0.031  -5.170  0.980   1.00 0.00 ? 14  ILE A CG2  3  
ATOM   1447  C  CD1  . ILE A 1 14 ? -2.122  -6.026  2.924   1.00 0.00 ? 14  ILE A CD1  3  
ATOM   1448  H  H    . ILE A 1 14 ? -3.209  -2.878  -0.340  1.00 0.00 ? 14  ILE A H    3  
ATOM   1449  H  HA   . ILE A 1 14 ? -1.989  -3.498  2.269   1.00 0.00 ? 14  ILE A HA   3  
ATOM   1450  H  HB   . ILE A 1 14 ? -1.680  -4.964  -0.338  1.00 0.00 ? 14  ILE A HB   3  
ATOM   1451  H  HG12 . ILE A 1 14 ? -3.414  -5.699  1.288   1.00 0.00 ? 14  ILE A HG12 3  
ATOM   1452  H  HG13 . ILE A 1 14 ? -2.174  -6.917  1.010   1.00 0.00 ? 14  ILE A HG13 3  
ATOM   1453  H  HG21 . ILE A 1 14 ? 0.139   -6.236  1.021   1.00 0.00 ? 14  ILE A HG21 3  
ATOM   1454  H  HG22 . ILE A 1 14 ? 0.556   -4.743  0.181   1.00 0.00 ? 14  ILE A HG22 3  
ATOM   1455  H  HG23 . ILE A 1 14 ? 0.259   -4.724  1.919   1.00 0.00 ? 14  ILE A HG23 3  
ATOM   1456  H  HD11 . ILE A 1 14 ? -2.937  -5.552  3.453   1.00 0.00 ? 14  ILE A HD11 3  
ATOM   1457  H  HD12 . ILE A 1 14 ? -2.057  -7.062  3.222   1.00 0.00 ? 14  ILE A HD12 3  
ATOM   1458  H  HD13 . ILE A 1 14 ? -1.198  -5.523  3.162   1.00 0.00 ? 14  ILE A HD13 3  
ATOM   1459  N  N    . CYS A 1 15 ? 0.152   -2.295  1.762   1.00 0.00 ? 15  CYS A N    3  
ATOM   1460  C  CA   . CYS A 1 15 ? 1.279   -1.398  1.535   1.00 0.00 ? 15  CYS A CA   3  
ATOM   1461  C  C    . CYS A 1 15 ? 2.499   -2.171  1.043   1.00 0.00 ? 15  CYS A C    3  
ATOM   1462  O  O    . CYS A 1 15 ? 3.386   -2.513  1.825   1.00 0.00 ? 15  CYS A O    3  
ATOM   1463  C  CB   . CYS A 1 15 ? 1.623   -0.642  2.820   1.00 0.00 ? 15  CYS A CB   3  
ATOM   1464  S  SG   . CYS A 1 15 ? 2.652   0.839   2.558   1.00 0.00 ? 15  CYS A SG   3  
ATOM   1465  H  H    . CYS A 1 15 ? 0.064   -2.740  2.632   1.00 0.00 ? 15  CYS A H    3  
ATOM   1466  H  HA   . CYS A 1 15 ? 0.989   -0.687  0.776   1.00 0.00 ? 15  CYS A HA   3  
ATOM   1467  H  HB2  . CYS A 1 15 ? 0.708   -0.325  3.298   1.00 0.00 ? 15  CYS A HB2  3  
ATOM   1468  H  HB3  . CYS A 1 15 ? 2.161   -1.303  3.484   1.00 0.00 ? 15  CYS A HB3  3  
ATOM   1469  N  N    . SER A 1 16 ? 2.536   -2.443  -0.257  1.00 0.00 ? 16  SER A N    3  
ATOM   1470  C  CA   . SER A 1 16 ? 3.645   -3.179  -0.853  1.00 0.00 ? 16  SER A CA   3  
ATOM   1471  C  C    . SER A 1 16 ? 4.976   -2.736  -0.253  1.00 0.00 ? 16  SER A C    3  
ATOM   1472  O  O    . SER A 1 16 ? 5.948   -3.490  -0.249  1.00 0.00 ? 16  SER A O    3  
ATOM   1473  C  CB   . SER A 1 16 ? 3.663   -2.976  -2.369  1.00 0.00 ? 16  SER A CB   3  
ATOM   1474  O  OG   . SER A 1 16 ? 4.612   -3.829  -2.987  1.00 0.00 ? 16  SER A OG   3  
ATOM   1475  H  H    . SER A 1 16 ? 1.798   -2.144  -0.829  1.00 0.00 ? 16  SER A H    3  
ATOM   1476  H  HA   . SER A 1 16 ? 3.499   -4.228  -0.640  1.00 0.00 ? 16  SER A HA   3  
ATOM   1477  H  HB2  . SER A 1 16 ? 2.685   -3.194  -2.771  1.00 0.00 ? 16  SER A HB2  3  
ATOM   1478  H  HB3  . SER A 1 16 ? 3.922   -1.950  -2.589  1.00 0.00 ? 16  SER A HB3  3  
ATOM   1479  H  HG   . SER A 1 16 ? 5.248   -3.301  -3.474  1.00 0.00 ? 16  SER A HG   3  
ATOM   1480  N  N    . GLU A 1 17 ? 5.010   -1.507  0.253   1.00 0.00 ? 17  GLU A N    3  
ATOM   1481  C  CA   . GLU A 1 17 ? 6.221   -0.962  0.855   1.00 0.00 ? 17  GLU A CA   3  
ATOM   1482  C  C    . GLU A 1 17 ? 6.587   -1.724  2.125   1.00 0.00 ? 17  GLU A C    3  
ATOM   1483  O  O    . GLU A 1 17 ? 7.632   -2.373  2.194   1.00 0.00 ? 17  GLU A O    3  
ATOM   1484  C  CB   . GLU A 1 17 ? 6.035   0.523   1.174   1.00 0.00 ? 17  GLU A CB   3  
ATOM   1485  C  CG   . GLU A 1 17 ? 6.336   1.440   -0.000  1.00 0.00 ? 17  GLU A CG   3  
ATOM   1486  C  CD   . GLU A 1 17 ? 5.350   1.272   -1.139  1.00 0.00 ? 17  GLU A CD   3  
ATOM   1487  O  OE1  . GLU A 1 17 ? 4.268   1.893   -1.083  1.00 0.00 ? 17  GLU A OE1  3  
ATOM   1488  O  OE2  . GLU A 1 17 ? 5.659   0.519   -2.087  1.00 0.00 ? 17  GLU A OE2  3  
ATOM   1489  H  H    . GLU A 1 17 ? 4.201   -0.953  0.220   1.00 0.00 ? 17  GLU A H    3  
ATOM   1490  H  HA   . GLU A 1 17 ? 7.023   -1.070  0.141   1.00 0.00 ? 17  GLU A HA   3  
ATOM   1491  H  HB2  . GLU A 1 17 ? 5.013   0.688   1.480   1.00 0.00 ? 17  GLU A HB2  3  
ATOM   1492  H  HB3  . GLU A 1 17 ? 6.693   0.788   1.988   1.00 0.00 ? 17  GLU A HB3  3  
ATOM   1493  H  HG2  . GLU A 1 17 ? 6.298   2.464   0.340   1.00 0.00 ? 17  GLU A HG2  3  
ATOM   1494  H  HG3  . GLU A 1 17 ? 7.328   1.220   -0.367  1.00 0.00 ? 17  GLU A HG3  3  
ATOM   1495  N  N    . CYS A 1 18 ? 5.721   -1.641  3.128   1.00 0.00 ? 18  CYS A N    3  
ATOM   1496  C  CA   . CYS A 1 18 ? 5.952   -2.321  4.397   1.00 0.00 ? 18  CYS A CA   3  
ATOM   1497  C  C    . CYS A 1 18 ? 5.144   -3.613  4.477   1.00 0.00 ? 18  CYS A C    3  
ATOM   1498  O  O    . CYS A 1 18 ? 5.662   -4.659  4.867   1.00 0.00 ? 18  CYS A O    3  
ATOM   1499  C  CB   . CYS A 1 18 ? 5.584   -1.404  5.566   1.00 0.00 ? 18  CYS A CB   3  
ATOM   1500  S  SG   . CYS A 1 18 ? 3.807   -1.019  5.677   1.00 0.00 ? 18  CYS A SG   3  
ATOM   1501  H  H    . CYS A 1 18 ? 4.905   -1.109  3.013   1.00 0.00 ? 18  CYS A H    3  
ATOM   1502  H  HA   . CYS A 1 18 ? 7.002   -2.563  4.458   1.00 0.00 ? 18  CYS A HA   3  
ATOM   1503  H  HB2  . CYS A 1 18 ? 5.875   -1.879  6.491   1.00 0.00 ? 18  CYS A HB2  3  
ATOM   1504  H  HB3  . CYS A 1 18 ? 6.117   -0.471  5.463   1.00 0.00 ? 18  CYS A HB3  3  
ATOM   1505  N  N    . GLY A 1 19 ? 3.870   -3.533  4.103   1.00 0.00 ? 19  GLY A N    3  
ATOM   1506  C  CA   . GLY A 1 19 ? 3.011   -4.702  4.139   1.00 0.00 ? 19  GLY A CA   3  
ATOM   1507  C  C    . GLY A 1 19 ? 1.912   -4.582  5.176   1.00 0.00 ? 19  GLY A C    3  
ATOM   1508  O  O    . GLY A 1 19 ? 1.579   -5.554  5.854   1.00 0.00 ? 19  GLY A O    3  
ATOM   1509  H  H    . GLY A 1 19 ? 3.511   -2.673  3.800   1.00 0.00 ? 19  GLY A H    3  
ATOM   1510  H  HA2  . GLY A 1 19 ? 2.562   -4.835  3.166   1.00 0.00 ? 19  GLY A HA2  3  
ATOM   1511  H  HA3  . GLY A 1 19 ? 3.613   -5.570  4.368   1.00 0.00 ? 19  GLY A HA3  3  
ATOM   1512  N  N    . LYS A 1 20 ? 1.347   -3.386  5.301   1.00 0.00 ? 20  LYS A N    3  
ATOM   1513  C  CA   . LYS A 1 20 ? 0.279   -3.141  6.263   1.00 0.00 ? 20  LYS A CA   3  
ATOM   1514  C  C    . LYS A 1 20 ? -1.070  -3.027  5.561   1.00 0.00 ? 20  LYS A C    3  
ATOM   1515  O  O    . LYS A 1 20 ? -1.149  -2.583  4.415   1.00 0.00 ? 20  LYS A O    3  
ATOM   1516  C  CB   . LYS A 1 20 ? 0.563   -1.864  7.057   1.00 0.00 ? 20  LYS A CB   3  
ATOM   1517  C  CG   . LYS A 1 20 ? -0.006  -1.884  8.465   1.00 0.00 ? 20  LYS A CG   3  
ATOM   1518  C  CD   . LYS A 1 20 ? 0.421   -0.659  9.257   1.00 0.00 ? 20  LYS A CD   3  
ATOM   1519  C  CE   . LYS A 1 20 ? 0.311   -0.897  10.755  1.00 0.00 ? 20  LYS A CE   3  
ATOM   1520  N  NZ   . LYS A 1 20 ? 0.643   0.326   11.537  1.00 0.00 ? 20  LYS A NZ   3  
ATOM   1521  H  H    . LYS A 1 20 ? 1.656   -2.650  4.732   1.00 0.00 ? 20  LYS A H    3  
ATOM   1522  H  HA   . LYS A 1 20 ? 0.247   -3.978  6.944   1.00 0.00 ? 20  LYS A HA   3  
ATOM   1523  H  HB2  . LYS A 1 20 ? 1.632   -1.727  7.125   1.00 0.00 ? 20  LYS A HB2  3  
ATOM   1524  H  HB3  . LYS A 1 20 ? 0.134   -1.024  6.530   1.00 0.00 ? 20  LYS A HB3  3  
ATOM   1525  H  HG2  . LYS A 1 20 ? -1.084  -1.904  8.408   1.00 0.00 ? 20  LYS A HG2  3  
ATOM   1526  H  HG3  . LYS A 1 20 ? 0.346   -2.770  8.973   1.00 0.00 ? 20  LYS A HG3  3  
ATOM   1527  H  HD2  . LYS A 1 20 ? 1.447   -0.425  9.015   1.00 0.00 ? 20  LYS A HD2  3  
ATOM   1528  H  HD3  . LYS A 1 20 ? -0.213  0.173   8.986   1.00 0.00 ? 20  LYS A HD3  3  
ATOM   1529  H  HE2  . LYS A 1 20 ? -0.699  -1.198  10.985  1.00 0.00 ? 20  LYS A HE2  3  
ATOM   1530  H  HE3  . LYS A 1 20 ? 0.994   -1.687  11.031  1.00 0.00 ? 20  LYS A HE3  3  
ATOM   1531  H  HZ1  . LYS A 1 20 ? 0.554   1.170   10.935  1.00 0.00 ? 20  LYS A HZ1  3  
ATOM   1532  H  HZ2  . LYS A 1 20 ? 1.618   0.268   11.893  1.00 0.00 ? 20  LYS A HZ2  3  
ATOM   1533  H  HZ3  . LYS A 1 20 ? -0.005  0.420   12.345  1.00 0.00 ? 20  LYS A HZ3  3  
ATOM   1534  N  N    . VAL A 1 21 ? -2.130  -3.428  6.256   1.00 0.00 ? 21  VAL A N    3  
ATOM   1535  C  CA   . VAL A 1 21 ? -3.476  -3.367  5.700   1.00 0.00 ? 21  VAL A CA   3  
ATOM   1536  C  C    . VAL A 1 21 ? -4.297  -2.270  6.366   1.00 0.00 ? 21  VAL A C    3  
ATOM   1537  O  O    . VAL A 1 21 ? -4.335  -2.166  7.593   1.00 0.00 ? 21  VAL A O    3  
ATOM   1538  C  CB   . VAL A 1 21 ? -4.210  -4.712  5.860   1.00 0.00 ? 21  VAL A CB   3  
ATOM   1539  C  CG1  . VAL A 1 21 ? -4.272  -5.115  7.325   1.00 0.00 ? 21  VAL A CG1  3  
ATOM   1540  C  CG2  . VAL A 1 21 ? -5.606  -4.631  5.261   1.00 0.00 ? 21  VAL A CG2  3  
ATOM   1541  H  H    . VAL A 1 21 ? -2.003  -3.772  7.165   1.00 0.00 ? 21  VAL A H    3  
ATOM   1542  H  HA   . VAL A 1 21 ? -3.392  -3.150  4.645   1.00 0.00 ? 21  VAL A HA   3  
ATOM   1543  H  HB   . VAL A 1 21 ? -3.655  -5.468  5.325   1.00 0.00 ? 21  VAL A HB   3  
ATOM   1544  H  HG11 . VAL A 1 21 ? -4.641  -6.128  7.404   1.00 0.00 ? 21  VAL A HG11 3  
ATOM   1545  H  HG12 . VAL A 1 21 ? -3.284  -5.055  7.758   1.00 0.00 ? 21  VAL A HG12 3  
ATOM   1546  H  HG13 . VAL A 1 21 ? -4.938  -4.449  7.854   1.00 0.00 ? 21  VAL A HG13 3  
ATOM   1547  H  HG21 . VAL A 1 21 ? -6.164  -5.517  5.525   1.00 0.00 ? 21  VAL A HG21 3  
ATOM   1548  H  HG22 . VAL A 1 21 ? -6.112  -3.758  5.646   1.00 0.00 ? 21  VAL A HG22 3  
ATOM   1549  H  HG23 . VAL A 1 21 ? -5.533  -4.559  4.185   1.00 0.00 ? 21  VAL A HG23 3  
ATOM   1550  N  N    . PHE A 1 22 ? -4.955  -1.452  5.551   1.00 0.00 ? 22  PHE A N    3  
ATOM   1551  C  CA   . PHE A 1 22 ? -5.776  -0.361  6.061   1.00 0.00 ? 22  PHE A CA   3  
ATOM   1552  C  C    . PHE A 1 22 ? -7.218  -0.493  5.578   1.00 0.00 ? 22  PHE A C    3  
ATOM   1553  O  O    . PHE A 1 22 ? -7.482  -1.083  4.529   1.00 0.00 ? 22  PHE A O    3  
ATOM   1554  C  CB   . PHE A 1 22 ? -5.201  0.987   5.623   1.00 0.00 ? 22  PHE A CB   3  
ATOM   1555  C  CG   . PHE A 1 22 ? -3.743  1.150   5.945   1.00 0.00 ? 22  PHE A CG   3  
ATOM   1556  C  CD1  . PHE A 1 22 ? -2.776  0.519   5.180   1.00 0.00 ? 22  PHE A CD1  3  
ATOM   1557  C  CD2  . PHE A 1 22 ? -3.340  1.935   7.014   1.00 0.00 ? 22  PHE A CD2  3  
ATOM   1558  C  CE1  . PHE A 1 22 ? -1.434  0.666   5.476   1.00 0.00 ? 22  PHE A CE1  3  
ATOM   1559  C  CE2  . PHE A 1 22 ? -1.999  2.087   7.314   1.00 0.00 ? 22  PHE A CE2  3  
ATOM   1560  C  CZ   . PHE A 1 22 ? -1.045  1.452   6.543   1.00 0.00 ? 22  PHE A CZ   3  
ATOM   1561  H  H    . PHE A 1 22 ? -4.885  -1.586  4.582   1.00 0.00 ? 22  PHE A H    3  
ATOM   1562  H  HA   . PHE A 1 22 ? -5.765  -0.414  7.139   1.00 0.00 ? 22  PHE A HA   3  
ATOM   1563  H  HB2  . PHE A 1 22 ? -5.317  1.090   4.554   1.00 0.00 ? 22  PHE A HB2  3  
ATOM   1564  H  HB3  . PHE A 1 22 ? -5.742  1.780   6.117   1.00 0.00 ? 22  PHE A HB3  3  
ATOM   1565  H  HD1  . PHE A 1 22 ? -3.078  -0.095  4.345   1.00 0.00 ? 22  PHE A HD1  3  
ATOM   1566  H  HD2  . PHE A 1 22 ? -4.086  2.432   7.617   1.00 0.00 ? 22  PHE A HD2  3  
ATOM   1567  H  HE1  . PHE A 1 22 ? -0.689  0.169   4.871   1.00 0.00 ? 22  PHE A HE1  3  
ATOM   1568  H  HE2  . PHE A 1 22 ? -1.699  2.702   8.149   1.00 0.00 ? 22  PHE A HE2  3  
ATOM   1569  H  HZ   . PHE A 1 22 ? 0.003   1.569   6.776   1.00 0.00 ? 22  PHE A HZ   3  
ATOM   1570  N  N    . THR A 1 23 ? -8.148  0.061   6.350   1.00 0.00 ? 23  THR A N    3  
ATOM   1571  C  CA   . THR A 1 23 ? -9.562  0.005   6.002   1.00 0.00 ? 23  THR A CA   3  
ATOM   1572  C  C    . THR A 1 23 ? -9.910  1.043   4.942   1.00 0.00 ? 23  THR A C    3  
ATOM   1573  O  O    . THR A 1 23 ? -10.650 0.759   4.000   1.00 0.00 ? 23  THR A O    3  
ATOM   1574  C  CB   . THR A 1 23 ? -10.453 0.231   7.238   1.00 0.00 ? 23  THR A CB   3  
ATOM   1575  O  OG1  . THR A 1 23 ? -9.936  -0.500  8.356   1.00 0.00 ? 23  THR A OG1  3  
ATOM   1576  C  CG2  . THR A 1 23 ? -11.885 -0.203  6.960   1.00 0.00 ? 23  THR A CG2  3  
ATOM   1577  H  H    . THR A 1 23 ? -7.874  0.517   7.173   1.00 0.00 ? 23  THR A H    3  
ATOM   1578  H  HA   . THR A 1 23 ? -9.770  -0.980  5.610   1.00 0.00 ? 23  THR A HA   3  
ATOM   1579  H  HB   . THR A 1 23 ? -10.452 1.285   7.476   1.00 0.00 ? 23  THR A HB   3  
ATOM   1580  H  HG1  . THR A 1 23 ? -10.329 -0.166  9.166   1.00 0.00 ? 23  THR A HG1  3  
ATOM   1581  H  HG21 . THR A 1 23 ? -12.505 0.670   6.823   1.00 0.00 ? 23  THR A HG21 3  
ATOM   1582  H  HG22 . THR A 1 23 ? -12.255 -0.780  7.795   1.00 0.00 ? 23  THR A HG22 3  
ATOM   1583  H  HG23 . THR A 1 23 ? -11.910 -0.806  6.065   1.00 0.00 ? 23  THR A HG23 3  
ATOM   1584  N  N    . HIS A 1 24 ? -9.371  2.248   5.101   1.00 0.00 ? 24  HIS A N    3  
ATOM   1585  C  CA   . HIS A 1 24 ? -9.624  3.329   4.155   1.00 0.00 ? 24  HIS A CA   3  
ATOM   1586  C  C    . HIS A 1 24 ? -8.330  3.772   3.478   1.00 0.00 ? 24  HIS A C    3  
ATOM   1587  O  O    . HIS A 1 24 ? -7.353  4.113   4.145   1.00 0.00 ? 24  HIS A O    3  
ATOM   1588  C  CB   . HIS A 1 24 ? -10.273 4.516   4.867   1.00 0.00 ? 24  HIS A CB   3  
ATOM   1589  C  CG   . HIS A 1 24 ? -11.188 5.313   3.990   1.00 0.00 ? 24  HIS A CG   3  
ATOM   1590  N  ND1  . HIS A 1 24 ? -10.755 6.358   3.201   1.00 0.00 ? 24  HIS A ND1  3  
ATOM   1591  C  CD2  . HIS A 1 24 ? -12.521 5.212   3.778   1.00 0.00 ? 24  HIS A CD2  3  
ATOM   1592  C  CE1  . HIS A 1 24 ? -11.781 6.866   2.544   1.00 0.00 ? 24  HIS A CE1  3  
ATOM   1593  N  NE2  . HIS A 1 24 ? -12.865 6.189   2.876   1.00 0.00 ? 24  HIS A NE2  3  
ATOM   1594  H  H    . HIS A 1 24 ? -8.789  2.413   5.872   1.00 0.00 ? 24  HIS A H    3  
ATOM   1595  H  HA   . HIS A 1 24 ? -10.301 2.959   3.401   1.00 0.00 ? 24  HIS A HA   3  
ATOM   1596  H  HB2  . HIS A 1 24 ? -10.850 4.154   5.705   1.00 0.00 ? 24  HIS A HB2  3  
ATOM   1597  H  HB3  . HIS A 1 24 ? -9.499  5.178   5.229   1.00 0.00 ? 24  HIS A HB3  3  
ATOM   1598  H  HD1  . HIS A 1 24 ? -9.832  6.680   3.135   1.00 0.00 ? 24  HIS A HD1  3  
ATOM   1599  H  HD2  . HIS A 1 24 ? -13.191 4.497   4.234   1.00 0.00 ? 24  HIS A HD2  3  
ATOM   1600  H  HE1  . HIS A 1 24 ? -11.742 7.695   1.852   1.00 0.00 ? 24  HIS A HE1  3  
ATOM   1601  N  N    . LYS A 1 25 ? -8.331  3.764   2.149   1.00 0.00 ? 25  LYS A N    3  
ATOM   1602  C  CA   . LYS A 1 25 ? -7.159  4.165   1.381   1.00 0.00 ? 25  LYS A CA   3  
ATOM   1603  C  C    . LYS A 1 25 ? -6.482  5.377   2.013   1.00 0.00 ? 25  LYS A C    3  
ATOM   1604  O  O    . LYS A 1 25 ? -5.276  5.368   2.264   1.00 0.00 ? 25  LYS A O    3  
ATOM   1605  C  CB   . LYS A 1 25 ? -7.555  4.485   -0.063  1.00 0.00 ? 25  LYS A CB   3  
ATOM   1606  C  CG   . LYS A 1 25 ? -7.485  3.286   -0.992  1.00 0.00 ? 25  LYS A CG   3  
ATOM   1607  C  CD   . LYS A 1 25 ? -7.506  3.709   -2.451  1.00 0.00 ? 25  LYS A CD   3  
ATOM   1608  C  CE   . LYS A 1 25 ? -8.925  3.961   -2.938  1.00 0.00 ? 25  LYS A CE   3  
ATOM   1609  N  NZ   . LYS A 1 25 ? -9.552  2.725   -3.482  1.00 0.00 ? 25  LYS A NZ   3  
ATOM   1610  H  H    . LYS A 1 25 ? -9.141  3.483   1.674   1.00 0.00 ? 25  LYS A H    3  
ATOM   1611  H  HA   . LYS A 1 25 ? -6.464  3.339   1.380   1.00 0.00 ? 25  LYS A HA   3  
ATOM   1612  H  HB2  . LYS A 1 25 ? -8.567  4.862   -0.071  1.00 0.00 ? 25  LYS A HB2  3  
ATOM   1613  H  HB3  . LYS A 1 25 ? -6.892  5.249   -0.444  1.00 0.00 ? 25  LYS A HB3  3  
ATOM   1614  H  HG2  . LYS A 1 25 ? -6.571  2.744   -0.799  1.00 0.00 ? 25  LYS A HG2  3  
ATOM   1615  H  HG3  . LYS A 1 25 ? -8.333  2.644   -0.801  1.00 0.00 ? 25  LYS A HG3  3  
ATOM   1616  H  HD2  . LYS A 1 25 ? -6.933  4.618   -2.562  1.00 0.00 ? 25  LYS A HD2  3  
ATOM   1617  H  HD3  . LYS A 1 25 ? -7.062  2.927   -3.051  1.00 0.00 ? 25  LYS A HD3  3  
ATOM   1618  H  HE2  . LYS A 1 25 ? -9.517  4.321   -2.111  1.00 0.00 ? 25  LYS A HE2  3  
ATOM   1619  H  HE3  . LYS A 1 25 ? -8.897  4.711   -3.715  1.00 0.00 ? 25  LYS A HE3  3  
ATOM   1620  H  HZ1  . LYS A 1 25 ? -10.496 2.940   -3.862  1.00 0.00 ? 25  LYS A HZ1  3  
ATOM   1621  H  HZ2  . LYS A 1 25 ? -9.648  2.012   -2.729  1.00 0.00 ? 25  LYS A HZ2  3  
ATOM   1622  H  HZ3  . LYS A 1 25 ? -8.965  2.331   -4.243  1.00 0.00 ? 25  LYS A HZ3  3  
ATOM   1623  N  N    . THR A 1 26 ? -7.265  6.420   2.271   1.00 0.00 ? 26  THR A N    3  
ATOM   1624  C  CA   . THR A 1 26 ? -6.742  7.639   2.875   1.00 0.00 ? 26  THR A CA   3  
ATOM   1625  C  C    . THR A 1 26 ? -5.685  7.321   3.927   1.00 0.00 ? 26  THR A C    3  
ATOM   1626  O  O    . THR A 1 26 ? -4.652  7.985   4.002   1.00 0.00 ? 26  THR A O    3  
ATOM   1627  C  CB   . THR A 1 26 ? -7.863  8.470   3.525   1.00 0.00 ? 26  THR A CB   3  
ATOM   1628  O  OG1  . THR A 1 26 ? -7.487  9.851   3.569   1.00 0.00 ? 26  THR A OG1  3  
ATOM   1629  C  CG2  . THR A 1 26 ? -8.157  7.975   4.933   1.00 0.00 ? 26  THR A CG2  3  
ATOM   1630  H  H    . THR A 1 26 ? -8.218  6.367   2.049   1.00 0.00 ? 26  THR A H    3  
ATOM   1631  H  HA   . THR A 1 26 ? -6.290  8.231   2.092   1.00 0.00 ? 26  THR A HA   3  
ATOM   1632  H  HB   . THR A 1 26 ? -8.759  8.367   2.929   1.00 0.00 ? 26  THR A HB   3  
ATOM   1633  H  HG1  . THR A 1 26 ? -7.573  10.234  2.692   1.00 0.00 ? 26  THR A HG1  3  
ATOM   1634  H  HG21 . THR A 1 26 ? -7.317  8.194   5.574   1.00 0.00 ? 26  THR A HG21 3  
ATOM   1635  H  HG22 . THR A 1 26 ? -8.325  6.908   4.912   1.00 0.00 ? 26  THR A HG22 3  
ATOM   1636  H  HG23 . THR A 1 26 ? -9.038  8.470   5.313   1.00 0.00 ? 26  THR A HG23 3  
ATOM   1637  N  N    . ASN A 1 27 ? -5.950  6.301   4.736   1.00 0.00 ? 27  ASN A N    3  
ATOM   1638  C  CA   . ASN A 1 27 ? -5.021  5.895   5.784   1.00 0.00 ? 27  ASN A CA   3  
ATOM   1639  C  C    . ASN A 1 27 ? -3.739  5.326   5.184   1.00 0.00 ? 27  ASN A C    3  
ATOM   1640  O  O    . ASN A 1 27 ? -2.642  5.575   5.686   1.00 0.00 ? 27  ASN A O    3  
ATOM   1641  C  CB   . ASN A 1 27 ? -5.673  4.857   6.700   1.00 0.00 ? 27  ASN A CB   3  
ATOM   1642  C  CG   . ASN A 1 27 ? -6.442  5.494   7.841   1.00 0.00 ? 27  ASN A CG   3  
ATOM   1643  O  OD1  . ASN A 1 27 ? -7.673  5.490   7.854   1.00 0.00 ? 27  ASN A OD1  3  
ATOM   1644  N  ND2  . ASN A 1 27 ? -5.717  6.046   8.807   1.00 0.00 ? 27  ASN A ND2  3  
ATOM   1645  H  H    . ASN A 1 27 ? -6.791  5.810   4.627   1.00 0.00 ? 27  ASN A H    3  
ATOM   1646  H  HA   . ASN A 1 27 ? -4.775  6.771   6.366   1.00 0.00 ? 27  ASN A HA   3  
ATOM   1647  H  HB2  . ASN A 1 27 ? -6.360  4.256   6.121   1.00 0.00 ? 27  ASN A HB2  3  
ATOM   1648  H  HB3  . ASN A 1 27 ? -4.907  4.221   7.116   1.00 0.00 ? 27  ASN A HB3  3  
ATOM   1649  H  HD21 . ASN A 1 27 ? -4.740  6.011   8.731   1.00 0.00 ? 27  ASN A HD21 3  
ATOM   1650  H  HD22 . ASN A 1 27 ? -6.188  6.464   9.558   1.00 0.00 ? 27  ASN A HD22 3  
ATOM   1651  N  N    . LEU A 1 28 ? -3.885  4.562   4.108   1.00 0.00 ? 28  LEU A N    3  
ATOM   1652  C  CA   . LEU A 1 28 ? -2.738  3.958   3.438   1.00 0.00 ? 28  LEU A CA   3  
ATOM   1653  C  C    . LEU A 1 28 ? -1.947  5.006   2.662   1.00 0.00 ? 28  LEU A C    3  
ATOM   1654  O  O    . LEU A 1 28 ? -0.742  5.162   2.864   1.00 0.00 ? 28  LEU A O    3  
ATOM   1655  C  CB   . LEU A 1 28 ? -3.202  2.849   2.491   1.00 0.00 ? 28  LEU A CB   3  
ATOM   1656  C  CG   . LEU A 1 28 ? -2.201  2.421   1.418   1.00 0.00 ? 28  LEU A CG   3  
ATOM   1657  C  CD1  . LEU A 1 28 ? -1.207  1.419   1.984   1.00 0.00 ? 28  LEU A CD1  3  
ATOM   1658  C  CD2  . LEU A 1 28 ? -2.927  1.834   0.216   1.00 0.00 ? 28  LEU A CD2  3  
ATOM   1659  H  H    . LEU A 1 28 ? -4.784  4.400   3.754   1.00 0.00 ? 28  LEU A H    3  
ATOM   1660  H  HA   . LEU A 1 28 ? -2.100  3.529   4.195   1.00 0.00 ? 28  LEU A HA   3  
ATOM   1661  H  HB2  . LEU A 1 28 ? -3.437  1.982   3.089   1.00 0.00 ? 28  LEU A HB2  3  
ATOM   1662  H  HB3  . LEU A 1 28 ? -4.097  3.194   1.993   1.00 0.00 ? 28  LEU A HB3  3  
ATOM   1663  H  HG   . LEU A 1 28 ? -1.648  3.288   1.084   1.00 0.00 ? 28  LEU A HG   3  
ATOM   1664  H  HD11 . LEU A 1 28 ? -0.391  1.947   2.452   1.00 0.00 ? 28  LEU A HD11 3  
ATOM   1665  H  HD12 . LEU A 1 28 ? -0.825  0.800   1.185   1.00 0.00 ? 28  LEU A HD12 3  
ATOM   1666  H  HD13 . LEU A 1 28 ? -1.701  0.796   2.716   1.00 0.00 ? 28  LEU A HD13 3  
ATOM   1667  H  HD21 . LEU A 1 28 ? -3.670  1.126   0.554   1.00 0.00 ? 28  LEU A HD21 3  
ATOM   1668  H  HD22 . LEU A 1 28 ? -2.216  1.331   -0.424  1.00 0.00 ? 28  LEU A HD22 3  
ATOM   1669  H  HD23 . LEU A 1 28 ? -3.410  2.627   -0.336  1.00 0.00 ? 28  LEU A HD23 3  
ATOM   1670  N  N    . ILE A 1 29 ? -2.631  5.721   1.776   1.00 0.00 ? 29  ILE A N    3  
ATOM   1671  C  CA   . ILE A 1 29 ? -1.992  6.756   0.973   1.00 0.00 ? 29  ILE A CA   3  
ATOM   1672  C  C    . ILE A 1 29 ? -1.174  7.702   1.846   1.00 0.00 ? 29  ILE A C    3  
ATOM   1673  O  O    . ILE A 1 29 ? -0.060  8.086   1.487   1.00 0.00 ? 29  ILE A O    3  
ATOM   1674  C  CB   . ILE A 1 29 ? -3.029  7.575   0.181   1.00 0.00 ? 29  ILE A CB   3  
ATOM   1675  C  CG1  . ILE A 1 29 ? -3.773  6.676   -0.809  1.00 0.00 ? 29  ILE A CG1  3  
ATOM   1676  C  CG2  . ILE A 1 29 ? -2.351  8.726   -0.547  1.00 0.00 ? 29  ILE A CG2  3  
ATOM   1677  C  CD1  . ILE A 1 29 ? -5.106  7.236   -1.250  1.00 0.00 ? 29  ILE A CD1  3  
ATOM   1678  H  H    . ILE A 1 29 ? -3.589  5.550   1.661   1.00 0.00 ? 29  ILE A H    3  
ATOM   1679  H  HA   . ILE A 1 29 ? -1.332  6.271   0.269   1.00 0.00 ? 29  ILE A HA   3  
ATOM   1680  H  HB   . ILE A 1 29 ? -3.737  7.991   0.881   1.00 0.00 ? 29  ILE A HB   3  
ATOM   1681  H  HG12 . ILE A 1 29 ? -3.164  6.538   -1.688  1.00 0.00 ? 29  ILE A HG12 3  
ATOM   1682  H  HG13 . ILE A 1 29 ? -3.952  5.715   -0.346  1.00 0.00 ? 29  ILE A HG13 3  
ATOM   1683  H  HG21 . ILE A 1 29 ? -1.311  8.770   -0.259  1.00 0.00 ? 29  ILE A HG21 3  
ATOM   1684  H  HG22 . ILE A 1 29 ? -2.422  8.569   -1.613  1.00 0.00 ? 29  ILE A HG22 3  
ATOM   1685  H  HG23 . ILE A 1 29 ? -2.837  9.654   -0.285  1.00 0.00 ? 29  ILE A HG23 3  
ATOM   1686  H  HD11 . ILE A 1 29 ? -5.572  7.752   -0.422  1.00 0.00 ? 29  ILE A HD11 3  
ATOM   1687  H  HD12 . ILE A 1 29 ? -4.954  7.930   -2.064  1.00 0.00 ? 29  ILE A HD12 3  
ATOM   1688  H  HD13 . ILE A 1 29 ? -5.746  6.430   -1.577  1.00 0.00 ? 29  ILE A HD13 3  
ATOM   1689  N  N    . ILE A 1 30 ? -1.732  8.072   2.993   1.00 0.00 ? 30  ILE A N    3  
ATOM   1690  C  CA   . ILE A 1 30 ? -1.053  8.970   3.918   1.00 0.00 ? 30  ILE A CA   3  
ATOM   1691  C  C    . ILE A 1 30 ? 0.072   8.252   4.655   1.00 0.00 ? 30  ILE A C    3  
ATOM   1692  O  O    . ILE A 1 30 ? 1.117   8.838   4.939   1.00 0.00 ? 30  ILE A O    3  
ATOM   1693  C  CB   . ILE A 1 30 ? -2.031  9.562   4.950   1.00 0.00 ? 30  ILE A CB   3  
ATOM   1694  C  CG1  . ILE A 1 30 ? -3.170  10.298  4.241   1.00 0.00 ? 30  ILE A CG1  3  
ATOM   1695  C  CG2  . ILE A 1 30 ? -1.298  10.498  5.899   1.00 0.00 ? 30  ILE A CG2  3  
ATOM   1696  C  CD1  . ILE A 1 30 ? -4.391  10.504  5.110   1.00 0.00 ? 30  ILE A CD1  3  
ATOM   1697  H  H    . ILE A 1 30 ? -2.622  7.732   3.223   1.00 0.00 ? 30  ILE A H    3  
ATOM   1698  H  HA   . ILE A 1 30 ? -0.631  9.783   3.344   1.00 0.00 ? 30  ILE A HA   3  
ATOM   1699  H  HB   . ILE A 1 30 ? -2.443  8.750   5.529   1.00 0.00 ? 30  ILE A HB   3  
ATOM   1700  H  HG12 . ILE A 1 30 ? -2.821  11.269  3.925   1.00 0.00 ? 30  ILE A HG12 3  
ATOM   1701  H  HG13 . ILE A 1 30 ? -3.471  9.729   3.373   1.00 0.00 ? 30  ILE A HG13 3  
ATOM   1702  H  HG21 . ILE A 1 30 ? -1.235  11.481  5.458   1.00 0.00 ? 30  ILE A HG21 3  
ATOM   1703  H  HG22 . ILE A 1 30 ? -1.838  10.557  6.833   1.00 0.00 ? 30  ILE A HG22 3  
ATOM   1704  H  HG23 . ILE A 1 30 ? -0.304  10.120  6.081   1.00 0.00 ? 30  ILE A HG23 3  
ATOM   1705  H  HD11 . ILE A 1 30 ? -4.212  10.078  6.088   1.00 0.00 ? 30  ILE A HD11 3  
ATOM   1706  H  HD12 . ILE A 1 30 ? -4.589  11.561  5.210   1.00 0.00 ? 30  ILE A HD12 3  
ATOM   1707  H  HD13 . ILE A 1 30 ? -5.242  10.018  4.657   1.00 0.00 ? 30  ILE A HD13 3  
ATOM   1708  N  N    . HIS A 1 31 ? -0.148  6.977   4.962   1.00 0.00 ? 31  HIS A N    3  
ATOM   1709  C  CA   . HIS A 1 31 ? 0.849   6.177   5.665   1.00 0.00 ? 31  HIS A CA   3  
ATOM   1710  C  C    . HIS A 1 31 ? 2.057   5.908   4.773   1.00 0.00 ? 31  HIS A C    3  
ATOM   1711  O  O    . HIS A 1 31 ? 3.176   5.749   5.260   1.00 0.00 ? 31  HIS A O    3  
ATOM   1712  C  CB   . HIS A 1 31 ? 0.237   4.854   6.127   1.00 0.00 ? 31  HIS A CB   3  
ATOM   1713  C  CG   . HIS A 1 31 ? 1.237   3.746   6.261   1.00 0.00 ? 31  HIS A CG   3  
ATOM   1714  N  ND1  . HIS A 1 31 ? 1.812   3.393   7.463   1.00 0.00 ? 31  HIS A ND1  3  
ATOM   1715  C  CD2  . HIS A 1 31 ? 1.762   2.911   5.335   1.00 0.00 ? 31  HIS A CD2  3  
ATOM   1716  C  CE1  . HIS A 1 31 ? 2.649   2.390   7.271   1.00 0.00 ? 31  HIS A CE1  3  
ATOM   1717  N  NE2  . HIS A 1 31 ? 2.637   2.077   5.988   1.00 0.00 ? 31  HIS A NE2  3  
ATOM   1718  H  H    . HIS A 1 31 ? -1.000  6.565   4.710   1.00 0.00 ? 31  HIS A H    3  
ATOM   1719  H  HA   . HIS A 1 31 ? 1.173   6.735   6.530   1.00 0.00 ? 31  HIS A HA   3  
ATOM   1720  H  HB2  . HIS A 1 31 ? -0.229  4.997   7.090   1.00 0.00 ? 31  HIS A HB2  3  
ATOM   1721  H  HB3  . HIS A 1 31 ? -0.511  4.541   5.413   1.00 0.00 ? 31  HIS A HB3  3  
ATOM   1722  H  HD1  . HIS A 1 31 ? 1.635   3.817   8.329   1.00 0.00 ? 31  HIS A HD1  3  
ATOM   1723  H  HD2  . HIS A 1 31 ? 1.536   2.901   4.278   1.00 0.00 ? 31  HIS A HD2  3  
ATOM   1724  H  HE1  . HIS A 1 31 ? 3.242   1.906   8.032   1.00 0.00 ? 31  HIS A HE1  3  
ATOM   1725  N  N    . GLN A 1 32 ? 1.822   5.859   3.465   1.00 0.00 ? 32  GLN A N    3  
ATOM   1726  C  CA   . GLN A 1 32 ? 2.892   5.609   2.507   1.00 0.00 ? 32  GLN A CA   3  
ATOM   1727  C  C    . GLN A 1 32 ? 3.930   6.725   2.545   1.00 0.00 ? 32  GLN A C    3  
ATOM   1728  O  O    . GLN A 1 32 ? 5.065   6.549   2.101   1.00 0.00 ? 32  GLN A O    3  
ATOM   1729  C  CB   . GLN A 1 32 ? 2.319   5.477   1.094   1.00 0.00 ? 32  GLN A CB   3  
ATOM   1730  C  CG   . GLN A 1 32 ? 1.564   4.178   0.863   1.00 0.00 ? 32  GLN A CG   3  
ATOM   1731  C  CD   . GLN A 1 32 ? 1.042   4.051   -0.555  1.00 0.00 ? 32  GLN A CD   3  
ATOM   1732  O  OE1  . GLN A 1 32 ? 0.795   5.051   -1.229  1.00 0.00 ? 32  GLN A OE1  3  
ATOM   1733  N  NE2  . GLN A 1 32 ? 0.872   2.817   -1.015  1.00 0.00 ? 32  GLN A NE2  3  
ATOM   1734  H  H    . GLN A 1 32 ? 0.909   5.994   3.138   1.00 0.00 ? 32  GLN A H    3  
ATOM   1735  H  HA   . GLN A 1 32 ? 3.370   4.680   2.779   1.00 0.00 ? 32  GLN A HA   3  
ATOM   1736  H  HB2  . GLN A 1 32 ? 1.642   6.299   0.915   1.00 0.00 ? 32  GLN A HB2  3  
ATOM   1737  H  HB3  . GLN A 1 32 ? 3.131   5.528   0.384   1.00 0.00 ? 32  GLN A HB3  3  
ATOM   1738  H  HG2  . GLN A 1 32 ? 2.229   3.350   1.060   1.00 0.00 ? 32  GLN A HG2  3  
ATOM   1739  H  HG3  . GLN A 1 32 ? 0.727   4.137   1.544   1.00 0.00 ? 32  GLN A HG3  3  
ATOM   1740  H  HE21 . GLN A 1 32 ? 1.089   2.068   -0.421  1.00 0.00 ? 32  GLN A HE21 3  
ATOM   1741  H  HE22 . GLN A 1 32 ? 0.536   2.706   -1.928  1.00 0.00 ? 32  GLN A HE22 3  
ATOM   1742  N  N    . LYS A 1 33 ? 3.535   7.876   3.079   1.00 0.00 ? 33  LYS A N    3  
ATOM   1743  C  CA   . LYS A 1 33 ? 4.430   9.022   3.177   1.00 0.00 ? 33  LYS A CA   3  
ATOM   1744  C  C    . LYS A 1 33 ? 5.671   8.676   3.993   1.00 0.00 ? 33  LYS A C    3  
ATOM   1745  O  O    . LYS A 1 33 ? 6.693   9.357   3.906   1.00 0.00 ? 33  LYS A O    3  
ATOM   1746  C  CB   . LYS A 1 33 ? 3.704   10.210  3.812   1.00 0.00 ? 33  LYS A CB   3  
ATOM   1747  C  CG   . LYS A 1 33 ? 2.561   10.747  2.968   1.00 0.00 ? 33  LYS A CG   3  
ATOM   1748  C  CD   . LYS A 1 33 ? 2.264   12.202  3.292   1.00 0.00 ? 33  LYS A CD   3  
ATOM   1749  C  CE   . LYS A 1 33 ? 0.975   12.667  2.633   1.00 0.00 ? 33  LYS A CE   3  
ATOM   1750  N  NZ   . LYS A 1 33 ? 0.779   14.137  2.774   1.00 0.00 ? 33  LYS A NZ   3  
ATOM   1751  H  H    . LYS A 1 33 ? 2.617   7.956   3.416   1.00 0.00 ? 33  LYS A H    3  
ATOM   1752  H  HA   . LYS A 1 33 ? 4.735   9.291   2.177   1.00 0.00 ? 33  LYS A HA   3  
ATOM   1753  H  HB2  . LYS A 1 33 ? 3.305   9.903   4.768   1.00 0.00 ? 33  LYS A HB2  3  
ATOM   1754  H  HB3  . LYS A 1 33 ? 4.414   11.009  3.969   1.00 0.00 ? 33  LYS A HB3  3  
ATOM   1755  H  HG2  . LYS A 1 33 ? 2.829   10.669  1.925   1.00 0.00 ? 33  LYS A HG2  3  
ATOM   1756  H  HG3  . LYS A 1 33 ? 1.676   10.157  3.160   1.00 0.00 ? 33  LYS A HG3  3  
ATOM   1757  H  HD2  . LYS A 1 33 ? 2.168   12.311  4.362   1.00 0.00 ? 33  LYS A HD2  3  
ATOM   1758  H  HD3  . LYS A 1 33 ? 3.081   12.814  2.938   1.00 0.00 ? 33  LYS A HD3  3  
ATOM   1759  H  HE2  . LYS A 1 33 ? 1.012   12.417  1.584   1.00 0.00 ? 33  LYS A HE2  3  
ATOM   1760  H  HE3  . LYS A 1 33 ? 0.144   12.156  3.096   1.00 0.00 ? 33  LYS A HE3  3  
ATOM   1761  H  HZ1  . LYS A 1 33 ? 1.498   14.648  2.223   1.00 0.00 ? 33  LYS A HZ1  3  
ATOM   1762  H  HZ2  . LYS A 1 33 ? 0.862   14.414  3.773   1.00 0.00 ? 33  LYS A HZ2  3  
ATOM   1763  H  HZ3  . LYS A 1 33 ? -0.164  14.407  2.429   1.00 0.00 ? 33  LYS A HZ3  3  
ATOM   1764  N  N    . ILE A 1 34 ? 5.575   7.612   4.784   1.00 0.00 ? 34  ILE A N    3  
ATOM   1765  C  CA   . ILE A 1 34 ? 6.691   7.174   5.613   1.00 0.00 ? 34  ILE A CA   3  
ATOM   1766  C  C    . ILE A 1 34 ? 7.670   6.322   4.812   1.00 0.00 ? 34  ILE A C    3  
ATOM   1767  O  O    . ILE A 1 34 ? 8.718   5.921   5.318   1.00 0.00 ? 34  ILE A O    3  
ATOM   1768  C  CB   . ILE A 1 34 ? 6.204   6.368   6.832   1.00 0.00 ? 34  ILE A CB   3  
ATOM   1769  C  CG1  . ILE A 1 34 ? 5.907   4.922   6.429   1.00 0.00 ? 34  ILE A CG1  3  
ATOM   1770  C  CG2  . ILE A 1 34 ? 4.970   7.019   7.439   1.00 0.00 ? 34  ILE A CG2  3  
ATOM   1771  C  CD1  . ILE A 1 34 ? 5.363   4.079   7.561   1.00 0.00 ? 34  ILE A CD1  3  
ATOM   1772  H  H    . ILE A 1 34 ? 4.734   7.110   4.809   1.00 0.00 ? 34  ILE A H    3  
ATOM   1773  H  HA   . ILE A 1 34 ? 7.205   8.054   5.971   1.00 0.00 ? 34  ILE A HA   3  
ATOM   1774  H  HB   . ILE A 1 34 ? 6.987   6.374   7.575   1.00 0.00 ? 34  ILE A HB   3  
ATOM   1775  H  HG12 . ILE A 1 34 ? 5.179   4.919   5.634   1.00 0.00 ? 34  ILE A HG12 3  
ATOM   1776  H  HG13 . ILE A 1 34 ? 6.819   4.460   6.078   1.00 0.00 ? 34  ILE A HG13 3  
ATOM   1777  H  HG21 . ILE A 1 34 ? 4.432   6.291   8.028   1.00 0.00 ? 34  ILE A HG21 3  
ATOM   1778  H  HG22 . ILE A 1 34 ? 5.271   7.841   8.071   1.00 0.00 ? 34  ILE A HG22 3  
ATOM   1779  H  HG23 . ILE A 1 34 ? 4.332   7.386   6.650   1.00 0.00 ? 34  ILE A HG23 3  
ATOM   1780  H  HD11 . ILE A 1 34 ? 5.671   4.503   8.506   1.00 0.00 ? 34  ILE A HD11 3  
ATOM   1781  H  HD12 . ILE A 1 34 ? 4.284   4.061   7.510   1.00 0.00 ? 34  ILE A HD12 3  
ATOM   1782  H  HD13 . ILE A 1 34 ? 5.745   3.073   7.477   1.00 0.00 ? 34  ILE A HD13 3  
ATOM   1783  N  N    . HIS A 1 35 ? 7.321   6.051   3.558   1.00 0.00 ? 35  HIS A N    3  
ATOM   1784  C  CA   . HIS A 1 35 ? 8.171   5.248   2.685   1.00 0.00 ? 35  HIS A CA   3  
ATOM   1785  C  C    . HIS A 1 35 ? 8.727   6.092   1.543   1.00 0.00 ? 35  HIS A C    3  
ATOM   1786  O  O    . HIS A 1 35 ? 9.609   5.653   0.804   1.00 0.00 ? 35  HIS A O    3  
ATOM   1787  C  CB   . HIS A 1 35 ? 7.385   4.063   2.123   1.00 0.00 ? 35  HIS A CB   3  
ATOM   1788  C  CG   . HIS A 1 35 ? 6.849   3.145   3.179   1.00 0.00 ? 35  HIS A CG   3  
ATOM   1789  N  ND1  . HIS A 1 35 ? 7.639   2.584   4.160   1.00 0.00 ? 35  HIS A ND1  3  
ATOM   1790  C  CD2  . HIS A 1 35 ? 5.594   2.692   3.404   1.00 0.00 ? 35  HIS A CD2  3  
ATOM   1791  C  CE1  . HIS A 1 35 ? 6.893   1.825   4.942   1.00 0.00 ? 35  HIS A CE1  3  
ATOM   1792  N  NE2  . HIS A 1 35 ? 5.648   1.873   4.505   1.00 0.00 ? 35  HIS A NE2  3  
ATOM   1793  H  H    . HIS A 1 35 ? 6.473   6.399   3.212   1.00 0.00 ? 35  HIS A H    3  
ATOM   1794  H  HA   . HIS A 1 35 ? 8.994   4.876   3.275   1.00 0.00 ? 35  HIS A HA   3  
ATOM   1795  H  HB2  . HIS A 1 35 ? 6.548   4.434   1.551   1.00 0.00 ? 35  HIS A HB2  3  
ATOM   1796  H  HB3  . HIS A 1 35 ? 8.030   3.486   1.477   1.00 0.00 ? 35  HIS A HB3  3  
ATOM   1797  H  HD1  . HIS A 1 35 ? 8.603   2.722   4.266   1.00 0.00 ? 35  HIS A HD1  3  
ATOM   1798  H  HD2  . HIS A 1 35 ? 4.712   2.929   2.825   1.00 0.00 ? 35  HIS A HD2  3  
ATOM   1799  H  HE1  . HIS A 1 35 ? 7.242   1.260   5.794   1.00 0.00 ? 35  HIS A HE1  3  
ATOM   1800  N  N    . THR A 1 36 ? 8.206   7.308   1.403   1.00 0.00 ? 36  THR A N    3  
ATOM   1801  C  CA   . THR A 1 36 ? 8.649   8.212   0.350   1.00 0.00 ? 36  THR A CA   3  
ATOM   1802  C  C    . THR A 1 36 ? 9.931   8.935   0.749   1.00 0.00 ? 36  THR A C    3  
ATOM   1803  O  O    . THR A 1 36 ? 10.834  9.114   -0.067  1.00 0.00 ? 36  THR A O    3  
ATOM   1804  C  CB   . THR A 1 36 ? 7.568   9.257   0.015   1.00 0.00 ? 36  THR A CB   3  
ATOM   1805  O  OG1  . THR A 1 36 ? 7.258   10.032  1.178   1.00 0.00 ? 36  THR A OG1  3  
ATOM   1806  C  CG2  . THR A 1 36 ? 6.306   8.583   -0.502  1.00 0.00 ? 36  THR A CG2  3  
ATOM   1807  H  H    . THR A 1 36 ? 7.507   7.601   2.023   1.00 0.00 ? 36  THR A H    3  
ATOM   1808  H  HA   . THR A 1 36 ? 8.839   7.625   -0.537  1.00 0.00 ? 36  THR A HA   3  
ATOM   1809  H  HB   . THR A 1 36 ? 7.949   9.913   -0.755  1.00 0.00 ? 36  THR A HB   3  
ATOM   1810  H  HG1  . THR A 1 36 ? 7.389   9.496   1.964   1.00 0.00 ? 36  THR A HG1  3  
ATOM   1811  H  HG21 . THR A 1 36 ? 5.627   9.332   -0.880  1.00 0.00 ? 36  THR A HG21 3  
ATOM   1812  H  HG22 . THR A 1 36 ? 5.831   8.042   0.304   1.00 0.00 ? 36  THR A HG22 3  
ATOM   1813  H  HG23 . THR A 1 36 ? 6.563   7.896   -1.294  1.00 0.00 ? 36  THR A HG23 3  
ATOM   1814  N  N    . GLY A 1 37 ? 10.004  9.348   2.010   1.00 0.00 ? 37  GLY A N    3  
ATOM   1815  C  CA   . GLY A 1 37 ? 11.180  10.046  2.496   1.00 0.00 ? 37  GLY A CA   3  
ATOM   1816  C  C    . GLY A 1 37 ? 11.056  11.551  2.366   1.00 0.00 ? 37  GLY A C    3  
ATOM   1817  O  O    . GLY A 1 37 ? 11.408  12.122  1.334   1.00 0.00 ? 37  GLY A O    3  
ATOM   1818  H  H    . GLY A 1 37 ? 9.253   9.178   2.617   1.00 0.00 ? 37  GLY A H    3  
ATOM   1819  H  HA2  . GLY A 1 37 ? 11.330  9.796   3.535   1.00 0.00 ? 37  GLY A HA2  3  
ATOM   1820  H  HA3  . GLY A 1 37 ? 12.039  9.718   1.929   1.00 0.00 ? 37  GLY A HA3  3  
ATOM   1821  N  N    . GLU A 1 38 ? 10.551  12.195  3.414   1.00 0.00 ? 38  GLU A N    3  
ATOM   1822  C  CA   . GLU A 1 38 ? 10.379  13.643  3.410   1.00 0.00 ? 38  GLU A CA   3  
ATOM   1823  C  C    . GLU A 1 38 ? 11.725  14.351  3.540   1.00 0.00 ? 38  GLU A C    3  
ATOM   1824  O  O    . GLU A 1 38 ? 12.599  13.912  4.287   1.00 0.00 ? 38  GLU A O    3  
ATOM   1825  C  CB   . GLU A 1 38 ? 9.453   14.072  4.550   1.00 0.00 ? 38  GLU A CB   3  
ATOM   1826  C  CG   . GLU A 1 38 ? 8.726   15.379  4.285   1.00 0.00 ? 38  GLU A CG   3  
ATOM   1827  C  CD   . GLU A 1 38 ? 7.531   15.578  5.196   1.00 0.00 ? 38  GLU A CD   3  
ATOM   1828  O  OE1  . GLU A 1 38 ? 7.733   15.692  6.423   1.00 0.00 ? 38  GLU A OE1  3  
ATOM   1829  O  OE2  . GLU A 1 38 ? 6.393   15.618  4.683   1.00 0.00 ? 38  GLU A OE2  3  
ATOM   1830  H  H    . GLU A 1 38 ? 10.288  11.684  4.208   1.00 0.00 ? 38  GLU A H    3  
ATOM   1831  H  HA   . GLU A 1 38 ? 9.929   13.921  2.469   1.00 0.00 ? 38  GLU A HA   3  
ATOM   1832  H  HB2  . GLU A 1 38 ? 8.715   13.299  4.708   1.00 0.00 ? 38  GLU A HB2  3  
ATOM   1833  H  HB3  . GLU A 1 38 ? 10.039  14.186  5.450   1.00 0.00 ? 38  GLU A HB3  3  
ATOM   1834  H  HG2  . GLU A 1 38 ? 9.415   16.197  4.438   1.00 0.00 ? 38  GLU A HG2  3  
ATOM   1835  H  HG3  . GLU A 1 38 ? 8.384   15.385  3.260   1.00 0.00 ? 38  GLU A HG3  3  
ATOM   1836  N  N    . ARG A 1 39 ? 11.883  15.448  2.807   1.00 0.00 ? 39  ARG A N    3  
ATOM   1837  C  CA   . ARG A 1 39 ? 13.121  16.216  2.838   1.00 0.00 ? 39  ARG A CA   3  
ATOM   1838  C  C    . ARG A 1 39 ? 13.381  16.773  4.235   1.00 0.00 ? 39  ARG A C    3  
ATOM   1839  O  O    . ARG A 1 39 ? 12.459  17.127  4.970   1.00 0.00 ? 39  ARG A O    3  
ATOM   1840  C  CB   . ARG A 1 39 ? 13.063  17.360  1.824   1.00 0.00 ? 39  ARG A CB   3  
ATOM   1841  C  CG   . ARG A 1 39 ? 11.948  18.357  2.094   1.00 0.00 ? 39  ARG A CG   3  
ATOM   1842  C  CD   . ARG A 1 39 ? 12.000  19.528  1.125   1.00 0.00 ? 39  ARG A CD   3  
ATOM   1843  N  NE   . ARG A 1 39 ? 10.705  20.191  0.998   1.00 0.00 ? 39  ARG A NE   3  
ATOM   1844  C  CZ   . ARG A 1 39 ? 10.532  21.351  0.374   1.00 0.00 ? 39  ARG A CZ   3  
ATOM   1845  N  NH1  . ARG A 1 39 ? 11.565  21.972  -0.177  1.00 0.00 ? 39  ARG A NH1  3  
ATOM   1846  N  NH2  . ARG A 1 39 ? 9.322   21.891  0.299   1.00 0.00 ? 39  ARG A NH2  3  
ATOM   1847  H  H    . ARG A 1 39 ? 11.149  15.748  2.230   1.00 0.00 ? 39  ARG A H    3  
ATOM   1848  H  HA   . ARG A 1 39 ? 13.930  15.553  2.572   1.00 0.00 ? 39  ARG A HA   3  
ATOM   1849  H  HB2  . ARG A 1 39 ? 14.003  17.892  1.843   1.00 0.00 ? 39  ARG A HB2  3  
ATOM   1850  H  HB3  . ARG A 1 39 ? 12.913  16.945  0.839   1.00 0.00 ? 39  ARG A HB3  3  
ATOM   1851  H  HG2  . ARG A 1 39 ? 10.996  17.857  1.986   1.00 0.00 ? 39  ARG A HG2  3  
ATOM   1852  H  HG3  . ARG A 1 39 ? 12.048  18.730  3.103   1.00 0.00 ? 39  ARG A HG3  3  
ATOM   1853  H  HD2  . ARG A 1 39 ? 12.726  20.243  1.484   1.00 0.00 ? 39  ARG A HD2  3  
ATOM   1854  H  HD3  . ARG A 1 39 ? 12.304  19.162  0.156   1.00 0.00 ? 39  ARG A HD3  3  
ATOM   1855  H  HE   . ARG A 1 39 ? 9.927   19.749  1.397   1.00 0.00 ? 39  ARG A HE   3  
ATOM   1856  H  HH11 . ARG A 1 39 ? 12.478  21.567  -0.123  1.00 0.00 ? 39  ARG A HH11 3  
ATOM   1857  H  HH12 . ARG A 1 39 ? 11.432  22.845  -0.647  1.00 0.00 ? 39  ARG A HH12 3  
ATOM   1858  H  HH21 . ARG A 1 39 ? 8.540   21.426  0.713   1.00 0.00 ? 39  ARG A HH21 3  
ATOM   1859  H  HH22 . ARG A 1 39 ? 9.193   22.764  -0.170  1.00 0.00 ? 39  ARG A HH22 3  
ATOM   1860  N  N    . PRO A 1 40 ? 14.666  16.853  4.611   1.00 0.00 ? 40  PRO A N    3  
ATOM   1861  C  CA   . PRO A 1 40 ? 15.076  17.365  5.922   1.00 0.00 ? 40  PRO A CA   3  
ATOM   1862  C  C    . PRO A 1 40 ? 14.842  18.866  6.056   1.00 0.00 ? 40  PRO A C    3  
ATOM   1863  O  O    . PRO A 1 40 ? 14.366  19.516  5.125   1.00 0.00 ? 40  PRO A O    3  
ATOM   1864  C  CB   . PRO A 1 40 ? 16.574  17.051  5.972   1.00 0.00 ? 40  PRO A CB   3  
ATOM   1865  C  CG   . PRO A 1 40 ? 16.996  16.990  4.545   1.00 0.00 ? 40  PRO A CG   3  
ATOM   1866  C  CD   . PRO A 1 40 ? 15.817  16.448  3.787   1.00 0.00 ? 40  PRO A CD   3  
ATOM   1867  H  HA   . PRO A 1 40 ? 14.571  16.850  6.726   1.00 0.00 ? 40  PRO A HA   3  
ATOM   1868  H  HB2  . PRO A 1 40 ? 17.091  17.836  6.506   1.00 0.00 ? 40  PRO A HB2  3  
ATOM   1869  H  HB3  . PRO A 1 40 ? 16.730  16.106  6.471   1.00 0.00 ? 40  PRO A HB3  3  
ATOM   1870  H  HG2  . PRO A 1 40 ? 17.246  17.980  4.194   1.00 0.00 ? 40  PRO A HG2  3  
ATOM   1871  H  HG3  . PRO A 1 40 ? 17.844  16.329  4.442   1.00 0.00 ? 40  PRO A HG3  3  
ATOM   1872  H  HD2  . PRO A 1 40 ? 15.762  16.894  2.804   1.00 0.00 ? 40  PRO A HD2  3  
ATOM   1873  H  HD3  . PRO A 1 40 ? 15.878  15.373  3.712   1.00 0.00 ? 40  PRO A HD3  3  
ATOM   1874  N  N    . SER A 1 41 ? 15.180  19.411  7.221   1.00 0.00 ? 41  SER A N    3  
ATOM   1875  C  CA   . SER A 1 41 ? 15.004  20.835  7.478   1.00 0.00 ? 41  SER A CA   3  
ATOM   1876  C  C    . SER A 1 41 ? 15.448  21.664  6.277   1.00 0.00 ? 41  SER A C    3  
ATOM   1877  O  O    . SER A 1 41 ? 16.129  21.164  5.382   1.00 0.00 ? 41  SER A O    3  
ATOM   1878  C  CB   . SER A 1 41 ? 15.793  21.253  8.720   1.00 0.00 ? 41  SER A CB   3  
ATOM   1879  O  OG   . SER A 1 41 ? 15.401  20.496  9.852   1.00 0.00 ? 41  SER A OG   3  
ATOM   1880  H  H    . SER A 1 41 ? 15.555  18.840  7.924   1.00 0.00 ? 41  SER A H    3  
ATOM   1881  H  HA   . SER A 1 41 ? 13.953  21.013  7.654   1.00 0.00 ? 41  SER A HA   3  
ATOM   1882  H  HB2  . SER A 1 41 ? 16.846  21.094  8.544   1.00 0.00 ? 41  SER A HB2  3  
ATOM   1883  H  HB3  . SER A 1 41 ? 15.615  22.299  8.922   1.00 0.00 ? 41  SER A HB3  3  
ATOM   1884  H  HG   . SER A 1 41 ? 16.158  20.013  10.193  1.00 0.00 ? 41  SER A HG   3  
ATOM   1885  N  N    . GLY A 1 42 ? 15.057  22.934  6.264   1.00 0.00 ? 42  GLY A N    3  
ATOM   1886  C  CA   . GLY A 1 42 ? 15.424  23.813  5.169   1.00 0.00 ? 42  GLY A CA   3  
ATOM   1887  C  C    . GLY A 1 42 ? 16.782  24.455  5.370   1.00 0.00 ? 42  GLY A C    3  
ATOM   1888  O  O    . GLY A 1 42 ? 17.824  23.820  5.203   1.00 0.00 ? 42  GLY A O    3  
ATOM   1889  H  H    . GLY A 1 42 ? 14.515  23.278  7.005   1.00 0.00 ? 42  GLY A H    3  
ATOM   1890  H  HA2  . GLY A 1 42 ? 15.440  23.241  4.253   1.00 0.00 ? 42  GLY A HA2  3  
ATOM   1891  H  HA3  . GLY A 1 42 ? 14.680  24.591  5.082   1.00 0.00 ? 42  GLY A HA3  3  
ATOM   1892  N  N    . PRO A 1 43 ? 16.782  25.745  5.736   1.00 0.00 ? 43  PRO A N    3  
ATOM   1893  C  CA   . PRO A 1 43 ? 18.016  26.502  5.967   1.00 0.00 ? 43  PRO A CA   3  
ATOM   1894  C  C    . PRO A 1 43 ? 18.751  26.045  7.223   1.00 0.00 ? 43  PRO A C    3  
ATOM   1895  O  O    . PRO A 1 43 ? 19.957  25.802  7.194   1.00 0.00 ? 43  PRO A O    3  
ATOM   1896  C  CB   . PRO A 1 43 ? 17.523  27.942  6.131   1.00 0.00 ? 43  PRO A CB   3  
ATOM   1897  C  CG   . PRO A 1 43 ? 16.116  27.810  6.602   1.00 0.00 ? 43  PRO A CG   3  
ATOM   1898  C  CD   . PRO A 1 43 ? 15.578  26.565  5.953   1.00 0.00 ? 43  PRO A CD   3  
ATOM   1899  H  HA   . PRO A 1 43 ? 18.683  26.443  5.119   1.00 0.00 ? 43  PRO A HA   3  
ATOM   1900  H  HB2  . PRO A 1 43 ? 18.138  28.455  6.858   1.00 0.00 ? 43  PRO A HB2  3  
ATOM   1901  H  HB3  . PRO A 1 43 ? 17.575  28.455  5.182   1.00 0.00 ? 43  PRO A HB3  3  
ATOM   1902  H  HG2  . PRO A 1 43 ? 16.096  27.712  7.676   1.00 0.00 ? 43  PRO A HG2  3  
ATOM   1903  H  HG3  . PRO A 1 43 ? 15.543  28.671  6.291   1.00 0.00 ? 43  PRO A HG3  3  
ATOM   1904  H  HD2  . PRO A 1 43 ? 14.885  26.064  6.614   1.00 0.00 ? 43  PRO A HD2  3  
ATOM   1905  H  HD3  . PRO A 1 43 ? 15.101  26.804  5.014   1.00 0.00 ? 43  PRO A HD3  3  
ATOM   1906  N  N    . SER A 1 44 ? 18.015  25.929  8.324   1.00 0.00 ? 44  SER A N    3  
ATOM   1907  C  CA   . SER A 1 44 ? 18.598  25.503  9.591   1.00 0.00 ? 44  SER A CA   3  
ATOM   1908  C  C    . SER A 1 44 ? 17.510  25.233  10.626  1.00 0.00 ? 44  SER A C    3  
ATOM   1909  O  O    . SER A 1 44 ? 16.586  26.028  10.793  1.00 0.00 ? 44  SER A O    3  
ATOM   1910  C  CB   . SER A 1 44 ? 19.564  26.568  10.116  1.00 0.00 ? 44  SER A CB   3  
ATOM   1911  O  OG   . SER A 1 44 ? 18.863  27.711  10.573  1.00 0.00 ? 44  SER A OG   3  
ATOM   1912  H  H    . SER A 1 44 ? 17.058  26.137  8.283   1.00 0.00 ? 44  SER A H    3  
ATOM   1913  H  HA   . SER A 1 44 ? 19.145  24.589  9.414   1.00 0.00 ? 44  SER A HA   3  
ATOM   1914  H  HB2  . SER A 1 44 ? 20.135  26.159  10.935  1.00 0.00 ? 44  SER A HB2  3  
ATOM   1915  H  HB3  . SER A 1 44 ? 20.234  26.864  9.322   1.00 0.00 ? 44  SER A HB3  3  
ATOM   1916  H  HG   . SER A 1 44 ? 18.086  27.851  10.027  1.00 0.00 ? 44  SER A HG   3  
ATOM   1917  N  N    . SER A 1 45 ? 17.628  24.104  11.318  1.00 0.00 ? 45  SER A N    3  
ATOM   1918  C  CA   . SER A 1 45 ? 16.653  23.726  12.334  1.00 0.00 ? 45  SER A CA   3  
ATOM   1919  C  C    . SER A 1 45 ? 17.342  23.416  13.660  1.00 0.00 ? 45  SER A C    3  
ATOM   1920  O  O    . SER A 1 45 ? 16.956  23.931  14.708  1.00 0.00 ? 45  SER A O    3  
ATOM   1921  C  CB   . SER A 1 45 ? 15.846  22.512  11.870  1.00 0.00 ? 45  SER A CB   3  
ATOM   1922  O  OG   . SER A 1 45 ? 14.737  22.907  11.082  1.00 0.00 ? 45  SER A OG   3  
ATOM   1923  H  H    . SER A 1 45 ? 18.387  23.511  11.139  1.00 0.00 ? 45  SER A H    3  
ATOM   1924  H  HA   . SER A 1 45 ? 15.982  24.560  12.477  1.00 0.00 ? 45  SER A HA   3  
ATOM   1925  H  HB2  . SER A 1 45 ? 16.479  21.866  11.281  1.00 0.00 ? 45  SER A HB2  3  
ATOM   1926  H  HB3  . SER A 1 45 ? 15.485  21.972  12.734  1.00 0.00 ? 45  SER A HB3  3  
ATOM   1927  H  HG   . SER A 1 45 ? 14.164  23.478  11.599  1.00 0.00 ? 45  SER A HG   3  
ATOM   1928  N  N    . GLY A 1 46 ? 18.367  22.571  13.604  1.00 0.00 ? 46  GLY A N    3  
ATOM   1929  C  CA   . GLY A 1 46 ? 19.094  22.206  14.805  1.00 0.00 ? 46  GLY A CA   3  
ATOM   1930  C  C    . GLY A 1 46 ? 20.271  21.294  14.516  1.00 0.00 ? 46  GLY A C    3  
ATOM   1931  O  O    . GLY A 1 46 ? 20.851  20.751  15.455  1.00 0.00 ? 46  GLY A O    3  
ATOM   1932  H  H    . GLY A 1 46 ? 18.630  22.191  12.739  1.00 0.00 ? 46  GLY A H    3  
ATOM   1933  H  HA2  . GLY A 1 46 ? 19.457  23.105  15.280  1.00 0.00 ? 46  GLY A HA2  3  
ATOM   1934  H  HA3  . GLY A 1 46 ? 18.420  21.701  15.481  1.00 0.00 ? 46  GLY A HA3  3  
HETATM 1935  ZN ZN   . ZN  B 2 .  ? 3.719   1.092   4.647   1.00 0.00 ? 201 ZN  A ZN   3  
ATOM   1936  N  N    . GLY A 1 1  ? 10.739  -22.490 -7.317  1.00 0.00 ? 1   GLY A N    4  
ATOM   1937  C  CA   . GLY A 1 1  ? 9.721   -21.823 -8.108  1.00 0.00 ? 1   GLY A CA   4  
ATOM   1938  C  C    . GLY A 1 1  ? 8.356   -21.867 -7.451  1.00 0.00 ? 1   GLY A C    4  
ATOM   1939  O  O    . GLY A 1 1  ? 8.250   -21.927 -6.226  1.00 0.00 ? 1   GLY A O    4  
ATOM   1940  H  H1   . GLY A 1 1  ? 10.549  -22.742 -6.389  1.00 0.00 ? 1   GLY A H1   4  
ATOM   1941  H  HA2  . GLY A 1 1  ? 10.009  -20.792 -8.249  1.00 0.00 ? 1   GLY A HA2  4  
ATOM   1942  H  HA3  . GLY A 1 1  ? 9.659   -22.304 -9.073  1.00 0.00 ? 1   GLY A HA3  4  
ATOM   1943  N  N    . SER A 1 2  ? 7.307   -21.835 -8.267  1.00 0.00 ? 2   SER A N    4  
ATOM   1944  C  CA   . SER A 1 2  ? 5.941   -21.866 -7.757  1.00 0.00 ? 2   SER A CA   4  
ATOM   1945  C  C    . SER A 1 2  ? 4.986   -22.442 -8.798  1.00 0.00 ? 2   SER A C    4  
ATOM   1946  O  O    . SER A 1 2  ? 4.985   -22.022 -9.955  1.00 0.00 ? 2   SER A O    4  
ATOM   1947  C  CB   . SER A 1 2  ? 5.491   -20.459 -7.359  1.00 0.00 ? 2   SER A CB   4  
ATOM   1948  O  OG   . SER A 1 2  ? 5.911   -20.142 -6.043  1.00 0.00 ? 2   SER A OG   4  
ATOM   1949  H  H    . SER A 1 2  ? 7.456   -21.787 -9.234  1.00 0.00 ? 2   SER A H    4  
ATOM   1950  H  HA   . SER A 1 2  ? 5.927   -22.500 -6.883  1.00 0.00 ? 2   SER A HA   4  
ATOM   1951  H  HB2  . SER A 1 2  ? 5.917   -19.740 -8.042  1.00 0.00 ? 2   SER A HB2  4  
ATOM   1952  H  HB3  . SER A 1 2  ? 4.413   -20.403 -7.403  1.00 0.00 ? 2   SER A HB3  4  
ATOM   1953  H  HG   . SER A 1 2  ? 5.156   -20.169 -5.451  1.00 0.00 ? 2   SER A HG   4  
ATOM   1954  N  N    . SER A 1 3  ? 4.174   -23.407 -8.378  1.00 0.00 ? 3   SER A N    4  
ATOM   1955  C  CA   . SER A 1 3  ? 3.216   -24.044 -9.273  1.00 0.00 ? 3   SER A CA   4  
ATOM   1956  C  C    . SER A 1 3  ? 2.355   -23.001 -9.979  1.00 0.00 ? 3   SER A C    4  
ATOM   1957  O  O    . SER A 1 3  ? 2.364   -22.900 -11.205 1.00 0.00 ? 3   SER A O    4  
ATOM   1958  C  CB   . SER A 1 3  ? 2.326   -25.015 -8.495  1.00 0.00 ? 3   SER A CB   4  
ATOM   1959  O  OG   . SER A 1 3  ? 2.959   -26.272 -8.336  1.00 0.00 ? 3   SER A OG   4  
ATOM   1960  H  H    . SER A 1 3  ? 4.223   -23.698 -7.443  1.00 0.00 ? 3   SER A H    4  
ATOM   1961  H  HA   . SER A 1 3  ? 3.773   -24.597 -10.015 1.00 0.00 ? 3   SER A HA   4  
ATOM   1962  H  HB2  . SER A 1 3  ? 2.118   -24.604 -7.518  1.00 0.00 ? 3   SER A HB2  4  
ATOM   1963  H  HB3  . SER A 1 3  ? 1.398   -25.157 -9.031  1.00 0.00 ? 3   SER A HB3  4  
ATOM   1964  H  HG   . SER A 1 3  ? 3.834   -26.146 -7.961  1.00 0.00 ? 3   SER A HG   4  
ATOM   1965  N  N    . GLY A 1 4  ? 1.611   -22.227 -9.195  1.00 0.00 ? 4   GLY A N    4  
ATOM   1966  C  CA   . GLY A 1 4  ? 0.755   -21.202 -9.761  1.00 0.00 ? 4   GLY A CA   4  
ATOM   1967  C  C    . GLY A 1 4  ? 0.018   -20.410 -8.699  1.00 0.00 ? 4   GLY A C    4  
ATOM   1968  O  O    . GLY A 1 4  ? -0.494  -20.979 -7.735  1.00 0.00 ? 4   GLY A O    4  
ATOM   1969  H  H    . GLY A 1 4  ? 1.645   -22.354 -8.223  1.00 0.00 ? 4   GLY A H    4  
ATOM   1970  H  HA2  . GLY A 1 4  ? 1.360   -20.525 -10.345 1.00 0.00 ? 4   GLY A HA2  4  
ATOM   1971  H  HA3  . GLY A 1 4  ? 0.030   -21.673 -10.410 1.00 0.00 ? 4   GLY A HA3  4  
ATOM   1972  N  N    . SER A 1 5  ? -0.035  -19.094 -8.874  1.00 0.00 ? 5   SER A N    4  
ATOM   1973  C  CA   . SER A 1 5  ? -0.709  -18.222 -7.920  1.00 0.00 ? 5   SER A CA   4  
ATOM   1974  C  C    . SER A 1 5  ? -1.811  -17.418 -8.604  1.00 0.00 ? 5   SER A C    4  
ATOM   1975  O  O    . SER A 1 5  ? -1.538  -16.547 -9.430  1.00 0.00 ? 5   SER A O    4  
ATOM   1976  C  CB   . SER A 1 5  ? 0.296   -17.274 -7.263  1.00 0.00 ? 5   SER A CB   4  
ATOM   1977  O  OG   . SER A 1 5  ? 0.749   -16.295 -8.182  1.00 0.00 ? 5   SER A OG   4  
ATOM   1978  H  H    . SER A 1 5  ? 0.393   -18.700 -9.664  1.00 0.00 ? 5   SER A H    4  
ATOM   1979  H  HA   . SER A 1 5  ? -1.154  -18.845 -7.159  1.00 0.00 ? 5   SER A HA   4  
ATOM   1980  H  HB2  . SER A 1 5  ? -0.173  -16.778 -6.428  1.00 0.00 ? 5   SER A HB2  4  
ATOM   1981  H  HB3  . SER A 1 5  ? 1.146   -17.843 -6.913  1.00 0.00 ? 5   SER A HB3  4  
ATOM   1982  H  HG   . SER A 1 5  ? 1.511   -15.840 -7.816  1.00 0.00 ? 5   SER A HG   4  
ATOM   1983  N  N    . SER A 1 6  ? -3.058  -17.717 -8.253  1.00 0.00 ? 6   SER A N    4  
ATOM   1984  C  CA   . SER A 1 6  ? -4.202  -17.025 -8.835  1.00 0.00 ? 6   SER A CA   4  
ATOM   1985  C  C    . SER A 1 6  ? -5.422  -17.132 -7.924  1.00 0.00 ? 6   SER A C    4  
ATOM   1986  O  O    . SER A 1 6  ? -5.768  -18.215 -7.456  1.00 0.00 ? 6   SER A O    4  
ATOM   1987  C  CB   . SER A 1 6  ? -4.529  -17.605 -10.212 1.00 0.00 ? 6   SER A CB   4  
ATOM   1988  O  OG   . SER A 1 6  ? -4.999  -18.937 -10.107 1.00 0.00 ? 6   SER A OG   4  
ATOM   1989  H  H    . SER A 1 6  ? -3.211  -18.421 -7.589  1.00 0.00 ? 6   SER A H    4  
ATOM   1990  H  HA   . SER A 1 6  ? -3.940  -15.984 -8.944  1.00 0.00 ? 6   SER A HA   4  
ATOM   1991  H  HB2  . SER A 1 6  ? -5.292  -17.003 -10.682 1.00 0.00 ? 6   SER A HB2  4  
ATOM   1992  H  HB3  . SER A 1 6  ? -3.638  -17.597 -10.823 1.00 0.00 ? 6   SER A HB3  4  
ATOM   1993  H  HG   . SER A 1 6  ? -5.621  -19.001 -9.378  1.00 0.00 ? 6   SER A HG   4  
ATOM   1994  N  N    . GLY A 1 7  ? -6.069  -15.997 -7.677  1.00 0.00 ? 7   GLY A N    4  
ATOM   1995  C  CA   . GLY A 1 7  ? -7.243  -15.983 -6.823  1.00 0.00 ? 7   GLY A CA   4  
ATOM   1996  C  C    . GLY A 1 7  ? -7.509  -14.616 -6.226  1.00 0.00 ? 7   GLY A C    4  
ATOM   1997  O  O    . GLY A 1 7  ? -6.655  -13.729 -6.279  1.00 0.00 ? 7   GLY A O    4  
ATOM   1998  H  H    . GLY A 1 7  ? -5.747  -15.162 -8.077  1.00 0.00 ? 7   GLY A H    4  
ATOM   1999  H  HA2  . GLY A 1 7  ? -8.101  -16.284 -7.405  1.00 0.00 ? 7   GLY A HA2  4  
ATOM   2000  H  HA3  . GLY A 1 7  ? -7.098  -16.692 -6.021  1.00 0.00 ? 7   GLY A HA3  4  
ATOM   2001  N  N    . THR A 1 8  ? -8.697  -14.441 -5.656  1.00 0.00 ? 8   THR A N    4  
ATOM   2002  C  CA   . THR A 1 8  ? -9.075  -13.172 -5.048  1.00 0.00 ? 8   THR A CA   4  
ATOM   2003  C  C    . THR A 1 8  ? -8.141  -12.813 -3.898  1.00 0.00 ? 8   THR A C    4  
ATOM   2004  O  O    . THR A 1 8  ? -7.924  -13.613 -2.989  1.00 0.00 ? 8   THR A O    4  
ATOM   2005  C  CB   . THR A 1 8  ? -10.524 -13.207 -4.526  1.00 0.00 ? 8   THR A CB   4  
ATOM   2006  O  OG1  . THR A 1 8  ? -11.404 -13.673 -5.555  1.00 0.00 ? 8   THR A OG1  4  
ATOM   2007  C  CG2  . THR A 1 8  ? -10.965 -11.828 -4.060  1.00 0.00 ? 8   THR A CG2  4  
ATOM   2008  H  H    . THR A 1 8  ? -9.334  -15.186 -5.645  1.00 0.00 ? 8   THR A H    4  
ATOM   2009  H  HA   . THR A 1 8  ? -9.006  -12.406 -5.807  1.00 0.00 ? 8   THR A HA   4  
ATOM   2010  H  HB   . THR A 1 8  ? -10.571 -13.887 -3.688  1.00 0.00 ? 8   THR A HB   4  
ATOM   2011  H  HG1  . THR A 1 8  ? -11.006 -13.510 -6.414  1.00 0.00 ? 8   THR A HG1  4  
ATOM   2012  H  HG21 . THR A 1 8  ? -10.648 -11.087 -4.778  1.00 0.00 ? 8   THR A HG21 4  
ATOM   2013  H  HG22 . THR A 1 8  ? -10.519 -11.613 -3.100  1.00 0.00 ? 8   THR A HG22 4  
ATOM   2014  H  HG23 . THR A 1 8  ? -12.041 -11.806 -3.971  1.00 0.00 ? 8   THR A HG23 4  
ATOM   2015  N  N    . GLY A 1 9  ? -7.591  -11.603 -3.943  1.00 0.00 ? 9   GLY A N    4  
ATOM   2016  C  CA   . GLY A 1 9  ? -6.687  -11.160 -2.898  1.00 0.00 ? 9   GLY A CA   4  
ATOM   2017  C  C    . GLY A 1 9  ? -7.290  -11.295 -1.514  1.00 0.00 ? 9   GLY A C    4  
ATOM   2018  O  O    . GLY A 1 9  ? -6.635  -11.773 -0.589  1.00 0.00 ? 9   GLY A O    4  
ATOM   2019  H  H    . GLY A 1 9  ? -7.800  -11.007 -4.693  1.00 0.00 ? 9   GLY A H    4  
ATOM   2020  H  HA2  . GLY A 1 9  ? -5.783  -11.750 -2.945  1.00 0.00 ? 9   GLY A HA2  4  
ATOM   2021  H  HA3  . GLY A 1 9  ? -6.437  -10.123 -3.070  1.00 0.00 ? 9   GLY A HA3  4  
ATOM   2022  N  N    . GLU A 1 10 ? -8.542  -10.870 -1.372  1.00 0.00 ? 10  GLU A N    4  
ATOM   2023  C  CA   . GLU A 1 10 ? -9.231  -10.944 -0.089  1.00 0.00 ? 10  GLU A CA   4  
ATOM   2024  C  C    . GLU A 1 10 ? -8.710  -9.879  0.871   1.00 0.00 ? 10  GLU A C    4  
ATOM   2025  O  O    . GLU A 1 10 ? -8.537  -10.134 2.062   1.00 0.00 ? 10  GLU A O    4  
ATOM   2026  C  CB   . GLU A 1 10 ? -9.058  -12.333 0.529   1.00 0.00 ? 10  GLU A CB   4  
ATOM   2027  C  CG   . GLU A 1 10 ? -10.177 -12.719 1.482   1.00 0.00 ? 10  GLU A CG   4  
ATOM   2028  C  CD   . GLU A 1 10 ? -10.338 -14.221 1.615   1.00 0.00 ? 10  GLU A CD   4  
ATOM   2029  O  OE1  . GLU A 1 10 ? -9.341  -14.897 1.946   1.00 0.00 ? 10  GLU A OE1  4  
ATOM   2030  O  OE2  . GLU A 1 10 ? -11.459 -14.721 1.388   1.00 0.00 ? 10  GLU A OE2  4  
ATOM   2031  H  H    . GLU A 1 10 ? -9.012  -10.499 -2.147  1.00 0.00 ? 10  GLU A H    4  
ATOM   2032  H  HA   . GLU A 1 10 ? -10.282 -10.768 -0.267  1.00 0.00 ? 10  GLU A HA   4  
ATOM   2033  H  HB2  . GLU A 1 10 ? -9.020  -13.065 -0.265  1.00 0.00 ? 10  GLU A HB2  4  
ATOM   2034  H  HB3  . GLU A 1 10 ? -8.126  -12.357 1.073   1.00 0.00 ? 10  GLU A HB3  4  
ATOM   2035  H  HG2  . GLU A 1 10 ? -9.960  -12.308 2.456   1.00 0.00 ? 10  GLU A HG2  4  
ATOM   2036  H  HG3  . GLU A 1 10 ? -11.104 -12.304 1.115   1.00 0.00 ? 10  GLU A HG3  4  
ATOM   2037  N  N    . ASN A 1 11 ? -8.460  -8.686  0.342   1.00 0.00 ? 11  ASN A N    4  
ATOM   2038  C  CA   . ASN A 1 11 ? -7.957  -7.581  1.152   1.00 0.00 ? 11  ASN A CA   4  
ATOM   2039  C  C    . ASN A 1 11 ? -8.327  -6.238  0.530   1.00 0.00 ? 11  ASN A C    4  
ATOM   2040  O  O    . ASN A 1 11 ? -8.338  -6.073  -0.690  1.00 0.00 ? 11  ASN A O    4  
ATOM   2041  C  CB   . ASN A 1 11 ? -6.438  -7.684  1.304   1.00 0.00 ? 11  ASN A CB   4  
ATOM   2042  C  CG   . ASN A 1 11 ? -6.030  -8.699  2.355   1.00 0.00 ? 11  ASN A CG   4  
ATOM   2043  O  OD1  . ASN A 1 11 ? -5.681  -9.836  2.034   1.00 0.00 ? 11  ASN A OD1  4  
ATOM   2044  N  ND2  . ASN A 1 11 ? -6.073  -8.293  3.618   1.00 0.00 ? 11  ASN A ND2  4  
ATOM   2045  H  H    . ASN A 1 11 ? -8.618  -8.543  -0.614  1.00 0.00 ? 11  ASN A H    4  
ATOM   2046  H  HA   . ASN A 1 11 ? -8.414  -7.651  2.127   1.00 0.00 ? 11  ASN A HA   4  
ATOM   2047  H  HB2  . ASN A 1 11 ? -6.007  -7.980  0.359   1.00 0.00 ? 11  ASN A HB2  4  
ATOM   2048  H  HB3  . ASN A 1 11 ? -6.045  -6.720  1.589   1.00 0.00 ? 11  ASN A HB3  4  
ATOM   2049  H  HD21 . ASN A 1 11 ? -6.362  -7.374  3.800   1.00 0.00 ? 11  ASN A HD21 4  
ATOM   2050  H  HD22 . ASN A 1 11 ? -5.814  -8.928  4.318   1.00 0.00 ? 11  ASN A HD22 4  
ATOM   2051  N  N    . PRO A 1 12 ? -8.637  -5.255  1.387   1.00 0.00 ? 12  PRO A N    4  
ATOM   2052  C  CA   . PRO A 1 12 ? -9.012  -3.908  0.945   1.00 0.00 ? 12  PRO A CA   4  
ATOM   2053  C  C    . PRO A 1 12 ? -7.835  -3.147  0.344   1.00 0.00 ? 12  PRO A C    4  
ATOM   2054  O  O    . PRO A 1 12 ? -7.933  -2.601  -0.755  1.00 0.00 ? 12  PRO A O    4  
ATOM   2055  C  CB   . PRO A 1 12 ? -9.485  -3.231  2.233   1.00 0.00 ? 12  PRO A CB   4  
ATOM   2056  C  CG   . PRO A 1 12 ? -8.781  -3.959  3.325   1.00 0.00 ? 12  PRO A CG   4  
ATOM   2057  C  CD   . PRO A 1 12 ? -8.645  -5.381  2.854   1.00 0.00 ? 12  PRO A CD   4  
ATOM   2058  H  HA   . PRO A 1 12 ? -9.823  -3.936  0.232   1.00 0.00 ? 12  PRO A HA   4  
ATOM   2059  H  HB2  . PRO A 1 12 ? -9.212  -2.185  2.214   1.00 0.00 ? 12  PRO A HB2  4  
ATOM   2060  H  HB3  . PRO A 1 12 ? -10.557 -3.327  2.322   1.00 0.00 ? 12  PRO A HB3  4  
ATOM   2061  H  HG2  . PRO A 1 12 ? -7.807  -3.523  3.488   1.00 0.00 ? 12  PRO A HG2  4  
ATOM   2062  H  HG3  . PRO A 1 12 ? -9.368  -3.919  4.231   1.00 0.00 ? 12  PRO A HG3  4  
ATOM   2063  H  HD2  . PRO A 1 12 ? -7.720  -5.809  3.209   1.00 0.00 ? 12  PRO A HD2  4  
ATOM   2064  H  HD3  . PRO A 1 12 ? -9.487  -5.970  3.185   1.00 0.00 ? 12  PRO A HD3  4  
ATOM   2065  N  N    . PHE A 1 13 ? -6.724  -3.115  1.071   1.00 0.00 ? 13  PHE A N    4  
ATOM   2066  C  CA   . PHE A 1 13 ? -5.528  -2.420  0.609   1.00 0.00 ? 13  PHE A CA   4  
ATOM   2067  C  C    . PHE A 1 13 ? -4.297  -2.879  1.386   1.00 0.00 ? 13  PHE A C    4  
ATOM   2068  O  O    . PHE A 1 13 ? -4.398  -3.290  2.543   1.00 0.00 ? 13  PHE A O    4  
ATOM   2069  C  CB   . PHE A 1 13 ? -5.703  -0.907  0.757   1.00 0.00 ? 13  PHE A CB   4  
ATOM   2070  C  CG   . PHE A 1 13 ? -7.069  -0.420  0.367   1.00 0.00 ? 13  PHE A CG   4  
ATOM   2071  C  CD1  . PHE A 1 13 ? -7.360  -0.117  -0.953  1.00 0.00 ? 13  PHE A CD1  4  
ATOM   2072  C  CD2  . PHE A 1 13 ? -8.062  -0.266  1.321   1.00 0.00 ? 13  PHE A CD2  4  
ATOM   2073  C  CE1  . PHE A 1 13 ? -8.617  0.331   -1.314  1.00 0.00 ? 13  PHE A CE1  4  
ATOM   2074  C  CE2  . PHE A 1 13 ? -9.321  0.182   0.966   1.00 0.00 ? 13  PHE A CE2  4  
ATOM   2075  C  CZ   . PHE A 1 13 ? -9.598  0.480   -0.354  1.00 0.00 ? 13  PHE A CZ   4  
ATOM   2076  H  H    . PHE A 1 13 ? -6.707  -3.569  1.940   1.00 0.00 ? 13  PHE A H    4  
ATOM   2077  H  HA   . PHE A 1 13 ? -5.389  -2.657  -0.434  1.00 0.00 ? 13  PHE A HA   4  
ATOM   2078  H  HB2  . PHE A 1 13 ? -5.534  -0.631  1.787   1.00 0.00 ? 13  PHE A HB2  4  
ATOM   2079  H  HB3  . PHE A 1 13 ? -4.979  -0.406  0.132   1.00 0.00 ? 13  PHE A HB3  4  
ATOM   2080  H  HD1  . PHE A 1 13 ? -6.594  -0.234  -1.705  1.00 0.00 ? 13  PHE A HD1  4  
ATOM   2081  H  HD2  . PHE A 1 13 ? -7.846  -0.500  2.354   1.00 0.00 ? 13  PHE A HD2  4  
ATOM   2082  H  HE1  . PHE A 1 13 ? -8.831  0.563   -2.347  1.00 0.00 ? 13  PHE A HE1  4  
ATOM   2083  H  HE2  . PHE A 1 13 ? -10.086 0.296   1.719   1.00 0.00 ? 13  PHE A HE2  4  
ATOM   2084  H  HZ   . PHE A 1 13 ? -10.581 0.830   -0.634  1.00 0.00 ? 13  PHE A HZ   4  
ATOM   2085  N  N    . ILE A 1 14 ? -3.138  -2.807  0.742   1.00 0.00 ? 14  ILE A N    4  
ATOM   2086  C  CA   . ILE A 1 14 ? -1.888  -3.215  1.372   1.00 0.00 ? 14  ILE A CA   4  
ATOM   2087  C  C    . ILE A 1 14 ? -0.726  -2.346  0.902   1.00 0.00 ? 14  ILE A C    4  
ATOM   2088  O  O    . ILE A 1 14 ? -0.633  -2.000  -0.276  1.00 0.00 ? 14  ILE A O    4  
ATOM   2089  C  CB   . ILE A 1 14 ? -1.563  -4.691  1.075   1.00 0.00 ? 14  ILE A CB   4  
ATOM   2090  C  CG1  . ILE A 1 14 ? -2.706  -5.592  1.548   1.00 0.00 ? 14  ILE A CG1  4  
ATOM   2091  C  CG2  . ILE A 1 14 ? -0.256  -5.090  1.742   1.00 0.00 ? 14  ILE A CG2  4  
ATOM   2092  C  CD1  . ILE A 1 14 ? -2.664  -6.983  0.954   1.00 0.00 ? 14  ILE A CD1  4  
ATOM   2093  H  H    . ILE A 1 14 ? -3.122  -2.472  -0.178  1.00 0.00 ? 14  ILE A H    4  
ATOM   2094  H  HA   . ILE A 1 14 ? -2.001  -3.100  2.441   1.00 0.00 ? 14  ILE A HA   4  
ATOM   2095  H  HB   . ILE A 1 14 ? -1.444  -4.803  0.009   1.00 0.00 ? 14  ILE A HB   4  
ATOM   2096  H  HG12 . ILE A 1 14 ? -2.659  -5.689  2.621   1.00 0.00 ? 14  ILE A HG12 4  
ATOM   2097  H  HG13 . ILE A 1 14 ? -3.648  -5.141  1.273   1.00 0.00 ? 14  ILE A HG13 4  
ATOM   2098  H  HG21 . ILE A 1 14 ? -0.013  -6.109  1.477   1.00 0.00 ? 14  ILE A HG21 4  
ATOM   2099  H  HG22 . ILE A 1 14 ? 0.534   -4.434  1.408   1.00 0.00 ? 14  ILE A HG22 4  
ATOM   2100  H  HG23 . ILE A 1 14 ? -0.359  -5.012  2.814   1.00 0.00 ? 14  ILE A HG23 4  
ATOM   2101  H  HD11 . ILE A 1 14 ? -2.633  -6.913  -0.124  1.00 0.00 ? 14  ILE A HD11 4  
ATOM   2102  H  HD12 . ILE A 1 14 ? -1.783  -7.499  1.306   1.00 0.00 ? 14  ILE A HD12 4  
ATOM   2103  H  HD13 . ILE A 1 14 ? -3.546  -7.529  1.253   1.00 0.00 ? 14  ILE A HD13 4  
ATOM   2104  N  N    . CYS A 1 15 ? 0.159   -1.999  1.830   1.00 0.00 ? 15  CYS A N    4  
ATOM   2105  C  CA   . CYS A 1 15 ? 1.316   -1.172  1.512   1.00 0.00 ? 15  CYS A CA   4  
ATOM   2106  C  C    . CYS A 1 15 ? 2.418   -2.004  0.863   1.00 0.00 ? 15  CYS A C    4  
ATOM   2107  O  O    . CYS A 1 15 ? 2.997   -2.888  1.495   1.00 0.00 ? 15  CYS A O    4  
ATOM   2108  C  CB   . CYS A 1 15 ? 1.850   -0.497  2.778   1.00 0.00 ? 15  CYS A CB   4  
ATOM   2109  S  SG   . CYS A 1 15 ? 3.152   0.739   2.468   1.00 0.00 ? 15  CYS A SG   4  
ATOM   2110  H  H    . CYS A 1 15 ? 0.030   -2.306  2.753   1.00 0.00 ? 15  CYS A H    4  
ATOM   2111  H  HA   . CYS A 1 15 ? 0.999   -0.411  0.816   1.00 0.00 ? 15  CYS A HA   4  
ATOM   2112  H  HB2  . CYS A 1 15 ? 1.036   0.004   3.280   1.00 0.00 ? 15  CYS A HB2  4  
ATOM   2113  H  HB3  . CYS A 1 15 ? 2.261   -1.251  3.432   1.00 0.00 ? 15  CYS A HB3  4  
ATOM   2114  N  N    . SER A 1 16 ? 2.702   -1.715  -0.403  1.00 0.00 ? 16  SER A N    4  
ATOM   2115  C  CA   . SER A 1 16 ? 3.732   -2.439  -1.139  1.00 0.00 ? 16  SER A CA   4  
ATOM   2116  C  C    . SER A 1 16 ? 5.094   -2.272  -0.474  1.00 0.00 ? 16  SER A C    4  
ATOM   2117  O  O    . SER A 1 16 ? 5.987   -3.100  -0.649  1.00 0.00 ? 16  SER A O    4  
ATOM   2118  C  CB   . SER A 1 16 ? 3.794   -1.947  -2.587  1.00 0.00 ? 16  SER A CB   4  
ATOM   2119  O  OG   . SER A 1 16 ? 4.112   -0.567  -2.643  1.00 0.00 ? 16  SER A OG   4  
ATOM   2120  H  H    . SER A 1 16 ? 2.206   -1.000  -0.852  1.00 0.00 ? 16  SER A H    4  
ATOM   2121  H  HA   . SER A 1 16 ? 3.468   -3.486  -1.135  1.00 0.00 ? 16  SER A HA   4  
ATOM   2122  H  HB2  . SER A 1 16 ? 4.552   -2.500  -3.120  1.00 0.00 ? 16  SER A HB2  4  
ATOM   2123  H  HB3  . SER A 1 16 ? 2.835   -2.103  -3.059  1.00 0.00 ? 16  SER A HB3  4  
ATOM   2124  H  HG   . SER A 1 16 ? 4.400   -0.340  -3.530  1.00 0.00 ? 16  SER A HG   4  
ATOM   2125  N  N    . GLU A 1 17 ? 5.245   -1.194  0.289   1.00 0.00 ? 17  GLU A N    4  
ATOM   2126  C  CA   . GLU A 1 17 ? 6.499   -0.918  0.980   1.00 0.00 ? 17  GLU A CA   4  
ATOM   2127  C  C    . GLU A 1 17 ? 6.730   -1.917  2.110   1.00 0.00 ? 17  GLU A C    4  
ATOM   2128  O  O    . GLU A 1 17 ? 7.683   -2.696  2.081   1.00 0.00 ? 17  GLU A O    4  
ATOM   2129  C  CB   . GLU A 1 17 ? 6.497   0.507   1.537   1.00 0.00 ? 17  GLU A CB   4  
ATOM   2130  C  CG   . GLU A 1 17 ? 6.209   1.570   0.490   1.00 0.00 ? 17  GLU A CG   4  
ATOM   2131  C  CD   . GLU A 1 17 ? 7.420   1.890   -0.365  1.00 0.00 ? 17  GLU A CD   4  
ATOM   2132  O  OE1  . GLU A 1 17 ? 8.277   0.997   -0.536  1.00 0.00 ? 17  GLU A OE1  4  
ATOM   2133  O  OE2  . GLU A 1 17 ? 7.511   3.032   -0.862  1.00 0.00 ? 17  GLU A OE2  4  
ATOM   2134  H  H    . GLU A 1 17 ? 4.496   -0.571  0.390   1.00 0.00 ? 17  GLU A H    4  
ATOM   2135  H  HA   . GLU A 1 17 ? 7.301   -1.013  0.263   1.00 0.00 ? 17  GLU A HA   4  
ATOM   2136  H  HB2  . GLU A 1 17 ? 5.745   0.578   2.309   1.00 0.00 ? 17  GLU A HB2  4  
ATOM   2137  H  HB3  . GLU A 1 17 ? 7.465   0.712   1.971   1.00 0.00 ? 17  GLU A HB3  4  
ATOM   2138  H  HG2  . GLU A 1 17 ? 5.416   1.218   -0.153  1.00 0.00 ? 17  GLU A HG2  4  
ATOM   2139  H  HG3  . GLU A 1 17 ? 5.891   2.473   0.990   1.00 0.00 ? 17  GLU A HG3  4  
ATOM   2140  N  N    . CYS A 1 18 ? 5.850   -1.889  3.106   1.00 0.00 ? 18  CYS A N    4  
ATOM   2141  C  CA   . CYS A 1 18 ? 5.956   -2.790  4.247   1.00 0.00 ? 18  CYS A CA   4  
ATOM   2142  C  C    . CYS A 1 18 ? 4.967   -3.945  4.121   1.00 0.00 ? 18  CYS A C    4  
ATOM   2143  O  O    . CYS A 1 18 ? 5.348   -5.113  4.188   1.00 0.00 ? 18  CYS A O    4  
ATOM   2144  C  CB   . CYS A 1 18 ? 5.705   -2.028  5.550   1.00 0.00 ? 18  CYS A CB   4  
ATOM   2145  S  SG   . CYS A 1 18 ? 4.256   -0.926  5.500   1.00 0.00 ? 18  CYS A SG   4  
ATOM   2146  H  H    . CYS A 1 18 ? 5.111   -1.245  3.073   1.00 0.00 ? 18  CYS A H    4  
ATOM   2147  H  HA   . CYS A 1 18 ? 6.958   -3.190  4.261   1.00 0.00 ? 18  CYS A HA   4  
ATOM   2148  H  HB2  . CYS A 1 18 ? 5.549   -2.739  6.349   1.00 0.00 ? 18  CYS A HB2  4  
ATOM   2149  H  HB3  . CYS A 1 18 ? 6.571   -1.424  5.777   1.00 0.00 ? 18  CYS A HB3  4  
ATOM   2150  N  N    . GLY A 1 19 ? 3.693   -3.609  3.939   1.00 0.00 ? 19  GLY A N    4  
ATOM   2151  C  CA   . GLY A 1 19 ? 2.669   -4.629  3.807   1.00 0.00 ? 19  GLY A CA   4  
ATOM   2152  C  C    . GLY A 1 19 ? 1.640   -4.563  4.917   1.00 0.00 ? 19  GLY A C    4  
ATOM   2153  O  O    . GLY A 1 19 ? 1.215   -5.593  5.442   1.00 0.00 ? 19  GLY A O    4  
ATOM   2154  H  H    . GLY A 1 19 ? 3.448   -2.661  3.894   1.00 0.00 ? 19  GLY A H    4  
ATOM   2155  H  HA2  . GLY A 1 19 ? 2.169   -4.500  2.858   1.00 0.00 ? 19  GLY A HA2  4  
ATOM   2156  H  HA3  . GLY A 1 19 ? 3.140   -5.601  3.826   1.00 0.00 ? 19  GLY A HA3  4  
ATOM   2157  N  N    . LYS A 1 20 ? 1.237   -3.349  5.279   1.00 0.00 ? 20  LYS A N    4  
ATOM   2158  C  CA   . LYS A 1 20 ? 0.251   -3.152  6.334   1.00 0.00 ? 20  LYS A CA   4  
ATOM   2159  C  C    . LYS A 1 20 ? -1.134  -2.906  5.746   1.00 0.00 ? 20  LYS A C    4  
ATOM   2160  O  O    . LYS A 1 20 ? -1.294  -2.109  4.821   1.00 0.00 ? 20  LYS A O    4  
ATOM   2161  C  CB   . LYS A 1 20 ? 0.656   -1.975  7.225   1.00 0.00 ? 20  LYS A CB   4  
ATOM   2162  C  CG   . LYS A 1 20 ? 0.112   -2.068  8.640   1.00 0.00 ? 20  LYS A CG   4  
ATOM   2163  C  CD   . LYS A 1 20 ? 0.425   -0.815  9.441   1.00 0.00 ? 20  LYS A CD   4  
ATOM   2164  C  CE   . LYS A 1 20 ? -0.523  -0.656  10.620  1.00 0.00 ? 20  LYS A CE   4  
ATOM   2165  N  NZ   . LYS A 1 20 ? -0.558  0.747   11.117  1.00 0.00 ? 20  LYS A NZ   4  
ATOM   2166  H  H    . LYS A 1 20 ? 1.613   -2.566  4.823   1.00 0.00 ? 20  LYS A H    4  
ATOM   2167  H  HA   . LYS A 1 20 ? 0.221   -4.051  6.932   1.00 0.00 ? 20  LYS A HA   4  
ATOM   2168  H  HB2  . LYS A 1 20 ? 1.734   -1.932  7.277   1.00 0.00 ? 20  LYS A HB2  4  
ATOM   2169  H  HB3  . LYS A 1 20 ? 0.290   -1.061  6.780   1.00 0.00 ? 20  LYS A HB3  4  
ATOM   2170  H  HG2  . LYS A 1 20 ? -0.959  -2.196  8.597   1.00 0.00 ? 20  LYS A HG2  4  
ATOM   2171  H  HG3  . LYS A 1 20 ? 0.560   -2.920  9.132   1.00 0.00 ? 20  LYS A HG3  4  
ATOM   2172  H  HD2  . LYS A 1 20 ? 1.437   -0.879  9.813   1.00 0.00 ? 20  LYS A HD2  4  
ATOM   2173  H  HD3  . LYS A 1 20 ? 0.331   0.047   8.795   1.00 0.00 ? 20  LYS A HD3  4  
ATOM   2174  H  HE2  . LYS A 1 20 ? -1.515  -0.943  10.308  1.00 0.00 ? 20  LYS A HE2  4  
ATOM   2175  H  HE3  . LYS A 1 20 ? -0.194  -1.304  11.419  1.00 0.00 ? 20  LYS A HE3  4  
ATOM   2176  H  HZ1  . LYS A 1 20 ? -1.381  1.246   10.723  1.00 0.00 ? 20  LYS A HZ1  4  
ATOM   2177  H  HZ2  . LYS A 1 20 ? 0.307   1.249   10.832  1.00 0.00 ? 20  LYS A HZ2  4  
ATOM   2178  H  HZ3  . LYS A 1 20 ? -0.625  0.757   12.155  1.00 0.00 ? 20  LYS A HZ3  4  
ATOM   2179  N  N    . VAL A 1 21 ? -2.133  -3.594  6.289   1.00 0.00 ? 21  VAL A N    4  
ATOM   2180  C  CA   . VAL A 1 21 ? -3.506  -3.447  5.819   1.00 0.00 ? 21  VAL A CA   4  
ATOM   2181  C  C    . VAL A 1 21 ? -4.184  -2.247  6.469   1.00 0.00 ? 21  VAL A C    4  
ATOM   2182  O  O    . VAL A 1 21 ? -4.074  -2.037  7.678   1.00 0.00 ? 21  VAL A O    4  
ATOM   2183  C  CB   . VAL A 1 21 ? -4.336  -4.712  6.109   1.00 0.00 ? 21  VAL A CB   4  
ATOM   2184  C  CG1  . VAL A 1 21 ? -5.760  -4.545  5.599   1.00 0.00 ? 21  VAL A CG1  4  
ATOM   2185  C  CG2  . VAL A 1 21 ? -3.679  -5.935  5.488   1.00 0.00 ? 21  VAL A CG2  4  
ATOM   2186  H  H    . VAL A 1 21 ? -1.943  -4.214  7.023   1.00 0.00 ? 21  VAL A H    4  
ATOM   2187  H  HA   . VAL A 1 21 ? -3.479  -3.298  4.750   1.00 0.00 ? 21  VAL A HA   4  
ATOM   2188  H  HB   . VAL A 1 21 ? -4.375  -4.855  7.179   1.00 0.00 ? 21  VAL A HB   4  
ATOM   2189  H  HG11 . VAL A 1 21 ? -6.130  -3.569  5.879   1.00 0.00 ? 21  VAL A HG11 4  
ATOM   2190  H  HG12 . VAL A 1 21 ? -5.771  -4.641  4.524   1.00 0.00 ? 21  VAL A HG12 4  
ATOM   2191  H  HG13 . VAL A 1 21 ? -6.390  -5.306  6.036   1.00 0.00 ? 21  VAL A HG13 4  
ATOM   2192  H  HG21 . VAL A 1 21 ? -4.340  -6.784  5.577   1.00 0.00 ? 21  VAL A HG21 4  
ATOM   2193  H  HG22 . VAL A 1 21 ? -3.476  -5.743  4.445   1.00 0.00 ? 21  VAL A HG22 4  
ATOM   2194  H  HG23 . VAL A 1 21 ? -2.752  -6.145  6.001   1.00 0.00 ? 21  VAL A HG23 4  
ATOM   2195  N  N    . PHE A 1 22 ? -4.887  -1.461  5.660   1.00 0.00 ? 22  PHE A N    4  
ATOM   2196  C  CA   . PHE A 1 22 ? -5.584  -0.280  6.156   1.00 0.00 ? 22  PHE A CA   4  
ATOM   2197  C  C    . PHE A 1 22 ? -7.083  -0.382  5.892   1.00 0.00 ? 22  PHE A C    4  
ATOM   2198  O  O    . PHE A 1 22 ? -7.513  -1.001  4.918   1.00 0.00 ? 22  PHE A O    4  
ATOM   2199  C  CB   . PHE A 1 22 ? -5.023  0.983   5.499   1.00 0.00 ? 22  PHE A CB   4  
ATOM   2200  C  CG   . PHE A 1 22 ? -3.620  1.308   5.926   1.00 0.00 ? 22  PHE A CG   4  
ATOM   2201  C  CD1  . PHE A 1 22 ? -2.544  0.604   5.410   1.00 0.00 ? 22  PHE A CD1  4  
ATOM   2202  C  CD2  . PHE A 1 22 ? -3.377  2.318   6.842   1.00 0.00 ? 22  PHE A CD2  4  
ATOM   2203  C  CE1  . PHE A 1 22 ? -1.252  0.901   5.801   1.00 0.00 ? 22  PHE A CE1  4  
ATOM   2204  C  CE2  . PHE A 1 22 ? -2.088  2.620   7.237   1.00 0.00 ? 22  PHE A CE2  4  
ATOM   2205  C  CZ   . PHE A 1 22 ? -1.024  1.911   6.715   1.00 0.00 ? 22  PHE A CZ   4  
ATOM   2206  H  H    . PHE A 1 22 ? -4.937  -1.681  4.706   1.00 0.00 ? 22  PHE A H    4  
ATOM   2207  H  HA   . PHE A 1 22 ? -5.421  -0.224  7.222   1.00 0.00 ? 22  PHE A HA   4  
ATOM   2208  H  HB2  . PHE A 1 22 ? -5.021  0.852   4.427   1.00 0.00 ? 22  PHE A HB2  4  
ATOM   2209  H  HB3  . PHE A 1 22 ? -5.652  1.822   5.754   1.00 0.00 ? 22  PHE A HB3  4  
ATOM   2210  H  HD1  . PHE A 1 22 ? -2.721  -0.185  4.694   1.00 0.00 ? 22  PHE A HD1  4  
ATOM   2211  H  HD2  . PHE A 1 22 ? -4.209  2.874   7.251   1.00 0.00 ? 22  PHE A HD2  4  
ATOM   2212  H  HE1  . PHE A 1 22 ? -0.422  0.345   5.391   1.00 0.00 ? 22  PHE A HE1  4  
ATOM   2213  H  HE2  . PHE A 1 22 ? -1.913  3.410   7.952   1.00 0.00 ? 22  PHE A HE2  4  
ATOM   2214  H  HZ   . PHE A 1 22 ? -0.015  2.145   7.023   1.00 0.00 ? 22  PHE A HZ   4  
ATOM   2215  N  N    . THR A 1 23 ? -7.875  0.230   6.767   1.00 0.00 ? 23  THR A N    4  
ATOM   2216  C  CA   . THR A 1 23 ? -9.326  0.207   6.630   1.00 0.00 ? 23  THR A CA   4  
ATOM   2217  C  C    . THR A 1 23 ? -9.797  1.225   5.598   1.00 0.00 ? 23  THR A C    4  
ATOM   2218  O  O    . THR A 1 23 ? -10.743 0.975   4.850   1.00 0.00 ? 23  THR A O    4  
ATOM   2219  C  CB   . THR A 1 23 ? -10.022 0.497   7.974   1.00 0.00 ? 23  THR A CB   4  
ATOM   2220  O  OG1  . THR A 1 23 ? -9.468  -0.334  9.000   1.00 0.00 ? 23  THR A OG1  4  
ATOM   2221  C  CG2  . THR A 1 23 ? -11.520 0.254   7.871   1.00 0.00 ? 23  THR A CG2  4  
ATOM   2222  H  H    . THR A 1 23 ? -7.473  0.707   7.522   1.00 0.00 ? 23  THR A H    4  
ATOM   2223  H  HA   . THR A 1 23 ? -9.615  -0.781  6.304   1.00 0.00 ? 23  THR A HA   4  
ATOM   2224  H  HB   . THR A 1 23 ? -9.856  1.533   8.231   1.00 0.00 ? 23  THR A HB   4  
ATOM   2225  H  HG1  . THR A 1 23 ? -10.040 -1.093  9.141   1.00 0.00 ? 23  THR A HG1  4  
ATOM   2226  H  HG21 . THR A 1 23 ? -11.999 1.132   7.464   1.00 0.00 ? 23  THR A HG21 4  
ATOM   2227  H  HG22 . THR A 1 23 ? -11.920 0.049   8.853   1.00 0.00 ? 23  THR A HG22 4  
ATOM   2228  H  HG23 . THR A 1 23 ? -11.704 -0.590  7.223   1.00 0.00 ? 23  THR A HG23 4  
ATOM   2229  N  N    . HIS A 1 24 ? -9.131  2.375   5.561   1.00 0.00 ? 24  HIS A N    4  
ATOM   2230  C  CA   . HIS A 1 24 ? -9.481  3.432   4.618   1.00 0.00 ? 24  HIS A CA   4  
ATOM   2231  C  C    . HIS A 1 24 ? -8.350  3.667   3.621   1.00 0.00 ? 24  HIS A C    4  
ATOM   2232  O  O    . HIS A 1 24 ? -7.240  4.041   4.002   1.00 0.00 ? 24  HIS A O    4  
ATOM   2233  C  CB   . HIS A 1 24 ? -9.796  4.728   5.365   1.00 0.00 ? 24  HIS A CB   4  
ATOM   2234  C  CG   . HIS A 1 24 ? -10.817 5.582   4.679   1.00 0.00 ? 24  HIS A CG   4  
ATOM   2235  N  ND1  . HIS A 1 24 ? -10.510 6.434   3.640   1.00 0.00 ? 24  HIS A ND1  4  
ATOM   2236  C  CD2  . HIS A 1 24 ? -12.148 5.710   4.889   1.00 0.00 ? 24  HIS A CD2  4  
ATOM   2237  C  CE1  . HIS A 1 24 ? -11.608 7.051   3.241   1.00 0.00 ? 24  HIS A CE1  4  
ATOM   2238  N  NE2  . HIS A 1 24 ? -12.616 6.629   3.982   1.00 0.00 ? 24  HIS A NE2  4  
ATOM   2239  H  H    . HIS A 1 24 ? -8.386  2.516   6.182   1.00 0.00 ? 24  HIS A H    4  
ATOM   2240  H  HA   . HIS A 1 24 ? -10.360 3.116   4.077   1.00 0.00 ? 24  HIS A HA   4  
ATOM   2241  H  HB2  . HIS A 1 24 ? -10.172 4.486   6.348   1.00 0.00 ? 24  HIS A HB2  4  
ATOM   2242  H  HB3  . HIS A 1 24 ? -8.890  5.308   5.464   1.00 0.00 ? 24  HIS A HB3  4  
ATOM   2243  H  HD1  . HIS A 1 24 ? -9.620  6.568   3.253   1.00 0.00 ? 24  HIS A HD1  4  
ATOM   2244  H  HD2  . HIS A 1 24 ? -12.735 5.188   5.632   1.00 0.00 ? 24  HIS A HD2  4  
ATOM   2245  H  HE1  . HIS A 1 24 ? -11.671 7.776   2.443   1.00 0.00 ? 24  HIS A HE1  4  
ATOM   2246  N  N    . LYS A 1 25 ? -8.638  3.445   2.343   1.00 0.00 ? 25  LYS A N    4  
ATOM   2247  C  CA   . LYS A 1 25 ? -7.647  3.633   1.291   1.00 0.00 ? 25  LYS A CA   4  
ATOM   2248  C  C    . LYS A 1 25 ? -6.837  4.903   1.527   1.00 0.00 ? 25  LYS A C    4  
ATOM   2249  O  O    . LYS A 1 25 ? -5.615  4.912   1.372   1.00 0.00 ? 25  LYS A O    4  
ATOM   2250  C  CB   . LYS A 1 25 ? -8.331  3.698   -0.077  1.00 0.00 ? 25  LYS A CB   4  
ATOM   2251  C  CG   . LYS A 1 25 ? -9.265  4.886   -0.233  1.00 0.00 ? 25  LYS A CG   4  
ATOM   2252  C  CD   . LYS A 1 25 ? -10.303 4.640   -1.315  1.00 0.00 ? 25  LYS A CD   4  
ATOM   2253  C  CE   . LYS A 1 25 ? -11.233 5.833   -1.477  1.00 0.00 ? 25  LYS A CE   4  
ATOM   2254  N  NZ   . LYS A 1 25 ? -12.317 5.833   -0.457  1.00 0.00 ? 25  LYS A NZ   4  
ATOM   2255  H  H    . LYS A 1 25 ? -9.541  3.148   2.102   1.00 0.00 ? 25  LYS A H    4  
ATOM   2256  H  HA   . LYS A 1 25 ? -6.979  2.785   1.309   1.00 0.00 ? 25  LYS A HA   4  
ATOM   2257  H  HB2  . LYS A 1 25 ? -7.572  3.760   -0.843  1.00 0.00 ? 25  LYS A HB2  4  
ATOM   2258  H  HB3  . LYS A 1 25 ? -8.904  2.794   -0.223  1.00 0.00 ? 25  LYS A HB3  4  
ATOM   2259  H  HG2  . LYS A 1 25 ? -9.772  5.059   0.704   1.00 0.00 ? 25  LYS A HG2  4  
ATOM   2260  H  HG3  . LYS A 1 25 ? -8.683  5.758   -0.497  1.00 0.00 ? 25  LYS A HG3  4  
ATOM   2261  H  HD2  . LYS A 1 25 ? -9.798  4.461   -2.253  1.00 0.00 ? 25  LYS A HD2  4  
ATOM   2262  H  HD3  . LYS A 1 25 ? -10.889 3.771   -1.049  1.00 0.00 ? 25  LYS A HD3  4  
ATOM   2263  H  HE2  . LYS A 1 25 ? -10.655 6.739   -1.377  1.00 0.00 ? 25  LYS A HE2  4  
ATOM   2264  H  HE3  . LYS A 1 25 ? -11.676 5.795   -2.462  1.00 0.00 ? 25  LYS A HE3  4  
ATOM   2265  H  HZ1  . LYS A 1 25 ? -12.757 4.893   -0.402  1.00 0.00 ? 25  LYS A HZ1  4  
ATOM   2266  H  HZ2  . LYS A 1 25 ? -13.046 6.531   -0.711  1.00 0.00 ? 25  LYS A HZ2  4  
ATOM   2267  H  HZ3  . LYS A 1 25 ? -11.929 6.078   0.476   1.00 0.00 ? 25  LYS A HZ3  4  
ATOM   2268  N  N    . THR A 1 26 ? -7.524  5.977   1.905   1.00 0.00 ? 26  THR A N    4  
ATOM   2269  C  CA   . THR A 1 26 ? -6.869  7.252   2.163   1.00 0.00 ? 26  THR A CA   4  
ATOM   2270  C  C    . THR A 1 26 ? -5.794  7.111   3.235   1.00 0.00 ? 26  THR A C    4  
ATOM   2271  O  O    . THR A 1 26 ? -4.666  7.571   3.061   1.00 0.00 ? 26  THR A O    4  
ATOM   2272  C  CB   . THR A 1 26 ? -7.882  8.325   2.606   1.00 0.00 ? 26  THR A CB   4  
ATOM   2273  O  OG1  . THR A 1 26 ? -8.938  8.427   1.645   1.00 0.00 ? 26  THR A OG1  4  
ATOM   2274  C  CG2  . THR A 1 26 ? -7.203  9.677   2.766   1.00 0.00 ? 26  THR A CG2  4  
ATOM   2275  H  H    . THR A 1 26 ? -8.496  5.907   2.011   1.00 0.00 ? 26  THR A H    4  
ATOM   2276  H  HA   . THR A 1 26 ? -6.406  7.582   1.244   1.00 0.00 ? 26  THR A HA   4  
ATOM   2277  H  HB   . THR A 1 26 ? -8.299  8.033   3.559   1.00 0.00 ? 26  THR A HB   4  
ATOM   2278  H  HG1  . THR A 1 26 ? -9.030  7.592   1.181   1.00 0.00 ? 26  THR A HG1  4  
ATOM   2279  H  HG21 . THR A 1 26 ? -6.926  10.058  1.795   1.00 0.00 ? 26  THR A HG21 4  
ATOM   2280  H  HG22 . THR A 1 26 ? -6.317  9.565   3.374   1.00 0.00 ? 26  THR A HG22 4  
ATOM   2281  H  HG23 . THR A 1 26 ? -7.883  10.367  3.244   1.00 0.00 ? 26  THR A HG23 4  
ATOM   2282  N  N    . ASN A 1 27 ? -6.152  6.472   4.344   1.00 0.00 ? 27  ASN A N    4  
ATOM   2283  C  CA   . ASN A 1 27 ? -5.217  6.271   5.445   1.00 0.00 ? 27  ASN A CA   4  
ATOM   2284  C  C    . ASN A 1 27 ? -3.920  5.638   4.949   1.00 0.00 ? 27  ASN A C    4  
ATOM   2285  O  O    . ASN A 1 27 ? -2.826  6.091   5.289   1.00 0.00 ? 27  ASN A O    4  
ATOM   2286  C  CB   . ASN A 1 27 ? -5.848  5.387   6.523   1.00 0.00 ? 27  ASN A CB   4  
ATOM   2287  C  CG   . ASN A 1 27 ? -4.929  5.178   7.711   1.00 0.00 ? 27  ASN A CG   4  
ATOM   2288  O  OD1  . ASN A 1 27 ? -3.800  5.667   7.730   1.00 0.00 ? 27  ASN A OD1  4  
ATOM   2289  N  ND2  . ASN A 1 27 ? -5.411  4.448   8.710   1.00 0.00 ? 27  ASN A ND2  4  
ATOM   2290  H  H    . ASN A 1 27 ? -7.066  6.128   4.425   1.00 0.00 ? 27  ASN A H    4  
ATOM   2291  H  HA   . ASN A 1 27 ? -4.993  7.237   5.871   1.00 0.00 ? 27  ASN A HA   4  
ATOM   2292  H  HB2  . ASN A 1 27 ? -6.758  5.852   6.874   1.00 0.00 ? 27  ASN A HB2  4  
ATOM   2293  H  HB3  . ASN A 1 27 ? -6.082  4.422   6.098   1.00 0.00 ? 27  ASN A HB3  4  
ATOM   2294  H  HD21 . ASN A 1 27 ? -6.320  4.090   8.626   1.00 0.00 ? 27  ASN A HD21 4  
ATOM   2295  H  HD22 . ASN A 1 27 ? -4.839  4.298   9.491   1.00 0.00 ? 27  ASN A HD22 4  
ATOM   2296  N  N    . LEU A 1 28 ? -4.050  4.591   4.143   1.00 0.00 ? 28  LEU A N    4  
ATOM   2297  C  CA   . LEU A 1 28 ? -2.888  3.896   3.598   1.00 0.00 ? 28  LEU A CA   4  
ATOM   2298  C  C    . LEU A 1 28 ? -2.016  4.848   2.786   1.00 0.00 ? 28  LEU A C    4  
ATOM   2299  O  O    . LEU A 1 28 ? -0.812  4.956   3.023   1.00 0.00 ? 28  LEU A O    4  
ATOM   2300  C  CB   . LEU A 1 28 ? -3.335  2.723   2.723   1.00 0.00 ? 28  LEU A CB   4  
ATOM   2301  C  CG   . LEU A 1 28 ? -2.275  2.143   1.786   1.00 0.00 ? 28  LEU A CG   4  
ATOM   2302  C  CD1  . LEU A 1 28 ? -1.161  1.483   2.584   1.00 0.00 ? 28  LEU A CD1  4  
ATOM   2303  C  CD2  . LEU A 1 28 ? -2.904  1.149   0.821   1.00 0.00 ? 28  LEU A CD2  4  
ATOM   2304  H  H    . LEU A 1 28 ? -4.947  4.276   3.908   1.00 0.00 ? 28  LEU A H    4  
ATOM   2305  H  HA   . LEU A 1 28 ? -2.311  3.516   4.427   1.00 0.00 ? 28  LEU A HA   4  
ATOM   2306  H  HB2  . LEU A 1 28 ? -3.668  1.932   3.376   1.00 0.00 ? 28  LEU A HB2  4  
ATOM   2307  H  HB3  . LEU A 1 28 ? -4.165  3.061   2.118   1.00 0.00 ? 28  LEU A HB3  4  
ATOM   2308  H  HG   . LEU A 1 28 ? -1.839  2.945   1.206   1.00 0.00 ? 28  LEU A HG   4  
ATOM   2309  H  HD11 . LEU A 1 28 ? -0.225  1.603   2.061   1.00 0.00 ? 28  LEU A HD11 4  
ATOM   2310  H  HD12 . LEU A 1 28 ? -1.377  0.431   2.701   1.00 0.00 ? 28  LEU A HD12 4  
ATOM   2311  H  HD13 . LEU A 1 28 ? -1.093  1.946   3.557   1.00 0.00 ? 28  LEU A HD13 4  
ATOM   2312  H  HD21 . LEU A 1 28 ? -3.959  1.061   1.031   1.00 0.00 ? 28  LEU A HD21 4  
ATOM   2313  H  HD22 . LEU A 1 28 ? -2.431  0.185   0.939   1.00 0.00 ? 28  LEU A HD22 4  
ATOM   2314  H  HD23 . LEU A 1 28 ? -2.766  1.495   -0.193  1.00 0.00 ? 28  LEU A HD23 4  
ATOM   2315  N  N    . ILE A 1 29 ? -2.631  5.536   1.830   1.00 0.00 ? 29  ILE A N    4  
ATOM   2316  C  CA   . ILE A 1 29 ? -1.911  6.481   0.986   1.00 0.00 ? 29  ILE A CA   4  
ATOM   2317  C  C    . ILE A 1 29 ? -1.094  7.457   1.826   1.00 0.00 ? 29  ILE A C    4  
ATOM   2318  O  O    . ILE A 1 29 ? 0.051   7.767   1.498   1.00 0.00 ? 29  ILE A O    4  
ATOM   2319  C  CB   . ILE A 1 29 ? -2.873  7.277   0.085   1.00 0.00 ? 29  ILE A CB   4  
ATOM   2320  C  CG1  . ILE A 1 29 ? -3.691  6.326   -0.790  1.00 0.00 ? 29  ILE A CG1  4  
ATOM   2321  C  CG2  . ILE A 1 29 ? -2.097  8.263   -0.777  1.00 0.00 ? 29  ILE A CG2  4  
ATOM   2322  C  CD1  . ILE A 1 29 ? -5.015  6.905   -1.239  1.00 0.00 ? 29  ILE A CD1  4  
ATOM   2323  H  H    . ILE A 1 29 ? -3.592  5.406   1.690   1.00 0.00 ? 29  ILE A H    4  
ATOM   2324  H  HA   . ILE A 1 29 ? -1.239  5.918   0.354   1.00 0.00 ? 29  ILE A HA   4  
ATOM   2325  H  HB   . ILE A 1 29 ? -3.542  7.839   0.718   1.00 0.00 ? 29  ILE A HB   4  
ATOM   2326  H  HG12 . ILE A 1 29 ? -3.122  6.078   -1.672  1.00 0.00 ? 29  ILE A HG12 4  
ATOM   2327  H  HG13 . ILE A 1 29 ? -3.895  5.423   -0.233  1.00 0.00 ? 29  ILE A HG13 4  
ATOM   2328  H  HG21 . ILE A 1 29 ? -1.350  8.758   -0.174  1.00 0.00 ? 29  ILE A HG21 4  
ATOM   2329  H  HG22 . ILE A 1 29 ? -1.614  7.732   -1.583  1.00 0.00 ? 29  ILE A HG22 4  
ATOM   2330  H  HG23 . ILE A 1 29 ? -2.776  8.997   -1.184  1.00 0.00 ? 29  ILE A HG23 4  
ATOM   2331  H  HD11 . ILE A 1 29 ? -5.772  6.687   -0.499  1.00 0.00 ? 29  ILE A HD11 4  
ATOM   2332  H  HD12 . ILE A 1 29 ? -4.920  7.975   -1.350  1.00 0.00 ? 29  ILE A HD12 4  
ATOM   2333  H  HD13 . ILE A 1 29 ? -5.299  6.467   -2.183  1.00 0.00 ? 29  ILE A HD13 4  
ATOM   2334  N  N    . ILE A 1 30 ? -1.691  7.937   2.913   1.00 0.00 ? 30  ILE A N    4  
ATOM   2335  C  CA   . ILE A 1 30 ? -1.017  8.875   3.802   1.00 0.00 ? 30  ILE A CA   4  
ATOM   2336  C  C    . ILE A 1 30 ? 0.141   8.206   4.532   1.00 0.00 ? 30  ILE A C    4  
ATOM   2337  O  O    . ILE A 1 30 ? 1.152   8.843   4.832   1.00 0.00 ? 30  ILE A O    4  
ATOM   2338  C  CB   . ILE A 1 30 ? -1.991  9.465   4.839   1.00 0.00 ? 30  ILE A CB   4  
ATOM   2339  C  CG1  . ILE A 1 30 ? -3.147  10.181  4.136   1.00 0.00 ? 30  ILE A CG1  4  
ATOM   2340  C  CG2  . ILE A 1 30 ? -1.258  10.419  5.770   1.00 0.00 ? 30  ILE A CG2  4  
ATOM   2341  C  CD1  . ILE A 1 30 ? -4.290  10.536  5.062   1.00 0.00 ? 30  ILE A CD1  4  
ATOM   2342  H  H    . ILE A 1 30 ? -2.604  7.652   3.121   1.00 0.00 ? 30  ILE A H    4  
ATOM   2343  H  HA   . ILE A 1 30 ? -0.630  9.685   3.200   1.00 0.00 ? 30  ILE A HA   4  
ATOM   2344  H  HB   . ILE A 1 30 ? -2.386  8.654   5.431   1.00 0.00 ? 30  ILE A HB   4  
ATOM   2345  H  HG12 . ILE A 1 30 ? -2.781  11.095  3.696   1.00 0.00 ? 30  ILE A HG12 4  
ATOM   2346  H  HG13 . ILE A 1 30 ? -3.536  9.541   3.357   1.00 0.00 ? 30  ILE A HG13 4  
ATOM   2347  H  HG21 . ILE A 1 30 ? -1.977  10.975  6.355   1.00 0.00 ? 30  ILE A HG21 4  
ATOM   2348  H  HG22 . ILE A 1 30 ? -0.618  9.855   6.432   1.00 0.00 ? 30  ILE A HG22 4  
ATOM   2349  H  HG23 . ILE A 1 30 ? -0.661  11.104  5.188   1.00 0.00 ? 30  ILE A HG23 4  
ATOM   2350  H  HD11 . ILE A 1 30 ? -3.935  10.551  6.082   1.00 0.00 ? 30  ILE A HD11 4  
ATOM   2351  H  HD12 . ILE A 1 30 ? -4.675  11.510  4.801   1.00 0.00 ? 30  ILE A HD12 4  
ATOM   2352  H  HD13 . ILE A 1 30 ? -5.073  9.800   4.965   1.00 0.00 ? 30  ILE A HD13 4  
ATOM   2353  N  N    . HIS A 1 31 ? -0.011  6.916   4.816   1.00 0.00 ? 31  HIS A N    4  
ATOM   2354  C  CA   . HIS A 1 31 ? 1.024   6.158   5.510   1.00 0.00 ? 31  HIS A CA   4  
ATOM   2355  C  C    . HIS A 1 31 ? 2.237   5.944   4.609   1.00 0.00 ? 31  HIS A C    4  
ATOM   2356  O  O    . HIS A 1 31 ? 3.363   6.270   4.981   1.00 0.00 ? 31  HIS A O    4  
ATOM   2357  C  CB   . HIS A 1 31 ? 0.474   4.809   5.974   1.00 0.00 ? 31  HIS A CB   4  
ATOM   2358  C  CG   . HIS A 1 31 ? 1.514   3.734   6.055   1.00 0.00 ? 31  HIS A CG   4  
ATOM   2359  N  ND1  . HIS A 1 31 ? 2.044   3.287   7.247   1.00 0.00 ? 31  HIS A ND1  4  
ATOM   2360  C  CD2  . HIS A 1 31 ? 2.120   3.014   5.082   1.00 0.00 ? 31  HIS A CD2  4  
ATOM   2361  C  CE1  . HIS A 1 31 ? 2.932   2.341   7.004   1.00 0.00 ? 31  HIS A CE1  4  
ATOM   2362  N  NE2  . HIS A 1 31 ? 2.998   2.156   5.698   1.00 0.00 ? 31  HIS A NE2  4  
ATOM   2363  H  H    . HIS A 1 31 ? -0.839  6.463   4.552   1.00 0.00 ? 31  HIS A H    4  
ATOM   2364  H  HA   . HIS A 1 31 ? 1.330   6.729   6.374   1.00 0.00 ? 31  HIS A HA   4  
ATOM   2365  H  HB2  . HIS A 1 31 ? 0.039   4.924   6.956   1.00 0.00 ? 31  HIS A HB2  4  
ATOM   2366  H  HB3  . HIS A 1 31 ? -0.290  4.482   5.283   1.00 0.00 ? 31  HIS A HB3  4  
ATOM   2367  H  HD1  . HIS A 1 31 ? 1.805   3.617   8.138   1.00 0.00 ? 31  HIS A HD1  4  
ATOM   2368  H  HD2  . HIS A 1 31 ? 1.948   3.099   4.018   1.00 0.00 ? 31  HIS A HD2  4  
ATOM   2369  H  HE1  . HIS A 1 31 ? 3.508   1.808   7.746   1.00 0.00 ? 31  HIS A HE1  4  
ATOM   2370  N  N    . GLN A 1 32 ? 1.997   5.393   3.423   1.00 0.00 ? 32  GLN A N    4  
ATOM   2371  C  CA   . GLN A 1 32 ? 3.070   5.134   2.470   1.00 0.00 ? 32  GLN A CA   4  
ATOM   2372  C  C    . GLN A 1 32 ? 4.084   6.273   2.470   1.00 0.00 ? 32  GLN A C    4  
ATOM   2373  O  O    . GLN A 1 32 ? 5.249   6.081   2.120   1.00 0.00 ? 32  GLN A O    4  
ATOM   2374  C  CB   . GLN A 1 32 ? 2.497   4.943   1.065   1.00 0.00 ? 32  GLN A CB   4  
ATOM   2375  C  CG   . GLN A 1 32 ? 1.640   3.696   0.921   1.00 0.00 ? 32  GLN A CG   4  
ATOM   2376  C  CD   . GLN A 1 32 ? 1.091   3.525   -0.482  1.00 0.00 ? 32  GLN A CD   4  
ATOM   2377  O  OE1  . GLN A 1 32 ? 1.304   4.369   -1.352  1.00 0.00 ? 32  GLN A OE1  4  
ATOM   2378  N  NE2  . GLN A 1 32 ? 0.380   2.426   -0.709  1.00 0.00 ? 32  GLN A NE2  4  
ATOM   2379  H  H    . GLN A 1 32 ? 1.077   5.155   3.184   1.00 0.00 ? 32  GLN A H    4  
ATOM   2380  H  HA   . GLN A 1 32 ? 3.568   4.225   2.772   1.00 0.00 ? 32  GLN A HA   4  
ATOM   2381  H  HB2  . GLN A 1 32 ? 1.892   5.802   0.816   1.00 0.00 ? 32  GLN A HB2  4  
ATOM   2382  H  HB3  . GLN A 1 32 ? 3.315   4.874   0.362   1.00 0.00 ? 32  GLN A HB3  4  
ATOM   2383  H  HG2  . GLN A 1 32 ? 2.240   2.832   1.164   1.00 0.00 ? 32  GLN A HG2  4  
ATOM   2384  H  HG3  . GLN A 1 32 ? 0.812   3.763   1.610   1.00 0.00 ? 32  GLN A HG3  4  
ATOM   2385  H  HE21 . GLN A 1 32 ? 0.250   1.798   0.032   1.00 0.00 ? 32  GLN A HE21 4  
ATOM   2386  H  HE22 . GLN A 1 32 ? 0.012   2.290   -1.607  1.00 0.00 ? 32  GLN A HE22 4  
ATOM   2387  N  N    . LYS A 1 33 ? 3.633   7.459   2.863   1.00 0.00 ? 33  LYS A N    4  
ATOM   2388  C  CA   . LYS A 1 33 ? 4.501   8.631   2.909   1.00 0.00 ? 33  LYS A CA   4  
ATOM   2389  C  C    . LYS A 1 33 ? 5.720   8.371   3.787   1.00 0.00 ? 33  LYS A C    4  
ATOM   2390  O  O    . LYS A 1 33 ? 6.849   8.683   3.406   1.00 0.00 ? 33  LYS A O    4  
ATOM   2391  C  CB   . LYS A 1 33 ? 3.728   9.842   3.436   1.00 0.00 ? 33  LYS A CB   4  
ATOM   2392  C  CG   . LYS A 1 33 ? 2.569   10.258  2.547   1.00 0.00 ? 33  LYS A CG   4  
ATOM   2393  C  CD   . LYS A 1 33 ? 2.280   11.745  2.665   1.00 0.00 ? 33  LYS A CD   4  
ATOM   2394  C  CE   . LYS A 1 33 ? 0.905   12.091  2.117   1.00 0.00 ? 33  LYS A CE   4  
ATOM   2395  N  NZ   . LYS A 1 33 ? 0.630   13.553  2.190   1.00 0.00 ? 33  LYS A NZ   4  
ATOM   2396  H  H    . LYS A 1 33 ? 2.694   7.549   3.130   1.00 0.00 ? 33  LYS A H    4  
ATOM   2397  H  HA   . LYS A 1 33 ? 4.834   8.836   1.903   1.00 0.00 ? 33  LYS A HA   4  
ATOM   2398  H  HB2  . LYS A 1 33 ? 3.338   9.607   4.415   1.00 0.00 ? 33  LYS A HB2  4  
ATOM   2399  H  HB3  . LYS A 1 33 ? 4.408   10.678  3.519   1.00 0.00 ? 33  LYS A HB3  4  
ATOM   2400  H  HG2  . LYS A 1 33 ? 2.814   10.030  1.520   1.00 0.00 ? 33  LYS A HG2  4  
ATOM   2401  H  HG3  . LYS A 1 33 ? 1.687   9.705   2.839   1.00 0.00 ? 33  LYS A HG3  4  
ATOM   2402  H  HD2  . LYS A 1 33 ? 2.322   12.029  3.706   1.00 0.00 ? 33  LYS A HD2  4  
ATOM   2403  H  HD3  . LYS A 1 33 ? 3.028   12.293  2.110   1.00 0.00 ? 33  LYS A HD3  4  
ATOM   2404  H  HE2  . LYS A 1 33 ? 0.852   11.776  1.086   1.00 0.00 ? 33  LYS A HE2  4  
ATOM   2405  H  HE3  . LYS A 1 33 ? 0.159   11.564  2.693   1.00 0.00 ? 33  LYS A HE3  4  
ATOM   2406  H  HZ1  . LYS A 1 33 ? 1.519   14.088  2.120   1.00 0.00 ? 33  LYS A HZ1  4  
ATOM   2407  H  HZ2  . LYS A 1 33 ? 0.169   13.785  3.094   1.00 0.00 ? 33  LYS A HZ2  4  
ATOM   2408  H  HZ3  . LYS A 1 33 ? 0.003   13.839  1.411   1.00 0.00 ? 33  LYS A HZ3  4  
ATOM   2409  N  N    . ILE A 1 34 ? 5.486   7.796   4.962   1.00 0.00 ? 34  ILE A N    4  
ATOM   2410  C  CA   . ILE A 1 34 ? 6.566   7.492   5.892   1.00 0.00 ? 34  ILE A CA   4  
ATOM   2411  C  C    . ILE A 1 34 ? 7.738   6.829   5.177   1.00 0.00 ? 34  ILE A C    4  
ATOM   2412  O  O    . ILE A 1 34 ? 8.885   6.935   5.611   1.00 0.00 ? 34  ILE A O    4  
ATOM   2413  C  CB   . ILE A 1 34 ? 6.086   6.571   7.030   1.00 0.00 ? 34  ILE A CB   4  
ATOM   2414  C  CG1  . ILE A 1 34 ? 5.858   5.152   6.505   1.00 0.00 ? 34  ILE A CG1  4  
ATOM   2415  C  CG2  . ILE A 1 34 ? 4.813   7.122   7.656   1.00 0.00 ? 34  ILE A CG2  4  
ATOM   2416  C  CD1  . ILE A 1 34 ? 5.796   4.107   7.597   1.00 0.00 ? 34  ILE A CD1  4  
ATOM   2417  H  H    . ILE A 1 34 ? 4.565   7.571   5.209   1.00 0.00 ? 34  ILE A H    4  
ATOM   2418  H  HA   . ILE A 1 34 ? 6.903   8.423   6.327   1.00 0.00 ? 34  ILE A HA   4  
ATOM   2419  H  HB   . ILE A 1 34 ? 6.852   6.548   7.791   1.00 0.00 ? 34  ILE A HB   4  
ATOM   2420  H  HG12 . ILE A 1 34 ? 4.926   5.121   5.964   1.00 0.00 ? 34  ILE A HG12 4  
ATOM   2421  H  HG13 . ILE A 1 34 ? 6.666   4.889   5.838   1.00 0.00 ? 34  ILE A HG13 4  
ATOM   2422  H  HG21 . ILE A 1 34 ? 5.026   7.471   8.656   1.00 0.00 ? 34  ILE A HG21 4  
ATOM   2423  H  HG22 . ILE A 1 34 ? 4.445   7.943   7.059   1.00 0.00 ? 34  ILE A HG22 4  
ATOM   2424  H  HG23 . ILE A 1 34 ? 4.067   6.343   7.698   1.00 0.00 ? 34  ILE A HG23 4  
ATOM   2425  H  HD11 . ILE A 1 34 ? 6.608   3.405   7.469   1.00 0.00 ? 34  ILE A HD11 4  
ATOM   2426  H  HD12 . ILE A 1 34 ? 5.885   4.587   8.561   1.00 0.00 ? 34  ILE A HD12 4  
ATOM   2427  H  HD13 . ILE A 1 34 ? 4.855   3.582   7.540   1.00 0.00 ? 34  ILE A HD13 4  
ATOM   2428  N  N    . HIS A 1 35 ? 7.441   6.146   4.075   1.00 0.00 ? 35  HIS A N    4  
ATOM   2429  C  CA   . HIS A 1 35 ? 8.471   5.467   3.297   1.00 0.00 ? 35  HIS A CA   4  
ATOM   2430  C  C    . HIS A 1 35 ? 9.237   6.460   2.428   1.00 0.00 ? 35  HIS A C    4  
ATOM   2431  O  O    . HIS A 1 35 ? 10.451  6.340   2.251   1.00 0.00 ? 35  HIS A O    4  
ATOM   2432  C  CB   . HIS A 1 35 ? 7.845   4.382   2.421   1.00 0.00 ? 35  HIS A CB   4  
ATOM   2433  C  CG   . HIS A 1 35 ? 7.380   3.184   3.191   1.00 0.00 ? 35  HIS A CG   4  
ATOM   2434  N  ND1  . HIS A 1 35 ? 8.228   2.176   3.599   1.00 0.00 ? 35  HIS A ND1  4  
ATOM   2435  C  CD2  . HIS A 1 35 ? 6.147   2.838   3.629   1.00 0.00 ? 35  HIS A CD2  4  
ATOM   2436  C  CE1  . HIS A 1 35 ? 7.536   1.261   4.254   1.00 0.00 ? 35  HIS A CE1  4  
ATOM   2437  N  NE2  . HIS A 1 35 ? 6.271   1.638   4.287   1.00 0.00 ? 35  HIS A NE2  4  
ATOM   2438  H  H    . HIS A 1 35 ? 6.509   6.098   3.780   1.00 0.00 ? 35  HIS A H    4  
ATOM   2439  H  HA   . HIS A 1 35 ? 9.160   5.007   3.988   1.00 0.00 ? 35  HIS A HA   4  
ATOM   2440  H  HB2  . HIS A 1 35 ? 6.992   4.794   1.903   1.00 0.00 ? 35  HIS A HB2  4  
ATOM   2441  H  HB3  . HIS A 1 35 ? 8.574   4.048   1.696   1.00 0.00 ? 35  HIS A HB3  4  
ATOM   2442  H  HD1  . HIS A 1 35 ? 9.192   2.137   3.432   1.00 0.00 ? 35  HIS A HD1  4  
ATOM   2443  H  HD2  . HIS A 1 35 ? 5.235   3.400   3.489   1.00 0.00 ? 35  HIS A HD2  4  
ATOM   2444  H  HE1  . HIS A 1 35 ? 7.937   0.357   4.689   1.00 0.00 ? 35  HIS A HE1  4  
ATOM   2445  N  N    . THR A 1 36 ? 8.522   7.440   1.885   1.00 0.00 ? 36  THR A N    4  
ATOM   2446  C  CA   . THR A 1 36 ? 9.134   8.452   1.033   1.00 0.00 ? 36  THR A CA   4  
ATOM   2447  C  C    . THR A 1 36 ? 9.392   9.739   1.807   1.00 0.00 ? 36  THR A C    4  
ATOM   2448  O  O    . THR A 1 36 ? 8.603   10.128  2.666   1.00 0.00 ? 36  THR A O    4  
ATOM   2449  C  CB   . THR A 1 36 ? 8.248   8.769   -0.187  1.00 0.00 ? 36  THR A CB   4  
ATOM   2450  O  OG1  . THR A 1 36 ? 8.937   9.657   -1.074  1.00 0.00 ? 36  THR A OG1  4  
ATOM   2451  C  CG2  . THR A 1 36 ? 6.933   9.397   0.248   1.00 0.00 ? 36  THR A CG2  4  
ATOM   2452  H  H    . THR A 1 36 ? 7.559   7.482   2.063   1.00 0.00 ? 36  THR A H    4  
ATOM   2453  H  HA   . THR A 1 36 ? 10.076  8.062   0.676   1.00 0.00 ? 36  THR A HA   4  
ATOM   2454  H  HB   . THR A 1 36 ? 8.035   7.846   -0.708  1.00 0.00 ? 36  THR A HB   4  
ATOM   2455  H  HG1  . THR A 1 36 ? 9.574   10.176  -0.577  1.00 0.00 ? 36  THR A HG1  4  
ATOM   2456  H  HG21 . THR A 1 36 ? 6.691   9.069   1.247   1.00 0.00 ? 36  THR A HG21 4  
ATOM   2457  H  HG22 . THR A 1 36 ? 6.148   9.094   -0.430  1.00 0.00 ? 36  THR A HG22 4  
ATOM   2458  H  HG23 . THR A 1 36 ? 7.026   10.473  0.234   1.00 0.00 ? 36  THR A HG23 4  
ATOM   2459  N  N    . GLY A 1 37 ? 10.505  10.398  1.496   1.00 0.00 ? 37  GLY A N    4  
ATOM   2460  C  CA   . GLY A 1 37 ? 10.847  11.636  2.172   1.00 0.00 ? 37  GLY A CA   4  
ATOM   2461  C  C    . GLY A 1 37 ? 12.227  12.140  1.795   1.00 0.00 ? 37  GLY A C    4  
ATOM   2462  O  O    . GLY A 1 37 ? 12.366  12.980  0.907   1.00 0.00 ? 37  GLY A O    4  
ATOM   2463  H  H    . GLY A 1 37 ? 11.098  10.041  0.802   1.00 0.00 ? 37  GLY A H    4  
ATOM   2464  H  HA2  . GLY A 1 37 ? 10.117  12.388  1.913   1.00 0.00 ? 37  GLY A HA2  4  
ATOM   2465  H  HA3  . GLY A 1 37 ? 10.816  11.471  3.239   1.00 0.00 ? 37  GLY A HA3  4  
ATOM   2466  N  N    . GLU A 1 38 ? 13.248  11.626  2.474   1.00 0.00 ? 38  GLU A N    4  
ATOM   2467  C  CA   . GLU A 1 38 ? 14.623  12.032  2.206   1.00 0.00 ? 38  GLU A CA   4  
ATOM   2468  C  C    . GLU A 1 38 ? 15.103  11.479  0.868   1.00 0.00 ? 38  GLU A C    4  
ATOM   2469  O  O    . GLU A 1 38 ? 14.582  10.478  0.375   1.00 0.00 ? 38  GLU A O    4  
ATOM   2470  C  CB   . GLU A 1 38 ? 15.547  11.555  3.329   1.00 0.00 ? 38  GLU A CB   4  
ATOM   2471  C  CG   . GLU A 1 38 ? 15.637  10.042  3.441   1.00 0.00 ? 38  GLU A CG   4  
ATOM   2472  C  CD   . GLU A 1 38 ? 16.729  9.457   2.567   1.00 0.00 ? 38  GLU A CD   4  
ATOM   2473  O  OE1  . GLU A 1 38 ? 17.894  9.886   2.707   1.00 0.00 ? 38  GLU A OE1  4  
ATOM   2474  O  OE2  . GLU A 1 38 ? 16.420  8.571   1.743   1.00 0.00 ? 38  GLU A OE2  4  
ATOM   2475  H  H    . GLU A 1 38 ? 13.073  10.960  3.171   1.00 0.00 ? 38  GLU A H    4  
ATOM   2476  H  HA   . GLU A 1 38 ? 14.648  13.111  2.166   1.00 0.00 ? 38  GLU A HA   4  
ATOM   2477  H  HB2  . GLU A 1 38 ? 16.539  11.942  3.152   1.00 0.00 ? 38  GLU A HB2  4  
ATOM   2478  H  HB3  . GLU A 1 38 ? 15.181  11.943  4.268   1.00 0.00 ? 38  GLU A HB3  4  
ATOM   2479  H  HG2  . GLU A 1 38 ? 15.841  9.781   4.468   1.00 0.00 ? 38  GLU A HG2  4  
ATOM   2480  H  HG3  . GLU A 1 38 ? 14.691  9.615   3.143   1.00 0.00 ? 38  GLU A HG3  4  
ATOM   2481  N  N    . ARG A 1 39 ? 16.099  12.137  0.285   1.00 0.00 ? 39  ARG A N    4  
ATOM   2482  C  CA   . ARG A 1 39 ? 16.649  11.713  -0.997  1.00 0.00 ? 39  ARG A CA   4  
ATOM   2483  C  C    . ARG A 1 39 ? 15.551  11.608  -2.051  1.00 0.00 ? 39  ARG A C    4  
ATOM   2484  O  O    . ARG A 1 39 ? 15.365  10.571  -2.689  1.00 0.00 ? 39  ARG A O    4  
ATOM   2485  C  CB   . ARG A 1 39 ? 17.360  10.367  -0.851  1.00 0.00 ? 39  ARG A CB   4  
ATOM   2486  C  CG   . ARG A 1 39 ? 18.704  10.462  -0.146  1.00 0.00 ? 39  ARG A CG   4  
ATOM   2487  C  CD   . ARG A 1 39 ? 19.827  10.763  -1.126  1.00 0.00 ? 39  ARG A CD   4  
ATOM   2488  N  NE   . ARG A 1 39 ? 21.113  10.255  -0.657  1.00 0.00 ? 39  ARG A NE   4  
ATOM   2489  C  CZ   . ARG A 1 39 ? 22.284  10.745  -1.049  1.00 0.00 ? 39  ARG A CZ   4  
ATOM   2490  N  NH1  . ARG A 1 39 ? 22.330  11.751  -1.911  1.00 0.00 ? 39  ARG A NH1  4  
ATOM   2491  N  NH2  . ARG A 1 39 ? 23.412  10.229  -0.577  1.00 0.00 ? 39  ARG A NH2  4  
ATOM   2492  H  H    . ARG A 1 39 ? 16.473  12.928  0.727   1.00 0.00 ? 39  ARG A H    4  
ATOM   2493  H  HA   . ARG A 1 39 ? 17.365  12.457  -1.314  1.00 0.00 ? 39  ARG A HA   4  
ATOM   2494  H  HB2  . ARG A 1 39 ? 16.729  9.698   -0.285  1.00 0.00 ? 39  ARG A HB2  4  
ATOM   2495  H  HB3  . ARG A 1 39 ? 17.523  9.951   -1.833  1.00 0.00 ? 39  ARG A HB3  4  
ATOM   2496  H  HG2  . ARG A 1 39 ? 18.660  11.253  0.588   1.00 0.00 ? 39  ARG A HG2  4  
ATOM   2497  H  HG3  . ARG A 1 39 ? 18.909  9.523   0.346   1.00 0.00 ? 39  ARG A HG3  4  
ATOM   2498  H  HD2  . ARG A 1 39 ? 19.593  10.303  -2.074  1.00 0.00 ? 39  ARG A HD2  4  
ATOM   2499  H  HD3  . ARG A 1 39 ? 19.898  11.833  -1.253  1.00 0.00 ? 39  ARG A HD3  4  
ATOM   2500  H  HE   . ARG A 1 39 ? 21.103  9.512   -0.019  1.00 0.00 ? 39  ARG A HE   4  
ATOM   2501  H  HH11 . ARG A 1 39 ? 21.482  12.143  -2.267  1.00 0.00 ? 39  ARG A HH11 4  
ATOM   2502  H  HH12 . ARG A 1 39 ? 23.213  12.120  -2.203  1.00 0.00 ? 39  ARG A HH12 4  
ATOM   2503  H  HH21 . ARG A 1 39 ? 23.381  9.471   0.073   1.00 0.00 ? 39  ARG A HH21 4  
ATOM   2504  H  HH22 . ARG A 1 39 ? 24.292  10.599  -0.873  1.00 0.00 ? 39  ARG A HH22 4  
ATOM   2505  N  N    . PRO A 1 40 ? 14.804  12.706  -2.240  1.00 0.00 ? 40  PRO A N    4  
ATOM   2506  C  CA   . PRO A 1 40 ? 13.711  12.763  -3.216  1.00 0.00 ? 40  PRO A CA   4  
ATOM   2507  C  C    . PRO A 1 40 ? 14.217  12.740  -4.654  1.00 0.00 ? 40  PRO A C    4  
ATOM   2508  O  O    . PRO A 1 40 ? 15.400  12.506  -4.903  1.00 0.00 ? 40  PRO A O    4  
ATOM   2509  C  CB   . PRO A 1 40 ? 13.031  14.099  -2.909  1.00 0.00 ? 40  PRO A CB   4  
ATOM   2510  C  CG   . PRO A 1 40 ? 14.095  14.931  -2.282  1.00 0.00 ? 40  PRO A CG   4  
ATOM   2511  C  CD   . PRO A 1 40 ? 14.969  13.977  -1.516  1.00 0.00 ? 40  PRO A CD   4  
ATOM   2512  H  HA   . PRO A 1 40 ? 13.008  11.956  -3.071  1.00 0.00 ? 40  PRO A HA   4  
ATOM   2513  H  HB2  . PRO A 1 40 ? 12.671  14.542  -3.828  1.00 0.00 ? 40  PRO A HB2  4  
ATOM   2514  H  HB3  . PRO A 1 40 ? 12.205  13.939  -2.233  1.00 0.00 ? 40  PRO A HB3  4  
ATOM   2515  H  HG2  . PRO A 1 40 ? 14.668  15.432  -3.047  1.00 0.00 ? 40  PRO A HG2  4  
ATOM   2516  H  HG3  . PRO A 1 40 ? 13.650  15.652  -1.612  1.00 0.00 ? 40  PRO A HG3  4  
ATOM   2517  H  HD2  . PRO A 1 40 ? 15.998  14.305  -1.541  1.00 0.00 ? 40  PRO A HD2  4  
ATOM   2518  H  HD3  . PRO A 1 40 ? 14.625  13.887  -0.496  1.00 0.00 ? 40  PRO A HD3  4  
ATOM   2519  N  N    . SER A 1 41 ? 13.314  12.986  -5.598  1.00 0.00 ? 41  SER A N    4  
ATOM   2520  C  CA   . SER A 1 41 ? 13.669  12.991  -7.013  1.00 0.00 ? 41  SER A CA   4  
ATOM   2521  C  C    . SER A 1 41 ? 13.035  14.180  -7.728  1.00 0.00 ? 41  SER A C    4  
ATOM   2522  O  O    . SER A 1 41 ? 11.813  14.306  -7.783  1.00 0.00 ? 41  SER A O    4  
ATOM   2523  C  CB   . SER A 1 41 ? 13.224  11.686  -7.676  1.00 0.00 ? 41  SER A CB   4  
ATOM   2524  O  OG   . SER A 1 41 ? 13.566  11.670  -9.051  1.00 0.00 ? 41  SER A OG   4  
ATOM   2525  H  H    . SER A 1 41 ? 12.387  13.166  -5.337  1.00 0.00 ? 41  SER A H    4  
ATOM   2526  H  HA   . SER A 1 41 ? 14.743  13.073  -7.085  1.00 0.00 ? 41  SER A HA   4  
ATOM   2527  H  HB2  . SER A 1 41 ? 13.708  10.854  -7.188  1.00 0.00 ? 41  SER A HB2  4  
ATOM   2528  H  HB3  . SER A 1 41 ? 12.152  11.585  -7.582  1.00 0.00 ? 41  SER A HB3  4  
ATOM   2529  H  HG   . SER A 1 41 ? 13.995  10.839  -9.265  1.00 0.00 ? 41  SER A HG   4  
ATOM   2530  N  N    . GLY A 1 42 ? 13.878  15.052  -8.274  1.00 0.00 ? 42  GLY A N    4  
ATOM   2531  C  CA   . GLY A 1 42 ? 13.383  16.220  -8.979  1.00 0.00 ? 42  GLY A CA   4  
ATOM   2532  C  C    . GLY A 1 42 ? 13.764  17.516  -8.292  1.00 0.00 ? 42  GLY A C    4  
ATOM   2533  O  O    . GLY A 1 42 ? 14.681  17.562  -7.471  1.00 0.00 ? 42  GLY A O    4  
ATOM   2534  H  H    . GLY A 1 42 ? 14.843  14.900  -8.199  1.00 0.00 ? 42  GLY A H    4  
ATOM   2535  H  HA2  . GLY A 1 42 ? 13.788  16.222  -9.979  1.00 0.00 ? 42  GLY A HA2  4  
ATOM   2536  H  HA3  . GLY A 1 42 ? 12.306  16.161  -9.038  1.00 0.00 ? 42  GLY A HA3  4  
ATOM   2537  N  N    . PRO A 1 43 ? 13.051  18.601  -8.628  1.00 0.00 ? 43  PRO A N    4  
ATOM   2538  C  CA   . PRO A 1 43 ? 13.303  19.924  -8.050  1.00 0.00 ? 43  PRO A CA   4  
ATOM   2539  C  C    . PRO A 1 43 ? 12.906  19.999  -6.580  1.00 0.00 ? 43  PRO A C    4  
ATOM   2540  O  O    . PRO A 1 43 ? 12.482  19.006  -5.990  1.00 0.00 ? 43  PRO A O    4  
ATOM   2541  C  CB   . PRO A 1 43 ? 12.421  20.852  -8.890  1.00 0.00 ? 43  PRO A CB   4  
ATOM   2542  C  CG   . PRO A 1 43 ? 11.328  19.977  -9.399  1.00 0.00 ? 43  PRO A CG   4  
ATOM   2543  C  CD   . PRO A 1 43 ? 11.944  18.619  -9.599  1.00 0.00 ? 43  PRO A CD   4  
ATOM   2544  H  HA   . PRO A 1 43 ? 14.338  20.214  -8.158  1.00 0.00 ? 43  PRO A HA   4  
ATOM   2545  H  HB2  . PRO A 1 43 ? 12.034  21.646  -8.267  1.00 0.00 ? 43  PRO A HB2  4  
ATOM   2546  H  HB3  . PRO A 1 43 ? 13.000  21.271  -9.698  1.00 0.00 ? 43  PRO A HB3  4  
ATOM   2547  H  HG2  . PRO A 1 43 ? 10.531  19.924  -8.673  1.00 0.00 ? 43  PRO A HG2  4  
ATOM   2548  H  HG3  . PRO A 1 43 ? 10.958  20.361  -10.338 1.00 0.00 ? 43  PRO A HG3  4  
ATOM   2549  H  HD2  . PRO A 1 43 ? 11.226  17.843  -9.379  1.00 0.00 ? 43  PRO A HD2  4  
ATOM   2550  H  HD3  . PRO A 1 43 ? 12.315  18.518  -10.608 1.00 0.00 ? 43  PRO A HD3  4  
ATOM   2551  N  N    . SER A 1 44 ? 13.047  21.184  -5.993  1.00 0.00 ? 44  SER A N    4  
ATOM   2552  C  CA   . SER A 1 44 ? 12.707  21.387  -4.590  1.00 0.00 ? 44  SER A CA   4  
ATOM   2553  C  C    . SER A 1 44 ? 12.098  22.770  -4.374  1.00 0.00 ? 44  SER A C    4  
ATOM   2554  O  O    . SER A 1 44 ? 12.780  23.787  -4.499  1.00 0.00 ? 44  SER A O    4  
ATOM   2555  C  CB   . SER A 1 44 ? 13.949  21.222  -3.712  1.00 0.00 ? 44  SER A CB   4  
ATOM   2556  O  OG   . SER A 1 44 ? 13.696  21.646  -2.384  1.00 0.00 ? 44  SER A OG   4  
ATOM   2557  H  H    . SER A 1 44 ? 13.391  21.938  -6.516  1.00 0.00 ? 44  SER A H    4  
ATOM   2558  H  HA   . SER A 1 44 ? 11.979  20.639  -4.314  1.00 0.00 ? 44  SER A HA   4  
ATOM   2559  H  HB2  . SER A 1 44 ? 14.239  20.182  -3.696  1.00 0.00 ? 44  SER A HB2  4  
ATOM   2560  H  HB3  . SER A 1 44 ? 14.755  21.814  -4.120  1.00 0.00 ? 44  SER A HB3  4  
ATOM   2561  H  HG   . SER A 1 44 ? 13.624  22.603  -2.362  1.00 0.00 ? 44  SER A HG   4  
ATOM   2562  N  N    . SER A 1 45 ? 10.810  22.798  -4.048  1.00 0.00 ? 45  SER A N    4  
ATOM   2563  C  CA   . SER A 1 45 ? 10.107  24.054  -3.817  1.00 0.00 ? 45  SER A CA   4  
ATOM   2564  C  C    . SER A 1 45 ? 10.570  24.706  -2.518  1.00 0.00 ? 45  SER A C    4  
ATOM   2565  O  O    . SER A 1 45 ? 10.889  25.893  -2.485  1.00 0.00 ? 45  SER A O    4  
ATOM   2566  C  CB   . SER A 1 45 ? 8.596   23.817  -3.772  1.00 0.00 ? 45  SER A CB   4  
ATOM   2567  O  OG   . SER A 1 45 ? 8.045   23.789  -5.077  1.00 0.00 ? 45  SER A OG   4  
ATOM   2568  H  H    . SER A 1 45 ? 10.320  21.953  -3.963  1.00 0.00 ? 45  SER A H    4  
ATOM   2569  H  HA   . SER A 1 45 ? 10.334  24.717  -4.639  1.00 0.00 ? 45  SER A HA   4  
ATOM   2570  H  HB2  . SER A 1 45 ? 8.397   22.872  -3.290  1.00 0.00 ? 45  SER A HB2  4  
ATOM   2571  H  HB3  . SER A 1 45 ? 8.126   24.613  -3.212  1.00 0.00 ? 45  SER A HB3  4  
ATOM   2572  H  HG   . SER A 1 45 ? 8.642   23.323  -5.667  1.00 0.00 ? 45  SER A HG   4  
ATOM   2573  N  N    . GLY A 1 46 ? 10.603  23.918  -1.447  1.00 0.00 ? 46  GLY A N    4  
ATOM   2574  C  CA   . GLY A 1 46 ? 11.028  24.434  -0.159  1.00 0.00 ? 46  GLY A CA   4  
ATOM   2575  C  C    . GLY A 1 46 ? 10.345  25.739  0.197   1.00 0.00 ? 46  GLY A C    4  
ATOM   2576  O  O    . GLY A 1 46 ? 10.806  26.429  1.104   1.00 0.00 ? 46  GLY A O    4  
ATOM   2577  H  H    . GLY A 1 46 ? 10.337  22.978  -1.533  1.00 0.00 ? 46  GLY A H    4  
ATOM   2578  H  HA2  . GLY A 1 46 ? 10.803  23.702  0.602   1.00 0.00 ? 46  GLY A HA2  4  
ATOM   2579  H  HA3  . GLY A 1 46 ? 12.096  24.596  -0.184  1.00 0.00 ? 46  GLY A HA3  4  
HETATM 2580  ZN ZN   . ZN  B 2 .  ? 4.331   1.033   4.525   1.00 0.00 ? 201 ZN  A ZN   4  
ATOM   2581  N  N    . GLY A 1 1  ? -11.457 -22.351 -7.791  1.00 0.00 ? 1   GLY A N    5  
ATOM   2582  C  CA   . GLY A 1 1  ? -12.053 -22.638 -6.499  1.00 0.00 ? 1   GLY A CA   5  
ATOM   2583  C  C    . GLY A 1 1  ? -11.219 -23.601 -5.676  1.00 0.00 ? 1   GLY A C    5  
ATOM   2584  O  O    . GLY A 1 1  ? -11.473 -24.805 -5.674  1.00 0.00 ? 1   GLY A O    5  
ATOM   2585  H  H1   . GLY A 1 1  ? -10.844 -22.998 -8.200  1.00 0.00 ? 1   GLY A H1   5  
ATOM   2586  H  HA2  . GLY A 1 1  ? -12.161 -21.713 -5.951  1.00 0.00 ? 1   GLY A HA2  5  
ATOM   2587  H  HA3  . GLY A 1 1  ? -13.031 -23.068 -6.654  1.00 0.00 ? 1   GLY A HA3  5  
ATOM   2588  N  N    . SER A 1 2  ? -10.221 -23.069 -4.978  1.00 0.00 ? 2   SER A N    5  
ATOM   2589  C  CA   . SER A 1 2  ? -9.344  -23.891 -4.152  1.00 0.00 ? 2   SER A CA   5  
ATOM   2590  C  C    . SER A 1 2  ? -9.632  -23.673 -2.670  1.00 0.00 ? 2   SER A C    5  
ATOM   2591  O  O    . SER A 1 2  ? -9.878  -22.549 -2.233  1.00 0.00 ? 2   SER A O    5  
ATOM   2592  C  CB   . SER A 1 2  ? -7.879  -23.570 -4.451  1.00 0.00 ? 2   SER A CB   5  
ATOM   2593  O  OG   . SER A 1 2  ? -7.596  -23.716 -5.832  1.00 0.00 ? 2   SER A OG   5  
ATOM   2594  H  H    . SER A 1 2  ? -10.070 -22.102 -5.021  1.00 0.00 ? 2   SER A H    5  
ATOM   2595  H  HA   . SER A 1 2  ? -9.534  -24.926 -4.395  1.00 0.00 ? 2   SER A HA   5  
ATOM   2596  H  HB2  . SER A 1 2  ? -7.669  -22.552 -4.159  1.00 0.00 ? 2   SER A HB2  5  
ATOM   2597  H  HB3  . SER A 1 2  ? -7.244  -24.243 -3.893  1.00 0.00 ? 2   SER A HB3  5  
ATOM   2598  H  HG   . SER A 1 2  ? -8.216  -24.336 -6.222  1.00 0.00 ? 2   SER A HG   5  
ATOM   2599  N  N    . SER A 1 3  ? -9.600  -24.757 -1.901  1.00 0.00 ? 3   SER A N    5  
ATOM   2600  C  CA   . SER A 1 3  ? -9.861  -24.686 -0.468  1.00 0.00 ? 3   SER A CA   5  
ATOM   2601  C  C    . SER A 1 3  ? -8.556  -24.631 0.320   1.00 0.00 ? 3   SER A C    5  
ATOM   2602  O  O    . SER A 1 3  ? -7.531  -25.152 -0.118  1.00 0.00 ? 3   SER A O    5  
ATOM   2603  C  CB   . SER A 1 3  ? -10.691 -25.890 -0.020  1.00 0.00 ? 3   SER A CB   5  
ATOM   2604  O  OG   . SER A 1 3  ? -11.183 -25.709 1.297   1.00 0.00 ? 3   SER A OG   5  
ATOM   2605  H  H    . SER A 1 3  ? -9.398  -25.625 -2.309  1.00 0.00 ? 3   SER A H    5  
ATOM   2606  H  HA   . SER A 1 3  ? -10.421 -23.783 -0.278  1.00 0.00 ? 3   SER A HA   5  
ATOM   2607  H  HB2  . SER A 1 3  ? -11.527 -26.018 -0.690  1.00 0.00 ? 3   SER A HB2  5  
ATOM   2608  H  HB3  . SER A 1 3  ? -10.074 -26.777 -0.041  1.00 0.00 ? 3   SER A HB3  5  
ATOM   2609  H  HG   . SER A 1 3  ? -10.578 -25.150 1.790   1.00 0.00 ? 3   SER A HG   5  
ATOM   2610  N  N    . GLY A 1 4  ? -8.602  -23.995 1.486   1.00 0.00 ? 4   GLY A N    5  
ATOM   2611  C  CA   . GLY A 1 4  ? -7.418  -23.883 2.318   1.00 0.00 ? 4   GLY A CA   5  
ATOM   2612  C  C    . GLY A 1 4  ? -7.071  -22.444 2.642   1.00 0.00 ? 4   GLY A C    5  
ATOM   2613  O  O    . GLY A 1 4  ? -7.448  -21.929 3.695   1.00 0.00 ? 4   GLY A O    5  
ATOM   2614  H  H    . GLY A 1 4  ? -9.447  -23.599 1.785   1.00 0.00 ? 4   GLY A H    5  
ATOM   2615  H  HA2  . GLY A 1 4  ? -7.587  -24.419 3.240   1.00 0.00 ? 4   GLY A HA2  5  
ATOM   2616  H  HA3  . GLY A 1 4  ? -6.584  -24.334 1.799   1.00 0.00 ? 4   GLY A HA3  5  
ATOM   2617  N  N    . SER A 1 5  ? -6.349  -21.792 1.736   1.00 0.00 ? 5   SER A N    5  
ATOM   2618  C  CA   . SER A 1 5  ? -5.947  -20.404 1.933   1.00 0.00 ? 5   SER A CA   5  
ATOM   2619  C  C    . SER A 1 5  ? -7.111  -19.457 1.659   1.00 0.00 ? 5   SER A C    5  
ATOM   2620  O  O    . SER A 1 5  ? -7.253  -18.935 0.553   1.00 0.00 ? 5   SER A O    5  
ATOM   2621  C  CB   . SER A 1 5  ? -4.767  -20.059 1.023   1.00 0.00 ? 5   SER A CB   5  
ATOM   2622  O  OG   . SER A 1 5  ? -3.652  -20.891 1.295   1.00 0.00 ? 5   SER A OG   5  
ATOM   2623  H  H    . SER A 1 5  ? -6.079  -22.257 0.916   1.00 0.00 ? 5   SER A H    5  
ATOM   2624  H  HA   . SER A 1 5  ? -5.641  -20.291 2.963   1.00 0.00 ? 5   SER A HA   5  
ATOM   2625  H  HB2  . SER A 1 5  ? -5.059  -20.194 -0.007  1.00 0.00 ? 5   SER A HB2  5  
ATOM   2626  H  HB3  . SER A 1 5  ? -4.481  -19.029 1.184   1.00 0.00 ? 5   SER A HB3  5  
ATOM   2627  H  HG   . SER A 1 5  ? -3.246  -20.622 2.122   1.00 0.00 ? 5   SER A HG   5  
ATOM   2628  N  N    . SER A 1 6  ? -7.941  -19.239 2.674   1.00 0.00 ? 6   SER A N    5  
ATOM   2629  C  CA   . SER A 1 6  ? -9.095  -18.358 2.542   1.00 0.00 ? 6   SER A CA   5  
ATOM   2630  C  C    . SER A 1 6  ? -9.476  -17.756 3.891   1.00 0.00 ? 6   SER A C    5  
ATOM   2631  O  O    . SER A 1 6  ? -9.932  -18.459 4.791   1.00 0.00 ? 6   SER A O    5  
ATOM   2632  C  CB   . SER A 1 6  ? -10.284 -19.124 1.959   1.00 0.00 ? 6   SER A CB   5  
ATOM   2633  O  OG   . SER A 1 6  ? -10.164 -19.259 0.553   1.00 0.00 ? 6   SER A OG   5  
ATOM   2634  H  H    . SER A 1 6  ? -7.774  -19.685 3.531   1.00 0.00 ? 6   SER A H    5  
ATOM   2635  H  HA   . SER A 1 6  ? -8.826  -17.559 1.867   1.00 0.00 ? 6   SER A HA   5  
ATOM   2636  H  HB2  . SER A 1 6  ? -10.327 -20.107 2.401   1.00 0.00 ? 6   SER A HB2  5  
ATOM   2637  H  HB3  . SER A 1 6  ? -11.197 -18.589 2.180   1.00 0.00 ? 6   SER A HB3  5  
ATOM   2638  H  HG   . SER A 1 6  ? -10.705 -19.994 0.255   1.00 0.00 ? 6   SER A HG   5  
ATOM   2639  N  N    . GLY A 1 7  ? -9.283  -16.447 4.023   1.00 0.00 ? 7   GLY A N    5  
ATOM   2640  C  CA   . GLY A 1 7  ? -9.611  -15.770 5.264   1.00 0.00 ? 7   GLY A CA   5  
ATOM   2641  C  C    . GLY A 1 7  ? -10.940 -15.044 5.196   1.00 0.00 ? 7   GLY A C    5  
ATOM   2642  O  O    . GLY A 1 7  ? -11.050 -13.893 5.618   1.00 0.00 ? 7   GLY A O    5  
ATOM   2643  H  H    . GLY A 1 7  ? -8.916  -15.936 3.271   1.00 0.00 ? 7   GLY A H    5  
ATOM   2644  H  HA2  . GLY A 1 7  ? -9.651  -16.500 6.059   1.00 0.00 ? 7   GLY A HA2  5  
ATOM   2645  H  HA3  . GLY A 1 7  ? -8.834  -15.054 5.487   1.00 0.00 ? 7   GLY A HA3  5  
ATOM   2646  N  N    . THR A 1 8  ? -11.954 -15.718 4.661   1.00 0.00 ? 8   THR A N    5  
ATOM   2647  C  CA   . THR A 1 8  ? -13.281 -15.129 4.536   1.00 0.00 ? 8   THR A CA   5  
ATOM   2648  C  C    . THR A 1 8  ? -13.233 -13.828 3.742   1.00 0.00 ? 8   THR A C    5  
ATOM   2649  O  O    . THR A 1 8  ? -13.895 -12.852 4.092   1.00 0.00 ? 8   THR A O    5  
ATOM   2650  C  CB   . THR A 1 8  ? -13.905 -14.852 5.917   1.00 0.00 ? 8   THR A CB   5  
ATOM   2651  O  OG1  . THR A 1 8  ? -13.791 -16.013 6.748   1.00 0.00 ? 8   THR A OG1  5  
ATOM   2652  C  CG2  . THR A 1 8  ? -15.369 -14.463 5.780   1.00 0.00 ? 8   THR A CG2  5  
ATOM   2653  H  H    . THR A 1 8  ? -11.803 -16.632 4.342   1.00 0.00 ? 8   THR A H    5  
ATOM   2654  H  HA   . THR A 1 8  ? -13.911 -15.835 4.014   1.00 0.00 ? 8   THR A HA   5  
ATOM   2655  H  HB   . THR A 1 8  ? -13.372 -14.034 6.378   1.00 0.00 ? 8   THR A HB   5  
ATOM   2656  H  HG1  . THR A 1 8  ? -12.900 -16.366 6.682   1.00 0.00 ? 8   THR A HG1  5  
ATOM   2657  H  HG21 . THR A 1 8  ? -15.888 -14.685 6.701   1.00 0.00 ? 8   THR A HG21 5  
ATOM   2658  H  HG22 . THR A 1 8  ? -15.817 -15.022 4.972   1.00 0.00 ? 8   THR A HG22 5  
ATOM   2659  H  HG23 . THR A 1 8  ? -15.442 -13.406 5.571   1.00 0.00 ? 8   THR A HG23 5  
ATOM   2660  N  N    . GLY A 1 9  ? -12.445 -13.822 2.671   1.00 0.00 ? 9   GLY A N    5  
ATOM   2661  C  CA   . GLY A 1 9  ? -12.326 -12.636 1.844   1.00 0.00 ? 9   GLY A CA   5  
ATOM   2662  C  C    . GLY A 1 9  ? -10.892 -12.162 1.713   1.00 0.00 ? 9   GLY A C    5  
ATOM   2663  O  O    . GLY A 1 9  ? -9.973  -12.795 2.232   1.00 0.00 ? 9   GLY A O    5  
ATOM   2664  H  H    . GLY A 1 9  ? -11.940 -14.631 2.441   1.00 0.00 ? 9   GLY A H    5  
ATOM   2665  H  HA2  . GLY A 1 9  ? -12.713 -12.855 0.861   1.00 0.00 ? 9   GLY A HA2  5  
ATOM   2666  H  HA3  . GLY A 1 9  ? -12.915 -11.844 2.284   1.00 0.00 ? 9   GLY A HA3  5  
ATOM   2667  N  N    . GLU A 1 10 ? -10.701 -11.046 1.016   1.00 0.00 ? 10  GLU A N    5  
ATOM   2668  C  CA   . GLU A 1 10 ? -9.367  -10.491 0.816   1.00 0.00 ? 10  GLU A CA   5  
ATOM   2669  C  C    . GLU A 1 10 ? -9.261  -9.097  1.430   1.00 0.00 ? 10  GLU A C    5  
ATOM   2670  O  O    . GLU A 1 10 ? -10.263 -8.403  1.596   1.00 0.00 ? 10  GLU A O    5  
ATOM   2671  C  CB   . GLU A 1 10 ? -9.034  -10.430 -0.676  1.00 0.00 ? 10  GLU A CB   5  
ATOM   2672  C  CG   . GLU A 1 10 ? -8.827  -11.795 -1.310  1.00 0.00 ? 10  GLU A CG   5  
ATOM   2673  C  CD   . GLU A 1 10 ? -7.856  -11.757 -2.474  1.00 0.00 ? 10  GLU A CD   5  
ATOM   2674  O  OE1  . GLU A 1 10 ? -7.005  -10.843 -2.506  1.00 0.00 ? 10  GLU A OE1  5  
ATOM   2675  O  OE2  . GLU A 1 10 ? -7.947  -12.639 -3.352  1.00 0.00 ? 10  GLU A OE2  5  
ATOM   2676  H  H    . GLU A 1 10 ? -11.474 -10.587 0.627   1.00 0.00 ? 10  GLU A H    5  
ATOM   2677  H  HA   . GLU A 1 10 ? -8.660  -11.142 1.307   1.00 0.00 ? 10  GLU A HA   5  
ATOM   2678  H  HB2  . GLU A 1 10 ? -9.843  -9.934  -1.193  1.00 0.00 ? 10  GLU A HB2  5  
ATOM   2679  H  HB3  . GLU A 1 10 ? -8.130  -9.855  -0.807  1.00 0.00 ? 10  GLU A HB3  5  
ATOM   2680  H  HG2  . GLU A 1 10 ? -8.441  -12.470 -0.561  1.00 0.00 ? 10  GLU A HG2  5  
ATOM   2681  H  HG3  . GLU A 1 10 ? -9.779  -12.161 -1.666  1.00 0.00 ? 10  GLU A HG3  5  
ATOM   2682  N  N    . ASN A 1 11 ? -8.039  -8.697  1.765   1.00 0.00 ? 11  ASN A N    5  
ATOM   2683  C  CA   . ASN A 1 11 ? -7.801  -7.387  2.361   1.00 0.00 ? 11  ASN A CA   5  
ATOM   2684  C  C    . ASN A 1 11 ? -8.142  -6.272  1.378   1.00 0.00 ? 11  ASN A C    5  
ATOM   2685  O  O    . ASN A 1 11 ? -8.070  -6.440  0.161   1.00 0.00 ? 11  ASN A O    5  
ATOM   2686  C  CB   . ASN A 1 11 ? -6.342  -7.263  2.805   1.00 0.00 ? 11  ASN A CB   5  
ATOM   2687  C  CG   . ASN A 1 11 ? -5.391  -7.992  1.875   1.00 0.00 ? 11  ASN A CG   5  
ATOM   2688  O  OD1  . ASN A 1 11 ? -5.098  -7.522  0.775   1.00 0.00 ? 11  ASN A OD1  5  
ATOM   2689  N  ND2  . ASN A 1 11 ? -4.904  -9.147  2.313   1.00 0.00 ? 11  ASN A ND2  5  
ATOM   2690  H  H    . ASN A 1 11 ? -7.279  -9.296  1.608   1.00 0.00 ? 11  ASN A H    5  
ATOM   2691  H  HA   . ASN A 1 11 ? -8.440  -7.296  3.227   1.00 0.00 ? 11  ASN A HA   5  
ATOM   2692  H  HB2  . ASN A 1 11 ? -6.065  -6.219  2.824   1.00 0.00 ? 11  ASN A HB2  5  
ATOM   2693  H  HB3  . ASN A 1 11 ? -6.236  -7.678  3.796   1.00 0.00 ? 11  ASN A HB3  5  
ATOM   2694  H  HD21 . ASN A 1 11 ? -5.182  -9.461  3.200   1.00 0.00 ? 11  ASN A HD21 5  
ATOM   2695  H  HD22 . ASN A 1 11 ? -4.287  -9.639  1.733   1.00 0.00 ? 11  ASN A HD22 5  
ATOM   2696  N  N    . PRO A 1 12 ? -8.521  -5.103  1.917   1.00 0.00 ? 12  PRO A N    5  
ATOM   2697  C  CA   . PRO A 1 12 ? -8.879  -3.936  1.105   1.00 0.00 ? 12  PRO A CA   5  
ATOM   2698  C  C    . PRO A 1 12 ? -7.673  -3.330  0.397   1.00 0.00 ? 12  PRO A C    5  
ATOM   2699  O  O    . PRO A 1 12 ? -7.712  -3.069  -0.805  1.00 0.00 ? 12  PRO A O    5  
ATOM   2700  C  CB   . PRO A 1 12 ? -9.448  -2.952  2.131   1.00 0.00 ? 12  PRO A CB   5  
ATOM   2701  C  CG   . PRO A 1 12 ? -8.813  -3.340  3.421   1.00 0.00 ? 12  PRO A CG   5  
ATOM   2702  C  CD   . PRO A 1 12 ? -8.629  -4.831  3.360   1.00 0.00 ? 12  PRO A CD   5  
ATOM   2703  H  HA   . PRO A 1 12 ? -9.639  -4.178  0.376   1.00 0.00 ? 12  PRO A HA   5  
ATOM   2704  H  HB2  . PRO A 1 12 ? -9.186  -1.943  1.848   1.00 0.00 ? 12  PRO A HB2  5  
ATOM   2705  H  HB3  . PRO A 1 12 ? -10.522 -3.052  2.174   1.00 0.00 ? 12  PRO A HB3  5  
ATOM   2706  H  HG2  . PRO A 1 12 ? -7.857  -2.848  3.522   1.00 0.00 ? 12  PRO A HG2  5  
ATOM   2707  H  HG3  . PRO A 1 12 ? -9.461  -3.076  4.243   1.00 0.00 ? 12  PRO A HG3  5  
ATOM   2708  H  HD2  . PRO A 1 12 ? -7.725  -5.122  3.876   1.00 0.00 ? 12  PRO A HD2  5  
ATOM   2709  H  HD3  . PRO A 1 12 ? -9.486  -5.335  3.784   1.00 0.00 ? 12  PRO A HD3  5  
ATOM   2710  N  N    . PHE A 1 13 ? -6.601  -3.108  1.151   1.00 0.00 ? 13  PHE A N    5  
ATOM   2711  C  CA   . PHE A 1 13 ? -5.382  -2.532  0.595   1.00 0.00 ? 13  PHE A CA   5  
ATOM   2712  C  C    . PHE A 1 13 ? -4.162  -2.947  1.412   1.00 0.00 ? 13  PHE A C    5  
ATOM   2713  O  O    . PHE A 1 13 ? -4.283  -3.334  2.574   1.00 0.00 ? 13  PHE A O    5  
ATOM   2714  C  CB   . PHE A 1 13 ? -5.487  -1.006  0.554   1.00 0.00 ? 13  PHE A CB   5  
ATOM   2715  C  CG   . PHE A 1 13 ? -6.801  -0.509  0.024   1.00 0.00 ? 13  PHE A CG   5  
ATOM   2716  C  CD1  . PHE A 1 13 ? -6.996  -0.341  -1.337  1.00 0.00 ? 13  PHE A CD1  5  
ATOM   2717  C  CD2  . PHE A 1 13 ? -7.843  -0.211  0.887   1.00 0.00 ? 13  PHE A CD2  5  
ATOM   2718  C  CE1  . PHE A 1 13 ? -8.204  0.116   -1.828  1.00 0.00 ? 13  PHE A CE1  5  
ATOM   2719  C  CE2  . PHE A 1 13 ? -9.054  0.247   0.403   1.00 0.00 ? 13  PHE A CE2  5  
ATOM   2720  C  CZ   . PHE A 1 13 ? -9.235  0.410   -0.956  1.00 0.00 ? 13  PHE A CZ   5  
ATOM   2721  H  H    . PHE A 1 13 ? -6.630  -3.337  2.103   1.00 0.00 ? 13  PHE A H    5  
ATOM   2722  H  HA   . PHE A 1 13 ? -5.270  -2.903  -0.412  1.00 0.00 ? 13  PHE A HA   5  
ATOM   2723  H  HB2  . PHE A 1 13 ? -5.364  -0.617  1.554   1.00 0.00 ? 13  PHE A HB2  5  
ATOM   2724  H  HB3  . PHE A 1 13 ? -4.704  -0.615  -0.078  1.00 0.00 ? 13  PHE A HB3  5  
ATOM   2725  H  HD1  . PHE A 1 13 ? -6.191  -0.571  -2.020  1.00 0.00 ? 13  PHE A HD1  5  
ATOM   2726  H  HD2  . PHE A 1 13 ? -7.703  -0.338  1.952   1.00 0.00 ? 13  PHE A HD2  5  
ATOM   2727  H  HE1  . PHE A 1 13 ? -8.343  0.243   -2.891  1.00 0.00 ? 13  PHE A HE1  5  
ATOM   2728  H  HE2  . PHE A 1 13 ? -9.858  0.475   1.087   1.00 0.00 ? 13  PHE A HE2  5  
ATOM   2729  H  HZ   . PHE A 1 13 ? -10.180 0.767   -1.337  1.00 0.00 ? 13  PHE A HZ   5  
ATOM   2730  N  N    . ILE A 1 14 ? -2.988  -2.864  0.795   1.00 0.00 ? 14  ILE A N    5  
ATOM   2731  C  CA   . ILE A 1 14 ? -1.746  -3.231  1.464   1.00 0.00 ? 14  ILE A CA   5  
ATOM   2732  C  C    . ILE A 1 14 ? -0.602  -2.317  1.039   1.00 0.00 ? 14  ILE A C    5  
ATOM   2733  O  O    . ILE A 1 14 ? -0.537  -1.878  -0.110  1.00 0.00 ? 14  ILE A O    5  
ATOM   2734  C  CB   . ILE A 1 14 ? -1.358  -4.692  1.170   1.00 0.00 ? 14  ILE A CB   5  
ATOM   2735  C  CG1  . ILE A 1 14 ? -2.390  -5.648  1.772   1.00 0.00 ? 14  ILE A CG1  5  
ATOM   2736  C  CG2  . ILE A 1 14 ? 0.031   -4.991  1.714   1.00 0.00 ? 14  ILE A CG2  5  
ATOM   2737  C  CD1  . ILE A 1 14 ? -2.273  -7.065  1.257   1.00 0.00 ? 14  ILE A CD1  5  
ATOM   2738  H  H    . ILE A 1 14 ? -2.956  -2.548  -0.132  1.00 0.00 ? 14  ILE A H    5  
ATOM   2739  H  HA   . ILE A 1 14 ? -1.899  -3.127  2.529   1.00 0.00 ? 14  ILE A HA   5  
ATOM   2740  H  HB   . ILE A 1 14 ? -1.335  -4.826  0.099   1.00 0.00 ? 14  ILE A HB   5  
ATOM   2741  H  HG12 . ILE A 1 14 ? -2.265  -5.674  2.843   1.00 0.00 ? 14  ILE A HG12 5  
ATOM   2742  H  HG13 . ILE A 1 14 ? -3.382  -5.289  1.538   1.00 0.00 ? 14  ILE A HG13 5  
ATOM   2743  H  HG21 . ILE A 1 14 ? 0.741   -4.296  1.290   1.00 0.00 ? 14  ILE A HG21 5  
ATOM   2744  H  HG22 . ILE A 1 14 ? 0.025   -4.887  2.789   1.00 0.00 ? 14  ILE A HG22 5  
ATOM   2745  H  HG23 . ILE A 1 14 ? 0.312   -5.999  1.450   1.00 0.00 ? 14  ILE A HG23 5  
ATOM   2746  H  HD11 . ILE A 1 14 ? -2.651  -7.112  0.245   1.00 0.00 ? 14  ILE A HD11 5  
ATOM   2747  H  HD12 . ILE A 1 14 ? -1.237  -7.368  1.267   1.00 0.00 ? 14  ILE A HD12 5  
ATOM   2748  H  HD13 . ILE A 1 14 ? -2.849  -7.726  1.886   1.00 0.00 ? 14  ILE A HD13 5  
ATOM   2749  N  N    . CYS A 1 15 ? 0.301   -2.035  1.972   1.00 0.00 ? 15  CYS A N    5  
ATOM   2750  C  CA   . CYS A 1 15 ? 1.445   -1.174  1.695   1.00 0.00 ? 15  CYS A CA   5  
ATOM   2751  C  C    . CYS A 1 15 ? 2.589   -1.973  1.078   1.00 0.00 ? 15  CYS A C    5  
ATOM   2752  O  O    . CYS A 1 15 ? 3.467   -2.467  1.785   1.00 0.00 ? 15  CYS A O    5  
ATOM   2753  C  CB   . CYS A 1 15 ? 1.919   -0.492  2.980   1.00 0.00 ? 15  CYS A CB   5  
ATOM   2754  S  SG   . CYS A 1 15 ? 2.979   0.963   2.701   1.00 0.00 ? 15  CYS A SG   5  
ATOM   2755  H  H    . CYS A 1 15 ? 0.195   -2.414  2.870   1.00 0.00 ? 15  CYS A H    5  
ATOM   2756  H  HA   . CYS A 1 15 ? 1.129   -0.419  0.992   1.00 0.00 ? 15  CYS A HA   5  
ATOM   2757  H  HB2  . CYS A 1 15 ? 1.058   -0.167  3.545   1.00 0.00 ? 15  CYS A HB2  5  
ATOM   2758  H  HB3  . CYS A 1 15 ? 2.482   -1.201  3.568   1.00 0.00 ? 15  CYS A HB3  5  
ATOM   2759  N  N    . SER A 1 16 ? 2.572   -2.094  -0.246  1.00 0.00 ? 16  SER A N    5  
ATOM   2760  C  CA   . SER A 1 16 ? 3.606   -2.835  -0.959  1.00 0.00 ? 16  SER A CA   5  
ATOM   2761  C  C    . SER A 1 16 ? 4.980   -2.570  -0.353  1.00 0.00 ? 16  SER A C    5  
ATOM   2762  O  O    . SER A 1 16 ? 5.888   -3.393  -0.463  1.00 0.00 ? 16  SER A O    5  
ATOM   2763  C  CB   . SER A 1 16 ? 3.607   -2.453  -2.440  1.00 0.00 ? 16  SER A CB   5  
ATOM   2764  O  OG   . SER A 1 16 ? 2.343   -2.703  -3.032  1.00 0.00 ? 16  SER A OG   5  
ATOM   2765  H  H    . SER A 1 16 ? 1.845   -1.677  -0.754  1.00 0.00 ? 16  SER A H    5  
ATOM   2766  H  HA   . SER A 1 16 ? 3.382   -3.888  -0.867  1.00 0.00 ? 16  SER A HA   5  
ATOM   2767  H  HB2  . SER A 1 16 ? 3.835   -1.403  -2.539  1.00 0.00 ? 16  SER A HB2  5  
ATOM   2768  H  HB3  . SER A 1 16 ? 4.355   -3.035  -2.959  1.00 0.00 ? 16  SER A HB3  5  
ATOM   2769  H  HG   . SER A 1 16 ? 1.663   -2.686  -2.355  1.00 0.00 ? 16  SER A HG   5  
ATOM   2770  N  N    . GLU A 1 17 ? 5.125   -1.413  0.287   1.00 0.00 ? 17  GLU A N    5  
ATOM   2771  C  CA   . GLU A 1 17 ? 6.389   -1.039  0.910   1.00 0.00 ? 17  GLU A CA   5  
ATOM   2772  C  C    . GLU A 1 17 ? 6.700   -1.945  2.098   1.00 0.00 ? 17  GLU A C    5  
ATOM   2773  O  O    . GLU A 1 17 ? 7.621   -2.760  2.047   1.00 0.00 ? 17  GLU A O    5  
ATOM   2774  C  CB   . GLU A 1 17 ? 6.345   0.421   1.366   1.00 0.00 ? 17  GLU A CB   5  
ATOM   2775  C  CG   . GLU A 1 17 ? 6.408   1.419   0.221   1.00 0.00 ? 17  GLU A CG   5  
ATOM   2776  C  CD   . GLU A 1 17 ? 5.037   1.758   -0.332  1.00 0.00 ? 17  GLU A CD   5  
ATOM   2777  O  OE1  . GLU A 1 17 ? 4.502   0.955   -1.125  1.00 0.00 ? 17  GLU A OE1  5  
ATOM   2778  O  OE2  . GLU A 1 17 ? 4.500   2.826   0.028   1.00 0.00 ? 17  GLU A OE2  5  
ATOM   2779  H  H    . GLU A 1 17 ? 4.364   -0.798  0.341   1.00 0.00 ? 17  GLU A H    5  
ATOM   2780  H  HA   . GLU A 1 17 ? 7.169   -1.152  0.172   1.00 0.00 ? 17  GLU A HA   5  
ATOM   2781  H  HB2  . GLU A 1 17 ? 5.428   0.588   1.912   1.00 0.00 ? 17  GLU A HB2  5  
ATOM   2782  H  HB3  . GLU A 1 17 ? 7.183   0.606   2.022   1.00 0.00 ? 17  GLU A HB3  5  
ATOM   2783  H  HG2  . GLU A 1 17 ? 6.870   2.327   0.577   1.00 0.00 ? 17  GLU A HG2  5  
ATOM   2784  H  HG3  . GLU A 1 17 ? 7.007   0.999   -0.573  1.00 0.00 ? 17  GLU A HG3  5  
ATOM   2785  N  N    . CYS A 1 18 ? 5.925   -1.795  3.167   1.00 0.00 ? 18  CYS A N    5  
ATOM   2786  C  CA   . CYS A 1 18 ? 6.117   -2.598  4.369   1.00 0.00 ? 18  CYS A CA   5  
ATOM   2787  C  C    . CYS A 1 18 ? 5.228   -3.839  4.342   1.00 0.00 ? 18  CYS A C    5  
ATOM   2788  O  O    . CYS A 1 18 ? 5.697   -4.956  4.555   1.00 0.00 ? 18  CYS A O    5  
ATOM   2789  C  CB   . CYS A 1 18 ? 5.813   -1.767  5.617   1.00 0.00 ? 18  CYS A CB   5  
ATOM   2790  S  SG   . CYS A 1 18 ? 4.217   -0.890  5.555   1.00 0.00 ? 18  CYS A SG   5  
ATOM   2791  H  H    . CYS A 1 18 ? 5.206   -1.128  3.148   1.00 0.00 ? 18  CYS A H    5  
ATOM   2792  H  HA   . CYS A 1 18 ? 7.149   -2.911  4.398   1.00 0.00 ? 18  CYS A HA   5  
ATOM   2793  H  HB2  . CYS A 1 18 ? 5.795   -2.418  6.478   1.00 0.00 ? 18  CYS A HB2  5  
ATOM   2794  H  HB3  . CYS A 1 18 ? 6.590   -1.028  5.746   1.00 0.00 ? 18  CYS A HB3  5  
ATOM   2795  N  N    . GLY A 1 19 ? 3.942   -3.633  4.077   1.00 0.00 ? 19  GLY A N    5  
ATOM   2796  C  CA   . GLY A 1 19 ? 3.008   -4.743  4.027   1.00 0.00 ? 19  GLY A CA   5  
ATOM   2797  C  C    . GLY A 1 19 ? 1.906   -4.621  5.061   1.00 0.00 ? 19  GLY A C    5  
ATOM   2798  O  O    . GLY A 1 19 ? 1.508   -5.611  5.674   1.00 0.00 ? 19  GLY A O    5  
ATOM   2799  H  H    . GLY A 1 19 ? 3.624   -2.720  3.915   1.00 0.00 ? 19  GLY A H    5  
ATOM   2800  H  HA2  . GLY A 1 19 ? 2.562   -4.780  3.044   1.00 0.00 ? 19  GLY A HA2  5  
ATOM   2801  H  HA3  . GLY A 1 19 ? 3.549   -5.661  4.201   1.00 0.00 ? 19  GLY A HA3  5  
ATOM   2802  N  N    . LYS A 1 20 ? 1.413   -3.403  5.257   1.00 0.00 ? 20  LYS A N    5  
ATOM   2803  C  CA   . LYS A 1 20 ? 0.351   -3.153  6.224   1.00 0.00 ? 20  LYS A CA   5  
ATOM   2804  C  C    . LYS A 1 20 ? -0.985  -2.935  5.521   1.00 0.00 ? 20  LYS A C    5  
ATOM   2805  O  O    . LYS A 1 20 ? -1.037  -2.379  4.423   1.00 0.00 ? 20  LYS A O    5  
ATOM   2806  C  CB   . LYS A 1 20 ? 0.692   -1.934  7.084   1.00 0.00 ? 20  LYS A CB   5  
ATOM   2807  C  CG   . LYS A 1 20 ? 0.108   -1.996  8.485   1.00 0.00 ? 20  LYS A CG   5  
ATOM   2808  C  CD   . LYS A 1 20 ? 0.648   -0.880  9.364   1.00 0.00 ? 20  LYS A CD   5  
ATOM   2809  C  CE   . LYS A 1 20 ? 2.053   -1.190  9.857   1.00 0.00 ? 20  LYS A CE   5  
ATOM   2810  N  NZ   . LYS A 1 20 ? 2.777   0.041   10.277  1.00 0.00 ? 20  LYS A NZ   5  
ATOM   2811  H  H    . LYS A 1 20 ? 1.772   -2.653  4.737   1.00 0.00 ? 20  LYS A H    5  
ATOM   2812  H  HA   . LYS A 1 20 ? 0.271   -4.021  6.860   1.00 0.00 ? 20  LYS A HA   5  
ATOM   2813  H  HB2  . LYS A 1 20 ? 1.766   -1.857  7.168   1.00 0.00 ? 20  LYS A HB2  5  
ATOM   2814  H  HB3  . LYS A 1 20 ? 0.313   -1.048  6.597   1.00 0.00 ? 20  LYS A HB3  5  
ATOM   2815  H  HG2  . LYS A 1 20 ? -0.966  -1.901  8.422   1.00 0.00 ? 20  LYS A HG2  5  
ATOM   2816  H  HG3  . LYS A 1 20 ? 0.362   -2.947  8.930   1.00 0.00 ? 20  LYS A HG3  5  
ATOM   2817  H  HD2  . LYS A 1 20 ? 0.674   0.036   8.792   1.00 0.00 ? 20  LYS A HD2  5  
ATOM   2818  H  HD3  . LYS A 1 20 ? -0.005  -0.757  10.216  1.00 0.00 ? 20  LYS A HD3  5  
ATOM   2819  H  HE2  . LYS A 1 20 ? 1.984   -1.862  10.699  1.00 0.00 ? 20  LYS A HE2  5  
ATOM   2820  H  HE3  . LYS A 1 20 ? 2.603   -1.667  9.060   1.00 0.00 ? 20  LYS A HE3  5  
ATOM   2821  H  HZ1  . LYS A 1 20 ? 3.670   0.128   9.750   1.00 0.00 ? 20  LYS A HZ1  5  
ATOM   2822  H  HZ2  . LYS A 1 20 ? 2.990   0.001   11.295  1.00 0.00 ? 20  LYS A HZ2  5  
ATOM   2823  H  HZ3  . LYS A 1 20 ? 2.193   0.881   10.090  1.00 0.00 ? 20  LYS A HZ3  5  
ATOM   2824  N  N    . VAL A 1 21 ? -2.064  -3.374  6.160   1.00 0.00 ? 21  VAL A N    5  
ATOM   2825  C  CA   . VAL A 1 21 ? -3.401  -3.223  5.597   1.00 0.00 ? 21  VAL A CA   5  
ATOM   2826  C  C    . VAL A 1 21 ? -4.149  -2.070  6.257   1.00 0.00 ? 21  VAL A C    5  
ATOM   2827  O  O    . VAL A 1 21 ? -4.092  -1.895  7.474   1.00 0.00 ? 21  VAL A O    5  
ATOM   2828  C  CB   . VAL A 1 21 ? -4.226  -4.514  5.758   1.00 0.00 ? 21  VAL A CB   5  
ATOM   2829  C  CG1  . VAL A 1 21 ? -5.645  -4.308  5.250   1.00 0.00 ? 21  VAL A CG1  5  
ATOM   2830  C  CG2  . VAL A 1 21 ? -3.554  -5.669  5.031   1.00 0.00 ? 21  VAL A CG2  5  
ATOM   2831  H  H    . VAL A 1 21 ? -1.959  -3.808  7.032   1.00 0.00 ? 21  VAL A H    5  
ATOM   2832  H  HA   . VAL A 1 21 ? -3.297  -3.016  4.542   1.00 0.00 ? 21  VAL A HA   5  
ATOM   2833  H  HB   . VAL A 1 21 ? -4.275  -4.758  6.809   1.00 0.00 ? 21  VAL A HB   5  
ATOM   2834  H  HG11 . VAL A 1 21 ? -5.613  -3.859  4.268   1.00 0.00 ? 21  VAL A HG11 5  
ATOM   2835  H  HG12 . VAL A 1 21 ? -6.150  -5.261  5.195   1.00 0.00 ? 21  VAL A HG12 5  
ATOM   2836  H  HG13 . VAL A 1 21 ? -6.177  -3.656  5.926   1.00 0.00 ? 21  VAL A HG13 5  
ATOM   2837  H  HG21 . VAL A 1 21 ? -3.763  -6.593  5.551   1.00 0.00 ? 21  VAL A HG21 5  
ATOM   2838  H  HG22 . VAL A 1 21 ? -3.933  -5.729  4.022   1.00 0.00 ? 21  VAL A HG22 5  
ATOM   2839  H  HG23 . VAL A 1 21 ? -2.486  -5.506  5.005   1.00 0.00 ? 21  VAL A HG23 5  
ATOM   2840  N  N    . PHE A 1 22 ? -4.850  -1.286  5.445   1.00 0.00 ? 22  PHE A N    5  
ATOM   2841  C  CA   . PHE A 1 22 ? -5.610  -0.148  5.950   1.00 0.00 ? 22  PHE A CA   5  
ATOM   2842  C  C    . PHE A 1 22 ? -7.059  -0.209  5.477   1.00 0.00 ? 22  PHE A C    5  
ATOM   2843  O  O    . PHE A 1 22 ? -7.334  -0.524  4.319   1.00 0.00 ? 22  PHE A O    5  
ATOM   2844  C  CB   . PHE A 1 22 ? -4.967  1.164   5.493   1.00 0.00 ? 22  PHE A CB   5  
ATOM   2845  C  CG   . PHE A 1 22 ? -3.516  1.281   5.864   1.00 0.00 ? 22  PHE A CG   5  
ATOM   2846  C  CD1  . PHE A 1 22 ? -2.552  0.560   5.178   1.00 0.00 ? 22  PHE A CD1  5  
ATOM   2847  C  CD2  . PHE A 1 22 ? -3.117  2.113   6.897   1.00 0.00 ? 22  PHE A CD2  5  
ATOM   2848  C  CE1  . PHE A 1 22 ? -1.217  0.666   5.517   1.00 0.00 ? 22  PHE A CE1  5  
ATOM   2849  C  CE2  . PHE A 1 22 ? -1.782  2.223   7.240   1.00 0.00 ? 22  PHE A CE2  5  
ATOM   2850  C  CZ   . PHE A 1 22 ? -0.831  1.499   6.549   1.00 0.00 ? 22  PHE A CZ   5  
ATOM   2851  H  H    . PHE A 1 22 ? -4.856  -1.477  4.484   1.00 0.00 ? 22  PHE A H    5  
ATOM   2852  H  HA   . PHE A 1 22 ? -5.593  -0.191  7.028   1.00 0.00 ? 22  PHE A HA   5  
ATOM   2853  H  HB2  . PHE A 1 22 ? -5.042  1.238   4.419   1.00 0.00 ? 22  PHE A HB2  5  
ATOM   2854  H  HB3  . PHE A 1 22 ? -5.495  1.990   5.945   1.00 0.00 ? 22  PHE A HB3  5  
ATOM   2855  H  HD1  . PHE A 1 22 ? -2.852  -0.091  4.370   1.00 0.00 ? 22  PHE A HD1  5  
ATOM   2856  H  HD2  . PHE A 1 22 ? -3.860  2.680   7.439   1.00 0.00 ? 22  PHE A HD2  5  
ATOM   2857  H  HE1  . PHE A 1 22 ? -0.475  0.099   4.974   1.00 0.00 ? 22  PHE A HE1  5  
ATOM   2858  H  HE2  . PHE A 1 22 ? -1.484  2.876   8.048   1.00 0.00 ? 22  PHE A HE2  5  
ATOM   2859  H  HZ   . PHE A 1 22 ? 0.212   1.584   6.816   1.00 0.00 ? 22  PHE A HZ   5  
ATOM   2860  N  N    . THR A 1 23 ? -7.984  0.094   6.383   1.00 0.00 ? 23  THR A N    5  
ATOM   2861  C  CA   . THR A 1 23 ? -9.405  0.072   6.060   1.00 0.00 ? 23  THR A CA   5  
ATOM   2862  C  C    . THR A 1 23 ? -9.766  1.191   5.090   1.00 0.00 ? 23  THR A C    5  
ATOM   2863  O  O    . THR A 1 23 ? -10.465 0.967   4.101   1.00 0.00 ? 23  THR A O    5  
ATOM   2864  C  CB   . THR A 1 23 ? -10.271 0.208   7.327   1.00 0.00 ? 23  THR A CB   5  
ATOM   2865  O  OG1  . THR A 1 23 ? -9.823  -0.713  8.328   1.00 0.00 ? 23  THR A OG1  5  
ATOM   2866  C  CG2  . THR A 1 23 ? -11.736 -0.051  7.012   1.00 0.00 ? 23  THR A CG2  5  
ATOM   2867  H  H    . THR A 1 23 ? -7.702  0.337   7.289   1.00 0.00 ? 23  THR A H    5  
ATOM   2868  H  HA   . THR A 1 23 ? -9.628  -0.878  5.598   1.00 0.00 ? 23  THR A HA   5  
ATOM   2869  H  HB   . THR A 1 23 ? -10.172 1.215   7.706   1.00 0.00 ? 23  THR A HB   5  
ATOM   2870  H  HG1  . THR A 1 23 ? -8.895  -0.917  8.183   1.00 0.00 ? 23  THR A HG1  5  
ATOM   2871  H  HG21 . THR A 1 23 ? -12.231 -0.432  7.892   1.00 0.00 ? 23  THR A HG21 5  
ATOM   2872  H  HG22 . THR A 1 23 ? -11.810 -0.777  6.215   1.00 0.00 ? 23  THR A HG22 5  
ATOM   2873  H  HG23 . THR A 1 23 ? -12.207 0.870   6.704   1.00 0.00 ? 23  THR A HG23 5  
ATOM   2874  N  N    . HIS A 1 24 ? -9.286  2.396   5.378   1.00 0.00 ? 24  HIS A N    5  
ATOM   2875  C  CA   . HIS A 1 24 ? -9.557  3.551   4.529   1.00 0.00 ? 24  HIS A CA   5  
ATOM   2876  C  C    . HIS A 1 24 ? -8.463  3.722   3.479   1.00 0.00 ? 24  HIS A C    5  
ATOM   2877  O  O    . HIS A 1 24 ? -7.274  3.639   3.786   1.00 0.00 ? 24  HIS A O    5  
ATOM   2878  C  CB   . HIS A 1 24 ? -9.669  4.819   5.377   1.00 0.00 ? 24  HIS A CB   5  
ATOM   2879  C  CG   . HIS A 1 24 ? -10.587 5.849   4.794   1.00 0.00 ? 24  HIS A CG   5  
ATOM   2880  N  ND1  . HIS A 1 24 ? -10.149 6.874   3.981   1.00 0.00 ? 24  HIS A ND1  5  
ATOM   2881  C  CD2  . HIS A 1 24 ? -11.926 6.009   4.909   1.00 0.00 ? 24  HIS A CD2  5  
ATOM   2882  C  CE1  . HIS A 1 24 ? -11.178 7.619   3.623   1.00 0.00 ? 24  HIS A CE1  5  
ATOM   2883  N  NE2  . HIS A 1 24 ? -12.269 7.116   4.172   1.00 0.00 ? 24  HIS A NE2  5  
ATOM   2884  H  H    . HIS A 1 24 ? -8.735  2.512   6.181   1.00 0.00 ? 24  HIS A H    5  
ATOM   2885  H  HA   . HIS A 1 24 ? -10.497 3.380   4.027   1.00 0.00 ? 24  HIS A HA   5  
ATOM   2886  H  HB2  . HIS A 1 24 ? -10.044 4.557   6.355   1.00 0.00 ? 24  HIS A HB2  5  
ATOM   2887  H  HB3  . HIS A 1 24 ? -8.690  5.264   5.478   1.00 0.00 ? 24  HIS A HB3  5  
ATOM   2888  H  HD1  . HIS A 1 24 ? -9.221  7.031   3.710   1.00 0.00 ? 24  HIS A HD1  5  
ATOM   2889  H  HD2  . HIS A 1 24 ? -12.601 5.382   5.475   1.00 0.00 ? 24  HIS A HD2  5  
ATOM   2890  H  HE1  . HIS A 1 24 ? -11.137 8.492   2.989   1.00 0.00 ? 24  HIS A HE1  5  
ATOM   2891  N  N    . LYS A 1 25 ? -8.874  3.962   2.238   1.00 0.00 ? 25  LYS A N    5  
ATOM   2892  C  CA   . LYS A 1 25 ? -7.930  4.145   1.142   1.00 0.00 ? 25  LYS A CA   5  
ATOM   2893  C  C    . LYS A 1 25 ? -6.957  5.280   1.446   1.00 0.00 ? 25  LYS A C    5  
ATOM   2894  O  O    . LYS A 1 25 ? -5.757  5.168   1.193   1.00 0.00 ? 25  LYS A O    5  
ATOM   2895  C  CB   . LYS A 1 25 ? -8.680  4.437   -0.160  1.00 0.00 ? 25  LYS A CB   5  
ATOM   2896  C  CG   . LYS A 1 25 ? -7.772  4.850   -1.305  1.00 0.00 ? 25  LYS A CG   5  
ATOM   2897  C  CD   . LYS A 1 25 ? -7.296  3.647   -2.102  1.00 0.00 ? 25  LYS A CD   5  
ATOM   2898  C  CE   . LYS A 1 25 ? -6.005  3.078   -1.535  1.00 0.00 ? 25  LYS A CE   5  
ATOM   2899  N  NZ   . LYS A 1 25 ? -5.216  2.355   -2.571  1.00 0.00 ? 25  LYS A NZ   5  
ATOM   2900  H  H    . LYS A 1 25 ? -9.836  4.017   2.055   1.00 0.00 ? 25  LYS A H    5  
ATOM   2901  H  HA   . LYS A 1 25 ? -7.371  3.229   1.028   1.00 0.00 ? 25  LYS A HA   5  
ATOM   2902  H  HB2  . LYS A 1 25 ? -9.219  3.549   -0.458  1.00 0.00 ? 25  LYS A HB2  5  
ATOM   2903  H  HB3  . LYS A 1 25 ? -9.387  5.235   0.017   1.00 0.00 ? 25  LYS A HB3  5  
ATOM   2904  H  HG2  . LYS A 1 25 ? -8.315  5.512   -1.963  1.00 0.00 ? 25  LYS A HG2  5  
ATOM   2905  H  HG3  . LYS A 1 25 ? -6.912  5.367   -0.902  1.00 0.00 ? 25  LYS A HG3  5  
ATOM   2906  H  HD2  . LYS A 1 25 ? -8.058  2.882   -2.071  1.00 0.00 ? 25  LYS A HD2  5  
ATOM   2907  H  HD3  . LYS A 1 25 ? -7.128  3.949   -3.126  1.00 0.00 ? 25  LYS A HD3  5  
ATOM   2908  H  HE2  . LYS A 1 25 ? -5.411  3.890   -1.144  1.00 0.00 ? 25  LYS A HE2  5  
ATOM   2909  H  HE3  . LYS A 1 25 ? -6.249  2.393   -0.737  1.00 0.00 ? 25  LYS A HE3  5  
ATOM   2910  H  HZ1  . LYS A 1 25 ? -4.743  3.035   -3.199  1.00 0.00 ? 25  LYS A HZ1  5  
ATOM   2911  H  HZ2  . LYS A 1 25 ? -5.842  1.751   -3.140  1.00 0.00 ? 25  LYS A HZ2  5  
ATOM   2912  H  HZ3  . LYS A 1 25 ? -4.495  1.758   -2.118  1.00 0.00 ? 25  LYS A HZ3  5  
ATOM   2913  N  N    . THR A 1 26 ? -7.482  6.373   1.992   1.00 0.00 ? 26  THR A N    5  
ATOM   2914  C  CA   . THR A 1 26 ? -6.659  7.528   2.330   1.00 0.00 ? 26  THR A CA   5  
ATOM   2915  C  C    . THR A 1 26 ? -5.724  7.215   3.493   1.00 0.00 ? 26  THR A C    5  
ATOM   2916  O  O    . THR A 1 26 ? -4.618  7.746   3.571   1.00 0.00 ? 26  THR A O    5  
ATOM   2917  C  CB   . THR A 1 26 ? -7.527  8.747   2.697   1.00 0.00 ? 26  THR A CB   5  
ATOM   2918  O  OG1  . THR A 1 26 ? -8.639  8.844   1.801   1.00 0.00 ? 26  THR A OG1  5  
ATOM   2919  C  CG2  . THR A 1 26 ? -6.710  10.029  2.642   1.00 0.00 ? 26  THR A CG2  5  
ATOM   2920  H  H    . THR A 1 26 ? -8.445  6.402   2.169   1.00 0.00 ? 26  THR A H    5  
ATOM   2921  H  HA   . THR A 1 26 ? -6.068  7.782   1.463   1.00 0.00 ? 26  THR A HA   5  
ATOM   2922  H  HB   . THR A 1 26 ? -7.896  8.616   3.705   1.00 0.00 ? 26  THR A HB   5  
ATOM   2923  H  HG1  . THR A 1 26 ? -8.685  8.052   1.260   1.00 0.00 ? 26  THR A HG1  5  
ATOM   2924  H  HG21 . THR A 1 26 ? -6.723  10.420  1.636   1.00 0.00 ? 26  THR A HG21 5  
ATOM   2925  H  HG22 . THR A 1 26 ? -5.691  9.820   2.933   1.00 0.00 ? 26  THR A HG22 5  
ATOM   2926  H  HG23 . THR A 1 26 ? -7.136  10.756  3.317   1.00 0.00 ? 26  THR A HG23 5  
ATOM   2927  N  N    . ASN A 1 27 ? -6.177  6.349   4.394   1.00 0.00 ? 27  ASN A N    5  
ATOM   2928  C  CA   . ASN A 1 27 ? -5.380  5.966   5.553   1.00 0.00 ? 27  ASN A CA   5  
ATOM   2929  C  C    . ASN A 1 27 ? -4.084  5.285   5.121   1.00 0.00 ? 27  ASN A C    5  
ATOM   2930  O  O    . ASN A 1 27 ? -3.048  5.428   5.772   1.00 0.00 ? 27  ASN A O    5  
ATOM   2931  C  CB   . ASN A 1 27 ? -6.181  5.032   6.463   1.00 0.00 ? 27  ASN A CB   5  
ATOM   2932  C  CG   . ASN A 1 27 ? -7.035  5.789   7.461   1.00 0.00 ? 27  ASN A CG   5  
ATOM   2933  O  OD1  . ASN A 1 27 ? -6.655  6.861   7.932   1.00 0.00 ? 27  ASN A OD1  5  
ATOM   2934  N  ND2  . ASN A 1 27 ? -8.196  5.234   7.788   1.00 0.00 ? 27  ASN A ND2  5  
ATOM   2935  H  H    . ASN A 1 27 ? -7.068  5.959   4.277   1.00 0.00 ? 27  ASN A H    5  
ATOM   2936  H  HA   . ASN A 1 27 ? -5.136  6.864   6.100   1.00 0.00 ? 27  ASN A HA   5  
ATOM   2937  H  HB2  . ASN A 1 27 ? -6.830  4.418   5.856   1.00 0.00 ? 27  ASN A HB2  5  
ATOM   2938  H  HB3  . ASN A 1 27 ? -5.498  4.397   7.008   1.00 0.00 ? 27  ASN A HB3  5  
ATOM   2939  H  HD21 . ASN A 1 27 ? -8.433  4.378   7.373   1.00 0.00 ? 27  ASN A HD21 5  
ATOM   2940  H  HD22 . ASN A 1 27 ? -8.768  5.702   8.430   1.00 0.00 ? 27  ASN A HD22 5  
ATOM   2941  N  N    . LEU A 1 28 ? -4.150  4.546   4.020   1.00 0.00 ? 28  LEU A N    5  
ATOM   2942  C  CA   . LEU A 1 28 ? -2.982  3.843   3.499   1.00 0.00 ? 28  LEU A CA   5  
ATOM   2943  C  C    . LEU A 1 28 ? -2.035  4.809   2.794   1.00 0.00 ? 28  LEU A C    5  
ATOM   2944  O  O    . LEU A 1 28 ? -0.826  4.789   3.028   1.00 0.00 ? 28  LEU A O    5  
ATOM   2945  C  CB   . LEU A 1 28 ? -3.415  2.739   2.533   1.00 0.00 ? 28  LEU A CB   5  
ATOM   2946  C  CG   . LEU A 1 28 ? -2.413  2.376   1.436   1.00 0.00 ? 28  LEU A CG   5  
ATOM   2947  C  CD1  . LEU A 1 28 ? -1.202  1.674   2.030   1.00 0.00 ? 28  LEU A CD1  5  
ATOM   2948  C  CD2  . LEU A 1 28 ? -3.073  1.503   0.379   1.00 0.00 ? 28  LEU A CD2  5  
ATOM   2949  H  H    . LEU A 1 28 ? -5.003  4.470   3.544   1.00 0.00 ? 28  LEU A H    5  
ATOM   2950  H  HA   . LEU A 1 28 ? -2.465  3.396   4.335   1.00 0.00 ? 28  LEU A HA   5  
ATOM   2951  H  HB2  . LEU A 1 28 ? -3.607  1.849   3.112   1.00 0.00 ? 28  LEU A HB2  5  
ATOM   2952  H  HB3  . LEU A 1 28 ? -4.330  3.060   2.054   1.00 0.00 ? 28  LEU A HB3  5  
ATOM   2953  H  HG   . LEU A 1 28 ? -2.071  3.283   0.956   1.00 0.00 ? 28  LEU A HG   5  
ATOM   2954  H  HD11 . LEU A 1 28 ? -1.495  0.704   2.402   1.00 0.00 ? 28  LEU A HD11 5  
ATOM   2955  H  HD12 . LEU A 1 28 ? -0.805  2.266   2.841   1.00 0.00 ? 28  LEU A HD12 5  
ATOM   2956  H  HD13 . LEU A 1 28 ? -0.446  1.555   1.268   1.00 0.00 ? 28  LEU A HD13 5  
ATOM   2957  H  HD21 . LEU A 1 28 ? -4.123  1.394   0.606   1.00 0.00 ? 28  LEU A HD21 5  
ATOM   2958  H  HD22 . LEU A 1 28 ? -2.603  0.531   0.371   1.00 0.00 ? 28  LEU A HD22 5  
ATOM   2959  H  HD23 . LEU A 1 28 ? -2.960  1.965   -0.592  1.00 0.00 ? 28  LEU A HD23 5  
ATOM   2960  N  N    . ILE A 1 29 ? -2.592  5.654   1.934   1.00 0.00 ? 29  ILE A N    5  
ATOM   2961  C  CA   . ILE A 1 29 ? -1.797  6.629   1.198   1.00 0.00 ? 29  ILE A CA   5  
ATOM   2962  C  C    . ILE A 1 29 ? -1.043  7.553   2.148   1.00 0.00 ? 29  ILE A C    5  
ATOM   2963  O  O    . ILE A 1 29 ? 0.140   7.831   1.951   1.00 0.00 ? 29  ILE A O    5  
ATOM   2964  C  CB   . ILE A 1 29 ? -2.675  7.480   0.262   1.00 0.00 ? 29  ILE A CB   5  
ATOM   2965  C  CG1  . ILE A 1 29 ? -3.158  6.641   -0.923  1.00 0.00 ? 29  ILE A CG1  5  
ATOM   2966  C  CG2  . ILE A 1 29 ? -1.906  8.699   -0.224  1.00 0.00 ? 29  ILE A CG2  5  
ATOM   2967  C  CD1  . ILE A 1 29 ? -4.213  7.329   -1.761  1.00 0.00 ? 29  ILE A CD1  5  
ATOM   2968  H  H    . ILE A 1 29 ? -3.561  5.621   1.791   1.00 0.00 ? 29  ILE A H    5  
ATOM   2969  H  HA   . ILE A 1 29 ? -1.082  6.089   0.595   1.00 0.00 ? 29  ILE A HA   5  
ATOM   2970  H  HB   . ILE A 1 29 ? -3.531  7.824   0.822   1.00 0.00 ? 29  ILE A HB   5  
ATOM   2971  H  HG12 . ILE A 1 29 ? -2.319  6.419   -1.564  1.00 0.00 ? 29  ILE A HG12 5  
ATOM   2972  H  HG13 . ILE A 1 29 ? -3.578  5.717   -0.553  1.00 0.00 ? 29  ILE A HG13 5  
ATOM   2973  H  HG21 . ILE A 1 29 ? -2.510  9.249   -0.930  1.00 0.00 ? 29  ILE A HG21 5  
ATOM   2974  H  HG22 . ILE A 1 29 ? -1.670  9.334   0.617   1.00 0.00 ? 29  ILE A HG22 5  
ATOM   2975  H  HG23 . ILE A 1 29 ? -0.992  8.381   -0.702  1.00 0.00 ? 29  ILE A HG23 5  
ATOM   2976  H  HD11 . ILE A 1 29 ? -4.444  6.718   -2.622  1.00 0.00 ? 29  ILE A HD11 5  
ATOM   2977  H  HD12 . ILE A 1 29 ? -5.107  7.470   -1.171  1.00 0.00 ? 29  ILE A HD12 5  
ATOM   2978  H  HD13 . ILE A 1 29 ? -3.843  8.288   -2.090  1.00 0.00 ? 29  ILE A HD13 5  
ATOM   2979  N  N    . ILE A 1 30 ? -1.735  8.024   3.180   1.00 0.00 ? 30  ILE A N    5  
ATOM   2980  C  CA   . ILE A 1 30 ? -1.130  8.914   4.163   1.00 0.00 ? 30  ILE A CA   5  
ATOM   2981  C  C    . ILE A 1 30 ? 0.002   8.218   4.911   1.00 0.00 ? 30  ILE A C    5  
ATOM   2982  O  O    . ILE A 1 30 ? 0.966   8.856   5.334   1.00 0.00 ? 30  ILE A O    5  
ATOM   2983  C  CB   . ILE A 1 30 ? -2.169  9.419   5.181   1.00 0.00 ? 30  ILE A CB   5  
ATOM   2984  C  CG1  . ILE A 1 30 ? -3.224  10.278  4.481   1.00 0.00 ? 30  ILE A CG1  5  
ATOM   2985  C  CG2  . ILE A 1 30 ? -1.486  10.207  6.289   1.00 0.00 ? 30  ILE A CG2  5  
ATOM   2986  C  CD1  . ILE A 1 30 ? -4.407  10.617  5.361   1.00 0.00 ? 30  ILE A CD1  5  
ATOM   2987  H  H    . ILE A 1 30 ? -2.675  7.766   3.283   1.00 0.00 ? 30  ILE A H    5  
ATOM   2988  H  HA   . ILE A 1 30 ? -0.727  9.767   3.636   1.00 0.00 ? 30  ILE A HA   5  
ATOM   2989  H  HB   . ILE A 1 30 ? -2.650  8.561   5.626   1.00 0.00 ? 30  ILE A HB   5  
ATOM   2990  H  HG12 . ILE A 1 30 ? -2.773  11.204  4.163   1.00 0.00 ? 30  ILE A HG12 5  
ATOM   2991  H  HG13 . ILE A 1 30 ? -3.595  9.747   3.616   1.00 0.00 ? 30  ILE A HG13 5  
ATOM   2992  H  HG21 . ILE A 1 30 ? -1.066  11.113  5.879   1.00 0.00 ? 30  ILE A HG21 5  
ATOM   2993  H  HG22 . ILE A 1 30 ? -2.210  10.458  7.049   1.00 0.00 ? 30  ILE A HG22 5  
ATOM   2994  H  HG23 . ILE A 1 30 ? -0.699  9.609   6.723   1.00 0.00 ? 30  ILE A HG23 5  
ATOM   2995  H  HD11 . ILE A 1 30 ? -4.595  9.800   6.043   1.00 0.00 ? 30  ILE A HD11 5  
ATOM   2996  H  HD12 . ILE A 1 30 ? -4.192  11.513  5.925   1.00 0.00 ? 30  ILE A HD12 5  
ATOM   2997  H  HD13 . ILE A 1 30 ? -5.280  10.779  4.746   1.00 0.00 ? 30  ILE A HD13 5  
ATOM   2998  N  N    . HIS A 1 31 ? -0.122  6.904   5.071   1.00 0.00 ? 31  HIS A N    5  
ATOM   2999  C  CA   . HIS A 1 31 ? 0.892   6.120   5.767   1.00 0.00 ? 31  HIS A CA   5  
ATOM   3000  C  C    . HIS A 1 31 ? 2.082   5.838   4.854   1.00 0.00 ? 31  HIS A C    5  
ATOM   3001  O  O    . HIS A 1 31 ? 3.235   5.939   5.274   1.00 0.00 ? 31  HIS A O    5  
ATOM   3002  C  CB   . HIS A 1 31 ? 0.296   4.803   6.266   1.00 0.00 ? 31  HIS A CB   5  
ATOM   3003  C  CG   . HIS A 1 31 ? 1.302   3.703   6.402   1.00 0.00 ? 31  HIS A CG   5  
ATOM   3004  N  ND1  . HIS A 1 31 ? 1.774   3.260   7.619   1.00 0.00 ? 31  HIS A ND1  5  
ATOM   3005  C  CD2  . HIS A 1 31 ? 1.925   2.953   5.463   1.00 0.00 ? 31  HIS A CD2  5  
ATOM   3006  C  CE1  . HIS A 1 31 ? 2.646   2.287   7.424   1.00 0.00 ? 31  HIS A CE1  5  
ATOM   3007  N  NE2  . HIS A 1 31 ? 2.755   2.080   6.124   1.00 0.00 ? 31  HIS A NE2  5  
ATOM   3008  H  H    . HIS A 1 31 ? -0.913  6.451   4.712   1.00 0.00 ? 31  HIS A H    5  
ATOM   3009  H  HA   . HIS A 1 31 ? 1.233   6.695   6.614   1.00 0.00 ? 31  HIS A HA   5  
ATOM   3010  H  HB2  . HIS A 1 31 ? -0.152  4.964   7.236   1.00 0.00 ? 31  HIS A HB2  5  
ATOM   3011  H  HB3  . HIS A 1 31 ? -0.466  4.475   5.573   1.00 0.00 ? 31  HIS A HB3  5  
ATOM   3012  H  HD1  . HIS A 1 31 ? 1.511   3.609   8.496   1.00 0.00 ? 31  HIS A HD1  5  
ATOM   3013  H  HD2  . HIS A 1 31 ? 1.795   3.026   4.392   1.00 0.00 ? 31  HIS A HD2  5  
ATOM   3014  H  HE1  . HIS A 1 31 ? 3.178   1.750   8.195   1.00 0.00 ? 31  HIS A HE1  5  
ATOM   3015  N  N    . GLN A 1 32 ? 1.794   5.485   3.606   1.00 0.00 ? 32  GLN A N    5  
ATOM   3016  C  CA   . GLN A 1 32 ? 2.841   5.188   2.636   1.00 0.00 ? 32  GLN A CA   5  
ATOM   3017  C  C    . GLN A 1 32 ? 3.876   6.307   2.591   1.00 0.00 ? 32  GLN A C    5  
ATOM   3018  O  O    . GLN A 1 32 ? 5.009   6.103   2.154   1.00 0.00 ? 32  GLN A O    5  
ATOM   3019  C  CB   . GLN A 1 32 ? 2.235   4.982   1.246   1.00 0.00 ? 32  GLN A CB   5  
ATOM   3020  C  CG   . GLN A 1 32 ? 1.450   3.688   1.110   1.00 0.00 ? 32  GLN A CG   5  
ATOM   3021  C  CD   . GLN A 1 32 ? 0.652   3.621   -0.177  1.00 0.00 ? 32  GLN A CD   5  
ATOM   3022  O  OE1  . GLN A 1 32 ? 0.145   4.635   -0.659  1.00 0.00 ? 32  GLN A OE1  5  
ATOM   3023  N  NE2  . GLN A 1 32 ? 0.535   2.425   -0.741  1.00 0.00 ? 32  GLN A NE2  5  
ATOM   3024  H  H    . GLN A 1 32 ? 0.856   5.422   3.331   1.00 0.00 ? 32  GLN A H    5  
ATOM   3025  H  HA   . GLN A 1 32 ? 3.329   4.276   2.944   1.00 0.00 ? 32  GLN A HA   5  
ATOM   3026  H  HB2  . GLN A 1 32 ? 1.570   5.806   1.031   1.00 0.00 ? 32  GLN A HB2  5  
ATOM   3027  H  HB3  . GLN A 1 32 ? 3.032   4.973   0.517   1.00 0.00 ? 32  GLN A HB3  5  
ATOM   3028  H  HG2  . GLN A 1 32 ? 2.142   2.858   1.129   1.00 0.00 ? 32  GLN A HG2  5  
ATOM   3029  H  HG3  . GLN A 1 32 ? 0.769   3.605   1.944   1.00 0.00 ? 32  GLN A HG3  5  
ATOM   3030  H  HE21 . GLN A 1 32 ? 0.965   1.662   -0.299  1.00 0.00 ? 32  GLN A HE21 5  
ATOM   3031  H  HE22 . GLN A 1 32 ? 0.024   2.353   -1.572  1.00 0.00 ? 32  GLN A HE22 5  
ATOM   3032  N  N    . LYS A 1 33 ? 3.480   7.491   3.047   1.00 0.00 ? 33  LYS A N    5  
ATOM   3033  C  CA   . LYS A 1 33 ? 4.372   8.644   3.060   1.00 0.00 ? 33  LYS A CA   5  
ATOM   3034  C  C    . LYS A 1 33 ? 5.640   8.341   3.852   1.00 0.00 ? 33  LYS A C    5  
ATOM   3035  O  O    . LYS A 1 33 ? 6.694   8.928   3.602   1.00 0.00 ? 33  LYS A O    5  
ATOM   3036  C  CB   . LYS A 1 33 ? 3.661   9.858   3.662   1.00 0.00 ? 33  LYS A CB   5  
ATOM   3037  C  CG   . LYS A 1 33 ? 2.449   10.309  2.866   1.00 0.00 ? 33  LYS A CG   5  
ATOM   3038  C  CD   . LYS A 1 33 ? 2.207   11.802  3.015   1.00 0.00 ? 33  LYS A CD   5  
ATOM   3039  C  CE   . LYS A 1 33 ? 1.546   12.386  1.776   1.00 0.00 ? 33  LYS A CE   5  
ATOM   3040  N  NZ   . LYS A 1 33 ? 0.181   11.829  1.561   1.00 0.00 ? 33  LYS A NZ   5  
ATOM   3041  H  H    . LYS A 1 33 ? 2.564   7.591   3.383   1.00 0.00 ? 33  LYS A H    5  
ATOM   3042  H  HA   . LYS A 1 33 ? 4.643   8.866   2.039   1.00 0.00 ? 33  LYS A HA   5  
ATOM   3043  H  HB2  . LYS A 1 33 ? 3.337   9.611   4.662   1.00 0.00 ? 33  LYS A HB2  5  
ATOM   3044  H  HB3  . LYS A 1 33 ? 4.359   10.681  3.712   1.00 0.00 ? 33  LYS A HB3  5  
ATOM   3045  H  HG2  . LYS A 1 33 ? 2.610   10.084  1.822   1.00 0.00 ? 33  LYS A HG2  5  
ATOM   3046  H  HG3  . LYS A 1 33 ? 1.578   9.776   3.220   1.00 0.00 ? 33  LYS A HG3  5  
ATOM   3047  H  HD2  . LYS A 1 33 ? 1.565   11.971  3.866   1.00 0.00 ? 33  LYS A HD2  5  
ATOM   3048  H  HD3  . LYS A 1 33 ? 3.155   12.297  3.174   1.00 0.00 ? 33  LYS A HD3  5  
ATOM   3049  H  HE2  . LYS A 1 33 ? 1.474   13.457  1.894   1.00 0.00 ? 33  LYS A HE2  5  
ATOM   3050  H  HE3  . LYS A 1 33 ? 2.158   12.159  0.916   1.00 0.00 ? 33  LYS A HE3  5  
ATOM   3051  H  HZ1  . LYS A 1 33 ? -0.537  12.507  1.888   1.00 0.00 ? 33  LYS A HZ1  5  
ATOM   3052  H  HZ2  . LYS A 1 33 ? 0.071   10.941  2.091   1.00 0.00 ? 33  LYS A HZ2  5  
ATOM   3053  H  HZ3  . LYS A 1 33 ? 0.029   11.638  0.551   1.00 0.00 ? 33  LYS A HZ3  5  
ATOM   3054  N  N    . ILE A 1 34 ? 5.532   7.421   4.804   1.00 0.00 ? 34  ILE A N    5  
ATOM   3055  C  CA   . ILE A 1 34 ? 6.672   7.039   5.629   1.00 0.00 ? 34  ILE A CA   5  
ATOM   3056  C  C    . ILE A 1 34 ? 7.743   6.342   4.798   1.00 0.00 ? 34  ILE A C    5  
ATOM   3057  O  O    . ILE A 1 34 ? 8.834   6.051   5.289   1.00 0.00 ? 34  ILE A O    5  
ATOM   3058  C  CB   . ILE A 1 34 ? 6.246   6.109   6.781   1.00 0.00 ? 34  ILE A CB   5  
ATOM   3059  C  CG1  . ILE A 1 34 ? 5.944   4.707   6.248   1.00 0.00 ? 34  ILE A CG1  5  
ATOM   3060  C  CG2  . ILE A 1 34 ? 5.034   6.679   7.502   1.00 0.00 ? 34  ILE A CG2  5  
ATOM   3061  C  CD1  . ILE A 1 34 ? 5.729   3.679   7.337   1.00 0.00 ? 34  ILE A CD1  5  
ATOM   3062  H  H    . ILE A 1 34 ? 4.666   6.988   4.955   1.00 0.00 ? 34  ILE A H    5  
ATOM   3063  H  HA   . ILE A 1 34 ? 7.090   7.939   6.056   1.00 0.00 ? 34  ILE A HA   5  
ATOM   3064  H  HB   . ILE A 1 34 ? 7.061   6.050   7.486   1.00 0.00 ? 34  ILE A HB   5  
ATOM   3065  H  HG12 . ILE A 1 34 ? 5.050   4.742   5.645   1.00 0.00 ? 34  ILE A HG12 5  
ATOM   3066  H  HG13 . ILE A 1 34 ? 6.771   4.376   5.637   1.00 0.00 ? 34  ILE A HG13 5  
ATOM   3067  H  HG21 . ILE A 1 34 ? 4.305   5.898   7.655   1.00 0.00 ? 34  ILE A HG21 5  
ATOM   3068  H  HG22 . ILE A 1 34 ? 5.340   7.077   8.459   1.00 0.00 ? 34  ILE A HG22 5  
ATOM   3069  H  HG23 . ILE A 1 34 ? 4.599   7.467   6.907   1.00 0.00 ? 34  ILE A HG23 5  
ATOM   3070  H  HD11 . ILE A 1 34 ? 6.577   3.011   7.374   1.00 0.00 ? 34  ILE A HD11 5  
ATOM   3071  H  HD12 . ILE A 1 34 ? 5.625   4.179   8.289   1.00 0.00 ? 34  ILE A HD12 5  
ATOM   3072  H  HD13 . ILE A 1 34 ? 4.834   3.113   7.127   1.00 0.00 ? 34  ILE A HD13 5  
ATOM   3073  N  N    . HIS A 1 35 ? 7.426   6.079   3.534   1.00 0.00 ? 35  HIS A N    5  
ATOM   3074  C  CA   . HIS A 1 35 ? 8.363   5.418   2.632   1.00 0.00 ? 35  HIS A CA   5  
ATOM   3075  C  C    . HIS A 1 35 ? 8.753   6.342   1.482   1.00 0.00 ? 35  HIS A C    5  
ATOM   3076  O  O    . HIS A 1 35 ? 9.808   6.176   0.868   1.00 0.00 ? 35  HIS A O    5  
ATOM   3077  C  CB   . HIS A 1 35 ? 7.752   4.129   2.082   1.00 0.00 ? 35  HIS A CB   5  
ATOM   3078  C  CG   . HIS A 1 35 ? 7.178   3.239   3.141   1.00 0.00 ? 35  HIS A CG   5  
ATOM   3079  N  ND1  . HIS A 1 35 ? 7.941   2.667   4.137   1.00 0.00 ? 35  HIS A ND1  5  
ATOM   3080  C  CD2  . HIS A 1 35 ? 5.908   2.825   3.357   1.00 0.00 ? 35  HIS A CD2  5  
ATOM   3081  C  CE1  . HIS A 1 35 ? 7.164   1.938   4.919   1.00 0.00 ? 35  HIS A CE1  5  
ATOM   3082  N  NE2  . HIS A 1 35 ? 5.926   2.017   4.467   1.00 0.00 ? 35  HIS A NE2  5  
ATOM   3083  H  H    . HIS A 1 35 ? 6.541   6.335   3.200   1.00 0.00 ? 35  HIS A H    5  
ATOM   3084  H  HA   . HIS A 1 35 ? 9.250   5.174   3.197   1.00 0.00 ? 35  HIS A HA   5  
ATOM   3085  H  HB2  . HIS A 1 35 ? 6.958   4.380   1.394   1.00 0.00 ? 35  HIS A HB2  5  
ATOM   3086  H  HB3  . HIS A 1 35 ? 8.515   3.573   1.557   1.00 0.00 ? 35  HIS A HB3  5  
ATOM   3087  H  HD1  . HIS A 1 35 ? 8.907   2.777   4.253   1.00 0.00 ? 35  HIS A HD1  5  
ATOM   3088  H  HD2  . HIS A 1 35 ? 5.040   3.082   2.765   1.00 0.00 ? 35  HIS A HD2  5  
ATOM   3089  H  HE1  . HIS A 1 35 ? 7.486   1.373   5.781   1.00 0.00 ? 35  HIS A HE1  5  
ATOM   3090  N  N    . THR A 1 36 ? 7.895   7.316   1.194   1.00 0.00 ? 36  THR A N    5  
ATOM   3091  C  CA   . THR A 1 36 ? 8.148   8.264   0.117   1.00 0.00 ? 36  THR A CA   5  
ATOM   3092  C  C    . THR A 1 36 ? 9.109   9.360   0.564   1.00 0.00 ? 36  THR A C    5  
ATOM   3093  O  O    . THR A 1 36 ? 8.688   10.448  0.954   1.00 0.00 ? 36  THR A O    5  
ATOM   3094  C  CB   . THR A 1 36 ? 6.842   8.914   -0.378  1.00 0.00 ? 36  THR A CB   5  
ATOM   3095  O  OG1  . THR A 1 36 ? 6.270   9.717   0.660   1.00 0.00 ? 36  THR A OG1  5  
ATOM   3096  C  CG2  . THR A 1 36 ? 5.842   7.854   -0.815  1.00 0.00 ? 36  THR A CG2  5  
ATOM   3097  H  H    . THR A 1 36 ? 7.072   7.396   1.720   1.00 0.00 ? 36  THR A H    5  
ATOM   3098  H  HA   . THR A 1 36 ? 8.591   7.723   -0.706  1.00 0.00 ? 36  THR A HA   5  
ATOM   3099  H  HB   . THR A 1 36 ? 7.070   9.544   -1.226  1.00 0.00 ? 36  THR A HB   5  
ATOM   3100  H  HG1  . THR A 1 36 ? 6.891   9.787   1.390   1.00 0.00 ? 36  THR A HG1  5  
ATOM   3101  H  HG21 . THR A 1 36 ? 4.840   8.204   -0.621  1.00 0.00 ? 36  THR A HG21 5  
ATOM   3102  H  HG22 . THR A 1 36 ? 6.018   6.943   -0.262  1.00 0.00 ? 36  THR A HG22 5  
ATOM   3103  H  HG23 . THR A 1 36 ? 5.959   7.662   -1.871  1.00 0.00 ? 36  THR A HG23 5  
ATOM   3104  N  N    . GLY A 1 37 ? 10.405  9.065   0.503   1.00 0.00 ? 37  GLY A N    5  
ATOM   3105  C  CA   . GLY A 1 37 ? 11.406  10.036  0.904   1.00 0.00 ? 37  GLY A CA   5  
ATOM   3106  C  C    . GLY A 1 37 ? 12.132  10.643  -0.280  1.00 0.00 ? 37  GLY A C    5  
ATOM   3107  O  O    . GLY A 1 37 ? 12.128  10.079  -1.374  1.00 0.00 ? 37  GLY A O    5  
ATOM   3108  H  H    . GLY A 1 37 ? 10.682  8.181   0.183   1.00 0.00 ? 37  GLY A H    5  
ATOM   3109  H  HA2  . GLY A 1 37 ? 10.923  10.826  1.460   1.00 0.00 ? 37  GLY A HA2  5  
ATOM   3110  H  HA3  . GLY A 1 37 ? 12.128  9.549   1.543   1.00 0.00 ? 37  GLY A HA3  5  
ATOM   3111  N  N    . GLU A 1 38 ? 12.756  11.796  -0.062  1.00 0.00 ? 38  GLU A N    5  
ATOM   3112  C  CA   . GLU A 1 38 ? 13.488  12.480  -1.122  1.00 0.00 ? 38  GLU A CA   5  
ATOM   3113  C  C    . GLU A 1 38 ? 14.955  12.659  -0.743  1.00 0.00 ? 38  GLU A C    5  
ATOM   3114  O  O    . GLU A 1 38 ? 15.341  13.683  -0.179  1.00 0.00 ? 38  GLU A O    5  
ATOM   3115  C  CB   . GLU A 1 38 ? 12.855  13.842  -1.412  1.00 0.00 ? 38  GLU A CB   5  
ATOM   3116  C  CG   . GLU A 1 38 ? 12.734  14.731  -0.185  1.00 0.00 ? 38  GLU A CG   5  
ATOM   3117  C  CD   . GLU A 1 38 ? 11.700  15.826  -0.358  1.00 0.00 ? 38  GLU A CD   5  
ATOM   3118  O  OE1  . GLU A 1 38 ? 12.007  16.832  -1.031  1.00 0.00 ? 38  GLU A OE1  5  
ATOM   3119  O  OE2  . GLU A 1 38 ? 10.583  15.677  0.182   1.00 0.00 ? 38  GLU A OE2  5  
ATOM   3120  H  H    . GLU A 1 38 ? 12.724  12.196  0.831   1.00 0.00 ? 38  GLU A H    5  
ATOM   3121  H  HA   . GLU A 1 38 ? 13.431  11.870  -2.012  1.00 0.00 ? 38  GLU A HA   5  
ATOM   3122  H  HB2  . GLU A 1 38 ? 13.457  14.357  -2.146  1.00 0.00 ? 38  GLU A HB2  5  
ATOM   3123  H  HB3  . GLU A 1 38 ? 11.866  13.687  -1.816  1.00 0.00 ? 38  GLU A HB3  5  
ATOM   3124  H  HG2  . GLU A 1 38 ? 12.452  14.120  0.659   1.00 0.00 ? 38  GLU A HG2  5  
ATOM   3125  H  HG3  . GLU A 1 38 ? 13.693  15.188  0.008   1.00 0.00 ? 38  GLU A HG3  5  
ATOM   3126  N  N    . ARG A 1 39 ? 15.768  11.655  -1.056  1.00 0.00 ? 39  ARG A N    5  
ATOM   3127  C  CA   . ARG A 1 39 ? 17.192  11.700  -0.746  1.00 0.00 ? 39  ARG A CA   5  
ATOM   3128  C  C    . ARG A 1 39 ? 17.988  10.838  -1.722  1.00 0.00 ? 39  ARG A C    5  
ATOM   3129  O  O    . ARG A 1 39 ? 17.567  9.748   -2.112  1.00 0.00 ? 39  ARG A O    5  
ATOM   3130  C  CB   . ARG A 1 39 ? 17.439  11.227  0.688   1.00 0.00 ? 39  ARG A CB   5  
ATOM   3131  C  CG   . ARG A 1 39 ? 18.646  11.877  1.344   1.00 0.00 ? 39  ARG A CG   5  
ATOM   3132  C  CD   . ARG A 1 39 ? 18.596  11.744  2.858   1.00 0.00 ? 39  ARG A CD   5  
ATOM   3133  N  NE   . ARG A 1 39 ? 19.138  10.467  3.313   1.00 0.00 ? 39  ARG A NE   5  
ATOM   3134  C  CZ   . ARG A 1 39 ? 18.985  10.002  4.548   1.00 0.00 ? 39  ARG A CZ   5  
ATOM   3135  N  NH1  . ARG A 1 39 ? 18.309  10.705  5.445   1.00 0.00 ? 39  ARG A NH1  5  
ATOM   3136  N  NH2  . ARG A 1 39 ? 19.508  8.830   4.886   1.00 0.00 ? 39  ARG A NH2  5  
ATOM   3137  H  H    . ARG A 1 39 ? 15.401  10.865  -1.505  1.00 0.00 ? 39  ARG A H    5  
ATOM   3138  H  HA   . ARG A 1 39 ? 17.520  12.724  -0.839  1.00 0.00 ? 39  ARG A HA   5  
ATOM   3139  H  HB2  . ARG A 1 39 ? 16.568  11.453  1.284   1.00 0.00 ? 39  ARG A HB2  5  
ATOM   3140  H  HB3  . ARG A 1 39 ? 17.593  10.159  0.680   1.00 0.00 ? 39  ARG A HB3  5  
ATOM   3141  H  HG2  . ARG A 1 39 ? 19.543  11.398  0.981   1.00 0.00 ? 39  ARG A HG2  5  
ATOM   3142  H  HG3  . ARG A 1 39 ? 18.665  12.925  1.083   1.00 0.00 ? 39  ARG A HG3  5  
ATOM   3143  H  HD2  . ARG A 1 39 ? 19.173  12.545  3.295   1.00 0.00 ? 39  ARG A HD2  5  
ATOM   3144  H  HD3  . ARG A 1 39 ? 17.569  11.824  3.179   1.00 0.00 ? 39  ARG A HD3  5  
ATOM   3145  H  HE   . ARG A 1 39 ? 19.641  9.931   2.666   1.00 0.00 ? 39  ARG A HE   5  
ATOM   3146  H  HH11 . ARG A 1 39 ? 17.913  11.588  5.193   1.00 0.00 ? 39  ARG A HH11 5  
ATOM   3147  H  HH12 . ARG A 1 39 ? 18.194  10.352  6.374   1.00 0.00 ? 39  ARG A HH12 5  
ATOM   3148  H  HH21 . ARG A 1 39 ? 20.018  8.297   4.212   1.00 0.00 ? 39  ARG A HH21 5  
ATOM   3149  H  HH22 . ARG A 1 39 ? 19.392  8.481   5.816   1.00 0.00 ? 39  ARG A HH22 5  
ATOM   3150  N  N    . PRO A 1 40 ? 19.166  11.336  -2.127  1.00 0.00 ? 40  PRO A N    5  
ATOM   3151  C  CA   . PRO A 1 40 ? 20.045  10.627  -3.061  1.00 0.00 ? 40  PRO A CA   5  
ATOM   3152  C  C    . PRO A 1 40 ? 20.673  9.385   -2.439  1.00 0.00 ? 40  PRO A C    5  
ATOM   3153  O  O    . PRO A 1 40 ? 21.403  8.648   -3.102  1.00 0.00 ? 40  PRO A O    5  
ATOM   3154  C  CB   . PRO A 1 40 ? 21.122  11.664  -3.389  1.00 0.00 ? 40  PRO A CB   5  
ATOM   3155  C  CG   . PRO A 1 40 ? 21.144  12.574  -2.210  1.00 0.00 ? 40  PRO A CG   5  
ATOM   3156  C  CD   . PRO A 1 40 ? 19.730  12.628  -1.702  1.00 0.00 ? 40  PRO A CD   5  
ATOM   3157  H  HA   . PRO A 1 40 ? 19.522  10.351  -3.965  1.00 0.00 ? 40  PRO A HA   5  
ATOM   3158  H  HB2  . PRO A 1 40 ? 22.073  11.168  -3.525  1.00 0.00 ? 40  PRO A HB2  5  
ATOM   3159  H  HB3  . PRO A 1 40 ? 20.855  12.194  -4.291  1.00 0.00 ? 40  PRO A HB3  5  
ATOM   3160  H  HG2  . PRO A 1 40 ? 21.800  12.175  -1.451  1.00 0.00 ? 40  PRO A HG2  5  
ATOM   3161  H  HG3  . PRO A 1 40 ? 21.472  13.558  -2.512  1.00 0.00 ? 40  PRO A HG3  5  
ATOM   3162  H  HD2  . PRO A 1 40 ? 19.718  12.719  -0.627  1.00 0.00 ? 40  PRO A HD2  5  
ATOM   3163  H  HD3  . PRO A 1 40 ? 19.197  13.449  -2.159  1.00 0.00 ? 40  PRO A HD3  5  
ATOM   3164  N  N    . SER A 1 41 ? 20.384  9.158   -1.162  1.00 0.00 ? 41  SER A N    5  
ATOM   3165  C  CA   . SER A 1 41 ? 20.923  8.006   -0.448  1.00 0.00 ? 41  SER A CA   5  
ATOM   3166  C  C    . SER A 1 41 ? 22.448  8.004   -0.494  1.00 0.00 ? 41  SER A C    5  
ATOM   3167  O  O    . SER A 1 41 ? 23.070  6.983   -0.781  1.00 0.00 ? 41  SER A O    5  
ATOM   3168  C  CB   . SER A 1 41 ? 20.382  6.708   -1.050  1.00 0.00 ? 41  SER A CB   5  
ATOM   3169  O  OG   . SER A 1 41 ? 20.544  5.624   -0.153  1.00 0.00 ? 41  SER A OG   5  
ATOM   3170  H  H    . SER A 1 41 ? 19.795  9.782   -0.687  1.00 0.00 ? 41  SER A H    5  
ATOM   3171  H  HA   . SER A 1 41 ? 20.605  8.076   0.581   1.00 0.00 ? 41  SER A HA   5  
ATOM   3172  H  HB2  . SER A 1 41 ? 19.331  6.826   -1.267  1.00 0.00 ? 41  SER A HB2  5  
ATOM   3173  H  HB3  . SER A 1 41 ? 20.915  6.488   -1.963  1.00 0.00 ? 41  SER A HB3  5  
ATOM   3174  H  HG   . SER A 1 41 ? 20.342  5.913   0.740   1.00 0.00 ? 41  SER A HG   5  
ATOM   3175  N  N    . GLY A 1 42 ? 23.044  9.158   -0.209  1.00 0.00 ? 42  GLY A N    5  
ATOM   3176  C  CA   . GLY A 1 42 ? 24.491  9.269   -0.223  1.00 0.00 ? 42  GLY A CA   5  
ATOM   3177  C  C    . GLY A 1 42 ? 25.057  9.647   1.131   1.00 0.00 ? 42  GLY A C    5  
ATOM   3178  O  O    . GLY A 1 42 ? 24.420  9.460   2.168   1.00 0.00 ? 42  GLY A O    5  
ATOM   3179  H  H    . GLY A 1 42 ? 22.497  9.941   0.013   1.00 0.00 ? 42  GLY A H    5  
ATOM   3180  H  HA2  . GLY A 1 42 ? 24.911  8.321   -0.525  1.00 0.00 ? 42  GLY A HA2  5  
ATOM   3181  H  HA3  . GLY A 1 42 ? 24.776  10.023  -0.942  1.00 0.00 ? 42  GLY A HA3  5  
ATOM   3182  N  N    . PRO A 1 43 ? 26.283  10.191  1.134   1.00 0.00 ? 43  PRO A N    5  
ATOM   3183  C  CA   . PRO A 1 43 ? 26.962  10.607  2.365   1.00 0.00 ? 43  PRO A CA   5  
ATOM   3184  C  C    . PRO A 1 43 ? 26.311  11.830  3.002   1.00 0.00 ? 43  PRO A C    5  
ATOM   3185  O  O    . PRO A 1 43 ? 25.503  12.513  2.372   1.00 0.00 ? 43  PRO A O    5  
ATOM   3186  C  CB   . PRO A 1 43 ? 28.379  10.940  1.893   1.00 0.00 ? 43  PRO A CB   5  
ATOM   3187  C  CG   . PRO A 1 43 ? 28.226  11.295  0.454   1.00 0.00 ? 43  PRO A CG   5  
ATOM   3188  C  CD   . PRO A 1 43 ? 27.100  10.443  -0.065  1.00 0.00 ? 43  PRO A CD   5  
ATOM   3189  H  HA   . PRO A 1 43 ? 27.000  9.804   3.087   1.00 0.00 ? 43  PRO A HA   5  
ATOM   3190  H  HB2  . PRO A 1 43 ? 28.766  11.770  2.466   1.00 0.00 ? 43  PRO A HB2  5  
ATOM   3191  H  HB3  . PRO A 1 43 ? 29.017  10.078  2.021   1.00 0.00 ? 43  PRO A HB3  5  
ATOM   3192  H  HG2  . PRO A 1 43 ? 27.979  12.341  0.358   1.00 0.00 ? 43  PRO A HG2  5  
ATOM   3193  H  HG3  . PRO A 1 43 ? 29.139  11.073  -0.078  1.00 0.00 ? 43  PRO A HG3  5  
ATOM   3194  H  HD2  . PRO A 1 43 ? 26.534  10.980  -0.812  1.00 0.00 ? 43  PRO A HD2  5  
ATOM   3195  H  HD3  . PRO A 1 43 ? 27.483  9.518   -0.471  1.00 0.00 ? 43  PRO A HD3  5  
ATOM   3196  N  N    . SER A 1 44 ? 26.668  12.101  4.253   1.00 0.00 ? 44  SER A N    5  
ATOM   3197  C  CA   . SER A 1 44 ? 26.116  13.240  4.976   1.00 0.00 ? 44  SER A CA   5  
ATOM   3198  C  C    . SER A 1 44 ? 25.937  14.438  4.047   1.00 0.00 ? 44  SER A C    5  
ATOM   3199  O  O    . SER A 1 44 ? 26.757  14.678  3.161   1.00 0.00 ? 44  SER A O    5  
ATOM   3200  C  CB   . SER A 1 44 ? 27.027  13.619  6.145   1.00 0.00 ? 44  SER A CB   5  
ATOM   3201  O  OG   . SER A 1 44 ? 28.213  14.245  5.686   1.00 0.00 ? 44  SER A OG   5  
ATOM   3202  H  H    . SER A 1 44 ? 27.317  11.519  4.701   1.00 0.00 ? 44  SER A H    5  
ATOM   3203  H  HA   . SER A 1 44 ? 25.150  12.952  5.362   1.00 0.00 ? 44  SER A HA   5  
ATOM   3204  H  HB2  . SER A 1 44 ? 26.504  14.301  6.799   1.00 0.00 ? 44  SER A HB2  5  
ATOM   3205  H  HB3  . SER A 1 44 ? 27.293  12.727  6.694   1.00 0.00 ? 44  SER A HB3  5  
ATOM   3206  H  HG   . SER A 1 44 ? 28.324  15.087  6.133   1.00 0.00 ? 44  SER A HG   5  
ATOM   3207  N  N    . SER A 1 45 ? 24.858  15.185  4.257   1.00 0.00 ? 45  SER A N    5  
ATOM   3208  C  CA   . SER A 1 45 ? 24.568  16.356  3.437   1.00 0.00 ? 45  SER A CA   5  
ATOM   3209  C  C    . SER A 1 45 ? 24.601  17.629  4.277   1.00 0.00 ? 45  SER A C    5  
ATOM   3210  O  O    . SER A 1 45 ? 24.579  17.576  5.506   1.00 0.00 ? 45  SER A O    5  
ATOM   3211  C  CB   . SER A 1 45 ? 23.201  16.209  2.767   1.00 0.00 ? 45  SER A CB   5  
ATOM   3212  O  OG   . SER A 1 45 ? 22.919  17.321  1.935   1.00 0.00 ? 45  SER A OG   5  
ATOM   3213  H  H    . SER A 1 45 ? 24.242  14.942  4.979   1.00 0.00 ? 45  SER A H    5  
ATOM   3214  H  HA   . SER A 1 45 ? 25.329  16.423  2.674   1.00 0.00 ? 45  SER A HA   5  
ATOM   3215  H  HB2  . SER A 1 45 ? 23.193  15.313  2.165   1.00 0.00 ? 45  SER A HB2  5  
ATOM   3216  H  HB3  . SER A 1 45 ? 22.436  16.139  3.527   1.00 0.00 ? 45  SER A HB3  5  
ATOM   3217  H  HG   . SER A 1 45 ? 22.725  18.087  2.479   1.00 0.00 ? 45  SER A HG   5  
ATOM   3218  N  N    . GLY A 1 46 ? 24.653  18.774  3.604   1.00 0.00 ? 46  GLY A N    5  
ATOM   3219  C  CA   . GLY A 1 46 ? 24.688  20.045  4.303   1.00 0.00 ? 46  GLY A CA   5  
ATOM   3220  C  C    . GLY A 1 46 ? 25.010  21.205  3.382   1.00 0.00 ? 46  GLY A C    5  
ATOM   3221  O  O    . GLY A 1 46 ? 25.868  21.059  2.512   1.00 0.00 ? 46  GLY A O    5  
ATOM   3222  H  H    . GLY A 1 46 ? 24.668  18.756  2.624   1.00 0.00 ? 46  GLY A H    5  
ATOM   3223  H  HA2  . GLY A 1 46 ? 23.726  20.219  4.760   1.00 0.00 ? 46  GLY A HA2  5  
ATOM   3224  H  HA3  . GLY A 1 46 ? 25.440  19.997  5.077   1.00 0.00 ? 46  GLY A HA3  5  
HETATM 3225  ZN ZN   . ZN  B 2 .  ? 4.081   1.172   4.783   1.00 0.00 ? 201 ZN  A ZN   5  
ATOM   3226  N  N    . GLY A 1 1  ? 6.106   -28.104 -3.959  1.00 0.00 ? 1   GLY A N    6  
ATOM   3227  C  CA   . GLY A 1 1  ? 5.955   -26.727 -4.392  1.00 0.00 ? 1   GLY A CA   6  
ATOM   3228  C  C    . GLY A 1 1  ? 5.972   -25.749 -3.234  1.00 0.00 ? 1   GLY A C    6  
ATOM   3229  O  O    . GLY A 1 1  ? 7.004   -25.150 -2.933  1.00 0.00 ? 1   GLY A O    6  
ATOM   3230  H  H1   . GLY A 1 1  ? 5.450   -28.497 -3.345  1.00 0.00 ? 1   GLY A H1   6  
ATOM   3231  H  HA2  . GLY A 1 1  ? 6.761   -26.483 -5.068  1.00 0.00 ? 1   GLY A HA2  6  
ATOM   3232  H  HA3  . GLY A 1 1  ? 5.016   -26.628 -4.917  1.00 0.00 ? 1   GLY A HA3  6  
ATOM   3233  N  N    . SER A 1 2  ? 4.825   -25.586 -2.582  1.00 0.00 ? 2   SER A N    6  
ATOM   3234  C  CA   . SER A 1 2  ? 4.710   -24.670 -1.454  1.00 0.00 ? 2   SER A CA   6  
ATOM   3235  C  C    . SER A 1 2  ? 5.110   -25.358 -0.152  1.00 0.00 ? 2   SER A C    6  
ATOM   3236  O  O    . SER A 1 2  ? 5.366   -26.562 -0.127  1.00 0.00 ? 2   SER A O    6  
ATOM   3237  C  CB   . SER A 1 2  ? 3.280   -24.138 -1.345  1.00 0.00 ? 2   SER A CB   6  
ATOM   3238  O  OG   . SER A 1 2  ? 2.899   -23.451 -2.524  1.00 0.00 ? 2   SER A OG   6  
ATOM   3239  H  H    . SER A 1 2  ? 4.036   -26.092 -2.870  1.00 0.00 ? 2   SER A H    6  
ATOM   3240  H  HA   . SER A 1 2  ? 5.380   -23.842 -1.630  1.00 0.00 ? 2   SER A HA   6  
ATOM   3241  H  HB2  . SER A 1 2  ? 2.602   -24.964 -1.189  1.00 0.00 ? 2   SER A HB2  6  
ATOM   3242  H  HB3  . SER A 1 2  ? 3.215   -23.457 -0.508  1.00 0.00 ? 2   SER A HB3  6  
ATOM   3243  H  HG   . SER A 1 2  ? 3.285   -23.887 -3.287  1.00 0.00 ? 2   SER A HG   6  
ATOM   3244  N  N    . SER A 1 3  ? 5.161   -24.584 0.927   1.00 0.00 ? 3   SER A N    6  
ATOM   3245  C  CA   . SER A 1 3  ? 5.534   -25.117 2.232   1.00 0.00 ? 3   SER A CA   6  
ATOM   3246  C  C    . SER A 1 3  ? 4.302   -25.312 3.111   1.00 0.00 ? 3   SER A C    6  
ATOM   3247  O  O    . SER A 1 3  ? 4.137   -26.352 3.747   1.00 0.00 ? 3   SER A O    6  
ATOM   3248  C  CB   . SER A 1 3  ? 6.526   -24.181 2.925   1.00 0.00 ? 3   SER A CB   6  
ATOM   3249  O  OG   . SER A 1 3  ? 5.920   -22.940 3.241   1.00 0.00 ? 3   SER A OG   6  
ATOM   3250  H  H    . SER A 1 3  ? 4.946   -23.632 0.843   1.00 0.00 ? 3   SER A H    6  
ATOM   3251  H  HA   . SER A 1 3  ? 6.005   -26.076 2.077   1.00 0.00 ? 3   SER A HA   6  
ATOM   3252  H  HB2  . SER A 1 3  ? 6.873   -24.641 3.838   1.00 0.00 ? 3   SER A HB2  6  
ATOM   3253  H  HB3  . SER A 1 3  ? 7.365   -24.002 2.269   1.00 0.00 ? 3   SER A HB3  6  
ATOM   3254  H  HG   . SER A 1 3  ? 6.354   -22.557 4.007   1.00 0.00 ? 3   SER A HG   6  
ATOM   3255  N  N    . GLY A 1 4  ? 3.438   -24.301 3.141   1.00 0.00 ? 4   GLY A N    6  
ATOM   3256  C  CA   . GLY A 1 4  ? 2.232   -24.380 3.944   1.00 0.00 ? 4   GLY A CA   6  
ATOM   3257  C  C    . GLY A 1 4  ? 2.198   -23.336 5.043   1.00 0.00 ? 4   GLY A C    6  
ATOM   3258  O  O    . GLY A 1 4  ? 1.779   -23.619 6.165   1.00 0.00 ? 4   GLY A O    6  
ATOM   3259  H  H    . GLY A 1 4  ? 3.621   -23.496 2.613   1.00 0.00 ? 4   GLY A H    6  
ATOM   3260  H  HA2  . GLY A 1 4  ? 1.375   -24.240 3.302   1.00 0.00 ? 4   GLY A HA2  6  
ATOM   3261  H  HA3  . GLY A 1 4  ? 2.176   -25.360 4.394   1.00 0.00 ? 4   GLY A HA3  6  
ATOM   3262  N  N    . SER A 1 5  ? 2.642   -22.125 4.720   1.00 0.00 ? 5   SER A N    6  
ATOM   3263  C  CA   . SER A 1 5  ? 2.666   -21.036 5.690   1.00 0.00 ? 5   SER A CA   6  
ATOM   3264  C  C    . SER A 1 5  ? 1.720   -19.915 5.271   1.00 0.00 ? 5   SER A C    6  
ATOM   3265  O  O    . SER A 1 5  ? 0.868   -19.484 6.048   1.00 0.00 ? 5   SER A O    6  
ATOM   3266  C  CB   . SER A 1 5  ? 4.087   -20.491 5.841   1.00 0.00 ? 5   SER A CB   6  
ATOM   3267  O  OG   . SER A 1 5  ? 4.810   -21.216 6.820   1.00 0.00 ? 5   SER A OG   6  
ATOM   3268  H  H    . SER A 1 5  ? 2.963   -21.961 3.809   1.00 0.00 ? 5   SER A H    6  
ATOM   3269  H  HA   . SER A 1 5  ? 2.338   -21.431 6.640   1.00 0.00 ? 5   SER A HA   6  
ATOM   3270  H  HB2  . SER A 1 5  ? 4.603   -20.571 4.896   1.00 0.00 ? 5   SER A HB2  6  
ATOM   3271  H  HB3  . SER A 1 5  ? 4.041   -19.453 6.139   1.00 0.00 ? 5   SER A HB3  6  
ATOM   3272  H  HG   . SER A 1 5  ? 5.743   -21.000 6.754   1.00 0.00 ? 5   SER A HG   6  
ATOM   3273  N  N    . SER A 1 6  ? 1.877   -19.447 4.037   1.00 0.00 ? 6   SER A N    6  
ATOM   3274  C  CA   . SER A 1 6  ? 1.040   -18.373 3.514   1.00 0.00 ? 6   SER A CA   6  
ATOM   3275  C  C    . SER A 1 6  ? -0.384  -18.863 3.272   1.00 0.00 ? 6   SER A C    6  
ATOM   3276  O  O    . SER A 1 6  ? -0.661  -20.060 3.336   1.00 0.00 ? 6   SER A O    6  
ATOM   3277  C  CB   . SER A 1 6  ? 1.631   -17.825 2.214   1.00 0.00 ? 6   SER A CB   6  
ATOM   3278  O  OG   . SER A 1 6  ? 2.546   -16.774 2.472   1.00 0.00 ? 6   SER A OG   6  
ATOM   3279  H  H    . SER A 1 6  ? 2.574   -19.832 3.465   1.00 0.00 ? 6   SER A H    6  
ATOM   3280  H  HA   . SER A 1 6  ? 1.017   -17.583 4.250   1.00 0.00 ? 6   SER A HA   6  
ATOM   3281  H  HB2  . SER A 1 6  ? 2.148   -18.617 1.694   1.00 0.00 ? 6   SER A HB2  6  
ATOM   3282  H  HB3  . SER A 1 6  ? 0.833   -17.446 1.591   1.00 0.00 ? 6   SER A HB3  6  
ATOM   3283  H  HG   . SER A 1 6  ? 2.063   -15.960 2.632   1.00 0.00 ? 6   SER A HG   6  
ATOM   3284  N  N    . GLY A 1 7  ? -1.286  -17.926 2.994   1.00 0.00 ? 7   GLY A N    6  
ATOM   3285  C  CA   . GLY A 1 7  ? -2.672  -18.281 2.747   1.00 0.00 ? 7   GLY A CA   6  
ATOM   3286  C  C    . GLY A 1 7  ? -3.277  -17.491 1.604   1.00 0.00 ? 7   GLY A C    6  
ATOM   3287  O  O    . GLY A 1 7  ? -2.558  -16.910 0.790   1.00 0.00 ? 7   GLY A O    6  
ATOM   3288  H  H    . GLY A 1 7  ? -1.009  -16.987 2.956   1.00 0.00 ? 7   GLY A H    6  
ATOM   3289  H  HA2  . GLY A 1 7  ? -2.726  -19.333 2.512   1.00 0.00 ? 7   GLY A HA2  6  
ATOM   3290  H  HA3  . GLY A 1 7  ? -3.245  -18.092 3.643   1.00 0.00 ? 7   GLY A HA3  6  
ATOM   3291  N  N    . THR A 1 8  ? -4.605  -17.468 1.540   1.00 0.00 ? 8   THR A N    6  
ATOM   3292  C  CA   . THR A 1 8  ? -5.307  -16.746 0.487   1.00 0.00 ? 8   THR A CA   6  
ATOM   3293  C  C    . THR A 1 8  ? -5.332  -15.248 0.769   1.00 0.00 ? 8   THR A C    6  
ATOM   3294  O  O    . THR A 1 8  ? -6.112  -14.775 1.595   1.00 0.00 ? 8   THR A O    6  
ATOM   3295  C  CB   . THR A 1 8  ? -6.754  -17.251 0.328   1.00 0.00 ? 8   THR A CB   6  
ATOM   3296  O  OG1  . THR A 1 8  ? -7.455  -17.128 1.571   1.00 0.00 ? 8   THR A OG1  6  
ATOM   3297  C  CG2  . THR A 1 8  ? -6.774  -18.701 -0.130  1.00 0.00 ? 8   THR A CG2  6  
ATOM   3298  H  H    . THR A 1 8  ? -5.123  -17.950 2.218   1.00 0.00 ? 8   THR A H    6  
ATOM   3299  H  HA   . THR A 1 8  ? -4.784  -16.919 -0.442  1.00 0.00 ? 8   THR A HA   6  
ATOM   3300  H  HB   . THR A 1 8  ? -7.250  -16.646 -0.418  1.00 0.00 ? 8   THR A HB   6  
ATOM   3301  H  HG1  . THR A 1 8  ? -7.375  -17.947 2.065   1.00 0.00 ? 8   THR A HG1  6  
ATOM   3302  H  HG21 . THR A 1 8  ? -7.674  -18.887 -0.697  1.00 0.00 ? 8   THR A HG21 6  
ATOM   3303  H  HG22 . THR A 1 8  ? -6.751  -19.351 0.732   1.00 0.00 ? 8   THR A HG22 6  
ATOM   3304  H  HG23 . THR A 1 8  ? -5.911  -18.895 -0.750  1.00 0.00 ? 8   THR A HG23 6  
ATOM   3305  N  N    . GLY A 1 9  ? -4.473  -14.506 0.077   1.00 0.00 ? 9   GLY A N    6  
ATOM   3306  C  CA   . GLY A 1 9  ? -4.413  -13.068 0.268   1.00 0.00 ? 9   GLY A CA   6  
ATOM   3307  C  C    . GLY A 1 9  ? -5.758  -12.400 0.062   1.00 0.00 ? 9   GLY A C    6  
ATOM   3308  O  O    . GLY A 1 9  ? -6.231  -12.277 -1.067  1.00 0.00 ? 9   GLY A O    6  
ATOM   3309  H  H    . GLY A 1 9  ? -3.875  -14.938 -0.568  1.00 0.00 ? 9   GLY A H    6  
ATOM   3310  H  HA2  . GLY A 1 9  ? -4.070  -12.863 1.271   1.00 0.00 ? 9   GLY A HA2  6  
ATOM   3311  H  HA3  . GLY A 1 9  ? -3.707  -12.652 -0.436  1.00 0.00 ? 9   GLY A HA3  6  
ATOM   3312  N  N    . GLU A 1 10 ? -6.377  -11.969 1.157   1.00 0.00 ? 10  GLU A N    6  
ATOM   3313  C  CA   . GLU A 1 10 ? -7.677  -11.312 1.091   1.00 0.00 ? 10  GLU A CA   6  
ATOM   3314  C  C    . GLU A 1 10 ? -7.696  -10.055 1.957   1.00 0.00 ? 10  GLU A C    6  
ATOM   3315  O  O    . GLU A 1 10 ? -8.024  -10.110 3.141   1.00 0.00 ? 10  GLU A O    6  
ATOM   3316  C  CB   . GLU A 1 10 ? -8.781  -12.271 1.540   1.00 0.00 ? 10  GLU A CB   6  
ATOM   3317  C  CG   . GLU A 1 10 ? -9.117  -13.337 0.511   1.00 0.00 ? 10  GLU A CG   6  
ATOM   3318  C  CD   . GLU A 1 10 ? -10.256 -14.236 0.952   1.00 0.00 ? 10  GLU A CD   6  
ATOM   3319  O  OE1  . GLU A 1 10 ? -11.421 -13.791 0.885   1.00 0.00 ? 10  GLU A OE1  6  
ATOM   3320  O  OE2  . GLU A 1 10 ? -9.983  -15.382 1.365   1.00 0.00 ? 10  GLU A OE2  6  
ATOM   3321  H  H    . GLU A 1 10 ? -5.949  -12.096 2.030   1.00 0.00 ? 10  GLU A H    6  
ATOM   3322  H  HA   . GLU A 1 10 ? -7.854  -11.030 0.064   1.00 0.00 ? 10  GLU A HA   6  
ATOM   3323  H  HB2  . GLU A 1 10 ? -8.466  -12.763 2.449   1.00 0.00 ? 10  GLU A HB2  6  
ATOM   3324  H  HB3  . GLU A 1 10 ? -9.676  -11.701 1.742   1.00 0.00 ? 10  GLU A HB3  6  
ATOM   3325  H  HG2  . GLU A 1 10 ? -9.398  -12.853 -0.412  1.00 0.00 ? 10  GLU A HG2  6  
ATOM   3326  H  HG3  . GLU A 1 10 ? -8.241  -13.947 0.344   1.00 0.00 ? 10  GLU A HG3  6  
ATOM   3327  N  N    . ASN A 1 11 ? -7.341  -8.924  1.356   1.00 0.00 ? 11  ASN A N    6  
ATOM   3328  C  CA   . ASN A 1 11 ? -7.317  -7.654  2.071   1.00 0.00 ? 11  ASN A CA   6  
ATOM   3329  C  C    . ASN A 1 11 ? -7.799  -6.516  1.177   1.00 0.00 ? 11  ASN A C    6  
ATOM   3330  O  O    . ASN A 1 11 ? -7.726  -6.585  -0.051  1.00 0.00 ? 11  ASN A O    6  
ATOM   3331  C  CB   . ASN A 1 11 ? -5.903  -7.356  2.576   1.00 0.00 ? 11  ASN A CB   6  
ATOM   3332  C  CG   . ASN A 1 11 ? -5.574  -8.109  3.851   1.00 0.00 ? 11  ASN A CG   6  
ATOM   3333  O  OD1  . ASN A 1 11 ? -6.118  -7.816  4.916   1.00 0.00 ? 11  ASN A OD1  6  
ATOM   3334  N  ND2  . ASN A 1 11 ? -4.680  -9.085  3.748   1.00 0.00 ? 11  ASN A ND2  6  
ATOM   3335  H  H    . ASN A 1 11 ? -7.090  -8.944  0.409   1.00 0.00 ? 11  ASN A H    6  
ATOM   3336  H  HA   . ASN A 1 11 ? -7.981  -7.737  2.918   1.00 0.00 ? 11  ASN A HA   6  
ATOM   3337  H  HB2  . ASN A 1 11 ? -5.189  -7.643  1.818   1.00 0.00 ? 11  ASN A HB2  6  
ATOM   3338  H  HB3  . ASN A 1 11 ? -5.811  -6.298  2.770   1.00 0.00 ? 11  ASN A HB3  6  
ATOM   3339  H  HD21 . ASN A 1 11 ? -4.288  -9.263  2.867   1.00 0.00 ? 11  ASN A HD21 6  
ATOM   3340  H  HD22 . ASN A 1 11 ? -4.450  -9.589  4.556   1.00 0.00 ? 11  ASN A HD22 6  
ATOM   3341  N  N    . PRO A 1 12 ? -8.303  -5.443  1.804   1.00 0.00 ? 12  PRO A N    6  
ATOM   3342  C  CA   . PRO A 1 12 ? -8.807  -4.269  1.084   1.00 0.00 ? 12  PRO A CA   6  
ATOM   3343  C  C    . PRO A 1 12 ? -7.689  -3.476  0.417   1.00 0.00 ? 12  PRO A C    6  
ATOM   3344  O  O    . PRO A 1 12 ? -7.761  -3.161  -0.772  1.00 0.00 ? 12  PRO A O    6  
ATOM   3345  C  CB   . PRO A 1 12 ? -9.470  -3.437  2.184   1.00 0.00 ? 12  PRO A CB   6  
ATOM   3346  C  CG   . PRO A 1 12 ? -8.775  -3.842  3.438   1.00 0.00 ? 12  PRO A CG   6  
ATOM   3347  C  CD   . PRO A 1 12 ? -8.421  -5.293  3.264   1.00 0.00 ? 12  PRO A CD   6  
ATOM   3348  H  HA   . PRO A 1 12 ? -9.543  -4.544  0.344   1.00 0.00 ? 12  PRO A HA   6  
ATOM   3349  H  HB2  . PRO A 1 12 ? -9.331  -2.385  1.976   1.00 0.00 ? 12  PRO A HB2  6  
ATOM   3350  H  HB3  . PRO A 1 12 ? -10.525 -3.665  2.226   1.00 0.00 ? 12  PRO A HB3  6  
ATOM   3351  H  HG2  . PRO A 1 12 ? -7.882  -3.251  3.570   1.00 0.00 ? 12  PRO A HG2  6  
ATOM   3352  H  HG3  . PRO A 1 12 ? -9.438  -3.717  4.281   1.00 0.00 ? 12  PRO A HG3  6  
ATOM   3353  H  HD2  . PRO A 1 12 ? -7.482  -5.513  3.751   1.00 0.00 ? 12  PRO A HD2  6  
ATOM   3354  H  HD3  . PRO A 1 12 ? -9.207  -5.923  3.654   1.00 0.00 ? 12  PRO A HD3  6  
ATOM   3355  N  N    . PHE A 1 13 ? -6.655  -3.155  1.188   1.00 0.00 ? 13  PHE A N    6  
ATOM   3356  C  CA   . PHE A 1 13 ? -5.522  -2.397  0.671   1.00 0.00 ? 13  PHE A CA   6  
ATOM   3357  C  C    . PHE A 1 13 ? -4.279  -2.625  1.526   1.00 0.00 ? 13  PHE A C    6  
ATOM   3358  O  O    . PHE A 1 13 ? -4.284  -2.362  2.729   1.00 0.00 ? 13  PHE A O    6  
ATOM   3359  C  CB   . PHE A 1 13 ? -5.857  -0.904  0.626   1.00 0.00 ? 13  PHE A CB   6  
ATOM   3360  C  CG   . PHE A 1 13 ? -7.076  -0.588  -0.192  1.00 0.00 ? 13  PHE A CG   6  
ATOM   3361  C  CD1  . PHE A 1 13 ? -6.996  -0.494  -1.572  1.00 0.00 ? 13  PHE A CD1  6  
ATOM   3362  C  CD2  . PHE A 1 13 ? -8.303  -0.385  0.419   1.00 0.00 ? 13  PHE A CD2  6  
ATOM   3363  C  CE1  . PHE A 1 13 ? -8.117  -0.202  -2.327  1.00 0.00 ? 13  PHE A CE1  6  
ATOM   3364  C  CE2  . PHE A 1 13 ? -9.427  -0.093  -0.330  1.00 0.00 ? 13  PHE A CE2  6  
ATOM   3365  C  CZ   . PHE A 1 13 ? -9.334  -0.003  -1.705  1.00 0.00 ? 13  PHE A CZ   6  
ATOM   3366  H  H    . PHE A 1 13 ? -6.655  -3.434  2.128   1.00 0.00 ? 13  PHE A H    6  
ATOM   3367  H  HA   . PHE A 1 13 ? -5.323  -2.742  -0.332  1.00 0.00 ? 13  PHE A HA   6  
ATOM   3368  H  HB2  . PHE A 1 13 ? -6.032  -0.551  1.631   1.00 0.00 ? 13  PHE A HB2  6  
ATOM   3369  H  HB3  . PHE A 1 13 ? -5.022  -0.368  0.200   1.00 0.00 ? 13  PHE A HB3  6  
ATOM   3370  H  HD1  . PHE A 1 13 ? -6.045  -0.651  -2.060  1.00 0.00 ? 13  PHE A HD1  6  
ATOM   3371  H  HD2  . PHE A 1 13 ? -8.377  -0.455  1.496   1.00 0.00 ? 13  PHE A HD2  6  
ATOM   3372  H  HE1  . PHE A 1 13 ? -8.041  -0.133  -3.402  1.00 0.00 ? 13  PHE A HE1  6  
ATOM   3373  H  HE2  . PHE A 1 13 ? -10.377 0.062   0.159   1.00 0.00 ? 13  PHE A HE2  6  
ATOM   3374  H  HZ   . PHE A 1 13 ? -10.211 0.226   -2.293  1.00 0.00 ? 13  PHE A HZ   6  
ATOM   3375  N  N    . ILE A 1 14 ? -3.217  -3.117  0.897   1.00 0.00 ? 14  ILE A N    6  
ATOM   3376  C  CA   . ILE A 1 14 ? -1.968  -3.380  1.599   1.00 0.00 ? 14  ILE A CA   6  
ATOM   3377  C  C    . ILE A 1 14 ? -0.835  -2.522  1.046   1.00 0.00 ? 14  ILE A C    6  
ATOM   3378  O  O    . ILE A 1 14 ? -0.848  -2.135  -0.123  1.00 0.00 ? 14  ILE A O    6  
ATOM   3379  C  CB   . ILE A 1 14 ? -1.568  -4.864  1.500   1.00 0.00 ? 14  ILE A CB   6  
ATOM   3380  C  CG1  . ILE A 1 14 ? -2.662  -5.751  2.099   1.00 0.00 ? 14  ILE A CG1  6  
ATOM   3381  C  CG2  . ILE A 1 14 ? -0.241  -5.104  2.204   1.00 0.00 ? 14  ILE A CG2  6  
ATOM   3382  C  CD1  . ILE A 1 14 ? -2.512  -7.215  1.750   1.00 0.00 ? 14  ILE A CD1  6  
ATOM   3383  H  H    . ILE A 1 14 ? -3.275  -3.306  -0.063  1.00 0.00 ? 14  ILE A H    6  
ATOM   3384  H  HA   . ILE A 1 14 ? -2.114  -3.136  2.642   1.00 0.00 ? 14  ILE A HA   6  
ATOM   3385  H  HB   . ILE A 1 14 ? -1.445  -5.112  0.457   1.00 0.00 ? 14  ILE A HB   6  
ATOM   3386  H  HG12 . ILE A 1 14 ? -2.640  -5.663  3.173   1.00 0.00 ? 14  ILE A HG12 6  
ATOM   3387  H  HG13 . ILE A 1 14 ? -3.624  -5.418  1.734   1.00 0.00 ? 14  ILE A HG13 6  
ATOM   3388  H  HG21 . ILE A 1 14 ? 0.571   -4.905  1.519   1.00 0.00 ? 14  ILE A HG21 6  
ATOM   3389  H  HG22 . ILE A 1 14 ? -0.161  -4.445  3.055   1.00 0.00 ? 14  ILE A HG22 6  
ATOM   3390  H  HG23 . ILE A 1 14 ? -0.189  -6.130  2.535   1.00 0.00 ? 14  ILE A HG23 6  
ATOM   3391  H  HD11 . ILE A 1 14 ? -2.755  -7.362  0.707   1.00 0.00 ? 14  ILE A HD11 6  
ATOM   3392  H  HD12 . ILE A 1 14 ? -1.493  -7.525  1.928   1.00 0.00 ? 14  ILE A HD12 6  
ATOM   3393  H  HD13 . ILE A 1 14 ? -3.181  -7.802  2.360   1.00 0.00 ? 14  ILE A HD13 6  
ATOM   3394  N  N    . CYS A 1 15 ? 0.146   -2.230  1.893   1.00 0.00 ? 15  CYS A N    6  
ATOM   3395  C  CA   . CYS A 1 15 ? 1.289   -1.419  1.491   1.00 0.00 ? 15  CYS A CA   6  
ATOM   3396  C  C    . CYS A 1 15 ? 2.414   -2.296  0.948   1.00 0.00 ? 15  CYS A C    6  
ATOM   3397  O  O    . CYS A 1 15 ? 3.294   -2.726  1.693   1.00 0.00 ? 15  CYS A O    6  
ATOM   3398  C  CB   . CYS A 1 15 ? 1.797   -0.592  2.674   1.00 0.00 ? 15  CYS A CB   6  
ATOM   3399  S  SG   . CYS A 1 15 ? 3.044   0.657   2.226   1.00 0.00 ? 15  CYS A SG   6  
ATOM   3400  H  H    . CYS A 1 15 ? 0.101   -2.567  2.813   1.00 0.00 ? 15  CYS A H    6  
ATOM   3401  H  HA   . CYS A 1 15 ? 0.962   -0.750  0.709   1.00 0.00 ? 15  CYS A HA   6  
ATOM   3402  H  HB2  . CYS A 1 15 ? 0.963   -0.076  3.126   1.00 0.00 ? 15  CYS A HB2  6  
ATOM   3403  H  HB3  . CYS A 1 15 ? 2.241   -1.255  3.402   1.00 0.00 ? 15  CYS A HB3  6  
ATOM   3404  N  N    . SER A 1 16 ? 2.378   -2.556  -0.355  1.00 0.00 ? 16  SER A N    6  
ATOM   3405  C  CA   . SER A 1 16 ? 3.392   -3.384  -0.997  1.00 0.00 ? 16  SER A CA   6  
ATOM   3406  C  C    . SER A 1 16 ? 4.787   -3.014  -0.505  1.00 0.00 ? 16  SER A C    6  
ATOM   3407  O  O    . SER A 1 16 ? 5.706   -3.831  -0.540  1.00 0.00 ? 16  SER A O    6  
ATOM   3408  C  CB   . SER A 1 16 ? 3.317   -3.231  -2.518  1.00 0.00 ? 16  SER A CB   6  
ATOM   3409  O  OG   . SER A 1 16 ? 4.480   -3.750  -3.140  1.00 0.00 ? 16  SER A OG   6  
ATOM   3410  H  H    . SER A 1 16 ? 1.650   -2.184  -0.896  1.00 0.00 ? 16  SER A H    6  
ATOM   3411  H  HA   . SER A 1 16 ? 3.193   -4.413  -0.738  1.00 0.00 ? 16  SER A HA   6  
ATOM   3412  H  HB2  . SER A 1 16 ? 2.456   -3.765  -2.889  1.00 0.00 ? 16  SER A HB2  6  
ATOM   3413  H  HB3  . SER A 1 16 ? 3.227   -2.183  -2.767  1.00 0.00 ? 16  SER A HB3  6  
ATOM   3414  H  HG   . SER A 1 16 ? 4.231   -4.232  -3.932  1.00 0.00 ? 16  SER A HG   6  
ATOM   3415  N  N    . GLU A 1 17 ? 4.937   -1.775  -0.047  1.00 0.00 ? 17  GLU A N    6  
ATOM   3416  C  CA   . GLU A 1 17 ? 6.221   -1.295  0.452   1.00 0.00 ? 17  GLU A CA   6  
ATOM   3417  C  C    . GLU A 1 17 ? 6.636   -2.056  1.707   1.00 0.00 ? 17  GLU A C    6  
ATOM   3418  O  O    . GLU A 1 17 ? 7.740   -2.595  1.785   1.00 0.00 ? 17  GLU A O    6  
ATOM   3419  C  CB   . GLU A 1 17 ? 6.149   0.204   0.751   1.00 0.00 ? 17  GLU A CB   6  
ATOM   3420  C  CG   . GLU A 1 17 ? 5.447   1.007   -0.330  1.00 0.00 ? 17  GLU A CG   6  
ATOM   3421  C  CD   . GLU A 1 17 ? 5.906   2.452   -0.375  1.00 0.00 ? 17  GLU A CD   6  
ATOM   3422  O  OE1  . GLU A 1 17 ? 7.129   2.681   -0.481  1.00 0.00 ? 17  GLU A OE1  6  
ATOM   3423  O  OE2  . GLU A 1 17 ? 5.044   3.352   -0.304  1.00 0.00 ? 17  GLU A OE2  6  
ATOM   3424  H  H    . GLU A 1 17 ? 4.167   -1.169  -0.045  1.00 0.00 ? 17  GLU A H    6  
ATOM   3425  H  HA   . GLU A 1 17 ? 6.959   -1.464  -0.317  1.00 0.00 ? 17  GLU A HA   6  
ATOM   3426  H  HB2  . GLU A 1 17 ? 5.619   0.348   1.681   1.00 0.00 ? 17  GLU A HB2  6  
ATOM   3427  H  HB3  . GLU A 1 17 ? 7.154   0.585   0.858   1.00 0.00 ? 17  GLU A HB3  6  
ATOM   3428  H  HG2  . GLU A 1 17 ? 5.648   0.552   -1.288  1.00 0.00 ? 17  GLU A HG2  6  
ATOM   3429  H  HG3  . GLU A 1 17 ? 4.383   0.989   -0.141  1.00 0.00 ? 17  GLU A HG3  6  
ATOM   3430  N  N    . CYS A 1 18 ? 5.742   -2.097  2.690   1.00 0.00 ? 18  CYS A N    6  
ATOM   3431  C  CA   . CYS A 1 18 ? 6.013   -2.790  3.943   1.00 0.00 ? 18  CYS A CA   6  
ATOM   3432  C  C    . CYS A 1 18 ? 5.085   -3.990  4.113   1.00 0.00 ? 18  CYS A C    6  
ATOM   3433  O  O    . CYS A 1 18 ? 5.533   -5.098  4.405   1.00 0.00 ? 18  CYS A O    6  
ATOM   3434  C  CB   . CYS A 1 18 ? 5.849   -1.833  5.126   1.00 0.00 ? 18  CYS A CB   6  
ATOM   3435  S  SG   . CYS A 1 18 ? 4.241   -0.979  5.174   1.00 0.00 ? 18  CYS A SG   6  
ATOM   3436  H  H    . CYS A 1 18 ? 4.878   -1.648  2.569   1.00 0.00 ? 18  CYS A H    6  
ATOM   3437  H  HA   . CYS A 1 18 ? 7.033   -3.141  3.914   1.00 0.00 ? 18  CYS A HA   6  
ATOM   3438  H  HB2  . CYS A 1 18 ? 5.952   -2.390  6.046   1.00 0.00 ? 18  CYS A HB2  6  
ATOM   3439  H  HB3  . CYS A 1 18 ? 6.621   -1.080  5.079   1.00 0.00 ? 18  CYS A HB3  6  
ATOM   3440  N  N    . GLY A 1 19 ? 3.789   -3.759  3.927   1.00 0.00 ? 19  GLY A N    6  
ATOM   3441  C  CA   . GLY A 1 19 ? 2.818   -4.830  4.064   1.00 0.00 ? 19  GLY A CA   6  
ATOM   3442  C  C    . GLY A 1 19 ? 1.765   -4.527  5.111   1.00 0.00 ? 19  GLY A C    6  
ATOM   3443  O  O    . GLY A 1 19 ? 1.247   -5.435  5.762   1.00 0.00 ? 19  GLY A O    6  
ATOM   3444  H  H    . GLY A 1 19 ? 3.489   -2.855  3.696   1.00 0.00 ? 19  GLY A H    6  
ATOM   3445  H  HA2  . GLY A 1 19 ? 2.331   -4.983  3.112   1.00 0.00 ? 19  GLY A HA2  6  
ATOM   3446  H  HA3  . GLY A 1 19 ? 3.336   -5.736  4.341   1.00 0.00 ? 19  GLY A HA3  6  
ATOM   3447  N  N    . LYS A 1 20 ? 1.448   -3.248  5.277   1.00 0.00 ? 20  LYS A N    6  
ATOM   3448  C  CA   . LYS A 1 20 ? 0.451   -2.826  6.254   1.00 0.00 ? 20  LYS A CA   6  
ATOM   3449  C  C    . LYS A 1 20 ? -0.911  -2.636  5.593   1.00 0.00 ? 20  LYS A C    6  
ATOM   3450  O  O    . LYS A 1 20 ? -1.042  -1.890  4.623   1.00 0.00 ? 20  LYS A O    6  
ATOM   3451  C  CB   . LYS A 1 20 ? 0.887   -1.525  6.931   1.00 0.00 ? 20  LYS A CB   6  
ATOM   3452  C  CG   . LYS A 1 20 ? 0.322   -1.348  8.329   1.00 0.00 ? 20  LYS A CG   6  
ATOM   3453  C  CD   . LYS A 1 20 ? 0.934   -0.146  9.029   1.00 0.00 ? 20  LYS A CD   6  
ATOM   3454  C  CE   . LYS A 1 20 ? 0.139   0.242   10.267  1.00 0.00 ? 20  LYS A CE   6  
ATOM   3455  N  NZ   . LYS A 1 20 ? 1.002   0.869   11.306  1.00 0.00 ? 20  LYS A NZ   6  
ATOM   3456  H  H    . LYS A 1 20 ? 1.896   -2.570  4.728   1.00 0.00 ? 20  LYS A H    6  
ATOM   3457  H  HA   . LYS A 1 20 ? 0.370   -3.601  7.001   1.00 0.00 ? 20  LYS A HA   6  
ATOM   3458  H  HB2  . LYS A 1 20 ? 1.965   -1.512  6.996   1.00 0.00 ? 20  LYS A HB2  6  
ATOM   3459  H  HB3  . LYS A 1 20 ? 0.562   -0.692  6.325   1.00 0.00 ? 20  LYS A HB3  6  
ATOM   3460  H  HG2  . LYS A 1 20 ? -0.746  -1.206  8.261   1.00 0.00 ? 20  LYS A HG2  6  
ATOM   3461  H  HG3  . LYS A 1 20 ? 0.533   -2.236  8.908   1.00 0.00 ? 20  LYS A HG3  6  
ATOM   3462  H  HD2  . LYS A 1 20 ? 1.944   -0.388  9.326   1.00 0.00 ? 20  LYS A HD2  6  
ATOM   3463  H  HD3  . LYS A 1 20 ? 0.948   0.690   8.345   1.00 0.00 ? 20  LYS A HD3  6  
ATOM   3464  H  HE2  . LYS A 1 20 ? -0.630  0.942   9.980   1.00 0.00 ? 20  LYS A HE2  6  
ATOM   3465  H  HE3  . LYS A 1 20 ? -0.318  -0.646  10.678  1.00 0.00 ? 20  LYS A HE3  6  
ATOM   3466  H  HZ1  . LYS A 1 20 ? 1.914   1.149   10.893  1.00 0.00 ? 20  LYS A HZ1  6  
ATOM   3467  H  HZ2  . LYS A 1 20 ? 1.176   0.195   12.080  1.00 0.00 ? 20  LYS A HZ2  6  
ATOM   3468  H  HZ3  . LYS A 1 20 ? 0.536   1.713   11.696  1.00 0.00 ? 20  LYS A HZ3  6  
ATOM   3469  N  N    . VAL A 1 21 ? -1.922  -3.314  6.126   1.00 0.00 ? 21  VAL A N    6  
ATOM   3470  C  CA   . VAL A 1 21 ? -3.274  -3.218  5.589   1.00 0.00 ? 21  VAL A CA   6  
ATOM   3471  C  C    . VAL A 1 21 ? -4.053  -2.093  6.262   1.00 0.00 ? 21  VAL A C    6  
ATOM   3472  O  O    . VAL A 1 21 ? -3.970  -1.904  7.476   1.00 0.00 ? 21  VAL A O    6  
ATOM   3473  C  CB   . VAL A 1 21 ? -4.045  -4.539  5.769   1.00 0.00 ? 21  VAL A CB   6  
ATOM   3474  C  CG1  . VAL A 1 21 ? -4.182  -4.882  7.244   1.00 0.00 ? 21  VAL A CG1  6  
ATOM   3475  C  CG2  . VAL A 1 21 ? -5.411  -4.453  5.104   1.00 0.00 ? 21  VAL A CG2  6  
ATOM   3476  H  H    . VAL A 1 21 ? -1.755  -3.893  6.899   1.00 0.00 ? 21  VAL A H    6  
ATOM   3477  H  HA   . VAL A 1 21 ? -3.200  -3.009  4.532   1.00 0.00 ? 21  VAL A HA   6  
ATOM   3478  H  HB   . VAL A 1 21 ? -3.484  -5.328  5.289   1.00 0.00 ? 21  VAL A HB   6  
ATOM   3479  H  HG11 . VAL A 1 21 ? -4.903  -4.221  7.702   1.00 0.00 ? 21  VAL A HG11 6  
ATOM   3480  H  HG12 . VAL A 1 21 ? -4.513  -5.905  7.347   1.00 0.00 ? 21  VAL A HG12 6  
ATOM   3481  H  HG13 . VAL A 1 21 ? -3.225  -4.762  7.731   1.00 0.00 ? 21  VAL A HG13 6  
ATOM   3482  H  HG21 . VAL A 1 21 ? -5.452  -3.575  4.477   1.00 0.00 ? 21  VAL A HG21 6  
ATOM   3483  H  HG22 . VAL A 1 21 ? -5.573  -5.335  4.502   1.00 0.00 ? 21  VAL A HG22 6  
ATOM   3484  H  HG23 . VAL A 1 21 ? -6.178  -4.390  5.863   1.00 0.00 ? 21  VAL A HG23 6  
ATOM   3485  N  N    . PHE A 1 22 ? -4.811  -1.347  5.465   1.00 0.00 ? 22  PHE A N    6  
ATOM   3486  C  CA   . PHE A 1 22 ? -5.606  -0.239  5.983   1.00 0.00 ? 22  PHE A CA   6  
ATOM   3487  C  C    . PHE A 1 22 ? -7.062  -0.363  5.545   1.00 0.00 ? 22  PHE A C    6  
ATOM   3488  O  O    . PHE A 1 22 ? -7.360  -0.911  4.482   1.00 0.00 ? 22  PHE A O    6  
ATOM   3489  C  CB   . PHE A 1 22 ? -5.030  1.096   5.506   1.00 0.00 ? 22  PHE A CB   6  
ATOM   3490  C  CG   . PHE A 1 22 ? -3.590  1.297   5.884   1.00 0.00 ? 22  PHE A CG   6  
ATOM   3491  C  CD1  . PHE A 1 22 ? -2.576  0.729   5.131   1.00 0.00 ? 22  PHE A CD1  6  
ATOM   3492  C  CD2  . PHE A 1 22 ? -3.252  2.055   6.994   1.00 0.00 ? 22  PHE A CD2  6  
ATOM   3493  C  CE1  . PHE A 1 22 ? -1.251  0.912   5.478   1.00 0.00 ? 22  PHE A CE1  6  
ATOM   3494  C  CE2  . PHE A 1 22 ? -1.928  2.242   7.345   1.00 0.00 ? 22  PHE A CE2  6  
ATOM   3495  C  CZ   . PHE A 1 22 ? -0.926  1.671   6.586   1.00 0.00 ? 22  PHE A CZ   6  
ATOM   3496  H  H    . PHE A 1 22 ? -4.837  -1.546  4.505   1.00 0.00 ? 22  PHE A H    6  
ATOM   3497  H  HA   . PHE A 1 22 ? -5.562  -0.276  7.060   1.00 0.00 ? 22  PHE A HA   6  
ATOM   3498  H  HB2  . PHE A 1 22 ? -5.099  1.146   4.429   1.00 0.00 ? 22  PHE A HB2  6  
ATOM   3499  H  HB3  . PHE A 1 22 ? -5.604  1.902   5.937   1.00 0.00 ? 22  PHE A HB3  6  
ATOM   3500  H  HD1  . PHE A 1 22 ? -2.828  0.136   4.264   1.00 0.00 ? 22  PHE A HD1  6  
ATOM   3501  H  HD2  . PHE A 1 22 ? -4.035  2.503   7.589   1.00 0.00 ? 22  PHE A HD2  6  
ATOM   3502  H  HE1  . PHE A 1 22 ? -0.469  0.464   4.882   1.00 0.00 ? 22  PHE A HE1  6  
ATOM   3503  H  HE2  . PHE A 1 22 ? -1.678  2.836   8.212   1.00 0.00 ? 22  PHE A HE2  6  
ATOM   3504  H  HZ   . PHE A 1 22 ? 0.108   1.815   6.859   1.00 0.00 ? 22  PHE A HZ   6  
ATOM   3505  N  N    . THR A 1 23 ? -7.968  0.150   6.372   1.00 0.00 ? 23  THR A N    6  
ATOM   3506  C  CA   . THR A 1 23 ? -9.394  0.095   6.072   1.00 0.00 ? 23  THR A CA   6  
ATOM   3507  C  C    . THR A 1 23 ? -9.794  1.200   5.101   1.00 0.00 ? 23  THR A C    6  
ATOM   3508  O  O    . THR A 1 23 ? -10.600 0.983   4.196   1.00 0.00 ? 23  THR A O    6  
ATOM   3509  C  CB   . THR A 1 23 ? -10.242 0.221   7.352   1.00 0.00 ? 23  THR A CB   6  
ATOM   3510  O  OG1  . THR A 1 23 ? -9.777  -0.705  8.340   1.00 0.00 ? 23  THR A OG1  6  
ATOM   3511  C  CG2  . THR A 1 23 ? -11.711 -0.041  7.056   1.00 0.00 ? 23  THR A CG2  6  
ATOM   3512  H  H    . THR A 1 23 ? -7.669  0.573   7.203   1.00 0.00 ? 23  THR A H    6  
ATOM   3513  H  HA   . THR A 1 23 ? -9.603  -0.863  5.619   1.00 0.00 ? 23  THR A HA   6  
ATOM   3514  H  HB   . THR A 1 23 ? -10.141 1.226   7.735   1.00 0.00 ? 23  THR A HB   6  
ATOM   3515  H  HG1  . THR A 1 23 ? -10.238 -1.541  8.238   1.00 0.00 ? 23  THR A HG1  6  
ATOM   3516  H  HG21 . THR A 1 23 ? -11.797 -0.877  6.377   1.00 0.00 ? 23  THR A HG21 6  
ATOM   3517  H  HG22 . THR A 1 23 ? -12.149 0.836   6.603   1.00 0.00 ? 23  THR A HG22 6  
ATOM   3518  H  HG23 . THR A 1 23 ? -12.228 -0.269  7.975   1.00 0.00 ? 23  THR A HG23 6  
ATOM   3519  N  N    . HIS A 1 24 ? -9.225  2.386   5.293   1.00 0.00 ? 24  HIS A N    6  
ATOM   3520  C  CA   . HIS A 1 24 ? -9.522  3.525   4.432   1.00 0.00 ? 24  HIS A CA   6  
ATOM   3521  C  C    . HIS A 1 24 ? -8.422  3.723   3.394   1.00 0.00 ? 24  HIS A C    6  
ATOM   3522  O  O    . HIS A 1 24 ? -7.241  3.810   3.733   1.00 0.00 ? 24  HIS A O    6  
ATOM   3523  C  CB   . HIS A 1 24 ? -9.683  4.795   5.269   1.00 0.00 ? 24  HIS A CB   6  
ATOM   3524  C  CG   . HIS A 1 24 ? -10.641 5.783   4.678   1.00 0.00 ? 24  HIS A CG   6  
ATOM   3525  N  ND1  . HIS A 1 24 ? -10.248 6.801   3.835   1.00 0.00 ? 24  HIS A ND1  6  
ATOM   3526  C  CD2  . HIS A 1 24 ? -11.983 5.904   4.812   1.00 0.00 ? 24  HIS A CD2  6  
ATOM   3527  C  CE1  . HIS A 1 24 ? -11.306 7.507   3.477   1.00 0.00 ? 24  HIS A CE1  6  
ATOM   3528  N  NE2  . HIS A 1 24 ? -12.372 6.983   4.056   1.00 0.00 ? 24  HIS A NE2  6  
ATOM   3529  H  H    . HIS A 1 24 ? -8.590  2.497   6.032   1.00 0.00 ? 24  HIS A H    6  
ATOM   3530  H  HA   . HIS A 1 24 ? -10.450 3.321   3.921   1.00 0.00 ? 24  HIS A HA   6  
ATOM   3531  H  HB2  . HIS A 1 24 ? -10.046 4.528   6.250   1.00 0.00 ? 24  HIS A HB2  6  
ATOM   3532  H  HB3  . HIS A 1 24 ? -8.723  5.280   5.365   1.00 0.00 ? 24  HIS A HB3  6  
ATOM   3533  H  HD1  . HIS A 1 24 ? -9.330  6.981   3.544   1.00 0.00 ? 24  HIS A HD1  6  
ATOM   3534  H  HD2  . HIS A 1 24 ? -12.629 5.271   5.403   1.00 0.00 ? 24  HIS A HD2  6  
ATOM   3535  H  HE1  . HIS A 1 24 ? -11.302 8.365   2.823   1.00 0.00 ? 24  HIS A HE1  6  
ATOM   3536  N  N    . LYS A 1 25 ? -8.816  3.791   2.127   1.00 0.00 ? 25  LYS A N    6  
ATOM   3537  C  CA   . LYS A 1 25 ? -7.865  3.979   1.038   1.00 0.00 ? 25  LYS A CA   6  
ATOM   3538  C  C    . LYS A 1 25 ? -6.971  5.187   1.299   1.00 0.00 ? 25  LYS A C    6  
ATOM   3539  O  O    . LYS A 1 25 ? -5.795  5.193   0.932   1.00 0.00 ? 25  LYS A O    6  
ATOM   3540  C  CB   . LYS A 1 25 ? -8.606  4.157   -0.289  1.00 0.00 ? 25  LYS A CB   6  
ATOM   3541  C  CG   . LYS A 1 25 ? -7.690  4.466   -1.461  1.00 0.00 ? 25  LYS A CG   6  
ATOM   3542  C  CD   . LYS A 1 25 ? -8.401  4.275   -2.790  1.00 0.00 ? 25  LYS A CD   6  
ATOM   3543  C  CE   . LYS A 1 25 ? -8.317  2.833   -3.265  1.00 0.00 ? 25  LYS A CE   6  
ATOM   3544  N  NZ   . LYS A 1 25 ? -6.961  2.496   -3.778  1.00 0.00 ? 25  LYS A NZ   6  
ATOM   3545  H  H    . LYS A 1 25 ? -9.772  3.715   1.919   1.00 0.00 ? 25  LYS A H    6  
ATOM   3546  H  HA   . LYS A 1 25 ? -7.248  3.095   0.980   1.00 0.00 ? 25  LYS A HA   6  
ATOM   3547  H  HB2  . LYS A 1 25 ? -9.146  3.248   -0.511  1.00 0.00 ? 25  LYS A HB2  6  
ATOM   3548  H  HB3  . LYS A 1 25 ? -9.312  4.968   -0.187  1.00 0.00 ? 25  LYS A HB3  6  
ATOM   3549  H  HG2  . LYS A 1 25 ? -7.359  5.491   -1.386  1.00 0.00 ? 25  LYS A HG2  6  
ATOM   3550  H  HG3  . LYS A 1 25 ? -6.836  3.806   -1.422  1.00 0.00 ? 25  LYS A HG3  6  
ATOM   3551  H  HD2  . LYS A 1 25 ? -9.441  4.544   -2.674  1.00 0.00 ? 25  LYS A HD2  6  
ATOM   3552  H  HD3  . LYS A 1 25 ? -7.942  4.916   -3.529  1.00 0.00 ? 25  LYS A HD3  6  
ATOM   3553  H  HE2  . LYS A 1 25 ? -8.552  2.181   -2.437  1.00 0.00 ? 25  LYS A HE2  6  
ATOM   3554  H  HE3  . LYS A 1 25 ? -9.039  2.686   -4.055  1.00 0.00 ? 25  LYS A HE3  6  
ATOM   3555  H  HZ1  . LYS A 1 25 ? -6.368  3.350   -3.809  1.00 0.00 ? 25  LYS A HZ1  6  
ATOM   3556  H  HZ2  . LYS A 1 25 ? -7.030  2.099   -4.736  1.00 0.00 ? 25  LYS A HZ2  6  
ATOM   3557  H  HZ3  . LYS A 1 25 ? -6.508  1.795   -3.157  1.00 0.00 ? 25  LYS A HZ3  6  
ATOM   3558  N  N    . THR A 1 26 ? -7.534  6.209   1.935   1.00 0.00 ? 26  THR A N    6  
ATOM   3559  C  CA   . THR A 1 26 ? -6.788  7.421   2.245   1.00 0.00 ? 26  THR A CA   6  
ATOM   3560  C  C    . THR A 1 26 ? -5.786  7.178   3.368   1.00 0.00 ? 26  THR A C    6  
ATOM   3561  O  O    . THR A 1 26 ? -4.651  7.651   3.313   1.00 0.00 ? 26  THR A O    6  
ATOM   3562  C  CB   . THR A 1 26 ? -7.729  8.571   2.652   1.00 0.00 ? 26  THR A CB   6  
ATOM   3563  O  OG1  . THR A 1 26 ? -8.879  8.588   1.800   1.00 0.00 ? 26  THR A OG1  6  
ATOM   3564  C  CG2  . THR A 1 26 ? -7.012  9.911   2.571   1.00 0.00 ? 26  THR A CG2  6  
ATOM   3565  H  H    . THR A 1 26 ? -8.475  6.144   2.202   1.00 0.00 ? 26  THR A H    6  
ATOM   3566  H  HA   . THR A 1 26 ? -6.252  7.720   1.356   1.00 0.00 ? 26  THR A HA   6  
ATOM   3567  H  HB   . THR A 1 26 ? -8.048  8.412   3.672   1.00 0.00 ? 26  THR A HB   6  
ATOM   3568  H  HG1  . THR A 1 26 ? -9.232  9.480   1.754   1.00 0.00 ? 26  THR A HG1  6  
ATOM   3569  H  HG21 . THR A 1 26 ? -7.734  10.694  2.391   1.00 0.00 ? 26  THR A HG21 6  
ATOM   3570  H  HG22 . THR A 1 26 ? -6.297  9.888   1.762   1.00 0.00 ? 26  THR A HG22 6  
ATOM   3571  H  HG23 . THR A 1 26 ? -6.498  10.101  3.501   1.00 0.00 ? 26  THR A HG23 6  
ATOM   3572  N  N    . ASN A 1 27 ? -6.213  6.438   4.386   1.00 0.00 ? 27  ASN A N    6  
ATOM   3573  C  CA   . ASN A 1 27 ? -5.352  6.132   5.523   1.00 0.00 ? 27  ASN A CA   6  
ATOM   3574  C  C    . ASN A 1 27 ? -4.041  5.504   5.059   1.00 0.00 ? 27  ASN A C    6  
ATOM   3575  O  O    . ASN A 1 27 ? -2.970  5.820   5.577   1.00 0.00 ? 27  ASN A O    6  
ATOM   3576  C  CB   . ASN A 1 27 ? -6.067  5.190   6.492   1.00 0.00 ? 27  ASN A CB   6  
ATOM   3577  C  CG   . ASN A 1 27 ? -6.878  5.938   7.533   1.00 0.00 ? 27  ASN A CG   6  
ATOM   3578  O  OD1  . ASN A 1 27 ? -7.151  7.129   7.385   1.00 0.00 ? 27  ASN A OD1  6  
ATOM   3579  N  ND2  . ASN A 1 27 ? -7.265  5.240   8.594   1.00 0.00 ? 27  ASN A ND2  6  
ATOM   3580  H  H    . ASN A 1 27 ? -7.128  6.089   4.373   1.00 0.00 ? 27  ASN A H    6  
ATOM   3581  H  HA   . ASN A 1 27 ? -5.133  7.059   6.031   1.00 0.00 ? 27  ASN A HA   6  
ATOM   3582  H  HB2  . ASN A 1 27 ? -6.736  4.550   5.935   1.00 0.00 ? 27  ASN A HB2  6  
ATOM   3583  H  HB3  . ASN A 1 27 ? -5.335  4.582   7.001   1.00 0.00 ? 27  ASN A HB3  6  
ATOM   3584  H  HD21 . ASN A 1 27 ? -7.011  4.294   8.646   1.00 0.00 ? 27  ASN A HD21 6  
ATOM   3585  H  HD22 . ASN A 1 27 ? -7.791  5.698   9.283   1.00 0.00 ? 27  ASN A HD22 6  
ATOM   3586  N  N    . LEU A 1 28 ? -4.134  4.612   4.078   1.00 0.00 ? 28  LEU A N    6  
ATOM   3587  C  CA   . LEU A 1 28 ? -2.956  3.938   3.543   1.00 0.00 ? 28  LEU A CA   6  
ATOM   3588  C  C    . LEU A 1 28 ? -2.015  4.936   2.875   1.00 0.00 ? 28  LEU A C    6  
ATOM   3589  O  O    . LEU A 1 28 ? -0.811  4.938   3.135   1.00 0.00 ? 28  LEU A O    6  
ATOM   3590  C  CB   . LEU A 1 28 ? -3.372  2.862   2.539   1.00 0.00 ? 28  LEU A CB   6  
ATOM   3591  C  CG   . LEU A 1 28 ? -2.292  2.406   1.557   1.00 0.00 ? 28  LEU A CG   6  
ATOM   3592  C  CD1  . LEU A 1 28 ? -1.183  1.667   2.290   1.00 0.00 ? 28  LEU A CD1  6  
ATOM   3593  C  CD2  . LEU A 1 28 ? -2.895  1.526   0.472   1.00 0.00 ? 28  LEU A CD2  6  
ATOM   3594  H  H    . LEU A 1 28 ? -5.015  4.401   3.705   1.00 0.00 ? 28  LEU A H    6  
ATOM   3595  H  HA   . LEU A 1 28 ? -2.439  3.470   4.367   1.00 0.00 ? 28  LEU A HA   6  
ATOM   3596  H  HB2  . LEU A 1 28 ? -3.697  1.997   3.097   1.00 0.00 ? 28  LEU A HB2  6  
ATOM   3597  H  HB3  . LEU A 1 28 ? -4.201  3.250   1.964   1.00 0.00 ? 28  LEU A HB3  6  
ATOM   3598  H  HG   . LEU A 1 28 ? -1.856  3.274   1.082   1.00 0.00 ? 28  LEU A HG   6  
ATOM   3599  H  HD11 . LEU A 1 28 ? -0.269  1.733   1.719   1.00 0.00 ? 28  LEU A HD11 6  
ATOM   3600  H  HD12 . LEU A 1 28 ? -1.459  0.630   2.409   1.00 0.00 ? 28  LEU A HD12 6  
ATOM   3601  H  HD13 . LEU A 1 28 ? -1.034  2.113   3.262   1.00 0.00 ? 28  LEU A HD13 6  
ATOM   3602  H  HD21 . LEU A 1 28 ? -2.213  1.468   -0.364  1.00 0.00 ? 28  LEU A HD21 6  
ATOM   3603  H  HD22 . LEU A 1 28 ? -3.832  1.951   0.144   1.00 0.00 ? 28  LEU A HD22 6  
ATOM   3604  H  HD23 . LEU A 1 28 ? -3.068  0.535   0.866   1.00 0.00 ? 28  LEU A HD23 6  
ATOM   3605  N  N    . ILE A 1 29 ? -2.571  5.783   2.016   1.00 0.00 ? 29  ILE A N    6  
ATOM   3606  C  CA   . ILE A 1 29 ? -1.782  6.787   1.314   1.00 0.00 ? 29  ILE A CA   6  
ATOM   3607  C  C    . ILE A 1 29 ? -1.006  7.660   2.294   1.00 0.00 ? 29  ILE A C    6  
ATOM   3608  O  O    . ILE A 1 29 ? 0.186   7.908   2.111   1.00 0.00 ? 29  ILE A O    6  
ATOM   3609  C  CB   . ILE A 1 29 ? -2.670  7.687   0.434   1.00 0.00 ? 29  ILE A CB   6  
ATOM   3610  C  CG1  . ILE A 1 29 ? -3.296  6.871   -0.699  1.00 0.00 ? 29  ILE A CG1  6  
ATOM   3611  C  CG2  . ILE A 1 29 ? -1.859  8.846   -0.125  1.00 0.00 ? 29  ILE A CG2  6  
ATOM   3612  C  CD1  . ILE A 1 29 ? -4.418  7.591   -1.414  1.00 0.00 ? 29  ILE A CD1  6  
ATOM   3613  H  H    . ILE A 1 29 ? -3.536  5.731   1.851   1.00 0.00 ? 29  ILE A H    6  
ATOM   3614  H  HA   . ILE A 1 29 ? -1.080  6.272   0.674   1.00 0.00 ? 29  ILE A HA   6  
ATOM   3615  H  HB   . ILE A 1 29 ? -3.456  8.094   1.052   1.00 0.00 ? 29  ILE A HB   6  
ATOM   3616  H  HG12 . ILE A 1 29 ? -2.536  6.637   -1.428  1.00 0.00 ? 29  ILE A HG12 6  
ATOM   3617  H  HG13 . ILE A 1 29 ? -3.695  5.953   -0.294  1.00 0.00 ? 29  ILE A HG13 6  
ATOM   3618  H  HG21 . ILE A 1 29 ? -1.356  9.356   0.683   1.00 0.00 ? 29  ILE A HG21 6  
ATOM   3619  H  HG22 . ILE A 1 29 ? -1.127  8.469   -0.823  1.00 0.00 ? 29  ILE A HG22 6  
ATOM   3620  H  HG23 . ILE A 1 29 ? -2.518  9.536   -0.632  1.00 0.00 ? 29  ILE A HG23 6  
ATOM   3621  H  HD11 . ILE A 1 29 ? -5.150  6.871   -1.752  1.00 0.00 ? 29  ILE A HD11 6  
ATOM   3622  H  HD12 . ILE A 1 29 ? -4.888  8.289   -0.736  1.00 0.00 ? 29  ILE A HD12 6  
ATOM   3623  H  HD13 . ILE A 1 29 ? -4.020  8.125   -2.263  1.00 0.00 ? 29  ILE A HD13 6  
ATOM   3624  N  N    . ILE A 1 30 ? -1.690  8.123   3.335   1.00 0.00 ? 30  ILE A N    6  
ATOM   3625  C  CA   . ILE A 1 30 ? -1.064  8.966   4.346   1.00 0.00 ? 30  ILE A CA   6  
ATOM   3626  C  C    . ILE A 1 30 ? 0.111   8.253   5.006   1.00 0.00 ? 30  ILE A C    6  
ATOM   3627  O  O    . ILE A 1 30 ? 1.098   8.883   5.388   1.00 0.00 ? 30  ILE A O    6  
ATOM   3628  C  CB   . ILE A 1 30 ? -2.072  9.383   5.434   1.00 0.00 ? 30  ILE A CB   6  
ATOM   3629  C  CG1  . ILE A 1 30 ? -3.254  10.126  4.807   1.00 0.00 ? 30  ILE A CG1  6  
ATOM   3630  C  CG2  . ILE A 1 30 ? -1.391  10.250  6.482   1.00 0.00 ? 30  ILE A CG2  6  
ATOM   3631  C  CD1  . ILE A 1 30 ? -4.479  10.170  5.693   1.00 0.00 ? 30  ILE A CD1  6  
ATOM   3632  H  H    . ILE A 1 30 ? -2.638  7.891   3.426   1.00 0.00 ? 30  ILE A H    6  
ATOM   3633  H  HA   . ILE A 1 30 ? -0.702  9.859   3.858   1.00 0.00 ? 30  ILE A HA   6  
ATOM   3634  H  HB   . ILE A 1 30 ? -2.434  8.490   5.920   1.00 0.00 ? 30  ILE A HB   6  
ATOM   3635  H  HG12 . ILE A 1 30 ? -2.961  11.142  4.596   1.00 0.00 ? 30  ILE A HG12 6  
ATOM   3636  H  HG13 . ILE A 1 30 ? -3.528  9.635   3.884   1.00 0.00 ? 30  ILE A HG13 6  
ATOM   3637  H  HG21 . ILE A 1 30 ? -1.072  11.177  6.030   1.00 0.00 ? 30  ILE A HG21 6  
ATOM   3638  H  HG22 . ILE A 1 30 ? -2.086  10.461  7.281   1.00 0.00 ? 30  ILE A HG22 6  
ATOM   3639  H  HG23 . ILE A 1 30 ? -0.533  9.729   6.879   1.00 0.00 ? 30  ILE A HG23 6  
ATOM   3640  H  HD11 . ILE A 1 30 ? -4.347  9.491   6.523   1.00 0.00 ? 30  ILE A HD11 6  
ATOM   3641  H  HD12 . ILE A 1 30 ? -4.616  11.173  6.068   1.00 0.00 ? 30  ILE A HD12 6  
ATOM   3642  H  HD13 . ILE A 1 30 ? -5.347  9.875   5.123   1.00 0.00 ? 30  ILE A HD13 6  
ATOM   3643  N  N    . HIS A 1 31 ? 0.000   6.934   5.134   1.00 0.00 ? 31  HIS A N    6  
ATOM   3644  C  CA   . HIS A 1 31 ? 1.056   6.134   5.745   1.00 0.00 ? 31  HIS A CA   6  
ATOM   3645  C  C    . HIS A 1 31 ? 2.241   5.983   4.797   1.00 0.00 ? 31  HIS A C    6  
ATOM   3646  O  O    . HIS A 1 31 ? 3.361   6.378   5.121   1.00 0.00 ? 31  HIS A O    6  
ATOM   3647  C  CB   . HIS A 1 31 ? 0.520   4.756   6.134   1.00 0.00 ? 31  HIS A CB   6  
ATOM   3648  C  CG   . HIS A 1 31 ? 1.565   3.683   6.125   1.00 0.00 ? 31  HIS A CG   6  
ATOM   3649  N  ND1  . HIS A 1 31 ? 2.248   3.289   7.256   1.00 0.00 ? 31  HIS A ND1  6  
ATOM   3650  C  CD2  . HIS A 1 31 ? 2.041   2.919   5.114   1.00 0.00 ? 31  HIS A CD2  6  
ATOM   3651  C  CE1  . HIS A 1 31 ? 3.100   2.330   6.941   1.00 0.00 ? 31  HIS A CE1  6  
ATOM   3652  N  NE2  . HIS A 1 31 ? 2.994   2.087   5.647   1.00 0.00 ? 31  HIS A NE2  6  
ATOM   3653  H  H    . HIS A 1 31 ? -0.810  6.489   4.811   1.00 0.00 ? 31  HIS A H    6  
ATOM   3654  H  HA   . HIS A 1 31 ? 1.387   6.646   6.636   1.00 0.00 ? 31  HIS A HA   6  
ATOM   3655  H  HB2  . HIS A 1 31 ? 0.105   4.806   7.130   1.00 0.00 ? 31  HIS A HB2  6  
ATOM   3656  H  HB3  . HIS A 1 31 ? -0.257  4.470   5.439   1.00 0.00 ? 31  HIS A HB3  6  
ATOM   3657  H  HD1  . HIS A 1 31 ? 2.127   3.658   8.156   1.00 0.00 ? 31  HIS A HD1  6  
ATOM   3658  H  HD2  . HIS A 1 31 ? 1.730   2.957   4.080   1.00 0.00 ? 31  HIS A HD2  6  
ATOM   3659  H  HE1  . HIS A 1 31 ? 3.770   1.829   7.624   1.00 0.00 ? 31  HIS A HE1  6  
ATOM   3660  N  N    . GLN A 1 32 ? 1.986   5.409   3.625   1.00 0.00 ? 32  GLN A N    6  
ATOM   3661  C  CA   . GLN A 1 32 ? 3.033   5.205   2.631   1.00 0.00 ? 32  GLN A CA   6  
ATOM   3662  C  C    . GLN A 1 32 ? 4.023   6.366   2.637   1.00 0.00 ? 32  GLN A C    6  
ATOM   3663  O  O    . GLN A 1 32 ? 5.201   6.193   2.326   1.00 0.00 ? 32  GLN A O    6  
ATOM   3664  C  CB   . GLN A 1 32 ? 2.420   5.049   1.239   1.00 0.00 ? 32  GLN A CB   6  
ATOM   3665  C  CG   . GLN A 1 32 ? 1.700   3.725   1.036   1.00 0.00 ? 32  GLN A CG   6  
ATOM   3666  C  CD   . GLN A 1 32 ? 0.883   3.695   -0.241  1.00 0.00 ? 32  GLN A CD   6  
ATOM   3667  O  OE1  . GLN A 1 32 ? 0.373   4.722   -0.690  1.00 0.00 ? 32  GLN A OE1  6  
ATOM   3668  N  NE2  . GLN A 1 32 ? 0.754   2.513   -0.833  1.00 0.00 ? 32  GLN A NE2  6  
ATOM   3669  H  H    . GLN A 1 32 ? 1.073   5.116   3.425   1.00 0.00 ? 32  GLN A H    6  
ATOM   3670  H  HA   . GLN A 1 32 ? 3.560   4.299   2.886   1.00 0.00 ? 32  GLN A HA   6  
ATOM   3671  H  HB2  . GLN A 1 32 ? 1.711   5.848   1.078   1.00 0.00 ? 32  GLN A HB2  6  
ATOM   3672  H  HB3  . GLN A 1 32 ? 3.206   5.122   0.502   1.00 0.00 ? 32  GLN A HB3  6  
ATOM   3673  H  HG2  . GLN A 1 32 ? 2.433   2.934   0.994   1.00 0.00 ? 32  GLN A HG2  6  
ATOM   3674  H  HG3  . GLN A 1 32 ? 1.039   3.558   1.874   1.00 0.00 ? 32  GLN A HG3  6  
ATOM   3675  H  HE21 . GLN A 1 32 ? 1.188   1.738   -0.418  1.00 0.00 ? 32  GLN A HE21 6  
ATOM   3676  H  HE22 . GLN A 1 32 ? 0.231   2.465   -1.659  1.00 0.00 ? 32  GLN A HE22 6  
ATOM   3677  N  N    . LYS A 1 33 ? 3.535   7.550   2.990   1.00 0.00 ? 33  LYS A N    6  
ATOM   3678  C  CA   . LYS A 1 33 ? 4.376   8.741   3.037   1.00 0.00 ? 33  LYS A CA   6  
ATOM   3679  C  C    . LYS A 1 33 ? 5.676   8.460   3.784   1.00 0.00 ? 33  LYS A C    6  
ATOM   3680  O  O    . LYS A 1 33 ? 6.761   8.800   3.310   1.00 0.00 ? 33  LYS A O    6  
ATOM   3681  C  CB   . LYS A 1 33 ? 3.627   9.893   3.711   1.00 0.00 ? 33  LYS A CB   6  
ATOM   3682  C  CG   . LYS A 1 33 ? 2.344   10.284  2.999   1.00 0.00 ? 33  LYS A CG   6  
ATOM   3683  C  CD   . LYS A 1 33 ? 2.003   11.747  3.226   1.00 0.00 ? 33  LYS A CD   6  
ATOM   3684  C  CE   . LYS A 1 33 ? 0.889   12.210  2.299   1.00 0.00 ? 33  LYS A CE   6  
ATOM   3685  N  NZ   . LYS A 1 33 ? 0.298   13.502  2.746   1.00 0.00 ? 33  LYS A NZ   6  
ATOM   3686  H  H    . LYS A 1 33 ? 2.587   7.626   3.227   1.00 0.00 ? 33  LYS A H    6  
ATOM   3687  H  HA   . LYS A 1 33 ? 4.612   9.021   2.022   1.00 0.00 ? 33  LYS A HA   6  
ATOM   3688  H  HB2  . LYS A 1 33 ? 3.379   9.603   4.722   1.00 0.00 ? 33  LYS A HB2  6  
ATOM   3689  H  HB3  . LYS A 1 33 ? 4.274   10.758  3.742   1.00 0.00 ? 33  LYS A HB3  6  
ATOM   3690  H  HG2  . LYS A 1 33 ? 2.465   10.114  1.939   1.00 0.00 ? 33  LYS A HG2  6  
ATOM   3691  H  HG3  . LYS A 1 33 ? 1.535   9.672   3.373   1.00 0.00 ? 33  LYS A HG3  6  
ATOM   3692  H  HD2  . LYS A 1 33 ? 1.683   11.878  4.249   1.00 0.00 ? 33  LYS A HD2  6  
ATOM   3693  H  HD3  . LYS A 1 33 ? 2.884   12.345  3.043   1.00 0.00 ? 33  LYS A HD3  6  
ATOM   3694  H  HE2  . LYS A 1 33 ? 1.293   12.333  1.306   1.00 0.00 ? 33  LYS A HE2  6  
ATOM   3695  H  HE3  . LYS A 1 33 ? 0.116   11.456  2.282   1.00 0.00 ? 33  LYS A HE3  6  
ATOM   3696  H  HZ1  . LYS A 1 33 ? -0.726  13.395  2.890   1.00 0.00 ? 33  LYS A HZ1  6  
ATOM   3697  H  HZ2  . LYS A 1 33 ? 0.461   14.236  2.028   1.00 0.00 ? 33  LYS A HZ2  6  
ATOM   3698  H  HZ3  . LYS A 1 33 ? 0.734   13.804  3.640   1.00 0.00 ? 33  LYS A HZ3  6  
ATOM   3699  N  N    . ILE A 1 34 ? 5.559   7.837   4.952   1.00 0.00 ? 34  ILE A N    6  
ATOM   3700  C  CA   . ILE A 1 34 ? 6.726   7.509   5.762   1.00 0.00 ? 34  ILE A CA   6  
ATOM   3701  C  C    . ILE A 1 34 ? 7.839   6.913   4.907   1.00 0.00 ? 34  ILE A C    6  
ATOM   3702  O  O    . ILE A 1 34 ? 9.018   7.011   5.248   1.00 0.00 ? 34  ILE A O    6  
ATOM   3703  C  CB   . ILE A 1 34 ? 6.370   6.516   6.885   1.00 0.00 ? 34  ILE A CB   6  
ATOM   3704  C  CG1  . ILE A 1 34 ? 6.026   5.147   6.295   1.00 0.00 ? 34  ILE A CG1  6  
ATOM   3705  C  CG2  . ILE A 1 34 ? 5.211   7.048   7.715   1.00 0.00 ? 34  ILE A CG2  6  
ATOM   3706  C  CD1  . ILE A 1 34 ? 6.188   4.008   7.277   1.00 0.00 ? 34  ILE A CD1  6  
ATOM   3707  H  H    . ILE A 1 34 ? 4.668   7.592   5.276   1.00 0.00 ? 34  ILE A H    6  
ATOM   3708  H  HA   . ILE A 1 34 ? 7.084   8.422   6.216   1.00 0.00 ? 34  ILE A HA   6  
ATOM   3709  H  HB   . ILE A 1 34 ? 7.228   6.416   7.532   1.00 0.00 ? 34  ILE A HB   6  
ATOM   3710  H  HG12 . ILE A 1 34 ? 5.000   5.153   5.962   1.00 0.00 ? 34  ILE A HG12 6  
ATOM   3711  H  HG13 . ILE A 1 34 ? 6.673   4.954   5.452   1.00 0.00 ? 34  ILE A HG13 6  
ATOM   3712  H  HG21 . ILE A 1 34 ? 4.472   6.271   7.841   1.00 0.00 ? 34  ILE A HG21 6  
ATOM   3713  H  HG22 . ILE A 1 34 ? 5.575   7.359   8.683   1.00 0.00 ? 34  ILE A HG22 6  
ATOM   3714  H  HG23 . ILE A 1 34 ? 4.764   7.891   7.210   1.00 0.00 ? 34  ILE A HG23 6  
ATOM   3715  H  HD11 . ILE A 1 34 ? 6.789   3.230   6.829   1.00 0.00 ? 34  ILE A HD11 6  
ATOM   3716  H  HD12 . ILE A 1 34 ? 6.677   4.369   8.170   1.00 0.00 ? 34  ILE A HD12 6  
ATOM   3717  H  HD13 . ILE A 1 34 ? 5.218   3.610   7.532   1.00 0.00 ? 34  ILE A HD13 6  
ATOM   3718  N  N    . HIS A 1 35 ? 7.457   6.298   3.792   1.00 0.00 ? 35  HIS A N    6  
ATOM   3719  C  CA   . HIS A 1 35 ? 8.423   5.688   2.886   1.00 0.00 ? 35  HIS A CA   6  
ATOM   3720  C  C    . HIS A 1 35 ? 9.132   6.752   2.052   1.00 0.00 ? 35  HIS A C    6  
ATOM   3721  O  O    . HIS A 1 35 ? 10.333  6.658   1.796   1.00 0.00 ? 35  HIS A O    6  
ATOM   3722  C  CB   . HIS A 1 35 ? 7.728   4.683   1.967   1.00 0.00 ? 35  HIS A CB   6  
ATOM   3723  C  CG   . HIS A 1 35 ? 7.118   3.527   2.697   1.00 0.00 ? 35  HIS A CG   6  
ATOM   3724  N  ND1  . HIS A 1 35 ? 7.780   2.823   3.681   1.00 0.00 ? 35  HIS A ND1  6  
ATOM   3725  C  CD2  . HIS A 1 35 ? 5.897   2.953   2.583   1.00 0.00 ? 35  HIS A CD2  6  
ATOM   3726  C  CE1  . HIS A 1 35 ? 6.994   1.866   4.139   1.00 0.00 ? 35  HIS A CE1  6  
ATOM   3727  N  NE2  . HIS A 1 35 ? 5.845   1.923   3.490   1.00 0.00 ? 35  HIS A NE2  6  
ATOM   3728  H  H    . HIS A 1 35 ? 6.502   6.253   3.575   1.00 0.00 ? 35  HIS A H    6  
ATOM   3729  H  HA   . HIS A 1 35 ? 9.157   5.169   3.483   1.00 0.00 ? 35  HIS A HA   6  
ATOM   3730  H  HB2  . HIS A 1 35 ? 6.941   5.185   1.424   1.00 0.00 ? 35  HIS A HB2  6  
ATOM   3731  H  HB3  . HIS A 1 35 ? 8.449   4.290   1.264   1.00 0.00 ? 35  HIS A HB3  6  
ATOM   3732  H  HD1  . HIS A 1 35 ? 8.691   2.999   3.995   1.00 0.00 ? 35  HIS A HD1  6  
ATOM   3733  H  HD2  . HIS A 1 35 ? 5.109   3.250   1.905   1.00 0.00 ? 35  HIS A HD2  6  
ATOM   3734  H  HE1  . HIS A 1 35 ? 7.246   1.157   4.913   1.00 0.00 ? 35  HIS A HE1  6  
ATOM   3735  N  N    . THR A 1 36 ? 8.380   7.765   1.631   1.00 0.00 ? 36  THR A N    6  
ATOM   3736  C  CA   . THR A 1 36 ? 8.936   8.845   0.825   1.00 0.00 ? 36  THR A CA   6  
ATOM   3737  C  C    . THR A 1 36 ? 10.341  9.210   1.289   1.00 0.00 ? 36  THR A C    6  
ATOM   3738  O  O    . THR A 1 36 ? 10.695  9.005   2.449   1.00 0.00 ? 36  THR A O    6  
ATOM   3739  C  CB   . THR A 1 36 ? 8.046   10.101  0.880   1.00 0.00 ? 36  THR A CB   6  
ATOM   3740  O  OG1  . THR A 1 36 ? 8.457   11.036  -0.124  1.00 0.00 ? 36  THR A OG1  6  
ATOM   3741  C  CG2  . THR A 1 36 ? 8.119   10.756  2.251   1.00 0.00 ? 36  THR A CG2  6  
ATOM   3742  H  H    . THR A 1 36 ? 7.430   7.784   1.867   1.00 0.00 ? 36  THR A H    6  
ATOM   3743  H  HA   . THR A 1 36 ? 8.982   8.506   -0.200  1.00 0.00 ? 36  THR A HA   6  
ATOM   3744  H  HB   . THR A 1 36 ? 7.023   9.808   0.691   1.00 0.00 ? 36  THR A HB   6  
ATOM   3745  H  HG1  . THR A 1 36 ? 7.682   11.450  -0.512  1.00 0.00 ? 36  THR A HG1  6  
ATOM   3746  H  HG21 . THR A 1 36 ? 8.560   10.067  2.955   1.00 0.00 ? 36  THR A HG21 6  
ATOM   3747  H  HG22 . THR A 1 36 ? 7.123   11.016  2.578   1.00 0.00 ? 36  THR A HG22 6  
ATOM   3748  H  HG23 . THR A 1 36 ? 8.723   11.648  2.192   1.00 0.00 ? 36  THR A HG23 6  
ATOM   3749  N  N    . GLY A 1 37 ? 11.138  9.754   0.374   1.00 0.00 ? 37  GLY A N    6  
ATOM   3750  C  CA   . GLY A 1 37 ? 12.496  10.141  0.710   1.00 0.00 ? 37  GLY A CA   6  
ATOM   3751  C  C    . GLY A 1 37 ? 13.407  10.169  -0.501  1.00 0.00 ? 37  GLY A C    6  
ATOM   3752  O  O    . GLY A 1 37 ? 13.319  11.074  -1.330  1.00 0.00 ? 37  GLY A O    6  
ATOM   3753  H  H    . GLY A 1 37 ? 10.802  9.895   -0.535  1.00 0.00 ? 37  GLY A H    6  
ATOM   3754  H  HA2  . GLY A 1 37 ? 12.479  11.123  1.158   1.00 0.00 ? 37  GLY A HA2  6  
ATOM   3755  H  HA3  . GLY A 1 37 ? 12.892  9.436   1.427   1.00 0.00 ? 37  GLY A HA3  6  
ATOM   3756  N  N    . GLU A 1 38 ? 14.286  9.176   -0.603  1.00 0.00 ? 38  GLU A N    6  
ATOM   3757  C  CA   . GLU A 1 38 ? 15.218  9.094   -1.721  1.00 0.00 ? 38  GLU A CA   6  
ATOM   3758  C  C    . GLU A 1 38 ? 14.836  7.957   -2.665  1.00 0.00 ? 38  GLU A C    6  
ATOM   3759  O  O    . GLU A 1 38 ? 14.384  6.898   -2.228  1.00 0.00 ? 38  GLU A O    6  
ATOM   3760  C  CB   . GLU A 1 38 ? 16.645  8.888   -1.210  1.00 0.00 ? 38  GLU A CB   6  
ATOM   3761  C  CG   . GLU A 1 38 ? 16.851  7.563   -0.495  1.00 0.00 ? 38  GLU A CG   6  
ATOM   3762  C  CD   . GLU A 1 38 ? 18.293  7.095   -0.538  1.00 0.00 ? 38  GLU A CD   6  
ATOM   3763  O  OE1  . GLU A 1 38 ? 19.029  7.521   -1.452  1.00 0.00 ? 38  GLU A OE1  6  
ATOM   3764  O  OE2  . GLU A 1 38 ? 18.685  6.302   0.344   1.00 0.00 ? 38  GLU A OE2  6  
ATOM   3765  H  H    . GLU A 1 38 ? 14.307  8.484   0.090   1.00 0.00 ? 38  GLU A H    6  
ATOM   3766  H  HA   . GLU A 1 38 ? 15.170  10.026  -2.262  1.00 0.00 ? 38  GLU A HA   6  
ATOM   3767  H  HB2  . GLU A 1 38 ? 17.325  8.931   -2.048  1.00 0.00 ? 38  GLU A HB2  6  
ATOM   3768  H  HB3  . GLU A 1 38 ? 16.886  9.685   -0.521  1.00 0.00 ? 38  GLU A HB3  6  
ATOM   3769  H  HG2  . GLU A 1 38 ? 16.556  7.676   0.538   1.00 0.00 ? 38  GLU A HG2  6  
ATOM   3770  H  HG3  . GLU A 1 38 ? 16.231  6.815   -0.965  1.00 0.00 ? 38  GLU A HG3  6  
ATOM   3771  N  N    . ARG A 1 39 ? 15.020  8.185   -3.961  1.00 0.00 ? 39  ARG A N    6  
ATOM   3772  C  CA   . ARG A 1 39 ? 14.693  7.183   -4.968  1.00 0.00 ? 39  ARG A CA   6  
ATOM   3773  C  C    . ARG A 1 39 ? 15.357  7.514   -6.301  1.00 0.00 ? 39  ARG A C    6  
ATOM   3774  O  O    . ARG A 1 39 ? 15.538  8.678   -6.660  1.00 0.00 ? 39  ARG A O    6  
ATOM   3775  C  CB   . ARG A 1 39 ? 13.177  7.087   -5.150  1.00 0.00 ? 39  ARG A CB   6  
ATOM   3776  C  CG   . ARG A 1 39 ? 12.547  8.362   -5.685  1.00 0.00 ? 39  ARG A CG   6  
ATOM   3777  C  CD   . ARG A 1 39 ? 12.151  9.304   -4.559  1.00 0.00 ? 39  ARG A CD   6  
ATOM   3778  N  NE   . ARG A 1 39 ? 11.002  8.806   -3.808  1.00 0.00 ? 39  ARG A NE   6  
ATOM   3779  C  CZ   . ARG A 1 39 ? 9.747   8.909   -4.232  1.00 0.00 ? 39  ARG A CZ   6  
ATOM   3780  N  NH1  . ARG A 1 39 ? 9.482   9.487   -5.395  1.00 0.00 ? 39  ARG A NH1  6  
ATOM   3781  N  NH2  . ARG A 1 39 ? 8.754   8.432   -3.492  1.00 0.00 ? 39  ARG A NH2  6  
ATOM   3782  H  H    . ARG A 1 39 ? 15.383  9.049   -4.248  1.00 0.00 ? 39  ARG A H    6  
ATOM   3783  H  HA   . ARG A 1 39 ? 15.066  6.230   -4.621  1.00 0.00 ? 39  ARG A HA   6  
ATOM   3784  H  HB2  . ARG A 1 39 ? 12.959  6.286   -5.841  1.00 0.00 ? 39  ARG A HB2  6  
ATOM   3785  H  HB3  . ARG A 1 39 ? 12.726  6.861   -4.196  1.00 0.00 ? 39  ARG A HB3  6  
ATOM   3786  H  HG2  . ARG A 1 39 ? 13.258  8.863   -6.325  1.00 0.00 ? 39  ARG A HG2  6  
ATOM   3787  H  HG3  . ARG A 1 39 ? 11.666  8.105   -6.254  1.00 0.00 ? 39  ARG A HG3  6  
ATOM   3788  H  HD2  . ARG A 1 39 ? 12.989  9.411   -3.886  1.00 0.00 ? 39  ARG A HD2  6  
ATOM   3789  H  HD3  . ARG A 1 39 ? 11.905  10.266  -4.982  1.00 0.00 ? 39  ARG A HD3  6  
ATOM   3790  H  HE   . ARG A 1 39 ? 11.174  8.375   -2.945  1.00 0.00 ? 39  ARG A HE   6  
ATOM   3791  H  HH11 . ARG A 1 39 ? 10.228  9.846   -5.955  1.00 0.00 ? 39  ARG A HH11 6  
ATOM   3792  H  HH12 . ARG A 1 39 ? 8.536   9.562   -5.713  1.00 0.00 ? 39  ARG A HH12 6  
ATOM   3793  H  HH21 . ARG A 1 39 ? 8.950   7.995   -2.615  1.00 0.00 ? 39  ARG A HH21 6  
ATOM   3794  H  HH22 . ARG A 1 39 ? 7.810   8.509   -3.812  1.00 0.00 ? 39  ARG A HH22 6  
ATOM   3795  N  N    . PRO A 1 40 ? 15.729  6.468   -7.054  1.00 0.00 ? 40  PRO A N    6  
ATOM   3796  C  CA   . PRO A 1 40 ? 16.378  6.623   -8.359  1.00 0.00 ? 40  PRO A CA   6  
ATOM   3797  C  C    . PRO A 1 40 ? 15.428  7.171   -9.418  1.00 0.00 ? 40  PRO A C    6  
ATOM   3798  O  O    . PRO A 1 40 ? 15.860  7.640   -10.471 1.00 0.00 ? 40  PRO A O    6  
ATOM   3799  C  CB   . PRO A 1 40 ? 16.807  5.197   -8.713  1.00 0.00 ? 40  PRO A CB   6  
ATOM   3800  C  CG   . PRO A 1 40 ? 15.866  4.320   -7.961  1.00 0.00 ? 40  PRO A CG   6  
ATOM   3801  C  CD   . PRO A 1 40 ? 15.544  5.053   -6.688  1.00 0.00 ? 40  PRO A CD   6  
ATOM   3802  H  HA   . PRO A 1 40 ? 17.250  7.258   -8.296  1.00 0.00 ? 40  PRO A HA   6  
ATOM   3803  H  HB2  . PRO A 1 40 ? 16.722  5.046   -9.780  1.00 0.00 ? 40  PRO A HB2  6  
ATOM   3804  H  HB3  . PRO A 1 40 ? 17.829  5.037   -8.402  1.00 0.00 ? 40  PRO A HB3  6  
ATOM   3805  H  HG2  . PRO A 1 40 ? 14.969  4.162   -8.540  1.00 0.00 ? 40  PRO A HG2  6  
ATOM   3806  H  HG3  . PRO A 1 40 ? 16.342  3.376   -7.739  1.00 0.00 ? 40  PRO A HG3  6  
ATOM   3807  H  HD2  . PRO A 1 40 ? 14.524  4.862   -6.390  1.00 0.00 ? 40  PRO A HD2  6  
ATOM   3808  H  HD3  . PRO A 1 40 ? 16.229  4.766   -5.904  1.00 0.00 ? 40  PRO A HD3  6  
ATOM   3809  N  N    . SER A 1 41 ? 14.131  7.110   -9.131  1.00 0.00 ? 41  SER A N    6  
ATOM   3810  C  CA   . SER A 1 41 ? 13.119  7.597   -10.061 1.00 0.00 ? 41  SER A CA   6  
ATOM   3811  C  C    . SER A 1 41 ? 13.447  7.177   -11.490 1.00 0.00 ? 41  SER A C    6  
ATOM   3812  O  O    . SER A 1 41 ? 13.299  7.959   -12.429 1.00 0.00 ? 41  SER A O    6  
ATOM   3813  C  CB   . SER A 1 41 ? 13.011  9.121   -9.977  1.00 0.00 ? 41  SER A CB   6  
ATOM   3814  O  OG   . SER A 1 41 ? 14.132  9.745   -10.579 1.00 0.00 ? 41  SER A OG   6  
ATOM   3815  H  H    . SER A 1 41 ? 13.849  6.725   -8.275  1.00 0.00 ? 41  SER A H    6  
ATOM   3816  H  HA   . SER A 1 41 ? 12.172  7.162   -9.778  1.00 0.00 ? 41  SER A HA   6  
ATOM   3817  H  HB2  . SER A 1 41 ? 12.117  9.445   -10.487 1.00 0.00 ? 41  SER A HB2  6  
ATOM   3818  H  HB3  . SER A 1 41 ? 12.962  9.419   -8.940  1.00 0.00 ? 41  SER A HB3  6  
ATOM   3819  H  HG   . SER A 1 41 ? 14.065  10.697  -10.470 1.00 0.00 ? 41  SER A HG   6  
ATOM   3820  N  N    . GLY A 1 42 ? 13.893  5.934   -11.648 1.00 0.00 ? 42  GLY A N    6  
ATOM   3821  C  CA   . GLY A 1 42 ? 14.236  5.431   -12.965 1.00 0.00 ? 42  GLY A CA   6  
ATOM   3822  C  C    . GLY A 1 42 ? 15.480  6.086   -13.531 1.00 0.00 ? 42  GLY A C    6  
ATOM   3823  O  O    . GLY A 1 42 ? 15.646  7.304   -13.473 1.00 0.00 ? 42  GLY A O    6  
ATOM   3824  H  H    . GLY A 1 42 ? 13.991  5.355   -10.863 1.00 0.00 ? 42  GLY A H    6  
ATOM   3825  H  HA2  . GLY A 1 42 ? 14.400  4.365   -12.899 1.00 0.00 ? 42  GLY A HA2  6  
ATOM   3826  H  HA3  . GLY A 1 42 ? 13.409  5.616   -13.635 1.00 0.00 ? 42  GLY A HA3  6  
ATOM   3827  N  N    . PRO A 1 43 ? 16.382  5.267   -14.092 1.00 0.00 ? 43  PRO A N    6  
ATOM   3828  C  CA   . PRO A 1 43 ? 17.634  5.752   -14.680 1.00 0.00 ? 43  PRO A CA   6  
ATOM   3829  C  C    . PRO A 1 43 ? 17.403  6.538   -15.966 1.00 0.00 ? 43  PRO A C    6  
ATOM   3830  O  O    . PRO A 1 43 ? 18.100  7.515   -16.241 1.00 0.00 ? 43  PRO A O    6  
ATOM   3831  C  CB   . PRO A 1 43 ? 18.410  4.466   -14.973 1.00 0.00 ? 43  PRO A CB   6  
ATOM   3832  C  CG   . PRO A 1 43 ? 17.363  3.418   -15.129 1.00 0.00 ? 43  PRO A CG   6  
ATOM   3833  C  CD   . PRO A 1 43 ? 16.248  3.804   -14.196 1.00 0.00 ? 43  PRO A CD   6  
ATOM   3834  H  HA   . PRO A 1 43 ? 18.190  6.360   -13.983 1.00 0.00 ? 43  PRO A HA   6  
ATOM   3835  H  HB2  . PRO A 1 43 ? 18.986  4.588   -15.879 1.00 0.00 ? 43  PRO A HB2  6  
ATOM   3836  H  HB3  . PRO A 1 43 ? 19.070  4.244   -14.147 1.00 0.00 ? 43  PRO A HB3  6  
ATOM   3837  H  HG2  . PRO A 1 43 ? 17.009  3.401   -16.148 1.00 0.00 ? 43  PRO A HG2  6  
ATOM   3838  H  HG3  . PRO A 1 43 ? 17.764  2.454   -14.853 1.00 0.00 ? 43  PRO A HG3  6  
ATOM   3839  H  HD2  . PRO A 1 43 ? 15.292  3.533   -14.617 1.00 0.00 ? 43  PRO A HD2  6  
ATOM   3840  H  HD3  . PRO A 1 43 ? 16.384  3.336   -13.232 1.00 0.00 ? 43  PRO A HD3  6  
ATOM   3841  N  N    . SER A 1 44 ? 16.420  6.107   -16.750 1.00 0.00 ? 44  SER A N    6  
ATOM   3842  C  CA   . SER A 1 44 ? 16.100  6.770   -18.009 1.00 0.00 ? 44  SER A CA   6  
ATOM   3843  C  C    . SER A 1 44 ? 15.343  8.070   -17.761 1.00 0.00 ? 44  SER A C    6  
ATOM   3844  O  O    . SER A 1 44 ? 14.159  8.183   -18.080 1.00 0.00 ? 44  SER A O    6  
ATOM   3845  C  CB   . SER A 1 44 ? 15.269  5.844   -18.900 1.00 0.00 ? 44  SER A CB   6  
ATOM   3846  O  OG   . SER A 1 44 ? 14.058  5.476   -18.264 1.00 0.00 ? 44  SER A OG   6  
ATOM   3847  H  H    . SER A 1 44 ? 15.900  5.323   -16.477 1.00 0.00 ? 44  SER A H    6  
ATOM   3848  H  HA   . SER A 1 44 ? 17.030  6.998   -18.510 1.00 0.00 ? 44  SER A HA   6  
ATOM   3849  H  HB2  . SER A 1 44 ? 15.037  6.351   -19.824 1.00 0.00 ? 44  SER A HB2  6  
ATOM   3850  H  HB3  . SER A 1 44 ? 15.837  4.950   -19.113 1.00 0.00 ? 44  SER A HB3  6  
ATOM   3851  H  HG   . SER A 1 44 ? 13.368  6.098   -18.505 1.00 0.00 ? 44  SER A HG   6  
ATOM   3852  N  N    . SER A 1 45 ? 16.034  9.051   -17.190 1.00 0.00 ? 45  SER A N    6  
ATOM   3853  C  CA   . SER A 1 45 ? 15.427  10.344  -16.896 1.00 0.00 ? 45  SER A CA   6  
ATOM   3854  C  C    . SER A 1 45 ? 16.392  11.482  -17.211 1.00 0.00 ? 45  SER A C    6  
ATOM   3855  O  O    . SER A 1 45 ? 17.347  11.725  -16.473 1.00 0.00 ? 45  SER A O    6  
ATOM   3856  C  CB   . SER A 1 45 ? 15.006  10.410  -15.426 1.00 0.00 ? 45  SER A CB   6  
ATOM   3857  O  OG   . SER A 1 45 ? 13.899  9.560   -15.174 1.00 0.00 ? 45  SER A OG   6  
ATOM   3858  H  H    . SER A 1 45 ? 16.975  8.901   -16.960 1.00 0.00 ? 45  SER A H    6  
ATOM   3859  H  HA   . SER A 1 45 ? 14.551  10.448  -17.518 1.00 0.00 ? 45  SER A HA   6  
ATOM   3860  H  HB2  . SER A 1 45 ? 15.831  10.100  -14.804 1.00 0.00 ? 45  SER A HB2  6  
ATOM   3861  H  HB3  . SER A 1 45 ? 14.729  11.425  -15.179 1.00 0.00 ? 45  SER A HB3  6  
ATOM   3862  H  HG   . SER A 1 45 ? 14.144  8.652   -15.363 1.00 0.00 ? 45  SER A HG   6  
ATOM   3863  N  N    . GLY A 1 46 ? 16.136  12.179  -18.314 1.00 0.00 ? 46  GLY A N    6  
ATOM   3864  C  CA   . GLY A 1 46 ? 16.990  13.283  -18.710 1.00 0.00 ? 46  GLY A CA   6  
ATOM   3865  C  C    . GLY A 1 46 ? 16.379  14.633  -18.388 1.00 0.00 ? 46  GLY A C    6  
ATOM   3866  O  O    . GLY A 1 46 ? 16.099  15.398  -19.310 1.00 0.00 ? 46  GLY A O    6  
ATOM   3867  H  H    . GLY A 1 46 ? 15.361  11.940  -18.865 1.00 0.00 ? 46  GLY A H    6  
ATOM   3868  H  HA2  . GLY A 1 46 ? 17.935  13.196  -18.194 1.00 0.00 ? 46  GLY A HA2  6  
ATOM   3869  H  HA3  . GLY A 1 46 ? 17.166  13.225  -19.774 1.00 0.00 ? 46  GLY A HA3  6  
HETATM 3870  ZN ZN   . ZN  B 2 .  ? 4.219   1.130   4.241   1.00 0.00 ? 201 ZN  A ZN   6  
ATOM   3871  N  N    . GLY A 1 1  ? 2.112   -24.197 -15.793 1.00 0.00 ? 1   GLY A N    7  
ATOM   3872  C  CA   . GLY A 1 1  ? 1.098   -23.782 -16.745 1.00 0.00 ? 1   GLY A CA   7  
ATOM   3873  C  C    . GLY A 1 1  ? 0.173   -22.722 -16.182 1.00 0.00 ? 1   GLY A C    7  
ATOM   3874  O  O    . GLY A 1 1  ? 0.610   -21.620 -15.848 1.00 0.00 ? 1   GLY A O    7  
ATOM   3875  H  H1   . GLY A 1 1  ? 2.011   -23.972 -14.845 1.00 0.00 ? 1   GLY A H1   7  
ATOM   3876  H  HA2  . GLY A 1 1  ? 1.585   -23.389 -17.625 1.00 0.00 ? 1   GLY A HA2  7  
ATOM   3877  H  HA3  . GLY A 1 1  ? 0.510   -24.644 -17.026 1.00 0.00 ? 1   GLY A HA3  7  
ATOM   3878  N  N    . SER A 1 2  ? -1.110  -23.053 -16.077 1.00 0.00 ? 2   SER A N    7  
ATOM   3879  C  CA   . SER A 1 2  ? -2.101  -22.119 -15.555 1.00 0.00 ? 2   SER A CA   7  
ATOM   3880  C  C    . SER A 1 2  ? -1.790  -21.750 -14.108 1.00 0.00 ? 2   SER A C    7  
ATOM   3881  O  O    . SER A 1 2  ? -2.113  -22.494 -13.182 1.00 0.00 ? 2   SER A O    7  
ATOM   3882  C  CB   . SER A 1 2  ? -3.503  -22.724 -15.649 1.00 0.00 ? 2   SER A CB   7  
ATOM   3883  O  OG   . SER A 1 2  ? -4.448  -21.933 -14.949 1.00 0.00 ? 2   SER A OG   7  
ATOM   3884  H  H    . SER A 1 2  ? -1.397  -23.947 -16.360 1.00 0.00 ? 2   SER A H    7  
ATOM   3885  H  HA   . SER A 1 2  ? -2.063  -21.225 -16.159 1.00 0.00 ? 2   SER A HA   7  
ATOM   3886  H  HB2  . SER A 1 2  ? -3.798  -22.784 -16.685 1.00 0.00 ? 2   SER A HB2  7  
ATOM   3887  H  HB3  . SER A 1 2  ? -3.493  -23.716 -15.220 1.00 0.00 ? 2   SER A HB3  7  
ATOM   3888  H  HG   . SER A 1 2  ? -4.110  -21.040 -14.855 1.00 0.00 ? 2   SER A HG   7  
ATOM   3889  N  N    . SER A 1 3  ? -1.159  -20.594 -13.921 1.00 0.00 ? 3   SER A N    7  
ATOM   3890  C  CA   . SER A 1 3  ? -0.800  -20.126 -12.588 1.00 0.00 ? 3   SER A CA   7  
ATOM   3891  C  C    . SER A 1 3  ? -1.241  -18.681 -12.382 1.00 0.00 ? 3   SER A C    7  
ATOM   3892  O  O    . SER A 1 3  ? -1.220  -17.875 -13.312 1.00 0.00 ? 3   SER A O    7  
ATOM   3893  C  CB   . SER A 1 3  ? 0.710   -20.246 -12.371 1.00 0.00 ? 3   SER A CB   7  
ATOM   3894  O  OG   . SER A 1 3  ? 1.021   -20.350 -10.993 1.00 0.00 ? 3   SER A OG   7  
ATOM   3895  H  H    . SER A 1 3  ? -0.928  -20.045 -14.699 1.00 0.00 ? 3   SER A H    7  
ATOM   3896  H  HA   . SER A 1 3  ? -1.309  -20.751 -11.869 1.00 0.00 ? 3   SER A HA   7  
ATOM   3897  H  HB2  . SER A 1 3  ? 1.075   -21.127 -12.878 1.00 0.00 ? 3   SER A HB2  7  
ATOM   3898  H  HB3  . SER A 1 3  ? 1.199   -19.371 -12.774 1.00 0.00 ? 3   SER A HB3  7  
ATOM   3899  H  HG   . SER A 1 3  ? 0.336   -20.853 -10.547 1.00 0.00 ? 3   SER A HG   7  
ATOM   3900  N  N    . GLY A 1 4  ? -1.642  -18.359 -11.155 1.00 0.00 ? 4   GLY A N    7  
ATOM   3901  C  CA   . GLY A 1 4  ? -2.083  -17.011 -10.849 1.00 0.00 ? 4   GLY A CA   7  
ATOM   3902  C  C    . GLY A 1 4  ? -1.964  -16.684 -9.373  1.00 0.00 ? 4   GLY A C    7  
ATOM   3903  O  O    . GLY A 1 4  ? -2.943  -16.769 -8.631  1.00 0.00 ? 4   GLY A O    7  
ATOM   3904  H  H    . GLY A 1 4  ? -1.637  -19.043 -10.453 1.00 0.00 ? 4   GLY A H    7  
ATOM   3905  H  HA2  . GLY A 1 4  ? -1.484  -16.311 -11.411 1.00 0.00 ? 4   GLY A HA2  7  
ATOM   3906  H  HA3  . GLY A 1 4  ? -3.116  -16.906 -11.147 1.00 0.00 ? 4   GLY A HA3  7  
ATOM   3907  N  N    . SER A 1 5  ? -0.762  -16.311 -8.946  1.00 0.00 ? 5   SER A N    7  
ATOM   3908  C  CA   . SER A 1 5  ? -0.518  -15.975 -7.548  1.00 0.00 ? 5   SER A CA   7  
ATOM   3909  C  C    . SER A 1 5  ? -0.306  -14.474 -7.379  1.00 0.00 ? 5   SER A C    7  
ATOM   3910  O  O    . SER A 1 5  ? -0.207  -13.735 -8.359  1.00 0.00 ? 5   SER A O    7  
ATOM   3911  C  CB   . SER A 1 5  ? 0.702   -16.735 -7.025  1.00 0.00 ? 5   SER A CB   7  
ATOM   3912  O  OG   . SER A 1 5  ? 0.835   -16.584 -5.623  1.00 0.00 ? 5   SER A OG   7  
ATOM   3913  H  H    . SER A 1 5  ? -0.021  -16.262 -9.587  1.00 0.00 ? 5   SER A H    7  
ATOM   3914  H  HA   . SER A 1 5  ? -1.387  -16.271 -6.980  1.00 0.00 ? 5   SER A HA   7  
ATOM   3915  H  HB2  . SER A 1 5  ? 0.594   -17.785 -7.253  1.00 0.00 ? 5   SER A HB2  7  
ATOM   3916  H  HB3  . SER A 1 5  ? 1.593   -16.353 -7.503  1.00 0.00 ? 5   SER A HB3  7  
ATOM   3917  H  HG   . SER A 1 5  ? 1.614   -17.057 -5.321  1.00 0.00 ? 5   SER A HG   7  
ATOM   3918  N  N    . SER A 1 6  ? -0.238  -14.029 -6.128  1.00 0.00 ? 6   SER A N    7  
ATOM   3919  C  CA   . SER A 1 6  ? -0.042  -12.616 -5.829  1.00 0.00 ? 6   SER A CA   7  
ATOM   3920  C  C    . SER A 1 6  ? -1.230  -11.788 -6.312  1.00 0.00 ? 6   SER A C    7  
ATOM   3921  O  O    . SER A 1 6  ? -1.060  -10.705 -6.869  1.00 0.00 ? 6   SER A O    7  
ATOM   3922  C  CB   . SER A 1 6  ? 1.246   -12.108 -6.480  1.00 0.00 ? 6   SER A CB   7  
ATOM   3923  O  OG   . SER A 1 6  ? 1.564   -10.802 -6.031  1.00 0.00 ? 6   SER A OG   7  
ATOM   3924  H  H    . SER A 1 6  ? -0.324  -14.667 -5.389  1.00 0.00 ? 6   SER A H    7  
ATOM   3925  H  HA   . SER A 1 6  ? 0.041   -12.512 -4.757  1.00 0.00 ? 6   SER A HA   7  
ATOM   3926  H  HB2  . SER A 1 6  ? 2.059   -12.771 -6.227  1.00 0.00 ? 6   SER A HB2  7  
ATOM   3927  H  HB3  . SER A 1 6  ? 1.119   -12.087 -7.553  1.00 0.00 ? 6   SER A HB3  7  
ATOM   3928  H  HG   . SER A 1 6  ? 1.176   -10.658 -5.165  1.00 0.00 ? 6   SER A HG   7  
ATOM   3929  N  N    . GLY A 1 7  ? -2.434  -12.309 -6.094  1.00 0.00 ? 7   GLY A N    7  
ATOM   3930  C  CA   . GLY A 1 7  ? -3.633  -11.607 -6.513  1.00 0.00 ? 7   GLY A CA   7  
ATOM   3931  C  C    . GLY A 1 7  ? -4.100  -10.594 -5.487  1.00 0.00 ? 7   GLY A C    7  
ATOM   3932  O  O    . GLY A 1 7  ? -3.316  -10.133 -4.657  1.00 0.00 ? 7   GLY A O    7  
ATOM   3933  H  H    . GLY A 1 7  ? -2.508  -13.177 -5.645  1.00 0.00 ? 7   GLY A H    7  
ATOM   3934  H  HA2  . GLY A 1 7  ? -3.431  -11.095 -7.443  1.00 0.00 ? 7   GLY A HA2  7  
ATOM   3935  H  HA3  . GLY A 1 7  ? -4.420  -12.328 -6.675  1.00 0.00 ? 7   GLY A HA3  7  
ATOM   3936  N  N    . THR A 1 8  ? -5.382  -10.245 -5.543  1.00 0.00 ? 8   THR A N    7  
ATOM   3937  C  CA   . THR A 1 8  ? -5.952  -9.278  -4.613  1.00 0.00 ? 8   THR A CA   7  
ATOM   3938  C  C    . THR A 1 8  ? -6.305  -9.936  -3.284  1.00 0.00 ? 8   THR A C    7  
ATOM   3939  O  O    . THR A 1 8  ? -6.072  -9.368  -2.218  1.00 0.00 ? 8   THR A O    7  
ATOM   3940  C  CB   . THR A 1 8  ? -7.214  -8.615  -5.196  1.00 0.00 ? 8   THR A CB   7  
ATOM   3941  O  OG1  . THR A 1 8  ? -7.742  -7.664  -4.265  1.00 0.00 ? 8   THR A OG1  7  
ATOM   3942  C  CG2  . THR A 1 8  ? -8.273  -9.658  -5.520  1.00 0.00 ? 8   THR A CG2  7  
ATOM   3943  H  H    . THR A 1 8  ? -5.956  -10.648 -6.227  1.00 0.00 ? 8   THR A H    7  
ATOM   3944  H  HA   . THR A 1 8  ? -5.214  -8.509  -4.438  1.00 0.00 ? 8   THR A HA   7  
ATOM   3945  H  HB   . THR A 1 8  ? -6.944  -8.103  -6.109  1.00 0.00 ? 8   THR A HB   7  
ATOM   3946  H  HG1  . THR A 1 8  ? -7.728  -8.040  -3.382  1.00 0.00 ? 8   THR A HG1  7  
ATOM   3947  H  HG21 . THR A 1 8  ? -8.588  -10.145 -4.609  1.00 0.00 ? 8   THR A HG21 7  
ATOM   3948  H  HG22 . THR A 1 8  ? -7.861  -10.392 -6.196  1.00 0.00 ? 8   THR A HG22 7  
ATOM   3949  H  HG23 . THR A 1 8  ? -9.122  -9.177  -5.983  1.00 0.00 ? 8   THR A HG23 7  
ATOM   3950  N  N    . GLY A 1 9  ? -6.869  -11.138 -3.355  1.00 0.00 ? 9   GLY A N    7  
ATOM   3951  C  CA   . GLY A 1 9  ? -7.244  -11.854 -2.150  1.00 0.00 ? 9   GLY A CA   7  
ATOM   3952  C  C    . GLY A 1 9  ? -8.203  -11.063 -1.281  1.00 0.00 ? 9   GLY A C    7  
ATOM   3953  O  O    . GLY A 1 9  ? -8.831  -10.113 -1.746  1.00 0.00 ? 9   GLY A O    7  
ATOM   3954  H  H    . GLY A 1 9  ? -7.031  -11.543 -4.233  1.00 0.00 ? 9   GLY A H    7  
ATOM   3955  H  HA2  . GLY A 1 9  ? -7.713  -12.786 -2.429  1.00 0.00 ? 9   GLY A HA2  7  
ATOM   3956  H  HA3  . GLY A 1 9  ? -6.353  -12.068 -1.579  1.00 0.00 ? 9   GLY A HA3  7  
ATOM   3957  N  N    . GLU A 1 10 ? -8.316  -11.457 -0.017  1.00 0.00 ? 10  GLU A N    7  
ATOM   3958  C  CA   . GLU A 1 10 ? -9.207  -10.779 0.917   1.00 0.00 ? 10  GLU A CA   7  
ATOM   3959  C  C    . GLU A 1 10 ? -8.478  -9.653  1.644   1.00 0.00 ? 10  GLU A C    7  
ATOM   3960  O  O    . GLU A 1 10 ? -8.071  -9.804  2.795   1.00 0.00 ? 10  GLU A O    7  
ATOM   3961  C  CB   . GLU A 1 10 ? -9.770  -11.775 1.933   1.00 0.00 ? 10  GLU A CB   7  
ATOM   3962  C  CG   . GLU A 1 10 ? -10.865 -11.194 2.812   1.00 0.00 ? 10  GLU A CG   7  
ATOM   3963  C  CD   . GLU A 1 10 ? -12.120 -10.852 2.032   1.00 0.00 ? 10  GLU A CD   7  
ATOM   3964  O  OE1  . GLU A 1 10 ? -12.135 -9.795  1.367   1.00 0.00 ? 10  GLU A OE1  7  
ATOM   3965  O  OE2  . GLU A 1 10 ? -13.085 -11.642 2.086   1.00 0.00 ? 10  GLU A OE2  7  
ATOM   3966  H  H    . GLU A 1 10 ? -7.788  -12.222 0.295   1.00 0.00 ? 10  GLU A H    7  
ATOM   3967  H  HA   . GLU A 1 10 ? -10.022 -10.357 0.351   1.00 0.00 ? 10  GLU A HA   7  
ATOM   3968  H  HB2  . GLU A 1 10 ? -10.176 -12.623 1.401   1.00 0.00 ? 10  GLU A HB2  7  
ATOM   3969  H  HB3  . GLU A 1 10 ? -8.967  -12.113 2.571   1.00 0.00 ? 10  GLU A HB3  7  
ATOM   3970  H  HG2  . GLU A 1 10 ? -11.120 -11.917 3.573   1.00 0.00 ? 10  GLU A HG2  7  
ATOM   3971  H  HG3  . GLU A 1 10 ? -10.494 -10.295 3.281   1.00 0.00 ? 10  GLU A HG3  7  
ATOM   3972  N  N    . ASN A 1 11 ? -8.317  -8.524  0.962   1.00 0.00 ? 11  ASN A N    7  
ATOM   3973  C  CA   . ASN A 1 11 ? -7.636  -7.371  1.541   1.00 0.00 ? 11  ASN A CA   7  
ATOM   3974  C  C    . ASN A 1 11 ? -8.078  -6.079  0.860   1.00 0.00 ? 11  ASN A C    7  
ATOM   3975  O  O    . ASN A 1 11 ? -8.090  -5.968  -0.366  1.00 0.00 ? 11  ASN A O    7  
ATOM   3976  C  CB   . ASN A 1 11 ? -6.120  -7.533  1.418   1.00 0.00 ? 11  ASN A CB   7  
ATOM   3977  C  CG   . ASN A 1 11 ? -5.566  -8.556  2.391   1.00 0.00 ? 11  ASN A CG   7  
ATOM   3978  O  OD1  . ASN A 1 11 ? -5.724  -9.762  2.197   1.00 0.00 ? 11  ASN A OD1  7  
ATOM   3979  N  ND2  . ASN A 1 11 ? -4.915  -8.079  3.445   1.00 0.00 ? 11  ASN A ND2  7  
ATOM   3980  H  H    . ASN A 1 11 ? -8.663  -8.464  0.047   1.00 0.00 ? 11  ASN A H    7  
ATOM   3981  H  HA   . ASN A 1 11 ? -7.900  -7.322  2.587   1.00 0.00 ? 11  ASN A HA   7  
ATOM   3982  H  HB2  . ASN A 1 11 ? -5.878  -7.852  0.415   1.00 0.00 ? 11  ASN A HB2  7  
ATOM   3983  H  HB3  . ASN A 1 11 ? -5.645  -6.584  1.614   1.00 0.00 ? 11  ASN A HB3  7  
ATOM   3984  H  HD21 . ASN A 1 11 ? -4.829  -7.107  3.535   1.00 0.00 ? 11  ASN A HD21 7  
ATOM   3985  H  HD22 . ASN A 1 11 ? -4.547  -8.718  4.090   1.00 0.00 ? 11  ASN A HD22 7  
ATOM   3986  N  N    . PRO A 1 12 ? -8.448  -5.079  1.673   1.00 0.00 ? 12  PRO A N    7  
ATOM   3987  C  CA   . PRO A 1 12 ? -8.896  -3.776  1.171   1.00 0.00 ? 12  PRO A CA   7  
ATOM   3988  C  C    . PRO A 1 12 ? -7.761  -2.976  0.542   1.00 0.00 ? 12  PRO A C    7  
ATOM   3989  O  O    . PRO A 1 12 ? -7.882  -2.484  -0.580  1.00 0.00 ? 12  PRO A O    7  
ATOM   3990  C  CB   . PRO A 1 12 ? -9.416  -3.072  2.427   1.00 0.00 ? 12  PRO A CB   7  
ATOM   3991  C  CG   . PRO A 1 12 ? -8.678  -3.711  3.552   1.00 0.00 ? 12  PRO A CG   7  
ATOM   3992  C  CD   . PRO A 1 12 ? -8.458  -5.142  3.144   1.00 0.00 ? 12  PRO A CD   7  
ATOM   3993  H  HA   . PRO A 1 12 ? -9.700  -3.881  0.457   1.00 0.00 ? 12  PRO A HA   7  
ATOM   3994  H  HB2  . PRO A 1 12 ? -9.202  -2.014  2.364   1.00 0.00 ? 12  PRO A HB2  7  
ATOM   3995  H  HB3  . PRO A 1 12 ? -10.481 -3.225  2.516   1.00 0.00 ? 12  PRO A HB3  7  
ATOM   3996  H  HG2  . PRO A 1 12 ? -7.731  -3.214  3.700   1.00 0.00 ? 12  PRO A HG2  7  
ATOM   3997  H  HG3  . PRO A 1 12 ? -9.272  -3.666  4.453   1.00 0.00 ? 12  PRO A HG3  7  
ATOM   3998  H  HD2  . PRO A 1 12 ? -7.512  -5.501  3.521   1.00 0.00 ? 12  PRO A HD2  7  
ATOM   3999  H  HD3  . PRO A 1 12 ? -9.268  -5.763  3.497   1.00 0.00 ? 12  PRO A HD3  7  
ATOM   4000  N  N    . PHE A 1 13 ? -6.658  -2.848  1.272   1.00 0.00 ? 13  PHE A N    7  
ATOM   4001  C  CA   . PHE A 1 13 ? -5.501  -2.106  0.786   1.00 0.00 ? 13  PHE A CA   7  
ATOM   4002  C  C    . PHE A 1 13 ? -4.244  -2.489  1.562   1.00 0.00 ? 13  PHE A C    7  
ATOM   4003  O  O    . PHE A 1 13 ? -4.249  -2.526  2.792   1.00 0.00 ? 13  PHE A O    7  
ATOM   4004  C  CB   . PHE A 1 13 ? -5.748  -0.601  0.902   1.00 0.00 ? 13  PHE A CB   7  
ATOM   4005  C  CG   . PHE A 1 13 ? -7.118  -0.181  0.451   1.00 0.00 ? 13  PHE A CG   7  
ATOM   4006  C  CD1  . PHE A 1 13 ? -8.174  -0.140  1.347   1.00 0.00 ? 13  PHE A CD1  7  
ATOM   4007  C  CD2  . PHE A 1 13 ? -7.350  0.171   -0.868  1.00 0.00 ? 13  PHE A CD2  7  
ATOM   4008  C  CE1  . PHE A 1 13 ? -9.436  0.246   0.936   1.00 0.00 ? 13  PHE A CE1  7  
ATOM   4009  C  CE2  . PHE A 1 13 ? -8.609  0.558   -1.285  1.00 0.00 ? 13  PHE A CE2  7  
ATOM   4010  C  CZ   . PHE A 1 13 ? -9.654  0.595   -0.382  1.00 0.00 ? 13  PHE A CZ   7  
ATOM   4011  H  H    . PHE A 1 13 ? -6.622  -3.263  2.160   1.00 0.00 ? 13  PHE A H    7  
ATOM   4012  H  HA   . PHE A 1 13 ? -5.359  -2.360  -0.254  1.00 0.00 ? 13  PHE A HA   7  
ATOM   4013  H  HB2  . PHE A 1 13 ? -5.633  -0.303  1.934   1.00 0.00 ? 13  PHE A HB2  7  
ATOM   4014  H  HB3  . PHE A 1 13 ? -5.023  -0.077  0.297   1.00 0.00 ? 13  PHE A HB3  7  
ATOM   4015  H  HD1  . PHE A 1 13 ? -8.004  -0.412  2.380   1.00 0.00 ? 13  PHE A HD1  7  
ATOM   4016  H  HD2  . PHE A 1 13 ? -6.534  0.142   -1.576  1.00 0.00 ? 13  PHE A HD2  7  
ATOM   4017  H  HE1  . PHE A 1 13 ? -10.250 0.274   1.645   1.00 0.00 ? 13  PHE A HE1  7  
ATOM   4018  H  HE2  . PHE A 1 13 ? -8.777  0.829   -2.317  1.00 0.00 ? 13  PHE A HE2  7  
ATOM   4019  H  HZ   . PHE A 1 13 ? -10.638 0.897   -0.706  1.00 0.00 ? 13  PHE A HZ   7  
ATOM   4020  N  N    . ILE A 1 14 ? -3.169  -2.772  0.833   1.00 0.00 ? 14  ILE A N    7  
ATOM   4021  C  CA   . ILE A 1 14 ? -1.906  -3.151  1.453   1.00 0.00 ? 14  ILE A CA   7  
ATOM   4022  C  C    . ILE A 1 14 ? -0.771  -2.248  0.983   1.00 0.00 ? 14  ILE A C    7  
ATOM   4023  O  O    . ILE A 1 14 ? -0.697  -1.884  -0.191  1.00 0.00 ? 14  ILE A O    7  
ATOM   4024  C  CB   . ILE A 1 14 ? -1.543  -4.615  1.142   1.00 0.00 ? 14  ILE A CB   7  
ATOM   4025  C  CG1  . ILE A 1 14 ? -2.619  -5.557  1.687   1.00 0.00 ? 14  ILE A CG1  7  
ATOM   4026  C  CG2  . ILE A 1 14 ? -0.182  -4.960  1.729   1.00 0.00 ? 14  ILE A CG2  7  
ATOM   4027  C  CD1  . ILE A 1 14 ? -2.398  -7.006  1.316   1.00 0.00 ? 14  ILE A CD1  7  
ATOM   4028  H  H    . ILE A 1 14 ? -3.228  -2.725  -0.144  1.00 0.00 ? 14  ILE A H    7  
ATOM   4029  H  HA   . ILE A 1 14 ? -2.015  -3.048  2.523   1.00 0.00 ? 14  ILE A HA   7  
ATOM   4030  H  HB   . ILE A 1 14 ? -1.485  -4.729  0.070   1.00 0.00 ? 14  ILE A HB   7  
ATOM   4031  H  HG12 . ILE A 1 14 ? -2.635  -5.490  2.764   1.00 0.00 ? 14  ILE A HG12 7  
ATOM   4032  H  HG13 . ILE A 1 14 ? -3.581  -5.256  1.297   1.00 0.00 ? 14  ILE A HG13 7  
ATOM   4033  H  HG21 . ILE A 1 14 ? -0.152  -4.661  2.766   1.00 0.00 ? 14  ILE A HG21 7  
ATOM   4034  H  HG22 . ILE A 1 14 ? -0.020  -6.025  1.657   1.00 0.00 ? 14  ILE A HG22 7  
ATOM   4035  H  HG23 . ILE A 1 14 ? 0.589   -4.440  1.181   1.00 0.00 ? 14  ILE A HG23 7  
ATOM   4036  H  HD11 . ILE A 1 14 ? -2.292  -7.091  0.244   1.00 0.00 ? 14  ILE A HD11 7  
ATOM   4037  H  HD12 . ILE A 1 14 ? -1.499  -7.368  1.794   1.00 0.00 ? 14  ILE A HD12 7  
ATOM   4038  H  HD13 . ILE A 1 14 ? -3.242  -7.595  1.641   1.00 0.00 ? 14  ILE A HD13 7  
ATOM   4039  N  N    . CYS A 1 15 ? 0.114   -1.889  1.908   1.00 0.00 ? 15  CYS A N    7  
ATOM   4040  C  CA   . CYS A 1 15 ? 1.247   -1.029  1.590   1.00 0.00 ? 15  CYS A CA   7  
ATOM   4041  C  C    . CYS A 1 15 ? 2.299   -1.789  0.786   1.00 0.00 ? 15  CYS A C    7  
ATOM   4042  O  O    . CYS A 1 15 ? 2.753   -2.858  1.194   1.00 0.00 ? 15  CYS A O    7  
ATOM   4043  C  CB   . CYS A 1 15 ? 1.871   -0.477  2.873   1.00 0.00 ? 15  CYS A CB   7  
ATOM   4044  S  SG   . CYS A 1 15 ? 3.114   0.826   2.595   1.00 0.00 ? 15  CYS A SG   7  
ATOM   4045  H  H    . CYS A 1 15 ? 0.002   -2.211  2.827   1.00 0.00 ? 15  CYS A H    7  
ATOM   4046  H  HA   . CYS A 1 15 ? 0.883   -0.206  0.994   1.00 0.00 ? 15  CYS A HA   7  
ATOM   4047  H  HB2  . CYS A 1 15 ? 1.091   -0.059  3.492   1.00 0.00 ? 15  CYS A HB2  7  
ATOM   4048  H  HB3  . CYS A 1 15 ? 2.353   -1.283  3.406   1.00 0.00 ? 15  CYS A HB3  7  
ATOM   4049  N  N    . SER A 1 16 ? 2.680   -1.230  -0.357  1.00 0.00 ? 16  SER A N    7  
ATOM   4050  C  CA   . SER A 1 16 ? 3.675   -1.856  -1.220  1.00 0.00 ? 16  SER A CA   7  
ATOM   4051  C  C    . SER A 1 16 ? 5.088   -1.500  -0.768  1.00 0.00 ? 16  SER A C    7  
ATOM   4052  O  O    . SER A 1 16 ? 5.992   -1.343  -1.588  1.00 0.00 ? 16  SER A O    7  
ATOM   4053  C  CB   . SER A 1 16 ? 3.467   -1.421  -2.672  1.00 0.00 ? 16  SER A CB   7  
ATOM   4054  O  OG   . SER A 1 16 ? 4.361   -2.098  -3.540  1.00 0.00 ? 16  SER A OG   7  
ATOM   4055  H  H    . SER A 1 16 ? 2.281   -0.376  -0.628  1.00 0.00 ? 16  SER A H    7  
ATOM   4056  H  HA   . SER A 1 16 ? 3.547   -2.926  -1.152  1.00 0.00 ? 16  SER A HA   7  
ATOM   4057  H  HB2  . SER A 1 16 ? 2.455   -1.646  -2.972  1.00 0.00 ? 16  SER A HB2  7  
ATOM   4058  H  HB3  . SER A 1 16 ? 3.640   -0.358  -2.755  1.00 0.00 ? 16  SER A HB3  7  
ATOM   4059  H  HG   . SER A 1 16 ? 4.173   -1.851  -4.449  1.00 0.00 ? 16  SER A HG   7  
ATOM   4060  N  N    . GLU A 1 17 ? 5.269   -1.374  0.543   1.00 0.00 ? 17  GLU A N    7  
ATOM   4061  C  CA   . GLU A 1 17 ? 6.571   -1.035  1.105   1.00 0.00 ? 17  GLU A CA   7  
ATOM   4062  C  C    . GLU A 1 17 ? 6.899   -1.930  2.296   1.00 0.00 ? 17  GLU A C    7  
ATOM   4063  O  O    . GLU A 1 17 ? 7.953   -2.566  2.338   1.00 0.00 ? 17  GLU A O    7  
ATOM   4064  C  CB   . GLU A 1 17 ? 6.600   0.434   1.533   1.00 0.00 ? 17  GLU A CB   7  
ATOM   4065  C  CG   . GLU A 1 17 ? 6.757   1.403   0.373   1.00 0.00 ? 17  GLU A CG   7  
ATOM   4066  C  CD   . GLU A 1 17 ? 8.169   1.427   -0.180  1.00 0.00 ? 17  GLU A CD   7  
ATOM   4067  O  OE1  . GLU A 1 17 ? 8.805   0.354   -0.228  1.00 0.00 ? 17  GLU A OE1  7  
ATOM   4068  O  OE2  . GLU A 1 17 ? 8.638   2.519   -0.563  1.00 0.00 ? 17  GLU A OE2  7  
ATOM   4069  H  H    . GLU A 1 17 ? 4.509   -1.511  1.146   1.00 0.00 ? 17  GLU A H    7  
ATOM   4070  H  HA   . GLU A 1 17 ? 7.314   -1.191  0.337   1.00 0.00 ? 17  GLU A HA   7  
ATOM   4071  H  HB2  . GLU A 1 17 ? 5.679   0.665   2.046   1.00 0.00 ? 17  GLU A HB2  7  
ATOM   4072  H  HB3  . GLU A 1 17 ? 7.427   0.581   2.212   1.00 0.00 ? 17  GLU A HB3  7  
ATOM   4073  H  HG2  . GLU A 1 17 ? 6.083   1.110   -0.418  1.00 0.00 ? 17  GLU A HG2  7  
ATOM   4074  H  HG3  . GLU A 1 17 ? 6.502   2.396   0.713   1.00 0.00 ? 17  GLU A HG3  7  
ATOM   4075  N  N    . CYS A 1 18 ? 5.989   -1.974  3.264   1.00 0.00 ? 18  CYS A N    7  
ATOM   4076  C  CA   . CYS A 1 18 ? 6.180   -2.789  4.457   1.00 0.00 ? 18  CYS A CA   7  
ATOM   4077  C  C    . CYS A 1 18 ? 5.244   -3.994  4.449   1.00 0.00 ? 18  CYS A C    7  
ATOM   4078  O  O    . CYS A 1 18 ? 5.674   -5.129  4.648   1.00 0.00 ? 18  CYS A O    7  
ATOM   4079  C  CB   . CYS A 1 18 ? 5.941   -1.952  5.716   1.00 0.00 ? 18  CYS A CB   7  
ATOM   4080  S  SG   . CYS A 1 18 ? 4.344   -1.076  5.733   1.00 0.00 ? 18  CYS A SG   7  
ATOM   4081  H  H    . CYS A 1 18 ? 5.169   -1.444  3.174   1.00 0.00 ? 18  CYS A H    7  
ATOM   4082  H  HA   . CYS A 1 18 ? 7.201   -3.141  4.459   1.00 0.00 ? 18  CYS A HA   7  
ATOM   4083  H  HB2  . CYS A 1 18 ? 5.968   -2.600  6.580   1.00 0.00 ? 18  CYS A HB2  7  
ATOM   4084  H  HB3  . CYS A 1 18 ? 6.723   -1.213  5.801   1.00 0.00 ? 18  CYS A HB3  7  
ATOM   4085  N  N    . GLY A 1 19 ? 3.961   -3.737  4.215   1.00 0.00 ? 19  GLY A N    7  
ATOM   4086  C  CA   . GLY A 1 19 ? 2.983   -4.810  4.185   1.00 0.00 ? 19  GLY A CA   7  
ATOM   4087  C  C    . GLY A 1 19 ? 1.891   -4.629  5.220   1.00 0.00 ? 19  GLY A C    7  
ATOM   4088  O  O    . GLY A 1 19 ? 1.463   -5.592  5.857   1.00 0.00 ? 19  GLY A O    7  
ATOM   4089  H  H    . GLY A 1 19 ? 3.675   -2.812  4.063   1.00 0.00 ? 19  GLY A H    7  
ATOM   4090  H  HA2  . GLY A 1 19 ? 2.533   -4.844  3.204   1.00 0.00 ? 19  GLY A HA2  7  
ATOM   4091  H  HA3  . GLY A 1 19 ? 3.488   -5.747  4.371   1.00 0.00 ? 19  GLY A HA3  7  
ATOM   4092  N  N    . LYS A 1 20 ? 1.439   -3.391  5.391   1.00 0.00 ? 20  LYS A N    7  
ATOM   4093  C  CA   . LYS A 1 20 ? 0.390   -3.086  6.356   1.00 0.00 ? 20  LYS A CA   7  
ATOM   4094  C  C    . LYS A 1 20 ? -0.970  -2.995  5.672   1.00 0.00 ? 20  LYS A C    7  
ATOM   4095  O  O    . LYS A 1 20 ? -1.057  -2.710  4.477   1.00 0.00 ? 20  LYS A O    7  
ATOM   4096  C  CB   . LYS A 1 20 ? 0.699   -1.771  7.077   1.00 0.00 ? 20  LYS A CB   7  
ATOM   4097  C  CG   . LYS A 1 20 ? 0.076   -1.674  8.459   1.00 0.00 ? 20  LYS A CG   7  
ATOM   4098  C  CD   . LYS A 1 20 ? 0.635   -0.498  9.241   1.00 0.00 ? 20  LYS A CD   7  
ATOM   4099  C  CE   . LYS A 1 20 ? 0.420   -0.670  10.737  1.00 0.00 ? 20  LYS A CE   7  
ATOM   4100  N  NZ   . LYS A 1 20 ? 1.501   -1.483  11.362  1.00 0.00 ? 20  LYS A NZ   7  
ATOM   4101  H  H    . LYS A 1 20 ? 1.820   -2.665  4.853   1.00 0.00 ? 20  LYS A H    7  
ATOM   4102  H  HA   . LYS A 1 20 ? 0.363   -3.886  7.081   1.00 0.00 ? 20  LYS A HA   7  
ATOM   4103  H  HB2  . LYS A 1 20 ? 1.770   -1.674  7.180   1.00 0.00 ? 20  LYS A HB2  7  
ATOM   4104  H  HB3  . LYS A 1 20 ? 0.328   -0.951  6.479   1.00 0.00 ? 20  LYS A HB3  7  
ATOM   4105  H  HG2  . LYS A 1 20 ? -0.991  -1.549  8.355   1.00 0.00 ? 20  LYS A HG2  7  
ATOM   4106  H  HG3  . LYS A 1 20 ? 0.282   -2.586  9.001   1.00 0.00 ? 20  LYS A HG3  7  
ATOM   4107  H  HD2  . LYS A 1 20 ? 1.695   -0.419  9.048   1.00 0.00 ? 20  LYS A HD2  7  
ATOM   4108  H  HD3  . LYS A 1 20 ? 0.140   0.407   8.917   1.00 0.00 ? 20  LYS A HD3  7  
ATOM   4109  H  HE2  . LYS A 1 20 ? 0.401   0.305   11.199  1.00 0.00 ? 20  LYS A HE2  7  
ATOM   4110  H  HE3  . LYS A 1 20 ? -0.527  -1.163  10.896  1.00 0.00 ? 20  LYS A HE3  7  
ATOM   4111  H  HZ1  . LYS A 1 20 ? 1.158   -2.445  11.556  1.00 0.00 ? 20  LYS A HZ1  7  
ATOM   4112  H  HZ2  . LYS A 1 20 ? 1.802   -1.047  12.257  1.00 0.00 ? 20  LYS A HZ2  7  
ATOM   4113  H  HZ3  . LYS A 1 20 ? 2.320   -1.539  10.724  1.00 0.00 ? 20  LYS A HZ3  7  
ATOM   4114  N  N    . VAL A 1 21 ? -2.029  -3.239  6.437   1.00 0.00 ? 21  VAL A N    7  
ATOM   4115  C  CA   . VAL A 1 21 ? -3.386  -3.182  5.904   1.00 0.00 ? 21  VAL A CA   7  
ATOM   4116  C  C    . VAL A 1 21 ? -4.175  -2.039  6.532   1.00 0.00 ? 21  VAL A C    7  
ATOM   4117  O  O    . VAL A 1 21 ? -4.144  -1.843  7.747   1.00 0.00 ? 21  VAL A O    7  
ATOM   4118  C  CB   . VAL A 1 21 ? -4.139  -4.504  6.144   1.00 0.00 ? 21  VAL A CB   7  
ATOM   4119  C  CG1  . VAL A 1 21 ? -5.544  -4.430  5.568   1.00 0.00 ? 21  VAL A CG1  7  
ATOM   4120  C  CG2  . VAL A 1 21 ? -3.368  -5.671  5.546   1.00 0.00 ? 21  VAL A CG2  7  
ATOM   4121  H  H    . VAL A 1 21 ? -1.896  -3.461  7.382   1.00 0.00 ? 21  VAL A H    7  
ATOM   4122  H  HA   . VAL A 1 21 ? -3.319  -3.018  4.838   1.00 0.00 ? 21  VAL A HA   7  
ATOM   4123  H  HB   . VAL A 1 21 ? -4.218  -4.661  7.210   1.00 0.00 ? 21  VAL A HB   7  
ATOM   4124  H  HG11 . VAL A 1 21 ? -5.901  -3.412  5.620   1.00 0.00 ? 21  VAL A HG11 7  
ATOM   4125  H  HG12 . VAL A 1 21 ? -5.529  -4.755  4.538   1.00 0.00 ? 21  VAL A HG12 7  
ATOM   4126  H  HG13 . VAL A 1 21 ? -6.201  -5.071  6.138   1.00 0.00 ? 21  VAL A HG13 7  
ATOM   4127  H  HG21 . VAL A 1 21 ? -4.062  -6.377  5.113   1.00 0.00 ? 21  VAL A HG21 7  
ATOM   4128  H  HG22 . VAL A 1 21 ? -2.701  -5.306  4.779   1.00 0.00 ? 21  VAL A HG22 7  
ATOM   4129  H  HG23 . VAL A 1 21 ? -2.794  -6.159  6.320   1.00 0.00 ? 21  VAL A HG23 7  
ATOM   4130  N  N    . PHE A 1 22 ? -4.883  -1.287  5.696   1.00 0.00 ? 22  PHE A N    7  
ATOM   4131  C  CA   . PHE A 1 22 ? -5.681  -0.162  6.169   1.00 0.00 ? 22  PHE A CA   7  
ATOM   4132  C  C    . PHE A 1 22 ? -7.117  -0.263  5.663   1.00 0.00 ? 22  PHE A C    7  
ATOM   4133  O  O    . PHE A 1 22 ? -7.356  -0.505  4.479   1.00 0.00 ? 22  PHE A O    7  
ATOM   4134  C  CB   . PHE A 1 22 ? -5.060  1.160   5.712   1.00 0.00 ? 22  PHE A CB   7  
ATOM   4135  C  CG   . PHE A 1 22 ? -3.680  1.394   6.258   1.00 0.00 ? 22  PHE A CG   7  
ATOM   4136  C  CD1  . PHE A 1 22 ? -2.568  0.884   5.607   1.00 0.00 ? 22  PHE A CD1  7  
ATOM   4137  C  CD2  . PHE A 1 22 ? -3.495  2.124   7.421   1.00 0.00 ? 22  PHE A CD2  7  
ATOM   4138  C  CE1  . PHE A 1 22 ? -1.298  1.097   6.107   1.00 0.00 ? 22  PHE A CE1  7  
ATOM   4139  C  CE2  . PHE A 1 22 ? -2.227  2.341   7.925   1.00 0.00 ? 22  PHE A CE2  7  
ATOM   4140  C  CZ   . PHE A 1 22 ? -1.127  1.827   7.267   1.00 0.00 ? 22  PHE A CZ   7  
ATOM   4141  H  H    . PHE A 1 22 ? -4.867  -1.493  4.738   1.00 0.00 ? 22  PHE A H    7  
ATOM   4142  H  HA   . PHE A 1 22 ? -5.689  -0.192  7.248   1.00 0.00 ? 22  PHE A HA   7  
ATOM   4143  H  HB2  . PHE A 1 22 ? -4.995  1.166   4.635   1.00 0.00 ? 22  PHE A HB2  7  
ATOM   4144  H  HB3  . PHE A 1 22 ? -5.689  1.976   6.036   1.00 0.00 ? 22  PHE A HB3  7  
ATOM   4145  H  HD1  . PHE A 1 22 ? -2.700  0.313   4.699   1.00 0.00 ? 22  PHE A HD1  7  
ATOM   4146  H  HD2  . PHE A 1 22 ? -4.356  2.526   7.936   1.00 0.00 ? 22  PHE A HD2  7  
ATOM   4147  H  HE1  . PHE A 1 22 ? -0.439  0.695   5.591   1.00 0.00 ? 22  PHE A HE1  7  
ATOM   4148  H  HE2  . PHE A 1 22 ? -2.097  2.912   8.833   1.00 0.00 ? 22  PHE A HE2  7  
ATOM   4149  H  HZ   . PHE A 1 22 ? -0.135  1.995   7.660   1.00 0.00 ? 22  PHE A HZ   7  
ATOM   4150  N  N    . THR A 1 23 ? -8.072  -0.077  6.569   1.00 0.00 ? 23  THR A N    7  
ATOM   4151  C  CA   . THR A 1 23 ? -9.485  -0.149  6.217   1.00 0.00 ? 23  THR A CA   7  
ATOM   4152  C  C    . THR A 1 23 ? -9.831  0.858   5.126   1.00 0.00 ? 23  THR A C    7  
ATOM   4153  O  O    . THR A 1 23 ? -10.502 0.523   4.149   1.00 0.00 ? 23  THR A O    7  
ATOM   4154  C  CB   . THR A 1 23 ? -10.383 0.109   7.442   1.00 0.00 ? 23  THR A CB   7  
ATOM   4155  O  OG1  . THR A 1 23 ? -9.963  -0.712  8.538   1.00 0.00 ? 23  THR A OG1  7  
ATOM   4156  C  CG2  . THR A 1 23 ? -11.840 -0.180  7.114   1.00 0.00 ? 23  THR A CG2  7  
ATOM   4157  H  H    . THR A 1 23 ? -7.819  0.113   7.497   1.00 0.00 ? 23  THR A H    7  
ATOM   4158  H  HA   . THR A 1 23 ? -9.687  -1.145  5.852   1.00 0.00 ? 23  THR A HA   7  
ATOM   4159  H  HB   . THR A 1 23 ? -10.292 1.148   7.724   1.00 0.00 ? 23  THR A HB   7  
ATOM   4160  H  HG1  . THR A 1 23 ? -10.039 -1.637  8.292   1.00 0.00 ? 23  THR A HG1  7  
ATOM   4161  H  HG21 . THR A 1 23 ? -12.196 0.540   6.393   1.00 0.00 ? 23  THR A HG21 7  
ATOM   4162  H  HG22 . THR A 1 23 ? -12.432 -0.110  8.015   1.00 0.00 ? 23  THR A HG22 7  
ATOM   4163  H  HG23 . THR A 1 23 ? -11.926 -1.175  6.703   1.00 0.00 ? 23  THR A HG23 7  
ATOM   4164  N  N    . HIS A 1 24 ? -9.370  2.093   5.299   1.00 0.00 ? 24  HIS A N    7  
ATOM   4165  C  CA   . HIS A 1 24 ? -9.631  3.149   4.327   1.00 0.00 ? 24  HIS A CA   7  
ATOM   4166  C  C    . HIS A 1 24 ? -8.458  3.302   3.363   1.00 0.00 ? 24  HIS A C    7  
ATOM   4167  O  O    . HIS A 1 24 ? -7.300  3.129   3.745   1.00 0.00 ? 24  HIS A O    7  
ATOM   4168  C  CB   . HIS A 1 24 ? -9.895  4.475   5.042   1.00 0.00 ? 24  HIS A CB   7  
ATOM   4169  C  CG   . HIS A 1 24 ? -10.827 5.381   4.298   1.00 0.00 ? 24  HIS A CG   7  
ATOM   4170  N  ND1  . HIS A 1 24 ? -10.393 6.350   3.419   1.00 0.00 ? 24  HIS A ND1  7  
ATOM   4171  C  CD2  . HIS A 1 24 ? -12.179 5.459   4.304   1.00 0.00 ? 24  HIS A CD2  7  
ATOM   4172  C  CE1  . HIS A 1 24 ? -11.436 6.987   2.919   1.00 0.00 ? 24  HIS A CE1  7  
ATOM   4173  N  NE2  . HIS A 1 24 ? -12.532 6.465   3.439   1.00 0.00 ? 24  HIS A NE2  7  
ATOM   4174  H  H    . HIS A 1 24 ? -8.842  2.298   6.098   1.00 0.00 ? 24  HIS A H    7  
ATOM   4175  H  HA   . HIS A 1 24 ? -10.509 2.872   3.764   1.00 0.00 ? 24  HIS A HA   7  
ATOM   4176  H  HB2  . HIS A 1 24 ? -10.331 4.274   6.010   1.00 0.00 ? 24  HIS A HB2  7  
ATOM   4177  H  HB3  . HIS A 1 24 ? -8.959  4.997   5.175   1.00 0.00 ? 24  HIS A HB3  7  
ATOM   4178  H  HD1  . HIS A 1 24 ? -9.459  6.544   3.197   1.00 0.00 ? 24  HIS A HD1  7  
ATOM   4179  H  HD2  . HIS A 1 24 ? -12.855 4.844   4.883   1.00 0.00 ? 24  HIS A HD2  7  
ATOM   4180  H  HE1  . HIS A 1 24 ? -11.401 7.797   2.205   1.00 0.00 ? 24  HIS A HE1  7  
ATOM   4181  N  N    . LYS A 1 25 ? -8.765  3.627   2.112   1.00 0.00 ? 25  LYS A N    7  
ATOM   4182  C  CA   . LYS A 1 25 ? -7.738  3.804   1.093   1.00 0.00 ? 25  LYS A CA   7  
ATOM   4183  C  C    . LYS A 1 25 ? -6.858  5.009   1.411   1.00 0.00 ? 25  LYS A C    7  
ATOM   4184  O  O    . LYS A 1 25 ? -5.631  4.908   1.427   1.00 0.00 ? 25  LYS A O    7  
ATOM   4185  C  CB   . LYS A 1 25 ? -8.382  3.979   -0.285  1.00 0.00 ? 25  LYS A CB   7  
ATOM   4186  C  CG   . LYS A 1 25 ? -7.376  4.164   -1.407  1.00 0.00 ? 25  LYS A CG   7  
ATOM   4187  C  CD   . LYS A 1 25 ? -8.025  3.997   -2.771  1.00 0.00 ? 25  LYS A CD   7  
ATOM   4188  C  CE   . LYS A 1 25 ? -7.026  4.224   -3.895  1.00 0.00 ? 25  LYS A CE   7  
ATOM   4189  N  NZ   . LYS A 1 25 ? -7.695  4.308   -5.223  1.00 0.00 ? 25  LYS A NZ   7  
ATOM   4190  H  H    . LYS A 1 25 ? -9.707  3.752   1.868   1.00 0.00 ? 25  LYS A H    7  
ATOM   4191  H  HA   . LYS A 1 25 ? -7.123  2.917   1.084   1.00 0.00 ? 25  LYS A HA   7  
ATOM   4192  H  HB2  . LYS A 1 25 ? -8.977  3.105   -0.504  1.00 0.00 ? 25  LYS A HB2  7  
ATOM   4193  H  HB3  . LYS A 1 25 ? -9.026  4.846   -0.260  1.00 0.00 ? 25  LYS A HB3  7  
ATOM   4194  H  HG2  . LYS A 1 25 ? -6.954  5.156   -1.340  1.00 0.00 ? 25  LYS A HG2  7  
ATOM   4195  H  HG3  . LYS A 1 25 ? -6.591  3.429   -1.300  1.00 0.00 ? 25  LYS A HG3  7  
ATOM   4196  H  HD2  . LYS A 1 25 ? -8.419  2.995   -2.852  1.00 0.00 ? 25  LYS A HD2  7  
ATOM   4197  H  HD3  . LYS A 1 25 ? -8.830  4.712   -2.867  1.00 0.00 ? 25  LYS A HD3  7  
ATOM   4198  H  HE2  . LYS A 1 25 ? -6.498  5.147   -3.709  1.00 0.00 ? 25  LYS A HE2  7  
ATOM   4199  H  HE3  . LYS A 1 25 ? -6.324  3.404   -3.906  1.00 0.00 ? 25  LYS A HE3  7  
ATOM   4200  H  HZ1  . LYS A 1 25 ? -8.410  5.063   -5.217  1.00 0.00 ? 25  LYS A HZ1  7  
ATOM   4201  H  HZ2  . LYS A 1 25 ? -8.161  3.405   -5.445  1.00 0.00 ? 25  LYS A HZ2  7  
ATOM   4202  H  HZ3  . LYS A 1 25 ? -6.994  4.514   -5.963  1.00 0.00 ? 25  LYS A HZ3  7  
ATOM   4203  N  N    . THR A 1 26 ? -7.493  6.149   1.664   1.00 0.00 ? 26  THR A N    7  
ATOM   4204  C  CA   . THR A 1 26 ? -6.768  7.373   1.982   1.00 0.00 ? 26  THR A CA   7  
ATOM   4205  C  C    . THR A 1 26 ? -5.780  7.147   3.121   1.00 0.00 ? 26  THR A C    7  
ATOM   4206  O  O    . THR A 1 26 ? -4.613  7.524   3.027   1.00 0.00 ? 26  THR A O    7  
ATOM   4207  C  CB   . THR A 1 26 ? -7.730  8.511   2.371   1.00 0.00 ? 26  THR A CB   7  
ATOM   4208  O  OG1  . THR A 1 26 ? -8.715  8.691   1.347   1.00 0.00 ? 26  THR A OG1  7  
ATOM   4209  C  CG2  . THR A 1 26 ? -6.971  9.812   2.584   1.00 0.00 ? 26  THR A CG2  7  
ATOM   4210  H  H    . THR A 1 26 ? -8.472  6.167   1.636   1.00 0.00 ? 26  THR A H    7  
ATOM   4211  H  HA   . THR A 1 26 ? -6.222  7.676   1.100   1.00 0.00 ? 26  THR A HA   7  
ATOM   4212  H  HB   . THR A 1 26 ? -8.225  8.245   3.293   1.00 0.00 ? 26  THR A HB   7  
ATOM   4213  H  HG1  . THR A 1 26 ? -9.557  8.339   1.647   1.00 0.00 ? 26  THR A HG1  7  
ATOM   4214  H  HG21 . THR A 1 26 ? -7.640  10.647  2.438   1.00 0.00 ? 26  THR A HG21 7  
ATOM   4215  H  HG22 . THR A 1 26 ? -6.158  9.875   1.877   1.00 0.00 ? 26  THR A HG22 7  
ATOM   4216  H  HG23 . THR A 1 26 ? -6.577  9.838   3.589   1.00 0.00 ? 26  THR A HG23 7  
ATOM   4217  N  N    . ASN A 1 27 ? -6.256  6.528   4.197   1.00 0.00 ? 27  ASN A N    7  
ATOM   4218  C  CA   . ASN A 1 27 ? -5.414  6.252   5.355   1.00 0.00 ? 27  ASN A CA   7  
ATOM   4219  C  C    . ASN A 1 27 ? -4.106  5.590   4.931   1.00 0.00 ? 27  ASN A C    7  
ATOM   4220  O  O    . ASN A 1 27 ? -3.031  5.951   5.411   1.00 0.00 ? 27  ASN A O    7  
ATOM   4221  C  CB   . ASN A 1 27 ? -6.155  5.354   6.348   1.00 0.00 ? 27  ASN A CB   7  
ATOM   4222  C  CG   . ASN A 1 27 ? -7.454  5.972   6.829   1.00 0.00 ? 27  ASN A CG   7  
ATOM   4223  O  OD1  . ASN A 1 27 ? -7.963  6.919   6.229   1.00 0.00 ? 27  ASN A OD1  7  
ATOM   4224  N  ND2  . ASN A 1 27 ? -7.996  5.437   7.916   1.00 0.00 ? 27  ASN A ND2  7  
ATOM   4225  H  H    . ASN A 1 27 ? -7.196  6.251   4.213   1.00 0.00 ? 27  ASN A H    7  
ATOM   4226  H  HA   . ASN A 1 27 ? -5.189  7.193   5.833   1.00 0.00 ? 27  ASN A HA   7  
ATOM   4227  H  HB2  . ASN A 1 27 ? -6.382  4.411   5.871   1.00 0.00 ? 27  ASN A HB2  7  
ATOM   4228  H  HB3  . ASN A 1 27 ? -5.523  5.176   7.205   1.00 0.00 ? 27  ASN A HB3  7  
ATOM   4229  H  HD21 . ASN A 1 27 ? -7.534  4.684   8.342   1.00 0.00 ? 27  ASN A HD21 7  
ATOM   4230  H  HD22 . ASN A 1 27 ? -8.836  5.817   8.249   1.00 0.00 ? 27  ASN A HD22 7  
ATOM   4231  N  N    . LEU A 1 28 ? -4.206  4.620   4.029   1.00 0.00 ? 28  LEU A N    7  
ATOM   4232  C  CA   . LEU A 1 28 ? -3.032  3.907   3.538   1.00 0.00 ? 28  LEU A CA   7  
ATOM   4233  C  C    . LEU A 1 28 ? -2.074  4.859   2.829   1.00 0.00 ? 28  LEU A C    7  
ATOM   4234  O  O    . LEU A 1 28 ? -0.880  4.892   3.130   1.00 0.00 ? 28  LEU A O    7  
ATOM   4235  C  CB   . LEU A 1 28 ? -3.452  2.786   2.587   1.00 0.00 ? 28  LEU A CB   7  
ATOM   4236  C  CG   . LEU A 1 28 ? -2.341  2.186   1.724   1.00 0.00 ? 28  LEU A CG   7  
ATOM   4237  C  CD1  . LEU A 1 28 ? -1.480  1.239   2.545   1.00 0.00 ? 28  LEU A CD1  7  
ATOM   4238  C  CD2  . LEU A 1 28 ? -2.930  1.467   0.520   1.00 0.00 ? 28  LEU A CD2  7  
ATOM   4239  H  H    . LEU A 1 28 ? -5.090  4.377   3.683   1.00 0.00 ? 28  LEU A H    7  
ATOM   4240  H  HA   . LEU A 1 28 ? -2.527  3.476   4.390   1.00 0.00 ? 28  LEU A HA   7  
ATOM   4241  H  HB2  . LEU A 1 28 ? -3.875  1.990   3.180   1.00 0.00 ? 28  LEU A HB2  7  
ATOM   4242  H  HB3  . LEU A 1 28 ? -4.209  3.181   1.925   1.00 0.00 ? 28  LEU A HB3  7  
ATOM   4243  H  HG   . LEU A 1 28 ? -1.706  2.983   1.361   1.00 0.00 ? 28  LEU A HG   7  
ATOM   4244  H  HD11 . LEU A 1 28 ? -1.393  1.613   3.553   1.00 0.00 ? 28  LEU A HD11 7  
ATOM   4245  H  HD12 . LEU A 1 28 ? -0.498  1.169   2.101   1.00 0.00 ? 28  LEU A HD12 7  
ATOM   4246  H  HD13 . LEU A 1 28 ? -1.937  0.260   2.561   1.00 0.00 ? 28  LEU A HD13 7  
ATOM   4247  H  HD21 . LEU A 1 28 ? -3.078  0.424   0.760   1.00 0.00 ? 28  LEU A HD21 7  
ATOM   4248  H  HD22 . LEU A 1 28 ? -2.252  1.551   -0.317  1.00 0.00 ? 28  LEU A HD22 7  
ATOM   4249  H  HD23 . LEU A 1 28 ? -3.879  1.915   0.261   1.00 0.00 ? 28  LEU A HD23 7  
ATOM   4250  N  N    . ILE A 1 29 ? -2.605  5.633   1.889   1.00 0.00 ? 29  ILE A N    7  
ATOM   4251  C  CA   . ILE A 1 29 ? -1.797  6.588   1.140   1.00 0.00 ? 29  ILE A CA   7  
ATOM   4252  C  C    . ILE A 1 29 ? -0.989  7.479   2.077   1.00 0.00 ? 29  ILE A C    7  
ATOM   4253  O  O    . ILE A 1 29 ? 0.180   7.768   1.820   1.00 0.00 ? 29  ILE A O    7  
ATOM   4254  C  CB   . ILE A 1 29 ? -2.671  7.474   0.233   1.00 0.00 ? 29  ILE A CB   7  
ATOM   4255  C  CG1  . ILE A 1 29 ? -3.451  6.612   -0.762  1.00 0.00 ? 29  ILE A CG1  7  
ATOM   4256  C  CG2  . ILE A 1 29 ? -1.810  8.492   -0.501  1.00 0.00 ? 29  ILE A CG2  7  
ATOM   4257  C  CD1  . ILE A 1 29 ? -4.661  7.307   -1.345  1.00 0.00 ? 29  ILE A CD1  7  
ATOM   4258  H  H    . ILE A 1 29 ? -3.562  5.560   1.694   1.00 0.00 ? 29  ILE A H    7  
ATOM   4259  H  HA   . ILE A 1 29 ? -1.116  6.029   0.515   1.00 0.00 ? 29  ILE A HA   7  
ATOM   4260  H  HB   . ILE A 1 29 ? -3.369  8.012   0.857   1.00 0.00 ? 29  ILE A HB   7  
ATOM   4261  H  HG12 . ILE A 1 29 ? -2.801  6.339   -1.578  1.00 0.00 ? 29  ILE A HG12 7  
ATOM   4262  H  HG13 . ILE A 1 29 ? -3.790  5.717   -0.262  1.00 0.00 ? 29  ILE A HG13 7  
ATOM   4263  H  HG21 . ILE A 1 29 ? -1.383  9.182   0.212   1.00 0.00 ? 29  ILE A HG21 7  
ATOM   4264  H  HG22 . ILE A 1 29 ? -1.017  7.981   -1.025  1.00 0.00 ? 29  ILE A HG22 7  
ATOM   4265  H  HG23 . ILE A 1 29 ? -2.418  9.036   -1.208  1.00 0.00 ? 29  ILE A HG23 7  
ATOM   4266  H  HD11 . ILE A 1 29 ? -4.537  7.411   -2.413  1.00 0.00 ? 29  ILE A HD11 7  
ATOM   4267  H  HD12 . ILE A 1 29 ? -5.546  6.721   -1.141  1.00 0.00 ? 29  ILE A HD12 7  
ATOM   4268  H  HD13 . ILE A 1 29 ? -4.765  8.285   -0.899  1.00 0.00 ? 29  ILE A HD13 7  
ATOM   4269  N  N    . ILE A 1 30 ? -1.619  7.909   3.165   1.00 0.00 ? 30  ILE A N    7  
ATOM   4270  C  CA   . ILE A 1 30 ? -0.958  8.765   4.142   1.00 0.00 ? 30  ILE A CA   7  
ATOM   4271  C  C    . ILE A 1 30 ? 0.187   8.029   4.831   1.00 0.00 ? 30  ILE A C    7  
ATOM   4272  O  O    . ILE A 1 30 ? 1.248   8.603   5.077   1.00 0.00 ? 30  ILE A O    7  
ATOM   4273  C  CB   . ILE A 1 30 ? -1.947  9.268   5.210   1.00 0.00 ? 30  ILE A CB   7  
ATOM   4274  C  CG1  . ILE A 1 30 ? -3.078  10.063  4.555   1.00 0.00 ? 30  ILE A CG1  7  
ATOM   4275  C  CG2  . ILE A 1 30 ? -1.223  10.120  6.243   1.00 0.00 ? 30  ILE A CG2  7  
ATOM   4276  C  CD1  . ILE A 1 30 ? -4.305  10.200  5.430   1.00 0.00 ? 30  ILE A CD1  7  
ATOM   4277  H  H    . ILE A 1 30 ? -2.551  7.644   3.314   1.00 0.00 ? 30  ILE A H    7  
ATOM   4278  H  HA   . ILE A 1 30 ? -0.558  9.621   3.618   1.00 0.00 ? 30  ILE A HA   7  
ATOM   4279  H  HB   . ILE A 1 30 ? -2.364  8.410   5.715   1.00 0.00 ? 30  ILE A HB   7  
ATOM   4280  H  HG12 . ILE A 1 30 ? -2.725  11.055  4.322   1.00 0.00 ? 30  ILE A HG12 7  
ATOM   4281  H  HG13 . ILE A 1 30 ? -3.374  9.566   3.642   1.00 0.00 ? 30  ILE A HG13 7  
ATOM   4282  H  HG21 . ILE A 1 30 ? -0.168  9.888   6.224   1.00 0.00 ? 30  ILE A HG21 7  
ATOM   4283  H  HG22 . ILE A 1 30 ? -1.365  11.164  6.010   1.00 0.00 ? 30  ILE A HG22 7  
ATOM   4284  H  HG23 . ILE A 1 30 ? -1.620  9.911   7.224   1.00 0.00 ? 30  ILE A HG23 7  
ATOM   4285  H  HD11 . ILE A 1 30 ? -4.552  11.246  5.541   1.00 0.00 ? 30  ILE A HD11 7  
ATOM   4286  H  HD12 . ILE A 1 30 ? -5.134  9.682   4.971   1.00 0.00 ? 30  ILE A HD12 7  
ATOM   4287  H  HD13 . ILE A 1 30 ? -4.105  9.773   6.401   1.00 0.00 ? 30  ILE A HD13 7  
ATOM   4288  N  N    . HIS A 1 31 ? -0.036  6.755   5.138   1.00 0.00 ? 31  HIS A N    7  
ATOM   4289  C  CA   . HIS A 1 31 ? 0.978   5.940   5.797   1.00 0.00 ? 31  HIS A CA   7  
ATOM   4290  C  C    . HIS A 1 31 ? 2.172   5.709   4.876   1.00 0.00 ? 31  HIS A C    7  
ATOM   4291  O  O    . HIS A 1 31 ? 3.322   5.881   5.280   1.00 0.00 ? 31  HIS A O    7  
ATOM   4292  C  CB   . HIS A 1 31 ? 0.384   4.598   6.227   1.00 0.00 ? 31  HIS A CB   7  
ATOM   4293  C  CG   . HIS A 1 31 ? 1.390   3.490   6.292   1.00 0.00 ? 31  HIS A CG   7  
ATOM   4294  N  ND1  . HIS A 1 31 ? 1.915   3.019   7.477   1.00 0.00 ? 31  HIS A ND1  7  
ATOM   4295  C  CD2  . HIS A 1 31 ? 1.966   2.759   5.310   1.00 0.00 ? 31  HIS A CD2  7  
ATOM   4296  C  CE1  . HIS A 1 31 ? 2.772   2.047   7.220   1.00 0.00 ? 31  HIS A CE1  7  
ATOM   4297  N  NE2  . HIS A 1 31 ? 2.821   1.869   5.912   1.00 0.00 ? 31  HIS A NE2  7  
ATOM   4298  H  H    . HIS A 1 31 ? -0.902  6.354   4.916   1.00 0.00 ? 31  HIS A H    7  
ATOM   4299  H  HA   . HIS A 1 31 ? 1.314   6.472   6.674   1.00 0.00 ? 31  HIS A HA   7  
ATOM   4300  H  HB2  . HIS A 1 31 ? -0.055  4.704   7.208   1.00 0.00 ? 31  HIS A HB2  7  
ATOM   4301  H  HB3  . HIS A 1 31 ? -0.383  4.310   5.523   1.00 0.00 ? 31  HIS A HB3  7  
ATOM   4302  H  HD1  . HIS A 1 31 ? 1.694   3.350   8.372   1.00 0.00 ? 31  HIS A HD1  7  
ATOM   4303  H  HD2  . HIS A 1 31 ? 1.787   2.856   4.248   1.00 0.00 ? 31  HIS A HD2  7  
ATOM   4304  H  HE1  . HIS A 1 31 ? 3.336   1.492   7.954   1.00 0.00 ? 31  HIS A HE1  7  
ATOM   4305  N  N    . GLN A 1 32 ? 1.891   5.317   3.637   1.00 0.00 ? 32  GLN A N    7  
ATOM   4306  C  CA   . GLN A 1 32 ? 2.942   5.061   2.660   1.00 0.00 ? 32  GLN A CA   7  
ATOM   4307  C  C    . GLN A 1 32 ? 3.955   6.201   2.638   1.00 0.00 ? 32  GLN A C    7  
ATOM   4308  O  O    . GLN A 1 32 ? 5.086   6.033   2.182   1.00 0.00 ? 32  GLN A O    7  
ATOM   4309  C  CB   . GLN A 1 32 ? 2.339   4.872   1.267   1.00 0.00 ? 32  GLN A CB   7  
ATOM   4310  C  CG   . GLN A 1 32 ? 1.676   3.518   1.069   1.00 0.00 ? 32  GLN A CG   7  
ATOM   4311  C  CD   . GLN A 1 32 ? 0.813   3.467   -0.176  1.00 0.00 ? 32  GLN A CD   7  
ATOM   4312  O  OE1  . GLN A 1 32 ? -0.198  4.164   -0.273  1.00 0.00 ? 32  GLN A OE1  7  
ATOM   4313  N  NE2  . GLN A 1 32 ? 1.208   2.641   -1.137  1.00 0.00 ? 32  GLN A NE2  7  
ATOM   4314  H  H    . GLN A 1 32 ? 0.955   5.196   3.375   1.00 0.00 ? 32  GLN A H    7  
ATOM   4315  H  HA   . GLN A 1 32 ? 3.449   4.152   2.949   1.00 0.00 ? 32  GLN A HA   7  
ATOM   4316  H  HB2  . GLN A 1 32 ? 1.597   5.640   1.103   1.00 0.00 ? 32  GLN A HB2  7  
ATOM   4317  H  HB3  . GLN A 1 32 ? 3.122   4.976   0.531   1.00 0.00 ? 32  GLN A HB3  7  
ATOM   4318  H  HG2  . GLN A 1 32 ? 2.445   2.764   0.986   1.00 0.00 ? 32  GLN A HG2  7  
ATOM   4319  H  HG3  . GLN A 1 32 ? 1.057   3.306   1.928   1.00 0.00 ? 32  GLN A HG3  7  
ATOM   4320  H  HE21 . GLN A 1 32 ? 2.023   2.116   -0.989  1.00 0.00 ? 32  GLN A HE21 7  
ATOM   4321  H  HE22 . GLN A 1 32 ? 0.668   2.587   -1.952  1.00 0.00 ? 32  GLN A HE22 7  
ATOM   4322  N  N    . LYS A 1 33 ? 3.541   7.362   3.134   1.00 0.00 ? 33  LYS A N    7  
ATOM   4323  C  CA   . LYS A 1 33 ? 4.411   8.532   3.173   1.00 0.00 ? 33  LYS A CA   7  
ATOM   4324  C  C    . LYS A 1 33 ? 5.720   8.212   3.889   1.00 0.00 ? 33  LYS A C    7  
ATOM   4325  O  O    . LYS A 1 33 ? 6.770   8.764   3.557   1.00 0.00 ? 33  LYS A O    7  
ATOM   4326  C  CB   . LYS A 1 33 ? 3.705   9.695   3.874   1.00 0.00 ? 33  LYS A CB   7  
ATOM   4327  C  CG   . LYS A 1 33 ? 2.420   10.127  3.190   1.00 0.00 ? 33  LYS A CG   7  
ATOM   4328  C  CD   . LYS A 1 33 ? 2.683   11.160  2.108   1.00 0.00 ? 33  LYS A CD   7  
ATOM   4329  C  CE   . LYS A 1 33 ? 1.431   11.961  1.785   1.00 0.00 ? 33  LYS A CE   7  
ATOM   4330  N  NZ   . LYS A 1 33 ? 0.350   11.099  1.230   1.00 0.00 ? 33  LYS A NZ   7  
ATOM   4331  H  H    . LYS A 1 33 ? 2.628   7.434   3.484   1.00 0.00 ? 33  LYS A H    7  
ATOM   4332  H  HA   . LYS A 1 33 ? 4.631   8.816   2.155   1.00 0.00 ? 33  LYS A HA   7  
ATOM   4333  H  HB2  . LYS A 1 33 ? 3.469   9.400   4.886   1.00 0.00 ? 33  LYS A HB2  7  
ATOM   4334  H  HB3  . LYS A 1 33 ? 4.376   10.542  3.902   1.00 0.00 ? 33  LYS A HB3  7  
ATOM   4335  H  HG2  . LYS A 1 33 ? 1.954   9.262   2.741   1.00 0.00 ? 33  LYS A HG2  7  
ATOM   4336  H  HG3  . LYS A 1 33 ? 1.756   10.553  3.929   1.00 0.00 ? 33  LYS A HG3  7  
ATOM   4337  H  HD2  . LYS A 1 33 ? 3.452   11.838  2.449   1.00 0.00 ? 33  LYS A HD2  7  
ATOM   4338  H  HD3  . LYS A 1 33 ? 3.018   10.655  1.214   1.00 0.00 ? 33  LYS A HD3  7  
ATOM   4339  H  HE2  . LYS A 1 33 ? 1.076   12.430  2.689   1.00 0.00 ? 33  LYS A HE2  7  
ATOM   4340  H  HE3  . LYS A 1 33 ? 1.683   12.720  1.059   1.00 0.00 ? 33  LYS A HE3  7  
ATOM   4341  H  HZ1  . LYS A 1 33 ? 0.350   10.175  1.706   1.00 0.00 ? 33  LYS A HZ1  7  
ATOM   4342  H  HZ2  . LYS A 1 33 ? 0.499   10.953  0.211   1.00 0.00 ? 33  LYS A HZ2  7  
ATOM   4343  H  HZ3  . LYS A 1 33 ? -0.575  11.551  1.373   1.00 0.00 ? 33  LYS A HZ3  7  
ATOM   4344  N  N    . ILE A 1 34 ? 5.650   7.318   4.869   1.00 0.00 ? 34  ILE A N    7  
ATOM   4345  C  CA   . ILE A 1 34 ? 6.831   6.925   5.629   1.00 0.00 ? 34  ILE A CA   7  
ATOM   4346  C  C    . ILE A 1 34 ? 7.863   6.252   4.730   1.00 0.00 ? 34  ILE A C    7  
ATOM   4347  O  O    . ILE A 1 34 ? 9.000   6.017   5.141   1.00 0.00 ? 34  ILE A O    7  
ATOM   4348  C  CB   . ILE A 1 34 ? 6.466   5.968   6.779   1.00 0.00 ? 34  ILE A CB   7  
ATOM   4349  C  CG1  . ILE A 1 34 ? 6.067   4.598   6.226   1.00 0.00 ? 34  ILE A CG1  7  
ATOM   4350  C  CG2  . ILE A 1 34 ? 5.341   6.554   7.619   1.00 0.00 ? 34  ILE A CG2  7  
ATOM   4351  C  CD1  . ILE A 1 34 ? 5.954   3.527   7.288   1.00 0.00 ? 34  ILE A CD1  7  
ATOM   4352  H  H    . ILE A 1 34 ? 4.785   6.914   5.087   1.00 0.00 ? 34  ILE A H    7  
ATOM   4353  H  HA   . ILE A 1 34 ? 7.266   7.817   6.054   1.00 0.00 ? 34  ILE A HA   7  
ATOM   4354  H  HB   . ILE A 1 34 ? 7.333   5.854   7.412   1.00 0.00 ? 34  ILE A HB   7  
ATOM   4355  H  HG12 . ILE A 1 34 ? 5.110   4.680   5.735   1.00 0.00 ? 34  ILE A HG12 7  
ATOM   4356  H  HG13 . ILE A 1 34 ? 6.809   4.278   5.509   1.00 0.00 ? 34  ILE A HG13 7  
ATOM   4357  H  HG21 . ILE A 1 34 ? 5.715   7.395   8.185   1.00 0.00 ? 34  ILE A HG21 7  
ATOM   4358  H  HG22 . ILE A 1 34 ? 4.543   6.884   6.972   1.00 0.00 ? 34  ILE A HG22 7  
ATOM   4359  H  HG23 . ILE A 1 34 ? 4.968   5.801   8.297   1.00 0.00 ? 34  ILE A HG23 7  
ATOM   4360  H  HD11 . ILE A 1 34 ? 6.670   2.743   7.086   1.00 0.00 ? 34  ILE A HD11 7  
ATOM   4361  H  HD12 . ILE A 1 34 ? 6.157   3.958   8.257   1.00 0.00 ? 34  ILE A HD12 7  
ATOM   4362  H  HD13 . ILE A 1 34 ? 4.957   3.114   7.278   1.00 0.00 ? 34  ILE A HD13 7  
ATOM   4363  N  N    . HIS A 1 35 ? 7.460   5.945   3.501   1.00 0.00 ? 35  HIS A N    7  
ATOM   4364  C  CA   . HIS A 1 35 ? 8.351   5.301   2.543   1.00 0.00 ? 35  HIS A CA   7  
ATOM   4365  C  C    . HIS A 1 35 ? 8.672   6.239   1.384   1.00 0.00 ? 35  HIS A C    7  
ATOM   4366  O  O    . HIS A 1 35 ? 9.769   6.200   0.825   1.00 0.00 ? 35  HIS A O    7  
ATOM   4367  C  CB   . HIS A 1 35 ? 7.718   4.014   2.012   1.00 0.00 ? 35  HIS A CB   7  
ATOM   4368  C  CG   . HIS A 1 35 ? 7.243   3.090   3.091   1.00 0.00 ? 35  HIS A CG   7  
ATOM   4369  N  ND1  . HIS A 1 35 ? 8.093   2.488   3.994   1.00 0.00 ? 35  HIS A ND1  7  
ATOM   4370  C  CD2  . HIS A 1 35 ? 5.998   2.668   3.409   1.00 0.00 ? 35  HIS A CD2  7  
ATOM   4371  C  CE1  . HIS A 1 35 ? 7.391   1.734   4.821   1.00 0.00 ? 35  HIS A CE1  7  
ATOM   4372  N  NE2  . HIS A 1 35 ? 6.116   1.826   4.488   1.00 0.00 ? 35  HIS A NE2  7  
ATOM   4373  H  H    . HIS A 1 35 ? 6.542   6.157   3.233   1.00 0.00 ? 35  HIS A H    7  
ATOM   4374  H  HA   . HIS A 1 35 ? 9.268   5.055   3.056   1.00 0.00 ? 35  HIS A HA   7  
ATOM   4375  H  HB2  . HIS A 1 35 ? 6.869   4.267   1.394   1.00 0.00 ? 35  HIS A HB2  7  
ATOM   4376  H  HB3  . HIS A 1 35 ? 8.446   3.482   1.415   1.00 0.00 ? 35  HIS A HB3  7  
ATOM   4377  H  HD1  . HIS A 1 35 ? 9.067   2.596   4.024   1.00 0.00 ? 35  HIS A HD1  7  
ATOM   4378  H  HD2  . HIS A 1 35 ? 5.079   2.941   2.909   1.00 0.00 ? 35  HIS A HD2  7  
ATOM   4379  H  HE1  . HIS A 1 35 ? 7.791   1.143   5.631   1.00 0.00 ? 35  HIS A HE1  7  
ATOM   4380  N  N    . THR A 1 36 ? 7.709   7.084   1.028   1.00 0.00 ? 36  THR A N    7  
ATOM   4381  C  CA   . THR A 1 36 ? 7.889   8.031   -0.065  1.00 0.00 ? 36  THR A CA   7  
ATOM   4382  C  C    . THR A 1 36 ? 9.204   8.789   0.075   1.00 0.00 ? 36  THR A C    7  
ATOM   4383  O  O    . THR A 1 36 ? 9.352   9.637   0.954   1.00 0.00 ? 36  THR A O    7  
ATOM   4384  C  CB   . THR A 1 36 ? 6.730   9.043   -0.127  1.00 0.00 ? 36  THR A CB   7  
ATOM   4385  O  OG1  . THR A 1 36 ? 6.736   9.868   1.043   1.00 0.00 ? 36  THR A OG1  7  
ATOM   4386  C  CG2  . THR A 1 36 ? 5.392   8.328   -0.242  1.00 0.00 ? 36  THR A CG2  7  
ATOM   4387  H  H    . THR A 1 36 ? 6.857   7.067   1.512   1.00 0.00 ? 36  THR A H    7  
ATOM   4388  H  HA   . THR A 1 36 ? 7.903   7.474   -0.991  1.00 0.00 ? 36  THR A HA   7  
ATOM   4389  H  HB   . THR A 1 36 ? 6.863   9.668   -0.999  1.00 0.00 ? 36  THR A HB   7  
ATOM   4390  H  HG1  . THR A 1 36 ? 5.894   10.323  1.119   1.00 0.00 ? 36  THR A HG1  7  
ATOM   4391  H  HG21 . THR A 1 36 ? 4.593   9.052   -0.204  1.00 0.00 ? 36  THR A HG21 7  
ATOM   4392  H  HG22 . THR A 1 36 ? 5.285   7.631   0.576   1.00 0.00 ? 36  THR A HG22 7  
ATOM   4393  H  HG23 . THR A 1 36 ? 5.349   7.793   -1.179  1.00 0.00 ? 36  THR A HG23 7  
ATOM   4394  N  N    . GLY A 1 37 ? 10.157  8.479   -0.799  1.00 0.00 ? 37  GLY A N    7  
ATOM   4395  C  CA   . GLY A 1 37 ? 11.447  9.141   -0.755  1.00 0.00 ? 37  GLY A CA   7  
ATOM   4396  C  C    . GLY A 1 37 ? 11.352  10.619  -1.077  1.00 0.00 ? 37  GLY A C    7  
ATOM   4397  O  O    . GLY A 1 37 ? 10.421  11.054  -1.755  1.00 0.00 ? 37  GLY A O    7  
ATOM   4398  H  H    . GLY A 1 37 ? 9.982   7.795   -1.479  1.00 0.00 ? 37  GLY A H    7  
ATOM   4399  H  HA2  . GLY A 1 37 ? 11.866  9.025   0.233   1.00 0.00 ? 37  GLY A HA2  7  
ATOM   4400  H  HA3  . GLY A 1 37 ? 12.105  8.671   -1.471  1.00 0.00 ? 37  GLY A HA3  7  
ATOM   4401  N  N    . GLU A 1 38 ? 12.316  11.394  -0.590  1.00 0.00 ? 38  GLU A N    7  
ATOM   4402  C  CA   . GLU A 1 38 ? 12.334  12.832  -0.828  1.00 0.00 ? 38  GLU A CA   7  
ATOM   4403  C  C    . GLU A 1 38 ? 13.684  13.274  -1.386  1.00 0.00 ? 38  GLU A C    7  
ATOM   4404  O  O    . GLU A 1 38 ? 14.219  14.311  -0.995  1.00 0.00 ? 38  GLU A O    7  
ATOM   4405  C  CB   . GLU A 1 38 ? 12.032  13.590  0.466   1.00 0.00 ? 38  GLU A CB   7  
ATOM   4406  C  CG   . GLU A 1 38 ? 13.053  13.350  1.565   1.00 0.00 ? 38  GLU A CG   7  
ATOM   4407  C  CD   . GLU A 1 38 ? 12.721  12.139  2.416   1.00 0.00 ? 38  GLU A CD   7  
ATOM   4408  O  OE1  . GLU A 1 38 ? 11.520  11.876  2.631   1.00 0.00 ? 38  GLU A OE1  7  
ATOM   4409  O  OE2  . GLU A 1 38 ? 13.664  11.454  2.865   1.00 0.00 ? 38  GLU A OE2  7  
ATOM   4410  H  H    . GLU A 1 38 ? 13.031  10.988  -0.057  1.00 0.00 ? 38  GLU A H    7  
ATOM   4411  H  HA   . GLU A 1 38 ? 11.567  13.057  -1.554  1.00 0.00 ? 38  GLU A HA   7  
ATOM   4412  H  HB2  . GLU A 1 38 ? 12.006  14.648  0.252   1.00 0.00 ? 38  GLU A HB2  7  
ATOM   4413  H  HB3  . GLU A 1 38 ? 11.063  13.282  0.831   1.00 0.00 ? 38  GLU A HB3  7  
ATOM   4414  H  HG2  . GLU A 1 38 ? 14.021  13.197  1.112   1.00 0.00 ? 38  GLU A HG2  7  
ATOM   4415  H  HG3  . GLU A 1 38 ? 13.088  14.220  2.203   1.00 0.00 ? 38  GLU A HG3  7  
ATOM   4416  N  N    . ARG A 1 39 ? 14.229  12.479  -2.301  1.00 0.00 ? 39  ARG A N    7  
ATOM   4417  C  CA   . ARG A 1 39 ? 15.516  12.787  -2.912  1.00 0.00 ? 39  ARG A CA   7  
ATOM   4418  C  C    . ARG A 1 39 ? 15.395  12.854  -4.431  1.00 0.00 ? 39  ARG A C    7  
ATOM   4419  O  O    . ARG A 1 39 ? 14.539  12.212  -5.039  1.00 0.00 ? 39  ARG A O    7  
ATOM   4420  C  CB   . ARG A 1 39 ? 16.555  11.735  -2.518  1.00 0.00 ? 39  ARG A CB   7  
ATOM   4421  C  CG   . ARG A 1 39 ? 16.169  10.319  -2.914  1.00 0.00 ? 39  ARG A CG   7  
ATOM   4422  C  CD   . ARG A 1 39 ? 17.306  9.341   -2.662  1.00 0.00 ? 39  ARG A CD   7  
ATOM   4423  N  NE   . ARG A 1 39 ? 16.820  7.978   -2.459  1.00 0.00 ? 39  ARG A NE   7  
ATOM   4424  C  CZ   . ARG A 1 39 ? 16.413  7.511   -1.285  1.00 0.00 ? 39  ARG A CZ   7  
ATOM   4425  N  NH1  . ARG A 1 39 ? 16.432  8.292   -0.213  1.00 0.00 ? 39  ARG A NH1  7  
ATOM   4426  N  NH2  . ARG A 1 39 ? 15.984  6.259   -1.180  1.00 0.00 ? 39  ARG A NH2  7  
ATOM   4427  H  H    . ARG A 1 39 ? 13.753  11.666  -2.572  1.00 0.00 ? 39  ARG A H    7  
ATOM   4428  H  HA   . ARG A 1 39 ? 15.836  13.751  -2.545  1.00 0.00 ? 39  ARG A HA   7  
ATOM   4429  H  HB2  . ARG A 1 39 ? 17.493  11.976  -2.997  1.00 0.00 ? 39  ARG A HB2  7  
ATOM   4430  H  HB3  . ARG A 1 39 ? 16.690  11.763  -1.447  1.00 0.00 ? 39  ARG A HB3  7  
ATOM   4431  H  HG2  . ARG A 1 39 ? 15.311  10.014  -2.332  1.00 0.00 ? 39  ARG A HG2  7  
ATOM   4432  H  HG3  . ARG A 1 39 ? 15.918  10.305  -3.964  1.00 0.00 ? 39  ARG A HG3  7  
ATOM   4433  H  HD2  . ARG A 1 39 ? 17.969  9.353   -3.514  1.00 0.00 ? 39  ARG A HD2  7  
ATOM   4434  H  HD3  . ARG A 1 39 ? 17.845  9.656   -1.781  1.00 0.00 ? 39  ARG A HD3  7  
ATOM   4435  H  HE   . ARG A 1 39 ? 16.797  7.384   -3.237  1.00 0.00 ? 39  ARG A HE   7  
ATOM   4436  H  HH11 . ARG A 1 39 ? 16.753  9.235   -0.290  1.00 0.00 ? 39  ARG A HH11 7  
ATOM   4437  H  HH12 . ARG A 1 39 ? 16.123  7.937   0.670   1.00 0.00 ? 39  ARG A HH12 7  
ATOM   4438  H  HH21 . ARG A 1 39 ? 15.968  5.667   -1.985  1.00 0.00 ? 39  ARG A HH21 7  
ATOM   4439  H  HH22 . ARG A 1 39 ? 15.678  5.908   -0.296  1.00 0.00 ? 39  ARG A HH22 7  
ATOM   4440  N  N    . PRO A 1 40 ? 16.273  13.650  -5.060  1.00 0.00 ? 40  PRO A N    7  
ATOM   4441  C  CA   . PRO A 1 40 ? 16.285  13.821  -6.516  1.00 0.00 ? 40  PRO A CA   7  
ATOM   4442  C  C    . PRO A 1 40 ? 16.754  12.565  -7.243  1.00 0.00 ? 40  PRO A C    7  
ATOM   4443  O  O    . PRO A 1 40 ? 16.108  12.102  -8.182  1.00 0.00 ? 40  PRO A O    7  
ATOM   4444  C  CB   . PRO A 1 40 ? 17.277  14.966  -6.731  1.00 0.00 ? 40  PRO A CB   7  
ATOM   4445  C  CG   . PRO A 1 40 ? 18.174  14.918  -5.542  1.00 0.00 ? 40  PRO A CG   7  
ATOM   4446  C  CD   . PRO A 1 40 ? 17.321  14.445  -4.398  1.00 0.00 ? 40  PRO A CD   7  
ATOM   4447  H  HA   . PRO A 1 40 ? 15.313  14.110  -6.890  1.00 0.00 ? 40  PRO A HA   7  
ATOM   4448  H  HB2  . PRO A 1 40 ? 17.826  14.803  -7.648  1.00 0.00 ? 40  PRO A HB2  7  
ATOM   4449  H  HB3  . PRO A 1 40 ? 16.745  15.904  -6.785  1.00 0.00 ? 40  PRO A HB3  7  
ATOM   4450  H  HG2  . PRO A 1 40 ? 18.982  14.224  -5.720  1.00 0.00 ? 40  PRO A HG2  7  
ATOM   4451  H  HG3  . PRO A 1 40 ? 18.564  15.904  -5.337  1.00 0.00 ? 40  PRO A HG3  7  
ATOM   4452  H  HD2  . PRO A 1 40 ? 17.900  13.834  -3.723  1.00 0.00 ? 40  PRO A HD2  7  
ATOM   4453  H  HD3  . PRO A 1 40 ? 16.892  15.287  -3.874  1.00 0.00 ? 40  PRO A HD3  7  
ATOM   4454  N  N    . SER A 1 41 ? 17.883  12.019  -6.802  1.00 0.00 ? 41  SER A N    7  
ATOM   4455  C  CA   . SER A 1 41 ? 18.440  10.818  -7.413  1.00 0.00 ? 41  SER A CA   7  
ATOM   4456  C  C    . SER A 1 41 ? 17.985  9.567   -6.668  1.00 0.00 ? 41  SER A C    7  
ATOM   4457  O  O    . SER A 1 41 ? 18.788  8.690   -6.354  1.00 0.00 ? 41  SER A O    7  
ATOM   4458  C  CB   . SER A 1 41 ? 19.968  10.889  -7.426  1.00 0.00 ? 41  SER A CB   7  
ATOM   4459  O  OG   . SER A 1 41 ? 20.425  11.875  -8.336  1.00 0.00 ? 41  SER A OG   7  
ATOM   4460  H  H    . SER A 1 41 ? 18.352  12.435  -6.049  1.00 0.00 ? 41  SER A H    7  
ATOM   4461  H  HA   . SER A 1 41 ? 18.082  10.767  -8.430  1.00 0.00 ? 41  SER A HA   7  
ATOM   4462  H  HB2  . SER A 1 41 ? 20.323  11.138  -6.437  1.00 0.00 ? 41  SER A HB2  7  
ATOM   4463  H  HB3  . SER A 1 41 ? 20.368  9.930   -7.721  1.00 0.00 ? 41  SER A HB3  7  
ATOM   4464  H  HG   . SER A 1 41 ? 20.044  11.712  -9.202  1.00 0.00 ? 41  SER A HG   7  
ATOM   4465  N  N    . GLY A 1 42 ? 16.687  9.493   -6.387  1.00 0.00 ? 42  GLY A N    7  
ATOM   4466  C  CA   . GLY A 1 42 ? 16.145  8.347   -5.681  1.00 0.00 ? 42  GLY A CA   7  
ATOM   4467  C  C    . GLY A 1 42 ? 15.601  7.290   -6.621  1.00 0.00 ? 42  GLY A C    7  
ATOM   4468  O  O    . GLY A 1 42 ? 15.626  7.444   -7.843  1.00 0.00 ? 42  GLY A O    7  
ATOM   4469  H  H    . GLY A 1 42 ? 16.093  10.222  -6.662  1.00 0.00 ? 42  GLY A H    7  
ATOM   4470  H  HA2  . GLY A 1 42 ? 16.925  7.908   -5.076  1.00 0.00 ? 42  GLY A HA2  7  
ATOM   4471  H  HA3  . GLY A 1 42 ? 15.348  8.681   -5.033  1.00 0.00 ? 42  GLY A HA3  7  
ATOM   4472  N  N    . PRO A 1 43 ? 15.095  6.187   -6.050  1.00 0.00 ? 43  PRO A N    7  
ATOM   4473  C  CA   . PRO A 1 43 ? 14.534  5.079   -6.828  1.00 0.00 ? 43  PRO A CA   7  
ATOM   4474  C  C    . PRO A 1 43 ? 13.217  5.452   -7.501  1.00 0.00 ? 43  PRO A C    7  
ATOM   4475  O  O    . PRO A 1 43 ? 12.140  5.179   -6.972  1.00 0.00 ? 43  PRO A O    7  
ATOM   4476  C  CB   . PRO A 1 43 ? 14.307  3.988   -5.778  1.00 0.00 ? 43  PRO A CB   7  
ATOM   4477  C  CG   . PRO A 1 43 ? 14.149  4.725   -4.493  1.00 0.00 ? 43  PRO A CG   7  
ATOM   4478  C  CD   . PRO A 1 43 ? 15.032  5.937   -4.600  1.00 0.00 ? 43  PRO A CD   7  
ATOM   4479  H  HA   . PRO A 1 43 ? 15.230  4.725   -7.573  1.00 0.00 ? 43  PRO A HA   7  
ATOM   4480  H  HB2  . PRO A 1 43 ? 13.417  3.427   -6.025  1.00 0.00 ? 43  PRO A HB2  7  
ATOM   4481  H  HB3  . PRO A 1 43 ? 15.160  3.327   -5.751  1.00 0.00 ? 43  PRO A HB3  7  
ATOM   4482  H  HG2  . PRO A 1 43 ? 13.119  5.022   -4.365  1.00 0.00 ? 43  PRO A HG2  7  
ATOM   4483  H  HG3  . PRO A 1 43 ? 14.467  4.101   -3.671  1.00 0.00 ? 43  PRO A HG3  7  
ATOM   4484  H  HD2  . PRO A 1 43 ? 14.588  6.775   -4.083  1.00 0.00 ? 43  PRO A HD2  7  
ATOM   4485  H  HD3  . PRO A 1 43 ? 16.014  5.724   -4.203  1.00 0.00 ? 43  PRO A HD3  7  
ATOM   4486  N  N    . SER A 1 44 ? 13.312  6.076   -8.671  1.00 0.00 ? 44  SER A N    7  
ATOM   4487  C  CA   . SER A 1 44 ? 12.128  6.489   -9.415  1.00 0.00 ? 44  SER A CA   7  
ATOM   4488  C  C    . SER A 1 44 ? 11.961  5.652   -10.679 1.00 0.00 ? 44  SER A C    7  
ATOM   4489  O  O    . SER A 1 44 ? 12.935  5.348   -11.369 1.00 0.00 ? 44  SER A O    7  
ATOM   4490  C  CB   . SER A 1 44 ? 12.221  7.972   -9.781  1.00 0.00 ? 44  SER A CB   7  
ATOM   4491  O  OG   . SER A 1 44 ? 10.945  8.501   -10.095 1.00 0.00 ? 44  SER A OG   7  
ATOM   4492  H  H    . SER A 1 44 ? 14.200  6.265   -9.041  1.00 0.00 ? 44  SER A H    7  
ATOM   4493  H  HA   . SER A 1 44 ? 11.268  6.337   -8.780  1.00 0.00 ? 44  SER A HA   7  
ATOM   4494  H  HB2  . SER A 1 44 ? 12.630  8.521   -8.946  1.00 0.00 ? 44  SER A HB2  7  
ATOM   4495  H  HB3  . SER A 1 44 ? 12.868  8.088   -10.639 1.00 0.00 ? 44  SER A HB3  7  
ATOM   4496  H  HG   . SER A 1 44 ? 10.351  8.368   -9.352  1.00 0.00 ? 44  SER A HG   7  
ATOM   4497  N  N    . SER A 1 45 ? 10.720  5.282   -10.977 1.00 0.00 ? 45  SER A N    7  
ATOM   4498  C  CA   . SER A 1 45 ? 10.424  4.476   -12.155 1.00 0.00 ? 45  SER A CA   7  
ATOM   4499  C  C    . SER A 1 45 ? 10.507  5.318   -13.424 1.00 0.00 ? 45  SER A C    7  
ATOM   4500  O  O    . SER A 1 45 ? 9.577   6.052   -13.757 1.00 0.00 ? 45  SER A O    7  
ATOM   4501  C  CB   . SER A 1 45 ? 9.034   3.849   -12.035 1.00 0.00 ? 45  SER A CB   7  
ATOM   4502  O  OG   . SER A 1 45 ? 8.916   2.705   -12.863 1.00 0.00 ? 45  SER A OG   7  
ATOM   4503  H  H    . SER A 1 45 ? 9.986   5.555   -10.388 1.00 0.00 ? 45  SER A H    7  
ATOM   4504  H  HA   . SER A 1 45 ? 11.161  3.688   -12.212 1.00 0.00 ? 45  SER A HA   7  
ATOM   4505  H  HB2  . SER A 1 45 ? 8.861   3.556   -11.011 1.00 0.00 ? 45  SER A HB2  7  
ATOM   4506  H  HB3  . SER A 1 45 ? 8.289   4.573   -12.333 1.00 0.00 ? 45  SER A HB3  7  
ATOM   4507  H  HG   . SER A 1 45 ? 9.199   1.927   -12.377 1.00 0.00 ? 45  SER A HG   7  
ATOM   4508  N  N    . GLY A 1 46 ? 11.629  5.207   -14.129 1.00 0.00 ? 46  GLY A N    7  
ATOM   4509  C  CA   . GLY A 1 46 ? 11.814  5.964   -15.354 1.00 0.00 ? 46  GLY A CA   7  
ATOM   4510  C  C    . GLY A 1 46 ? 12.378  7.348   -15.101 1.00 0.00 ? 46  GLY A C    7  
ATOM   4511  O  O    . GLY A 1 46 ? 11.604  8.293   -14.960 1.00 0.00 ? 46  GLY A O    7  
ATOM   4512  H  H    . GLY A 1 46 ? 12.337  4.606   -13.816 1.00 0.00 ? 46  GLY A H    7  
ATOM   4513  H  HA2  . GLY A 1 46 ? 12.490  5.423   -16.000 1.00 0.00 ? 46  GLY A HA2  7  
ATOM   4514  H  HA3  . GLY A 1 46 ? 10.859  6.062   -15.850 1.00 0.00 ? 46  GLY A HA3  7  
HETATM 4515  ZN ZN   . ZN  B 2 .  ? 4.239   0.927   4.687   1.00 0.00 ? 201 ZN  A ZN   7  
ATOM   4516  N  N    . GLY A 1 1  ? -0.114  -31.536 -1.598  1.00 0.00 ? 1   GLY A N    8  
ATOM   4517  C  CA   . GLY A 1 1  ? -0.737  -30.278 -1.227  1.00 0.00 ? 1   GLY A CA   8  
ATOM   4518  C  C    . GLY A 1 1  ? 0.274   -29.167 -1.029  1.00 0.00 ? 1   GLY A C    8  
ATOM   4519  O  O    . GLY A 1 1  ? 1.261   -29.079 -1.759  1.00 0.00 ? 1   GLY A O    8  
ATOM   4520  H  H1   . GLY A 1 1  ? -0.647  -32.235 -2.032  1.00 0.00 ? 1   GLY A H1   8  
ATOM   4521  H  HA2  . GLY A 1 1  ? -1.428  -29.988 -2.004  1.00 0.00 ? 1   GLY A HA2  8  
ATOM   4522  H  HA3  . GLY A 1 1  ? -1.285  -30.419 -0.306  1.00 0.00 ? 1   GLY A HA3  8  
ATOM   4523  N  N    . SER A 1 2  ? 0.028   -28.314 -0.040  1.00 0.00 ? 2   SER A N    8  
ATOM   4524  C  CA   . SER A 1 2  ? 0.922   -27.198 0.248   1.00 0.00 ? 2   SER A CA   8  
ATOM   4525  C  C    . SER A 1 2  ? 1.339   -26.491 -1.037  1.00 0.00 ? 2   SER A C    8  
ATOM   4526  O  O    . SER A 1 2  ? 2.503   -26.129 -1.210  1.00 0.00 ? 2   SER A O    8  
ATOM   4527  C  CB   . SER A 1 2  ? 2.161   -27.691 0.998   1.00 0.00 ? 2   SER A CB   8  
ATOM   4528  O  OG   . SER A 1 2  ? 2.912   -28.594 0.205   1.00 0.00 ? 2   SER A OG   8  
ATOM   4529  H  H    . SER A 1 2  ? -0.776  -28.436 0.507   1.00 0.00 ? 2   SER A H    8  
ATOM   4530  H  HA   . SER A 1 2  ? 0.388   -26.498 0.873   1.00 0.00 ? 2   SER A HA   8  
ATOM   4531  H  HB2  . SER A 1 2  ? 2.785   -26.848 1.250   1.00 0.00 ? 2   SER A HB2  8  
ATOM   4532  H  HB3  . SER A 1 2  ? 1.854   -28.195 1.903   1.00 0.00 ? 2   SER A HB3  8  
ATOM   4533  H  HG   . SER A 1 2  ? 3.805   -28.657 0.549   1.00 0.00 ? 2   SER A HG   8  
ATOM   4534  N  N    . SER A 1 3  ? 0.380   -26.296 -1.937  1.00 0.00 ? 3   SER A N    8  
ATOM   4535  C  CA   . SER A 1 3  ? 0.648   -25.636 -3.209  1.00 0.00 ? 3   SER A CA   8  
ATOM   4536  C  C    . SER A 1 3  ? -0.626  -25.018 -3.779  1.00 0.00 ? 3   SER A C    8  
ATOM   4537  O  O    . SER A 1 3  ? -1.697  -25.621 -3.729  1.00 0.00 ? 3   SER A O    8  
ATOM   4538  C  CB   . SER A 1 3  ? 1.238   -26.630 -4.210  1.00 0.00 ? 3   SER A CB   8  
ATOM   4539  O  OG   . SER A 1 3  ? 1.365   -26.046 -5.495  1.00 0.00 ? 3   SER A OG   8  
ATOM   4540  H  H    . SER A 1 3  ? -0.528  -26.608 -1.741  1.00 0.00 ? 3   SER A H    8  
ATOM   4541  H  HA   . SER A 1 3  ? 1.366   -24.849 -3.030  1.00 0.00 ? 3   SER A HA   8  
ATOM   4542  H  HB2  . SER A 1 3  ? 2.214   -26.942 -3.871  1.00 0.00 ? 3   SER A HB2  8  
ATOM   4543  H  HB3  . SER A 1 3  ? 0.590   -27.492 -4.282  1.00 0.00 ? 3   SER A HB3  8  
ATOM   4544  H  HG   . SER A 1 3  ? 0.630   -26.321 -6.047  1.00 0.00 ? 3   SER A HG   8  
ATOM   4545  N  N    . GLY A 1 4  ? -0.500  -23.811 -4.321  1.00 0.00 ? 4   GLY A N    8  
ATOM   4546  C  CA   . GLY A 1 4  ? -1.647  -23.130 -4.892  1.00 0.00 ? 4   GLY A CA   8  
ATOM   4547  C  C    . GLY A 1 4  ? -2.671  -22.740 -3.845  1.00 0.00 ? 4   GLY A C    8  
ATOM   4548  O  O    . GLY A 1 4  ? -3.483  -23.564 -3.424  1.00 0.00 ? 4   GLY A O    8  
ATOM   4549  H  H    . GLY A 1 4  ? 0.380   -23.378 -4.332  1.00 0.00 ? 4   GLY A H    8  
ATOM   4550  H  HA2  . GLY A 1 4  ? -1.308  -22.239 -5.399  1.00 0.00 ? 4   GLY A HA2  8  
ATOM   4551  H  HA3  . GLY A 1 4  ? -2.117  -23.785 -5.612  1.00 0.00 ? 4   GLY A HA3  8  
ATOM   4552  N  N    . SER A 1 5  ? -2.632  -21.481 -3.421  1.00 0.00 ? 5   SER A N    8  
ATOM   4553  C  CA   . SER A 1 5  ? -3.560  -20.985 -2.412  1.00 0.00 ? 5   SER A CA   8  
ATOM   4554  C  C    . SER A 1 5  ? -4.866  -20.526 -3.053  1.00 0.00 ? 5   SER A C    8  
ATOM   4555  O  O    . SER A 1 5  ? -4.943  -20.346 -4.268  1.00 0.00 ? 5   SER A O    8  
ATOM   4556  C  CB   . SER A 1 5  ? -2.928  -19.831 -1.631  1.00 0.00 ? 5   SER A CB   8  
ATOM   4557  O  OG   . SER A 1 5  ? -2.179  -20.310 -0.529  1.00 0.00 ? 5   SER A OG   8  
ATOM   4558  H  H    . SER A 1 5  ? -1.960  -20.872 -3.794  1.00 0.00 ? 5   SER A H    8  
ATOM   4559  H  HA   . SER A 1 5  ? -3.772  -21.795 -1.730  1.00 0.00 ? 5   SER A HA   8  
ATOM   4560  H  HB2  . SER A 1 5  ? -2.272  -19.275 -2.283  1.00 0.00 ? 5   SER A HB2  8  
ATOM   4561  H  HB3  . SER A 1 5  ? -3.708  -19.178 -1.265  1.00 0.00 ? 5   SER A HB3  8  
ATOM   4562  H  HG   . SER A 1 5  ? -2.347  -21.248 -0.410  1.00 0.00 ? 5   SER A HG   8  
ATOM   4563  N  N    . SER A 1 6  ? -5.890  -20.339 -2.227  1.00 0.00 ? 6   SER A N    8  
ATOM   4564  C  CA   . SER A 1 6  ? -7.194  -19.904 -2.713  1.00 0.00 ? 6   SER A CA   8  
ATOM   4565  C  C    . SER A 1 6  ? -7.608  -18.591 -2.057  1.00 0.00 ? 6   SER A C    8  
ATOM   4566  O  O    . SER A 1 6  ? -7.053  -18.192 -1.034  1.00 0.00 ? 6   SER A O    8  
ATOM   4567  C  CB   . SER A 1 6  ? -8.248  -20.979 -2.438  1.00 0.00 ? 6   SER A CB   8  
ATOM   4568  O  OG   . SER A 1 6  ? -8.096  -22.079 -3.319  1.00 0.00 ? 6   SER A OG   8  
ATOM   4569  H  H    . SER A 1 6  ? -5.765  -20.499 -1.268  1.00 0.00 ? 6   SER A H    8  
ATOM   4570  H  HA   . SER A 1 6  ? -7.117  -19.752 -3.779  1.00 0.00 ? 6   SER A HA   8  
ATOM   4571  H  HB2  . SER A 1 6  ? -8.145  -21.330 -1.422  1.00 0.00 ? 6   SER A HB2  8  
ATOM   4572  H  HB3  . SER A 1 6  ? -9.233  -20.556 -2.575  1.00 0.00 ? 6   SER A HB3  8  
ATOM   4573  H  HG   . SER A 1 6  ? -8.932  -22.544 -3.397  1.00 0.00 ? 6   SER A HG   8  
ATOM   4574  N  N    . GLY A 1 7  ? -8.590  -17.921 -2.654  1.00 0.00 ? 7   GLY A N    8  
ATOM   4575  C  CA   . GLY A 1 7  ? -9.062  -16.659 -2.116  1.00 0.00 ? 7   GLY A CA   8  
ATOM   4576  C  C    . GLY A 1 7  ? -9.582  -16.793 -0.698  1.00 0.00 ? 7   GLY A C    8  
ATOM   4577  O  O    . GLY A 1 7  ? -10.759 -17.083 -0.484  1.00 0.00 ? 7   GLY A O    8  
ATOM   4578  H  H    . GLY A 1 7  ? -8.996  -18.287 -3.468  1.00 0.00 ? 7   GLY A H    8  
ATOM   4579  H  HA2  . GLY A 1 7  ? -8.249  -15.949 -2.125  1.00 0.00 ? 7   GLY A HA2  8  
ATOM   4580  H  HA3  . GLY A 1 7  ? -9.858  -16.288 -2.744  1.00 0.00 ? 7   GLY A HA3  8  
ATOM   4581  N  N    . THR A 1 8  ? -8.701  -16.582 0.276   1.00 0.00 ? 8   THR A N    8  
ATOM   4582  C  CA   . THR A 1 8  ? -9.076  -16.683 1.680   1.00 0.00 ? 8   THR A CA   8  
ATOM   4583  C  C    . THR A 1 8  ? -8.895  -15.349 2.395   1.00 0.00 ? 8   THR A C    8  
ATOM   4584  O  O    . THR A 1 8  ? -7.772  -14.927 2.668   1.00 0.00 ? 8   THR A O    8  
ATOM   4585  C  CB   . THR A 1 8  ? -8.246  -17.758 2.407   1.00 0.00 ? 8   THR A CB   8  
ATOM   4586  O  OG1  . THR A 1 8  ? -6.852  -17.445 2.318   1.00 0.00 ? 8   THR A OG1  8  
ATOM   4587  C  CG2  . THR A 1 8  ? -8.501  -19.134 1.810   1.00 0.00 ? 8   THR A CG2  8  
ATOM   4588  H  H    . THR A 1 8  ? -7.777  -16.354 0.042   1.00 0.00 ? 8   THR A H    8  
ATOM   4589  H  HA   . THR A 1 8  ? -10.117 -16.968 1.728   1.00 0.00 ? 8   THR A HA   8  
ATOM   4590  H  HB   . THR A 1 8  ? -8.538  -17.774 3.448   1.00 0.00 ? 8   THR A HB   8  
ATOM   4591  H  HG1  . THR A 1 8  ? -6.744  -16.499 2.195   1.00 0.00 ? 8   THR A HG1  8  
ATOM   4592  H  HG21 . THR A 1 8  ? -8.618  -19.045 0.740   1.00 0.00 ? 8   THR A HG21 8  
ATOM   4593  H  HG22 . THR A 1 8  ? -9.401  -19.551 2.237   1.00 0.00 ? 8   THR A HG22 8  
ATOM   4594  H  HG23 . THR A 1 8  ? -7.665  -19.782 2.028   1.00 0.00 ? 8   THR A HG23 8  
ATOM   4595  N  N    . GLY A 1 9  ? -10.009 -14.688 2.697   1.00 0.00 ? 9   GLY A N    8  
ATOM   4596  C  CA   . GLY A 1 9  ? -9.950  -13.408 3.378   1.00 0.00 ? 9   GLY A CA   8  
ATOM   4597  C  C    . GLY A 1 9  ? -9.378  -12.311 2.502   1.00 0.00 ? 9   GLY A C    8  
ATOM   4598  O  O    . GLY A 1 9  ? -8.225  -11.914 2.669   1.00 0.00 ? 9   GLY A O    8  
ATOM   4599  H  H    . GLY A 1 9  ? -10.877 -15.073 2.454   1.00 0.00 ? 9   GLY A H    8  
ATOM   4600  H  HA2  . GLY A 1 9  ? -10.948 -13.128 3.681   1.00 0.00 ? 9   GLY A HA2  8  
ATOM   4601  H  HA3  . GLY A 1 9  ? -9.332  -13.509 4.258   1.00 0.00 ? 9   GLY A HA3  8  
ATOM   4602  N  N    . GLU A 1 10 ? -10.185 -11.821 1.566   1.00 0.00 ? 10  GLU A N    8  
ATOM   4603  C  CA   . GLU A 1 10 ? -9.750  -10.765 0.660   1.00 0.00 ? 10  GLU A CA   8  
ATOM   4604  C  C    . GLU A 1 10 ? -9.446  -9.481  1.427   1.00 0.00 ? 10  GLU A C    8  
ATOM   4605  O  O    . GLU A 1 10 ? -10.311 -8.932  2.108   1.00 0.00 ? 10  GLU A O    8  
ATOM   4606  C  CB   . GLU A 1 10 ? -10.822 -10.497 -0.399  1.00 0.00 ? 10  GLU A CB   8  
ATOM   4607  C  CG   . GLU A 1 10 ? -10.837 -11.521 -1.522  1.00 0.00 ? 10  GLU A CG   8  
ATOM   4608  C  CD   . GLU A 1 10 ? -11.729 -12.708 -1.217  1.00 0.00 ? 10  GLU A CD   8  
ATOM   4609  O  OE1  . GLU A 1 10 ? -11.871 -13.055 -0.026  1.00 0.00 ? 10  GLU A OE1  8  
ATOM   4610  O  OE2  . GLU A 1 10 ? -12.287 -13.290 -2.172  1.00 0.00 ? 10  GLU A OE2  8  
ATOM   4611  H  H    . GLU A 1 10 ? -11.094 -12.178 1.483   1.00 0.00 ? 10  GLU A H    8  
ATOM   4612  H  HA   . GLU A 1 10 ? -8.849  -11.099 0.170   1.00 0.00 ? 10  GLU A HA   8  
ATOM   4613  H  HB2  . GLU A 1 10 ? -11.791 -10.502 0.078   1.00 0.00 ? 10  GLU A HB2  8  
ATOM   4614  H  HB3  . GLU A 1 10 ? -10.648 -9.523  -0.831  1.00 0.00 ? 10  GLU A HB3  8  
ATOM   4615  H  HG2  . GLU A 1 10 ? -11.194 -11.043 -2.422  1.00 0.00 ? 10  GLU A HG2  8  
ATOM   4616  H  HG3  . GLU A 1 10 ? -9.829  -11.877 -1.680  1.00 0.00 ? 10  GLU A HG3  8  
ATOM   4617  N  N    . ASN A 1 11 ? -8.209  -9.008  1.311   1.00 0.00 ? 11  ASN A N    8  
ATOM   4618  C  CA   . ASN A 1 11 ? -7.789  -7.790  1.994   1.00 0.00 ? 11  ASN A CA   8  
ATOM   4619  C  C    . ASN A 1 11 ? -8.212  -6.553  1.208   1.00 0.00 ? 11  ASN A C    8  
ATOM   4620  O  O    . ASN A 1 11 ? -8.185  -6.529  -0.023  1.00 0.00 ? 11  ASN A O    8  
ATOM   4621  C  CB   . ASN A 1 11 ? -6.272  -7.788  2.191   1.00 0.00 ? 11  ASN A CB   8  
ATOM   4622  C  CG   . ASN A 1 11 ? -5.520  -7.584  0.890   1.00 0.00 ? 11  ASN A CG   8  
ATOM   4623  O  OD1  . ASN A 1 11 ? -5.259  -6.452  0.481   1.00 0.00 ? 11  ASN A OD1  8  
ATOM   4624  N  ND2  . ASN A 1 11 ? -5.167  -8.683  0.232   1.00 0.00 ? 11  ASN A ND2  8  
ATOM   4625  H  H    . ASN A 1 11 ? -7.563  -9.490  0.753   1.00 0.00 ? 11  ASN A H    8  
ATOM   4626  H  HA   . ASN A 1 11 ? -8.269  -7.770  2.961   1.00 0.00 ? 11  ASN A HA   8  
ATOM   4627  H  HB2  . ASN A 1 11 ? -6.004  -6.990  2.868   1.00 0.00 ? 11  ASN A HB2  8  
ATOM   4628  H  HB3  . ASN A 1 11 ? -5.969  -8.733  2.617   1.00 0.00 ? 11  ASN A HB3  8  
ATOM   4629  H  HD21 . ASN A 1 11 ? -5.409  -9.551  0.617   1.00 0.00 ? 11  ASN A HD21 8  
ATOM   4630  H  HD22 . ASN A 1 11 ? -4.680  -8.580  -0.612  1.00 0.00 ? 11  ASN A HD22 8  
ATOM   4631  N  N    . PRO A 1 12 ? -8.613  -5.499  1.935   1.00 0.00 ? 12  PRO A N    8  
ATOM   4632  C  CA   . PRO A 1 12 ? -9.049  -4.238  1.327   1.00 0.00 ? 12  PRO A CA   8  
ATOM   4633  C  C    . PRO A 1 12 ? -7.897  -3.478  0.681   1.00 0.00 ? 12  PRO A C    8  
ATOM   4634  O  O    . PRO A 1 12 ? -7.981  -3.070  -0.478  1.00 0.00 ? 12  PRO A O    8  
ATOM   4635  C  CB   . PRO A 1 12 ? -9.612  -3.449  2.512   1.00 0.00 ? 12  PRO A CB   8  
ATOM   4636  C  CG   . PRO A 1 12 ? -8.910  -4.003  3.704   1.00 0.00 ? 12  PRO A CG   8  
ATOM   4637  C  CD   . PRO A 1 12 ? -8.672  -5.457  3.406   1.00 0.00 ? 12  PRO A CD   8  
ATOM   4638  H  HA   . PRO A 1 12 ? -9.828  -4.398  0.596   1.00 0.00 ? 12  PRO A HA   8  
ATOM   4639  H  HB2  . PRO A 1 12 ? -9.401  -2.398  2.381   1.00 0.00 ? 12  PRO A HB2  8  
ATOM   4640  H  HB3  . PRO A 1 12 ? -10.679 -3.602  2.577   1.00 0.00 ? 12  PRO A HB3  8  
ATOM   4641  H  HG2  . PRO A 1 12 ? -7.971  -3.491  3.847   1.00 0.00 ? 12  PRO A HG2  8  
ATOM   4642  H  HG3  . PRO A 1 12 ? -9.534  -3.897  4.579   1.00 0.00 ? 12  PRO A HG3  8  
ATOM   4643  H  HD2  . PRO A 1 12 ? -7.738  -5.783  3.838   1.00 0.00 ? 12  PRO A HD2  8  
ATOM   4644  H  HD3  . PRO A 1 12 ? -9.491  -6.057  3.775   1.00 0.00 ? 12  PRO A HD3  8  
ATOM   4645  N  N    . PHE A 1 13 ? -6.820  -3.290  1.436   1.00 0.00 ? 13  PHE A N    8  
ATOM   4646  C  CA   . PHE A 1 13 ? -5.650  -2.577  0.936   1.00 0.00 ? 13  PHE A CA   8  
ATOM   4647  C  C    . PHE A 1 13 ? -4.391  -3.006  1.685   1.00 0.00 ? 13  PHE A C    8  
ATOM   4648  O  O    . PHE A 1 13 ? -4.456  -3.423  2.842   1.00 0.00 ? 13  PHE A O    8  
ATOM   4649  C  CB   . PHE A 1 13 ? -5.849  -1.066  1.074   1.00 0.00 ? 13  PHE A CB   8  
ATOM   4650  C  CG   . PHE A 1 13 ? -7.020  -0.543  0.292   1.00 0.00 ? 13  PHE A CG   8  
ATOM   4651  C  CD1  . PHE A 1 13 ? -6.875  -0.179  -1.037  1.00 0.00 ? 13  PHE A CD1  8  
ATOM   4652  C  CD2  . PHE A 1 13 ? -8.265  -0.415  0.886   1.00 0.00 ? 13  PHE A CD2  8  
ATOM   4653  C  CE1  . PHE A 1 13 ? -7.951  0.304   -1.758  1.00 0.00 ? 13  PHE A CE1  8  
ATOM   4654  C  CE2  . PHE A 1 13 ? -9.345  0.067   0.169   1.00 0.00 ? 13  PHE A CE2  8  
ATOM   4655  C  CZ   . PHE A 1 13 ? -9.187  0.426   -1.155  1.00 0.00 ? 13  PHE A CZ   8  
ATOM   4656  H  H    . PHE A 1 13 ? -6.812  -3.638  2.353   1.00 0.00 ? 13  PHE A H    8  
ATOM   4657  H  HA   . PHE A 1 13 ? -5.534  -2.823  -0.108  1.00 0.00 ? 13  PHE A HA   8  
ATOM   4658  H  HB2  . PHE A 1 13 ? -6.011  -0.825  2.113   1.00 0.00 ? 13  PHE A HB2  8  
ATOM   4659  H  HB3  . PHE A 1 13 ? -4.962  -0.560  0.724   1.00 0.00 ? 13  PHE A HB3  8  
ATOM   4660  H  HD1  . PHE A 1 13 ? -5.909  -0.274  -1.511  1.00 0.00 ? 13  PHE A HD1  8  
ATOM   4661  H  HD2  . PHE A 1 13 ? -8.390  -0.697  1.922   1.00 0.00 ? 13  PHE A HD2  8  
ATOM   4662  H  HE1  . PHE A 1 13 ? -7.825  0.584   -2.794  1.00 0.00 ? 13  PHE A HE1  8  
ATOM   4663  H  HE2  . PHE A 1 13 ? -10.310 0.160   0.644   1.00 0.00 ? 13  PHE A HE2  8  
ATOM   4664  H  HZ   . PHE A 1 13 ? -10.029 0.803   -1.716  1.00 0.00 ? 13  PHE A HZ   8  
ATOM   4665  N  N    . ILE A 1 14 ? -3.248  -2.900  1.017   1.00 0.00 ? 14  ILE A N    8  
ATOM   4666  C  CA   . ILE A 1 14 ? -1.974  -3.275  1.619   1.00 0.00 ? 14  ILE A CA   8  
ATOM   4667  C  C    . ILE A 1 14 ? -0.846  -2.377  1.123   1.00 0.00 ? 14  ILE A C    8  
ATOM   4668  O  O    . ILE A 1 14 ? -0.748  -2.085  -0.069  1.00 0.00 ? 14  ILE A O    8  
ATOM   4669  C  CB   . ILE A 1 14 ? -1.619  -4.743  1.314   1.00 0.00 ? 14  ILE A CB   8  
ATOM   4670  C  CG1  . ILE A 1 14 ? -2.704  -5.676  1.854   1.00 0.00 ? 14  ILE A CG1  8  
ATOM   4671  C  CG2  . ILE A 1 14 ? -0.265  -5.094  1.912   1.00 0.00 ? 14  ILE A CG2  8  
ATOM   4672  C  CD1  . ILE A 1 14 ? -2.539  -7.114  1.415   1.00 0.00 ? 14  ILE A CD1  8  
ATOM   4673  H  H    . ILE A 1 14 ? -3.261  -2.560  0.098   1.00 0.00 ? 14  ILE A H    8  
ATOM   4674  H  HA   . ILE A 1 14 ? -2.066  -3.163  2.689   1.00 0.00 ? 14  ILE A HA   8  
ATOM   4675  H  HB   . ILE A 1 14 ? -1.554  -4.859  0.243   1.00 0.00 ? 14  ILE A HB   8  
ATOM   4676  H  HG12 . ILE A 1 14 ? -2.684  -5.655  2.933   1.00 0.00 ? 14  ILE A HG12 8  
ATOM   4677  H  HG13 . ILE A 1 14 ? -3.669  -5.331  1.509   1.00 0.00 ? 14  ILE A HG13 8  
ATOM   4678  H  HG21 . ILE A 1 14 ? 0.477   -5.131  1.127   1.00 0.00 ? 14  ILE A HG21 8  
ATOM   4679  H  HG22 . ILE A 1 14 ? 0.015   -4.343  2.635   1.00 0.00 ? 14  ILE A HG22 8  
ATOM   4680  H  HG23 . ILE A 1 14 ? -0.324  -6.057  2.396   1.00 0.00 ? 14  ILE A HG23 8  
ATOM   4681  H  HD11 . ILE A 1 14 ? -2.912  -7.227  0.407   1.00 0.00 ? 14  ILE A HD11 8  
ATOM   4682  H  HD12 . ILE A 1 14 ? -1.492  -7.380  1.441   1.00 0.00 ? 14  ILE A HD12 8  
ATOM   4683  H  HD13 . ILE A 1 14 ? -3.093  -7.760  2.078   1.00 0.00 ? 14  ILE A HD13 8  
ATOM   4684  N  N    . CYS A 1 15 ? 0.006   -1.943  2.046   1.00 0.00 ? 15  CYS A N    8  
ATOM   4685  C  CA   . CYS A 1 15 ? 1.130   -1.079  1.704   1.00 0.00 ? 15  CYS A CA   8  
ATOM   4686  C  C    . CYS A 1 15 ? 2.125   -1.810  0.807   1.00 0.00 ? 15  CYS A C    8  
ATOM   4687  O  O    . CYS A 1 15 ? 2.586   -2.903  1.136   1.00 0.00 ? 15  CYS A O    8  
ATOM   4688  C  CB   . CYS A 1 15 ? 1.831   -0.594  2.974   1.00 0.00 ? 15  CYS A CB   8  
ATOM   4689  S  SG   . CYS A 1 15 ? 2.995   0.781   2.701   1.00 0.00 ? 15  CYS A SG   8  
ATOM   4690  H  H    . CYS A 1 15 ? -0.124  -2.210  2.980   1.00 0.00 ? 15  CYS A H    8  
ATOM   4691  H  HA   . CYS A 1 15 ? 0.741   -0.226  1.169   1.00 0.00 ? 15  CYS A HA   8  
ATOM   4692  H  HB2  . CYS A 1 15 ? 1.087   -0.257  3.681   1.00 0.00 ? 15  CYS A HB2  8  
ATOM   4693  H  HB3  . CYS A 1 15 ? 2.386   -1.414  3.405   1.00 0.00 ? 15  CYS A HB3  8  
ATOM   4694  N  N    . SER A 1 16 ? 2.451   -1.199  -0.327  1.00 0.00 ? 16  SER A N    8  
ATOM   4695  C  CA   . SER A 1 16 ? 3.389   -1.792  -1.273  1.00 0.00 ? 16  SER A CA   8  
ATOM   4696  C  C    . SER A 1 16 ? 4.829   -1.481  -0.878  1.00 0.00 ? 16  SER A C    8  
ATOM   4697  O  O    . SER A 1 16 ? 5.734   -1.524  -1.710  1.00 0.00 ? 16  SER A O    8  
ATOM   4698  C  CB   . SER A 1 16 ? 3.113   -1.278  -2.687  1.00 0.00 ? 16  SER A CB   8  
ATOM   4699  O  OG   . SER A 1 16 ? 1.976   -1.912  -3.248  1.00 0.00 ? 16  SER A OG   8  
ATOM   4700  H  H    . SER A 1 16 ? 2.050   -0.328  -0.533  1.00 0.00 ? 16  SER A H    8  
ATOM   4701  H  HA   . SER A 1 16 ? 3.246   -2.862  -1.254  1.00 0.00 ? 16  SER A HA   8  
ATOM   4702  H  HB2  . SER A 1 16 ? 2.936   -0.214  -2.653  1.00 0.00 ? 16  SER A HB2  8  
ATOM   4703  H  HB3  . SER A 1 16 ? 3.969   -1.480  -3.314  1.00 0.00 ? 16  SER A HB3  8  
ATOM   4704  H  HG   . SER A 1 16 ? 1.187   -1.627  -2.781  1.00 0.00 ? 16  SER A HG   8  
ATOM   4705  N  N    . GLU A 1 17 ? 5.032   -1.167  0.397   1.00 0.00 ? 17  GLU A N    8  
ATOM   4706  C  CA   . GLU A 1 17 ? 6.362   -0.847  0.903   1.00 0.00 ? 17  GLU A CA   8  
ATOM   4707  C  C    . GLU A 1 17 ? 6.747   -1.778  2.048   1.00 0.00 ? 17  GLU A C    8  
ATOM   4708  O  O    . GLU A 1 17 ? 7.806   -2.406  2.024   1.00 0.00 ? 17  GLU A O    8  
ATOM   4709  C  CB   . GLU A 1 17 ? 6.417   0.608   1.373   1.00 0.00 ? 17  GLU A CB   8  
ATOM   4710  C  CG   . GLU A 1 17 ? 6.454   1.615   0.236   1.00 0.00 ? 17  GLU A CG   8  
ATOM   4711  C  CD   . GLU A 1 17 ? 7.726   1.522   -0.584  1.00 0.00 ? 17  GLU A CD   8  
ATOM   4712  O  OE1  . GLU A 1 17 ? 8.797   1.895   -0.063  1.00 0.00 ? 17  GLU A OE1  8  
ATOM   4713  O  OE2  . GLU A 1 17 ? 7.650   1.074   -1.748  1.00 0.00 ? 17  GLU A OE2  8  
ATOM   4714  H  H    . GLU A 1 17 ? 4.269   -1.149  1.013   1.00 0.00 ? 17  GLU A H    8  
ATOM   4715  H  HA   . GLU A 1 17 ? 7.065   -0.981  0.094   1.00 0.00 ? 17  GLU A HA   8  
ATOM   4716  H  HB2  . GLU A 1 17 ? 5.546   0.811   1.978   1.00 0.00 ? 17  GLU A HB2  8  
ATOM   4717  H  HB3  . GLU A 1 17 ? 7.302   0.745   1.976   1.00 0.00 ? 17  GLU A HB3  8  
ATOM   4718  H  HG2  . GLU A 1 17 ? 5.611   1.435   -0.415  1.00 0.00 ? 17  GLU A HG2  8  
ATOM   4719  H  HG3  . GLU A 1 17 ? 6.382   2.610   0.650   1.00 0.00 ? 17  GLU A HG3  8  
ATOM   4720  N  N    . CYS A 1 18 ? 5.880   -1.863  3.052   1.00 0.00 ? 18  CYS A N    8  
ATOM   4721  C  CA   . CYS A 1 18 ? 6.128   -2.715  4.208   1.00 0.00 ? 18  CYS A CA   8  
ATOM   4722  C  C    . CYS A 1 18 ? 5.202   -3.929  4.197   1.00 0.00 ? 18  CYS A C    8  
ATOM   4723  O  O    . CYS A 1 18 ? 5.655   -5.069  4.291   1.00 0.00 ? 18  CYS A O    8  
ATOM   4724  C  CB   . CYS A 1 18 ? 5.933   -1.924  5.503   1.00 0.00 ? 18  CYS A CB   8  
ATOM   4725  S  SG   . CYS A 1 18 ? 4.394   -0.951  5.556   1.00 0.00 ? 18  CYS A SG   8  
ATOM   4726  H  H    . CYS A 1 18 ? 5.052   -1.338  3.014   1.00 0.00 ? 18  CYS A H    8  
ATOM   4727  H  HA   . CYS A 1 18 ? 7.150   -3.057  4.155   1.00 0.00 ? 18  CYS A HA   8  
ATOM   4728  H  HB2  . CYS A 1 18 ? 5.915   -2.611  6.336   1.00 0.00 ? 18  CYS A HB2  8  
ATOM   4729  H  HB3  . CYS A 1 18 ? 6.760   -1.240  5.625   1.00 0.00 ? 18  CYS A HB3  8  
ATOM   4730  N  N    . GLY A 1 19 ? 3.903   -3.674  4.080   1.00 0.00 ? 19  GLY A N    8  
ATOM   4731  C  CA   . GLY A 1 19 ? 2.934   -4.755  4.059   1.00 0.00 ? 19  GLY A CA   8  
ATOM   4732  C  C    . GLY A 1 19 ? 1.870   -4.602  5.128   1.00 0.00 ? 19  GLY A C    8  
ATOM   4733  O  O    . GLY A 1 19 ? 1.466   -5.579  5.758   1.00 0.00 ? 19  GLY A O    8  
ATOM   4734  H  H    . GLY A 1 19 ? 3.599   -2.745  4.009   1.00 0.00 ? 19  GLY A H    8  
ATOM   4735  H  HA2  . GLY A 1 19 ? 2.456   -4.776  3.091   1.00 0.00 ? 19  GLY A HA2  8  
ATOM   4736  H  HA3  . GLY A 1 19 ? 3.452   -5.690  4.215   1.00 0.00 ? 19  GLY A HA3  8  
ATOM   4737  N  N    . LYS A 1 20 ? 1.416   -3.370  5.336   1.00 0.00 ? 20  LYS A N    8  
ATOM   4738  C  CA   . LYS A 1 20 ? 0.393   -3.091  6.337   1.00 0.00 ? 20  LYS A CA   8  
ATOM   4739  C  C    . LYS A 1 20 ? -0.972  -2.903  5.682   1.00 0.00 ? 20  LYS A C    8  
ATOM   4740  O  O    . LYS A 1 20 ? -1.088  -2.257  4.640   1.00 0.00 ? 20  LYS A O    8  
ATOM   4741  C  CB   . LYS A 1 20 ? 0.763   -1.840  7.138   1.00 0.00 ? 20  LYS A CB   8  
ATOM   4742  C  CG   . LYS A 1 20 ? 0.214   -1.841  8.554   1.00 0.00 ? 20  LYS A CG   8  
ATOM   4743  C  CD   . LYS A 1 20 ? 0.611   -0.582  9.307   1.00 0.00 ? 20  LYS A CD   8  
ATOM   4744  C  CE   . LYS A 1 20 ? 0.053   -0.579  10.722  1.00 0.00 ? 20  LYS A CE   8  
ATOM   4745  N  NZ   . LYS A 1 20 ? 0.818   0.331   11.618  1.00 0.00 ? 20  LYS A NZ   8  
ATOM   4746  H  H    . LYS A 1 20 ? 1.777   -2.631  4.802   1.00 0.00 ? 20  LYS A H    8  
ATOM   4747  H  HA   . LYS A 1 20 ? 0.345   -3.936  7.007   1.00 0.00 ? 20  LYS A HA   8  
ATOM   4748  H  HB2  . LYS A 1 20 ? 1.839   -1.766  7.191   1.00 0.00 ? 20  LYS A HB2  8  
ATOM   4749  H  HB3  . LYS A 1 20 ? 0.376   -0.972  6.625   1.00 0.00 ? 20  LYS A HB3  8  
ATOM   4750  H  HG2  . LYS A 1 20 ? -0.864  -1.898  8.513   1.00 0.00 ? 20  LYS A HG2  8  
ATOM   4751  H  HG3  . LYS A 1 20 ? 0.602   -2.702  9.080   1.00 0.00 ? 20  LYS A HG3  8  
ATOM   4752  H  HD2  . LYS A 1 20 ? 1.689   -0.528  9.357   1.00 0.00 ? 20  LYS A HD2  8  
ATOM   4753  H  HD3  . LYS A 1 20 ? 0.230   0.279   8.777   1.00 0.00 ? 20  LYS A HD3  8  
ATOM   4754  H  HE2  . LYS A 1 20 ? -0.976  -0.256  10.688  1.00 0.00 ? 20  LYS A HE2  8  
ATOM   4755  H  HE3  . LYS A 1 20 ? 0.101   -1.584  11.116  1.00 0.00 ? 20  LYS A HE3  8  
ATOM   4756  H  HZ1  . LYS A 1 20 ? 1.472   -0.218  12.212  1.00 0.00 ? 20  LYS A HZ1  8  
ATOM   4757  H  HZ2  . LYS A 1 20 ? 0.166   0.857   12.234  1.00 0.00 ? 20  LYS A HZ2  8  
ATOM   4758  H  HZ3  . LYS A 1 20 ? 1.367   1.010   11.053  1.00 0.00 ? 20  LYS A HZ3  8  
ATOM   4759  N  N    . VAL A 1 21 ? -2.003  -3.471  6.300   1.00 0.00 ? 21  VAL A N    8  
ATOM   4760  C  CA   . VAL A 1 21 ? -3.360  -3.364  5.778   1.00 0.00 ? 21  VAL A CA   8  
ATOM   4761  C  C    . VAL A 1 21 ? -4.125  -2.237  6.464   1.00 0.00 ? 21  VAL A C    8  
ATOM   4762  O  O    . VAL A 1 21 ? -4.061  -2.081  7.683   1.00 0.00 ? 21  VAL A O    8  
ATOM   4763  C  CB   . VAL A 1 21 ? -4.137  -4.681  5.960   1.00 0.00 ? 21  VAL A CB   8  
ATOM   4764  C  CG1  . VAL A 1 21 ? -5.558  -4.540  5.437   1.00 0.00 ? 21  VAL A CG1  8  
ATOM   4765  C  CG2  . VAL A 1 21 ? -3.415  -5.825  5.263   1.00 0.00 ? 21  VAL A CG2  8  
ATOM   4766  H  H    . VAL A 1 21 ? -1.847  -3.973  7.127   1.00 0.00 ? 21  VAL A H    8  
ATOM   4767  H  HA   . VAL A 1 21 ? -3.296  -3.151  4.721   1.00 0.00 ? 21  VAL A HA   8  
ATOM   4768  H  HB   . VAL A 1 21 ? -4.186  -4.904  7.016   1.00 0.00 ? 21  VAL A HB   8  
ATOM   4769  H  HG11 . VAL A 1 21 ? -6.185  -5.293  5.891   1.00 0.00 ? 21  VAL A HG11 8  
ATOM   4770  H  HG12 . VAL A 1 21 ? -5.937  -3.559  5.683   1.00 0.00 ? 21  VAL A HG12 8  
ATOM   4771  H  HG13 . VAL A 1 21 ? -5.561  -4.668  4.364   1.00 0.00 ? 21  VAL A HG13 8  
ATOM   4772  H  HG21 . VAL A 1 21 ? -3.277  -6.640  5.958   1.00 0.00 ? 21  VAL A HG21 8  
ATOM   4773  H  HG22 . VAL A 1 21 ? -4.003  -6.162  4.423   1.00 0.00 ? 21  VAL A HG22 8  
ATOM   4774  H  HG23 . VAL A 1 21 ? -2.451  -5.483  4.914   1.00 0.00 ? 21  VAL A HG23 8  
ATOM   4775  N  N    . PHE A 1 22 ? -4.849  -1.454  5.672   1.00 0.00 ? 22  PHE A N    8  
ATOM   4776  C  CA   . PHE A 1 22 ? -5.627  -0.340  6.202   1.00 0.00 ? 22  PHE A CA   8  
ATOM   4777  C  C    . PHE A 1 22 ? -7.102  -0.485  5.839   1.00 0.00 ? 22  PHE A C    8  
ATOM   4778  O  O    . PHE A 1 22 ? -7.474  -1.336  5.031   1.00 0.00 ? 22  PHE A O    8  
ATOM   4779  C  CB   . PHE A 1 22 ? -5.087  0.988   5.667   1.00 0.00 ? 22  PHE A CB   8  
ATOM   4780  C  CG   . PHE A 1 22 ? -3.712  1.323   6.171   1.00 0.00 ? 22  PHE A CG   8  
ATOM   4781  C  CD1  . PHE A 1 22 ? -2.592  0.723   5.618   1.00 0.00 ? 22  PHE A CD1  8  
ATOM   4782  C  CD2  . PHE A 1 22 ? -3.540  2.238   7.197   1.00 0.00 ? 22  PHE A CD2  8  
ATOM   4783  C  CE1  . PHE A 1 22 ? -1.326  1.029   6.081   1.00 0.00 ? 22  PHE A CE1  8  
ATOM   4784  C  CE2  . PHE A 1 22 ? -2.277  2.548   7.664   1.00 0.00 ? 22  PHE A CE2  8  
ATOM   4785  C  CZ   . PHE A 1 22 ? -1.168  1.944   7.105   1.00 0.00 ? 22  PHE A CZ   8  
ATOM   4786  H  H    . PHE A 1 22 ? -4.860  -1.628  4.707   1.00 0.00 ? 22  PHE A H    8  
ATOM   4787  H  HA   . PHE A 1 22 ? -5.530  -0.351  7.277   1.00 0.00 ? 22  PHE A HA   8  
ATOM   4788  H  HB2  . PHE A 1 22 ? -5.042  0.942   4.589   1.00 0.00 ? 22  PHE A HB2  8  
ATOM   4789  H  HB3  . PHE A 1 22 ? -5.753  1.784   5.962   1.00 0.00 ? 22  PHE A HB3  8  
ATOM   4790  H  HD1  . PHE A 1 22 ? -2.714  0.009   4.817   1.00 0.00 ? 22  PHE A HD1  8  
ATOM   4791  H  HD2  . PHE A 1 22 ? -4.408  2.711   7.636   1.00 0.00 ? 22  PHE A HD2  8  
ATOM   4792  H  HE1  . PHE A 1 22 ? -0.461  0.556   5.642   1.00 0.00 ? 22  PHE A HE1  8  
ATOM   4793  H  HE2  . PHE A 1 22 ? -2.157  3.263   8.465   1.00 0.00 ? 22  PHE A HE2  8  
ATOM   4794  H  HZ   . PHE A 1 22 ? -0.180  2.184   7.468   1.00 0.00 ? 22  PHE A HZ   8  
ATOM   4795  N  N    . THR A 1 23 ? -7.939  0.352   6.444   1.00 0.00 ? 23  THR A N    8  
ATOM   4796  C  CA   . THR A 1 23 ? -9.373  0.317   6.187   1.00 0.00 ? 23  THR A CA   8  
ATOM   4797  C  C    . THR A 1 23 ? -9.718  1.045   4.893   1.00 0.00 ? 23  THR A C    8  
ATOM   4798  O  O    . THR A 1 23 ? -10.340 0.476   3.995   1.00 0.00 ? 23  THR A O    8  
ATOM   4799  C  CB   . THR A 1 23 ? -10.167 0.949   7.346   1.00 0.00 ? 23  THR A CB   8  
ATOM   4800  O  OG1  . THR A 1 23 ? -9.795  0.337   8.586   1.00 0.00 ? 23  THR A OG1  8  
ATOM   4801  C  CG2  . THR A 1 23 ? -11.664 0.790   7.126   1.00 0.00 ? 23  THR A CG2  8  
ATOM   4802  H  H    . THR A 1 23 ? -7.582  1.008   7.078   1.00 0.00 ? 23  THR A H    8  
ATOM   4803  H  HA   . THR A 1 23 ? -9.671  -0.718  6.097   1.00 0.00 ? 23  THR A HA   8  
ATOM   4804  H  HB   . THR A 1 23 ? -9.934  2.003   7.389   1.00 0.00 ? 23  THR A HB   8  
ATOM   4805  H  HG1  . THR A 1 23 ? -10.171 0.836   9.315   1.00 0.00 ? 23  THR A HG1  8  
ATOM   4806  H  HG21 . THR A 1 23 ? -11.947 -0.236  7.303   1.00 0.00 ? 23  THR A HG21 8  
ATOM   4807  H  HG22 . THR A 1 23 ? -11.910 1.061   6.110   1.00 0.00 ? 23  THR A HG22 8  
ATOM   4808  H  HG23 . THR A 1 23 ? -12.198 1.434   7.809   1.00 0.00 ? 23  THR A HG23 8  
ATOM   4809  N  N    . HIS A 1 24 ? -9.310  2.307   4.803   1.00 0.00 ? 24  HIS A N    8  
ATOM   4810  C  CA   . HIS A 1 24 ? -9.575  3.113   3.617   1.00 0.00 ? 24  HIS A CA   8  
ATOM   4811  C  C    . HIS A 1 24 ? -8.272  3.569   2.967   1.00 0.00 ? 24  HIS A C    8  
ATOM   4812  O  O    . HIS A 1 24 ? -7.324  3.951   3.653   1.00 0.00 ? 24  HIS A O    8  
ATOM   4813  C  CB   . HIS A 1 24 ? -10.429 4.328   3.980   1.00 0.00 ? 24  HIS A CB   8  
ATOM   4814  C  CG   . HIS A 1 24 ? -10.211 4.816   5.379   1.00 0.00 ? 24  HIS A CG   8  
ATOM   4815  N  ND1  . HIS A 1 24 ? -9.447  5.924   5.679   1.00 0.00 ? 24  HIS A ND1  8  
ATOM   4816  C  CD2  . HIS A 1 24 ? -10.664 4.342   6.563   1.00 0.00 ? 24  HIS A CD2  8  
ATOM   4817  C  CE1  . HIS A 1 24 ? -9.437  6.109   6.987   1.00 0.00 ? 24  HIS A CE1  8  
ATOM   4818  N  NE2  . HIS A 1 24 ? -10.169 5.162   7.547   1.00 0.00 ? 24  HIS A NE2  8  
ATOM   4819  H  H    . HIS A 1 24 ? -8.819  2.705   5.551   1.00 0.00 ? 24  HIS A H    8  
ATOM   4820  H  HA   . HIS A 1 24 ? -10.118 2.500   2.913   1.00 0.00 ? 24  HIS A HA   8  
ATOM   4821  H  HB2  . HIS A 1 24 ? -10.195 5.139   3.306   1.00 0.00 ? 24  HIS A HB2  8  
ATOM   4822  H  HB3  . HIS A 1 24 ? -11.473 4.070   3.877   1.00 0.00 ? 24  HIS A HB3  8  
ATOM   4823  H  HD1  . HIS A 1 24 ? -8.980  6.490   5.030   1.00 0.00 ? 24  HIS A HD1  8  
ATOM   4824  H  HD2  . HIS A 1 24 ? -11.297 3.478   6.708   1.00 0.00 ? 24  HIS A HD2  8  
ATOM   4825  H  HE1  . HIS A 1 24 ? -8.921  6.899   7.510   1.00 0.00 ? 24  HIS A HE1  8  
ATOM   4826  N  N    . LYS A 1 25 ? -8.231  3.525   1.640   1.00 0.00 ? 25  LYS A N    8  
ATOM   4827  C  CA   . LYS A 1 25 ? -7.045  3.933   0.896   1.00 0.00 ? 25  LYS A CA   8  
ATOM   4828  C  C    . LYS A 1 25 ? -6.449  5.209   1.481   1.00 0.00 ? 25  LYS A C    8  
ATOM   4829  O  O    . LYS A 1 25 ? -5.270  5.251   1.834   1.00 0.00 ? 25  LYS A O    8  
ATOM   4830  C  CB   . LYS A 1 25 ? -7.392  4.149   -0.579  1.00 0.00 ? 25  LYS A CB   8  
ATOM   4831  C  CG   . LYS A 1 25 ? -8.508  5.155   -0.800  1.00 0.00 ? 25  LYS A CG   8  
ATOM   4832  C  CD   . LYS A 1 25 ? -9.067  5.066   -2.211  1.00 0.00 ? 25  LYS A CD   8  
ATOM   4833  C  CE   . LYS A 1 25 ? -9.633  6.401   -2.671  1.00 0.00 ? 25  LYS A CE   8  
ATOM   4834  N  NZ   . LYS A 1 25 ? -9.912  6.411   -4.133  1.00 0.00 ? 25  LYS A NZ   8  
ATOM   4835  H  H    . LYS A 1 25 ? -9.019  3.210   1.148   1.00 0.00 ? 25  LYS A H    8  
ATOM   4836  H  HA   . LYS A 1 25 ? -6.316  3.141   0.974   1.00 0.00 ? 25  LYS A HA   8  
ATOM   4837  H  HB2  . LYS A 1 25 ? -6.511  4.499   -1.096  1.00 0.00 ? 25  LYS A HB2  8  
ATOM   4838  H  HB3  . LYS A 1 25 ? -7.697  3.204   -1.006  1.00 0.00 ? 25  LYS A HB3  8  
ATOM   4839  H  HG2  . LYS A 1 25 ? -9.303  4.958   -0.097  1.00 0.00 ? 25  LYS A HG2  8  
ATOM   4840  H  HG3  . LYS A 1 25 ? -8.120  6.150   -0.639  1.00 0.00 ? 25  LYS A HG3  8  
ATOM   4841  H  HD2  . LYS A 1 25 ? -8.275  4.773   -2.885  1.00 0.00 ? 25  LYS A HD2  8  
ATOM   4842  H  HD3  . LYS A 1 25 ? -9.853  4.325   -2.231  1.00 0.00 ? 25  LYS A HD3  8  
ATOM   4843  H  HE2  . LYS A 1 25 ? -10.552 6.590   -2.137  1.00 0.00 ? 25  LYS A HE2  8  
ATOM   4844  H  HE3  . LYS A 1 25 ? -8.918  7.178   -2.444  1.00 0.00 ? 25  LYS A HE3  8  
ATOM   4845  H  HZ1  . LYS A 1 25 ? -10.813 5.930   -4.329  1.00 0.00 ? 25  LYS A HZ1  8  
ATOM   4846  H  HZ2  . LYS A 1 25 ? -9.151  5.920   -4.645  1.00 0.00 ? 25  LYS A HZ2  8  
ATOM   4847  H  HZ3  . LYS A 1 25 ? -9.971  7.389   -4.479  1.00 0.00 ? 25  LYS A HZ3  8  
ATOM   4848  N  N    . THR A 1 26 ? -7.271  6.249   1.582   1.00 0.00 ? 26  THR A N    8  
ATOM   4849  C  CA   . THR A 1 26 ? -6.825  7.526   2.124   1.00 0.00 ? 26  THR A CA   8  
ATOM   4850  C  C    . THR A 1 26 ? -5.861  7.323   3.288   1.00 0.00 ? 26  THR A C    8  
ATOM   4851  O  O    . THR A 1 26 ? -4.769  7.889   3.307   1.00 0.00 ? 26  THR A O    8  
ATOM   4852  C  CB   . THR A 1 26 ? -8.015  8.380   2.602   1.00 0.00 ? 26  THR A CB   8  
ATOM   4853  O  OG1  . THR A 1 26 ? -9.010  8.452   1.574   1.00 0.00 ? 26  THR A OG1  8  
ATOM   4854  C  CG2  . THR A 1 26 ? -7.560  9.783   2.973   1.00 0.00 ? 26  THR A CG2  8  
ATOM   4855  H  H    . THR A 1 26 ? -8.200  6.153   1.284   1.00 0.00 ? 26  THR A H    8  
ATOM   4856  H  HA   . THR A 1 26 ? -6.317  8.063   1.337   1.00 0.00 ? 26  THR A HA   8  
ATOM   4857  H  HB   . THR A 1 26 ? -8.445  7.913   3.477   1.00 0.00 ? 26  THR A HB   8  
ATOM   4858  H  HG1  . THR A 1 26 ? -9.479  7.615   1.523   1.00 0.00 ? 26  THR A HG1  8  
ATOM   4859  H  HG21 . THR A 1 26 ? -6.481  9.815   3.003   1.00 0.00 ? 26  THR A HG21 8  
ATOM   4860  H  HG22 . THR A 1 26 ? -7.954  10.044  3.944   1.00 0.00 ? 26  THR A HG22 8  
ATOM   4861  H  HG23 . THR A 1 26 ? -7.921  10.485  2.237   1.00 0.00 ? 26  THR A HG23 8  
ATOM   4862  N  N    . ASN A 1 27 ? -6.272  6.511   4.256   1.00 0.00 ? 27  ASN A N    8  
ATOM   4863  C  CA   . ASN A 1 27 ? -5.444  6.233   5.424   1.00 0.00 ? 27  ASN A CA   8  
ATOM   4864  C  C    . ASN A 1 27 ? -4.109  5.620   5.010   1.00 0.00 ? 27  ASN A C    8  
ATOM   4865  O  O    . ASN A 1 27 ? -3.049  6.050   5.466   1.00 0.00 ? 27  ASN A O    8  
ATOM   4866  C  CB   . ASN A 1 27 ? -6.176  5.290   6.381   1.00 0.00 ? 27  ASN A CB   8  
ATOM   4867  C  CG   . ASN A 1 27 ? -5.780  5.514   7.828   1.00 0.00 ? 27  ASN A CG   8  
ATOM   4868  O  OD1  . ASN A 1 27 ? -6.611  5.873   8.662   1.00 0.00 ? 27  ASN A OD1  8  
ATOM   4869  N  ND2  . ASN A 1 27 ? -4.504  5.304   8.132   1.00 0.00 ? 27  ASN A ND2  8  
ATOM   4870  H  H    . ASN A 1 27 ? -7.154  6.088   4.184   1.00 0.00 ? 27  ASN A H    8  
ATOM   4871  H  HA   . ASN A 1 27 ? -5.257  7.169   5.927   1.00 0.00 ? 27  ASN A HA   8  
ATOM   4872  H  HB2  . ASN A 1 27 ? -7.240  5.450   6.291   1.00 0.00 ? 27  ASN A HB2  8  
ATOM   4873  H  HB3  . ASN A 1 27 ? -5.945  4.269   6.118   1.00 0.00 ? 27  ASN A HB3  8  
ATOM   4874  H  HD21 . ASN A 1 27 ? -3.898  5.019   7.416   1.00 0.00 ? 27  ASN A HD21 8  
ATOM   4875  H  HD22 . ASN A 1 27 ? -4.221  5.441   9.060   1.00 0.00 ? 27  ASN A HD22 8  
ATOM   4876  N  N    . LEU A 1 28 ? -4.169  4.615   4.144   1.00 0.00 ? 28  LEU A N    8  
ATOM   4877  C  CA   . LEU A 1 28 ? -2.965  3.943   3.667   1.00 0.00 ? 28  LEU A CA   8  
ATOM   4878  C  C    . LEU A 1 28 ? -2.023  4.931   2.987   1.00 0.00 ? 28  LEU A C    8  
ATOM   4879  O  O    . LEU A 1 28 ? -0.844  5.017   3.331   1.00 0.00 ? 28  LEU A O    8  
ATOM   4880  C  CB   . LEU A 1 28 ? -3.334  2.821   2.695   1.00 0.00 ? 28  LEU A CB   8  
ATOM   4881  C  CG   . LEU A 1 28 ? -2.226  2.363   1.746   1.00 0.00 ? 28  LEU A CG   8  
ATOM   4882  C  CD1  . LEU A 1 28 ? -1.214  1.500   2.484   1.00 0.00 ? 28  LEU A CD1  8  
ATOM   4883  C  CD2  . LEU A 1 28 ? -2.815  1.606   0.565   1.00 0.00 ? 28  LEU A CD2  8  
ATOM   4884  H  H    . LEU A 1 28 ? -5.043  4.317   3.816   1.00 0.00 ? 28  LEU A H    8  
ATOM   4885  H  HA   . LEU A 1 28 ? -2.463  3.517   4.523   1.00 0.00 ? 28  LEU A HA   8  
ATOM   4886  H  HB2  . LEU A 1 28 ? -3.644  1.967   3.278   1.00 0.00 ? 28  LEU A HB2  8  
ATOM   4887  H  HB3  . LEU A 1 28 ? -4.165  3.165   2.095   1.00 0.00 ? 28  LEU A HB3  8  
ATOM   4888  H  HG   . LEU A 1 28 ? -1.707  3.231   1.363   1.00 0.00 ? 28  LEU A HG   8  
ATOM   4889  H  HD11 . LEU A 1 28 ? -1.603  0.498   2.586   1.00 0.00 ? 28  LEU A HD11 8  
ATOM   4890  H  HD12 . LEU A 1 28 ? -1.031  1.918   3.463   1.00 0.00 ? 28  LEU A HD12 8  
ATOM   4891  H  HD13 . LEU A 1 28 ? -0.289  1.474   1.926   1.00 0.00 ? 28  LEU A HD13 8  
ATOM   4892  H  HD21 . LEU A 1 28 ? -2.035  1.046   0.072   1.00 0.00 ? 28  LEU A HD21 8  
ATOM   4893  H  HD22 . LEU A 1 28 ? -3.249  2.308   -0.131  1.00 0.00 ? 28  LEU A HD22 8  
ATOM   4894  H  HD23 . LEU A 1 28 ? -3.579  0.928   0.917   1.00 0.00 ? 28  LEU A HD23 8  
ATOM   4895  N  N    . ILE A 1 29 ? -2.552  5.676   2.022   1.00 0.00 ? 29  ILE A N    8  
ATOM   4896  C  CA   . ILE A 1 29 ? -1.759  6.660   1.296   1.00 0.00 ? 29  ILE A CA   8  
ATOM   4897  C  C    . ILE A 1 29 ? -0.982  7.556   2.255   1.00 0.00 ? 29  ILE A C    8  
ATOM   4898  O  O    . ILE A 1 29 ? 0.184   7.872   2.018   1.00 0.00 ? 29  ILE A O    8  
ATOM   4899  C  CB   . ILE A 1 29 ? -2.643  7.539   0.392   1.00 0.00 ? 29  ILE A CB   8  
ATOM   4900  C  CG1  . ILE A 1 29 ? -3.380  6.675   -0.633  1.00 0.00 ? 29  ILE A CG1  8  
ATOM   4901  C  CG2  . ILE A 1 29 ? -1.800  8.596   -0.307  1.00 0.00 ? 29  ILE A CG2  8  
ATOM   4902  C  CD1  . ILE A 1 29 ? -4.565  7.369   -1.268  1.00 0.00 ? 29  ILE A CD1  8  
ATOM   4903  H  H    . ILE A 1 29 ? -3.497  5.561   1.793   1.00 0.00 ? 29  ILE A H    8  
ATOM   4904  H  HA   . ILE A 1 29 ? -1.057  6.127   0.671   1.00 0.00 ? 29  ILE A HA   8  
ATOM   4905  H  HB   . ILE A 1 29 ? -3.366  8.044   1.014   1.00 0.00 ? 29  ILE A HB   8  
ATOM   4906  H  HG12 . ILE A 1 29 ? -2.697  6.400   -1.421  1.00 0.00 ? 29  ILE A HG12 8  
ATOM   4907  H  HG13 . ILE A 1 29 ? -3.741  5.781   -0.146  1.00 0.00 ? 29  ILE A HG13 8  
ATOM   4908  H  HG21 . ILE A 1 29 ? -1.116  9.038   0.403   1.00 0.00 ? 29  ILE A HG21 8  
ATOM   4909  H  HG22 . ILE A 1 29 ? -1.239  8.137   -1.107  1.00 0.00 ? 29  ILE A HG22 8  
ATOM   4910  H  HG23 . ILE A 1 29 ? -2.445  9.362   -0.711  1.00 0.00 ? 29  ILE A HG23 8  
ATOM   4911  H  HD11 . ILE A 1 29 ? -5.476  7.027   -0.798  1.00 0.00 ? 29  ILE A HD11 8  
ATOM   4912  H  HD12 . ILE A 1 29 ? -4.472  8.437   -1.134  1.00 0.00 ? 29  ILE A HD12 8  
ATOM   4913  H  HD13 . ILE A 1 29 ? -4.596  7.139   -2.322  1.00 0.00 ? 29  ILE A HD13 8  
ATOM   4914  N  N    . ILE A 1 30 ? -1.636  7.960   3.339   1.00 0.00 ? 30  ILE A N    8  
ATOM   4915  C  CA   . ILE A 1 30 ? -1.006  8.817   4.335   1.00 0.00 ? 30  ILE A CA   8  
ATOM   4916  C  C    . ILE A 1 30 ? 0.162   8.108   5.011   1.00 0.00 ? 30  ILE A C    8  
ATOM   4917  O  O    . ILE A 1 30 ? 1.200   8.715   5.279   1.00 0.00 ? 30  ILE A O    8  
ATOM   4918  C  CB   . ILE A 1 30 ? -2.013  9.263   5.412   1.00 0.00 ? 30  ILE A CB   8  
ATOM   4919  C  CG1  . ILE A 1 30 ? -3.130  10.098  4.783   1.00 0.00 ? 30  ILE A CG1  8  
ATOM   4920  C  CG2  . ILE A 1 30 ? -1.306  10.051  6.505   1.00 0.00 ? 30  ILE A CG2  8  
ATOM   4921  C  CD1  . ILE A 1 30 ? -4.308  10.326  5.705   1.00 0.00 ? 30  ILE A CD1  8  
ATOM   4922  H  H    . ILE A 1 30 ? -2.564  7.675   3.471   1.00 0.00 ? 30  ILE A H    8  
ATOM   4923  H  HA   . ILE A 1 30 ? -0.636  9.698   3.831   1.00 0.00 ? 30  ILE A HA   8  
ATOM   4924  H  HB   . ILE A 1 30 ? -2.443  8.379   5.859   1.00 0.00 ? 30  ILE A HB   8  
ATOM   4925  H  HG12 . ILE A 1 30 ? -2.736  11.063  4.504   1.00 0.00 ? 30  ILE A HG12 8  
ATOM   4926  H  HG13 . ILE A 1 30 ? -3.492  9.593   3.899   1.00 0.00 ? 30  ILE A HG13 8  
ATOM   4927  H  HG21 . ILE A 1 30 ? -2.002  10.261  7.304   1.00 0.00 ? 30  ILE A HG21 8  
ATOM   4928  H  HG22 . ILE A 1 30 ? -0.481  9.471   6.890   1.00 0.00 ? 30  ILE A HG22 8  
ATOM   4929  H  HG23 . ILE A 1 30 ? -0.935  10.979  6.097   1.00 0.00 ? 30  ILE A HG23 8  
ATOM   4930  H  HD11 . ILE A 1 30 ? -3.948  10.602  6.686   1.00 0.00 ? 30  ILE A HD11 8  
ATOM   4931  H  HD12 . ILE A 1 30 ? -4.925  11.120  5.312   1.00 0.00 ? 30  ILE A HD12 8  
ATOM   4932  H  HD13 . ILE A 1 30 ? -4.889  9.419   5.778   1.00 0.00 ? 30  ILE A HD13 8  
ATOM   4933  N  N    . HIS A 1 31 ? -0.012  6.818   5.282   1.00 0.00 ? 31  HIS A N    8  
ATOM   4934  C  CA   . HIS A 1 31 ? 1.030   6.024   5.924   1.00 0.00 ? 31  HIS A CA   8  
ATOM   4935  C  C    . HIS A 1 31 ? 2.192   5.778   4.967   1.00 0.00 ? 31  HIS A C    8  
ATOM   4936  O  O    . HIS A 1 31 ? 3.355   5.937   5.336   1.00 0.00 ? 31  HIS A O    8  
ATOM   4937  C  CB   . HIS A 1 31 ? 0.459   4.690   6.406   1.00 0.00 ? 31  HIS A CB   8  
ATOM   4938  C  CG   . HIS A 1 31 ? 1.466   3.582   6.428   1.00 0.00 ? 31  HIS A CG   8  
ATOM   4939  N  ND1  . HIS A 1 31 ? 1.960   3.037   7.595   1.00 0.00 ? 31  HIS A ND1  8  
ATOM   4940  C  CD2  . HIS A 1 31 ? 2.071   2.914   5.418   1.00 0.00 ? 31  HIS A CD2  8  
ATOM   4941  C  CE1  . HIS A 1 31 ? 2.826   2.083   7.301   1.00 0.00 ? 31  HIS A CE1  8  
ATOM   4942  N  NE2  . HIS A 1 31 ? 2.911   1.989   5.986   1.00 0.00 ? 31  HIS A NE2  8  
ATOM   4943  H  H    . HIS A 1 31 ? -0.861  6.391   5.044   1.00 0.00 ? 31  HIS A H    8  
ATOM   4944  H  HA   . HIS A 1 31 ? 1.392   6.580   6.775   1.00 0.00 ? 31  HIS A HA   8  
ATOM   4945  H  HB2  . HIS A 1 31 ? 0.077   4.811   7.408   1.00 0.00 ? 31  HIS A HB2  8  
ATOM   4946  H  HB3  . HIS A 1 31 ? -0.348  4.394   5.751   1.00 0.00 ? 31  HIS A HB3  8  
ATOM   4947  H  HD1  . HIS A 1 31 ? 1.713   3.310   8.503   1.00 0.00 ? 31  HIS A HD1  8  
ATOM   4948  H  HD2  . HIS A 1 31 ? 1.921   3.079   4.360   1.00 0.00 ? 31  HIS A HD2  8  
ATOM   4949  H  HE1  . HIS A 1 31 ? 3.371   1.483   8.013   1.00 0.00 ? 31  HIS A HE1  8  
ATOM   4950  N  N    . GLN A 1 32 ? 1.869   5.389   3.738   1.00 0.00 ? 32  GLN A N    8  
ATOM   4951  C  CA   . GLN A 1 32 ? 2.888   5.120   2.730   1.00 0.00 ? 32  GLN A CA   8  
ATOM   4952  C  C    . GLN A 1 32 ? 3.904   6.255   2.666   1.00 0.00 ? 32  GLN A C    8  
ATOM   4953  O  O    . GLN A 1 32 ? 5.021   6.076   2.181   1.00 0.00 ? 32  GLN A O    8  
ATOM   4954  C  CB   . GLN A 1 32 ? 2.239   4.923   1.359   1.00 0.00 ? 32  GLN A CB   8  
ATOM   4955  C  CG   . GLN A 1 32 ? 1.417   3.648   1.252   1.00 0.00 ? 32  GLN A CG   8  
ATOM   4956  C  CD   . GLN A 1 32 ? 0.683   3.536   -0.070  1.00 0.00 ? 32  GLN A CD   8  
ATOM   4957  O  OE1  . GLN A 1 32 ? 0.475   4.532   -0.764  1.00 0.00 ? 32  GLN A OE1  8  
ATOM   4958  N  NE2  . GLN A 1 32 ? 0.287   2.320   -0.426  1.00 0.00 ? 32  GLN A NE2  8  
ATOM   4959  H  H    . GLN A 1 32 ? 0.924   5.280   3.504   1.00 0.00 ? 32  GLN A H    8  
ATOM   4960  H  HA   . GLN A 1 32 ? 3.399   4.211   3.010   1.00 0.00 ? 32  GLN A HA   8  
ATOM   4961  H  HB2  . GLN A 1 32 ? 1.590   5.762   1.157   1.00 0.00 ? 32  GLN A HB2  8  
ATOM   4962  H  HB3  . GLN A 1 32 ? 3.014   4.889   0.608   1.00 0.00 ? 32  GLN A HB3  8  
ATOM   4963  H  HG2  . GLN A 1 32 ? 2.077   2.800   1.352   1.00 0.00 ? 32  GLN A HG2  8  
ATOM   4964  H  HG3  . GLN A 1 32 ? 0.692   3.635   2.052   1.00 0.00 ? 32  GLN A HG3  8  
ATOM   4965  H  HE21 . GLN A 1 32 ? 0.487   1.573   0.178   1.00 0.00 ? 32  GLN A HE21 8  
ATOM   4966  H  HE22 . GLN A 1 32 ? -0.190  2.219   -1.275  1.00 0.00 ? 32  GLN A HE22 8  
ATOM   4967  N  N    . LYS A 1 33 ? 3.510   7.424   3.160   1.00 0.00 ? 33  LYS A N    8  
ATOM   4968  C  CA   . LYS A 1 33 ? 4.386   8.589   3.160   1.00 0.00 ? 33  LYS A CA   8  
ATOM   4969  C  C    . LYS A 1 33 ? 5.701   8.281   3.869   1.00 0.00 ? 33  LYS A C    8  
ATOM   4970  O  O    . LYS A 1 33 ? 6.745   8.839   3.530   1.00 0.00 ? 33  LYS A O    8  
ATOM   4971  C  CB   . LYS A 1 33 ? 3.694   9.773   3.840   1.00 0.00 ? 33  LYS A CB   8  
ATOM   4972  C  CG   . LYS A 1 33 ? 2.475   10.279  3.088   1.00 0.00 ? 33  LYS A CG   8  
ATOM   4973  C  CD   . LYS A 1 33 ? 2.153   11.719  3.451   1.00 0.00 ? 33  LYS A CD   8  
ATOM   4974  C  CE   . LYS A 1 33 ? 0.815   12.153  2.874   1.00 0.00 ? 33  LYS A CE   8  
ATOM   4975  N  NZ   . LYS A 1 33 ? 0.830   12.165  1.385   1.00 0.00 ? 33  LYS A NZ   8  
ATOM   4976  H  H    . LYS A 1 33 ? 2.607   7.505   3.534   1.00 0.00 ? 33  LYS A H    8  
ATOM   4977  H  HA   . LYS A 1 33 ? 4.596   8.847   2.133   1.00 0.00 ? 33  LYS A HA   8  
ATOM   4978  H  HB2  . LYS A 1 33 ? 3.382   9.472   4.829   1.00 0.00 ? 33  LYS A HB2  8  
ATOM   4979  H  HB3  . LYS A 1 33 ? 4.400   10.586  3.927   1.00 0.00 ? 33  LYS A HB3  8  
ATOM   4980  H  HG2  . LYS A 1 33 ? 2.668   10.221  2.027   1.00 0.00 ? 33  LYS A HG2  8  
ATOM   4981  H  HG3  . LYS A 1 33 ? 1.627   9.656   3.336   1.00 0.00 ? 33  LYS A HG3  8  
ATOM   4982  H  HD2  . LYS A 1 33 ? 2.116   11.810  4.526   1.00 0.00 ? 33  LYS A HD2  8  
ATOM   4983  H  HD3  . LYS A 1 33 ? 2.930   12.361  3.060   1.00 0.00 ? 33  LYS A HD3  8  
ATOM   4984  H  HE2  . LYS A 1 33 ? 0.053   11.468  3.212   1.00 0.00 ? 33  LYS A HE2  8  
ATOM   4985  H  HE3  . LYS A 1 33 ? 0.590   13.147  3.231   1.00 0.00 ? 33  LYS A HE3  8  
ATOM   4986  H  HZ1  . LYS A 1 33 ? -0.113  11.930  1.016   1.00 0.00 ? 33  LYS A HZ1  8  
ATOM   4987  H  HZ2  . LYS A 1 33 ? 1.514   11.466  1.030   1.00 0.00 ? 33  LYS A HZ2  8  
ATOM   4988  H  HZ3  . LYS A 1 33 ? 1.102   13.107  1.038   1.00 0.00 ? 33  LYS A HZ3  8  
ATOM   4989  N  N    . ILE A 1 34 ? 5.644   7.389   4.851   1.00 0.00 ? 34  ILE A N    8  
ATOM   4990  C  CA   . ILE A 1 34 ? 6.831   7.005   5.605   1.00 0.00 ? 34  ILE A CA   8  
ATOM   4991  C  C    . ILE A 1 34 ? 7.859   6.330   4.703   1.00 0.00 ? 34  ILE A C    8  
ATOM   4992  O  O    . ILE A 1 34 ? 8.983   6.052   5.124   1.00 0.00 ? 34  ILE A O    8  
ATOM   4993  C  CB   . ILE A 1 34 ? 6.479   6.055   6.765   1.00 0.00 ? 34  ILE A CB   8  
ATOM   4994  C  CG1  . ILE A 1 34 ? 6.103   4.673   6.225   1.00 0.00 ? 34  ILE A CG1  8  
ATOM   4995  C  CG2  . ILE A 1 34 ? 5.343   6.632   7.596   1.00 0.00 ? 34  ILE A CG2  8  
ATOM   4996  C  CD1  . ILE A 1 34 ? 6.026   3.607   7.295   1.00 0.00 ? 34  ILE A CD1  8  
ATOM   4997  H  H    . ILE A 1 34 ? 4.783   6.978   5.075   1.00 0.00 ? 34  ILE A H    8  
ATOM   4998  H  HA   . ILE A 1 34 ? 7.266   7.902   6.020   1.00 0.00 ? 34  ILE A HA   8  
ATOM   4999  H  HB   . ILE A 1 34 ? 7.347   5.961   7.400   1.00 0.00 ? 34  ILE A HB   8  
ATOM   5000  H  HG12 . ILE A 1 34 ? 5.139   4.731   5.745   1.00 0.00 ? 34  ILE A HG12 8  
ATOM   5001  H  HG13 . ILE A 1 34 ? 6.843   4.364   5.501   1.00 0.00 ? 34  ILE A HG13 8  
ATOM   5002  H  HG21 . ILE A 1 34 ? 4.677   7.192   6.956   1.00 0.00 ? 34  ILE A HG21 8  
ATOM   5003  H  HG22 . ILE A 1 34 ? 4.798   5.828   8.066   1.00 0.00 ? 34  ILE A HG22 8  
ATOM   5004  H  HG23 . ILE A 1 34 ? 5.748   7.285   8.354   1.00 0.00 ? 34  ILE A HG23 8  
ATOM   5005  H  HD11 . ILE A 1 34 ? 5.011   3.240   7.365   1.00 0.00 ? 34  ILE A HD11 8  
ATOM   5006  H  HD12 . ILE A 1 34 ? 6.685   2.791   7.040   1.00 0.00 ? 34  ILE A HD12 8  
ATOM   5007  H  HD13 . ILE A 1 34 ? 6.322   4.027   8.245   1.00 0.00 ? 34  ILE A HD13 8  
ATOM   5008  N  N    . HIS A 1 35 ? 7.468   6.069   3.460   1.00 0.00 ? 35  HIS A N    8  
ATOM   5009  C  CA   . HIS A 1 35 ? 8.357   5.428   2.497   1.00 0.00 ? 35  HIS A CA   8  
ATOM   5010  C  C    . HIS A 1 35 ? 8.737   6.396   1.381   1.00 0.00 ? 35  HIS A C    8  
ATOM   5011  O  O    . HIS A 1 35 ? 9.852   6.352   0.859   1.00 0.00 ? 35  HIS A O    8  
ATOM   5012  C  CB   . HIS A 1 35 ? 7.691   4.185   1.905   1.00 0.00 ? 35  HIS A CB   8  
ATOM   5013  C  CG   . HIS A 1 35 ? 7.212   3.213   2.939   1.00 0.00 ? 35  HIS A CG   8  
ATOM   5014  N  ND1  . HIS A 1 35 ? 8.060   2.554   3.803   1.00 0.00 ? 35  HIS A ND1  8  
ATOM   5015  C  CD2  . HIS A 1 35 ? 5.963   2.790   3.245   1.00 0.00 ? 35  HIS A CD2  8  
ATOM   5016  C  CE1  . HIS A 1 35 ? 7.354   1.767   4.595   1.00 0.00 ? 35  HIS A CE1  8  
ATOM   5017  N  NE2  . HIS A 1 35 ? 6.078   1.892   4.277   1.00 0.00 ? 35  HIS A NE2  8  
ATOM   5018  H  H    . HIS A 1 35 ? 6.560   6.313   3.184   1.00 0.00 ? 35  HIS A H    8  
ATOM   5019  H  HA   . HIS A 1 35 ? 9.253   5.131   3.020   1.00 0.00 ? 35  HIS A HA   8  
ATOM   5020  H  HB2  . HIS A 1 35 ? 6.839   4.488   1.315   1.00 0.00 ? 35  HIS A HB2  8  
ATOM   5021  H  HB3  . HIS A 1 35 ? 8.399   3.673   1.270   1.00 0.00 ? 35  HIS A HB3  8  
ATOM   5022  H  HD1  . HIS A 1 35 ? 9.035   2.648   3.831   1.00 0.00 ? 35  HIS A HD1  8  
ATOM   5023  H  HD2  . HIS A 1 35 ? 5.044   3.101   2.766   1.00 0.00 ? 35  HIS A HD2  8  
ATOM   5024  H  HE1  . HIS A 1 35 ? 7.752   1.130   5.371   1.00 0.00 ? 35  HIS A HE1  8  
ATOM   5025  N  N    . THR A 1 36 ? 7.804   7.270   1.019   1.00 0.00 ? 36  THR A N    8  
ATOM   5026  C  CA   . THR A 1 36 ? 8.040   8.248   -0.036  1.00 0.00 ? 36  THR A CA   8  
ATOM   5027  C  C    . THR A 1 36 ? 9.099   9.262   0.381   1.00 0.00 ? 36  THR A C    8  
ATOM   5028  O  O    . THR A 1 36 ? 9.987   9.603   -0.398  1.00 0.00 ? 36  THR A O    8  
ATOM   5029  C  CB   . THR A 1 36 ? 6.747   8.996   -0.409  1.00 0.00 ? 36  THR A CB   8  
ATOM   5030  O  OG1  . THR A 1 36 ? 6.210   9.652   0.746   1.00 0.00 ? 36  THR A OG1  8  
ATOM   5031  C  CG2  . THR A 1 36 ? 5.713   8.038   -0.981  1.00 0.00 ? 36  THR A CG2  8  
ATOM   5032  H  H    . THR A 1 36 ? 6.935   7.256   1.472   1.00 0.00 ? 36  THR A H    8  
ATOM   5033  H  HA   . THR A 1 36 ? 8.389   7.717   -0.910  1.00 0.00 ? 36  THR A HA   8  
ATOM   5034  H  HB   . THR A 1 36 ? 6.982   9.739   -1.158  1.00 0.00 ? 36  THR A HB   8  
ATOM   5035  H  HG1  . THR A 1 36 ? 6.478   9.177   1.537   1.00 0.00 ? 36  THR A HG1  8  
ATOM   5036  H  HG21 . THR A 1 36 ? 4.892   7.939   -0.287  1.00 0.00 ? 36  THR A HG21 8  
ATOM   5037  H  HG22 . THR A 1 36 ? 6.167   7.072   -1.141  1.00 0.00 ? 36  THR A HG22 8  
ATOM   5038  H  HG23 . THR A 1 36 ? 5.346   8.424   -1.921  1.00 0.00 ? 36  THR A HG23 8  
ATOM   5039  N  N    . GLY A 1 37 ? 8.998   9.741   1.618   1.00 0.00 ? 37  GLY A N    8  
ATOM   5040  C  CA   . GLY A 1 37 ? 9.954   10.712  2.117   1.00 0.00 ? 37  GLY A CA   8  
ATOM   5041  C  C    . GLY A 1 37 ? 11.383  10.358  1.755   1.00 0.00 ? 37  GLY A C    8  
ATOM   5042  O  O    . GLY A 1 37 ? 12.121  11.192  1.230   1.00 0.00 ? 37  GLY A O    8  
ATOM   5043  H  H    . GLY A 1 37 ? 8.269   9.432   2.195   1.00 0.00 ? 37  GLY A H    8  
ATOM   5044  H  HA2  . GLY A 1 37 ? 9.717   11.680  1.703   1.00 0.00 ? 37  GLY A HA2  8  
ATOM   5045  H  HA3  . GLY A 1 37 ? 9.870   10.761  3.193   1.00 0.00 ? 37  GLY A HA3  8  
ATOM   5046  N  N    . GLU A 1 38 ? 11.774  9.119   2.036   1.00 0.00 ? 38  GLU A N    8  
ATOM   5047  C  CA   . GLU A 1 38 ? 13.125  8.659   1.737   1.00 0.00 ? 38  GLU A CA   8  
ATOM   5048  C  C    . GLU A 1 38 ? 13.188  8.017   0.354   1.00 0.00 ? 38  GLU A C    8  
ATOM   5049  O  O    . GLU A 1 38 ? 13.067  6.800   0.217   1.00 0.00 ? 38  GLU A O    8  
ATOM   5050  C  CB   . GLU A 1 38 ? 13.593  7.659   2.797   1.00 0.00 ? 38  GLU A CB   8  
ATOM   5051  C  CG   . GLU A 1 38 ? 13.964  8.306   4.121   1.00 0.00 ? 38  GLU A CG   8  
ATOM   5052  C  CD   . GLU A 1 38 ? 14.069  7.300   5.252   1.00 0.00 ? 38  GLU A CD   8  
ATOM   5053  O  OE1  . GLU A 1 38 ? 14.592  6.192   5.013   1.00 0.00 ? 38  GLU A OE1  8  
ATOM   5054  O  OE2  . GLU A 1 38 ? 13.628  7.622   6.375   1.00 0.00 ? 38  GLU A OE2  8  
ATOM   5055  H  H    . GLU A 1 38 ? 11.139  8.500   2.454   1.00 0.00 ? 38  GLU A H    8  
ATOM   5056  H  HA   . GLU A 1 38 ? 13.779  9.518   1.753   1.00 0.00 ? 38  GLU A HA   8  
ATOM   5057  H  HB2  . GLU A 1 38 ? 12.802  6.947   2.977   1.00 0.00 ? 38  GLU A HB2  8  
ATOM   5058  H  HB3  . GLU A 1 38 ? 14.459  7.135   2.422   1.00 0.00 ? 38  GLU A HB3  8  
ATOM   5059  H  HG2  . GLU A 1 38 ? 14.918  8.800   4.011   1.00 0.00 ? 38  GLU A HG2  8  
ATOM   5060  H  HG3  . GLU A 1 38 ? 13.209  9.035   4.376   1.00 0.00 ? 38  GLU A HG3  8  
ATOM   5061  N  N    . ARG A 1 39 ? 13.379  8.846   -0.667  1.00 0.00 ? 39  ARG A N    8  
ATOM   5062  C  CA   . ARG A 1 39 ? 13.457  8.360   -2.040  1.00 0.00 ? 39  ARG A CA   8  
ATOM   5063  C  C    . ARG A 1 39 ? 14.781  8.759   -2.684  1.00 0.00 ? 39  ARG A C    8  
ATOM   5064  O  O    . ARG A 1 39 ? 14.834  9.589   -3.591  1.00 0.00 ? 39  ARG A O    8  
ATOM   5065  C  CB   . ARG A 1 39 ? 12.291  8.910   -2.865  1.00 0.00 ? 39  ARG A CB   8  
ATOM   5066  C  CG   . ARG A 1 39 ? 12.161  10.423  -2.803  1.00 0.00 ? 39  ARG A CG   8  
ATOM   5067  C  CD   . ARG A 1 39 ? 11.111  10.932  -3.777  1.00 0.00 ? 39  ARG A CD   8  
ATOM   5068  N  NE   . ARG A 1 39 ? 11.445  10.606  -5.161  1.00 0.00 ? 39  ARG A NE   8  
ATOM   5069  C  CZ   . ARG A 1 39 ? 11.055  11.333  -6.202  1.00 0.00 ? 39  ARG A CZ   8  
ATOM   5070  N  NH1  . ARG A 1 39 ? 10.322  12.422  -6.017  1.00 0.00 ? 39  ARG A NH1  8  
ATOM   5071  N  NH2  . ARG A 1 39 ? 11.399  10.971  -7.432  1.00 0.00 ? 39  ARG A NH2  8  
ATOM   5072  H  H    . ARG A 1 39 ? 13.469  9.806   -0.494  1.00 0.00 ? 39  ARG A H    8  
ATOM   5073  H  HA   . ARG A 1 39 ? 13.392  7.283   -2.015  1.00 0.00 ? 39  ARG A HA   8  
ATOM   5074  H  HB2  . ARG A 1 39 ? 12.430  8.625   -3.897  1.00 0.00 ? 39  ARG A HB2  8  
ATOM   5075  H  HB3  . ARG A 1 39 ? 11.372  8.476   -2.500  1.00 0.00 ? 39  ARG A HB3  8  
ATOM   5076  H  HG2  . ARG A 1 39 ? 11.876  10.710  -1.801  1.00 0.00 ? 39  ARG A HG2  8  
ATOM   5077  H  HG3  . ARG A 1 39 ? 13.114  10.867  -3.049  1.00 0.00 ? 39  ARG A HG3  8  
ATOM   5078  H  HD2  . ARG A 1 39 ? 10.162  10.482  -3.531  1.00 0.00 ? 39  ARG A HD2  8  
ATOM   5079  H  HD3  . ARG A 1 39 ? 11.038  12.005  -3.678  1.00 0.00 ? 39  ARG A HD3  8  
ATOM   5080  H  HE   . ARG A 1 39 ? 11.986  9.805   -5.321  1.00 0.00 ? 39  ARG A HE   8  
ATOM   5081  H  HH11 . ARG A 1 39 ? 10.062  12.698  -5.092  1.00 0.00 ? 39  ARG A HH11 8  
ATOM   5082  H  HH12 . ARG A 1 39 ? 10.031  12.968  -6.803  1.00 0.00 ? 39  ARG A HH12 8  
ATOM   5083  H  HH21 . ARG A 1 39 ? 11.951  10.150  -7.575  1.00 0.00 ? 39  ARG A HH21 8  
ATOM   5084  H  HH22 . ARG A 1 39 ? 11.105  11.518  -8.215  1.00 0.00 ? 39  ARG A HH22 8  
ATOM   5085  N  N    . PRO A 1 40 ? 15.878  8.155   -2.203  1.00 0.00 ? 40  PRO A N    8  
ATOM   5086  C  CA   . PRO A 1 40 ? 17.223  8.431   -2.717  1.00 0.00 ? 40  PRO A CA   8  
ATOM   5087  C  C    . PRO A 1 40 ? 17.426  7.893   -4.130  1.00 0.00 ? 40  PRO A C    8  
ATOM   5088  O  O    . PRO A 1 40 ? 18.062  8.537   -4.964  1.00 0.00 ? 40  PRO A O    8  
ATOM   5089  C  CB   . PRO A 1 40 ? 18.137  7.699   -1.730  1.00 0.00 ? 40  PRO A CB   8  
ATOM   5090  C  CG   . PRO A 1 40 ? 17.291  6.610   -1.167  1.00 0.00 ? 40  PRO A CG   8  
ATOM   5091  C  CD   . PRO A 1 40 ? 15.890  7.155   -1.122  1.00 0.00 ? 40  PRO A CD   8  
ATOM   5092  H  HA   . PRO A 1 40 ? 17.445  9.488   -2.700  1.00 0.00 ? 40  PRO A HA   8  
ATOM   5093  H  HB2  . PRO A 1 40 ? 18.994  7.303   -2.256  1.00 0.00 ? 40  PRO A HB2  8  
ATOM   5094  H  HB3  . PRO A 1 40 ? 18.463  8.383   -0.962  1.00 0.00 ? 40  PRO A HB3  8  
ATOM   5095  H  HG2  . PRO A 1 40 ? 17.336  5.742   -1.807  1.00 0.00 ? 40  PRO A HG2  8  
ATOM   5096  H  HG3  . PRO A 1 40 ? 17.628  6.362   -0.171  1.00 0.00 ? 40  PRO A HG3  8  
ATOM   5097  H  HD2  . PRO A 1 40 ? 15.174  6.370   -1.315  1.00 0.00 ? 40  PRO A HD2  8  
ATOM   5098  H  HD3  . PRO A 1 40 ? 15.696  7.619   -0.167  1.00 0.00 ? 40  PRO A HD3  8  
ATOM   5099  N  N    . SER A 1 41 ? 16.881  6.709   -4.391  1.00 0.00 ? 41  SER A N    8  
ATOM   5100  C  CA   . SER A 1 41 ? 17.005  6.084   -5.703  1.00 0.00 ? 41  SER A CA   8  
ATOM   5101  C  C    . SER A 1 41 ? 15.639  5.658   -6.233  1.00 0.00 ? 41  SER A C    8  
ATOM   5102  O  O    . SER A 1 41 ? 15.140  4.583   -5.903  1.00 0.00 ? 41  SER A O    8  
ATOM   5103  C  CB   . SER A 1 41 ? 17.936  4.871   -5.627  1.00 0.00 ? 41  SER A CB   8  
ATOM   5104  O  OG   . SER A 1 41 ? 17.928  4.146   -6.844  1.00 0.00 ? 41  SER A OG   8  
ATOM   5105  H  H    . SER A 1 41 ? 16.386  6.244   -3.684  1.00 0.00 ? 41  SER A H    8  
ATOM   5106  H  HA   . SER A 1 41 ? 17.430  6.811   -6.378  1.00 0.00 ? 41  SER A HA   8  
ATOM   5107  H  HB2  . SER A 1 41 ? 18.942  5.205   -5.427  1.00 0.00 ? 41  SER A HB2  8  
ATOM   5108  H  HB3  . SER A 1 41 ? 17.608  4.219   -4.830  1.00 0.00 ? 41  SER A HB3  8  
ATOM   5109  H  HG   . SER A 1 41 ? 18.425  3.332   -6.735  1.00 0.00 ? 41  SER A HG   8  
ATOM   5110  N  N    . GLY A 1 42 ? 15.040  6.512   -7.058  1.00 0.00 ? 42  GLY A N    8  
ATOM   5111  C  CA   . GLY A 1 42 ? 13.737  6.208   -7.621  1.00 0.00 ? 42  GLY A CA   8  
ATOM   5112  C  C    . GLY A 1 42 ? 13.809  5.161   -8.715  1.00 0.00 ? 42  GLY A C    8  
ATOM   5113  O  O    . GLY A 1 42 ? 14.888  4.728   -9.120  1.00 0.00 ? 42  GLY A O    8  
ATOM   5114  H  H    . GLY A 1 42 ? 15.485  7.354   -7.285  1.00 0.00 ? 42  GLY A H    8  
ATOM   5115  H  HA2  . GLY A 1 42 ? 13.092  5.847   -6.834  1.00 0.00 ? 42  GLY A HA2  8  
ATOM   5116  H  HA3  . GLY A 1 42 ? 13.316  7.113   -8.032  1.00 0.00 ? 42  GLY A HA3  8  
ATOM   5117  N  N    . PRO A 1 43 ? 12.637  4.736   -9.210  1.00 0.00 ? 43  PRO A N    8  
ATOM   5118  C  CA   . PRO A 1 43 ? 12.544  3.727   -10.270 1.00 0.00 ? 43  PRO A CA   8  
ATOM   5119  C  C    . PRO A 1 43 ? 13.034  4.253   -11.615 1.00 0.00 ? 43  PRO A C    8  
ATOM   5120  O  O    . PRO A 1 43 ? 12.308  4.953   -12.320 1.00 0.00 ? 43  PRO A O    8  
ATOM   5121  C  CB   . PRO A 1 43 ? 11.047  3.413   -10.331 1.00 0.00 ? 43  PRO A CB   8  
ATOM   5122  C  CG   . PRO A 1 43 ? 10.382  4.640   -9.810  1.00 0.00 ? 43  PRO A CG   8  
ATOM   5123  C  CD   . PRO A 1 43 ? 11.312  5.208   -8.775  1.00 0.00 ? 43  PRO A CD   8  
ATOM   5124  H  HA   . PRO A 1 43 ? 13.092  2.832   -10.014 1.00 0.00 ? 43  PRO A HA   8  
ATOM   5125  H  HB2  . PRO A 1 43 ? 10.761  3.211   -11.354 1.00 0.00 ? 43  PRO A HB2  8  
ATOM   5126  H  HB3  . PRO A 1 43 ? 10.830  2.554   -9.714  1.00 0.00 ? 43  PRO A HB3  8  
ATOM   5127  H  HG2  . PRO A 1 43 ? 10.236  5.347   -10.612 1.00 0.00 ? 43  PRO A HG2  8  
ATOM   5128  H  HG3  . PRO A 1 43 ? 9.434   4.380   -9.361  1.00 0.00 ? 43  PRO A HG3  8  
ATOM   5129  H  HD2  . PRO A 1 43 ? 11.267  6.287   -8.778  1.00 0.00 ? 43  PRO A HD2  8  
ATOM   5130  H  HD3  . PRO A 1 43 ? 11.068  4.821   -7.796  1.00 0.00 ? 43  PRO A HD3  8  
ATOM   5131  N  N    . SER A 1 44 ? 14.270  3.910   -11.965 1.00 0.00 ? 44  SER A N    8  
ATOM   5132  C  CA   . SER A 1 44 ? 14.858  4.350   -13.225 1.00 0.00 ? 44  SER A CA   8  
ATOM   5133  C  C    . SER A 1 44 ? 14.445  3.428   -14.368 1.00 0.00 ? 44  SER A C    8  
ATOM   5134  O  O    . SER A 1 44 ? 13.959  2.320   -14.142 1.00 0.00 ? 44  SER A O    8  
ATOM   5135  C  CB   . SER A 1 44 ? 16.383  4.393   -13.113 1.00 0.00 ? 44  SER A CB   8  
ATOM   5136  O  OG   . SER A 1 44 ? 16.813  5.565   -12.443 1.00 0.00 ? 44  SER A OG   8  
ATOM   5137  H  H    . SER A 1 44 ? 14.799  3.349   -11.360 1.00 0.00 ? 44  SER A H    8  
ATOM   5138  H  HA   . SER A 1 44 ? 14.493  5.345   -13.431 1.00 0.00 ? 44  SER A HA   8  
ATOM   5139  H  HB2  . SER A 1 44 ? 16.725  3.531   -12.560 1.00 0.00 ? 44  SER A HB2  8  
ATOM   5140  H  HB3  . SER A 1 44 ? 16.814  4.379   -14.104 1.00 0.00 ? 44  SER A HB3  8  
ATOM   5141  H  HG   . SER A 1 44 ? 16.091  6.197   -12.409 1.00 0.00 ? 44  SER A HG   8  
ATOM   5142  N  N    . SER A 1 45 ? 14.643  3.895   -15.597 1.00 0.00 ? 45  SER A N    8  
ATOM   5143  C  CA   . SER A 1 45 ? 14.289  3.115   -16.777 1.00 0.00 ? 45  SER A CA   8  
ATOM   5144  C  C    . SER A 1 45 ? 15.528  2.475   -17.397 1.00 0.00 ? 45  SER A C    8  
ATOM   5145  O  O    . SER A 1 45 ? 16.572  3.112   -17.523 1.00 0.00 ? 45  SER A O    8  
ATOM   5146  C  CB   . SER A 1 45 ? 13.589  4.001   -17.809 1.00 0.00 ? 45  SER A CB   8  
ATOM   5147  O  OG   . SER A 1 45 ? 13.456  3.331   -19.050 1.00 0.00 ? 45  SER A OG   8  
ATOM   5148  H  H    . SER A 1 45 ? 15.035  4.786   -15.712 1.00 0.00 ? 45  SER A H    8  
ATOM   5149  H  HA   . SER A 1 45 ? 13.612  2.334   -16.467 1.00 0.00 ? 45  SER A HA   8  
ATOM   5150  H  HB2  . SER A 1 45 ? 12.606  4.262   -17.447 1.00 0.00 ? 45  SER A HB2  8  
ATOM   5151  H  HB3  . SER A 1 45 ? 14.168  4.901   -17.958 1.00 0.00 ? 45  SER A HB3  8  
ATOM   5152  H  HG   . SER A 1 45 ? 12.526  3.184   -19.237 1.00 0.00 ? 45  SER A HG   8  
ATOM   5153  N  N    . GLY A 1 46 ? 15.402  1.208   -17.782 1.00 0.00 ? 46  GLY A N    8  
ATOM   5154  C  CA   . GLY A 1 46 ? 16.517  0.501   -18.384 1.00 0.00 ? 46  GLY A CA   8  
ATOM   5155  C  C    . GLY A 1 46 ? 16.746  0.902   -19.828 1.00 0.00 ? 46  GLY A C    8  
ATOM   5156  O  O    . GLY A 1 46 ? 16.350  0.161   -20.725 1.00 0.00 ? 46  GLY A O    8  
ATOM   5157  H  H    . GLY A 1 46 ? 14.544  0.750   -17.656 1.00 0.00 ? 46  GLY A H    8  
ATOM   5158  H  HA2  . GLY A 1 46 ? 17.411  0.712   -17.816 1.00 0.00 ? 46  GLY A HA2  8  
ATOM   5159  H  HA3  . GLY A 1 46 ? 16.320  -0.560  -18.344 1.00 0.00 ? 46  GLY A HA3  8  
HETATM 5160  ZN ZN   . ZN  B 2 .  ? 4.270   1.059   4.690   1.00 0.00 ? 201 ZN  A ZN   8  
ATOM   5161  N  N    . GLY A 1 1  ? 9.799   -30.053 -2.663  1.00 0.00 ? 1   GLY A N    9  
ATOM   5162  C  CA   . GLY A 1 1  ? 9.749   -29.737 -1.247  1.00 0.00 ? 1   GLY A CA   9  
ATOM   5163  C  C    . GLY A 1 1  ? 8.511   -28.947 -0.873  1.00 0.00 ? 1   GLY A C    9  
ATOM   5164  O  O    . GLY A 1 1  ? 7.387   -29.413 -1.065  1.00 0.00 ? 1   GLY A O    9  
ATOM   5165  H  H1   . GLY A 1 1  ? 10.260  -29.449 -3.282  1.00 0.00 ? 1   GLY A H1   9  
ATOM   5166  H  HA2  . GLY A 1 1  ? 9.760   -30.657 -0.683  1.00 0.00 ? 1   GLY A HA2  9  
ATOM   5167  H  HA3  . GLY A 1 1  ? 10.623  -29.157 -0.989  1.00 0.00 ? 1   GLY A HA3  9  
ATOM   5168  N  N    . SER A 1 2  ? 8.715   -27.748 -0.337  1.00 0.00 ? 2   SER A N    9  
ATOM   5169  C  CA   . SER A 1 2  ? 7.606   -26.893 0.070   1.00 0.00 ? 2   SER A CA   9  
ATOM   5170  C  C    . SER A 1 2  ? 6.710   -26.562 -1.120  1.00 0.00 ? 2   SER A C    9  
ATOM   5171  O  O    . SER A 1 2  ? 7.132   -25.887 -2.059  1.00 0.00 ? 2   SER A O    9  
ATOM   5172  C  CB   . SER A 1 2  ? 8.133   -25.603 0.701   1.00 0.00 ? 2   SER A CB   9  
ATOM   5173  O  OG   . SER A 1 2  ? 8.761   -25.863 1.945   1.00 0.00 ? 2   SER A OG   9  
ATOM   5174  H  H    . SER A 1 2  ? 9.634   -27.432 -0.210  1.00 0.00 ? 2   SER A H    9  
ATOM   5175  H  HA   . SER A 1 2  ? 7.025   -27.432 0.804   1.00 0.00 ? 2   SER A HA   9  
ATOM   5176  H  HB2  . SER A 1 2  ? 8.852   -25.148 0.037   1.00 0.00 ? 2   SER A HB2  9  
ATOM   5177  H  HB3  . SER A 1 2  ? 7.310   -24.922 0.862   1.00 0.00 ? 2   SER A HB3  9  
ATOM   5178  H  HG   . SER A 1 2  ? 9.064   -25.037 2.329   1.00 0.00 ? 2   SER A HG   9  
ATOM   5179  N  N    . SER A 1 3  ? 5.472   -27.042 -1.072  1.00 0.00 ? 3   SER A N    9  
ATOM   5180  C  CA   . SER A 1 3  ? 4.516   -26.801 -2.147  1.00 0.00 ? 3   SER A CA   9  
ATOM   5181  C  C    . SER A 1 3  ? 3.949   -25.387 -2.062  1.00 0.00 ? 3   SER A C    9  
ATOM   5182  O  O    . SER A 1 3  ? 3.763   -24.845 -0.974  1.00 0.00 ? 3   SER A O    9  
ATOM   5183  C  CB   . SER A 1 3  ? 3.380   -27.823 -2.087  1.00 0.00 ? 3   SER A CB   9  
ATOM   5184  O  OG   . SER A 1 3  ? 2.710   -27.915 -3.332  1.00 0.00 ? 3   SER A OG   9  
ATOM   5185  H  H    . SER A 1 3  ? 5.195   -27.573 -0.296  1.00 0.00 ? 3   SER A H    9  
ATOM   5186  H  HA   . SER A 1 3  ? 5.039   -26.911 -3.085  1.00 0.00 ? 3   SER A HA   9  
ATOM   5187  H  HB2  . SER A 1 3  ? 3.784   -28.793 -1.837  1.00 0.00 ? 3   SER A HB2  9  
ATOM   5188  H  HB3  . SER A 1 3  ? 2.669   -27.523 -1.330  1.00 0.00 ? 3   SER A HB3  9  
ATOM   5189  H  HG   . SER A 1 3  ? 1.997   -28.555 -3.266  1.00 0.00 ? 3   SER A HG   9  
ATOM   5190  N  N    . GLY A 1 4  ? 3.676   -24.796 -3.221  1.00 0.00 ? 4   GLY A N    9  
ATOM   5191  C  CA   . GLY A 1 4  ? 3.133   -23.450 -3.258  1.00 0.00 ? 4   GLY A CA   9  
ATOM   5192  C  C    . GLY A 1 4  ? 2.059   -23.230 -2.210  1.00 0.00 ? 4   GLY A C    9  
ATOM   5193  O  O    . GLY A 1 4  ? 1.020   -23.890 -2.229  1.00 0.00 ? 4   GLY A O    9  
ATOM   5194  H  H    . GLY A 1 4  ? 3.845   -25.276 -4.059  1.00 0.00 ? 4   GLY A H    9  
ATOM   5195  H  HA2  . GLY A 1 4  ? 3.934   -22.746 -3.091  1.00 0.00 ? 4   GLY A HA2  9  
ATOM   5196  H  HA3  . GLY A 1 4  ? 2.708   -23.272 -4.235  1.00 0.00 ? 4   GLY A HA3  9  
ATOM   5197  N  N    . SER A 1 5  ? 2.311   -22.301 -1.294  1.00 0.00 ? 5   SER A N    9  
ATOM   5198  C  CA   . SER A 1 5  ? 1.360   -22.000 -0.230  1.00 0.00 ? 5   SER A CA   9  
ATOM   5199  C  C    . SER A 1 5  ? 0.744   -20.618 -0.427  1.00 0.00 ? 5   SER A C    9  
ATOM   5200  O  O    . SER A 1 5  ? 1.396   -19.598 -0.203  1.00 0.00 ? 5   SER A O    9  
ATOM   5201  C  CB   . SER A 1 5  ? 2.048   -22.074 1.134   1.00 0.00 ? 5   SER A CB   9  
ATOM   5202  O  OG   . SER A 1 5  ? 2.581   -23.366 1.368   1.00 0.00 ? 5   SER A OG   9  
ATOM   5203  H  H    . SER A 1 5  ? 3.158   -21.809 -1.332  1.00 0.00 ? 5   SER A H    9  
ATOM   5204  H  HA   . SER A 1 5  ? 0.574   -22.740 -0.268  1.00 0.00 ? 5   SER A HA   9  
ATOM   5205  H  HB2  . SER A 1 5  ? 2.852   -21.355 1.169   1.00 0.00 ? 5   SER A HB2  9  
ATOM   5206  H  HB3  . SER A 1 5  ? 1.330   -21.848 1.910   1.00 0.00 ? 5   SER A HB3  9  
ATOM   5207  H  HG   . SER A 1 5  ? 3.531   -23.304 1.487   1.00 0.00 ? 5   SER A HG   9  
ATOM   5208  N  N    . SER A 1 6  ? -0.516  -20.593 -0.848  1.00 0.00 ? 6   SER A N    9  
ATOM   5209  C  CA   . SER A 1 6  ? -1.220  -19.337 -1.080  1.00 0.00 ? 6   SER A CA   9  
ATOM   5210  C  C    . SER A 1 6  ? -2.455  -19.235 -0.190  1.00 0.00 ? 6   SER A C    9  
ATOM   5211  O  O    . SER A 1 6  ? -2.906  -20.226 0.382   1.00 0.00 ? 6   SER A O    9  
ATOM   5212  C  CB   . SER A 1 6  ? -1.626  -19.220 -2.551  1.00 0.00 ? 6   SER A CB   9  
ATOM   5213  O  OG   . SER A 1 6  ? -0.499  -19.336 -3.402  1.00 0.00 ? 6   SER A OG   9  
ATOM   5214  H  H    . SER A 1 6  ? -0.983  -21.440 -1.009  1.00 0.00 ? 6   SER A H    9  
ATOM   5215  H  HA   . SER A 1 6  ? -0.546  -18.530 -0.836  1.00 0.00 ? 6   SER A HA   9  
ATOM   5216  H  HB2  . SER A 1 6  ? -2.326  -20.005 -2.792  1.00 0.00 ? 6   SER A HB2  9  
ATOM   5217  H  HB3  . SER A 1 6  ? -2.091  -18.258 -2.717  1.00 0.00 ? 6   SER A HB3  9  
ATOM   5218  H  HG   . SER A 1 6  ? 0.231   -18.829 -3.038  1.00 0.00 ? 6   SER A HG   9  
ATOM   5219  N  N    . GLY A 1 7  ? -2.998  -18.026 -0.079  1.00 0.00 ? 7   GLY A N    9  
ATOM   5220  C  CA   . GLY A 1 7  ? -4.175  -17.814 0.742   1.00 0.00 ? 7   GLY A CA   9  
ATOM   5221  C  C    . GLY A 1 7  ? -4.307  -16.378 1.209   1.00 0.00 ? 7   GLY A C    9  
ATOM   5222  O  O    . GLY A 1 7  ? -3.588  -15.940 2.108   1.00 0.00 ? 7   GLY A O    9  
ATOM   5223  H  H    . GLY A 1 7  ? -2.595  -17.272 -0.559  1.00 0.00 ? 7   GLY A H    9  
ATOM   5224  H  HA2  . GLY A 1 7  ? -5.052  -18.078 0.170   1.00 0.00 ? 7   GLY A HA2  9  
ATOM   5225  H  HA3  . GLY A 1 7  ? -4.117  -18.457 1.608   1.00 0.00 ? 7   GLY A HA3  9  
ATOM   5226  N  N    . THR A 1 8  ? -5.227  -15.640 0.595   1.00 0.00 ? 8   THR A N    9  
ATOM   5227  C  CA   . THR A 1 8  ? -5.448  -14.244 0.950   1.00 0.00 ? 8   THR A CA   9  
ATOM   5228  C  C    . THR A 1 8  ? -6.879  -14.017 1.424   1.00 0.00 ? 8   THR A C    9  
ATOM   5229  O  O    . THR A 1 8  ? -7.794  -14.741 1.035   1.00 0.00 ? 8   THR A O    9  
ATOM   5230  C  CB   . THR A 1 8  ? -5.159  -13.309 -0.240  1.00 0.00 ? 8   THR A CB   9  
ATOM   5231  O  OG1  . THR A 1 8  ? -5.939  -13.704 -1.374  1.00 0.00 ? 8   THR A OG1  9  
ATOM   5232  C  CG2  . THR A 1 8  ? -3.681  -13.333 -0.601  1.00 0.00 ? 8   THR A CG2  9  
ATOM   5233  H  H    . THR A 1 8  ? -5.768  -16.045 -0.114  1.00 0.00 ? 8   THR A H    9  
ATOM   5234  H  HA   . THR A 1 8  ? -4.769  -13.992 1.752   1.00 0.00 ? 8   THR A HA   9  
ATOM   5235  H  HB   . THR A 1 8  ? -5.430  -12.301 0.040   1.00 0.00 ? 8   THR A HB   9  
ATOM   5236  H  HG1  . THR A 1 8  ? -6.636  -13.061 -1.523  1.00 0.00 ? 8   THR A HG1  9  
ATOM   5237  H  HG21 . THR A 1 8  ? -3.090  -13.241 0.298   1.00 0.00 ? 8   THR A HG21 9  
ATOM   5238  H  HG22 . THR A 1 8  ? -3.459  -12.509 -1.263  1.00 0.00 ? 8   THR A HG22 9  
ATOM   5239  H  HG23 . THR A 1 8  ? -3.446  -14.265 -1.093  1.00 0.00 ? 8   THR A HG23 9  
ATOM   5240  N  N    . GLY A 1 9  ? -7.065  -13.006 2.268   1.00 0.00 ? 9   GLY A N    9  
ATOM   5241  C  CA   . GLY A 1 9  ? -8.388  -12.702 2.781   1.00 0.00 ? 9   GLY A CA   9  
ATOM   5242  C  C    . GLY A 1 9  ? -9.003  -11.488 2.114   1.00 0.00 ? 9   GLY A C    9  
ATOM   5243  O  O    . GLY A 1 9  ? -9.442  -10.557 2.789   1.00 0.00 ? 9   GLY A O    9  
ATOM   5244  H  H    . GLY A 1 9  ? -6.297  -12.462 2.544   1.00 0.00 ? 9   GLY A H    9  
ATOM   5245  H  HA2  . GLY A 1 9  ? -9.030  -13.554 2.616   1.00 0.00 ? 9   GLY A HA2  9  
ATOM   5246  H  HA3  . GLY A 1 9  ? -8.316  -12.517 3.842   1.00 0.00 ? 9   GLY A HA3  9  
ATOM   5247  N  N    . GLU A 1 10 ? -9.034  -11.496 0.785   1.00 0.00 ? 10  GLU A N    9  
ATOM   5248  C  CA   . GLU A 1 10 ? -9.598  -10.385 0.027   1.00 0.00 ? 10  GLU A CA   9  
ATOM   5249  C  C    . GLU A 1 10 ? -9.333  -9.057  0.731   1.00 0.00 ? 10  GLU A C    9  
ATOM   5250  O  O    . GLU A 1 10 ? -10.221 -8.213  0.842   1.00 0.00 ? 10  GLU A O    9  
ATOM   5251  C  CB   . GLU A 1 10 ? -11.103 -10.581 -0.165  1.00 0.00 ? 10  GLU A CB   9  
ATOM   5252  C  CG   . GLU A 1 10 ? -11.707 -9.664  -1.214  1.00 0.00 ? 10  GLU A CG   9  
ATOM   5253  C  CD   . GLU A 1 10 ? -11.350 -10.079 -2.628  1.00 0.00 ? 10  GLU A CD   9  
ATOM   5254  O  OE1  . GLU A 1 10 ? -11.781 -11.172 -3.052  1.00 0.00 ? 10  GLU A OE1  9  
ATOM   5255  O  OE2  . GLU A 1 10 ? -10.638 -9.312  -3.310  1.00 0.00 ? 10  GLU A OE2  9  
ATOM   5256  H  H    . GLU A 1 10 ? -8.668  -12.267 0.303   1.00 0.00 ? 10  GLU A H    9  
ATOM   5257  H  HA   . GLU A 1 10 ? -9.120  -10.367 -0.941  1.00 0.00 ? 10  GLU A HA   9  
ATOM   5258  H  HB2  . GLU A 1 10 ? -11.285 -11.604 -0.461  1.00 0.00 ? 10  GLU A HB2  9  
ATOM   5259  H  HB3  . GLU A 1 10 ? -11.600 -10.395 0.775   1.00 0.00 ? 10  GLU A HB3  9  
ATOM   5260  H  HG2  . GLU A 1 10 ? -12.782 -9.680  -1.112  1.00 0.00 ? 10  GLU A HG2  9  
ATOM   5261  H  HG3  . GLU A 1 10 ? -11.346 -8.660  -1.047  1.00 0.00 ? 10  GLU A HG3  9  
ATOM   5262  N  N    . ASN A 1 11 ? -8.104  -8.880  1.204   1.00 0.00 ? 11  ASN A N    9  
ATOM   5263  C  CA   . ASN A 1 11 ? -7.721  -7.655  1.898   1.00 0.00 ? 11  ASN A CA   9  
ATOM   5264  C  C    . ASN A 1 11 ? -8.164  -6.424  1.114   1.00 0.00 ? 11  ASN A C    9  
ATOM   5265  O  O    . ASN A 1 11 ? -8.156  -6.406  -0.117  1.00 0.00 ? 11  ASN A O    9  
ATOM   5266  C  CB   . ASN A 1 11 ? -6.207  -7.619  2.114   1.00 0.00 ? 11  ASN A CB   9  
ATOM   5267  C  CG   . ASN A 1 11 ? -5.766  -8.495  3.270   1.00 0.00 ? 11  ASN A CG   9  
ATOM   5268  O  OD1  . ASN A 1 11 ? -5.194  -9.566  3.069   1.00 0.00 ? 11  ASN A OD1  9  
ATOM   5269  N  ND2  . ASN A 1 11 ? -6.031  -8.042  4.490   1.00 0.00 ? 11  ASN A ND2  9  
ATOM   5270  H  H    . ASN A 1 11 ? -7.438  -9.589  1.085   1.00 0.00 ? 11  ASN A H    9  
ATOM   5271  H  HA   . ASN A 1 11 ? -8.213  -7.652  2.859   1.00 0.00 ? 11  ASN A HA   9  
ATOM   5272  H  HB2  . ASN A 1 11 ? -5.713  -7.964  1.217   1.00 0.00 ? 11  ASN A HB2  9  
ATOM   5273  H  HB3  . ASN A 1 11 ? -5.902  -6.603  2.319   1.00 0.00 ? 11  ASN A HB3  9  
ATOM   5274  H  HD21 . ASN A 1 11 ? -6.490  -7.180  4.575   1.00 0.00 ? 11  ASN A HD21 9  
ATOM   5275  H  HD22 . ASN A 1 11 ? -5.757  -8.589  5.256   1.00 0.00 ? 11  ASN A HD22 9  
ATOM   5276  N  N    . PRO A 1 12 ? -8.560  -5.370  1.842   1.00 0.00 ? 12  PRO A N    9  
ATOM   5277  C  CA   . PRO A 1 12 ? -9.013  -4.114  1.236   1.00 0.00 ? 12  PRO A CA   9  
ATOM   5278  C  C    . PRO A 1 12 ? -7.876  -3.350  0.568   1.00 0.00 ? 12  PRO A C    9  
ATOM   5279  O  O    . PRO A 1 12 ? -7.982  -2.946  -0.591  1.00 0.00 ? 12  PRO A O    9  
ATOM   5280  C  CB   . PRO A 1 12 ? -9.563  -3.323  2.426   1.00 0.00 ? 12  PRO A CB   9  
ATOM   5281  C  CG   . PRO A 1 12 ? -8.838  -3.867  3.609   1.00 0.00 ? 12  PRO A CG   9  
ATOM   5282  C  CD   . PRO A 1 12 ? -8.596  -5.321  3.313   1.00 0.00 ? 12  PRO A CD   9  
ATOM   5283  H  HA   . PRO A 1 12 ? -9.803  -4.283  0.518   1.00 0.00 ? 12  PRO A HA   9  
ATOM   5284  H  HB2  . PRO A 1 12 ? -9.360  -2.271  2.286   1.00 0.00 ? 12  PRO A HB2  9  
ATOM   5285  H  HB3  . PRO A 1 12 ? -10.627 -3.483  2.508   1.00 0.00 ? 12  PRO A HB3  9  
ATOM   5286  H  HG2  . PRO A 1 12 ? -7.900  -3.349  3.735   1.00 0.00 ? 12  PRO A HG2  9  
ATOM   5287  H  HG3  . PRO A 1 12 ? -9.449  -3.761  4.493   1.00 0.00 ? 12  PRO A HG3  9  
ATOM   5288  H  HD2  . PRO A 1 12 ? -7.653  -5.640  3.733   1.00 0.00 ? 12  PRO A HD2  9  
ATOM   5289  H  HD3  . PRO A 1 12 ? -9.405  -5.925  3.699   1.00 0.00 ? 12  PRO A HD3  9  
ATOM   5290  N  N    . PHE A 1 13 ? -6.787  -3.154  1.304   1.00 0.00 ? 13  PHE A N    9  
ATOM   5291  C  CA   . PHE A 1 13 ? -5.630  -2.437  0.783   1.00 0.00 ? 13  PHE A CA   9  
ATOM   5292  C  C    . PHE A 1 13 ? -4.371  -2.791  1.570   1.00 0.00 ? 13  PHE A C    9  
ATOM   5293  O  O    . PHE A 1 13 ? -4.425  -3.017  2.779   1.00 0.00 ? 13  PHE A O    9  
ATOM   5294  C  CB   . PHE A 1 13 ? -5.871  -0.927  0.837   1.00 0.00 ? 13  PHE A CB   9  
ATOM   5295  C  CG   . PHE A 1 13 ? -7.233  -0.520  0.350   1.00 0.00 ? 13  PHE A CG   9  
ATOM   5296  C  CD1  . PHE A 1 13 ? -7.457  -0.274  -0.995  1.00 0.00 ? 13  PHE A CD1  9  
ATOM   5297  C  CD2  . PHE A 1 13 ? -8.288  -0.383  1.237   1.00 0.00 ? 13  PHE A CD2  9  
ATOM   5298  C  CE1  . PHE A 1 13 ? -8.708  0.101   -1.445  1.00 0.00 ? 13  PHE A CE1  9  
ATOM   5299  C  CE2  . PHE A 1 13 ? -9.542  -0.008  0.793   1.00 0.00 ? 13  PHE A CE2  9  
ATOM   5300  C  CZ   . PHE A 1 13 ? -9.752  0.233   -0.551  1.00 0.00 ? 13  PHE A CZ   9  
ATOM   5301  H  H    . PHE A 1 13 ? -6.763  -3.500  2.222   1.00 0.00 ? 13  PHE A H    9  
ATOM   5302  H  HA   . PHE A 1 13 ? -5.493  -2.734  -0.245  1.00 0.00 ? 13  PHE A HA   9  
ATOM   5303  H  HB2  . PHE A 1 13 ? -5.770  -0.590  1.858   1.00 0.00 ? 13  PHE A HB2  9  
ATOM   5304  H  HB3  . PHE A 1 13 ? -5.135  -0.430  0.224   1.00 0.00 ? 13  PHE A HB3  9  
ATOM   5305  H  HD1  . PHE A 1 13 ? -6.641  -0.378  -1.696  1.00 0.00 ? 13  PHE A HD1  9  
ATOM   5306  H  HD2  . PHE A 1 13 ? -8.124  -0.572  2.289   1.00 0.00 ? 13  PHE A HD2  9  
ATOM   5307  H  HE1  . PHE A 1 13 ? -8.870  0.289   -2.496  1.00 0.00 ? 13  PHE A HE1  9  
ATOM   5308  H  HE2  . PHE A 1 13 ? -10.356 0.094   1.495   1.00 0.00 ? 13  PHE A HE2  9  
ATOM   5309  H  HZ   . PHE A 1 13 ? -10.731 0.527   -0.900  1.00 0.00 ? 13  PHE A HZ   9  
ATOM   5310  N  N    . ILE A 1 14 ? -3.240  -2.838  0.874   1.00 0.00 ? 14  ILE A N    9  
ATOM   5311  C  CA   . ILE A 1 14 ? -1.968  -3.163  1.507   1.00 0.00 ? 14  ILE A CA   9  
ATOM   5312  C  C    . ILE A 1 14 ? -0.855  -2.249  1.006   1.00 0.00 ? 14  ILE A C    9  
ATOM   5313  O  O    . ILE A 1 14 ? -0.844  -1.845  -0.157  1.00 0.00 ? 14  ILE A O    9  
ATOM   5314  C  CB   . ILE A 1 14 ? -1.569  -4.628  1.248   1.00 0.00 ? 14  ILE A CB   9  
ATOM   5315  C  CG1  . ILE A 1 14 ? -2.603  -5.577  1.859   1.00 0.00 ? 14  ILE A CG1  9  
ATOM   5316  C  CG2  . ILE A 1 14 ? -0.185  -4.909  1.816   1.00 0.00 ? 14  ILE A CG2  9  
ATOM   5317  C  CD1  . ILE A 1 14 ? -2.403  -7.023  1.465   1.00 0.00 ? 14  ILE A CD1  9  
ATOM   5318  H  H    . ILE A 1 14 ? -3.261  -2.648  -0.087  1.00 0.00 ? 14  ILE A H    9  
ATOM   5319  H  HA   . ILE A 1 14 ? -2.081  -3.025  2.573   1.00 0.00 ? 14  ILE A HA   9  
ATOM   5320  H  HB   . ILE A 1 14 ? -1.533  -4.785  0.181   1.00 0.00 ? 14  ILE A HB   9  
ATOM   5321  H  HG12 . ILE A 1 14 ? -2.548  -5.515  2.934   1.00 0.00 ? 14  ILE A HG12 9  
ATOM   5322  H  HG13 . ILE A 1 14 ? -3.590  -5.277  1.535   1.00 0.00 ? 14  ILE A HG13 9  
ATOM   5323  H  HG21 . ILE A 1 14 ? 0.534   -4.251  1.350   1.00 0.00 ? 14  ILE A HG21 9  
ATOM   5324  H  HG22 . ILE A 1 14 ? -0.192  -4.736  2.881   1.00 0.00 ? 14  ILE A HG22 9  
ATOM   5325  H  HG23 . ILE A 1 14 ? 0.084   -5.935  1.618   1.00 0.00 ? 14  ILE A HG23 9  
ATOM   5326  H  HD11 . ILE A 1 14 ? -2.640  -7.148  0.418   1.00 0.00 ? 14  ILE A HD11 9  
ATOM   5327  H  HD12 . ILE A 1 14 ? -1.374  -7.304  1.635   1.00 0.00 ? 14  ILE A HD12 9  
ATOM   5328  H  HD13 . ILE A 1 14 ? -3.050  -7.651  2.058   1.00 0.00 ? 14  ILE A HD13 9  
ATOM   5329  N  N    . CYS A 1 15 ? 0.083   -1.928  1.892   1.00 0.00 ? 15  CYS A N    9  
ATOM   5330  C  CA   . CYS A 1 15 ? 1.203   -1.063  1.541   1.00 0.00 ? 15  CYS A CA   9  
ATOM   5331  C  C    . CYS A 1 15 ? 2.268   -1.838  0.770   1.00 0.00 ? 15  CYS A C    9  
ATOM   5332  O  O    . CYS A 1 15 ? 2.775   -2.854  1.243   1.00 0.00 ? 15  CYS A O    9  
ATOM   5333  C  CB   . CYS A 1 15 ? 1.815   -0.449  2.801   1.00 0.00 ? 15  CYS A CB   9  
ATOM   5334  S  SG   . CYS A 1 15 ? 3.009   0.887   2.474   1.00 0.00 ? 15  CYS A SG   9  
ATOM   5335  H  H    . CYS A 1 15 ? 0.021   -2.282  2.804   1.00 0.00 ? 15  CYS A H    9  
ATOM   5336  H  HA   . CYS A 1 15 ? 0.826   -0.271  0.912   1.00 0.00 ? 15  CYS A HA   9  
ATOM   5337  H  HB2  . CYS A 1 15 ? 1.024   -0.040  3.413   1.00 0.00 ? 15  CYS A HB2  9  
ATOM   5338  H  HB3  . CYS A 1 15 ? 2.328   -1.221  3.355   1.00 0.00 ? 15  CYS A HB3  9  
ATOM   5339  N  N    . SER A 1 16 ? 2.602   -1.349  -0.420  1.00 0.00 ? 16  SER A N    9  
ATOM   5340  C  CA   . SER A 1 16 ? 3.603   -1.997  -1.259  1.00 0.00 ? 16  SER A CA   9  
ATOM   5341  C  C    . SER A 1 16 ? 5.011   -1.576  -0.847  1.00 0.00 ? 16  SER A C    9  
ATOM   5342  O  O    . SER A 1 16 ? 5.889   -1.398  -1.691  1.00 0.00 ? 16  SER A O    9  
ATOM   5343  C  CB   . SER A 1 16 ? 3.367   -1.653  -2.731  1.00 0.00 ? 16  SER A CB   9  
ATOM   5344  O  OG   . SER A 1 16 ? 3.929   -2.638  -3.581  1.00 0.00 ? 16  SER A OG   9  
ATOM   5345  H  H    . SER A 1 16 ? 2.161   -0.535  -0.743  1.00 0.00 ? 16  SER A H    9  
ATOM   5346  H  HA   . SER A 1 16 ? 3.506   -3.064  -1.127  1.00 0.00 ? 16  SER A HA   9  
ATOM   5347  H  HB2  . SER A 1 16 ? 2.305   -1.596  -2.918  1.00 0.00 ? 16  SER A HB2  9  
ATOM   5348  H  HB3  . SER A 1 16 ? 3.823   -0.699  -2.953  1.00 0.00 ? 16  SER A HB3  9  
ATOM   5349  H  HG   . SER A 1 16 ? 4.336   -3.325  -3.049  1.00 0.00 ? 16  SER A HG   9  
ATOM   5350  N  N    . GLU A 1 17 ? 5.217   -1.419  0.457   1.00 0.00 ? 17  GLU A N    9  
ATOM   5351  C  CA   . GLU A 1 17 ? 6.517   -1.018  0.982   1.00 0.00 ? 17  GLU A CA   9  
ATOM   5352  C  C    . GLU A 1 17 ? 6.904   -1.871  2.187   1.00 0.00 ? 17  GLU A C    9  
ATOM   5353  O  O    . GLU A 1 17 ? 8.012   -2.405  2.254   1.00 0.00 ? 17  GLU A O    9  
ATOM   5354  C  CB   . GLU A 1 17 ? 6.500   0.461   1.374   1.00 0.00 ? 17  GLU A CB   9  
ATOM   5355  C  CG   . GLU A 1 17 ? 6.721   1.404   0.203   1.00 0.00 ? 17  GLU A CG   9  
ATOM   5356  C  CD   . GLU A 1 17 ? 8.191   1.663   -0.067  1.00 0.00 ? 17  GLU A CD   9  
ATOM   5357  O  OE1  . GLU A 1 17 ? 9.008   0.750   0.175   1.00 0.00 ? 17  GLU A OE1  9  
ATOM   5358  O  OE2  . GLU A 1 17 ? 8.523   2.778   -0.520  1.00 0.00 ? 17  GLU A OE2  9  
ATOM   5359  H  H    . GLU A 1 17 ? 4.477   -1.576  1.081   1.00 0.00 ? 17  GLU A H    9  
ATOM   5360  H  HA   . GLU A 1 17 ? 7.249   -1.165  0.202   1.00 0.00 ? 17  GLU A HA   9  
ATOM   5361  H  HB2  . GLU A 1 17 ? 5.544   0.691   1.820   1.00 0.00 ? 17  GLU A HB2  9  
ATOM   5362  H  HB3  . GLU A 1 17 ? 7.278   0.636   2.102   1.00 0.00 ? 17  GLU A HB3  9  
ATOM   5363  H  HG2  . GLU A 1 17 ? 6.280   0.969   -0.681  1.00 0.00 ? 17  GLU A HG2  9  
ATOM   5364  H  HG3  . GLU A 1 17 ? 6.239   2.345   0.419   1.00 0.00 ? 17  GLU A HG3  9  
ATOM   5365  N  N    . CYS A 1 18 ? 5.984   -1.993  3.137   1.00 0.00 ? 18  CYS A N    9  
ATOM   5366  C  CA   . CYS A 1 18 ? 6.227   -2.779  4.341   1.00 0.00 ? 18  CYS A CA   9  
ATOM   5367  C  C    . CYS A 1 18 ? 5.303   -3.992  4.394   1.00 0.00 ? 18  CYS A C    9  
ATOM   5368  O  O    . CYS A 1 18 ? 5.752   -5.120  4.595   1.00 0.00 ? 18  CYS A O    9  
ATOM   5369  C  CB   . CYS A 1 18 ? 6.026   -1.916  5.588   1.00 0.00 ? 18  CYS A CB   9  
ATOM   5370  S  SG   . CYS A 1 18 ? 4.434   -1.031  5.631   1.00 0.00 ? 18  CYS A SG   9  
ATOM   5371  H  H    . CYS A 1 18 ? 5.119   -1.543  3.027   1.00 0.00 ? 18  CYS A H    9  
ATOM   5372  H  HA   . CYS A 1 18 ? 7.250   -3.123  4.312   1.00 0.00 ? 18  CYS A HA   9  
ATOM   5373  H  HB2  . CYS A 1 18 ? 6.075   -2.546  6.464   1.00 0.00 ? 18  CYS A HB2  9  
ATOM   5374  H  HB3  . CYS A 1 18 ? 6.814   -1.179  5.637   1.00 0.00 ? 18  CYS A HB3  9  
ATOM   5375  N  N    . GLY A 1 19 ? 4.008   -3.751  4.213   1.00 0.00 ? 19  GLY A N    9  
ATOM   5376  C  CA   . GLY A 1 19 ? 3.040   -4.833  4.244   1.00 0.00 ? 19  GLY A CA   9  
ATOM   5377  C  C    . GLY A 1 19 ? 1.958   -4.613  5.282   1.00 0.00 ? 19  GLY A C    9  
ATOM   5378  O  O    . GLY A 1 19 ? 1.588   -5.535  6.009   1.00 0.00 ? 19  GLY A O    9  
ATOM   5379  H  H    . GLY A 1 19 ? 3.707   -2.832  4.057   1.00 0.00 ? 19  GLY A H    9  
ATOM   5380  H  HA2  . GLY A 1 19 ? 2.580   -4.917  3.271   1.00 0.00 ? 19  GLY A HA2  9  
ATOM   5381  H  HA3  . GLY A 1 19 ? 3.556   -5.755  4.468   1.00 0.00 ? 19  GLY A HA3  9  
ATOM   5382  N  N    . LYS A 1 20 ? 1.449   -3.388  5.353   1.00 0.00 ? 20  LYS A N    9  
ATOM   5383  C  CA   . LYS A 1 20 ? 0.402   -3.048  6.310   1.00 0.00 ? 20  LYS A CA   9  
ATOM   5384  C  C    . LYS A 1 20 ? -0.950  -2.924  5.616   1.00 0.00 ? 20  LYS A C    9  
ATOM   5385  O  O    . LYS A 1 20 ? -1.027  -2.553  4.445   1.00 0.00 ? 20  LYS A O    9  
ATOM   5386  C  CB   . LYS A 1 20 ? 0.742   -1.739  7.025   1.00 0.00 ? 20  LYS A CB   9  
ATOM   5387  C  CG   . LYS A 1 20 ? 0.192   -1.657  8.439   1.00 0.00 ? 20  LYS A CG   9  
ATOM   5388  C  CD   . LYS A 1 20 ? 0.539   -0.332  9.096   1.00 0.00 ? 20  LYS A CD   9  
ATOM   5389  C  CE   . LYS A 1 20 ? -0.261  -0.116  10.372  1.00 0.00 ? 20  LYS A CE   9  
ATOM   5390  N  NZ   . LYS A 1 20 ? 0.061   1.188   11.015  1.00 0.00 ? 20  LYS A NZ   9  
ATOM   5391  H  H    . LYS A 1 20 ? 1.785   -2.695  4.746   1.00 0.00 ? 20  LYS A H    9  
ATOM   5392  H  HA   . LYS A 1 20 ? 0.348   -3.843  7.039   1.00 0.00 ? 20  LYS A HA   9  
ATOM   5393  H  HB2  . LYS A 1 20 ? 1.816   -1.637  7.073   1.00 0.00 ? 20  LYS A HB2  9  
ATOM   5394  H  HB3  . LYS A 1 20 ? 0.336   -0.915  6.455   1.00 0.00 ? 20  LYS A HB3  9  
ATOM   5395  H  HG2  . LYS A 1 20 ? -0.882  -1.759  8.404   1.00 0.00 ? 20  LYS A HG2  9  
ATOM   5396  H  HG3  . LYS A 1 20 ? 0.613   -2.461  9.026   1.00 0.00 ? 20  LYS A HG3  9  
ATOM   5397  H  HD2  . LYS A 1 20 ? 1.592   -0.325  9.340   1.00 0.00 ? 20  LYS A HD2  9  
ATOM   5398  H  HD3  . LYS A 1 20 ? 0.322   0.471   8.406   1.00 0.00 ? 20  LYS A HD3  9  
ATOM   5399  H  HE2  . LYS A 1 20 ? -1.312  -0.139  10.130  1.00 0.00 ? 20  LYS A HE2  9  
ATOM   5400  H  HE3  . LYS A 1 20 ? -0.033  -0.915  11.063  1.00 0.00 ? 20  LYS A HE3  9  
ATOM   5401  H  HZ1  . LYS A 1 20 ? 0.082   1.943   10.301  1.00 0.00 ? 20  LYS A HZ1  9  
ATOM   5402  H  HZ2  . LYS A 1 20 ? 0.992   1.137   11.478  1.00 0.00 ? 20  LYS A HZ2  9  
ATOM   5403  H  HZ3  . LYS A 1 20 ? -0.657  1.420   11.730  1.00 0.00 ? 20  LYS A HZ3  9  
ATOM   5404  N  N    . VAL A 1 21 ? -2.016  -3.236  6.347   1.00 0.00 ? 21  VAL A N    9  
ATOM   5405  C  CA   . VAL A 1 21 ? -3.366  -3.157  5.802   1.00 0.00 ? 21  VAL A CA   9  
ATOM   5406  C  C    . VAL A 1 21 ? -4.158  -2.030  6.456   1.00 0.00 ? 21  VAL A C    9  
ATOM   5407  O  O    . VAL A 1 21 ? -4.032  -1.784  7.656   1.00 0.00 ? 21  VAL A O    9  
ATOM   5408  C  CB   . VAL A 1 21 ? -4.127  -4.483  5.994   1.00 0.00 ? 21  VAL A CB   9  
ATOM   5409  C  CG1  . VAL A 1 21 ? -5.555  -4.357  5.485   1.00 0.00 ? 21  VAL A CG1  9  
ATOM   5410  C  CG2  . VAL A 1 21 ? -3.401  -5.620  5.293   1.00 0.00 ? 21  VAL A CG2  9  
ATOM   5411  H  H    . VAL A 1 21 ? -1.891  -3.526  7.274   1.00 0.00 ? 21  VAL A H    9  
ATOM   5412  H  HA   . VAL A 1 21 ? -3.288  -2.962  4.742   1.00 0.00 ? 21  VAL A HA   9  
ATOM   5413  H  HB   . VAL A 1 21 ? -4.164  -4.704  7.050   1.00 0.00 ? 21  VAL A HB   9  
ATOM   5414  H  HG11 . VAL A 1 21 ? -5.897  -5.319  5.132   1.00 0.00 ? 21  VAL A HG11 9  
ATOM   5415  H  HG12 . VAL A 1 21 ? -6.195  -4.018  6.286   1.00 0.00 ? 21  VAL A HG12 9  
ATOM   5416  H  HG13 . VAL A 1 21 ? -5.586  -3.645  4.673   1.00 0.00 ? 21  VAL A HG13 9  
ATOM   5417  H  HG21 . VAL A 1 21 ? -3.905  -5.853  4.367   1.00 0.00 ? 21  VAL A HG21 9  
ATOM   5418  H  HG22 . VAL A 1 21 ? -2.384  -5.323  5.085   1.00 0.00 ? 21  VAL A HG22 9  
ATOM   5419  H  HG23 . VAL A 1 21 ? -3.397  -6.493  5.930   1.00 0.00 ? 21  VAL A HG23 9  
ATOM   5420  N  N    . PHE A 1 22 ? -4.973  -1.348  5.659   1.00 0.00 ? 22  PHE A N    9  
ATOM   5421  C  CA   . PHE A 1 22 ? -5.786  -0.245  6.160   1.00 0.00 ? 22  PHE A CA   9  
ATOM   5422  C  C    . PHE A 1 22 ? -7.239  -0.397  5.720   1.00 0.00 ? 22  PHE A C    9  
ATOM   5423  O  O    . PHE A 1 22 ? -7.527  -0.997  4.684   1.00 0.00 ? 22  PHE A O    9  
ATOM   5424  C  CB   . PHE A 1 22 ? -5.229  1.092   5.667   1.00 0.00 ? 22  PHE A CB   9  
ATOM   5425  C  CG   . PHE A 1 22 ? -3.837  1.377   6.154   1.00 0.00 ? 22  PHE A CG   9  
ATOM   5426  C  CD1  . PHE A 1 22 ? -2.739  0.810   5.527   1.00 0.00 ? 22  PHE A CD1  9  
ATOM   5427  C  CD2  . PHE A 1 22 ? -3.627  2.214   7.239   1.00 0.00 ? 22  PHE A CD2  9  
ATOM   5428  C  CE1  . PHE A 1 22 ? -1.458  1.071   5.974   1.00 0.00 ? 22  PHE A CE1  9  
ATOM   5429  C  CE2  . PHE A 1 22 ? -2.347  2.479   7.690   1.00 0.00 ? 22  PHE A CE2  9  
ATOM   5430  C  CZ   . PHE A 1 22 ? -1.261  1.907   7.056   1.00 0.00 ? 22  PHE A CZ   9  
ATOM   5431  H  H    . PHE A 1 22 ? -5.030  -1.591  4.711   1.00 0.00 ? 22  PHE A H    9  
ATOM   5432  H  HA   . PHE A 1 22 ? -5.744  -0.267  7.238   1.00 0.00 ? 22  PHE A HA   9  
ATOM   5433  H  HB2  . PHE A 1 22 ? -5.208  1.089   4.587   1.00 0.00 ? 22  PHE A HB2  9  
ATOM   5434  H  HB3  . PHE A 1 22 ? -5.872  1.889   6.008   1.00 0.00 ? 22  PHE A HB3  9  
ATOM   5435  H  HD1  . PHE A 1 22 ? -2.891  0.157   4.681   1.00 0.00 ? 22  PHE A HD1  9  
ATOM   5436  H  HD2  . PHE A 1 22 ? -4.476  2.662   7.735   1.00 0.00 ? 22  PHE A HD2  9  
ATOM   5437  H  HE1  . PHE A 1 22 ? -0.610  0.623   5.477   1.00 0.00 ? 22  PHE A HE1  9  
ATOM   5438  H  HE2  . PHE A 1 22 ? -2.198  3.133   8.536   1.00 0.00 ? 22  PHE A HE2  9  
ATOM   5439  H  HZ   . PHE A 1 22 ? -0.261  2.112   7.408   1.00 0.00 ? 22  PHE A HZ   9  
ATOM   5440  N  N    . THR A 1 23 ? -8.152  0.151   6.515   1.00 0.00 ? 23  THR A N    9  
ATOM   5441  C  CA   . THR A 1 23 ? -9.576  0.076   6.210   1.00 0.00 ? 23  THR A CA   9  
ATOM   5442  C  C    . THR A 1 23 ? -9.957  1.069   5.118   1.00 0.00 ? 23  THR A C    9  
ATOM   5443  O  O    . THR A 1 23 ? -10.770 0.764   4.245   1.00 0.00 ? 23  THR A O    9  
ATOM   5444  C  CB   . THR A 1 23 ? -10.433 0.351   7.460   1.00 0.00 ? 23  THR A CB   9  
ATOM   5445  O  OG1  . THR A 1 23 ? -9.917  -0.379  8.579   1.00 0.00 ? 23  THR A OG1  9  
ATOM   5446  C  CG2  . THR A 1 23 ? -11.883 -0.041  7.218   1.00 0.00 ? 23  THR A CG2  9  
ATOM   5447  H  H    . THR A 1 23 ? -7.860  0.616   7.327   1.00 0.00 ? 23  THR A H    9  
ATOM   5448  H  HA   . THR A 1 23 ? -9.790  -0.925  5.865   1.00 0.00 ? 23  THR A HA   9  
ATOM   5449  H  HB   . THR A 1 23 ? -10.393 1.408   7.680   1.00 0.00 ? 23  THR A HB   9  
ATOM   5450  H  HG1  . THR A 1 23 ? -10.357 -1.231  8.636   1.00 0.00 ? 23  THR A HG1  9  
ATOM   5451  H  HG21 . THR A 1 23 ? -12.360 0.709   6.605   1.00 0.00 ? 23  THR A HG21 9  
ATOM   5452  H  HG22 . THR A 1 23 ? -12.399 -0.113  8.164   1.00 0.00 ? 23  THR A HG22 9  
ATOM   5453  H  HG23 . THR A 1 23 ? -11.919 -0.995  6.714   1.00 0.00 ? 23  THR A HG23 9  
ATOM   5454  N  N    . HIS A 1 24 ? -9.364  2.257   5.172   1.00 0.00 ? 24  HIS A N    9  
ATOM   5455  C  CA   . HIS A 1 24 ? -9.642  3.295   4.185   1.00 0.00 ? 24  HIS A CA   9  
ATOM   5456  C  C    . HIS A 1 24 ? -8.389  3.629   3.381   1.00 0.00 ? 24  HIS A C    9  
ATOM   5457  O  O    . HIS A 1 24 ? -7.332  3.911   3.947   1.00 0.00 ? 24  HIS A O    9  
ATOM   5458  C  CB   . HIS A 1 24 ? -10.171 4.554   4.873   1.00 0.00 ? 24  HIS A CB   9  
ATOM   5459  C  CG   . HIS A 1 24 ? -11.129 5.339   4.031   1.00 0.00 ? 24  HIS A CG   9  
ATOM   5460  N  ND1  . HIS A 1 24 ? -10.729 6.335   3.165   1.00 0.00 ? 24  HIS A ND1  9  
ATOM   5461  C  CD2  . HIS A 1 24 ? -12.477 5.268   3.924   1.00 0.00 ? 24  HIS A CD2  9  
ATOM   5462  C  CE1  . HIS A 1 24 ? -11.789 6.844   2.563   1.00 0.00 ? 24  HIS A CE1  9  
ATOM   5463  N  NE2  . HIS A 1 24 ? -12.862 6.214   3.006   1.00 0.00 ? 24  HIS A NE2  9  
ATOM   5464  H  H    . HIS A 1 24 ? -8.725  2.441   5.892   1.00 0.00 ? 24  HIS A H    9  
ATOM   5465  H  HA   . HIS A 1 24 ? -10.397 2.919   3.512   1.00 0.00 ? 24  HIS A HA   9  
ATOM   5466  H  HB2  . HIS A 1 24 ? -10.682 4.272   5.781   1.00 0.00 ? 24  HIS A HB2  9  
ATOM   5467  H  HB3  . HIS A 1 24 ? -9.339  5.199   5.119   1.00 0.00 ? 24  HIS A HB3  9  
ATOM   5468  H  HD1  . HIS A 1 24 ? -9.806  6.626   3.015   1.00 0.00 ? 24  HIS A HD1  9  
ATOM   5469  H  HD2  . HIS A 1 24 ? -13.129 4.594   4.462   1.00 0.00 ? 24  HIS A HD2  9  
ATOM   5470  H  HE1  . HIS A 1 24 ? -11.781 7.639   1.834   1.00 0.00 ? 24  HIS A HE1  9  
ATOM   5471  N  N    . LYS A 1 25 ? -8.513  3.594   2.059   1.00 0.00 ? 25  LYS A N    9  
ATOM   5472  C  CA   . LYS A 1 25 ? -7.392  3.893   1.176   1.00 0.00 ? 25  LYS A CA   9  
ATOM   5473  C  C    . LYS A 1 25 ? -6.701  5.188   1.593   1.00 0.00 ? 25  LYS A C    9  
ATOM   5474  O  O    . LYS A 1 25 ? -5.474  5.283   1.574   1.00 0.00 ? 25  LYS A O    9  
ATOM   5475  C  CB   . LYS A 1 25 ? -7.873  4.003   -0.273  1.00 0.00 ? 25  LYS A CB   9  
ATOM   5476  C  CG   . LYS A 1 25 ? -6.747  4.203   -1.273  1.00 0.00 ? 25  LYS A CG   9  
ATOM   5477  C  CD   . LYS A 1 25 ? -7.191  3.863   -2.686  1.00 0.00 ? 25  LYS A CD   9  
ATOM   5478  C  CE   . LYS A 1 25 ? -6.261  4.474   -3.724  1.00 0.00 ? 25  LYS A CE   9  
ATOM   5479  N  NZ   . LYS A 1 25 ? -5.116  3.577   -4.040  1.00 0.00 ? 25  LYS A NZ   9  
ATOM   5480  H  H    . LYS A 1 25 ? -9.382  3.362   1.667   1.00 0.00 ? 25  LYS A H    9  
ATOM   5481  H  HA   . LYS A 1 25 ? -6.685  3.081   1.251   1.00 0.00 ? 25  LYS A HA   9  
ATOM   5482  H  HB2  . LYS A 1 25 ? -8.402  3.099   -0.534  1.00 0.00 ? 25  LYS A HB2  9  
ATOM   5483  H  HB3  . LYS A 1 25 ? -8.550  4.842   -0.352  1.00 0.00 ? 25  LYS A HB3  9  
ATOM   5484  H  HG2  . LYS A 1 25 ? -6.432  5.236   -1.245  1.00 0.00 ? 25  LYS A HG2  9  
ATOM   5485  H  HG3  . LYS A 1 25 ? -5.919  3.564   -1.002  1.00 0.00 ? 25  LYS A HG3  9  
ATOM   5486  H  HD2  . LYS A 1 25 ? -7.190  2.790   -2.807  1.00 0.00 ? 25  LYS A HD2  9  
ATOM   5487  H  HD3  . LYS A 1 25 ? -8.190  4.244   -2.842  1.00 0.00 ? 25  LYS A HD3  9  
ATOM   5488  H  HE2  . LYS A 1 25 ? -6.823  4.658   -4.627  1.00 0.00 ? 25  LYS A HE2  9  
ATOM   5489  H  HE3  . LYS A 1 25 ? -5.880  5.409   -3.341  1.00 0.00 ? 25  LYS A HE3  9  
ATOM   5490  H  HZ1  . LYS A 1 25 ? -5.409  2.582   -3.964  1.00 0.00 ? 25  LYS A HZ1  9  
ATOM   5491  H  HZ2  . LYS A 1 25 ? -4.334  3.748   -3.375  1.00 0.00 ? 25  LYS A HZ2  9  
ATOM   5492  H  HZ3  . LYS A 1 25 ? -4.778  3.754   -5.007  1.00 0.00 ? 25  LYS A HZ3  9  
ATOM   5493  N  N    . THR A 1 26 ? -7.497  6.183   1.972   1.00 0.00 ? 26  THR A N    9  
ATOM   5494  C  CA   . THR A 1 26 ? -6.962  7.471   2.394   1.00 0.00 ? 26  THR A CA   9  
ATOM   5495  C  C    . THR A 1 26 ? -5.868  7.296   3.441   1.00 0.00 ? 26  THR A C    9  
ATOM   5496  O  O    . THR A 1 26 ? -4.843  7.974   3.400   1.00 0.00 ? 26  THR A O    9  
ATOM   5497  C  CB   . THR A 1 26 ? -8.067  8.377   2.970   1.00 0.00 ? 26  THR A CB   9  
ATOM   5498  O  OG1  . THR A 1 26 ? -7.684  9.752   2.853   1.00 0.00 ? 26  THR A OG1  9  
ATOM   5499  C  CG2  . THR A 1 26 ? -8.336  8.042   4.429   1.00 0.00 ? 26  THR A CG2  9  
ATOM   5500  H  H    . THR A 1 26 ? -8.468  6.046   1.965   1.00 0.00 ? 26  THR A H    9  
ATOM   5501  H  HA   . THR A 1 26 ? -6.542  7.959   1.526   1.00 0.00 ? 26  THR A HA   9  
ATOM   5502  H  HB   . THR A 1 26 ? -8.975  8.215   2.405   1.00 0.00 ? 26  THR A HB   9  
ATOM   5503  H  HG1  . THR A 1 26 ? -7.231  10.027  3.654   1.00 0.00 ? 26  THR A HG1  9  
ATOM   5504  H  HG21 . THR A 1 26 ? -7.486  8.334   5.027   1.00 0.00 ? 26  THR A HG21 9  
ATOM   5505  H  HG22 . THR A 1 26 ? -8.499  6.979   4.530   1.00 0.00 ? 26  THR A HG22 9  
ATOM   5506  H  HG23 . THR A 1 26 ? -9.213  8.575   4.765   1.00 0.00 ? 26  THR A HG23 9  
ATOM   5507  N  N    . ASN A 1 27 ? -6.094  6.381   4.378   1.00 0.00 ? 27  ASN A N    9  
ATOM   5508  C  CA   . ASN A 1 27 ? -5.126  6.116   5.437   1.00 0.00 ? 27  ASN A CA   9  
ATOM   5509  C  C    . ASN A 1 27 ? -3.874  5.449   4.875   1.00 0.00 ? 27  ASN A C    9  
ATOM   5510  O  O    . ASN A 1 27 ? -2.755  5.757   5.287   1.00 0.00 ? 27  ASN A O    9  
ATOM   5511  C  CB   . ASN A 1 27 ? -5.749  5.229   6.516   1.00 0.00 ? 27  ASN A CB   9  
ATOM   5512  C  CG   . ASN A 1 27 ? -6.421  6.036   7.610   1.00 0.00 ? 27  ASN A CG   9  
ATOM   5513  O  OD1  . ASN A 1 27 ? -7.280  6.875   7.340   1.00 0.00 ? 27  ASN A OD1  9  
ATOM   5514  N  ND2  . ASN A 1 27 ? -6.031  5.785   8.855   1.00 0.00 ? 27  ASN A ND2  9  
ATOM   5515  H  H    . ASN A 1 27 ? -6.931  5.872   4.358   1.00 0.00 ? 27  ASN A H    9  
ATOM   5516  H  HA   . ASN A 1 27 ? -4.849  7.063   5.876   1.00 0.00 ? 27  ASN A HA   9  
ATOM   5517  H  HB2  . ASN A 1 27 ? -6.490  4.587   6.062   1.00 0.00 ? 27  ASN A HB2  9  
ATOM   5518  H  HB3  . ASN A 1 27 ? -4.978  4.621   6.964   1.00 0.00 ? 27  ASN A HB3  9  
ATOM   5519  H  HD21 . ASN A 1 27 ? -5.342  5.102   8.995   1.00 0.00 ? 27  ASN A HD21 9  
ATOM   5520  H  HD22 . ASN A 1 27 ? -6.450  6.292   9.582   1.00 0.00 ? 27  ASN A HD22 9  
ATOM   5521  N  N    . LEU A 1 28 ? -4.071  4.535   3.931   1.00 0.00 ? 28  LEU A N    9  
ATOM   5522  C  CA   . LEU A 1 28 ? -2.958  3.824   3.311   1.00 0.00 ? 28  LEU A CA   9  
ATOM   5523  C  C    . LEU A 1 28 ? -2.067  4.784   2.529   1.00 0.00 ? 28  LEU A C    9  
ATOM   5524  O  O    . LEU A 1 28 ? -0.840  4.706   2.602   1.00 0.00 ? 28  LEU A O    9  
ATOM   5525  C  CB   . LEU A 1 28 ? -3.482  2.726   2.383   1.00 0.00 ? 28  LEU A CB   9  
ATOM   5526  C  CG   . LEU A 1 28 ? -2.522  2.257   1.290   1.00 0.00 ? 28  LEU A CG   9  
ATOM   5527  C  CD1  . LEU A 1 28 ? -1.488  1.299   1.862   1.00 0.00 ? 28  LEU A CD1  9  
ATOM   5528  C  CD2  . LEU A 1 28 ? -3.290  1.598   0.153   1.00 0.00 ? 28  LEU A CD2  9  
ATOM   5529  H  H    . LEU A 1 28 ? -4.985  4.333   3.643   1.00 0.00 ? 28  LEU A H    9  
ATOM   5530  H  HA   . LEU A 1 28 ? -2.375  3.371   4.098   1.00 0.00 ? 28  LEU A HA   9  
ATOM   5531  H  HB2  . LEU A 1 28 ? -3.733  1.872   2.992   1.00 0.00 ? 28  LEU A HB2  9  
ATOM   5532  H  HB3  . LEU A 1 28 ? -4.375  3.099   1.903   1.00 0.00 ? 28  LEU A HB3  9  
ATOM   5533  H  HG   . LEU A 1 28 ? -1.997  3.112   0.889   1.00 0.00 ? 28  LEU A HG   9  
ATOM   5534  H  HD11 . LEU A 1 28 ? -0.813  1.842   2.507   1.00 0.00 ? 28  LEU A HD11 9  
ATOM   5535  H  HD12 . LEU A 1 28 ? -0.931  0.847   1.056   1.00 0.00 ? 28  LEU A HD12 9  
ATOM   5536  H  HD13 . LEU A 1 28 ? -1.988  0.528   2.431   1.00 0.00 ? 28  LEU A HD13 9  
ATOM   5537  H  HD21 . LEU A 1 28 ? -3.124  2.149   -0.760  1.00 0.00 ? 28  LEU A HD21 9  
ATOM   5538  H  HD22 . LEU A 1 28 ? -4.344  1.595   0.386   1.00 0.00 ? 28  LEU A HD22 9  
ATOM   5539  H  HD23 . LEU A 1 28 ? -2.946  0.581   0.028   1.00 0.00 ? 28  LEU A HD23 9  
ATOM   5540  N  N    . ILE A 1 29 ? -2.692  5.689   1.783   1.00 0.00 ? 29  ILE A N    9  
ATOM   5541  C  CA   . ILE A 1 29 ? -1.955  6.666   0.991   1.00 0.00 ? 29  ILE A CA   9  
ATOM   5542  C  C    . ILE A 1 29 ? -1.108  7.569   1.881   1.00 0.00 ? 29  ILE A C    9  
ATOM   5543  O  O    . ILE A 1 29 ? 0.020   7.920   1.531   1.00 0.00 ? 29  ILE A O    9  
ATOM   5544  C  CB   . ILE A 1 29 ? -2.904  7.538   0.149   1.00 0.00 ? 29  ILE A CB   9  
ATOM   5545  C  CG1  . ILE A 1 29 ? -3.708  6.668   -0.820  1.00 0.00 ? 29  ILE A CG1  9  
ATOM   5546  C  CG2  . ILE A 1 29 ? -2.117  8.597   -0.610  1.00 0.00 ? 29  ILE A CG2  9  
ATOM   5547  C  CD1  . ILE A 1 29 ? -4.903  7.376   -1.419  1.00 0.00 ? 29  ILE A CD1  9  
ATOM   5548  H  H    . ILE A 1 29 ? -3.671  5.701   1.766   1.00 0.00 ? 29  ILE A H    9  
ATOM   5549  H  HA   . ILE A 1 29 ? -1.303  6.126   0.319   1.00 0.00 ? 29  ILE A HA   9  
ATOM   5550  H  HB   . ILE A 1 29 ? -3.584  8.041   0.819   1.00 0.00 ? 29  ILE A HB   9  
ATOM   5551  H  HG12 . ILE A 1 29 ? -3.067  6.356   -1.630  1.00 0.00 ? 29  ILE A HG12 9  
ATOM   5552  H  HG13 . ILE A 1 29 ? -4.067  5.795   -0.294  1.00 0.00 ? 29  ILE A HG13 9  
ATOM   5553  H  HG21 . ILE A 1 29 ? -2.460  9.578   -0.317  1.00 0.00 ? 29  ILE A HG21 9  
ATOM   5554  H  HG22 . ILE A 1 29 ? -1.067  8.499   -0.378  1.00 0.00 ? 29  ILE A HG22 9  
ATOM   5555  H  HG23 . ILE A 1 29 ? -2.266  8.465   -1.671  1.00 0.00 ? 29  ILE A HG23 9  
ATOM   5556  H  HD11 . ILE A 1 29 ? -5.785  7.145   -0.839  1.00 0.00 ? 29  ILE A HD11 9  
ATOM   5557  H  HD12 . ILE A 1 29 ? -4.734  8.442   -1.406  1.00 0.00 ? 29  ILE A HD12 9  
ATOM   5558  H  HD13 . ILE A 1 29 ? -5.045  7.045   -2.436  1.00 0.00 ? 29  ILE A HD13 9  
ATOM   5559  N  N    . ILE A 1 30 ? -1.657  7.939   3.032   1.00 0.00 ? 30  ILE A N    9  
ATOM   5560  C  CA   . ILE A 1 30 ? -0.950  8.799   3.973   1.00 0.00 ? 30  ILE A CA   9  
ATOM   5561  C  C    . ILE A 1 30 ? 0.171   8.040   4.676   1.00 0.00 ? 30  ILE A C    9  
ATOM   5562  O  O    . ILE A 1 30 ? 1.233   8.598   4.954   1.00 0.00 ? 30  ILE A O    9  
ATOM   5563  C  CB   . ILE A 1 30 ? -1.905  9.378   5.034   1.00 0.00 ? 30  ILE A CB   9  
ATOM   5564  C  CG1  . ILE A 1 30 ? -3.065  10.113  4.359   1.00 0.00 ? 30  ILE A CG1  9  
ATOM   5565  C  CG2  . ILE A 1 30 ? -1.153  10.311  5.971   1.00 0.00 ? 30  ILE A CG2  9  
ATOM   5566  C  CD1  . ILE A 1 30 ? -4.296  10.229  5.232   1.00 0.00 ? 30  ILE A CD1  9  
ATOM   5567  H  H    . ILE A 1 30 ? -2.558  7.627   3.254   1.00 0.00 ? 30  ILE A H    9  
ATOM   5568  H  HA   . ILE A 1 30 ? -0.521  9.620   3.417   1.00 0.00 ? 30  ILE A HA   9  
ATOM   5569  H  HB   . ILE A 1 30 ? -2.298  8.560   5.618   1.00 0.00 ? 30  ILE A HB   9  
ATOM   5570  H  HG12 . ILE A 1 30 ? -2.749  11.111  4.099   1.00 0.00 ? 30  ILE A HG12 9  
ATOM   5571  H  HG13 . ILE A 1 30 ? -3.344  9.582   3.460   1.00 0.00 ? 30  ILE A HG13 9  
ATOM   5572  H  HG21 . ILE A 1 30 ? -0.186  9.888   6.201   1.00 0.00 ? 30  ILE A HG21 9  
ATOM   5573  H  HG22 . ILE A 1 30 ? -1.021  11.270  5.494   1.00 0.00 ? 30  ILE A HG22 9  
ATOM   5574  H  HG23 . ILE A 1 30 ? -1.717  10.437  6.883   1.00 0.00 ? 30  ILE A HG23 9  
ATOM   5575  H  HD11 . ILE A 1 30 ? -4.150  9.658   6.137   1.00 0.00 ? 30  ILE A HD11 9  
ATOM   5576  H  HD12 . ILE A 1 30 ? -4.461  11.266  5.485   1.00 0.00 ? 30  ILE A HD12 9  
ATOM   5577  H  HD13 . ILE A 1 30 ? -5.153  9.847   4.699   1.00 0.00 ? 30  ILE A HD13 9  
ATOM   5578  N  N    . HIS A 1 31 ? -0.072  6.764   4.958   1.00 0.00 ? 31  HIS A N    9  
ATOM   5579  C  CA   . HIS A 1 31 ? 0.919   5.927   5.626   1.00 0.00 ? 31  HIS A CA   9  
ATOM   5580  C  C    . HIS A 1 31 ? 2.156   5.746   4.751   1.00 0.00 ? 31  HIS A C    9  
ATOM   5581  O  O    . HIS A 1 31 ? 3.282   5.955   5.202   1.00 0.00 ? 31  HIS A O    9  
ATOM   5582  C  CB   . HIS A 1 31 ? 0.318   4.564   5.968   1.00 0.00 ? 31  HIS A CB   9  
ATOM   5583  C  CG   . HIS A 1 31 ? 1.332   3.464   6.042   1.00 0.00 ? 31  HIS A CG   9  
ATOM   5584  N  ND1  . HIS A 1 31 ? 1.863   3.009   7.230   1.00 0.00 ? 31  HIS A ND1  9  
ATOM   5585  C  CD2  . HIS A 1 31 ? 1.910   2.725   5.066   1.00 0.00 ? 31  HIS A CD2  9  
ATOM   5586  C  CE1  . HIS A 1 31 ? 2.726   2.040   6.981   1.00 0.00 ? 31  HIS A CE1  9  
ATOM   5587  N  NE2  . HIS A 1 31 ? 2.772   1.848   5.675   1.00 0.00 ? 31  HIS A NE2  9  
ATOM   5588  H  H    . HIS A 1 31 ? -0.937  6.377   4.711   1.00 0.00 ? 31  HIS A H    9  
ATOM   5589  H  HA   . HIS A 1 31 ? 1.209   6.422   6.540   1.00 0.00 ? 31  HIS A HA   9  
ATOM   5590  H  HB2  . HIS A 1 31 ? -0.175  4.625   6.927   1.00 0.00 ? 31  HIS A HB2  9  
ATOM   5591  H  HB3  . HIS A 1 31 ? -0.408  4.297   5.213   1.00 0.00 ? 31  HIS A HB3  9  
ATOM   5592  H  HD1  . HIS A 1 31 ? 1.643   3.347   8.122   1.00 0.00 ? 31  HIS A HD1  9  
ATOM   5593  H  HD2  . HIS A 1 31 ? 1.727   2.810   4.003   1.00 0.00 ? 31  HIS A HD2  9  
ATOM   5594  H  HE1  . HIS A 1 31 ? 3.296   1.496   7.720   1.00 0.00 ? 31  HIS A HE1  9  
ATOM   5595  N  N    . GLN A 1 32 ? 1.937   5.356   3.499   1.00 0.00 ? 32  GLN A N    9  
ATOM   5596  C  CA   . GLN A 1 32 ? 3.035   5.146   2.563   1.00 0.00 ? 32  GLN A CA   9  
ATOM   5597  C  C    . GLN A 1 32 ? 4.047   6.284   2.645   1.00 0.00 ? 32  GLN A C    9  
ATOM   5598  O  O    . GLN A 1 32 ? 5.207   6.127   2.263   1.00 0.00 ? 32  GLN A O    9  
ATOM   5599  C  CB   . GLN A 1 32 ? 2.499   5.027   1.135   1.00 0.00 ? 32  GLN A CB   9  
ATOM   5600  C  CG   . GLN A 1 32 ? 1.742   3.734   0.875   1.00 0.00 ? 32  GLN A CG   9  
ATOM   5601  C  CD   . GLN A 1 32 ? 0.885   3.801   -0.374  1.00 0.00 ? 32  GLN A CD   9  
ATOM   5602  O  OE1  . GLN A 1 32 ? 0.654   4.877   -0.925  1.00 0.00 ? 32  GLN A OE1  9  
ATOM   5603  N  NE2  . GLN A 1 32 ? 0.408   2.648   -0.827  1.00 0.00 ? 32  GLN A NE2  9  
ATOM   5604  H  H    . GLN A 1 32 ? 1.017   5.206   3.199   1.00 0.00 ? 32  GLN A H    9  
ATOM   5605  H  HA   . GLN A 1 32 ? 3.527   4.223   2.830   1.00 0.00 ? 32  GLN A HA   9  
ATOM   5606  H  HB2  . GLN A 1 32 ? 1.832   5.854   0.943   1.00 0.00 ? 32  GLN A HB2  9  
ATOM   5607  H  HB3  . GLN A 1 32 ? 3.330   5.077   0.446   1.00 0.00 ? 32  GLN A HB3  9  
ATOM   5608  H  HG2  . GLN A 1 32 ? 2.455   2.931   0.760   1.00 0.00 ? 32  GLN A HG2  9  
ATOM   5609  H  HG3  . GLN A 1 32 ? 1.104   3.529   1.722   1.00 0.00 ? 32  GLN A HG3  9  
ATOM   5610  H  HE21 . GLN A 1 32 ? 0.632   1.829   -0.335  1.00 0.00 ? 32  GLN A HE21 9  
ATOM   5611  H  HE22 . GLN A 1 32 ? -0.150  2.662   -1.632  1.00 0.00 ? 32  GLN A HE22 9  
ATOM   5612  N  N    . LYS A 1 33 ? 3.600   7.430   3.146   1.00 0.00 ? 33  LYS A N    9  
ATOM   5613  C  CA   . LYS A 1 33 ? 4.466   8.596   3.281   1.00 0.00 ? 33  LYS A CA   9  
ATOM   5614  C  C    . LYS A 1 33 ? 5.744   8.241   4.035   1.00 0.00 ? 33  LYS A C    9  
ATOM   5615  O  O    . LYS A 1 33 ? 6.821   8.748   3.723   1.00 0.00 ? 33  LYS A O    9  
ATOM   5616  C  CB   . LYS A 1 33 ? 3.729   9.723   4.007   1.00 0.00 ? 33  LYS A CB   9  
ATOM   5617  C  CG   . LYS A 1 33 ? 2.465   10.178  3.299   1.00 0.00 ? 33  LYS A CG   9  
ATOM   5618  C  CD   . LYS A 1 33 ? 2.752   11.286  2.300   1.00 0.00 ? 33  LYS A CD   9  
ATOM   5619  C  CE   . LYS A 1 33 ? 1.480   11.768  1.620   1.00 0.00 ? 33  LYS A CE   9  
ATOM   5620  N  NZ   . LYS A 1 33 ? 1.741   12.261  0.240   1.00 0.00 ? 33  LYS A NZ   9  
ATOM   5621  H  H    . LYS A 1 33 ? 2.665   7.494   3.434   1.00 0.00 ? 33  LYS A H    9  
ATOM   5622  H  HA   . LYS A 1 33 ? 4.730   8.930   2.288   1.00 0.00 ? 33  LYS A HA   9  
ATOM   5623  H  HB2  . LYS A 1 33 ? 3.461   9.383   4.996   1.00 0.00 ? 33  LYS A HB2  9  
ATOM   5624  H  HB3  . LYS A 1 33 ? 4.392   10.572  4.095   1.00 0.00 ? 33  LYS A HB3  9  
ATOM   5625  H  HG2  . LYS A 1 33 ? 2.035   9.338   2.774   1.00 0.00 ? 33  LYS A HG2  9  
ATOM   5626  H  HG3  . LYS A 1 33 ? 1.762   10.543  4.035   1.00 0.00 ? 33  LYS A HG3  9  
ATOM   5627  H  HD2  . LYS A 1 33 ? 3.206   12.118  2.819   1.00 0.00 ? 33  LYS A HD2  9  
ATOM   5628  H  HD3  . LYS A 1 33 ? 3.433   10.914  1.548   1.00 0.00 ? 33  LYS A HD3  9  
ATOM   5629  H  HE2  . LYS A 1 33 ? 0.779   10.948  1.574   1.00 0.00 ? 33  LYS A HE2  9  
ATOM   5630  H  HE3  . LYS A 1 33 ? 1.056   12.570  2.206   1.00 0.00 ? 33  LYS A HE3  9  
ATOM   5631  H  HZ1  . LYS A 1 33 ? 1.668   11.477  -0.440  1.00 0.00 ? 33  LYS A HZ1  9  
ATOM   5632  H  HZ2  . LYS A 1 33 ? 2.696   12.669  0.181   1.00 0.00 ? 33  LYS A HZ2  9  
ATOM   5633  H  HZ3  . LYS A 1 33 ? 1.047   12.992  -0.016  1.00 0.00 ? 33  LYS A HZ3  9  
ATOM   5634  N  N    . ILE A 1 34 ? 5.615   7.366   5.027   1.00 0.00 ? 34  ILE A N    9  
ATOM   5635  C  CA   . ILE A 1 34 ? 6.760   6.942   5.823   1.00 0.00 ? 34  ILE A CA   9  
ATOM   5636  C  C    . ILE A 1 34 ? 7.850   6.339   4.942   1.00 0.00 ? 34  ILE A C    9  
ATOM   5637  O  O    . ILE A 1 34 ? 8.974   6.117   5.392   1.00 0.00 ? 34  ILE A O    9  
ATOM   5638  C  CB   . ILE A 1 34 ? 6.352   5.911   6.892   1.00 0.00 ? 34  ILE A CB   9  
ATOM   5639  C  CG1  . ILE A 1 34 ? 5.955   4.589   6.232   1.00 0.00 ? 34  ILE A CG1  9  
ATOM   5640  C  CG2  . ILE A 1 34 ? 5.209   6.451   7.739   1.00 0.00 ? 34  ILE A CG2  9  
ATOM   5641  C  CD1  . ILE A 1 34 ? 5.902   3.424   7.195   1.00 0.00 ? 34  ILE A CD1  9  
ATOM   5642  H  H    . ILE A 1 34 ? 4.731   6.997   5.228   1.00 0.00 ? 34  ILE A H    9  
ATOM   5643  H  HA   . ILE A 1 34 ? 7.158   7.812   6.325   1.00 0.00 ? 34  ILE A HA   9  
ATOM   5644  H  HB   . ILE A 1 34 ? 7.198   5.742   7.539   1.00 0.00 ? 34  ILE A HB   9  
ATOM   5645  H  HG12 . ILE A 1 34 ? 4.978   4.695   5.787   1.00 0.00 ? 34  ILE A HG12 9  
ATOM   5646  H  HG13 . ILE A 1 34 ? 6.673   4.351   5.461   1.00 0.00 ? 34  ILE A HG13 9  
ATOM   5647  H  HG21 . ILE A 1 34 ? 4.564   7.063   7.125   1.00 0.00 ? 34  ILE A HG21 9  
ATOM   5648  H  HG22 . ILE A 1 34 ? 4.642   5.627   8.145   1.00 0.00 ? 34  ILE A HG22 9  
ATOM   5649  H  HG23 . ILE A 1 34 ? 5.608   7.046   8.546   1.00 0.00 ? 34  ILE A HG23 9  
ATOM   5650  H  HD11 . ILE A 1 34 ? 6.247   3.746   8.168   1.00 0.00 ? 34  ILE A HD11 9  
ATOM   5651  H  HD12 . ILE A 1 34 ? 4.885   3.068   7.275   1.00 0.00 ? 34  ILE A HD12 9  
ATOM   5652  H  HD13 . ILE A 1 34 ? 6.536   2.629   6.834   1.00 0.00 ? 34  ILE A HD13 9  
ATOM   5653  N  N    . HIS A 1 35 ? 7.509   6.078   3.684   1.00 0.00 ? 35  HIS A N    9  
ATOM   5654  C  CA   . HIS A 1 35 ? 8.459   5.503   2.738   1.00 0.00 ? 35  HIS A CA   9  
ATOM   5655  C  C    . HIS A 1 35 ? 8.887   6.538   1.702   1.00 0.00 ? 35  HIS A C    9  
ATOM   5656  O  O    . HIS A 1 35 ? 9.986   6.464   1.151   1.00 0.00 ? 35  HIS A O    9  
ATOM   5657  C  CB   . HIS A 1 35 ? 7.845   4.289   2.041   1.00 0.00 ? 35  HIS A CB   9  
ATOM   5658  C  CG   . HIS A 1 35 ? 7.271   3.281   2.988   1.00 0.00 ? 35  HIS A CG   9  
ATOM   5659  N  ND1  . HIS A 1 35 ? 8.016   2.662   3.970   1.00 0.00 ? 35  HIS A ND1  9  
ATOM   5660  C  CD2  . HIS A 1 35 ? 6.017   2.785   3.101   1.00 0.00 ? 35  HIS A CD2  9  
ATOM   5661  C  CE1  . HIS A 1 35 ? 7.244   1.828   4.645   1.00 0.00 ? 35  HIS A CE1  9  
ATOM   5662  N  NE2  . HIS A 1 35 ? 6.026   1.885   4.137   1.00 0.00 ? 35  HIS A NE2  9  
ATOM   5663  H  H    . HIS A 1 35 ? 6.597   6.277   3.385   1.00 0.00 ? 35  HIS A H    9  
ATOM   5664  H  HA   . HIS A 1 35 ? 9.329   5.187   3.293   1.00 0.00 ? 35  HIS A HA   9  
ATOM   5665  H  HB2  . HIS A 1 35 ? 7.050   4.620   1.389   1.00 0.00 ? 35  HIS A HB2  9  
ATOM   5666  H  HB3  . HIS A 1 35 ? 8.606   3.797   1.452   1.00 0.00 ? 35  HIS A HB3  9  
ATOM   5667  H  HD1  . HIS A 1 35 ? 8.968   2.810   4.145   1.00 0.00 ? 35  HIS A HD1  9  
ATOM   5668  H  HD2  . HIS A 1 35 ? 5.165   3.049   2.489   1.00 0.00 ? 35  HIS A HD2  9  
ATOM   5669  H  HE1  . HIS A 1 35 ? 7.556   1.206   5.471   1.00 0.00 ? 35  HIS A HE1  9  
ATOM   5670  N  N    . THR A 1 36 ? 8.010   7.503   1.439   1.00 0.00 ? 36  THR A N    9  
ATOM   5671  C  CA   . THR A 1 36 ? 8.296   8.551   0.467   1.00 0.00 ? 36  THR A CA   9  
ATOM   5672  C  C    . THR A 1 36 ? 9.532   9.349   0.868   1.00 0.00 ? 36  THR A C    9  
ATOM   5673  O  O    . THR A 1 36 ? 10.430  9.569   0.057   1.00 0.00 ? 36  THR A O    9  
ATOM   5674  C  CB   . THR A 1 36 ? 7.104   9.514   0.313   1.00 0.00 ? 36  THR A CB   9  
ATOM   5675  O  OG1  . THR A 1 36 ? 6.930   10.275  1.514   1.00 0.00 ? 36  THR A OG1  9  
ATOM   5676  C  CG2  . THR A 1 36 ? 5.827   8.749   0.002   1.00 0.00 ? 36  THR A CG2  9  
ATOM   5677  H  H    . THR A 1 36 ? 7.151   7.508   1.910   1.00 0.00 ? 36  THR A H    9  
ATOM   5678  H  HA   . THR A 1 36 ? 8.478   8.080   -0.488  1.00 0.00 ? 36  THR A HA   9  
ATOM   5679  H  HB   . THR A 1 36 ? 7.310   10.189  -0.505  1.00 0.00 ? 36  THR A HB   9  
ATOM   5680  H  HG1  . THR A 1 36 ? 5.993   10.360  1.705   1.00 0.00 ? 36  THR A HG1  9  
ATOM   5681  H  HG21 . THR A 1 36 ? 4.975   9.316   0.346   1.00 0.00 ? 36  THR A HG21 9  
ATOM   5682  H  HG22 . THR A 1 36 ? 5.849   7.792   0.503   1.00 0.00 ? 36  THR A HG22 9  
ATOM   5683  H  HG23 . THR A 1 36 ? 5.750   8.595   -1.064  1.00 0.00 ? 36  THR A HG23 9  
ATOM   5684  N  N    . GLY A 1 37 ? 9.571   9.781   2.125   1.00 0.00 ? 37  GLY A N    9  
ATOM   5685  C  CA   . GLY A 1 37 ? 10.701  10.550  2.610   1.00 0.00 ? 37  GLY A CA   9  
ATOM   5686  C  C    . GLY A 1 37 ? 10.475  11.094  4.007   1.00 0.00 ? 37  GLY A C    9  
ATOM   5687  O  O    . GLY A 1 37 ? 9.338   11.182  4.469   1.00 0.00 ? 37  GLY A O    9  
ATOM   5688  H  H    . GLY A 1 37 ? 8.825   9.575   2.727   1.00 0.00 ? 37  GLY A H    9  
ATOM   5689  H  HA2  . GLY A 1 37 ? 11.576  9.917   2.619   1.00 0.00 ? 37  GLY A HA2  9  
ATOM   5690  H  HA3  . GLY A 1 37 ? 10.874  11.378  1.938   1.00 0.00 ? 37  GLY A HA3  9  
ATOM   5691  N  N    . GLU A 1 38 ? 11.562  11.457  4.682   1.00 0.00 ? 38  GLU A N    9  
ATOM   5692  C  CA   . GLU A 1 38 ? 11.476  11.992  6.036   1.00 0.00 ? 38  GLU A CA   9  
ATOM   5693  C  C    . GLU A 1 38 ? 11.954  13.441  6.079   1.00 0.00 ? 38  GLU A C    9  
ATOM   5694  O  O    . GLU A 1 38 ? 11.206  14.341  6.461   1.00 0.00 ? 38  GLU A O    9  
ATOM   5695  C  CB   . GLU A 1 38 ? 12.305  11.140  6.998   1.00 0.00 ? 38  GLU A CB   9  
ATOM   5696  C  CG   . GLU A 1 38 ? 11.779  9.725   7.168   1.00 0.00 ? 38  GLU A CG   9  
ATOM   5697  C  CD   . GLU A 1 38 ? 12.521  8.951   8.239   1.00 0.00 ? 38  GLU A CD   9  
ATOM   5698  O  OE1  . GLU A 1 38 ? 13.132  9.593   9.119   1.00 0.00 ? 38  GLU A OE1  9  
ATOM   5699  O  OE2  . GLU A 1 38 ? 12.492  7.703   8.198   1.00 0.00 ? 38  GLU A OE2  9  
ATOM   5700  H  H    . GLU A 1 38 ? 12.441  11.363  4.260   1.00 0.00 ? 38  GLU A H    9  
ATOM   5701  H  HA   . GLU A 1 38 ? 10.441  11.959  6.341   1.00 0.00 ? 38  GLU A HA   9  
ATOM   5702  H  HB2  . GLU A 1 38 ? 13.319  11.084  6.629   1.00 0.00 ? 38  GLU A HB2  9  
ATOM   5703  H  HB3  . GLU A 1 38 ? 12.312  11.618  7.967   1.00 0.00 ? 38  GLU A HB3  9  
ATOM   5704  H  HG2  . GLU A 1 38 ? 10.734  9.773   7.438   1.00 0.00 ? 38  GLU A HG2  9  
ATOM   5705  H  HG3  . GLU A 1 38 ? 11.882  9.202   6.228   1.00 0.00 ? 38  GLU A HG3  9  
ATOM   5706  N  N    . ARG A 1 39 ? 13.205  13.657  5.686   1.00 0.00 ? 39  ARG A N    9  
ATOM   5707  C  CA   . ARG A 1 39 ? 13.785  14.994  5.682   1.00 0.00 ? 39  ARG A CA   9  
ATOM   5708  C  C    . ARG A 1 39 ? 12.859  15.986  4.982   1.00 0.00 ? 39  ARG A C    9  
ATOM   5709  O  O    . ARG A 1 39 ? 12.075  15.627  4.103   1.00 0.00 ? 39  ARG A O    9  
ATOM   5710  C  CB   . ARG A 1 39 ? 15.150  14.980  4.991   1.00 0.00 ? 39  ARG A CB   9  
ATOM   5711  C  CG   . ARG A 1 39 ? 15.069  14.775  3.488   1.00 0.00 ? 39  ARG A CG   9  
ATOM   5712  C  CD   . ARG A 1 39 ? 16.411  14.352  2.911   1.00 0.00 ? 39  ARG A CD   9  
ATOM   5713  N  NE   . ARG A 1 39 ? 16.275  13.766  1.580   1.00 0.00 ? 39  ARG A NE   9  
ATOM   5714  C  CZ   . ARG A 1 39 ? 17.253  13.747  0.681   1.00 0.00 ? 39  ARG A CZ   9  
ATOM   5715  N  NH1  . ARG A 1 39 ? 18.432  14.280  0.969   1.00 0.00 ? 39  ARG A NH1  9  
ATOM   5716  N  NH2  . ARG A 1 39 ? 17.052  13.195  -0.509  1.00 0.00 ? 39  ARG A NH2  9  
ATOM   5717  H  H    . ARG A 1 39 ? 13.752  12.898  5.393   1.00 0.00 ? 39  ARG A H    9  
ATOM   5718  H  HA   . ARG A 1 39 ? 13.914  15.304  6.708   1.00 0.00 ? 39  ARG A HA   9  
ATOM   5719  H  HB2  . ARG A 1 39 ? 15.645  15.922  5.178   1.00 0.00 ? 39  ARG A HB2  9  
ATOM   5720  H  HB3  . ARG A 1 39 ? 15.743  14.181  5.411   1.00 0.00 ? 39  ARG A HB3  9  
ATOM   5721  H  HG2  . ARG A 1 39 ? 14.341  14.005  3.277   1.00 0.00 ? 39  ARG A HG2  9  
ATOM   5722  H  HG3  . ARG A 1 39 ? 14.763  15.700  3.023   1.00 0.00 ? 39  ARG A HG3  9  
ATOM   5723  H  HD2  . ARG A 1 39 ? 17.050  15.220  2.847   1.00 0.00 ? 39  ARG A HD2  9  
ATOM   5724  H  HD3  . ARG A 1 39 ? 16.858  13.624  3.571   1.00 0.00 ? 39  ARG A HD3  9  
ATOM   5725  H  HE   . ARG A 1 39 ? 15.411  13.367  1.346   1.00 0.00 ? 39  ARG A HE   9  
ATOM   5726  H  HH11 . ARG A 1 39 ? 18.587  14.695  1.865   1.00 0.00 ? 39  ARG A HH11 9  
ATOM   5727  H  HH12 . ARG A 1 39 ? 19.167  14.264  0.291   1.00 0.00 ? 39  ARG A HH12 9  
ATOM   5728  H  HH21 . ARG A 1 39 ? 16.164  12.793  -0.729  1.00 0.00 ? 39  ARG A HH21 9  
ATOM   5729  H  HH22 . ARG A 1 39 ? 17.788  13.182  -1.184  1.00 0.00 ? 39  ARG A HH22 9  
ATOM   5730  N  N    . PRO A 1 40 ? 12.950  17.263  5.380   1.00 0.00 ? 40  PRO A N    9  
ATOM   5731  C  CA   . PRO A 1 40 ? 12.129  18.332  4.804   1.00 0.00 ? 40  PRO A CA   9  
ATOM   5732  C  C    . PRO A 1 40 ? 12.518  18.650  3.365   1.00 0.00 ? 40  PRO A C    9  
ATOM   5733  O  O    . PRO A 1 40 ? 13.667  18.990  3.083   1.00 0.00 ? 40  PRO A O    9  
ATOM   5734  C  CB   . PRO A 1 40 ? 12.418  19.530  5.713   1.00 0.00 ? 40  PRO A CB   9  
ATOM   5735  C  CG   . PRO A 1 40 ? 13.767  19.257  6.283   1.00 0.00 ? 40  PRO A CG   9  
ATOM   5736  C  CD   . PRO A 1 40 ? 13.863  17.763  6.422   1.00 0.00 ? 40  PRO A CD   9  
ATOM   5737  H  HA   . PRO A 1 40 ? 11.077  18.091  4.847   1.00 0.00 ? 40  PRO A HA   9  
ATOM   5738  H  HB2  . PRO A 1 40 ? 12.411  20.439  5.128   1.00 0.00 ? 40  PRO A HB2  9  
ATOM   5739  H  HB3  . PRO A 1 40 ? 11.667  19.588  6.487   1.00 0.00 ? 40  PRO A HB3  9  
ATOM   5740  H  HG2  . PRO A 1 40 ? 14.529  19.620  5.611   1.00 0.00 ? 40  PRO A HG2  9  
ATOM   5741  H  HG3  . PRO A 1 40 ? 13.860  19.730  7.249   1.00 0.00 ? 40  PRO A HG3  9  
ATOM   5742  H  HD2  . PRO A 1 40 ? 14.874  17.431  6.241   1.00 0.00 ? 40  PRO A HD2  9  
ATOM   5743  H  HD3  . PRO A 1 40 ? 13.533  17.453  7.403   1.00 0.00 ? 40  PRO A HD3  9  
ATOM   5744  N  N    . SER A 1 41 ? 11.553  18.539  2.457   1.00 0.00 ? 41  SER A N    9  
ATOM   5745  C  CA   . SER A 1 41 ? 11.796  18.812  1.046   1.00 0.00 ? 41  SER A CA   9  
ATOM   5746  C  C    . SER A 1 41 ? 12.685  20.040  0.875   1.00 0.00 ? 41  SER A C    9  
ATOM   5747  O  O    . SER A 1 41 ? 12.460  21.076  1.499   1.00 0.00 ? 41  SER A O    9  
ATOM   5748  C  CB   . SER A 1 41 ? 10.471  19.022  0.310   1.00 0.00 ? 41  SER A CB   9  
ATOM   5749  O  OG   . SER A 1 41 ? 10.691  19.385  -1.042  1.00 0.00 ? 41  SER A OG   9  
ATOM   5750  H  H    . SER A 1 41 ? 10.657  18.265  2.744   1.00 0.00 ? 41  SER A H    9  
ATOM   5751  H  HA   . SER A 1 41 ? 12.300  17.955  0.624   1.00 0.00 ? 41  SER A HA   9  
ATOM   5752  H  HB2  . SER A 1 41 ? 9.899   18.107  0.335   1.00 0.00 ? 41  SER A HB2  9  
ATOM   5753  H  HB3  . SER A 1 41 ? 9.913   19.809  0.796   1.00 0.00 ? 41  SER A HB3  9  
ATOM   5754  H  HG   . SER A 1 41 ? 11.273  20.148  -1.078  1.00 0.00 ? 41  SER A HG   9  
ATOM   5755  N  N    . GLY A 1 42 ? 13.699  19.915  0.023   1.00 0.00 ? 42  GLY A N    9  
ATOM   5756  C  CA   . GLY A 1 42 ? 14.608  21.021  -0.216  1.00 0.00 ? 42  GLY A CA   9  
ATOM   5757  C  C    . GLY A 1 42 ? 15.384  20.865  -1.508  1.00 0.00 ? 42  GLY A C    9  
ATOM   5758  O  O    . GLY A 1 42 ? 14.952  21.307  -2.573  1.00 0.00 ? 42  GLY A O    9  
ATOM   5759  H  H    . GLY A 1 42 ? 13.830  19.065  -0.447  1.00 0.00 ? 42  GLY A H    9  
ATOM   5760  H  HA2  . GLY A 1 42 ? 14.039  21.938  -0.258  1.00 0.00 ? 42  GLY A HA2  9  
ATOM   5761  H  HA3  . GLY A 1 42 ? 15.307  21.081  0.606   1.00 0.00 ? 42  GLY A HA3  9  
ATOM   5762  N  N    . PRO A 1 43 ? 16.559  20.224  -1.424  1.00 0.00 ? 43  PRO A N    9  
ATOM   5763  C  CA   . PRO A 1 43 ? 17.422  19.997  -2.587  1.00 0.00 ? 43  PRO A CA   9  
ATOM   5764  C  C    . PRO A 1 43 ? 16.829  18.986  -3.561  1.00 0.00 ? 43  PRO A C    9  
ATOM   5765  O  O    . PRO A 1 43 ? 16.840  19.197  -4.773  1.00 0.00 ? 43  PRO A O    9  
ATOM   5766  C  CB   . PRO A 1 43 ? 18.712  19.452  -1.969  1.00 0.00 ? 43  PRO A CB   9  
ATOM   5767  C  CG   . PRO A 1 43 ? 18.286  18.839  -0.681  1.00 0.00 ? 43  PRO A CG   9  
ATOM   5768  C  CD   . PRO A 1 43 ? 17.135  19.671  -0.187  1.00 0.00 ? 43  PRO A CD   9  
ATOM   5769  H  HA   . PRO A 1 43 ? 17.633  20.919  -3.110  1.00 0.00 ? 43  PRO A HA   9  
ATOM   5770  H  HB2  . PRO A 1 43 ? 19.149  18.718  -2.632  1.00 0.00 ? 43  PRO A HB2  9  
ATOM   5771  H  HB3  . PRO A 1 43 ? 19.409  20.261  -1.810  1.00 0.00 ? 43  PRO A HB3  9  
ATOM   5772  H  HG2  . PRO A 1 43 ? 17.969  17.820  -0.846  1.00 0.00 ? 43  PRO A HG2  9  
ATOM   5773  H  HG3  . PRO A 1 43 ? 19.101  18.870  0.028   1.00 0.00 ? 43  PRO A HG3  9  
ATOM   5774  H  HD2  . PRO A 1 43 ? 16.416  19.052  0.330   1.00 0.00 ? 43  PRO A HD2  9  
ATOM   5775  H  HD3  . PRO A 1 43 ? 17.489  20.460  0.459   1.00 0.00 ? 43  PRO A HD3  9  
ATOM   5776  N  N    . SER A 1 44 ? 16.311  17.886  -3.023  1.00 0.00 ? 44  SER A N    9  
ATOM   5777  C  CA   . SER A 1 44 ? 15.715  16.840  -3.845  1.00 0.00 ? 44  SER A CA   9  
ATOM   5778  C  C    . SER A 1 44 ? 16.571  16.565  -5.078  1.00 0.00 ? 44  SER A C    9  
ATOM   5779  O  O    . SER A 1 44 ? 16.055  16.425  -6.187  1.00 0.00 ? 44  SER A O    9  
ATOM   5780  C  CB   . SER A 1 44 ? 14.301  17.239  -4.271  1.00 0.00 ? 44  SER A CB   9  
ATOM   5781  O  OG   . SER A 1 44 ? 14.333  18.181  -5.329  1.00 0.00 ? 44  SER A OG   9  
ATOM   5782  H  H    . SER A 1 44 ? 16.332  17.775  -2.049  1.00 0.00 ? 44  SER A H    9  
ATOM   5783  H  HA   . SER A 1 44 ? 15.663  15.940  -3.250  1.00 0.00 ? 44  SER A HA   9  
ATOM   5784  H  HB2  . SER A 1 44 ? 13.767  16.362  -4.603  1.00 0.00 ? 44  SER A HB2  9  
ATOM   5785  H  HB3  . SER A 1 44 ? 13.785  17.678  -3.429  1.00 0.00 ? 44  SER A HB3  9  
ATOM   5786  H  HG   . SER A 1 44 ? 14.761  17.789  -6.094  1.00 0.00 ? 44  SER A HG   9  
ATOM   5787  N  N    . SER A 1 45 ? 17.883  16.489  -4.875  1.00 0.00 ? 45  SER A N    9  
ATOM   5788  C  CA   . SER A 1 45 ? 18.812  16.236  -5.970  1.00 0.00 ? 45  SER A CA   9  
ATOM   5789  C  C    . SER A 1 45 ? 18.422  17.035  -7.210  1.00 0.00 ? 45  SER A C    9  
ATOM   5790  O  O    . SER A 1 45 ? 18.469  16.527  -8.330  1.00 0.00 ? 45  SER A O    9  
ATOM   5791  C  CB   . SER A 1 45 ? 18.846  14.742  -6.302  1.00 0.00 ? 45  SER A CB   9  
ATOM   5792  O  OG   . SER A 1 45 ? 19.304  13.985  -5.195  1.00 0.00 ? 45  SER A OG   9  
ATOM   5793  H  H    . SER A 1 45 ? 18.233  16.610  -3.968  1.00 0.00 ? 45  SER A H    9  
ATOM   5794  H  HA   . SER A 1 45 ? 19.795  16.547  -5.650  1.00 0.00 ? 45  SER A HA   9  
ATOM   5795  H  HB2  . SER A 1 45 ? 17.853  14.411  -6.563  1.00 0.00 ? 45  SER A HB2  9  
ATOM   5796  H  HB3  . SER A 1 45 ? 19.512  14.577  -7.136  1.00 0.00 ? 45  SER A HB3  9  
ATOM   5797  H  HG   . SER A 1 45 ? 19.318  13.054  -5.428  1.00 0.00 ? 45  SER A HG   9  
ATOM   5798  N  N    . GLY A 1 46 ? 18.036  18.290  -7.000  1.00 0.00 ? 46  GLY A N    9  
ATOM   5799  C  CA   . GLY A 1 46 ? 17.643  19.140  -8.109  1.00 0.00 ? 46  GLY A CA   9  
ATOM   5800  C  C    . GLY A 1 46 ? 16.156  19.069  -8.395  1.00 0.00 ? 46  GLY A C    9  
ATOM   5801  O  O    . GLY A 1 46 ? 15.632  17.971  -8.575  1.00 0.00 ? 46  GLY A O    9  
ATOM   5802  H  H    . GLY A 1 46 ? 18.018  18.641  -6.086  1.00 0.00 ? 46  GLY A H    9  
ATOM   5803  H  HA2  . GLY A 1 46 ? 17.906  20.161  -7.877  1.00 0.00 ? 46  GLY A HA2  9  
ATOM   5804  H  HA3  . GLY A 1 46 ? 18.183  18.832  -8.993  1.00 0.00 ? 46  GLY A HA3  9  
HETATM 5805  ZN ZN   . ZN  B 2 .  ? 4.240   0.904   4.504   1.00 0.00 ? 201 ZN  A ZN   9  
ATOM   5806  N  N    . GLY A 1 1  ? -16.985 -28.572 -6.221  1.00 0.00 ? 1   GLY A N    10 
ATOM   5807  C  CA   . GLY A 1 1  ? -17.855 -28.066 -5.176  1.00 0.00 ? 1   GLY A CA   10 
ATOM   5808  C  C    . GLY A 1 1  ? -17.415 -26.709 -4.663  1.00 0.00 ? 1   GLY A C    10 
ATOM   5809  O  O    . GLY A 1 1  ? -18.153 -25.729 -4.770  1.00 0.00 ? 1   GLY A O    10 
ATOM   5810  H  H1   . GLY A 1 1  ? -16.028 -28.690 -6.045  1.00 0.00 ? 1   GLY A H1   10 
ATOM   5811  H  HA2  . GLY A 1 1  ? -18.858 -27.984 -5.566  1.00 0.00 ? 1   GLY A HA2  10 
ATOM   5812  H  HA3  . GLY A 1 1  ? -17.855 -28.765 -4.353  1.00 0.00 ? 1   GLY A HA3  10 
ATOM   5813  N  N    . SER A 1 2  ? -16.211 -26.651 -4.103  1.00 0.00 ? 2   SER A N    10 
ATOM   5814  C  CA   . SER A 1 2  ? -15.677 -25.404 -3.567  1.00 0.00 ? 2   SER A CA   10 
ATOM   5815  C  C    . SER A 1 2  ? -15.225 -24.478 -4.691  1.00 0.00 ? 2   SER A C    10 
ATOM   5816  O  O    . SER A 1 2  ? -15.080 -24.901 -5.838  1.00 0.00 ? 2   SER A O    10 
ATOM   5817  C  CB   . SER A 1 2  ? -14.506 -25.691 -2.624  1.00 0.00 ? 2   SER A CB   10 
ATOM   5818  O  OG   . SER A 1 2  ? -14.300 -24.615 -1.726  1.00 0.00 ? 2   SER A OG   10 
ATOM   5819  H  H    . SER A 1 2  ? -15.670 -27.466 -4.048  1.00 0.00 ? 2   SER A H    10 
ATOM   5820  H  HA   . SER A 1 2  ? -16.465 -24.918 -3.011  1.00 0.00 ? 2   SER A HA   10 
ATOM   5821  H  HB2  . SER A 1 2  ? -14.715 -26.584 -2.056  1.00 0.00 ? 2   SER A HB2  10 
ATOM   5822  H  HB3  . SER A 1 2  ? -13.607 -25.836 -3.206  1.00 0.00 ? 2   SER A HB3  10 
ATOM   5823  H  HG   . SER A 1 2  ? -14.245 -24.952 -0.829  1.00 0.00 ? 2   SER A HG   10 
ATOM   5824  N  N    . SER A 1 3  ? -15.004 -23.212 -4.354  1.00 0.00 ? 3   SER A N    10 
ATOM   5825  C  CA   . SER A 1 3  ? -14.571 -22.223 -5.335  1.00 0.00 ? 3   SER A CA   10 
ATOM   5826  C  C    . SER A 1 3  ? -13.255 -21.578 -4.913  1.00 0.00 ? 3   SER A C    10 
ATOM   5827  O  O    . SER A 1 3  ? -13.036 -21.302 -3.734  1.00 0.00 ? 3   SER A O    10 
ATOM   5828  C  CB   . SER A 1 3  ? -15.645 -21.148 -5.514  1.00 0.00 ? 3   SER A CB   10 
ATOM   5829  O  OG   . SER A 1 3  ? -15.804 -20.384 -4.331  1.00 0.00 ? 3   SER A OG   10 
ATOM   5830  H  H    . SER A 1 3  ? -15.137 -22.935 -3.423  1.00 0.00 ? 3   SER A H    10 
ATOM   5831  H  HA   . SER A 1 3  ? -14.424 -22.733 -6.276  1.00 0.00 ? 3   SER A HA   10 
ATOM   5832  H  HB2  . SER A 1 3  ? -15.359 -20.488 -6.318  1.00 0.00 ? 3   SER A HB2  10 
ATOM   5833  H  HB3  . SER A 1 3  ? -16.587 -21.620 -5.753  1.00 0.00 ? 3   SER A HB3  10 
ATOM   5834  H  HG   . SER A 1 3  ? -14.950 -20.048 -4.049  1.00 0.00 ? 3   SER A HG   10 
ATOM   5835  N  N    . GLY A 1 4  ? -12.380 -21.341 -5.886  1.00 0.00 ? 4   GLY A N    10 
ATOM   5836  C  CA   . GLY A 1 4  ? -11.096 -20.731 -5.597  1.00 0.00 ? 4   GLY A CA   10 
ATOM   5837  C  C    . GLY A 1 4  ? -10.088 -21.728 -5.058  1.00 0.00 ? 4   GLY A C    10 
ATOM   5838  O  O    . GLY A 1 4  ? -10.282 -22.938 -5.171  1.00 0.00 ? 4   GLY A O    10 
ATOM   5839  H  H    . GLY A 1 4  ? -12.609 -21.583 -6.808  1.00 0.00 ? 4   GLY A H    10 
ATOM   5840  H  HA2  . GLY A 1 4  ? -10.705 -20.293 -6.503  1.00 0.00 ? 4   GLY A HA2  10 
ATOM   5841  H  HA3  . GLY A 1 4  ? -11.238 -19.950 -4.864  1.00 0.00 ? 4   GLY A HA3  10 
ATOM   5842  N  N    . SER A 1 5  ? -9.009  -21.218 -4.473  1.00 0.00 ? 5   SER A N    10 
ATOM   5843  C  CA   . SER A 1 5  ? -7.965  -22.072 -3.920  1.00 0.00 ? 5   SER A CA   10 
ATOM   5844  C  C    . SER A 1 5  ? -7.727  -21.756 -2.447  1.00 0.00 ? 5   SER A C    10 
ATOM   5845  O  O    . SER A 1 5  ? -7.729  -22.650 -1.600  1.00 0.00 ? 5   SER A O    10 
ATOM   5846  C  CB   . SER A 1 5  ? -6.664  -21.898 -4.707  1.00 0.00 ? 5   SER A CB   10 
ATOM   5847  O  OG   . SER A 1 5  ? -5.690  -22.842 -4.298  1.00 0.00 ? 5   SER A OG   10 
ATOM   5848  H  H    . SER A 1 5  ? -8.912  -20.245 -4.414  1.00 0.00 ? 5   SER A H    10 
ATOM   5849  H  HA   . SER A 1 5  ? -8.293  -23.097 -4.008  1.00 0.00 ? 5   SER A HA   10 
ATOM   5850  H  HB2  . SER A 1 5  ? -6.862  -22.035 -5.759  1.00 0.00 ? 5   SER A HB2  10 
ATOM   5851  H  HB3  . SER A 1 5  ? -6.277  -20.903 -4.540  1.00 0.00 ? 5   SER A HB3  10 
ATOM   5852  H  HG   . SER A 1 5  ? -5.844  -23.676 -4.747  1.00 0.00 ? 5   SER A HG   10 
ATOM   5853  N  N    . SER A 1 6  ? -7.524  -20.477 -2.148  1.00 0.00 ? 6   SER A N    10 
ATOM   5854  C  CA   . SER A 1 6  ? -7.281  -20.041 -0.777  1.00 0.00 ? 6   SER A CA   10 
ATOM   5855  C  C    . SER A 1 6  ? -8.581  -20.009 0.021   1.00 0.00 ? 6   SER A C    10 
ATOM   5856  O  O    . SER A 1 6  ? -8.724  -20.706 1.024   1.00 0.00 ? 6   SER A O    10 
ATOM   5857  C  CB   . SER A 1 6  ? -6.629  -18.658 -0.768  1.00 0.00 ? 6   SER A CB   10 
ATOM   5858  O  OG   . SER A 1 6  ? -6.257  -18.278 0.546   1.00 0.00 ? 6   SER A OG   10 
ATOM   5859  H  H    . SER A 1 6  ? -7.535  -19.811 -2.867  1.00 0.00 ? 6   SER A H    10 
ATOM   5860  H  HA   . SER A 1 6  ? -6.608  -20.751 -0.318  1.00 0.00 ? 6   SER A HA   10 
ATOM   5861  H  HB2  . SER A 1 6  ? -5.745  -18.675 -1.388  1.00 0.00 ? 6   SER A HB2  10 
ATOM   5862  H  HB3  . SER A 1 6  ? -7.327  -17.931 -1.156  1.00 0.00 ? 6   SER A HB3  10 
ATOM   5863  H  HG   . SER A 1 6  ? -6.924  -17.692 0.911   1.00 0.00 ? 6   SER A HG   10 
ATOM   5864  N  N    . GLY A 1 7  ? -9.527  -19.193 -0.435  1.00 0.00 ? 7   GLY A N    10 
ATOM   5865  C  CA   . GLY A 1 7  ? -10.803 -19.084 0.248   1.00 0.00 ? 7   GLY A CA   10 
ATOM   5866  C  C    . GLY A 1 7  ? -11.470 -17.742 0.019   1.00 0.00 ? 7   GLY A C    10 
ATOM   5867  O  O    . GLY A 1 7  ? -11.272 -17.110 -1.020  1.00 0.00 ? 7   GLY A O    10 
ATOM   5868  H  H    . GLY A 1 7  ? -9.357  -18.661 -1.240  1.00 0.00 ? 7   GLY A H    10 
ATOM   5869  H  HA2  . GLY A 1 7  ? -11.458 -19.865 -0.109  1.00 0.00 ? 7   GLY A HA2  10 
ATOM   5870  H  HA3  . GLY A 1 7  ? -10.644 -19.217 1.308   1.00 0.00 ? 7   GLY A HA3  10 
ATOM   5871  N  N    . THR A 1 8  ? -12.265 -17.304 0.990   1.00 0.00 ? 8   THR A N    10 
ATOM   5872  C  CA   . THR A 1 8  ? -12.966 -16.030 0.889   1.00 0.00 ? 8   THR A CA   10 
ATOM   5873  C  C    . THR A 1 8  ? -12.420 -15.021 1.892   1.00 0.00 ? 8   THR A C    10 
ATOM   5874  O  O    . THR A 1 8  ? -12.099 -15.370 3.027   1.00 0.00 ? 8   THR A O    10 
ATOM   5875  C  CB   . THR A 1 8  ? -14.479 -16.201 1.122   1.00 0.00 ? 8   THR A CB   10 
ATOM   5876  O  OG1  . THR A 1 8  ? -15.136 -14.933 1.024   1.00 0.00 ? 8   THR A OG1  10 
ATOM   5877  C  CG2  . THR A 1 8  ? -14.750 -16.814 2.488   1.00 0.00 ? 8   THR A CG2  10 
ATOM   5878  H  H    . THR A 1 8  ? -12.383 -17.853 1.793   1.00 0.00 ? 8   THR A H    10 
ATOM   5879  H  HA   . THR A 1 8  ? -12.818 -15.647 -0.110  1.00 0.00 ? 8   THR A HA   10 
ATOM   5880  H  HB   . THR A 1 8  ? -14.872 -16.862 0.363   1.00 0.00 ? 8   THR A HB   10 
ATOM   5881  H  HG1  . THR A 1 8  ? -16.001 -15.050 0.624   1.00 0.00 ? 8   THR A HG1  10 
ATOM   5882  H  HG21 . THR A 1 8  ? -15.103 -17.826 2.364   1.00 0.00 ? 8   THR A HG21 10 
ATOM   5883  H  HG22 . THR A 1 8  ? -15.501 -16.231 3.001   1.00 0.00 ? 8   THR A HG22 10 
ATOM   5884  H  HG23 . THR A 1 8  ? -13.839 -16.819 3.067   1.00 0.00 ? 8   THR A HG23 10 
ATOM   5885  N  N    . GLY A 1 9  ? -12.316 -13.766 1.466   1.00 0.00 ? 9   GLY A N    10 
ATOM   5886  C  CA   . GLY A 1 9  ? -11.809 -12.724 2.340   1.00 0.00 ? 9   GLY A CA   10 
ATOM   5887  C  C    . GLY A 1 9  ? -10.606 -12.011 1.754   1.00 0.00 ? 9   GLY A C    10 
ATOM   5888  O  O    . GLY A 1 9  ? -9.464  -12.375 2.033   1.00 0.00 ? 9   GLY A O    10 
ATOM   5889  H  H    . GLY A 1 9  ? -12.587 -13.545 0.550   1.00 0.00 ? 9   GLY A H    10 
ATOM   5890  H  HA2  . GLY A 1 9  ? -12.592 -12.003 2.515   1.00 0.00 ? 9   GLY A HA2  10 
ATOM   5891  H  HA3  . GLY A 1 9  ? -11.525 -13.169 3.283   1.00 0.00 ? 9   GLY A HA3  10 
ATOM   5892  N  N    . GLU A 1 10 ? -10.863 -10.993 0.939   1.00 0.00 ? 10  GLU A N    10 
ATOM   5893  C  CA   . GLU A 1 10 ? -9.792  -10.229 0.311   1.00 0.00 ? 10  GLU A CA   10 
ATOM   5894  C  C    . GLU A 1 10 ? -9.613  -8.877  0.996   1.00 0.00 ? 10  GLU A C    10 
ATOM   5895  O  O    . GLU A 1 10 ? -10.527 -8.054  1.015   1.00 0.00 ? 10  GLU A O    10 
ATOM   5896  C  CB   . GLU A 1 10 ? -10.086 -10.024 -1.177  1.00 0.00 ? 10  GLU A CB   10 
ATOM   5897  C  CG   . GLU A 1 10 ? -8.965  -9.324  -1.928  1.00 0.00 ? 10  GLU A CG   10 
ATOM   5898  C  CD   . GLU A 1 10 ? -8.939  -9.682  -3.401  1.00 0.00 ? 10  GLU A CD   10 
ATOM   5899  O  OE1  . GLU A 1 10 ? -10.003 -10.053 -3.940  1.00 0.00 ? 10  GLU A OE1  10 
ATOM   5900  O  OE2  . GLU A 1 10 ? -7.855  -9.591  -4.015  1.00 0.00 ? 10  GLU A OE2  10 
ATOM   5901  H  H    . GLU A 1 10 ? -11.795 -10.750 0.755   1.00 0.00 ? 10  GLU A H    10 
ATOM   5902  H  HA   . GLU A 1 10 ? -8.878  -10.794 0.413   1.00 0.00 ? 10  GLU A HA   10 
ATOM   5903  H  HB2  . GLU A 1 10 ? -10.252 -10.988 -1.635  1.00 0.00 ? 10  GLU A HB2  10 
ATOM   5904  H  HB3  . GLU A 1 10 ? -10.982 -9.429  -1.275  1.00 0.00 ? 10  GLU A HB3  10 
ATOM   5905  H  HG2  . GLU A 1 10 ? -9.098  -8.257  -1.835  1.00 0.00 ? 10  GLU A HG2  10 
ATOM   5906  H  HG3  . GLU A 1 10 ? -8.021  -9.608  -1.486  1.00 0.00 ? 10  GLU A HG3  10 
ATOM   5907  N  N    . ASN A 1 11 ? -8.429  -8.658  1.559   1.00 0.00 ? 11  ASN A N    10 
ATOM   5908  C  CA   . ASN A 1 11 ? -8.130  -7.407  2.247   1.00 0.00 ? 11  ASN A CA   10 
ATOM   5909  C  C    . ASN A 1 11 ? -8.488  -6.207  1.375   1.00 0.00 ? 11  ASN A C    10 
ATOM   5910  O  O    . ASN A 1 11 ? -8.505  -6.284  0.146   1.00 0.00 ? 11  ASN A O    10 
ATOM   5911  C  CB   . ASN A 1 11 ? -6.649  -7.351  2.627   1.00 0.00 ? 11  ASN A CB   10 
ATOM   5912  C  CG   . ASN A 1 11 ? -5.760  -8.000  1.584   1.00 0.00 ? 11  ASN A CG   10 
ATOM   5913  O  OD1  . ASN A 1 11 ? -5.486  -7.416  0.535   1.00 0.00 ? 11  ASN A OD1  10 
ATOM   5914  N  ND2  . ASN A 1 11 ? -5.304  -9.214  1.868   1.00 0.00 ? 11  ASN A ND2  10 
ATOM   5915  H  H    . ASN A 1 11 ? -7.740  -9.353  1.511   1.00 0.00 ? 11  ASN A H    10 
ATOM   5916  H  HA   . ASN A 1 11 ? -8.725  -7.373  3.147   1.00 0.00 ? 11  ASN A HA   10 
ATOM   5917  H  HB2  . ASN A 1 11 ? -6.350  -6.318  2.734   1.00 0.00 ? 11  ASN A HB2  10 
ATOM   5918  H  HB3  . ASN A 1 11 ? -6.505  -7.863  3.566   1.00 0.00 ? 11  ASN A HB3  10 
ATOM   5919  H  HD21 . ASN A 1 11 ? -5.563  -9.618  2.723   1.00 0.00 ? 11  ASN A HD21 10 
ATOM   5920  H  HD22 . ASN A 1 11 ? -4.726  -9.657  1.212   1.00 0.00 ? 11  ASN A HD22 10 
ATOM   5921  N  N    . PRO A 1 12 ? -8.782  -5.071  2.024   1.00 0.00 ? 12  PRO A N    10 
ATOM   5922  C  CA   . PRO A 1 12 ? -9.144  -3.832  1.328   1.00 0.00 ? 12  PRO A CA   10 
ATOM   5923  C  C    . PRO A 1 12 ? -7.963  -3.218  0.584   1.00 0.00 ? 12  PRO A C    10 
ATOM   5924  O  O    . PRO A 1 12 ? -8.061  -2.897  -0.600  1.00 0.00 ? 12  PRO A O    10 
ATOM   5925  C  CB   . PRO A 1 12 ? -9.601  -2.910  2.460   1.00 0.00 ? 12  PRO A CB   10 
ATOM   5926  C  CG   . PRO A 1 12 ? -8.898  -3.419  3.671   1.00 0.00 ? 12  PRO A CG   10 
ATOM   5927  C  CD   . PRO A 1 12 ? -8.782  -4.906  3.487   1.00 0.00 ? 12  PRO A CD   10 
ATOM   5928  H  HA   . PRO A 1 12 ? -9.960  -3.990  0.638   1.00 0.00 ? 12  PRO A HA   10 
ATOM   5929  H  HB2  . PRO A 1 12 ? -9.316  -1.891  2.236   1.00 0.00 ? 12  PRO A HB2  10 
ATOM   5930  H  HB3  . PRO A 1 12 ? -10.673 -2.973  2.571   1.00 0.00 ? 12  PRO A HB3  10 
ATOM   5931  H  HG2  . PRO A 1 12 ? -7.918  -2.972  3.742   1.00 0.00 ? 12  PRO A HG2  10 
ATOM   5932  H  HG3  . PRO A 1 12 ? -9.479  -3.195  4.554   1.00 0.00 ? 12  PRO A HG3  10 
ATOM   5933  H  HD2  . PRO A 1 12 ? -7.859  -5.269  3.916   1.00 0.00 ? 12  PRO A HD2  10 
ATOM   5934  H  HD3  . PRO A 1 12 ? -9.629  -5.409  3.931   1.00 0.00 ? 12  PRO A HD3  10 
ATOM   5935  N  N    . PHE A 1 13 ? -6.846  -3.058  1.287   1.00 0.00 ? 13  PHE A N    10 
ATOM   5936  C  CA   . PHE A 1 13 ? -5.645  -2.482  0.693   1.00 0.00 ? 13  PHE A CA   10 
ATOM   5937  C  C    . PHE A 1 13 ? -4.415  -2.798  1.538   1.00 0.00 ? 13  PHE A C    10 
ATOM   5938  O  O    . PHE A 1 13 ? -4.465  -2.754  2.768   1.00 0.00 ? 13  PHE A O    10 
ATOM   5939  C  CB   . PHE A 1 13 ? -5.800  -0.967  0.545   1.00 0.00 ? 13  PHE A CB   10 
ATOM   5940  C  CG   . PHE A 1 13 ? -7.157  -0.549  0.056   1.00 0.00 ? 13  PHE A CG   10 
ATOM   5941  C  CD1  . PHE A 1 13 ? -7.436  -0.505  -1.301  1.00 0.00 ? 13  PHE A CD1  10 
ATOM   5942  C  CD2  . PHE A 1 13 ? -8.154  -0.200  0.952   1.00 0.00 ? 13  PHE A CD2  10 
ATOM   5943  C  CE1  . PHE A 1 13 ? -8.683  -0.119  -1.754  1.00 0.00 ? 13  PHE A CE1  10 
ATOM   5944  C  CE2  . PHE A 1 13 ? -9.404  0.186   0.505   1.00 0.00 ? 13  PHE A CE2  10 
ATOM   5945  C  CZ   . PHE A 1 13 ? -9.669  0.226   -0.850  1.00 0.00 ? 13  PHE A CZ   10 
ATOM   5946  H  H    . PHE A 1 13 ? -6.829  -3.334  2.228   1.00 0.00 ? 13  PHE A H    10 
ATOM   5947  H  HA   . PHE A 1 13 ? -5.517  -2.920  -0.285  1.00 0.00 ? 13  PHE A HA   10 
ATOM   5948  H  HB2  . PHE A 1 13 ? -5.636  -0.500  1.504   1.00 0.00 ? 13  PHE A HB2  10 
ATOM   5949  H  HB3  . PHE A 1 13 ? -5.066  -0.605  -0.158  1.00 0.00 ? 13  PHE A HB3  10 
ATOM   5950  H  HD1  . PHE A 1 13 ? -6.666  -0.775  -2.009  1.00 0.00 ? 13  PHE A HD1  10 
ATOM   5951  H  HD2  . PHE A 1 13 ? -7.948  -0.230  2.013   1.00 0.00 ? 13  PHE A HD2  10 
ATOM   5952  H  HE1  . PHE A 1 13 ? -8.888  -0.089  -2.814  1.00 0.00 ? 13  PHE A HE1  10 
ATOM   5953  H  HE2  . PHE A 1 13 ? -10.172 0.455   1.215   1.00 0.00 ? 13  PHE A HE2  10 
ATOM   5954  H  HZ   . PHE A 1 13 ? -10.644 0.528   -1.201  1.00 0.00 ? 13  PHE A HZ   10 
ATOM   5955  N  N    . ILE A 1 14 ? -3.312  -3.118  0.870   1.00 0.00 ? 14  ILE A N    10 
ATOM   5956  C  CA   . ILE A 1 14 ? -2.069  -3.441  1.559   1.00 0.00 ? 14  ILE A CA   10 
ATOM   5957  C  C    . ILE A 1 14 ? -0.903  -2.633  0.999   1.00 0.00 ? 14  ILE A C    10 
ATOM   5958  O  O    . ILE A 1 14 ? -0.767  -2.478  -0.215  1.00 0.00 ? 14  ILE A O    10 
ATOM   5959  C  CB   . ILE A 1 14 ? -1.737  -4.941  1.449   1.00 0.00 ? 14  ILE A CB   10 
ATOM   5960  C  CG1  . ILE A 1 14 ? -2.790  -5.774  2.185   1.00 0.00 ? 14  ILE A CG1  10 
ATOM   5961  C  CG2  . ILE A 1 14 ? -0.349  -5.220  2.006   1.00 0.00 ? 14  ILE A CG2  10 
ATOM   5962  C  CD1  . ILE A 1 14 ? -2.476  -7.253  2.215   1.00 0.00 ? 14  ILE A CD1  10 
ATOM   5963  H  H    . ILE A 1 14 ? -3.334  -3.136  -0.109  1.00 0.00 ? 14  ILE A H    10 
ATOM   5964  H  HA   . ILE A 1 14 ? -2.194  -3.197  2.604   1.00 0.00 ? 14  ILE A HA   10 
ATOM   5965  H  HB   . ILE A 1 14 ? -1.740  -5.212  0.404   1.00 0.00 ? 14  ILE A HB   10 
ATOM   5966  H  HG12 . ILE A 1 14 ? -2.863  -5.430  3.204   1.00 0.00 ? 14  ILE A HG12 10 
ATOM   5967  H  HG13 . ILE A 1 14 ? -3.745  -5.646  1.696   1.00 0.00 ? 14  ILE A HG13 10 
ATOM   5968  H  HG21 . ILE A 1 14 ? 0.376   -5.169  1.208   1.00 0.00 ? 14  ILE A HG21 10 
ATOM   5969  H  HG22 . ILE A 1 14 ? -0.109  -4.482  2.757   1.00 0.00 ? 14  ILE A HG22 10 
ATOM   5970  H  HG23 . ILE A 1 14 ? -0.329  -6.204  2.449   1.00 0.00 ? 14  ILE A HG23 10 
ATOM   5971  H  HD11 . ILE A 1 14 ? -1.998  -7.500  3.153   1.00 0.00 ? 14  ILE A HD11 10 
ATOM   5972  H  HD12 . ILE A 1 14 ? -3.392  -7.818  2.120   1.00 0.00 ? 14  ILE A HD12 10 
ATOM   5973  H  HD13 . ILE A 1 14 ? -1.814  -7.499  1.399   1.00 0.00 ? 14  ILE A HD13 10 
ATOM   5974  N  N    . CYS A 1 15 ? -0.064  -2.119  1.892   1.00 0.00 ? 15  CYS A N    10 
ATOM   5975  C  CA   . CYS A 1 15 ? 1.092   -1.326  1.489   1.00 0.00 ? 15  CYS A CA   10 
ATOM   5976  C  C    . CYS A 1 15 ? 2.080   -2.173  0.692   1.00 0.00 ? 15  CYS A C    10 
ATOM   5977  O  O    . CYS A 1 15 ? 2.492   -3.245  1.134   1.00 0.00 ? 15  CYS A O    10 
ATOM   5978  C  CB   . CYS A 1 15 ? 1.785   -0.735  2.718   1.00 0.00 ? 15  CYS A CB   10 
ATOM   5979  S  SG   . CYS A 1 15 ? 2.907   0.651   2.344   1.00 0.00 ? 15  CYS A SG   10 
ATOM   5980  H  H    . CYS A 1 15 ? -0.226  -2.276  2.847   1.00 0.00 ? 15  CYS A H    10 
ATOM   5981  H  HA   . CYS A 1 15 ? 0.739   -0.521  0.862   1.00 0.00 ? 15  CYS A HA   10 
ATOM   5982  H  HB2  . CYS A 1 15 ? 1.034   -0.372  3.405   1.00 0.00 ? 15  CYS A HB2  10 
ATOM   5983  H  HB3  . CYS A 1 15 ? 2.364   -1.507  3.201   1.00 0.00 ? 15  CYS A HB3  10 
ATOM   5984  N  N    . SER A 1 16 ? 2.456   -1.683  -0.485  1.00 0.00 ? 16  SER A N    10 
ATOM   5985  C  CA   . SER A 1 16 ? 3.393   -2.395  -1.345  1.00 0.00 ? 16  SER A CA   10 
ATOM   5986  C  C    . SER A 1 16 ? 4.835   -2.086  -0.952  1.00 0.00 ? 16  SER A C    10 
ATOM   5987  O  O    . SER A 1 16 ? 5.762   -2.308  -1.730  1.00 0.00 ? 16  SER A O    10 
ATOM   5988  C  CB   . SER A 1 16 ? 3.161   -2.019  -2.810  1.00 0.00 ? 16  SER A CB   10 
ATOM   5989  O  OG   . SER A 1 16 ? 3.842   -2.907  -3.679  1.00 0.00 ? 16  SER A OG   10 
ATOM   5990  H  H    . SER A 1 16 ? 2.092   -0.822  -0.782  1.00 0.00 ? 16  SER A H    10 
ATOM   5991  H  HA   . SER A 1 16 ? 3.218   -3.453  -1.222  1.00 0.00 ? 16  SER A HA   10 
ATOM   5992  H  HB2  . SER A 1 16 ? 2.104   -2.063  -3.027  1.00 0.00 ? 16  SER A HB2  10 
ATOM   5993  H  HB3  . SER A 1 16 ? 3.523   -1.015  -2.983  1.00 0.00 ? 16  SER A HB3  10 
ATOM   5994  H  HG   . SER A 1 16 ? 3.908   -3.771  -3.267  1.00 0.00 ? 16  SER A HG   10 
ATOM   5995  N  N    . GLU A 1 17 ? 5.013   -1.572  0.261   1.00 0.00 ? 17  GLU A N    10 
ATOM   5996  C  CA   . GLU A 1 17 ? 6.341   -1.232  0.758   1.00 0.00 ? 17  GLU A CA   10 
ATOM   5997  C  C    . GLU A 1 17 ? 6.721   -2.114  1.944   1.00 0.00 ? 17  GLU A C    10 
ATOM   5998  O  O    . GLU A 1 17 ? 7.690   -2.871  1.883   1.00 0.00 ? 17  GLU A O    10 
ATOM   5999  C  CB   . GLU A 1 17 ? 6.395   0.242   1.167   1.00 0.00 ? 17  GLU A CB   10 
ATOM   6000  C  CG   . GLU A 1 17 ? 6.023   1.198   0.046   1.00 0.00 ? 17  GLU A CG   10 
ATOM   6001  C  CD   . GLU A 1 17 ? 4.527   1.428   -0.053  1.00 0.00 ? 17  GLU A CD   10 
ATOM   6002  O  OE1  . GLU A 1 17 ? 3.818   0.522   -0.538  1.00 0.00 ? 17  GLU A OE1  10 
ATOM   6003  O  OE2  . GLU A 1 17 ? 4.066   2.514   0.356   1.00 0.00 ? 17  GLU A OE2  10 
ATOM   6004  H  H    . GLU A 1 17 ? 4.234   -1.418  0.835   1.00 0.00 ? 17  GLU A H    10 
ATOM   6005  H  HA   . GLU A 1 17 ? 7.047   -1.400  -0.041  1.00 0.00 ? 17  GLU A HA   10 
ATOM   6006  H  HB2  . GLU A 1 17 ? 5.713   0.400   1.989   1.00 0.00 ? 17  GLU A HB2  10 
ATOM   6007  H  HB3  . GLU A 1 17 ? 7.397   0.476   1.493   1.00 0.00 ? 17  GLU A HB3  10 
ATOM   6008  H  HG2  . GLU A 1 17 ? 6.506   2.147   0.225   1.00 0.00 ? 17  GLU A HG2  10 
ATOM   6009  H  HG3  . GLU A 1 17 ? 6.372   0.788   -0.890  1.00 0.00 ? 17  GLU A HG3  10 
ATOM   6010  N  N    . CYS A 1 18 ? 5.951   -2.010  3.022   1.00 0.00 ? 18  CYS A N    10 
ATOM   6011  C  CA   . CYS A 1 18 ? 6.206   -2.796  4.223   1.00 0.00 ? 18  CYS A CA   10 
ATOM   6012  C  C    . CYS A 1 18 ? 5.247   -3.979  4.312   1.00 0.00 ? 18  CYS A C    10 
ATOM   6013  O  O    . CYS A 1 18 ? 5.666   -5.118  4.513   1.00 0.00 ? 18  CYS A O    10 
ATOM   6014  C  CB   . CYS A 1 18 ? 6.070   -1.920  5.470   1.00 0.00 ? 18  CYS A CB   10 
ATOM   6015  S  SG   . CYS A 1 18 ? 4.499   -1.002  5.565   1.00 0.00 ? 18  CYS A SG   10 
ATOM   6016  H  H    . CYS A 1 18 ? 5.193   -1.388  3.010   1.00 0.00 ? 18  CYS A H    10 
ATOM   6017  H  HA   . CYS A 1 18 ? 7.217   -3.171  4.166   1.00 0.00 ? 18  CYS A HA   10 
ATOM   6018  H  HB2  . CYS A 1 18 ? 6.138   -2.545  6.348   1.00 0.00 ? 18  CYS A HB2  10 
ATOM   6019  H  HB3  . CYS A 1 18 ? 6.874   -1.199  5.483   1.00 0.00 ? 18  CYS A HB3  10 
ATOM   6020  N  N    . GLY A 1 19 ? 3.956   -3.700  4.160   1.00 0.00 ? 19  GLY A N    10 
ATOM   6021  C  CA   . GLY A 1 19 ? 2.957   -4.751  4.226   1.00 0.00 ? 19  GLY A CA   10 
ATOM   6022  C  C    . GLY A 1 19 ? 1.903   -4.484  5.283   1.00 0.00 ? 19  GLY A C    10 
ATOM   6023  O  O    . GLY A 1 19 ? 1.508   -5.387  6.020   1.00 0.00 ? 19  GLY A O    10 
ATOM   6024  H  H    . GLY A 1 19 ? 3.679   -2.773  4.002   1.00 0.00 ? 19  GLY A H    10 
ATOM   6025  H  HA2  . GLY A 1 19 ? 2.474   -4.835  3.264   1.00 0.00 ? 19  GLY A HA2  10 
ATOM   6026  H  HA3  . GLY A 1 19 ? 3.449   -5.685  4.454   1.00 0.00 ? 19  GLY A HA3  10 
ATOM   6027  N  N    . LYS A 1 20 ? 1.446   -3.238  5.358   1.00 0.00 ? 20  LYS A N    10 
ATOM   6028  C  CA   . LYS A 1 20 ? 0.432   -2.852  6.332   1.00 0.00 ? 20  LYS A CA   10 
ATOM   6029  C  C    . LYS A 1 20 ? -0.911  -2.610  5.652   1.00 0.00 ? 20  LYS A C    10 
ATOM   6030  O  O    . LYS A 1 20 ? -0.999  -1.863  4.677   1.00 0.00 ? 20  LYS A O    10 
ATOM   6031  C  CB   . LYS A 1 20 ? 0.870   -1.593  7.083   1.00 0.00 ? 20  LYS A CB   10 
ATOM   6032  C  CG   . LYS A 1 20 ? 0.151   -1.393  8.407   1.00 0.00 ? 20  LYS A CG   10 
ATOM   6033  C  CD   . LYS A 1 20 ? 0.691   -0.188  9.158   1.00 0.00 ? 20  LYS A CD   10 
ATOM   6034  C  CE   . LYS A 1 20 ? -0.326  0.349   10.154  1.00 0.00 ? 20  LYS A CE   10 
ATOM   6035  N  NZ   . LYS A 1 20 ? -0.222  -0.332  11.474  1.00 0.00 ? 20  LYS A NZ   10 
ATOM   6036  H  H    . LYS A 1 20 ? 1.800   -2.561  4.743   1.00 0.00 ? 20  LYS A H    10 
ATOM   6037  H  HA   . LYS A 1 20 ? 0.324   -3.662  7.037   1.00 0.00 ? 20  LYS A HA   10 
ATOM   6038  H  HB2  . LYS A 1 20 ? 1.930   -1.655  7.279   1.00 0.00 ? 20  LYS A HB2  10 
ATOM   6039  H  HB3  . LYS A 1 20 ? 0.677   -0.731  6.460   1.00 0.00 ? 20  LYS A HB3  10 
ATOM   6040  H  HG2  . LYS A 1 20 ? -0.901  -1.244  8.216   1.00 0.00 ? 20  LYS A HG2  10 
ATOM   6041  H  HG3  . LYS A 1 20 ? 0.287   -2.276  9.016   1.00 0.00 ? 20  LYS A HG3  10 
ATOM   6042  H  HD2  . LYS A 1 20 ? 1.583   -0.478  9.693   1.00 0.00 ? 20  LYS A HD2  10 
ATOM   6043  H  HD3  . LYS A 1 20 ? 0.932   0.590   8.447   1.00 0.00 ? 20  LYS A HD3  10 
ATOM   6044  H  HE2  . LYS A 1 20 ? -0.154  1.406   10.289  1.00 0.00 ? 20  LYS A HE2  10 
ATOM   6045  H  HE3  . LYS A 1 20 ? -1.317  0.194   9.755   1.00 0.00 ? 20  LYS A HE3  10 
ATOM   6046  H  HZ1  . LYS A 1 20 ? -0.955  0.025   12.119  1.00 0.00 ? 20  LYS A HZ1  10 
ATOM   6047  H  HZ2  . LYS A 1 20 ? 0.712   -0.154  11.895  1.00 0.00 ? 20  LYS A HZ2  10 
ATOM   6048  H  HZ3  . LYS A 1 20 ? -0.347  -1.358  11.358  1.00 0.00 ? 20  LYS A HZ3  10 
ATOM   6049  N  N    . VAL A 1 21 ? -1.956  -3.246  6.172   1.00 0.00 ? 21  VAL A N    10 
ATOM   6050  C  CA   . VAL A 1 21 ? -3.296  -3.097  5.617   1.00 0.00 ? 21  VAL A CA   10 
ATOM   6051  C  C    . VAL A 1 21 ? -4.052  -1.963  6.300   1.00 0.00 ? 21  VAL A C    10 
ATOM   6052  O  O    . VAL A 1 21 ? -3.887  -1.725  7.496   1.00 0.00 ? 21  VAL A O    10 
ATOM   6053  C  CB   . VAL A 1 21 ? -4.109  -4.398  5.756   1.00 0.00 ? 21  VAL A CB   10 
ATOM   6054  C  CG1  . VAL A 1 21 ? -4.384  -4.702  7.221   1.00 0.00 ? 21  VAL A CG1  10 
ATOM   6055  C  CG2  . VAL A 1 21 ? -5.408  -4.301  4.971   1.00 0.00 ? 21  VAL A CG2  10 
ATOM   6056  H  H    . VAL A 1 21 ? -1.823  -3.828  6.949   1.00 0.00 ? 21  VAL A H    10 
ATOM   6057  H  HA   . VAL A 1 21 ? -3.198  -2.870  4.565   1.00 0.00 ? 21  VAL A HA   10 
ATOM   6058  H  HB   . VAL A 1 21 ? -3.525  -5.209  5.346   1.00 0.00 ? 21  VAL A HB   10 
ATOM   6059  H  HG11 . VAL A 1 21 ? -4.705  -5.728  7.321   1.00 0.00 ? 21  VAL A HG11 10 
ATOM   6060  H  HG12 . VAL A 1 21 ? -3.483  -4.548  7.796   1.00 0.00 ? 21  VAL A HG12 10 
ATOM   6061  H  HG13 . VAL A 1 21 ? -5.160  -4.045  7.585   1.00 0.00 ? 21  VAL A HG13 10 
ATOM   6062  H  HG21 . VAL A 1 21 ? -5.271  -4.734  3.991   1.00 0.00 ? 21  VAL A HG21 10 
ATOM   6063  H  HG22 . VAL A 1 21 ? -6.186  -4.835  5.495   1.00 0.00 ? 21  VAL A HG22 10 
ATOM   6064  H  HG23 . VAL A 1 21 ? -5.691  -3.263  4.868   1.00 0.00 ? 21  VAL A HG23 10 
ATOM   6065  N  N    . PHE A 1 22 ? -4.882  -1.266  5.532   1.00 0.00 ? 22  PHE A N    10 
ATOM   6066  C  CA   . PHE A 1 22 ? -5.664  -0.155  6.062   1.00 0.00 ? 22  PHE A CA   10 
ATOM   6067  C  C    . PHE A 1 22 ? -7.132  -0.285  5.666   1.00 0.00 ? 22  PHE A C    10 
ATOM   6068  O  O    . PHE A 1 22 ? -7.453  -0.724  4.562   1.00 0.00 ? 22  PHE A O    10 
ATOM   6069  C  CB   . PHE A 1 22 ? -5.104  1.177   5.559   1.00 0.00 ? 22  PHE A CB   10 
ATOM   6070  C  CG   . PHE A 1 22 ? -3.690  1.436   5.994   1.00 0.00 ? 22  PHE A CG   10 
ATOM   6071  C  CD1  . PHE A 1 22 ? -2.628  0.846   5.328   1.00 0.00 ? 22  PHE A CD1  10 
ATOM   6072  C  CD2  . PHE A 1 22 ? -3.423  2.269   7.068   1.00 0.00 ? 22  PHE A CD2  10 
ATOM   6073  C  CE1  . PHE A 1 22 ? -1.326  1.082   5.726   1.00 0.00 ? 22  PHE A CE1  10 
ATOM   6074  C  CE2  . PHE A 1 22 ? -2.123  2.509   7.471   1.00 0.00 ? 22  PHE A CE2  10 
ATOM   6075  C  CZ   . PHE A 1 22 ? -1.073  1.915   6.798   1.00 0.00 ? 22  PHE A CZ   10 
ATOM   6076  H  H    . PHE A 1 22 ? -4.971  -1.503  4.585   1.00 0.00 ? 22  PHE A H    10 
ATOM   6077  H  HA   . PHE A 1 22 ? -5.590  -0.183  7.138   1.00 0.00 ? 22  PHE A HA   10 
ATOM   6078  H  HB2  . PHE A 1 22 ? -5.125  1.183   4.479   1.00 0.00 ? 22  PHE A HB2  10 
ATOM   6079  H  HB3  . PHE A 1 22 ? -5.720  1.982   5.931   1.00 0.00 ? 22  PHE A HB3  10 
ATOM   6080  H  HD1  . PHE A 1 22 ? -2.824  0.195   4.488   1.00 0.00 ? 22  PHE A HD1  10 
ATOM   6081  H  HD2  . PHE A 1 22 ? -4.245  2.735   7.595   1.00 0.00 ? 22  PHE A HD2  10 
ATOM   6082  H  HE1  . PHE A 1 22 ? -0.506  0.617   5.199   1.00 0.00 ? 22  PHE A HE1  10 
ATOM   6083  H  HE2  . PHE A 1 22 ? -1.929  3.161   8.309   1.00 0.00 ? 22  PHE A HE2  10 
ATOM   6084  H  HZ   . PHE A 1 22 ? -0.056  2.101   7.112   1.00 0.00 ? 22  PHE A HZ   10 
ATOM   6085  N  N    . THR A 1 23 ? -8.021  0.100   6.577   1.00 0.00 ? 23  THR A N    10 
ATOM   6086  C  CA   . THR A 1 23 ? -9.454  0.025   6.325   1.00 0.00 ? 23  THR A CA   10 
ATOM   6087  C  C    . THR A 1 23 ? -9.940  1.243   5.547   1.00 0.00 ? 23  THR A C    10 
ATOM   6088  O  O    . THR A 1 23 ? -11.141 1.507   5.473   1.00 0.00 ? 23  THR A O    10 
ATOM   6089  C  CB   . THR A 1 23 ? -10.251 -0.081  7.639   1.00 0.00 ? 23  THR A CB   10 
ATOM   6090  O  OG1  . THR A 1 23 ? -9.532  -0.882  8.584   1.00 0.00 ? 23  THR A OG1  10 
ATOM   6091  C  CG2  . THR A 1 23 ? -11.624 -0.688  7.392   1.00 0.00 ? 23  THR A CG2  10 
ATOM   6092  H  H    . THR A 1 23 ? -7.703  0.441   7.439   1.00 0.00 ? 23  THR A H    10 
ATOM   6093  H  HA   . THR A 1 23 ? -9.645  -0.863  5.740   1.00 0.00 ? 23  THR A HA   10 
ATOM   6094  H  HB   . THR A 1 23 ? -10.380 0.912   8.046   1.00 0.00 ? 23  THR A HB   10 
ATOM   6095  H  HG1  . THR A 1 23 ? -9.411  -1.766  8.228   1.00 0.00 ? 23  THR A HG1  10 
ATOM   6096  H  HG21 . THR A 1 23 ? -11.636 -1.707  7.750   1.00 0.00 ? 23  THR A HG21 10 
ATOM   6097  H  HG22 . THR A 1 23 ? -11.838 -0.676  6.334   1.00 0.00 ? 23  THR A HG22 10 
ATOM   6098  H  HG23 . THR A 1 23 ? -12.371 -0.113  7.918   1.00 0.00 ? 23  THR A HG23 10 
ATOM   6099  N  N    . HIS A 1 24 ? -9.000  1.982   4.967   1.00 0.00 ? 24  HIS A N    10 
ATOM   6100  C  CA   . HIS A 1 24 ? -9.333  3.173   4.193   1.00 0.00 ? 24  HIS A CA   10 
ATOM   6101  C  C    . HIS A 1 24 ? -8.224  3.502   3.198   1.00 0.00 ? 24  HIS A C    10 
ATOM   6102  O  O    . HIS A 1 24 ? -7.059  3.641   3.574   1.00 0.00 ? 24  HIS A O    10 
ATOM   6103  C  CB   . HIS A 1 24 ? -9.570  4.363   5.123   1.00 0.00 ? 24  HIS A CB   10 
ATOM   6104  C  CG   . HIS A 1 24 ? -10.555 5.355   4.587   1.00 0.00 ? 24  HIS A CG   10 
ATOM   6105  N  ND1  . HIS A 1 24 ? -10.187 6.448   3.831   1.00 0.00 ? 24  HIS A ND1  10 
ATOM   6106  C  CD2  . HIS A 1 24 ? -11.903 5.414   4.700   1.00 0.00 ? 24  HIS A CD2  10 
ATOM   6107  C  CE1  . HIS A 1 24 ? -11.266 7.137   3.504   1.00 0.00 ? 24  HIS A CE1  10 
ATOM   6108  N  NE2  . HIS A 1 24 ? -12.320 6.531   4.019   1.00 0.00 ? 24  HIS A NE2  10 
ATOM   6109  H  H    . HIS A 1 24 ? -8.060  1.721   5.062   1.00 0.00 ? 24  HIS A H    10 
ATOM   6110  H  HA   . HIS A 1 24 ? -10.241 2.969   3.645   1.00 0.00 ? 24  HIS A HA   10 
ATOM   6111  H  HB2  . HIS A 1 24 ? -9.945  4.002   6.070   1.00 0.00 ? 24  HIS A HB2  10 
ATOM   6112  H  HB3  . HIS A 1 24 ? -8.634  4.877   5.284   1.00 0.00 ? 24  HIS A HB3  10 
ATOM   6113  H  HD1  . HIS A 1 24 ? -9.272  6.684   3.574   1.00 0.00 ? 24  HIS A HD1  10 
ATOM   6114  H  HD2  . HIS A 1 24 ? -12.534 4.714   5.230   1.00 0.00 ? 24  HIS A HD2  10 
ATOM   6115  H  HE1  . HIS A 1 24 ? -11.283 8.042   2.915   1.00 0.00 ? 24  HIS A HE1  10 
ATOM   6116  N  N    . LYS A 1 25 ? -8.592  3.625   1.928   1.00 0.00 ? 25  LYS A N    10 
ATOM   6117  C  CA   . LYS A 1 25 ? -7.629  3.938   0.878   1.00 0.00 ? 25  LYS A CA   10 
ATOM   6118  C  C    . LYS A 1 25 ? -6.818  5.180   1.237   1.00 0.00 ? 25  LYS A C    10 
ATOM   6119  O  O    . LYS A 1 25 ? -5.639  5.284   0.897   1.00 0.00 ? 25  LYS A O    10 
ATOM   6120  C  CB   . LYS A 1 25 ? -8.349  4.153   -0.455  1.00 0.00 ? 25  LYS A CB   10 
ATOM   6121  C  CG   . LYS A 1 25 ? -9.287  5.348   -0.454  1.00 0.00 ? 25  LYS A CG   10 
ATOM   6122  C  CD   . LYS A 1 25 ? -10.666 4.973   0.063   1.00 0.00 ? 25  LYS A CD   10 
ATOM   6123  C  CE   . LYS A 1 25 ? -11.721 5.969   -0.393  1.00 0.00 ? 25  LYS A CE   10 
ATOM   6124  N  NZ   . LYS A 1 25 ? -11.507 7.316   0.203   1.00 0.00 ? 25  LYS A NZ   10 
ATOM   6125  H  H    . LYS A 1 25 ? -9.535  3.503   1.690   1.00 0.00 ? 25  LYS A H    10 
ATOM   6126  H  HA   . LYS A 1 25 ? -6.957  3.099   0.784   1.00 0.00 ? 25  LYS A HA   10 
ATOM   6127  H  HB2  . LYS A 1 25 ? -7.610  4.303   -1.229  1.00 0.00 ? 25  LYS A HB2  10 
ATOM   6128  H  HB3  . LYS A 1 25 ? -8.925  3.269   -0.686  1.00 0.00 ? 25  LYS A HB3  10 
ATOM   6129  H  HG2  . LYS A 1 25 ? -8.874  6.118   0.181   1.00 0.00 ? 25  LYS A HG2  10 
ATOM   6130  H  HG3  . LYS A 1 25 ? -9.380  5.722   -1.464  1.00 0.00 ? 25  LYS A HG3  10 
ATOM   6131  H  HD2  . LYS A 1 25 ? -10.927 3.994   -0.310  1.00 0.00 ? 25  LYS A HD2  10 
ATOM   6132  H  HD3  . LYS A 1 25 ? -10.643 4.954   1.143   1.00 0.00 ? 25  LYS A HD3  10 
ATOM   6133  H  HE2  . LYS A 1 25 ? -11.681 6.050   -1.468  1.00 0.00 ? 25  LYS A HE2  10 
ATOM   6134  H  HE3  . LYS A 1 25 ? -12.694 5.604   -0.096  1.00 0.00 ? 25  LYS A HE3  10 
ATOM   6135  H  HZ1  . LYS A 1 25 ? -10.491 7.486   0.348   1.00 0.00 ? 25  LYS A HZ1  10 
ATOM   6136  H  HZ2  . LYS A 1 25 ? -11.993 7.382   1.121   1.00 0.00 ? 25  LYS A HZ2  10 
ATOM   6137  H  HZ3  . LYS A 1 25 ? -11.883 8.051   -0.429  1.00 0.00 ? 25  LYS A HZ3  10 
ATOM   6138  N  N    . THR A 1 26 ? -7.457  6.119   1.927   1.00 0.00 ? 26  THR A N    10 
ATOM   6139  C  CA   . THR A 1 26 ? -6.796  7.353   2.332   1.00 0.00 ? 26  THR A CA   10 
ATOM   6140  C  C    . THR A 1 26 ? -5.748  7.088   3.407   1.00 0.00 ? 26  THR A C    10 
ATOM   6141  O  O    . THR A 1 26 ? -4.623  7.579   3.325   1.00 0.00 ? 26  THR A O    10 
ATOM   6142  C  CB   . THR A 1 26 ? -7.809  8.386   2.861   1.00 0.00 ? 26  THR A CB   10 
ATOM   6143  O  OG1  . THR A 1 26 ? -8.994  8.365   2.059   1.00 0.00 ? 26  THR A OG1  10 
ATOM   6144  C  CG2  . THR A 1 26 ? -7.210  9.784   2.854   1.00 0.00 ? 26  THR A CG2  10 
ATOM   6145  H  H    . THR A 1 26 ? -8.397  5.978   2.169   1.00 0.00 ? 26  THR A H    10 
ATOM   6146  H  HA   . THR A 1 26 ? -6.308  7.771   1.463   1.00 0.00 ? 26  THR A HA   10 
ATOM   6147  H  HB   . THR A 1 26 ? -8.067  8.126   3.878   1.00 0.00 ? 26  THR A HB   10 
ATOM   6148  H  HG1  . THR A 1 26 ? -9.316  9.262   1.939   1.00 0.00 ? 26  THR A HG1  10 
ATOM   6149  H  HG21 . THR A 1 26 ? -7.684  10.383  3.618   1.00 0.00 ? 26  THR A HG21 10 
ATOM   6150  H  HG22 . THR A 1 26 ? -7.371  10.240  1.888   1.00 0.00 ? 26  THR A HG22 10 
ATOM   6151  H  HG23 . THR A 1 26 ? -6.150  9.723   3.051   1.00 0.00 ? 26  THR A HG23 10 
ATOM   6152  N  N    . ASN A 1 27 ? -6.126  6.309   4.415   1.00 0.00 ? 27  ASN A N    10 
ATOM   6153  C  CA   . ASN A 1 27 ? -5.218  5.978   5.508   1.00 0.00 ? 27  ASN A CA   10 
ATOM   6154  C  C    . ASN A 1 27 ? -3.949  5.316   4.979   1.00 0.00 ? 27  ASN A C    10 
ATOM   6155  O  O    . ASN A 1 27 ? -2.849  5.581   5.465   1.00 0.00 ? 27  ASN A O    10 
ATOM   6156  C  CB   . ASN A 1 27 ? -5.909  5.053   6.511   1.00 0.00 ? 27  ASN A CB   10 
ATOM   6157  C  CG   . ASN A 1 27 ? -6.633  5.820   7.601   1.00 0.00 ? 27  ASN A CG   10 
ATOM   6158  O  OD1  . ASN A 1 27 ? -6.041  6.650   8.289   1.00 0.00 ? 27  ASN A OD1  10 
ATOM   6159  N  ND2  . ASN A 1 27 ? -7.922  5.543   7.762   1.00 0.00 ? 27  ASN A ND2  10 
ATOM   6160  H  H    . ASN A 1 27 ? -7.037  5.947   4.425   1.00 0.00 ? 27  ASN A H    10 
ATOM   6161  H  HA   . ASN A 1 27 ? -4.950  6.898   6.005   1.00 0.00 ? 27  ASN A HA   10 
ATOM   6162  H  HB2  . ASN A 1 27 ? -6.630  4.440   5.989   1.00 0.00 ? 27  ASN A HB2  10 
ATOM   6163  H  HB3  . ASN A 1 27 ? -5.170  4.417   6.974   1.00 0.00 ? 27  ASN A HB3  10 
ATOM   6164  H  HD21 . ASN A 1 27 ? -8.328  4.869   7.177   1.00 0.00 ? 27  ASN A HD21 10 
ATOM   6165  H  HD22 . ASN A 1 27 ? -8.415  6.024   8.459   1.00 0.00 ? 27  ASN A HD22 10 
ATOM   6166  N  N    . LEU A 1 28 ? -4.110  4.455   3.981   1.00 0.00 ? 28  LEU A N    10 
ATOM   6167  C  CA   . LEU A 1 28 ? -2.977  3.754   3.385   1.00 0.00 ? 28  LEU A CA   10 
ATOM   6168  C  C    . LEU A 1 28 ? -2.026  4.735   2.707   1.00 0.00 ? 28  LEU A C    10 
ATOM   6169  O  O    . LEU A 1 28 ? -0.823  4.729   2.968   1.00 0.00 ? 28  LEU A O    10 
ATOM   6170  C  CB   . LEU A 1 28 ? -3.469  2.720   2.371   1.00 0.00 ? 28  LEU A CB   10 
ATOM   6171  C  CG   . LEU A 1 28 ? -2.451  2.273   1.321   1.00 0.00 ? 28  LEU A CG   10 
ATOM   6172  C  CD1  . LEU A 1 28 ? -1.282  1.558   1.980   1.00 0.00 ? 28  LEU A CD1  10 
ATOM   6173  C  CD2  . LEU A 1 28 ? -3.112  1.375   0.285   1.00 0.00 ? 28  LEU A CD2  10 
ATOM   6174  H  H    . LEU A 1 28 ? -5.011  4.284   3.636   1.00 0.00 ? 28  LEU A H    10 
ATOM   6175  H  HA   . LEU A 1 28 ? -2.447  3.247   4.177   1.00 0.00 ? 28  LEU A HA   10 
ATOM   6176  H  HB2  . LEU A 1 28 ? -3.784  1.845   2.918   1.00 0.00 ? 28  LEU A HB2  10 
ATOM   6177  H  HB3  . LEU A 1 28 ? -4.317  3.143   1.852   1.00 0.00 ? 28  LEU A HB3  10 
ATOM   6178  H  HG   . LEU A 1 28 ? -2.064  3.144   0.811   1.00 0.00 ? 28  LEU A HG   10 
ATOM   6179  H  HD11 . LEU A 1 28 ? -0.948  0.752   1.344   1.00 0.00 ? 28  LEU A HD11 10 
ATOM   6180  H  HD12 . LEU A 1 28 ? -1.596  1.158   2.933   1.00 0.00 ? 28  LEU A HD12 10 
ATOM   6181  H  HD13 . LEU A 1 28 ? -0.473  2.257   2.133   1.00 0.00 ? 28  LEU A HD13 10 
ATOM   6182  H  HD21 . LEU A 1 28 ? -3.826  0.728   0.773   1.00 0.00 ? 28  LEU A HD21 10 
ATOM   6183  H  HD22 . LEU A 1 28 ? -2.359  0.777   -0.206  1.00 0.00 ? 28  LEU A HD22 10 
ATOM   6184  H  HD23 . LEU A 1 28 ? -3.621  1.985   -0.448  1.00 0.00 ? 28  LEU A HD23 10 
ATOM   6185  N  N    . ILE A 1 29 ? -2.574  5.578   1.838   1.00 0.00 ? 29  ILE A N    10 
ATOM   6186  C  CA   . ILE A 1 29 ? -1.775  6.567   1.125   1.00 0.00 ? 29  ILE A CA   10 
ATOM   6187  C  C    . ILE A 1 29 ? -0.992  7.443   2.097   1.00 0.00 ? 29  ILE A C    10 
ATOM   6188  O  O    . ILE A 1 29 ? 0.211   7.650   1.931   1.00 0.00 ? 29  ILE A O    10 
ATOM   6189  C  CB   . ILE A 1 29 ? -2.653  7.465   0.235   1.00 0.00 ? 29  ILE A CB   10 
ATOM   6190  C  CG1  . ILE A 1 29 ? -3.394  6.622   -0.805  1.00 0.00 ? 29  ILE A CG1  10 
ATOM   6191  C  CG2  . ILE A 1 29 ? -1.805  8.529   -0.446  1.00 0.00 ? 29  ILE A CG2  10 
ATOM   6192  C  CD1  . ILE A 1 29 ? -4.532  7.356   -1.479  1.00 0.00 ? 29  ILE A CD1  10 
ATOM   6193  H  H    . ILE A 1 29 ? -3.539  5.534   1.672   1.00 0.00 ? 29  ILE A H    10 
ATOM   6194  H  HA   . ILE A 1 29 ? -1.077  6.038   0.492   1.00 0.00 ? 29  ILE A HA   10 
ATOM   6195  H  HB   . ILE A 1 29 ? -3.375  7.963   0.864   1.00 0.00 ? 29  ILE A HB   10 
ATOM   6196  H  HG12 . ILE A 1 29 ? -2.700  6.313   -1.570  1.00 0.00 ? 29  ILE A HG12 10 
ATOM   6197  H  HG13 . ILE A 1 29 ? -3.803  5.746   -0.321  1.00 0.00 ? 29  ILE A HG13 10 
ATOM   6198  H  HG21 . ILE A 1 29 ? -1.220  8.074   -1.232  1.00 0.00 ? 29  ILE A HG21 10 
ATOM   6199  H  HG22 . ILE A 1 29 ? -2.448  9.286   -0.869  1.00 0.00 ? 29  ILE A HG22 10 
ATOM   6200  H  HG23 . ILE A 1 29 ? -1.144  8.981   0.279   1.00 0.00 ? 29  ILE A HG23 10 
ATOM   6201  H  HD11 . ILE A 1 29 ? -5.442  6.781   -1.376  1.00 0.00 ? 29  ILE A HD11 10 
ATOM   6202  H  HD12 . ILE A 1 29 ? -4.664  8.321   -1.013  1.00 0.00 ? 29  ILE A HD12 10 
ATOM   6203  H  HD13 . ILE A 1 29 ? -4.307  7.487   -2.526  1.00 0.00 ? 29  ILE A HD13 10 
ATOM   6204  N  N    . ILE A 1 30 ? -1.681  7.955   3.111   1.00 0.00 ? 30  ILE A N    10 
ATOM   6205  C  CA   . ILE A 1 30 ? -1.049  8.807   4.110   1.00 0.00 ? 30  ILE A CA   10 
ATOM   6206  C  C    . ILE A 1 30 ? 0.107   8.087   4.795   1.00 0.00 ? 30  ILE A C    10 
ATOM   6207  O  O    . ILE A 1 30 ? 1.105   8.705   5.168   1.00 0.00 ? 30  ILE A O    10 
ATOM   6208  C  CB   . ILE A 1 30 ? -2.059  9.265   5.180   1.00 0.00 ? 30  ILE A CB   10 
ATOM   6209  C  CG1  . ILE A 1 30 ? -3.193  10.063  4.533   1.00 0.00 ? 30  ILE A CG1  10 
ATOM   6210  C  CG2  . ILE A 1 30 ? -1.361  10.095  6.246   1.00 0.00 ? 30  ILE A CG2  10 
ATOM   6211  C  CD1  . ILE A 1 30 ? -4.381  10.272  5.445   1.00 0.00 ? 30  ILE A CD1  10 
ATOM   6212  H  H    . ILE A 1 30 ? -2.637  7.755   3.189   1.00 0.00 ? 30  ILE A H    10 
ATOM   6213  H  HA   . ILE A 1 30 ? -0.666  9.684   3.607   1.00 0.00 ? 30  ILE A HA   10 
ATOM   6214  H  HB   . ILE A 1 30 ? -2.471  8.387   5.653   1.00 0.00 ? 30  ILE A HB   10 
ATOM   6215  H  HG12 . ILE A 1 30 ? -2.823  11.034  4.244   1.00 0.00 ? 30  ILE A HG12 10 
ATOM   6216  H  HG13 . ILE A 1 30 ? -3.537  9.537   3.654   1.00 0.00 ? 30  ILE A HG13 10 
ATOM   6217  H  HG21 . ILE A 1 30 ? -1.201  11.097  5.875   1.00 0.00 ? 30  ILE A HG21 10 
ATOM   6218  H  HG22 . ILE A 1 30 ? -1.977  10.134  7.132   1.00 0.00 ? 30  ILE A HG22 10 
ATOM   6219  H  HG23 . ILE A 1 30 ? -0.410  9.645   6.488   1.00 0.00 ? 30  ILE A HG23 10 
ATOM   6220  H  HD11 . ILE A 1 30 ? -4.514  11.329  5.627   1.00 0.00 ? 30  ILE A HD11 10 
ATOM   6221  H  HD12 . ILE A 1 30 ? -5.270  9.875   4.976   1.00 0.00 ? 30  ILE A HD12 10 
ATOM   6222  H  HD13 . ILE A 1 30 ? -4.210  9.764   6.382   1.00 0.00 ? 30  ILE A HD13 10 
ATOM   6223  N  N    . HIS A 1 31 ? -0.032  6.775   4.956   1.00 0.00 ? 31  HIS A N    10 
ATOM   6224  C  CA   . HIS A 1 31 ? 1.003   5.968   5.594   1.00 0.00 ? 31  HIS A CA   10 
ATOM   6225  C  C    . HIS A 1 31 ? 2.234   5.859   4.700   1.00 0.00 ? 31  HIS A C    10 
ATOM   6226  O  O    . HIS A 1 31 ? 3.350   6.152   5.128   1.00 0.00 ? 31  HIS A O    10 
ATOM   6227  C  CB   . HIS A 1 31 ? 0.466   4.573   5.915   1.00 0.00 ? 31  HIS A CB   10 
ATOM   6228  C  CG   . HIS A 1 31 ? 1.528   3.517   5.953   1.00 0.00 ? 31  HIS A CG   10 
ATOM   6229  N  ND1  . HIS A 1 31 ? 2.072   3.040   7.126   1.00 0.00 ? 31  HIS A ND1  10 
ATOM   6230  C  CD2  . HIS A 1 31 ? 2.144   2.845   4.953   1.00 0.00 ? 31  HIS A CD2  10 
ATOM   6231  C  CE1  . HIS A 1 31 ? 2.979   2.121   6.847   1.00 0.00 ? 31  HIS A CE1  10 
ATOM   6232  N  NE2  . HIS A 1 31 ? 3.041   1.983   5.534   1.00 0.00 ? 31  HIS A NE2  10 
ATOM   6233  H  H    . HIS A 1 31 ? -0.850  6.339   4.638   1.00 0.00 ? 31  HIS A H    10 
ATOM   6234  H  HA   . HIS A 1 31 ? 1.283   6.457   6.514   1.00 0.00 ? 31  HIS A HA   10 
ATOM   6235  H  HB2  . HIS A 1 31 ? -0.016  4.594   6.881   1.00 0.00 ? 31  HIS A HB2  10 
ATOM   6236  H  HB3  . HIS A 1 31 ? -0.257  4.291   5.163   1.00 0.00 ? 31  HIS A HB3  10 
ATOM   6237  H  HD1  . HIS A 1 31 ? 1.831   3.332   8.030   1.00 0.00 ? 31  HIS A HD1  10 
ATOM   6238  H  HD2  . HIS A 1 31 ? 1.965   2.964   3.893   1.00 0.00 ? 31  HIS A HD2  10 
ATOM   6239  H  HE1  . HIS A 1 31 ? 3.568   1.574   7.567   1.00 0.00 ? 31  HIS A HE1  10 
ATOM   6240  N  N    . GLN A 1 32 ? 2.023   5.436   3.458   1.00 0.00 ? 32  GLN A N    10 
ATOM   6241  C  CA   . GLN A 1 32 ? 3.117   5.287   2.505   1.00 0.00 ? 32  GLN A CA   10 
ATOM   6242  C  C    . GLN A 1 32 ? 4.099   6.449   2.619   1.00 0.00 ? 32  GLN A C    10 
ATOM   6243  O  O    . GLN A 1 32 ? 5.273   6.319   2.271   1.00 0.00 ? 32  GLN A O    10 
ATOM   6244  C  CB   . GLN A 1 32 ? 2.571   5.203   1.079   1.00 0.00 ? 32  GLN A CB   10 
ATOM   6245  C  CG   . GLN A 1 32 ? 1.671   4.001   0.842   1.00 0.00 ? 32  GLN A CG   10 
ATOM   6246  C  CD   . GLN A 1 32 ? 1.523   3.664   -0.629  1.00 0.00 ? 32  GLN A CD   10 
ATOM   6247  O  OE1  . GLN A 1 32 ? 2.498   3.673   -1.381  1.00 0.00 ? 32  GLN A OE1  10 
ATOM   6248  N  NE2  . GLN A 1 32 ? 0.299   3.362   -1.047  1.00 0.00 ? 32  GLN A NE2  10 
ATOM   6249  H  H    . GLN A 1 32 ? 1.110   5.218   3.176   1.00 0.00 ? 32  GLN A H    10 
ATOM   6250  H  HA   . GLN A 1 32 ? 3.635   4.370   2.737   1.00 0.00 ? 32  GLN A HA   10 
ATOM   6251  H  HB2  . GLN A 1 32 ? 2.003   6.098   0.870   1.00 0.00 ? 32  GLN A HB2  10 
ATOM   6252  H  HB3  . GLN A 1 32 ? 3.401   5.144   0.391   1.00 0.00 ? 32  GLN A HB3  10 
ATOM   6253  H  HG2  . GLN A 1 32 ? 2.091   3.147   1.350   1.00 0.00 ? 32  GLN A HG2  10 
ATOM   6254  H  HG3  . GLN A 1 32 ? 0.693   4.215   1.247   1.00 0.00 ? 32  GLN A HG3  10 
ATOM   6255  H  HE21 . GLN A 1 32 ? -0.430  3.376   -0.392  1.00 0.00 ? 32  GLN A HE21 10 
ATOM   6256  H  HE22 . GLN A 1 32 ? 0.175   3.141   -1.993  1.00 0.00 ? 32  GLN A HE22 10 
ATOM   6257  N  N    . LYS A 1 33 ? 3.611   7.584   3.107   1.00 0.00 ? 33  LYS A N    10 
ATOM   6258  C  CA   . LYS A 1 33 ? 4.446   8.769   3.268   1.00 0.00 ? 33  LYS A CA   10 
ATOM   6259  C  C    . LYS A 1 33 ? 5.724   8.435   4.030   1.00 0.00 ? 33  LYS A C    10 
ATOM   6260  O  O    . LYS A 1 33 ? 6.814   8.862   3.649   1.00 0.00 ? 33  LYS A O    10 
ATOM   6261  C  CB   . LYS A 1 33 ? 3.673   9.866   4.004   1.00 0.00 ? 33  LYS A CB   10 
ATOM   6262  C  CG   . LYS A 1 33 ? 2.405   10.301  3.289   1.00 0.00 ? 33  LYS A CG   10 
ATOM   6263  C  CD   . LYS A 1 33 ? 2.674   11.446  2.327   1.00 0.00 ? 33  LYS A CD   10 
ATOM   6264  C  CE   . LYS A 1 33 ? 1.641   11.490  1.211   1.00 0.00 ? 33  LYS A CE   10 
ATOM   6265  N  NZ   . LYS A 1 33 ? 1.727   10.294  0.328   1.00 0.00 ? 33  LYS A NZ   10 
ATOM   6266  H  H    . LYS A 1 33 ? 2.667   7.625   3.367   1.00 0.00 ? 33  LYS A H    10 
ATOM   6267  H  HA   . LYS A 1 33 ? 4.710   9.125   2.284   1.00 0.00 ? 33  LYS A HA   10 
ATOM   6268  H  HB2  . LYS A 1 33 ? 3.401   9.503   4.984   1.00 0.00 ? 33  LYS A HB2  10 
ATOM   6269  H  HB3  . LYS A 1 33 ? 4.313   10.729  4.114   1.00 0.00 ? 33  LYS A HB3  10 
ATOM   6270  H  HG2  . LYS A 1 33 ? 2.010   9.464   2.733   1.00 0.00 ? 33  LYS A HG2  10 
ATOM   6271  H  HG3  . LYS A 1 33 ? 1.681   10.622  4.023   1.00 0.00 ? 33  LYS A HG3  10 
ATOM   6272  H  HD2  . LYS A 1 33 ? 2.638   12.378  2.871   1.00 0.00 ? 33  LYS A HD2  10 
ATOM   6273  H  HD3  . LYS A 1 33 ? 3.655   11.318  1.893   1.00 0.00 ? 33  LYS A HD3  10 
ATOM   6274  H  HE2  . LYS A 1 33 ? 0.657   11.532  1.650   1.00 0.00 ? 33  LYS A HE2  10 
ATOM   6275  H  HE3  . LYS A 1 33 ? 1.809   12.377  0.618   1.00 0.00 ? 33  LYS A HE3  10 
ATOM   6276  H  HZ1  . LYS A 1 33 ? 1.441   10.542  -0.640  1.00 0.00 ? 33  LYS A HZ1  10 
ATOM   6277  H  HZ2  . LYS A 1 33 ? 1.100   9.543   0.682   1.00 0.00 ? 33  LYS A HZ2  10 
ATOM   6278  H  HZ3  . LYS A 1 33 ? 2.702   9.933   0.309   1.00 0.00 ? 33  LYS A HZ3  10 
ATOM   6279  N  N    . ILE A 1 34 ? 5.583   7.668   5.106   1.00 0.00 ? 34  ILE A N    10 
ATOM   6280  C  CA   . ILE A 1 34 ? 6.728   7.276   5.919   1.00 0.00 ? 34  ILE A CA   10 
ATOM   6281  C  C    . ILE A 1 34 ? 7.840   6.691   5.055   1.00 0.00 ? 34  ILE A C    10 
ATOM   6282  O  O    . ILE A 1 34 ? 9.005   6.671   5.454   1.00 0.00 ? 34  ILE A O    10 
ATOM   6283  C  CB   . ILE A 1 34 ? 6.329   6.244   6.991   1.00 0.00 ? 34  ILE A CB   10 
ATOM   6284  C  CG1  . ILE A 1 34 ? 6.012   4.896   6.340   1.00 0.00 ? 34  ILE A CG1  10 
ATOM   6285  C  CG2  . ILE A 1 34 ? 5.137   6.746   7.791   1.00 0.00 ? 34  ILE A CG2  10 
ATOM   6286  C  CD1  . ILE A 1 34 ? 5.959   3.748   7.323   1.00 0.00 ? 34  ILE A CD1  10 
ATOM   6287  H  H    . ILE A 1 34 ? 4.689   7.359   5.359   1.00 0.00 ? 34  ILE A H    10 
ATOM   6288  H  HA   . ILE A 1 34 ? 7.100   8.159   6.418   1.00 0.00 ? 34  ILE A HA   10 
ATOM   6289  H  HB   . ILE A 1 34 ? 7.161   6.122   7.668   1.00 0.00 ? 34  ILE A HB   10 
ATOM   6290  H  HG12 . ILE A 1 34 ? 5.053   4.957   5.850   1.00 0.00 ? 34  ILE A HG12 10 
ATOM   6291  H  HG13 . ILE A 1 34 ? 6.772   4.671   5.606   1.00 0.00 ? 34  ILE A HG13 10 
ATOM   6292  H  HG21 . ILE A 1 34 ? 4.358   5.998   7.785   1.00 0.00 ? 34  ILE A HG21 10 
ATOM   6293  H  HG22 . ILE A 1 34 ? 5.442   6.937   8.809   1.00 0.00 ? 34  ILE A HG22 10 
ATOM   6294  H  HG23 . ILE A 1 34 ? 4.764   7.658   7.350   1.00 0.00 ? 34  ILE A HG23 10 
ATOM   6295  H  HD11 . ILE A 1 34 ? 6.021   4.134   8.331   1.00 0.00 ? 34  ILE A HD11 10 
ATOM   6296  H  HD12 . ILE A 1 34 ? 5.030   3.212   7.201   1.00 0.00 ? 34  ILE A HD12 10 
ATOM   6297  H  HD13 . ILE A 1 34 ? 6.788   3.081   7.143   1.00 0.00 ? 34  ILE A HD13 10 
ATOM   6298  N  N    . HIS A 1 35 ? 7.474   6.216   3.869   1.00 0.00 ? 35  HIS A N    10 
ATOM   6299  C  CA   . HIS A 1 35 ? 8.442   5.633   2.947   1.00 0.00 ? 35  HIS A CA   10 
ATOM   6300  C  C    . HIS A 1 35 ? 9.041   6.703   2.040   1.00 0.00 ? 35  HIS A C    10 
ATOM   6301  O  O    . HIS A 1 35 ? 9.588   6.399   0.979   1.00 0.00 ? 35  HIS A O    10 
ATOM   6302  C  CB   . HIS A 1 35 ? 7.780   4.544   2.101   1.00 0.00 ? 35  HIS A CB   10 
ATOM   6303  C  CG   . HIS A 1 35 ? 7.245   3.401   2.909   1.00 0.00 ? 35  HIS A CG   10 
ATOM   6304  N  ND1  . HIS A 1 35 ? 8.005   2.708   3.827   1.00 0.00 ? 35  HIS A ND1  10 
ATOM   6305  C  CD2  . HIS A 1 35 ? 6.017   2.833   2.933   1.00 0.00 ? 35  HIS A CD2  10 
ATOM   6306  C  CE1  . HIS A 1 35 ? 7.268   1.761   4.380   1.00 0.00 ? 35  HIS A CE1  10 
ATOM   6307  N  NE2  . HIS A 1 35 ? 6.057   1.816   3.855   1.00 0.00 ? 35  HIS A NE2  10 
ATOM   6308  H  H    . HIS A 1 35 ? 6.531   6.260   3.607   1.00 0.00 ? 35  HIS A H    10 
ATOM   6309  H  HA   . HIS A 1 35 ? 9.233   5.191   3.532   1.00 0.00 ? 35  HIS A HA   10 
ATOM   6310  H  HB2  . HIS A 1 35 ? 6.956   4.975   1.551   1.00 0.00 ? 35  HIS A HB2  10 
ATOM   6311  H  HB3  . HIS A 1 35 ? 8.504   4.148   1.404   1.00 0.00 ? 35  HIS A HB3  10 
ATOM   6312  H  HD1  . HIS A 1 35 ? 8.945   2.883   4.041   1.00 0.00 ? 35  HIS A HD1  10 
ATOM   6313  H  HD2  . HIS A 1 35 ? 5.163   3.124   2.337   1.00 0.00 ? 35  HIS A HD2  10 
ATOM   6314  H  HE1  . HIS A 1 35 ? 7.598   1.062   5.133   1.00 0.00 ? 35  HIS A HE1  10 
ATOM   6315  N  N    . THR A 1 36 ? 8.935   7.959   2.463   1.00 0.00 ? 36  THR A N    10 
ATOM   6316  C  CA   . THR A 1 36 ? 9.464   9.074   1.689   1.00 0.00 ? 36  THR A CA   10 
ATOM   6317  C  C    . THR A 1 36 ? 9.491   10.354  2.516   1.00 0.00 ? 36  THR A C    10 
ATOM   6318  O  O    . THR A 1 36 ? 8.507   10.706  3.165   1.00 0.00 ? 36  THR A O    10 
ATOM   6319  C  CB   . THR A 1 36 ? 8.635   9.317   0.414   1.00 0.00 ? 36  THR A CB   10 
ATOM   6320  O  OG1  . THR A 1 36 ? 9.075   10.515  -0.236  1.00 0.00 ? 36  THR A OG1  10 
ATOM   6321  C  CG2  . THR A 1 36 ? 7.154   9.429   0.745   1.00 0.00 ? 36  THR A CG2  10 
ATOM   6322  H  H    . THR A 1 36 ? 8.488   8.138   3.317   1.00 0.00 ? 36  THR A H    10 
ATOM   6323  H  HA   . THR A 1 36 ? 10.474  8.826   1.394   1.00 0.00 ? 36  THR A HA   10 
ATOM   6324  H  HB   . THR A 1 36 ? 8.777   8.480   -0.255  1.00 0.00 ? 36  THR A HB   10 
ATOM   6325  H  HG1  . THR A 1 36 ? 9.588   10.286  -1.015  1.00 0.00 ? 36  THR A HG1  10 
ATOM   6326  H  HG21 . THR A 1 36 ? 6.578   9.383   -0.167  1.00 0.00 ? 36  THR A HG21 10 
ATOM   6327  H  HG22 . THR A 1 36 ? 6.966   10.369  1.242   1.00 0.00 ? 36  THR A HG22 10 
ATOM   6328  H  HG23 . THR A 1 36 ? 6.868   8.614   1.393   1.00 0.00 ? 36  THR A HG23 10 
ATOM   6329  N  N    . GLY A 1 37 ? 10.624  11.049  2.487   1.00 0.00 ? 37  GLY A N    10 
ATOM   6330  C  CA   . GLY A 1 37 ? 10.757  12.284  3.238   1.00 0.00 ? 37  GLY A CA   10 
ATOM   6331  C  C    . GLY A 1 37 ? 11.053  13.475  2.348   1.00 0.00 ? 37  GLY A C    10 
ATOM   6332  O  O    . GLY A 1 37 ? 10.455  13.626  1.284   1.00 0.00 ? 37  GLY A O    10 
ATOM   6333  H  H    . GLY A 1 37 ? 11.376  10.721  1.951   1.00 0.00 ? 37  GLY A H    10 
ATOM   6334  H  HA2  . GLY A 1 37 ? 9.837   12.467  3.773   1.00 0.00 ? 37  GLY A HA2  10 
ATOM   6335  H  HA3  . GLY A 1 37 ? 11.560  12.173  3.951   1.00 0.00 ? 37  GLY A HA3  10 
ATOM   6336  N  N    . GLU A 1 38 ? 11.978  14.323  2.787   1.00 0.00 ? 38  GLU A N    10 
ATOM   6337  C  CA   . GLU A 1 38 ? 12.350  15.508  2.023   1.00 0.00 ? 38  GLU A CA   10 
ATOM   6338  C  C    . GLU A 1 38 ? 13.845  15.513  1.720   1.00 0.00 ? 38  GLU A C    10 
ATOM   6339  O  O    . GLU A 1 38 ? 14.650  15.990  2.521   1.00 0.00 ? 38  GLU A O    10 
ATOM   6340  C  CB   . GLU A 1 38 ? 11.969  16.777  2.789   1.00 0.00 ? 38  GLU A CB   10 
ATOM   6341  C  CG   . GLU A 1 38 ? 11.845  18.007  1.906   1.00 0.00 ? 38  GLU A CG   10 
ATOM   6342  C  CD   . GLU A 1 38 ? 11.788  19.295  2.705   1.00 0.00 ? 38  GLU A CD   10 
ATOM   6343  O  OE1  . GLU A 1 38 ? 10.684  19.668  3.153   1.00 0.00 ? 38  GLU A OE1  10 
ATOM   6344  O  OE2  . GLU A 1 38 ? 12.850  19.930  2.882   1.00 0.00 ? 38  GLU A OE2  10 
ATOM   6345  H  H    . GLU A 1 38 ? 12.420  14.148  3.644   1.00 0.00 ? 38  GLU A H    10 
ATOM   6346  H  HA   . GLU A 1 38 ? 11.806  15.486  1.090   1.00 0.00 ? 38  GLU A HA   10 
ATOM   6347  H  HB2  . GLU A 1 38 ? 11.022  16.615  3.282   1.00 0.00 ? 38  GLU A HB2  10 
ATOM   6348  H  HB3  . GLU A 1 38 ? 12.725  16.971  3.537   1.00 0.00 ? 38  GLU A HB3  10 
ATOM   6349  H  HG2  . GLU A 1 38 ? 12.698  18.049  1.246   1.00 0.00 ? 38  GLU A HG2  10 
ATOM   6350  H  HG3  . GLU A 1 38 ? 10.942  17.924  1.320   1.00 0.00 ? 38  GLU A HG3  10 
ATOM   6351  N  N    . ARG A 1 39 ? 14.210  14.978  0.559   1.00 0.00 ? 39  ARG A N    10 
ATOM   6352  C  CA   . ARG A 1 39 ? 15.608  14.919  0.151   1.00 0.00 ? 39  ARG A CA   10 
ATOM   6353  C  C    . ARG A 1 39 ? 15.866  15.837  -1.041  1.00 0.00 ? 39  ARG A C    10 
ATOM   6354  O  O    . ARG A 1 39 ? 15.909  15.403  -2.192  1.00 0.00 ? 39  ARG A O    10 
ATOM   6355  C  CB   . ARG A 1 39 ? 15.997  13.483  -0.205  1.00 0.00 ? 39  ARG A CB   10 
ATOM   6356  C  CG   . ARG A 1 39 ? 16.544  12.691  0.972   1.00 0.00 ? 39  ARG A CG   10 
ATOM   6357  C  CD   . ARG A 1 39 ? 15.431  12.244  1.908   1.00 0.00 ? 39  ARG A CD   10 
ATOM   6358  N  NE   . ARG A 1 39 ? 14.835  10.980  1.485   1.00 0.00 ? 39  ARG A NE   10 
ATOM   6359  C  CZ   . ARG A 1 39 ? 13.779  10.897  0.684   1.00 0.00 ? 39  ARG A CZ   10 
ATOM   6360  N  NH1  . ARG A 1 39 ? 13.205  11.999  0.221   1.00 0.00 ? 39  ARG A NH1  10 
ATOM   6361  N  NH2  . ARG A 1 39 ? 13.294  9.710   0.344   1.00 0.00 ? 39  ARG A NH2  10 
ATOM   6362  H  H    . ARG A 1 39 ? 13.522  14.614  -0.037  1.00 0.00 ? 39  ARG A H    10 
ATOM   6363  H  HA   . ARG A 1 39 ? 16.211  15.250  0.983   1.00 0.00 ? 39  ARG A HA   10 
ATOM   6364  H  HB2  . ARG A 1 39 ? 15.126  12.969  -0.582  1.00 0.00 ? 39  ARG A HB2  10 
ATOM   6365  H  HB3  . ARG A 1 39 ? 16.753  13.508  -0.976  1.00 0.00 ? 39  ARG A HB3  10 
ATOM   6366  H  HG2  . ARG A 1 39 ? 17.057  11.817  0.599   1.00 0.00 ? 39  ARG A HG2  10 
ATOM   6367  H  HG3  . ARG A 1 39 ? 17.237  13.311  1.521   1.00 0.00 ? 39  ARG A HG3  10 
ATOM   6368  H  HD2  . ARG A 1 39 ? 15.840  12.124  2.900   1.00 0.00 ? 39  ARG A HD2  10 
ATOM   6369  H  HD3  . ARG A 1 39 ? 14.666  13.005  1.924   1.00 0.00 ? 39  ARG A HD3  10 
ATOM   6370  H  HE   . ARG A 1 39 ? 15.243  10.153  1.815   1.00 0.00 ? 39  ARG A HE   10 
ATOM   6371  H  HH11 . ARG A 1 39 ? 13.569  12.896  0.475   1.00 0.00 ? 39  ARG A HH11 10 
ATOM   6372  H  HH12 . ARG A 1 39 ? 12.411  11.934  -0.383  1.00 0.00 ? 39  ARG A HH12 10 
ATOM   6373  H  HH21 . ARG A 1 39 ? 13.723  8.877   0.690   1.00 0.00 ? 39  ARG A HH21 10 
ATOM   6374  H  HH22 . ARG A 1 39 ? 12.499  9.648   -0.259  1.00 0.00 ? 39  ARG A HH22 10 
ATOM   6375  N  N    . PRO A 1 40 ? 16.042  17.136  -0.759  1.00 0.00 ? 40  PRO A N    10 
ATOM   6376  C  CA   . PRO A 1 40 ? 16.299  18.143  -1.794  1.00 0.00 ? 40  PRO A CA   10 
ATOM   6377  C  C    . PRO A 1 40 ? 17.681  17.990  -2.421  1.00 0.00 ? 40  PRO A C    10 
ATOM   6378  O  O    . PRO A 1 40 ? 18.693  18.314  -1.800  1.00 0.00 ? 40  PRO A O    10 
ATOM   6379  C  CB   . PRO A 1 40 ? 16.200  19.467  -1.033  1.00 0.00 ? 40  PRO A CB   10 
ATOM   6380  C  CG   . PRO A 1 40 ? 16.525  19.118  0.378   1.00 0.00 ? 40  PRO A CG   10 
ATOM   6381  C  CD   . PRO A 1 40 ? 16.005  17.724  0.591   1.00 0.00 ? 40  PRO A CD   10 
ATOM   6382  H  HA   . PRO A 1 40 ? 15.548  18.114  -2.570  1.00 0.00 ? 40  PRO A HA   10 
ATOM   6383  H  HB2  . PRO A 1 40 ? 16.910  20.173  -1.441  1.00 0.00 ? 40  PRO A HB2  10 
ATOM   6384  H  HB3  . PRO A 1 40 ? 15.200  19.863  -1.121  1.00 0.00 ? 40  PRO A HB3  10 
ATOM   6385  H  HG2  . PRO A 1 40 ? 17.594  19.147  0.526   1.00 0.00 ? 40  PRO A HG2  10 
ATOM   6386  H  HG3  . PRO A 1 40 ? 16.033  19.808  1.049   1.00 0.00 ? 40  PRO A HG3  10 
ATOM   6387  H  HD2  . PRO A 1 40 ? 16.649  17.180  1.266   1.00 0.00 ? 40  PRO A HD2  10 
ATOM   6388  H  HD3  . PRO A 1 40 ? 14.994  17.752  0.970   1.00 0.00 ? 40  PRO A HD3  10 
ATOM   6389  N  N    . SER A 1 41 ? 17.715  17.495  -3.654  1.00 0.00 ? 41  SER A N    10 
ATOM   6390  C  CA   . SER A 1 41 ? 18.973  17.297  -4.363  1.00 0.00 ? 41  SER A CA   10 
ATOM   6391  C  C    . SER A 1 41 ? 19.819  18.566  -4.334  1.00 0.00 ? 41  SER A C    10 
ATOM   6392  O  O    . SER A 1 41 ? 19.422  19.603  -4.865  1.00 0.00 ? 41  SER A O    10 
ATOM   6393  C  CB   . SER A 1 41 ? 18.707  16.881  -5.811  1.00 0.00 ? 41  SER A CB   10 
ATOM   6394  O  OG   . SER A 1 41 ? 18.192  15.563  -5.877  1.00 0.00 ? 41  SER A OG   10 
ATOM   6395  H  H    . SER A 1 41 ? 16.873  17.256  -4.096  1.00 0.00 ? 41  SER A H    10 
ATOM   6396  H  HA   . SER A 1 41 ? 19.514  16.506  -3.865  1.00 0.00 ? 41  SER A HA   10 
ATOM   6397  H  HB2  . SER A 1 41 ? 17.989  17.557  -6.251  1.00 0.00 ? 41  SER A HB2  10 
ATOM   6398  H  HB3  . SER A 1 41 ? 19.631  16.923  -6.371  1.00 0.00 ? 41  SER A HB3  10 
ATOM   6399  H  HG   . SER A 1 41 ? 17.754  15.348  -5.050  1.00 0.00 ? 41  SER A HG   10 
ATOM   6400  N  N    . GLY A 1 42 ? 20.989  18.476  -3.709  1.00 0.00 ? 42  GLY A N    10 
ATOM   6401  C  CA   . GLY A 1 42 ? 21.874  19.623  -3.621  1.00 0.00 ? 42  GLY A CA   10 
ATOM   6402  C  C    . GLY A 1 42 ? 21.181  20.847  -3.056  1.00 0.00 ? 42  GLY A C    10 
ATOM   6403  O  O    . GLY A 1 42 ? 20.164  20.750  -2.368  1.00 0.00 ? 42  GLY A O    10 
ATOM   6404  H  H    . GLY A 1 42 ? 21.254  17.624  -3.304  1.00 0.00 ? 42  GLY A H    10 
ATOM   6405  H  HA2  . GLY A 1 42 ? 22.711  19.371  -2.988  1.00 0.00 ? 42  GLY A HA2  10 
ATOM   6406  H  HA3  . GLY A 1 42 ? 22.241  19.857  -4.610  1.00 0.00 ? 42  GLY A HA3  10 
ATOM   6407  N  N    . PRO A 1 43 ? 21.738  22.033  -3.344  1.00 0.00 ? 43  PRO A N    10 
ATOM   6408  C  CA   . PRO A 1 43 ? 21.185  23.304  -2.868  1.00 0.00 ? 43  PRO A CA   10 
ATOM   6409  C  C    . PRO A 1 43 ? 19.863  23.650  -3.544  1.00 0.00 ? 43  PRO A C    10 
ATOM   6410  O  O    . PRO A 1 43 ? 19.840  24.308  -4.584  1.00 0.00 ? 43  PRO A O    10 
ATOM   6411  C  CB   . PRO A 1 43 ? 22.262  24.324  -3.246  1.00 0.00 ? 43  PRO A CB   10 
ATOM   6412  C  CG   . PRO A 1 43 ? 22.979  23.708  -4.398  1.00 0.00 ? 43  PRO A CG   10 
ATOM   6413  C  CD   . PRO A 1 43 ? 22.951  22.224  -4.157  1.00 0.00 ? 43  PRO A CD   10 
ATOM   6414  H  HA   . PRO A 1 43 ? 21.050  23.301  -1.796  1.00 0.00 ? 43  PRO A HA   10 
ATOM   6415  H  HB2  . PRO A 1 43 ? 21.795  25.258  -3.524  1.00 0.00 ? 43  PRO A HB2  10 
ATOM   6416  H  HB3  . PRO A 1 43 ? 22.924  24.481  -2.408  1.00 0.00 ? 43  PRO A HB3  10 
ATOM   6417  H  HG2  . PRO A 1 43 ? 22.469  23.949  -5.318  1.00 0.00 ? 43  PRO A HG2  10 
ATOM   6418  H  HG3  . PRO A 1 43 ? 23.998  24.064  -4.427  1.00 0.00 ? 43  PRO A HG3  10 
ATOM   6419  H  HD2  . PRO A 1 43 ? 22.875  21.691  -5.094  1.00 0.00 ? 43  PRO A HD2  10 
ATOM   6420  H  HD3  . PRO A 1 43 ? 23.831  21.913  -3.614  1.00 0.00 ? 43  PRO A HD3  10 
ATOM   6421  N  N    . SER A 1 44 ? 18.763  23.203  -2.946  1.00 0.00 ? 44  SER A N    10 
ATOM   6422  C  CA   . SER A 1 44 ? 17.436  23.463  -3.493  1.00 0.00 ? 44  SER A CA   10 
ATOM   6423  C  C    . SER A 1 44 ? 16.902  24.807  -3.007  1.00 0.00 ? 44  SER A C    10 
ATOM   6424  O  O    . SER A 1 44 ? 16.626  25.703  -3.805  1.00 0.00 ? 44  SER A O    10 
ATOM   6425  C  CB   . SER A 1 44 ? 16.470  22.345  -3.098  1.00 0.00 ? 44  SER A CB   10 
ATOM   6426  O  OG   . SER A 1 44 ? 15.355  22.302  -3.971  1.00 0.00 ? 44  SER A OG   10 
ATOM   6427  H  H    . SER A 1 44 ? 18.846  22.684  -2.119  1.00 0.00 ? 44  SER A H    10 
ATOM   6428  H  HA   . SER A 1 44 ? 17.521  23.491  -4.569  1.00 0.00 ? 44  SER A HA   10 
ATOM   6429  H  HB2  . SER A 1 44 ? 16.984  21.396  -3.142  1.00 0.00 ? 44  SER A HB2  10 
ATOM   6430  H  HB3  . SER A 1 44 ? 16.118  22.517  -2.091  1.00 0.00 ? 44  SER A HB3  10 
ATOM   6431  H  HG   . SER A 1 44 ? 14.549  22.444  -3.469  1.00 0.00 ? 44  SER A HG   10 
ATOM   6432  N  N    . SER A 1 45 ? 16.759  24.940  -1.693  1.00 0.00 ? 45  SER A N    10 
ATOM   6433  C  CA   . SER A 1 45 ? 16.255  26.173  -1.099  1.00 0.00 ? 45  SER A CA   10 
ATOM   6434  C  C    . SER A 1 45 ? 16.667  26.279  0.366   1.00 0.00 ? 45  SER A C    10 
ATOM   6435  O  O    . SER A 1 45 ? 17.207  25.334  0.941   1.00 0.00 ? 45  SER A O    10 
ATOM   6436  C  CB   . SER A 1 45 ? 14.730  26.234  -1.217  1.00 0.00 ? 45  SER A CB   10 
ATOM   6437  O  OG   . SER A 1 45 ? 14.251  27.543  -0.962  1.00 0.00 ? 45  SER A OG   10 
ATOM   6438  H  H    . SER A 1 45 ? 16.997  24.190  -1.108  1.00 0.00 ? 45  SER A H    10 
ATOM   6439  H  HA   . SER A 1 45 ? 16.683  27.002  -1.642  1.00 0.00 ? 45  SER A HA   10 
ATOM   6440  H  HB2  . SER A 1 45 ? 14.437  25.945  -2.215  1.00 0.00 ? 45  SER A HB2  10 
ATOM   6441  H  HB3  . SER A 1 45 ? 14.289  25.555  -0.501  1.00 0.00 ? 45  SER A HB3  10 
ATOM   6442  H  HG   . SER A 1 45 ? 13.577  27.768  -1.606  1.00 0.00 ? 45  SER A HG   10 
ATOM   6443  N  N    . GLY A 1 46 ? 16.409  27.438  0.965   1.00 0.00 ? 46  GLY A N    10 
ATOM   6444  C  CA   . GLY A 1 46 ? 16.760  27.648  2.357   1.00 0.00 ? 46  GLY A CA   10 
ATOM   6445  C  C    . GLY A 1 46 ? 15.551  27.615  3.271   1.00 0.00 ? 46  GLY A C    10 
ATOM   6446  O  O    . GLY A 1 46 ? 15.623  28.145  4.379   1.00 0.00 ? 46  GLY A O    10 
ATOM   6447  H  H    . GLY A 1 46 ? 15.977  28.156  0.457   1.00 0.00 ? 46  GLY A H    10 
ATOM   6448  H  HA2  . GLY A 1 46 ? 17.451  26.876  2.663   1.00 0.00 ? 46  GLY A HA2  10 
ATOM   6449  H  HA3  . GLY A 1 46 ? 17.243  28.609  2.454   1.00 0.00 ? 46  GLY A HA3  10 
HETATM 6450  ZN ZN   . ZN  B 2 .  ? 4.255   0.838   4.297   1.00 0.00 ? 201 ZN  A ZN   10 
ATOM   6451  N  N    . GLY A 1 1  ? 14.546  -16.548 8.752   1.00 0.00 ? 1   GLY A N    11 
ATOM   6452  C  CA   . GLY A 1 1  ? 14.246  -17.744 7.987   1.00 0.00 ? 1   GLY A CA   11 
ATOM   6453  C  C    . GLY A 1 1  ? 13.142  -17.522 6.972   1.00 0.00 ? 1   GLY A C    11 
ATOM   6454  O  O    . GLY A 1 1  ? 12.334  -16.604 7.115   1.00 0.00 ? 1   GLY A O    11 
ATOM   6455  H  H1   . GLY A 1 1  ? 14.154  -15.689 8.489   1.00 0.00 ? 1   GLY A H1   11 
ATOM   6456  H  HA2  . GLY A 1 1  ? 15.139  -18.061 7.469   1.00 0.00 ? 1   GLY A HA2  11 
ATOM   6457  H  HA3  . GLY A 1 1  ? 13.941  -18.525 8.668   1.00 0.00 ? 1   GLY A HA3  11 
ATOM   6458  N  N    . SER A 1 2  ? 13.109  -18.362 5.943   1.00 0.00 ? 2   SER A N    11 
ATOM   6459  C  CA   . SER A 1 2  ? 12.099  -18.250 4.897   1.00 0.00 ? 2   SER A CA   11 
ATOM   6460  C  C    . SER A 1 2  ? 10.699  -18.445 5.470   1.00 0.00 ? 2   SER A C    11 
ATOM   6461  O  O    . SER A 1 2  ? 10.526  -19.070 6.516   1.00 0.00 ? 2   SER A O    11 
ATOM   6462  C  CB   . SER A 1 2  ? 12.360  -19.278 3.794   1.00 0.00 ? 2   SER A CB   11 
ATOM   6463  O  OG   . SER A 1 2  ? 11.345  -19.235 2.807   1.00 0.00 ? 2   SER A OG   11 
ATOM   6464  H  H    . SER A 1 2  ? 13.781  -19.074 5.885   1.00 0.00 ? 2   SER A H    11 
ATOM   6465  H  HA   . SER A 1 2  ? 12.168  -17.258 4.476   1.00 0.00 ? 2   SER A HA   11 
ATOM   6466  H  HB2  . SER A 1 2  ? 13.309  -19.067 3.327   1.00 0.00 ? 2   SER A HB2  11 
ATOM   6467  H  HB3  . SER A 1 2  ? 12.383  -20.267 4.228   1.00 0.00 ? 2   SER A HB3  11 
ATOM   6468  H  HG   . SER A 1 2  ? 11.450  -19.977 2.207   1.00 0.00 ? 2   SER A HG   11 
ATOM   6469  N  N    . SER A 1 3  ? 9.702   -17.906 4.775   1.00 0.00 ? 3   SER A N    11 
ATOM   6470  C  CA   . SER A 1 3  ? 8.316   -18.017 5.216   1.00 0.00 ? 3   SER A CA   11 
ATOM   6471  C  C    . SER A 1 3  ? 7.435   -18.573 4.101   1.00 0.00 ? 3   SER A C    11 
ATOM   6472  O  O    . SER A 1 3  ? 7.875   -18.721 2.962   1.00 0.00 ? 3   SER A O    11 
ATOM   6473  C  CB   . SER A 1 3  ? 7.790   -16.652 5.665   1.00 0.00 ? 3   SER A CB   11 
ATOM   6474  O  OG   . SER A 1 3  ? 8.460   -16.206 6.831   1.00 0.00 ? 3   SER A OG   11 
ATOM   6475  H  H    . SER A 1 3  ? 9.903   -17.420 3.949   1.00 0.00 ? 3   SER A H    11 
ATOM   6476  H  HA   . SER A 1 3  ? 8.288   -18.697 6.054   1.00 0.00 ? 3   SER A HA   11 
ATOM   6477  H  HB2  . SER A 1 3  ? 7.948   -15.932 4.876   1.00 0.00 ? 3   SER A HB2  11 
ATOM   6478  H  HB3  . SER A 1 3  ? 6.734   -16.729 5.877   1.00 0.00 ? 3   SER A HB3  11 
ATOM   6479  H  HG   . SER A 1 3  ? 8.506   -16.924 7.468   1.00 0.00 ? 3   SER A HG   11 
ATOM   6480  N  N    . GLY A 1 4  ? 6.186   -18.879 4.440   1.00 0.00 ? 4   GLY A N    11 
ATOM   6481  C  CA   . GLY A 1 4  ? 5.261   -19.415 3.458   1.00 0.00 ? 4   GLY A CA   11 
ATOM   6482  C  C    . GLY A 1 4  ? 4.763   -18.358 2.493   1.00 0.00 ? 4   GLY A C    11 
ATOM   6483  O  O    . GLY A 1 4  ? 5.557   -17.685 1.835   1.00 0.00 ? 4   GLY A O    11 
ATOM   6484  H  H    . GLY A 1 4  ? 5.890   -18.740 5.364   1.00 0.00 ? 4   GLY A H    11 
ATOM   6485  H  HA2  . GLY A 1 4  ? 5.759   -20.193 2.898   1.00 0.00 ? 4   GLY A HA2  11 
ATOM   6486  H  HA3  . GLY A 1 4  ? 4.414   -19.842 3.974   1.00 0.00 ? 4   GLY A HA3  11 
ATOM   6487  N  N    . SER A 1 5  ? 3.445   -18.212 2.405   1.00 0.00 ? 5   SER A N    11 
ATOM   6488  C  CA   . SER A 1 5  ? 2.842   -17.233 1.509   1.00 0.00 ? 5   SER A CA   11 
ATOM   6489  C  C    . SER A 1 5  ? 1.443   -16.850 1.984   1.00 0.00 ? 5   SER A C    11 
ATOM   6490  O  O    . SER A 1 5  ? 0.765   -17.635 2.647   1.00 0.00 ? 5   SER A O    11 
ATOM   6491  C  CB   . SER A 1 5  ? 2.775   -17.787 0.085   1.00 0.00 ? 5   SER A CB   11 
ATOM   6492  O  OG   . SER A 1 5  ? 2.125   -19.046 0.057   1.00 0.00 ? 5   SER A OG   11 
ATOM   6493  H  H    . SER A 1 5  ? 2.864   -18.779 2.956   1.00 0.00 ? 5   SER A H    11 
ATOM   6494  H  HA   . SER A 1 5  ? 3.465   -16.351 1.514   1.00 0.00 ? 5   SER A HA   11 
ATOM   6495  H  HB2  . SER A 1 5  ? 2.227   -17.100 -0.541  1.00 0.00 ? 5   SER A HB2  11 
ATOM   6496  H  HB3  . SER A 1 5  ? 3.778   -17.904 -0.300  1.00 0.00 ? 5   SER A HB3  11 
ATOM   6497  H  HG   . SER A 1 5  ? 1.183   -18.924 0.196   1.00 0.00 ? 5   SER A HG   11 
ATOM   6498  N  N    . SER A 1 6  ? 1.019   -15.639 1.640   1.00 0.00 ? 6   SER A N    11 
ATOM   6499  C  CA   . SER A 1 6  ? -0.297  -15.149 2.034   1.00 0.00 ? 6   SER A CA   11 
ATOM   6500  C  C    . SER A 1 6  ? -1.176  -14.909 0.810   1.00 0.00 ? 6   SER A C    11 
ATOM   6501  O  O    . SER A 1 6  ? -0.695  -14.907 -0.322  1.00 0.00 ? 6   SER A O    11 
ATOM   6502  C  CB   . SER A 1 6  ? -0.163  -13.856 2.841   1.00 0.00 ? 6   SER A CB   11 
ATOM   6503  O  OG   . SER A 1 6  ? 0.490   -12.850 2.087   1.00 0.00 ? 6   SER A OG   11 
ATOM   6504  H  H    . SER A 1 6  ? 1.607   -15.059 1.111   1.00 0.00 ? 6   SER A H    11 
ATOM   6505  H  HA   . SER A 1 6  ? -0.760  -15.903 2.652   1.00 0.00 ? 6   SER A HA   11 
ATOM   6506  H  HB2  . SER A 1 6  ? -1.145  -13.503 3.117   1.00 0.00 ? 6   SER A HB2  11 
ATOM   6507  H  HB3  . SER A 1 6  ? 0.413   -14.051 3.734   1.00 0.00 ? 6   SER A HB3  11 
ATOM   6508  H  HG   . SER A 1 6  ? 0.522   -12.037 2.598   1.00 0.00 ? 6   SER A HG   11 
ATOM   6509  N  N    . GLY A 1 7  ? -2.468  -14.706 1.048   1.00 0.00 ? 7   GLY A N    11 
ATOM   6510  C  CA   . GLY A 1 7  ? -3.395  -14.467 -0.043  1.00 0.00 ? 7   GLY A CA   11 
ATOM   6511  C  C    . GLY A 1 7  ? -4.721  -15.174 0.157   1.00 0.00 ? 7   GLY A C    11 
ATOM   6512  O  O    . GLY A 1 7  ? -5.237  -15.237 1.274   1.00 0.00 ? 7   GLY A O    11 
ATOM   6513  H  H    . GLY A 1 7  ? -2.795  -14.719 1.972   1.00 0.00 ? 7   GLY A H    11 
ATOM   6514  H  HA2  . GLY A 1 7  ? -3.573  -13.406 -0.124  1.00 0.00 ? 7   GLY A HA2  11 
ATOM   6515  H  HA3  . GLY A 1 7  ? -2.949  -14.818 -0.962  1.00 0.00 ? 7   GLY A HA3  11 
ATOM   6516  N  N    . THR A 1 8  ? -5.276  -15.706 -0.927  1.00 0.00 ? 8   THR A N    11 
ATOM   6517  C  CA   . THR A 1 8  ? -6.551  -16.409 -0.866  1.00 0.00 ? 8   THR A CA   11 
ATOM   6518  C  C    . THR A 1 8  ? -7.472  -15.788 0.177   1.00 0.00 ? 8   THR A C    11 
ATOM   6519  O  O    . THR A 1 8  ? -8.047  -16.489 1.009   1.00 0.00 ? 8   THR A O    11 
ATOM   6520  C  CB   . THR A 1 8  ? -6.355  -17.901 -0.537  1.00 0.00 ? 8   THR A CB   11 
ATOM   6521  O  OG1  . THR A 1 8  ? -7.619  -18.574 -0.540  1.00 0.00 ? 8   THR A OG1  11 
ATOM   6522  C  CG2  . THR A 1 8  ? -5.686  -18.074 0.818   1.00 0.00 ? 8   THR A CG2  11 
ATOM   6523  H  H    . THR A 1 8  ? -4.816  -15.623 -1.788  1.00 0.00 ? 8   THR A H    11 
ATOM   6524  H  HA   . THR A 1 8  ? -7.020  -16.334 -1.837  1.00 0.00 ? 8   THR A HA   11 
ATOM   6525  H  HB   . THR A 1 8  ? -5.721  -18.341 -1.294  1.00 0.00 ? 8   THR A HB   11 
ATOM   6526  H  HG1  . THR A 1 8  ? -8.308  -17.962 -0.266  1.00 0.00 ? 8   THR A HG1  11 
ATOM   6527  H  HG21 . THR A 1 8  ? -5.346  -19.093 0.924   1.00 0.00 ? 8   THR A HG21 11 
ATOM   6528  H  HG22 . THR A 1 8  ? -6.394  -17.848 1.601   1.00 0.00 ? 8   THR A HG22 11 
ATOM   6529  H  HG23 . THR A 1 8  ? -4.842  -17.403 0.890   1.00 0.00 ? 8   THR A HG23 11 
ATOM   6530  N  N    . GLY A 1 9  ? -7.609  -14.466 0.127   1.00 0.00 ? 9   GLY A N    11 
ATOM   6531  C  CA   . GLY A 1 9  ? -8.463  -13.772 1.074   1.00 0.00 ? 9   GLY A CA   11 
ATOM   6532  C  C    . GLY A 1 9  ? -9.012  -12.474 0.516   1.00 0.00 ? 9   GLY A C    11 
ATOM   6533  O  O    . GLY A 1 9  ? -8.716  -12.105 -0.620  1.00 0.00 ? 9   GLY A O    11 
ATOM   6534  H  H    . GLY A 1 9  ? -7.126  -13.958 -0.558  1.00 0.00 ? 9   GLY A H    11 
ATOM   6535  H  HA2  . GLY A 1 9  ? -9.288  -14.416 1.337   1.00 0.00 ? 9   GLY A HA2  11 
ATOM   6536  H  HA3  . GLY A 1 9  ? -7.891  -13.554 1.964   1.00 0.00 ? 9   GLY A HA3  11 
ATOM   6537  N  N    . GLU A 1 10 ? -9.815  -11.780 1.316   1.00 0.00 ? 10  GLU A N    11 
ATOM   6538  C  CA   . GLU A 1 10 ? -10.409 -10.517 0.894   1.00 0.00 ? 10  GLU A CA   11 
ATOM   6539  C  C    . GLU A 1 10 ? -9.825  -9.350  1.685   1.00 0.00 ? 10  GLU A C    11 
ATOM   6540  O  O    . GLU A 1 10 ? -10.330 -8.994  2.749   1.00 0.00 ? 10  GLU A O    11 
ATOM   6541  C  CB   . GLU A 1 10 ? -11.928 -10.558 1.070   1.00 0.00 ? 10  GLU A CB   11 
ATOM   6542  C  CG   . GLU A 1 10 ? -12.651 -11.291 -0.048  1.00 0.00 ? 10  GLU A CG   11 
ATOM   6543  C  CD   . GLU A 1 10 ? -12.122 -12.696 -0.261  1.00 0.00 ? 10  GLU A CD   11 
ATOM   6544  O  OE1  . GLU A 1 10 ? -11.750 -13.347 0.738   1.00 0.00 ? 10  GLU A OE1  11 
ATOM   6545  O  OE2  . GLU A 1 10 ? -12.080 -13.145 -1.425  1.00 0.00 ? 10  GLU A OE2  11 
ATOM   6546  H  H    . GLU A 1 10 ? -10.014 -12.126 2.211   1.00 0.00 ? 10  GLU A H    11 
ATOM   6547  H  HA   . GLU A 1 10 ? -10.181 -10.377 -0.152  1.00 0.00 ? 10  GLU A HA   11 
ATOM   6548  H  HB2  . GLU A 1 10 ? -12.157 -11.050 2.003   1.00 0.00 ? 10  GLU A HB2  11 
ATOM   6549  H  HB3  . GLU A 1 10 ? -12.301 -9.545  1.107   1.00 0.00 ? 10  GLU A HB3  11 
ATOM   6550  H  HG2  . GLU A 1 10 ? -13.700 -11.352 0.199   1.00 0.00 ? 10  GLU A HG2  11 
ATOM   6551  H  HG3  . GLU A 1 10 ? -12.529 -10.734 -0.965  1.00 0.00 ? 10  GLU A HG3  11 
ATOM   6552  N  N    . ASN A 1 11 ? -8.758  -8.760  1.157   1.00 0.00 ? 11  ASN A N    11 
ATOM   6553  C  CA   . ASN A 1 11 ? -8.104  -7.634  1.814   1.00 0.00 ? 11  ASN A CA   11 
ATOM   6554  C  C    . ASN A 1 11 ? -8.463  -6.320  1.127   1.00 0.00 ? 11  ASN A C    11 
ATOM   6555  O  O    . ASN A 1 11 ? -8.540  -6.232  -0.099  1.00 0.00 ? 11  ASN A O    11 
ATOM   6556  C  CB   . ASN A 1 11 ? -6.586  -7.826  1.811   1.00 0.00 ? 11  ASN A CB   11 
ATOM   6557  C  CG   . ASN A 1 11 ? -5.876  -6.837  2.715   1.00 0.00 ? 11  ASN A CG   11 
ATOM   6558  O  OD1  . ASN A 1 11 ? -5.327  -7.211  3.752   1.00 0.00 ? 11  ASN A OD1  11 
ATOM   6559  N  ND2  . ASN A 1 11 ? -5.884  -5.568  2.326   1.00 0.00 ? 11  ASN A ND2  11 
ATOM   6560  H  H    . ASN A 1 11 ? -8.401  -9.089  0.306   1.00 0.00 ? 11  ASN A H    11 
ATOM   6561  H  HA   . ASN A 1 11 ? -8.451  -7.599  2.836   1.00 0.00 ? 11  ASN A HA   11 
ATOM   6562  H  HB2  . ASN A 1 11 ? -6.355  -8.825  2.150   1.00 0.00 ? 11  ASN A HB2  11 
ATOM   6563  H  HB3  . ASN A 1 11 ? -6.215  -7.697  0.805   1.00 0.00 ? 11  ASN A HB3  11 
ATOM   6564  H  HD21 . ASN A 1 11 ? -6.341  -5.343  1.488   1.00 0.00 ? 11  ASN A HD21 11 
ATOM   6565  H  HD22 . ASN A 1 11 ? -5.432  -4.908  2.891   1.00 0.00 ? 11  ASN A HD22 11 
ATOM   6566  N  N    . PRO A 1 12 ? -8.688  -5.272  1.934   1.00 0.00 ? 12  PRO A N    11 
ATOM   6567  C  CA   . PRO A 1 12 ? -9.041  -3.943  1.426   1.00 0.00 ? 12  PRO A CA   11 
ATOM   6568  C  C    . PRO A 1 12 ? -7.877  -3.267  0.711   1.00 0.00 ? 12  PRO A C    11 
ATOM   6569  O  O    . PRO A 1 12 ? -8.019  -2.792  -0.416  1.00 0.00 ? 12  PRO A O    11 
ATOM   6570  C  CB   . PRO A 1 12 ? -9.415  -3.168  2.692   1.00 0.00 ? 12  PRO A CB   11 
ATOM   6571  C  CG   . PRO A 1 12 ? -8.673  -3.852  3.788   1.00 0.00 ? 12  PRO A CG   11 
ATOM   6572  C  CD   . PRO A 1 12 ? -8.614  -5.304  3.404   1.00 0.00 ? 12  PRO A CD   11 
ATOM   6573  H  HA   . PRO A 1 12 ? -9.893  -3.986  0.763   1.00 0.00 ? 12  PRO A HA   11 
ATOM   6574  H  HB2  . PRO A 1 12 ? -9.107  -2.136  2.589   1.00 0.00 ? 12  PRO A HB2  11 
ATOM   6575  H  HB3  . PRO A 1 12 ? -10.482 -3.217  2.847   1.00 0.00 ? 12  PRO A HB3  11 
ATOM   6576  H  HG2  . PRO A 1 12 ? -7.676  -3.444  3.867   1.00 0.00 ? 12  PRO A HG2  11 
ATOM   6577  H  HG3  . PRO A 1 12 ? -9.204  -3.732  4.720   1.00 0.00 ? 12  PRO A HG3  11 
ATOM   6578  H  HD2  . PRO A 1 12 ? -7.685  -5.744  3.734   1.00 0.00 ? 12  PRO A HD2  11 
ATOM   6579  H  HD3  . PRO A 1 12 ? -9.455  -5.839  3.820   1.00 0.00 ? 12  PRO A HD3  11 
ATOM   6580  N  N    . PHE A 1 13 ? -6.725  -3.228  1.372   1.00 0.00 ? 13  PHE A N    11 
ATOM   6581  C  CA   . PHE A 1 13 ? -5.535  -2.609  0.800   1.00 0.00 ? 13  PHE A CA   11 
ATOM   6582  C  C    . PHE A 1 13 ? -4.278  -3.059  1.540   1.00 0.00 ? 13  PHE A C    11 
ATOM   6583  O  O    . PHE A 1 13 ? -4.344  -3.487  2.692   1.00 0.00 ? 13  PHE A O    11 
ATOM   6584  C  CB   . PHE A 1 13 ? -5.652  -1.085  0.850   1.00 0.00 ? 13  PHE A CB   11 
ATOM   6585  C  CG   . PHE A 1 13 ? -6.802  -0.545  0.047   1.00 0.00 ? 13  PHE A CG   11 
ATOM   6586  C  CD1  . PHE A 1 13 ? -6.644  -0.244  -1.296  1.00 0.00 ? 13  PHE A CD1  11 
ATOM   6587  C  CD2  . PHE A 1 13 ? -8.039  -0.340  0.636   1.00 0.00 ? 13  PHE A CD2  11 
ATOM   6588  C  CE1  . PHE A 1 13 ? -7.700  0.253   -2.037  1.00 0.00 ? 13  PHE A CE1  11 
ATOM   6589  C  CE2  . PHE A 1 13 ? -9.098  0.157   -0.100  1.00 0.00 ? 13  PHE A CE2  11 
ATOM   6590  C  CZ   . PHE A 1 13 ? -8.929  0.453   -1.438  1.00 0.00 ? 13  PHE A CZ   11 
ATOM   6591  H  H    . PHE A 1 13 ? -6.674  -3.624  2.268   1.00 0.00 ? 13  PHE A H    11 
ATOM   6592  H  HA   . PHE A 1 13 ? -5.463  -2.922  -0.231  1.00 0.00 ? 13  PHE A HA   11 
ATOM   6593  H  HB2  . PHE A 1 13 ? -5.790  -0.775  1.875   1.00 0.00 ? 13  PHE A HB2  11 
ATOM   6594  H  HB3  . PHE A 1 13 ? -4.743  -0.648  0.465   1.00 0.00 ? 13  PHE A HB3  11 
ATOM   6595  H  HD1  . PHE A 1 13 ? -5.684  -0.401  -1.766  1.00 0.00 ? 13  PHE A HD1  11 
ATOM   6596  H  HD2  . PHE A 1 13 ? -8.173  -0.571  1.683   1.00 0.00 ? 13  PHE A HD2  11 
ATOM   6597  H  HE1  . PHE A 1 13 ? -7.565  0.483   -3.083  1.00 0.00 ? 13  PHE A HE1  11 
ATOM   6598  H  HE2  . PHE A 1 13 ? -10.058 0.312   0.371   1.00 0.00 ? 13  PHE A HE2  11 
ATOM   6599  H  HZ   . PHE A 1 13 ? -9.755  0.842   -2.015  1.00 0.00 ? 13  PHE A HZ   11 
ATOM   6600  N  N    . ILE A 1 14 ? -3.136  -2.959  0.868   1.00 0.00 ? 14  ILE A N    11 
ATOM   6601  C  CA   . ILE A 1 14 ? -1.865  -3.354  1.462   1.00 0.00 ? 14  ILE A CA   11 
ATOM   6602  C  C    . ILE A 1 14 ? -0.721  -2.496  0.932   1.00 0.00 ? 14  ILE A C    11 
ATOM   6603  O  O    . ILE A 1 14 ? -0.682  -2.154  -0.250  1.00 0.00 ? 14  ILE A O    11 
ATOM   6604  C  CB   . ILE A 1 14 ? -1.551  -4.836  1.185   1.00 0.00 ? 14  ILE A CB   11 
ATOM   6605  C  CG1  . ILE A 1 14 ? -2.464  -5.737  2.019   1.00 0.00 ? 14  ILE A CG1  11 
ATOM   6606  C  CG2  . ILE A 1 14 ? -0.089  -5.132  1.483   1.00 0.00 ? 14  ILE A CG2  11 
ATOM   6607  C  CD1  . ILE A 1 14 ? -2.346  -5.505  3.509   1.00 0.00 ? 14  ILE A CD1  11 
ATOM   6608  H  H    . ILE A 1 14 ? -3.148  -2.610  -0.047  1.00 0.00 ? 14  ILE A H    11 
ATOM   6609  H  HA   . ILE A 1 14 ? -1.939  -3.216  2.531   1.00 0.00 ? 14  ILE A HA   11 
ATOM   6610  H  HB   . ILE A 1 14 ? -1.726  -5.028  0.138   1.00 0.00 ? 14  ILE A HB   11 
ATOM   6611  H  HG12 . ILE A 1 14 ? -3.489  -5.561  1.736   1.00 0.00 ? 14  ILE A HG12 11 
ATOM   6612  H  HG13 . ILE A 1 14 ? -2.214  -6.770  1.823   1.00 0.00 ? 14  ILE A HG13 11 
ATOM   6613  H  HG21 . ILE A 1 14 ? 0.476   -5.123  0.563   1.00 0.00 ? 14  ILE A HG21 11 
ATOM   6614  H  HG22 . ILE A 1 14 ? 0.302   -4.379  2.152   1.00 0.00 ? 14  ILE A HG22 11 
ATOM   6615  H  HG23 . ILE A 1 14 ? -0.005  -6.104  1.947   1.00 0.00 ? 14  ILE A HG23 11 
ATOM   6616  H  HD11 . ILE A 1 14 ? -1.523  -4.831  3.704   1.00 0.00 ? 14  ILE A HD11 11 
ATOM   6617  H  HD12 . ILE A 1 14 ? -3.262  -5.069  3.879   1.00 0.00 ? 14  ILE A HD12 11 
ATOM   6618  H  HD13 . ILE A 1 14 ? -2.166  -6.445  4.008   1.00 0.00 ? 14  ILE A HD13 11 
ATOM   6619  N  N    . CYS A 1 15 ? 0.212   -2.153  1.815   1.00 0.00 ? 15  CYS A N    11 
ATOM   6620  C  CA   . CYS A 1 15 ? 1.359   -1.336  1.437   1.00 0.00 ? 15  CYS A CA   11 
ATOM   6621  C  C    . CYS A 1 15 ? 2.408   -2.174  0.711   1.00 0.00 ? 15  CYS A C    11 
ATOM   6622  O  O    . CYS A 1 15 ? 2.832   -3.219  1.204   1.00 0.00 ? 15  CYS A O    11 
ATOM   6623  C  CB   . CYS A 1 15 ? 1.978   -0.686  2.676   1.00 0.00 ? 15  CYS A CB   11 
ATOM   6624  S  SG   . CYS A 1 15 ? 3.292   0.520   2.305   1.00 0.00 ? 15  CYS A SG   11 
ATOM   6625  H  H    . CYS A 1 15 ? 0.126   -2.456  2.744   1.00 0.00 ? 15  CYS A H    11 
ATOM   6626  H  HA   . CYS A 1 15 ? 1.010   -0.562  0.771   1.00 0.00 ? 15  CYS A HA   11 
ATOM   6627  H  HB2  . CYS A 1 15 ? 1.205   -0.169  3.226   1.00 0.00 ? 15  CYS A HB2  11 
ATOM   6628  H  HB3  . CYS A 1 15 ? 2.404   -1.455  3.302   1.00 0.00 ? 15  CYS A HB3  11 
ATOM   6629  N  N    . SER A 1 16 ? 2.822   -1.707  -0.462  1.00 0.00 ? 16  SER A N    11 
ATOM   6630  C  CA   . SER A 1 16 ? 3.818   -2.414  -1.258  1.00 0.00 ? 16  SER A CA   11 
ATOM   6631  C  C    . SER A 1 16 ? 5.230   -2.061  -0.799  1.00 0.00 ? 16  SER A C    11 
ATOM   6632  O  O    . SER A 1 16 ? 6.190   -2.194  -1.556  1.00 0.00 ? 16  SER A O    11 
ATOM   6633  C  CB   . SER A 1 16 ? 3.652   -2.074  -2.741  1.00 0.00 ? 16  SER A CB   11 
ATOM   6634  O  OG   . SER A 1 16 ? 4.385   -2.973  -3.555  1.00 0.00 ? 16  SER A OG   11 
ATOM   6635  H  H    . SER A 1 16 ? 2.446   -0.867  -0.801  1.00 0.00 ? 16  SER A H    11 
ATOM   6636  H  HA   . SER A 1 16 ? 3.661   -3.473  -1.120  1.00 0.00 ? 16  SER A HA   11 
ATOM   6637  H  HB2  . SER A 1 16 ? 2.608   -2.136  -3.007  1.00 0.00 ? 16  SER A HB2  11 
ATOM   6638  H  HB3  . SER A 1 16 ? 4.010   -1.071  -2.919  1.00 0.00 ? 16  SER A HB3  11 
ATOM   6639  H  HG   . SER A 1 16 ? 5.270   -3.078  -3.199  1.00 0.00 ? 16  SER A HG   11 
ATOM   6640  N  N    . GLU A 1 17 ? 5.345   -1.612  0.447   1.00 0.00 ? 17  GLU A N    11 
ATOM   6641  C  CA   . GLU A 1 17 ? 6.639   -1.239  1.006   1.00 0.00 ? 17  GLU A CA   11 
ATOM   6642  C  C    . GLU A 1 17 ? 6.983   -2.112  2.210   1.00 0.00 ? 17  GLU A C    11 
ATOM   6643  O  O    . GLU A 1 17 ? 8.040   -2.742  2.253   1.00 0.00 ? 17  GLU A O    11 
ATOM   6644  C  CB   . GLU A 1 17 ? 6.637   0.235   1.415   1.00 0.00 ? 17  GLU A CB   11 
ATOM   6645  C  CG   . GLU A 1 17 ? 6.360   1.186   0.263   1.00 0.00 ? 17  GLU A CG   11 
ATOM   6646  C  CD   . GLU A 1 17 ? 4.881   1.306   -0.051  1.00 0.00 ? 17  GLU A CD   11 
ATOM   6647  O  OE1  . GLU A 1 17 ? 4.322   0.361   -0.646  1.00 0.00 ? 17  GLU A OE1  11 
ATOM   6648  O  OE2  . GLU A 1 17 ? 4.283   2.345   0.299   1.00 0.00 ? 17  GLU A OE2  11 
ATOM   6649  H  H    . GLU A 1 17 ? 4.542   -1.528  1.001   1.00 0.00 ? 17  GLU A H    11 
ATOM   6650  H  HA   . GLU A 1 17 ? 7.387   -1.390  0.243   1.00 0.00 ? 17  GLU A HA   11 
ATOM   6651  H  HB2  . GLU A 1 17 ? 5.880   0.386   2.171   1.00 0.00 ? 17  GLU A HB2  11 
ATOM   6652  H  HB3  . GLU A 1 17 ? 7.603   0.481   1.833   1.00 0.00 ? 17  GLU A HB3  11 
ATOM   6653  H  HG2  . GLU A 1 17 ? 6.737   2.164   0.522   1.00 0.00 ? 17  GLU A HG2  11 
ATOM   6654  H  HG3  . GLU A 1 17 ? 6.872   0.825   -0.616  1.00 0.00 ? 17  GLU A HG3  11 
ATOM   6655  N  N    . CYS A 1 18 ? 6.082   -2.143  3.187   1.00 0.00 ? 18  CYS A N    11 
ATOM   6656  C  CA   . CYS A 1 18 ? 6.288   -2.937  4.392   1.00 0.00 ? 18  CYS A CA   11 
ATOM   6657  C  C    . CYS A 1 18 ? 5.285   -4.084  4.467   1.00 0.00 ? 18  CYS A C    11 
ATOM   6658  O  O    . CYS A 1 18 ? 5.660   -5.240  4.657   1.00 0.00 ? 18  CYS A O    11 
ATOM   6659  C  CB   . CYS A 1 18 ? 6.164   -2.054  5.636   1.00 0.00 ? 18  CYS A CB   11 
ATOM   6660  S  SG   . CYS A 1 18 ? 4.650   -1.042  5.681   1.00 0.00 ? 18  CYS A SG   11 
ATOM   6661  H  H    . CYS A 1 18 ? 5.258   -1.619  3.095   1.00 0.00 ? 18  CYS A H    11 
ATOM   6662  H  HA   . CYS A 1 18 ? 7.285   -3.349  4.352   1.00 0.00 ? 18  CYS A HA   11 
ATOM   6663  H  HB2  . CYS A 1 18 ? 6.164   -2.683  6.515   1.00 0.00 ? 18  CYS A HB2  11 
ATOM   6664  H  HB3  . CYS A 1 18 ? 7.010   -1.384  5.679   1.00 0.00 ? 18  CYS A HB3  11 
ATOM   6665  N  N    . GLY A 1 19 ? 4.005   -3.755  4.315   1.00 0.00 ? 19  GLY A N    11 
ATOM   6666  C  CA   . GLY A 1 19 ? 2.967   -4.767  4.367   1.00 0.00 ? 19  GLY A CA   11 
ATOM   6667  C  C    . GLY A 1 19 ? 1.870   -4.422  5.354   1.00 0.00 ? 19  GLY A C    11 
ATOM   6668  O  O    . GLY A 1 19 ? 1.364   -5.292  6.062   1.00 0.00 ? 19  GLY A O    11 
ATOM   6669  H  H    . GLY A 1 19 ? 3.765   -2.816  4.165   1.00 0.00 ? 19  GLY A H    11 
ATOM   6670  H  HA2  . GLY A 1 19 ? 2.533   -4.874  3.384   1.00 0.00 ? 19  GLY A HA2  11 
ATOM   6671  H  HA3  . GLY A 1 19 ? 3.413   -5.708  4.658   1.00 0.00 ? 19  GLY A HA3  11 
ATOM   6672  N  N    . LYS A 1 20 ? 1.500   -3.146  5.403   1.00 0.00 ? 20  LYS A N    11 
ATOM   6673  C  CA   . LYS A 1 20 ? 0.456   -2.686  6.309   1.00 0.00 ? 20  LYS A CA   11 
ATOM   6674  C  C    . LYS A 1 20 ? -0.910  -2.725  5.631   1.00 0.00 ? 20  LYS A C    11 
ATOM   6675  O  O    . LYS A 1 20 ? -1.014  -2.578  4.413   1.00 0.00 ? 20  LYS A O    11 
ATOM   6676  C  CB   . LYS A 1 20 ? 0.759   -1.264  6.789   1.00 0.00 ? 20  LYS A CB   11 
ATOM   6677  C  CG   . LYS A 1 20 ? -0.132  -0.805  7.931   1.00 0.00 ? 20  LYS A CG   11 
ATOM   6678  C  CD   . LYS A 1 20 ? 0.503   -1.089  9.282   1.00 0.00 ? 20  LYS A CD   11 
ATOM   6679  C  CE   . LYS A 1 20 ? 0.031   -2.418  9.852   1.00 0.00 ? 20  LYS A CE   11 
ATOM   6680  N  NZ   . LYS A 1 20 ? 1.040   -3.020  10.767  1.00 0.00 ? 20  LYS A NZ   11 
ATOM   6681  H  H    . LYS A 1 20 ? 1.941   -2.498  4.813   1.00 0.00 ? 20  LYS A H    11 
ATOM   6682  H  HA   . LYS A 1 20 ? 0.440   -3.348  7.161   1.00 0.00 ? 20  LYS A HA   11 
ATOM   6683  H  HB2  . LYS A 1 20 ? 1.785   -1.220  7.121   1.00 0.00 ? 20  LYS A HB2  11 
ATOM   6684  H  HB3  . LYS A 1 20 ? 0.627   -0.582  5.961   1.00 0.00 ? 20  LYS A HB3  11 
ATOM   6685  H  HG2  . LYS A 1 20 ? -0.299  0.258   7.841   1.00 0.00 ? 20  LYS A HG2  11 
ATOM   6686  H  HG3  . LYS A 1 20 ? -1.077  -1.326  7.871   1.00 0.00 ? 20  LYS A HG3  11 
ATOM   6687  H  HD2  . LYS A 1 20 ? 1.577   -1.122  9.166   1.00 0.00 ? 20  LYS A HD2  11 
ATOM   6688  H  HD3  . LYS A 1 20 ? 0.237   -0.298  9.969   1.00 0.00 ? 20  LYS A HD3  11 
ATOM   6689  H  HE2  . LYS A 1 20 ? -0.886  -2.255  10.398  1.00 0.00 ? 20  LYS A HE2  11 
ATOM   6690  H  HE3  . LYS A 1 20 ? -0.154  -3.100  9.034   1.00 0.00 ? 20  LYS A HE3  11 
ATOM   6691  H  HZ1  . LYS A 1 20 ? 1.895   -2.429  10.794  1.00 0.00 ? 20  LYS A HZ1  11 
ATOM   6692  H  HZ2  . LYS A 1 20 ? 1.299   -3.971  10.436  1.00 0.00 ? 20  LYS A HZ2  11 
ATOM   6693  H  HZ3  . LYS A 1 20 ? 0.651   -3.094  11.728  1.00 0.00 ? 20  LYS A HZ3  11 
ATOM   6694  N  N    . VAL A 1 21 ? -1.956  -2.921  6.428   1.00 0.00 ? 21  VAL A N    11 
ATOM   6695  C  CA   . VAL A 1 21 ? -3.316  -2.977  5.904   1.00 0.00 ? 21  VAL A CA   11 
ATOM   6696  C  C    . VAL A 1 21 ? -4.140  -1.791  6.391   1.00 0.00 ? 21  VAL A C    11 
ATOM   6697  O  O    . VAL A 1 21 ? -4.079  -1.417  7.562   1.00 0.00 ? 21  VAL A O    11 
ATOM   6698  C  CB   . VAL A 1 21 ? -4.022  -4.282  6.314   1.00 0.00 ? 21  VAL A CB   11 
ATOM   6699  C  CG1  . VAL A 1 21 ? -4.039  -4.428  7.828   1.00 0.00 ? 21  VAL A CG1  11 
ATOM   6700  C  CG2  . VAL A 1 21 ? -5.435  -4.323  5.751   1.00 0.00 ? 21  VAL A CG2  11 
ATOM   6701  H  H    . VAL A 1 21 ? -1.810  -3.031  7.390   1.00 0.00 ? 21  VAL A H    11 
ATOM   6702  H  HA   . VAL A 1 21 ? -3.260  -2.946  4.826   1.00 0.00 ? 21  VAL A HA   11 
ATOM   6703  H  HB   . VAL A 1 21 ? -3.468  -5.113  5.901   1.00 0.00 ? 21  VAL A HB   11 
ATOM   6704  H  HG11 . VAL A 1 21 ? -4.332  -5.434  8.090   1.00 0.00 ? 21  VAL A HG11 11 
ATOM   6705  H  HG12 . VAL A 1 21 ? -3.053  -4.225  8.221   1.00 0.00 ? 21  VAL A HG12 11 
ATOM   6706  H  HG13 . VAL A 1 21 ? -4.745  -3.727  8.249   1.00 0.00 ? 21  VAL A HG13 11 
ATOM   6707  H  HG21 . VAL A 1 21 ? -5.999  -3.485  6.132   1.00 0.00 ? 21  VAL A HG21 11 
ATOM   6708  H  HG22 . VAL A 1 21 ? -5.393  -4.270  4.673   1.00 0.00 ? 21  VAL A HG22 11 
ATOM   6709  H  HG23 . VAL A 1 21 ? -5.915  -5.244  6.048   1.00 0.00 ? 21  VAL A HG23 11 
ATOM   6710  N  N    . PHE A 1 22 ? -4.914  -1.203  5.484   1.00 0.00 ? 22  PHE A N    11 
ATOM   6711  C  CA   . PHE A 1 22 ? -5.752  -0.058  5.820   1.00 0.00 ? 22  PHE A CA   11 
ATOM   6712  C  C    . PHE A 1 22 ? -7.172  -0.250  5.296   1.00 0.00 ? 22  PHE A C    11 
ATOM   6713  O  O    . PHE A 1 22 ? -7.375  -0.743  4.186   1.00 0.00 ? 22  PHE A O    11 
ATOM   6714  C  CB   . PHE A 1 22 ? -5.153  1.227   5.243   1.00 0.00 ? 22  PHE A CB   11 
ATOM   6715  C  CG   . PHE A 1 22 ? -3.773  1.528   5.755   1.00 0.00 ? 22  PHE A CG   11 
ATOM   6716  C  CD1  . PHE A 1 22 ? -2.658  0.980   5.143   1.00 0.00 ? 22  PHE A CD1  11 
ATOM   6717  C  CD2  . PHE A 1 22 ? -3.592  2.359   6.849   1.00 0.00 ? 22  PHE A CD2  11 
ATOM   6718  C  CE1  . PHE A 1 22 ? -1.387  1.254   5.613   1.00 0.00 ? 22  PHE A CE1  11 
ATOM   6719  C  CE2  . PHE A 1 22 ? -2.324  2.637   7.323   1.00 0.00 ? 22  PHE A CE2  11 
ATOM   6720  C  CZ   . PHE A 1 22 ? -1.220  2.085   6.703   1.00 0.00 ? 22  PHE A CZ   11 
ATOM   6721  H  H    . PHE A 1 22 ? -4.920  -1.547  4.566   1.00 0.00 ? 22  PHE A H    11 
ATOM   6722  H  HA   . PHE A 1 22 ? -5.785  0.022   6.896   1.00 0.00 ? 22  PHE A HA   11 
ATOM   6723  H  HB2  . PHE A 1 22 ? -5.095  1.137   4.169   1.00 0.00 ? 22  PHE A HB2  11 
ATOM   6724  H  HB3  . PHE A 1 22 ? -5.791  2.059   5.498   1.00 0.00 ? 22  PHE A HB3  11 
ATOM   6725  H  HD1  . PHE A 1 22 ? -2.787  0.331   4.289   1.00 0.00 ? 22  PHE A HD1  11 
ATOM   6726  H  HD2  . PHE A 1 22 ? -4.455  2.792   7.335   1.00 0.00 ? 22  PHE A HD2  11 
ATOM   6727  H  HE1  . PHE A 1 22 ? -0.526  0.822   5.126   1.00 0.00 ? 22  PHE A HE1  11 
ATOM   6728  H  HE2  . PHE A 1 22 ? -2.197  3.288   8.176   1.00 0.00 ? 22  PHE A HE2  11 
ATOM   6729  H  HZ   . PHE A 1 22 ? -0.228  2.301   7.072   1.00 0.00 ? 22  PHE A HZ   11 
ATOM   6730  N  N    . THR A 1 23 ? -8.152  0.141   6.103   1.00 0.00 ? 23  THR A N    11 
ATOM   6731  C  CA   . THR A 1 23 ? -9.553  0.011   5.723   1.00 0.00 ? 23  THR A CA   11 
ATOM   6732  C  C    . THR A 1 23 ? -9.959  1.100   4.737   1.00 0.00 ? 23  THR A C    11 
ATOM   6733  O  O    . THR A 1 23 ? -10.737 0.857   3.814   1.00 0.00 ? 23  THR A O    11 
ATOM   6734  C  CB   . THR A 1 23 ? -10.478 0.078   6.954   1.00 0.00 ? 23  THR A CB   11 
ATOM   6735  O  OG1  . THR A 1 23 ? -9.987  -0.789  7.983   1.00 0.00 ? 23  THR A OG1  11 
ATOM   6736  C  CG2  . THR A 1 23 ? -11.899 -0.319  6.585   1.00 0.00 ? 23  THR A CG2  11 
ATOM   6737  H  H    . THR A 1 23 ? -7.927  0.526   6.976   1.00 0.00 ? 23  THR A H    11 
ATOM   6738  H  HA   . THR A 1 23 ? -9.683  -0.954  5.254   1.00 0.00 ? 23  THR A HA   11 
ATOM   6739  H  HB   . THR A 1 23 ? -10.487 1.093   7.323   1.00 0.00 ? 23  THR A HB   11 
ATOM   6740  H  HG1  . THR A 1 23 ? -9.457  -1.485  7.589   1.00 0.00 ? 23  THR A HG1  11 
ATOM   6741  H  HG21 . THR A 1 23 ? -12.294 0.386   5.868   1.00 0.00 ? 23  THR A HG21 11 
ATOM   6742  H  HG22 . THR A 1 23 ? -12.516 -0.314  7.471   1.00 0.00 ? 23  THR A HG22 11 
ATOM   6743  H  HG23 . THR A 1 23 ? -11.896 -1.308  6.153   1.00 0.00 ? 23  THR A HG23 11 
ATOM   6744  N  N    . HIS A 1 24 ? -9.427  2.301   4.937   1.00 0.00 ? 24  HIS A N    11 
ATOM   6745  C  CA   . HIS A 1 24 ? -9.734  3.428   4.063   1.00 0.00 ? 24  HIS A CA   11 
ATOM   6746  C  C    . HIS A 1 24 ? -8.512  3.825   3.239   1.00 0.00 ? 24  HIS A C    11 
ATOM   6747  O  O    . HIS A 1 24 ? -7.506  4.283   3.782   1.00 0.00 ? 24  HIS A O    11 
ATOM   6748  C  CB   . HIS A 1 24 ? -10.217 4.622   4.887   1.00 0.00 ? 24  HIS A CB   11 
ATOM   6749  C  CG   . HIS A 1 24 ? -11.180 5.505   4.154   1.00 0.00 ? 24  HIS A CG   11 
ATOM   6750  N  ND1  . HIS A 1 24 ? -10.787 6.611   3.431   1.00 0.00 ? 24  HIS A ND1  11 
ATOM   6751  C  CD2  . HIS A 1 24 ? -12.527 5.438   4.033   1.00 0.00 ? 24  HIS A CD2  11 
ATOM   6752  C  CE1  . HIS A 1 24 ? -11.850 7.188   2.899   1.00 0.00 ? 24  HIS A CE1  11 
ATOM   6753  N  NE2  . HIS A 1 24 ? -12.918 6.495   3.249   1.00 0.00 ? 24  HIS A NE2  11 
ATOM   6754  H  H    . HIS A 1 24 ? -8.814  2.433   5.690   1.00 0.00 ? 24  HIS A H    11 
ATOM   6755  H  HA   . HIS A 1 24 ? -10.521 3.123   3.392   1.00 0.00 ? 24  HIS A HA   11 
ATOM   6756  H  HB2  . HIS A 1 24 ? -10.711 4.261   5.777   1.00 0.00 ? 24  HIS A HB2  11 
ATOM   6757  H  HB3  . HIS A 1 24 ? -9.366  5.224   5.172   1.00 0.00 ? 24  HIS A HB3  11 
ATOM   6758  H  HD1  . HIS A 1 24 ? -9.866  6.928   3.326   1.00 0.00 ? 24  HIS A HD1  11 
ATOM   6759  H  HD2  . HIS A 1 24 ? -13.174 4.692   4.472   1.00 0.00 ? 24  HIS A HD2  11 
ATOM   6760  H  HE1  . HIS A 1 24 ? -11.846 8.074   2.283   1.00 0.00 ? 24  HIS A HE1  11 
ATOM   6761  N  N    . LYS A 1 25 ? -8.607  3.645   1.926   1.00 0.00 ? 25  LYS A N    11 
ATOM   6762  C  CA   . LYS A 1 25 ? -7.511  3.984   1.026   1.00 0.00 ? 25  LYS A CA   11 
ATOM   6763  C  C    . LYS A 1 25 ? -6.753  5.208   1.529   1.00 0.00 ? 25  LYS A C    11 
ATOM   6764  O  O    . LYS A 1 25 ? -5.522  5.218   1.566   1.00 0.00 ? 25  LYS A O    11 
ATOM   6765  C  CB   . LYS A 1 25 ? -8.044  4.245   -0.384  1.00 0.00 ? 25  LYS A CB   11 
ATOM   6766  C  CG   . LYS A 1 25 ? -6.970  4.204   -1.457  1.00 0.00 ? 25  LYS A CG   11 
ATOM   6767  C  CD   . LYS A 1 25 ? -7.575  4.152   -2.850  1.00 0.00 ? 25  LYS A CD   11 
ATOM   6768  C  CE   . LYS A 1 25 ? -6.501  4.190   -3.927  1.00 0.00 ? 25  LYS A CE   11 
ATOM   6769  N  NZ   . LYS A 1 25 ? -5.927  5.554   -4.089  1.00 0.00 ? 25  LYS A NZ   11 
ATOM   6770  H  H    . LYS A 1 25 ? -9.435  3.276   1.553   1.00 0.00 ? 25  LYS A H    11 
ATOM   6771  H  HA   . LYS A 1 25 ? -6.834  3.143   0.997   1.00 0.00 ? 25  LYS A HA   11 
ATOM   6772  H  HB2  . LYS A 1 25 ? -8.787  3.497   -0.619  1.00 0.00 ? 25  LYS A HB2  11 
ATOM   6773  H  HB3  . LYS A 1 25 ? -8.508  5.220   -0.406  1.00 0.00 ? 25  LYS A HB3  11 
ATOM   6774  H  HG2  . LYS A 1 25 ? -6.358  5.090   -1.376  1.00 0.00 ? 25  LYS A HG2  11 
ATOM   6775  H  HG3  . LYS A 1 25 ? -6.357  3.326   -1.308  1.00 0.00 ? 25  LYS A HG3  11 
ATOM   6776  H  HD2  . LYS A 1 25 ? -8.140  3.237   -2.954  1.00 0.00 ? 25  LYS A HD2  11 
ATOM   6777  H  HD3  . LYS A 1 25 ? -8.232  5.000   -2.980  1.00 0.00 ? 25  LYS A HD3  11 
ATOM   6778  H  HE2  . LYS A 1 25 ? -5.711  3.507   -3.653  1.00 0.00 ? 25  LYS A HE2  11 
ATOM   6779  H  HE3  . LYS A 1 25 ? -6.938  3.878   -4.864  1.00 0.00 ? 25  LYS A HE3  11 
ATOM   6780  H  HZ1  . LYS A 1 25 ? -5.244  5.563   -4.873  1.00 0.00 ? 25  LYS A HZ1  11 
ATOM   6781  H  HZ2  . LYS A 1 25 ? -5.441  5.843   -3.216  1.00 0.00 ? 25  LYS A HZ2  11 
ATOM   6782  H  HZ3  . LYS A 1 25 ? -6.683  6.238   -4.295  1.00 0.00 ? 25  LYS A HZ3  11 
ATOM   6783  N  N    . THR A 1 26 ? -7.495  6.240   1.917   1.00 0.00 ? 26  THR A N    11 
ATOM   6784  C  CA   . THR A 1 26 ? -6.893  7.470   2.418   1.00 0.00 ? 26  THR A CA   11 
ATOM   6785  C  C    . THR A 1 26 ? -5.853  7.174   3.492   1.00 0.00 ? 26  THR A C    11 
ATOM   6786  O  O    . THR A 1 26 ? -4.736  7.689   3.446   1.00 0.00 ? 26  THR A O    11 
ATOM   6787  C  CB   . THR A 1 26 ? -7.957  8.421   2.998   1.00 0.00 ? 26  THR A CB   11 
ATOM   6788  O  OG1  . THR A 1 26 ? -9.007  8.621   2.045   1.00 0.00 ? 26  THR A OG1  11 
ATOM   6789  C  CG2  . THR A 1 26 ? -7.341  9.760   3.371   1.00 0.00 ? 26  THR A CG2  11 
ATOM   6790  H  H    . THR A 1 26 ? -8.471  6.172   1.864   1.00 0.00 ? 26  THR A H    11 
ATOM   6791  H  HA   . THR A 1 26 ? -6.410  7.966   1.589   1.00 0.00 ? 26  THR A HA   11 
ATOM   6792  H  HB   . THR A 1 26 ? -8.372  7.972   3.889   1.00 0.00 ? 26  THR A HB   11 
ATOM   6793  H  HG1  . THR A 1 26 ? -9.851  8.655   2.501   1.00 0.00 ? 26  THR A HG1  11 
ATOM   6794  H  HG21 . THR A 1 26 ? -7.414  10.436  2.532   1.00 0.00 ? 26  THR A HG21 11 
ATOM   6795  H  HG22 . THR A 1 26 ? -6.301  9.619   3.628   1.00 0.00 ? 26  THR A HG22 11 
ATOM   6796  H  HG23 . THR A 1 26 ? -7.868  10.177  4.216   1.00 0.00 ? 26  THR A HG23 11 
ATOM   6797  N  N    . ASN A 1 27 ? -6.226  6.342   4.458   1.00 0.00 ? 27  ASN A N    11 
ATOM   6798  C  CA   . ASN A 1 27 ? -5.324  5.978   5.545   1.00 0.00 ? 27  ASN A CA   11 
ATOM   6799  C  C    . ASN A 1 27 ? -4.031  5.378   5.000   1.00 0.00 ? 27  ASN A C    11 
ATOM   6800  O  O    . ASN A 1 27 ? -2.936  5.738   5.434   1.00 0.00 ? 27  ASN A O    11 
ATOM   6801  C  CB   . ASN A 1 27 ? -6.003  4.982   6.488   1.00 0.00 ? 27  ASN A CB   11 
ATOM   6802  C  CG   . ASN A 1 27 ? -5.477  5.079   7.907   1.00 0.00 ? 27  ASN A CG   11 
ATOM   6803  O  OD1  . ASN A 1 27 ? -6.239  5.289   8.851   1.00 0.00 ? 27  ASN A OD1  11 
ATOM   6804  N  ND2  . ASN A 1 27 ? -4.167  4.925   8.064   1.00 0.00 ? 27  ASN A ND2  11 
ATOM   6805  H  H    . ASN A 1 27 ? -7.130  5.963   4.441   1.00 0.00 ? 27  ASN A H    11 
ATOM   6806  H  HA   . ASN A 1 27 ? -5.087  6.876   6.094   1.00 0.00 ? 27  ASN A HA   11 
ATOM   6807  H  HB2  . ASN A 1 27 ? -7.065  5.179   6.505   1.00 0.00 ? 27  ASN A HB2  11 
ATOM   6808  H  HB3  . ASN A 1 27 ? -5.832  3.979   6.127   1.00 0.00 ? 27  ASN A HB3  11 
ATOM   6809  H  HD21 . ASN A 1 27 ? -3.621  4.760   7.266   1.00 0.00 ? 27  ASN A HD21 11 
ATOM   6810  H  HD22 . ASN A 1 27 ? -3.800  4.982   8.970   1.00 0.00 ? 27  ASN A HD22 11 
ATOM   6811  N  N    . LEU A 1 28 ? -4.165  4.463   4.047   1.00 0.00 ? 28  LEU A N    11 
ATOM   6812  C  CA   . LEU A 1 28 ? -3.008  3.813   3.441   1.00 0.00 ? 28  LEU A CA   11 
ATOM   6813  C  C    . LEU A 1 28 ? -2.074  4.841   2.812   1.00 0.00 ? 28  LEU A C    11 
ATOM   6814  O  O    . LEU A 1 28 ? -0.859  4.795   3.011   1.00 0.00 ? 28  LEU A O    11 
ATOM   6815  C  CB   . LEU A 1 28 ? -3.460  2.804   2.385   1.00 0.00 ? 28  LEU A CB   11 
ATOM   6816  C  CG   . LEU A 1 28 ? -2.419  2.424   1.331   1.00 0.00 ? 28  LEU A CG   11 
ATOM   6817  C  CD1  . LEU A 1 28 ? -1.287  1.628   1.960   1.00 0.00 ? 28  LEU A CD1  11 
ATOM   6818  C  CD2  . LEU A 1 28 ? -3.066  1.634   0.203   1.00 0.00 ? 28  LEU A CD2  11 
ATOM   6819  H  H    . LEU A 1 28 ? -5.063  4.217   3.742   1.00 0.00 ? 28  LEU A H    11 
ATOM   6820  H  HA   . LEU A 1 28 ? -2.475  3.291   4.222   1.00 0.00 ? 28  LEU A HA   11 
ATOM   6821  H  HB2  . LEU A 1 28 ? -3.757  1.901   2.896   1.00 0.00 ? 28  LEU A HB2  11 
ATOM   6822  H  HB3  . LEU A 1 28 ? -4.314  3.223   1.872   1.00 0.00 ? 28  LEU A HB3  11 
ATOM   6823  H  HG   . LEU A 1 28 ? -1.997  3.326   0.909   1.00 0.00 ? 28  LEU A HG   11 
ATOM   6824  H  HD11 . LEU A 1 28 ? -0.429  2.268   2.098   1.00 0.00 ? 28  LEU A HD11 11 
ATOM   6825  H  HD12 . LEU A 1 28 ? -1.022  0.805   1.313   1.00 0.00 ? 28  LEU A HD12 11 
ATOM   6826  H  HD13 . LEU A 1 28 ? -1.607  1.243   2.918   1.00 0.00 ? 28  LEU A HD13 11 
ATOM   6827  H  HD21 . LEU A 1 28 ? -3.276  2.295   -0.626  1.00 0.00 ? 28  LEU A HD21 11 
ATOM   6828  H  HD22 . LEU A 1 28 ? -3.988  1.194   0.554   1.00 0.00 ? 28  LEU A HD22 11 
ATOM   6829  H  HD23 . LEU A 1 28 ? -2.395  0.852   -0.121  1.00 0.00 ? 28  LEU A HD23 11 
ATOM   6830  N  N    . ILE A 1 29 ? -2.648  5.769   2.054   1.00 0.00 ? 29  ILE A N    11 
ATOM   6831  C  CA   . ILE A 1 29 ? -1.867  6.811   1.399   1.00 0.00 ? 29  ILE A CA   11 
ATOM   6832  C  C    . ILE A 1 29 ? -1.055  7.609   2.413   1.00 0.00 ? 29  ILE A C    11 
ATOM   6833  O  O    . ILE A 1 29 ? 0.114   7.921   2.180   1.00 0.00 ? 29  ILE A O    11 
ATOM   6834  C  CB   . ILE A 1 29 ? -2.768  7.776   0.606   1.00 0.00 ? 29  ILE A CB   11 
ATOM   6835  C  CG1  . ILE A 1 29 ? -3.597  7.004   -0.423  1.00 0.00 ? 29  ILE A CG1  11 
ATOM   6836  C  CG2  . ILE A 1 29 ? -1.928  8.845   -0.077  1.00 0.00 ? 29  ILE A CG2  11 
ATOM   6837  C  CD1  . ILE A 1 29 ? -4.734  7.811   -1.010  1.00 0.00 ? 29  ILE A CD1  11 
ATOM   6838  H  H    . ILE A 1 29 ? -3.620  5.754   1.934   1.00 0.00 ? 29  ILE A H    11 
ATOM   6839  H  HA   . ILE A 1 29 ? -1.188  6.333   0.707   1.00 0.00 ? 29  ILE A HA   11 
ATOM   6840  H  HB   . ILE A 1 29 ? -3.434  8.264   1.301   1.00 0.00 ? 29  ILE A HB   11 
ATOM   6841  H  HG12 . ILE A 1 29 ? -2.956  6.697   -1.235  1.00 0.00 ? 29  ILE A HG12 11 
ATOM   6842  H  HG13 . ILE A 1 29 ? -4.019  6.129   0.049   1.00 0.00 ? 29  ILE A HG13 11 
ATOM   6843  H  HG21 . ILE A 1 29 ? -1.139  9.162   0.589   1.00 0.00 ? 29  ILE A HG21 11 
ATOM   6844  H  HG22 . ILE A 1 29 ? -1.494  8.440   -0.979  1.00 0.00 ? 29  ILE A HG22 11 
ATOM   6845  H  HG23 . ILE A 1 29 ? -2.552  9.690   -0.324  1.00 0.00 ? 29  ILE A HG23 11 
ATOM   6846  H  HD11 . ILE A 1 29 ? -5.259  7.213   -1.742  1.00 0.00 ? 29  ILE A HD11 11 
ATOM   6847  H  HD12 . ILE A 1 29 ? -5.417  8.097   -0.224  1.00 0.00 ? 29  ILE A HD12 11 
ATOM   6848  H  HD13 . ILE A 1 29 ? -4.340  8.696   -1.486  1.00 0.00 ? 29  ILE A HD13 11 
ATOM   6849  N  N    . ILE A 1 30 ? -1.681  7.935   3.539   1.00 0.00 ? 30  ILE A N    11 
ATOM   6850  C  CA   . ILE A 1 30 ? -1.015  8.695   4.590   1.00 0.00 ? 30  ILE A CA   11 
ATOM   6851  C  C    . ILE A 1 30 ? 0.206   7.949   5.117   1.00 0.00 ? 30  ILE A C    11 
ATOM   6852  O  O    . ILE A 1 30 ? 1.277   8.533   5.288   1.00 0.00 ? 30  ILE A O    11 
ATOM   6853  C  CB   . ILE A 1 30 ? -1.969  8.988   5.763   1.00 0.00 ? 30  ILE A CB   11 
ATOM   6854  C  CG1  . ILE A 1 30 ? -3.169  9.806   5.281   1.00 0.00 ? 30  ILE A CG1  11 
ATOM   6855  C  CG2  . ILE A 1 30 ? -1.233  9.722   6.874   1.00 0.00 ? 30  ILE A CG2  11 
ATOM   6856  C  CD1  . ILE A 1 30 ? -4.274  9.920   6.306   1.00 0.00 ? 30  ILE A CD1  11 
ATOM   6857  H  H    . ILE A 1 30 ? -2.612  7.658   3.666   1.00 0.00 ? 30  ILE A H    11 
ATOM   6858  H  HA   . ILE A 1 30 ? -0.695  9.636   4.168   1.00 0.00 ? 30  ILE A HA   11 
ATOM   6859  H  HB   . ILE A 1 30 ? -2.319  8.046   6.157   1.00 0.00 ? 30  ILE A HB   11 
ATOM   6860  H  HG12 . ILE A 1 30 ? -2.841  10.804  5.035   1.00 0.00 ? 30  ILE A HG12 11 
ATOM   6861  H  HG13 . ILE A 1 30 ? -3.581  9.340   4.397   1.00 0.00 ? 30  ILE A HG13 11 
ATOM   6862  H  HG21 . ILE A 1 30 ? -0.433  9.100   7.248   1.00 0.00 ? 30  ILE A HG21 11 
ATOM   6863  H  HG22 . ILE A 1 30 ? -0.821  10.641  6.486   1.00 0.00 ? 30  ILE A HG22 11 
ATOM   6864  H  HG23 . ILE A 1 30 ? -1.920  9.945   7.676   1.00 0.00 ? 30  ILE A HG23 11 
ATOM   6865  H  HD11 . ILE A 1 30 ? -4.572  8.931   6.625   1.00 0.00 ? 30  ILE A HD11 11 
ATOM   6866  H  HD12 . ILE A 1 30 ? -3.919  10.480  7.159   1.00 0.00 ? 30  ILE A HD12 11 
ATOM   6867  H  HD13 . ILE A 1 30 ? -5.121  10.427  5.869   1.00 0.00 ? 30  ILE A HD13 11 
ATOM   6868  N  N    . HIS A 1 31 ? 0.039   6.655   5.372   1.00 0.00 ? 31  HIS A N    11 
ATOM   6869  C  CA   . HIS A 1 31 ? 1.129   5.829   5.877   1.00 0.00 ? 31  HIS A CA   11 
ATOM   6870  C  C    . HIS A 1 31 ? 2.261   5.739   4.858   1.00 0.00 ? 31  HIS A C    11 
ATOM   6871  O  O    . HIS A 1 31 ? 3.436   5.840   5.212   1.00 0.00 ? 31  HIS A O    11 
ATOM   6872  C  CB   . HIS A 1 31 ? 0.620   4.427   6.216   1.00 0.00 ? 31  HIS A CB   11 
ATOM   6873  C  CG   . HIS A 1 31 ? 1.656   3.358   6.053   1.00 0.00 ? 31  HIS A CG   11 
ATOM   6874  N  ND1  . HIS A 1 31 ? 2.237   2.704   7.119   1.00 0.00 ? 31  HIS A ND1  11 
ATOM   6875  C  CD2  . HIS A 1 31 ? 2.214   2.827   4.939   1.00 0.00 ? 31  HIS A CD2  11 
ATOM   6876  C  CE1  . HIS A 1 31 ? 3.108   1.820   6.669   1.00 0.00 ? 31  HIS A CE1  11 
ATOM   6877  N  NE2  . HIS A 1 31 ? 3.113   1.874   5.349   1.00 0.00 ? 31  HIS A NE2  11 
ATOM   6878  H  H    . HIS A 1 31 ? -0.838  6.247   5.215   1.00 0.00 ? 31  HIS A H    11 
ATOM   6879  H  HA   . HIS A 1 31 ? 1.507   6.291   6.776   1.00 0.00 ? 31  HIS A HA   11 
ATOM   6880  H  HB2  . HIS A 1 31 ? 0.286   4.411   7.242   1.00 0.00 ? 31  HIS A HB2  11 
ATOM   6881  H  HB3  . HIS A 1 31 ? -0.211  4.187   5.568   1.00 0.00 ? 31  HIS A HB3  11 
ATOM   6882  H  HD1  . HIS A 1 31 ? 2.041   2.866   8.065   1.00 0.00 ? 31  HIS A HD1  11 
ATOM   6883  H  HD2  . HIS A 1 31 ? 1.993   3.103   3.917   1.00 0.00 ? 31  HIS A HD2  11 
ATOM   6884  H  HE1  . HIS A 1 31 ? 3.714   1.163   7.275   1.00 0.00 ? 31  HIS A HE1  11 
ATOM   6885  N  N    . GLN A 1 32 ? 1.899   5.548   3.594   1.00 0.00 ? 32  GLN A N    11 
ATOM   6886  C  CA   . GLN A 1 32 ? 2.885   5.444   2.525   1.00 0.00 ? 32  GLN A CA   11 
ATOM   6887  C  C    . GLN A 1 32 ? 3.886   6.593   2.593   1.00 0.00 ? 32  GLN A C    11 
ATOM   6888  O  O    . GLN A 1 32 ? 4.981   6.510   2.036   1.00 0.00 ? 32  GLN A O    11 
ATOM   6889  C  CB   . GLN A 1 32 ? 2.191   5.437   1.161   1.00 0.00 ? 32  GLN A CB   11 
ATOM   6890  C  CG   . GLN A 1 32 ? 1.394   4.171   0.890   1.00 0.00 ? 32  GLN A CG   11 
ATOM   6891  C  CD   . GLN A 1 32 ? 0.476   4.304   -0.309  1.00 0.00 ? 32  GLN A CD   11 
ATOM   6892  O  OE1  . GLN A 1 32 ? 0.347   5.383   -0.889  1.00 0.00 ? 32  GLN A OE1  11 
ATOM   6893  N  NE2  . GLN A 1 32 ? -0.167  3.206   -0.687  1.00 0.00 ? 32  GLN A NE2  11 
ATOM   6894  H  H    . GLN A 1 32 ? 0.947   5.476   3.375   1.00 0.00 ? 32  GLN A H    11 
ATOM   6895  H  HA   . GLN A 1 32 ? 3.415   4.513   2.653   1.00 0.00 ? 32  GLN A HA   11 
ATOM   6896  H  HB2  . GLN A 1 32 ? 1.517   6.279   1.109   1.00 0.00 ? 32  GLN A HB2  11 
ATOM   6897  H  HB3  . GLN A 1 32 ? 2.939   5.537   0.389   1.00 0.00 ? 32  GLN A HB3  11 
ATOM   6898  H  HG2  . GLN A 1 32 ? 2.083   3.359   0.708   1.00 0.00 ? 32  GLN A HG2  11 
ATOM   6899  H  HG3  . GLN A 1 32 ? 0.796   3.945   1.761   1.00 0.00 ? 32  GLN A HG3  11 
ATOM   6900  H  HE21 . GLN A 1 32 ? -0.016  2.383   -0.176  1.00 0.00 ? 32  GLN A HE21 11 
ATOM   6901  H  HE22 . GLN A 1 32 ? -0.767  3.264   -1.458  1.00 0.00 ? 32  GLN A HE22 11 
ATOM   6902  N  N    . LYS A 1 33 ? 3.504   7.664   3.280   1.00 0.00 ? 33  LYS A N    11 
ATOM   6903  C  CA   . LYS A 1 33 ? 4.367   8.830   3.423   1.00 0.00 ? 33  LYS A CA   11 
ATOM   6904  C  C    . LYS A 1 33 ? 5.707   8.442   4.039   1.00 0.00 ? 33  LYS A C    11 
ATOM   6905  O  O    . LYS A 1 33 ? 6.728   9.079   3.778   1.00 0.00 ? 33  LYS A O    11 
ATOM   6906  C  CB   . LYS A 1 33 ? 3.685   9.892   4.287   1.00 0.00 ? 33  LYS A CB   11 
ATOM   6907  C  CG   . LYS A 1 33 ? 2.379   10.404  3.705   1.00 0.00 ? 33  LYS A CG   11 
ATOM   6908  C  CD   . LYS A 1 33 ? 2.615   11.521  2.702   1.00 0.00 ? 33  LYS A CD   11 
ATOM   6909  C  CE   . LYS A 1 33 ? 1.479   11.615  1.695   1.00 0.00 ? 33  LYS A CE   11 
ATOM   6910  N  NZ   . LYS A 1 33 ? 1.430   12.950  1.037   1.00 0.00 ? 33  LYS A NZ   11 
ATOM   6911  H  H    . LYS A 1 33 ? 2.618   7.670   3.702   1.00 0.00 ? 33  LYS A H    11 
ATOM   6912  H  HA   . LYS A 1 33 ? 4.541   9.236   2.438   1.00 0.00 ? 33  LYS A HA   11 
ATOM   6913  H  HB2  . LYS A 1 33 ? 3.480   9.471   5.260   1.00 0.00 ? 33  LYS A HB2  11 
ATOM   6914  H  HB3  . LYS A 1 33 ? 4.356   10.731  4.402   1.00 0.00 ? 33  LYS A HB3  11 
ATOM   6915  H  HG2  . LYS A 1 33 ? 1.873   9.589   3.207   1.00 0.00 ? 33  LYS A HG2  11 
ATOM   6916  H  HG3  . LYS A 1 33 ? 1.759   10.777  4.507   1.00 0.00 ? 33  LYS A HG3  11 
ATOM   6917  H  HD2  . LYS A 1 33 ? 2.689   12.459  3.232   1.00 0.00 ? 33  LYS A HD2  11 
ATOM   6918  H  HD3  . LYS A 1 33 ? 3.538   11.330  2.174   1.00 0.00 ? 33  LYS A HD3  11 
ATOM   6919  H  HE2  . LYS A 1 33 ? 1.621   10.857  0.940   1.00 0.00 ? 33  LYS A HE2  11 
ATOM   6920  H  HE3  . LYS A 1 33 ? 0.545   11.442  2.208   1.00 0.00 ? 33  LYS A HE3  11 
ATOM   6921  H  HZ1  . LYS A 1 33 ? 1.890   13.663  1.639   1.00 0.00 ? 33  LYS A HZ1  11 
ATOM   6922  H  HZ2  . LYS A 1 33 ? 0.442   13.233  0.877   1.00 0.00 ? 33  LYS A HZ2  11 
ATOM   6923  H  HZ3  . LYS A 1 33 ? 1.922   12.916  0.122   1.00 0.00 ? 33  LYS A HZ3  11 
ATOM   6924  N  N    . ILE A 1 34 ? 5.697   7.394   4.856   1.00 0.00 ? 34  ILE A N    11 
ATOM   6925  C  CA   . ILE A 1 34 ? 6.912   6.921   5.506   1.00 0.00 ? 34  ILE A CA   11 
ATOM   6926  C  C    . ILE A 1 34 ? 7.841   6.240   4.507   1.00 0.00 ? 34  ILE A C    11 
ATOM   6927  O  O    . ILE A 1 34 ? 8.993   5.936   4.820   1.00 0.00 ? 34  ILE A O    11 
ATOM   6928  C  CB   . ILE A 1 34 ? 6.594   5.936   6.647   1.00 0.00 ? 34  ILE A CB   11 
ATOM   6929  C  CG1  . ILE A 1 34 ? 6.194   4.573   6.076   1.00 0.00 ? 34  ILE A CG1  11 
ATOM   6930  C  CG2  . ILE A 1 34 ? 5.488   6.490   7.532   1.00 0.00 ? 34  ILE A CG2  11 
ATOM   6931  C  CD1  . ILE A 1 34 ? 5.981   3.514   7.135   1.00 0.00 ? 34  ILE A CD1  11 
ATOM   6932  H  H    . ILE A 1 34 ? 4.852   6.928   5.024   1.00 0.00 ? 34  ILE A H    11 
ATOM   6933  H  HA   . ILE A 1 34 ? 7.419   7.777   5.928   1.00 0.00 ? 34  ILE A HA   11 
ATOM   6934  H  HB   . ILE A 1 34 ? 7.481   5.819   7.250   1.00 0.00 ? 34  ILE A HB   11 
ATOM   6935  H  HG12 . ILE A 1 34 ? 5.274   4.678   5.522   1.00 0.00 ? 34  ILE A HG12 11 
ATOM   6936  H  HG13 . ILE A 1 34 ? 6.972   4.227   5.411   1.00 0.00 ? 34  ILE A HG13 11 
ATOM   6937  H  HG21 . ILE A 1 34 ? 4.689   6.873   6.914   1.00 0.00 ? 34  ILE A HG21 11 
ATOM   6938  H  HG22 . ILE A 1 34 ? 5.106   5.704   8.166   1.00 0.00 ? 34  ILE A HG22 11 
ATOM   6939  H  HG23 . ILE A 1 34 ? 5.882   7.287   8.144   1.00 0.00 ? 34  ILE A HG23 11 
ATOM   6940  H  HD11 . ILE A 1 34 ? 6.618   2.666   6.929   1.00 0.00 ? 34  ILE A HD11 11 
ATOM   6941  H  HD12 . ILE A 1 34 ? 6.226   3.920   8.105   1.00 0.00 ? 34  ILE A HD12 11 
ATOM   6942  H  HD13 . ILE A 1 34 ? 4.949   3.198   7.126   1.00 0.00 ? 34  ILE A HD13 11 
ATOM   6943  N  N    . HIS A 1 35 ? 7.334   6.006   3.301   1.00 0.00 ? 35  HIS A N    11 
ATOM   6944  C  CA   . HIS A 1 35 ? 8.120   5.364   2.253   1.00 0.00 ? 35  HIS A CA   11 
ATOM   6945  C  C    . HIS A 1 35 ? 8.344   6.315   1.081   1.00 0.00 ? 35  HIS A C    11 
ATOM   6946  O  O    . HIS A 1 35 ? 8.663   5.886   -0.029  1.00 0.00 ? 35  HIS A O    11 
ATOM   6947  C  CB   . HIS A 1 35 ? 7.420   4.094   1.767   1.00 0.00 ? 35  HIS A CB   11 
ATOM   6948  C  CG   . HIS A 1 35 ? 7.038   3.160   2.874   1.00 0.00 ? 35  HIS A CG   11 
ATOM   6949  N  ND1  . HIS A 1 35 ? 7.962   2.447   3.610   1.00 0.00 ? 35  HIS A ND1  11 
ATOM   6950  C  CD2  . HIS A 1 35 ? 5.825   2.824   3.371   1.00 0.00 ? 35  HIS A CD2  11 
ATOM   6951  C  CE1  . HIS A 1 35 ? 7.332   1.713   4.510   1.00 0.00 ? 35  HIS A CE1  11 
ATOM   6952  N  NE2  . HIS A 1 35 ? 6.034   1.924   4.386   1.00 0.00 ? 35  HIS A NE2  11 
ATOM   6953  H  H    . HIS A 1 35 ? 6.411   6.271   3.111   1.00 0.00 ? 35  HIS A H    11 
ATOM   6954  H  HA   . HIS A 1 35 ? 9.078   5.098   2.672   1.00 0.00 ? 35  HIS A HA   11 
ATOM   6955  H  HB2  . HIS A 1 35 ? 6.519   4.367   1.239   1.00 0.00 ? 35  HIS A HB2  11 
ATOM   6956  H  HB3  . HIS A 1 35 ? 8.079   3.562   1.095   1.00 0.00 ? 35  HIS A HB3  11 
ATOM   6957  H  HD1  . HIS A 1 35 ? 8.933   2.475   3.489   1.00 0.00 ? 35  HIS A HD1  11 
ATOM   6958  H  HD2  . HIS A 1 35 ? 4.868   3.195   3.031   1.00 0.00 ? 35  HIS A HD2  11 
ATOM   6959  H  HE1  . HIS A 1 35 ? 7.799   1.053   5.226   1.00 0.00 ? 35  HIS A HE1  11 
ATOM   6960  N  N    . THR A 1 36 ? 8.173   7.609   1.334   1.00 0.00 ? 36  THR A N    11 
ATOM   6961  C  CA   . THR A 1 36 ? 8.355   8.620   0.301   1.00 0.00 ? 36  THR A CA   11 
ATOM   6962  C  C    . THR A 1 36 ? 9.299   9.721   0.769   1.00 0.00 ? 36  THR A C    11 
ATOM   6963  O  O    . THR A 1 36 ? 9.092   10.897  0.474   1.00 0.00 ? 36  THR A O    11 
ATOM   6964  C  CB   . THR A 1 36 ? 7.011   9.252   -0.109  1.00 0.00 ? 36  THR A CB   11 
ATOM   6965  O  OG1  . THR A 1 36 ? 6.427   9.930   1.010   1.00 0.00 ? 36  THR A OG1  11 
ATOM   6966  C  CG2  . THR A 1 36 ? 6.049   8.192   -0.624  1.00 0.00 ? 36  THR A CG2  11 
ATOM   6967  H  H    . THR A 1 36 ? 7.919   7.888   2.238   1.00 0.00 ? 36  THR A H    11 
ATOM   6968  H  HA   . THR A 1 36 ? 8.781   8.138   -0.567  1.00 0.00 ? 36  THR A HA   11 
ATOM   6969  H  HB   . THR A 1 36 ? 7.192   9.967   -0.899  1.00 0.00 ? 36  THR A HB   11 
ATOM   6970  H  HG1  . THR A 1 36 ? 5.523   10.174  0.799   1.00 0.00 ? 36  THR A HG1  11 
ATOM   6971  H  HG21 . THR A 1 36 ? 5.288   8.006   0.119   1.00 0.00 ? 36  THR A HG21 11 
ATOM   6972  H  HG22 . THR A 1 36 ? 6.591   7.279   -0.820  1.00 0.00 ? 36  THR A HG22 11 
ATOM   6973  H  HG23 . THR A 1 36 ? 5.586   8.539   -1.535  1.00 0.00 ? 36  THR A HG23 11 
ATOM   6974  N  N    . GLY A 1 37 ? 10.339  9.332   1.501   1.00 0.00 ? 37  GLY A N    11 
ATOM   6975  C  CA   . GLY A 1 37 ? 11.300  10.298  1.998   1.00 0.00 ? 37  GLY A CA   11 
ATOM   6976  C  C    . GLY A 1 37 ? 10.660  11.354  2.877   1.00 0.00 ? 37  GLY A C    11 
ATOM   6977  O  O    . GLY A 1 37 ? 10.408  12.473  2.430   1.00 0.00 ? 37  GLY A O    11 
ATOM   6978  H  H    . GLY A 1 37 ? 10.453  8.380   1.705   1.00 0.00 ? 37  GLY A H    11 
ATOM   6979  H  HA2  . GLY A 1 37 ? 12.055  9.779   2.569   1.00 0.00 ? 37  GLY A HA2  11 
ATOM   6980  H  HA3  . GLY A 1 37 ? 11.772  10.785  1.156   1.00 0.00 ? 37  GLY A HA3  11 
ATOM   6981  N  N    . GLU A 1 38 ? 10.394  10.997  4.129   1.00 0.00 ? 38  GLU A N    11 
ATOM   6982  C  CA   . GLU A 1 38 ? 9.776   11.923  5.072   1.00 0.00 ? 38  GLU A CA   11 
ATOM   6983  C  C    . GLU A 1 38 ? 10.625  12.063  6.332   1.00 0.00 ? 38  GLU A C    11 
ATOM   6984  O  O    . GLU A 1 38 ? 11.017  13.167  6.709   1.00 0.00 ? 38  GLU A O    11 
ATOM   6985  C  CB   . GLU A 1 38 ? 8.370   11.446  5.441   1.00 0.00 ? 38  GLU A CB   11 
ATOM   6986  C  CG   . GLU A 1 38 ? 7.292   11.929  4.484   1.00 0.00 ? 38  GLU A CG   11 
ATOM   6987  C  CD   . GLU A 1 38 ? 6.708   13.268  4.891   1.00 0.00 ? 38  GLU A CD   11 
ATOM   6988  O  OE1  . GLU A 1 38 ? 7.486   14.234  5.035   1.00 0.00 ? 38  GLU A OE1  11 
ATOM   6989  O  OE2  . GLU A 1 38 ? 5.475   13.349  5.065   1.00 0.00 ? 38  GLU A OE2  11 
ATOM   6990  H  H    . GLU A 1 38 ? 10.618  10.091  4.426   1.00 0.00 ? 38  GLU A H    11 
ATOM   6991  H  HA   . GLU A 1 38 ? 9.704   12.887  4.591   1.00 0.00 ? 38  GLU A HA   11 
ATOM   6992  H  HB2  . GLU A 1 38 ? 8.359   10.366  5.448   1.00 0.00 ? 38  GLU A HB2  11 
ATOM   6993  H  HB3  . GLU A 1 38 ? 8.130   11.806  6.431   1.00 0.00 ? 38  GLU A HB3  11 
ATOM   6994  H  HG2  . GLU A 1 38 ? 7.722   12.025  3.498   1.00 0.00 ? 38  GLU A HG2  11 
ATOM   6995  H  HG3  . GLU A 1 38 ? 6.497   11.198  4.460   1.00 0.00 ? 38  GLU A HG3  11 
ATOM   6996  N  N    . ARG A 1 39 ? 10.903  10.936  6.980   1.00 0.00 ? 39  ARG A N    11 
ATOM   6997  C  CA   . ARG A 1 39 ? 11.703  10.933  8.198   1.00 0.00 ? 39  ARG A CA   11 
ATOM   6998  C  C    . ARG A 1 39 ? 13.128  11.399  7.914   1.00 0.00 ? 39  ARG A C    11 
ATOM   6999  O  O    . ARG A 1 39 ? 13.704  11.111  6.865   1.00 0.00 ? 39  ARG A O    11 
ATOM   7000  C  CB   . ARG A 1 39 ? 11.726  9.533   8.815   1.00 0.00 ? 39  ARG A CB   11 
ATOM   7001  C  CG   . ARG A 1 39 ? 10.387  9.099   9.390   1.00 0.00 ? 39  ARG A CG   11 
ATOM   7002  C  CD   . ARG A 1 39 ? 10.478  7.726   10.037  1.00 0.00 ? 39  ARG A CD   11 
ATOM   7003  N  NE   . ARG A 1 39 ? 10.831  7.809   11.451  1.00 0.00 ? 39  ARG A NE   11 
ATOM   7004  C  CZ   . ARG A 1 39 ? 9.950   8.047   12.416  1.00 0.00 ? 39  ARG A CZ   11 
ATOM   7005  N  NH1  . ARG A 1 39 ? 8.670   8.224   12.120  1.00 0.00 ? 39  ARG A NH1  11 
ATOM   7006  N  NH2  . ARG A 1 39 ? 10.349  8.108   13.680  1.00 0.00 ? 39  ARG A NH2  11 
ATOM   7007  H  H    . ARG A 1 39 ? 10.561  10.087  6.630   1.00 0.00 ? 39  ARG A H    11 
ATOM   7008  H  HA   . ARG A 1 39 ? 11.246  11.617  8.897   1.00 0.00 ? 39  ARG A HA   11 
ATOM   7009  H  HB2  . ARG A 1 39 ? 12.013  8.822   8.055   1.00 0.00 ? 39  ARG A HB2  11 
ATOM   7010  H  HB3  . ARG A 1 39 ? 12.457  9.515   9.609   1.00 0.00 ? 39  ARG A HB3  11 
ATOM   7011  H  HG2  . ARG A 1 39 ? 10.077  9.816   10.136  1.00 0.00 ? 39  ARG A HG2  11 
ATOM   7012  H  HG3  . ARG A 1 39 ? 9.658   9.066   8.595   1.00 0.00 ? 39  ARG A HG3  11 
ATOM   7013  H  HD2  . ARG A 1 39 ? 9.521   7.235   9.943   1.00 0.00 ? 39  ARG A HD2  11 
ATOM   7014  H  HD3  . ARG A 1 39 ? 11.230  7.149   9.520   1.00 0.00 ? 39  ARG A HD3  11 
ATOM   7015  H  HE   . ARG A 1 39 ? 11.772  7.681   11.692  1.00 0.00 ? 39  ARG A HE   11 
ATOM   7016  H  HH11 . ARG A 1 39 ? 8.366   8.178   11.169  1.00 0.00 ? 39  ARG A HH11 11 
ATOM   7017  H  HH12 . ARG A 1 39 ? 8.008   8.402   12.849  1.00 0.00 ? 39  ARG A HH12 11 
ATOM   7018  H  HH21 . ARG A 1 39 ? 11.313  7.975   13.907  1.00 0.00 ? 39  ARG A HH21 11 
ATOM   7019  H  HH22 . ARG A 1 39 ? 9.685   8.287   14.406  1.00 0.00 ? 39  ARG A HH22 11 
ATOM   7020  N  N    . PRO A 1 40 ? 13.712  12.136  8.871   1.00 0.00 ? 40  PRO A N    11 
ATOM   7021  C  CA   . PRO A 1 40 ? 15.076  12.657  8.747   1.00 0.00 ? 40  PRO A CA   11 
ATOM   7022  C  C    . PRO A 1 40 ? 16.127  11.554  8.819   1.00 0.00 ? 40  PRO A C    11 
ATOM   7023  O  O    . PRO A 1 40 ? 16.673  11.273  9.886   1.00 0.00 ? 40  PRO A O    11 
ATOM   7024  C  CB   . PRO A 1 40 ? 15.207  13.599  9.946   1.00 0.00 ? 40  PRO A CB   11 
ATOM   7025  C  CG   . PRO A 1 40 ? 14.230  13.080  10.943  1.00 0.00 ? 40  PRO A CG   11 
ATOM   7026  C  CD   . PRO A 1 40 ? 13.085  12.517  10.147  1.00 0.00 ? 40  PRO A CD   11 
ATOM   7027  H  HA   . PRO A 1 40 ? 15.206  13.216  7.831   1.00 0.00 ? 40  PRO A HA   11 
ATOM   7028  H  HB2  . PRO A 1 40 ? 16.218  13.563  10.327  1.00 0.00 ? 40  PRO A HB2  11 
ATOM   7029  H  HB3  . PRO A 1 40 ? 14.965  14.607  9.644   1.00 0.00 ? 40  PRO A HB3  11 
ATOM   7030  H  HG2  . PRO A 1 40 ? 14.689  12.306  11.539  1.00 0.00 ? 40  PRO A HG2  11 
ATOM   7031  H  HG3  . PRO A 1 40 ? 13.886  13.887  11.574  1.00 0.00 ? 40  PRO A HG3  11 
ATOM   7032  H  HD2  . PRO A 1 40 ? 12.667  11.654  10.645  1.00 0.00 ? 40  PRO A HD2  11 
ATOM   7033  H  HD3  . PRO A 1 40 ? 12.326  13.270  9.994   1.00 0.00 ? 40  PRO A HD3  11 
ATOM   7034  N  N    . SER A 1 41 ? 16.406  10.933  7.677   1.00 0.00 ? 41  SER A N    11 
ATOM   7035  C  CA   . SER A 1 41 ? 17.389  9.858   7.612   1.00 0.00 ? 41  SER A CA   11 
ATOM   7036  C  C    . SER A 1 41 ? 18.631  10.304  6.847   1.00 0.00 ? 41  SER A C    11 
ATOM   7037  O  O    . SER A 1 41 ? 19.749  10.217  7.351   1.00 0.00 ? 41  SER A O    11 
ATOM   7038  C  CB   . SER A 1 41 ? 16.781  8.622   6.946   1.00 0.00 ? 41  SER A CB   11 
ATOM   7039  O  OG   . SER A 1 41 ? 17.648  7.506   7.054   1.00 0.00 ? 41  SER A OG   11 
ATOM   7040  H  H    . SER A 1 41 ? 15.937  11.203  6.860   1.00 0.00 ? 41  SER A H    11 
ATOM   7041  H  HA   . SER A 1 41 ? 17.674  9.608   8.623   1.00 0.00 ? 41  SER A HA   11 
ATOM   7042  H  HB2  . SER A 1 41 ? 15.844  8.382   7.425   1.00 0.00 ? 41  SER A HB2  11 
ATOM   7043  H  HB3  . SER A 1 41 ? 16.609  8.829   5.900   1.00 0.00 ? 41  SER A HB3  11 
ATOM   7044  H  HG   . SER A 1 41 ? 18.015  7.300   6.191   1.00 0.00 ? 41  SER A HG   11 
ATOM   7045  N  N    . GLY A 1 42 ? 18.425  10.781  5.623   1.00 0.00 ? 42  GLY A N    11 
ATOM   7046  C  CA   . GLY A 1 42 ? 19.536  11.234  4.806   1.00 0.00 ? 42  GLY A CA   11 
ATOM   7047  C  C    . GLY A 1 42 ? 19.087  12.099  3.645   1.00 0.00 ? 42  GLY A C    11 
ATOM   7048  O  O    . GLY A 1 42 ? 18.050  12.759  3.700   1.00 0.00 ? 42  GLY A O    11 
ATOM   7049  H  H    . GLY A 1 42 ? 17.511  10.827  5.272   1.00 0.00 ? 42  GLY A H    11 
ATOM   7050  H  HA2  . GLY A 1 42 ? 20.215  11.802  5.424   1.00 0.00 ? 42  GLY A HA2  11 
ATOM   7051  H  HA3  . GLY A 1 42 ? 20.056  10.371  4.417   1.00 0.00 ? 42  GLY A HA3  11 
ATOM   7052  N  N    . PRO A 1 43 ? 19.882  12.104  2.564   1.00 0.00 ? 43  PRO A N    11 
ATOM   7053  C  CA   . PRO A 1 43 ? 19.581  12.891  1.365   1.00 0.00 ? 43  PRO A CA   11 
ATOM   7054  C  C    . PRO A 1 43 ? 18.380  12.347  0.600   1.00 0.00 ? 43  PRO A C    11 
ATOM   7055  O  O    . PRO A 1 43 ? 18.280  11.145  0.356   1.00 0.00 ? 43  PRO A O    11 
ATOM   7056  C  CB   . PRO A 1 43 ? 20.854  12.758  0.525   1.00 0.00 ? 43  PRO A CB   11 
ATOM   7057  C  CG   . PRO A 1 43 ? 21.469  11.476  0.970   1.00 0.00 ? 43  PRO A CG   11 
ATOM   7058  C  CD   . PRO A 1 43 ? 21.134  11.340  2.430   1.00 0.00 ? 43  PRO A CD   11 
ATOM   7059  H  HA   . PRO A 1 43 ? 19.414  13.931  1.605   1.00 0.00 ? 43  PRO A HA   11 
ATOM   7060  H  HB2  . PRO A 1 43 ? 20.595  12.729  -0.524  1.00 0.00 ? 43  PRO A HB2  11 
ATOM   7061  H  HB3  . PRO A 1 43 ? 21.507  13.596  0.718   1.00 0.00 ? 43  PRO A HB3  11 
ATOM   7062  H  HG2  . PRO A 1 43 ? 21.049  10.653  0.411   1.00 0.00 ? 43  PRO A HG2  11 
ATOM   7063  H  HG3  . PRO A 1 43 ? 22.540  11.516  0.834   1.00 0.00 ? 43  PRO A HG3  11 
ATOM   7064  H  HD2  . PRO A 1 43 ? 20.982  10.303  2.688   1.00 0.00 ? 43  PRO A HD2  11 
ATOM   7065  H  HD3  . PRO A 1 43 ? 21.915  11.772  3.038   1.00 0.00 ? 43  PRO A HD3  11 
ATOM   7066  N  N    . SER A 1 44 ? 17.469  13.240  0.224   1.00 0.00 ? 44  SER A N    11 
ATOM   7067  C  CA   . SER A 1 44 ? 16.272  12.849  -0.510  1.00 0.00 ? 44  SER A CA   11 
ATOM   7068  C  C    . SER A 1 44 ? 16.221  13.535  -1.871  1.00 0.00 ? 44  SER A C    11 
ATOM   7069  O  O    . SER A 1 44 ? 16.636  14.685  -2.015  1.00 0.00 ? 44  SER A O    11 
ATOM   7070  C  CB   . SER A 1 44 ? 15.018  13.194  0.295   1.00 0.00 ? 44  SER A CB   11 
ATOM   7071  O  OG   . SER A 1 44 ? 13.861  12.626  -0.293  1.00 0.00 ? 44  SER A OG   11 
ATOM   7072  H  H    . SER A 1 44 ? 17.606  14.184  0.449   1.00 0.00 ? 44  SER A H    11 
ATOM   7073  H  HA   . SER A 1 44 ? 16.310  11.780  -0.660  1.00 0.00 ? 44  SER A HA   11 
ATOM   7074  H  HB2  . SER A 1 44 ? 15.121  12.811  1.299   1.00 0.00 ? 44  SER A HB2  11 
ATOM   7075  H  HB3  . SER A 1 44 ? 14.900  14.268  0.330   1.00 0.00 ? 44  SER A HB3  11 
ATOM   7076  H  HG   . SER A 1 44 ? 14.042  11.717  -0.543  1.00 0.00 ? 44  SER A HG   11 
ATOM   7077  N  N    . SER A 1 45 ? 15.709  12.821  -2.869  1.00 0.00 ? 45  SER A N    11 
ATOM   7078  C  CA   . SER A 1 45 ? 15.606  13.359  -4.220  1.00 0.00 ? 45  SER A CA   11 
ATOM   7079  C  C    . SER A 1 45 ? 14.566  14.474  -4.284  1.00 0.00 ? 45  SER A C    11 
ATOM   7080  O  O    . SER A 1 45 ? 13.849  14.725  -3.316  1.00 0.00 ? 45  SER A O    11 
ATOM   7081  C  CB   . SER A 1 45 ? 15.241  12.249  -5.207  1.00 0.00 ? 45  SER A CB   11 
ATOM   7082  O  OG   . SER A 1 45 ? 16.381  11.485  -5.559  1.00 0.00 ? 45  SER A OG   11 
ATOM   7083  H  H    . SER A 1 45 ? 15.394  11.910  -2.691  1.00 0.00 ? 45  SER A H    11 
ATOM   7084  H  HA   . SER A 1 45 ? 16.570  13.766  -4.489  1.00 0.00 ? 45  SER A HA   11 
ATOM   7085  H  HB2  . SER A 1 45 ? 14.510  11.596  -4.756  1.00 0.00 ? 45  SER A HB2  11 
ATOM   7086  H  HB3  . SER A 1 45 ? 14.827  12.689  -6.103  1.00 0.00 ? 45  SER A HB3  11 
ATOM   7087  H  HG   . SER A 1 45 ? 17.000  11.475  -4.825  1.00 0.00 ? 45  SER A HG   11 
ATOM   7088  N  N    . GLY A 1 46 ? 14.491  15.140  -5.432  1.00 0.00 ? 46  GLY A N    11 
ATOM   7089  C  CA   . GLY A 1 46 ? 13.537  16.220  -5.602  1.00 0.00 ? 46  GLY A CA   11 
ATOM   7090  C  C    . GLY A 1 46 ? 13.718  16.953  -6.917  1.00 0.00 ? 46  GLY A C    11 
ATOM   7091  O  O    . GLY A 1 46 ? 14.810  16.907  -7.482  1.00 0.00 ? 46  GLY A O    11 
ATOM   7092  H  H    . GLY A 1 46 ? 15.088  14.896  -6.170  1.00 0.00 ? 46  GLY A H    11 
ATOM   7093  H  HA2  . GLY A 1 46 ? 12.538  15.813  -5.564  1.00 0.00 ? 46  GLY A HA2  11 
ATOM   7094  H  HA3  . GLY A 1 46 ? 13.659  16.924  -4.792  1.00 0.00 ? 46  GLY A HA3  11 
HETATM 7095  ZN ZN   . ZN  B 2 .  ? 4.445   0.719   4.353   1.00 0.00 ? 201 ZN  A ZN   11 
ATOM   7096  N  N    . GLY A 1 1  ? 10.239  -20.280 -11.728 1.00 0.00 ? 1   GLY A N    12 
ATOM   7097  C  CA   . GLY A 1 1  ? 9.024   -19.519 -11.953 1.00 0.00 ? 1   GLY A CA   12 
ATOM   7098  C  C    . GLY A 1 1  ? 7.887   -19.964 -11.054 1.00 0.00 ? 1   GLY A C    12 
ATOM   7099  O  O    . GLY A 1 1  ? 7.492   -21.130 -11.073 1.00 0.00 ? 1   GLY A O    12 
ATOM   7100  H  H1   . GLY A 1 1  ? 10.359  -20.771 -10.889 1.00 0.00 ? 1   GLY A H1   12 
ATOM   7101  H  HA2  . GLY A 1 1  ? 9.226   -18.475 -11.769 1.00 0.00 ? 1   GLY A HA2  12 
ATOM   7102  H  HA3  . GLY A 1 1  ? 8.722   -19.642 -12.983 1.00 0.00 ? 1   GLY A HA3  12 
ATOM   7103  N  N    . SER A 1 2  ? 7.361   -19.034 -10.264 1.00 0.00 ? 2   SER A N    12 
ATOM   7104  C  CA   . SER A 1 2  ? 6.266   -19.338 -9.350  1.00 0.00 ? 2   SER A CA   12 
ATOM   7105  C  C    . SER A 1 2  ? 4.917   -19.081 -10.013 1.00 0.00 ? 2   SER A C    12 
ATOM   7106  O  O    . SER A 1 2  ? 4.823   -18.328 -10.983 1.00 0.00 ? 2   SER A O    12 
ATOM   7107  C  CB   . SER A 1 2  ? 6.389   -18.499 -8.076  1.00 0.00 ? 2   SER A CB   12 
ATOM   7108  O  OG   . SER A 1 2  ? 5.827   -19.175 -6.964  1.00 0.00 ? 2   SER A OG   12 
ATOM   7109  H  H    . SER A 1 2  ? 7.719   -18.123 -10.295 1.00 0.00 ? 2   SER A H    12 
ATOM   7110  H  HA   . SER A 1 2  ? 6.332   -20.384 -9.089  1.00 0.00 ? 2   SER A HA   12 
ATOM   7111  H  HB2  . SER A 1 2  ? 7.432   -18.305 -7.875  1.00 0.00 ? 2   SER A HB2  12 
ATOM   7112  H  HB3  . SER A 1 2  ? 5.869   -17.562 -8.214  1.00 0.00 ? 2   SER A HB3  12 
ATOM   7113  H  HG   . SER A 1 2  ? 6.056   -20.106 -7.006  1.00 0.00 ? 2   SER A HG   12 
ATOM   7114  N  N    . SER A 1 3  ? 3.874   -19.713 -9.484  1.00 0.00 ? 3   SER A N    12 
ATOM   7115  C  CA   . SER A 1 3  ? 2.529   -19.557 -10.027 1.00 0.00 ? 3   SER A CA   12 
ATOM   7116  C  C    . SER A 1 3  ? 2.188   -18.082 -10.216 1.00 0.00 ? 3   SER A C    12 
ATOM   7117  O  O    . SER A 1 3  ? 1.880   -17.641 -11.323 1.00 0.00 ? 3   SER A O    12 
ATOM   7118  C  CB   . SER A 1 3  ? 1.504   -20.214 -9.102  1.00 0.00 ? 3   SER A CB   12 
ATOM   7119  O  OG   . SER A 1 3  ? 0.288   -20.467 -9.785  1.00 0.00 ? 3   SER A OG   12 
ATOM   7120  H  H    . SER A 1 3  ? 4.013   -20.300 -8.712  1.00 0.00 ? 3   SER A H    12 
ATOM   7121  H  HA   . SER A 1 3  ? 2.501   -20.047 -10.988 1.00 0.00 ? 3   SER A HA   12 
ATOM   7122  H  HB2  . SER A 1 3  ? 1.899   -21.150 -8.738  1.00 0.00 ? 3   SER A HB2  12 
ATOM   7123  H  HB3  . SER A 1 3  ? 1.304   -19.559 -8.266  1.00 0.00 ? 3   SER A HB3  12 
ATOM   7124  H  HG   . SER A 1 3  ? -0.431  -20.018 -9.335  1.00 0.00 ? 3   SER A HG   12 
ATOM   7125  N  N    . GLY A 1 4  ? 2.245   -17.323 -9.126  1.00 0.00 ? 4   GLY A N    12 
ATOM   7126  C  CA   . GLY A 1 4  ? 1.940   -15.906 -9.192  1.00 0.00 ? 4   GLY A CA   12 
ATOM   7127  C  C    . GLY A 1 4  ? 1.479   -15.349 -7.859  1.00 0.00 ? 4   GLY A C    12 
ATOM   7128  O  O    . GLY A 1 4  ? 0.908   -16.071 -7.042  1.00 0.00 ? 4   GLY A O    12 
ATOM   7129  H  H    . GLY A 1 4  ? 2.497   -17.729 -8.270  1.00 0.00 ? 4   GLY A H    12 
ATOM   7130  H  HA2  . GLY A 1 4  ? 2.824   -15.372 -9.506  1.00 0.00 ? 4   GLY A HA2  12 
ATOM   7131  H  HA3  . GLY A 1 4  ? 1.159   -15.751 -9.922  1.00 0.00 ? 4   GLY A HA3  12 
ATOM   7132  N  N    . SER A 1 5  ? 1.729   -14.062 -7.638  1.00 0.00 ? 5   SER A N    12 
ATOM   7133  C  CA   . SER A 1 5  ? 1.341   -13.411 -6.393  1.00 0.00 ? 5   SER A CA   12 
ATOM   7134  C  C    . SER A 1 5  ? 0.237   -12.387 -6.637  1.00 0.00 ? 5   SER A C    12 
ATOM   7135  O  O    . SER A 1 5  ? 0.436   -11.400 -7.345  1.00 0.00 ? 5   SER A O    12 
ATOM   7136  C  CB   . SER A 1 5  ? 2.551   -12.730 -5.750  1.00 0.00 ? 5   SER A CB   12 
ATOM   7137  O  OG   . SER A 1 5  ? 3.572   -13.670 -5.463  1.00 0.00 ? 5   SER A OG   12 
ATOM   7138  H  H    . SER A 1 5  ? 2.188   -13.540 -8.329  1.00 0.00 ? 5   SER A H    12 
ATOM   7139  H  HA   . SER A 1 5  ? 0.969   -14.171 -5.723  1.00 0.00 ? 5   SER A HA   12 
ATOM   7140  H  HB2  . SER A 1 5  ? 2.943   -11.986 -6.426  1.00 0.00 ? 5   SER A HB2  12 
ATOM   7141  H  HB3  . SER A 1 5  ? 2.246   -12.255 -4.829  1.00 0.00 ? 5   SER A HB3  12 
ATOM   7142  H  HG   . SER A 1 5  ? 3.185   -14.543 -5.363  1.00 0.00 ? 5   SER A HG   12 
ATOM   7143  N  N    . SER A 1 6  ? -0.928  -12.629 -6.045  1.00 0.00 ? 6   SER A N    12 
ATOM   7144  C  CA   . SER A 1 6  ? -2.066  -11.731 -6.200  1.00 0.00 ? 6   SER A CA   12 
ATOM   7145  C  C    . SER A 1 6  ? -2.774  -11.516 -4.866  1.00 0.00 ? 6   SER A C    12 
ATOM   7146  O  O    . SER A 1 6  ? -2.739  -12.374 -3.985  1.00 0.00 ? 6   SER A O    12 
ATOM   7147  C  CB   . SER A 1 6  ? -3.050  -12.293 -7.227  1.00 0.00 ? 6   SER A CB   12 
ATOM   7148  O  OG   . SER A 1 6  ? -4.004  -11.317 -7.607  1.00 0.00 ? 6   SER A OG   12 
ATOM   7149  H  H    . SER A 1 6  ? -1.025  -13.433 -5.492  1.00 0.00 ? 6   SER A H    12 
ATOM   7150  H  HA   . SER A 1 6  ? -1.693  -10.781 -6.553  1.00 0.00 ? 6   SER A HA   12 
ATOM   7151  H  HB2  . SER A 1 6  ? -2.508  -12.610 -8.105  1.00 0.00 ? 6   SER A HB2  12 
ATOM   7152  H  HB3  . SER A 1 6  ? -3.569  -13.139 -6.799  1.00 0.00 ? 6   SER A HB3  12 
ATOM   7153  H  HG   . SER A 1 6  ? -3.554  -10.501 -7.836  1.00 0.00 ? 6   SER A HG   12 
ATOM   7154  N  N    . GLY A 1 7  ? -3.418  -10.361 -4.724  1.00 0.00 ? 7   GLY A N    12 
ATOM   7155  C  CA   . GLY A 1 7  ? -4.125  -10.052 -3.495  1.00 0.00 ? 7   GLY A CA   12 
ATOM   7156  C  C    . GLY A 1 7  ? -5.437  -9.335  -3.745  1.00 0.00 ? 7   GLY A C    12 
ATOM   7157  O  O    . GLY A 1 7  ? -6.456  -9.655  -3.132  1.00 0.00 ? 7   GLY A O    12 
ATOM   7158  H  H    . GLY A 1 7  ? -3.412  -9.713  -5.460  1.00 0.00 ? 7   GLY A H    12 
ATOM   7159  H  HA2  . GLY A 1 7  ? -4.325  -10.972 -2.966  1.00 0.00 ? 7   GLY A HA2  12 
ATOM   7160  H  HA3  . GLY A 1 7  ? -3.497  -9.424  -2.880  1.00 0.00 ? 7   GLY A HA3  12 
ATOM   7161  N  N    . THR A 1 8  ? -5.414  -8.361  -4.650  1.00 0.00 ? 8   THR A N    12 
ATOM   7162  C  CA   . THR A 1 8  ? -6.610  -7.595  -4.978  1.00 0.00 ? 8   THR A CA   12 
ATOM   7163  C  C    . THR A 1 8  ? -7.853  -8.476  -4.948  1.00 0.00 ? 8   THR A C    12 
ATOM   7164  O  O    . THR A 1 8  ? -8.008  -9.376  -5.772  1.00 0.00 ? 8   THR A O    12 
ATOM   7165  C  CB   . THR A 1 8  ? -6.493  -6.939  -6.367  1.00 0.00 ? 8   THR A CB   12 
ATOM   7166  O  OG1  . THR A 1 8  ? -6.100  -7.916  -7.338  1.00 0.00 ? 8   THR A OG1  12 
ATOM   7167  C  CG2  . THR A 1 8  ? -5.482  -5.802  -6.346  1.00 0.00 ? 8   THR A CG2  12 
ATOM   7168  H  H    . THR A 1 8  ? -4.572  -8.153  -5.106  1.00 0.00 ? 8   THR A H    12 
ATOM   7169  H  HA   . THR A 1 8  ? -6.717  -6.812  -4.242  1.00 0.00 ? 8   THR A HA   12 
ATOM   7170  H  HB   . THR A 1 8  ? -7.458  -6.538  -6.642  1.00 0.00 ? 8   THR A HB   12 
ATOM   7171  H  HG1  . THR A 1 8  ? -5.186  -7.765  -7.592  1.00 0.00 ? 8   THR A HG1  12 
ATOM   7172  H  HG21 . THR A 1 8  ? -5.749  -5.070  -7.093  1.00 0.00 ? 8   THR A HG21 12 
ATOM   7173  H  HG22 . THR A 1 8  ? -4.498  -6.192  -6.560  1.00 0.00 ? 8   THR A HG22 12 
ATOM   7174  H  HG23 . THR A 1 8  ? -5.482  -5.339  -5.371  1.00 0.00 ? 8   THR A HG23 12 
ATOM   7175  N  N    . GLY A 1 9  ? -8.738  -8.210  -3.992  1.00 0.00 ? 9   GLY A N    12 
ATOM   7176  C  CA   . GLY A 1 9  ? -9.958  -8.988  -3.873  1.00 0.00 ? 9   GLY A CA   12 
ATOM   7177  C  C    . GLY A 1 9  ? -10.371 -9.200  -2.430  1.00 0.00 ? 9   GLY A C    12 
ATOM   7178  O  O    . GLY A 1 9  ? -11.414 -8.711  -1.999  1.00 0.00 ? 9   GLY A O    12 
ATOM   7179  H  H    . GLY A 1 9  ? -8.562  -7.479  -3.363  1.00 0.00 ? 9   GLY A H    12 
ATOM   7180  H  HA2  . GLY A 1 9  ? -10.752 -8.473  -4.392  1.00 0.00 ? 9   GLY A HA2  12 
ATOM   7181  H  HA3  . GLY A 1 9  ? -9.803  -9.951  -4.337  1.00 0.00 ? 9   GLY A HA3  12 
ATOM   7182  N  N    . GLU A 1 10 ? -9.551  -9.934  -1.683  1.00 0.00 ? 10  GLU A N    12 
ATOM   7183  C  CA   . GLU A 1 10 ? -9.840  -10.212 -0.281  1.00 0.00 ? 10  GLU A CA   12 
ATOM   7184  C  C    . GLU A 1 10 ? -9.428  -9.038  0.602   1.00 0.00 ? 10  GLU A C    12 
ATOM   7185  O  O    . GLU A 1 10 ? -10.236 -8.503  1.360   1.00 0.00 ? 10  GLU A O    12 
ATOM   7186  C  CB   . GLU A 1 10 ? -9.116  -11.482 0.169   1.00 0.00 ? 10  GLU A CB   12 
ATOM   7187  C  CG   . GLU A 1 10 ? -9.317  -11.808 1.640   1.00 0.00 ? 10  GLU A CG   12 
ATOM   7188  C  CD   . GLU A 1 10 ? -10.725 -12.282 1.945   1.00 0.00 ? 10  GLU A CD   12 
ATOM   7189  O  OE1  . GLU A 1 10 ? -11.075 -13.406 1.529   1.00 0.00 ? 10  GLU A OE1  12 
ATOM   7190  O  OE2  . GLU A 1 10 ? -11.476 -11.530 2.600   1.00 0.00 ? 10  GLU A OE2  12 
ATOM   7191  H  H    . GLU A 1 10 ? -8.734  -10.296 -2.084  1.00 0.00 ? 10  GLU A H    12 
ATOM   7192  H  HA   . GLU A 1 10 ? -10.905 -10.362 -0.185  1.00 0.00 ? 10  GLU A HA   12 
ATOM   7193  H  HB2  . GLU A 1 10 ? -9.478  -12.315 -0.416  1.00 0.00 ? 10  GLU A HB2  12 
ATOM   7194  H  HB3  . GLU A 1 10 ? -8.058  -11.361 -0.009  1.00 0.00 ? 10  GLU A HB3  12 
ATOM   7195  H  HG2  . GLU A 1 10 ? -8.623  -12.586 1.921   1.00 0.00 ? 10  GLU A HG2  12 
ATOM   7196  H  HG3  . GLU A 1 10 ? -9.117  -10.921 2.223   1.00 0.00 ? 10  GLU A HG3  12 
ATOM   7197  N  N    . ASN A 1 11 ? -8.163  -8.643  0.499   1.00 0.00 ? 11  ASN A N    12 
ATOM   7198  C  CA   . ASN A 1 11 ? -7.642  -7.533  1.289   1.00 0.00 ? 11  ASN A CA   12 
ATOM   7199  C  C    . ASN A 1 11 ? -8.037  -6.194  0.674   1.00 0.00 ? 11  ASN A C    12 
ATOM   7200  O  O    . ASN A 1 11 ? -8.037  -6.019  -0.544  1.00 0.00 ? 11  ASN A O    12 
ATOM   7201  C  CB   . ASN A 1 11 ? -6.118  -7.628  1.397   1.00 0.00 ? 11  ASN A CB   12 
ATOM   7202  C  CG   . ASN A 1 11 ? -5.418  -7.121  0.150   1.00 0.00 ? 11  ASN A CG   12 
ATOM   7203  O  OD1  . ASN A 1 11 ? -4.864  -6.021  0.140   1.00 0.00 ? 11  ASN A OD1  12 
ATOM   7204  N  ND2  . ASN A 1 11 ? -5.441  -7.922  -0.908  1.00 0.00 ? 11  ASN A ND2  12 
ATOM   7205  H  H    . ASN A 1 11 ? -7.565  -9.109  -0.122  1.00 0.00 ? 11  ASN A H    12 
ATOM   7206  H  HA   . ASN A 1 11 ? -8.068  -7.602  2.279   1.00 0.00 ? 11  ASN A HA   12 
ATOM   7207  H  HB2  . ASN A 1 11 ? -5.785  -7.037  2.238   1.00 0.00 ? 11  ASN A HB2  12 
ATOM   7208  H  HB3  . ASN A 1 11 ? -5.837  -8.658  1.552   1.00 0.00 ? 11  ASN A HB3  12 
ATOM   7209  H  HD21 . ASN A 1 11 ? -5.901  -8.784  -0.827  1.00 0.00 ? 11  ASN A HD21 12 
ATOM   7210  H  HD22 . ASN A 1 11 ? -4.996  -7.620  -1.727  1.00 0.00 ? 11  ASN A HD22 12 
ATOM   7211  N  N    . PRO A 1 12 ? -8.383  -5.227  1.536   1.00 0.00 ? 12  PRO A N    12 
ATOM   7212  C  CA   . PRO A 1 12 ? -8.786  -3.886  1.101   1.00 0.00 ? 12  PRO A CA   12 
ATOM   7213  C  C    . PRO A 1 12 ? -7.622  -3.090  0.522   1.00 0.00 ? 12  PRO A C    12 
ATOM   7214  O  O    . PRO A 1 12 ? -7.716  -2.542  -0.577  1.00 0.00 ? 12  PRO A O    12 
ATOM   7215  C  CB   . PRO A 1 12 ? -9.293  -3.232  2.389   1.00 0.00 ? 12  PRO A CB   12 
ATOM   7216  C  CG   . PRO A 1 12 ? -8.584  -3.953  3.483   1.00 0.00 ? 12  PRO A CG   12 
ATOM   7217  C  CD   . PRO A 1 12 ? -8.406  -5.366  3.002   1.00 0.00 ? 12  PRO A CD   12 
ATOM   7218  H  HA   . PRO A 1 12 ? -9.587  -3.928  0.377   1.00 0.00 ? 12  PRO A HA   12 
ATOM   7219  H  HB2  . PRO A 1 12 ? -9.046  -2.180  2.382   1.00 0.00 ? 12  PRO A HB2  12 
ATOM   7220  H  HB3  . PRO A 1 12 ? -10.363 -3.356  2.463   1.00 0.00 ? 12  PRO A HB3  12 
ATOM   7221  H  HG2  . PRO A 1 12 ? -7.624  -3.494  3.663   1.00 0.00 ? 12  PRO A HG2  12 
ATOM   7222  H  HG3  . PRO A 1 12 ? -9.184  -3.936  4.381   1.00 0.00 ? 12  PRO A HG3  12 
ATOM   7223  H  HD2  . PRO A 1 12 ? -7.475  -5.774  3.365   1.00 0.00 ? 12  PRO A HD2  12 
ATOM   7224  H  HD3  . PRO A 1 12 ? -9.238  -5.979  3.317   1.00 0.00 ? 12  PRO A HD3  12 
ATOM   7225  N  N    . PHE A 1 13 ? -6.523  -3.030  1.267   1.00 0.00 ? 13  PHE A N    12 
ATOM   7226  C  CA   . PHE A 1 13 ? -5.340  -2.300  0.827   1.00 0.00 ? 13  PHE A CA   12 
ATOM   7227  C  C    . PHE A 1 13 ? -4.108  -2.736  1.616   1.00 0.00 ? 13  PHE A C    12 
ATOM   7228  O  O    . PHE A 1 13 ? -4.113  -2.732  2.847   1.00 0.00 ? 13  PHE A O    12 
ATOM   7229  C  CB   . PHE A 1 13 ? -5.555  -0.794  0.987   1.00 0.00 ? 13  PHE A CB   12 
ATOM   7230  C  CG   . PHE A 1 13 ? -6.737  -0.272  0.221   1.00 0.00 ? 13  PHE A CG   12 
ATOM   7231  C  CD1  . PHE A 1 13 ? -6.651  -0.050  -1.144  1.00 0.00 ? 13  PHE A CD1  12 
ATOM   7232  C  CD2  . PHE A 1 13 ? -7.934  -0.005  0.865   1.00 0.00 ? 13  PHE A CD2  12 
ATOM   7233  C  CE1  . PHE A 1 13 ? -7.737  0.430   -1.851  1.00 0.00 ? 13  PHE A CE1  12 
ATOM   7234  C  CE2  . PHE A 1 13 ? -9.024  0.475   0.163   1.00 0.00 ? 13  PHE A CE2  12 
ATOM   7235  C  CZ   . PHE A 1 13 ? -8.925  0.692   -1.197  1.00 0.00 ? 13  PHE A CZ   12 
ATOM   7236  H  H    . PHE A 1 13 ? -6.508  -3.488  2.134   1.00 0.00 ? 13  PHE A H    12 
ATOM   7237  H  HA   . PHE A 1 13 ? -5.182  -2.524  -0.216  1.00 0.00 ? 13  PHE A HA   12 
ATOM   7238  H  HB2  . PHE A 1 13 ? -5.712  -0.569  2.031   1.00 0.00 ? 13  PHE A HB2  12 
ATOM   7239  H  HB3  . PHE A 1 13 ? -4.676  -0.273  0.639   1.00 0.00 ? 13  PHE A HB3  12 
ATOM   7240  H  HD1  . PHE A 1 13 ? -5.723  -0.255  -1.657  1.00 0.00 ? 13  PHE A HD1  12 
ATOM   7241  H  HD2  . PHE A 1 13 ? -8.012  -0.175  1.930   1.00 0.00 ? 13  PHE A HD2  12 
ATOM   7242  H  HE1  . PHE A 1 13 ? -7.657  0.599   -2.915  1.00 0.00 ? 13  PHE A HE1  12 
ATOM   7243  H  HE2  . PHE A 1 13 ? -9.951  0.678   0.678   1.00 0.00 ? 13  PHE A HE2  12 
ATOM   7244  H  HZ   . PHE A 1 13 ? -9.775  1.067   -1.748  1.00 0.00 ? 13  PHE A HZ   12 
ATOM   7245  N  N    . ILE A 1 14 ? -3.055  -3.111  0.897   1.00 0.00 ? 14  ILE A N    12 
ATOM   7246  C  CA   . ILE A 1 14 ? -1.817  -3.549  1.529   1.00 0.00 ? 14  ILE A CA   12 
ATOM   7247  C  C    . ILE A 1 14 ? -0.622  -2.761  1.001   1.00 0.00 ? 14  ILE A C    12 
ATOM   7248  O  O    . ILE A 1 14 ? -0.282  -2.844  -0.179  1.00 0.00 ? 14  ILE A O    12 
ATOM   7249  C  CB   . ILE A 1 14 ? -1.568  -5.051  1.299   1.00 0.00 ? 14  ILE A CB   12 
ATOM   7250  C  CG1  . ILE A 1 14 ? -2.607  -5.883  2.053   1.00 0.00 ? 14  ILE A CG1  12 
ATOM   7251  C  CG2  . ILE A 1 14 ? -0.160  -5.428  1.736   1.00 0.00 ? 14  ILE A CG2  12 
ATOM   7252  C  CD1  . ILE A 1 14 ? -2.603  -7.346  1.670   1.00 0.00 ? 14  ILE A CD1  12 
ATOM   7253  H  H    . ILE A 1 14 ? -3.113  -3.092  -0.081  1.00 0.00 ? 14  ILE A H    12 
ATOM   7254  H  HA   . ILE A 1 14 ? -1.906  -3.377  2.592   1.00 0.00 ? 14  ILE A HA   12 
ATOM   7255  H  HB   . ILE A 1 14 ? -1.656  -5.250  0.242   1.00 0.00 ? 14  ILE A HB   12 
ATOM   7256  H  HG12 . ILE A 1 14 ? -2.411  -5.818  3.112   1.00 0.00 ? 14  ILE A HG12 12 
ATOM   7257  H  HG13 . ILE A 1 14 ? -3.591  -5.488  1.848   1.00 0.00 ? 14  ILE A HG13 12 
ATOM   7258  H  HG21 . ILE A 1 14 ? -0.175  -6.408  2.189   1.00 0.00 ? 14  ILE A HG21 12 
ATOM   7259  H  HG22 . ILE A 1 14 ? 0.492   -5.440  0.876   1.00 0.00 ? 14  ILE A HG22 12 
ATOM   7260  H  HG23 . ILE A 1 14 ? 0.200   -4.705  2.452   1.00 0.00 ? 14  ILE A HG23 12 
ATOM   7261  H  HD11 . ILE A 1 14 ? -1.604  -7.744  1.776   1.00 0.00 ? 14  ILE A HD11 12 
ATOM   7262  H  HD12 . ILE A 1 14 ? -3.276  -7.890  2.316   1.00 0.00 ? 14  ILE A HD12 12 
ATOM   7263  H  HD13 . ILE A 1 14 ? -2.924  -7.451  0.644   1.00 0.00 ? 14  ILE A HD13 12 
ATOM   7264  N  N    . CYS A 1 15 ? 0.012   -1.997  1.884   1.00 0.00 ? 15  CYS A N    12 
ATOM   7265  C  CA   . CYS A 1 15 ? 1.170   -1.194  1.509   1.00 0.00 ? 15  CYS A CA   12 
ATOM   7266  C  C    . CYS A 1 15 ? 2.186   -2.032  0.739   1.00 0.00 ? 15  CYS A C    12 
ATOM   7267  O  O    . CYS A 1 15 ? 2.659   -3.058  1.228   1.00 0.00 ? 15  CYS A O    12 
ATOM   7268  C  CB   . CYS A 1 15 ? 1.826   -0.595  2.755   1.00 0.00 ? 15  CYS A CB   12 
ATOM   7269  S  SG   . CYS A 1 15 ? 2.957   0.790   2.407   1.00 0.00 ? 15  CYS A SG   12 
ATOM   7270  H  H    . CYS A 1 15 ? -0.306  -1.972  2.812   1.00 0.00 ? 15  CYS A H    12 
ATOM   7271  H  HA   . CYS A 1 15 ? 0.827   -0.393  0.873   1.00 0.00 ? 15  CYS A HA   12 
ATOM   7272  H  HB2  . CYS A 1 15 ? 1.056   -0.230  3.418   1.00 0.00 ? 15  CYS A HB2  12 
ATOM   7273  H  HB3  . CYS A 1 15 ? 2.393   -1.364  3.259   1.00 0.00 ? 15  CYS A HB3  12 
ATOM   7274  N  N    . SER A 1 16 ? 2.518   -1.587  -0.469  1.00 0.00 ? 16  SER A N    12 
ATOM   7275  C  CA   . SER A 1 16 ? 3.475   -2.296  -1.309  1.00 0.00 ? 16  SER A CA   12 
ATOM   7276  C  C    . SER A 1 16 ? 4.906   -1.903  -0.955  1.00 0.00 ? 16  SER A C    12 
ATOM   7277  O  O    . SER A 1 16 ? 5.797   -1.934  -1.803  1.00 0.00 ? 16  SER A O    12 
ATOM   7278  C  CB   . SER A 1 16 ? 3.205   -2.003  -2.786  1.00 0.00 ? 16  SER A CB   12 
ATOM   7279  O  OG   . SER A 1 16 ? 2.105   -2.760  -3.263  1.00 0.00 ? 16  SER A OG   12 
ATOM   7280  H  H    . SER A 1 16 ? 2.107   -0.762  -0.803  1.00 0.00 ? 16  SER A H    12 
ATOM   7281  H  HA   . SER A 1 16 ? 3.351   -3.354  -1.132  1.00 0.00 ? 16  SER A HA   12 
ATOM   7282  H  HB2  . SER A 1 16 ? 2.984   -0.954  -2.908  1.00 0.00 ? 16  SER A HB2  12 
ATOM   7283  H  HB3  . SER A 1 16 ? 4.080   -2.257  -3.367  1.00 0.00 ? 16  SER A HB3  12 
ATOM   7284  H  HG   . SER A 1 16 ? 1.934   -2.533  -4.180  1.00 0.00 ? 16  SER A HG   12 
ATOM   7285  N  N    . GLU A 1 17 ? 5.116   -1.533  0.305   1.00 0.00 ? 17  GLU A N    12 
ATOM   7286  C  CA   . GLU A 1 17 ? 6.438   -1.133  0.772   1.00 0.00 ? 17  GLU A CA   12 
ATOM   7287  C  C    . GLU A 1 17 ? 6.802   -1.859  2.063   1.00 0.00 ? 17  GLU A C    12 
ATOM   7288  O  O    . GLU A 1 17 ? 7.955   -2.239  2.272   1.00 0.00 ? 17  GLU A O    12 
ATOM   7289  C  CB   . GLU A 1 17 ? 6.489   0.380   0.993   1.00 0.00 ? 17  GLU A CB   12 
ATOM   7290  C  CG   . GLU A 1 17 ? 6.164   1.189   -0.252  1.00 0.00 ? 17  GLU A CG   12 
ATOM   7291  C  CD   . GLU A 1 17 ? 6.675   2.614   -0.172  1.00 0.00 ? 17  GLU A CD   12 
ATOM   7292  O  OE1  . GLU A 1 17 ? 7.906   2.808   -0.258  1.00 0.00 ? 17  GLU A OE1  12 
ATOM   7293  O  OE2  . GLU A 1 17 ? 5.845   3.535   -0.022  1.00 0.00 ? 17  GLU A OE2  12 
ATOM   7294  H  H    . GLU A 1 17 ? 4.365   -1.529  0.934   1.00 0.00 ? 17  GLU A H    12 
ATOM   7295  H  HA   . GLU A 1 17 ? 7.154   -1.399  0.009   1.00 0.00 ? 17  GLU A HA   12 
ATOM   7296  H  HB2  . GLU A 1 17 ? 5.779   0.643   1.764   1.00 0.00 ? 17  GLU A HB2  12 
ATOM   7297  H  HB3  . GLU A 1 17 ? 7.481   0.651   1.323   1.00 0.00 ? 17  GLU A HB3  12 
ATOM   7298  H  HG2  . GLU A 1 17 ? 6.617   0.708   -1.106  1.00 0.00 ? 17  GLU A HG2  12 
ATOM   7299  H  HG3  . GLU A 1 17 ? 5.092   1.213   -0.381  1.00 0.00 ? 17  GLU A HG3  12 
ATOM   7300  N  N    . CYS A 1 18 ? 5.811   -2.048  2.928   1.00 0.00 ? 18  CYS A N    12 
ATOM   7301  C  CA   . CYS A 1 18 ? 6.025   -2.727  4.200   1.00 0.00 ? 18  CYS A CA   12 
ATOM   7302  C  C    . CYS A 1 18 ? 5.082   -3.918  4.346   1.00 0.00 ? 18  CYS A C    12 
ATOM   7303  O  O    . CYS A 1 18 ? 5.502   -5.015  4.712   1.00 0.00 ? 18  CYS A O    12 
ATOM   7304  C  CB   . CYS A 1 18 ? 5.819   -1.754  5.363   1.00 0.00 ? 18  CYS A CB   12 
ATOM   7305  S  SG   . CYS A 1 18 ? 4.165   -0.992  5.410   1.00 0.00 ? 18  CYS A SG   12 
ATOM   7306  H  H    . CYS A 1 18 ? 4.913   -1.722  2.706   1.00 0.00 ? 18  CYS A H    12 
ATOM   7307  H  HA   . CYS A 1 18 ? 7.043   -3.086  4.218   1.00 0.00 ? 18  CYS A HA   12 
ATOM   7308  H  HB2  . CYS A 1 18 ? 5.963   -2.283  6.294   1.00 0.00 ? 18  CYS A HB2  12 
ATOM   7309  H  HB3  . CYS A 1 18 ? 6.546   -0.959  5.290   1.00 0.00 ? 18  CYS A HB3  12 
ATOM   7310  N  N    . GLY A 1 19 ? 3.804   -3.693  4.056   1.00 0.00 ? 19  GLY A N    12 
ATOM   7311  C  CA   . GLY A 1 19 ? 2.822   -4.756  4.161   1.00 0.00 ? 19  GLY A CA   12 
ATOM   7312  C  C    . GLY A 1 19 ? 1.800   -4.496  5.250   1.00 0.00 ? 19  GLY A C    12 
ATOM   7313  O  O    . GLY A 1 19 ? 1.484   -5.386  6.041   1.00 0.00 ? 19  GLY A O    12 
ATOM   7314  H  H    . GLY A 1 19 ? 3.526   -2.798  3.769   1.00 0.00 ? 19  GLY A H    12 
ATOM   7315  H  HA2  . GLY A 1 19 ? 2.308   -4.852  3.216   1.00 0.00 ? 19  GLY A HA2  12 
ATOM   7316  H  HA3  . GLY A 1 19 ? 3.333   -5.683  4.377   1.00 0.00 ? 19  GLY A HA3  12 
ATOM   7317  N  N    . LYS A 1 20 ? 1.283   -3.273  5.294   1.00 0.00 ? 20  LYS A N    12 
ATOM   7318  C  CA   . LYS A 1 20 ? 0.291   -2.897  6.295   1.00 0.00 ? 20  LYS A CA   12 
ATOM   7319  C  C    . LYS A 1 20 ? -1.106  -2.849  5.685   1.00 0.00 ? 20  LYS A C    12 
ATOM   7320  O  O    . LYS A 1 20 ? -1.280  -2.432  4.540   1.00 0.00 ? 20  LYS A O    12 
ATOM   7321  C  CB   . LYS A 1 20 ? 0.641   -1.537  6.903   1.00 0.00 ? 20  LYS A CB   12 
ATOM   7322  C  CG   . LYS A 1 20 ? 0.098   -1.342  8.308   1.00 0.00 ? 20  LYS A CG   12 
ATOM   7323  C  CD   . LYS A 1 20 ? 0.754   -0.159  9.000   1.00 0.00 ? 20  LYS A CD   12 
ATOM   7324  C  CE   . LYS A 1 20 ? 2.046   -0.565  9.692   1.00 0.00 ? 20  LYS A CE   12 
ATOM   7325  N  NZ   . LYS A 1 20 ? 2.323   0.277   10.889  1.00 0.00 ? 20  LYS A NZ   12 
ATOM   7326  H  H    . LYS A 1 20 ? 1.574   -2.607  4.637   1.00 0.00 ? 20  LYS A H    12 
ATOM   7327  H  HA   . LYS A 1 20 ? 0.305   -3.645  7.074   1.00 0.00 ? 20  LYS A HA   12 
ATOM   7328  H  HB2  . LYS A 1 20 ? 1.716   -1.438  6.938   1.00 0.00 ? 20  LYS A HB2  12 
ATOM   7329  H  HB3  . LYS A 1 20 ? 0.236   -0.759  6.272   1.00 0.00 ? 20  LYS A HB3  12 
ATOM   7330  H  HG2  . LYS A 1 20 ? -0.966  -1.167  8.252   1.00 0.00 ? 20  LYS A HG2  12 
ATOM   7331  H  HG3  . LYS A 1 20 ? 0.288   -2.236  8.885   1.00 0.00 ? 20  LYS A HG3  12 
ATOM   7332  H  HD2  . LYS A 1 20 ? 0.976   0.600   8.264   1.00 0.00 ? 20  LYS A HD2  12 
ATOM   7333  H  HD3  . LYS A 1 20 ? 0.071   0.240   9.737   1.00 0.00 ? 20  LYS A HD3  12 
ATOM   7334  H  HE2  . LYS A 1 20 ? 1.966   -1.596  9.999   1.00 0.00 ? 20  LYS A HE2  12 
ATOM   7335  H  HE3  . LYS A 1 20 ? 2.862   -0.460  8.992   1.00 0.00 ? 20  LYS A HE3  12 
ATOM   7336  H  HZ1  . LYS A 1 20 ? 3.153   -0.087  11.398  1.00 0.00 ? 20  LYS A HZ1  12 
ATOM   7337  H  HZ2  . LYS A 1 20 ? 1.504   0.267   11.530  1.00 0.00 ? 20  LYS A HZ2  12 
ATOM   7338  H  HZ3  . LYS A 1 20 ? 2.510   1.259   10.600  1.00 0.00 ? 20  LYS A HZ3  12 
ATOM   7339  N  N    . VAL A 1 21 ? -2.099  -3.277  6.458   1.00 0.00 ? 21  VAL A N    12 
ATOM   7340  C  CA   . VAL A 1 21 ? -3.482  -3.280  5.994   1.00 0.00 ? 21  VAL A CA   12 
ATOM   7341  C  C    . VAL A 1 21 ? -4.260  -2.108  6.581   1.00 0.00 ? 21  VAL A C    12 
ATOM   7342  O  O    . VAL A 1 21 ? -4.283  -1.909  7.795   1.00 0.00 ? 21  VAL A O    12 
ATOM   7343  C  CB   . VAL A 1 21 ? -4.196  -4.593  6.366   1.00 0.00 ? 21  VAL A CB   12 
ATOM   7344  C  CG1  . VAL A 1 21 ? -5.580  -4.645  5.737   1.00 0.00 ? 21  VAL A CG1  12 
ATOM   7345  C  CG2  . VAL A 1 21 ? -3.362  -5.792  5.938   1.00 0.00 ? 21  VAL A CG2  12 
ATOM   7346  H  H    . VAL A 1 21 ? -1.898  -3.598  7.361   1.00 0.00 ? 21  VAL A H    12 
ATOM   7347  H  HA   . VAL A 1 21 ? -3.473  -3.192  4.917   1.00 0.00 ? 21  VAL A HA   12 
ATOM   7348  H  HB   . VAL A 1 21 ? -4.310  -4.626  7.439   1.00 0.00 ? 21  VAL A HB   12 
ATOM   7349  H  HG11 . VAL A 1 21 ? -6.211  -5.308  6.312   1.00 0.00 ? 21  VAL A HG11 12 
ATOM   7350  H  HG12 . VAL A 1 21 ? -6.009  -3.654  5.729   1.00 0.00 ? 21  VAL A HG12 12 
ATOM   7351  H  HG13 . VAL A 1 21 ? -5.501  -5.013  4.724   1.00 0.00 ? 21  VAL A HG13 12 
ATOM   7352  H  HG21 . VAL A 1 21 ? -2.676  -6.055  6.730   1.00 0.00 ? 21  VAL A HG21 12 
ATOM   7353  H  HG22 . VAL A 1 21 ? -4.013  -6.628  5.732   1.00 0.00 ? 21  VAL A HG22 12 
ATOM   7354  H  HG23 . VAL A 1 21 ? -2.803  -5.543  5.047   1.00 0.00 ? 21  VAL A HG23 12 
ATOM   7355  N  N    . PHE A 1 22 ? -4.899  -1.334  5.709   1.00 0.00 ? 22  PHE A N    12 
ATOM   7356  C  CA   . PHE A 1 22 ? -5.679  -0.180  6.140   1.00 0.00 ? 22  PHE A CA   12 
ATOM   7357  C  C    . PHE A 1 22 ? -7.147  -0.342  5.757   1.00 0.00 ? 22  PHE A C    12 
ATOM   7358  O  O    . PHE A 1 22 ? -7.474  -0.999  4.768   1.00 0.00 ? 22  PHE A O    12 
ATOM   7359  C  CB   . PHE A 1 22 ? -5.118  1.102   5.521   1.00 0.00 ? 22  PHE A CB   12 
ATOM   7360  C  CG   . PHE A 1 22 ? -3.620  1.195   5.589   1.00 0.00 ? 22  PHE A CG   12 
ATOM   7361  C  CD1  . PHE A 1 22 ? -2.826  0.340   4.841   1.00 0.00 ? 22  PHE A CD1  12 
ATOM   7362  C  CD2  . PHE A 1 22 ? -3.007  2.136   6.399   1.00 0.00 ? 22  PHE A CD2  12 
ATOM   7363  C  CE1  . PHE A 1 22 ? -1.448  0.422   4.902   1.00 0.00 ? 22  PHE A CE1  12 
ATOM   7364  C  CE2  . PHE A 1 22 ? -1.629  2.224   6.463   1.00 0.00 ? 22  PHE A CE2  12 
ATOM   7365  C  CZ   . PHE A 1 22 ? -0.848  1.366   5.713   1.00 0.00 ? 22  PHE A CZ   12 
ATOM   7366  H  H    . PHE A 1 22 ? -4.843  -1.543  4.753   1.00 0.00 ? 22  PHE A H    12 
ATOM   7367  H  HA   . PHE A 1 22 ? -5.605  -0.113  7.215   1.00 0.00 ? 22  PHE A HA   12 
ATOM   7368  H  HB2  . PHE A 1 22 ? -5.406  1.148   4.482   1.00 0.00 ? 22  PHE A HB2  12 
ATOM   7369  H  HB3  . PHE A 1 22 ? -5.528  1.954   6.042   1.00 0.00 ? 22  PHE A HB3  12 
ATOM   7370  H  HD1  . PHE A 1 22 ? -3.293  -0.398  4.206   1.00 0.00 ? 22  PHE A HD1  12 
ATOM   7371  H  HD2  . PHE A 1 22 ? -3.617  2.808   6.986   1.00 0.00 ? 22  PHE A HD2  12 
ATOM   7372  H  HE1  . PHE A 1 22 ? -0.840  -0.249  4.314   1.00 0.00 ? 22  PHE A HE1  12 
ATOM   7373  H  HE2  . PHE A 1 22 ? -1.163  2.963   7.098   1.00 0.00 ? 22  PHE A HE2  12 
ATOM   7374  H  HZ   . PHE A 1 22 ? 0.228   1.432   5.762   1.00 0.00 ? 22  PHE A HZ   12 
ATOM   7375  N  N    . THR A 1 23 ? -8.029  0.261   6.549   1.00 0.00 ? 23  THR A N    12 
ATOM   7376  C  CA   . THR A 1 23 ? -9.462  0.182   6.295   1.00 0.00 ? 23  THR A CA   12 
ATOM   7377  C  C    . THR A 1 23 ? -9.866  1.088   5.137   1.00 0.00 ? 23  THR A C    12 
ATOM   7378  O  O    . THR A 1 23 ? -10.570 0.663   4.220   1.00 0.00 ? 23  THR A O    12 
ATOM   7379  C  CB   . THR A 1 23 ? -10.276 0.571   7.544   1.00 0.00 ? 23  THR A CB   12 
ATOM   7380  O  OG1  . THR A 1 23 ? -9.992  -0.335  8.615   1.00 0.00 ? 23  THR A OG1  12 
ATOM   7381  C  CG2  . THR A 1 23 ? -11.767 0.558   7.244   1.00 0.00 ? 23  THR A CG2  12 
ATOM   7382  H  H    . THR A 1 23 ? -7.707  0.769   7.322   1.00 0.00 ? 23  THR A H    12 
ATOM   7383  H  HA   . THR A 1 23 ? -9.700  -0.840  6.040   1.00 0.00 ? 23  THR A HA   12 
ATOM   7384  H  HB   . THR A 1 23 ? -9.993  1.570   7.843   1.00 0.00 ? 23  THR A HB   12 
ATOM   7385  H  HG1  . THR A 1 23 ? -10.340 -1.204  8.401   1.00 0.00 ? 23  THR A HG1  12 
ATOM   7386  H  HG21 . THR A 1 23 ? -12.239 1.398   7.730   1.00 0.00 ? 23  THR A HG21 12 
ATOM   7387  H  HG22 . THR A 1 23 ? -12.201 -0.361  7.611   1.00 0.00 ? 23  THR A HG22 12 
ATOM   7388  H  HG23 . THR A 1 23 ? -11.920 0.627   6.177   1.00 0.00 ? 23  THR A HG23 12 
ATOM   7389  N  N    . HIS A 1 24 ? -9.416  2.338   5.185   1.00 0.00 ? 24  HIS A N    12 
ATOM   7390  C  CA   . HIS A 1 24 ? -9.730  3.303   4.138   1.00 0.00 ? 24  HIS A CA   12 
ATOM   7391  C  C    . HIS A 1 24 ? -8.473  3.702   3.371   1.00 0.00 ? 24  HIS A C    12 
ATOM   7392  O  O    . HIS A 1 24 ? -7.511  4.203   3.953   1.00 0.00 ? 24  HIS A O    12 
ATOM   7393  C  CB   . HIS A 1 24 ? -10.389 4.545   4.740   1.00 0.00 ? 24  HIS A CB   12 
ATOM   7394  C  CG   . HIS A 1 24 ? -9.673  5.079   5.942   1.00 0.00 ? 24  HIS A CG   12 
ATOM   7395  N  ND1  . HIS A 1 24 ? -9.161  6.358   6.006   1.00 0.00 ? 24  HIS A ND1  12 
ATOM   7396  C  CD2  . HIS A 1 24 ? -9.385  4.500   7.131   1.00 0.00 ? 24  HIS A CD2  12 
ATOM   7397  C  CE1  . HIS A 1 24 ? -8.588  6.542   7.182   1.00 0.00 ? 24  HIS A CE1  12 
ATOM   7398  N  NE2  . HIS A 1 24 ? -8.711  5.430   7.884   1.00 0.00 ? 24  HIS A NE2  12 
ATOM   7399  H  H    . HIS A 1 24 ? -8.860  2.617   5.941   1.00 0.00 ? 24  HIS A H    12 
ATOM   7400  H  HA   . HIS A 1 24 ? -10.422 2.837   3.452   1.00 0.00 ? 24  HIS A HA   12 
ATOM   7401  H  HB2  . HIS A 1 24 ? -10.417 5.327   3.996   1.00 0.00 ? 24  HIS A HB2  12 
ATOM   7402  H  HB3  . HIS A 1 24 ? -11.399 4.300   5.037   1.00 0.00 ? 24  HIS A HB3  12 
ATOM   7403  H  HD1  . HIS A 1 24 ? -9.210  7.030   5.295   1.00 0.00 ? 24  HIS A HD1  12 
ATOM   7404  H  HD2  . HIS A 1 24 ? -9.638  3.493   7.433   1.00 0.00 ? 24  HIS A HD2  12 
ATOM   7405  H  HE1  . HIS A 1 24 ? -8.103  7.448   7.515   1.00 0.00 ? 24  HIS A HE1  12 
ATOM   7406  N  N    . LYS A 1 25 ? -8.487  3.475   2.062   1.00 0.00 ? 25  LYS A N    12 
ATOM   7407  C  CA   . LYS A 1 25 ? -7.349  3.810   1.215   1.00 0.00 ? 25  LYS A CA   12 
ATOM   7408  C  C    . LYS A 1 25 ? -6.628  5.049   1.737   1.00 0.00 ? 25  LYS A C    12 
ATOM   7409  O  O    . LYS A 1 25 ? -5.429  5.012   2.015   1.00 0.00 ? 25  LYS A O    12 
ATOM   7410  C  CB   . LYS A 1 25 ? -7.810  4.045   -0.225  1.00 0.00 ? 25  LYS A CB   12 
ATOM   7411  C  CG   . LYS A 1 25 ? -6.698  4.500   -1.154  1.00 0.00 ? 25  LYS A CG   12 
ATOM   7412  C  CD   . LYS A 1 25 ? -7.180  4.608   -2.591  1.00 0.00 ? 25  LYS A CD   12 
ATOM   7413  C  CE   . LYS A 1 25 ? -7.034  3.287   -3.329  1.00 0.00 ? 25  LYS A CE   12 
ATOM   7414  N  NZ   . LYS A 1 25 ? -7.112  3.464   -4.805  1.00 0.00 ? 25  LYS A NZ   12 
ATOM   7415  H  H    . LYS A 1 25 ? -9.283  3.073   1.655   1.00 0.00 ? 25  LYS A H    12 
ATOM   7416  H  HA   . LYS A 1 25 ? -6.664  2.976   1.233   1.00 0.00 ? 25  LYS A HA   12 
ATOM   7417  H  HB2  . LYS A 1 25 ? -8.220  3.124   -0.614  1.00 0.00 ? 25  LYS A HB2  12 
ATOM   7418  H  HB3  . LYS A 1 25 ? -8.582  4.800   -0.225  1.00 0.00 ? 25  LYS A HB3  12 
ATOM   7419  H  HG2  . LYS A 1 25 ? -6.345  5.468   -0.831  1.00 0.00 ? 25  LYS A HG2  12 
ATOM   7420  H  HG3  . LYS A 1 25 ? -5.888  3.786   -1.108  1.00 0.00 ? 25  LYS A HG3  12 
ATOM   7421  H  HD2  . LYS A 1 25 ? -8.222  4.894   -2.591  1.00 0.00 ? 25  LYS A HD2  12 
ATOM   7422  H  HD3  . LYS A 1 25 ? -6.598  5.362   -3.101  1.00 0.00 ? 25  LYS A HD3  12 
ATOM   7423  H  HE2  . LYS A 1 25 ? -6.078  2.853   -3.077  1.00 0.00 ? 25  LYS A HE2  12 
ATOM   7424  H  HE3  . LYS A 1 25 ? -7.825  2.623   -3.012  1.00 0.00 ? 25  LYS A HE3  12 
ATOM   7425  H  HZ1  . LYS A 1 25 ? -6.373  4.121   -5.126  1.00 0.00 ? 25  LYS A HZ1  12 
ATOM   7426  H  HZ2  . LYS A 1 25 ? -8.042  3.849   -5.070  1.00 0.00 ? 25  LYS A HZ2  12 
ATOM   7427  H  HZ3  . LYS A 1 25 ? -6.979  2.550   -5.283  1.00 0.00 ? 25  LYS A HZ3  12 
ATOM   7428  N  N    . THR A 1 26 ? -7.367  6.147   1.869   1.00 0.00 ? 26  THR A N    12 
ATOM   7429  C  CA   . THR A 1 26 ? -6.799  7.396   2.358   1.00 0.00 ? 26  THR A CA   12 
ATOM   7430  C  C    . THR A 1 26 ? -5.714  7.138   3.397   1.00 0.00 ? 26  THR A C    12 
ATOM   7431  O  O    . THR A 1 26 ? -4.599  7.644   3.283   1.00 0.00 ? 26  THR A O    12 
ATOM   7432  C  CB   . THR A 1 26 ? -7.881  8.302   2.975   1.00 0.00 ? 26  THR A CB   12 
ATOM   7433  O  OG1  . THR A 1 26 ? -8.980  8.440   2.069   1.00 0.00 ? 26  THR A OG1  12 
ATOM   7434  C  CG2  . THR A 1 26 ? -7.314  9.674   3.306   1.00 0.00 ? 26  THR A CG2  12 
ATOM   7435  H  H    . THR A 1 26 ? -8.317  6.113   1.631   1.00 0.00 ? 26  THR A H    12 
ATOM   7436  H  HA   . THR A 1 26 ? -6.362  7.916   1.517   1.00 0.00 ? 26  THR A HA   12 
ATOM   7437  H  HB   . THR A 1 26 ? -8.233  7.844   3.889   1.00 0.00 ? 26  THR A HB   12 
ATOM   7438  H  HG1  . THR A 1 26 ? -9.711  7.893   2.366   1.00 0.00 ? 26  THR A HG1  12 
ATOM   7439  H  HG21 . THR A 1 26 ? -6.241  9.606   3.403   1.00 0.00 ? 26  THR A HG21 12 
ATOM   7440  H  HG22 . THR A 1 26 ? -7.738  10.025  4.236   1.00 0.00 ? 26  THR A HG22 12 
ATOM   7441  H  HG23 . THR A 1 26 ? -7.561  10.366  2.514   1.00 0.00 ? 26  THR A HG23 12 
ATOM   7442  N  N    . ASN A 1 27 ? -6.049  6.346   4.410   1.00 0.00 ? 27  ASN A N    12 
ATOM   7443  C  CA   . ASN A 1 27 ? -5.102  6.020   5.471   1.00 0.00 ? 27  ASN A CA   12 
ATOM   7444  C  C    . ASN A 1 27 ? -3.822  5.425   4.893   1.00 0.00 ? 27  ASN A C    12 
ATOM   7445  O  O    . ASN A 1 27 ? -2.717  5.830   5.257   1.00 0.00 ? 27  ASN A O    12 
ATOM   7446  C  CB   . ASN A 1 27 ? -5.732  5.038   6.461   1.00 0.00 ? 27  ASN A CB   12 
ATOM   7447  C  CG   . ASN A 1 27 ? -5.191  5.208   7.867   1.00 0.00 ? 27  ASN A CG   12 
ATOM   7448  O  OD1  . ASN A 1 27 ? -4.200  4.582   8.244   1.00 0.00 ? 27  ASN A OD1  12 
ATOM   7449  N  ND2  . ASN A 1 27 ? -5.841  6.060   8.652   1.00 0.00 ? 27  ASN A ND2  12 
ATOM   7450  H  H    . ASN A 1 27 ? -6.954  5.972   4.446   1.00 0.00 ? 27  ASN A H    12 
ATOM   7451  H  HA   . ASN A 1 27 ? -4.859  6.934   5.990   1.00 0.00 ? 27  ASN A HA   12 
ATOM   7452  H  HB2  . ASN A 1 27 ? -6.801  5.197   6.486   1.00 0.00 ? 27  ASN A HB2  12 
ATOM   7453  H  HB3  . ASN A 1 27 ? -5.530  4.028   6.137   1.00 0.00 ? 27  ASN A HB3  12 
ATOM   7454  H  HD21 . ASN A 1 27 ? -6.623  6.524   8.286   1.00 0.00 ? 27  ASN A HD21 12 
ATOM   7455  H  HD22 . ASN A 1 27 ? -5.512  6.189   9.566   1.00 0.00 ? 27  ASN A HD22 12 
ATOM   7456  N  N    . LEU A 1 28 ? -3.977  4.464   3.990   1.00 0.00 ? 28  LEU A N    12 
ATOM   7457  C  CA   . LEU A 1 28 ? -2.834  3.813   3.360   1.00 0.00 ? 28  LEU A CA   12 
ATOM   7458  C  C    . LEU A 1 28 ? -1.967  4.829   2.623   1.00 0.00 ? 28  LEU A C    12 
ATOM   7459  O  O    . LEU A 1 28 ? -0.744  4.839   2.770   1.00 0.00 ? 28  LEU A O    12 
ATOM   7460  C  CB   . LEU A 1 28 ? -3.309  2.731   2.389   1.00 0.00 ? 28  LEU A CB   12 
ATOM   7461  C  CG   . LEU A 1 28 ? -2.294  2.281   1.337   1.00 0.00 ? 28  LEU A CG   12 
ATOM   7462  C  CD1  . LEU A 1 28 ? -1.169  1.489   1.984   1.00 0.00 ? 28  LEU A CD1  12 
ATOM   7463  C  CD2  . LEU A 1 28 ? -2.977  1.456   0.256   1.00 0.00 ? 28  LEU A CD2  12 
ATOM   7464  H  H    . LEU A 1 28 ? -4.882  4.184   3.740   1.00 0.00 ? 28  LEU A H    12 
ATOM   7465  H  HA   . LEU A 1 28 ? -2.244  3.353   4.139   1.00 0.00 ? 28  LEU A HA   12 
ATOM   7466  H  HB2  . LEU A 1 28 ? -3.588  1.865   2.970   1.00 0.00 ? 28  LEU A HB2  12 
ATOM   7467  H  HB3  . LEU A 1 28 ? -4.178  3.111   1.871   1.00 0.00 ? 28  LEU A HB3  12 
ATOM   7468  H  HG   . LEU A 1 28 ? -1.860  3.154   0.868   1.00 0.00 ? 28  LEU A HG   12 
ATOM   7469  H  HD11 . LEU A 1 28 ? -1.400  0.435   1.940   1.00 0.00 ? 28  LEU A HD11 12 
ATOM   7470  H  HD12 . LEU A 1 28 ? -1.062  1.792   3.015   1.00 0.00 ? 28  LEU A HD12 12 
ATOM   7471  H  HD13 . LEU A 1 28 ? -0.246  1.678   1.456   1.00 0.00 ? 28  LEU A HD13 12 
ATOM   7472  H  HD21 . LEU A 1 28 ? -2.582  1.731   -0.711  1.00 0.00 ? 28  LEU A HD21 12 
ATOM   7473  H  HD22 . LEU A 1 28 ? -4.040  1.645   0.278   1.00 0.00 ? 28  LEU A HD22 12 
ATOM   7474  H  HD23 . LEU A 1 28 ? -2.795  0.406   0.435   1.00 0.00 ? 28  LEU A HD23 12 
ATOM   7475  N  N    . ILE A 1 29 ? -2.608  5.683   1.833   1.00 0.00 ? 29  ILE A N    12 
ATOM   7476  C  CA   . ILE A 1 29 ? -1.896  6.705   1.076   1.00 0.00 ? 29  ILE A CA   12 
ATOM   7477  C  C    . ILE A 1 29 ? -1.068  7.594   1.997   1.00 0.00 ? 29  ILE A C    12 
ATOM   7478  O  O    . ILE A 1 29 ? 0.098   7.876   1.721   1.00 0.00 ? 29  ILE A O    12 
ATOM   7479  C  CB   . ILE A 1 29 ? -2.867  7.586   0.268   1.00 0.00 ? 29  ILE A CB   12 
ATOM   7480  C  CG1  . ILE A 1 29 ? -3.680  6.729   -0.704  1.00 0.00 ? 29  ILE A CG1  12 
ATOM   7481  C  CG2  . ILE A 1 29 ? -2.103  8.666   -0.482  1.00 0.00 ? 29  ILE A CG2  12 
ATOM   7482  C  CD1  . ILE A 1 29 ? -4.880  7.445   -1.283  1.00 0.00 ? 29  ILE A CD1  12 
ATOM   7483  H  H    . ILE A 1 29 ? -3.583  5.625   1.758   1.00 0.00 ? 29  ILE A H    12 
ATOM   7484  H  HA   . ILE A 1 29 ? -1.234  6.206   0.384   1.00 0.00 ? 29  ILE A HA   12 
ATOM   7485  H  HB   . ILE A 1 29 ? -3.540  8.070   0.960   1.00 0.00 ? 29  ILE A HB   12 
ATOM   7486  H  HG12 . ILE A 1 29 ? -3.047  6.426   -1.523  1.00 0.00 ? 29  ILE A HG12 12 
ATOM   7487  H  HG13 . ILE A 1 29 ? -4.036  5.850   -0.185  1.00 0.00 ? 29  ILE A HG13 12 
ATOM   7488  H  HG21 . ILE A 1 29 ? -2.727  9.072   -1.264  1.00 0.00 ? 29  ILE A HG21 12 
ATOM   7489  H  HG22 . ILE A 1 29 ? -1.828  9.454   0.203   1.00 0.00 ? 29  ILE A HG22 12 
ATOM   7490  H  HG23 . ILE A 1 29 ? -1.212  8.240   -0.918  1.00 0.00 ? 29  ILE A HG23 12 
ATOM   7491  H  HD11 . ILE A 1 29 ? -5.178  6.961   -2.203  1.00 0.00 ? 29  ILE A HD11 12 
ATOM   7492  H  HD12 . ILE A 1 29 ? -5.697  7.408   -0.578  1.00 0.00 ? 29  ILE A HD12 12 
ATOM   7493  H  HD13 . ILE A 1 29 ? -4.623  8.473   -1.486  1.00 0.00 ? 29  ILE A HD13 12 
ATOM   7494  N  N    . ILE A 1 30 ? -1.678  8.031   3.094   1.00 0.00 ? 30  ILE A N    12 
ATOM   7495  C  CA   . ILE A 1 30 ? -0.995  8.886   4.058   1.00 0.00 ? 30  ILE A CA   12 
ATOM   7496  C  C    . ILE A 1 30 ? 0.119   8.128   4.772   1.00 0.00 ? 30  ILE A C    12 
ATOM   7497  O  O    . ILE A 1 30 ? 1.164   8.695   5.093   1.00 0.00 ? 30  ILE A O    12 
ATOM   7498  C  CB   . ILE A 1 30 ? -1.974  9.445   5.107   1.00 0.00 ? 30  ILE A CB   12 
ATOM   7499  C  CG1  . ILE A 1 30 ? -3.131  10.173  4.419   1.00 0.00 ? 30  ILE A CG1  12 
ATOM   7500  C  CG2  . ILE A 1 30 ? -1.249  10.379  6.064   1.00 0.00 ? 30  ILE A CG2  12 
ATOM   7501  C  CD1  . ILE A 1 30 ? -4.247  10.563  5.363   1.00 0.00 ? 30  ILE A CD1  12 
ATOM   7502  H  H    . ILE A 1 30 ? -2.608  7.773   3.259   1.00 0.00 ? 30  ILE A H    12 
ATOM   7503  H  HA   . ILE A 1 30 ? -0.563  9.717   3.519   1.00 0.00 ? 30  ILE A HA   12 
ATOM   7504  H  HB   . ILE A 1 30 ? -2.367  8.618   5.677   1.00 0.00 ? 30  ILE A HB   12 
ATOM   7505  H  HG12 . ILE A 1 30 ? -2.758  11.074  3.957   1.00 0.00 ? 30  ILE A HG12 12 
ATOM   7506  H  HG13 . ILE A 1 30 ? -3.549  9.530   3.658   1.00 0.00 ? 30  ILE A HG13 12 
ATOM   7507  H  HG21 . ILE A 1 30 ? -0.303  9.941   6.346   1.00 0.00 ? 30  ILE A HG21 12 
ATOM   7508  H  HG22 . ILE A 1 30 ? -1.074  11.327  5.579   1.00 0.00 ? 30  ILE A HG22 12 
ATOM   7509  H  HG23 . ILE A 1 30 ? -1.852  10.531  6.946   1.00 0.00 ? 30  ILE A HG23 12 
ATOM   7510  H  HD11 . ILE A 1 30 ? -4.032  10.180  6.351   1.00 0.00 ? 30  ILE A HD11 12 
ATOM   7511  H  HD12 . ILE A 1 30 ? -4.323  11.640  5.405   1.00 0.00 ? 30  ILE A HD12 12 
ATOM   7512  H  HD13 . ILE A 1 30 ? -5.179  10.148  5.011   1.00 0.00 ? 30  ILE A HD13 12 
ATOM   7513  N  N    . HIS A 1 31 ? -0.111  6.842   5.018   1.00 0.00 ? 31  HIS A N    12 
ATOM   7514  C  CA   . HIS A 1 31 ? 0.875   6.005   5.692   1.00 0.00 ? 31  HIS A CA   12 
ATOM   7515  C  C    . HIS A 1 31 ? 2.094   5.778   4.804   1.00 0.00 ? 31  HIS A C    12 
ATOM   7516  O  O    . HIS A 1 31 ? 3.233   5.922   5.249   1.00 0.00 ? 31  HIS A O    12 
ATOM   7517  C  CB   . HIS A 1 31 ? 0.255   4.662   6.080   1.00 0.00 ? 31  HIS A CB   12 
ATOM   7518  C  CG   . HIS A 1 31 ? 1.255   3.555   6.209   1.00 0.00 ? 31  HIS A CG   12 
ATOM   7519  N  ND1  . HIS A 1 31 ? 1.602   2.991   7.419   1.00 0.00 ? 31  HIS A ND1  12 
ATOM   7520  C  CD2  . HIS A 1 31 ? 1.984   2.906   5.271   1.00 0.00 ? 31  HIS A CD2  12 
ATOM   7521  C  CE1  . HIS A 1 31 ? 2.502   2.044   7.219   1.00 0.00 ? 31  HIS A CE1  12 
ATOM   7522  N  NE2  . HIS A 1 31 ? 2.750   1.973   5.924   1.00 0.00 ? 31  HIS A NE2  12 
ATOM   7523  H  H    . HIS A 1 31 ? -0.963  6.447   4.738   1.00 0.00 ? 31  HIS A H    12 
ATOM   7524  H  HA   . HIS A 1 31 ? 1.189   6.518   6.588   1.00 0.00 ? 31  HIS A HA   12 
ATOM   7525  H  HB2  . HIS A 1 31 ? -0.248  4.766   7.030   1.00 0.00 ? 31  HIS A HB2  12 
ATOM   7526  H  HB3  . HIS A 1 31 ? -0.465  4.374   5.327   1.00 0.00 ? 31  HIS A HB3  12 
ATOM   7527  H  HD1  . HIS A 1 31 ? 1.243   3.247   8.293   1.00 0.00 ? 31  HIS A HD1  12 
ATOM   7528  H  HD2  . HIS A 1 31 ? 1.967   3.089   4.205   1.00 0.00 ? 31  HIS A HD2  12 
ATOM   7529  H  HE1  . HIS A 1 31 ? 2.956   1.433   7.984   1.00 0.00 ? 31  HIS A HE1  12 
ATOM   7530  N  N    . GLN A 1 32 ? 1.847   5.422   3.548   1.00 0.00 ? 32  GLN A N    12 
ATOM   7531  C  CA   . GLN A 1 32 ? 2.926   5.174   2.598   1.00 0.00 ? 32  GLN A CA   12 
ATOM   7532  C  C    . GLN A 1 32 ? 3.933   6.319   2.608   1.00 0.00 ? 32  GLN A C    12 
ATOM   7533  O  O    . GLN A 1 32 ? 5.071   6.162   2.164   1.00 0.00 ? 32  GLN A O    12 
ATOM   7534  C  CB   . GLN A 1 32 ? 2.360   4.988   1.189   1.00 0.00 ? 32  GLN A CB   12 
ATOM   7535  C  CG   . GLN A 1 32 ? 1.556   3.709   1.020   1.00 0.00 ? 32  GLN A CG   12 
ATOM   7536  C  CD   . GLN A 1 32 ? 0.652   3.745   -0.197  1.00 0.00 ? 32  GLN A CD   12 
ATOM   7537  O  OE1  . GLN A 1 32 ? 0.281   4.816   -0.678  1.00 0.00 ? 32  GLN A OE1  12 
ATOM   7538  N  NE2  . GLN A 1 32 ? 0.292   2.571   -0.702  1.00 0.00 ? 32  GLN A NE2  12 
ATOM   7539  H  H    . GLN A 1 32 ? 0.918   5.324   3.253   1.00 0.00 ? 32  GLN A H    12 
ATOM   7540  H  HA   . GLN A 1 32 ? 3.428   4.266   2.897   1.00 0.00 ? 32  GLN A HA   12 
ATOM   7541  H  HB2  . GLN A 1 32 ? 1.719   5.825   0.958   1.00 0.00 ? 32  GLN A HB2  12 
ATOM   7542  H  HB3  . GLN A 1 32 ? 3.179   4.967   0.485   1.00 0.00 ? 32  GLN A HB3  12 
ATOM   7543  H  HG2  . GLN A 1 32 ? 2.239   2.880   0.917   1.00 0.00 ? 32  GLN A HG2  12 
ATOM   7544  H  HG3  . GLN A 1 32 ? 0.946   3.565   1.900   1.00 0.00 ? 32  GLN A HG3  12 
ATOM   7545  H  HE21 . GLN A 1 32 ? 0.624   1.758   -0.265  1.00 0.00 ? 32  GLN A HE21 12 
ATOM   7546  H  HE22 . GLN A 1 32 ? -0.292  2.564   -1.487  1.00 0.00 ? 32  GLN A HE22 12 
ATOM   7547  N  N    . LYS A 1 33 ? 3.508   7.470   3.116   1.00 0.00 ? 33  LYS A N    12 
ATOM   7548  C  CA   . LYS A 1 33 ? 4.373   8.642   3.185   1.00 0.00 ? 33  LYS A CA   12 
ATOM   7549  C  C    . LYS A 1 33 ? 5.635   8.341   3.986   1.00 0.00 ? 33  LYS A C    12 
ATOM   7550  O  O    . LYS A 1 33 ? 6.693   8.918   3.734   1.00 0.00 ? 33  LYS A O    12 
ATOM   7551  C  CB   . LYS A 1 33 ? 3.623   9.818   3.817   1.00 0.00 ? 33  LYS A CB   12 
ATOM   7552  C  CG   . LYS A 1 33 ? 2.471   10.330  2.970   1.00 0.00 ? 33  LYS A CG   12 
ATOM   7553  C  CD   . LYS A 1 33 ? 2.161   11.787  3.273   1.00 0.00 ? 33  LYS A CD   12 
ATOM   7554  C  CE   . LYS A 1 33 ? 0.979   12.286  2.456   1.00 0.00 ? 33  LYS A CE   12 
ATOM   7555  N  NZ   . LYS A 1 33 ? 1.372   12.624  1.060   1.00 0.00 ? 33  LYS A NZ   12 
ATOM   7556  H  H    . LYS A 1 33 ? 2.590   7.533   3.454   1.00 0.00 ? 33  LYS A H    12 
ATOM   7557  H  HA   . LYS A 1 33 ? 4.655   8.906   2.177   1.00 0.00 ? 33  LYS A HA   12 
ATOM   7558  H  HB2  . LYS A 1 33 ? 3.230   9.506   4.773   1.00 0.00 ? 33  LYS A HB2  12 
ATOM   7559  H  HB3  . LYS A 1 33 ? 4.318   10.631  3.971   1.00 0.00 ? 33  LYS A HB3  12 
ATOM   7560  H  HG2  . LYS A 1 33 ? 2.734   10.238  1.927   1.00 0.00 ? 33  LYS A HG2  12 
ATOM   7561  H  HG3  . LYS A 1 33 ? 1.593   9.735   3.176   1.00 0.00 ? 33  LYS A HG3  12 
ATOM   7562  H  HD2  . LYS A 1 33 ? 1.927   11.886  4.322   1.00 0.00 ? 33  LYS A HD2  12 
ATOM   7563  H  HD3  . LYS A 1 33 ? 3.029   12.386  3.037   1.00 0.00 ? 33  LYS A HD3  12 
ATOM   7564  H  HE2  . LYS A 1 33 ? 0.224   11.516  2.432   1.00 0.00 ? 33  LYS A HE2  12 
ATOM   7565  H  HE3  . LYS A 1 33 ? 0.578   13.169  2.932   1.00 0.00 ? 33  LYS A HE3  12 
ATOM   7566  H  HZ1  . LYS A 1 33 ? 1.079   13.595  0.831   1.00 0.00 ? 33  LYS A HZ1  12 
ATOM   7567  H  HZ2  . LYS A 1 33 ? 0.917   11.969  0.393   1.00 0.00 ? 33  LYS A HZ2  12 
ATOM   7568  H  HZ3  . LYS A 1 33 ? 2.404   12.551  0.952   1.00 0.00 ? 33  LYS A HZ3  12 
ATOM   7569  N  N    . ILE A 1 34 ? 5.517   7.434   4.949   1.00 0.00 ? 34  ILE A N    12 
ATOM   7570  C  CA   . ILE A 1 34 ? 6.649   7.055   5.785   1.00 0.00 ? 34  ILE A CA   12 
ATOM   7571  C  C    . ILE A 1 34 ? 7.760   6.424   4.951   1.00 0.00 ? 34  ILE A C    12 
ATOM   7572  O  O    . ILE A 1 34 ? 8.854   6.161   5.452   1.00 0.00 ? 34  ILE A O    12 
ATOM   7573  C  CB   . ILE A 1 34 ? 6.229   6.068   6.890   1.00 0.00 ? 34  ILE A CB   12 
ATOM   7574  C  CG1  . ILE A 1 34 ? 5.929   4.693   6.289   1.00 0.00 ? 34  ILE A CG1  12 
ATOM   7575  C  CG2  . ILE A 1 34 ? 5.018   6.600   7.641   1.00 0.00 ? 34  ILE A CG2  12 
ATOM   7576  C  CD1  . ILE A 1 34 ? 5.768   3.603   7.326   1.00 0.00 ? 34  ILE A CD1  12 
ATOM   7577  H  H    . ILE A 1 34 ? 4.647   7.009   5.102   1.00 0.00 ? 34  ILE A H    12 
ATOM   7578  H  HA   . ILE A 1 34 ? 7.031   7.950   6.255   1.00 0.00 ? 34  ILE A HA   12 
ATOM   7579  H  HB   . ILE A 1 34 ? 7.045   5.977   7.590   1.00 0.00 ? 34  ILE A HB   12 
ATOM   7580  H  HG12 . ILE A 1 34 ? 5.013   4.747   5.722   1.00 0.00 ? 34  ILE A HG12 12 
ATOM   7581  H  HG13 . ILE A 1 34 ? 6.739   4.411   5.632   1.00 0.00 ? 34  ILE A HG13 12 
ATOM   7582  H  HG21 . ILE A 1 34 ? 4.424   5.772   7.999   1.00 0.00 ? 34  ILE A HG21 12 
ATOM   7583  H  HG22 . ILE A 1 34 ? 5.347   7.193   8.481   1.00 0.00 ? 34  ILE A HG22 12 
ATOM   7584  H  HG23 . ILE A 1 34 ? 4.422   7.211   6.980   1.00 0.00 ? 34  ILE A HG23 12 
ATOM   7585  H  HD11 . ILE A 1 34 ? 4.760   3.216   7.287   1.00 0.00 ? 34  ILE A HD11 12 
ATOM   7586  H  HD12 . ILE A 1 34 ? 6.467   2.805   7.120   1.00 0.00 ? 34  ILE A HD12 12 
ATOM   7587  H  HD13 . ILE A 1 34 ? 5.961   4.008   8.308   1.00 0.00 ? 34  ILE A HD13 12 
ATOM   7588  N  N    . HIS A 1 35 ? 7.472   6.185   3.676   1.00 0.00 ? 35  HIS A N    12 
ATOM   7589  C  CA   . HIS A 1 35 ? 8.448   5.587   2.771   1.00 0.00 ? 35  HIS A CA   12 
ATOM   7590  C  C    . HIS A 1 35 ? 8.881   6.586   1.703   1.00 0.00 ? 35  HIS A C    12 
ATOM   7591  O  O    . HIS A 1 35 ? 9.461   6.209   0.683   1.00 0.00 ? 35  HIS A O    12 
ATOM   7592  C  CB   . HIS A 1 35 ? 7.864   4.338   2.111   1.00 0.00 ? 35  HIS A CB   12 
ATOM   7593  C  CG   . HIS A 1 35 ? 7.228   3.390   3.081   1.00 0.00 ? 35  HIS A CG   12 
ATOM   7594  N  ND1  . HIS A 1 35 ? 7.919   2.796   4.116   1.00 0.00 ? 35  HIS A ND1  12 
ATOM   7595  C  CD2  . HIS A 1 35 ? 5.956   2.935   3.170   1.00 0.00 ? 35  HIS A CD2  12 
ATOM   7596  C  CE1  . HIS A 1 35 ? 7.100   2.015   4.799   1.00 0.00 ? 35  HIS A CE1  12 
ATOM   7597  N  NE2  . HIS A 1 35 ? 5.903   2.083   4.245   1.00 0.00 ? 35  HIS A NE2  12 
ATOM   7598  H  H    . HIS A 1 35 ? 6.583   6.416   3.335   1.00 0.00 ? 35  HIS A H    12 
ATOM   7599  H  HA   . HIS A 1 35 ? 9.312   5.305   3.354   1.00 0.00 ? 35  HIS A HA   12 
ATOM   7600  H  HB2  . HIS A 1 35 ? 7.111   4.635   1.396   1.00 0.00 ? 35  HIS A HB2  12 
ATOM   7601  H  HB3  . HIS A 1 35 ? 8.653   3.808   1.597   1.00 0.00 ? 35  HIS A HB3  12 
ATOM   7602  H  HD1  . HIS A 1 35 ? 8.868   2.925   4.319   1.00 0.00 ? 35  HIS A HD1  12 
ATOM   7603  H  HD2  . HIS A 1 35 ? 5.135   3.194   2.516   1.00 0.00 ? 35  HIS A HD2  12 
ATOM   7604  H  HE1  . HIS A 1 35 ? 7.363   1.424   5.662   1.00 0.00 ? 35  HIS A HE1  12 
ATOM   7605  N  N    . THR A 1 36 ? 8.596   7.862   1.942   1.00 0.00 ? 36  THR A N    12 
ATOM   7606  C  CA   . THR A 1 36 ? 8.954   8.915   0.999   1.00 0.00 ? 36  THR A CA   12 
ATOM   7607  C  C    . THR A 1 36 ? 9.713   10.040  1.694   1.00 0.00 ? 36  THR A C    12 
ATOM   7608  O  O    . THR A 1 36 ? 9.153   10.763  2.517   1.00 0.00 ? 36  THR A O    12 
ATOM   7609  C  CB   . THR A 1 36 ? 7.707   9.500   0.311   1.00 0.00 ? 36  THR A CB   12 
ATOM   7610  O  OG1  . THR A 1 36 ? 6.759   9.927   1.295   1.00 0.00 ? 36  THR A OG1  12 
ATOM   7611  C  CG2  . THR A 1 36 ? 7.064   8.473   -0.609  1.00 0.00 ? 36  THR A CG2  12 
ATOM   7612  H  H    . THR A 1 36 ? 8.133   8.100   2.772   1.00 0.00 ? 36  THR A H    12 
ATOM   7613  H  HA   . THR A 1 36 ? 9.589   8.481   0.240   1.00 0.00 ? 36  THR A HA   12 
ATOM   7614  H  HB   . THR A 1 36 ? 8.009   10.353  -0.282  1.00 0.00 ? 36  THR A HB   12 
ATOM   7615  H  HG1  . THR A 1 36 ? 6.079   10.460  0.875   1.00 0.00 ? 36  THR A HG1  12 
ATOM   7616  H  HG21 . THR A 1 36 ? 7.831   7.970   -1.178  1.00 0.00 ? 36  THR A HG21 12 
ATOM   7617  H  HG22 . THR A 1 36 ? 6.383   8.970   -1.284  1.00 0.00 ? 36  THR A HG22 12 
ATOM   7618  H  HG23 . THR A 1 36 ? 6.522   7.750   -0.017  1.00 0.00 ? 36  THR A HG23 12 
ATOM   7619  N  N    . GLY A 1 37 ? 10.991  10.183  1.356   1.00 0.00 ? 37  GLY A N    12 
ATOM   7620  C  CA   . GLY A 1 37 ? 11.805  11.223  1.957   1.00 0.00 ? 37  GLY A CA   12 
ATOM   7621  C  C    . GLY A 1 37 ? 13.149  11.376  1.273   1.00 0.00 ? 37  GLY A C    12 
ATOM   7622  O  O    . GLY A 1 37 ? 13.396  10.764  0.234   1.00 0.00 ? 37  GLY A O    12 
ATOM   7623  H  H    . GLY A 1 37 ? 11.384  9.577   0.694   1.00 0.00 ? 37  GLY A H    12 
ATOM   7624  H  HA2  . GLY A 1 37 ? 11.273  12.161  1.897   1.00 0.00 ? 37  GLY A HA2  12 
ATOM   7625  H  HA3  . GLY A 1 37 ? 11.969  10.980  2.997   1.00 0.00 ? 37  GLY A HA3  12 
ATOM   7626  N  N    . GLU A 1 38 ? 14.018  12.195  1.855   1.00 0.00 ? 38  GLU A N    12 
ATOM   7627  C  CA   . GLU A 1 38 ? 15.343  12.428  1.292   1.00 0.00 ? 38  GLU A CA   12 
ATOM   7628  C  C    . GLU A 1 38 ? 16.430  11.892  2.220   1.00 0.00 ? 38  GLU A C    12 
ATOM   7629  O  O    . GLU A 1 38 ? 16.146  11.432  3.326   1.00 0.00 ? 38  GLU A O    12 
ATOM   7630  C  CB   . GLU A 1 38 ? 15.561  13.922  1.043   1.00 0.00 ? 38  GLU A CB   12 
ATOM   7631  C  CG   . GLU A 1 38 ? 14.754  14.468  -0.123  1.00 0.00 ? 38  GLU A CG   12 
ATOM   7632  C  CD   . GLU A 1 38 ? 15.401  14.182  -1.465  1.00 0.00 ? 38  GLU A CD   12 
ATOM   7633  O  OE1  . GLU A 1 38 ? 16.643  14.055  -1.510  1.00 0.00 ? 38  GLU A OE1  12 
ATOM   7634  O  OE2  . GLU A 1 38 ? 14.665  14.085  -2.469  1.00 0.00 ? 38  GLU A OE2  12 
ATOM   7635  H  H    . GLU A 1 38 ? 13.763  12.655  2.682   1.00 0.00 ? 38  GLU A H    12 
ATOM   7636  H  HA   . GLU A 1 38 ? 15.400  11.903  0.350   1.00 0.00 ? 38  GLU A HA   12 
ATOM   7637  H  HB2  . GLU A 1 38 ? 15.284  14.467  1.933   1.00 0.00 ? 38  GLU A HB2  12 
ATOM   7638  H  HB3  . GLU A 1 38 ? 16.608  14.091  0.840   1.00 0.00 ? 38  GLU A HB3  12 
ATOM   7639  H  HG2  . GLU A 1 38 ? 13.774  14.015  -0.110  1.00 0.00 ? 38  GLU A HG2  12 
ATOM   7640  H  HG3  . GLU A 1 38 ? 14.657  15.537  -0.008  1.00 0.00 ? 38  GLU A HG3  12 
ATOM   7641  N  N    . ARG A 1 39 ? 17.676  11.955  1.760   1.00 0.00 ? 39  ARG A N    12 
ATOM   7642  C  CA   . ARG A 1 39 ? 18.805  11.475  2.547   1.00 0.00 ? 39  ARG A CA   12 
ATOM   7643  C  C    . ARG A 1 39 ? 20.055  12.304  2.266   1.00 0.00 ? 39  ARG A C    12 
ATOM   7644  O  O    . ARG A 1 39 ? 20.325  12.700  1.132   1.00 0.00 ? 39  ARG A O    12 
ATOM   7645  C  CB   . ARG A 1 39 ? 19.079  10.001  2.240   1.00 0.00 ? 39  ARG A CB   12 
ATOM   7646  C  CG   . ARG A 1 39 ? 19.417  9.736   0.782   1.00 0.00 ? 39  ARG A CG   12 
ATOM   7647  C  CD   . ARG A 1 39 ? 18.162  9.607   -0.067  1.00 0.00 ? 39  ARG A CD   12 
ATOM   7648  N  NE   . ARG A 1 39 ? 17.324  8.490   0.361   1.00 0.00 ? 39  ARG A NE   12 
ATOM   7649  C  CZ   . ARG A 1 39 ? 16.447  7.883   -0.431  1.00 0.00 ? 39  ARG A CZ   12 
ATOM   7650  N  NH1  . ARG A 1 39 ? 16.294  8.284   -1.686  1.00 0.00 ? 39  ARG A NH1  12 
ATOM   7651  N  NH2  . ARG A 1 39 ? 15.721  6.874   0.032   1.00 0.00 ? 39  ARG A NH2  12 
ATOM   7652  H  H    . ARG A 1 39 ? 17.839  12.332  0.870   1.00 0.00 ? 39  ARG A H    12 
ATOM   7653  H  HA   . ARG A 1 39 ? 18.549  11.574  3.591   1.00 0.00 ? 39  ARG A HA   12 
ATOM   7654  H  HB2  . ARG A 1 39 ? 19.908  9.667   2.845   1.00 0.00 ? 39  ARG A HB2  12 
ATOM   7655  H  HB3  . ARG A 1 39 ? 18.202  9.424   2.494   1.00 0.00 ? 39  ARG A HB3  12 
ATOM   7656  H  HG2  . ARG A 1 39 ? 20.011  10.555  0.405   1.00 0.00 ? 39  ARG A HG2  12 
ATOM   7657  H  HG3  . ARG A 1 39 ? 19.983  8.818   0.715   1.00 0.00 ? 39  ARG A HG3  12 
ATOM   7658  H  HD2  . ARG A 1 39 ? 17.594  10.521  0.013   1.00 0.00 ? 39  ARG A HD2  12 
ATOM   7659  H  HD3  . ARG A 1 39 ? 18.454  9.453   -1.095  1.00 0.00 ? 39  ARG A HD3  12 
ATOM   7660  H  HE   . ARG A 1 39 ? 17.421  8.178   1.285   1.00 0.00 ? 39  ARG A HE   12 
ATOM   7661  H  HH11 . ARG A 1 39 ? 16.841  9.043   -2.037  1.00 0.00 ? 39  ARG A HH11 12 
ATOM   7662  H  HH12 . ARG A 1 39 ? 15.634  7.824   -2.280  1.00 0.00 ? 39  ARG A HH12 12 
ATOM   7663  H  HH21 . ARG A 1 39 ? 15.833  6.569   0.977   1.00 0.00 ? 39  ARG A HH21 12 
ATOM   7664  H  HH22 . ARG A 1 39 ? 15.061  6.418   -0.565  1.00 0.00 ? 39  ARG A HH22 12 
ATOM   7665  N  N    . PRO A 1 40 ? 20.836  12.574  3.323   1.00 0.00 ? 40  PRO A N    12 
ATOM   7666  C  CA   . PRO A 1 40 ? 22.069  13.359  3.215   1.00 0.00 ? 40  PRO A CA   12 
ATOM   7667  C  C    . PRO A 1 40 ? 23.169  12.611  2.470   1.00 0.00 ? 40  PRO A C    12 
ATOM   7668  O  O    . PRO A 1 40 ? 22.953  11.507  1.971   1.00 0.00 ? 40  PRO A O    12 
ATOM   7669  C  CB   . PRO A 1 40 ? 22.472  13.588  4.674   1.00 0.00 ? 40  PRO A CB   12 
ATOM   7670  C  CG   . PRO A 1 40 ? 21.858  12.453  5.419   1.00 0.00 ? 40  PRO A CG   12 
ATOM   7671  C  CD   . PRO A 1 40 ? 20.575  12.134  4.704   1.00 0.00 ? 40  PRO A CD   12 
ATOM   7672  H  HA   . PRO A 1 40 ? 21.893  14.311  2.735   1.00 0.00 ? 40  PRO A HA   12 
ATOM   7673  H  HB2  . PRO A 1 40 ? 23.550  13.580  4.758   1.00 0.00 ? 40  PRO A HB2  12 
ATOM   7674  H  HB3  . PRO A 1 40 ? 22.086  14.537  5.013   1.00 0.00 ? 40  PRO A HB3  12 
ATOM   7675  H  HG2  . PRO A 1 40 ? 22.520  11.601  5.401   1.00 0.00 ? 40  PRO A HG2  12 
ATOM   7676  H  HG3  . PRO A 1 40 ? 21.655  12.751  6.438   1.00 0.00 ? 40  PRO A HG3  12 
ATOM   7677  H  HD2  . PRO A 1 40 ? 20.376  11.073  4.739   1.00 0.00 ? 40  PRO A HD2  12 
ATOM   7678  H  HD3  . PRO A 1 40 ? 19.754  12.688  5.135   1.00 0.00 ? 40  PRO A HD3  12 
ATOM   7679  N  N    . SER A 1 41 ? 24.349  13.219  2.399   1.00 0.00 ? 41  SER A N    12 
ATOM   7680  C  CA   . SER A 1 41 ? 25.482  12.611  1.711   1.00 0.00 ? 41  SER A CA   12 
ATOM   7681  C  C    . SER A 1 41 ? 26.505  12.084  2.712   1.00 0.00 ? 41  SER A C    12 
ATOM   7682  O  O    . SER A 1 41 ? 27.712  12.162  2.484   1.00 0.00 ? 41  SER A O    12 
ATOM   7683  C  CB   . SER A 1 41 ? 26.143  13.627  0.777   1.00 0.00 ? 41  SER A CB   12 
ATOM   7684  O  OG   . SER A 1 41 ? 26.821  14.630  1.512   1.00 0.00 ? 41  SER A OG   12 
ATOM   7685  H  H    . SER A 1 41 ? 24.459  14.099  2.817   1.00 0.00 ? 41  SER A H    12 
ATOM   7686  H  HA   . SER A 1 41 ? 25.110  11.785  1.125   1.00 0.00 ? 41  SER A HA   12 
ATOM   7687  H  HB2  . SER A 1 41 ? 26.854  13.119  0.143   1.00 0.00 ? 41  SER A HB2  12 
ATOM   7688  H  HB3  . SER A 1 41 ? 25.385  14.095  0.165   1.00 0.00 ? 41  SER A HB3  12 
ATOM   7689  H  HG   . SER A 1 41 ? 26.196  15.095  2.073   1.00 0.00 ? 41  SER A HG   12 
ATOM   7690  N  N    . GLY A 1 42 ? 26.013  11.545  3.824   1.00 0.00 ? 42  GLY A N    12 
ATOM   7691  C  CA   . GLY A 1 42 ? 26.897  11.012  4.844   1.00 0.00 ? 42  GLY A CA   12 
ATOM   7692  C  C    . GLY A 1 42 ? 26.634  9.547   5.131   1.00 0.00 ? 42  GLY A C    12 
ATOM   7693  O  O    . GLY A 1 42 ? 25.555  9.022   4.855   1.00 0.00 ? 42  GLY A O    12 
ATOM   7694  H  H    . GLY A 1 42 ? 25.042  11.510  3.953   1.00 0.00 ? 42  GLY A H    12 
ATOM   7695  H  HA2  . GLY A 1 42 ? 27.919  11.126  4.515   1.00 0.00 ? 42  GLY A HA2  12 
ATOM   7696  H  HA3  . GLY A 1 42 ? 26.758  11.576  5.755   1.00 0.00 ? 42  GLY A HA3  12 
ATOM   7697  N  N    . PRO A 1 43 ? 27.638  8.862   5.698   1.00 0.00 ? 43  PRO A N    12 
ATOM   7698  C  CA   . PRO A 1 43 ? 27.535  7.438   6.033   1.00 0.00 ? 43  PRO A CA   12 
ATOM   7699  C  C    . PRO A 1 43 ? 26.577  7.184   7.193   1.00 0.00 ? 43  PRO A C    12 
ATOM   7700  O  O    . PRO A 1 43 ? 26.941  7.348   8.357   1.00 0.00 ? 43  PRO A O    12 
ATOM   7701  C  CB   . PRO A 1 43 ? 28.965  7.062   6.428   1.00 0.00 ? 43  PRO A CB   12 
ATOM   7702  C  CG   . PRO A 1 43 ? 29.580  8.339   6.886   1.00 0.00 ? 43  PRO A CG   12 
ATOM   7703  C  CD   . PRO A 1 43 ? 28.952  9.423   6.054   1.00 0.00 ? 43  PRO A CD   12 
ATOM   7704  H  HA   . PRO A 1 43 ? 27.229  6.851   5.180   1.00 0.00 ? 43  PRO A HA   12 
ATOM   7705  H  HB2  . PRO A 1 43 ? 28.940  6.328   7.221   1.00 0.00 ? 43  PRO A HB2  12 
ATOM   7706  H  HB3  . PRO A 1 43 ? 29.485  6.659   5.572   1.00 0.00 ? 43  PRO A HB3  12 
ATOM   7707  H  HG2  . PRO A 1 43 ? 29.364  8.497   7.932   1.00 0.00 ? 43  PRO A HG2  12 
ATOM   7708  H  HG3  . PRO A 1 43 ? 30.647  8.312   6.722   1.00 0.00 ? 43  PRO A HG3  12 
ATOM   7709  H  HD2  . PRO A 1 43 ? 28.841  10.327  6.634   1.00 0.00 ? 43  PRO A HD2  12 
ATOM   7710  H  HD3  . PRO A 1 43 ? 29.544  9.610   5.170   1.00 0.00 ? 43  PRO A HD3  12 
ATOM   7711  N  N    . SER A 1 44 ? 25.353  6.784   6.866   1.00 0.00 ? 44  SER A N    12 
ATOM   7712  C  CA   . SER A 1 44 ? 24.342  6.511   7.881   1.00 0.00 ? 44  SER A CA   12 
ATOM   7713  C  C    . SER A 1 44 ? 24.533  5.119   8.477   1.00 0.00 ? 44  SER A C    12 
ATOM   7714  O  O    . SER A 1 44 ? 23.576  4.359   8.626   1.00 0.00 ? 44  SER A O    12 
ATOM   7715  C  CB   . SER A 1 44 ? 22.940  6.632   7.280   1.00 0.00 ? 44  SER A CB   12 
ATOM   7716  O  OG   . SER A 1 44 ? 22.705  7.943   6.795   1.00 0.00 ? 44  SER A OG   12 
ATOM   7717  H  H    . SER A 1 44 ? 25.123  6.672   5.920   1.00 0.00 ? 44  SER A H    12 
ATOM   7718  H  HA   . SER A 1 44 ? 24.453  7.244   8.665   1.00 0.00 ? 44  SER A HA   12 
ATOM   7719  H  HB2  . SER A 1 44 ? 22.840  5.935   6.463   1.00 0.00 ? 44  SER A HB2  12 
ATOM   7720  H  HB3  . SER A 1 44 ? 22.205  6.405   8.039   1.00 0.00 ? 44  SER A HB3  12 
ATOM   7721  H  HG   . SER A 1 44 ? 22.445  7.901   5.872   1.00 0.00 ? 44  SER A HG   12 
ATOM   7722  N  N    . SER A 1 45 ? 25.776  4.793   8.816   1.00 0.00 ? 45  SER A N    12 
ATOM   7723  C  CA   . SER A 1 45 ? 26.095  3.492   9.392   1.00 0.00 ? 45  SER A CA   12 
ATOM   7724  C  C    . SER A 1 45 ? 25.224  2.399   8.780   1.00 0.00 ? 45  SER A C    12 
ATOM   7725  O  O    . SER A 1 45 ? 24.741  1.510   9.480   1.00 0.00 ? 45  SER A O    12 
ATOM   7726  C  CB   . SER A 1 45 ? 25.904  3.522   10.910  1.00 0.00 ? 45  SER A CB   12 
ATOM   7727  O  OG   . SER A 1 45 ? 26.527  2.408   11.524  1.00 0.00 ? 45  SER A OG   12 
ATOM   7728  H  H    . SER A 1 45 ? 26.496  5.442   8.672   1.00 0.00 ? 45  SER A H    12 
ATOM   7729  H  HA   . SER A 1 45 ? 27.130  3.277   9.172   1.00 0.00 ? 45  SER A HA   12 
ATOM   7730  H  HB2  . SER A 1 45 ? 26.339  4.427   11.307  1.00 0.00 ? 45  SER A HB2  12 
ATOM   7731  H  HB3  . SER A 1 45 ? 24.848  3.501   11.137  1.00 0.00 ? 45  SER A HB3  12 
ATOM   7732  H  HG   . SER A 1 45 ? 26.103  1.600   11.227  1.00 0.00 ? 45  SER A HG   12 
ATOM   7733  N  N    . GLY A 1 46 ? 25.029  2.472   7.467   1.00 0.00 ? 46  GLY A N    12 
ATOM   7734  C  CA   . GLY A 1 46 ? 24.217  1.483   6.782   1.00 0.00 ? 46  GLY A CA   12 
ATOM   7735  C  C    . GLY A 1 46 ? 24.607  0.063   7.141   1.00 0.00 ? 46  GLY A C    12 
ATOM   7736  O  O    . GLY A 1 46 ? 25.798  -0.219  7.262   1.00 0.00 ? 46  GLY A O    12 
ATOM   7737  H  H    . GLY A 1 46 ? 25.440  3.203   6.959   1.00 0.00 ? 46  GLY A H    12 
ATOM   7738  H  HA2  . GLY A 1 46 ? 23.182  1.639   7.044   1.00 0.00 ? 46  GLY A HA2  12 
ATOM   7739  H  HA3  . GLY A 1 46 ? 24.332  1.616   5.716   1.00 0.00 ? 46  GLY A HA3  12 
HETATM 7740  ZN ZN   . ZN  B 2 .  ? 4.052   1.145   4.504   1.00 0.00 ? 201 ZN  A ZN   12 
ATOM   7741  N  N    . GLY A 1 1  ? 2.665   -24.389 -14.343 1.00 0.00 ? 1   GLY A N    13 
ATOM   7742  C  CA   . GLY A 1 1  ? 1.948   -23.317 -13.676 1.00 0.00 ? 1   GLY A CA   13 
ATOM   7743  C  C    . GLY A 1 1  ? 1.817   -23.548 -12.184 1.00 0.00 ? 1   GLY A C    13 
ATOM   7744  O  O    . GLY A 1 1  ? 2.193   -24.605 -11.677 1.00 0.00 ? 1   GLY A O    13 
ATOM   7745  H  H1   . GLY A 1 1  ? 3.642   -24.435 -14.279 1.00 0.00 ? 1   GLY A H1   13 
ATOM   7746  H  HA2  . GLY A 1 1  ? 2.475   -22.389 -13.842 1.00 0.00 ? 1   GLY A HA2  13 
ATOM   7747  H  HA3  . GLY A 1 1  ? 0.960   -23.240 -14.105 1.00 0.00 ? 1   GLY A HA3  13 
ATOM   7748  N  N    . SER A 1 2  ? 1.284   -22.556 -11.478 1.00 0.00 ? 2   SER A N    13 
ATOM   7749  C  CA   . SER A 1 2  ? 1.110   -22.653 -10.033 1.00 0.00 ? 2   SER A CA   13 
ATOM   7750  C  C    . SER A 1 2  ? -0.105  -21.850 -9.577  1.00 0.00 ? 2   SER A C    13 
ATOM   7751  O  O    . SER A 1 2  ? -0.409  -20.795 -10.133 1.00 0.00 ? 2   SER A O    13 
ATOM   7752  C  CB   . SER A 1 2  ? 2.364   -22.157 -9.312  1.00 0.00 ? 2   SER A CB   13 
ATOM   7753  O  OG   . SER A 1 2  ? 2.728   -20.861 -9.755  1.00 0.00 ? 2   SER A OG   13 
ATOM   7754  H  H    . SER A 1 2  ? 1.004   -21.738 -11.939 1.00 0.00 ? 2   SER A H    13 
ATOM   7755  H  HA   . SER A 1 2  ? 0.951   -23.693 -9.788  1.00 0.00 ? 2   SER A HA   13 
ATOM   7756  H  HB2  . SER A 1 2  ? 2.175   -22.121 -8.250  1.00 0.00 ? 2   SER A HB2  13 
ATOM   7757  H  HB3  . SER A 1 2  ? 3.182   -22.835 -9.510  1.00 0.00 ? 2   SER A HB3  13 
ATOM   7758  H  HG   . SER A 1 2  ? 1.951   -20.407 -10.091 1.00 0.00 ? 2   SER A HG   13 
ATOM   7759  N  N    . SER A 1 3  ? -0.795  -22.358 -8.561  1.00 0.00 ? 3   SER A N    13 
ATOM   7760  C  CA   . SER A 1 3  ? -1.979  -21.691 -8.032  1.00 0.00 ? 3   SER A CA   13 
ATOM   7761  C  C    . SER A 1 3  ? -1.696  -21.092 -6.658  1.00 0.00 ? 3   SER A C    13 
ATOM   7762  O  O    . SER A 1 3  ? -1.213  -21.777 -5.757  1.00 0.00 ? 3   SER A O    13 
ATOM   7763  C  CB   . SER A 1 3  ? -3.147  -22.675 -7.941  1.00 0.00 ? 3   SER A CB   13 
ATOM   7764  O  OG   . SER A 1 3  ? -4.390  -21.999 -8.018  1.00 0.00 ? 3   SER A OG   13 
ATOM   7765  H  H    . SER A 1 3  ? -0.502  -23.203 -8.160  1.00 0.00 ? 3   SER A H    13 
ATOM   7766  H  HA   . SER A 1 3  ? -2.242  -20.895 -8.712  1.00 0.00 ? 3   SER A HA   13 
ATOM   7767  H  HB2  . SER A 1 3  ? -3.084  -23.381 -8.755  1.00 0.00 ? 3   SER A HB2  13 
ATOM   7768  H  HB3  . SER A 1 3  ? -3.095  -23.205 -7.001  1.00 0.00 ? 3   SER A HB3  13 
ATOM   7769  H  HG   . SER A 1 3  ? -4.394  -21.423 -8.785  1.00 0.00 ? 3   SER A HG   13 
ATOM   7770  N  N    . GLY A 1 4  ? -2.001  -19.807 -6.505  1.00 0.00 ? 4   GLY A N    13 
ATOM   7771  C  CA   . GLY A 1 4  ? -1.773  -19.136 -5.239  1.00 0.00 ? 4   GLY A CA   13 
ATOM   7772  C  C    . GLY A 1 4  ? -3.059  -18.653 -4.598  1.00 0.00 ? 4   GLY A C    13 
ATOM   7773  O  O    . GLY A 1 4  ? -3.514  -17.541 -4.865  1.00 0.00 ? 4   GLY A O    13 
ATOM   7774  H  H    . GLY A 1 4  ? -2.384  -19.310 -7.259  1.00 0.00 ? 4   GLY A H    13 
ATOM   7775  H  HA2  . GLY A 1 4  ? -1.281  -19.821 -4.564  1.00 0.00 ? 4   GLY A HA2  13 
ATOM   7776  H  HA3  . GLY A 1 4  ? -1.127  -18.286 -5.406  1.00 0.00 ? 4   GLY A HA3  13 
ATOM   7777  N  N    . SER A 1 5  ? -3.648  -19.492 -3.752  1.00 0.00 ? 5   SER A N    13 
ATOM   7778  C  CA   . SER A 1 5  ? -4.892  -19.148 -3.076  1.00 0.00 ? 5   SER A CA   13 
ATOM   7779  C  C    . SER A 1 5  ? -5.128  -20.058 -1.874  1.00 0.00 ? 5   SER A C    13 
ATOM   7780  O  O    . SER A 1 5  ? -5.014  -21.279 -1.975  1.00 0.00 ? 5   SER A O    13 
ATOM   7781  C  CB   . SER A 1 5  ? -6.070  -19.250 -4.047  1.00 0.00 ? 5   SER A CB   13 
ATOM   7782  O  OG   . SER A 1 5  ? -7.298  -18.992 -3.388  1.00 0.00 ? 5   SER A OG   13 
ATOM   7783  H  H    . SER A 1 5  ? -3.236  -20.365 -3.580  1.00 0.00 ? 5   SER A H    13 
ATOM   7784  H  HA   . SER A 1 5  ? -4.810  -18.128 -2.729  1.00 0.00 ? 5   SER A HA   13 
ATOM   7785  H  HB2  . SER A 1 5  ? -5.943  -18.530 -4.840  1.00 0.00 ? 5   SER A HB2  13 
ATOM   7786  H  HB3  . SER A 1 5  ? -6.102  -20.246 -4.465  1.00 0.00 ? 5   SER A HB3  13 
ATOM   7787  H  HG   . SER A 1 5  ? -7.160  -18.998 -2.438  1.00 0.00 ? 5   SER A HG   13 
ATOM   7788  N  N    . SER A 1 6  ? -5.458  -19.453 -0.737  1.00 0.00 ? 6   SER A N    13 
ATOM   7789  C  CA   . SER A 1 6  ? -5.707  -20.208 0.485   1.00 0.00 ? 6   SER A CA   13 
ATOM   7790  C  C    . SER A 1 6  ? -7.189  -20.186 0.845   1.00 0.00 ? 6   SER A C    13 
ATOM   7791  O  O    . SER A 1 6  ? -7.818  -21.233 0.997   1.00 0.00 ? 6   SER A O    13 
ATOM   7792  C  CB   . SER A 1 6  ? -4.882  -19.636 1.639   1.00 0.00 ? 6   SER A CB   13 
ATOM   7793  O  OG   . SER A 1 6  ? -4.963  -20.465 2.785   1.00 0.00 ? 6   SER A OG   13 
ATOM   7794  H  H    . SER A 1 6  ? -5.534  -18.476 -0.720  1.00 0.00 ? 6   SER A H    13 
ATOM   7795  H  HA   . SER A 1 6  ? -5.406  -21.230 0.311   1.00 0.00 ? 6   SER A HA   13 
ATOM   7796  H  HB2  . SER A 1 6  ? -3.848  -19.561 1.337   1.00 0.00 ? 6   SER A HB2  13 
ATOM   7797  H  HB3  . SER A 1 6  ? -5.255  -18.654 1.893   1.00 0.00 ? 6   SER A HB3  13 
ATOM   7798  H  HG   . SER A 1 6  ? -5.026  -21.384 2.512   1.00 0.00 ? 6   SER A HG   13 
ATOM   7799  N  N    . GLY A 1 7  ? -7.741  -18.984 0.981   1.00 0.00 ? 7   GLY A N    13 
ATOM   7800  C  CA   . GLY A 1 7  ? -9.145  -18.847 1.323   1.00 0.00 ? 7   GLY A CA   13 
ATOM   7801  C  C    . GLY A 1 7  ? -9.537  -17.409 1.598   1.00 0.00 ? 7   GLY A C    13 
ATOM   7802  O  O    . GLY A 1 7  ? -9.862  -16.658 0.677   1.00 0.00 ? 7   GLY A O    13 
ATOM   7803  H  H    . GLY A 1 7  ? -7.191  -18.184 0.849   1.00 0.00 ? 7   GLY A H    13 
ATOM   7804  H  HA2  . GLY A 1 7  ? -9.742  -19.222 0.504   1.00 0.00 ? 7   GLY A HA2  13 
ATOM   7805  H  HA3  . GLY A 1 7  ? -9.349  -19.438 2.204   1.00 0.00 ? 7   GLY A HA3  13 
ATOM   7806  N  N    . THR A 1 8  ? -9.508  -17.022 2.869   1.00 0.00 ? 8   THR A N    13 
ATOM   7807  C  CA   . THR A 1 8  ? -9.866  -15.665 3.264   1.00 0.00 ? 8   THR A CA   13 
ATOM   7808  C  C    . THR A 1 8  ? -8.870  -14.652 2.713   1.00 0.00 ? 8   THR A C    13 
ATOM   7809  O  O    . THR A 1 8  ? -7.784  -14.473 3.262   1.00 0.00 ? 8   THR A O    13 
ATOM   7810  C  CB   . THR A 1 8  ? -9.930  -15.524 4.796   1.00 0.00 ? 8   THR A CB   13 
ATOM   7811  O  OG1  . THR A 1 8  ? -10.908 -16.424 5.331   1.00 0.00 ? 8   THR A OG1  13 
ATOM   7812  C  CG2  . THR A 1 8  ? -10.276 -14.097 5.195   1.00 0.00 ? 8   THR A CG2  13 
ATOM   7813  H  H    . THR A 1 8  ? -9.241  -17.666 3.558   1.00 0.00 ? 8   THR A H    13 
ATOM   7814  H  HA   . THR A 1 8  ? -10.845 -15.448 2.862   1.00 0.00 ? 8   THR A HA   13 
ATOM   7815  H  HB   . THR A 1 8  ? -8.962  -15.772 5.206   1.00 0.00 ? 8   THR A HB   13 
ATOM   7816  H  HG1  . THR A 1 8  ? -11.765 -15.992 5.348   1.00 0.00 ? 8   THR A HG1  13 
ATOM   7817  H  HG21 . THR A 1 8  ? -10.301 -13.474 4.313   1.00 0.00 ? 8   THR A HG21 13 
ATOM   7818  H  HG22 . THR A 1 8  ? -9.528  -13.723 5.878   1.00 0.00 ? 8   THR A HG22 13 
ATOM   7819  H  HG23 . THR A 1 8  ? -11.243 -14.082 5.674   1.00 0.00 ? 8   THR A HG23 13 
ATOM   7820  N  N    . GLY A 1 9  ? -9.247  -13.989 1.623   1.00 0.00 ? 9   GLY A N    13 
ATOM   7821  C  CA   . GLY A 1 9  ? -8.375  -13.001 1.017   1.00 0.00 ? 9   GLY A CA   13 
ATOM   7822  C  C    . GLY A 1 9  ? -9.129  -11.774 0.544   1.00 0.00 ? 9   GLY A C    13 
ATOM   7823  O  O    . GLY A 1 9  ? -9.000  -11.365 -0.609  1.00 0.00 ? 9   GLY A O    13 
ATOM   7824  H  H    . GLY A 1 9  ? -10.125 -14.174 1.229   1.00 0.00 ? 9   GLY A H    13 
ATOM   7825  H  HA2  . GLY A 1 9  ? -7.634  -12.698 1.741   1.00 0.00 ? 9   GLY A HA2  13 
ATOM   7826  H  HA3  . GLY A 1 9  ? -7.875  -13.450 0.171   1.00 0.00 ? 9   GLY A HA3  13 
ATOM   7827  N  N    . GLU A 1 10 ? -9.921  -11.188 1.436   1.00 0.00 ? 10  GLU A N    13 
ATOM   7828  C  CA   . GLU A 1 10 ? -10.701 -10.002 1.101   1.00 0.00 ? 10  GLU A CA   13 
ATOM   7829  C  C    . GLU A 1 10 ? -10.053 -8.745  1.675   1.00 0.00 ? 10  GLU A C    13 
ATOM   7830  O  O    . GLU A 1 10 ? -10.729 -7.894  2.251   1.00 0.00 ? 10  GLU A O    13 
ATOM   7831  C  CB   . GLU A 1 10 ? -12.131 -10.139 1.630   1.00 0.00 ? 10  GLU A CB   13 
ATOM   7832  C  CG   . GLU A 1 10 ? -12.915 -11.265 0.978   1.00 0.00 ? 10  GLU A CG   13 
ATOM   7833  C  CD   . GLU A 1 10 ? -14.150 -11.650 1.769   1.00 0.00 ? 10  GLU A CD   13 
ATOM   7834  O  OE1  . GLU A 1 10 ? -14.012 -11.965 2.970   1.00 0.00 ? 10  GLU A OE1  13 
ATOM   7835  O  OE2  . GLU A 1 10 ? -15.255 -11.635 1.187   1.00 0.00 ? 10  GLU A OE2  13 
ATOM   7836  H  H    . GLU A 1 10 ? -9.983  -11.561 2.340   1.00 0.00 ? 10  GLU A H    13 
ATOM   7837  H  HA   . GLU A 1 10 ? -10.731 -9.918  0.026   1.00 0.00 ? 10  GLU A HA   13 
ATOM   7838  H  HB2  . GLU A 1 10 ? -12.093 -10.322 2.693   1.00 0.00 ? 10  GLU A HB2  13 
ATOM   7839  H  HB3  . GLU A 1 10 ? -12.657 -9.213  1.452   1.00 0.00 ? 10  GLU A HB3  13 
ATOM   7840  H  HG2  . GLU A 1 10 ? -13.222 -10.950 -0.008  1.00 0.00 ? 10  GLU A HG2  13 
ATOM   7841  H  HG3  . GLU A 1 10 ? -12.275 -12.131 0.894   1.00 0.00 ? 10  GLU A HG3  13 
ATOM   7842  N  N    . ASN A 1 11 ? -8.739  -8.637  1.513   1.00 0.00 ? 11  ASN A N    13 
ATOM   7843  C  CA   . ASN A 1 11 ? -7.999  -7.485  2.015   1.00 0.00 ? 11  ASN A CA   13 
ATOM   7844  C  C    . ASN A 1 11 ? -8.395  -6.216  1.267   1.00 0.00 ? 11  ASN A C    13 
ATOM   7845  O  O    . ASN A 1 11 ? -8.450  -6.182  0.038   1.00 0.00 ? 11  ASN A O    13 
ATOM   7846  C  CB   . ASN A 1 11 ? -6.493  -7.722  1.879   1.00 0.00 ? 11  ASN A CB   13 
ATOM   7847  C  CG   . ASN A 1 11 ? -6.141  -8.507  0.631   1.00 0.00 ? 11  ASN A CG   13 
ATOM   7848  O  OD1  . ASN A 1 11 ? -6.095  -9.737  0.650   1.00 0.00 ? 11  ASN A OD1  13 
ATOM   7849  N  ND2  . ASN A 1 11 ? -5.890  -7.797  -0.463  1.00 0.00 ? 11  ASN A ND2  13 
ATOM   7850  H  H    . ASN A 1 11 ? -8.255  -9.349  1.044   1.00 0.00 ? 11  ASN A H    13 
ATOM   7851  H  HA   . ASN A 1 11 ? -8.242  -7.365  3.060   1.00 0.00 ? 11  ASN A HA   13 
ATOM   7852  H  HB2  . ASN A 1 11 ? -5.988  -6.768  1.836   1.00 0.00 ? 11  ASN A HB2  13 
ATOM   7853  H  HB3  . ASN A 1 11 ? -6.142  -8.272  2.739   1.00 0.00 ? 11  ASN A HB3  13 
ATOM   7854  H  HD21 . ASN A 1 11 ? -5.945  -6.820  -0.404  1.00 0.00 ? 11  ASN A HD21 13 
ATOM   7855  H  HD22 . ASN A 1 11 ? -5.661  -8.279  -1.285  1.00 0.00 ? 11  ASN A HD22 13 
ATOM   7856  N  N    . PRO A 1 12 ? -8.676  -5.146  2.025   1.00 0.00 ? 12  PRO A N    13 
ATOM   7857  C  CA   . PRO A 1 12 ? -9.071  -3.854  1.456   1.00 0.00 ? 12  PRO A CA   13 
ATOM   7858  C  C    . PRO A 1 12 ? -7.919  -3.162  0.735   1.00 0.00 ? 12  PRO A C    13 
ATOM   7859  O  O    . PRO A 1 12 ? -8.057  -2.737  -0.412  1.00 0.00 ? 12  PRO A O    13 
ATOM   7860  C  CB   . PRO A 1 12 ? -9.499  -3.042  2.681   1.00 0.00 ? 12  PRO A CB   13 
ATOM   7861  C  CG   . PRO A 1 12 ? -8.753  -3.651  3.818   1.00 0.00 ? 12  PRO A CG   13 
ATOM   7862  C  CD   . PRO A 1 12 ? -8.630  -5.115  3.497   1.00 0.00 ? 12  PRO A CD   13 
ATOM   7863  H  HA   . PRO A 1 12 ? -9.907  -3.957  0.780   1.00 0.00 ? 12  PRO A HA   13 
ATOM   7864  H  HB2  . PRO A 1 12 ? -9.229  -2.005  2.541   1.00 0.00 ? 12  PRO A HB2  13 
ATOM   7865  H  HB3  . PRO A 1 12 ? -10.566 -3.127  2.819   1.00 0.00 ? 12  PRO A HB3  13 
ATOM   7866  H  HG2  . PRO A 1 12 ? -7.775  -3.201  3.899   1.00 0.00 ? 12  PRO A HG2  13 
ATOM   7867  H  HG3  . PRO A 1 12 ? -9.307  -3.514  4.735   1.00 0.00 ? 12  PRO A HG3  13 
ATOM   7868  H  HD2  . PRO A 1 12 ? -7.691  -5.504  3.862   1.00 0.00 ? 12  PRO A HD2  13 
ATOM   7869  H  HD3  . PRO A 1 12 ? -9.458  -5.665  3.919   1.00 0.00 ? 12  PRO A HD3  13 
ATOM   7870  N  N    . PHE A 1 13 ? -6.782  -3.053  1.414   1.00 0.00 ? 13  PHE A N    13 
ATOM   7871  C  CA   . PHE A 1 13 ? -5.606  -2.412  0.837   1.00 0.00 ? 13  PHE A CA   13 
ATOM   7872  C  C    . PHE A 1 13 ? -4.343  -2.809  1.597   1.00 0.00 ? 13  PHE A C    13 
ATOM   7873  O  O    . PHE A 1 13 ? -4.366  -2.974  2.817   1.00 0.00 ? 13  PHE A O    13 
ATOM   7874  C  CB   . PHE A 1 13 ? -5.768  -0.891  0.854   1.00 0.00 ? 13  PHE A CB   13 
ATOM   7875  C  CG   . PHE A 1 13 ? -7.073  -0.421  0.279   1.00 0.00 ? 13  PHE A CG   13 
ATOM   7876  C  CD1  . PHE A 1 13 ? -7.233  -0.286  -1.091  1.00 0.00 ? 13  PHE A CD1  13 
ATOM   7877  C  CD2  . PHE A 1 13 ? -8.140  -0.114  1.107   1.00 0.00 ? 13  PHE A CD2  13 
ATOM   7878  C  CE1  . PHE A 1 13 ? -8.433  0.147   -1.623  1.00 0.00 ? 13  PHE A CE1  13 
ATOM   7879  C  CE2  . PHE A 1 13 ? -9.343  0.319   0.581   1.00 0.00 ? 13  PHE A CE2  13 
ATOM   7880  C  CZ   . PHE A 1 13 ? -9.489  0.449   -0.786  1.00 0.00 ? 13  PHE A CZ   13 
ATOM   7881  H  H    . PHE A 1 13 ? -6.733  -3.412  2.325   1.00 0.00 ? 13  PHE A H    13 
ATOM   7882  H  HA   . PHE A 1 13 ? -5.516  -2.745  -0.185  1.00 0.00 ? 13  PHE A HA   13 
ATOM   7883  H  HB2  . PHE A 1 13 ? -5.710  -0.541  1.874   1.00 0.00 ? 13  PHE A HB2  13 
ATOM   7884  H  HB3  . PHE A 1 13 ? -4.970  -0.445  0.280   1.00 0.00 ? 13  PHE A HB3  13 
ATOM   7885  H  HD1  . PHE A 1 13 ? -6.408  -0.522  -1.747  1.00 0.00 ? 13  PHE A HD1  13 
ATOM   7886  H  HD2  . PHE A 1 13 ? -8.027  -0.216  2.178   1.00 0.00 ? 13  PHE A HD2  13 
ATOM   7887  H  HE1  . PHE A 1 13 ? -8.544  0.248   -2.692  1.00 0.00 ? 13  PHE A HE1  13 
ATOM   7888  H  HE2  . PHE A 1 13 ? -10.167 0.554   1.238   1.00 0.00 ? 13  PHE A HE2  13 
ATOM   7889  H  HZ   . PHE A 1 13 ? -10.427 0.788   -1.200  1.00 0.00 ? 13  PHE A HZ   13 
ATOM   7890  N  N    . ILE A 1 14 ? -3.243  -2.960  0.867   1.00 0.00 ? 14  ILE A N    13 
ATOM   7891  C  CA   . ILE A 1 14 ? -1.971  -3.337  1.471   1.00 0.00 ? 14  ILE A CA   13 
ATOM   7892  C  C    . ILE A 1 14 ? -0.850  -2.411  1.012   1.00 0.00 ? 14  ILE A C    13 
ATOM   7893  O  O    . ILE A 1 14 ? -0.861  -1.914  -0.115  1.00 0.00 ? 14  ILE A O    13 
ATOM   7894  C  CB   . ILE A 1 14 ? -1.595  -4.790  1.130   1.00 0.00 ? 14  ILE A CB   13 
ATOM   7895  C  CG1  . ILE A 1 14 ? -2.498  -5.766  1.887   1.00 0.00 ? 14  ILE A CG1  13 
ATOM   7896  C  CG2  . ILE A 1 14 ? -0.132  -5.050  1.459   1.00 0.00 ? 14  ILE A CG2  13 
ATOM   7897  C  CD1  . ILE A 1 14 ? -2.340  -7.204  1.445   1.00 0.00 ? 14  ILE A CD1  13 
ATOM   7898  H  H    . ILE A 1 14 ? -3.288  -2.814  -0.101  1.00 0.00 ? 14  ILE A H    13 
ATOM   7899  H  HA   . ILE A 1 14 ? -2.075  -3.255  2.543   1.00 0.00 ? 14  ILE A HA   13 
ATOM   7900  H  HB   . ILE A 1 14 ? -1.731  -4.934  0.069   1.00 0.00 ? 14  ILE A HB   13 
ATOM   7901  H  HG12 . ILE A 1 14 ? -2.268  -5.716  2.940   1.00 0.00 ? 14  ILE A HG12 13 
ATOM   7902  H  HG13 . ILE A 1 14 ? -3.529  -5.482  1.734   1.00 0.00 ? 14  ILE A HG13 13 
ATOM   7903  H  HG21 . ILE A 1 14 ? 0.133   -4.519  2.362   1.00 0.00 ? 14  ILE A HG21 13 
ATOM   7904  H  HG22 . ILE A 1 14 ? 0.021   -6.108  1.607   1.00 0.00 ? 14  ILE A HG22 13 
ATOM   7905  H  HG23 . ILE A 1 14 ? 0.487   -4.706  0.644   1.00 0.00 ? 14  ILE A HG23 13 
ATOM   7906  H  HD11 . ILE A 1 14 ? -1.408  -7.597  1.826   1.00 0.00 ? 14  ILE A HD11 13 
ATOM   7907  H  HD12 . ILE A 1 14 ? -3.161  -7.791  1.829   1.00 0.00 ? 14  ILE A HD12 13 
ATOM   7908  H  HD13 . ILE A 1 14 ? -2.336  -7.251  0.366   1.00 0.00 ? 14  ILE A HD13 13 
ATOM   7909  N  N    . CYS A 1 15 ? 0.120   -2.185  1.891   1.00 0.00 ? 15  CYS A N    13 
ATOM   7910  C  CA   . CYS A 1 15 ? 1.252   -1.321  1.578   1.00 0.00 ? 15  CYS A CA   13 
ATOM   7911  C  C    . CYS A 1 15 ? 2.390   -2.120  0.950   1.00 0.00 ? 15  CYS A C    13 
ATOM   7912  O  O    . CYS A 1 15 ? 3.249   -2.653  1.652   1.00 0.00 ? 15  CYS A O    13 
ATOM   7913  C  CB   . CYS A 1 15 ? 1.746   -0.614  2.841   1.00 0.00 ? 15  CYS A CB   13 
ATOM   7914  S  SG   . CYS A 1 15 ? 2.946   0.720   2.526   1.00 0.00 ? 15  CYS A SG   13 
ATOM   7915  H  H    . CYS A 1 15 ? 0.074   -2.610  2.774   1.00 0.00 ? 15  CYS A H    13 
ATOM   7916  H  HA   . CYS A 1 15 ? 0.916   -0.579  0.869   1.00 0.00 ? 15  CYS A HA   13 
ATOM   7917  H  HB2  . CYS A 1 15 ? 0.902   -0.180  3.356   1.00 0.00 ? 15  CYS A HB2  13 
ATOM   7918  H  HB3  . CYS A 1 15 ? 2.221   -1.338  3.487   1.00 0.00 ? 15  CYS A HB3  13 
ATOM   7919  N  N    . SER A 1 16 ? 2.388   -2.199  -0.377  1.00 0.00 ? 16  SER A N    13 
ATOM   7920  C  CA   . SER A 1 16 ? 3.418   -2.937  -1.100  1.00 0.00 ? 16  SER A CA   13 
ATOM   7921  C  C    . SER A 1 16 ? 4.808   -2.571  -0.588  1.00 0.00 ? 16  SER A C    13 
ATOM   7922  O  O    . SER A 1 16 ? 5.769   -3.314  -0.786  1.00 0.00 ? 16  SER A O    13 
ATOM   7923  C  CB   . SER A 1 16 ? 3.323   -2.650  -2.599  1.00 0.00 ? 16  SER A CB   13 
ATOM   7924  O  OG   . SER A 1 16 ? 4.055   -3.604  -3.349  1.00 0.00 ? 16  SER A OG   13 
ATOM   7925  H  H    . SER A 1 16 ? 1.676   -1.753  -0.881  1.00 0.00 ? 16  SER A H    13 
ATOM   7926  H  HA   . SER A 1 16 ? 3.251   -3.990  -0.932  1.00 0.00 ? 16  SER A HA   13 
ATOM   7927  H  HB2  . SER A 1 16 ? 2.288   -2.687  -2.905  1.00 0.00 ? 16  SER A HB2  13 
ATOM   7928  H  HB3  . SER A 1 16 ? 3.723   -1.667  -2.801  1.00 0.00 ? 16  SER A HB3  13 
ATOM   7929  H  HG   . SER A 1 16 ? 3.764   -3.586  -4.263  1.00 0.00 ? 16  SER A HG   13 
ATOM   7930  N  N    . GLU A 1 17 ? 4.906   -1.421  0.071   1.00 0.00 ? 17  GLU A N    13 
ATOM   7931  C  CA   . GLU A 1 17 ? 6.178   -0.957  0.611   1.00 0.00 ? 17  GLU A CA   13 
ATOM   7932  C  C    . GLU A 1 17 ? 6.610   -1.811  1.800   1.00 0.00 ? 17  GLU A C    13 
ATOM   7933  O  O    . GLU A 1 17 ? 7.685   -2.410  1.791   1.00 0.00 ? 17  GLU A O    13 
ATOM   7934  C  CB   . GLU A 1 17 ? 6.073   0.510   1.034   1.00 0.00 ? 17  GLU A CB   13 
ATOM   7935  C  CG   . GLU A 1 17 ? 5.452   1.406   -0.024  1.00 0.00 ? 17  GLU A CG   13 
ATOM   7936  C  CD   . GLU A 1 17 ? 5.942   2.838   0.063   1.00 0.00 ? 17  GLU A CD   13 
ATOM   7937  O  OE1  . GLU A 1 17 ? 7.168   3.053   -0.044  1.00 0.00 ? 17  GLU A OE1  13 
ATOM   7938  O  OE2  . GLU A 1 17 ? 5.101   3.744   0.238   1.00 0.00 ? 17  GLU A OE2  13 
ATOM   7939  H  H    . GLU A 1 17 ? 4.104   -0.872  0.197   1.00 0.00 ? 17  GLU A H    13 
ATOM   7940  H  HA   . GLU A 1 17 ? 6.921   -1.044  -0.168  1.00 0.00 ? 17  GLU A HA   13 
ATOM   7941  H  HB2  . GLU A 1 17 ? 5.470   0.572   1.928   1.00 0.00 ? 17  GLU A HB2  13 
ATOM   7942  H  HB3  . GLU A 1 17 ? 7.064   0.881   1.253   1.00 0.00 ? 17  GLU A HB3  13 
ATOM   7943  H  HG2  . GLU A 1 17 ? 5.701   1.016   -1.000  1.00 0.00 ? 17  GLU A HG2  13 
ATOM   7944  H  HG3  . GLU A 1 17 ? 4.379   1.400   0.101   1.00 0.00 ? 17  GLU A HG3  13 
ATOM   7945  N  N    . CYS A 1 18 ? 5.763   -1.861  2.823   1.00 0.00 ? 18  CYS A N    13 
ATOM   7946  C  CA   . CYS A 1 18 ? 6.055   -2.639  4.020   1.00 0.00 ? 18  CYS A CA   13 
ATOM   7947  C  C    . CYS A 1 18 ? 5.192   -3.897  4.075   1.00 0.00 ? 18  CYS A C    13 
ATOM   7948  O  O    . CYS A 1 18 ? 5.696   -5.000  4.280   1.00 0.00 ? 18  CYS A O    13 
ATOM   7949  C  CB   . CYS A 1 18 ? 5.823   -1.793  5.273   1.00 0.00 ? 18  CYS A CB   13 
ATOM   7950  S  SG   . CYS A 1 18 ? 4.164   -1.047  5.370   1.00 0.00 ? 18  CYS A SG   13 
ATOM   7951  H  H    . CYS A 1 18 ? 4.920   -1.361  2.771   1.00 0.00 ? 18  CYS A H    13 
ATOM   7952  H  HA   . CYS A 1 18 ? 7.093   -2.932  3.981   1.00 0.00 ? 18  CYS A HA   13 
ATOM   7953  H  HB2  . CYS A 1 18 ? 5.954   -2.415  6.147   1.00 0.00 ? 18  CYS A HB2  13 
ATOM   7954  H  HB3  . CYS A 1 18 ? 6.546   -0.992  5.296   1.00 0.00 ? 18  CYS A HB3  13 
ATOM   7955  N  N    . GLY A 1 19 ? 3.887   -3.721  3.890   1.00 0.00 ? 19  GLY A N    13 
ATOM   7956  C  CA   . GLY A 1 19 ? 2.974   -4.849  3.922   1.00 0.00 ? 19  GLY A CA   13 
ATOM   7957  C  C    . GLY A 1 19 ? 1.841   -4.650  4.908   1.00 0.00 ? 19  GLY A C    13 
ATOM   7958  O  O    . GLY A 1 19 ? 1.196   -5.611  5.327   1.00 0.00 ? 19  GLY A O    13 
ATOM   7959  H  H    . GLY A 1 19 ? 3.541   -2.818  3.730   1.00 0.00 ? 19  GLY A H    13 
ATOM   7960  H  HA2  . GLY A 1 19 ? 2.559   -4.990  2.935   1.00 0.00 ? 19  GLY A HA2  13 
ATOM   7961  H  HA3  . GLY A 1 19 ? 3.526   -5.735  4.200   1.00 0.00 ? 19  GLY A HA3  13 
ATOM   7962  N  N    . LYS A 1 20 ? 1.596   -3.398  5.281   1.00 0.00 ? 20  LYS A N    13 
ATOM   7963  C  CA   . LYS A 1 20 ? 0.533   -3.074  6.225   1.00 0.00 ? 20  LYS A CA   13 
ATOM   7964  C  C    . LYS A 1 20 ? -0.816  -2.996  5.518   1.00 0.00 ? 20  LYS A C    13 
ATOM   7965  O  O    . LYS A 1 20 ? -0.884  -2.756  4.312   1.00 0.00 ? 20  LYS A O    13 
ATOM   7966  C  CB   . LYS A 1 20 ? 0.831   -1.747  6.926   1.00 0.00 ? 20  LYS A CB   13 
ATOM   7967  C  CG   . LYS A 1 20 ? 1.580   -1.907  8.238   1.00 0.00 ? 20  LYS A CG   13 
ATOM   7968  C  CD   . LYS A 1 20 ? 2.489   -0.720  8.509   1.00 0.00 ? 20  LYS A CD   13 
ATOM   7969  C  CE   . LYS A 1 20 ? 3.657   -1.107  9.403   1.00 0.00 ? 20  LYS A CE   13 
ATOM   7970  N  NZ   . LYS A 1 20 ? 4.494   0.072   9.763   1.00 0.00 ? 20  LYS A NZ   13 
ATOM   7971  H  H    . LYS A 1 20 ? 2.145   -2.674  4.912   1.00 0.00 ? 20  LYS A H    13 
ATOM   7972  H  HA   . LYS A 1 20 ? 0.494   -3.861  6.963   1.00 0.00 ? 20  LYS A HA   13 
ATOM   7973  H  HB2  . LYS A 1 20 ? 1.428   -1.133  6.267   1.00 0.00 ? 20  LYS A HB2  13 
ATOM   7974  H  HB3  . LYS A 1 20 ? -0.102  -1.242  7.127   1.00 0.00 ? 20  LYS A HB3  13 
ATOM   7975  H  HG2  . LYS A 1 20 ? 0.864   -1.989  9.042   1.00 0.00 ? 20  LYS A HG2  13 
ATOM   7976  H  HG3  . LYS A 1 20 ? 2.178   -2.805  8.193   1.00 0.00 ? 20  LYS A HG3  13 
ATOM   7977  H  HD2  . LYS A 1 20 ? 2.876   -0.352  7.570   1.00 0.00 ? 20  LYS A HD2  13 
ATOM   7978  H  HD3  . LYS A 1 20 ? 1.917   0.057   8.995   1.00 0.00 ? 20  LYS A HD3  13 
ATOM   7979  H  HE2  . LYS A 1 20 ? 3.270   -1.551  10.307  1.00 0.00 ? 20  LYS A HE2  13 
ATOM   7980  H  HE3  . LYS A 1 20 ? 4.270   -1.827  8.882   1.00 0.00 ? 20  LYS A HE3  13 
ATOM   7981  H  HZ1  . LYS A 1 20 ? 4.236   0.887   9.172   1.00 0.00 ? 20  LYS A HZ1  13 
ATOM   7982  H  HZ2  . LYS A 1 20 ? 5.500   -0.146  9.614   1.00 0.00 ? 20  LYS A HZ2  13 
ATOM   7983  H  HZ3  . LYS A 1 20 ? 4.350   0.321   10.762  1.00 0.00 ? 20  LYS A HZ3  13 
ATOM   7984  N  N    . VAL A 1 21 ? -1.889  -3.198  6.276   1.00 0.00 ? 21  VAL A N    13 
ATOM   7985  C  CA   . VAL A 1 21 ? -3.237  -3.148  5.722   1.00 0.00 ? 21  VAL A CA   13 
ATOM   7986  C  C    . VAL A 1 21 ? -4.052  -2.029  6.362   1.00 0.00 ? 21  VAL A C    13 
ATOM   7987  O  O    . VAL A 1 21 ? -4.058  -1.870  7.583   1.00 0.00 ? 21  VAL A O    13 
ATOM   7988  C  CB   . VAL A 1 21 ? -3.976  -4.485  5.921   1.00 0.00 ? 21  VAL A CB   13 
ATOM   7989  C  CG1  . VAL A 1 21 ? -5.407  -4.384  5.417   1.00 0.00 ? 21  VAL A CG1  13 
ATOM   7990  C  CG2  . VAL A 1 21 ? -3.233  -5.612  5.220   1.00 0.00 ? 21  VAL A CG2  13 
ATOM   7991  H  H    . VAL A 1 21 ? -1.771  -3.385  7.231   1.00 0.00 ? 21  VAL A H    13 
ATOM   7992  H  HA   . VAL A 1 21 ? -3.156  -2.960  4.662   1.00 0.00 ? 21  VAL A HA   13 
ATOM   7993  H  HB   . VAL A 1 21 ? -4.005  -4.703  6.978   1.00 0.00 ? 21  VAL A HB   13 
ATOM   7994  H  HG11 . VAL A 1 21 ? -5.583  -3.391  5.028   1.00 0.00 ? 21  VAL A HG11 13 
ATOM   7995  H  HG12 . VAL A 1 21 ? -5.566  -5.112  4.635   1.00 0.00 ? 21  VAL A HG12 13 
ATOM   7996  H  HG13 . VAL A 1 21 ? -6.090  -4.576  6.232   1.00 0.00 ? 21  VAL A HG13 13 
ATOM   7997  H  HG21 . VAL A 1 21 ? -2.224  -5.297  5.000   1.00 0.00 ? 21  VAL A HG21 13 
ATOM   7998  H  HG22 . VAL A 1 21 ? -3.208  -6.480  5.863   1.00 0.00 ? 21  VAL A HG22 13 
ATOM   7999  H  HG23 . VAL A 1 21 ? -3.742  -5.861  4.300   1.00 0.00 ? 21  VAL A HG23 13 
ATOM   8000  N  N    . PHE A 1 22 ? -4.741  -1.256  5.529   1.00 0.00 ? 22  PHE A N    13 
ATOM   8001  C  CA   . PHE A 1 22 ? -5.561  -0.151  6.013   1.00 0.00 ? 22  PHE A CA   13 
ATOM   8002  C  C    . PHE A 1 22 ? -7.005  -0.298  5.542   1.00 0.00 ? 22  PHE A C    13 
ATOM   8003  O  O    . PHE A 1 22 ? -7.263  -0.730  4.418   1.00 0.00 ? 22  PHE A O    13 
ATOM   8004  C  CB   . PHE A 1 22 ? -4.989  1.184   5.532   1.00 0.00 ? 22  PHE A CB   13 
ATOM   8005  C  CG   . PHE A 1 22 ? -3.586  1.440   6.003   1.00 0.00 ? 22  PHE A CG   13 
ATOM   8006  C  CD1  . PHE A 1 22 ? -2.503  0.923   5.310   1.00 0.00 ? 22  PHE A CD1  13 
ATOM   8007  C  CD2  . PHE A 1 22 ? -3.350  2.198   7.138   1.00 0.00 ? 22  PHE A CD2  13 
ATOM   8008  C  CE1  . PHE A 1 22 ? -1.212  1.157   5.742   1.00 0.00 ? 22  PHE A CE1  13 
ATOM   8009  C  CE2  . PHE A 1 22 ? -2.060  2.436   7.575   1.00 0.00 ? 22  PHE A CE2  13 
ATOM   8010  C  CZ   . PHE A 1 22 ? -0.990  1.915   6.875   1.00 0.00 ? 22  PHE A CZ   13 
ATOM   8011  H  H    . PHE A 1 22 ? -4.697  -1.433  4.566   1.00 0.00 ? 22  PHE A H    13 
ATOM   8012  H  HA   . PHE A 1 22 ? -5.542  -0.174  7.091   1.00 0.00 ? 22  PHE A HA   13 
ATOM   8013  H  HB2  . PHE A 1 22 ? -4.984  1.197   4.452   1.00 0.00 ? 22  PHE A HB2  13 
ATOM   8014  H  HB3  . PHE A 1 22 ? -5.614  1.986   5.894   1.00 0.00 ? 22  PHE A HB3  13 
ATOM   8015  H  HD1  . PHE A 1 22 ? -2.675  0.331   4.423   1.00 0.00 ? 22  PHE A HD1  13 
ATOM   8016  H  HD2  . PHE A 1 22 ? -4.188  2.607   7.687   1.00 0.00 ? 22  PHE A HD2  13 
ATOM   8017  H  HE1  . PHE A 1 22 ? -0.376  0.749   5.193   1.00 0.00 ? 22  PHE A HE1  13 
ATOM   8018  H  HE2  . PHE A 1 22 ? -1.891  3.029   8.461   1.00 0.00 ? 22  PHE A HE2  13 
ATOM   8019  H  HZ   . PHE A 1 22 ? 0.019   2.098   7.215   1.00 0.00 ? 22  PHE A HZ   13 
ATOM   8020  N  N    . THR A 1 23 ? -7.944  0.063   6.411   1.00 0.00 ? 23  THR A N    13 
ATOM   8021  C  CA   . THR A 1 23 ? -9.362  -0.030  6.087   1.00 0.00 ? 23  THR A CA   13 
ATOM   8022  C  C    . THR A 1 23 ? -9.752  0.995   5.028   1.00 0.00 ? 23  THR A C    13 
ATOM   8023  O  O    . THR A 1 23 ? -10.453 0.675   4.068   1.00 0.00 ? 23  THR A O    13 
ATOM   8024  C  CB   . THR A 1 23 ? -10.239 0.179   7.336   1.00 0.00 ? 23  THR A CB   13 
ATOM   8025  O  OG1  . THR A 1 23 ? -9.751  -0.623  8.417   1.00 0.00 ? 23  THR A OG1  13 
ATOM   8026  C  CG2  . THR A 1 23 ? -11.688 -0.179  7.045   1.00 0.00 ? 23  THR A CG2  13 
ATOM   8027  H  H    . THR A 1 23 ? -7.675  0.399   7.291   1.00 0.00 ? 23  THR A H    13 
ATOM   8028  H  HA   . THR A 1 23 ? -9.552  -1.021  5.701   1.00 0.00 ? 23  THR A HA   13 
ATOM   8029  H  HB   . THR A 1 23 ? -10.191 1.221   7.620   1.00 0.00 ? 23  THR A HB   13 
ATOM   8030  H  HG1  . THR A 1 23 ? -8.815  -0.453  8.545   1.00 0.00 ? 23  THR A HG1  13 
ATOM   8031  H  HG21 . THR A 1 23 ? -12.102 -0.715  7.886   1.00 0.00 ? 23  THR A HG21 13 
ATOM   8032  H  HG22 . THR A 1 23 ? -11.736 -0.801  6.163   1.00 0.00 ? 23  THR A HG22 13 
ATOM   8033  H  HG23 . THR A 1 23 ? -12.256 0.725   6.880   1.00 0.00 ? 23  THR A HG23 13 
ATOM   8034  N  N    . HIS A 1 24 ? -9.293  2.230   5.209   1.00 0.00 ? 24  HIS A N    13 
ATOM   8035  C  CA   . HIS A 1 24 ? -9.594  3.303   4.268   1.00 0.00 ? 24  HIS A CA   13 
ATOM   8036  C  C    . HIS A 1 24 ? -8.407  3.564   3.345   1.00 0.00 ? 24  HIS A C    13 
ATOM   8037  O  O    . HIS A 1 24 ? -7.271  3.695   3.799   1.00 0.00 ? 24  HIS A O    13 
ATOM   8038  C  CB   . HIS A 1 24 ? -9.961  4.582   5.021   1.00 0.00 ? 24  HIS A CB   13 
ATOM   8039  C  CG   . HIS A 1 24 ? -10.925 5.457   4.280   1.00 0.00 ? 24  HIS A CG   13 
ATOM   8040  N  ND1  . HIS A 1 24 ? -10.526 6.497   3.467   1.00 0.00 ? 24  HIS A ND1  13 
ATOM   8041  C  CD2  . HIS A 1 24 ? -12.278 5.441   4.232   1.00 0.00 ? 24  HIS A CD2  13 
ATOM   8042  C  CE1  . HIS A 1 24 ? -11.592 7.084   2.952   1.00 0.00 ? 24  HIS A CE1  13 
ATOM   8043  N  NE2  . HIS A 1 24 ? -12.667 6.462   3.400   1.00 0.00 ? 24  HIS A NE2  13 
ATOM   8044  H  H    . HIS A 1 24 ? -8.740  2.424   5.994   1.00 0.00 ? 24  HIS A H    13 
ATOM   8045  H  HA   . HIS A 1 24 ? -10.437 2.993   3.670   1.00 0.00 ? 24  HIS A HA   13 
ATOM   8046  H  HB2  . HIS A 1 24 ? -10.411 4.319   5.966   1.00 0.00 ? 24  HIS A HB2  13 
ATOM   8047  H  HB3  . HIS A 1 24 ? -9.063  5.156   5.202   1.00 0.00 ? 24  HIS A HB3  13 
ATOM   8048  H  HD1  . HIS A 1 24 ? -9.600  6.765   3.294   1.00 0.00 ? 24  HIS A HD1  13 
ATOM   8049  H  HD2  . HIS A 1 24 ? -12.930 4.754   4.752   1.00 0.00 ? 24  HIS A HD2  13 
ATOM   8050  H  HE1  . HIS A 1 24 ? -11.585 7.928   2.279   1.00 0.00 ? 24  HIS A HE1  13 
ATOM   8051  N  N    . LYS A 1 25 ? -8.679  3.637   2.046   1.00 0.00 ? 25  LYS A N    13 
ATOM   8052  C  CA   . LYS A 1 25 ? -7.635  3.883   1.059   1.00 0.00 ? 25  LYS A CA   13 
ATOM   8053  C  C    . LYS A 1 25 ? -6.810  5.110   1.433   1.00 0.00 ? 25  LYS A C    13 
ATOM   8054  O  O    . LYS A 1 25 ? -5.580  5.085   1.376   1.00 0.00 ? 25  LYS A O    13 
ATOM   8055  C  CB   . LYS A 1 25 ? -8.252  4.074   -0.329  1.00 0.00 ? 25  LYS A CB   13 
ATOM   8056  C  CG   . LYS A 1 25 ? -7.225  4.188   -1.441  1.00 0.00 ? 25  LYS A CG   13 
ATOM   8057  C  CD   . LYS A 1 25 ? -7.803  3.761   -2.780  1.00 0.00 ? 25  LYS A CD   13 
ATOM   8058  C  CE   . LYS A 1 25 ? -8.580  4.892   -3.437  1.00 0.00 ? 25  LYS A CE   13 
ATOM   8059  N  NZ   . LYS A 1 25 ? -8.715  4.691   -4.907  1.00 0.00 ? 25  LYS A NZ   13 
ATOM   8060  H  H    . LYS A 1 25 ? -9.606  3.524   1.745   1.00 0.00 ? 25  LYS A H    13 
ATOM   8061  H  HA   . LYS A 1 25 ? -6.987  3.020   1.039   1.00 0.00 ? 25  LYS A HA   13 
ATOM   8062  H  HB2  . LYS A 1 25 ? -8.894  3.232   -0.544  1.00 0.00 ? 25  LYS A HB2  13 
ATOM   8063  H  HB3  . LYS A 1 25 ? -8.847  4.976   -0.324  1.00 0.00 ? 25  LYS A HB3  13 
ATOM   8064  H  HG2  . LYS A 1 25 ? -6.897  5.214   -1.513  1.00 0.00 ? 25  LYS A HG2  13 
ATOM   8065  H  HG3  . LYS A 1 25 ? -6.381  3.554   -1.205  1.00 0.00 ? 25  LYS A HG3  13 
ATOM   8066  H  HD2  . LYS A 1 25 ? -6.995  3.467   -3.434  1.00 0.00 ? 25  LYS A HD2  13 
ATOM   8067  H  HD3  . LYS A 1 25 ? -8.467  2.922   -2.625  1.00 0.00 ? 25  LYS A HD3  13 
ATOM   8068  H  HE2  . LYS A 1 25 ? -9.564  4.938   -2.997  1.00 0.00 ? 25  LYS A HE2  13 
ATOM   8069  H  HE3  . LYS A 1 25 ? -8.060  5.821   -3.255  1.00 0.00 ? 25  LYS A HE3  13 
ATOM   8070  H  HZ1  . LYS A 1 25 ? -9.718  4.603   -5.165  1.00 0.00 ? 25  LYS A HZ1  13 
ATOM   8071  H  HZ2  . LYS A 1 25 ? -8.216  3.825   -5.196  1.00 0.00 ? 25  LYS A HZ2  13 
ATOM   8072  H  HZ3  . LYS A 1 25 ? -8.306  5.500   -5.417  1.00 0.00 ? 25  LYS A HZ3  13 
ATOM   8073  N  N    . THR A 1 26 ? -7.494  6.183   1.818   1.00 0.00 ? 26  THR A N    13 
ATOM   8074  C  CA   . THR A 1 26 ? -6.824  7.419   2.202   1.00 0.00 ? 26  THR A CA   13 
ATOM   8075  C  C    . THR A 1 26 ? -5.828  7.177   3.330   1.00 0.00 ? 26  THR A C    13 
ATOM   8076  O  O    . THR A 1 26 ? -4.712  7.694   3.307   1.00 0.00 ? 26  THR A O    13 
ATOM   8077  C  CB   . THR A 1 26 ? -7.836  8.491   2.647   1.00 0.00 ? 26  THR A CB   13 
ATOM   8078  O  OG1  . THR A 1 26 ? -8.825  8.684   1.630   1.00 0.00 ? 26  THR A OG1  13 
ATOM   8079  C  CG2  . THR A 1 26 ? -7.135  9.810   2.936   1.00 0.00 ? 26  THR A CG2  13 
ATOM   8080  H  H    . THR A 1 26 ? -8.473  6.141   1.843   1.00 0.00 ? 26  THR A H    13 
ATOM   8081  H  HA   . THR A 1 26 ? -6.292  7.792   1.339   1.00 0.00 ? 26  THR A HA   13 
ATOM   8082  H  HB   . THR A 1 26 ? -8.322  8.153   3.552   1.00 0.00 ? 26  THR A HB   13 
ATOM   8083  H  HG1  . THR A 1 26 ? -8.394  8.765   0.776   1.00 0.00 ? 26  THR A HG1  13 
ATOM   8084  H  HG21 . THR A 1 26 ? -7.848  10.517  3.332   1.00 0.00 ? 26  THR A HG21 13 
ATOM   8085  H  HG22 . THR A 1 26 ? -6.711  10.200  2.023   1.00 0.00 ? 26  THR A HG22 13 
ATOM   8086  H  HG23 . THR A 1 26 ? -6.349  9.649   3.658   1.00 0.00 ? 26  THR A HG23 13 
ATOM   8087  N  N    . ASN A 1 27 ? -6.239  6.387   4.317   1.00 0.00 ? 27  ASN A N    13 
ATOM   8088  C  CA   . ASN A 1 27 ? -5.381  6.076   5.455   1.00 0.00 ? 27  ASN A CA   13 
ATOM   8089  C  C    . ASN A 1 27 ? -4.055  5.481   4.990   1.00 0.00 ? 27  ASN A C    13 
ATOM   8090  O  O    . ASN A 1 27 ? -2.994  5.811   5.521   1.00 0.00 ? 27  ASN A O    13 
ATOM   8091  C  CB   . ASN A 1 27 ? -6.087  5.102   6.400   1.00 0.00 ? 27  ASN A CB   13 
ATOM   8092  C  CG   . ASN A 1 27 ? -7.164  5.776   7.227   1.00 0.00 ? 27  ASN A CG   13 
ATOM   8093  O  OD1  . ASN A 1 27 ? -7.092  6.974   7.503   1.00 0.00 ? 27  ASN A OD1  13 
ATOM   8094  N  ND2  . ASN A 1 27 ? -8.171  5.008   7.626   1.00 0.00 ? 27  ASN A ND2  13 
ATOM   8095  H  H    . ASN A 1 27 ? -7.140  6.003   4.279   1.00 0.00 ? 27  ASN A H    13 
ATOM   8096  H  HA   . ASN A 1 27 ? -5.184  6.997   5.982   1.00 0.00 ? 27  ASN A HA   13 
ATOM   8097  H  HB2  . ASN A 1 27 ? -6.546  4.314   5.820   1.00 0.00 ? 27  ASN A HB2  13 
ATOM   8098  H  HB3  . ASN A 1 27 ? -5.360  4.671   7.072   1.00 0.00 ? 27  ASN A HB3  13 
ATOM   8099  H  HD21 . ASN A 1 27 ? -8.163  4.063   7.369   1.00 0.00 ? 27  ASN A HD21 13 
ATOM   8100  H  HD22 . ASN A 1 27 ? -8.882  5.419   8.162   1.00 0.00 ? 27  ASN A HD22 13 
ATOM   8101  N  N    . LEU A 1 28 ? -4.124  4.603   3.996   1.00 0.00 ? 28  LEU A N    13 
ATOM   8102  C  CA   . LEU A 1 28 ? -2.929  3.961   3.458   1.00 0.00 ? 28  LEU A CA   13 
ATOM   8103  C  C    . LEU A 1 28 ? -2.006  4.987   2.807   1.00 0.00 ? 28  LEU A C    13 
ATOM   8104  O  O    . LEU A 1 28 ? -0.836  5.102   3.171   1.00 0.00 ? 28  LEU A O    13 
ATOM   8105  C  CB   . LEU A 1 28 ? -3.317  2.888   2.439   1.00 0.00 ? 28  LEU A CB   13 
ATOM   8106  C  CG   . LEU A 1 28 ? -2.227  2.480   1.447   1.00 0.00 ? 28  LEU A CG   13 
ATOM   8107  C  CD1  . LEU A 1 28 ? -1.109  1.734   2.159   1.00 0.00 ? 28  LEU A CD1  13 
ATOM   8108  C  CD2  . LEU A 1 28 ? -2.814  1.627   0.332   1.00 0.00 ? 28  LEU A CD2  13 
ATOM   8109  H  H    . LEU A 1 28 ? -4.997  4.380   3.613   1.00 0.00 ? 28  LEU A H    13 
ATOM   8110  H  HA   . LEU A 1 28 ? -2.405  3.494   4.279   1.00 0.00 ? 28  LEU A HA   13 
ATOM   8111  H  HB2  . LEU A 1 28 ? -3.614  2.006   2.985   1.00 0.00 ? 28  LEU A HB2  13 
ATOM   8112  H  HB3  . LEU A 1 28 ? -4.159  3.260   1.873   1.00 0.00 ? 28  LEU A HB3  13 
ATOM   8113  H  HG   . LEU A 1 28 ? -1.803  3.369   1.001   1.00 0.00 ? 28  LEU A HG   13 
ATOM   8114  H  HD11 . LEU A 1 28 ? -1.513  1.207   3.010   1.00 0.00 ? 28  LEU A HD11 13 
ATOM   8115  H  HD12 . LEU A 1 28 ? -0.362  2.439   2.493   1.00 0.00 ? 28  LEU A HD12 13 
ATOM   8116  H  HD13 . LEU A 1 28 ? -0.657  1.027   1.478   1.00 0.00 ? 28  LEU A HD13 13 
ATOM   8117  H  HD21 . LEU A 1 28 ? -3.122  2.263   -0.484  1.00 0.00 ? 28  LEU A HD21 13 
ATOM   8118  H  HD22 . LEU A 1 28 ? -3.668  1.083   0.707   1.00 0.00 ? 28  LEU A HD22 13 
ATOM   8119  H  HD23 . LEU A 1 28 ? -2.068  0.928   -0.018  1.00 0.00 ? 28  LEU A HD23 13 
ATOM   8120  N  N    . ILE A 1 29 ? -2.542  5.730   1.845   1.00 0.00 ? 29  ILE A N    13 
ATOM   8121  C  CA   . ILE A 1 29 ? -1.768  6.748   1.146   1.00 0.00 ? 29  ILE A CA   13 
ATOM   8122  C  C    . ILE A 1 29 ? -0.996  7.622   2.129   1.00 0.00 ? 29  ILE A C    13 
ATOM   8123  O  O    . ILE A 1 29 ? 0.199   7.863   1.954   1.00 0.00 ? 29  ILE A O    13 
ATOM   8124  C  CB   . ILE A 1 29 ? -2.670  7.645   0.278   1.00 0.00 ? 29  ILE A CB   13 
ATOM   8125  C  CG1  . ILE A 1 29 ? -3.422  6.802   -0.754  1.00 0.00 ? 29  ILE A CG1  13 
ATOM   8126  C  CG2  . ILE A 1 29 ? -1.844  8.721   -0.409  1.00 0.00 ? 29  ILE A CG2  13 
ATOM   8127  C  CD1  . ILE A 1 29 ? -4.669  7.471   -1.288  1.00 0.00 ? 29  ILE A CD1  13 
ATOM   8128  H  H    . ILE A 1 29 ? -3.480  5.591   1.600   1.00 0.00 ? 29  ILE A H    13 
ATOM   8129  H  HA   . ILE A 1 29 ? -1.064  6.245   0.498   1.00 0.00 ? 29  ILE A HA   13 
ATOM   8130  H  HB   . ILE A 1 29 ? -3.385  8.132   0.924   1.00 0.00 ? 29  ILE A HB   13 
ATOM   8131  H  HG12 . ILE A 1 29 ? -2.770  6.603   -1.590  1.00 0.00 ? 29  ILE A HG12 13 
ATOM   8132  H  HG13 . ILE A 1 29 ? -3.715  5.867   -0.300  1.00 0.00 ? 29  ILE A HG13 13 
ATOM   8133  H  HG21 . ILE A 1 29 ? -2.415  9.636   -0.460  1.00 0.00 ? 29  ILE A HG21 13 
ATOM   8134  H  HG22 . ILE A 1 29 ? -0.939  8.894   0.154   1.00 0.00 ? 29  ILE A HG22 13 
ATOM   8135  H  HG23 . ILE A 1 29 ? -1.591  8.399   -1.408  1.00 0.00 ? 29  ILE A HG23 13 
ATOM   8136  H  HD11 . ILE A 1 29 ? -4.919  8.317   -0.663  1.00 0.00 ? 29  ILE A HD11 13 
ATOM   8137  H  HD12 . ILE A 1 29 ? -4.492  7.811   -2.298  1.00 0.00 ? 29  ILE A HD12 13 
ATOM   8138  H  HD13 . ILE A 1 29 ? -5.487  6.767   -1.282  1.00 0.00 ? 29  ILE A HD13 13 
ATOM   8139  N  N    . ILE A 1 30 ? -1.686  8.093   3.162   1.00 0.00 ? 30  ILE A N    13 
ATOM   8140  C  CA   . ILE A 1 30 ? -1.064  8.938   4.174   1.00 0.00 ? 30  ILE A CA   13 
ATOM   8141  C  C    . ILE A 1 30 ? 0.081   8.210   4.869   1.00 0.00 ? 30  ILE A C    13 
ATOM   8142  O  O    . ILE A 1 30 ? 1.064   8.828   5.282   1.00 0.00 ? 30  ILE A O    13 
ATOM   8143  C  CB   . ILE A 1 30 ? -2.086  9.393   5.232   1.00 0.00 ? 30  ILE A CB   13 
ATOM   8144  C  CG1  . ILE A 1 30 ? -3.235  10.155  4.569   1.00 0.00 ? 30  ILE A CG1  13 
ATOM   8145  C  CG2  . ILE A 1 30 ? -1.409  10.258  6.285   1.00 0.00 ? 30  ILE A CG2  13 
ATOM   8146  C  CD1  . ILE A 1 30 ? -4.446  10.319  5.461   1.00 0.00 ? 30  ILE A CD1  13 
ATOM   8147  H  H    . ILE A 1 30 ? -2.635  7.866   3.246   1.00 0.00 ? 30  ILE A H    13 
ATOM   8148  H  HA   . ILE A 1 30 ? -0.672  9.815   3.680   1.00 0.00 ? 30  ILE A HA   13 
ATOM   8149  H  HB   . ILE A 1 30 ? -2.480  8.516   5.721   1.00 0.00 ? 30  ILE A HB   13 
ATOM   8150  H  HG12 . ILE A 1 30 ? -2.893  11.139  4.290   1.00 0.00 ? 30  ILE A HG12 13 
ATOM   8151  H  HG13 . ILE A 1 30 ? -3.546  9.622   3.682   1.00 0.00 ? 30  ILE A HG13 13 
ATOM   8152  H  HG21 . ILE A 1 30 ? -2.130  10.540  7.037   1.00 0.00 ? 30  ILE A HG21 13 
ATOM   8153  H  HG22 . ILE A 1 30 ? -0.608  9.700   6.747   1.00 0.00 ? 30  ILE A HG22 13 
ATOM   8154  H  HG23 . ILE A 1 30 ? -1.008  11.146  5.819   1.00 0.00 ? 30  ILE A HG23 13 
ATOM   8155  H  HD11 . ILE A 1 30 ? -4.179  10.913  6.324   1.00 0.00 ? 30  ILE A HD11 13 
ATOM   8156  H  HD12 . ILE A 1 30 ? -5.232  10.817  4.913   1.00 0.00 ? 30  ILE A HD12 13 
ATOM   8157  H  HD13 . ILE A 1 30 ? -4.790  9.349   5.784   1.00 0.00 ? 30  ILE A HD13 13 
ATOM   8158  N  N    . HIS A 1 31 ? -0.051  6.894   4.995   1.00 0.00 ? 31  HIS A N    13 
ATOM   8159  C  CA   . HIS A 1 31 ? 0.975   6.080   5.638   1.00 0.00 ? 31  HIS A CA   13 
ATOM   8160  C  C    . HIS A 1 31 ? 2.195   5.930   4.735   1.00 0.00 ? 31  HIS A C    13 
ATOM   8161  O  O    . HIS A 1 31 ? 3.304   6.312   5.107   1.00 0.00 ? 31  HIS A O    13 
ATOM   8162  C  CB   . HIS A 1 31 ? 0.415   4.702   5.992   1.00 0.00 ? 31  HIS A CB   13 
ATOM   8163  C  CG   . HIS A 1 31 ? 1.456   3.626   6.038   1.00 0.00 ? 31  HIS A CG   13 
ATOM   8164  N  ND1  . HIS A 1 31 ? 2.129   3.279   7.190   1.00 0.00 ? 31  HIS A ND1  13 
ATOM   8165  C  CD2  . HIS A 1 31 ? 1.937   2.818   5.065   1.00 0.00 ? 31  HIS A CD2  13 
ATOM   8166  C  CE1  . HIS A 1 31 ? 2.981   2.305   6.923   1.00 0.00 ? 31  HIS A CE1  13 
ATOM   8167  N  NE2  . HIS A 1 31 ? 2.884   2.006   5.640   1.00 0.00 ? 31  HIS A NE2  13 
ATOM   8168  H  H    . HIS A 1 31 ? -0.857  6.459   4.646   1.00 0.00 ? 31  HIS A H    13 
ATOM   8169  H  HA   . HIS A 1 31 ? 1.274   6.581   6.546   1.00 0.00 ? 31  HIS A HA   13 
ATOM   8170  H  HB2  . HIS A 1 31 ? -0.054  4.750   6.964   1.00 0.00 ? 31  HIS A HB2  13 
ATOM   8171  H  HB3  . HIS A 1 31 ? -0.323  4.420   5.255   1.00 0.00 ? 31  HIS A HB3  13 
ATOM   8172  H  HD1  . HIS A 1 31 ? 2.003   3.687   8.072   1.00 0.00 ? 31  HIS A HD1  13 
ATOM   8173  H  HD2  . HIS A 1 31 ? 1.634   2.812   4.027   1.00 0.00 ? 31  HIS A HD2  13 
ATOM   8174  H  HE1  . HIS A 1 31 ? 3.644   1.832   7.633   1.00 0.00 ? 31  HIS A HE1  13 
ATOM   8175  N  N    . GLN A 1 32 ? 1.982   5.371   3.549   1.00 0.00 ? 32  GLN A N    13 
ATOM   8176  C  CA   . GLN A 1 32 ? 3.065   5.169   2.594   1.00 0.00 ? 32  GLN A CA   13 
ATOM   8177  C  C    . GLN A 1 32 ? 4.063   6.321   2.652   1.00 0.00 ? 32  GLN A C    13 
ATOM   8178  O  O    . GLN A 1 32 ? 5.253   6.140   2.393   1.00 0.00 ? 32  GLN A O    13 
ATOM   8179  C  CB   . GLN A 1 32 ? 2.506   5.034   1.177   1.00 0.00 ? 32  GLN A CB   13 
ATOM   8180  C  CG   . GLN A 1 32 ? 1.867   3.682   0.901   1.00 0.00 ? 32  GLN A CG   13 
ATOM   8181  C  CD   . GLN A 1 32 ? 1.245   3.601   -0.479  1.00 0.00 ? 32  GLN A CD   13 
ATOM   8182  O  OE1  . GLN A 1 32 ? 0.843   4.615   -1.052  1.00 0.00 ? 32  GLN A OE1  13 
ATOM   8183  N  NE2  . GLN A 1 32 ? 1.163   2.392   -1.022  1.00 0.00 ? 32  GLN A NE2  13 
ATOM   8184  H  H    . GLN A 1 32 ? 1.076   5.087   3.310   1.00 0.00 ? 32  GLN A H    13 
ATOM   8185  H  HA   . GLN A 1 32 ? 3.575   4.255   2.859   1.00 0.00 ? 32  GLN A HA   13 
ATOM   8186  H  HB2  . GLN A 1 32 ? 1.760   5.799   1.022   1.00 0.00 ? 32  GLN A HB2  13 
ATOM   8187  H  HB3  . GLN A 1 32 ? 3.310   5.178   0.470   1.00 0.00 ? 32  GLN A HB3  13 
ATOM   8188  H  HG2  . GLN A 1 32 ? 2.625   2.917   0.982   1.00 0.00 ? 32  GLN A HG2  13 
ATOM   8189  H  HG3  . GLN A 1 32 ? 1.098   3.506   1.638   1.00 0.00 ? 32  GLN A HG3  13 
ATOM   8190  H  HE21 . GLN A 1 32 ? 1.503   1.630   -0.507  1.00 0.00 ? 32  GLN A HE21 13 
ATOM   8191  H  HE22 . GLN A 1 32 ? 0.765   2.311   -1.912  1.00 0.00 ? 32  GLN A HE22 13 
ATOM   8192  N  N    . LYS A 1 33 ? 3.571   7.508   2.992   1.00 0.00 ? 33  LYS A N    13 
ATOM   8193  C  CA   . LYS A 1 33 ? 4.418   8.690   3.085   1.00 0.00 ? 33  LYS A CA   13 
ATOM   8194  C  C    . LYS A 1 33 ? 5.688   8.389   3.875   1.00 0.00 ? 33  LYS A C    13 
ATOM   8195  O  O    . LYS A 1 33 ? 6.793   8.716   3.441   1.00 0.00 ? 33  LYS A O    13 
ATOM   8196  C  CB   . LYS A 1 33 ? 3.654   9.840   3.745   1.00 0.00 ? 33  LYS A CB   13 
ATOM   8197  C  CG   . LYS A 1 33 ? 2.410   10.261  2.983   1.00 0.00 ? 33  LYS A CG   13 
ATOM   8198  C  CD   . LYS A 1 33 ? 2.080   11.725  3.218   1.00 0.00 ? 33  LYS A CD   13 
ATOM   8199  C  CE   . LYS A 1 33 ? 1.242   12.297  2.085   1.00 0.00 ? 33  LYS A CE   13 
ATOM   8200  N  NZ   . LYS A 1 33 ? 2.073   12.635  0.896   1.00 0.00 ? 33  LYS A NZ   13 
ATOM   8201  H  H    . LYS A 1 33 ? 2.613   7.589   3.186   1.00 0.00 ? 33  LYS A H    13 
ATOM   8202  H  HA   . LYS A 1 33 ? 4.693   8.981   2.082   1.00 0.00 ? 33  LYS A HA   13 
ATOM   8203  H  HB2  . LYS A 1 33 ? 3.357   9.535   4.738   1.00 0.00 ? 33  LYS A HB2  13 
ATOM   8204  H  HB3  . LYS A 1 33 ? 4.310   10.695  3.822   1.00 0.00 ? 33  LYS A HB3  13 
ATOM   8205  H  HG2  . LYS A 1 33 ? 2.576   10.106  1.927   1.00 0.00 ? 33  LYS A HG2  13 
ATOM   8206  H  HG3  . LYS A 1 33 ? 1.576   9.656   3.310   1.00 0.00 ? 33  LYS A HG3  13 
ATOM   8207  H  HD2  . LYS A 1 33 ? 1.527   11.817  4.141   1.00 0.00 ? 33  LYS A HD2  13 
ATOM   8208  H  HD3  . LYS A 1 33 ? 3.002   12.285  3.290   1.00 0.00 ? 33  LYS A HD3  13 
ATOM   8209  H  HE2  . LYS A 1 33 ? 0.501   11.566  1.799   1.00 0.00 ? 33  LYS A HE2  13 
ATOM   8210  H  HE3  . LYS A 1 33 ? 0.749   13.192  2.435   1.00 0.00 ? 33  LYS A HE3  13 
ATOM   8211  H  HZ1  . LYS A 1 33 ? 1.957   11.910  0.160   1.00 0.00 ? 33  LYS A HZ1  13 
ATOM   8212  H  HZ2  . LYS A 1 33 ? 3.077   12.684  1.165   1.00 0.00 ? 33  LYS A HZ2  13 
ATOM   8213  H  HZ3  . LYS A 1 33 ? 1.784   13.556  0.509   1.00 0.00 ? 33  LYS A HZ3  13 
ATOM   8214  N  N    . ILE A 1 34 ? 5.522   7.764   5.036   1.00 0.00 ? 34  ILE A N    13 
ATOM   8215  C  CA   . ILE A 1 34 ? 6.655   7.417   5.885   1.00 0.00 ? 34  ILE A CA   13 
ATOM   8216  C  C    . ILE A 1 34 ? 7.776   6.780   5.071   1.00 0.00 ? 34  ILE A C    13 
ATOM   8217  O  O    . ILE A 1 34 ? 8.949   6.862   5.439   1.00 0.00 ? 34  ILE A O    13 
ATOM   8218  C  CB   . ILE A 1 34 ? 6.240   6.452   7.011   1.00 0.00 ? 34  ILE A CB   13 
ATOM   8219  C  CG1  . ILE A 1 34 ? 5.879   5.083   6.432   1.00 0.00 ? 34  ILE A CG1  13 
ATOM   8220  C  CG2  . ILE A 1 34 ? 5.071   7.027   7.797   1.00 0.00 ? 34  ILE A CG2  13 
ATOM   8221  C  CD1  . ILE A 1 34 ? 6.000   3.953   7.430   1.00 0.00 ? 34  ILE A CD1  13 
ATOM   8222  H  H    . ILE A 1 34 ? 4.617   7.530   5.328   1.00 0.00 ? 34  ILE A H    13 
ATOM   8223  H  HA   . ILE A 1 34 ? 7.025   8.328   6.335   1.00 0.00 ? 34  ILE A HA   13 
ATOM   8224  H  HB   . ILE A 1 34 ? 7.076   6.341   7.685   1.00 0.00 ? 34  ILE A HB   13 
ATOM   8225  H  HG12 . ILE A 1 34 ? 4.859   5.106   6.080   1.00 0.00 ? 34  ILE A HG12 13 
ATOM   8226  H  HG13 . ILE A 1 34 ? 6.537   4.867   5.602   1.00 0.00 ? 34  ILE A HG13 13 
ATOM   8227  H  HG21 . ILE A 1 34 ? 5.424   7.399   8.748   1.00 0.00 ? 34  ILE A HG21 13 
ATOM   8228  H  HG22 . ILE A 1 34 ? 4.626   7.836   7.238   1.00 0.00 ? 34  ILE A HG22 13 
ATOM   8229  H  HG23 . ILE A 1 34 ? 4.335   6.255   7.963   1.00 0.00 ? 34  ILE A HG23 13 
ATOM   8230  H  HD11 . ILE A 1 34 ? 6.972   3.490   7.332   1.00 0.00 ? 34  ILE A HD11 13 
ATOM   8231  H  HD12 . ILE A 1 34 ? 5.889   4.343   8.431   1.00 0.00 ? 34  ILE A HD12 13 
ATOM   8232  H  HD13 . ILE A 1 34 ? 5.231   3.220   7.240   1.00 0.00 ? 34  ILE A HD13 13 
ATOM   8233  N  N    . HIS A 1 35 ? 7.409   6.145   3.963   1.00 0.00 ? 35  HIS A N    13 
ATOM   8234  C  CA   . HIS A 1 35 ? 8.384   5.495   3.095   1.00 0.00 ? 35  HIS A CA   13 
ATOM   8235  C  C    . HIS A 1 35 ? 9.091   6.518   2.210   1.00 0.00 ? 35  HIS A C    13 
ATOM   8236  O  O    . HIS A 1 35 ? 10.289  6.405   1.948   1.00 0.00 ? 35  HIS A O    13 
ATOM   8237  C  CB   . HIS A 1 35 ? 7.701   4.438   2.226   1.00 0.00 ? 35  HIS A CB   13 
ATOM   8238  C  CG   . HIS A 1 35 ? 7.111   3.308   3.011   1.00 0.00 ? 35  HIS A CG   13 
ATOM   8239  N  ND1  . HIS A 1 35 ? 7.809   2.621   3.982   1.00 0.00 ? 35  HIS A ND1  13 
ATOM   8240  C  CD2  . HIS A 1 35 ? 5.881   2.745   2.966   1.00 0.00 ? 35  HIS A CD2  13 
ATOM   8241  C  CE1  . HIS A 1 35 ? 7.035   1.684   4.499   1.00 0.00 ? 35  HIS A CE1  13 
ATOM   8242  N  NE2  . HIS A 1 35 ? 5.859   1.739   3.900   1.00 0.00 ? 35  HIS A NE2  13 
ATOM   8243  H  H    . HIS A 1 35 ? 6.459   6.114   3.723   1.00 0.00 ? 35  HIS A H    13 
ATOM   8244  H  HA   . HIS A 1 35 ? 9.117   5.013   3.723   1.00 0.00 ? 35  HIS A HA   13 
ATOM   8245  H  HB2  . HIS A 1 35 ? 6.903   4.904   1.666   1.00 0.00 ? 35  HIS A HB2  13 
ATOM   8246  H  HB3  . HIS A 1 35 ? 8.424   4.024   1.538   1.00 0.00 ? 35  HIS A HB3  13 
ATOM   8247  H  HD1  . HIS A 1 35 ? 8.735   2.794   4.251   1.00 0.00 ? 35  HIS A HD1  13 
ATOM   8248  H  HD2  . HIS A 1 35 ? 5.066   3.034   2.316   1.00 0.00 ? 35  HIS A HD2  13 
ATOM   8249  H  HE1  . HIS A 1 35 ? 7.314   0.991   5.279   1.00 0.00 ? 35  HIS A HE1  13 
ATOM   8250  N  N    . THR A 1 36 ? 8.342   7.516   1.752   1.00 0.00 ? 36  THR A N    13 
ATOM   8251  C  CA   . THR A 1 36 ? 8.896   8.557   0.896   1.00 0.00 ? 36  THR A CA   13 
ATOM   8252  C  C    . THR A 1 36 ? 9.548   9.659   1.723   1.00 0.00 ? 36  THR A C    13 
ATOM   8253  O  O    . THR A 1 36 ? 10.227  10.533  1.185   1.00 0.00 ? 36  THR A O    13 
ATOM   8254  C  CB   . THR A 1 36 ? 7.812   9.179   -0.005  1.00 0.00 ? 36  THR A CB   13 
ATOM   8255  O  OG1  . THR A 1 36 ? 8.419   9.790   -1.149  1.00 0.00 ? 36  THR A OG1  13 
ATOM   8256  C  CG2  . THR A 1 36 ? 7.002   10.215  0.760   1.00 0.00 ? 36  THR A CG2  13 
ATOM   8257  H  H    . THR A 1 36 ? 7.393   7.551   1.996   1.00 0.00 ? 36  THR A H    13 
ATOM   8258  H  HA   . THR A 1 36 ? 9.645   8.104   0.263   1.00 0.00 ? 36  THR A HA   13 
ATOM   8259  H  HB   . THR A 1 36 ? 7.146   8.395   -0.335  1.00 0.00 ? 36  THR A HB   13 
ATOM   8260  H  HG1  . THR A 1 36 ? 7.759   10.299  -1.627  1.00 0.00 ? 36  THR A HG1  13 
ATOM   8261  H  HG21 . THR A 1 36 ? 7.200   10.118  1.816   1.00 0.00 ? 36  THR A HG21 13 
ATOM   8262  H  HG22 . THR A 1 36 ? 5.950   10.057  0.575   1.00 0.00 ? 36  THR A HG22 13 
ATOM   8263  H  HG23 . THR A 1 36 ? 7.281   11.205  0.430   1.00 0.00 ? 36  THR A HG23 13 
ATOM   8264  N  N    . GLY A 1 37 ? 9.337   9.613   3.035   1.00 0.00 ? 37  GLY A N    13 
ATOM   8265  C  CA   . GLY A 1 37 ? 9.912   10.613  3.915   1.00 0.00 ? 37  GLY A CA   13 
ATOM   8266  C  C    . GLY A 1 37 ? 9.281   11.979  3.729   1.00 0.00 ? 37  GLY A C    13 
ATOM   8267  O  O    . GLY A 1 37 ? 9.983   12.973  3.545   1.00 0.00 ? 37  GLY A O    13 
ATOM   8268  H  H    . GLY A 1 37 ? 8.786   8.893   3.408   1.00 0.00 ? 37  GLY A H    13 
ATOM   8269  H  HA2  . GLY A 1 37 ? 9.772   10.300  4.938   1.00 0.00 ? 37  GLY A HA2  13 
ATOM   8270  H  HA3  . GLY A 1 37 ? 10.970  10.688  3.713   1.00 0.00 ? 37  GLY A HA3  13 
ATOM   8271  N  N    . GLU A 1 38 ? 7.954   12.028  3.776   1.00 0.00 ? 38  GLU A N    13 
ATOM   8272  C  CA   . GLU A 1 38 ? 7.230   13.283  3.609   1.00 0.00 ? 38  GLU A CA   13 
ATOM   8273  C  C    . GLU A 1 38 ? 7.080   14.006  4.945   1.00 0.00 ? 38  GLU A C    13 
ATOM   8274  O  O    . GLU A 1 38 ? 6.556   13.448  5.909   1.00 0.00 ? 38  GLU A O    13 
ATOM   8275  C  CB   . GLU A 1 38 ? 5.851   13.025  2.999   1.00 0.00 ? 38  GLU A CB   13 
ATOM   8276  C  CG   . GLU A 1 38 ? 5.231   14.253  2.354   1.00 0.00 ? 38  GLU A CG   13 
ATOM   8277  C  CD   . GLU A 1 38 ? 6.030   14.756  1.168   1.00 0.00 ? 38  GLU A CD   13 
ATOM   8278  O  OE1  . GLU A 1 38 ? 6.714   13.933  0.522   1.00 0.00 ? 38  GLU A OE1  13 
ATOM   8279  O  OE2  . GLU A 1 38 ? 5.973   15.970  0.885   1.00 0.00 ? 38  GLU A OE2  13 
ATOM   8280  H  H    . GLU A 1 38 ? 7.450   11.202  3.926   1.00 0.00 ? 38  GLU A H    13 
ATOM   8281  H  HA   . GLU A 1 38 ? 7.799   13.908  2.938   1.00 0.00 ? 38  GLU A HA   13 
ATOM   8282  H  HB2  . GLU A 1 38 ? 5.942   12.255  2.246   1.00 0.00 ? 38  GLU A HB2  13 
ATOM   8283  H  HB3  . GLU A 1 38 ? 5.186   12.678  3.776   1.00 0.00 ? 38  GLU A HB3  13 
ATOM   8284  H  HG2  . GLU A 1 38 ? 4.235   14.004  2.018   1.00 0.00 ? 38  GLU A HG2  13 
ATOM   8285  H  HG3  . GLU A 1 38 ? 5.174   15.041  3.091   1.00 0.00 ? 38  GLU A HG3  13 
ATOM   8286  N  N    . ARG A 1 39 ? 7.542   15.251  4.992   1.00 0.00 ? 39  ARG A N    13 
ATOM   8287  C  CA   . ARG A 1 39 ? 7.461   16.051  6.208   1.00 0.00 ? 39  ARG A CA   13 
ATOM   8288  C  C    . ARG A 1 39 ? 7.152   17.509  5.881   1.00 0.00 ? 39  ARG A C    13 
ATOM   8289  O  O    . ARG A 1 39 ? 7.598   18.052  4.870   1.00 0.00 ? 39  ARG A O    13 
ATOM   8290  C  CB   . ARG A 1 39 ? 8.772   15.960  6.992   1.00 0.00 ? 39  ARG A CB   13 
ATOM   8291  C  CG   . ARG A 1 39 ? 10.003  16.277  6.158   1.00 0.00 ? 39  ARG A CG   13 
ATOM   8292  C  CD   . ARG A 1 39 ? 10.410  15.093  5.294   1.00 0.00 ? 39  ARG A CD   13 
ATOM   8293  N  NE   . ARG A 1 39 ? 11.840  15.101  4.994   1.00 0.00 ? 39  ARG A NE   13 
ATOM   8294  C  CZ   . ARG A 1 39 ? 12.391  15.872  4.064   1.00 0.00 ? 39  ARG A CZ   13 
ATOM   8295  N  NH1  . ARG A 1 39 ? 11.637  16.695  3.348   1.00 0.00 ? 39  ARG A NH1  13 
ATOM   8296  N  NH2  . ARG A 1 39 ? 13.700  15.823  3.850   1.00 0.00 ? 39  ARG A NH2  13 
ATOM   8297  H  H    . ARG A 1 39 ? 7.949   15.641  4.190   1.00 0.00 ? 39  ARG A H    13 
ATOM   8298  H  HA   . ARG A 1 39 ? 6.662   15.653  6.814   1.00 0.00 ? 39  ARG A HA   13 
ATOM   8299  H  HB2  . ARG A 1 39 ? 8.734   16.657  7.816   1.00 0.00 ? 39  ARG A HB2  13 
ATOM   8300  H  HB3  . ARG A 1 39 ? 8.876   14.959  7.381   1.00 0.00 ? 39  ARG A HB3  13 
ATOM   8301  H  HG2  . ARG A 1 39 ? 9.786   17.118  5.517   1.00 0.00 ? 39  ARG A HG2  13 
ATOM   8302  H  HG3  . ARG A 1 39 ? 10.819  16.527  6.820   1.00 0.00 ? 39  ARG A HG3  13 
ATOM   8303  H  HD2  . ARG A 1 39 ? 10.167  14.181  5.819   1.00 0.00 ? 39  ARG A HD2  13 
ATOM   8304  H  HD3  . ARG A 1 39 ? 9.857   15.134  4.368   1.00 0.00 ? 39  ARG A HD3  13 
ATOM   8305  H  HE   . ARG A 1 39 ? 12.415  14.501  5.512   1.00 0.00 ? 39  ARG A HE   13 
ATOM   8306  H  HH11 . ARG A 1 39 ? 10.651  16.735  3.508   1.00 0.00 ? 39  ARG A HH11 13 
ATOM   8307  H  HH12 . ARG A 1 39 ? 12.055  17.276  2.649   1.00 0.00 ? 39  ARG A HH12 13 
ATOM   8308  H  HH21 . ARG A 1 39 ? 14.271  15.204  4.388   1.00 0.00 ? 39  ARG A HH21 13 
ATOM   8309  H  HH22 . ARG A 1 39 ? 14.114  16.403  3.150   1.00 0.00 ? 39  ARG A HH22 13 
ATOM   8310  N  N    . PRO A 1 40 ? 6.369   18.158  6.755   1.00 0.00 ? 40  PRO A N    13 
ATOM   8311  C  CA   . PRO A 1 40 ? 5.982   19.561  6.581   1.00 0.00 ? 40  PRO A CA   13 
ATOM   8312  C  C    . PRO A 1 40 ? 7.156   20.515  6.774   1.00 0.00 ? 40  PRO A C    13 
ATOM   8313  O  O    . PRO A 1 40 ? 7.567   20.787  7.902   1.00 0.00 ? 40  PRO A O    13 
ATOM   8314  C  CB   . PRO A 1 40 ? 4.932   19.778  7.673   1.00 0.00 ? 40  PRO A CB   13 
ATOM   8315  C  CG   . PRO A 1 40 ? 5.256   18.766  8.717   1.00 0.00 ? 40  PRO A CG   13 
ATOM   8316  C  CD   . PRO A 1 40 ? 5.801   17.573  7.981   1.00 0.00 ? 40  PRO A CD   13 
ATOM   8317  H  HA   . PRO A 1 40 ? 5.537   19.733  5.611   1.00 0.00 ? 40  PRO A HA   13 
ATOM   8318  H  HB2  . PRO A 1 40 ? 5.012   20.785  8.059   1.00 0.00 ? 40  PRO A HB2  13 
ATOM   8319  H  HB3  . PRO A 1 40 ? 3.945   19.621  7.264   1.00 0.00 ? 40  PRO A HB3  13 
ATOM   8320  H  HG2  . PRO A 1 40 ? 5.998   19.161  9.393   1.00 0.00 ? 40  PRO A HG2  13 
ATOM   8321  H  HG3  . PRO A 1 40 ? 4.360   18.496  9.256   1.00 0.00 ? 40  PRO A HG3  13 
ATOM   8322  H  HD2  . PRO A 1 40 ? 6.567   17.087  8.567   1.00 0.00 ? 40  PRO A HD2  13 
ATOM   8323  H  HD3  . PRO A 1 40 ? 5.007   16.880  7.745   1.00 0.00 ? 40  PRO A HD3  13 
ATOM   8324  N  N    . SER A 1 41 ? 7.692   21.019  5.667   1.00 0.00 ? 41  SER A N    13 
ATOM   8325  C  CA   . SER A 1 41 ? 8.822   21.940  5.716   1.00 0.00 ? 41  SER A CA   13 
ATOM   8326  C  C    . SER A 1 41 ? 8.345   23.388  5.658   1.00 0.00 ? 41  SER A C    13 
ATOM   8327  O  O    . SER A 1 41 ? 7.891   23.864  4.618   1.00 0.00 ? 41  SER A O    13 
ATOM   8328  C  CB   . SER A 1 41 ? 9.783   21.662  4.559   1.00 0.00 ? 41  SER A CB   13 
ATOM   8329  O  OG   . SER A 1 41 ? 9.129   21.793  3.309   1.00 0.00 ? 41  SER A OG   13 
ATOM   8330  H  H    . SER A 1 41 ? 7.320   20.764  4.797   1.00 0.00 ? 41  SER A H    13 
ATOM   8331  H  HA   . SER A 1 41 ? 9.339   21.781  6.650   1.00 0.00 ? 41  SER A HA   13 
ATOM   8332  H  HB2  . SER A 1 41 ? 10.602  22.364  4.598   1.00 0.00 ? 41  SER A HB2  13 
ATOM   8333  H  HB3  . SER A 1 41 ? 10.167  20.656  4.648   1.00 0.00 ? 41  SER A HB3  13 
ATOM   8334  H  HG   . SER A 1 41 ? 9.641   21.346  2.631   1.00 0.00 ? 41  SER A HG   13 
ATOM   8335  N  N    . GLY A 1 42 ? 8.451   24.085  6.786   1.00 0.00 ? 42  GLY A N    13 
ATOM   8336  C  CA   . GLY A 1 42 ? 8.027   25.471  6.844   1.00 0.00 ? 42  GLY A CA   13 
ATOM   8337  C  C    . GLY A 1 42 ? 6.531   25.612  7.042   1.00 0.00 ? 42  GLY A C    13 
ATOM   8338  O  O    . GLY A 1 42 ? 5.856   24.697  7.515   1.00 0.00 ? 42  GLY A O    13 
ATOM   8339  H  H    . GLY A 1 42 ? 8.820   23.653  7.585   1.00 0.00 ? 42  GLY A H    13 
ATOM   8340  H  HA2  . GLY A 1 42 ? 8.535   25.958  7.663   1.00 0.00 ? 42  GLY A HA2  13 
ATOM   8341  H  HA3  . GLY A 1 42 ? 8.304   25.959  5.921   1.00 0.00 ? 42  GLY A HA3  13 
ATOM   8342  N  N    . PRO A 1 43 ? 5.989   26.784  6.676   1.00 0.00 ? 43  PRO A N    13 
ATOM   8343  C  CA   . PRO A 1 43 ? 4.557   27.070  6.807   1.00 0.00 ? 43  PRO A CA   13 
ATOM   8344  C  C    . PRO A 1 43 ? 3.713   26.261  5.828   1.00 0.00 ? 43  PRO A C    13 
ATOM   8345  O  O    . PRO A 1 43 ? 4.242   25.616  4.923   1.00 0.00 ? 43  PRO A O    13 
ATOM   8346  C  CB   . PRO A 1 43 ? 4.463   28.564  6.488   1.00 0.00 ? 43  PRO A CB   13 
ATOM   8347  C  CG   . PRO A 1 43 ? 5.646   28.842  5.627   1.00 0.00 ? 43  PRO A CG   13 
ATOM   8348  C  CD   . PRO A 1 43 ? 6.733   27.919  6.105   1.00 0.00 ? 43  PRO A CD   13 
ATOM   8349  H  HA   . PRO A 1 43 ? 4.208   26.892  7.814   1.00 0.00 ? 43  PRO A HA   13 
ATOM   8350  H  HB2  . PRO A 1 43 ? 3.538   28.765  5.967   1.00 0.00 ? 43  PRO A HB2  13 
ATOM   8351  H  HB3  . PRO A 1 43 ? 4.498   29.134  7.404   1.00 0.00 ? 43  PRO A HB3  13 
ATOM   8352  H  HG2  . PRO A 1 43 ? 5.406   28.637  4.595   1.00 0.00 ? 43  PRO A HG2  13 
ATOM   8353  H  HG3  . PRO A 1 43 ? 5.951   29.872  5.745   1.00 0.00 ? 43  PRO A HG3  13 
ATOM   8354  H  HD2  . PRO A 1 43 ? 7.348   27.600  5.276   1.00 0.00 ? 43  PRO A HD2  13 
ATOM   8355  H  HD3  . PRO A 1 43 ? 7.335   28.404  6.859   1.00 0.00 ? 43  PRO A HD3  13 
ATOM   8356  N  N    . SER A 1 44 ? 2.397   26.302  6.015   1.00 0.00 ? 44  SER A N    13 
ATOM   8357  C  CA   . SER A 1 44 ? 1.479   25.570  5.150   1.00 0.00 ? 44  SER A CA   13 
ATOM   8358  C  C    . SER A 1 44 ? 0.848   26.500  4.118   1.00 0.00 ? 44  SER A C    13 
ATOM   8359  O  O    . SER A 1 44 ? -0.014  27.315  4.446   1.00 0.00 ? 44  SER A O    13 
ATOM   8360  C  CB   . SER A 1 44 ? 0.387   24.897  5.983   1.00 0.00 ? 44  SER A CB   13 
ATOM   8361  O  OG   . SER A 1 44 ? -0.462  24.108  5.168   1.00 0.00 ? 44  SER A OG   13 
ATOM   8362  H  H    . SER A 1 44 ? 2.036   26.835  6.754   1.00 0.00 ? 44  SER A H    13 
ATOM   8363  H  HA   . SER A 1 44 ? 2.046   24.810  4.633   1.00 0.00 ? 44  SER A HA   13 
ATOM   8364  H  HB2  . SER A 1 44 ? 0.844   24.262  6.726   1.00 0.00 ? 44  SER A HB2  13 
ATOM   8365  H  HB3  . SER A 1 44 ? -0.206  25.655  6.473   1.00 0.00 ? 44  SER A HB3  13 
ATOM   8366  H  HG   . SER A 1 44 ? -1.376  24.252  5.425   1.00 0.00 ? 44  SER A HG   13 
ATOM   8367  N  N    . SER A 1 45 ? 1.283   26.370  2.869   1.00 0.00 ? 45  SER A N    13 
ATOM   8368  C  CA   . SER A 1 45 ? 0.764   27.200  1.788   1.00 0.00 ? 45  SER A CA   13 
ATOM   8369  C  C    . SER A 1 45 ? -0.659  26.790  1.423   1.00 0.00 ? 45  SER A C    13 
ATOM   8370  O  O    . SER A 1 45 ? -0.900  25.666  0.984   1.00 0.00 ? 45  SER A O    13 
ATOM   8371  C  CB   . SER A 1 45 ? 1.668   27.097  0.558   1.00 0.00 ? 45  SER A CB   13 
ATOM   8372  O  OG   . SER A 1 45 ? 1.768   25.757  0.109   1.00 0.00 ? 45  SER A OG   13 
ATOM   8373  H  H    . SER A 1 45 ? 1.972   25.701  2.670   1.00 0.00 ? 45  SER A H    13 
ATOM   8374  H  HA   . SER A 1 45 ? 0.754   28.224  2.133   1.00 0.00 ? 45  SER A HA   13 
ATOM   8375  H  HB2  . SER A 1 45 ? 1.259   27.701  -0.237  1.00 0.00 ? 45  SER A HB2  13 
ATOM   8376  H  HB3  . SER A 1 45 ? 2.656   27.455  0.810   1.00 0.00 ? 45  SER A HB3  13 
ATOM   8377  H  HG   . SER A 1 45 ? 1.406   25.688  -0.777  1.00 0.00 ? 45  SER A HG   13 
ATOM   8378  N  N    . GLY A 1 46 ? -1.600  27.711  1.610   1.00 0.00 ? 46  GLY A N    13 
ATOM   8379  C  CA   . GLY A 1 46 ? -2.989  27.426  1.296   1.00 0.00 ? 46  GLY A CA   13 
ATOM   8380  C  C    . GLY A 1 46 ? -3.308  27.645  -0.170  1.00 0.00 ? 46  GLY A C    13 
ATOM   8381  O  O    . GLY A 1 46 ? -2.384  27.762  -0.973  1.00 0.00 ? 46  GLY A O    13 
ATOM   8382  H  H    . GLY A 1 46 ? -1.350  28.590  1.963   1.00 0.00 ? 46  GLY A H    13 
ATOM   8383  H  HA2  . GLY A 1 46 ? -3.201  26.399  1.550   1.00 0.00 ? 46  GLY A HA2  13 
ATOM   8384  H  HA3  . GLY A 1 46 ? -3.619  28.072  1.890   1.00 0.00 ? 46  GLY A HA3  13 
HETATM 8385  ZN ZN   . ZN  B 2 .  ? 4.129   1.061   4.467   1.00 0.00 ? 201 ZN  A ZN   13 
ATOM   8386  N  N    . GLY A 1 1  ? 8.592   -29.402 -1.776  1.00 0.00 ? 1   GLY A N    14 
ATOM   8387  C  CA   . GLY A 1 1  ? 7.198   -29.280 -1.392  1.00 0.00 ? 1   GLY A CA   14 
ATOM   8388  C  C    . GLY A 1 1  ? 7.013   -28.459 -0.131  1.00 0.00 ? 1   GLY A C    14 
ATOM   8389  O  O    . GLY A 1 1  ? 7.421   -27.300 -0.072  1.00 0.00 ? 1   GLY A O    14 
ATOM   8390  H  H1   . GLY A 1 1  ? 8.927   -30.249 -2.138  1.00 0.00 ? 1   GLY A H1   14 
ATOM   8391  H  HA2  . GLY A 1 1  ? 6.654   -28.812 -2.198  1.00 0.00 ? 1   GLY A HA2  14 
ATOM   8392  H  HA3  . GLY A 1 1  ? 6.795   -30.269 -1.226  1.00 0.00 ? 1   GLY A HA3  14 
ATOM   8393  N  N    . SER A 1 2  ? 6.394   -29.061 0.879   1.00 0.00 ? 2   SER A N    14 
ATOM   8394  C  CA   . SER A 1 2  ? 6.151   -28.376 2.143   1.00 0.00 ? 2   SER A CA   14 
ATOM   8395  C  C    . SER A 1 2  ? 5.337   -27.104 1.924   1.00 0.00 ? 2   SER A C    14 
ATOM   8396  O  O    . SER A 1 2  ? 5.621   -26.063 2.516   1.00 0.00 ? 2   SER A O    14 
ATOM   8397  C  CB   . SER A 1 2  ? 7.476   -28.035 2.827   1.00 0.00 ? 2   SER A CB   14 
ATOM   8398  O  OG   . SER A 1 2  ? 8.069   -29.191 3.395   1.00 0.00 ? 2   SER A OG   14 
ATOM   8399  H  H    . SER A 1 2  ? 6.092   -29.987 0.771   1.00 0.00 ? 2   SER A H    14 
ATOM   8400  H  HA   . SER A 1 2  ? 5.589   -29.043 2.779   1.00 0.00 ? 2   SER A HA   14 
ATOM   8401  H  HB2  . SER A 1 2  ? 8.156   -27.618 2.100   1.00 0.00 ? 2   SER A HB2  14 
ATOM   8402  H  HB3  . SER A 1 2  ? 7.299   -27.313 3.611   1.00 0.00 ? 2   SER A HB3  14 
ATOM   8403  H  HG   . SER A 1 2  ? 8.097   -29.891 2.739   1.00 0.00 ? 2   SER A HG   14 
ATOM   8404  N  N    . SER A 1 3  ? 4.325   -27.197 1.067   1.00 0.00 ? 3   SER A N    14 
ATOM   8405  C  CA   . SER A 1 3  ? 3.472   -26.053 0.766   1.00 0.00 ? 3   SER A CA   14 
ATOM   8406  C  C    . SER A 1 3  ? 2.369   -25.908 1.810   1.00 0.00 ? 3   SER A C    14 
ATOM   8407  O  O    . SER A 1 3  ? 2.012   -26.869 2.490   1.00 0.00 ? 3   SER A O    14 
ATOM   8408  C  CB   . SER A 1 3  ? 2.855   -26.204 -0.627  1.00 0.00 ? 3   SER A CB   14 
ATOM   8409  O  OG   . SER A 1 3  ? 3.844   -26.095 -1.636  1.00 0.00 ? 3   SER A OG   14 
ATOM   8410  H  H    . SER A 1 3  ? 4.150   -28.054 0.626   1.00 0.00 ? 3   SER A H    14 
ATOM   8411  H  HA   . SER A 1 3  ? 4.087   -25.167 0.783   1.00 0.00 ? 3   SER A HA   14 
ATOM   8412  H  HB2  . SER A 1 3  ? 2.382   -27.171 -0.705  1.00 0.00 ? 3   SER A HB2  14 
ATOM   8413  H  HB3  . SER A 1 3  ? 2.118   -25.429 -0.776  1.00 0.00 ? 3   SER A HB3  14 
ATOM   8414  H  HG   . SER A 1 3  ? 3.465   -25.672 -2.411  1.00 0.00 ? 3   SER A HG   14 
ATOM   8415  N  N    . GLY A 1 4  ? 1.832   -24.697 1.930   1.00 0.00 ? 4   GLY A N    14 
ATOM   8416  C  CA   . GLY A 1 4  ? 0.775   -24.447 2.892   1.00 0.00 ? 4   GLY A CA   14 
ATOM   8417  C  C    . GLY A 1 4  ? 0.951   -23.126 3.615   1.00 0.00 ? 4   GLY A C    14 
ATOM   8418  O  O    . GLY A 1 4  ? 1.023   -22.071 2.986   1.00 0.00 ? 4   GLY A O    14 
ATOM   8419  H  H    . GLY A 1 4  ? 2.156   -23.969 1.360   1.00 0.00 ? 4   GLY A H    14 
ATOM   8420  H  HA2  . GLY A 1 4  ? -0.173  -24.439 2.376   1.00 0.00 ? 4   GLY A HA2  14 
ATOM   8421  H  HA3  . GLY A 1 4  ? 0.771   -25.244 3.621   1.00 0.00 ? 4   GLY A HA3  14 
ATOM   8422  N  N    . SER A 1 5  ? 1.019   -23.183 4.941   1.00 0.00 ? 5   SER A N    14 
ATOM   8423  C  CA   . SER A 1 5  ? 1.182   -21.982 5.751   1.00 0.00 ? 5   SER A CA   14 
ATOM   8424  C  C    . SER A 1 5  ? 0.447   -20.801 5.125   1.00 0.00 ? 5   SER A C    14 
ATOM   8425  O  O    . SER A 1 5  ? 0.965   -19.685 5.081   1.00 0.00 ? 5   SER A O    14 
ATOM   8426  C  CB   . SER A 1 5  ? 2.666   -21.647 5.912   1.00 0.00 ? 5   SER A CB   14 
ATOM   8427  O  OG   . SER A 1 5  ? 3.258   -21.342 4.661   1.00 0.00 ? 5   SER A OG   14 
ATOM   8428  H  H    . SER A 1 5  ? 0.956   -24.055 5.386   1.00 0.00 ? 5   SER A H    14 
ATOM   8429  H  HA   . SER A 1 5  ? 0.758   -22.178 6.725   1.00 0.00 ? 5   SER A HA   14 
ATOM   8430  H  HB2  . SER A 1 5  ? 2.771   -20.793 6.564   1.00 0.00 ? 5   SER A HB2  14 
ATOM   8431  H  HB3  . SER A 1 5  ? 3.179   -22.494 6.344   1.00 0.00 ? 5   SER A HB3  14 
ATOM   8432  H  HG   . SER A 1 5  ? 4.210   -21.269 4.767   1.00 0.00 ? 5   SER A HG   14 
ATOM   8433  N  N    . SER A 1 6  ? -0.764  -21.055 4.640   1.00 0.00 ? 6   SER A N    14 
ATOM   8434  C  CA   . SER A 1 6  ? -1.570  -20.015 4.011   1.00 0.00 ? 6   SER A CA   14 
ATOM   8435  C  C    . SER A 1 6  ? -3.002  -20.046 4.536   1.00 0.00 ? 6   SER A C    14 
ATOM   8436  O  O    . SER A 1 6  ? -3.550  -21.112 4.814   1.00 0.00 ? 6   SER A O    14 
ATOM   8437  C  CB   . SER A 1 6  ? -1.568  -20.187 2.491   1.00 0.00 ? 6   SER A CB   14 
ATOM   8438  O  OG   . SER A 1 6  ? -2.307  -19.155 1.860   1.00 0.00 ? 6   SER A OG   14 
ATOM   8439  H  H    . SER A 1 6  ? -1.123  -21.965 4.704   1.00 0.00 ? 6   SER A H    14 
ATOM   8440  H  HA   . SER A 1 6  ? -1.130  -19.060 4.258   1.00 0.00 ? 6   SER A HA   14 
ATOM   8441  H  HB2  . SER A 1 6  ? -0.551  -20.157 2.130   1.00 0.00 ? 6   SER A HB2  14 
ATOM   8442  H  HB3  . SER A 1 6  ? -2.012  -21.139 2.239   1.00 0.00 ? 6   SER A HB3  14 
ATOM   8443  H  HG   . SER A 1 6  ? -2.156  -18.326 2.320   1.00 0.00 ? 6   SER A HG   14 
ATOM   8444  N  N    . GLY A 1 7  ? -3.603  -18.868 4.669   1.00 0.00 ? 7   GLY A N    14 
ATOM   8445  C  CA   . GLY A 1 7  ? -4.967  -18.781 5.159   1.00 0.00 ? 7   GLY A CA   14 
ATOM   8446  C  C    . GLY A 1 7  ? -5.704  -17.576 4.612   1.00 0.00 ? 7   GLY A C    14 
ATOM   8447  O  O    . GLY A 1 7  ? -6.599  -17.712 3.776   1.00 0.00 ? 7   GLY A O    14 
ATOM   8448  H  H    . GLY A 1 7  ? -3.117  -18.050 4.431   1.00 0.00 ? 7   GLY A H    14 
ATOM   8449  H  HA2  . GLY A 1 7  ? -5.498  -19.676 4.873   1.00 0.00 ? 7   GLY A HA2  14 
ATOM   8450  H  HA3  . GLY A 1 7  ? -4.945  -18.716 6.237   1.00 0.00 ? 7   GLY A HA3  14 
ATOM   8451  N  N    . THR A 1 8  ? -5.331  -16.390 5.084   1.00 0.00 ? 8   THR A N    14 
ATOM   8452  C  CA   . THR A 1 8  ? -5.965  -15.156 4.639   1.00 0.00 ? 8   THR A CA   14 
ATOM   8453  C  C    . THR A 1 8  ? -5.947  -15.045 3.119   1.00 0.00 ? 8   THR A C    14 
ATOM   8454  O  O    . THR A 1 8  ? -5.130  -15.678 2.451   1.00 0.00 ? 8   THR A O    14 
ATOM   8455  C  CB   . THR A 1 8  ? -5.272  -13.919 5.241   1.00 0.00 ? 8   THR A CB   14 
ATOM   8456  O  OG1  . THR A 1 8  ? -5.982  -12.732 4.872   1.00 0.00 ? 8   THR A OG1  14 
ATOM   8457  C  CG2  . THR A 1 8  ? -3.830  -13.822 4.765   1.00 0.00 ? 8   THR A CG2  14 
ATOM   8458  H  H    . THR A 1 8  ? -4.612  -16.347 5.748   1.00 0.00 ? 8   THR A H    14 
ATOM   8459  H  HA   . THR A 1 8  ? -6.991  -15.168 4.977   1.00 0.00 ? 8   THR A HA   14 
ATOM   8460  H  HB   . THR A 1 8  ? -5.275  -14.012 6.318   1.00 0.00 ? 8   THR A HB   14 
ATOM   8461  H  HG1  . THR A 1 8  ? -6.594  -12.494 5.573   1.00 0.00 ? 8   THR A HG1  14 
ATOM   8462  H  HG21 . THR A 1 8  ? -3.278  -14.681 5.116   1.00 0.00 ? 8   THR A HG21 14 
ATOM   8463  H  HG22 . THR A 1 8  ? -3.381  -12.922 5.157   1.00 0.00 ? 8   THR A HG22 14 
ATOM   8464  H  HG23 . THR A 1 8  ? -3.808  -13.796 3.686   1.00 0.00 ? 8   THR A HG23 14 
ATOM   8465  N  N    . GLY A 1 9  ? -6.852  -14.236 2.578   1.00 0.00 ? 9   GLY A N    14 
ATOM   8466  C  CA   . GLY A 1 9  ? -6.922  -14.057 1.139   1.00 0.00 ? 9   GLY A CA   14 
ATOM   8467  C  C    . GLY A 1 9  ? -7.465  -12.697 0.750   1.00 0.00 ? 9   GLY A C    14 
ATOM   8468  O  O    . GLY A 1 9  ? -6.768  -11.899 0.123   1.00 0.00 ? 9   GLY A O    14 
ATOM   8469  H  H    . GLY A 1 9  ? -7.478  -13.757 3.160   1.00 0.00 ? 9   GLY A H    14 
ATOM   8470  H  HA2  . GLY A 1 9  ? -5.931  -14.170 0.725   1.00 0.00 ? 9   GLY A HA2  14 
ATOM   8471  H  HA3  . GLY A 1 9  ? -7.564  -14.820 0.724   1.00 0.00 ? 9   GLY A HA3  14 
ATOM   8472  N  N    . GLU A 1 10 ? -8.714  -12.432 1.120   1.00 0.00 ? 10  GLU A N    14 
ATOM   8473  C  CA   . GLU A 1 10 ? -9.351  -11.159 0.803   1.00 0.00 ? 10  GLU A CA   14 
ATOM   8474  C  C    . GLU A 1 10 ? -8.843  -10.052 1.723   1.00 0.00 ? 10  GLU A C    14 
ATOM   8475  O  O    . GLU A 1 10 ? -8.699  -10.251 2.929   1.00 0.00 ? 10  GLU A O    14 
ATOM   8476  C  CB   . GLU A 1 10 ? -10.872 -11.280 0.923   1.00 0.00 ? 10  GLU A CB   14 
ATOM   8477  C  CG   . GLU A 1 10 ? -11.631 -10.254 0.098   1.00 0.00 ? 10  GLU A CG   14 
ATOM   8478  C  CD   . GLU A 1 10 ? -11.648 -8.883  0.744   1.00 0.00 ? 10  GLU A CD   14 
ATOM   8479  O  OE1  . GLU A 1 10 ? -11.520 -8.809  1.984   1.00 0.00 ? 10  GLU A OE1  14 
ATOM   8480  O  OE2  . GLU A 1 10 ? -11.789 -7.883  0.009   1.00 0.00 ? 10  GLU A OE2  14 
ATOM   8481  H  H    . GLU A 1 10 ? -9.219  -13.108 1.618   1.00 0.00 ? 10  GLU A H    14 
ATOM   8482  H  HA   . GLU A 1 10 ? -9.099  -10.907 -0.216  1.00 0.00 ? 10  GLU A HA   14 
ATOM   8483  H  HB2  . GLU A 1 10 ? -11.169 -12.265 0.597   1.00 0.00 ? 10  GLU A HB2  14 
ATOM   8484  H  HB3  . GLU A 1 10 ? -11.150 -11.154 1.959   1.00 0.00 ? 10  GLU A HB3  14 
ATOM   8485  H  HG2  . GLU A 1 10 ? -11.162 -10.172 -0.871  1.00 0.00 ? 10  GLU A HG2  14 
ATOM   8486  H  HG3  . GLU A 1 10 ? -12.649 -10.592 -0.024  1.00 0.00 ? 10  GLU A HG3  14 
ATOM   8487  N  N    . ASN A 1 11 ? -8.574  -8.887  1.145   1.00 0.00 ? 11  ASN A N    14 
ATOM   8488  C  CA   . ASN A 1 11 ? -8.081  -7.748  1.912   1.00 0.00 ? 11  ASN A CA   14 
ATOM   8489  C  C    . ASN A 1 11 ? -8.560  -6.434  1.303   1.00 0.00 ? 11  ASN A C    14 
ATOM   8490  O  O    . ASN A 1 11 ? -8.719  -6.304  0.089   1.00 0.00 ? 11  ASN A O    14 
ATOM   8491  C  CB   . ASN A 1 11 ? -6.553  -7.769  1.970   1.00 0.00 ? 11  ASN A CB   14 
ATOM   8492  C  CG   . ASN A 1 11 ? -6.004  -9.149  2.278   1.00 0.00 ? 11  ASN A CG   14 
ATOM   8493  O  OD1  . ASN A 1 11 ? -6.125  -9.641  3.401   1.00 0.00 ? 11  ASN A OD1  14 
ATOM   8494  N  ND2  . ASN A 1 11 ? -5.398  -9.781  1.280   1.00 0.00 ? 11  ASN A ND2  14 
ATOM   8495  H  H    . ASN A 1 11 ? -8.709  -8.789  0.179   1.00 0.00 ? 11  ASN A H    14 
ATOM   8496  H  HA   . ASN A 1 11 ? -8.472  -7.831  2.915   1.00 0.00 ? 11  ASN A HA   14 
ATOM   8497  H  HB2  . ASN A 1 11 ? -6.158  -7.451  1.016   1.00 0.00 ? 11  ASN A HB2  14 
ATOM   8498  H  HB3  . ASN A 1 11 ? -6.218  -7.089  2.739   1.00 0.00 ? 11  ASN A HB3  14 
ATOM   8499  H  HD21 . ASN A 1 11 ? -5.339  -9.328  0.413   1.00 0.00 ? 11  ASN A HD21 14 
ATOM   8500  H  HD22 . ASN A 1 11 ? -5.035  -10.675 1.451   1.00 0.00 ? 11  ASN A HD22 14 
ATOM   8501  N  N    . PRO A 1 12 ? -8.796  -5.434  2.165   1.00 0.00 ? 12  PRO A N    14 
ATOM   8502  C  CA   . PRO A 1 12 ? -9.259  -4.111  1.736   1.00 0.00 ? 12  PRO A CA   14 
ATOM   8503  C  C    . PRO A 1 12 ? -8.184  -3.337  0.981   1.00 0.00 ? 12  PRO A C    14 
ATOM   8504  O  O    . PRO A 1 12 ? -8.423  -2.832  -0.116  1.00 0.00 ? 12  PRO A O    14 
ATOM   8505  C  CB   . PRO A 1 12 ? -9.598  -3.409  3.053   1.00 0.00 ? 12  PRO A CB   14 
ATOM   8506  C  CG   . PRO A 1 12 ? -8.750  -4.087  4.073   1.00 0.00 ? 12  PRO A CG   14 
ATOM   8507  C  CD   . PRO A 1 12 ? -8.629  -5.517  3.626   1.00 0.00 ? 12  PRO A CD   14 
ATOM   8508  H  HA   . PRO A 1 12 ? -10.147 -4.181  1.124   1.00 0.00 ? 12  PRO A HA   14 
ATOM   8509  H  HB2  . PRO A 1 12 ? -9.360  -2.357  2.975   1.00 0.00 ? 12  PRO A HB2  14 
ATOM   8510  H  HB3  . PRO A 1 12 ? -10.649 -3.530  3.270   1.00 0.00 ? 12  PRO A HB3  14 
ATOM   8511  H  HG2  . PRO A 1 12 ? -7.777  -3.622  4.109   1.00 0.00 ? 12  PRO A HG2  14 
ATOM   8512  H  HG3  . PRO A 1 12 ? -9.228  -4.036  5.040   1.00 0.00 ? 12  PRO A HG3  14 
ATOM   8513  H  HD2  . PRO A 1 12 ? -7.656  -5.911  3.881   1.00 0.00 ? 12  PRO A HD2  14 
ATOM   8514  H  HD3  . PRO A 1 12 ? -9.409  -6.119  4.069   1.00 0.00 ? 12  PRO A HD3  14 
ATOM   8515  N  N    . PHE A 1 13 ? -6.998  -3.249  1.575   1.00 0.00 ? 13  PHE A N    14 
ATOM   8516  C  CA   . PHE A 1 13 ? -5.886  -2.536  0.959   1.00 0.00 ? 13  PHE A CA   14 
ATOM   8517  C  C    . PHE A 1 13 ? -4.558  -2.954  1.584   1.00 0.00 ? 13  PHE A C    14 
ATOM   8518  O  O    . PHE A 1 13 ? -4.494  -3.277  2.770   1.00 0.00 ? 13  PHE A O    14 
ATOM   8519  C  CB   . PHE A 1 13 ? -6.077  -1.025  1.104   1.00 0.00 ? 13  PHE A CB   14 
ATOM   8520  C  CG   . PHE A 1 13 ? -7.448  -0.553  0.710   1.00 0.00 ? 13  PHE A CG   14 
ATOM   8521  C  CD1  . PHE A 1 13 ? -7.730  -0.225  -0.607  1.00 0.00 ? 13  PHE A CD1  14 
ATOM   8522  C  CD2  . PHE A 1 13 ? -8.454  -0.439  1.655   1.00 0.00 ? 13  PHE A CD2  14 
ATOM   8523  C  CE1  . PHE A 1 13 ? -8.990  0.210   -0.972  1.00 0.00 ? 13  PHE A CE1  14 
ATOM   8524  C  CE2  . PHE A 1 13 ? -9.717  -0.006  1.295   1.00 0.00 ? 13  PHE A CE2  14 
ATOM   8525  C  CZ   . PHE A 1 13 ? -9.985  0.318   -0.020  1.00 0.00 ? 13  PHE A CZ   14 
ATOM   8526  H  H    . PHE A 1 13 ? -6.869  -3.673  2.450   1.00 0.00 ? 13  PHE A H    14 
ATOM   8527  H  HA   . PHE A 1 13 ? -5.871  -2.789  -0.090  1.00 0.00 ? 13  PHE A HA   14 
ATOM   8528  H  HB2  . PHE A 1 13 ? -5.915  -0.746  2.134   1.00 0.00 ? 13  PHE A HB2  14 
ATOM   8529  H  HB3  . PHE A 1 13 ? -5.358  -0.516  0.480   1.00 0.00 ? 13  PHE A HB3  14 
ATOM   8530  H  HD1  . PHE A 1 13 ? -6.953  -0.310  -1.352  1.00 0.00 ? 13  PHE A HD1  14 
ATOM   8531  H  HD2  . PHE A 1 13 ? -8.245  -0.693  2.685   1.00 0.00 ? 13  PHE A HD2  14 
ATOM   8532  H  HE1  . PHE A 1 13 ? -9.197  0.462   -2.001  1.00 0.00 ? 13  PHE A HE1  14 
ATOM   8533  H  HE2  . PHE A 1 13 ? -10.492 0.078   2.042   1.00 0.00 ? 13  PHE A HE2  14 
ATOM   8534  H  HZ   . PHE A 1 13 ? -10.970 0.658   -0.303  1.00 0.00 ? 13  PHE A HZ   14 
ATOM   8535  N  N    . ILE A 1 14 ? -3.502  -2.946  0.777   1.00 0.00 ? 14  ILE A N    14 
ATOM   8536  C  CA   . ILE A 1 14 ? -2.177  -3.324  1.251   1.00 0.00 ? 14  ILE A CA   14 
ATOM   8537  C  C    . ILE A 1 14 ? -1.128  -2.304  0.820   1.00 0.00 ? 14  ILE A C    14 
ATOM   8538  O  O    . ILE A 1 14 ? -1.275  -1.642  -0.208  1.00 0.00 ? 14  ILE A O    14 
ATOM   8539  C  CB   . ILE A 1 14 ? -1.769  -4.715  0.732   1.00 0.00 ? 14  ILE A CB   14 
ATOM   8540  C  CG1  . ILE A 1 14 ? -2.814  -5.759  1.130   1.00 0.00 ? 14  ILE A CG1  14 
ATOM   8541  C  CG2  . ILE A 1 14 ? -0.397  -5.099  1.268   1.00 0.00 ? 14  ILE A CG2  14 
ATOM   8542  C  CD1  . ILE A 1 14 ? -2.858  -6.033  2.617   1.00 0.00 ? 14  ILE A CD1  14 
ATOM   8543  H  H    . ILE A 1 14 ? -3.618  -2.679  -0.158  1.00 0.00 ? 14  ILE A H    14 
ATOM   8544  H  HA   . ILE A 1 14 ? -2.207  -3.359  2.331   1.00 0.00 ? 14  ILE A HA   14 
ATOM   8545  H  HB   . ILE A 1 14 ? -1.708  -4.669  -0.345  1.00 0.00 ? 14  ILE A HB   14 
ATOM   8546  H  HG12 . ILE A 1 14 ? -3.790  -5.415  0.828   1.00 0.00 ? 14  ILE A HG12 14 
ATOM   8547  H  HG13 . ILE A 1 14 ? -2.592  -6.689  0.627   1.00 0.00 ? 14  ILE A HG13 14 
ATOM   8548  H  HG21 . ILE A 1 14 ? 0.361   -4.806  0.557   1.00 0.00 ? 14  ILE A HG21 14 
ATOM   8549  H  HG22 . ILE A 1 14 ? -0.224  -4.595  2.207   1.00 0.00 ? 14  ILE A HG22 14 
ATOM   8550  H  HG23 . ILE A 1 14 ? -0.356  -6.167  1.418   1.00 0.00 ? 14  ILE A HG23 14 
ATOM   8551  H  HD11 . ILE A 1 14 ? -2.618  -5.128  3.157   1.00 0.00 ? 14  ILE A HD11 14 
ATOM   8552  H  HD12 . ILE A 1 14 ? -3.849  -6.363  2.894   1.00 0.00 ? 14  ILE A HD12 14 
ATOM   8553  H  HD13 . ILE A 1 14 ? -2.140  -6.800  2.864   1.00 0.00 ? 14  ILE A HD13 14 
ATOM   8554  N  N    . CYS A 1 15 ? -0.067  -2.185  1.611   1.00 0.00 ? 15  CYS A N    14 
ATOM   8555  C  CA   . CYS A 1 15 ? 1.009   -1.247  1.312   1.00 0.00 ? 15  CYS A CA   14 
ATOM   8556  C  C    . CYS A 1 15 ? 2.109   -1.924  0.499   1.00 0.00 ? 15  CYS A C    14 
ATOM   8557  O  O    . CYS A 1 15 ? 2.702   -2.909  0.937   1.00 0.00 ? 15  CYS A O    14 
ATOM   8558  C  CB   . CYS A 1 15 ? 1.593   -0.678  2.606   1.00 0.00 ? 15  CYS A CB   14 
ATOM   8559  S  SG   . CYS A 1 15 ? 2.637   0.795   2.366   1.00 0.00 ? 15  CYS A SG   14 
ATOM   8560  H  H    . CYS A 1 15 ? -0.006  -2.740  2.417   1.00 0.00 ? 15  CYS A H    14 
ATOM   8561  H  HA   . CYS A 1 15 ? 0.593   -0.440  0.729   1.00 0.00 ? 15  CYS A HA   14 
ATOM   8562  H  HB2  . CYS A 1 15 ? 0.783   -0.402  3.266   1.00 0.00 ? 15  CYS A HB2  14 
ATOM   8563  H  HB3  . CYS A 1 15 ? 2.197   -1.436  3.083   1.00 0.00 ? 15  CYS A HB3  14 
ATOM   8564  N  N    . SER A 1 16 ? 2.376   -1.387  -0.688  1.00 0.00 ? 16  SER A N    14 
ATOM   8565  C  CA   . SER A 1 16 ? 3.402   -1.940  -1.564  1.00 0.00 ? 16  SER A CA   14 
ATOM   8566  C  C    . SER A 1 16 ? 4.787   -1.447  -1.157  1.00 0.00 ? 16  SER A C    14 
ATOM   8567  O  O    . SER A 1 16 ? 5.652   -1.228  -2.004  1.00 0.00 ? 16  SER A O    14 
ATOM   8568  C  CB   . SER A 1 16 ? 3.119   -1.560  -3.018  1.00 0.00 ? 16  SER A CB   14 
ATOM   8569  O  OG   . SER A 1 16 ? 3.971   -2.266  -3.905  1.00 0.00 ? 16  SER A OG   14 
ATOM   8570  H  H    . SER A 1 16 ? 1.868   -0.602  -0.982  1.00 0.00 ? 16  SER A H    14 
ATOM   8571  H  HA   . SER A 1 16 ? 3.373   -3.016  -1.470  1.00 0.00 ? 16  SER A HA   14 
ATOM   8572  H  HB2  . SER A 1 16 ? 2.094   -1.798  -3.258  1.00 0.00 ? 16  SER A HB2  14 
ATOM   8573  H  HB3  . SER A 1 16 ? 3.283   -0.500  -3.149  1.00 0.00 ? 16  SER A HB3  14 
ATOM   8574  H  HG   . SER A 1 16 ? 4.656   -1.676  -4.229  1.00 0.00 ? 16  SER A HG   14 
ATOM   8575  N  N    . GLU A 1 17 ? 4.988   -1.276  0.146   1.00 0.00 ? 17  GLU A N    14 
ATOM   8576  C  CA   . GLU A 1 17 ? 6.268   -0.808  0.665   1.00 0.00 ? 17  GLU A CA   14 
ATOM   8577  C  C    . GLU A 1 17 ? 6.699   -1.634  1.874   1.00 0.00 ? 17  GLU A C    14 
ATOM   8578  O  O    . GLU A 1 17 ? 7.854   -2.047  1.978   1.00 0.00 ? 17  GLU A O    14 
ATOM   8579  C  CB   . GLU A 1 17 ? 6.178   0.670   1.049   1.00 0.00 ? 17  GLU A CB   14 
ATOM   8580  C  CG   . GLU A 1 17 ? 6.181   1.610   -0.144  1.00 0.00 ? 17  GLU A CG   14 
ATOM   8581  C  CD   . GLU A 1 17 ? 6.799   2.958   0.176   1.00 0.00 ? 17  GLU A CD   14 
ATOM   8582  O  OE1  . GLU A 1 17 ? 8.044   3.043   0.225   1.00 0.00 ? 17  GLU A OE1  14 
ATOM   8583  O  OE2  . GLU A 1 17 ? 6.038   3.927   0.378   1.00 0.00 ? 17  GLU A OE2  14 
ATOM   8584  H  H    . GLU A 1 17 ? 4.260   -1.468  0.772   1.00 0.00 ? 17  GLU A H    14 
ATOM   8585  H  HA   . GLU A 1 17 ? 7.005   -0.924  -0.115  1.00 0.00 ? 17  GLU A HA   14 
ATOM   8586  H  HB2  . GLU A 1 17 ? 5.266   0.830   1.606   1.00 0.00 ? 17  GLU A HB2  14 
ATOM   8587  H  HB3  . GLU A 1 17 ? 7.020   0.918   1.678   1.00 0.00 ? 17  GLU A HB3  14 
ATOM   8588  H  HG2  . GLU A 1 17 ? 6.746   1.154   -0.944  1.00 0.00 ? 17  GLU A HG2  14 
ATOM   8589  H  HG3  . GLU A 1 17 ? 5.162   1.765   -0.467  1.00 0.00 ? 17  GLU A HG3  14 
ATOM   8590  N  N    . CYS A 1 18 ? 5.762   -1.869  2.787   1.00 0.00 ? 18  CYS A N    14 
ATOM   8591  C  CA   . CYS A 1 18 ? 6.043   -2.644  3.989   1.00 0.00 ? 18  CYS A CA   14 
ATOM   8592  C  C    . CYS A 1 18 ? 5.117   -3.853  4.086   1.00 0.00 ? 18  CYS A C    14 
ATOM   8593  O  O    . CYS A 1 18 ? 5.562   -4.970  4.344   1.00 0.00 ? 18  CYS A O    14 
ATOM   8594  C  CB   . CYS A 1 18 ? 5.888   -1.767  5.234   1.00 0.00 ? 18  CYS A CB   14 
ATOM   8595  S  SG   . CYS A 1 18 ? 4.215   -1.082  5.456   1.00 0.00 ? 18  CYS A SG   14 
ATOM   8596  H  H    . CYS A 1 18 ? 4.859   -1.513  2.648   1.00 0.00 ? 18  CYS A H    14 
ATOM   8597  H  HA   . CYS A 1 18 ? 7.063   -2.992  3.930   1.00 0.00 ? 18  CYS A HA   14 
ATOM   8598  H  HB2  . CYS A 1 18 ? 6.120   -2.355  6.110   1.00 0.00 ? 18  CYS A HB2  14 
ATOM   8599  H  HB3  . CYS A 1 18 ? 6.577   -0.939  5.169   1.00 0.00 ? 18  CYS A HB3  14 
ATOM   8600  N  N    . GLY A 1 19 ? 3.825   -3.620  3.877   1.00 0.00 ? 19  GLY A N    14 
ATOM   8601  C  CA   . GLY A 1 19 ? 2.856   -4.698  3.945   1.00 0.00 ? 19  GLY A CA   14 
ATOM   8602  C  C    . GLY A 1 19 ? 1.862   -4.514  5.075   1.00 0.00 ? 19  GLY A C    14 
ATOM   8603  O  O    . GLY A 1 19 ? 1.542   -5.463  5.792   1.00 0.00 ? 19  GLY A O    14 
ATOM   8604  H  H    . GLY A 1 19 ? 3.527   -2.708  3.675   1.00 0.00 ? 19  GLY A H    14 
ATOM   8605  H  HA2  . GLY A 1 19 ? 2.318   -4.744  3.010   1.00 0.00 ? 19  GLY A HA2  14 
ATOM   8606  H  HA3  . GLY A 1 19 ? 3.382   -5.630  4.093   1.00 0.00 ? 19  GLY A HA3  14 
ATOM   8607  N  N    . LYS A 1 20 ? 1.371   -3.290  5.235   1.00 0.00 ? 20  LYS A N    14 
ATOM   8608  C  CA   . LYS A 1 20 ? 0.408   -2.983  6.286   1.00 0.00 ? 20  LYS A CA   14 
ATOM   8609  C  C    . LYS A 1 20 ? -1.010  -2.928  5.725   1.00 0.00 ? 20  LYS A C    14 
ATOM   8610  O  O    . LYS A 1 20 ? -1.223  -2.499  4.590   1.00 0.00 ? 20  LYS A O    14 
ATOM   8611  C  CB   . LYS A 1 20 ? 0.756   -1.650  6.952   1.00 0.00 ? 20  LYS A CB   14 
ATOM   8612  C  CG   . LYS A 1 20 ? 0.315   -1.561  8.403   1.00 0.00 ? 20  LYS A CG   14 
ATOM   8613  C  CD   . LYS A 1 20 ? 1.206   -0.623  9.200   1.00 0.00 ? 20  LYS A CD   14 
ATOM   8614  C  CE   . LYS A 1 20 ? 2.558   -1.254  9.494   1.00 0.00 ? 20  LYS A CE   14 
ATOM   8615  N  NZ   . LYS A 1 20 ? 2.507   -2.145  10.686  1.00 0.00 ? 20  LYS A NZ   14 
ATOM   8616  H  H    . LYS A 1 20 ? 1.664   -2.575  4.632   1.00 0.00 ? 20  LYS A H    14 
ATOM   8617  H  HA   . LYS A 1 20 ? 0.460   -3.769  7.024   1.00 0.00 ? 20  LYS A HA   14 
ATOM   8618  H  HB2  . LYS A 1 20 ? 1.826   -1.510  6.913   1.00 0.00 ? 20  LYS A HB2  14 
ATOM   8619  H  HB3  . LYS A 1 20 ? 0.277   -0.851  6.403   1.00 0.00 ? 20  LYS A HB3  14 
ATOM   8620  H  HG2  . LYS A 1 20 ? -0.700  -1.195  8.440   1.00 0.00 ? 20  LYS A HG2  14 
ATOM   8621  H  HG3  . LYS A 1 20 ? 0.360   -2.547  8.844   1.00 0.00 ? 20  LYS A HG3  14 
ATOM   8622  H  HD2  . LYS A 1 20 ? 1.360   0.283   8.632   1.00 0.00 ? 20  LYS A HD2  14 
ATOM   8623  H  HD3  . LYS A 1 20 ? 0.718   -0.385  10.134  1.00 0.00 ? 20  LYS A HD3  14 
ATOM   8624  H  HE2  . LYS A 1 20 ? 2.866   -1.832  8.636   1.00 0.00 ? 20  LYS A HE2  14 
ATOM   8625  H  HE3  . LYS A 1 20 ? 3.276   -0.467  9.674   1.00 0.00 ? 20  LYS A HE3  14 
ATOM   8626  H  HZ1  . LYS A 1 20 ? 3.053   -1.730  11.467  1.00 0.00 ? 20  LYS A HZ1  14 
ATOM   8627  H  HZ2  . LYS A 1 20 ? 2.908   -3.076  10.453  1.00 0.00 ? 20  LYS A HZ2  14 
ATOM   8628  H  HZ3  . LYS A 1 20 ? 1.522   -2.272  10.995  1.00 0.00 ? 20  LYS A HZ3  14 
ATOM   8629  N  N    . VAL A 1 21 ? -1.976  -3.364  6.527   1.00 0.00 ? 21  VAL A N    14 
ATOM   8630  C  CA   . VAL A 1 21 ? -3.373  -3.361  6.111   1.00 0.00 ? 21  VAL A CA   14 
ATOM   8631  C  C    . VAL A 1 21 ? -4.113  -2.155  6.677   1.00 0.00 ? 21  VAL A C    14 
ATOM   8632  O  O    . VAL A 1 21 ? -4.070  -1.894  7.879   1.00 0.00 ? 21  VAL A O    14 
ATOM   8633  C  CB   . VAL A 1 21 ? -4.094  -4.647  6.558   1.00 0.00 ? 21  VAL A CB   14 
ATOM   8634  C  CG1  . VAL A 1 21 ? -5.541  -4.639  6.090   1.00 0.00 ? 21  VAL A CG1  14 
ATOM   8635  C  CG2  . VAL A 1 21 ? -3.363  -5.876  6.037   1.00 0.00 ? 21  VAL A CG2  14 
ATOM   8636  H  H    . VAL A 1 21 ? -1.744  -3.693  7.420   1.00 0.00 ? 21  VAL A H    14 
ATOM   8637  H  HA   . VAL A 1 21 ? -3.401  -3.315  5.032   1.00 0.00 ? 21  VAL A HA   14 
ATOM   8638  H  HB   . VAL A 1 21 ? -4.088  -4.682  7.638   1.00 0.00 ? 21  VAL A HB   14 
ATOM   8639  H  HG11 . VAL A 1 21 ? -6.109  -5.357  6.664   1.00 0.00 ? 21  VAL A HG11 14 
ATOM   8640  H  HG12 . VAL A 1 21 ? -5.959  -3.653  6.228   1.00 0.00 ? 21  VAL A HG12 14 
ATOM   8641  H  HG13 . VAL A 1 21 ? -5.582  -4.904  5.043   1.00 0.00 ? 21  VAL A HG13 14 
ATOM   8642  H  HG21 . VAL A 1 21 ? -4.013  -6.736  6.101   1.00 0.00 ? 21  VAL A HG21 14 
ATOM   8643  H  HG22 . VAL A 1 21 ? -3.079  -5.715  5.008   1.00 0.00 ? 21  VAL A HG22 14 
ATOM   8644  H  HG23 . VAL A 1 21 ? -2.478  -6.048  6.632   1.00 0.00 ? 21  VAL A HG23 14 
ATOM   8645  N  N    . PHE A 1 22 ? -4.793  -1.421  5.802   1.00 0.00 ? 22  PHE A N    14 
ATOM   8646  C  CA   . PHE A 1 22 ? -5.543  -0.240  6.214   1.00 0.00 ? 22  PHE A CA   14 
ATOM   8647  C  C    . PHE A 1 22 ? -7.011  -0.361  5.814   1.00 0.00 ? 22  PHE A C    14 
ATOM   8648  O  O    . PHE A 1 22 ? -7.336  -0.897  4.754   1.00 0.00 ? 22  PHE A O    14 
ATOM   8649  C  CB   . PHE A 1 22 ? -4.936  1.019   5.592   1.00 0.00 ? 22  PHE A CB   14 
ATOM   8650  C  CG   . PHE A 1 22 ? -3.492  1.228   5.951   1.00 0.00 ? 22  PHE A CG   14 
ATOM   8651  C  CD1  . PHE A 1 22 ? -2.486  0.643   5.199   1.00 0.00 ? 22  PHE A CD1  14 
ATOM   8652  C  CD2  . PHE A 1 22 ? -3.142  2.010   7.040   1.00 0.00 ? 22  PHE A CD2  14 
ATOM   8653  C  CE1  . PHE A 1 22 ? -1.157  0.834   5.528   1.00 0.00 ? 22  PHE A CE1  14 
ATOM   8654  C  CE2  . PHE A 1 22 ? -1.815  2.204   7.373   1.00 0.00 ? 22  PHE A CE2  14 
ATOM   8655  C  CZ   . PHE A 1 22 ? -0.821  1.616   6.615   1.00 0.00 ? 22  PHE A CZ   14 
ATOM   8656  H  H    . PHE A 1 22 ? -4.790  -1.679  4.856   1.00 0.00 ? 22  PHE A H    14 
ATOM   8657  H  HA   . PHE A 1 22 ? -5.480  -0.167  7.288   1.00 0.00 ? 22  PHE A HA   14 
ATOM   8658  H  HB2  . PHE A 1 22 ? -5.003  0.949   4.516   1.00 0.00 ? 22  PHE A HB2  14 
ATOM   8659  H  HB3  . PHE A 1 22 ? -5.491  1.881   5.928   1.00 0.00 ? 22  PHE A HB3  14 
ATOM   8660  H  HD1  . PHE A 1 22 ? -2.747  0.032   4.348   1.00 0.00 ? 22  PHE A HD1  14 
ATOM   8661  H  HD2  . PHE A 1 22 ? -3.919  2.471   7.633   1.00 0.00 ? 22  PHE A HD2  14 
ATOM   8662  H  HE1  . PHE A 1 22 ? -0.382  0.373   4.934   1.00 0.00 ? 22  PHE A HE1  14 
ATOM   8663  H  HE2  . PHE A 1 22 ? -1.556  2.817   8.224   1.00 0.00 ? 22  PHE A HE2  14 
ATOM   8664  H  HZ   . PHE A 1 22 ? 0.216   1.766   6.874   1.00 0.00 ? 22  PHE A HZ   14 
ATOM   8665  N  N    . THR A 1 23 ? -7.895  0.140   6.671   1.00 0.00 ? 23  THR A N    14 
ATOM   8666  C  CA   . THR A 1 23 ? -9.328  0.088   6.409   1.00 0.00 ? 23  THR A CA   14 
ATOM   8667  C  C    . THR A 1 23 ? -9.716  1.034   5.279   1.00 0.00 ? 23  THR A C    14 
ATOM   8668  O  O    . THR A 1 23 ? -10.490 0.673   4.392   1.00 0.00 ? 23  THR A O    14 
ATOM   8669  C  CB   . THR A 1 23 ? -10.142 0.447   7.666   1.00 0.00 ? 23  THR A CB   14 
ATOM   8670  O  OG1  . THR A 1 23 ? -9.660  -0.295  8.792   1.00 0.00 ? 23  THR A OG1  14 
ATOM   8671  C  CG2  . THR A 1 23 ? -11.620 0.156   7.456   1.00 0.00 ? 23  THR A CG2  14 
ATOM   8672  H  H    . THR A 1 23 ? -7.574  0.555   7.499   1.00 0.00 ? 23  THR A H    14 
ATOM   8673  H  HA   . THR A 1 23 ? -9.577  -0.923  6.121   1.00 0.00 ? 23  THR A HA   14 
ATOM   8674  H  HB   . THR A 1 23 ? -10.023 1.503   7.864   1.00 0.00 ? 23  THR A HB   14 
ATOM   8675  H  HG1  . THR A 1 23 ? -8.710  -0.178  8.869   1.00 0.00 ? 23  THR A HG1  14 
ATOM   8676  H  HG21 . THR A 1 23 ? -12.106 1.033   7.057   1.00 0.00 ? 23  THR A HG21 14 
ATOM   8677  H  HG22 . THR A 1 23 ? -12.073 -0.109  8.400   1.00 0.00 ? 23  THR A HG22 14 
ATOM   8678  H  HG23 . THR A 1 23 ? -11.730 -0.664  6.761   1.00 0.00 ? 23  THR A HG23 14 
ATOM   8679  N  N    . HIS A 1 24 ? -9.172  2.246   5.315   1.00 0.00 ? 24  HIS A N    14 
ATOM   8680  C  CA   . HIS A 1 24 ? -9.461  3.245   4.292   1.00 0.00 ? 24  HIS A CA   14 
ATOM   8681  C  C    . HIS A 1 24 ? -8.297  3.372   3.313   1.00 0.00 ? 24  HIS A C    14 
ATOM   8682  O  O    . HIS A 1 24 ? -7.132  3.315   3.707   1.00 0.00 ? 24  HIS A O    14 
ATOM   8683  C  CB   . HIS A 1 24 ? -9.749  4.600   4.938   1.00 0.00 ? 24  HIS A CB   14 
ATOM   8684  C  CG   . HIS A 1 24 ? -10.703 5.447   4.154   1.00 0.00 ? 24  HIS A CG   14 
ATOM   8685  N  ND1  . HIS A 1 24 ? -10.292 6.419   3.267   1.00 0.00 ? 24  HIS A ND1  14 
ATOM   8686  C  CD2  . HIS A 1 24 ? -12.056 5.462   4.125   1.00 0.00 ? 24  HIS A CD2  14 
ATOM   8687  C  CE1  . HIS A 1 24 ? -11.350 6.997   2.728   1.00 0.00 ? 24  HIS A CE1  14 
ATOM   8688  N  NE2  . HIS A 1 24 ? -12.434 6.434   3.232   1.00 0.00 ? 24  HIS A NE2  14 
ATOM   8689  H  H    . HIS A 1 24 ? -8.563  2.475   6.048   1.00 0.00 ? 24  HIS A H    14 
ATOM   8690  H  HA   . HIS A 1 24 ? -10.337 2.921   3.750   1.00 0.00 ? 24  HIS A HA   14 
ATOM   8691  H  HB2  . HIS A 1 24 ? -10.176 4.441   5.918   1.00 0.00 ? 24  HIS A HB2  14 
ATOM   8692  H  HB3  . HIS A 1 24 ? -8.823  5.148   5.039   1.00 0.00 ? 24  HIS A HB3  14 
ATOM   8693  H  HD1  . HIS A 1 24 ? -9.362  6.652   3.064   1.00 0.00 ? 24  HIS A HD1  14 
ATOM   8694  H  HD2  . HIS A 1 24 ? -12.717 4.828   4.699   1.00 0.00 ? 24  HIS A HD2  14 
ATOM   8695  H  HE1  . HIS A 1 24 ? -11.334 7.794   1.999   1.00 0.00 ? 24  HIS A HE1  14 
ATOM   8696  N  N    . LYS A 1 25 ? -8.621  3.543   2.036   1.00 0.00 ? 25  LYS A N    14 
ATOM   8697  C  CA   . LYS A 1 25 ? -7.604  3.679   1.000   1.00 0.00 ? 25  LYS A CA   14 
ATOM   8698  C  C    . LYS A 1 25 ? -6.742  4.914   1.242   1.00 0.00 ? 25  LYS A C    14 
ATOM   8699  O  O    . LYS A 1 25 ? -5.519  4.869   1.101   1.00 0.00 ? 25  LYS A O    14 
ATOM   8700  C  CB   . LYS A 1 25 ? -8.260  3.764   -0.380  1.00 0.00 ? 25  LYS A CB   14 
ATOM   8701  C  CG   . LYS A 1 25 ? -7.284  3.580   -1.529  1.00 0.00 ? 25  LYS A CG   14 
ATOM   8702  C  CD   . LYS A 1 25 ? -8.002  3.202   -2.814  1.00 0.00 ? 25  LYS A CD   14 
ATOM   8703  C  CE   . LYS A 1 25 ? -7.037  3.116   -3.987  1.00 0.00 ? 25  LYS A CE   14 
ATOM   8704  N  NZ   . LYS A 1 25 ? -6.449  1.754   -4.123  1.00 0.00 ? 25  LYS A NZ   14 
ATOM   8705  H  H    . LYS A 1 25 ? -9.568  3.581   1.784   1.00 0.00 ? 25  LYS A H    14 
ATOM   8706  H  HA   . LYS A 1 25 ? -6.974  2.803   1.037   1.00 0.00 ? 25  LYS A HA   14 
ATOM   8707  H  HB2  . LYS A 1 25 ? -9.018  2.998   -0.452  1.00 0.00 ? 25  LYS A HB2  14 
ATOM   8708  H  HB3  . LYS A 1 25 ? -8.727  4.733   -0.484  1.00 0.00 ? 25  LYS A HB3  14 
ATOM   8709  H  HG2  . LYS A 1 25 ? -6.749  4.505   -1.687  1.00 0.00 ? 25  LYS A HG2  14 
ATOM   8710  H  HG3  . LYS A 1 25 ? -6.585  2.796   -1.274  1.00 0.00 ? 25  LYS A HG3  14 
ATOM   8711  H  HD2  . LYS A 1 25 ? -8.476  2.241   -2.682  1.00 0.00 ? 25  LYS A HD2  14 
ATOM   8712  H  HD3  . LYS A 1 25 ? -8.752  3.949   -3.031  1.00 0.00 ? 25  LYS A HD3  14 
ATOM   8713  H  HE2  . LYS A 1 25 ? -7.569  3.362   -4.893  1.00 0.00 ? 25  LYS A HE2  14 
ATOM   8714  H  HE3  . LYS A 1 25 ? -6.240  3.829   -3.833  1.00 0.00 ? 25  LYS A HE3  14 
ATOM   8715  H  HZ1  . LYS A 1 25 ? -5.878  1.697   -4.990  1.00 0.00 ? 25  LYS A HZ1  14 
ATOM   8716  H  HZ2  . LYS A 1 25 ? -7.206  1.042   -4.172  1.00 0.00 ? 25  LYS A HZ2  14 
ATOM   8717  H  HZ3  . LYS A 1 25 ? -5.843  1.543   -3.306  1.00 0.00 ? 25  LYS A HZ3  14 
ATOM   8718  N  N    . THR A 1 26 ? -7.387  6.018   1.609   1.00 0.00 ? 26  THR A N    14 
ATOM   8719  C  CA   . THR A 1 26 ? -6.680  7.265   1.870   1.00 0.00 ? 26  THR A CA   14 
ATOM   8720  C  C    . THR A 1 26 ? -5.667  7.097   2.997   1.00 0.00 ? 26  THR A C    14 
ATOM   8721  O  O    . THR A 1 26 ? -4.550  7.607   2.922   1.00 0.00 ? 26  THR A O    14 
ATOM   8722  C  CB   . THR A 1 26 ? -7.657  8.398   2.238   1.00 0.00 ? 26  THR A CB   14 
ATOM   8723  O  OG1  . THR A 1 26 ? -8.675  8.511   1.238   1.00 0.00 ? 26  THR A OG1  14 
ATOM   8724  C  CG2  . THR A 1 26 ? -6.922  9.723   2.373   1.00 0.00 ? 26  THR A CG2  14 
ATOM   8725  H  H    . THR A 1 26 ? -8.362  5.991   1.704   1.00 0.00 ? 26  THR A H    14 
ATOM   8726  H  HA   . THR A 1 26 ? -6.157  7.548   0.968   1.00 0.00 ? 26  THR A HA   14 
ATOM   8727  H  HB   . THR A 1 26 ? -8.118  8.161   3.186   1.00 0.00 ? 26  THR A HB   14 
ATOM   8728  H  HG1  . THR A 1 26 ? -8.415  8.013   0.459   1.00 0.00 ? 26  THR A HG1  14 
ATOM   8729  H  HG21 . THR A 1 26 ? -6.420  9.952   1.445   1.00 0.00 ? 26  THR A HG21 14 
ATOM   8730  H  HG22 . THR A 1 26 ? -6.195  9.653   3.168   1.00 0.00 ? 26  THR A HG22 14 
ATOM   8731  H  HG23 . THR A 1 26 ? -7.631  10.506  2.601   1.00 0.00 ? 26  THR A HG23 14 
ATOM   8732  N  N    . ASN A 1 27 ? -6.065  6.378   4.042   1.00 0.00 ? 27  ASN A N    14 
ATOM   8733  C  CA   . ASN A 1 27 ? -5.191  6.143   5.185   1.00 0.00 ? 27  ASN A CA   14 
ATOM   8734  C  C    . ASN A 1 27 ? -3.887  5.484   4.746   1.00 0.00 ? 27  ASN A C    14 
ATOM   8735  O  O    . ASN A 1 27 ? -2.805  5.858   5.202   1.00 0.00 ? 27  ASN A O    14 
ATOM   8736  C  CB   . ASN A 1 27 ? -5.896  5.264   6.220   1.00 0.00 ? 27  ASN A CB   14 
ATOM   8737  C  CG   . ASN A 1 27 ? -7.015  5.997   6.936   1.00 0.00 ? 27  ASN A CG   14 
ATOM   8738  O  OD1  . ASN A 1 27 ? -7.692  6.841   6.350   1.00 0.00 ? 27  ASN A OD1  14 
ATOM   8739  N  ND2  . ASN A 1 27 ? -7.213  5.676   8.209   1.00 0.00 ? 27  ASN A ND2  14 
ATOM   8740  H  H    . ASN A 1 27 ? -6.968  5.997   4.044   1.00 0.00 ? 27  ASN A H    14 
ATOM   8741  H  HA   . ASN A 1 27 ? -4.966  7.099   5.632   1.00 0.00 ? 27  ASN A HA   14 
ATOM   8742  H  HB2  . ASN A 1 27 ? -6.317  4.401   5.724   1.00 0.00 ? 27  ASN A HB2  14 
ATOM   8743  H  HB3  . ASN A 1 27 ? -5.177  4.936   6.956   1.00 0.00 ? 27  ASN A HB3  14 
ATOM   8744  H  HD21 . ASN A 1 27 ? -6.634  4.994   8.610   1.00 0.00 ? 27  ASN A HD21 14 
ATOM   8745  H  HD22 . ASN A 1 27 ? -7.930  6.134   8.695   1.00 0.00 ? 27  ASN A HD22 14 
ATOM   8746  N  N    . LEU A 1 28 ? -3.996  4.502   3.859   1.00 0.00 ? 28  LEU A N    14 
ATOM   8747  C  CA   . LEU A 1 28 ? -2.826  3.790   3.357   1.00 0.00 ? 28  LEU A CA   14 
ATOM   8748  C  C    . LEU A 1 28 ? -1.913  4.729   2.574   1.00 0.00 ? 28  LEU A C    14 
ATOM   8749  O  O    . LEU A 1 28 ? -0.689  4.663   2.693   1.00 0.00 ? 28  LEU A O    14 
ATOM   8750  C  CB   . LEU A 1 28 ? -3.256  2.621   2.470   1.00 0.00 ? 28  LEU A CB   14 
ATOM   8751  C  CG   . LEU A 1 28 ? -2.215  2.119   1.469   1.00 0.00 ? 28  LEU A CG   14 
ATOM   8752  C  CD1  . LEU A 1 28 ? -1.070  1.428   2.192   1.00 0.00 ? 28  LEU A CD1  14 
ATOM   8753  C  CD2  . LEU A 1 28 ? -2.856  1.178   0.459   1.00 0.00 ? 28  LEU A CD2  14 
ATOM   8754  H  H    . LEU A 1 28 ? -4.884  4.248   3.533   1.00 0.00 ? 28  LEU A H    14 
ATOM   8755  H  HA   . LEU A 1 28 ? -2.282  3.406   4.207   1.00 0.00 ? 28  LEU A HA   14 
ATOM   8756  H  HB2  . LEU A 1 28 ? -3.520  1.797   3.114   1.00 0.00 ? 28  LEU A HB2  14 
ATOM   8757  H  HB3  . LEU A 1 28 ? -4.129  2.934   1.913   1.00 0.00 ? 28  LEU A HB3  14 
ATOM   8758  H  HG   . LEU A 1 28 ? -1.808  2.963   0.929   1.00 0.00 ? 28  LEU A HG   14 
ATOM   8759  H  HD11 . LEU A 1 28 ? -1.299  1.356   3.244   1.00 0.00 ? 28  LEU A HD11 14 
ATOM   8760  H  HD12 . LEU A 1 28 ? -0.163  2.000   2.059   1.00 0.00 ? 28  LEU A HD12 14 
ATOM   8761  H  HD13 . LEU A 1 28 ? -0.933  0.437   1.784   1.00 0.00 ? 28  LEU A HD13 14 
ATOM   8762  H  HD21 . LEU A 1 28 ? -3.208  0.292   0.966   1.00 0.00 ? 28  LEU A HD21 14 
ATOM   8763  H  HD22 . LEU A 1 28 ? -2.127  0.901   -0.287  1.00 0.00 ? 28  LEU A HD22 14 
ATOM   8764  H  HD23 . LEU A 1 28 ? -3.689  1.675   -0.018  1.00 0.00 ? 28  LEU A HD23 14 
ATOM   8765  N  N    . ILE A 1 29 ? -2.516  5.602   1.775   1.00 0.00 ? 29  ILE A N    14 
ATOM   8766  C  CA   . ILE A 1 29 ? -1.758  6.556   0.975   1.00 0.00 ? 29  ILE A CA   14 
ATOM   8767  C  C    . ILE A 1 29 ? -0.955  7.501   1.862   1.00 0.00 ? 29  ILE A C    14 
ATOM   8768  O  O    . ILE A 1 29 ? 0.204   7.803   1.575   1.00 0.00 ? 29  ILE A O    14 
ATOM   8769  C  CB   . ILE A 1 29 ? -2.681  7.385   0.062   1.00 0.00 ? 29  ILE A CB   14 
ATOM   8770  C  CG1  . ILE A 1 29 ? -3.447  6.469   -0.893  1.00 0.00 ? 29  ILE A CG1  14 
ATOM   8771  C  CG2  . ILE A 1 29 ? -1.872  8.413   -0.715  1.00 0.00 ? 29  ILE A CG2  14 
ATOM   8772  C  CD1  . ILE A 1 29 ? -4.807  7.003   -1.282  1.00 0.00 ? 29  ILE A CD1  14 
ATOM   8773  H  H    . ILE A 1 29 ? -3.495  5.606   1.722   1.00 0.00 ? 29  ILE A H    14 
ATOM   8774  H  HA   . ILE A 1 29 ? -1.075  5.998   0.351   1.00 0.00 ? 29  ILE A HA   14 
ATOM   8775  H  HB   . ILE A 1 29 ? -3.386  7.914   0.686   1.00 0.00 ? 29  ILE A HB   14 
ATOM   8776  H  HG12 . ILE A 1 29 ? -2.872  6.339   -1.796  1.00 0.00 ? 29  ILE A HG12 14 
ATOM   8777  H  HG13 . ILE A 1 29 ? -3.589  5.507   -0.421  1.00 0.00 ? 29  ILE A HG13 14 
ATOM   8778  H  HG21 . ILE A 1 29 ? -2.493  8.856   -1.480  1.00 0.00 ? 29  ILE A HG21 14 
ATOM   8779  H  HG22 . ILE A 1 29 ? -1.528  9.184   -0.041  1.00 0.00 ? 29  ILE A HG22 14 
ATOM   8780  H  HG23 . ILE A 1 29 ? -1.023  7.931   -1.175  1.00 0.00 ? 29  ILE A HG23 14 
ATOM   8781  H  HD11 . ILE A 1 29 ? -5.576  6.409   -0.808  1.00 0.00 ? 29  ILE A HD11 14 
ATOM   8782  H  HD12 . ILE A 1 29 ? -4.897  8.030   -0.960  1.00 0.00 ? 29  ILE A HD12 14 
ATOM   8783  H  HD13 . ILE A 1 29 ? -4.923  6.950   -2.354  1.00 0.00 ? 29  ILE A HD13 14 
ATOM   8784  N  N    . ILE A 1 30 ? -1.578  7.964   2.940   1.00 0.00 ? 30  ILE A N    14 
ATOM   8785  C  CA   . ILE A 1 30 ? -0.921  8.873   3.871   1.00 0.00 ? 30  ILE A CA   14 
ATOM   8786  C  C    . ILE A 1 30 ? 0.206   8.171   4.621   1.00 0.00 ? 30  ILE A C    14 
ATOM   8787  O  O    . ILE A 1 30 ? 1.225   8.782   4.946   1.00 0.00 ? 30  ILE A O    14 
ATOM   8788  C  CB   . ILE A 1 30 ? -1.918  9.453   4.891   1.00 0.00 ? 30  ILE A CB   14 
ATOM   8789  C  CG1  . ILE A 1 30 ? -3.042  10.201  4.170   1.00 0.00 ? 30  ILE A CG1  14 
ATOM   8790  C  CG2  . ILE A 1 30 ? -1.202  10.374  5.867   1.00 0.00 ? 30  ILE A CG2  14 
ATOM   8791  C  CD1  . ILE A 1 30 ? -4.146  10.667  5.093   1.00 0.00 ? 30  ILE A CD1  14 
ATOM   8792  H  H    . ILE A 1 30 ? -2.502  7.687   3.114   1.00 0.00 ? 30  ILE A H    14 
ATOM   8793  H  HA   . ILE A 1 30 ? -0.505  9.691   3.300   1.00 0.00 ? 30  ILE A HA   14 
ATOM   8794  H  HB   . ILE A 1 30 ? -2.343  8.634   5.451   1.00 0.00 ? 30  ILE A HB   14 
ATOM   8795  H  HG12 . ILE A 1 30 ? -2.631  11.070  3.681   1.00 0.00 ? 30  ILE A HG12 14 
ATOM   8796  H  HG13 . ILE A 1 30 ? -3.480  9.549   3.429   1.00 0.00 ? 30  ILE A HG13 14 
ATOM   8797  H  HG21 . ILE A 1 30 ? -0.990  11.316  5.383   1.00 0.00 ? 30  ILE A HG21 14 
ATOM   8798  H  HG22 . ILE A 1 30 ? -1.832  10.546  6.727   1.00 0.00 ? 30  ILE A HG22 14 
ATOM   8799  H  HG23 . ILE A 1 30 ? -0.278  9.915   6.184   1.00 0.00 ? 30  ILE A HG23 14 
ATOM   8800  H  HD11 . ILE A 1 30 ? -4.009  10.225  6.069   1.00 0.00 ? 30  ILE A HD11 14 
ATOM   8801  H  HD12 . ILE A 1 30 ? -4.115  11.743  5.178   1.00 0.00 ? 30  ILE A HD12 14 
ATOM   8802  H  HD13 . ILE A 1 30 ? -5.102  10.365  4.692   1.00 0.00 ? 30  ILE A HD13 14 
ATOM   8803  N  N    . HIS A 1 31 ? 0.018   6.884   4.892   1.00 0.00 ? 31  HIS A N    14 
ATOM   8804  C  CA   . HIS A 1 31 ? 1.020   6.097   5.602   1.00 0.00 ? 31  HIS A CA   14 
ATOM   8805  C  C    . HIS A 1 31 ? 2.279   5.931   4.756   1.00 0.00 ? 31  HIS A C    14 
ATOM   8806  O  O    . HIS A 1 31 ? 3.366   6.343   5.159   1.00 0.00 ? 31  HIS A O    14 
ATOM   8807  C  CB   . HIS A 1 31 ? 0.455   4.725   5.970   1.00 0.00 ? 31  HIS A CB   14 
ATOM   8808  C  CG   . HIS A 1 31 ? 1.498   3.657   6.080   1.00 0.00 ? 31  HIS A CG   14 
ATOM   8809  N  ND1  . HIS A 1 31 ? 2.135   3.345   7.263   1.00 0.00 ? 31  HIS A ND1  14 
ATOM   8810  C  CD2  . HIS A 1 31 ? 2.015   2.825   5.146   1.00 0.00 ? 31  HIS A CD2  14 
ATOM   8811  C  CE1  . HIS A 1 31 ? 2.999   2.369   7.051   1.00 0.00 ? 31  HIS A CE1  14 
ATOM   8812  N  NE2  . HIS A 1 31 ? 2.946   2.034   5.774   1.00 0.00 ? 31  HIS A NE2  14 
ATOM   8813  H  H    . HIS A 1 31 ? -0.815  6.453   4.607   1.00 0.00 ? 31  HIS A H    14 
ATOM   8814  H  HA   . HIS A 1 31 ? 1.276   6.626   6.507   1.00 0.00 ? 31  HIS A HA   14 
ATOM   8815  H  HB2  . HIS A 1 31 ? -0.049  4.795   6.923   1.00 0.00 ? 31  HIS A HB2  14 
ATOM   8816  H  HB3  . HIS A 1 31 ? -0.255  4.420   5.215   1.00 0.00 ? 31  HIS A HB3  14 
ATOM   8817  H  HD1  . HIS A 1 31 ? 1.978   3.776   8.128   1.00 0.00 ? 31  HIS A HD1  14 
ATOM   8818  H  HD2  . HIS A 1 31 ? 1.746   2.789   4.099   1.00 0.00 ? 31  HIS A HD2  14 
ATOM   8819  H  HE1  . HIS A 1 31 ? 3.640   1.919   7.795   1.00 0.00 ? 31  HIS A HE1  14 
ATOM   8820  N  N    . GLN A 1 32 ? 2.123   5.324   3.584   1.00 0.00 ? 32  GLN A N    14 
ATOM   8821  C  CA   . GLN A 1 32 ? 3.248   5.102   2.683   1.00 0.00 ? 32  GLN A CA   14 
ATOM   8822  C  C    . GLN A 1 32 ? 4.243   6.256   2.761   1.00 0.00 ? 32  GLN A C    14 
ATOM   8823  O  O    . GLN A 1 32 ? 5.447   6.064   2.587   1.00 0.00 ? 32  GLN A O    14 
ATOM   8824  C  CB   . GLN A 1 32 ? 2.753   4.937   1.246   1.00 0.00 ? 32  GLN A CB   14 
ATOM   8825  C  CG   . GLN A 1 32 ? 1.872   3.715   1.043   1.00 0.00 ? 32  GLN A CG   14 
ATOM   8826  C  CD   . GLN A 1 32 ? 0.869   3.899   -0.080  1.00 0.00 ? 32  GLN A CD   14 
ATOM   8827  O  OE1  . GLN A 1 32 ? 0.784   4.969   -0.683  1.00 0.00 ? 32  GLN A OE1  14 
ATOM   8828  N  NE2  . GLN A 1 32 ? 0.104   2.852   -0.368  1.00 0.00 ? 32  GLN A NE2  14 
ATOM   8829  H  H    . GLN A 1 32 ? 1.231   5.018   3.319   1.00 0.00 ? 32  GLN A H    14 
ATOM   8830  H  HA   . GLN A 1 32 ? 3.744   4.194   2.990   1.00 0.00 ? 32  GLN A HA   14 
ATOM   8831  H  HB2  . GLN A 1 32 ? 2.186   5.814   0.969   1.00 0.00 ? 32  GLN A HB2  14 
ATOM   8832  H  HB3  . GLN A 1 32 ? 3.608   4.850   0.591   1.00 0.00 ? 32  GLN A HB3  14 
ATOM   8833  H  HG2  . GLN A 1 32 ? 2.500   2.869   0.808   1.00 0.00 ? 32  GLN A HG2  14 
ATOM   8834  H  HG3  . GLN A 1 32 ? 1.333   3.520   1.958   1.00 0.00 ? 32  GLN A HG3  14 
ATOM   8835  H  HE21 . GLN A 1 32 ? 0.227   2.032   0.155   1.00 0.00 ? 32  GLN A HE21 14 
ATOM   8836  H  HE22 . GLN A 1 32 ? -0.553  2.943   -1.088  1.00 0.00 ? 32  GLN A HE22 14 
ATOM   8837  N  N    . LYS A 1 33 ? 3.733   7.454   3.024   1.00 0.00 ? 33  LYS A N    14 
ATOM   8838  C  CA   . LYS A 1 33 ? 4.576   8.639   3.127   1.00 0.00 ? 33  LYS A CA   14 
ATOM   8839  C  C    . LYS A 1 33 ? 5.778   8.376   4.028   1.00 0.00 ? 33  LYS A C    14 
ATOM   8840  O  O    . LYS A 1 33 ? 6.916   8.673   3.663   1.00 0.00 ? 33  LYS A O    14 
ATOM   8841  C  CB   . LYS A 1 33 ? 3.767   9.820   3.669   1.00 0.00 ? 33  LYS A CB   14 
ATOM   8842  C  CG   . LYS A 1 33 ? 2.630   10.249  2.757   1.00 0.00 ? 33  LYS A CG   14 
ATOM   8843  C  CD   . LYS A 1 33 ? 2.348   11.737  2.880   1.00 0.00 ? 33  LYS A CD   14 
ATOM   8844  C  CE   . LYS A 1 33 ? 1.010   12.103  2.255   1.00 0.00 ? 33  LYS A CE   14 
ATOM   8845  N  NZ   . LYS A 1 33 ? 1.138   12.388  0.799   1.00 0.00 ? 33  LYS A NZ   14 
ATOM   8846  H  H    . LYS A 1 33 ? 2.765   7.543   3.154   1.00 0.00 ? 33  LYS A H    14 
ATOM   8847  H  HA   . LYS A 1 33 ? 4.930   8.881   2.136   1.00 0.00 ? 33  LYS A HA   14 
ATOM   8848  H  HB2  . LYS A 1 33 ? 3.349   9.545   4.626   1.00 0.00 ? 33  LYS A HB2  14 
ATOM   8849  H  HB3  . LYS A 1 33 ? 4.430   10.663  3.804   1.00 0.00 ? 33  LYS A HB3  14 
ATOM   8850  H  HG2  . LYS A 1 33 ? 2.898   10.027  1.735   1.00 0.00 ? 33  LYS A HG2  14 
ATOM   8851  H  HG3  . LYS A 1 33 ? 1.739   9.699   3.026   1.00 0.00 ? 33  LYS A HG3  14 
ATOM   8852  H  HD2  . LYS A 1 33 ? 2.330   12.006  3.925   1.00 0.00 ? 33  LYS A HD2  14 
ATOM   8853  H  HD3  . LYS A 1 33 ? 3.132   12.285  2.378   1.00 0.00 ? 33  LYS A HD3  14 
ATOM   8854  H  HE2  . LYS A 1 33 ? 0.326   11.281  2.393   1.00 0.00 ? 33  LYS A HE2  14 
ATOM   8855  H  HE3  . LYS A 1 33 ? 0.624   12.981  2.753   1.00 0.00 ? 33  LYS A HE3  14 
ATOM   8856  H  HZ1  . LYS A 1 33 ? 2.141   12.413  0.526   1.00 0.00 ? 33  LYS A HZ1  14 
ATOM   8857  H  HZ2  . LYS A 1 33 ? 0.706   13.308  0.576   1.00 0.00 ? 33  LYS A HZ2  14 
ATOM   8858  H  HZ3  . LYS A 1 33 ? 0.657   11.650  0.247   1.00 0.00 ? 33  LYS A HZ3  14 
ATOM   8859  N  N    . ILE A 1 34 ? 5.518   7.817   5.205   1.00 0.00 ? 34  ILE A N    14 
ATOM   8860  C  CA   . ILE A 1 34 ? 6.579   7.512   6.157   1.00 0.00 ? 34  ILE A CA   14 
ATOM   8861  C  C    . ILE A 1 34 ? 7.768   6.856   5.463   1.00 0.00 ? 34  ILE A C    14 
ATOM   8862  O  O    . ILE A 1 34 ? 8.903   6.951   5.930   1.00 0.00 ? 34  ILE A O    14 
ATOM   8863  C  CB   . ILE A 1 34 ? 6.079   6.585   7.280   1.00 0.00 ? 34  ILE A CB   14 
ATOM   8864  C  CG1  . ILE A 1 34 ? 5.783   5.190   6.725   1.00 0.00 ? 34  ILE A CG1  14 
ATOM   8865  C  CG2  . ILE A 1 34 ? 4.840   7.172   7.939   1.00 0.00 ? 34  ILE A CG2  14 
ATOM   8866  C  CD1  . ILE A 1 34 ? 5.872   4.095   7.765   1.00 0.00 ? 34  ILE A CD1  14 
ATOM   8867  H  H    . ILE A 1 34 ? 4.590   7.605   5.439   1.00 0.00 ? 34  ILE A H    14 
ATOM   8868  H  HA   . ILE A 1 34 ? 6.904   8.441   6.602   1.00 0.00 ? 34  ILE A HA   14 
ATOM   8869  H  HB   . ILE A 1 34 ? 6.854   6.511   8.027   1.00 0.00 ? 34  ILE A HB   14 
ATOM   8870  H  HG12 . ILE A 1 34 ? 4.786   5.176   6.315   1.00 0.00 ? 34  ILE A HG12 14 
ATOM   8871  H  HG13 . ILE A 1 34 ? 6.493   4.964   5.943   1.00 0.00 ? 34  ILE A HG13 14 
ATOM   8872  H  HG21 . ILE A 1 34 ? 5.113   7.622   8.882   1.00 0.00 ? 34  ILE A HG21 14 
ATOM   8873  H  HG22 . ILE A 1 34 ? 4.411   7.924   7.294   1.00 0.00 ? 34  ILE A HG22 14 
ATOM   8874  H  HG23 . ILE A 1 34 ? 4.117   6.389   8.110   1.00 0.00 ? 34  ILE A HG23 14 
ATOM   8875  H  HD11 . ILE A 1 34 ? 4.903   3.952   8.222   1.00 0.00 ? 34  ILE A HD11 14 
ATOM   8876  H  HD12 . ILE A 1 34 ? 6.185   3.175   7.294   1.00 0.00 ? 34  ILE A HD12 14 
ATOM   8877  H  HD13 . ILE A 1 34 ? 6.588   4.374   8.523   1.00 0.00 ? 34  ILE A HD13 14 
ATOM   8878  N  N    . HIS A 1 35 ? 7.499   6.192   4.343   1.00 0.00 ? 35  HIS A N    14 
ATOM   8879  C  CA   . HIS A 1 35 ? 8.547   5.521   3.582   1.00 0.00 ? 35  HIS A CA   14 
ATOM   8880  C  C    . HIS A 1 35 ? 9.360   6.528   2.773   1.00 0.00 ? 35  HIS A C    14 
ATOM   8881  O  O    . HIS A 1 35 ? 10.578  6.401   2.647   1.00 0.00 ? 35  HIS A O    14 
ATOM   8882  C  CB   . HIS A 1 35 ? 7.939   4.473   2.650   1.00 0.00 ? 35  HIS A CB   14 
ATOM   8883  C  CG   . HIS A 1 35 ? 7.183   3.399   3.369   1.00 0.00 ? 35  HIS A CG   14 
ATOM   8884  N  ND1  . HIS A 1 35 ? 7.652   2.784   4.511   1.00 0.00 ? 35  HIS A ND1  14 
ATOM   8885  C  CD2  . HIS A 1 35 ? 5.983   2.831   3.104   1.00 0.00 ? 35  HIS A CD2  14 
ATOM   8886  C  CE1  . HIS A 1 35 ? 6.774   1.884   4.916   1.00 0.00 ? 35  HIS A CE1  14 
ATOM   8887  N  NE2  . HIS A 1 35 ? 5.752   1.893   4.079   1.00 0.00 ? 35  HIS A NE2  14 
ATOM   8888  H  H    . HIS A 1 35 ? 6.575   6.152   4.021   1.00 0.00 ? 35  HIS A H    14 
ATOM   8889  H  HA   . HIS A 1 35 ? 9.203   5.029   4.283   1.00 0.00 ? 35  HIS A HA   14 
ATOM   8890  H  HB2  . HIS A 1 35 ? 7.256   4.959   1.969   1.00 0.00 ? 35  HIS A HB2  14 
ATOM   8891  H  HB3  . HIS A 1 35 ? 8.730   4.001   2.084   1.00 0.00 ? 35  HIS A HB3  14 
ATOM   8892  H  HD1  . HIS A 1 35 ? 8.502   2.978   4.957   1.00 0.00 ? 35  HIS A HD1  14 
ATOM   8893  H  HD2  . HIS A 1 35 ? 5.329   3.071   2.277   1.00 0.00 ? 35  HIS A HD2  14 
ATOM   8894  H  HE1  . HIS A 1 35 ? 6.874   1.249   5.784   1.00 0.00 ? 35  HIS A HE1  14 
ATOM   8895  N  N    . THR A 1 36 ? 8.677   7.528   2.225   1.00 0.00 ? 36  THR A N    14 
ATOM   8896  C  CA   . THR A 1 36 ? 9.335   8.555   1.427   1.00 0.00 ? 36  THR A CA   14 
ATOM   8897  C  C    . THR A 1 36 ? 9.322   9.901   2.143   1.00 0.00 ? 36  THR A C    14 
ATOM   8898  O  O    . THR A 1 36 ? 8.263   10.486  2.367   1.00 0.00 ? 36  THR A O    14 
ATOM   8899  C  CB   . THR A 1 36 ? 8.662   8.713   0.050   1.00 0.00 ? 36  THR A CB   14 
ATOM   8900  O  OG1  . THR A 1 36 ? 9.256   9.804   -0.663  1.00 0.00 ? 36  THR A OG1  14 
ATOM   8901  C  CG2  . THR A 1 36 ? 7.168   8.954   0.202   1.00 0.00 ? 36  THR A CG2  14 
ATOM   8902  H  H    . THR A 1 36 ? 7.708   7.575   2.361   1.00 0.00 ? 36  THR A H    14 
ATOM   8903  H  HA   . THR A 1 36 ? 10.360  8.251   1.271   1.00 0.00 ? 36  THR A HA   14 
ATOM   8904  H  HB   . THR A 1 36 ? 8.810   7.803   -0.513  1.00 0.00 ? 36  THR A HB   14 
ATOM   8905  H  HG1  . THR A 1 36 ? 10.046  9.499   -1.115  1.00 0.00 ? 36  THR A HG1  14 
ATOM   8906  H  HG21 . THR A 1 36 ? 6.748   8.203   0.855   1.00 0.00 ? 36  THR A HG21 14 
ATOM   8907  H  HG22 . THR A 1 36 ? 6.693   8.895   -0.766  1.00 0.00 ? 36  THR A HG22 14 
ATOM   8908  H  HG23 . THR A 1 36 ? 7.002   9.933   0.626   1.00 0.00 ? 36  THR A HG23 14 
ATOM   8909  N  N    . GLY A 1 37 ? 10.507  10.387  2.501   1.00 0.00 ? 37  GLY A N    14 
ATOM   8910  C  CA   . GLY A 1 37 ? 10.609  11.661  3.189   1.00 0.00 ? 37  GLY A CA   14 
ATOM   8911  C  C    . GLY A 1 37 ? 10.795  11.500  4.684   1.00 0.00 ? 37  GLY A C    14 
ATOM   8912  O  O    . GLY A 1 37 ? 10.033  12.056  5.474   1.00 0.00 ? 37  GLY A O    14 
ATOM   8913  H  H    . GLY A 1 37 ? 11.318  9.877   2.297   1.00 0.00 ? 37  GLY A H    14 
ATOM   8914  H  HA2  . GLY A 1 37 ? 11.449  12.208  2.788   1.00 0.00 ? 37  GLY A HA2  14 
ATOM   8915  H  HA3  . GLY A 1 37 ? 9.706   12.227  3.009   1.00 0.00 ? 37  GLY A HA3  14 
ATOM   8916  N  N    . GLU A 1 38 ? 11.810  10.735  5.073   1.00 0.00 ? 38  GLU A N    14 
ATOM   8917  C  CA   . GLU A 1 38 ? 12.092  10.500  6.485   1.00 0.00 ? 38  GLU A CA   14 
ATOM   8918  C  C    . GLU A 1 38 ? 13.459  11.060  6.867   1.00 0.00 ? 38  GLU A C    14 
ATOM   8919  O  O    . GLU A 1 38 ? 14.402  11.017  6.076   1.00 0.00 ? 38  GLU A O    14 
ATOM   8920  C  CB   . GLU A 1 38 ? 12.036  9.004   6.797   1.00 0.00 ? 38  GLU A CB   14 
ATOM   8921  C  CG   . GLU A 1 38 ? 12.453  8.662   8.218   1.00 0.00 ? 38  GLU A CG   14 
ATOM   8922  C  CD   . GLU A 1 38 ? 12.780  7.192   8.392   1.00 0.00 ? 38  GLU A CD   14 
ATOM   8923  O  OE1  . GLU A 1 38 ? 12.070  6.351   7.802   1.00 0.00 ? 38  GLU A OE1  14 
ATOM   8924  O  OE2  . GLU A 1 38 ? 13.747  6.882   9.120   1.00 0.00 ? 38  GLU A OE2  14 
ATOM   8925  H  H    . GLU A 1 38 ? 12.383  10.318  4.396   1.00 0.00 ? 38  GLU A H    14 
ATOM   8926  H  HA   . GLU A 1 38 ? 11.335  11.008  7.063   1.00 0.00 ? 38  GLU A HA   14 
ATOM   8927  H  HB2  . GLU A 1 38 ? 11.025  8.654   6.646   1.00 0.00 ? 38  GLU A HB2  14 
ATOM   8928  H  HB3  . GLU A 1 38 ? 12.692  8.482   6.116   1.00 0.00 ? 38  GLU A HB3  14 
ATOM   8929  H  HG2  . GLU A 1 38 ? 13.328  9.242   8.472   1.00 0.00 ? 38  GLU A HG2  14 
ATOM   8930  H  HG3  . GLU A 1 38 ? 11.646  8.918   8.888   1.00 0.00 ? 38  GLU A HG3  14 
ATOM   8931  N  N    . ARG A 1 39 ? 13.558  11.584  8.084   1.00 0.00 ? 39  ARG A N    14 
ATOM   8932  C  CA   . ARG A 1 39 ? 14.809  12.154  8.571   1.00 0.00 ? 39  ARG A CA   14 
ATOM   8933  C  C    . ARG A 1 39 ? 15.500  12.963  7.478   1.00 0.00 ? 39  ARG A C    14 
ATOM   8934  O  O    . ARG A 1 39 ? 16.663  12.734  7.143   1.00 0.00 ? 39  ARG A O    14 
ATOM   8935  C  CB   . ARG A 1 39 ? 15.740  11.046  9.067   1.00 0.00 ? 39  ARG A CB   14 
ATOM   8936  C  CG   . ARG A 1 39 ? 16.950  11.562  9.828   1.00 0.00 ? 39  ARG A CG   14 
ATOM   8937  C  CD   . ARG A 1 39 ? 16.591  11.934  11.258  1.00 0.00 ? 39  ARG A CD   14 
ATOM   8938  N  NE   . ARG A 1 39 ? 16.199  10.768  12.045  1.00 0.00 ? 39  ARG A NE   14 
ATOM   8939  C  CZ   . ARG A 1 39 ? 17.066  9.979   12.671  1.00 0.00 ? 39  ARG A CZ   14 
ATOM   8940  N  NH1  . ARG A 1 39 ? 18.366  10.231  12.603  1.00 0.00 ? 39  ARG A NH1  14 
ATOM   8941  N  NH2  . ARG A 1 39 ? 16.632  8.937   13.368  1.00 0.00 ? 39  ARG A NH2  14 
ATOM   8942  H  H    . ARG A 1 39 ? 12.771  11.589  8.669   1.00 0.00 ? 39  ARG A H    14 
ATOM   8943  H  HA   . ARG A 1 39 ? 14.575  12.811  9.396   1.00 0.00 ? 39  ARG A HA   14 
ATOM   8944  H  HB2  . ARG A 1 39 ? 15.184  10.390  9.721   1.00 0.00 ? 39  ARG A HB2  14 
ATOM   8945  H  HB3  . ARG A 1 39 ? 16.091  10.480  8.217   1.00 0.00 ? 39  ARG A HB3  14 
ATOM   8946  H  HG2  . ARG A 1 39 ? 17.707  10.792  9.848   1.00 0.00 ? 39  ARG A HG2  14 
ATOM   8947  H  HG3  . ARG A 1 39 ? 17.335  12.436  9.323   1.00 0.00 ? 39  ARG A HG3  14 
ATOM   8948  H  HD2  . ARG A 1 39 ? 17.449  12.397  11.722  1.00 0.00 ? 39  ARG A HD2  14 
ATOM   8949  H  HD3  . ARG A 1 39 ? 15.771  12.636  11.238  1.00 0.00 ? 39  ARG A HD3  14 
ATOM   8950  H  HE   . ARG A 1 39 ? 15.244  10.564  12.109  1.00 0.00 ? 39  ARG A HE   14 
ATOM   8951  H  HH11 . ARG A 1 39 ? 18.695  11.016  12.079  1.00 0.00 ? 39  ARG A HH11 14 
ATOM   8952  H  HH12 . ARG A 1 39 ? 19.016  9.636   13.076  1.00 0.00 ? 39  ARG A HH12 14 
ATOM   8953  H  HH21 . ARG A 1 39 ? 15.653  8.744   13.422  1.00 0.00 ? 39  ARG A HH21 14 
ATOM   8954  H  HH22 . ARG A 1 39 ? 17.285  8.344   13.839  1.00 0.00 ? 39  ARG A HH22 14 
ATOM   8955  N  N    . PRO A 1 40 ? 14.769  13.931  6.906   1.00 0.00 ? 40  PRO A N    14 
ATOM   8956  C  CA   . PRO A 1 40 ? 15.292  14.793  5.842   1.00 0.00 ? 40  PRO A CA   14 
ATOM   8957  C  C    . PRO A 1 40 ? 16.355  15.761  6.349   1.00 0.00 ? 40  PRO A C    14 
ATOM   8958  O  O    . PRO A 1 40 ? 16.675  15.779  7.538   1.00 0.00 ? 40  PRO A O    14 
ATOM   8959  C  CB   . PRO A 1 40 ? 14.054  15.560  5.367   1.00 0.00 ? 40  PRO A CB   14 
ATOM   8960  C  CG   . PRO A 1 40 ? 13.136  15.560  6.539   1.00 0.00 ? 40  PRO A CG   14 
ATOM   8961  C  CD   . PRO A 1 40 ? 13.377  14.259  7.254   1.00 0.00 ? 40  PRO A CD   14 
ATOM   8962  H  HA   . PRO A 1 40 ? 15.694  14.214  5.023   1.00 0.00 ? 40  PRO A HA   14 
ATOM   8963  H  HB2  . PRO A 1 40 ? 14.337  16.564  5.085   1.00 0.00 ? 40  PRO A HB2  14 
ATOM   8964  H  HB3  . PRO A 1 40 ? 13.615  15.052  4.521   1.00 0.00 ? 40  PRO A HB3  14 
ATOM   8965  H  HG2  . PRO A 1 40 ? 13.367  16.392  7.187   1.00 0.00 ? 40  PRO A HG2  14 
ATOM   8966  H  HG3  . PRO A 1 40 ? 12.111  15.618  6.203   1.00 0.00 ? 40  PRO A HG3  14 
ATOM   8967  H  HD2  . PRO A 1 40 ? 13.266  14.389  8.321   1.00 0.00 ? 40  PRO A HD2  14 
ATOM   8968  H  HD3  . PRO A 1 40 ? 12.700  13.499  6.893   1.00 0.00 ? 40  PRO A HD3  14 
ATOM   8969  N  N    . SER A 1 41 ? 16.900  16.564  5.440   1.00 0.00 ? 41  SER A N    14 
ATOM   8970  C  CA   . SER A 1 41 ? 17.931  17.532  5.796   1.00 0.00 ? 41  SER A CA   14 
ATOM   8971  C  C    . SER A 1 41 ? 17.443  18.957  5.555   1.00 0.00 ? 41  SER A C    14 
ATOM   8972  O  O    . SER A 1 41 ? 17.183  19.353  4.420   1.00 0.00 ? 41  SER A O    14 
ATOM   8973  C  CB   . SER A 1 41 ? 19.204  17.273  4.988   1.00 0.00 ? 41  SER A CB   14 
ATOM   8974  O  OG   . SER A 1 41 ? 19.988  16.255  5.585   1.00 0.00 ? 41  SER A OG   14 
ATOM   8975  H  H    . SER A 1 41 ? 16.603  16.501  4.508   1.00 0.00 ? 41  SER A H    14 
ATOM   8976  H  HA   . SER A 1 41 ? 18.150  17.412  6.846   1.00 0.00 ? 41  SER A HA   14 
ATOM   8977  H  HB2  . SER A 1 41 ? 18.937  16.966  3.989   1.00 0.00 ? 41  SER A HB2  14 
ATOM   8978  H  HB3  . SER A 1 41 ? 19.788  18.181  4.942   1.00 0.00 ? 41  SER A HB3  14 
ATOM   8979  H  HG   . SER A 1 41 ? 20.440  16.608  6.355   1.00 0.00 ? 41  SER A HG   14 
ATOM   8980  N  N    . GLY A 1 42 ? 17.322  19.725  6.634   1.00 0.00 ? 42  GLY A N    14 
ATOM   8981  C  CA   . GLY A 1 42 ? 16.866  21.098  6.520   1.00 0.00 ? 42  GLY A CA   14 
ATOM   8982  C  C    . GLY A 1 42 ? 17.884  22.093  7.042   1.00 0.00 ? 42  GLY A C    14 
ATOM   8983  O  O    . GLY A 1 42 ? 19.001  21.732  7.415   1.00 0.00 ? 42  GLY A O    14 
ATOM   8984  H  H    . GLY A 1 42 ? 17.544  19.356  7.515   1.00 0.00 ? 42  GLY A H    14 
ATOM   8985  H  HA2  . GLY A 1 42 ? 16.667  21.315  5.481   1.00 0.00 ? 42  GLY A HA2  14 
ATOM   8986  H  HA3  . GLY A 1 42 ? 15.951  21.209  7.083   1.00 0.00 ? 42  GLY A HA3  14 
ATOM   8987  N  N    . PRO A 1 43 ? 17.501  23.377  7.073   1.00 0.00 ? 43  PRO A N    14 
ATOM   8988  C  CA   . PRO A 1 43 ? 18.374  24.453  7.550   1.00 0.00 ? 43  PRO A CA   14 
ATOM   8989  C  C    . PRO A 1 43 ? 18.608  24.386  9.056   1.00 0.00 ? 43  PRO A C    14 
ATOM   8990  O  O    . PRO A 1 43 ? 19.240  25.268  9.636   1.00 0.00 ? 43  PRO A O    14 
ATOM   8991  C  CB   . PRO A 1 43 ? 17.603  25.724  7.186   1.00 0.00 ? 43  PRO A CB   14 
ATOM   8992  C  CG   . PRO A 1 43 ? 16.176  25.300  7.134   1.00 0.00 ? 43  PRO A CG   14 
ATOM   8993  C  CD   . PRO A 1 43 ? 16.184  23.879  6.644   1.00 0.00 ? 43  PRO A CD   14 
ATOM   8994  H  HA   . PRO A 1 43 ? 19.326  24.448  7.039   1.00 0.00 ? 43  PRO A HA   14 
ATOM   8995  H  HB2  . PRO A 1 43 ? 17.766  26.477  7.944   1.00 0.00 ? 43  PRO A HB2  14 
ATOM   8996  H  HB3  . PRO A 1 43 ? 17.940  26.092  6.228   1.00 0.00 ? 43  PRO A HB3  14 
ATOM   8997  H  HG2  . PRO A 1 43 ? 15.741  25.355  8.121   1.00 0.00 ? 43  PRO A HG2  14 
ATOM   8998  H  HG3  . PRO A 1 43 ? 15.631  25.930  6.447   1.00 0.00 ? 43  PRO A HG3  14 
ATOM   8999  H  HD2  . PRO A 1 43 ? 15.387  23.316  7.107   1.00 0.00 ? 43  PRO A HD2  14 
ATOM   9000  H  HD3  . PRO A 1 43 ? 16.093  23.850  5.568   1.00 0.00 ? 43  PRO A HD3  14 
ATOM   9001  N  N    . SER A 1 44 ? 18.095  23.332  9.683   1.00 0.00 ? 44  SER A N    14 
ATOM   9002  C  CA   . SER A 1 44 ? 18.245  23.151  11.122  1.00 0.00 ? 44  SER A CA   14 
ATOM   9003  C  C    . SER A 1 44 ? 19.717  23.027  11.503  1.00 0.00 ? 44  SER A C    14 
ATOM   9004  O  O    . SER A 1 44 ? 20.548  22.622  10.690  1.00 0.00 ? 44  SER A O    14 
ATOM   9005  C  CB   . SER A 1 44 ? 17.481  21.908  11.583  1.00 0.00 ? 44  SER A CB   14 
ATOM   9006  O  OG   . SER A 1 44 ? 16.087  22.061  11.379  1.00 0.00 ? 44  SER A OG   14 
ATOM   9007  H  H    . SER A 1 44 ? 17.601  22.662  9.165   1.00 0.00 ? 44  SER A H    14 
ATOM   9008  H  HA   . SER A 1 44 ? 17.830  24.020  11.610  1.00 0.00 ? 44  SER A HA   14 
ATOM   9009  H  HB2  . SER A 1 44 ? 17.822  21.051  11.024  1.00 0.00 ? 44  SER A HB2  14 
ATOM   9010  H  HB3  . SER A 1 44 ? 17.663  21.748  12.636  1.00 0.00 ? 44  SER A HB3  14 
ATOM   9011  H  HG   . SER A 1 44 ? 15.832  21.619  10.566  1.00 0.00 ? 44  SER A HG   14 
ATOM   9012  N  N    . SER A 1 45 ? 20.031  23.380  12.745  1.00 0.00 ? 45  SER A N    14 
ATOM   9013  C  CA   . SER A 1 45 ? 21.403  23.313  13.235  1.00 0.00 ? 45  SER A CA   14 
ATOM   9014  C  C    . SER A 1 45 ? 21.752  21.896  13.683  1.00 0.00 ? 45  SER A C    14 
ATOM   9015  O  O    . SER A 1 45 ? 22.792  21.354  13.312  1.00 0.00 ? 45  SER A O    14 
ATOM   9016  C  CB   . SER A 1 45 ? 21.602  24.290  14.395  1.00 0.00 ? 45  SER A CB   14 
ATOM   9017  O  OG   . SER A 1 45 ? 20.778  23.947  15.497  1.00 0.00 ? 45  SER A OG   14 
ATOM   9018  H  H    . SER A 1 45 ? 19.324  23.695  13.346  1.00 0.00 ? 45  SER A H    14 
ATOM   9019  H  HA   . SER A 1 45 ? 22.059  23.593  12.424  1.00 0.00 ? 45  SER A HA   14 
ATOM   9020  H  HB2  . SER A 1 45 ? 22.633  24.265  14.711  1.00 0.00 ? 45  SER A HB2  14 
ATOM   9021  H  HB3  . SER A 1 45 ? 21.349  25.288  14.069  1.00 0.00 ? 45  SER A HB3  14 
ATOM   9022  H  HG   . SER A 1 45 ? 19.888  23.766  15.187  1.00 0.00 ? 45  SER A HG   14 
ATOM   9023  N  N    . GLY A 1 46 ? 20.872  21.302  14.483  1.00 0.00 ? 46  GLY A N    14 
ATOM   9024  C  CA   . GLY A 1 46 ? 21.104  19.954  14.969  1.00 0.00 ? 46  GLY A CA   14 
ATOM   9025  C  C    . GLY A 1 46 ? 21.713  19.054  13.913  1.00 0.00 ? 46  GLY A C    14 
ATOM   9026  O  O    . GLY A 1 46 ? 22.905  18.760  13.992  1.00 0.00 ? 46  GLY A O    14 
ATOM   9027  H  H    . GLY A 1 46 ? 20.059  21.783  14.746  1.00 0.00 ? 46  GLY A H    14 
ATOM   9028  H  HA2  . GLY A 1 46 ? 21.770  19.999  15.817  1.00 0.00 ? 46  GLY A HA2  14 
ATOM   9029  H  HA3  . GLY A 1 46 ? 20.161  19.531  15.285  1.00 0.00 ? 46  GLY A HA3  14 
HETATM 9030  ZN ZN   . ZN  B 2 .  ? 3.927   0.961   4.298   1.00 0.00 ? 201 ZN  A ZN   14 
ATOM   9031  N  N    . GLY A 1 1  ? -6.087  -27.565 -16.502 1.00 0.00 ? 1   GLY A N    15 
ATOM   9032  C  CA   . GLY A 1 1  ? -6.448  -26.732 -15.370 1.00 0.00 ? 1   GLY A CA   15 
ATOM   9033  C  C    . GLY A 1 1  ? -5.944  -25.310 -15.513 1.00 0.00 ? 1   GLY A C    15 
ATOM   9034  O  O    . GLY A 1 1  ? -6.174  -24.662 -16.535 1.00 0.00 ? 1   GLY A O    15 
ATOM   9035  H  H1   . GLY A 1 1  ? -5.156  -27.845 -16.625 1.00 0.00 ? 1   GLY A H1   15 
ATOM   9036  H  HA2  . GLY A 1 1  ? -7.523  -26.715 -15.278 1.00 0.00 ? 1   GLY A HA2  15 
ATOM   9037  H  HA3  . GLY A 1 1  ? -6.026  -27.162 -14.473 1.00 0.00 ? 1   GLY A HA3  15 
ATOM   9038  N  N    . SER A 1 2  ? -5.256  -24.821 -14.486 1.00 0.00 ? 2   SER A N    15 
ATOM   9039  C  CA   . SER A 1 2  ? -4.723  -23.463 -14.500 1.00 0.00 ? 2   SER A CA   15 
ATOM   9040  C  C    . SER A 1 2  ? -5.682  -22.511 -15.207 1.00 0.00 ? 2   SER A C    15 
ATOM   9041  O  O    . SER A 1 2  ? -5.262  -21.654 -15.986 1.00 0.00 ? 2   SER A O    15 
ATOM   9042  C  CB   . SER A 1 2  ? -3.357  -23.436 -15.190 1.00 0.00 ? 2   SER A CB   15 
ATOM   9043  O  OG   . SER A 1 2  ? -3.477  -23.741 -16.569 1.00 0.00 ? 2   SER A OG   15 
ATOM   9044  H  H    . SER A 1 2  ? -5.105  -25.386 -13.700 1.00 0.00 ? 2   SER A H    15 
ATOM   9045  H  HA   . SER A 1 2  ? -4.606  -23.143 -13.476 1.00 0.00 ? 2   SER A HA   15 
ATOM   9046  H  HB2  . SER A 1 2  ? -2.925  -22.452 -15.088 1.00 0.00 ? 2   SER A HB2  15 
ATOM   9047  H  HB3  . SER A 1 2  ? -2.709  -24.165 -14.727 1.00 0.00 ? 2   SER A HB3  15 
ATOM   9048  H  HG   . SER A 1 2  ? -2.627  -23.619 -16.999 1.00 0.00 ? 2   SER A HG   15 
ATOM   9049  N  N    . SER A 1 3  ? -6.972  -22.667 -14.931 1.00 0.00 ? 3   SER A N    15 
ATOM   9050  C  CA   . SER A 1 3  ? -7.993  -21.823 -15.542 1.00 0.00 ? 3   SER A CA   15 
ATOM   9051  C  C    . SER A 1 3  ? -9.172  -21.624 -14.595 1.00 0.00 ? 3   SER A C    15 
ATOM   9052  O  O    . SER A 1 3  ? -9.870  -22.575 -14.245 1.00 0.00 ? 3   SER A O    15 
ATOM   9053  C  CB   . SER A 1 3  ? -8.477  -22.443 -16.854 1.00 0.00 ? 3   SER A CB   15 
ATOM   9054  O  OG   . SER A 1 3  ? -9.137  -21.482 -17.660 1.00 0.00 ? 3   SER A OG   15 
ATOM   9055  H  H    . SER A 1 3  ? -7.245  -23.367 -14.302 1.00 0.00 ? 3   SER A H    15 
ATOM   9056  H  HA   . SER A 1 3  ? -7.547  -20.862 -15.751 1.00 0.00 ? 3   SER A HA   15 
ATOM   9057  H  HB2  . SER A 1 3  ? -7.631  -22.832 -17.400 1.00 0.00 ? 3   SER A HB2  15 
ATOM   9058  H  HB3  . SER A 1 3  ? -9.166  -23.247 -16.637 1.00 0.00 ? 3   SER A HB3  15 
ATOM   9059  H  HG   . SER A 1 3  ? -8.586  -21.264 -18.415 1.00 0.00 ? 3   SER A HG   15 
ATOM   9060  N  N    . GLY A 1 4  ? -9.388  -20.378 -14.183 1.00 0.00 ? 4   GLY A N    15 
ATOM   9061  C  CA   . GLY A 1 4  ? -10.483 -20.074 -13.280 1.00 0.00 ? 4   GLY A CA   15 
ATOM   9062  C  C    . GLY A 1 4  ? -10.426 -18.653 -12.757 1.00 0.00 ? 4   GLY A C    15 
ATOM   9063  O  O    . GLY A 1 4  ? -9.520  -17.893 -13.101 1.00 0.00 ? 4   GLY A O    15 
ATOM   9064  H  H    . GLY A 1 4  ? -8.799  -19.659 -14.495 1.00 0.00 ? 4   GLY A H    15 
ATOM   9065  H  HA2  . GLY A 1 4  ? -11.417 -20.217 -13.803 1.00 0.00 ? 4   GLY A HA2  15 
ATOM   9066  H  HA3  . GLY A 1 4  ? -10.443 -20.755 -12.443 1.00 0.00 ? 4   GLY A HA3  15 
ATOM   9067  N  N    . SER A 1 5  ? -11.396 -18.291 -11.924 1.00 0.00 ? 5   SER A N    15 
ATOM   9068  C  CA   . SER A 1 5  ? -11.456 -16.949 -11.357 1.00 0.00 ? 5   SER A CA   15 
ATOM   9069  C  C    . SER A 1 5  ? -11.215 -16.985 -9.850  1.00 0.00 ? 5   SER A C    15 
ATOM   9070  O  O    . SER A 1 5  ? -12.158 -16.962 -9.059  1.00 0.00 ? 5   SER A O    15 
ATOM   9071  C  CB   . SER A 1 5  ? -12.812 -16.307 -11.653 1.00 0.00 ? 5   SER A CB   15 
ATOM   9072  O  OG   . SER A 1 5  ? -13.097 -16.334 -13.040 1.00 0.00 ? 5   SER A OG   15 
ATOM   9073  H  H    . SER A 1 5  ? -12.090 -18.942 -11.687 1.00 0.00 ? 5   SER A H    15 
ATOM   9074  H  HA   . SER A 1 5  ? -10.679 -16.359 -11.819 1.00 0.00 ? 5   SER A HA   15 
ATOM   9075  H  HB2  . SER A 1 5  ? -13.585 -16.847 -11.128 1.00 0.00 ? 5   SER A HB2  15 
ATOM   9076  H  HB3  . SER A 1 5  ? -12.801 -15.279 -11.319 1.00 0.00 ? 5   SER A HB3  15 
ATOM   9077  H  HG   . SER A 1 5  ? -13.425 -15.476 -13.317 1.00 0.00 ? 5   SER A HG   15 
ATOM   9078  N  N    . SER A 1 6  ? -9.945  -17.042 -9.462  1.00 0.00 ? 6   SER A N    15 
ATOM   9079  C  CA   . SER A 1 6  ? -9.579  -17.085 -8.051  1.00 0.00 ? 6   SER A CA   15 
ATOM   9080  C  C    . SER A 1 6  ? -8.067  -16.980 -7.878  1.00 0.00 ? 6   SER A C    15 
ATOM   9081  O  O    . SER A 1 6  ? -7.311  -17.101 -8.841  1.00 0.00 ? 6   SER A O    15 
ATOM   9082  C  CB   . SER A 1 6  ? -10.088 -18.377 -7.409  1.00 0.00 ? 6   SER A CB   15 
ATOM   9083  O  OG   . SER A 1 6  ? -9.695  -19.510 -8.164  1.00 0.00 ? 6   SER A OG   15 
ATOM   9084  H  H    . SER A 1 6  ? -9.238  -17.058 -10.140 1.00 0.00 ? 6   SER A H    15 
ATOM   9085  H  HA   . SER A 1 6  ? -10.045 -16.242 -7.561  1.00 0.00 ? 6   SER A HA   15 
ATOM   9086  H  HB2  . SER A 1 6  ? -9.683  -18.465 -6.413  1.00 0.00 ? 6   SER A HB2  15 
ATOM   9087  H  HB3  . SER A 1 6  ? -11.167 -18.350 -7.358  1.00 0.00 ? 6   SER A HB3  15 
ATOM   9088  H  HG   . SER A 1 6  ? -8.906  -19.301 -8.668  1.00 0.00 ? 6   SER A HG   15 
ATOM   9089  N  N    . GLY A 1 7  ? -7.633  -16.752 -6.642  1.00 0.00 ? 7   GLY A N    15 
ATOM   9090  C  CA   . GLY A 1 7  ? -6.213  -16.634 -6.365  1.00 0.00 ? 7   GLY A CA   15 
ATOM   9091  C  C    . GLY A 1 7  ? -5.937  -16.118 -4.966  1.00 0.00 ? 7   GLY A C    15 
ATOM   9092  O  O    . GLY A 1 7  ? -5.347  -16.819 -4.143  1.00 0.00 ? 7   GLY A O    15 
ATOM   9093  H  H    . GLY A 1 7  ? -8.282  -16.664 -5.913  1.00 0.00 ? 7   GLY A H    15 
ATOM   9094  H  HA2  . GLY A 1 7  ? -5.753  -17.604 -6.477  1.00 0.00 ? 7   GLY A HA2  15 
ATOM   9095  H  HA3  . GLY A 1 7  ? -5.774  -15.953 -7.080  1.00 0.00 ? 7   GLY A HA3  15 
ATOM   9096  N  N    . THR A 1 8  ? -6.362  -14.888 -4.696  1.00 0.00 ? 8   THR A N    15 
ATOM   9097  C  CA   . THR A 1 8  ? -6.155  -14.277 -3.389  1.00 0.00 ? 8   THR A CA   15 
ATOM   9098  C  C    . THR A 1 8  ? -6.862  -12.931 -3.292  1.00 0.00 ? 8   THR A C    15 
ATOM   9099  O  O    . THR A 1 8  ? -6.852  -12.144 -4.238  1.00 0.00 ? 8   THR A O    15 
ATOM   9100  C  CB   . THR A 1 8  ? -4.656  -14.079 -3.093  1.00 0.00 ? 8   THR A CB   15 
ATOM   9101  O  OG1  . THR A 1 8  ? -4.487  -13.470 -1.808  1.00 0.00 ? 8   THR A OG1  15 
ATOM   9102  C  CG2  . THR A 1 8  ? -4.003  -13.215 -4.160  1.00 0.00 ? 8   THR A CG2  15 
ATOM   9103  H  H    . THR A 1 8  ? -6.825  -14.379 -5.394  1.00 0.00 ? 8   THR A H    15 
ATOM   9104  H  HA   . THR A 1 8  ? -6.563  -14.942 -2.642  1.00 0.00 ? 8   THR A HA   15 
ATOM   9105  H  HB   . THR A 1 8  ? -4.174  -15.047 -3.090  1.00 0.00 ? 8   THR A HB   15 
ATOM   9106  H  HG1  . THR A 1 8  ? -5.118  -12.752 -1.709  1.00 0.00 ? 8   THR A HG1  15 
ATOM   9107  H  HG21 . THR A 1 8  ? -3.220  -13.775 -4.648  1.00 0.00 ? 8   THR A HG21 15 
ATOM   9108  H  HG22 . THR A 1 8  ? -3.581  -12.333 -3.701  1.00 0.00 ? 8   THR A HG22 15 
ATOM   9109  H  HG23 . THR A 1 8  ? -4.744  -12.922 -4.889  1.00 0.00 ? 8   THR A HG23 15 
ATOM   9110  N  N    . GLY A 1 9  ? -7.476  -12.671 -2.142  1.00 0.00 ? 9   GLY A N    15 
ATOM   9111  C  CA   . GLY A 1 9  ? -8.180  -11.417 -1.943  1.00 0.00 ? 9   GLY A CA   15 
ATOM   9112  C  C    . GLY A 1 9  ? -8.858  -11.342 -0.590  1.00 0.00 ? 9   GLY A C    15 
ATOM   9113  O  O    . GLY A 1 9  ? -10.083 -11.257 -0.507  1.00 0.00 ? 9   GLY A O    15 
ATOM   9114  H  H    . GLY A 1 9  ? -7.451  -13.336 -1.422  1.00 0.00 ? 9   GLY A H    15 
ATOM   9115  H  HA2  . GLY A 1 9  ? -7.475  -10.604 -2.027  1.00 0.00 ? 9   GLY A HA2  15 
ATOM   9116  H  HA3  . GLY A 1 9  ? -8.929  -11.312 -2.714  1.00 0.00 ? 9   GLY A HA3  15 
ATOM   9117  N  N    . GLU A 1 10 ? -8.060  -11.373 0.473   1.00 0.00 ? 10  GLU A N    15 
ATOM   9118  C  CA   . GLU A 1 10 ? -8.592  -11.310 1.829   1.00 0.00 ? 10  GLU A CA   15 
ATOM   9119  C  C    . GLU A 1 10 ? -8.148  -10.028 2.529   1.00 0.00 ? 10  GLU A C    15 
ATOM   9120  O  O    . GLU A 1 10 ? -7.883  -10.025 3.730   1.00 0.00 ? 10  GLU A O    15 
ATOM   9121  C  CB   . GLU A 1 10 ? -8.138  -12.528 2.636   1.00 0.00 ? 10  GLU A CB   15 
ATOM   9122  C  CG   . GLU A 1 10 ? -6.629  -12.686 2.703   1.00 0.00 ? 10  GLU A CG   15 
ATOM   9123  C  CD   . GLU A 1 10 ? -6.205  -13.942 3.439   1.00 0.00 ? 10  GLU A CD   15 
ATOM   9124  O  OE1  . GLU A 1 10 ? -6.686  -15.035 3.072   1.00 0.00 ? 10  GLU A OE1  15 
ATOM   9125  O  OE2  . GLU A 1 10 ? -5.394  -13.832 4.382   1.00 0.00 ? 10  GLU A OE2  15 
ATOM   9126  H  H    . GLU A 1 10 ? -7.091  -11.442 0.342   1.00 0.00 ? 10  GLU A H    15 
ATOM   9127  H  HA   . GLU A 1 10 ? -9.670  -11.315 1.763   1.00 0.00 ? 10  GLU A HA   15 
ATOM   9128  H  HB2  . GLU A 1 10 ? -8.515  -12.438 3.645   1.00 0.00 ? 10  GLU A HB2  15 
ATOM   9129  H  HB3  . GLU A 1 10 ? -8.553  -13.418 2.186   1.00 0.00 ? 10  GLU A HB3  15 
ATOM   9130  H  HG2  . GLU A 1 10 ? -6.239  -12.729 1.696   1.00 0.00 ? 10  GLU A HG2  15 
ATOM   9131  H  HG3  . GLU A 1 10 ? -6.212  -11.830 3.212   1.00 0.00 ? 10  GLU A HG3  15 
ATOM   9132  N  N    . ASN A 1 11 ? -8.070  -8.942  1.767   1.00 0.00 ? 11  ASN A N    15 
ATOM   9133  C  CA   . ASN A 1 11 ? -7.658  -7.654  2.312   1.00 0.00 ? 11  ASN A CA   15 
ATOM   9134  C  C    . ASN A 1 11 ? -8.093  -6.512  1.399   1.00 0.00 ? 11  ASN A C    15 
ATOM   9135  O  O    . ASN A 1 11 ? -8.016  -6.600  0.173   1.00 0.00 ? 11  ASN A O    15 
ATOM   9136  C  CB   . ASN A 1 11 ? -6.140  -7.620  2.502   1.00 0.00 ? 11  ASN A CB   15 
ATOM   9137  C  CG   . ASN A 1 11 ? -5.394  -8.154  1.295   1.00 0.00 ? 11  ASN A CG   15 
ATOM   9138  O  OD1  . ASN A 1 11 ? -5.948  -8.245  0.199   1.00 0.00 ? 11  ASN A OD1  15 
ATOM   9139  N  ND2  . ASN A 1 11 ? -4.130  -8.511  1.491   1.00 0.00 ? 11  ASN A ND2  15 
ATOM   9140  H  H    . ASN A 1 11 ? -8.295  -9.008  0.815   1.00 0.00 ? 11  ASN A H    15 
ATOM   9141  H  HA   . ASN A 1 11 ? -8.135  -7.533  3.273   1.00 0.00 ? 11  ASN A HA   15 
ATOM   9142  H  HB2  . ASN A 1 11 ? -5.827  -6.600  2.672   1.00 0.00 ? 11  ASN A HB2  15 
ATOM   9143  H  HB3  . ASN A 1 11 ? -5.876  -8.220  3.360   1.00 0.00 ? 11  ASN A HB3  15 
ATOM   9144  H  HD21 . ASN A 1 11 ? -3.755  -8.412  2.391   1.00 0.00 ? 11  ASN A HD21 15 
ATOM   9145  H  HD22 . ASN A 1 11 ? -3.624  -8.859  0.727   1.00 0.00 ? 11  ASN A HD22 15 
ATOM   9146  N  N    . PRO A 1 12 ? -8.561  -5.413  2.008   1.00 0.00 ? 12  PRO A N    15 
ATOM   9147  C  CA   . PRO A 1 12 ? -9.016  -4.231  1.270   1.00 0.00 ? 12  PRO A CA   15 
ATOM   9148  C  C    . PRO A 1 12 ? -7.866  -3.489  0.598   1.00 0.00 ? 12  PRO A C    15 
ATOM   9149  O  O    . PRO A 1 12 ? -7.917  -3.195  -0.597  1.00 0.00 ? 12  PRO A O    15 
ATOM   9150  C  CB   . PRO A 1 12 ? -9.655  -3.360  2.354   1.00 0.00 ? 12  PRO A CB   15 
ATOM   9151  C  CG   . PRO A 1 12 ? -8.983  -3.773  3.617   1.00 0.00 ? 12  PRO A CG   15 
ATOM   9152  C  CD   . PRO A 1 12 ? -8.681  -5.238  3.466   1.00 0.00 ? 12  PRO A CD   15 
ATOM   9153  H  HA   . PRO A 1 12 ? -9.759  -4.489  0.528   1.00 0.00 ? 12  PRO A HA   15 
ATOM   9154  H  HB2  . PRO A 1 12 ? -9.476  -2.317  2.133   1.00 0.00 ? 12  PRO A HB2  15 
ATOM   9155  H  HB3  . PRO A 1 12 ? -10.718 -3.548  2.393   1.00 0.00 ? 12  PRO A HB3  15 
ATOM   9156  H  HG2  . PRO A 1 12 ? -8.069  -3.213  3.747   1.00 0.00 ? 12  PRO A HG2  15 
ATOM   9157  H  HG3  . PRO A 1 12 ? -9.645  -3.612  4.455   1.00 0.00 ? 12  PRO A HG3  15 
ATOM   9158  H  HD2  . PRO A 1 12 ? -7.754  -5.486  3.961   1.00 0.00 ? 12  PRO A HD2  15 
ATOM   9159  H  HD3  . PRO A 1 12 ? -9.492  -5.833  3.859   1.00 0.00 ? 12  PRO A HD3  15 
ATOM   9160  N  N    . PHE A 1 13 ? -6.830  -3.187  1.373   1.00 0.00 ? 13  PHE A N    15 
ATOM   9161  C  CA   . PHE A 1 13 ? -5.667  -2.477  0.853   1.00 0.00 ? 13  PHE A CA   15 
ATOM   9162  C  C    . PHE A 1 13 ? -4.396  -2.912  1.577   1.00 0.00 ? 13  PHE A C    15 
ATOM   9163  O  O    . PHE A 1 13 ? -4.419  -3.202  2.773   1.00 0.00 ? 13  PHE A O    15 
ATOM   9164  C  CB   . PHE A 1 13 ? -5.858  -0.966  0.998   1.00 0.00 ? 13  PHE A CB   15 
ATOM   9165  C  CG   . PHE A 1 13 ? -6.933  -0.410  0.108   1.00 0.00 ? 13  PHE A CG   15 
ATOM   9166  C  CD1  . PHE A 1 13 ? -6.641  -0.012  -1.187  1.00 0.00 ? 13  PHE A CD1  15 
ATOM   9167  C  CD2  . PHE A 1 13 ? -8.234  -0.286  0.566   1.00 0.00 ? 13  PHE A CD2  15 
ATOM   9168  C  CE1  . PHE A 1 13 ? -7.628  0.501   -2.008  1.00 0.00 ? 13  PHE A CE1  15 
ATOM   9169  C  CE2  . PHE A 1 13 ? -9.226  0.226   -0.251  1.00 0.00 ? 13  PHE A CE2  15 
ATOM   9170  C  CZ   . PHE A 1 13 ? -8.922  0.619   -1.539  1.00 0.00 ? 13  PHE A CZ   15 
ATOM   9171  H  H    . PHE A 1 13 ? -6.848  -3.447  2.318   1.00 0.00 ? 13  PHE A H    15 
ATOM   9172  H  HA   . PHE A 1 13 ? -5.572  -2.721  -0.194  1.00 0.00 ? 13  PHE A HA   15 
ATOM   9173  H  HB2  . PHE A 1 13 ? -6.124  -0.740  2.019   1.00 0.00 ? 13  PHE A HB2  15 
ATOM   9174  H  HB3  . PHE A 1 13 ? -4.932  -0.469  0.753   1.00 0.00 ? 13  PHE A HB3  15 
ATOM   9175  H  HD1  . PHE A 1 13 ? -5.630  -0.105  -1.555  1.00 0.00 ? 13  PHE A HD1  15 
ATOM   9176  H  HD2  . PHE A 1 13 ? -8.473  -0.593  1.574   1.00 0.00 ? 13  PHE A HD2  15 
ATOM   9177  H  HE1  . PHE A 1 13 ? -7.388  0.807   -3.015  1.00 0.00 ? 13  PHE A HE1  15 
ATOM   9178  H  HE2  . PHE A 1 13 ? -10.236 0.317   0.119   1.00 0.00 ? 13  PHE A HE2  15 
ATOM   9179  H  HZ   . PHE A 1 13 ? -9.694  1.020   -2.179  1.00 0.00 ? 13  PHE A HZ   15 
ATOM   9180  N  N    . ILE A 1 14 ? -3.290  -2.955  0.842   1.00 0.00 ? 14  ILE A N    15 
ATOM   9181  C  CA   . ILE A 1 14 ? -2.009  -3.354  1.413   1.00 0.00 ? 14  ILE A CA   15 
ATOM   9182  C  C    . ILE A 1 14 ? -0.894  -2.412  0.973   1.00 0.00 ? 14  ILE A C    15 
ATOM   9183  O  O    . ILE A 1 14 ? -0.898  -1.910  -0.151  1.00 0.00 ? 14  ILE A O    15 
ATOM   9184  C  CB   . ILE A 1 14 ? -1.638  -4.794  1.013   1.00 0.00 ? 14  ILE A CB   15 
ATOM   9185  C  CG1  . ILE A 1 14 ? -2.624  -5.788  1.629   1.00 0.00 ? 14  ILE A CG1  15 
ATOM   9186  C  CG2  . ILE A 1 14 ? -0.215  -5.114  1.445   1.00 0.00 ? 14  ILE A CG2  15 
ATOM   9187  C  CD1  . ILE A 1 14 ? -2.633  -5.772  3.142   1.00 0.00 ? 14  ILE A CD1  15 
ATOM   9188  H  H    . ILE A 1 14 ? -3.335  -2.712  -0.106  1.00 0.00 ? 14  ILE A H    15 
ATOM   9189  H  HA   . ILE A 1 14 ? -2.097  -3.312  2.489   1.00 0.00 ? 14  ILE A HA   15 
ATOM   9190  H  HB   . ILE A 1 14 ? -1.687  -4.869  -0.063  1.00 0.00 ? 14  ILE A HB   15 
ATOM   9191  H  HG12 . ILE A 1 14 ? -3.621  -5.554  1.290   1.00 0.00 ? 14  ILE A HG12 15 
ATOM   9192  H  HG13 . ILE A 1 14 ? -2.365  -6.787  1.309   1.00 0.00 ? 14  ILE A HG13 15 
ATOM   9193  H  HG21 . ILE A 1 14 ? -0.172  -6.126  1.821   1.00 0.00 ? 14  ILE A HG21 15 
ATOM   9194  H  HG22 . ILE A 1 14 ? 0.448   -5.016  0.599   1.00 0.00 ? 14  ILE A HG22 15 
ATOM   9195  H  HG23 . ILE A 1 14 ? 0.088   -4.428  2.222   1.00 0.00 ? 14  ILE A HG23 15 
ATOM   9196  H  HD11 . ILE A 1 14 ? -1.635  -5.965  3.509   1.00 0.00 ? 14  ILE A HD11 15 
ATOM   9197  H  HD12 . ILE A 1 14 ? -2.962  -4.804  3.490   1.00 0.00 ? 14  ILE A HD12 15 
ATOM   9198  H  HD13 . ILE A 1 14 ? -3.304  -6.535  3.507   1.00 0.00 ? 14  ILE A HD13 15 
ATOM   9199  N  N    . CYS A 1 15 ? 0.063   -2.178  1.865   1.00 0.00 ? 15  CYS A N    15 
ATOM   9200  C  CA   . CYS A 1 15 ? 1.187   -1.298  1.569   1.00 0.00 ? 15  CYS A CA   15 
ATOM   9201  C  C    . CYS A 1 15 ? 2.280   -2.048  0.813   1.00 0.00 ? 15  CYS A C    15 
ATOM   9202  O  O    . CYS A 1 15 ? 2.796   -3.060  1.288   1.00 0.00 ? 15  CYS A O    15 
ATOM   9203  C  CB   . CYS A 1 15 ? 1.756   -0.712  2.862   1.00 0.00 ? 15  CYS A CB   15 
ATOM   9204  S  SG   . CYS A 1 15 ? 2.788   0.770   2.616   1.00 0.00 ? 15  CYS A SG   15 
ATOM   9205  H  H    . CYS A 1 15 ? 0.011   -2.608  2.745   1.00 0.00 ? 15  CYS A H    15 
ATOM   9206  H  HA   . CYS A 1 15 ? 0.824   -0.494  0.948   1.00 0.00 ? 15  CYS A HA   15 
ATOM   9207  H  HB2  . CYS A 1 15 ? 0.939   -0.437  3.514   1.00 0.00 ? 15  CYS A HB2  15 
ATOM   9208  H  HB3  . CYS A 1 15 ? 2.364   -1.459  3.351   1.00 0.00 ? 15  CYS A HB3  15 
ATOM   9209  N  N    . SER A 1 16 ? 2.629   -1.543  -0.366  1.00 0.00 ? 16  SER A N    15 
ATOM   9210  C  CA   . SER A 1 16 ? 3.659   -2.166  -1.189  1.00 0.00 ? 16  SER A CA   15 
ATOM   9211  C  C    . SER A 1 16 ? 5.048   -1.697  -0.769  1.00 0.00 ? 16  SER A C    15 
ATOM   9212  O  O    . SER A 1 16 ? 5.974   -1.664  -1.579  1.00 0.00 ? 16  SER A O    15 
ATOM   9213  C  CB   . SER A 1 16 ? 3.424   -1.844  -2.666  1.00 0.00 ? 16  SER A CB   15 
ATOM   9214  O  OG   . SER A 1 16 ? 2.331   -2.584  -3.183  1.00 0.00 ? 16  SER A OG   15 
ATOM   9215  H  H    . SER A 1 16 ? 2.182   -0.734  -0.690  1.00 0.00 ? 16  SER A H    15 
ATOM   9216  H  HA   . SER A 1 16 ? 3.594   -3.235  -1.048  1.00 0.00 ? 16  SER A HA   15 
ATOM   9217  H  HB2  . SER A 1 16 ? 3.213   -0.791  -2.773  1.00 0.00 ? 16  SER A HB2  15 
ATOM   9218  H  HB3  . SER A 1 16 ? 4.311   -2.093  -3.231  1.00 0.00 ? 16  SER A HB3  15 
ATOM   9219  H  HG   . SER A 1 16 ? 2.086   -2.235  -4.043  1.00 0.00 ? 16  SER A HG   15 
ATOM   9220  N  N    . GLU A 1 17 ? 5.184   -1.336  0.503   1.00 0.00 ? 17  GLU A N    15 
ATOM   9221  C  CA   . GLU A 1 17 ? 6.461   -0.868  1.031   1.00 0.00 ? 17  GLU A CA   15 
ATOM   9222  C  C    . GLU A 1 17 ? 6.866   -1.670  2.264   1.00 0.00 ? 17  GLU A C    15 
ATOM   9223  O  O    . GLU A 1 17 ? 8.012   -2.104  2.387   1.00 0.00 ? 17  GLU A O    15 
ATOM   9224  C  CB   . GLU A 1 17 ? 6.378   0.620   1.381   1.00 0.00 ? 17  GLU A CB   15 
ATOM   9225  C  CG   . GLU A 1 17 ? 6.246   1.524   0.167   1.00 0.00 ? 17  GLU A CG   15 
ATOM   9226  C  CD   . GLU A 1 17 ? 7.581   1.816   -0.491  1.00 0.00 ? 17  GLU A CD   15 
ATOM   9227  O  OE1  . GLU A 1 17 ? 8.432   0.903   -0.535  1.00 0.00 ? 17  GLU A OE1  15 
ATOM   9228  O  OE2  . GLU A 1 17 ? 7.774   2.956   -0.962  1.00 0.00 ? 17  GLU A OE2  15 
ATOM   9229  H  H    . GLU A 1 17 ? 4.409   -1.384  1.100   1.00 0.00 ? 17  GLU A H    15 
ATOM   9230  H  HA   . GLU A 1 17 ? 7.208   -1.007  0.264   1.00 0.00 ? 17  GLU A HA   15 
ATOM   9231  H  HB2  . GLU A 1 17 ? 5.522   0.780   2.019   1.00 0.00 ? 17  GLU A HB2  15 
ATOM   9232  H  HB3  . GLU A 1 17 ? 7.273   0.901   1.916   1.00 0.00 ? 17  GLU A HB3  15 
ATOM   9233  H  HG2  . GLU A 1 17 ? 5.603   1.044   -0.556  1.00 0.00 ? 17  GLU A HG2  15 
ATOM   9234  H  HG3  . GLU A 1 17 ? 5.802   2.458   0.477   1.00 0.00 ? 17  GLU A HG3  15 
ATOM   9235  N  N    . CYS A 1 18 ? 5.919   -1.861  3.176   1.00 0.00 ? 18  CYS A N    15 
ATOM   9236  C  CA   . CYS A 1 18 ? 6.175   -2.610  4.401   1.00 0.00 ? 18  CYS A CA   15 
ATOM   9237  C  C    . CYS A 1 18 ? 5.316   -3.869  4.459   1.00 0.00 ? 18  CYS A C    15 
ATOM   9238  O  O    . CYS A 1 18 ? 5.814   -4.962  4.726   1.00 0.00 ? 18  CYS A O    15 
ATOM   9239  C  CB   . CYS A 1 18 ? 5.901   -1.734  5.625   1.00 0.00 ? 18  CYS A CB   15 
ATOM   9240  S  SG   . CYS A 1 18 ? 4.247   -0.970  5.636   1.00 0.00 ? 18  CYS A SG   15 
ATOM   9241  H  H    . CYS A 1 18 ? 5.024   -1.490  3.022   1.00 0.00 ? 18  CYS A H    15 
ATOM   9242  H  HA   . CYS A 1 18 ? 7.215   -2.898  4.401   1.00 0.00 ? 18  CYS A HA   15 
ATOM   9243  H  HB2  . CYS A 1 18 ? 5.988   -2.338  6.516   1.00 0.00 ? 18  CYS A HB2  15 
ATOM   9244  H  HB3  . CYS A 1 18 ? 6.631   -0.940  5.661   1.00 0.00 ? 18  CYS A HB3  15 
ATOM   9245  N  N    . GLY A 1 19 ? 4.021   -3.707  4.206   1.00 0.00 ? 19  GLY A N    15 
ATOM   9246  C  CA   . GLY A 1 19 ? 3.112   -4.839  4.234   1.00 0.00 ? 19  GLY A CA   15 
ATOM   9247  C  C    . GLY A 1 19 ? 2.007   -4.670  5.258   1.00 0.00 ? 19  GLY A C    15 
ATOM   9248  O  O    . GLY A 1 19 ? 1.658   -5.614  5.967   1.00 0.00 ? 19  GLY A O    15 
ATOM   9249  H  H    . GLY A 1 19 ? 3.679   -2.812  3.998   1.00 0.00 ? 19  GLY A H    15 
ATOM   9250  H  HA2  . GLY A 1 19 ? 2.668   -4.955  3.257   1.00 0.00 ? 19  GLY A HA2  15 
ATOM   9251  H  HA3  . GLY A 1 19 ? 3.674   -5.731  4.472   1.00 0.00 ? 19  GLY A HA3  15 
ATOM   9252  N  N    . LYS A 1 20 ? 1.456   -3.463  5.338   1.00 0.00 ? 20  LYS A N    15 
ATOM   9253  C  CA   . LYS A 1 20 ? 0.385   -3.172  6.283   1.00 0.00 ? 20  LYS A CA   15 
ATOM   9254  C  C    . LYS A 1 20 ? -0.947  -3.000  5.559   1.00 0.00 ? 20  LYS A C    15 
ATOM   9255  O  O    . LYS A 1 20 ? -0.985  -2.598  4.396   1.00 0.00 ? 20  LYS A O    15 
ATOM   9256  C  CB   . LYS A 1 20 ? 0.711   -1.908  7.082   1.00 0.00 ? 20  LYS A CB   15 
ATOM   9257  C  CG   . LYS A 1 20 ? -0.271  -1.629  8.207   1.00 0.00 ? 20  LYS A CG   15 
ATOM   9258  C  CD   . LYS A 1 20 ? 0.305   -0.656  9.221   1.00 0.00 ? 20  LYS A CD   15 
ATOM   9259  C  CE   . LYS A 1 20 ? 1.306   -1.337  10.141  1.00 0.00 ? 20  LYS A CE   15 
ATOM   9260  N  NZ   . LYS A 1 20 ? 2.271   -0.365  10.728  1.00 0.00 ? 20  LYS A NZ   15 
ATOM   9261  H  H    . LYS A 1 20 ? 1.778   -2.751  4.746   1.00 0.00 ? 20  LYS A H    15 
ATOM   9262  H  HA   . LYS A 1 20 ? 0.306   -4.007  6.963   1.00 0.00 ? 20  LYS A HA   15 
ATOM   9263  H  HB2  . LYS A 1 20 ? 1.697   -2.011  7.509   1.00 0.00 ? 20  LYS A HB2  15 
ATOM   9264  H  HB3  . LYS A 1 20 ? 0.706   -1.061  6.410   1.00 0.00 ? 20  LYS A HB3  15 
ATOM   9265  H  HG2  . LYS A 1 20 ? -1.172  -1.206  7.789   1.00 0.00 ? 20  LYS A HG2  15 
ATOM   9266  H  HG3  . LYS A 1 20 ? -0.505  -2.559  8.706   1.00 0.00 ? 20  LYS A HG3  15 
ATOM   9267  H  HD2  . LYS A 1 20 ? 0.804   0.145   8.695   1.00 0.00 ? 20  LYS A HD2  15 
ATOM   9268  H  HD3  . LYS A 1 20 ? -0.501  -0.251  9.816   1.00 0.00 ? 20  LYS A HD3  15 
ATOM   9269  H  HE2  . LYS A 1 20 ? 0.768   -1.823  10.940  1.00 0.00 ? 20  LYS A HE2  15 
ATOM   9270  H  HE3  . LYS A 1 20 ? 1.853   -2.075  9.573   1.00 0.00 ? 20  LYS A HE3  15 
ATOM   9271  H  HZ1  . LYS A 1 20 ? 2.712   -0.769  11.579  1.00 0.00 ? 20  LYS A HZ1  15 
ATOM   9272  H  HZ2  . LYS A 1 20 ? 1.778   0.513   10.989  1.00 0.00 ? 20  LYS A HZ2  15 
ATOM   9273  H  HZ3  . LYS A 1 20 ? 3.015   -0.140  10.038  1.00 0.00 ? 20  LYS A HZ3  15 
ATOM   9274  N  N    . VAL A 1 21 ? -2.038  -3.304  6.255   1.00 0.00 ? 21  VAL A N    15 
ATOM   9275  C  CA   . VAL A 1 21 ? -3.371  -3.180  5.680   1.00 0.00 ? 21  VAL A CA   15 
ATOM   9276  C  C    . VAL A 1 21 ? -4.149  -2.044  6.334   1.00 0.00 ? 21  VAL A C    15 
ATOM   9277  O  O    . VAL A 1 21 ? -4.054  -1.827  7.542   1.00 0.00 ? 21  VAL A O    15 
ATOM   9278  C  CB   . VAL A 1 21 ? -4.171  -4.488  5.830   1.00 0.00 ? 21  VAL A CB   15 
ATOM   9279  C  CG1  . VAL A 1 21 ? -4.447  -4.780  7.297   1.00 0.00 ? 21  VAL A CG1  15 
ATOM   9280  C  CG2  . VAL A 1 21 ? -5.469  -4.412  5.040   1.00 0.00 ? 21  VAL A CG2  15 
ATOM   9281  H  H    . VAL A 1 21 ? -1.943  -3.619  7.178   1.00 0.00 ? 21  VAL A H    15 
ATOM   9282  H  HA   . VAL A 1 21 ? -3.262  -2.969  4.626   1.00 0.00 ? 21  VAL A HA   15 
ATOM   9283  H  HB   . VAL A 1 21 ? -3.578  -5.297  5.430   1.00 0.00 ? 21  VAL A HB   15 
ATOM   9284  H  HG11 . VAL A 1 21 ? -5.286  -4.188  7.630   1.00 0.00 ? 21  VAL A HG11 15 
ATOM   9285  H  HG12 . VAL A 1 21 ? -4.674  -5.829  7.419   1.00 0.00 ? 21  VAL A HG12 15 
ATOM   9286  H  HG13 . VAL A 1 21 ? -3.575  -4.530  7.883   1.00 0.00 ? 21  VAL A HG13 15 
ATOM   9287  H  HG21 . VAL A 1 21 ? -5.394  -5.037  4.163   1.00 0.00 ? 21  VAL A HG21 15 
ATOM   9288  H  HG22 . VAL A 1 21 ? -6.286  -4.753  5.658   1.00 0.00 ? 21  VAL A HG22 15 
ATOM   9289  H  HG23 . VAL A 1 21 ? -5.648  -3.390  4.738   1.00 0.00 ? 21  VAL A HG23 15 
ATOM   9290  N  N    . PHE A 1 22 ? -4.919  -1.320  5.528   1.00 0.00 ? 22  PHE A N    15 
ATOM   9291  C  CA   . PHE A 1 22 ? -5.714  -0.205  6.029   1.00 0.00 ? 22  PHE A CA   15 
ATOM   9292  C  C    . PHE A 1 22 ? -7.156  -0.301  5.538   1.00 0.00 ? 22  PHE A C    15 
ATOM   9293  O  O    . PHE A 1 22 ? -7.413  -0.719  4.409   1.00 0.00 ? 22  PHE A O    15 
ATOM   9294  C  CB   . PHE A 1 22 ? -5.100  1.125   5.586   1.00 0.00 ? 22  PHE A CB   15 
ATOM   9295  C  CG   . PHE A 1 22 ? -3.696  1.330   6.078   1.00 0.00 ? 22  PHE A CG   15 
ATOM   9296  C  CD1  . PHE A 1 22 ? -2.640  0.639   5.507   1.00 0.00 ? 22  PHE A CD1  15 
ATOM   9297  C  CD2  . PHE A 1 22 ? -3.432  2.215   7.111   1.00 0.00 ? 22  PHE A CD2  15 
ATOM   9298  C  CE1  . PHE A 1 22 ? -1.347  0.825   5.958   1.00 0.00 ? 22  PHE A CE1  15 
ATOM   9299  C  CE2  . PHE A 1 22 ? -2.141  2.406   7.567   1.00 0.00 ? 22  PHE A CE2  15 
ATOM   9300  C  CZ   . PHE A 1 22 ? -1.097  1.711   6.988   1.00 0.00 ? 22  PHE A CZ   15 
ATOM   9301  H  H    . PHE A 1 22 ? -4.953  -1.542  4.574   1.00 0.00 ? 22  PHE A H    15 
ATOM   9302  H  HA   . PHE A 1 22 ? -5.709  -0.253  7.107   1.00 0.00 ? 22  PHE A HA   15 
ATOM   9303  H  HB2  . PHE A 1 22 ? -5.082  1.164   4.508   1.00 0.00 ? 22  PHE A HB2  15 
ATOM   9304  H  HB3  . PHE A 1 22 ? -5.707  1.935   5.962   1.00 0.00 ? 22  PHE A HB3  15 
ATOM   9305  H  HD1  . PHE A 1 22 ? -2.833  -0.053  4.700   1.00 0.00 ? 22  PHE A HD1  15 
ATOM   9306  H  HD2  . PHE A 1 22 ? -4.248  2.759   7.565   1.00 0.00 ? 22  PHE A HD2  15 
ATOM   9307  H  HE1  . PHE A 1 22 ? -0.532  0.281   5.504   1.00 0.00 ? 22  PHE A HE1  15 
ATOM   9308  H  HE2  . PHE A 1 22 ? -1.949  3.099   8.372   1.00 0.00 ? 22  PHE A HE2  15 
ATOM   9309  H  HZ   . PHE A 1 22 ? -0.088  1.858   7.342   1.00 0.00 ? 22  PHE A HZ   15 
ATOM   9310  N  N    . THR A 1 23 ? -8.094  0.089   6.396   1.00 0.00 ? 23  THR A N    15 
ATOM   9311  C  CA   . THR A 1 23 ? -9.509  0.046   6.052   1.00 0.00 ? 23  THR A CA   15 
ATOM   9312  C  C    . THR A 1 23 ? -9.852  1.095   5.001   1.00 0.00 ? 23  THR A C    15 
ATOM   9313  O  O    . THR A 1 23 ? -10.546 0.807   4.025   1.00 0.00 ? 23  THR A O    15 
ATOM   9314  C  CB   . THR A 1 23 ? -10.395 0.269   7.292   1.00 0.00 ? 23  THR A CB   15 
ATOM   9315  O  OG1  . THR A 1 23 ? -9.984  -0.601  8.352   1.00 0.00 ? 23  THR A OG1  15 
ATOM   9316  C  CG2  . THR A 1 23 ? -11.859 0.019   6.963   1.00 0.00 ? 23  THR A CG2  15 
ATOM   9317  H  H    . THR A 1 23 ? -7.825  0.412   7.281   1.00 0.00 ? 23  THR A H    15 
ATOM   9318  H  HA   . THR A 1 23 ? -9.726  -0.935  5.653   1.00 0.00 ? 23  THR A HA   15 
ATOM   9319  H  HB   . THR A 1 23 ? -10.284 1.295   7.615   1.00 0.00 ? 23  THR A HB   15 
ATOM   9320  H  HG1  . THR A 1 23 ? -9.060  -0.834  8.235   1.00 0.00 ? 23  THR A HG1  15 
ATOM   9321  H  HG21 . THR A 1 23 ? -12.366 -0.357  7.839   1.00 0.00 ? 23  THR A HG21 15 
ATOM   9322  H  HG22 . THR A 1 23 ? -11.931 -0.707  6.167   1.00 0.00 ? 23  THR A HG22 15 
ATOM   9323  H  HG23 . THR A 1 23 ? -12.321 0.944   6.649   1.00 0.00 ? 23  THR A HG23 15 
ATOM   9324  N  N    . HIS A 1 24 ? -9.361  2.313   5.205   1.00 0.00 ? 24  HIS A N    15 
ATOM   9325  C  CA   . HIS A 1 24 ? -9.615  3.406   4.272   1.00 0.00 ? 24  HIS A CA   15 
ATOM   9326  C  C    . HIS A 1 24 ? -8.459  3.560   3.289   1.00 0.00 ? 24  HIS A C    15 
ATOM   9327  O  O    . HIS A 1 24 ? -7.293  3.405   3.655   1.00 0.00 ? 24  HIS A O    15 
ATOM   9328  C  CB   . HIS A 1 24 ? -9.831  4.714   5.034   1.00 0.00 ? 24  HIS A CB   15 
ATOM   9329  C  CG   . HIS A 1 24 ? -10.752 5.667   4.337   1.00 0.00 ? 24  HIS A CG   15 
ATOM   9330  N  ND1  . HIS A 1 24 ? -10.304 6.709   3.552   1.00 0.00 ? 24  HIS A ND1  15 
ATOM   9331  C  CD2  . HIS A 1 24 ? -12.104 5.731   4.309   1.00 0.00 ? 24  HIS A CD2  15 
ATOM   9332  C  CE1  . HIS A 1 24 ? -11.341 7.373   3.073   1.00 0.00 ? 24  HIS A CE1  15 
ATOM   9333  N  NE2  . HIS A 1 24 ? -12.445 6.800   3.517   1.00 0.00 ? 24  HIS A NE2  15 
ATOM   9334  H  H    . HIS A 1 24 ? -8.815  2.481   6.001   1.00 0.00 ? 24  HIS A H    15 
ATOM   9335  H  HA   . HIS A 1 24 ? -10.511 3.169   3.720   1.00 0.00 ? 24  HIS A HA   15 
ATOM   9336  H  HB2  . HIS A 1 24 ? -10.253 4.493   6.003   1.00 0.00 ? 24  HIS A HB2  15 
ATOM   9337  H  HB3  . HIS A 1 24 ? -8.879  5.208   5.165   1.00 0.00 ? 24  HIS A HB3  15 
ATOM   9338  H  HD1  . HIS A 1 24 ? -9.366  6.929   3.374   1.00 0.00 ? 24  HIS A HD1  15 
ATOM   9339  H  HD2  . HIS A 1 24 ? -12.788 5.066   4.816   1.00 0.00 ? 24  HIS A HD2  15 
ATOM   9340  H  HE1  . HIS A 1 24 ? -11.294 8.237   2.427   1.00 0.00 ? 24  HIS A HE1  15 
ATOM   9341  N  N    . LYS A 1 25 ? -8.788  3.866   2.039   1.00 0.00 ? 25  LYS A N    15 
ATOM   9342  C  CA   . LYS A 1 25 ? -7.779  4.042   1.002   1.00 0.00 ? 25  LYS A CA   15 
ATOM   9343  C  C    . LYS A 1 25 ? -6.820  5.173   1.362   1.00 0.00 ? 25  LYS A C    15 
ATOM   9344  O  O    . LYS A 1 25 ? -5.603  5.033   1.238   1.00 0.00 ? 25  LYS A O    15 
ATOM   9345  C  CB   . LYS A 1 25 ? -8.446  4.334   -0.344  1.00 0.00 ? 25  LYS A CB   15 
ATOM   9346  C  CG   . LYS A 1 25 ? -7.489  4.277   -1.522  1.00 0.00 ? 25  LYS A CG   15 
ATOM   9347  C  CD   . LYS A 1 25 ? -8.074  4.956   -2.749  1.00 0.00 ? 25  LYS A CD   15 
ATOM   9348  C  CE   . LYS A 1 25 ? -9.022  4.032   -3.498  1.00 0.00 ? 25  LYS A CE   15 
ATOM   9349  N  NZ   . LYS A 1 25 ? -10.408 4.101   -2.956  1.00 0.00 ? 25  LYS A NZ   15 
ATOM   9350  H  H    . LYS A 1 25 ? -9.735  3.977   1.808   1.00 0.00 ? 25  LYS A H    15 
ATOM   9351  H  HA   . LYS A 1 25 ? -7.219  3.123   0.924   1.00 0.00 ? 25  LYS A HA   15 
ATOM   9352  H  HB2  . LYS A 1 25 ? -9.230  3.610   -0.508  1.00 0.00 ? 25  LYS A HB2  15 
ATOM   9353  H  HB3  . LYS A 1 25 ? -8.882  5.322   -0.309  1.00 0.00 ? 25  LYS A HB3  15 
ATOM   9354  H  HG2  . LYS A 1 25 ? -6.570  4.776   -1.253  1.00 0.00 ? 25  LYS A HG2  15 
ATOM   9355  H  HG3  . LYS A 1 25 ? -7.284  3.242   -1.758  1.00 0.00 ? 25  LYS A HG3  15 
ATOM   9356  H  HD2  . LYS A 1 25 ? -8.618  5.836   -2.439  1.00 0.00 ? 25  LYS A HD2  15 
ATOM   9357  H  HD3  . LYS A 1 25 ? -7.268  5.243   -3.410  1.00 0.00 ? 25  LYS A HD3  15 
ATOM   9358  H  HE2  . LYS A 1 25 ? -9.037  4.319   -4.538  1.00 0.00 ? 25  LYS A HE2  15 
ATOM   9359  H  HE3  . LYS A 1 25 ? -8.660  3.018   -3.410  1.00 0.00 ? 25  LYS A HE3  15 
ATOM   9360  H  HZ1  . LYS A 1 25 ? -10.739 3.150   -2.699  1.00 0.00 ? 25  LYS A HZ1  15 
ATOM   9361  H  HZ2  . LYS A 1 25 ? -11.051 4.500   -3.670  1.00 0.00 ? 25  LYS A HZ2  15 
ATOM   9362  H  HZ3  . LYS A 1 25 ? -10.430 4.705   -2.110  1.00 0.00 ? 25  LYS A HZ3  15 
ATOM   9363  N  N    . THR A 1 26 ? -7.377  6.294   1.811   1.00 0.00 ? 26  THR A N    15 
ATOM   9364  C  CA   . THR A 1 26 ? -6.572  7.448   2.190   1.00 0.00 ? 26  THR A CA   15 
ATOM   9365  C  C    . THR A 1 26 ? -5.638  7.111   3.347   1.00 0.00 ? 26  THR A C    15 
ATOM   9366  O  O    . THR A 1 26 ? -4.473  7.507   3.353   1.00 0.00 ? 26  THR A O    15 
ATOM   9367  C  CB   . THR A 1 26 ? -7.457  8.643   2.591   1.00 0.00 ? 26  THR A CB   15 
ATOM   9368  O  OG1  . THR A 1 26 ? -8.302  9.015   1.496   1.00 0.00 ? 26  THR A OG1  15 
ATOM   9369  C  CG2  . THR A 1 26 ? -6.604  9.832   3.007   1.00 0.00 ? 26  THR A CG2  15 
ATOM   9370  H  H    . THR A 1 26 ? -8.352  6.344   1.888   1.00 0.00 ? 26  THR A H    15 
ATOM   9371  H  HA   . THR A 1 26 ? -5.979  7.737   1.334   1.00 0.00 ? 26  THR A HA   15 
ATOM   9372  H  HB   . THR A 1 26 ? -8.073  8.350   3.428   1.00 0.00 ? 26  THR A HB   15 
ATOM   9373  H  HG1  . THR A 1 26 ? -8.230  8.359   0.799   1.00 0.00 ? 26  THR A HG1  15 
ATOM   9374  H  HG21 . THR A 1 26 ? -6.929  10.187  3.974   1.00 0.00 ? 26  THR A HG21 15 
ATOM   9375  H  HG22 . THR A 1 26 ? -6.711  10.624  2.280   1.00 0.00 ? 26  THR A HG22 15 
ATOM   9376  H  HG23 . THR A 1 26 ? -5.569  9.531   3.063   1.00 0.00 ? 26  THR A HG23 15 
ATOM   9377  N  N    . ASN A 1 27 ? -6.157  6.377   4.326   1.00 0.00 ? 27  ASN A N    15 
ATOM   9378  C  CA   . ASN A 1 27 ? -5.369  5.987   5.489   1.00 0.00 ? 27  ASN A CA   15 
ATOM   9379  C  C    . ASN A 1 27 ? -4.040  5.369   5.064   1.00 0.00 ? 27  ASN A C    15 
ATOM   9380  O  O    . ASN A 1 27 ? -3.003  5.616   5.680   1.00 0.00 ? 27  ASN A O    15 
ATOM   9381  C  CB   . ASN A 1 27 ? -6.152  4.996   6.353   1.00 0.00 ? 27  ASN A CB   15 
ATOM   9382  C  CG   . ASN A 1 27 ? -7.140  5.686   7.274   1.00 0.00 ? 27  ASN A CG   15 
ATOM   9383  O  OD1  . ASN A 1 27 ? -7.282  6.909   7.245   1.00 0.00 ? 27  ASN A OD1  15 
ATOM   9384  N  ND2  . ASN A 1 27 ? -7.827  4.904   8.097   1.00 0.00 ? 27  ASN A ND2  15 
ATOM   9385  H  H    . ASN A 1 27 ? -7.093  6.091   4.265   1.00 0.00 ? 27  ASN A H    15 
ATOM   9386  H  HA   . ASN A 1 27 ? -5.170  6.876   6.068   1.00 0.00 ? 27  ASN A HA   15 
ATOM   9387  H  HB2  . ASN A 1 27 ? -6.699  4.322   5.710   1.00 0.00 ? 27  ASN A HB2  15 
ATOM   9388  H  HB3  . ASN A 1 27 ? -5.460  4.429   6.957   1.00 0.00 ? 27  ASN A HB3  15 
ATOM   9389  H  HD21 . ASN A 1 27 ? -7.661  3.938   8.065   1.00 0.00 ? 27  ASN A HD21 15 
ATOM   9390  H  HD22 . ASN A 1 27 ? -8.473  5.324   8.703   1.00 0.00 ? 27  ASN A HD22 15 
ATOM   9391  N  N    . LEU A 1 28 ? -4.080  4.565   4.007   1.00 0.00 ? 28  LEU A N    15 
ATOM   9392  C  CA   . LEU A 1 28 ? -2.879  3.912   3.497   1.00 0.00 ? 28  LEU A CA   15 
ATOM   9393  C  C    . LEU A 1 28 ? -1.965  4.916   2.804   1.00 0.00 ? 28  LEU A C    15 
ATOM   9394  O  O    . LEU A 1 28 ? -0.756  4.934   3.037   1.00 0.00 ? 28  LEU A O    15 
ATOM   9395  C  CB   . LEU A 1 28 ? -3.258  2.793   2.525   1.00 0.00 ? 28  LEU A CB   15 
ATOM   9396  C  CG   . LEU A 1 28 ? -2.129  2.264   1.639   1.00 0.00 ? 28  LEU A CG   15 
ATOM   9397  C  CD1  . LEU A 1 28 ? -1.250  1.296   2.416   1.00 0.00 ? 28  LEU A CD1  15 
ATOM   9398  C  CD2  . LEU A 1 28 ? -2.696  1.592   0.397   1.00 0.00 ? 28  LEU A CD2  15 
ATOM   9399  H  H    . LEU A 1 28 ? -4.936  4.407   3.558   1.00 0.00 ? 28  LEU A H    15 
ATOM   9400  H  HA   . LEU A 1 28 ? -2.353  3.484   4.338   1.00 0.00 ? 28  LEU A HA   15 
ATOM   9401  H  HB2  . LEU A 1 28 ? -3.639  1.966   3.104   1.00 0.00 ? 28  LEU A HB2  15 
ATOM   9402  H  HB3  . LEU A 1 28 ? -4.038  3.168   1.878   1.00 0.00 ? 28  LEU A HB3  15 
ATOM   9403  H  HG   . LEU A 1 28 ? -1.511  3.092   1.320   1.00 0.00 ? 28  LEU A HG   15 
ATOM   9404  H  HD11 . LEU A 1 28 ? -0.874  0.535   1.749   1.00 0.00 ? 28  LEU A HD11 15 
ATOM   9405  H  HD12 . LEU A 1 28 ? -1.831  0.832   3.200   1.00 0.00 ? 28  LEU A HD12 15 
ATOM   9406  H  HD13 . LEU A 1 28 ? -0.421  1.834   2.853   1.00 0.00 ? 28  LEU A HD13 15 
ATOM   9407  H  HD21 . LEU A 1 28 ? -1.897  1.115   -0.151  1.00 0.00 ? 28  LEU A HD21 15 
ATOM   9408  H  HD22 . LEU A 1 28 ? -3.169  2.334   -0.229  1.00 0.00 ? 28  LEU A HD22 15 
ATOM   9409  H  HD23 . LEU A 1 28 ? -3.426  0.851   0.690   1.00 0.00 ? 28  LEU A HD23 15 
ATOM   9410  N  N    . ILE A 1 29 ? -2.550  5.752   1.953   1.00 0.00 ? 29  ILE A N    15 
ATOM   9411  C  CA   . ILE A 1 29 ? -1.789  6.762   1.229   1.00 0.00 ? 29  ILE A CA   15 
ATOM   9412  C  C    . ILE A 1 29 ? -0.991  7.641   2.187   1.00 0.00 ? 29  ILE A C    15 
ATOM   9413  O  O    . ILE A 1 29 ? 0.193   7.899   1.969   1.00 0.00 ? 29  ILE A O    15 
ATOM   9414  C  CB   . ILE A 1 29 ? -2.707  7.655   0.375   1.00 0.00 ? 29  ILE A CB   15 
ATOM   9415  C  CG1  . ILE A 1 29 ? -3.487  6.807   -0.633  1.00 0.00 ? 29  ILE A CG1  15 
ATOM   9416  C  CG2  . ILE A 1 29 ? -1.892  8.722   -0.341  1.00 0.00 ? 29  ILE A CG2  15 
ATOM   9417  C  CD1  . ILE A 1 29 ? -4.761  7.462   -1.116  1.00 0.00 ? 29  ILE A CD1  15 
ATOM   9418  H  H    . ILE A 1 29 ? -3.517  5.689   1.810   1.00 0.00 ? 29  ILE A H    15 
ATOM   9419  H  HA   . ILE A 1 29 ? -1.102  6.251   0.570   1.00 0.00 ? 29  ILE A HA   15 
ATOM   9420  H  HB   . ILE A 1 29 ? -3.404  8.150   1.033   1.00 0.00 ? 29  ILE A HB   15 
ATOM   9421  H  HG12 . ILE A 1 29 ? -2.864  6.619   -1.493  1.00 0.00 ? 29  ILE A HG12 15 
ATOM   9422  H  HG13 . ILE A 1 29 ? -3.750  5.866   -0.172  1.00 0.00 ? 29  ILE A HG13 15 
ATOM   9423  H  HG21 . ILE A 1 29 ? -1.610  8.363   -1.320  1.00 0.00 ? 29  ILE A HG21 15 
ATOM   9424  H  HG22 . ILE A 1 29 ? -2.486  9.618   -0.444  1.00 0.00 ? 29  ILE A HG22 15 
ATOM   9425  H  HG23 . ILE A 1 29 ? -1.004  8.942   0.232   1.00 0.00 ? 29  ILE A HG23 15 
ATOM   9426  H  HD11 . ILE A 1 29 ? -5.595  6.795   -0.949  1.00 0.00 ? 29  ILE A HD11 15 
ATOM   9427  H  HD12 . ILE A 1 29 ? -4.923  8.381   -0.572  1.00 0.00 ? 29  ILE A HD12 15 
ATOM   9428  H  HD13 . ILE A 1 29 ? -4.679  7.677   -2.171  1.00 0.00 ? 29  ILE A HD13 15 
ATOM   9429  N  N    . ILE A 1 30 ? -1.648  8.097   3.248   1.00 0.00 ? 30  ILE A N    15 
ATOM   9430  C  CA   . ILE A 1 30 ? -0.999  8.944   4.241   1.00 0.00 ? 30  ILE A CA   15 
ATOM   9431  C  C    . ILE A 1 30 ? 0.122   8.196   4.954   1.00 0.00 ? 30  ILE A C    15 
ATOM   9432  O  O    . ILE A 1 30 ? 1.116   8.794   5.369   1.00 0.00 ? 30  ILE A O    15 
ATOM   9433  C  CB   . ILE A 1 30 ? -2.006  9.457   5.288   1.00 0.00 ? 30  ILE A CB   15 
ATOM   9434  C  CG1  . ILE A 1 30 ? -3.118  10.258  4.608   1.00 0.00 ? 30  ILE A CG1  15 
ATOM   9435  C  CG2  . ILE A 1 30 ? -1.298  10.304  6.334   1.00 0.00 ? 30  ILE A CG2  15 
ATOM   9436  C  CD1  . ILE A 1 30 ? -4.272  10.591  5.528   1.00 0.00 ? 30  ILE A CD1  15 
ATOM   9437  H  H    . ILE A 1 30 ? -2.590  7.857   3.367   1.00 0.00 ? 30  ILE A H    15 
ATOM   9438  H  HA   . ILE A 1 30 ? -0.579  9.797   3.728   1.00 0.00 ? 30  ILE A HA   15 
ATOM   9439  H  HB   . ILE A 1 30 ? -2.440  8.603   5.785   1.00 0.00 ? 30  ILE A HB   15 
ATOM   9440  H  HG12 . ILE A 1 30 ? -2.710  11.187  4.240   1.00 0.00 ? 30  ILE A HG12 15 
ATOM   9441  H  HG13 . ILE A 1 30 ? -3.508  9.687   3.778   1.00 0.00 ? 30  ILE A HG13 15 
ATOM   9442  H  HG21 . ILE A 1 30 ? -1.945  10.438  7.188   1.00 0.00 ? 30  ILE A HG21 15 
ATOM   9443  H  HG22 . ILE A 1 30 ? -0.391  9.808   6.645   1.00 0.00 ? 30  ILE A HG22 15 
ATOM   9444  H  HG23 . ILE A 1 30 ? -1.055  11.268  5.912   1.00 0.00 ? 30  ILE A HG23 15 
ATOM   9445  H  HD11 . ILE A 1 30 ? -4.973  9.768   5.538   1.00 0.00 ? 30  ILE A HD11 15 
ATOM   9446  H  HD12 . ILE A 1 30 ? -3.900  10.757  6.528   1.00 0.00 ? 30  ILE A HD12 15 
ATOM   9447  H  HD13 . ILE A 1 30 ? -4.769  11.481  5.175   1.00 0.00 ? 30  ILE A HD13 15 
ATOM   9448  N  N    . HIS A 1 31 ? -0.043  6.884   5.092   1.00 0.00 ? 31  HIS A N    15 
ATOM   9449  C  CA   . HIS A 1 31 ? 0.957   6.053   5.753   1.00 0.00 ? 31  HIS A CA   15 
ATOM   9450  C  C    . HIS A 1 31 ? 2.158   5.820   4.841   1.00 0.00 ? 31  HIS A C    15 
ATOM   9451  O  O    . HIS A 1 31 ? 3.305   5.890   5.281   1.00 0.00 ? 31  HIS A O    15 
ATOM   9452  C  CB   . HIS A 1 31 ? 0.346   4.713   6.164   1.00 0.00 ? 31  HIS A CB   15 
ATOM   9453  C  CG   . HIS A 1 31 ? 1.355   3.619   6.327   1.00 0.00 ? 31  HIS A CG   15 
ATOM   9454  N  ND1  . HIS A 1 31 ? 1.845   3.223   7.554   1.00 0.00 ? 31  HIS A ND1  15 
ATOM   9455  C  CD2  . HIS A 1 31 ? 1.967   2.835   5.409   1.00 0.00 ? 31  HIS A CD2  15 
ATOM   9456  C  CE1  . HIS A 1 31 ? 2.715   2.244   7.383   1.00 0.00 ? 31  HIS A CE1  15 
ATOM   9457  N  NE2  . HIS A 1 31 ? 2.807   1.989   6.090   1.00 0.00 ? 31  HIS A NE2  15 
ATOM   9458  H  H    . HIS A 1 31 ? -0.856  6.466   4.740   1.00 0.00 ? 31  HIS A H    15 
ATOM   9459  H  HA   . HIS A 1 31 ? 1.289   6.574   6.638   1.00 0.00 ? 31  HIS A HA   15 
ATOM   9460  H  HB2  . HIS A 1 31 ? -0.168  4.833   7.107   1.00 0.00 ? 31  HIS A HB2  15 
ATOM   9461  H  HB3  . HIS A 1 31 ? -0.364  4.402   5.410   1.00 0.00 ? 31  HIS A HB3  15 
ATOM   9462  H  HD1  . HIS A 1 31 ? 1.593   3.604   8.420   1.00 0.00 ? 31  HIS A HD1  15 
ATOM   9463  H  HD2  . HIS A 1 31 ? 1.823   2.868   4.338   1.00 0.00 ? 31  HIS A HD2  15 
ATOM   9464  H  HE1  . HIS A 1 31 ? 3.258   1.737   8.166   1.00 0.00 ? 31  HIS A HE1  15 
ATOM   9465  N  N    . GLN A 1 32 ? 1.885   5.541   3.570   1.00 0.00 ? 32  GLN A N    15 
ATOM   9466  C  CA   . GLN A 1 32 ? 2.944   5.296   2.598   1.00 0.00 ? 32  GLN A CA   15 
ATOM   9467  C  C    . GLN A 1 32 ? 3.978   6.417   2.625   1.00 0.00 ? 32  GLN A C    15 
ATOM   9468  O  O    . GLN A 1 32 ? 5.116   6.236   2.193   1.00 0.00 ? 32  GLN A O    15 
ATOM   9469  C  CB   . GLN A 1 32 ? 2.354   5.164   1.193   1.00 0.00 ? 32  GLN A CB   15 
ATOM   9470  C  CG   . GLN A 1 32 ? 1.591   3.867   0.973   1.00 0.00 ? 32  GLN A CG   15 
ATOM   9471  C  CD   . GLN A 1 32 ? 1.373   3.560   -0.495  1.00 0.00 ? 32  GLN A CD   15 
ATOM   9472  O  OE1  . GLN A 1 32 ? 2.327   3.380   -1.252  1.00 0.00 ? 32  GLN A OE1  15 
ATOM   9473  N  NE2  . GLN A 1 32 ? 0.112   3.499   -0.906  1.00 0.00 ? 32  GLN A NE2  15 
ATOM   9474  H  H    . GLN A 1 32 ? 0.950   5.500   3.280   1.00 0.00 ? 32  GLN A H    15 
ATOM   9475  H  HA   . GLN A 1 32 ? 3.429   4.369   2.864   1.00 0.00 ? 32  GLN A HA   15 
ATOM   9476  H  HB2  . GLN A 1 32 ? 1.678   5.988   1.020   1.00 0.00 ? 32  GLN A HB2  15 
ATOM   9477  H  HB3  . GLN A 1 32 ? 3.158   5.209   0.473   1.00 0.00 ? 32  GLN A HB3  15 
ATOM   9478  H  HG2  . GLN A 1 32 ? 2.151   3.056   1.415   1.00 0.00 ? 32  GLN A HG2  15 
ATOM   9479  H  HG3  . GLN A 1 32 ? 0.629   3.944   1.457   1.00 0.00 ? 32  GLN A HG3  15 
ATOM   9480  H  HE21 . GLN A 1 32 ? -0.597  3.655   -0.247  1.00 0.00 ? 32  GLN A HE21 15 
ATOM   9481  H  HE22 . GLN A 1 32 ? -0.058  3.303   -1.850  1.00 0.00 ? 32  GLN A HE22 15 
ATOM   9482  N  N    . LYS A 1 33 ? 3.573   7.576   3.134   1.00 0.00 ? 33  LYS A N    15 
ATOM   9483  C  CA   . LYS A 1 33 ? 4.464   8.727   3.219   1.00 0.00 ? 33  LYS A CA   15 
ATOM   9484  C  C    . LYS A 1 33 ? 5.725   8.383   4.006   1.00 0.00 ? 33  LYS A C    15 
ATOM   9485  O  O    . LYS A 1 33 ? 6.761   9.029   3.849   1.00 0.00 ? 33  LYS A O    15 
ATOM   9486  C  CB   . LYS A 1 33 ? 3.745   9.907   3.877   1.00 0.00 ? 33  LYS A CB   15 
ATOM   9487  C  CG   . LYS A 1 33 ? 2.593   10.454  3.052   1.00 0.00 ? 33  LYS A CG   15 
ATOM   9488  C  CD   . LYS A 1 33 ? 2.277   11.894  3.421   1.00 0.00 ? 33  LYS A CD   15 
ATOM   9489  C  CE   . LYS A 1 33 ? 1.303   12.521  2.436   1.00 0.00 ? 33  LYS A CE   15 
ATOM   9490  N  NZ   . LYS A 1 33 ? 2.008   13.180  1.302   1.00 0.00 ? 33  LYS A NZ   15 
ATOM   9491  H  H    . LYS A 1 33 ? 2.653   7.658   3.463   1.00 0.00 ? 33  LYS A H    15 
ATOM   9492  H  HA   . LYS A 1 33 ? 4.746   9.003   2.214   1.00 0.00 ? 33  LYS A HA   15 
ATOM   9493  H  HB2  . LYS A 1 33 ? 3.356   9.588   4.833   1.00 0.00 ? 33  LYS A HB2  15 
ATOM   9494  H  HB3  . LYS A 1 33 ? 4.457   10.704  4.035   1.00 0.00 ? 33  LYS A HB3  15 
ATOM   9495  H  HG2  . LYS A 1 33 ? 2.860   10.412  2.006   1.00 0.00 ? 33  LYS A HG2  15 
ATOM   9496  H  HG3  . LYS A 1 33 ? 1.717   9.846   3.226   1.00 0.00 ? 33  LYS A HG3  15 
ATOM   9497  H  HD2  . LYS A 1 33 ? 1.838   11.915  4.407   1.00 0.00 ? 33  LYS A HD2  15 
ATOM   9498  H  HD3  . LYS A 1 33 ? 3.195   12.466  3.421   1.00 0.00 ? 33  LYS A HD3  15 
ATOM   9499  H  HE2  . LYS A 1 33 ? 0.658   11.749  2.047   1.00 0.00 ? 33  LYS A HE2  15 
ATOM   9500  H  HE3  . LYS A 1 33 ? 0.709   13.258  2.957   1.00 0.00 ? 33  LYS A HE3  15 
ATOM   9501  H  HZ1  . LYS A 1 33 ? 2.552   12.477  0.762   1.00 0.00 ? 33  LYS A HZ1  15 
ATOM   9502  H  HZ2  . LYS A 1 33 ? 2.661   13.906  1.661   1.00 0.00 ? 33  LYS A HZ2  15 
ATOM   9503  H  HZ3  . LYS A 1 33 ? 1.320   13.633  0.667   1.00 0.00 ? 33  LYS A HZ3  15 
ATOM   9504  N  N    . ILE A 1 34 ? 5.629   7.363   4.851   1.00 0.00 ? 34  ILE A N    15 
ATOM   9505  C  CA   . ILE A 1 34 ? 6.762   6.932   5.660   1.00 0.00 ? 34  ILE A CA   15 
ATOM   9506  C  C    . ILE A 1 34 ? 7.841   6.288   4.796   1.00 0.00 ? 34  ILE A C    15 
ATOM   9507  O  O    . ILE A 1 34 ? 8.949   6.022   5.263   1.00 0.00 ? 34  ILE A O    15 
ATOM   9508  C  CB   . ILE A 1 34 ? 6.330   5.934   6.750   1.00 0.00 ? 34  ILE A CB   15 
ATOM   9509  C  CG1  . ILE A 1 34 ? 6.011   4.573   6.128   1.00 0.00 ? 34  ILE A CG1  15 
ATOM   9510  C  CG2  . ILE A 1 34 ? 5.126   6.470   7.511   1.00 0.00 ? 34  ILE A CG2  15 
ATOM   9511  C  CD1  . ILE A 1 34 ? 5.818   3.473   7.148   1.00 0.00 ? 34  ILE A CD1  15 
ATOM   9512  H  H    . ILE A 1 34 ? 4.776   6.887   4.932   1.00 0.00 ? 34  ILE A H    15 
ATOM   9513  H  HA   . ILE A 1 34 ? 7.177   7.805   6.144   1.00 0.00 ? 34  ILE A HA   15 
ATOM   9514  H  HB   . ILE A 1 34 ? 7.145   5.821   7.448   1.00 0.00 ? 34  ILE A HB   15 
ATOM   9515  H  HG12 . ILE A 1 34 ? 5.103   4.651   5.551   1.00 0.00 ? 34  ILE A HG12 15 
ATOM   9516  H  HG13 . ILE A 1 34 ? 6.823   4.284   5.477   1.00 0.00 ? 34  ILE A HG13 15 
ATOM   9517  H  HG21 . ILE A 1 34 ? 4.605   5.650   7.984   1.00 0.00 ? 34  ILE A HG21 15 
ATOM   9518  H  HG22 . ILE A 1 34 ? 5.459   7.166   8.266   1.00 0.00 ? 34  ILE A HG22 15 
ATOM   9519  H  HG23 . ILE A 1 34 ? 4.460   6.972   6.826   1.00 0.00 ? 34  ILE A HG23 15 
ATOM   9520  H  HD11 . ILE A 1 34 ? 5.725   3.908   8.134   1.00 0.00 ? 34  ILE A HD11 15 
ATOM   9521  H  HD12 . ILE A 1 34 ? 4.921   2.918   6.916   1.00 0.00 ? 34  ILE A HD12 15 
ATOM   9522  H  HD13 . ILE A 1 34 ? 6.669   2.808   7.128   1.00 0.00 ? 34  ILE A HD13 15 
ATOM   9523  N  N    . HIS A 1 35 ? 7.511   6.041   3.533   1.00 0.00 ? 35  HIS A N    15 
ATOM   9524  C  CA   . HIS A 1 35 ? 8.453   5.430   2.601   1.00 0.00 ? 35  HIS A CA   15 
ATOM   9525  C  C    . HIS A 1 35 ? 8.805   6.395   1.474   1.00 0.00 ? 35  HIS A C    15 
ATOM   9526  O  O    . HIS A 1 35 ? 9.279   5.983   0.414   1.00 0.00 ? 35  HIS A O    15 
ATOM   9527  C  CB   . HIS A 1 35 ? 7.866   4.142   2.022   1.00 0.00 ? 35  HIS A CB   15 
ATOM   9528  C  CG   . HIS A 1 35 ? 7.186   3.282   3.041   1.00 0.00 ? 35  HIS A CG   15 
ATOM   9529  N  ND1  . HIS A 1 35 ? 7.848   2.716   4.111   1.00 0.00 ? 35  HIS A ND1  15 
ATOM   9530  C  CD2  . HIS A 1 35 ? 5.894   2.893   3.152   1.00 0.00 ? 35  HIS A CD2  15 
ATOM   9531  C  CE1  . HIS A 1 35 ? 6.993   2.015   4.834   1.00 0.00 ? 35  HIS A CE1  15 
ATOM   9532  N  NE2  . HIS A 1 35 ? 5.800   2.106   4.273   1.00 0.00 ? 35  HIS A NE2  15 
ATOM   9533  H  H    . HIS A 1 35 ? 6.613   6.276   3.219   1.00 0.00 ? 35  HIS A H    15 
ATOM   9534  H  HA   . HIS A 1 35 ? 9.352   5.192   3.148   1.00 0.00 ? 35  HIS A HA   15 
ATOM   9535  H  HB2  . HIS A 1 35 ? 7.140   4.395   1.264   1.00 0.00 ? 35  HIS A HB2  15 
ATOM   9536  H  HB3  . HIS A 1 35 ? 8.661   3.563   1.574   1.00 0.00 ? 35  HIS A HB3  15 
ATOM   9537  H  HD1  . HIS A 1 35 ? 8.802   2.812   4.309   1.00 0.00 ? 35  HIS A HD1  15 
ATOM   9538  H  HD2  . HIS A 1 35 ? 5.086   3.153   2.482   1.00 0.00 ? 35  HIS A HD2  15 
ATOM   9539  H  HE1  . HIS A 1 35 ? 7.228   1.461   5.730   1.00 0.00 ? 35  HIS A HE1  15 
ATOM   9540  N  N    . THR A 1 36 ? 8.570   7.683   1.708   1.00 0.00 ? 36  THR A N    15 
ATOM   9541  C  CA   . THR A 1 36 ? 8.860   8.706   0.712   1.00 0.00 ? 36  THR A CA   15 
ATOM   9542  C  C    . THR A 1 36 ? 9.928   9.673   1.212   1.00 0.00 ? 36  THR A C    15 
ATOM   9543  O  O    . THR A 1 36 ? 9.872   10.871  0.937   1.00 0.00 ? 36  THR A O    15 
ATOM   9544  C  CB   . THR A 1 36 ? 7.596   9.503   0.339   1.00 0.00 ? 36  THR A CB   15 
ATOM   9545  O  OG1  . THR A 1 36 ? 7.149   10.267  1.465   1.00 0.00 ? 36  THR A OG1  15 
ATOM   9546  C  CG2  . THR A 1 36 ? 6.485   8.571   -0.121  1.00 0.00 ? 36  THR A CG2  15 
ATOM   9547  H  H    . THR A 1 36 ? 8.191   7.949   2.571   1.00 0.00 ? 36  THR A H    15 
ATOM   9548  H  HA   . THR A 1 36 ? 9.224   8.212   -0.178  1.00 0.00 ? 36  THR A HA   15 
ATOM   9549  H  HB   . THR A 1 36 ? 7.839   10.177  -0.470  1.00 0.00 ? 36  THR A HB   15 
ATOM   9550  H  HG1  . THR A 1 36 ? 6.694   11.055  1.158   1.00 0.00 ? 36  THR A HG1  15 
ATOM   9551  H  HG21 . THR A 1 36 ? 6.606   7.607   0.350   1.00 0.00 ? 36  THR A HG21 15 
ATOM   9552  H  HG22 . THR A 1 36 ? 6.533   8.456   -1.194  1.00 0.00 ? 36  THR A HG22 15 
ATOM   9553  H  HG23 . THR A 1 36 ? 5.528   8.989   0.154   1.00 0.00 ? 36  THR A HG23 15 
ATOM   9554  N  N    . GLY A 1 37 ? 10.901  9.145   1.948   1.00 0.00 ? 37  GLY A N    15 
ATOM   9555  C  CA   . GLY A 1 37 ? 11.968  9.975   2.474   1.00 0.00 ? 37  GLY A CA   15 
ATOM   9556  C  C    . GLY A 1 37 ? 13.222  9.914   1.626   1.00 0.00 ? 37  GLY A C    15 
ATOM   9557  O  O    . GLY A 1 37 ? 13.650  10.922  1.065   1.00 0.00 ? 37  GLY A O    15 
ATOM   9558  H  H    . GLY A 1 37 ? 10.894  8.182   2.135   1.00 0.00 ? 37  GLY A H    15 
ATOM   9559  H  HA2  . GLY A 1 37 ? 11.624  10.998  2.517   1.00 0.00 ? 37  GLY A HA2  15 
ATOM   9560  H  HA3  . GLY A 1 37 ? 12.206  9.644   3.474   1.00 0.00 ? 37  GLY A HA3  15 
ATOM   9561  N  N    . GLU A 1 38 ? 13.815  8.727   1.534   1.00 0.00 ? 38  GLU A N    15 
ATOM   9562  C  CA   . GLU A 1 38 ? 15.030  8.540   0.751   1.00 0.00 ? 38  GLU A CA   15 
ATOM   9563  C  C    . GLU A 1 38 ? 14.923  9.248   -0.597  1.00 0.00 ? 38  GLU A C    15 
ATOM   9564  O  O    . GLU A 1 38 ? 13.847  9.312   -1.192  1.00 0.00 ? 38  GLU A O    15 
ATOM   9565  C  CB   . GLU A 1 38 ? 15.301  7.049   0.536   1.00 0.00 ? 38  GLU A CB   15 
ATOM   9566  C  CG   . GLU A 1 38 ? 15.925  6.364   1.740   1.00 0.00 ? 38  GLU A CG   15 
ATOM   9567  C  CD   . GLU A 1 38 ? 14.983  6.297   2.927   1.00 0.00 ? 38  GLU A CD   15 
ATOM   9568  O  OE1  . GLU A 1 38 ? 13.816  5.896   2.734   1.00 0.00 ? 38  GLU A OE1  15 
ATOM   9569  O  OE2  . GLU A 1 38 ? 15.412  6.646   4.046   1.00 0.00 ? 38  GLU A OE2  15 
ATOM   9570  H  H    . GLU A 1 38 ? 13.426  7.961   2.005   1.00 0.00 ? 38  GLU A H    15 
ATOM   9571  H  HA   . GLU A 1 38 ? 15.851  8.969   1.304   1.00 0.00 ? 38  GLU A HA   15 
ATOM   9572  H  HB2  . GLU A 1 38 ? 14.367  6.555   0.310   1.00 0.00 ? 38  GLU A HB2  15 
ATOM   9573  H  HB3  . GLU A 1 38 ? 15.970  6.935   -0.304  1.00 0.00 ? 38  GLU A HB3  15 
ATOM   9574  H  HG2  . GLU A 1 38 ? 16.202  5.358   1.463   1.00 0.00 ? 38  GLU A HG2  15 
ATOM   9575  H  HG3  . GLU A 1 38 ? 16.809  6.912   2.032   1.00 0.00 ? 38  GLU A HG3  15 
ATOM   9576  N  N    . ARG A 1 39 ? 16.046  9.777   -1.072  1.00 0.00 ? 39  ARG A N    15 
ATOM   9577  C  CA   . ARG A 1 39 ? 16.078  10.482  -2.348  1.00 0.00 ? 39  ARG A CA   15 
ATOM   9578  C  C    . ARG A 1 39 ? 17.514  10.798  -2.758  1.00 0.00 ? 39  ARG A C    15 
ATOM   9579  O  O    . ARG A 1 39 ? 18.290  11.376  -1.997  1.00 0.00 ? 39  ARG A O    15 
ATOM   9580  C  CB   . ARG A 1 39 ? 15.265  11.774  -2.262  1.00 0.00 ? 39  ARG A CB   15 
ATOM   9581  C  CG   . ARG A 1 39 ? 14.772  12.275  -3.610  1.00 0.00 ? 39  ARG A CG   15 
ATOM   9582  C  CD   . ARG A 1 39 ? 14.048  13.606  -3.479  1.00 0.00 ? 39  ARG A CD   15 
ATOM   9583  N  NE   . ARG A 1 39 ? 14.966  14.739  -3.569  1.00 0.00 ? 39  ARG A NE   15 
ATOM   9584  C  CZ   . ARG A 1 39 ? 14.714  15.932  -3.044  1.00 0.00 ? 39  ARG A CZ   15 
ATOM   9585  N  NH1  . ARG A 1 39 ? 13.578  16.148  -2.394  1.00 0.00 ? 39  ARG A NH1  15 
ATOM   9586  N  NH2  . ARG A 1 39 ? 15.599  16.913  -3.167  1.00 0.00 ? 39  ARG A NH2  15 
ATOM   9587  H  H    . ARG A 1 39 ? 16.872  9.693   -0.551  1.00 0.00 ? 39  ARG A H    15 
ATOM   9588  H  HA   . ARG A 1 39 ? 15.637  9.838   -3.094  1.00 0.00 ? 39  ARG A HA   15 
ATOM   9589  H  HB2  . ARG A 1 39 ? 14.405  11.604  -1.630  1.00 0.00 ? 39  ARG A HB2  15 
ATOM   9590  H  HB3  . ARG A 1 39 ? 15.880  12.544  -1.820  1.00 0.00 ? 39  ARG A HB3  15 
ATOM   9591  H  HG2  . ARG A 1 39 ? 15.618  12.401  -4.268  1.00 0.00 ? 39  ARG A HG2  15 
ATOM   9592  H  HG3  . ARG A 1 39 ? 14.094  11.546  -4.027  1.00 0.00 ? 39  ARG A HG3  15 
ATOM   9593  H  HD2  . ARG A 1 39 ? 13.318  13.683  -4.271  1.00 0.00 ? 39  ARG A HD2  15 
ATOM   9594  H  HD3  . ARG A 1 39 ? 13.547  13.636  -2.523  1.00 0.00 ? 39  ARG A HD3  15 
ATOM   9595  H  HE   . ARG A 1 39 ? 15.811  14.601  -4.045  1.00 0.00 ? 39  ARG A HE   15 
ATOM   9596  H  HH11 . ARG A 1 39 ? 12.910  15.410  -2.299  1.00 0.00 ? 39  ARG A HH11 15 
ATOM   9597  H  HH12 . ARG A 1 39 ? 13.391  17.047  -1.998  1.00 0.00 ? 39  ARG A HH12 15 
ATOM   9598  H  HH21 . ARG A 1 39 ? 16.456  16.755  -3.656  1.00 0.00 ? 39  ARG A HH21 15 
ATOM   9599  H  HH22 . ARG A 1 39 ? 15.408  17.811  -2.771  1.00 0.00 ? 39  ARG A HH22 15 
ATOM   9600  N  N    . PRO A 1 40 ? 17.877  10.409  -3.989  1.00 0.00 ? 40  PRO A N    15 
ATOM   9601  C  CA   . PRO A 1 40 ? 19.220  10.641  -4.528  1.00 0.00 ? 40  PRO A CA   15 
ATOM   9602  C  C    . PRO A 1 40 ? 19.486  12.116  -4.809  1.00 0.00 ? 40  PRO A C    15 
ATOM   9603  O  O    . PRO A 1 40 ? 18.621  12.825  -5.322  1.00 0.00 ? 40  PRO A O    15 
ATOM   9604  C  CB   . PRO A 1 40 ? 19.222  9.839   -5.833  1.00 0.00 ? 40  PRO A CB   15 
ATOM   9605  C  CG   . PRO A 1 40 ? 17.788  9.763   -6.232  1.00 0.00 ? 40  PRO A CG   15 
ATOM   9606  C  CD   . PRO A 1 40 ? 17.003  9.715   -4.950  1.00 0.00 ? 40  PRO A CD   15 
ATOM   9607  H  HA   . PRO A 1 40 ? 19.984  10.258  -3.868  1.00 0.00 ? 40  PRO A HA   15 
ATOM   9608  H  HB2  . PRO A 1 40 ? 19.813  10.357  -6.575  1.00 0.00 ? 40  PRO A HB2  15 
ATOM   9609  H  HB3  . PRO A 1 40 ? 19.635  8.858   -5.656  1.00 0.00 ? 40  PRO A HB3  15 
ATOM   9610  H  HG2  . PRO A 1 40 ? 17.520  10.638  -6.804  1.00 0.00 ? 40  PRO A HG2  15 
ATOM   9611  H  HG3  . PRO A 1 40 ? 17.616  8.867   -6.810  1.00 0.00 ? 40  PRO A HG3  15 
ATOM   9612  H  HD2  . PRO A 1 40 ? 16.064  10.235  -5.063  1.00 0.00 ? 40  PRO A HD2  15 
ATOM   9613  H  HD3  . PRO A 1 40 ? 16.836  8.692   -4.649  1.00 0.00 ? 40  PRO A HD3  15 
ATOM   9614  N  N    . SER A 1 41 ? 20.688  12.571  -4.469  1.00 0.00 ? 41  SER A N    15 
ATOM   9615  C  CA   . SER A 1 41 ? 21.067  13.963  -4.681  1.00 0.00 ? 41  SER A CA   15 
ATOM   9616  C  C    . SER A 1 41 ? 22.323  14.059  -5.542  1.00 0.00 ? 41  SER A C    15 
ATOM   9617  O  O    . SER A 1 41 ? 23.279  14.748  -5.189  1.00 0.00 ? 41  SER A O    15 
ATOM   9618  C  CB   . SER A 1 41 ? 21.299  14.661  -3.340  1.00 0.00 ? 41  SER A CB   15 
ATOM   9619  O  OG   . SER A 1 41 ? 21.693  16.009  -3.528  1.00 0.00 ? 41  SER A OG   15 
ATOM   9620  H  H    . SER A 1 41 ? 21.334  11.955  -4.063  1.00 0.00 ? 41  SER A H    15 
ATOM   9621  H  HA   . SER A 1 41 ? 20.254  14.452  -5.196  1.00 0.00 ? 41  SER A HA   15 
ATOM   9622  H  HB2  . SER A 1 41 ? 20.386  14.642  -2.765  1.00 0.00 ? 41  SER A HB2  15 
ATOM   9623  H  HB3  . SER A 1 41 ? 22.077  14.143  -2.798  1.00 0.00 ? 41  SER A HB3  15 
ATOM   9624  H  HG   . SER A 1 41 ? 22.198  16.304  -2.767  1.00 0.00 ? 41  SER A HG   15 
ATOM   9625  N  N    . GLY A 1 42 ? 22.313  13.360  -6.673  1.00 0.00 ? 42  GLY A N    15 
ATOM   9626  C  CA   . GLY A 1 42 ? 23.456  13.380  -7.567  1.00 0.00 ? 42  GLY A CA   15 
ATOM   9627  C  C    . GLY A 1 42 ? 23.343  14.455  -8.629  1.00 0.00 ? 42  GLY A C    15 
ATOM   9628  O  O    . GLY A 1 42 ? 22.566  15.402  -8.504  1.00 0.00 ? 42  GLY A O    15 
ATOM   9629  H  H    . GLY A 1 42 ? 21.523  12.828  -6.903  1.00 0.00 ? 42  GLY A H    15 
ATOM   9630  H  HA2  . GLY A 1 42 ? 24.350  13.553  -6.987  1.00 0.00 ? 42  GLY A HA2  15 
ATOM   9631  H  HA3  . GLY A 1 42 ? 23.535  12.418  -8.052  1.00 0.00 ? 42  GLY A HA3  15 
ATOM   9632  N  N    . PRO A 1 43 ? 24.135  14.316  -9.703  1.00 0.00 ? 43  PRO A N    15 
ATOM   9633  C  CA   . PRO A 1 43 ? 24.140  15.275  -10.812 1.00 0.00 ? 43  PRO A CA   15 
ATOM   9634  C  C    . PRO A 1 43 ? 22.854  15.222  -11.630 1.00 0.00 ? 43  PRO A C    15 
ATOM   9635  O  O    . PRO A 1 43 ? 22.602  16.091  -12.465 1.00 0.00 ? 43  PRO A O    15 
ATOM   9636  C  CB   . PRO A 1 43 ? 25.333  14.830  -11.661 1.00 0.00 ? 43  PRO A CB   15 
ATOM   9637  C  CG   . PRO A 1 43 ? 25.496  13.381  -11.355 1.00 0.00 ? 43  PRO A CG   15 
ATOM   9638  C  CD   . PRO A 1 43 ? 25.085  13.212  -9.918  1.00 0.00 ? 43  PRO A CD   15 
ATOM   9639  H  HA   . PRO A 1 43 ? 24.301  16.285  -10.463 1.00 0.00 ? 43  PRO A HA   15 
ATOM   9640  H  HB2  . PRO A 1 43 ? 25.114  14.992  -12.707 1.00 0.00 ? 43  PRO A HB2  15 
ATOM   9641  H  HB3  . PRO A 1 43 ? 26.210  15.393  -11.380 1.00 0.00 ? 43  PRO A HB3  15 
ATOM   9642  H  HG2  . PRO A 1 43 ? 24.857  12.796  -11.999 1.00 0.00 ? 43  PRO A HG2  15 
ATOM   9643  H  HG3  . PRO A 1 43 ? 26.528  13.092  -11.486 1.00 0.00 ? 43  PRO A HG3  15 
ATOM   9644  H  HD2  . PRO A 1 43 ? 24.605  12.256  -9.773  1.00 0.00 ? 43  PRO A HD2  15 
ATOM   9645  H  HD3  . PRO A 1 43 ? 25.942  13.310  -9.267  1.00 0.00 ? 43  PRO A HD3  15 
ATOM   9646  N  N    . SER A 1 44 ? 22.044  14.197  -11.385 1.00 0.00 ? 44  SER A N    15 
ATOM   9647  C  CA   . SER A 1 44 ? 20.786  14.029  -12.103 1.00 0.00 ? 44  SER A CA   15 
ATOM   9648  C  C    . SER A 1 44 ? 19.647  14.736  -11.374 1.00 0.00 ? 44  SER A C    15 
ATOM   9649  O  O    . SER A 1 44 ? 19.342  14.423  -10.224 1.00 0.00 ? 44  SER A O    15 
ATOM   9650  C  CB   . SER A 1 44 ? 20.459  12.543  -12.261 1.00 0.00 ? 44  SER A CB   15 
ATOM   9651  O  OG   . SER A 1 44 ? 21.216  11.963  -13.310 1.00 0.00 ? 44  SER A OG   15 
ATOM   9652  H  H    . SER A 1 44 ? 22.301  13.537  -10.708 1.00 0.00 ? 44  SER A H    15 
ATOM   9653  H  HA   . SER A 1 44 ? 20.901  14.470  -13.081 1.00 0.00 ? 44  SER A HA   15 
ATOM   9654  H  HB2  . SER A 1 44 ? 20.688  12.026  -11.341 1.00 0.00 ? 44  SER A HB2  15 
ATOM   9655  H  HB3  . SER A 1 44 ? 19.409  12.430  -12.486 1.00 0.00 ? 44  SER A HB3  15 
ATOM   9656  H  HG   . SER A 1 44 ? 22.065  11.672  -12.970 1.00 0.00 ? 44  SER A HG   15 
ATOM   9657  N  N    . SER A 1 45 ? 19.022  15.692  -12.054 1.00 0.00 ? 45  SER A N    15 
ATOM   9658  C  CA   . SER A 1 45 ? 17.919  16.448  -11.472 1.00 0.00 ? 45  SER A CA   15 
ATOM   9659  C  C    . SER A 1 45 ? 16.976  15.528  -10.703 1.00 0.00 ? 45  SER A C    15 
ATOM   9660  O  O    . SER A 1 45 ? 16.531  14.504  -11.220 1.00 0.00 ? 45  SER A O    15 
ATOM   9661  C  CB   . SER A 1 45 ? 17.147  17.189  -12.565 1.00 0.00 ? 45  SER A CB   15 
ATOM   9662  O  OG   . SER A 1 45 ? 16.557  16.280  -13.478 1.00 0.00 ? 45  SER A OG   15 
ATOM   9663  H  H    . SER A 1 45 ? 19.312  15.896  -12.968 1.00 0.00 ? 45  SER A H    15 
ATOM   9664  H  HA   . SER A 1 45 ? 18.337  17.170  -10.786 1.00 0.00 ? 45  SER A HA   15 
ATOM   9665  H  HB2  . SER A 1 45 ? 16.368  17.783  -12.113 1.00 0.00 ? 45  SER A HB2  15 
ATOM   9666  H  HB3  . SER A 1 45 ? 17.824  17.834  -13.106 1.00 0.00 ? 45  SER A HB3  15 
ATOM   9667  H  HG   . SER A 1 45 ? 16.360  15.455  -13.027 1.00 0.00 ? 45  SER A HG   15 
ATOM   9668  N  N    . GLY A 1 46 ? 16.676  15.901  -9.462  1.00 0.00 ? 46  GLY A N    15 
ATOM   9669  C  CA   . GLY A 1 46 ? 15.788  15.099  -8.641  1.00 0.00 ? 46  GLY A CA   15 
ATOM   9670  C  C    . GLY A 1 46 ? 15.201  15.884  -7.485  1.00 0.00 ? 46  GLY A C    15 
ATOM   9671  O  O    . GLY A 1 46 ? 14.558  15.289  -6.621  1.00 0.00 ? 46  GLY A O    15 
ATOM   9672  H  H    . GLY A 1 46 ? 17.061  16.727  -9.102  1.00 0.00 ? 46  GLY A H    15 
ATOM   9673  H  HA2  . GLY A 1 46 ? 14.983  14.728  -9.256  1.00 0.00 ? 46  GLY A HA2  15 
ATOM   9674  H  HA3  . GLY A 1 46 ? 16.342  14.260  -8.246  1.00 0.00 ? 46  GLY A HA3  15 
HETATM 9675  ZN ZN   . ZN  B 2 .  ? 4.018   1.059   4.644   1.00 0.00 ? 201 ZN  A ZN   15 
ATOM   9676  N  N    . GLY A 1 1  ? 18.060  -19.382 8.697   1.00 0.00 ? 1   GLY A N    16 
ATOM   9677  C  CA   . GLY A 1 1  ? 17.077  -18.816 7.792   1.00 0.00 ? 1   GLY A CA   16 
ATOM   9678  C  C    . GLY A 1 1  ? 17.144  -17.303 7.736   1.00 0.00 ? 1   GLY A C    16 
ATOM   9679  O  O    . GLY A 1 1  ? 17.213  -16.639 8.770   1.00 0.00 ? 1   GLY A O    16 
ATOM   9680  H  H1   . GLY A 1 1  ? 18.021  -19.171 9.653   1.00 0.00 ? 1   GLY A H1   16 
ATOM   9681  H  HA2  . GLY A 1 1  ? 17.246  -19.211 6.801   1.00 0.00 ? 1   GLY A HA2  16 
ATOM   9682  H  HA3  . GLY A 1 1  ? 16.091  -19.108 8.121   1.00 0.00 ? 1   GLY A HA3  16 
ATOM   9683  N  N    . SER A 1 2  ? 17.127  -16.756 6.524   1.00 0.00 ? 2   SER A N    16 
ATOM   9684  C  CA   . SER A 1 2  ? 17.193  -15.311 6.337   1.00 0.00 ? 2   SER A CA   16 
ATOM   9685  C  C    . SER A 1 2  ? 15.838  -14.757 5.906   1.00 0.00 ? 2   SER A C    16 
ATOM   9686  O  O    . SER A 1 2  ? 15.349  -13.776 6.466   1.00 0.00 ? 2   SER A O    16 
ATOM   9687  C  CB   . SER A 1 2  ? 18.256  -14.958 5.295   1.00 0.00 ? 2   SER A CB   16 
ATOM   9688  O  OG   . SER A 1 2  ? 18.784  -13.663 5.523   1.00 0.00 ? 2   SER A OG   16 
ATOM   9689  H  H    . SER A 1 2  ? 17.071  -17.338 5.738   1.00 0.00 ? 2   SER A H    16 
ATOM   9690  H  HA   . SER A 1 2  ? 17.466  -14.866 7.282   1.00 0.00 ? 2   SER A HA   16 
ATOM   9691  H  HB2  . SER A 1 2  ? 19.060  -15.676 5.347   1.00 0.00 ? 2   SER A HB2  16 
ATOM   9692  H  HB3  . SER A 1 2  ? 17.813  -14.985 4.310   1.00 0.00 ? 2   SER A HB3  16 
ATOM   9693  H  HG   . SER A 1 2  ? 19.612  -13.567 5.047   1.00 0.00 ? 2   SER A HG   16 
ATOM   9694  N  N    . SER A 1 3  ? 15.237  -15.394 4.905   1.00 0.00 ? 3   SER A N    16 
ATOM   9695  C  CA   . SER A 1 3  ? 13.940  -14.964 4.395   1.00 0.00 ? 3   SER A CA   16 
ATOM   9696  C  C    . SER A 1 3  ? 13.112  -16.160 3.937   1.00 0.00 ? 3   SER A C    16 
ATOM   9697  O  O    . SER A 1 3  ? 13.638  -17.255 3.742   1.00 0.00 ? 3   SER A O    16 
ATOM   9698  C  CB   . SER A 1 3  ? 14.125  -13.983 3.235   1.00 0.00 ? 3   SER A CB   16 
ATOM   9699  O  OG   . SER A 1 3  ? 14.974  -14.526 2.239   1.00 0.00 ? 3   SER A OG   16 
ATOM   9700  H  H    . SER A 1 3  ? 15.677  -16.170 4.500   1.00 0.00 ? 3   SER A H    16 
ATOM   9701  H  HA   . SER A 1 3  ? 13.417  -14.464 5.197   1.00 0.00 ? 3   SER A HA   16 
ATOM   9702  H  HB2  . SER A 1 3  ? 13.164  -13.767 2.793   1.00 0.00 ? 3   SER A HB2  16 
ATOM   9703  H  HB3  . SER A 1 3  ? 14.564  -13.069 3.607   1.00 0.00 ? 3   SER A HB3  16 
ATOM   9704  H  HG   . SER A 1 3  ? 15.890  -14.357 2.472   1.00 0.00 ? 3   SER A HG   16 
ATOM   9705  N  N    . GLY A 1 4  ? 11.812  -15.943 3.769   1.00 0.00 ? 4   GLY A N    16 
ATOM   9706  C  CA   . GLY A 1 4  ? 10.930  -17.011 3.336   1.00 0.00 ? 4   GLY A CA   16 
ATOM   9707  C  C    . GLY A 1 4  ? 9.543   -16.899 3.937   1.00 0.00 ? 4   GLY A C    16 
ATOM   9708  O  O    . GLY A 1 4  ? 9.208   -17.616 4.879   1.00 0.00 ? 4   GLY A O    16 
ATOM   9709  H  H    . GLY A 1 4  ? 11.447  -15.049 3.940   1.00 0.00 ? 4   GLY A H    16 
ATOM   9710  H  HA2  . GLY A 1 4  ? 10.849  -16.982 2.260   1.00 0.00 ? 4   GLY A HA2  16 
ATOM   9711  H  HA3  . GLY A 1 4  ? 11.361  -17.958 3.628   1.00 0.00 ? 4   GLY A HA3  16 
ATOM   9712  N  N    . SER A 1 5  ? 8.736   -15.995 3.392   1.00 0.00 ? 5   SER A N    16 
ATOM   9713  C  CA   . SER A 1 5  ? 7.379   -15.787 3.884   1.00 0.00 ? 5   SER A CA   16 
ATOM   9714  C  C    . SER A 1 5  ? 6.450   -15.358 2.752   1.00 0.00 ? 5   SER A C    16 
ATOM   9715  O  O    . SER A 1 5  ? 6.795   -14.495 1.945   1.00 0.00 ? 5   SER A O    16 
ATOM   9716  C  CB   . SER A 1 5  ? 7.372   -14.732 4.992   1.00 0.00 ? 5   SER A CB   16 
ATOM   9717  O  OG   . SER A 1 5  ? 7.515   -13.428 4.456   1.00 0.00 ? 5   SER A OG   16 
ATOM   9718  H  H    . SER A 1 5  ? 9.061   -15.453 2.643   1.00 0.00 ? 5   SER A H    16 
ATOM   9719  H  HA   . SER A 1 5  ? 7.026   -16.724 4.289   1.00 0.00 ? 5   SER A HA   16 
ATOM   9720  H  HB2  . SER A 1 5  ? 6.438   -14.786 5.531   1.00 0.00 ? 5   SER A HB2  16 
ATOM   9721  H  HB3  . SER A 1 5  ? 8.191   -14.921 5.671   1.00 0.00 ? 5   SER A HB3  16 
ATOM   9722  H  HG   . SER A 1 5  ? 8.311   -13.387 3.922   1.00 0.00 ? 5   SER A HG   16 
ATOM   9723  N  N    . SER A 1 6  ? 5.270   -15.968 2.700   1.00 0.00 ? 6   SER A N    16 
ATOM   9724  C  CA   . SER A 1 6  ? 4.292   -15.653 1.665   1.00 0.00 ? 6   SER A CA   16 
ATOM   9725  C  C    . SER A 1 6  ? 3.704   -14.262 1.879   1.00 0.00 ? 6   SER A C    16 
ATOM   9726  O  O    . SER A 1 6  ? 3.785   -13.703 2.972   1.00 0.00 ? 6   SER A O    16 
ATOM   9727  C  CB   . SER A 1 6  ? 3.174   -16.697 1.657   1.00 0.00 ? 6   SER A CB   16 
ATOM   9728  O  OG   . SER A 1 6  ? 2.356   -16.559 0.508   1.00 0.00 ? 6   SER A OG   16 
ATOM   9729  H  H    . SER A 1 6  ? 5.054   -16.648 3.372   1.00 0.00 ? 6   SER A H    16 
ATOM   9730  H  HA   . SER A 1 6  ? 4.799   -15.674 0.712   1.00 0.00 ? 6   SER A HA   16 
ATOM   9731  H  HB2  . SER A 1 6  ? 3.607   -17.686 1.659   1.00 0.00 ? 6   SER A HB2  16 
ATOM   9732  H  HB3  . SER A 1 6  ? 2.561   -16.571 2.538   1.00 0.00 ? 6   SER A HB3  16 
ATOM   9733  H  HG   . SER A 1 6  ? 2.000   -17.417 0.263   1.00 0.00 ? 6   SER A HG   16 
ATOM   9734  N  N    . GLY A 1 7  ? 3.109   -13.709 0.826   1.00 0.00 ? 7   GLY A N    16 
ATOM   9735  C  CA   . GLY A 1 7  ? 2.516   -12.388 0.918   1.00 0.00 ? 7   GLY A CA   16 
ATOM   9736  C  C    . GLY A 1 7  ? 1.328   -12.221 -0.009  1.00 0.00 ? 7   GLY A C    16 
ATOM   9737  O  O    . GLY A 1 7  ? 1.360   -11.406 -0.932  1.00 0.00 ? 7   GLY A O    16 
ATOM   9738  H  H    . GLY A 1 7  ? 3.074   -14.203 -0.020  1.00 0.00 ? 7   GLY A H    16 
ATOM   9739  H  HA2  . GLY A 1 7  ? 2.192   -12.221 1.934   1.00 0.00 ? 7   GLY A HA2  16 
ATOM   9740  H  HA3  . GLY A 1 7  ? 3.263   -11.652 0.663   1.00 0.00 ? 7   GLY A HA3  16 
ATOM   9741  N  N    . THR A 1 8  ? 0.275   -12.995 0.235   1.00 0.00 ? 8   THR A N    16 
ATOM   9742  C  CA   . THR A 1 8  ? -0.927  -12.932 -0.587  1.00 0.00 ? 8   THR A CA   16 
ATOM   9743  C  C    . THR A 1 8  ? -2.177  -13.189 0.247   1.00 0.00 ? 8   THR A C    16 
ATOM   9744  O  O    . THR A 1 8  ? -2.131  -13.900 1.250   1.00 0.00 ? 8   THR A O    16 
ATOM   9745  C  CB   . THR A 1 8  ? -0.874  -13.951 -1.740  1.00 0.00 ? 8   THR A CB   16 
ATOM   9746  O  OG1  . THR A 1 8  ? -1.980  -13.745 -2.627  1.00 0.00 ? 8   THR A OG1  16 
ATOM   9747  C  CG2  . THR A 1 8  ? -0.906  -15.375 -1.205  1.00 0.00 ? 8   THR A CG2  16 
ATOM   9748  H  H    . THR A 1 8  ? 0.310   -13.625 0.985   1.00 0.00 ? 8   THR A H    16 
ATOM   9749  H  HA   . THR A 1 8  ? -0.988  -11.940 -1.013  1.00 0.00 ? 8   THR A HA   16 
ATOM   9750  H  HB   . THR A 1 8  ? 0.047   -13.807 -2.286  1.00 0.00 ? 8   THR A HB   16 
ATOM   9751  H  HG1  . THR A 1 8  ? -2.802  -13.821 -2.137  1.00 0.00 ? 8   THR A HG1  16 
ATOM   9752  H  HG21 . THR A 1 8  ? -0.505  -15.391 -0.203  1.00 0.00 ? 8   THR A HG21 16 
ATOM   9753  H  HG22 . THR A 1 8  ? -0.308  -16.012 -1.841  1.00 0.00 ? 8   THR A HG22 16 
ATOM   9754  H  HG23 . THR A 1 8  ? -1.924  -15.732 -1.192  1.00 0.00 ? 8   THR A HG23 16 
ATOM   9755  N  N    . GLY A 1 9  ? -3.295  -12.605 -0.175  1.00 0.00 ? 9   GLY A N    16 
ATOM   9756  C  CA   . GLY A 1 9  ? -4.542  -12.784 0.545   1.00 0.00 ? 9   GLY A CA   16 
ATOM   9757  C  C    . GLY A 1 9  ? -5.592  -11.765 0.149   1.00 0.00 ? 9   GLY A C    16 
ATOM   9758  O  O    . GLY A 1 9  ? -5.280  -10.763 -0.495  1.00 0.00 ? 9   GLY A O    16 
ATOM   9759  H  H    . GLY A 1 9  ? -3.272  -12.049 -0.982  1.00 0.00 ? 9   GLY A H    16 
ATOM   9760  H  HA2  . GLY A 1 9  ? -4.923  -13.774 0.343   1.00 0.00 ? 9   GLY A HA2  16 
ATOM   9761  H  HA3  . GLY A 1 9  ? -4.350  -12.693 1.604   1.00 0.00 ? 9   GLY A HA3  16 
ATOM   9762  N  N    . GLU A 1 10 ? -6.838  -12.021 0.533   1.00 0.00 ? 10  GLU A N    16 
ATOM   9763  C  CA   . GLU A 1 10 ? -7.937  -11.118 0.211   1.00 0.00 ? 10  GLU A CA   16 
ATOM   9764  C  C    . GLU A 1 10 ? -7.949  -9.917  1.153   1.00 0.00 ? 10  GLU A C    16 
ATOM   9765  O  O    . GLU A 1 10 ? -8.527  -9.972  2.238   1.00 0.00 ? 10  GLU A O    16 
ATOM   9766  C  CB   . GLU A 1 10 ? -9.274  -11.856 0.292   1.00 0.00 ? 10  GLU A CB   16 
ATOM   9767  C  CG   . GLU A 1 10 ? -9.464  -12.894 -0.802  1.00 0.00 ? 10  GLU A CG   16 
ATOM   9768  C  CD   . GLU A 1 10 ? -10.925 -13.200 -1.069  1.00 0.00 ? 10  GLU A CD   16 
ATOM   9769  O  OE1  . GLU A 1 10 ? -11.537 -12.492 -1.896  1.00 0.00 ? 10  GLU A OE1  16 
ATOM   9770  O  OE2  . GLU A 1 10 ? -11.456 -14.147 -0.452  1.00 0.00 ? 10  GLU A OE2  16 
ATOM   9771  H  H    . GLU A 1 10 ? -7.024  -12.836 1.044   1.00 0.00 ? 10  GLU A H    16 
ATOM   9772  H  HA   . GLU A 1 10 ? -7.792  -10.765 -0.799  1.00 0.00 ? 10  GLU A HA   16 
ATOM   9773  H  HB2  . GLU A 1 10 ? -9.340  -12.355 1.248   1.00 0.00 ? 10  GLU A HB2  16 
ATOM   9774  H  HB3  . GLU A 1 10 ? -10.075 -11.135 0.217   1.00 0.00 ? 10  GLU A HB3  16 
ATOM   9775  H  HG2  . GLU A 1 10 ? -9.017  -12.524 -1.713  1.00 0.00 ? 10  GLU A HG2  16 
ATOM   9776  H  HG3  . GLU A 1 10 ? -8.969  -13.807 -0.505  1.00 0.00 ? 10  GLU A HG3  16 
ATOM   9777  N  N    . ASN A 1 11 ? -7.305  -8.834  0.730   1.00 0.00 ? 11  ASN A N    16 
ATOM   9778  C  CA   . ASN A 1 11 ? -7.239  -7.621  1.536   1.00 0.00 ? 11  ASN A CA   16 
ATOM   9779  C  C    . ASN A 1 11 ? -7.737  -6.415  0.745   1.00 0.00 ? 11  ASN A C    16 
ATOM   9780  O  O    . ASN A 1 11 ? -7.646  -6.365  -0.481  1.00 0.00 ? 11  ASN A O    16 
ATOM   9781  C  CB   . ASN A 1 11 ? -5.806  -7.376  2.012   1.00 0.00 ? 11  ASN A CB   16 
ATOM   9782  C  CG   . ASN A 1 11 ? -5.344  -8.415  3.016   1.00 0.00 ? 11  ASN A CG   16 
ATOM   9783  O  OD1  . ASN A 1 11 ? -6.159  -9.067  3.669   1.00 0.00 ? 11  ASN A OD1  16 
ATOM   9784  N  ND2  . ASN A 1 11 ? -4.032  -8.573  3.143   1.00 0.00 ? 11  ASN A ND2  16 
ATOM   9785  H  H    . ASN A 1 11 ? -6.862  -8.851  -0.144  1.00 0.00 ? 11  ASN A H    16 
ATOM   9786  H  HA   . ASN A 1 11 ? -7.876  -7.760  2.397   1.00 0.00 ? 11  ASN A HA   16 
ATOM   9787  H  HB2  . ASN A 1 11 ? -5.141  -7.405  1.161   1.00 0.00 ? 11  ASN A HB2  16 
ATOM   9788  H  HB3  . ASN A 1 11 ? -5.748  -6.403  2.476   1.00 0.00 ? 11  ASN A HB3  16 
ATOM   9789  H  HD21 . ASN A 1 11 ? -3.443  -8.018  2.590   1.00 0.00 ? 11  ASN A HD21 16 
ATOM   9790  H  HD22 . ASN A 1 11 ? -3.706  -9.238  3.784   1.00 0.00 ? 11  ASN A HD22 16 
ATOM   9791  N  N    . PRO A 1 12 ? -8.277  -5.418  1.463   1.00 0.00 ? 12  PRO A N    16 
ATOM   9792  C  CA   . PRO A 1 12 ? -8.799  -4.194  0.849   1.00 0.00 ? 12  PRO A CA   16 
ATOM   9793  C  C    . PRO A 1 12 ? -7.692  -3.314  0.278   1.00 0.00 ? 12  PRO A C    16 
ATOM   9794  O  O    . PRO A 1 12 ? -7.754  -2.894  -0.878  1.00 0.00 ? 12  PRO A O    16 
ATOM   9795  C  CB   . PRO A 1 12 ? -9.499  -3.485  2.012   1.00 0.00 ? 12  PRO A CB   16 
ATOM   9796  C  CG   . PRO A 1 12 ? -8.812  -3.991  3.233   1.00 0.00 ? 12  PRO A CG   16 
ATOM   9797  C  CD   . PRO A 1 12 ? -8.419  -5.410  2.929   1.00 0.00 ? 12  PRO A CD   16 
ATOM   9798  H  HA   . PRO A 1 12 ? -9.519  -4.414  0.074   1.00 0.00 ? 12  PRO A HA   16 
ATOM   9799  H  HB2  . PRO A 1 12 ? -9.383  -2.415  1.906   1.00 0.00 ? 12  PRO A HB2  16 
ATOM   9800  H  HB3  . PRO A 1 12 ? -10.548 -3.741  2.015   1.00 0.00 ? 12  PRO A HB3  16 
ATOM   9801  H  HG2  . PRO A 1 12 ? -7.935  -3.394  3.435   1.00 0.00 ? 12  PRO A HG2  16 
ATOM   9802  H  HG3  . PRO A 1 12 ? -9.489  -3.962  4.073   1.00 0.00 ? 12  PRO A HG3  16 
ATOM   9803  H  HD2  . PRO A 1 12 ? -7.482  -5.653  3.408   1.00 0.00 ? 12  PRO A HD2  16 
ATOM   9804  H  HD3  . PRO A 1 12 ? -9.194  -6.092  3.244   1.00 0.00 ? 12  PRO A HD3  16 
ATOM   9805  N  N    . PHE A 1 13 ? -6.680  -3.040  1.094   1.00 0.00 ? 13  PHE A N    16 
ATOM   9806  C  CA   . PHE A 1 13 ? -5.559  -2.210  0.669   1.00 0.00 ? 13  PHE A CA   16 
ATOM   9807  C  C    . PHE A 1 13 ? -4.315  -2.509  1.500   1.00 0.00 ? 13  PHE A C    16 
ATOM   9808  O  O    . PHE A 1 13 ? -4.324  -2.368  2.724   1.00 0.00 ? 13  PHE A O    16 
ATOM   9809  C  CB   . PHE A 1 13 ? -5.921  -0.728  0.788   1.00 0.00 ? 13  PHE A CB   16 
ATOM   9810  C  CG   . PHE A 1 13 ? -7.162  -0.351  0.030   1.00 0.00 ? 13  PHE A CG   16 
ATOM   9811  C  CD1  . PHE A 1 13 ? -7.147  -0.273  -1.354  1.00 0.00 ? 13  PHE A CD1  16 
ATOM   9812  C  CD2  . PHE A 1 13 ? -8.342  -0.076  0.700   1.00 0.00 ? 13  PHE A CD2  16 
ATOM   9813  C  CE1  . PHE A 1 13 ? -8.287  0.074   -2.053  1.00 0.00 ? 13  PHE A CE1  16 
ATOM   9814  C  CE2  . PHE A 1 13 ? -9.486  0.272   0.006   1.00 0.00 ? 13  PHE A CE2  16 
ATOM   9815  C  CZ   . PHE A 1 13 ? -9.458  0.345   -1.373  1.00 0.00 ? 13  PHE A CZ   16 
ATOM   9816  H  H    . PHE A 1 13 ? -6.688  -3.405  2.004   1.00 0.00 ? 13  PHE A H    16 
ATOM   9817  H  HA   . PHE A 1 13 ? -5.351  -2.439  -0.364  1.00 0.00 ? 13  PHE A HA   16 
ATOM   9818  H  HB2  . PHE A 1 13 ? -6.082  -0.486  1.828   1.00 0.00 ? 13  PHE A HB2  16 
ATOM   9819  H  HB3  . PHE A 1 13 ? -5.104  -0.134  0.406   1.00 0.00 ? 13  PHE A HB3  16 
ATOM   9820  H  HD1  . PHE A 1 13 ? -6.233  -0.486  -1.887  1.00 0.00 ? 13  PHE A HD1  16 
ATOM   9821  H  HD2  . PHE A 1 13 ? -8.365  -0.134  1.780   1.00 0.00 ? 13  PHE A HD2  16 
ATOM   9822  H  HE1  . PHE A 1 13 ? -8.263  0.131   -3.132  1.00 0.00 ? 13  PHE A HE1  16 
ATOM   9823  H  HE2  . PHE A 1 13 ? -10.400 0.483   0.541   1.00 0.00 ? 13  PHE A HE2  16 
ATOM   9824  H  HZ   . PHE A 1 13 ? -10.350 0.617   -1.918  1.00 0.00 ? 13  PHE A HZ   16 
ATOM   9825  N  N    . ILE A 1 14 ? -3.247  -2.923  0.827   1.00 0.00 ? 14  ILE A N    16 
ATOM   9826  C  CA   . ILE A 1 14 ? -1.995  -3.242  1.503   1.00 0.00 ? 14  ILE A CA   16 
ATOM   9827  C  C    . ILE A 1 14 ? -0.868  -2.330  1.031   1.00 0.00 ? 14  ILE A C    16 
ATOM   9828  O  O    . ILE A 1 14 ? -0.884  -1.838  -0.098  1.00 0.00 ? 14  ILE A O    16 
ATOM   9829  C  CB   . ILE A 1 14 ? -1.586  -4.708  1.269   1.00 0.00 ? 14  ILE A CB   16 
ATOM   9830  C  CG1  . ILE A 1 14 ? -2.666  -5.653  1.800   1.00 0.00 ? 14  ILE A CG1  16 
ATOM   9831  C  CG2  . ILE A 1 14 ? -0.249  -4.998  1.932   1.00 0.00 ? 14  ILE A CG2  16 
ATOM   9832  C  CD1  . ILE A 1 14 ? -2.895  -5.532  3.290   1.00 0.00 ? 14  ILE A CD1  16 
ATOM   9833  H  H    . ILE A 1 14 ? -3.301  -3.016  -0.146  1.00 0.00 ? 14  ILE A H    16 
ATOM   9834  H  HA   . ILE A 1 14 ? -2.142  -3.095  2.563   1.00 0.00 ? 14  ILE A HA   16 
ATOM   9835  H  HB   . ILE A 1 14 ? -1.475  -4.862  0.206   1.00 0.00 ? 14  ILE A HB   16 
ATOM   9836  H  HG12 . ILE A 1 14 ? -3.600  -5.438  1.304   1.00 0.00 ? 14  ILE A HG12 16 
ATOM   9837  H  HG13 . ILE A 1 14 ? -2.378  -6.672  1.589   1.00 0.00 ? 14  ILE A HG13 16 
ATOM   9838  H  HG21 . ILE A 1 14 ? -0.181  -4.449  2.860   1.00 0.00 ? 14  ILE A HG21 16 
ATOM   9839  H  HG22 . ILE A 1 14 ? -0.169  -6.055  2.135   1.00 0.00 ? 14  ILE A HG22 16 
ATOM   9840  H  HG23 . ILE A 1 14 ? 0.553   -4.695  1.275   1.00 0.00 ? 14  ILE A HG23 16 
ATOM   9841  H  HD11 . ILE A 1 14 ? -1.991  -5.179  3.765   1.00 0.00 ? 14  ILE A HD11 16 
ATOM   9842  H  HD12 . ILE A 1 14 ? -3.695  -4.831  3.477   1.00 0.00 ? 14  ILE A HD12 16 
ATOM   9843  H  HD13 . ILE A 1 14 ? -3.159  -6.498  3.694   1.00 0.00 ? 14  ILE A HD13 16 
ATOM   9844  N  N    . CYS A 1 15 ? 0.112   -2.110  1.902   1.00 0.00 ? 15  CYS A N    16 
ATOM   9845  C  CA   . CYS A 1 15 ? 1.249   -1.258  1.575   1.00 0.00 ? 15  CYS A CA   16 
ATOM   9846  C  C    . CYS A 1 15 ? 2.383   -2.076  0.965   1.00 0.00 ? 15  CYS A C    16 
ATOM   9847  O  O    . CYS A 1 15 ? 3.252   -2.580  1.676   1.00 0.00 ? 15  CYS A O    16 
ATOM   9848  C  CB   . CYS A 1 15 ? 1.745   -0.532  2.827   1.00 0.00 ? 15  CYS A CB   16 
ATOM   9849  S  SG   . CYS A 1 15 ? 2.789   0.920   2.479   1.00 0.00 ? 15  CYS A SG   16 
ATOM   9850  H  H    . CYS A 1 15 ? 0.068   -2.530  2.787   1.00 0.00 ? 15  CYS A H    16 
ATOM   9851  H  HA   . CYS A 1 15 ? 0.920   -0.527  0.852   1.00 0.00 ? 15  CYS A HA   16 
ATOM   9852  H  HB2  . CYS A 1 15 ? 0.894   -0.194  3.399   1.00 0.00 ? 15  CYS A HB2  16 
ATOM   9853  H  HB3  . CYS A 1 15 ? 2.325   -1.219  3.426   1.00 0.00 ? 15  CYS A HB3  16 
ATOM   9854  N  N    . SER A 1 16 ? 2.368   -2.204  -0.358  1.00 0.00 ? 16  SER A N    16 
ATOM   9855  C  CA   . SER A 1 16 ? 3.393   -2.963  -1.065  1.00 0.00 ? 16  SER A CA   16 
ATOM   9856  C  C    . SER A 1 16 ? 4.770   -2.713  -0.458  1.00 0.00 ? 16  SER A C    16 
ATOM   9857  O  O    . SER A 1 16 ? 5.658   -3.561  -0.537  1.00 0.00 ? 16  SER A O    16 
ATOM   9858  C  CB   . SER A 1 16 ? 3.401   -2.591  -2.549  1.00 0.00 ? 16  SER A CB   16 
ATOM   9859  O  OG   . SER A 1 16 ? 2.258   -3.105  -3.210  1.00 0.00 ? 16  SER A OG   16 
ATOM   9860  H  H    . SER A 1 16 ? 1.648   -1.779  -0.871  1.00 0.00 ? 16  SER A H    16 
ATOM   9861  H  HA   . SER A 1 16 ? 3.155   -4.012  -0.967  1.00 0.00 ? 16  SER A HA   16 
ATOM   9862  H  HB2  . SER A 1 16 ? 3.406   -1.516  -2.648  1.00 0.00 ? 16  SER A HB2  16 
ATOM   9863  H  HB3  . SER A 1 16 ? 4.286   -3.000  -3.015  1.00 0.00 ? 16  SER A HB3  16 
ATOM   9864  H  HG   . SER A 1 16 ? 2.488   -3.339  -4.112  1.00 0.00 ? 16  SER A HG   16 
ATOM   9865  N  N    . GLU A 1 17 ? 4.939   -1.541  0.147   1.00 0.00 ? 17  GLU A N    16 
ATOM   9866  C  CA   . GLU A 1 17 ? 6.208   -1.178  0.767   1.00 0.00 ? 17  GLU A CA   16 
ATOM   9867  C  C    . GLU A 1 17 ? 6.527   -2.105  1.936   1.00 0.00 ? 17  GLU A C    16 
ATOM   9868  O  O    . GLU A 1 17 ? 7.456   -2.911  1.868   1.00 0.00 ? 17  GLU A O    16 
ATOM   9869  C  CB   . GLU A 1 17 ? 6.168   0.274   1.249   1.00 0.00 ? 17  GLU A CB   16 
ATOM   9870  C  CG   . GLU A 1 17 ? 6.169   1.290   0.120   1.00 0.00 ? 17  GLU A CG   16 
ATOM   9871  C  CD   . GLU A 1 17 ? 4.992   1.119   -0.820  1.00 0.00 ? 17  GLU A CD   16 
ATOM   9872  O  OE1  . GLU A 1 17 ? 3.904   1.648   -0.509  1.00 0.00 ? 17  GLU A OE1  16 
ATOM   9873  O  OE2  . GLU A 1 17 ? 5.159   0.458   -1.866  1.00 0.00 ? 17  GLU A OE2  16 
ATOM   9874  H  H    . GLU A 1 17 ? 4.193   -0.907  0.178   1.00 0.00 ? 17  GLU A H    16 
ATOM   9875  H  HA   . GLU A 1 17 ? 6.982   -1.279  0.021   1.00 0.00 ? 17  GLU A HA   16 
ATOM   9876  H  HB2  . GLU A 1 17 ? 5.275   0.421   1.838   1.00 0.00 ? 17  GLU A HB2  16 
ATOM   9877  H  HB3  . GLU A 1 17 ? 7.032   0.457   1.871   1.00 0.00 ? 17  GLU A HB3  16 
ATOM   9878  H  HG2  . GLU A 1 17 ? 6.129   2.282   0.545   1.00 0.00 ? 17  GLU A HG2  16 
ATOM   9879  H  HG3  . GLU A 1 17 ? 7.083   1.179   -0.446  1.00 0.00 ? 17  GLU A HG3  16 
ATOM   9880  N  N    . CYS A 1 18 ? 5.752   -1.985  3.008   1.00 0.00 ? 18  CYS A N    16 
ATOM   9881  C  CA   . CYS A 1 18 ? 5.952   -2.810  4.194   1.00 0.00 ? 18  CYS A CA   16 
ATOM   9882  C  C    . CYS A 1 18 ? 4.955   -3.965  4.226   1.00 0.00 ? 18  CYS A C    16 
ATOM   9883  O  O    . CYS A 1 18 ? 5.334   -5.121  4.411   1.00 0.00 ? 18  CYS A O    16 
ATOM   9884  C  CB   . CYS A 1 18 ? 5.809   -1.963  5.460   1.00 0.00 ? 18  CYS A CB   16 
ATOM   9885  S  SG   . CYS A 1 18 ? 4.291   -0.958  5.516   1.00 0.00 ? 18  CYS A SG   16 
ATOM   9886  H  H    . CYS A 1 18 ? 5.028   -1.323  3.003   1.00 0.00 ? 18  CYS A H    16 
ATOM   9887  H  HA   . CYS A 1 18 ? 6.952   -3.214  4.152   1.00 0.00 ? 18  CYS A HA   16 
ATOM   9888  H  HB2  . CYS A 1 18 ? 5.802   -2.616  6.321   1.00 0.00 ? 18  CYS A HB2  16 
ATOM   9889  H  HB3  . CYS A 1 18 ? 6.652   -1.291  5.531   1.00 0.00 ? 18  CYS A HB3  16 
ATOM   9890  N  N    . GLY A 1 19 ? 3.678   -3.643  4.045   1.00 0.00 ? 19  GLY A N    16 
ATOM   9891  C  CA   . GLY A 1 19 ? 2.646   -4.664  4.057   1.00 0.00 ? 19  GLY A CA   16 
ATOM   9892  C  C    . GLY A 1 19 ? 1.600   -4.418  5.125   1.00 0.00 ? 19  GLY A C    16 
ATOM   9893  O  O    . GLY A 1 19 ? 1.171   -5.346  5.811   1.00 0.00 ? 19  GLY A O    16 
ATOM   9894  H  H    . GLY A 1 19 ? 3.434   -2.704  3.902   1.00 0.00 ? 19  GLY A H    16 
ATOM   9895  H  HA2  . GLY A 1 19 ? 2.163   -4.683  3.092   1.00 0.00 ? 19  GLY A HA2  16 
ATOM   9896  H  HA3  . GLY A 1 19 ? 3.108   -5.623  4.237   1.00 0.00 ? 19  GLY A HA3  16 
ATOM   9897  N  N    . LYS A 1 20 ? 1.187   -3.163  5.269   1.00 0.00 ? 20  LYS A N    16 
ATOM   9898  C  CA   . LYS A 1 20 ? 0.184   -2.796  6.262   1.00 0.00 ? 20  LYS A CA   16 
ATOM   9899  C  C    . LYS A 1 20 ? -1.190  -2.645  5.617   1.00 0.00 ? 20  LYS A C    16 
ATOM   9900  O  O    . LYS A 1 20 ? -1.332  -2.000  4.578   1.00 0.00 ? 20  LYS A O    16 
ATOM   9901  C  CB   . LYS A 1 20 ? 0.579   -1.491  6.957   1.00 0.00 ? 20  LYS A CB   16 
ATOM   9902  C  CG   . LYS A 1 20 ? 0.068   -1.383  8.384   1.00 0.00 ? 20  LYS A CG   16 
ATOM   9903  C  CD   . LYS A 1 20 ? 0.546   -0.105  9.052   1.00 0.00 ? 20  LYS A CD   16 
ATOM   9904  C  CE   . LYS A 1 20 ? 1.982   -0.233  9.537   1.00 0.00 ? 20  LYS A CE   16 
ATOM   9905  N  NZ   . LYS A 1 20 ? 2.253   0.648   10.706  1.00 0.00 ? 20  LYS A NZ   16 
ATOM   9906  H  H    . LYS A 1 20 ? 1.566   -2.466  4.693   1.00 0.00 ? 20  LYS A H    16 
ATOM   9907  H  HA   . LYS A 1 20 ? 0.140   -3.586  6.996   1.00 0.00 ? 20  LYS A HA   16 
ATOM   9908  H  HB2  . LYS A 1 20 ? 1.656   -1.419  6.976   1.00 0.00 ? 20  LYS A HB2  16 
ATOM   9909  H  HB3  . LYS A 1 20 ? 0.181   -0.661  6.391   1.00 0.00 ? 20  LYS A HB3  16 
ATOM   9910  H  HG2  . LYS A 1 20 ? -1.012  -1.388  8.371   1.00 0.00 ? 20  LYS A HG2  16 
ATOM   9911  H  HG3  . LYS A 1 20 ? 0.427   -2.231  8.950   1.00 0.00 ? 20  LYS A HG3  16 
ATOM   9912  H  HD2  . LYS A 1 20 ? 0.490   0.706   8.342   1.00 0.00 ? 20  LYS A HD2  16 
ATOM   9913  H  HD3  . LYS A 1 20 ? -0.093  0.109   9.898   1.00 0.00 ? 20  LYS A HD3  16 
ATOM   9914  H  HE2  . LYS A 1 20 ? 2.162   -1.259  9.821   1.00 0.00 ? 20  LYS A HE2  16 
ATOM   9915  H  HE3  . LYS A 1 20 ? 2.646   0.038   8.730   1.00 0.00 ? 20  LYS A HE3  16 
ATOM   9916  H  HZ1  . LYS A 1 20 ? 1.722   1.537   10.615  1.00 0.00 ? 20  LYS A HZ1  16 
ATOM   9917  H  HZ2  . LYS A 1 20 ? 3.269   0.868   10.760  1.00 0.00 ? 20  LYS A HZ2  16 
ATOM   9918  H  HZ3  . LYS A 1 20 ? 1.966   0.174   11.586  1.00 0.00 ? 20  LYS A HZ3  16 
ATOM   9919  N  N    . VAL A 1 21 ? -2.200  -3.244  6.241   1.00 0.00 ? 21  VAL A N    16 
ATOM   9920  C  CA   . VAL A 1 21 ? -3.563  -3.174  5.729   1.00 0.00 ? 21  VAL A CA   16 
ATOM   9921  C  C    . VAL A 1 21 ? -4.332  -2.023  6.368   1.00 0.00 ? 21  VAL A C    16 
ATOM   9922  O  O    . VAL A 1 21 ? -4.301  -1.842  7.586   1.00 0.00 ? 21  VAL A O    16 
ATOM   9923  C  CB   . VAL A 1 21 ? -4.325  -4.488  5.981   1.00 0.00 ? 21  VAL A CB   16 
ATOM   9924  C  CG1  . VAL A 1 21 ? -4.412  -4.778  7.471   1.00 0.00 ? 21  VAL A CG1  16 
ATOM   9925  C  CG2  . VAL A 1 21 ? -5.713  -4.427  5.360   1.00 0.00 ? 21  VAL A CG2  16 
ATOM   9926  H  H    . VAL A 1 21 ? -2.024  -3.743  7.065   1.00 0.00 ? 21  VAL A H    16 
ATOM   9927  H  HA   . VAL A 1 21 ? -3.512  -3.011  4.662   1.00 0.00 ? 21  VAL A HA   16 
ATOM   9928  H  HB   . VAL A 1 21 ? -3.779  -5.293  5.511   1.00 0.00 ? 21  VAL A HB   16 
ATOM   9929  H  HG11 . VAL A 1 21 ? -3.430  -4.688  7.913   1.00 0.00 ? 21  VAL A HG11 16 
ATOM   9930  H  HG12 . VAL A 1 21 ? -5.084  -4.073  7.937   1.00 0.00 ? 21  VAL A HG12 16 
ATOM   9931  H  HG13 . VAL A 1 21 ? -4.783  -5.782  7.622   1.00 0.00 ? 21  VAL A HG13 16 
ATOM   9932  H  HG21 . VAL A 1 21 ? -6.027  -3.397  5.280   1.00 0.00 ? 21  VAL A HG21 16 
ATOM   9933  H  HG22 . VAL A 1 21 ? -5.686  -4.873  4.377   1.00 0.00 ? 21  VAL A HG22 16 
ATOM   9934  H  HG23 . VAL A 1 21 ? -6.411  -4.968  5.982   1.00 0.00 ? 21  VAL A HG23 16 
ATOM   9935  N  N    . PHE A 1 22 ? -5.022  -1.247  5.539   1.00 0.00 ? 22  PHE A N    16 
ATOM   9936  C  CA   . PHE A 1 22 ? -5.800  -0.112  6.023   1.00 0.00 ? 22  PHE A CA   16 
ATOM   9937  C  C    . PHE A 1 22 ? -7.267  -0.249  5.626   1.00 0.00 ? 22  PHE A C    16 
ATOM   9938  O  O    . PHE A 1 22 ? -7.586  -0.541  4.473   1.00 0.00 ? 22  PHE A O    16 
ATOM   9939  C  CB   . PHE A 1 22 ? -5.230  1.196   5.472   1.00 0.00 ? 22  PHE A CB   16 
ATOM   9940  C  CG   . PHE A 1 22 ? -3.793  1.428   5.843   1.00 0.00 ? 22  PHE A CG   16 
ATOM   9941  C  CD1  . PHE A 1 22 ? -2.771  0.892   5.077   1.00 0.00 ? 22  PHE A CD1  16 
ATOM   9942  C  CD2  . PHE A 1 22 ? -3.465  2.182   6.958   1.00 0.00 ? 22  PHE A CD2  16 
ATOM   9943  C  CE1  . PHE A 1 22 ? -1.448  1.104   5.417   1.00 0.00 ? 22  PHE A CE1  16 
ATOM   9944  C  CE2  . PHE A 1 22 ? -2.144  2.397   7.303   1.00 0.00 ? 22  PHE A CE2  16 
ATOM   9945  C  CZ   . PHE A 1 22 ? -1.134  1.858   6.531   1.00 0.00 ? 22  PHE A CZ   16 
ATOM   9946  H  H    . PHE A 1 22 ? -5.008  -1.442  4.579   1.00 0.00 ? 22  PHE A H    16 
ATOM   9947  H  HA   . PHE A 1 22 ? -5.731  -0.099  7.100   1.00 0.00 ? 22  PHE A HA   16 
ATOM   9948  H  HB2  . PHE A 1 22 ? -5.295  1.183   4.394   1.00 0.00 ? 22  PHE A HB2  16 
ATOM   9949  H  HB3  . PHE A 1 22 ? -5.810  2.023   5.854   1.00 0.00 ? 22  PHE A HB3  16 
ATOM   9950  H  HD1  . PHE A 1 22 ? -3.014  0.303   4.205   1.00 0.00 ? 22  PHE A HD1  16 
ATOM   9951  H  HD2  . PHE A 1 22 ? -4.255  2.605   7.563   1.00 0.00 ? 22  PHE A HD2  16 
ATOM   9952  H  HE1  . PHE A 1 22 ? -0.660  0.681   4.812   1.00 0.00 ? 22  PHE A HE1  16 
ATOM   9953  H  HE2  . PHE A 1 22 ? -1.903  2.988   8.175   1.00 0.00 ? 22  PHE A HE2  16 
ATOM   9954  H  HZ   . PHE A 1 22 ? -0.101  2.024   6.799   1.00 0.00 ? 22  PHE A HZ   16 
ATOM   9955  N  N    . THR A 1 23 ? -8.157  -0.036  6.590   1.00 0.00 ? 23  THR A N    16 
ATOM   9956  C  CA   . THR A 1 23 ? -9.590  -0.136  6.343   1.00 0.00 ? 23  THR A CA   16 
ATOM   9957  C  C    . THR A 1 23 ? -10.050 0.915   5.340   1.00 0.00 ? 23  THR A C    16 
ATOM   9958  O  O    . THR A 1 23 ? -11.123 0.795   4.747   1.00 0.00 ? 23  THR A O    16 
ATOM   9959  C  CB   . THR A 1 23 ? -10.397 0.025   7.645   1.00 0.00 ? 23  THR A CB   16 
ATOM   9960  O  OG1  . THR A 1 23 ? -9.828  1.064   8.449   1.00 0.00 ? 23  THR A OG1  16 
ATOM   9961  C  CG2  . THR A 1 23 ? -10.421 -1.277  8.431   1.00 0.00 ? 23  THR A CG2  16 
ATOM   9962  H  H    . THR A 1 23 ? -7.841  0.194   7.489   1.00 0.00 ? 23  THR A H    16 
ATOM   9963  H  HA   . THR A 1 23 ? -9.791  -1.118  5.938   1.00 0.00 ? 23  THR A HA   16 
ATOM   9964  H  HB   . THR A 1 23 ? -11.413 0.293   7.390   1.00 0.00 ? 23  THR A HB   16 
ATOM   9965  H  HG1  . THR A 1 23 ? -9.200  0.682   9.068   1.00 0.00 ? 23  THR A HG1  16 
ATOM   9966  H  HG21 . THR A 1 23 ? -9.409  -1.609  8.607   1.00 0.00 ? 23  THR A HG21 16 
ATOM   9967  H  HG22 . THR A 1 23 ? -10.953 -2.029  7.867   1.00 0.00 ? 23  THR A HG22 16 
ATOM   9968  H  HG23 . THR A 1 23 ? -10.917 -1.117  9.377   1.00 0.00 ? 23  THR A HG23 16 
ATOM   9969  N  N    . HIS A 1 24 ? -9.232  1.946   5.153   1.00 0.00 ? 24  HIS A N    16 
ATOM   9970  C  CA   . HIS A 1 24 ? -9.555  3.019   4.219   1.00 0.00 ? 24  HIS A CA   16 
ATOM   9971  C  C    . HIS A 1 24 ? -8.306  3.491   3.480   1.00 0.00 ? 24  HIS A C    16 
ATOM   9972  O  O    . HIS A 1 24 ? -7.383  4.037   4.084   1.00 0.00 ? 24  HIS A O    16 
ATOM   9973  C  CB   . HIS A 1 24 ? -10.197 4.193   4.960   1.00 0.00 ? 24  HIS A CB   16 
ATOM   9974  C  CG   . HIS A 1 24 ? -9.440  4.616   6.181   1.00 0.00 ? 24  HIS A CG   16 
ATOM   9975  N  ND1  . HIS A 1 24 ? -9.165  5.934   6.477   1.00 0.00 ? 24  HIS A ND1  16 
ATOM   9976  C  CD2  . HIS A 1 24 ? -8.900  3.886   7.186   1.00 0.00 ? 24  HIS A CD2  16 
ATOM   9977  C  CE1  . HIS A 1 24 ? -8.488  5.997   7.610   1.00 0.00 ? 24  HIS A CE1  16 
ATOM   9978  N  NE2  . HIS A 1 24 ? -8.314  4.768   8.060   1.00 0.00 ? 24  HIS A NE2  16 
ATOM   9979  H  H    . HIS A 1 24 ? -8.391  1.986   5.654   1.00 0.00 ? 24  HIS A H    16 
ATOM   9980  H  HA   . HIS A 1 24 ? -10.259 2.631   3.499   1.00 0.00 ? 24  HIS A HA   16 
ATOM   9981  H  HB2  . HIS A 1 24 ? -10.254 5.042   4.295   1.00 0.00 ? 24  HIS A HB2  16 
ATOM   9982  H  HB3  . HIS A 1 24 ? -11.194 3.914   5.267   1.00 0.00 ? 24  HIS A HB3  16 
ATOM   9983  H  HD1  . HIS A 1 24 ? -9.426  6.709   5.937   1.00 0.00 ? 24  HIS A HD1  16 
ATOM   9984  H  HD2  . HIS A 1 24 ? -8.925  2.810   7.282   1.00 0.00 ? 24  HIS A HD2  16 
ATOM   9985  H  HE1  . HIS A 1 24 ? -8.136  6.900   8.087   1.00 0.00 ? 24  HIS A HE1  16 
ATOM   9986  N  N    . LYS A 1 25 ? -8.284  3.275   2.169   1.00 0.00 ? 25  LYS A N    16 
ATOM   9987  C  CA   . LYS A 1 25 ? -7.150  3.678   1.346   1.00 0.00 ? 25  LYS A CA   16 
ATOM   9988  C  C    . LYS A 1 25 ? -6.529  4.969   1.869   1.00 0.00 ? 25  LYS A C    16 
ATOM   9989  O  O    . LYS A 1 25 ? -5.310  5.072   2.010   1.00 0.00 ? 25  LYS A O    16 
ATOM   9990  C  CB   . LYS A 1 25 ? -7.589  3.863   -0.108  1.00 0.00 ? 25  LYS A CB   16 
ATOM   9991  C  CG   . LYS A 1 25 ? -6.492  3.568   -1.117  1.00 0.00 ? 25  LYS A CG   16 
ATOM   9992  C  CD   . LYS A 1 25 ? -6.955  3.839   -2.539  1.00 0.00 ? 25  LYS A CD   16 
ATOM   9993  C  CE   . LYS A 1 25 ? -7.950  2.790   -3.011  1.00 0.00 ? 25  LYS A CE   16 
ATOM   9994  N  NZ   . LYS A 1 25 ? -8.812  3.299   -4.113  1.00 0.00 ? 25  LYS A NZ   16 
ATOM   9995  H  H    . LYS A 1 25 ? -9.051  2.835   1.744   1.00 0.00 ? 25  LYS A H    16 
ATOM   9996  H  HA   . LYS A 1 25 ? -6.411  2.893   1.393   1.00 0.00 ? 25  LYS A HA   16 
ATOM   9997  H  HB2  . LYS A 1 25 ? -8.420  3.203   -0.308  1.00 0.00 ? 25  LYS A HB2  16 
ATOM   9998  H  HB3  . LYS A 1 25 ? -7.911  4.886   -0.247  1.00 0.00 ? 25  LYS A HB3  16 
ATOM   9999  H  HG2  . LYS A 1 25 ? -5.640  4.195   -0.902  1.00 0.00 ? 25  LYS A HG2  16 
ATOM   10000 H  HG3  . LYS A 1 25 ? -6.209  2.529   -1.032  1.00 0.00 ? 25  LYS A HG3  16 
ATOM   10001 H  HD2  . LYS A 1 25 ? -7.427  4.809   -2.576  1.00 0.00 ? 25  LYS A HD2  16 
ATOM   10002 H  HD3  . LYS A 1 25 ? -6.096  3.830   -3.195  1.00 0.00 ? 25  LYS A HD3  16 
ATOM   10003 H  HE2  . LYS A 1 25 ? -7.405  1.927   -3.361  1.00 0.00 ? 25  LYS A HE2  16 
ATOM   10004 H  HE3  . LYS A 1 25 ? -8.576  2.507   -2.177  1.00 0.00 ? 25  LYS A HE3  16 
ATOM   10005 H  HZ1  . LYS A 1 25 ? -8.412  3.028   -5.034  1.00 0.00 ? 25  LYS A HZ1  16 
ATOM   10006 H  HZ2  . LYS A 1 25 ? -8.875  4.336   -4.067  1.00 0.00 ? 25  LYS A HZ2  16 
ATOM   10007 H  HZ3  . LYS A 1 25 ? -9.769  2.901   -4.032  1.00 0.00 ? 25  LYS A HZ3  16 
ATOM   10008 N  N    . THR A 1 26 ? -7.376  5.953   2.158   1.00 0.00 ? 26  THR A N    16 
ATOM   10009 C  CA   . THR A 1 26 ? -6.910  7.237   2.666   1.00 0.00 ? 26  THR A CA   16 
ATOM   10010 C  C    . THR A 1 26 ? -5.709  7.062   3.587   1.00 0.00 ? 26  THR A C    16 
ATOM   10011 O  O    . THR A 1 26 ? -4.637  7.612   3.337   1.00 0.00 ? 26  THR A O    16 
ATOM   10012 C  CB   . THR A 1 26 ? -8.025  7.977   3.430   1.00 0.00 ? 26  THR A CB   16 
ATOM   10013 O  OG1  . THR A 1 26 ? -9.136  8.220   2.561   1.00 0.00 ? 26  THR A OG1  16 
ATOM   10014 C  CG2  . THR A 1 26 ? -7.514  9.295   3.991   1.00 0.00 ? 26  THR A CG2  16 
ATOM   10015 H  H    . THR A 1 26 ? -8.336  5.811   2.024   1.00 0.00 ? 26  THR A H    16 
ATOM   10016 H  HA   . THR A 1 26 ? -6.618  7.844   1.821   1.00 0.00 ? 26  THR A HA   16 
ATOM   10017 H  HB   . THR A 1 26 ? -8.350  7.355   4.252   1.00 0.00 ? 26  THR A HB   16 
ATOM   10018 H  HG1  . THR A 1 26 ? -9.016  9.063   2.116   1.00 0.00 ? 26  THR A HG1  16 
ATOM   10019 H  HG21 . THR A 1 26 ? -7.212  9.156   5.018   1.00 0.00 ? 26  THR A HG21 16 
ATOM   10020 H  HG22 . THR A 1 26 ? -8.300  10.035  3.944   1.00 0.00 ? 26  THR A HG22 16 
ATOM   10021 H  HG23 . THR A 1 26 ? -6.668  9.630   3.409   1.00 0.00 ? 26  THR A HG23 16 
ATOM   10022 N  N    . ASN A 1 27 ? -5.894  6.290   4.653   1.00 0.00 ? 27  ASN A N    16 
ATOM   10023 C  CA   . ASN A 1 27 ? -4.824  6.042   5.612   1.00 0.00 ? 27  ASN A CA   16 
ATOM   10024 C  C    . ASN A 1 27 ? -3.585  5.491   4.914   1.00 0.00 ? 27  ASN A C    16 
ATOM   10025 O  O    . ASN A 1 27 ? -2.466  5.944   5.162   1.00 0.00 ? 27  ASN A O    16 
ATOM   10026 C  CB   . ASN A 1 27 ? -5.294  5.061   6.689   1.00 0.00 ? 27  ASN A CB   16 
ATOM   10027 C  CG   . ASN A 1 27 ? -4.479  5.169   7.964   1.00 0.00 ? 27  ASN A CG   16 
ATOM   10028 O  OD1  . ASN A 1 27 ? -3.260  4.996   7.951   1.00 0.00 ? 27  ASN A OD1  16 
ATOM   10029 N  ND2  . ASN A 1 27 ? -5.151  5.455   9.073   1.00 0.00 ? 27  ASN A ND2  16 
ATOM   10030 H  H    . ASN A 1 27 ? -6.772  5.878   4.799   1.00 0.00 ? 27  ASN A H    16 
ATOM   10031 H  HA   . ASN A 1 27 ? -4.573  6.982   6.079   1.00 0.00 ? 27  ASN A HA   16 
ATOM   10032 H  HB2  . ASN A 1 27 ? -6.328  5.266   6.928   1.00 0.00 ? 27  ASN A HB2  16 
ATOM   10033 H  HB3  . ASN A 1 27 ? -5.208  4.053   6.313   1.00 0.00 ? 27  ASN A HB3  16 
ATOM   10034 H  HD21 . ASN A 1 27 ? -6.121  5.580   9.008   1.00 0.00 ? 27  ASN A HD21 16 
ATOM   10035 H  HD22 . ASN A 1 27 ? -4.649  5.531   9.911   1.00 0.00 ? 27  ASN A HD22 16 
ATOM   10036 N  N    . LEU A 1 28 ? -3.791  4.513   4.039   1.00 0.00 ? 28  LEU A N    16 
ATOM   10037 C  CA   . LEU A 1 28 ? -2.690  3.900   3.303   1.00 0.00 ? 28  LEU A CA   16 
ATOM   10038 C  C    . LEU A 1 28 ? -1.900  4.951   2.531   1.00 0.00 ? 28  LEU A C    16 
ATOM   10039 O  O    . LEU A 1 28 ? -0.669  4.954   2.549   1.00 0.00 ? 28  LEU A O    16 
ATOM   10040 C  CB   . LEU A 1 28 ? -3.223  2.837   2.341   1.00 0.00 ? 28  LEU A CB   16 
ATOM   10041 C  CG   . LEU A 1 28 ? -2.261  2.382   1.243   1.00 0.00 ? 28  LEU A CG   16 
ATOM   10042 C  CD1  . LEU A 1 28 ? -1.193  1.464   1.817   1.00 0.00 ? 28  LEU A CD1  16 
ATOM   10043 C  CD2  . LEU A 1 28 ? -3.020  1.685   0.124   1.00 0.00 ? 28  LEU A CD2  16 
ATOM   10044 H  H    . LEU A 1 28 ? -4.704  4.194   3.884   1.00 0.00 ? 28  LEU A H    16 
ATOM   10045 H  HA   . LEU A 1 28 ? -2.034  3.428   4.020   1.00 0.00 ? 28  LEU A HA   16 
ATOM   10046 H  HB2  . LEU A 1 28 ? -3.494  1.970   2.923   1.00 0.00 ? 28  LEU A HB2  16 
ATOM   10047 H  HB3  . LEU A 1 28 ? -4.106  3.238   1.863   1.00 0.00 ? 28  LEU A HB3  16 
ATOM   10048 H  HG   . LEU A 1 28 ? -1.766  3.248   0.825   1.00 0.00 ? 28  LEU A HG   16 
ATOM   10049 H  HD11 . LEU A 1 28 ? -0.318  2.044   2.071   1.00 0.00 ? 28  LEU A HD11 16 
ATOM   10050 H  HD12 . LEU A 1 28 ? -0.929  0.716   1.084   1.00 0.00 ? 28  LEU A HD12 16 
ATOM   10051 H  HD13 . LEU A 1 28 ? -1.574  0.979   2.704   1.00 0.00 ? 28  LEU A HD13 16 
ATOM   10052 H  HD21 . LEU A 1 28 ? -4.057  1.578   0.404   1.00 0.00 ? 28  LEU A HD21 16 
ATOM   10053 H  HD22 . LEU A 1 28 ? -2.591  0.709   -0.049  1.00 0.00 ? 28  LEU A HD22 16 
ATOM   10054 H  HD23 . LEU A 1 28 ? -2.949  2.274   -0.780  1.00 0.00 ? 28  LEU A HD23 16 
ATOM   10055 N  N    . ILE A 1 29 ? -2.615  5.844   1.855   1.00 0.00 ? 29  ILE A N    16 
ATOM   10056 C  CA   . ILE A 1 29 ? -1.981  6.902   1.079   1.00 0.00 ? 29  ILE A CA   16 
ATOM   10057 C  C    . ILE A 1 29 ? -1.174  7.833   1.978   1.00 0.00 ? 29  ILE A C    16 
ATOM   10058 O  O    . ILE A 1 29 ? -0.105  8.311   1.594   1.00 0.00 ? 29  ILE A O    16 
ATOM   10059 C  CB   . ILE A 1 29 ? -3.020  7.731   0.301   1.00 0.00 ? 29  ILE A CB   16 
ATOM   10060 C  CG1  . ILE A 1 29 ? -3.748  6.850   -0.717  1.00 0.00 ? 29  ILE A CG1  16 
ATOM   10061 C  CG2  . ILE A 1 29 ? -2.348  8.907   -0.392  1.00 0.00 ? 29  ILE A CG2  16 
ATOM   10062 C  CD1  . ILE A 1 29 ? -5.056  7.438   -1.198  1.00 0.00 ? 29  ILE A CD1  16 
ATOM   10063 H  H    . ILE A 1 29 ? -3.593  5.790   1.879   1.00 0.00 ? 29  ILE A H    16 
ATOM   10064 H  HA   . ILE A 1 29 ? -1.313  6.438   0.367   1.00 0.00 ? 29  ILE A HA   16 
ATOM   10065 H  HB   . ILE A 1 29 ? -3.737  8.121   1.007   1.00 0.00 ? 29  ILE A HB   16 
ATOM   10066 H  HG12 . ILE A 1 29 ? -3.113  6.705   -1.577  1.00 0.00 ? 29  ILE A HG12 16 
ATOM   10067 H  HG13 . ILE A 1 29 ? -3.960  5.892   -0.265  1.00 0.00 ? 29  ILE A HG13 16 
ATOM   10068 H  HG21 . ILE A 1 29 ? -2.049  9.636   0.346   1.00 0.00 ? 29  ILE A HG21 16 
ATOM   10069 H  HG22 . ILE A 1 29 ? -1.477  8.559   -0.926  1.00 0.00 ? 29  ILE A HG22 16 
ATOM   10070 H  HG23 . ILE A 1 29 ? -3.040  9.359   -1.085  1.00 0.00 ? 29  ILE A HG23 16 
ATOM   10071 H  HD11 . ILE A 1 29 ? -5.641  6.667   -1.679  1.00 0.00 ? 29  ILE A HD11 16 
ATOM   10072 H  HD12 . ILE A 1 29 ? -5.605  7.833   -0.356  1.00 0.00 ? 29  ILE A HD12 16 
ATOM   10073 H  HD13 . ILE A 1 29 ? -4.857  8.231   -1.903  1.00 0.00 ? 29  ILE A HD13 16 
ATOM   10074 N  N    . ILE A 1 30 ? -1.691  8.086   3.175   1.00 0.00 ? 30  ILE A N    16 
ATOM   10075 C  CA   . ILE A 1 30 ? -1.017  8.958   4.129   1.00 0.00 ? 30  ILE A CA   16 
ATOM   10076 C  C    . ILE A 1 30 ? 0.157   8.245   4.791   1.00 0.00 ? 30  ILE A C    16 
ATOM   10077 O  O    . ILE A 1 30 ? 1.170   8.865   5.118   1.00 0.00 ? 30  ILE A O    16 
ATOM   10078 C  CB   . ILE A 1 30 ? -1.984  9.453   5.221   1.00 0.00 ? 30  ILE A CB   16 
ATOM   10079 C  CG1  . ILE A 1 30 ? -3.155  10.209  4.590   1.00 0.00 ? 30  ILE A CG1  16 
ATOM   10080 C  CG2  . ILE A 1 30 ? -1.251  10.338  6.217   1.00 0.00 ? 30  ILE A CG2  16 
ATOM   10081 C  CD1  . ILE A 1 30 ? -4.189  10.668  5.594   1.00 0.00 ? 30  ILE A CD1  16 
ATOM   10082 H  H    . ILE A 1 30 ? -2.545  7.676   3.423   1.00 0.00 ? 30  ILE A H    16 
ATOM   10083 H  HA   . ILE A 1 30 ? -0.644  9.817   3.590   1.00 0.00 ? 30  ILE A HA   16 
ATOM   10084 H  HB   . ILE A 1 30 ? -2.364  8.593   5.751   1.00 0.00 ? 30  ILE A HB   16 
ATOM   10085 H  HG12 . ILE A 1 30 ? -2.780  11.081  4.079   1.00 0.00 ? 30  ILE A HG12 16 
ATOM   10086 H  HG13 . ILE A 1 30 ? -3.648  9.564   3.877   1.00 0.00 ? 30  ILE A HG13 16 
ATOM   10087 H  HG21 . ILE A 1 30 ? -0.861  11.207  5.707   1.00 0.00 ? 30  ILE A HG21 16 
ATOM   10088 H  HG22 . ILE A 1 30 ? -1.935  10.653  6.990   1.00 0.00 ? 30  ILE A HG22 16 
ATOM   10089 H  HG23 . ILE A 1 30 ? -0.436  9.785   6.659   1.00 0.00 ? 30  ILE A HG23 16 
ATOM   10090 H  HD11 . ILE A 1 30 ? -4.159  11.746  5.674   1.00 0.00 ? 30  ILE A HD11 16 
ATOM   10091 H  HD12 . ILE A 1 30 ? -5.171  10.360  5.267   1.00 0.00 ? 30  ILE A HD12 16 
ATOM   10092 H  HD13 . ILE A 1 30 ? -3.975  10.230  6.557   1.00 0.00 ? 30  ILE A HD13 16 
ATOM   10093 N  N    . HIS A 1 31 ? 0.015   6.938   4.986   1.00 0.00 ? 31  HIS A N    16 
ATOM   10094 C  CA   . HIS A 1 31 ? 1.065   6.138   5.607   1.00 0.00 ? 31  HIS A CA   16 
ATOM   10095 C  C    . HIS A 1 31 ? 2.258   5.985   4.669   1.00 0.00 ? 31  HIS A C    16 
ATOM   10096 O  O    . HIS A 1 31 ? 3.374   6.383   5.000   1.00 0.00 ? 31  HIS A O    16 
ATOM   10097 C  CB   . HIS A 1 31 ? 0.525   4.761   5.994   1.00 0.00 ? 31  HIS A CB   16 
ATOM   10098 C  CG   . HIS A 1 31 ? 1.589   3.715   6.121   1.00 0.00 ? 31  HIS A CG   16 
ATOM   10099 N  ND1  . HIS A 1 31 ? 2.152   3.357   7.328   1.00 0.00 ? 31  HIS A ND1  16 
ATOM   10100 C  CD2  . HIS A 1 31 ? 2.192   2.947   5.184   1.00 0.00 ? 31  HIS A CD2  16 
ATOM   10101 C  CE1  . HIS A 1 31 ? 3.056   2.415   7.127   1.00 0.00 ? 31  HIS A CE1  16 
ATOM   10102 N  NE2  . HIS A 1 31 ? 3.100   2.148   5.835   1.00 0.00 ? 31  HIS A NE2  16 
ATOM   10103 H  H    . HIS A 1 31 ? -0.815  6.500   4.704   1.00 0.00 ? 31  HIS A H    16 
ATOM   10104 H  HA   . HIS A 1 31 ? 1.389   6.652   6.499   1.00 0.00 ? 31  HIS A HA   16 
ATOM   10105 H  HB2  . HIS A 1 31 ? 0.018   4.835   6.945   1.00 0.00 ? 31  HIS A HB2  16 
ATOM   10106 H  HB3  . HIS A 1 31 ? -0.177  4.432   5.242   1.00 0.00 ? 31  HIS A HB3  16 
ATOM   10107 H  HD1  . HIS A 1 31 ? 1.924   3.737   8.201   1.00 0.00 ? 31  HIS A HD1  16 
ATOM   10108 H  HD2  . HIS A 1 31 ? 1.996   2.960   4.121   1.00 0.00 ? 31  HIS A HD2  16 
ATOM   10109 H  HE1  . HIS A 1 31 ? 3.658   1.943   7.890   1.00 0.00 ? 31  HIS A HE1  16 
ATOM   10110 N  N    . GLN A 1 32 ? 2.013   5.404   3.498   1.00 0.00 ? 32  GLN A N    16 
ATOM   10111 C  CA   . GLN A 1 32 ? 3.069   5.197   2.514   1.00 0.00 ? 32  GLN A CA   16 
ATOM   10112 C  C    . GLN A 1 32 ? 4.072   6.346   2.541   1.00 0.00 ? 32  GLN A C    16 
ATOM   10113 O  O    . GLN A 1 32 ? 5.258   6.155   2.270   1.00 0.00 ? 32  GLN A O    16 
ATOM   10114 C  CB   . GLN A 1 32 ? 2.469   5.061   1.113   1.00 0.00 ? 32  GLN A CB   16 
ATOM   10115 C  CG   . GLN A 1 32 ? 1.727   3.753   0.893   1.00 0.00 ? 32  GLN A CG   16 
ATOM   10116 C  CD   . GLN A 1 32 ? 0.929   3.744   -0.396  1.00 0.00 ? 32  GLN A CD   16 
ATOM   10117 O  OE1  . GLN A 1 32 ? 0.920   4.725   -1.141  1.00 0.00 ? 32  GLN A OE1  16 
ATOM   10118 N  NE2  . GLN A 1 32 ? 0.255   2.633   -0.668  1.00 0.00 ? 32  GLN A NE2  16 
ATOM   10119 H  H    . GLN A 1 32 ? 1.103   5.108   3.293   1.00 0.00 ? 32  GLN A H    16 
ATOM   10120 H  HA   . GLN A 1 32 ? 3.582   4.282   2.765   1.00 0.00 ? 32  GLN A HA   16 
ATOM   10121 H  HB2  . GLN A 1 32 ? 1.777   5.875   0.950   1.00 0.00 ? 32  GLN A HB2  16 
ATOM   10122 H  HB3  . GLN A 1 32 ? 3.265   5.125   0.386   1.00 0.00 ? 32  GLN A HB3  16 
ATOM   10123 H  HG2  . GLN A 1 32 ? 2.445   2.948   0.859   1.00 0.00 ? 32  GLN A HG2  16 
ATOM   10124 H  HG3  . GLN A 1 32 ? 1.049   3.595   1.719   1.00 0.00 ? 32  GLN A HG3  16 
ATOM   10125 H  HE21 . GLN A 1 32 ? 0.308   1.892   -0.028  1.00 0.00 ? 32  GLN A HE21 16 
ATOM   10126 H  HE22 . GLN A 1 32 ? -0.269  2.599   -1.494  1.00 0.00 ? 32  GLN A HE22 16 
ATOM   10127 N  N    . LYS A 1 33 ? 3.588   7.539   2.870   1.00 0.00 ? 33  LYS A N    16 
ATOM   10128 C  CA   . LYS A 1 33 ? 4.442   8.719   2.934   1.00 0.00 ? 33  LYS A CA   16 
ATOM   10129 C  C    . LYS A 1 33 ? 5.714   8.429   3.723   1.00 0.00 ? 33  LYS A C    16 
ATOM   10130 O  O    . LYS A 1 33 ? 6.819   8.736   3.273   1.00 0.00 ? 33  LYS A O    16 
ATOM   10131 C  CB   . LYS A 1 33 ? 3.687   9.886   3.574   1.00 0.00 ? 33  LYS A CB   16 
ATOM   10132 C  CG   . LYS A 1 33 ? 2.455   10.315  2.795   1.00 0.00 ? 33  LYS A CG   16 
ATOM   10133 C  CD   . LYS A 1 33 ? 2.182   11.800  2.957   1.00 0.00 ? 33  LYS A CD   16 
ATOM   10134 C  CE   . LYS A 1 33 ? 1.289   12.328  1.844   1.00 0.00 ? 33  LYS A CE   16 
ATOM   10135 N  NZ   . LYS A 1 33 ? -0.148  12.035  2.101   1.00 0.00 ? 33  LYS A NZ   16 
ATOM   10136 H  H    . LYS A 1 33 ? 2.634   7.628   3.075   1.00 0.00 ? 33  LYS A H    16 
ATOM   10137 H  HA   . LYS A 1 33 ? 4.713   8.988   1.924   1.00 0.00 ? 33  LYS A HA   16 
ATOM   10138 H  HB2  . LYS A 1 33 ? 3.376   9.596   4.567   1.00 0.00 ? 33  LYS A HB2  16 
ATOM   10139 H  HB3  . LYS A 1 33 ? 4.353   10.733  3.648   1.00 0.00 ? 33  LYS A HB3  16 
ATOM   10140 H  HG2  . LYS A 1 33 ? 2.610   10.100  1.748   1.00 0.00 ? 33  LYS A HG2  16 
ATOM   10141 H  HG3  . LYS A 1 33 ? 1.601   9.759   3.156   1.00 0.00 ? 33  LYS A HG3  16 
ATOM   10142 H  HD2  . LYS A 1 33 ? 1.692   11.966  3.905   1.00 0.00 ? 33  LYS A HD2  16 
ATOM   10143 H  HD3  . LYS A 1 33 ? 3.121   12.335  2.937   1.00 0.00 ? 33  LYS A HD3  16 
ATOM   10144 H  HE2  . LYS A 1 33 ? 1.422   13.396  1.769   1.00 0.00 ? 33  LYS A HE2  16 
ATOM   10145 H  HE3  . LYS A 1 33 ? 1.582   11.862  0.915   1.00 0.00 ? 33  LYS A HE3  16 
ATOM   10146 H  HZ1  . LYS A 1 33 ? -0.261  11.588  3.033   1.00 0.00 ? 33  LYS A HZ1  16 
ATOM   10147 H  HZ2  . LYS A 1 33 ? -0.518  11.392  1.372   1.00 0.00 ? 33  LYS A HZ2  16 
ATOM   10148 H  HZ3  . LYS A 1 33 ? -0.701  12.916  2.082   1.00 0.00 ? 33  LYS A HZ3  16 
ATOM   10149 N  N    . ILE A 1 34 ? 5.552   7.835   4.901   1.00 0.00 ? 34  ILE A N    16 
ATOM   10150 C  CA   . ILE A 1 34 ? 6.688   7.501   5.750   1.00 0.00 ? 34  ILE A CA   16 
ATOM   10151 C  C    . ILE A 1 34 ? 7.814   6.868   4.940   1.00 0.00 ? 34  ILE A C    16 
ATOM   10152 O  O    . ILE A 1 34 ? 8.982   6.933   5.323   1.00 0.00 ? 34  ILE A O    16 
ATOM   10153 C  CB   . ILE A 1 34 ? 6.281   6.538   6.882   1.00 0.00 ? 34  ILE A CB   16 
ATOM   10154 C  CG1  . ILE A 1 34 ? 5.883   5.178   6.305   1.00 0.00 ? 34  ILE A CG1  16 
ATOM   10155 C  CG2  . ILE A 1 34 ? 5.139   7.130   7.695   1.00 0.00 ? 34  ILE A CG2  16 
ATOM   10156 C  CD1  . ILE A 1 34 ? 6.166   4.021   7.237   1.00 0.00 ? 34  ILE A CD1  16 
ATOM   10157 H  H    . ILE A 1 34 ? 4.647   7.616   5.204   1.00 0.00 ? 34  ILE A H    16 
ATOM   10158 H  HA   . ILE A 1 34 ? 7.050   8.416   6.197   1.00 0.00 ? 34  ILE A HA   16 
ATOM   10159 H  HB   . ILE A 1 34 ? 7.129   6.410   7.537   1.00 0.00 ? 34  ILE A HB   16 
ATOM   10160 H  HG12 . ILE A 1 34 ? 4.826   5.180   6.091   1.00 0.00 ? 34  ILE A HG12 16 
ATOM   10161 H  HG13 . ILE A 1 34 ? 6.431   5.010   5.389   1.00 0.00 ? 34  ILE A HG13 16 
ATOM   10162 H  HG21 . ILE A 1 34 ? 5.538   7.629   8.566   1.00 0.00 ? 34  ILE A HG21 16 
ATOM   10163 H  HG22 . ILE A 1 34 ? 4.597   7.841   7.090   1.00 0.00 ? 34  ILE A HG22 16 
ATOM   10164 H  HG23 . ILE A 1 34 ? 4.473   6.340   8.007   1.00 0.00 ? 34  ILE A HG23 16 
ATOM   10165 H  HD11 . ILE A 1 34 ? 5.232   3.589   7.567   1.00 0.00 ? 34  ILE A HD11 16 
ATOM   10166 H  HD12 . ILE A 1 34 ? 6.743   3.271   6.716   1.00 0.00 ? 34  ILE A HD12 16 
ATOM   10167 H  HD13 . ILE A 1 34 ? 6.721   4.374   8.092   1.00 0.00 ? 34  ILE A HD13 16 
ATOM   10168 N  N    . HIS A 1 35 ? 7.454   6.257   3.815   1.00 0.00 ? 35  HIS A N    16 
ATOM   10169 C  CA   . HIS A 1 35 ? 8.435   5.614   2.948   1.00 0.00 ? 35  HIS A CA   16 
ATOM   10170 C  C    . HIS A 1 35 ? 9.120   6.638   2.049   1.00 0.00 ? 35  HIS A C    16 
ATOM   10171 O  O    . HIS A 1 35 ? 10.311  6.525   1.755   1.00 0.00 ? 35  HIS A O    16 
ATOM   10172 C  CB   . HIS A 1 35 ? 7.763   4.538   2.094   1.00 0.00 ? 35  HIS A CB   16 
ATOM   10173 C  CG   . HIS A 1 35 ? 7.166   3.423   2.896   1.00 0.00 ? 35  HIS A CG   16 
ATOM   10174 N  ND1  . HIS A 1 35 ? 7.839   2.785   3.917   1.00 0.00 ? 35  HIS A ND1  16 
ATOM   10175 C  CD2  . HIS A 1 35 ? 5.949   2.834   2.824   1.00 0.00 ? 35  HIS A CD2  16 
ATOM   10176 C  CE1  . HIS A 1 35 ? 7.063   1.851   4.436   1.00 0.00 ? 35  HIS A CE1  16 
ATOM   10177 N  NE2  . HIS A 1 35 ? 5.910   1.860   3.791   1.00 0.00 ? 35  HIS A NE2  16 
ATOM   10178 H  H    . HIS A 1 35 ? 6.508   6.238   3.563   1.00 0.00 ? 35  HIS A H    16 
ATOM   10179 H  HA   . HIS A 1 35 ? 9.179   5.149   3.576   1.00 0.00 ? 35  HIS A HA   16 
ATOM   10180 H  HB2  . HIS A 1 35 ? 6.972   4.990   1.514   1.00 0.00 ? 35  HIS A HB2  16 
ATOM   10181 H  HB3  . HIS A 1 35 ? 8.495   4.110   1.424   1.00 0.00 ? 35  HIS A HB3  16 
ATOM   10182 H  HD1  . HIS A 1 35 ? 8.750   2.987   4.214   1.00 0.00 ? 35  HIS A HD1  16 
ATOM   10183 H  HD2  . HIS A 1 35 ? 5.156   3.082   2.133   1.00 0.00 ? 35  HIS A HD2  16 
ATOM   10184 H  HE1  . HIS A 1 35 ? 7.325   1.192   5.250   1.00 0.00 ? 35  HIS A HE1  16 
ATOM   10185 N  N    . THR A 1 36 ? 8.361   7.640   1.615   1.00 0.00 ? 36  THR A N    16 
ATOM   10186 C  CA   . THR A 1 36 ? 8.895   8.683   0.749   1.00 0.00 ? 36  THR A CA   16 
ATOM   10187 C  C    . THR A 1 36 ? 9.407   9.865   1.564   1.00 0.00 ? 36  THR A C    16 
ATOM   10188 O  O    . THR A 1 36 ? 9.933   10.831  1.012   1.00 0.00 ? 36  THR A O    16 
ATOM   10189 C  CB   . THR A 1 36 ? 7.832   9.184   -0.248  1.00 0.00 ? 36  THR A CB   16 
ATOM   10190 O  OG1  . THR A 1 36 ? 8.468   9.786   -1.381  1.00 0.00 ? 36  THR A OG1  16 
ATOM   10191 C  CG2  . THR A 1 36 ? 6.902   10.190  0.412   1.00 0.00 ? 36  THR A CG2  16 
ATOM   10192 H  H    . THR A 1 36 ? 7.420   7.675   1.884   1.00 0.00 ? 36  THR A H    16 
ATOM   10193 H  HA   . THR A 1 36 ? 9.716   8.263   0.187   1.00 0.00 ? 36  THR A HA   16 
ATOM   10194 H  HB   . THR A 1 36 ? 7.247   8.338   -0.581  1.00 0.00 ? 36  THR A HB   16 
ATOM   10195 H  HG1  . THR A 1 36 ? 7.804   10.192  -1.943  1.00 0.00 ? 36  THR A HG1  16 
ATOM   10196 H  HG21 . THR A 1 36 ? 5.888   10.007  0.091   1.00 0.00 ? 36  THR A HG21 16 
ATOM   10197 H  HG22 . THR A 1 36 ? 7.194   11.190  0.129   1.00 0.00 ? 36  THR A HG22 16 
ATOM   10198 H  HG23 . THR A 1 36 ? 6.964   10.087  1.486   1.00 0.00 ? 36  THR A HG23 16 
ATOM   10199 N  N    . GLY A 1 37 ? 9.252   9.782   2.882   1.00 0.00 ? 37  GLY A N    16 
ATOM   10200 C  CA   . GLY A 1 37 ? 9.705   10.852  3.751   1.00 0.00 ? 37  GLY A CA   16 
ATOM   10201 C  C    . GLY A 1 37 ? 10.577  10.348  4.884   1.00 0.00 ? 37  GLY A C    16 
ATOM   10202 O  O    . GLY A 1 37 ? 10.330  10.656  6.049   1.00 0.00 ? 37  GLY A O    16 
ATOM   10203 H  H    . GLY A 1 37 ? 8.826   8.987   3.266   1.00 0.00 ? 37  GLY A H    16 
ATOM   10204 H  HA2  . GLY A 1 37 ? 10.268  11.563  3.165   1.00 0.00 ? 37  GLY A HA2  16 
ATOM   10205 H  HA3  . GLY A 1 37 ? 8.842   11.349  4.170   1.00 0.00 ? 37  GLY A HA3  16 
ATOM   10206 N  N    . GLU A 1 38 ? 11.599  9.570   4.541   1.00 0.00 ? 38  GLU A N    16 
ATOM   10207 C  CA   . GLU A 1 38 ? 12.509  9.021   5.540   1.00 0.00 ? 38  GLU A CA   16 
ATOM   10208 C  C    . GLU A 1 38 ? 13.677  9.969   5.791   1.00 0.00 ? 38  GLU A C    16 
ATOM   10209 O  O    . GLU A 1 38 ? 14.510  10.192  4.913   1.00 0.00 ? 38  GLU A O    16 
ATOM   10210 C  CB   . GLU A 1 38 ? 13.034  7.656   5.088   1.00 0.00 ? 38  GLU A CB   16 
ATOM   10211 C  CG   . GLU A 1 38 ? 12.130  6.498   5.476   1.00 0.00 ? 38  GLU A CG   16 
ATOM   10212 C  CD   . GLU A 1 38 ? 11.876  6.432   6.970   1.00 0.00 ? 38  GLU A CD   16 
ATOM   10213 O  OE1  . GLU A 1 38 ? 12.687  6.992   7.736   1.00 0.00 ? 38  GLU A OE1  16 
ATOM   10214 O  OE2  . GLU A 1 38 ? 10.864  5.820   7.372   1.00 0.00 ? 38  GLU A OE2  16 
ATOM   10215 H  H    . GLU A 1 38 ? 11.744  9.360   3.595   1.00 0.00 ? 38  GLU A H    16 
ATOM   10216 H  HA   . GLU A 1 38 ? 11.957  8.897   6.459   1.00 0.00 ? 38  GLU A HA   16 
ATOM   10217 H  HB2  . GLU A 1 38 ? 13.136  7.661   4.013   1.00 0.00 ? 38  GLU A HB2  16 
ATOM   10218 H  HB3  . GLU A 1 38 ? 14.004  7.493   5.532   1.00 0.00 ? 38  GLU A HB3  16 
ATOM   10219 H  HG2  . GLU A 1 38 ? 11.184  6.610   4.970   1.00 0.00 ? 38  GLU A HG2  16 
ATOM   10220 H  HG3  . GLU A 1 38 ? 12.596  5.574   5.164   1.00 0.00 ? 38  GLU A HG3  16 
ATOM   10221 N  N    . ARG A 1 39 ? 13.730  10.526  6.997   1.00 0.00 ? 39  ARG A N    16 
ATOM   10222 C  CA   . ARG A 1 39 ? 14.795  11.452  7.365   1.00 0.00 ? 39  ARG A CA   16 
ATOM   10223 C  C    . ARG A 1 39 ? 15.419  11.060  8.700   1.00 0.00 ? 39  ARG A C    16 
ATOM   10224 O  O    . ARG A 1 39 ? 14.743  10.959  9.724   1.00 0.00 ? 39  ARG A O    16 
ATOM   10225 C  CB   . ARG A 1 39 ? 14.252  12.880  7.443   1.00 0.00 ? 39  ARG A CB   16 
ATOM   10226 C  CG   . ARG A 1 39 ? 13.767  13.422  6.108   1.00 0.00 ? 39  ARG A CG   16 
ATOM   10227 C  CD   . ARG A 1 39 ? 12.736  14.523  6.296   1.00 0.00 ? 39  ARG A CD   16 
ATOM   10228 N  NE   . ARG A 1 39 ? 12.323  15.109  5.023   1.00 0.00 ? 39  ARG A NE   16 
ATOM   10229 C  CZ   . ARG A 1 39 ? 13.120  15.853  4.263   1.00 0.00 ? 39  ARG A CZ   16 
ATOM   10230 N  NH1  . ARG A 1 39 ? 14.365  16.099  4.646   1.00 0.00 ? 39  ARG A NH1  16 
ATOM   10231 N  NH2  . ARG A 1 39 ? 12.672  16.351  3.118   1.00 0.00 ? 39  ARG A NH2  16 
ATOM   10232 H  H    . ARG A 1 39 ? 13.037  10.309  7.655   1.00 0.00 ? 39  ARG A H    16 
ATOM   10233 H  HA   . ARG A 1 39 ? 15.554  11.406  6.598   1.00 0.00 ? 39  ARG A HA   16 
ATOM   10234 H  HB2  . ARG A 1 39 ? 13.425  12.901  8.137   1.00 0.00 ? 39  ARG A HB2  16 
ATOM   10235 H  HB3  . ARG A 1 39 ? 15.034  13.530  7.807   1.00 0.00 ? 39  ARG A HB3  16 
ATOM   10236 H  HG2  . ARG A 1 39 ? 14.610  13.822  5.565   1.00 0.00 ? 39  ARG A HG2  16 
ATOM   10237 H  HG3  . ARG A 1 39 ? 13.322  12.616  5.544   1.00 0.00 ? 39  ARG A HG3  16 
ATOM   10238 H  HD2  . ARG A 1 39 ? 11.869  14.107  6.787   1.00 0.00 ? 39  ARG A HD2  16 
ATOM   10239 H  HD3  . ARG A 1 39 ? 13.164  15.297  6.916   1.00 0.00 ? 39  ARG A HD3  16 
ATOM   10240 H  HE   . ARG A 1 39 ? 11.407  14.940  4.721   1.00 0.00 ? 39  ARG A HE   16 
ATOM   10241 H  HH11 . ARG A 1 39 ? 14.706  15.724  5.508   1.00 0.00 ? 39  ARG A HH11 16 
ATOM   10242 H  HH12 . ARG A 1 39 ? 14.964  16.658  4.071   1.00 0.00 ? 39  ARG A HH12 16 
ATOM   10243 H  HH21 . ARG A 1 39 ? 11.734  16.167  2.826   1.00 0.00 ? 39  ARG A HH21 16 
ATOM   10244 H  HH22 . ARG A 1 39 ? 13.272  16.910  2.547   1.00 0.00 ? 39  ARG A HH22 16 
ATOM   10245 N  N    . PRO A 1 40 ? 16.741  10.832  8.691   1.00 0.00 ? 40  PRO A N    16 
ATOM   10246 C  CA   . PRO A 1 40 ? 17.486  10.447  9.894   1.00 0.00 ? 40  PRO A CA   16 
ATOM   10247 C  C    . PRO A 1 40 ? 17.591  11.587  10.901  1.00 0.00 ? 40  PRO A C    16 
ATOM   10248 O  O    . PRO A 1 40 ? 17.665  11.357  12.108  1.00 0.00 ? 40  PRO A O    16 
ATOM   10249 C  CB   . PRO A 1 40 ? 18.871  10.083  9.352   1.00 0.00 ? 40  PRO A CB   16 
ATOM   10250 C  CG   . PRO A 1 40 ? 18.996  10.856  8.084   1.00 0.00 ? 40  PRO A CG   16 
ATOM   10251 C  CD   . PRO A 1 40 ? 17.610  10.932  7.507   1.00 0.00 ? 40  PRO A CD   16 
ATOM   10252 H  HA   . PRO A 1 40 ? 17.047  9.584   10.373  1.00 0.00 ? 40  PRO A HA   16 
ATOM   10253 H  HB2  . PRO A 1 40 ? 19.628  10.371  10.068  1.00 0.00 ? 40  PRO A HB2  16 
ATOM   10254 H  HB3  . PRO A 1 40 ? 18.923  9.020   9.172   1.00 0.00 ? 40  PRO A HB3  16 
ATOM   10255 H  HG2  . PRO A 1 40 ? 19.371  11.846  8.294   1.00 0.00 ? 40  PRO A HG2  16 
ATOM   10256 H  HG3  . PRO A 1 40 ? 19.657  10.340  7.404   1.00 0.00 ? 40  PRO A HG3  16 
ATOM   10257 H  HD2  . PRO A 1 40 ? 17.464  11.875  7.000   1.00 0.00 ? 40  PRO A HD2  16 
ATOM   10258 H  HD3  . PRO A 1 40 ? 17.437  10.108  6.831   1.00 0.00 ? 40  PRO A HD3  16 
ATOM   10259 N  N    . SER A 1 41 ? 17.596  12.817  10.397  1.00 0.00 ? 41  SER A N    16 
ATOM   10260 C  CA   . SER A 1 41 ? 17.695  13.993  11.253  1.00 0.00 ? 41  SER A CA   16 
ATOM   10261 C  C    . SER A 1 41 ? 18.827  13.836  12.264  1.00 0.00 ? 41  SER A C    16 
ATOM   10262 O  O    . SER A 1 41 ? 18.717  14.272  13.409  1.00 0.00 ? 41  SER A O    16 
ATOM   10263 C  CB   . SER A 1 41 ? 16.372  14.231  11.984  1.00 0.00 ? 41  SER A CB   16 
ATOM   10264 O  OG   . SER A 1 41 ? 16.146  13.234  12.965  1.00 0.00 ? 41  SER A OG   16 
ATOM   10265 H  H    . SER A 1 41 ? 17.535  12.935  9.425   1.00 0.00 ? 41  SER A H    16 
ATOM   10266 H  HA   . SER A 1 41 ? 17.907  14.844  10.623  1.00 0.00 ? 41  SER A HA   16 
ATOM   10267 H  HB2  . SER A 1 41 ? 16.399  15.195  12.467  1.00 0.00 ? 41  SER A HB2  16 
ATOM   10268 H  HB3  . SER A 1 41 ? 15.561  14.208  11.270  1.00 0.00 ? 41  SER A HB3  16 
ATOM   10269 H  HG   . SER A 1 41 ? 15.210  13.022  12.996  1.00 0.00 ? 41  SER A HG   16 
ATOM   10270 N  N    . GLY A 1 42 ? 19.916  13.208  11.830  1.00 0.00 ? 42  GLY A N    16 
ATOM   10271 C  CA   . GLY A 1 42 ? 21.053  13.003  12.709  1.00 0.00 ? 42  GLY A CA   16 
ATOM   10272 C  C    . GLY A 1 42 ? 22.010  11.952  12.183  1.00 0.00 ? 42  GLY A C    16 
ATOM   10273 O  O    . GLY A 1 42 ? 22.890  12.235  11.369  1.00 0.00 ? 42  GLY A O    16 
ATOM   10274 H  H    . GLY A 1 42 ? 19.948  12.882  10.907  1.00 0.00 ? 42  GLY A H    16 
ATOM   10275 H  HA2  . GLY A 1 42 ? 21.584  13.938  12.816  1.00 0.00 ? 42  GLY A HA2  16 
ATOM   10276 H  HA3  . GLY A 1 42 ? 20.693  12.692  13.678  1.00 0.00 ? 42  GLY A HA3  16 
ATOM   10277 N  N    . PRO A 1 43 ? 21.845  10.707  12.653  1.00 0.00 ? 43  PRO A N    16 
ATOM   10278 C  CA   . PRO A 1 43 ? 22.693  9.585   12.239  1.00 0.00 ? 43  PRO A CA   16 
ATOM   10279 C  C    . PRO A 1 43 ? 22.447  9.177   10.790  1.00 0.00 ? 43  PRO A C    16 
ATOM   10280 O  O    . PRO A 1 43 ? 21.305  8.982   10.375  1.00 0.00 ? 43  PRO A O    16 
ATOM   10281 C  CB   . PRO A 1 43 ? 22.280  8.459   13.189  1.00 0.00 ? 43  PRO A CB   16 
ATOM   10282 C  CG   . PRO A 1 43 ? 20.887  8.796   13.594  1.00 0.00 ? 43  PRO A CG   16 
ATOM   10283 C  CD   . PRO A 1 43 ? 20.816  10.298  13.624  1.00 0.00 ? 43  PRO A CD   16 
ATOM   10284 H  HA   . PRO A 1 43 ? 23.741  9.809   12.376  1.00 0.00 ? 43  PRO A HA   16 
ATOM   10285 H  HB2  . PRO A 1 43 ? 22.323  7.512   12.670  1.00 0.00 ? 43  PRO A HB2  16 
ATOM   10286 H  HB3  . PRO A 1 43 ? 22.945  8.440   14.040  1.00 0.00 ? 43  PRO A HB3  16 
ATOM   10287 H  HG2  . PRO A 1 43 ? 20.189  8.402   12.872  1.00 0.00 ? 43  PRO A HG2  16 
ATOM   10288 H  HG3  . PRO A 1 43 ? 20.682  8.393   14.575  1.00 0.00 ? 43  PRO A HG3  16 
ATOM   10289 H  HD2  . PRO A 1 43 ? 19.838  10.636  13.315  1.00 0.00 ? 43  PRO A HD2  16 
ATOM   10290 H  HD3  . PRO A 1 43 ? 21.051  10.668  14.611  1.00 0.00 ? 43  PRO A HD3  16 
ATOM   10291 N  N    . SER A 1 44 ? 23.527  9.048   10.025  1.00 0.00 ? 44  SER A N    16 
ATOM   10292 C  CA   . SER A 1 44 ? 23.428  8.665   8.622   1.00 0.00 ? 44  SER A CA   16 
ATOM   10293 C  C    . SER A 1 44 ? 23.810  7.200   8.430   1.00 0.00 ? 44  SER A C    16 
ATOM   10294 O  O    . SER A 1 44 ? 24.367  6.570   9.328   1.00 0.00 ? 44  SER A O    16 
ATOM   10295 C  CB   . SER A 1 44 ? 24.328  9.556   7.764   1.00 0.00 ? 44  SER A CB   16 
ATOM   10296 O  OG   . SER A 1 44 ? 23.961  9.485   6.397   1.00 0.00 ? 44  SER A OG   16 
ATOM   10297 H  H    . SER A 1 44 ? 24.411  9.216   10.414  1.00 0.00 ? 44  SER A H    16 
ATOM   10298 H  HA   . SER A 1 44 ? 22.402  8.800   8.313   1.00 0.00 ? 44  SER A HA   16 
ATOM   10299 H  HB2  . SER A 1 44 ? 24.239  10.579  8.095   1.00 0.00 ? 44  SER A HB2  16 
ATOM   10300 H  HB3  . SER A 1 44 ? 25.353  9.232   7.867   1.00 0.00 ? 44  SER A HB3  16 
ATOM   10301 H  HG   . SER A 1 44 ? 24.725  9.232   5.873   1.00 0.00 ? 44  SER A HG   16 
ATOM   10302 N  N    . SER A 1 45 ? 23.507  6.666   7.251   1.00 0.00 ? 45  SER A N    16 
ATOM   10303 C  CA   . SER A 1 45 ? 23.815  5.275   6.941   1.00 0.00 ? 45  SER A CA   16 
ATOM   10304 C  C    . SER A 1 45 ? 23.324  4.349   8.050   1.00 0.00 ? 45  SER A C    16 
ATOM   10305 O  O    . SER A 1 45 ? 24.016  3.411   8.443   1.00 0.00 ? 45  SER A O    16 
ATOM   10306 C  CB   . SER A 1 45 ? 25.321  5.096   6.741   1.00 0.00 ? 45  SER A CB   16 
ATOM   10307 O  OG   . SER A 1 45 ? 25.609  3.861   6.108   1.00 0.00 ? 45  SER A OG   16 
ATOM   10308 H  H    . SER A 1 45 ? 23.063  7.220   6.575   1.00 0.00 ? 45  SER A H    16 
ATOM   10309 H  HA   . SER A 1 45 ? 23.306  5.019   6.024   1.00 0.00 ? 45  SER A HA   16 
ATOM   10310 H  HB2  . SER A 1 45 ? 25.698  5.899   6.125   1.00 0.00 ? 45  SER A HB2  16 
ATOM   10311 H  HB3  . SER A 1 45 ? 25.814  5.118   7.702   1.00 0.00 ? 45  SER A HB3  16 
ATOM   10312 H  HG   . SER A 1 45 ? 24.905  3.235   6.293   1.00 0.00 ? 45  SER A HG   16 
ATOM   10313 N  N    . GLY A 1 46 ? 22.123  4.622   8.552   1.00 0.00 ? 46  GLY A N    16 
ATOM   10314 C  CA   . GLY A 1 46 ? 21.559  3.806   9.611   1.00 0.00 ? 46  GLY A CA   16 
ATOM   10315 C  C    . GLY A 1 46 ? 21.587  2.326   9.280   1.00 0.00 ? 46  GLY A C    16 
ATOM   10316 O  O    . GLY A 1 46 ? 21.836  1.518   10.173  1.00 0.00 ? 46  GLY A O    16 
ATOM   10317 H  H    . GLY A 1 46 ? 21.616  5.383   8.200   1.00 0.00 ? 46  GLY A H    16 
ATOM   10318 H  HA2  . GLY A 1 46 ? 22.122  3.972   10.517  1.00 0.00 ? 46  GLY A HA2  16 
ATOM   10319 H  HA3  . GLY A 1 46 ? 20.535  4.107   9.775   1.00 0.00 ? 46  GLY A HA3  16 
HETATM 10320 ZN ZN   . ZN  B 2 .  ? 4.135   0.950   4.453   1.00 0.00 ? 201 ZN  A ZN   16 
ATOM   10321 N  N    . GLY A 1 1  ? -1.404  -34.409 -7.982  1.00 0.00 ? 1   GLY A N    17 
ATOM   10322 C  CA   . GLY A 1 1  ? -2.277  -33.501 -7.261  1.00 0.00 ? 1   GLY A CA   17 
ATOM   10323 C  C    . GLY A 1 1  ? -1.878  -32.050 -7.438  1.00 0.00 ? 1   GLY A C    17 
ATOM   10324 O  O    . GLY A 1 1  ? -1.795  -31.554 -8.561  1.00 0.00 ? 1   GLY A O    17 
ATOM   10325 H  H1   . GLY A 1 1  ? -0.710  -34.051 -8.575  1.00 0.00 ? 1   GLY A H1   17 
ATOM   10326 H  HA2  . GLY A 1 1  ? -3.288  -33.632 -7.618  1.00 0.00 ? 1   GLY A HA2  17 
ATOM   10327 H  HA3  . GLY A 1 1  ? -2.242  -33.746 -6.210  1.00 0.00 ? 1   GLY A HA3  17 
ATOM   10328 N  N    . SER A 1 2  ? -1.631  -31.366 -6.325  1.00 0.00 ? 2   SER A N    17 
ATOM   10329 C  CA   . SER A 1 2  ? -1.243  -29.960 -6.362  1.00 0.00 ? 2   SER A CA   17 
ATOM   10330 C  C    . SER A 1 2  ? -0.203  -29.655 -5.288  1.00 0.00 ? 2   SER A C    17 
ATOM   10331 O  O    . SER A 1 2  ? -0.126  -30.344 -4.270  1.00 0.00 ? 2   SER A O    17 
ATOM   10332 C  CB   . SER A 1 2  ? -2.470  -29.066 -6.169  1.00 0.00 ? 2   SER A CB   17 
ATOM   10333 O  OG   . SER A 1 2  ? -2.310  -27.830 -6.842  1.00 0.00 ? 2   SER A OG   17 
ATOM   10334 H  H    . SER A 1 2  ? -1.713  -31.817 -5.459  1.00 0.00 ? 2   SER A H    17 
ATOM   10335 H  HA   . SER A 1 2  ? -0.812  -29.761 -7.331  1.00 0.00 ? 2   SER A HA   17 
ATOM   10336 H  HB2  . SER A 1 2  ? -3.342  -29.567 -6.561  1.00 0.00 ? 2   SER A HB2  17 
ATOM   10337 H  HB3  . SER A 1 2  ? -2.609  -28.874 -5.115  1.00 0.00 ? 2   SER A HB3  17 
ATOM   10338 H  HG   . SER A 1 2  ? -1.715  -27.945 -7.587  1.00 0.00 ? 2   SER A HG   17 
ATOM   10339 N  N    . SER A 1 3  ? 0.594   -28.618 -5.523  1.00 0.00 ? 3   SER A N    17 
ATOM   10340 C  CA   . SER A 1 3  ? 1.632   -28.223 -4.578  1.00 0.00 ? 3   SER A CA   17 
ATOM   10341 C  C    . SER A 1 3  ? 1.118   -27.149 -3.624  1.00 0.00 ? 3   SER A C    17 
ATOM   10342 O  O    . SER A 1 3  ? 1.061   -25.971 -3.970  1.00 0.00 ? 3   SER A O    17 
ATOM   10343 C  CB   . SER A 1 3  ? 2.864   -27.709 -5.327  1.00 0.00 ? 3   SER A CB   17 
ATOM   10344 O  OG   . SER A 1 3  ? 3.774   -27.081 -4.441  1.00 0.00 ? 3   SER A OG   17 
ATOM   10345 H  H    . SER A 1 3  ? 0.483   -28.108 -6.353  1.00 0.00 ? 3   SER A H    17 
ATOM   10346 H  HA   . SER A 1 3  ? 1.909   -29.095 -4.005  1.00 0.00 ? 3   SER A HA   17 
ATOM   10347 H  HB2  . SER A 1 3  ? 3.362   -28.537 -5.807  1.00 0.00 ? 3   SER A HB2  17 
ATOM   10348 H  HB3  . SER A 1 3  ? 2.554   -26.992 -6.074  1.00 0.00 ? 3   SER A HB3  17 
ATOM   10349 H  HG   . SER A 1 3  ? 3.817   -26.142 -4.638  1.00 0.00 ? 3   SER A HG   17 
ATOM   10350 N  N    . GLY A 1 4  ? 0.745   -27.568 -2.418  1.00 0.00 ? 4   GLY A N    17 
ATOM   10351 C  CA   . GLY A 1 4  ? 0.241   -26.631 -1.431  1.00 0.00 ? 4   GLY A CA   17 
ATOM   10352 C  C    . GLY A 1 4  ? -1.024  -25.933 -1.888  1.00 0.00 ? 4   GLY A C    17 
ATOM   10353 O  O    . GLY A 1 4  ? -1.315  -25.880 -3.083  1.00 0.00 ? 4   GLY A O    17 
ATOM   10354 H  H    . GLY A 1 4  ? 0.813   -28.520 -2.197  1.00 0.00 ? 4   GLY A H    17 
ATOM   10355 H  HA2  . GLY A 1 4  ? 0.034   -27.166 -0.516  1.00 0.00 ? 4   GLY A HA2  17 
ATOM   10356 H  HA3  . GLY A 1 4  ? 0.999   -25.886 -1.238  1.00 0.00 ? 4   GLY A HA3  17 
ATOM   10357 N  N    . SER A 1 5  ? -1.780  -25.396 -0.935  1.00 0.00 ? 5   SER A N    17 
ATOM   10358 C  CA   . SER A 1 5  ? -3.024  -24.702 -1.246  1.00 0.00 ? 5   SER A CA   17 
ATOM   10359 C  C    . SER A 1 5  ? -3.499  -23.877 -0.054  1.00 0.00 ? 5   SER A C    17 
ATOM   10360 O  O    . SER A 1 5  ? -3.442  -24.328 1.090   1.00 0.00 ? 5   SER A O    17 
ATOM   10361 C  CB   . SER A 1 5  ? -4.106  -25.707 -1.649  1.00 0.00 ? 5   SER A CB   17 
ATOM   10362 O  OG   . SER A 1 5  ? -4.241  -26.728 -0.676  1.00 0.00 ? 5   SER A OG   17 
ATOM   10363 H  H    . SER A 1 5  ? -1.495  -25.471 -0.001  1.00 0.00 ? 5   SER A H    17 
ATOM   10364 H  HA   . SER A 1 5  ? -2.835  -24.038 -2.077  1.00 0.00 ? 5   SER A HA   17 
ATOM   10365 H  HB2  . SER A 1 5  ? -5.051  -25.194 -1.748  1.00 0.00 ? 5   SER A HB2  17 
ATOM   10366 H  HB3  . SER A 1 5  ? -3.841  -26.158 -2.593  1.00 0.00 ? 5   SER A HB3  17 
ATOM   10367 H  HG   . SER A 1 5  ? -3.419  -26.817 -0.189  1.00 0.00 ? 5   SER A HG   17 
ATOM   10368 N  N    . SER A 1 6  ? -3.967  -22.664 -0.331  1.00 0.00 ? 6   SER A N    17 
ATOM   10369 C  CA   . SER A 1 6  ? -4.448  -21.773 0.718   1.00 0.00 ? 6   SER A CA   17 
ATOM   10370 C  C    . SER A 1 6  ? -5.926  -21.449 0.520   1.00 0.00 ? 6   SER A C    17 
ATOM   10371 O  O    . SER A 1 6  ? -6.337  -20.293 0.615   1.00 0.00 ? 6   SER A O    17 
ATOM   10372 C  CB   . SER A 1 6  ? -3.629  -20.481 0.734   1.00 0.00 ? 6   SER A CB   17 
ATOM   10373 O  OG   . SER A 1 6  ? -2.378  -20.678 1.371   1.00 0.00 ? 6   SER A OG   17 
ATOM   10374 H  H    . SER A 1 6  ? -3.987  -22.361 -1.263  1.00 0.00 ? 6   SER A H    17 
ATOM   10375 H  HA   . SER A 1 6  ? -4.326  -22.278 1.664   1.00 0.00 ? 6   SER A HA   17 
ATOM   10376 H  HB2  . SER A 1 6  ? -3.455  -20.155 -0.280  1.00 0.00 ? 6   SER A HB2  17 
ATOM   10377 H  HB3  . SER A 1 6  ? -4.176  -19.718 1.269   1.00 0.00 ? 6   SER A HB3  17 
ATOM   10378 H  HG   . SER A 1 6  ? -2.406  -20.302 2.254   1.00 0.00 ? 6   SER A HG   17 
ATOM   10379 N  N    . GLY A 1 7  ? -6.719  -22.479 0.246   1.00 0.00 ? 7   GLY A N    17 
ATOM   10380 C  CA   . GLY A 1 7  ? -8.142  -22.285 0.038   1.00 0.00 ? 7   GLY A CA   17 
ATOM   10381 C  C    . GLY A 1 7  ? -8.453  -20.975 -0.658  1.00 0.00 ? 7   GLY A C    17 
ATOM   10382 O  O    . GLY A 1 7  ? -8.196  -20.821 -1.852  1.00 0.00 ? 7   GLY A O    17 
ATOM   10383 H  H    . GLY A 1 7  ? -6.335  -23.379 0.183   1.00 0.00 ? 7   GLY A H    17 
ATOM   10384 H  HA2  . GLY A 1 7  ? -8.522  -23.099 -0.561  1.00 0.00 ? 7   GLY A HA2  17 
ATOM   10385 H  HA3  . GLY A 1 7  ? -8.639  -22.296 0.998   1.00 0.00 ? 7   GLY A HA3  17 
ATOM   10386 N  N    . THR A 1 8  ? -9.011  -20.027 0.090   1.00 0.00 ? 8   THR A N    17 
ATOM   10387 C  CA   . THR A 1 8  ? -9.361  -18.725 -0.463  1.00 0.00 ? 8   THR A CA   17 
ATOM   10388 C  C    . THR A 1 8  ? -9.077  -17.609 0.536   1.00 0.00 ? 8   THR A C    17 
ATOM   10389 O  O    . THR A 1 8  ? -9.129  -17.820 1.747   1.00 0.00 ? 8   THR A O    17 
ATOM   10390 C  CB   . THR A 1 8  ? -10.845 -18.668 -0.872  1.00 0.00 ? 8   THR A CB   17 
ATOM   10391 O  OG1  . THR A 1 8  ? -11.147 -17.389 -1.441  1.00 0.00 ? 8   THR A OG1  17 
ATOM   10392 C  CG2  . THR A 1 8  ? -11.746 -18.921 0.327   1.00 0.00 ? 8   THR A CG2  17 
ATOM   10393 H  H    . THR A 1 8  ? -9.192  -20.210 1.035   1.00 0.00 ? 8   THR A H    17 
ATOM   10394 H  HA   . THR A 1 8  ? -8.759  -18.565 -1.347  1.00 0.00 ? 8   THR A HA   17 
ATOM   10395 H  HB   . THR A 1 8  ? -11.029 -19.435 -1.610  1.00 0.00 ? 8   THR A HB   17 
ATOM   10396 H  HG1  . THR A 1 8  ? -12.072 -17.181 -1.286  1.00 0.00 ? 8   THR A HG1  17 
ATOM   10397 H  HG21 . THR A 1 8  ? -12.727 -18.514 0.133   1.00 0.00 ? 8   THR A HG21 17 
ATOM   10398 H  HG22 . THR A 1 8  ? -11.326 -18.445 1.201   1.00 0.00 ? 8   THR A HG22 17 
ATOM   10399 H  HG23 . THR A 1 8  ? -11.826 -19.984 0.500   1.00 0.00 ? 8   THR A HG23 17 
ATOM   10400 N  N    . GLY A 1 9  ? -8.778  -16.421 0.021   1.00 0.00 ? 9   GLY A N    17 
ATOM   10401 C  CA   . GLY A 1 9  ? -8.491  -15.289 0.883   1.00 0.00 ? 9   GLY A CA   17 
ATOM   10402 C  C    . GLY A 1 9  ? -8.861  -13.965 0.244   1.00 0.00 ? 9   GLY A C    17 
ATOM   10403 O  O    . GLY A 1 9  ? -9.091  -13.895 -0.963  1.00 0.00 ? 9   GLY A O    17 
ATOM   10404 H  H    . GLY A 1 9  ? -8.751  -16.312 -0.953  1.00 0.00 ? 9   GLY A H    17 
ATOM   10405 H  HA2  . GLY A 1 9  ? -9.046  -15.401 1.802   1.00 0.00 ? 9   GLY A HA2  17 
ATOM   10406 H  HA3  . GLY A 1 9  ? -7.435  -15.283 1.110   1.00 0.00 ? 9   GLY A HA3  17 
ATOM   10407 N  N    . GLU A 1 10 ? -8.920  -12.914 1.055   1.00 0.00 ? 10  GLU A N    17 
ATOM   10408 C  CA   . GLU A 1 10 ? -9.267  -11.587 0.561   1.00 0.00 ? 10  GLU A CA   17 
ATOM   10409 C  C    . GLU A 1 10 ? -8.587  -10.502 1.392   1.00 0.00 ? 10  GLU A C    17 
ATOM   10410 O  O    . GLU A 1 10 ? -8.287  -10.703 2.568   1.00 0.00 ? 10  GLU A O    17 
ATOM   10411 C  CB   . GLU A 1 10 ? -10.784 -11.389 0.588   1.00 0.00 ? 10  GLU A CB   17 
ATOM   10412 C  CG   . GLU A 1 10 ? -11.355 -11.252 1.989   1.00 0.00 ? 10  GLU A CG   17 
ATOM   10413 C  CD   . GLU A 1 10 ? -12.871 -11.205 2.000   1.00 0.00 ? 10  GLU A CD   17 
ATOM   10414 O  OE1  . GLU A 1 10 ? -13.454 -10.629 1.057   1.00 0.00 ? 10  GLU A OE1  17 
ATOM   10415 O  OE2  . GLU A 1 10 ? -13.474 -11.745 2.951   1.00 0.00 ? 10  GLU A OE2  17 
ATOM   10416 H  H    . GLU A 1 10 ? -8.726  -13.034 2.008   1.00 0.00 ? 10  GLU A H    17 
ATOM   10417 H  HA   . GLU A 1 10 ? -8.922  -11.512 -0.459  1.00 0.00 ? 10  GLU A HA   17 
ATOM   10418 H  HB2  . GLU A 1 10 ? -11.029 -10.496 0.032   1.00 0.00 ? 10  GLU A HB2  17 
ATOM   10419 H  HB3  . GLU A 1 10 ? -11.253 -12.238 0.113   1.00 0.00 ? 10  GLU A HB3  17 
ATOM   10420 H  HG2  . GLU A 1 10 ? -11.033 -12.095 2.580   1.00 0.00 ? 10  GLU A HG2  17 
ATOM   10421 H  HG3  . GLU A 1 10 ? -10.979 -10.340 2.430   1.00 0.00 ? 10  GLU A HG3  17 
ATOM   10422 N  N    . ASN A 1 11 ? -8.347  -9.352  0.770   1.00 0.00 ? 11  ASN A N    17 
ATOM   10423 C  CA   . ASN A 1 11 ? -7.701  -8.235  1.450   1.00 0.00 ? 11  ASN A CA   17 
ATOM   10424 C  C    . ASN A 1 11 ? -8.078  -6.909  0.797   1.00 0.00 ? 11  ASN A C    17 
ATOM   10425 O  O    . ASN A 1 11 ? -8.072  -6.768  -0.426  1.00 0.00 ? 11  ASN A O    17 
ATOM   10426 C  CB   . ASN A 1 11 ? -6.182  -8.411  1.434   1.00 0.00 ? 11  ASN A CB   17 
ATOM   10427 C  CG   . ASN A 1 11 ? -5.642  -8.656  0.038   1.00 0.00 ? 11  ASN A CG   17 
ATOM   10428 O  OD1  . ASN A 1 11 ? -5.938  -9.676  -0.584  1.00 0.00 ? 11  ASN A OD1  17 
ATOM   10429 N  ND2  . ASN A 1 11 ? -4.846  -7.718  -0.461  1.00 0.00 ? 11  ASN A ND2  17 
ATOM   10430 H  H    . ASN A 1 11 ? -8.610  -9.252  -0.169  1.00 0.00 ? 11  ASN A H    17 
ATOM   10431 H  HA   . ASN A 1 11 ? -8.043  -8.229  2.474   1.00 0.00 ? 11  ASN A HA   17 
ATOM   10432 H  HB2  . ASN A 1 11 ? -5.718  -7.518  1.827   1.00 0.00 ? 11  ASN A HB2  17 
ATOM   10433 H  HB3  . ASN A 1 11 ? -5.916  -9.253  2.056   1.00 0.00 ? 11  ASN A HB3  17 
ATOM   10434 H  HD21 . ASN A 1 11 ? -4.654  -6.931  0.091   1.00 0.00 ? 11  ASN A HD21 17 
ATOM   10435 H  HD22 . ASN A 1 11 ? -4.484  -7.850  -1.362  1.00 0.00 ? 11  ASN A HD22 17 
ATOM   10436 N  N    . PRO A 1 12 ? -8.413  -5.913  1.630   1.00 0.00 ? 12  PRO A N    17 
ATOM   10437 C  CA   . PRO A 1 12 ? -8.798  -4.580  1.156   1.00 0.00 ? 12  PRO A CA   17 
ATOM   10438 C  C    . PRO A 1 12 ? -7.621  -3.816  0.559   1.00 0.00 ? 12  PRO A C    17 
ATOM   10439 O  O    . PRO A 1 12 ? -7.347  -3.915  -0.637  1.00 0.00 ? 12  PRO A O    17 
ATOM   10440 C  CB   . PRO A 1 12 ? -9.299  -3.884  2.424   1.00 0.00 ? 12  PRO A CB   17 
ATOM   10441 C  CG   . PRO A 1 12 ? -8.603  -4.583  3.541   1.00 0.00 ? 12  PRO A CG   17 
ATOM   10442 C  CD   . PRO A 1 12 ? -8.442  -6.011  3.099   1.00 0.00 ? 12  PRO A CD   17 
ATOM   10443 H  HA   . PRO A 1 12 ? -9.597  -4.632  0.432   1.00 0.00 ? 12  PRO A HA   17 
ATOM   10444 H  HB2  . PRO A 1 12 ? -9.038  -2.836  2.389   1.00 0.00 ? 12  PRO A HB2  17 
ATOM   10445 H  HB3  . PRO A 1 12 ? -10.371 -3.992  2.499   1.00 0.00 ? 12  PRO A HB3  17 
ATOM   10446 H  HG2  . PRO A 1 12 ? -7.637  -4.132  3.710   1.00 0.00 ? 12  PRO A HG2  17 
ATOM   10447 H  HG3  . PRO A 1 12 ? -9.204  -4.533  4.436   1.00 0.00 ? 12  PRO A HG3  17 
ATOM   10448 H  HD2  . PRO A 1 12 ? -7.517  -6.421  3.477   1.00 0.00 ? 12  PRO A HD2  17 
ATOM   10449 H  HD3  . PRO A 1 12 ? -9.282  -6.605  3.429   1.00 0.00 ? 12  PRO A HD3  17 
ATOM   10450 N  N    . PHE A 1 13 ? -6.929  -3.053  1.399   1.00 0.00 ? 13  PHE A N    17 
ATOM   10451 C  CA   . PHE A 1 13 ? -5.782  -2.271  0.952   1.00 0.00 ? 13  PHE A CA   17 
ATOM   10452 C  C    . PHE A 1 13 ? -4.499  -2.759  1.619   1.00 0.00 ? 13  PHE A C    17 
ATOM   10453 O  O    . PHE A 1 13 ? -4.503  -3.150  2.786   1.00 0.00 ? 13  PHE A O    17 
ATOM   10454 C  CB   . PHE A 1 13 ? -5.998  -0.788  1.261   1.00 0.00 ? 13  PHE A CB   17 
ATOM   10455 C  CG   . PHE A 1 13 ? -7.017  -0.133  0.373   1.00 0.00 ? 13  PHE A CG   17 
ATOM   10456 C  CD1  . PHE A 1 13 ? -6.660  0.346   -0.877  1.00 0.00 ? 13  PHE A CD1  17 
ATOM   10457 C  CD2  . PHE A 1 13 ? -8.332  0.003   0.788   1.00 0.00 ? 13  PHE A CD2  17 
ATOM   10458 C  CE1  . PHE A 1 13 ? -7.596  0.949   -1.696  1.00 0.00 ? 13  PHE A CE1  17 
ATOM   10459 C  CE2  . PHE A 1 13 ? -9.272  0.606   -0.026  1.00 0.00 ? 13  PHE A CE2  17 
ATOM   10460 C  CZ   . PHE A 1 13 ? -8.903  1.079   -1.270  1.00 0.00 ? 13  PHE A CZ   17 
ATOM   10461 H  H    . PHE A 1 13 ? -7.197  -3.015  2.341   1.00 0.00 ? 13  PHE A H    17 
ATOM   10462 H  HA   . PHE A 1 13 ? -5.690  -2.398  -0.115  1.00 0.00 ? 13  PHE A HA   17 
ATOM   10463 H  HB2  . PHE A 1 13 ? -6.334  -0.685  2.282   1.00 0.00 ? 13  PHE A HB2  17 
ATOM   10464 H  HB3  . PHE A 1 13 ? -5.063  -0.263  1.139   1.00 0.00 ? 13  PHE A HB3  17 
ATOM   10465 H  HD1  . PHE A 1 13 ? -5.638  0.244   -1.212  1.00 0.00 ? 13  PHE A HD1  17 
ATOM   10466 H  HD2  . PHE A 1 13 ? -8.621  -0.367  1.762   1.00 0.00 ? 13  PHE A HD2  17 
ATOM   10467 H  HE1  . PHE A 1 13 ? -7.305  1.318   -2.668  1.00 0.00 ? 13  PHE A HE1  17 
ATOM   10468 H  HE2  . PHE A 1 13 ? -10.293 0.705   0.310   1.00 0.00 ? 13  PHE A HE2  17 
ATOM   10469 H  HZ   . PHE A 1 13 ? -9.636  1.550   -1.908  1.00 0.00 ? 13  PHE A HZ   17 
ATOM   10470 N  N    . ILE A 1 14 ? -3.403  -2.734  0.868   1.00 0.00 ? 14  ILE A N    17 
ATOM   10471 C  CA   . ILE A 1 14 ? -2.113  -3.173  1.384   1.00 0.00 ? 14  ILE A CA   17 
ATOM   10472 C  C    . ILE A 1 14 ? -0.996  -2.231  0.948   1.00 0.00 ? 14  ILE A C    17 
ATOM   10473 O  O    . ILE A 1 14 ? -1.106  -1.551  -0.072  1.00 0.00 ? 14  ILE A O    17 
ATOM   10474 C  CB   . ILE A 1 14 ? -1.776  -4.601  0.917   1.00 0.00 ? 14  ILE A CB   17 
ATOM   10475 C  CG1  . ILE A 1 14 ? -2.906  -5.563  1.290   1.00 0.00 ? 14  ILE A CG1  17 
ATOM   10476 C  CG2  . ILE A 1 14 ? -0.459  -5.061  1.526   1.00 0.00 ? 14  ILE A CG2  17 
ATOM   10477 C  CD1  . ILE A 1 14 ? -3.015  -5.820  2.777   1.00 0.00 ? 14  ILE A CD1  17 
ATOM   10478 H  H    . ILE A 1 14 ? -3.464  -2.412  -0.056  1.00 0.00 ? 14  ILE A H    17 
ATOM   10479 H  HA   . ILE A 1 14 ? -2.169  -3.173  2.464   1.00 0.00 ? 14  ILE A HA   17 
ATOM   10480 H  HB   . ILE A 1 14 ? -1.664  -4.588  -0.156  1.00 0.00 ? 14  ILE A HB   17 
ATOM   10481 H  HG12 . ILE A 1 14 ? -3.845  -5.153  0.955   1.00 0.00 ? 14  ILE A HG12 17 
ATOM   10482 H  HG13 . ILE A 1 14 ? -2.737  -6.512  0.801   1.00 0.00 ? 14  ILE A HG13 17 
ATOM   10483 H  HG21 . ILE A 1 14 ? 0.358   -4.746  0.894   1.00 0.00 ? 14  ILE A HG21 17 
ATOM   10484 H  HG22 . ILE A 1 14 ? -0.344  -4.623  2.506   1.00 0.00 ? 14  ILE A HG22 17 
ATOM   10485 H  HG23 . ILE A 1 14 ? -0.457  -6.137  1.609   1.00 0.00 ? 14  ILE A HG23 17 
ATOM   10486 H  HD11 . ILE A 1 14 ? -2.606  -6.794  3.005   1.00 0.00 ? 14  ILE A HD11 17 
ATOM   10487 H  HD12 . ILE A 1 14 ? -2.462  -5.064  3.315   1.00 0.00 ? 14  ILE A HD12 17 
ATOM   10488 H  HD13 . ILE A 1 14 ? -4.053  -5.787  3.073   1.00 0.00 ? 14  ILE A HD13 17 
ATOM   10489 N  N    . CYS A 1 15 ? 0.079   -2.196  1.728   1.00 0.00 ? 15  CYS A N    17 
ATOM   10490 C  CA   . CYS A 1 15 ? 1.218   -1.339  1.422   1.00 0.00 ? 15  CYS A CA   17 
ATOM   10491 C  C    . CYS A 1 15 ? 2.336   -2.136  0.756   1.00 0.00 ? 15  CYS A C    17 
ATOM   10492 O  O    . CYS A 1 15 ? 2.893   -3.059  1.350   1.00 0.00 ? 15  CYS A O    17 
ATOM   10493 C  CB   . CYS A 1 15 ? 1.740   -0.676  2.699   1.00 0.00 ? 15  CYS A CB   17 
ATOM   10494 S  SG   . CYS A 1 15 ? 2.808   0.771   2.402   1.00 0.00 ? 15  CYS A SG   17 
ATOM   10495 H  H    . CYS A 1 15 ? 0.108   -2.762  2.529   1.00 0.00 ? 15  CYS A H    17 
ATOM   10496 H  HA   . CYS A 1 15 ? 0.883   -0.572  0.740   1.00 0.00 ? 15  CYS A HA   17 
ATOM   10497 H  HB2  . CYS A 1 15 ? 0.901   -0.347  3.294   1.00 0.00 ? 15  CYS A HB2  17 
ATOM   10498 H  HB3  . CYS A 1 15 ? 2.313   -1.397  3.262   1.00 0.00 ? 15  CYS A HB3  17 
ATOM   10499 N  N    . SER A 1 16 ? 2.659   -1.771  -0.481  1.00 0.00 ? 16  SER A N    17 
ATOM   10500 C  CA   . SER A 1 16 ? 3.707   -2.454  -1.230  1.00 0.00 ? 16  SER A CA   17 
ATOM   10501 C  C    . SER A 1 16 ? 5.085   -2.108  -0.673  1.00 0.00 ? 16  SER A C    17 
ATOM   10502 O  O    . SER A 1 16 ? 6.103   -2.598  -1.160  1.00 0.00 ? 16  SER A O    17 
ATOM   10503 C  CB   . SER A 1 16 ? 3.634   -2.077  -2.711  1.00 0.00 ? 16  SER A CB   17 
ATOM   10504 O  OG   . SER A 1 16 ? 4.575   -2.814  -3.472  1.00 0.00 ? 16  SER A OG   17 
ATOM   10505 H  H    . SER A 1 16 ? 2.178   -1.027  -0.900  1.00 0.00 ? 16  SER A H    17 
ATOM   10506 H  HA   . SER A 1 16 ? 3.548   -3.517  -1.129  1.00 0.00 ? 16  SER A HA   17 
ATOM   10507 H  HB2  . SER A 1 16 ? 2.643   -2.287  -3.084  1.00 0.00 ? 16  SER A HB2  17 
ATOM   10508 H  HB3  . SER A 1 16 ? 3.845   -1.023  -2.822  1.00 0.00 ? 16  SER A HB3  17 
ATOM   10509 H  HG   . SER A 1 16 ? 5.294   -3.099  -2.903  1.00 0.00 ? 16  SER A HG   17 
ATOM   10510 N  N    . GLU A 1 17 ? 5.108   -1.261  0.351   1.00 0.00 ? 17  GLU A N    17 
ATOM   10511 C  CA   . GLU A 1 17 ? 6.360   -0.848  0.973   1.00 0.00 ? 17  GLU A CA   17 
ATOM   10512 C  C    . GLU A 1 17 ? 6.703   -1.751  2.155   1.00 0.00 ? 17  GLU A C    17 
ATOM   10513 O  O    . GLU A 1 17 ? 7.831   -2.229  2.279   1.00 0.00 ? 17  GLU A O    17 
ATOM   10514 C  CB   . GLU A 1 17 ? 6.270   0.607   1.438   1.00 0.00 ? 17  GLU A CB   17 
ATOM   10515 C  CG   . GLU A 1 17 ? 6.209   1.607   0.296   1.00 0.00 ? 17  GLU A CG   17 
ATOM   10516 C  CD   . GLU A 1 17 ? 7.542   1.769   -0.410  1.00 0.00 ? 17  GLU A CD   17 
ATOM   10517 O  OE1  . GLU A 1 17 ? 8.588   1.634   0.258   1.00 0.00 ? 17  GLU A OE1  17 
ATOM   10518 O  OE2  . GLU A 1 17 ? 7.538   2.030   -1.631  1.00 0.00 ? 17  GLU A OE2  17 
ATOM   10519 H  H    . GLU A 1 17 ? 4.262   -0.904  0.695   1.00 0.00 ? 17  GLU A H    17 
ATOM   10520 H  HA   . GLU A 1 17 ? 7.142   -0.933  0.233   1.00 0.00 ? 17  GLU A HA   17 
ATOM   10521 H  HB2  . GLU A 1 17 ? 5.382   0.725   2.041   1.00 0.00 ? 17  GLU A HB2  17 
ATOM   10522 H  HB3  . GLU A 1 17 ? 7.137   0.833   2.041   1.00 0.00 ? 17  GLU A HB3  17 
ATOM   10523 H  HG2  . GLU A 1 17 ? 5.478   1.270   -0.423  1.00 0.00 ? 17  GLU A HG2  17 
ATOM   10524 H  HG3  . GLU A 1 17 ? 5.909   2.567   0.690   1.00 0.00 ? 17  GLU A HG3  17 
ATOM   10525 N  N    . CYS A 1 18 ? 5.722   -1.978  3.022   1.00 0.00 ? 18  CYS A N    17 
ATOM   10526 C  CA   . CYS A 1 18 ? 5.918   -2.821  4.195   1.00 0.00 ? 18  CYS A CA   17 
ATOM   10527 C  C    . CYS A 1 18 ? 4.985   -4.029  4.159   1.00 0.00 ? 18  CYS A C    17 
ATOM   10528 O  O    . CYS A 1 18 ? 5.423   -5.169  4.306   1.00 0.00 ? 18  CYS A O    17 
ATOM   10529 C  CB   . CYS A 1 18 ? 5.678   -2.016  5.474   1.00 0.00 ? 18  CYS A CB   17 
ATOM   10530 S  SG   . CYS A 1 18 ? 4.114   -1.083  5.482   1.00 0.00 ? 18  CYS A SG   17 
ATOM   10531 H  H    . CYS A 1 18 ? 4.844   -1.568  2.870   1.00 0.00 ? 18  CYS A H    17 
ATOM   10532 H  HA   . CYS A 1 18 ? 6.939   -3.170  4.186   1.00 0.00 ? 18  CYS A HA   17 
ATOM   10533 H  HB2  . CYS A 1 18 ? 5.661   -2.691  6.317   1.00 0.00 ? 18  CYS A HB2  17 
ATOM   10534 H  HB3  . CYS A 1 18 ? 6.484   -1.309  5.601   1.00 0.00 ? 18  CYS A HB3  17 
ATOM   10535 N  N    . GLY A 1 19 ? 3.697   -3.769  3.962   1.00 0.00 ? 19  GLY A N    17 
ATOM   10536 C  CA   . GLY A 1 19 ? 2.722   -4.843  3.910   1.00 0.00 ? 19  GLY A CA   17 
ATOM   10537 C  C    . GLY A 1 19 ? 1.653   -4.708  4.975   1.00 0.00 ? 19  GLY A C    17 
ATOM   10538 O  O    . GLY A 1 19 ? 1.161   -5.706  5.502   1.00 0.00 ? 19  GLY A O    17 
ATOM   10539 H  H    . GLY A 1 19 ? 3.405   -2.839  3.851   1.00 0.00 ? 19  GLY A H    17 
ATOM   10540 H  HA2  . GLY A 1 19 ? 2.251   -4.840  2.938   1.00 0.00 ? 19  GLY A HA2  17 
ATOM   10541 H  HA3  . GLY A 1 19 ? 3.234   -5.784  4.047   1.00 0.00 ? 19  GLY A HA3  17 
ATOM   10542 N  N    . LYS A 1 20 ? 1.292   -3.470  5.296   1.00 0.00 ? 20  LYS A N    17 
ATOM   10543 C  CA   . LYS A 1 20 ? 0.274   -3.207  6.306   1.00 0.00 ? 20  LYS A CA   17 
ATOM   10544 C  C    . LYS A 1 20 ? -1.120  -3.215  5.689   1.00 0.00 ? 20  LYS A C    17 
ATOM   10545 O  O    . LYS A 1 20 ? -1.270  -3.167  4.467   1.00 0.00 ? 20  LYS A O    17 
ATOM   10546 C  CB   . LYS A 1 20 ? 0.536   -1.860  6.984   1.00 0.00 ? 20  LYS A CB   17 
ATOM   10547 C  CG   . LYS A 1 20 ? -0.001  -1.778  8.403   1.00 0.00 ? 20  LYS A CG   17 
ATOM   10548 C  CD   . LYS A 1 20 ? 0.603   -0.608  9.161   1.00 0.00 ? 20  LYS A CD   17 
ATOM   10549 C  CE   . LYS A 1 20 ? 1.995   -0.939  9.679   1.00 0.00 ? 20  LYS A CE   17 
ATOM   10550 N  NZ   . LYS A 1 20 ? 1.959   -1.989  10.734  1.00 0.00 ? 20  LYS A NZ   17 
ATOM   10551 H  H    . LYS A 1 20 ? 1.721   -2.715  4.841   1.00 0.00 ? 20  LYS A H    17 
ATOM   10552 H  HA   . LYS A 1 20 ? 0.331   -3.990  7.047   1.00 0.00 ? 20  LYS A HA   17 
ATOM   10553 H  HB2  . LYS A 1 20 ? 1.601   -1.686  7.014   1.00 0.00 ? 20  LYS A HB2  17 
ATOM   10554 H  HB3  . LYS A 1 20 ? 0.069   -1.080  6.400   1.00 0.00 ? 20  LYS A HB3  17 
ATOM   10555 H  HG2  . LYS A 1 20 ? -1.073  -1.655  8.366   1.00 0.00 ? 20  LYS A HG2  17 
ATOM   10556 H  HG3  . LYS A 1 20 ? 0.240   -2.695  8.922   1.00 0.00 ? 20  LYS A HG3  17 
ATOM   10557 H  HD2  . LYS A 1 20 ? 0.671   0.242   8.499   1.00 0.00 ? 20  LYS A HD2  17 
ATOM   10558 H  HD3  . LYS A 1 20 ? -0.035  -0.365  9.999   1.00 0.00 ? 20  LYS A HD3  17 
ATOM   10559 H  HE2  . LYS A 1 20 ? 2.598   -1.289  8.856   1.00 0.00 ? 20  LYS A HE2  17 
ATOM   10560 H  HE3  . LYS A 1 20 ? 2.433   -0.042  10.091  1.00 0.00 ? 20  LYS A HE3  17 
ATOM   10561 H  HZ1  . LYS A 1 20 ? 2.786   -2.613  10.646  1.00 0.00 ? 20  LYS A HZ1  17 
ATOM   10562 H  HZ2  . LYS A 1 20 ? 1.095   -2.561  10.640  1.00 0.00 ? 20  LYS A HZ2  17 
ATOM   10563 H  HZ3  . LYS A 1 20 ? 1.968   -1.549  11.677  1.00 0.00 ? 20  LYS A HZ3  17 
ATOM   10564 N  N    . VAL A 1 21 ? -2.140  -3.274  6.540   1.00 0.00 ? 21  VAL A N    17 
ATOM   10565 C  CA   . VAL A 1 21 ? -3.522  -3.285  6.078   1.00 0.00 ? 21  VAL A CA   17 
ATOM   10566 C  C    . VAL A 1 21 ? -4.285  -2.071  6.595   1.00 0.00 ? 21  VAL A C    17 
ATOM   10567 O  O    . VAL A 1 21 ? -4.345  -1.829  7.801   1.00 0.00 ? 21  VAL A O    17 
ATOM   10568 C  CB   . VAL A 1 21 ? -4.253  -4.565  6.525   1.00 0.00 ? 21  VAL A CB   17 
ATOM   10569 C  CG1  . VAL A 1 21 ? -5.595  -4.688  5.819   1.00 0.00 ? 21  VAL A CG1  17 
ATOM   10570 C  CG2  . VAL A 1 21 ? -3.390  -5.790  6.264   1.00 0.00 ? 21  VAL A CG2  17 
ATOM   10571 H  H    . VAL A 1 21 ? -1.957  -3.310  7.502   1.00 0.00 ? 21  VAL A H    17 
ATOM   10572 H  HA   . VAL A 1 21 ? -3.513  -3.260  4.998   1.00 0.00 ? 21  VAL A HA   17 
ATOM   10573 H  HB   . VAL A 1 21 ? -4.435  -4.499  7.587   1.00 0.00 ? 21  VAL A HB   17 
ATOM   10574 H  HG11 . VAL A 1 21 ? -5.712  -5.694  5.442   1.00 0.00 ? 21  VAL A HG11 17 
ATOM   10575 H  HG12 . VAL A 1 21 ? -6.390  -4.470  6.516   1.00 0.00 ? 21  VAL A HG12 17 
ATOM   10576 H  HG13 . VAL A 1 21 ? -5.634  -3.989  4.997   1.00 0.00 ? 21  VAL A HG13 17 
ATOM   10577 H  HG21 . VAL A 1 21 ? -2.469  -5.708  6.822   1.00 0.00 ? 21  VAL A HG21 17 
ATOM   10578 H  HG22 . VAL A 1 21 ? -3.921  -6.677  6.575   1.00 0.00 ? 21  VAL A HG22 17 
ATOM   10579 H  HG23 . VAL A 1 21 ? -3.166  -5.856  5.209   1.00 0.00 ? 21  VAL A HG23 17 
ATOM   10580 N  N    . PHE A 1 22 ? -4.866  -1.308  5.675   1.00 0.00 ? 22  PHE A N    17 
ATOM   10581 C  CA   . PHE A 1 22 ? -5.625  -0.117  6.037   1.00 0.00 ? 22  PHE A CA   17 
ATOM   10582 C  C    . PHE A 1 22 ? -7.076  -0.236  5.579   1.00 0.00 ? 22  PHE A C    17 
ATOM   10583 O  O    . PHE A 1 22 ? -7.351  -0.626  4.444   1.00 0.00 ? 22  PHE A O    17 
ATOM   10584 C  CB   . PHE A 1 22 ? -4.985  1.129   5.422   1.00 0.00 ? 22  PHE A CB   17 
ATOM   10585 C  CG   . PHE A 1 22 ? -3.542  1.310   5.799   1.00 0.00 ? 22  PHE A CG   17 
ATOM   10586 C  CD1  . PHE A 1 22 ? -2.539  0.694   5.068   1.00 0.00 ? 22  PHE A CD1  17 
ATOM   10587 C  CD2  . PHE A 1 22 ? -3.189  2.095   6.884   1.00 0.00 ? 22  PHE A CD2  17 
ATOM   10588 C  CE1  . PHE A 1 22 ? -1.211  0.858   5.413   1.00 0.00 ? 22  PHE A CE1  17 
ATOM   10589 C  CE2  . PHE A 1 22 ? -1.862  2.263   7.234   1.00 0.00 ? 22  PHE A CE2  17 
ATOM   10590 C  CZ   . PHE A 1 22 ? -0.872  1.645   6.497   1.00 0.00 ? 22  PHE A CZ   17 
ATOM   10591 H  H    . PHE A 1 22 ? -4.782  -1.552  4.729   1.00 0.00 ? 22  PHE A H    17 
ATOM   10592 H  HA   . PHE A 1 22 ? -5.606  -0.027  7.112   1.00 0.00 ? 22  PHE A HA   17 
ATOM   10593 H  HB2  . PHE A 1 22 ? -5.039  1.059   4.346   1.00 0.00 ? 22  PHE A HB2  17 
ATOM   10594 H  HB3  . PHE A 1 22 ? -5.527  2.003   5.750   1.00 0.00 ? 22  PHE A HB3  17 
ATOM   10595 H  HD1  . PHE A 1 22 ? -2.802  0.080   4.219   1.00 0.00 ? 22  PHE A HD1  17 
ATOM   10596 H  HD2  . PHE A 1 22 ? -3.964  2.580   7.462   1.00 0.00 ? 22  PHE A HD2  17 
ATOM   10597 H  HE1  . PHE A 1 22 ? -0.438  0.374   4.835   1.00 0.00 ? 22  PHE A HE1  17 
ATOM   10598 H  HE2  . PHE A 1 22 ? -1.602  2.879   8.082   1.00 0.00 ? 22  PHE A HE2  17 
ATOM   10599 H  HZ   . PHE A 1 22 ? 0.165   1.774   6.769   1.00 0.00 ? 22  PHE A HZ   17 
ATOM   10600 N  N    . THR A 1 23 ? -8.002  0.102   6.471   1.00 0.00 ? 23  THR A N    17 
ATOM   10601 C  CA   . THR A 1 23 ? -9.424  0.032   6.161   1.00 0.00 ? 23  THR A CA   17 
ATOM   10602 C  C    . THR A 1 23 ? -9.809  1.069   5.111   1.00 0.00 ? 23  THR A C    17 
ATOM   10603 O  O    . THR A 1 23 ? -10.584 0.783   4.198   1.00 0.00 ? 23  THR A O    17 
ATOM   10604 C  CB   . THR A 1 23 ? -10.285 0.248   7.419   1.00 0.00 ? 23  THR A CB   17 
ATOM   10605 O  OG1  . THR A 1 23 ? -9.764  -0.523  8.508   1.00 0.00 ? 23  THR A OG1  17 
ATOM   10606 C  CG2  . THR A 1 23 ? -11.731 -0.145  7.159   1.00 0.00 ? 23  THR A CG2  17 
ATOM   10607 H  H    . THR A 1 23 ? -7.720  0.405   7.359   1.00 0.00 ? 23  THR A H    17 
ATOM   10608 H  HA   . THR A 1 23 ? -9.632  -0.954  5.772   1.00 0.00 ? 23  THR A HA   17 
ATOM   10609 H  HB   . THR A 1 23 ? -10.254 1.295   7.683   1.00 0.00 ? 23  THR A HB   17 
ATOM   10610 H  HG1  . THR A 1 23 ? -9.283  -1.280  8.163   1.00 0.00 ? 23  THR A HG1  17 
ATOM   10611 H  HG21 . THR A 1 23 ? -11.974 -1.026  7.735   1.00 0.00 ? 23  THR A HG21 17 
ATOM   10612 H  HG22 . THR A 1 23 ? -11.864 -0.355  6.108   1.00 0.00 ? 23  THR A HG22 17 
ATOM   10613 H  HG23 . THR A 1 23 ? -12.383 0.666   7.450   1.00 0.00 ? 23  THR A HG23 17 
ATOM   10614 N  N    . HIS A 1 24 ? -9.263  2.273   5.248   1.00 0.00 ? 24  HIS A N    17 
ATOM   10615 C  CA   . HIS A 1 24 ? -9.550  3.353   4.309   1.00 0.00 ? 24  HIS A CA   17 
ATOM   10616 C  C    . HIS A 1 24 ? -8.305  3.719   3.506   1.00 0.00 ? 24  HIS A C    17 
ATOM   10617 O  O    . HIS A 1 24 ? -7.272  4.077   4.072   1.00 0.00 ? 24  HIS A O    17 
ATOM   10618 C  CB   . HIS A 1 24 ? -10.069 4.582   5.056   1.00 0.00 ? 24  HIS A CB   17 
ATOM   10619 C  CG   . HIS A 1 24 ? -11.014 5.418   4.250   1.00 0.00 ? 24  HIS A CG   17 
ATOM   10620 N  ND1  . HIS A 1 24 ? -10.594 6.398   3.375   1.00 0.00 ? 24  HIS A ND1  17 
ATOM   10621 C  CD2  . HIS A 1 24 ? -12.366 5.415   4.187   1.00 0.00 ? 24  HIS A CD2  17 
ATOM   10622 C  CE1  . HIS A 1 24 ? -11.646 6.962   2.811   1.00 0.00 ? 24  HIS A CE1  17 
ATOM   10623 N  NE2  . HIS A 1 24 ? -12.734 6.384   3.287   1.00 0.00 ? 24  HIS A NE2  17 
ATOM   10624 H  H    . HIS A 1 24 ? -8.654  2.439   5.996   1.00 0.00 ? 24  HIS A H    17 
ATOM   10625 H  HA   . HIS A 1 24 ? -10.313 3.007   3.629   1.00 0.00 ? 24  HIS A HA   17 
ATOM   10626 H  HB2  . HIS A 1 24 ? -10.588 4.260   5.947   1.00 0.00 ? 24  HIS A HB2  17 
ATOM   10627 H  HB3  . HIS A 1 24 ? -9.232  5.204   5.338   1.00 0.00 ? 24  HIS A HB3  17 
ATOM   10628 H  HD1  . HIS A 1 24 ? -9.662  6.643   3.196   1.00 0.00 ? 24  HIS A HD1  17 
ATOM   10629 H  HD2  . HIS A 1 24 ? -13.033 4.770   4.743   1.00 0.00 ? 24  HIS A HD2  17 
ATOM   10630 H  HE1  . HIS A 1 24 ? -11.622 7.761   2.085   1.00 0.00 ? 24  HIS A HE1  17 
ATOM   10631 N  N    . LYS A 1 25 ? -8.411  3.626   2.185   1.00 0.00 ? 25  LYS A N    17 
ATOM   10632 C  CA   . LYS A 1 25 ? -7.295  3.947   1.303   1.00 0.00 ? 25  LYS A CA   17 
ATOM   10633 C  C    . LYS A 1 25 ? -6.572  5.204   1.777   1.00 0.00 ? 25  LYS A C    17 
ATOM   10634 O  O    . LYS A 1 25 ? -5.342  5.258   1.790   1.00 0.00 ? 25  LYS A O    17 
ATOM   10635 C  CB   . LYS A 1 25 ? -7.791  4.141   -0.131  1.00 0.00 ? 25  LYS A CB   17 
ATOM   10636 C  CG   . LYS A 1 25 ? -8.871  5.201   -0.263  1.00 0.00 ? 25  LYS A CG   17 
ATOM   10637 C  CD   . LYS A 1 25 ? -9.725  4.976   -1.499  1.00 0.00 ? 25  LYS A CD   17 
ATOM   10638 C  CE   . LYS A 1 25 ? -9.107  5.623   -2.729  1.00 0.00 ? 25  LYS A CE   17 
ATOM   10639 N  NZ   . LYS A 1 25 ? -9.965  5.454   -3.935  1.00 0.00 ? 25  LYS A NZ   17 
ATOM   10640 H  H    . LYS A 1 25 ? -9.261  3.334   1.793   1.00 0.00 ? 25  LYS A H    17 
ATOM   10641 H  HA   . LYS A 1 25 ? -6.604  3.118   1.327   1.00 0.00 ? 25  LYS A HA   17 
ATOM   10642 H  HB2  . LYS A 1 25 ? -6.956  4.428   -0.753  1.00 0.00 ? 25  LYS A HB2  17 
ATOM   10643 H  HB3  . LYS A 1 25 ? -8.191  3.204   -0.491  1.00 0.00 ? 25  LYS A HB3  17 
ATOM   10644 H  HG2  . LYS A 1 25 ? -9.505  5.167   0.610   1.00 0.00 ? 25  LYS A HG2  17 
ATOM   10645 H  HG3  . LYS A 1 25 ? -8.402  6.173   -0.332  1.00 0.00 ? 25  LYS A HG3  17 
ATOM   10646 H  HD2  . LYS A 1 25 ? -9.819  3.915   -1.674  1.00 0.00 ? 25  LYS A HD2  17 
ATOM   10647 H  HD3  . LYS A 1 25 ? -10.704 5.404   -1.333  1.00 0.00 ? 25  LYS A HD3  17 
ATOM   10648 H  HE2  . LYS A 1 25 ? -8.973  6.676   -2.538  1.00 0.00 ? 25  LYS A HE2  17 
ATOM   10649 H  HE3  . LYS A 1 25 ? -8.146  5.166   -2.915  1.00 0.00 ? 25  LYS A HE3  17 
ATOM   10650 H  HZ1  . LYS A 1 25 ? -10.012 4.451   -4.203  1.00 0.00 ? 25  LYS A HZ1  17 
ATOM   10651 H  HZ2  . LYS A 1 25 ? -9.572  5.997   -4.731  1.00 0.00 ? 25  LYS A HZ2  17 
ATOM   10652 H  HZ3  . LYS A 1 25 ? -10.927 5.796   -3.739  1.00 0.00 ? 25  LYS A HZ3  17 
ATOM   10653 N  N    . THR A 1 26 ? -7.344  6.214   2.166   1.00 0.00 ? 26  THR A N    17 
ATOM   10654 C  CA   . THR A 1 26 ? -6.777  7.471   2.640   1.00 0.00 ? 26  THR A CA   17 
ATOM   10655 C  C    . THR A 1 26 ? -5.686  7.225   3.675   1.00 0.00 ? 26  THR A C    17 
ATOM   10656 O  O    . THR A 1 26 ? -4.651  7.891   3.670   1.00 0.00 ? 26  THR A O    17 
ATOM   10657 C  CB   . THR A 1 26 ? -7.859  8.377   3.257   1.00 0.00 ? 26  THR A CB   17 
ATOM   10658 O  OG1  . THR A 1 26 ? -7.456  9.749   3.171   1.00 0.00 ? 26  THR A OG1  17 
ATOM   10659 C  CG2  . THR A 1 26 ? -8.111  8.008   4.711   1.00 0.00 ? 26  THR A CG2  17 
ATOM   10660 H  H    . THR A 1 26 ? -8.318  6.111   2.132   1.00 0.00 ? 26  THR A H    17 
ATOM   10661 H  HA   . THR A 1 26 ? -6.348  7.984   1.792   1.00 0.00 ? 26  THR A HA   17 
ATOM   10662 H  HB   . THR A 1 26 ? -8.778  8.244   2.703   1.00 0.00 ? 26  THR A HB   17 
ATOM   10663 H  HG1  . THR A 1 26 ? -7.199  9.951   2.268   1.00 0.00 ? 26  THR A HG1  17 
ATOM   10664 H  HG21 . THR A 1 26 ? -7.255  8.289   5.306   1.00 0.00 ? 26  THR A HG21 17 
ATOM   10665 H  HG22 . THR A 1 26 ? -8.270  6.943   4.790   1.00 0.00 ? 26  THR A HG22 17 
ATOM   10666 H  HG23 . THR A 1 26 ? -8.986  8.530   5.069   1.00 0.00 ? 26  THR A HG23 17 
ATOM   10667 N  N    . ASN A 1 27 ? -5.923  6.264   4.563   1.00 0.00 ? 27  ASN A N    17 
ATOM   10668 C  CA   . ASN A 1 27 ? -4.959  5.931   5.605   1.00 0.00 ? 27  ASN A CA   17 
ATOM   10669 C  C    . ASN A 1 27 ? -3.705  5.301   5.004   1.00 0.00 ? 27  ASN A C    17 
ATOM   10670 O  O    . ASN A 1 27 ? -2.601  5.475   5.522   1.00 0.00 ? 27  ASN A O    17 
ATOM   10671 C  CB   . ASN A 1 27 ? -5.586  4.976   6.622   1.00 0.00 ? 27  ASN A CB   17 
ATOM   10672 C  CG   . ASN A 1 27 ? -4.792  4.903   7.912   1.00 0.00 ? 27  ASN A CG   17 
ATOM   10673 O  OD1  . ASN A 1 27 ? -3.573  5.075   7.915   1.00 0.00 ? 27  ASN A OD1  17 
ATOM   10674 N  ND2  . ASN A 1 27 ? -5.482  4.647   9.017   1.00 0.00 ? 27  ASN A ND2  17 
ATOM   10675 H  H    . ASN A 1 27 ? -6.767  5.768   4.516   1.00 0.00 ? 27  ASN A H    17 
ATOM   10676 H  HA   . ASN A 1 27 ? -4.683  6.846   6.106   1.00 0.00 ? 27  ASN A HA   17 
ATOM   10677 H  HB2  . ASN A 1 27 ? -6.585  5.314   6.856   1.00 0.00 ? 27  ASN A HB2  17 
ATOM   10678 H  HB3  . ASN A 1 27 ? -5.635  3.986   6.195   1.00 0.00 ? 27  ASN A HB3  17 
ATOM   10679 H  HD21 . ASN A 1 27 ? -6.451  4.520   8.940   1.00 0.00 ? 27  ASN A HD21 17 
ATOM   10680 H  HD22 . ASN A 1 27 ? -4.994  4.595   9.866   1.00 0.00 ? 27  ASN A HD22 17 
ATOM   10681 N  N    . LEU A 1 28 ? -3.883  4.570   3.910   1.00 0.00 ? 28  LEU A N    17 
ATOM   10682 C  CA   . LEU A 1 28 ? -2.767  3.915   3.237   1.00 0.00 ? 28  LEU A CA   17 
ATOM   10683 C  C    . LEU A 1 28 ? -1.924  4.927   2.469   1.00 0.00 ? 28  LEU A C    17 
ATOM   10684 O  O    . LEU A 1 28 ? -0.699  4.949   2.591   1.00 0.00 ? 28  LEU A O    17 
ATOM   10685 C  CB   . LEU A 1 28 ? -3.283  2.835   2.284   1.00 0.00 ? 28  LEU A CB   17 
ATOM   10686 C  CG   . LEU A 1 28 ? -2.403  2.535   1.071   1.00 0.00 ? 28  LEU A CG   17 
ATOM   10687 C  CD1  . LEU A 1 28 ? -1.168  1.751   1.488   1.00 0.00 ? 28  LEU A CD1  17 
ATOM   10688 C  CD2  . LEU A 1 28 ? -3.190  1.771   0.016   1.00 0.00 ? 28  LEU A CD2  17 
ATOM   10689 H  H    . LEU A 1 28 ? -4.787  4.468   3.544   1.00 0.00 ? 28  LEU A H    17 
ATOM   10690 H  HA   . LEU A 1 28 ? -2.151  3.451   3.994   1.00 0.00 ? 28  LEU A HA   17 
ATOM   10691 H  HB2  . LEU A 1 28 ? -3.392  1.921   2.848   1.00 0.00 ? 28  LEU A HB2  17 
ATOM   10692 H  HB3  . LEU A 1 28 ? -4.251  3.150   1.922   1.00 0.00 ? 28  LEU A HB3  17 
ATOM   10693 H  HG   . LEU A 1 28 ? -2.074  3.467   0.633   1.00 0.00 ? 28  LEU A HG   17 
ATOM   10694 H  HD11 . LEU A 1 28 ? -1.049  1.810   2.559   1.00 0.00 ? 28  LEU A HD11 17 
ATOM   10695 H  HD12 . LEU A 1 28 ? -0.296  2.170   1.005   1.00 0.00 ? 28  LEU A HD12 17 
ATOM   10696 H  HD13 . LEU A 1 28 ? -1.281  0.718   1.193   1.00 0.00 ? 28  LEU A HD13 17 
ATOM   10697 H  HD21 . LEU A 1 28 ? -4.230  2.057   0.066   1.00 0.00 ? 28  LEU A HD21 17 
ATOM   10698 H  HD22 . LEU A 1 28 ? -3.099  0.710   0.198   1.00 0.00 ? 28  LEU A HD22 17 
ATOM   10699 H  HD23 . LEU A 1 28 ? -2.799  2.002   -0.964  1.00 0.00 ? 28  LEU A HD23 17 
ATOM   10700 N  N    . ILE A 1 29 ? -2.588  5.764   1.679   1.00 0.00 ? 29  ILE A N    17 
ATOM   10701 C  CA   . ILE A 1 29 ? -1.900  6.780   0.893   1.00 0.00 ? 29  ILE A CA   17 
ATOM   10702 C  C    . ILE A 1 29 ? -1.078  7.703   1.787   1.00 0.00 ? 29  ILE A C    17 
ATOM   10703 O  O    . ILE A 1 29 ? 0.071   8.020   1.479   1.00 0.00 ? 29  ILE A O    17 
ATOM   10704 C  CB   . ILE A 1 29 ? -2.892  7.627   0.075   1.00 0.00 ? 29  ILE A CB   17 
ATOM   10705 C  CG1  . ILE A 1 29 ? -3.717  6.732   -0.852  1.00 0.00 ? 29  ILE A CG1  17 
ATOM   10706 C  CG2  . ILE A 1 29 ? -2.150  8.687   -0.726  1.00 0.00 ? 29  ILE A CG2  17 
ATOM   10707 C  CD1  . ILE A 1 29 ? -4.962  7.403   -1.390  1.00 0.00 ? 29  ILE A CD1  17 
ATOM   10708 H  H    . ILE A 1 29 ? -3.564  5.696   1.623   1.00 0.00 ? 29  ILE A H    17 
ATOM   10709 H  HA   . ILE A 1 29 ? -1.235  6.277   0.206   1.00 0.00 ? 29  ILE A HA   17 
ATOM   10710 H  HB   . ILE A 1 29 ? -3.555  8.129   0.763   1.00 0.00 ? 29  ILE A HB   17 
ATOM   10711 H  HG12 . ILE A 1 29 ? -3.110  6.439   -1.693  1.00 0.00 ? 29  ILE A HG12 17 
ATOM   10712 H  HG13 . ILE A 1 29 ? -4.023  5.849   -0.309  1.00 0.00 ? 29  ILE A HG13 17 
ATOM   10713 H  HG21 . ILE A 1 29 ? -2.050  8.360   -1.750  1.00 0.00 ? 29  ILE A HG21 17 
ATOM   10714 H  HG22 . ILE A 1 29 ? -2.704  9.613   -0.697  1.00 0.00 ? 29  ILE A HG22 17 
ATOM   10715 H  HG23 . ILE A 1 29 ? -1.170  8.839   -0.300  1.00 0.00 ? 29  ILE A HG23 17 
ATOM   10716 H  HD11 . ILE A 1 29 ? -5.443  7.956   -0.596  1.00 0.00 ? 29  ILE A HD11 17 
ATOM   10717 H  HD12 . ILE A 1 29 ? -4.691  8.080   -2.186  1.00 0.00 ? 29  ILE A HD12 17 
ATOM   10718 H  HD13 . ILE A 1 29 ? -5.640  6.653   -1.768  1.00 0.00 ? 29  ILE A HD13 17 
ATOM   10719 N  N    . ILE A 1 30 ? -1.674  8.128   2.896   1.00 0.00 ? 30  ILE A N    17 
ATOM   10720 C  CA   . ILE A 1 30 ? -0.996  9.012   3.836   1.00 0.00 ? 30  ILE A CA   17 
ATOM   10721 C  C    . ILE A 1 30 ? 0.125   8.281   4.567   1.00 0.00 ? 30  ILE A C    17 
ATOM   10722 O  O    . ILE A 1 30 ? 1.135   8.880   4.935   1.00 0.00 ? 30  ILE A O    17 
ATOM   10723 C  CB   . ILE A 1 30 ? -1.977  9.591   4.872   1.00 0.00 ? 30  ILE A CB   17 
ATOM   10724 C  CG1  . ILE A 1 30 ? -3.093  10.369  4.170   1.00 0.00 ? 30  ILE A CG1  17 
ATOM   10725 C  CG2  . ILE A 1 30 ? -1.240  10.485  5.858   1.00 0.00 ? 30  ILE A CG2  17 
ATOM   10726 C  CD1  . ILE A 1 30 ? -4.279  10.661  5.063   1.00 0.00 ? 30  ILE A CD1  17 
ATOM   10727 H  H    . ILE A 1 30 ? -2.591  7.841   3.086   1.00 0.00 ? 30  ILE A H    17 
ATOM   10728 H  HA   . ILE A 1 30 ? -0.570  9.832   3.275   1.00 0.00 ? 30  ILE A HA   17 
ATOM   10729 H  HB   . ILE A 1 30 ? -2.411  8.770   5.422   1.00 0.00 ? 30  ILE A HB   17 
ATOM   10730 H  HG12 . ILE A 1 30 ? -2.702  11.311  3.821   1.00 0.00 ? 30  ILE A HG12 17 
ATOM   10731 H  HG13 . ILE A 1 30 ? -3.446  9.794   3.326   1.00 0.00 ? 30  ILE A HG13 17 
ATOM   10732 H  HG21 . ILE A 1 30 ? -0.850  11.348  5.339   1.00 0.00 ? 30  ILE A HG21 17 
ATOM   10733 H  HG22 . ILE A 1 30 ? -1.922  10.809  6.629   1.00 0.00 ? 30  ILE A HG22 17 
ATOM   10734 H  HG23 . ILE A 1 30 ? -0.426  9.935   6.304   1.00 0.00 ? 30  ILE A HG23 17 
ATOM   10735 H  HD11 . ILE A 1 30 ? -5.144  10.126  4.699   1.00 0.00 ? 30  ILE A HD11 17 
ATOM   10736 H  HD12 . ILE A 1 30 ? -4.059  10.343  6.071   1.00 0.00 ? 30  ILE A HD12 17 
ATOM   10737 H  HD13 . ILE A 1 30 ? -4.483  11.721  5.056   1.00 0.00 ? 30  ILE A HD13 17 
ATOM   10738 N  N    . HIS A 1 31 ? -0.061  6.981   4.774   1.00 0.00 ? 31  HIS A N    17 
ATOM   10739 C  CA   . HIS A 1 31 ? 0.936   6.166   5.460   1.00 0.00 ? 31  HIS A CA   17 
ATOM   10740 C  C    . HIS A 1 31 ? 2.163   5.953   4.578   1.00 0.00 ? 31  HIS A C    17 
ATOM   10741 O  O    . HIS A 1 31 ? 3.293   6.190   5.005   1.00 0.00 ? 31  HIS A O    17 
ATOM   10742 C  CB   . HIS A 1 31 ? 0.337   4.815   5.855   1.00 0.00 ? 31  HIS A CB   17 
ATOM   10743 C  CG   . HIS A 1 31 ? 1.351   3.718   5.958   1.00 0.00 ? 31  HIS A CG   17 
ATOM   10744 N  ND1  . HIS A 1 31 ? 1.878   3.290   7.158   1.00 0.00 ? 31  HIS A ND1  17 
ATOM   10745 C  CD2  . HIS A 1 31 ? 1.934   2.958   5.001   1.00 0.00 ? 31  HIS A CD2  17 
ATOM   10746 C  CE1  . HIS A 1 31 ? 2.742   2.316   6.935   1.00 0.00 ? 31  HIS A CE1  17 
ATOM   10747 N  NE2  . HIS A 1 31 ? 2.794   2.095   5.634   1.00 0.00 ? 31  HIS A NE2  17 
ATOM   10748 H  H    . HIS A 1 31 ? -0.887  6.560   4.458   1.00 0.00 ? 31  HIS A H    17 
ATOM   10749 H  HA   . HIS A 1 31 ? 1.237   6.692   6.353   1.00 0.00 ? 31  HIS A HA   17 
ATOM   10750 H  HB2  . HIS A 1 31 ? -0.146  4.911   6.816   1.00 0.00 ? 31  HIS A HB2  17 
ATOM   10751 H  HB3  . HIS A 1 31 ? -0.395  4.523   5.116   1.00 0.00 ? 31  HIS A HB3  17 
ATOM   10752 H  HD1  . HIS A 1 31 ? 1.653   3.649   8.042   1.00 0.00 ? 31  HIS A HD1  17 
ATOM   10753 H  HD2  . HIS A 1 31 ? 1.756   3.019   3.936   1.00 0.00 ? 31  HIS A HD2  17 
ATOM   10754 H  HE1  . HIS A 1 31 ? 3.309   1.790   7.688   1.00 0.00 ? 31  HIS A HE1  17 
ATOM   10755 N  N    . GLN A 1 32 ? 1.933   5.505   3.349   1.00 0.00 ? 32  GLN A N    17 
ATOM   10756 C  CA   . GLN A 1 32 ? 3.020   5.259   2.409   1.00 0.00 ? 32  GLN A CA   17 
ATOM   10757 C  C    . GLN A 1 32 ? 4.049   6.384   2.461   1.00 0.00 ? 32  GLN A C    17 
ATOM   10758 O  O    . GLN A 1 32 ? 5.212   6.192   2.107   1.00 0.00 ? 32  GLN A O    17 
ATOM   10759 C  CB   . GLN A 1 32 ? 2.472   5.119   0.988   1.00 0.00 ? 32  GLN A CB   17 
ATOM   10760 C  CG   . GLN A 1 32 ? 1.723   3.818   0.750   1.00 0.00 ? 32  GLN A CG   17 
ATOM   10761 C  CD   . GLN A 1 32 ? 1.555   3.501   -0.723  1.00 0.00 ? 32  GLN A CD   17 
ATOM   10762 O  OE1  . GLN A 1 32 ? 2.536   3.364   -1.455  1.00 0.00 ? 32  GLN A OE1  17 
ATOM   10763 N  NE2  . GLN A 1 32 ? 0.309   3.383   -1.165  1.00 0.00 ? 32  GLN A NE2  17 
ATOM   10764 H  H    . GLN A 1 32 ? 1.010   5.334   3.067   1.00 0.00 ? 32  GLN A H    17 
ATOM   10765 H  HA   . GLN A 1 32 ? 3.501   4.335   2.693   1.00 0.00 ? 32  GLN A HA   17 
ATOM   10766 H  HB2  . GLN A 1 32 ? 1.798   5.939   0.792   1.00 0.00 ? 32  GLN A HB2  17 
ATOM   10767 H  HB3  . GLN A 1 32 ? 3.296   5.166   0.291   1.00 0.00 ? 32  GLN A HB3  17 
ATOM   10768 H  HG2  . GLN A 1 32 ? 2.270   3.011   1.216   1.00 0.00 ? 32  GLN A HG2  17 
ATOM   10769 H  HG3  . GLN A 1 32 ? 0.744   3.894   1.201   1.00 0.00 ? 32  GLN A HG3  17 
ATOM   10770 H  HE21 . GLN A 1 32 ? -0.423  3.506   -0.524  1.00 0.00 ? 32  GLN A HE21 17 
ATOM   10771 H  HE22 . GLN A 1 32 ? 0.172   3.179   -2.113  1.00 0.00 ? 32  GLN A HE22 17 
ATOM   10772 N  N    . LYS A 1 33 ? 3.613   7.557   2.906   1.00 0.00 ? 33  LYS A N    17 
ATOM   10773 C  CA   . LYS A 1 33 ? 4.496   8.714   3.006   1.00 0.00 ? 33  LYS A CA   17 
ATOM   10774 C  C    . LYS A 1 33 ? 5.697   8.406   3.895   1.00 0.00 ? 33  LYS A C    17 
ATOM   10775 O  O    . LYS A 1 33 ? 6.833   8.733   3.553   1.00 0.00 ? 33  LYS A O    17 
ATOM   10776 C  CB   . LYS A 1 33 ? 3.731   9.918   3.562   1.00 0.00 ? 33  LYS A CB   17 
ATOM   10777 C  CG   . LYS A 1 33 ? 2.606   10.393  2.660   1.00 0.00 ? 33  LYS A CG   17 
ATOM   10778 C  CD   . LYS A 1 33 ? 2.367   11.886  2.805   1.00 0.00 ? 33  LYS A CD   17 
ATOM   10779 C  CE   . LYS A 1 33 ? 1.521   12.429  1.664   1.00 0.00 ? 33  LYS A CE   17 
ATOM   10780 N  NZ   . LYS A 1 33 ? 1.706   13.896  1.485   1.00 0.00 ? 33  LYS A NZ   17 
ATOM   10781 H  H    . LYS A 1 33 ? 2.674   7.648   3.174   1.00 0.00 ? 33  LYS A H    17 
ATOM   10782 H  HA   . LYS A 1 33 ? 4.848   8.949   2.013   1.00 0.00 ? 33  LYS A HA   17 
ATOM   10783 H  HB2  . LYS A 1 33 ? 3.309   9.650   4.519   1.00 0.00 ? 33  LYS A HB2  17 
ATOM   10784 H  HB3  . LYS A 1 33 ? 4.424   10.736  3.699   1.00 0.00 ? 33  LYS A HB3  17 
ATOM   10785 H  HG2  . LYS A 1 33 ? 2.864   10.179  1.633   1.00 0.00 ? 33  LYS A HG2  17 
ATOM   10786 H  HG3  . LYS A 1 33 ? 1.699   9.865   2.922   1.00 0.00 ? 33  LYS A HG3  17 
ATOM   10787 H  HD2  . LYS A 1 33 ? 1.854   12.071  3.737   1.00 0.00 ? 33  LYS A HD2  17 
ATOM   10788 H  HD3  . LYS A 1 33 ? 3.320   12.396  2.809   1.00 0.00 ? 33  LYS A HD3  17 
ATOM   10789 H  HE2  . LYS A 1 33 ? 1.804   11.926  0.752   1.00 0.00 ? 33  LYS A HE2  17 
ATOM   10790 H  HE3  . LYS A 1 33 ? 0.481   12.229  1.877   1.00 0.00 ? 33  LYS A HE3  17 
ATOM   10791 H  HZ1  . LYS A 1 33 ? 1.425   14.400  2.350   1.00 0.00 ? 33  LYS A HZ1  17 
ATOM   10792 H  HZ2  . LYS A 1 33 ? 1.123   14.235  0.693   1.00 0.00 ? 33  LYS A HZ2  17 
ATOM   10793 H  HZ3  . LYS A 1 33 ? 2.704   14.108  1.282   1.00 0.00 ? 33  LYS A HZ3  17 
ATOM   10794 N  N    . ILE A 1 34 ? 5.437   7.775   5.035   1.00 0.00 ? 34  ILE A N    17 
ATOM   10795 C  CA   . ILE A 1 34 ? 6.498   7.422   5.970   1.00 0.00 ? 34  ILE A CA   17 
ATOM   10796 C  C    . ILE A 1 34 ? 7.670   6.765   5.250   1.00 0.00 ? 34  ILE A C    17 
ATOM   10797 O  O    . ILE A 1 34 ? 8.792   6.745   5.756   1.00 0.00 ? 34  ILE A O    17 
ATOM   10798 C  CB   . ILE A 1 34 ? 5.986   6.471   7.068   1.00 0.00 ? 34  ILE A CB   17 
ATOM   10799 C  CG1  . ILE A 1 34 ? 5.804   5.059   6.507   1.00 0.00 ? 34  ILE A CG1  17 
ATOM   10800 C  CG2  . ILE A 1 34 ? 4.679   6.988   7.650   1.00 0.00 ? 34  ILE A CG2  17 
ATOM   10801 C  CD1  . ILE A 1 34 ? 5.485   4.025   7.564   1.00 0.00 ? 34  ILE A CD1  17 
ATOM   10802 H  H    . ILE A 1 34 ? 4.511   7.542   5.252   1.00 0.00 ? 34  ILE A H    17 
ATOM   10803 H  HA   . ILE A 1 34 ? 6.843   8.331   6.441   1.00 0.00 ? 34  ILE A HA   17 
ATOM   10804 H  HB   . ILE A 1 34 ? 6.719   6.444   7.860   1.00 0.00 ? 34  ILE A HB   17 
ATOM   10805 H  HG12 . ILE A 1 34 ? 4.995   5.064   5.794   1.00 0.00 ? 34  ILE A HG12 17 
ATOM   10806 H  HG13 . ILE A 1 34 ? 6.715   4.758   6.010   1.00 0.00 ? 34  ILE A HG13 17 
ATOM   10807 H  HG21 . ILE A 1 34 ? 4.787   7.123   8.716   1.00 0.00 ? 34  ILE A HG21 17 
ATOM   10808 H  HG22 . ILE A 1 34 ? 4.431   7.934   7.192   1.00 0.00 ? 34  ILE A HG22 17 
ATOM   10809 H  HG23 . ILE A 1 34 ? 3.891   6.276   7.455   1.00 0.00 ? 34  ILE A HG23 17 
ATOM   10810 H  HD11 . ILE A 1 34 ? 5.999   3.103   7.331   1.00 0.00 ? 34  ILE A HD11 17 
ATOM   10811 H  HD12 . ILE A 1 34 ? 5.811   4.384   8.529   1.00 0.00 ? 34  ILE A HD12 17 
ATOM   10812 H  HD13 . ILE A 1 34 ? 4.421   3.848   7.585   1.00 0.00 ? 34  ILE A HD13 17 
ATOM   10813 N  N    . HIS A 1 35 ? 7.402   6.228   4.063   1.00 0.00 ? 35  HIS A N    17 
ATOM   10814 C  CA   . HIS A 1 35 ? 8.436   5.571   3.271   1.00 0.00 ? 35  HIS A CA   17 
ATOM   10815 C  C    . HIS A 1 35 ? 9.130   6.569   2.350   1.00 0.00 ? 35  HIS A C    17 
ATOM   10816 O  O    . HIS A 1 35 ? 10.335  6.477   2.112   1.00 0.00 ? 35  HIS A O    17 
ATOM   10817 C  CB   . HIS A 1 35 ? 7.830   4.435   2.446   1.00 0.00 ? 35  HIS A CB   17 
ATOM   10818 C  CG   . HIS A 1 35 ? 7.174   3.375   3.278   1.00 0.00 ? 35  HIS A CG   17 
ATOM   10819 N  ND1  . HIS A 1 35 ? 7.800   2.755   4.338   1.00 0.00 ? 35  HIS A ND1  17 
ATOM   10820 C  CD2  . HIS A 1 35 ? 5.938   2.829   3.200   1.00 0.00 ? 35  HIS A CD2  17 
ATOM   10821 C  CE1  . HIS A 1 35 ? 6.979   1.872   4.876   1.00 0.00 ? 35  HIS A CE1  17 
ATOM   10822 N  NE2  . HIS A 1 35 ? 5.842   1.897   4.204   1.00 0.00 ? 35  HIS A NE2  17 
ATOM   10823 H  H    . HIS A 1 35 ? 6.488   6.275   3.713   1.00 0.00 ? 35  HIS A H    17 
ATOM   10824 H  HA   . HIS A 1 35 ? 9.165   5.161   3.952   1.00 0.00 ? 35  HIS A HA   17 
ATOM   10825 H  HB2  . HIS A 1 35 ? 7.085   4.840   1.778   1.00 0.00 ? 35  HIS A HB2  17 
ATOM   10826 H  HB3  . HIS A 1 35 ? 8.611   3.965   1.865   1.00 0.00 ? 35  HIS A HB3  17 
ATOM   10827 H  HD1  . HIS A 1 35 ? 8.712   2.935   4.649   1.00 0.00 ? 35  HIS A HD1  17 
ATOM   10828 H  HD2  . HIS A 1 35 ? 5.170   3.078   2.482   1.00 0.00 ? 35  HIS A HD2  17 
ATOM   10829 H  HE1  . HIS A 1 35 ? 7.198   1.237   5.721   1.00 0.00 ? 35  HIS A HE1  17 
ATOM   10830 N  N    . THR A 1 36 ? 8.363   7.524   1.833   1.00 0.00 ? 36  THR A N    17 
ATOM   10831 C  CA   . THR A 1 36 ? 8.904   8.538   0.936   1.00 0.00 ? 36  THR A CA   17 
ATOM   10832 C  C    . THR A 1 36 ? 8.826   9.925   1.564   1.00 0.00 ? 36  THR A C    17 
ATOM   10833 O  O    . THR A 1 36 ? 8.354   10.874  0.940   1.00 0.00 ? 36  THR A O    17 
ATOM   10834 C  CB   . THR A 1 36 ? 8.156   8.553   -0.411  1.00 0.00 ? 36  THR A CB   17 
ATOM   10835 O  OG1  . THR A 1 36 ? 8.675   9.593   -1.247  1.00 0.00 ? 36  THR A OG1  17 
ATOM   10836 C  CG2  . THR A 1 36 ? 6.664   8.763   -0.199  1.00 0.00 ? 36  THR A CG2  17 
ATOM   10837 H  H    . THR A 1 36 ? 7.410   7.544   2.059   1.00 0.00 ? 36  THR A H    17 
ATOM   10838 H  HA   . THR A 1 36 ? 9.940   8.297   0.746   1.00 0.00 ? 36  THR A HA   17 
ATOM   10839 H  HB   . THR A 1 36 ? 8.305   7.601   -0.899  1.00 0.00 ? 36  THR A HB   17 
ATOM   10840 H  HG1  . THR A 1 36 ? 9.488   9.295   -1.662  1.00 0.00 ? 36  THR A HG1  17 
ATOM   10841 H  HG21 . THR A 1 36 ? 6.505   9.668   0.367   1.00 0.00 ? 36  THR A HG21 17 
ATOM   10842 H  HG22 . THR A 1 36 ? 6.256   7.923   0.344   1.00 0.00 ? 36  THR A HG22 17 
ATOM   10843 H  HG23 . THR A 1 36 ? 6.173   8.846   -1.157  1.00 0.00 ? 36  THR A HG23 17 
ATOM   10844 N  N    . GLY A 1 37 ? 9.292   10.035  2.804   1.00 0.00 ? 37  GLY A N    17 
ATOM   10845 C  CA   . GLY A 1 37 ? 9.267   11.311  3.496   1.00 0.00 ? 37  GLY A CA   17 
ATOM   10846 C  C    . GLY A 1 37 ? 10.611  11.672  4.096   1.00 0.00 ? 37  GLY A C    17 
ATOM   10847 O  O    . GLY A 1 37 ? 11.209  12.683  3.729   1.00 0.00 ? 37  GLY A O    17 
ATOM   10848 H  H    . GLY A 1 37 ? 9.657   9.244   3.253   1.00 0.00 ? 37  GLY A H    17 
ATOM   10849 H  HA2  . GLY A 1 37 ? 8.977   12.081  2.796   1.00 0.00 ? 37  GLY A HA2  17 
ATOM   10850 H  HA3  . GLY A 1 37 ? 8.533   11.263  4.287   1.00 0.00 ? 37  GLY A HA3  17 
ATOM   10851 N  N    . GLU A 1 38 ? 11.085  10.845  5.022   1.00 0.00 ? 38  GLU A N    17 
ATOM   10852 C  CA   . GLU A 1 38 ? 12.366  11.086  5.676   1.00 0.00 ? 38  GLU A CA   17 
ATOM   10853 C  C    . GLU A 1 38 ? 13.397  10.043  5.253   1.00 0.00 ? 38  GLU A C    17 
ATOM   10854 O  O    . GLU A 1 38 ? 13.703  9.117   6.003   1.00 0.00 ? 38  GLU A O    17 
ATOM   10855 C  CB   . GLU A 1 38 ? 12.200  11.066  7.197   1.00 0.00 ? 38  GLU A CB   17 
ATOM   10856 C  CG   . GLU A 1 38 ? 11.356  12.210  7.732   1.00 0.00 ? 38  GLU A CG   17 
ATOM   10857 C  CD   . GLU A 1 38 ? 12.118  13.520  7.789   1.00 0.00 ? 38  GLU A CD   17 
ATOM   10858 O  OE1  . GLU A 1 38 ? 13.333  13.488  8.076   1.00 0.00 ? 38  GLU A OE1  17 
ATOM   10859 O  OE2  . GLU A 1 38 ? 11.499  14.577  7.547   1.00 0.00 ? 38  GLU A OE2  17 
ATOM   10860 H  H    . GLU A 1 38 ? 10.561  10.056  5.272   1.00 0.00 ? 38  GLU A H    17 
ATOM   10861 H  HA   . GLU A 1 38 ? 12.715  12.062  5.374   1.00 0.00 ? 38  GLU A HA   17 
ATOM   10862 H  HB2  . GLU A 1 38 ? 11.732  10.135  7.484   1.00 0.00 ? 38  GLU A HB2  17 
ATOM   10863 H  HB3  . GLU A 1 38 ? 13.176  11.122  7.654   1.00 0.00 ? 38  GLU A HB3  17 
ATOM   10864 H  HG2  . GLU A 1 38 ? 10.498  12.339  7.089   1.00 0.00 ? 38  GLU A HG2  17 
ATOM   10865 H  HG3  . GLU A 1 38 ? 11.023  11.960  8.728   1.00 0.00 ? 38  GLU A HG3  17 
ATOM   10866 N  N    . ARG A 1 39 ? 13.928  10.202  4.045   1.00 0.00 ? 39  ARG A N    17 
ATOM   10867 C  CA   . ARG A 1 39 ? 14.923  9.274   3.520   1.00 0.00 ? 39  ARG A CA   17 
ATOM   10868 C  C    . ARG A 1 39 ? 16.198  10.012  3.121   1.00 0.00 ? 39  ARG A C    17 
ATOM   10869 O  O    . ARG A 1 39 ? 16.163  11.139  2.625   1.00 0.00 ? 39  ARG A O    17 
ATOM   10870 C  CB   . ARG A 1 39 ? 14.361  8.517   2.315   1.00 0.00 ? 39  ARG A CB   17 
ATOM   10871 C  CG   . ARG A 1 39 ? 13.279  7.513   2.678   1.00 0.00 ? 39  ARG A CG   17 
ATOM   10872 C  CD   . ARG A 1 39 ? 13.859  6.307   3.402   1.00 0.00 ? 39  ARG A CD   17 
ATOM   10873 N  NE   . ARG A 1 39 ? 12.844  5.587   4.166   1.00 0.00 ? 39  ARG A NE   17 
ATOM   10874 C  CZ   . ARG A 1 39 ? 12.944  4.304   4.495   1.00 0.00 ? 39  ARG A CZ   17 
ATOM   10875 N  NH1  . ARG A 1 39 ? 14.008  3.604   4.128   1.00 0.00 ? 39  ARG A NH1  17 
ATOM   10876 N  NH2  . ARG A 1 39 ? 11.978  3.720   5.192   1.00 0.00 ? 39  ARG A NH2  17 
ATOM   10877 H  H    . ARG A 1 39 ? 13.644  10.960  3.493   1.00 0.00 ? 39  ARG A H    17 
ATOM   10878 H  HA   . ARG A 1 39 ? 15.161  8.566   4.300   1.00 0.00 ? 39  ARG A HA   17 
ATOM   10879 H  HB2  . ARG A 1 39 ? 13.941  9.230   1.621   1.00 0.00 ? 39  ARG A HB2  17 
ATOM   10880 H  HB3  . ARG A 1 39 ? 15.167  7.987   1.831   1.00 0.00 ? 39  ARG A HB3  17 
ATOM   10881 H  HG2  . ARG A 1 39 ? 12.557  7.992   3.322   1.00 0.00 ? 39  ARG A HG2  17 
ATOM   10882 H  HG3  . ARG A 1 39 ? 12.793  7.179   1.773   1.00 0.00 ? 39  ARG A HG3  17 
ATOM   10883 H  HD2  . ARG A 1 39 ? 14.288  5.638   2.672   1.00 0.00 ? 39  ARG A HD2  17 
ATOM   10884 H  HD3  . ARG A 1 39 ? 14.631  6.647   4.076   1.00 0.00 ? 39  ARG A HD3  17 
ATOM   10885 H  HE   . ARG A 1 39 ? 12.049  6.086   4.447   1.00 0.00 ? 39  ARG A HE   17 
ATOM   10886 H  HH11 . ARG A 1 39 ? 14.738  4.042   3.604   1.00 0.00 ? 39  ARG A HH11 17 
ATOM   10887 H  HH12 . ARG A 1 39 ? 14.082  2.638   4.378   1.00 0.00 ? 39  ARG A HH12 17 
ATOM   10888 H  HH21 . ARG A 1 39 ? 11.174  4.245   5.470   1.00 0.00 ? 39  ARG A HH21 17 
ATOM   10889 H  HH22 . ARG A 1 39 ? 12.054  2.754   5.439   1.00 0.00 ? 39  ARG A HH22 17 
ATOM   10890 N  N    . PRO A 1 40 ? 17.351  9.364   3.341   1.00 0.00 ? 40  PRO A N    17 
ATOM   10891 C  CA   . PRO A 1 40 ? 18.658  9.940   3.012   1.00 0.00 ? 40  PRO A CA   17 
ATOM   10892 C  C    . PRO A 1 40 ? 18.887  10.036  1.507   1.00 0.00 ? 40  PRO A C    17 
ATOM   10893 O  O    . PRO A 1 40 ? 19.454  11.013  1.017   1.00 0.00 ? 40  PRO A O    17 
ATOM   10894 C  CB   . PRO A 1 40 ? 19.648  8.956   3.641   1.00 0.00 ? 40  PRO A CB   17 
ATOM   10895 C  CG   . PRO A 1 40 ? 18.911  7.663   3.700   1.00 0.00 ? 40  PRO A CG   17 
ATOM   10896 C  CD   . PRO A 1 40 ? 17.468  8.019   3.928   1.00 0.00 ? 40  PRO A CD   17 
ATOM   10897 H  HA   . PRO A 1 40 ? 18.786  10.915  3.457   1.00 0.00 ? 40  PRO A HA   17 
ATOM   10898 H  HB2  . PRO A 1 40 ? 20.529  8.881   3.019   1.00 0.00 ? 40  PRO A HB2  17 
ATOM   10899 H  HB3  . PRO A 1 40 ? 19.924  9.298   4.627   1.00 0.00 ? 40  PRO A HB3  17 
ATOM   10900 H  HG2  . PRO A 1 40 ? 19.023  7.133   2.766   1.00 0.00 ? 40  PRO A HG2  17 
ATOM   10901 H  HG3  . PRO A 1 40 ? 19.283  7.065   4.518   1.00 0.00 ? 40  PRO A HG3  17 
ATOM   10902 H  HD2  . PRO A 1 40 ? 16.821  7.318   3.420   1.00 0.00 ? 40  PRO A HD2  17 
ATOM   10903 H  HD3  . PRO A 1 40 ? 17.247  8.040   4.986   1.00 0.00 ? 40  PRO A HD3  17 
ATOM   10904 N  N    . SER A 1 41 ? 18.441  9.018   0.779   1.00 0.00 ? 41  SER A N    17 
ATOM   10905 C  CA   . SER A 1 41 ? 18.599  8.987   -0.670  1.00 0.00 ? 41  SER A CA   17 
ATOM   10906 C  C    . SER A 1 41 ? 17.328  9.464   -1.366  1.00 0.00 ? 41  SER A C    17 
ATOM   10907 O  O    . SER A 1 41 ? 16.437  8.670   -1.668  1.00 0.00 ? 41  SER A O    17 
ATOM   10908 C  CB   . SER A 1 41 ? 18.950  7.573   -1.136  1.00 0.00 ? 41  SER A CB   17 
ATOM   10909 O  OG   . SER A 1 41 ? 17.977  6.637   -0.703  1.00 0.00 ? 41  SER A OG   17 
ATOM   10910 H  H    . SER A 1 41 ? 17.996  8.268   1.228   1.00 0.00 ? 41  SER A H    17 
ATOM   10911 H  HA   . SER A 1 41 ? 19.409  9.653   -0.929  1.00 0.00 ? 41  SER A HA   17 
ATOM   10912 H  HB2  . SER A 1 41 ? 18.996  7.552   -2.214  1.00 0.00 ? 41  SER A HB2  17 
ATOM   10913 H  HB3  . SER A 1 41 ? 19.910  7.290   -0.729  1.00 0.00 ? 41  SER A HB3  17 
ATOM   10914 H  HG   . SER A 1 41 ? 18.125  6.426   0.222   1.00 0.00 ? 41  SER A HG   17 
ATOM   10915 N  N    . GLY A 1 42 ? 17.252  10.767  -1.619  1.00 0.00 ? 42  GLY A N    17 
ATOM   10916 C  CA   . GLY A 1 42 ? 16.087  11.328  -2.278  1.00 0.00 ? 42  GLY A CA   17 
ATOM   10917 C  C    . GLY A 1 42 ? 16.429  12.531  -3.134  1.00 0.00 ? 42  GLY A C    17 
ATOM   10918 O  O    . GLY A 1 42 ? 17.571  12.717  -3.554  1.00 0.00 ? 42  GLY A O    17 
ATOM   10919 H  H    . GLY A 1 42 ? 17.993  11.352  -1.356  1.00 0.00 ? 42  GLY A H    17 
ATOM   10920 H  HA2  . GLY A 1 42 ? 15.640  10.569  -2.902  1.00 0.00 ? 42  GLY A HA2  17 
ATOM   10921 H  HA3  . GLY A 1 42 ? 15.372  11.628  -1.525  1.00 0.00 ? 42  GLY A HA3  17 
ATOM   10922 N  N    . PRO A 1 43 ? 15.421  13.373  -3.407  1.00 0.00 ? 43  PRO A N    17 
ATOM   10923 C  CA   . PRO A 1 43 ? 15.595  14.578  -4.223  1.00 0.00 ? 43  PRO A CA   17 
ATOM   10924 C  C    . PRO A 1 43 ? 16.423  15.644  -3.513  1.00 0.00 ? 43  PRO A C    17 
ATOM   10925 O  O    . PRO A 1 43 ? 15.903  16.408  -2.700  1.00 0.00 ? 43  PRO A O    17 
ATOM   10926 C  CB   . PRO A 1 43 ? 14.162  15.071  -4.440  1.00 0.00 ? 43  PRO A CB   17 
ATOM   10927 C  CG   . PRO A 1 43 ? 13.398  14.533  -3.279  1.00 0.00 ? 43  PRO A CG   17 
ATOM   10928 C  CD   . PRO A 1 43 ? 14.033  13.214  -2.940  1.00 0.00 ? 43  PRO A CD   17 
ATOM   10929 H  HA   . PRO A 1 43 ? 16.047  14.350  -5.177  1.00 0.00 ? 43  PRO A HA   17 
ATOM   10930 H  HB2  . PRO A 1 43 ? 14.149  16.152  -4.456  1.00 0.00 ? 43  PRO A HB2  17 
ATOM   10931 H  HB3  . PRO A 1 43 ? 13.783  14.686  -5.374  1.00 0.00 ? 43  PRO A HB3  17 
ATOM   10932 H  HG2  . PRO A 1 43 ? 13.474  15.212  -2.444  1.00 0.00 ? 43  PRO A HG2  17 
ATOM   10933 H  HG3  . PRO A 1 43 ? 12.364  14.391  -3.556  1.00 0.00 ? 43  PRO A HG3  17 
ATOM   10934 H  HD2  . PRO A 1 43 ? 14.003  13.043  -1.874  1.00 0.00 ? 43  PRO A HD2  17 
ATOM   10935 H  HD3  . PRO A 1 43 ? 13.540  12.410  -3.468  1.00 0.00 ? 43  PRO A HD3  17 
ATOM   10936 N  N    . SER A 1 44 ? 17.714  15.690  -3.826  1.00 0.00 ? 44  SER A N    17 
ATOM   10937 C  CA   . SER A 1 44 ? 18.615  16.660  -3.215  1.00 0.00 ? 44  SER A CA   17 
ATOM   10938 C  C    . SER A 1 44 ? 18.596  17.978  -3.983  1.00 0.00 ? 44  SER A C    17 
ATOM   10939 O  O    . SER A 1 44 ? 19.640  18.580  -4.231  1.00 0.00 ? 44  SER A O    17 
ATOM   10940 C  CB   . SER A 1 44 ? 20.040  16.105  -3.167  1.00 0.00 ? 44  SER A CB   17 
ATOM   10941 O  OG   . SER A 1 44 ? 20.530  15.846  -4.471  1.00 0.00 ? 44  SER A OG   17 
ATOM   10942 H  H    . SER A 1 44 ? 18.070  15.054  -4.482  1.00 0.00 ? 44  SER A H    17 
ATOM   10943 H  HA   . SER A 1 44 ? 18.274  16.840  -2.206  1.00 0.00 ? 44  SER A HA   17 
ATOM   10944 H  HB2  . SER A 1 44 ? 20.688  16.824  -2.688  1.00 0.00 ? 44  SER A HB2  17 
ATOM   10945 H  HB3  . SER A 1 44 ? 20.046  15.184  -2.603  1.00 0.00 ? 44  SER A HB3  17 
ATOM   10946 H  HG   . SER A 1 44 ? 20.074  16.407  -5.102  1.00 0.00 ? 44  SER A HG   17 
ATOM   10947 N  N    . SER A 1 45 ? 17.399  18.420  -4.357  1.00 0.00 ? 45  SER A N    17 
ATOM   10948 C  CA   . SER A 1 45 ? 17.243  19.665  -5.101  1.00 0.00 ? 45  SER A CA   17 
ATOM   10949 C  C    . SER A 1 45 ? 18.277  19.764  -6.218  1.00 0.00 ? 45  SER A C    17 
ATOM   10950 O  O    . SER A 1 45 ? 18.848  20.827  -6.458  1.00 0.00 ? 45  SER A O    17 
ATOM   10951 C  CB   . SER A 1 45 ? 17.373  20.865  -4.161  1.00 0.00 ? 45  SER A CB   17 
ATOM   10952 O  OG   . SER A 1 45 ? 16.256  20.958  -3.294  1.00 0.00 ? 45  SER A OG   17 
ATOM   10953 H  H    . SER A 1 45 ? 16.604  17.895  -4.130  1.00 0.00 ? 45  SER A H    17 
ATOM   10954 H  HA   . SER A 1 45 ? 16.256  19.667  -5.539  1.00 0.00 ? 45  SER A HA   17 
ATOM   10955 H  HB2  . SER A 1 45 ? 18.267  20.757  -3.566  1.00 0.00 ? 45  SER A HB2  17 
ATOM   10956 H  HB3  . SER A 1 45 ? 17.437  21.771  -4.746  1.00 0.00 ? 45  SER A HB3  17 
ATOM   10957 H  HG   . SER A 1 45 ? 15.451  21.016  -3.814  1.00 0.00 ? 45  SER A HG   17 
ATOM   10958 N  N    . GLY A 1 46 ? 18.513  18.647  -6.899  1.00 0.00 ? 46  GLY A N    17 
ATOM   10959 C  CA   . GLY A 1 46 ? 19.478  18.628  -7.983  1.00 0.00 ? 46  GLY A CA   17 
ATOM   10960 C  C    . GLY A 1 46 ? 19.765  17.225  -8.479  1.00 0.00 ? 46  GLY A C    17 
ATOM   10961 O  O    . GLY A 1 46 ? 18.980  16.695  -9.264  1.00 0.00 ? 46  GLY A O    17 
ATOM   10962 H  H    . GLY A 1 46 ? 18.027  17.828  -6.663  1.00 0.00 ? 46  GLY A H    17 
ATOM   10963 H  HA2  . GLY A 1 46 ? 19.094  19.217  -8.802  1.00 0.00 ? 46  GLY A HA2  17 
ATOM   10964 H  HA3  . GLY A 1 46 ? 20.400  19.070  -7.635  1.00 0.00 ? 46  GLY A HA3  17 
HETATM 10965 ZN ZN   . ZN  B 2 .  ? 4.055   0.917   4.436   1.00 0.00 ? 201 ZN  A ZN   17 
ATOM   10966 N  N    . GLY A 1 1  ? 7.249   -32.051 6.068   1.00 0.00 ? 1   GLY A N    18 
ATOM   10967 C  CA   . GLY A 1 1  ? 6.629   -30.988 5.299   1.00 0.00 ? 1   GLY A CA   18 
ATOM   10968 C  C    . GLY A 1 1  ? 5.198   -30.725 5.723   1.00 0.00 ? 1   GLY A C    18 
ATOM   10969 O  O    . GLY A 1 1  ? 4.419   -31.659 5.917   1.00 0.00 ? 1   GLY A O    18 
ATOM   10970 H  H1   . GLY A 1 1  ? 8.223   -32.164 6.049   1.00 0.00 ? 1   GLY A H1   18 
ATOM   10971 H  HA2  . GLY A 1 1  ? 7.204   -30.083 5.428   1.00 0.00 ? 1   GLY A HA2  18 
ATOM   10972 H  HA3  . GLY A 1 1  ? 6.638   -31.263 4.255   1.00 0.00 ? 1   GLY A HA3  18 
ATOM   10973 N  N    . SER A 1 2  ? 4.850   -29.451 5.869   1.00 0.00 ? 2   SER A N    18 
ATOM   10974 C  CA   . SER A 1 2  ? 3.504   -29.068 6.279   1.00 0.00 ? 2   SER A CA   18 
ATOM   10975 C  C    . SER A 1 2  ? 3.048   -27.812 5.541   1.00 0.00 ? 2   SER A C    18 
ATOM   10976 O  O    . SER A 1 2  ? 3.760   -26.808 5.504   1.00 0.00 ? 2   SER A O    18 
ATOM   10977 C  CB   . SER A 1 2  ? 3.455   -28.832 7.789   1.00 0.00 ? 2   SER A CB   18 
ATOM   10978 O  OG   . SER A 1 2  ? 2.267   -28.154 8.162   1.00 0.00 ? 2   SER A OG   18 
ATOM   10979 H  H    . SER A 1 2  ? 5.516   -28.752 5.700   1.00 0.00 ? 2   SER A H    18 
ATOM   10980 H  HA   . SER A 1 2  ? 2.837   -29.880 6.028   1.00 0.00 ? 2   SER A HA   18 
ATOM   10981 H  HB2  . SER A 1 2  ? 3.489   -29.782 8.301   1.00 0.00 ? 2   SER A HB2  18 
ATOM   10982 H  HB3  . SER A 1 2  ? 4.305   -28.233 8.085   1.00 0.00 ? 2   SER A HB3  18 
ATOM   10983 H  HG   . SER A 1 2  ? 1.557   -28.401 7.565   1.00 0.00 ? 2   SER A HG   18 
ATOM   10984 N  N    . SER A 1 3  ? 1.857   -27.877 4.955   1.00 0.00 ? 3   SER A N    18 
ATOM   10985 C  CA   . SER A 1 3  ? 1.307   -26.747 4.215   1.00 0.00 ? 3   SER A CA   18 
ATOM   10986 C  C    . SER A 1 3  ? -0.178  -26.572 4.517   1.00 0.00 ? 3   SER A C    18 
ATOM   10987 O  O    . SER A 1 3  ? -0.912  -27.547 4.672   1.00 0.00 ? 3   SER A O    18 
ATOM   10988 C  CB   . SER A 1 3  ? 1.513   -26.946 2.713   1.00 0.00 ? 3   SER A CB   18 
ATOM   10989 O  OG   . SER A 1 3  ? 2.884   -27.137 2.407   1.00 0.00 ? 3   SER A OG   18 
ATOM   10990 H  H    . SER A 1 3  ? 1.337   -28.705 5.021   1.00 0.00 ? 3   SER A H    18 
ATOM   10991 H  HA   . SER A 1 3  ? 1.833   -25.858 4.528   1.00 0.00 ? 3   SER A HA   18 
ATOM   10992 H  HB2  . SER A 1 3  ? 0.960   -27.814 2.387   1.00 0.00 ? 3   SER A HB2  18 
ATOM   10993 H  HB3  . SER A 1 3  ? 1.157   -26.073 2.185   1.00 0.00 ? 3   SER A HB3  18 
ATOM   10994 H  HG   . SER A 1 3  ? 3.408   -26.472 2.860   1.00 0.00 ? 3   SER A HG   18 
ATOM   10995 N  N    . GLY A 1 4  ? -0.615  -25.318 4.600   1.00 0.00 ? 4   GLY A N    18 
ATOM   10996 C  CA   . GLY A 1 4  ? -2.010  -25.036 4.884   1.00 0.00 ? 4   GLY A CA   18 
ATOM   10997 C  C    . GLY A 1 4  ? -2.219  -23.638 5.430   1.00 0.00 ? 4   GLY A C    18 
ATOM   10998 O  O    . GLY A 1 4  ? -2.501  -23.463 6.615   1.00 0.00 ? 4   GLY A O    18 
ATOM   10999 H  H    . GLY A 1 4  ? 0.016   -24.580 4.468   1.00 0.00 ? 4   GLY A H    18 
ATOM   11000 H  HA2  . GLY A 1 4  ? -2.580  -25.145 3.973   1.00 0.00 ? 4   GLY A HA2  18 
ATOM   11001 H  HA3  . GLY A 1 4  ? -2.370  -25.751 5.609   1.00 0.00 ? 4   GLY A HA3  18 
ATOM   11002 N  N    . SER A 1 5  ? -2.079  -22.639 4.564   1.00 0.00 ? 5   SER A N    18 
ATOM   11003 C  CA   . SER A 1 5  ? -2.249  -21.248 4.968   1.00 0.00 ? 5   SER A CA   18 
ATOM   11004 C  C    . SER A 1 5  ? -3.716  -20.836 4.892   1.00 0.00 ? 5   SER A C    18 
ATOM   11005 O  O    . SER A 1 5  ? -4.298  -20.769 3.809   1.00 0.00 ? 5   SER A O    18 
ATOM   11006 C  CB   . SER A 1 5  ? -1.403  -20.331 4.083   1.00 0.00 ? 5   SER A CB   18 
ATOM   11007 O  OG   . SER A 1 5  ? -1.317  -19.028 4.634   1.00 0.00 ? 5   SER A OG   18 
ATOM   11008 H  H    . SER A 1 5  ? -1.854  -22.842 3.632   1.00 0.00 ? 5   SER A H    18 
ATOM   11009 H  HA   . SER A 1 5  ? -1.914  -21.156 5.991   1.00 0.00 ? 5   SER A HA   18 
ATOM   11010 H  HB2  . SER A 1 5  ? -0.407  -20.738 3.995   1.00 0.00 ? 5   SER A HB2  18 
ATOM   11011 H  HB3  . SER A 1 5  ? -1.853  -20.265 3.103   1.00 0.00 ? 5   SER A HB3  18 
ATOM   11012 H  HG   . SER A 1 5  ? -0.519  -18.598 4.318   1.00 0.00 ? 5   SER A HG   18 
ATOM   11013 N  N    . SER A 1 6  ? -4.308  -20.560 6.050   1.00 0.00 ? 6   SER A N    18 
ATOM   11014 C  CA   . SER A 1 6  ? -5.708  -20.158 6.116   1.00 0.00 ? 6   SER A CA   18 
ATOM   11015 C  C    . SER A 1 6  ? -5.844  -18.760 6.713   1.00 0.00 ? 6   SER A C    18 
ATOM   11016 O  O    . SER A 1 6  ? -6.729  -18.504 7.528   1.00 0.00 ? 6   SER A O    18 
ATOM   11017 C  CB   . SER A 1 6  ? -6.510  -21.160 6.948   1.00 0.00 ? 6   SER A CB   18 
ATOM   11018 O  OG   . SER A 1 6  ? -7.887  -20.828 6.959   1.00 0.00 ? 6   SER A OG   18 
ATOM   11019 H  H    . SER A 1 6  ? -3.791  -20.631 6.879   1.00 0.00 ? 6   SER A H    18 
ATOM   11020 H  HA   . SER A 1 6  ? -6.097  -20.146 5.109   1.00 0.00 ? 6   SER A HA   18 
ATOM   11021 H  HB2  . SER A 1 6  ? -6.393  -22.147 6.528   1.00 0.00 ? 6   SER A HB2  18 
ATOM   11022 H  HB3  . SER A 1 6  ? -6.142  -21.155 7.964   1.00 0.00 ? 6   SER A HB3  18 
ATOM   11023 H  HG   . SER A 1 6  ? -8.208  -20.822 7.863   1.00 0.00 ? 6   SER A HG   18 
ATOM   11024 N  N    . GLY A 1 7  ? -4.959  -17.858 6.299   1.00 0.00 ? 7   GLY A N    18 
ATOM   11025 C  CA   . GLY A 1 7  ? -4.996  -16.497 6.802   1.00 0.00 ? 7   GLY A CA   18 
ATOM   11026 C  C    . GLY A 1 7  ? -6.099  -15.674 6.166   1.00 0.00 ? 7   GLY A C    18 
ATOM   11027 O  O    . GLY A 1 7  ? -6.860  -16.175 5.337   1.00 0.00 ? 7   GLY A O    18 
ATOM   11028 H  H    . GLY A 1 7  ? -4.275  -18.119 5.647   1.00 0.00 ? 7   GLY A H    18 
ATOM   11029 H  HA2  . GLY A 1 7  ? -5.151  -16.524 7.870   1.00 0.00 ? 7   GLY A HA2  18 
ATOM   11030 H  HA3  . GLY A 1 7  ? -4.047  -16.024 6.598   1.00 0.00 ? 7   GLY A HA3  18 
ATOM   11031 N  N    . THR A 1 8  ? -6.190  -14.407 6.557   1.00 0.00 ? 8   THR A N    18 
ATOM   11032 C  CA   . THR A 1 8  ? -7.210  -13.513 6.022   1.00 0.00 ? 8   THR A CA   18 
ATOM   11033 C  C    . THR A 1 8  ? -7.288  -13.615 4.503   1.00 0.00 ? 8   THR A C    18 
ATOM   11034 O  O    . THR A 1 8  ? -6.293  -13.420 3.806   1.00 0.00 ? 8   THR A O    18 
ATOM   11035 C  CB   . THR A 1 8  ? -6.935  -12.049 6.414   1.00 0.00 ? 8   THR A CB   18 
ATOM   11036 O  OG1  . THR A 1 8  ? -6.910  -11.920 7.840   1.00 0.00 ? 8   THR A OG1  18 
ATOM   11037 C  CG2  . THR A 1 8  ? -7.996  -11.126 5.835   1.00 0.00 ? 8   THR A CG2  18 
ATOM   11038 H  H    . THR A 1 8  ? -5.555  -14.066 7.221   1.00 0.00 ? 8   THR A H    18 
ATOM   11039 H  HA   . THR A 1 8  ? -8.161  -13.804 6.443   1.00 0.00 ? 8   THR A HA   18 
ATOM   11040 H  HB   . THR A 1 8  ? -5.972  -11.760 6.017   1.00 0.00 ? 8   THR A HB   18 
ATOM   11041 H  HG1  . THR A 1 8  ? -6.192  -12.449 8.197   1.00 0.00 ? 8   THR A HG1  18 
ATOM   11042 H  HG21 . THR A 1 8  ? -8.513  -10.623 6.639   1.00 0.00 ? 8   THR A HG21 18 
ATOM   11043 H  HG22 . THR A 1 8  ? -8.703  -11.705 5.260   1.00 0.00 ? 8   THR A HG22 18 
ATOM   11044 H  HG23 . THR A 1 8  ? -7.526  -10.393 5.196   1.00 0.00 ? 8   THR A HG23 18 
ATOM   11045 N  N    . GLY A 1 9  ? -8.479  -13.920 3.996   1.00 0.00 ? 9   GLY A N    18 
ATOM   11046 C  CA   . GLY A 1 9  ? -8.665  -14.042 2.562   1.00 0.00 ? 9   GLY A CA   18 
ATOM   11047 C  C    . GLY A 1 9  ? -8.891  -12.701 1.891   1.00 0.00 ? 9   GLY A C    18 
ATOM   11048 O  O    . GLY A 1 9  ? -8.254  -12.388 0.886   1.00 0.00 ? 9   GLY A O    18 
ATOM   11049 H  H    . GLY A 1 9  ? -9.237  -14.065 4.600   1.00 0.00 ? 9   GLY A H    18 
ATOM   11050 H  HA2  . GLY A 1 9  ? -7.787  -14.503 2.134   1.00 0.00 ? 9   GLY A HA2  18 
ATOM   11051 H  HA3  . GLY A 1 9  ? -9.519  -14.674 2.373   1.00 0.00 ? 9   GLY A HA3  18 
ATOM   11052 N  N    . GLU A 1 10 ? -9.804  -11.910 2.447   1.00 0.00 ? 10  GLU A N    18 
ATOM   11053 C  CA   . GLU A 1 10 ? -10.114 -10.597 1.893   1.00 0.00 ? 10  GLU A CA   18 
ATOM   11054 C  C    . GLU A 1 10 ? -8.989  -9.606  2.178   1.00 0.00 ? 10  GLU A C    18 
ATOM   11055 O  O    . GLU A 1 10 ? -8.329  -9.682  3.214   1.00 0.00 ? 10  GLU A O    18 
ATOM   11056 C  CB   . GLU A 1 10 ? -11.429 -10.073 2.473   1.00 0.00 ? 10  GLU A CB   18 
ATOM   11057 C  CG   . GLU A 1 10 ? -11.409 -9.917  3.985   1.00 0.00 ? 10  GLU A CG   18 
ATOM   11058 C  CD   . GLU A 1 10 ? -12.765 -9.542  4.551   1.00 0.00 ? 10  GLU A CD   18 
ATOM   11059 O  OE1  . GLU A 1 10 ? -13.557 -8.908  3.823   1.00 0.00 ? 10  GLU A OE1  18 
ATOM   11060 O  OE2  . GLU A 1 10 ? -13.033 -9.882  5.722   1.00 0.00 ? 10  GLU A OE2  18 
ATOM   11061 H  H    . GLU A 1 10 ? -10.279 -12.216 3.247   1.00 0.00 ? 10  GLU A H    18 
ATOM   11062 H  HA   . GLU A 1 10 ? -10.220 -10.704 0.824   1.00 0.00 ? 10  GLU A HA   18 
ATOM   11063 H  HB2  . GLU A 1 10 ? -11.643 -9.109  2.035   1.00 0.00 ? 10  GLU A HB2  18 
ATOM   11064 H  HB3  . GLU A 1 10 ? -12.222 -10.759 2.214   1.00 0.00 ? 10  GLU A HB3  18 
ATOM   11065 H  HG2  . GLU A 1 10 ? -11.099 -10.853 4.426   1.00 0.00 ? 10  GLU A HG2  18 
ATOM   11066 H  HG3  . GLU A 1 10 ? -10.700 -9.145  4.245   1.00 0.00 ? 10  GLU A HG3  18 
ATOM   11067 N  N    . ASN A 1 11 ? -8.776  -8.679  1.251   1.00 0.00 ? 11  ASN A N    18 
ATOM   11068 C  CA   . ASN A 1 11 ? -7.730  -7.673  1.401   1.00 0.00 ? 11  ASN A CA   18 
ATOM   11069 C  C    . ASN A 1 11 ? -8.125  -6.371  0.712   1.00 0.00 ? 11  ASN A C    18 
ATOM   11070 O  O    . ASN A 1 11 ? -8.094  -6.253  -0.513  1.00 0.00 ? 11  ASN A O    18 
ATOM   11071 C  CB   . ASN A 1 11 ? -6.411  -8.189  0.823   1.00 0.00 ? 11  ASN A CB   18 
ATOM   11072 C  CG   . ASN A 1 11 ? -5.675  -9.101  1.786   1.00 0.00 ? 11  ASN A CG   18 
ATOM   11073 O  OD1  . ASN A 1 11 ? -5.376  -8.715  2.917   1.00 0.00 ? 11  ASN A OD1  18 
ATOM   11074 N  ND2  . ASN A 1 11 ? -5.379  -10.316 1.342   1.00 0.00 ? 11  ASN A ND2  18 
ATOM   11075 H  H    . ASN A 1 11 ? -9.335  -8.670  0.446   1.00 0.00 ? 11  ASN A H    18 
ATOM   11076 H  HA   . ASN A 1 11 ? -7.601  -7.484  2.456   1.00 0.00 ? 11  ASN A HA   18 
ATOM   11077 H  HB2  . ASN A 1 11 ? -6.614  -8.743  -0.082  1.00 0.00 ? 11  ASN A HB2  18 
ATOM   11078 H  HB3  . ASN A 1 11 ? -5.773  -7.350  0.591   1.00 0.00 ? 11  ASN A HB3  18 
ATOM   11079 H  HD21 . ASN A 1 11 ? -5.648  -10.554 0.430   1.00 0.00 ? 11  ASN A HD21 18 
ATOM   11080 H  HD22 . ASN A 1 11 ? -4.904  -10.926 1.944   1.00 0.00 ? 11  ASN A HD22 18 
ATOM   11081 N  N    . PRO A 1 12 ? -8.505  -5.367  1.517   1.00 0.00 ? 12  PRO A N    18 
ATOM   11082 C  CA   . PRO A 1 12 ? -8.912  -4.054  1.008   1.00 0.00 ? 12  PRO A CA   18 
ATOM   11083 C  C    . PRO A 1 12 ? -7.742  -3.272  0.422   1.00 0.00 ? 12  PRO A C    18 
ATOM   11084 O  O    . PRO A 1 12 ? -7.815  -2.774  -0.702  1.00 0.00 ? 12  PRO A O    18 
ATOM   11085 C  CB   . PRO A 1 12 ? -9.461  -3.347  2.249   1.00 0.00 ? 12  PRO A CB   18 
ATOM   11086 C  CG   . PRO A 1 12 ? -8.773  -4.005  3.395   1.00 0.00 ? 12  PRO A CG   18 
ATOM   11087 C  CD   . PRO A 1 12 ? -8.566  -5.437  2.987   1.00 0.00 ? 12  PRO A CD   18 
ATOM   11088 H  HA   . PRO A 1 12 ? -9.693  -4.141  0.266   1.00 0.00 ? 12  PRO A HA   18 
ATOM   11089 H  HB2  . PRO A 1 12 ? -9.226  -2.292  2.199   1.00 0.00 ? 12  PRO A HB2  18 
ATOM   11090 H  HB3  . PRO A 1 12 ? -10.531 -3.481  2.301   1.00 0.00 ? 12  PRO A HB3  18 
ATOM   11091 H  HG2  . PRO A 1 12 ? -7.824  -3.526  3.578   1.00 0.00 ? 12  PRO A HG2  18 
ATOM   11092 H  HG3  . PRO A 1 12 ? -9.397  -3.953  4.276   1.00 0.00 ? 12  PRO A HG3  18 
ATOM   11093 H  HD2  . PRO A 1 12 ? -7.640  -5.815  3.394   1.00 0.00 ? 12  PRO A HD2  18 
ATOM   11094 H  HD3  . PRO A 1 12 ? -9.398  -6.045  3.309   1.00 0.00 ? 12  PRO A HD3  18 
ATOM   11095 N  N    . PHE A 1 13 ? -6.663  -3.166  1.190   1.00 0.00 ? 13  PHE A N    18 
ATOM   11096 C  CA   . PHE A 1 13 ? -5.476  -2.443  0.747   1.00 0.00 ? 13  PHE A CA   18 
ATOM   11097 C  C    . PHE A 1 13 ? -4.259  -2.835  1.579   1.00 0.00 ? 13  PHE A C    18 
ATOM   11098 O  O    . PHE A 1 13 ? -4.319  -2.871  2.808   1.00 0.00 ? 13  PHE A O    18 
ATOM   11099 C  CB   . PHE A 1 13 ? -5.709  -0.934  0.841   1.00 0.00 ? 13  PHE A CB   18 
ATOM   11100 C  CG   . PHE A 1 13 ? -6.941  -0.471  0.118   1.00 0.00 ? 13  PHE A CG   18 
ATOM   11101 C  CD1  . PHE A 1 13 ? -6.920  -0.263  -1.251  1.00 0.00 ? 13  PHE A CD1  18 
ATOM   11102 C  CD2  . PHE A 1 13 ? -8.121  -0.243  0.809   1.00 0.00 ? 13  PHE A CD2  18 
ATOM   11103 C  CE1  . PHE A 1 13 ? -8.053  0.164   -1.919  1.00 0.00 ? 13  PHE A CE1  18 
ATOM   11104 C  CE2  . PHE A 1 13 ? -9.257  0.184   0.147   1.00 0.00 ? 13  PHE A CE2  18 
ATOM   11105 C  CZ   . PHE A 1 13 ? -9.223  0.386   -1.219  1.00 0.00 ? 13  PHE A CZ   18 
ATOM   11106 H  H    . PHE A 1 13 ? -6.665  -3.585  2.077   1.00 0.00 ? 13  PHE A H    18 
ATOM   11107 H  HA   . PHE A 1 13 ? -5.294  -2.707  -0.283  1.00 0.00 ? 13  PHE A HA   18 
ATOM   11108 H  HB2  . PHE A 1 13 ? -5.809  -0.656  1.879   1.00 0.00 ? 13  PHE A HB2  18 
ATOM   11109 H  HB3  . PHE A 1 13 ? -4.860  -0.419  0.416   1.00 0.00 ? 13  PHE A HB3  18 
ATOM   11110 H  HD1  . PHE A 1 13 ? -6.007  -0.438  -1.800  1.00 0.00 ? 13  PHE A HD1  18 
ATOM   11111 H  HD2  . PHE A 1 13 ? -8.148  -0.402  1.878   1.00 0.00 ? 13  PHE A HD2  18 
ATOM   11112 H  HE1  . PHE A 1 13 ? -8.024  0.321   -2.986  1.00 0.00 ? 13  PHE A HE1  18 
ATOM   11113 H  HE2  . PHE A 1 13 ? -10.170 0.357   0.697   1.00 0.00 ? 13  PHE A HE2  18 
ATOM   11114 H  HZ   . PHE A 1 13 ? -10.109 0.720   -1.738  1.00 0.00 ? 13  PHE A HZ   18 
ATOM   11115 N  N    . ILE A 1 14 ? -3.155  -3.127  0.899   1.00 0.00 ? 14  ILE A N    18 
ATOM   11116 C  CA   . ILE A 1 14 ? -1.923  -3.515  1.575   1.00 0.00 ? 14  ILE A CA   18 
ATOM   11117 C  C    . ILE A 1 14 ? -0.727  -2.750  1.019   1.00 0.00 ? 14  ILE A C    18 
ATOM   11118 O  O    . ILE A 1 14 ? -0.497  -2.727  -0.190  1.00 0.00 ? 14  ILE A O    18 
ATOM   11119 C  CB   . ILE A 1 14 ? -1.659  -5.027  1.439   1.00 0.00 ? 14  ILE A CB   18 
ATOM   11120 C  CG1  . ILE A 1 14 ? -2.778  -5.824  2.111   1.00 0.00 ? 14  ILE A CG1  18 
ATOM   11121 C  CG2  . ILE A 1 14 ? -0.309  -5.385  2.043   1.00 0.00 ? 14  ILE A CG2  18 
ATOM   11122 C  CD1  . ILE A 1 14 ? -2.716  -7.309  1.827   1.00 0.00 ? 14  ILE A CD1  18 
ATOM   11123 H  H    . ILE A 1 14 ? -3.169  -3.080  -0.079  1.00 0.00 ? 14  ILE A H    18 
ATOM   11124 H  HA   . ILE A 1 14 ? -2.031  -3.282  2.624   1.00 0.00 ? 14  ILE A HA   18 
ATOM   11125 H  HB   . ILE A 1 14 ? -1.632  -5.272  0.388   1.00 0.00 ? 14  ILE A HB   18 
ATOM   11126 H  HG12 . ILE A 1 14 ? -2.717  -5.689  3.179   1.00 0.00 ? 14  ILE A HG12 18 
ATOM   11127 H  HG13 . ILE A 1 14 ? -3.732  -5.458  1.759   1.00 0.00 ? 14  ILE A HG13 18 
ATOM   11128 H  HG21 . ILE A 1 14 ? 0.469   -4.827  1.542   1.00 0.00 ? 14  ILE A HG21 18 
ATOM   11129 H  HG22 . ILE A 1 14 ? -0.309  -5.136  3.094   1.00 0.00 ? 14  ILE A HG22 18 
ATOM   11130 H  HG23 . ILE A 1 14 ? -0.130  -6.442  1.922   1.00 0.00 ? 14  ILE A HG23 18 
ATOM   11131 H  HD11 . ILE A 1 14 ? -2.997  -7.491  0.800   1.00 0.00 ? 14  ILE A HD11 18 
ATOM   11132 H  HD12 . ILE A 1 14 ? -1.710  -7.666  1.993   1.00 0.00 ? 14  ILE A HD12 18 
ATOM   11133 H  HD13 . ILE A 1 14 ? -3.396  -7.830  2.483   1.00 0.00 ? 14  ILE A HD13 18 
ATOM   11134 N  N    . CYS A 1 15 ? 0.034   -2.124  1.911   1.00 0.00 ? 15  CYS A N    18 
ATOM   11135 C  CA   . CYS A 1 15 ? 1.208   -1.358  1.512   1.00 0.00 ? 15  CYS A CA   18 
ATOM   11136 C  C    . CYS A 1 15 ? 2.194   -2.234  0.745   1.00 0.00 ? 15  CYS A C    18 
ATOM   11137 O  O    . CYS A 1 15 ? 2.630   -3.274  1.238   1.00 0.00 ? 15  CYS A O    18 
ATOM   11138 C  CB   . CYS A 1 15 ? 1.893   -0.756  2.741   1.00 0.00 ? 15  CYS A CB   18 
ATOM   11139 S  SG   . CYS A 1 15 ? 3.022   0.622   2.364   1.00 0.00 ? 15  CYS A SG   18 
ATOM   11140 H  H    . CYS A 1 15 ? -0.200  -2.178  2.862   1.00 0.00 ? 15  CYS A H    18 
ATOM   11141 H  HA   . CYS A 1 15 ? 0.879   -0.558  0.867   1.00 0.00 ? 15  CYS A HA   18 
ATOM   11142 H  HB2  . CYS A 1 15 ? 1.137   -0.385  3.419   1.00 0.00 ? 15  CYS A HB2  18 
ATOM   11143 H  HB3  . CYS A 1 15 ? 2.466   -1.526  3.237   1.00 0.00 ? 15  CYS A HB3  18 
ATOM   11144 N  N    . SER A 1 16 ? 2.542   -1.805  -0.464  1.00 0.00 ? 16  SER A N    18 
ATOM   11145 C  CA   . SER A 1 16 ? 3.474   -2.551  -1.301  1.00 0.00 ? 16  SER A CA   18 
ATOM   11146 C  C    . SER A 1 16 ? 4.917   -2.211  -0.944  1.00 0.00 ? 16  SER A C    18 
ATOM   11147 O  O    . SER A 1 16 ? 5.797   -2.210  -1.805  1.00 0.00 ? 16  SER A O    18 
ATOM   11148 C  CB   . SER A 1 16 ? 3.217   -2.251  -2.779  1.00 0.00 ? 16  SER A CB   18 
ATOM   11149 O  OG   . SER A 1 16 ? 3.939   -3.140  -3.613  1.00 0.00 ? 16  SER A OG   18 
ATOM   11150 H  H    . SER A 1 16 ? 2.160   -0.967  -0.802  1.00 0.00 ? 16  SER A H    18 
ATOM   11151 H  HA   . SER A 1 16 ? 3.310   -3.603  -1.123  1.00 0.00 ? 16  SER A HA   18 
ATOM   11152 H  HB2  . SER A 1 16 ? 2.164   -2.356  -2.988  1.00 0.00 ? 16  SER A HB2  18 
ATOM   11153 H  HB3  . SER A 1 16 ? 3.528   -1.239  -2.997  1.00 0.00 ? 16  SER A HB3  18 
ATOM   11154 H  HG   . SER A 1 16 ? 4.879   -3.051  -3.439  1.00 0.00 ? 16  SER A HG   18 
ATOM   11155 N  N    . GLU A 1 17 ? 5.153   -1.922  0.332   1.00 0.00 ? 17  GLU A N    18 
ATOM   11156 C  CA   . GLU A 1 17 ? 6.489   -1.579  0.803   1.00 0.00 ? 17  GLU A CA   18 
ATOM   11157 C  C    . GLU A 1 17 ? 6.828   -2.342  2.080   1.00 0.00 ? 17  GLU A C    18 
ATOM   11158 O  O    . GLU A 1 17 ? 7.930   -2.872  2.226   1.00 0.00 ? 17  GLU A O    18 
ATOM   11159 C  CB   . GLU A 1 17 ? 6.595   -0.073  1.052   1.00 0.00 ? 17  GLU A CB   18 
ATOM   11160 C  CG   . GLU A 1 17 ? 6.608   0.755   -0.222  1.00 0.00 ? 17  GLU A CG   18 
ATOM   11161 C  CD   . GLU A 1 17 ? 7.406   2.037   -0.077  1.00 0.00 ? 17  GLU A CD   18 
ATOM   11162 O  OE1  . GLU A 1 17 ? 8.630   1.949   0.155   1.00 0.00 ? 17  GLU A OE1  18 
ATOM   11163 O  OE2  . GLU A 1 17 ? 6.807   3.126   -0.195  1.00 0.00 ? 17  GLU A OE2  18 
ATOM   11164 H  H    . GLU A 1 17 ? 4.410   -1.940  0.971   1.00 0.00 ? 17  GLU A H    18 
ATOM   11165 H  HA   . GLU A 1 17 ? 7.194   -1.857  0.034   1.00 0.00 ? 17  GLU A HA   18 
ATOM   11166 H  HB2  . GLU A 1 17 ? 5.754   0.241   1.653   1.00 0.00 ? 17  GLU A HB2  18 
ATOM   11167 H  HB3  . GLU A 1 17 ? 7.508   0.126   1.595   1.00 0.00 ? 17  GLU A HB3  18 
ATOM   11168 H  HG2  . GLU A 1 17 ? 7.043   0.166   -1.015  1.00 0.00 ? 17  GLU A HG2  18 
ATOM   11169 H  HG3  . GLU A 1 17 ? 5.591   1.010   -0.481  1.00 0.00 ? 17  GLU A HG3  18 
ATOM   11170 N  N    . CYS A 1 18 ? 5.874   -2.392  3.004   1.00 0.00 ? 18  CYS A N    18 
ATOM   11171 C  CA   . CYS A 1 18 ? 6.070   -3.088  4.269   1.00 0.00 ? 18  CYS A CA   18 
ATOM   11172 C  C    . CYS A 1 18 ? 5.090   -4.249  4.409   1.00 0.00 ? 18  CYS A C    18 
ATOM   11173 O  O    . CYS A 1 18 ? 5.482   -5.373  4.720   1.00 0.00 ? 18  CYS A O    18 
ATOM   11174 C  CB   . CYS A 1 18 ? 5.899   -2.118  5.441   1.00 0.00 ? 18  CYS A CB   18 
ATOM   11175 S  SG   . CYS A 1 18 ? 4.335   -1.186  5.412   1.00 0.00 ? 18  CYS A SG   18 
ATOM   11176 H  H    . CYS A 1 18 ? 5.016   -1.949  2.830   1.00 0.00 ? 18  CYS A H    18 
ATOM   11177 H  HA   . CYS A 1 18 ? 7.076   -3.479  4.281   1.00 0.00 ? 18  CYS A HA   18 
ATOM   11178 H  HB2  . CYS A 1 18 ? 5.933   -2.674  6.366   1.00 0.00 ? 18  CYS A HB2  18 
ATOM   11179 H  HB3  . CYS A 1 18 ? 6.709   -1.403  5.427   1.00 0.00 ? 18  CYS A HB3  18 
ATOM   11180 N  N    . GLY A 1 19 ? 3.811   -3.968  4.176   1.00 0.00 ? 19  GLY A N    18 
ATOM   11181 C  CA   . GLY A 1 19 ? 2.794   -4.998  4.281   1.00 0.00 ? 19  GLY A CA   18 
ATOM   11182 C  C    . GLY A 1 19 ? 1.759   -4.685  5.343   1.00 0.00 ? 19  GLY A C    18 
ATOM   11183 O  O    . GLY A 1 19 ? 1.384   -5.554  6.131   1.00 0.00 ? 19  GLY A O    18 
ATOM   11184 H  H    . GLY A 1 19 ? 3.556   -3.053  3.932   1.00 0.00 ? 19  GLY A H    18 
ATOM   11185 H  HA2  . GLY A 1 19 ? 2.297   -5.096  3.327   1.00 0.00 ? 19  GLY A HA2  18 
ATOM   11186 H  HA3  . GLY A 1 19 ? 3.272   -5.935  4.525   1.00 0.00 ? 19  GLY A HA3  18 
ATOM   11187 N  N    . LYS A 1 20 ? 1.296   -3.440  5.368   1.00 0.00 ? 20  LYS A N    18 
ATOM   11188 C  CA   . LYS A 1 20 ? 0.299   -3.013  6.342   1.00 0.00 ? 20  LYS A CA   18 
ATOM   11189 C  C    . LYS A 1 20 ? -1.070  -2.859  5.687   1.00 0.00 ? 20  LYS A C    18 
ATOM   11190 O  O    . LYS A 1 20 ? -1.183  -2.338  4.577   1.00 0.00 ? 20  LYS A O    18 
ATOM   11191 C  CB   . LYS A 1 20 ? 0.719   -1.690  6.987   1.00 0.00 ? 20  LYS A CB   18 
ATOM   11192 C  CG   . LYS A 1 20 ? -0.098  -1.325  8.214   1.00 0.00 ? 20  LYS A CG   18 
ATOM   11193 C  CD   . LYS A 1 20 ? 0.697   -0.458  9.176   1.00 0.00 ? 20  LYS A CD   18 
ATOM   11194 C  CE   . LYS A 1 20 ? -0.191  0.127   10.263  1.00 0.00 ? 20  LYS A CE   18 
ATOM   11195 N  NZ   . LYS A 1 20 ? -0.504  -0.873  11.321  1.00 0.00 ? 20  LYS A NZ   18 
ATOM   11196 H  H    . LYS A 1 20 ? 1.634   -2.792  4.714   1.00 0.00 ? 20  LYS A H    18 
ATOM   11197 H  HA   . LYS A 1 20 ? 0.235   -3.772  7.106   1.00 0.00 ? 20  LYS A HA   18 
ATOM   11198 H  HB2  . LYS A 1 20 ? 1.756   -1.759  7.278   1.00 0.00 ? 20  LYS A HB2  18 
ATOM   11199 H  HB3  . LYS A 1 20 ? 0.610   -0.898  6.260   1.00 0.00 ? 20  LYS A HB3  18 
ATOM   11200 H  HG2  . LYS A 1 20 ? -0.979  -0.784  7.902   1.00 0.00 ? 20  LYS A HG2  18 
ATOM   11201 H  HG3  . LYS A 1 20 ? -0.393  -2.233  8.722   1.00 0.00 ? 20  LYS A HG3  18 
ATOM   11202 H  HD2  . LYS A 1 20 ? 1.465   -1.060  9.639   1.00 0.00 ? 20  LYS A HD2  18 
ATOM   11203 H  HD3  . LYS A 1 20 ? 1.155   0.350   8.623   1.00 0.00 ? 20  LYS A HD3  18 
ATOM   11204 H  HE2  . LYS A 1 20 ? 0.317   0.966   10.712  1.00 0.00 ? 20  LYS A HE2  18 
ATOM   11205 H  HE3  . LYS A 1 20 ? -1.114  0.464   9.813   1.00 0.00 ? 20  LYS A HE3  18 
ATOM   11206 H  HZ1  . LYS A 1 20 ? 0.371   -1.189  11.785  1.00 0.00 ? 20  LYS A HZ1  18 
ATOM   11207 H  HZ2  . LYS A 1 20 ? -0.980  -1.698  10.903  1.00 0.00 ? 20  LYS A HZ2  18 
ATOM   11208 H  HZ3  . LYS A 1 20 ? -1.131  -0.452  12.036  1.00 0.00 ? 20  LYS A HZ3  18 
ATOM   11209 N  N    . VAL A 1 21 ? -2.108  -3.314  6.381   1.00 0.00 ? 21  VAL A N    18 
ATOM   11210 C  CA   . VAL A 1 21 ? -3.470  -3.224  5.868   1.00 0.00 ? 21  VAL A CA   18 
ATOM   11211 C  C    . VAL A 1 21 ? -4.188  -2.000  6.424   1.00 0.00 ? 21  VAL A C    18 
ATOM   11212 O  O    . VAL A 1 21 ? -4.114  -1.714  7.620   1.00 0.00 ? 21  VAL A O    18 
ATOM   11213 C  CB   . VAL A 1 21 ? -4.285  -4.485  6.214   1.00 0.00 ? 21  VAL A CB   18 
ATOM   11214 C  CG1  . VAL A 1 21 ? -5.707  -4.363  5.688   1.00 0.00 ? 21  VAL A CG1  18 
ATOM   11215 C  CG2  . VAL A 1 21 ? -3.606  -5.727  5.657   1.00 0.00 ? 21  VAL A CG2  18 
ATOM   11216 H  H    . VAL A 1 21 ? -1.955  -3.719  7.260   1.00 0.00 ? 21  VAL A H    18 
ATOM   11217 H  HA   . VAL A 1 21 ? -3.416  -3.140  4.792   1.00 0.00 ? 21  VAL A HA   18 
ATOM   11218 H  HB   . VAL A 1 21 ? -4.329  -4.576  7.290   1.00 0.00 ? 21  VAL A HB   18 
ATOM   11219 H  HG11 . VAL A 1 21 ? -6.066  -3.357  5.852   1.00 0.00 ? 21  VAL A HG11 18 
ATOM   11220 H  HG12 . VAL A 1 21 ? -5.720  -4.584  4.631   1.00 0.00 ? 21  VAL A HG12 18 
ATOM   11221 H  HG13 . VAL A 1 21 ? -6.344  -5.061  6.210   1.00 0.00 ? 21  VAL A HG13 18 
ATOM   11222 H  HG21 . VAL A 1 21 ? -2.545  -5.548  5.565   1.00 0.00 ? 21  VAL A HG21 18 
ATOM   11223 H  HG22 . VAL A 1 21 ? -3.775  -6.558  6.325   1.00 0.00 ? 21  VAL A HG22 18 
ATOM   11224 H  HG23 . VAL A 1 21 ? -4.017  -5.957  4.685   1.00 0.00 ? 21  VAL A HG23 18 
ATOM   11225 N  N    . PHE A 1 22 ? -4.882  -1.280  5.550   1.00 0.00 ? 22  PHE A N    18 
ATOM   11226 C  CA   . PHE A 1 22 ? -5.613  -0.084  5.953   1.00 0.00 ? 22  PHE A CA   18 
ATOM   11227 C  C    . PHE A 1 22 ? -7.085  -0.190  5.564   1.00 0.00 ? 22  PHE A C    18 
ATOM   11228 O  O    . PHE A 1 22 ? -7.419  -0.632  4.464   1.00 0.00 ? 22  PHE A O    18 
ATOM   11229 C  CB   . PHE A 1 22 ? -4.993  1.159   5.314   1.00 0.00 ? 22  PHE A CB   18 
ATOM   11230 C  CG   . PHE A 1 22 ? -3.516  1.285   5.556   1.00 0.00 ? 22  PHE A CG   18 
ATOM   11231 C  CD1  . PHE A 1 22 ? -2.623  0.426   4.936   1.00 0.00 ? 22  PHE A CD1  18 
ATOM   11232 C  CD2  . PHE A 1 22 ? -3.020  2.262   6.404   1.00 0.00 ? 22  PHE A CD2  18 
ATOM   11233 C  CE1  . PHE A 1 22 ? -1.264  0.539   5.158   1.00 0.00 ? 22  PHE A CE1  18 
ATOM   11234 C  CE2  . PHE A 1 22 ? -1.662  2.380   6.630   1.00 0.00 ? 22  PHE A CE2  18 
ATOM   11235 C  CZ   . PHE A 1 22 ? -0.782  1.518   6.005   1.00 0.00 ? 22  PHE A CZ   18 
ATOM   11236 H  H    . PHE A 1 22 ? -4.902  -1.558  4.610   1.00 0.00 ? 22  PHE A H    18 
ATOM   11237 H  HA   . PHE A 1 22 ? -5.543  -0.000  7.027   1.00 0.00 ? 22  PHE A HA   18 
ATOM   11238 H  HB2  . PHE A 1 22 ? -5.151  1.124   4.246   1.00 0.00 ? 22  PHE A HB2  18 
ATOM   11239 H  HB3  . PHE A 1 22 ? -5.473  2.039   5.715   1.00 0.00 ? 22  PHE A HB3  18 
ATOM   11240 H  HD1  . PHE A 1 22 ? -2.998  -0.339  4.272   1.00 0.00 ? 22  PHE A HD1  18 
ATOM   11241 H  HD2  . PHE A 1 22 ? -3.708  2.938   6.894   1.00 0.00 ? 22  PHE A HD2  18 
ATOM   11242 H  HE1  . PHE A 1 22 ? -0.578  -0.136  4.668   1.00 0.00 ? 22  PHE A HE1  18 
ATOM   11243 H  HE2  . PHE A 1 22 ? -1.289  3.147   7.293   1.00 0.00 ? 22  PHE A HE2  18 
ATOM   11244 H  HZ   . PHE A 1 22 ? 0.279   1.608   6.181   1.00 0.00 ? 22  PHE A HZ   18 
ATOM   11245 N  N    . THR A 1 23 ? -7.963  0.219   6.475   1.00 0.00 ? 23  THR A N    18 
ATOM   11246 C  CA   . THR A 1 23 ? -9.399  0.169   6.229   1.00 0.00 ? 23  THR A CA   18 
ATOM   11247 C  C    . THR A 1 23 ? -9.772  0.973   4.989   1.00 0.00 ? 23  THR A C    18 
ATOM   11248 O  O    . THR A 1 23 ? -10.426 0.462   4.079   1.00 0.00 ? 23  THR A O    18 
ATOM   11249 C  CB   . THR A 1 23 ? -10.194 0.706   7.434   1.00 0.00 ? 23  THR A CB   18 
ATOM   11250 O  OG1  . THR A 1 23 ? -9.535  1.851   7.985   1.00 0.00 ? 23  THR A OG1  18 
ATOM   11251 C  CG2  . THR A 1 23 ? -10.341 -0.365  8.505   1.00 0.00 ? 23  THR A CG2  18 
ATOM   11252 H  H    . THR A 1 23 ? -7.636  0.561   7.333   1.00 0.00 ? 23  THR A H    18 
ATOM   11253 H  HA   . THR A 1 23 ? -9.675  -0.864  6.073   1.00 0.00 ? 23  THR A HA   18 
ATOM   11254 H  HB   . THR A 1 23 ? -11.179 0.994   7.097   1.00 0.00 ? 23  THR A HB   18 
ATOM   11255 H  HG1  . THR A 1 23 ? -10.131 2.604   7.966   1.00 0.00 ? 23  THR A HG1  18 
ATOM   11256 H  HG21 . THR A 1 23 ? -9.622  -1.150  8.330   1.00 0.00 ? 23  THR A HG21 18 
ATOM   11257 H  HG22 . THR A 1 23 ? -11.339 -0.776  8.468   1.00 0.00 ? 23  THR A HG22 18 
ATOM   11258 H  HG23 . THR A 1 23 ? -10.168 0.073   9.477   1.00 0.00 ? 23  THR A HG23 18 
ATOM   11259 N  N    . HIS A 1 24 ? -9.353  2.235   4.959   1.00 0.00 ? 24  HIS A N    18 
ATOM   11260 C  CA   . HIS A 1 24 ? -9.644  3.110   3.829   1.00 0.00 ? 24  HIS A CA   18 
ATOM   11261 C  C    . HIS A 1 24 ? -8.355  3.634   3.203   1.00 0.00 ? 24  HIS A C    18 
ATOM   11262 O  O    . HIS A 1 24 ? -7.479  4.150   3.899   1.00 0.00 ? 24  HIS A O    18 
ATOM   11263 C  CB   . HIS A 1 24 ? -10.521 4.280   4.275   1.00 0.00 ? 24  HIS A CB   18 
ATOM   11264 C  CG   . HIS A 1 24 ? -10.303 4.682   5.702   1.00 0.00 ? 24  HIS A CG   18 
ATOM   11265 N  ND1  . HIS A 1 24 ? -9.204  5.401   6.121   1.00 0.00 ? 24  HIS A ND1  18 
ATOM   11266 C  CD2  . HIS A 1 24 ? -11.052 4.463   6.807   1.00 0.00 ? 24  HIS A CD2  18 
ATOM   11267 C  CE1  . HIS A 1 24 ? -9.285  5.606   7.424   1.00 0.00 ? 24  HIS A CE1  18 
ATOM   11268 N  NE2  . HIS A 1 24 ? -10.398 5.047   7.864   1.00 0.00 ? 24  HIS A NE2  18 
ATOM   11269 H  H    . HIS A 1 24 ? -8.837  2.585   5.715   1.00 0.00 ? 24  HIS A H    18 
ATOM   11270 H  HA   . HIS A 1 24 ? -10.178 2.532   3.091   1.00 0.00 ? 24  HIS A HA   18 
ATOM   11271 H  HB2  . HIS A 1 24 ? -10.309 5.137   3.653   1.00 0.00 ? 24  HIS A HB2  18 
ATOM   11272 H  HB3  . HIS A 1 24 ? -11.560 4.007   4.162   1.00 0.00 ? 24  HIS A HB3  18 
ATOM   11273 H  HD1  . HIS A 1 24 ? -8.472  5.714   5.550   1.00 0.00 ? 24  HIS A HD1  18 
ATOM   11274 H  HD2  . HIS A 1 24 ? -11.990 3.928   6.851   1.00 0.00 ? 24  HIS A HD2  18 
ATOM   11275 H  HE1  . HIS A 1 24 ? -8.566  6.139   8.027   1.00 0.00 ? 24  HIS A HE1  18 
ATOM   11276 N  N    . LYS A 1 25 ? -8.245  3.499   1.886   1.00 0.00 ? 25  LYS A N    18 
ATOM   11277 C  CA   . LYS A 1 25 ? -7.064  3.959   1.165   1.00 0.00 ? 25  LYS A CA   18 
ATOM   11278 C  C    . LYS A 1 25 ? -6.500  5.227   1.798   1.00 0.00 ? 25  LYS A C    18 
ATOM   11279 O  O    . LYS A 1 25 ? -5.319  5.289   2.144   1.00 0.00 ? 25  LYS A O    18 
ATOM   11280 C  CB   . LYS A 1 25 ? -7.406  4.217   -0.304  1.00 0.00 ? 25  LYS A CB   18 
ATOM   11281 C  CG   . LYS A 1 25 ? -6.208  4.128   -1.232  1.00 0.00 ? 25  LYS A CG   18 
ATOM   11282 C  CD   . LYS A 1 25 ? -5.804  2.685   -1.484  1.00 0.00 ? 25  LYS A CD   18 
ATOM   11283 C  CE   . LYS A 1 25 ? -4.907  2.563   -2.707  1.00 0.00 ? 25  LYS A CE   18 
ATOM   11284 N  NZ   . LYS A 1 25 ? -5.683  2.653   -3.975  1.00 0.00 ? 25  LYS A NZ   18 
ATOM   11285 H  H    . LYS A 1 25 ? -8.977  3.079   1.386   1.00 0.00 ? 25  LYS A H    18 
ATOM   11286 H  HA   . LYS A 1 25 ? -6.317  3.181   1.220   1.00 0.00 ? 25  LYS A HA   18 
ATOM   11287 H  HB2  . LYS A 1 25 ? -8.138  3.490   -0.624  1.00 0.00 ? 25  LYS A HB2  18 
ATOM   11288 H  HB3  . LYS A 1 25 ? -7.831  5.207   -0.393  1.00 0.00 ? 25  LYS A HB3  18 
ATOM   11289 H  HG2  . LYS A 1 25 ? -6.459  4.590   -2.176  1.00 0.00 ? 25  LYS A HG2  18 
ATOM   11290 H  HG3  . LYS A 1 25 ? -5.376  4.652   -0.783  1.00 0.00 ? 25  LYS A HG3  18 
ATOM   11291 H  HD2  . LYS A 1 25 ? -5.270  2.314   -0.622  1.00 0.00 ? 25  LYS A HD2  18 
ATOM   11292 H  HD3  . LYS A 1 25 ? -6.694  2.093   -1.641  1.00 0.00 ? 25  LYS A HD3  18 
ATOM   11293 H  HE2  . LYS A 1 25 ? -4.178  3.359   -2.684  1.00 0.00 ? 25  LYS A HE2  18 
ATOM   11294 H  HE3  . LYS A 1 25 ? -4.400  1.610   -2.672  1.00 0.00 ? 25  LYS A HE3  18 
ATOM   11295 H  HZ1  . LYS A 1 25 ? -5.863  3.649   -4.214  1.00 0.00 ? 25  LYS A HZ1  18 
ATOM   11296 H  HZ2  . LYS A 1 25 ? -6.594  2.162   -3.871  1.00 0.00 ? 25  LYS A HZ2  18 
ATOM   11297 H  HZ3  . LYS A 1 25 ? -5.151  2.211   -4.752  1.00 0.00 ? 25  LYS A HZ3  18 
ATOM   11298 N  N    . THR A 1 26 ? -7.351  6.237   1.948   1.00 0.00 ? 26  THR A N    18 
ATOM   11299 C  CA   . THR A 1 26 ? -6.938  7.503   2.539   1.00 0.00 ? 26  THR A CA   18 
ATOM   11300 C  C    . THR A 1 26 ? -5.884  7.288   3.619   1.00 0.00 ? 26  THR A C    18 
ATOM   11301 O  O    . THR A 1 26 ? -4.838  7.936   3.616   1.00 0.00 ? 26  THR A O    18 
ATOM   11302 C  CB   . THR A 1 26 ? -8.135  8.256   3.149   1.00 0.00 ? 26  THR A CB   18 
ATOM   11303 O  OG1  . THR A 1 26 ? -9.195  8.350   2.191   1.00 0.00 ? 26  THR A OG1  18 
ATOM   11304 C  CG2  . THR A 1 26 ? -7.726  9.650   3.599   1.00 0.00 ? 26  THR A CG2  18 
ATOM   11305 H  H    . THR A 1 26 ? -8.279  6.127   1.652   1.00 0.00 ? 26  THR A H    18 
ATOM   11306 H  HA   . THR A 1 26 ? -6.517  8.116   1.755   1.00 0.00 ? 26  THR A HA   18 
ATOM   11307 H  HB   . THR A 1 26 ? -8.487  7.704   4.010   1.00 0.00 ? 26  THR A HB   18 
ATOM   11308 H  HG1  . THR A 1 26 ? -10.012 8.581   2.639   1.00 0.00 ? 26  THR A HG1  18 
ATOM   11309 H  HG21 . THR A 1 26 ? -6.649  9.721   3.615   1.00 0.00 ? 26  THR A HG21 18 
ATOM   11310 H  HG22 . THR A 1 26 ? -8.114  9.837   4.590   1.00 0.00 ? 26  THR A HG22 18 
ATOM   11311 H  HG23 . THR A 1 26 ? -8.125  10.382  2.913   1.00 0.00 ? 26  THR A HG23 18 
ATOM   11312 N  N    . ASN A 1 27 ? -6.166  6.373   4.540   1.00 0.00 ? 27  ASN A N    18 
ATOM   11313 C  CA   . ASN A 1 27 ? -5.241  6.072   5.627   1.00 0.00 ? 27  ASN A CA   18 
ATOM   11314 C  C    . ASN A 1 27 ? -3.930  5.509   5.085   1.00 0.00 ? 27  ASN A C    18 
ATOM   11315 O  O    . ASN A 1 27 ? -2.846  5.897   5.523   1.00 0.00 ? 27  ASN A O    18 
ATOM   11316 C  CB   . ASN A 1 27 ? -5.873  5.077   6.602   1.00 0.00 ? 27  ASN A CB   18 
ATOM   11317 C  CG   . ASN A 1 27 ? -5.351  5.243   8.017   1.00 0.00 ? 27  ASN A CG   18 
ATOM   11318 O  OD1  . ASN A 1 27 ? -4.674  4.363   8.547   1.00 0.00 ? 27  ASN A OD1  18 
ATOM   11319 N  ND2  . ASN A 1 27 ? -5.666