data_2ERR
# 
_entry.id   2ERR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2ERR         
RCSB  RCSB035013   
WWPDB D_1000035013 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2ERR 
_pdbx_database_status.recvd_initial_deposition_date   2005-10-25 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Allain, F.H.'  1 
'Auweter, S.D.' 2 
# 
_citation.id                        primary 
_citation.title                     'Molecular basis of RNA recognition by the human alternative splicing factor Fox-1.' 
_citation.journal_abbrev            'Embo J.' 
_citation.journal_volume            25 
_citation.page_first                163 
_citation.page_last                 173 
_citation.year                      2006 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16362037 
_citation.pdbx_database_id_DOI      10.1038/sj.emboj.7600918 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Auweter, S.D.'   1 
primary 'Fasan, R.'       2 
primary 'Reymond, L.'     3 
primary 'Underwood, J.G.' 4 
primary 'Black, D.L.'     5 
primary 'Pitsch, S.'      6 
primary 'Allain, F.H.'    7 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn UGCAUGU                      2198.339  1 ? ? ?                    ? 
2 polymer man 'Ataxin-2-binding protein 1' 12399.978 1 ? ? 'RNA BINDING DOMAIN' ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polyribonucleotide no no UGCAUGU UGCAUGU B ? 
2 'polypeptide(L)'   no no 
;MGSSHHHHHHSSGLVPRGSHMNTENKSQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSA
DADRAREKLHGTVVEGRKIEVNNATARVM
;
;MGSSHHHHHHSSGLVPRGSHMNTENKSQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSA
DADRAREKLHGTVVEGRKIEVNNATARVM
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   U   n 
1 2   G   n 
1 3   C   n 
1 4   A   n 
1 5   U   n 
1 6   G   n 
1 7   U   n 
2 1   MET n 
2 2   GLY n 
2 3   SER n 
2 4   SER n 
2 5   HIS n 
2 6   HIS n 
2 7   HIS n 
2 8   HIS n 
2 9   HIS n 
2 10  HIS n 
2 11  SER n 
2 12  SER n 
2 13  GLY n 
2 14  LEU n 
2 15  VAL n 
2 16  PRO n 
2 17  ARG n 
2 18  GLY n 
2 19  SER n 
2 20  HIS n 
2 21  MET n 
2 22  ASN n 
2 23  THR n 
2 24  GLU n 
2 25  ASN n 
2 26  LYS n 
2 27  SER n 
2 28  GLN n 
2 29  PRO n 
2 30  LYS n 
2 31  ARG n 
2 32  LEU n 
2 33  HIS n 
2 34  VAL n 
2 35  SER n 
2 36  ASN n 
2 37  ILE n 
2 38  PRO n 
2 39  PHE n 
2 40  ARG n 
2 41  PHE n 
2 42  ARG n 
2 43  ASP n 
2 44  PRO n 
2 45  ASP n 
2 46  LEU n 
2 47  ARG n 
2 48  GLN n 
2 49  MET n 
2 50  PHE n 
2 51  GLY n 
2 52  GLN n 
2 53  PHE n 
2 54  GLY n 
2 55  LYS n 
2 56  ILE n 
2 57  LEU n 
2 58  ASP n 
2 59  VAL n 
2 60  GLU n 
2 61  ILE n 
2 62  ILE n 
2 63  PHE n 
2 64  ASN n 
2 65  GLU n 
2 66  ARG n 
2 67  GLY n 
2 68  SER n 
2 69  LYS n 
2 70  GLY n 
2 71  PHE n 
2 72  GLY n 
2 73  PHE n 
2 74  VAL n 
2 75  THR n 
2 76  PHE n 
2 77  GLU n 
2 78  ASN n 
2 79  SER n 
2 80  ALA n 
2 81  ASP n 
2 82  ALA n 
2 83  ASP n 
2 84  ARG n 
2 85  ALA n 
2 86  ARG n 
2 87  GLU n 
2 88  LYS n 
2 89  LEU n 
2 90  HIS n 
2 91  GLY n 
2 92  THR n 
2 93  VAL n 
2 94  VAL n 
2 95  GLU n 
2 96  GLY n 
2 97  ARG n 
2 98  LYS n 
2 99  ILE n 
2 100 GLU n 
2 101 VAL n 
2 102 ASN n 
2 103 ASN n 
2 104 ALA n 
2 105 THR n 
2 106 ALA n 
2 107 ARG n 
2 108 VAL n 
2 109 MET n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'A2BP1, A2BP' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a+ 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              1 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'This sequence occurs naturally in humans.' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP A2BP1_HUMAN Q9NWB1 2 
;NTENKSQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEV
NNATARVM
;
1 ? 
2 PDB 2ERR        2ERR   1 ?                                                                                           ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2ERR A 22 ? 109 ? Q9NWB1 109 ? 196 ? 109 196 
2 2 2ERR B 1  ? 7   ? 2ERR   197 ? 203 ? 197 203 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2ERR MET A 1  ? UNP Q9NWB1 ? ? 'EXPRESSION TAG' 88  1  
1 2ERR GLY A 2  ? UNP Q9NWB1 ? ? 'EXPRESSION TAG' 89  2  
1 2ERR SER A 3  ? UNP Q9NWB1 ? ? 'EXPRESSION TAG' 90  3  
1 2ERR SER A 4  ? UNP Q9NWB1 ? ? 'EXPRESSION TAG' 91  4  
1 2ERR HIS A 5  ? UNP Q9NWB1 ? ? 'EXPRESSION TAG' 92  5  
1 2ERR HIS A 6  ? UNP Q9NWB1 ? ? 'EXPRESSION TAG' 93  6  
1 2ERR HIS A 7  ? UNP Q9NWB1 ? ? 'EXPRESSION TAG' 94  7  
1 2ERR HIS A 8  ? UNP Q9NWB1 ? ? 'EXPRESSION TAG' 95  8  
1 2ERR HIS A 9  ? UNP Q9NWB1 ? ? 'EXPRESSION TAG' 96  9  
1 2ERR HIS A 10 ? UNP Q9NWB1 ? ? 'EXPRESSION TAG' 97  10 
1 2ERR SER A 11 ? UNP Q9NWB1 ? ? 'EXPRESSION TAG' 98  11 
1 2ERR SER A 12 ? UNP Q9NWB1 ? ? 'EXPRESSION TAG' 99  12 
1 2ERR GLY A 13 ? UNP Q9NWB1 ? ? 'EXPRESSION TAG' 100 13 
1 2ERR LEU A 14 ? UNP Q9NWB1 ? ? 'EXPRESSION TAG' 101 14 
1 2ERR VAL A 15 ? UNP Q9NWB1 ? ? 'EXPRESSION TAG' 102 15 
1 2ERR PRO A 16 ? UNP Q9NWB1 ? ? 'EXPRESSION TAG' 103 16 
1 2ERR ARG A 17 ? UNP Q9NWB1 ? ? 'EXPRESSION TAG' 104 17 
1 2ERR GLY A 18 ? UNP Q9NWB1 ? ? 'EXPRESSION TAG' 105 18 
1 2ERR SER A 19 ? UNP Q9NWB1 ? ? 'EXPRESSION TAG' 106 19 
1 2ERR HIS A 20 ? UNP Q9NWB1 ? ? 'EXPRESSION TAG' 107 20 
1 2ERR MET A 21 ? UNP Q9NWB1 ? ? 'EXPRESSION TAG' 108 21 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O8 P'  323.197 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'      119.119 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'     117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1  1 '2D NOESY'                       1 
2  1 3D_13C-separated_NOESY           4 
3  1 3D_15N-separated_NOESY           1 
4  1 HNCA                             2 
5  1 CBCACONH                         2 
6  1 HNCOCA                           2 
7  1 HCCH-TOCSY                       4 
8  1 '2D F1,F2-edited NOESY'          5 
9  1 '2D F1-edited, F2-fitered NOESY' 5 
10 1 '2D F1-edited, F2-fitered NOESY' 6 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         313 
_pdbx_nmr_exptl_sample_conditions.pressure            1 
_pdbx_nmr_exptl_sample_conditions.pH                  6.5 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      atm 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '1mM Fox-1 15N; 1mM UGCAUGU; 20mM sodium phoshphate; 30mM NaCl'                               '90% H2O/10% D2O' 
2 '1mM Fox-1 15N, 13C; 1mM UGUAUGU; 20mM sodium phoshphate; 30mM NaCl'                          '90% H2O/10% D2O' 
3 '1mM Fox-1 15N; 1mM UGCAUGU; 20mM sodium phoshphate; 30mM NaCl'                               '100% D2O'        
4 '1mM Fox-1 15N, 13C; 1mM UGCAUGU; 20mM sodium phoshphate; 30mM NaCl'                          '100% D2O'        
5 '1mM Fox-1 15N; 1mM UGCAUGU, sugars of U1, C3, U5 13C; 20mM sodium phoshphate; 30mM NaCl'     '100% D2O'        
6 '1mM Fox-1 15N; 1mM UGCAUGU, sugars of G2, A4, G6, U7 13C; 20mM sodium phoshphate; 30mM NaCl' '100% D2O'        
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 DRX    Bruker 500 ? 
2 DRX    Bruker 600 ? 
3 Avance Bruker 900 ? 
# 
_pdbx_nmr_refine.entry_id           2ERR 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            
;The structures are based on a total of 1460 NOE-derived distance constraints, 29 hydrogen bond constraints and 6 torsion angle constraints. 149 and 119 of the NOE constraints are intermolecular and intra-RNA, respectively.
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2ERR 
_pdbx_nmr_ensemble.conformers_calculated_total_number            30 
_pdbx_nmr_ensemble.conformers_submitted_total_number             30 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'all calculated structures submitted' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2ERR 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'closest to the average' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
'structure solution' CYANA 2.0 'Peter Guentert' 1 
refinement           AMBER 7.0 'David A. Case'  2 
# 
_exptl.entry_id          2ERR 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  2ERR 
_struct.title                     'NMR Structure of the RNA Binding Domain of Human Fox-1 in Complex with UGCAUGU' 
_struct.pdbx_descriptor           'PROTEIN/RNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2ERR 
_struct_keywords.pdbx_keywords   'RNA BINDING PROTEIN' 
_struct_keywords.text            'PROTEIN-RNA COMPLEX, RNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ARG B 42 ? PHE B 50 ? ARG A 129 PHE A 137 1 ? 9  
HELX_P HELX_P2 2 GLY B 51 ? PHE B 53 ? GLY A 138 PHE A 140 5 ? 3  
HELX_P HELX_P3 3 SER B 79 ? HIS B 90 ? SER A 166 HIS A 177 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1 hydrog ? ? A U 1 O2 ? ? ? 1_555 A C 3 N4 ? ? B U 197 B C 199 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? ? 
hydrog2 hydrog ? ? A G 2 N2 ? ? ? 1_555 A A 4 N1 ? ? B G 198 B A 200 1_555 ? ? ? ? ? ? TYPE_10_PAIR  ? ? 
hydrog3 hydrog ? ? A G 2 N3 ? ? ? 1_555 A A 4 N6 ? ? B G 198 B A 200 1_555 ? ? ? ? ? ? TYPE_10_PAIR  ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ALA 106 B . ? ALA 193 A ARG 107 B ? ARG 194 A 1  -10.39 
2  LYS 30  B . ? LYS 117 A ARG 31  B ? ARG 118 A 2  -24.77 
3  ALA 106 B . ? ALA 193 A ARG 107 B ? ARG 194 A 5  -8.88  
4  ALA 106 B . ? ALA 193 A ARG 107 B ? ARG 194 A 6  -12.46 
5  ALA 106 B . ? ALA 193 A ARG 107 B ? ARG 194 A 7  -3.47  
6  LYS 30  B . ? LYS 117 A ARG 31  B ? ARG 118 A 8  -10.58 
7  ALA 106 B . ? ALA 193 A ARG 107 B ? ARG 194 A 8  -11.99 
8  LYS 30  B . ? LYS 117 A ARG 31  B ? ARG 118 A 9  -13.26 
9  ALA 106 B . ? ALA 193 A ARG 107 B ? ARG 194 A 9  -14.60 
10 ALA 106 B . ? ALA 193 A ARG 107 B ? ARG 194 A 10 -4.71  
11 ALA 106 B . ? ALA 193 A ARG 107 B ? ARG 194 A 12 -5.59  
12 ALA 106 B . ? ALA 193 A ARG 107 B ? ARG 194 A 13 -6.70  
13 LYS 30  B . ? LYS 117 A ARG 31  B ? ARG 118 A 15 -20.59 
14 ALA 106 B . ? ALA 193 A ARG 107 B ? ARG 194 A 15 -5.69  
15 ALA 106 B . ? ALA 193 A ARG 107 B ? ARG 194 A 17 -10.95 
16 ALA 106 B . ? ALA 193 A ARG 107 B ? ARG 194 A 18 -3.06  
17 ALA 106 B . ? ALA 193 A ARG 107 B ? ARG 194 A 19 -4.03  
18 ALA 106 B . ? ALA 193 A ARG 107 B ? ARG 194 A 20 -12.86 
19 GLN 28  B . ? GLN 115 A PRO 29  B ? PRO 116 A 21 -18.89 
20 ALA 106 B . ? ALA 193 A ARG 107 B ? ARG 194 A 21 -14.18 
21 VAL 108 B . ? VAL 195 A MET 109 B ? MET 196 A 21 -12.34 
22 LYS 30  B . ? LYS 117 A ARG 31  B ? ARG 118 A 24 -15.33 
23 ALA 106 B . ? ALA 193 A ARG 107 B ? ARG 194 A 24 -9.54  
24 VAL 108 B . ? VAL 195 A MET 109 B ? MET 196 A 24 -11.02 
25 LYS 30  B . ? LYS 117 A ARG 31  B ? ARG 118 A 25 -15.62 
26 LYS 30  B . ? LYS 117 A ARG 31  B ? ARG 118 A 26 -17.25 
27 ALA 106 B . ? ALA 193 A ARG 107 B ? ARG 194 A 26 -1.10  
28 ALA 106 B . ? ALA 193 A ARG 107 B ? ARG 194 A 27 -13.76 
29 ALA 106 B . ? ALA 193 A ARG 107 B ? ARG 194 A 28 -15.85 
30 GLN 28  B . ? GLN 115 A PRO 29  B ? PRO 116 A 29 -9.64  
31 LYS 30  B . ? LYS 117 A ARG 31  B ? ARG 118 A 30 -8.37  
32 ALA 106 B . ? ALA 193 A ARG 107 B ? ARG 194 A 30 -14.45 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL B 59  ? ILE B 61  ? VAL A 146 ILE A 148 
A 2 PHE B 71  ? THR B 75  ? PHE A 158 THR A 162 
A 3 ARG B 31  ? SER B 35  ? ARG A 118 SER A 122 
A 4 GLU B 100 ? ASN B 103 ? GLU A 187 ASN A 190 
B 1 VAL B 93  ? VAL B 94  ? VAL A 180 VAL A 181 
B 2 ARG B 97  ? LYS B 98  ? ARG A 184 LYS A 185 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU B 60 ? N GLU A 147 O PHE B 73  ? O PHE A 160 
A 2 3 O GLY B 72 ? O GLY A 159 N VAL B 34  ? N VAL A 121 
A 3 4 N SER B 35 ? N SER A 122 O GLU B 100 ? O GLU A 187 
B 1 2 N VAL B 94 ? N VAL A 181 O ARG B 97  ? O ARG A 184 
# 
_database_PDB_matrix.entry_id          2ERR 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2ERR 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     O "O5'"  . U   A 1 1   ? 0.651   -14.907 9.030   1.00 10.00 ? 197 U   B "O5'"  1  
ATOM 2     C "C5'"  . U   A 1 1   ? -0.621  -14.411 8.626   1.00 10.00 ? 197 U   B "C5'"  1  
ATOM 3     C "C4'"  . U   A 1 1   ? -0.680  -12.890 8.792   1.00 10.00 ? 197 U   B "C4'"  1  
ATOM 4     O "O4'"  . U   A 1 1   ? 0.292   -12.263 7.961   1.00 10.00 ? 197 U   B "O4'"  1  
ATOM 5     C "C3'"  . U   A 1 1   ? -2.028  -12.307 8.361   1.00 10.00 ? 197 U   B "C3'"  1  
ATOM 6     O "O3'"  . U   A 1 1   ? -3.039  -12.391 9.350   1.00 10.00 ? 197 U   B "O3'"  1  
ATOM 7     C "C2'"  . U   A 1 1   ? -1.630  -10.863 8.037   1.00 10.00 ? 197 U   B "C2'"  1  
ATOM 8     O "O2'"  . U   A 1 1   ? -1.461  -10.090 9.221   1.00 10.00 ? 197 U   B "O2'"  1  
ATOM 9     C "C1'"  . U   A 1 1   ? -0.244  -11.067 7.406   1.00 10.00 ? 197 U   B "C1'"  1  
ATOM 10    N N1     . U   A 1 1   ? -0.215  -11.180 5.915   1.00 10.00 ? 197 U   B N1     1  
ATOM 11    C C2     . U   A 1 1   ? 0.497   -10.194 5.222   1.00 10.00 ? 197 U   B C2     1  
ATOM 12    O O2     . U   A 1 1   ? 0.728   -9.072  5.675   1.00 10.00 ? 197 U   B O2     1  
ATOM 13    N N3     . U   A 1 1   ? 0.984   -10.535 3.981   1.00 10.00 ? 197 U   B N3     1  
ATOM 14    C C4     . U   A 1 1   ? 0.694   -11.683 3.289   1.00 10.00 ? 197 U   B C4     1  
ATOM 15    O O4     . U   A 1 1   ? 1.185   -11.885 2.182   1.00 10.00 ? 197 U   B O4     1  
ATOM 16    C C5     . U   A 1 1   ? -0.226  -12.557 3.969   1.00 10.00 ? 197 U   B C5     1  
ATOM 17    C C6     . U   A 1 1   ? -0.634  -12.315 5.244   1.00 10.00 ? 197 U   B C6     1  
ATOM 18    H "H5'"  . U   A 1 1   ? -1.406  -14.867 9.228   1.00 10.00 ? 197 U   B "H5'"  1  
ATOM 19    H "H5''" . U   A 1 1   ? -0.797  -14.666 7.580   1.00 10.00 ? 197 U   B "H5''" 1  
ATOM 20    H "H4'"  . U   A 1 1   ? -0.495  -12.622 9.834   1.00 10.00 ? 197 U   B "H4'"  1  
ATOM 21    H "H3'"  . U   A 1 1   ? -2.362  -12.796 7.448   1.00 10.00 ? 197 U   B "H3'"  1  
ATOM 22    H "H2'"  . U   A 1 1   ? -2.357  -10.391 7.374   1.00 10.00 ? 197 U   B "H2'"  1  
ATOM 23    H "HO2'" . U   A 1 1   ? -2.147  -10.358 9.858   1.00 10.00 ? 197 U   B "HO2'" 1  
ATOM 24    H "H1'"  . U   A 1 1   ? 0.401   -10.237 7.710   1.00 10.00 ? 197 U   B "H1'"  1  
ATOM 25    H H3     . U   A 1 1   ? 1.668   -9.934  3.566   1.00 10.00 ? 197 U   B H3     1  
ATOM 26    H H5     . U   A 1 1   ? -0.546  -13.431 3.427   1.00 10.00 ? 197 U   B H5     1  
ATOM 27    H H6     . U   A 1 1   ? -1.266  -13.044 5.735   1.00 10.00 ? 197 U   B H6     1  
ATOM 28    H "HO5'" . U   A 1 1   ? 0.686   -14.960 10.009  1.00 10.00 ? 197 U   B "HO5'" 1  
ATOM 29    P P      . G   A 1 2   ? -4.570  -12.545 8.920   1.00 10.00 ? 198 G   B P      1  
ATOM 30    O OP1    . G   A 1 2   ? -5.398  -12.478 10.145  1.00 10.00 ? 198 G   B OP1    1  
ATOM 31    O OP2    . G   A 1 2   ? -4.682  -13.734 8.043   1.00 10.00 ? 198 G   B OP2    1  
ATOM 32    O "O5'"  . G   A 1 2   ? -4.851  -11.239 8.018   1.00 10.00 ? 198 G   B "O5'"  1  
ATOM 33    C "C5'"  . G   A 1 2   ? -4.860  -9.929  8.572   1.00 10.00 ? 198 G   B "C5'"  1  
ATOM 34    C "C4'"  . G   A 1 2   ? -6.227  -9.218  8.538   1.00 10.00 ? 198 G   B "C4'"  1  
ATOM 35    O "O4'"  . G   A 1 2   ? -6.522  -8.791  7.211   1.00 10.00 ? 198 G   B "O4'"  1  
ATOM 36    C "C3'"  . G   A 1 2   ? -7.452  -10.030 8.991   1.00 10.00 ? 198 G   B "C3'"  1  
ATOM 37    O "O3'"  . G   A 1 2   ? -8.511  -9.170  9.411   1.00 10.00 ? 198 G   B "O3'"  1  
ATOM 38    C "C2'"  . G   A 1 2   ? -7.842  -10.712 7.677   1.00 10.00 ? 198 G   B "C2'"  1  
ATOM 39    O "O2'"  . G   A 1 2   ? -9.200  -11.143 7.645   1.00 10.00 ? 198 G   B "O2'"  1  
ATOM 40    C "C1'"  . G   A 1 2   ? -7.534  -9.624  6.645   1.00 10.00 ? 198 G   B "C1'"  1  
ATOM 41    N N9     . G   A 1 2   ? -7.118  -10.143 5.316   1.00 10.00 ? 198 G   B N9     1  
ATOM 42    C C8     . G   A 1 2   ? -7.005  -11.442 4.872   1.00 10.00 ? 198 G   B C8     1  
ATOM 43    N N7     . G   A 1 2   ? -6.619  -11.557 3.627   1.00 10.00 ? 198 G   B N7     1  
ATOM 44    C C5     . G   A 1 2   ? -6.485  -10.230 3.197   1.00 10.00 ? 198 G   B C5     1  
ATOM 45    C C6     . G   A 1 2   ? -6.077  -9.671  1.932   1.00 10.00 ? 198 G   B C6     1  
ATOM 46    O O6     . G   A 1 2   ? -5.731  -10.236 0.891   1.00 10.00 ? 198 G   B O6     1  
ATOM 47    N N1     . G   A 1 2   ? -6.104  -8.294  1.912   1.00 10.00 ? 198 G   B N1     1  
ATOM 48    C C2     . G   A 1 2   ? -6.478  -7.532  2.962   1.00 10.00 ? 198 G   B C2     1  
ATOM 49    N N2     . G   A 1 2   ? -6.452  -6.238  2.781   1.00 10.00 ? 198 G   B N2     1  
ATOM 50    N N3     . G   A 1 2   ? -6.861  -7.996  4.144   1.00 10.00 ? 198 G   B N3     1  
ATOM 51    C C4     . G   A 1 2   ? -6.832  -9.364  4.214   1.00 10.00 ? 198 G   B C4     1  
ATOM 52    H "H5'"  . G   A 1 2   ? -4.153  -9.311  8.018   1.00 10.00 ? 198 G   B "H5'"  1  
ATOM 53    H "H5''" . G   A 1 2   ? -4.473  -9.965  9.588   1.00 10.00 ? 198 G   B "H5''" 1  
ATOM 54    H "H4'"  . G   A 1 2   ? -6.127  -8.338  9.170   1.00 10.00 ? 198 G   B "H4'"  1  
ATOM 55    H "H3'"  . G   A 1 2   ? -7.201  -10.767 9.749   1.00 10.00 ? 198 G   B "H3'"  1  
ATOM 56    H "H2'"  . G   A 1 2   ? -7.187  -11.571 7.531   1.00 10.00 ? 198 G   B "H2'"  1  
ATOM 57    H "HO2'" . G   A 1 2   ? -9.730  -10.493 8.145   1.00 10.00 ? 198 G   B "HO2'" 1  
ATOM 58    H "H1'"  . G   A 1 2   ? -8.434  -9.027  6.503   1.00 10.00 ? 198 G   B "H1'"  1  
ATOM 59    H H8     . G   A 1 2   ? -7.202  -12.298 5.508   1.00 10.00 ? 198 G   B H8     1  
ATOM 60    H H1     . G   A 1 2   ? -5.809  -7.806  1.084   1.00 10.00 ? 198 G   B H1     1  
ATOM 61    H H21    . G   A 1 2   ? -6.081  -5.871  1.917   1.00 10.00 ? 198 G   B H21    1  
ATOM 62    H H22    . G   A 1 2   ? -6.714  -5.633  3.549   1.00 10.00 ? 198 G   B H22    1  
ATOM 63    P P      . C   A 1 3   ? -8.684  -8.739  10.947  1.00 10.00 ? 199 C   B P      1  
ATOM 64    O OP1    . C   A 1 3   ? -8.534  -9.945  11.798  1.00 10.00 ? 199 C   B OP1    1  
ATOM 65    O OP2    . C   A 1 3   ? -9.939  -7.959  11.055  1.00 10.00 ? 199 C   B OP2    1  
ATOM 66    O "O5'"  . C   A 1 3   ? -7.443  -7.761  11.251  1.00 10.00 ? 199 C   B "O5'"  1  
ATOM 67    C "C5'"  . C   A 1 3   ? -7.347  -6.468  10.668  1.00 10.00 ? 199 C   B "C5'"  1  
ATOM 68    C "C4'"  . C   A 1 3   ? -6.145  -5.723  11.265  1.00 10.00 ? 199 C   B "C4'"  1  
ATOM 69    O "O4'"  . C   A 1 3   ? -4.915  -6.347  10.897  1.00 10.00 ? 199 C   B "O4'"  1  
ATOM 70    C "C3'"  . C   A 1 3   ? -6.072  -4.258  10.788  1.00 10.00 ? 199 C   B "C3'"  1  
ATOM 71    O "O3'"  . C   A 1 3   ? -5.967  -3.375  11.900  1.00 10.00 ? 199 C   B "O3'"  1  
ATOM 72    C "C2'"  . C   A 1 3   ? -4.783  -4.241  9.949   1.00 10.00 ? 199 C   B "C2'"  1  
ATOM 73    O "O2'"  . C   A 1 3   ? -4.139  -2.974  9.938   1.00 10.00 ? 199 C   B "O2'"  1  
ATOM 74    C "C1'"  . C   A 1 3   ? -3.967  -5.324  10.652  1.00 10.00 ? 199 C   B "C1'"  1  
ATOM 75    N N1     . C   A 1 3   ? -2.813  -5.837  9.851   1.00 10.00 ? 199 C   B N1     1  
ATOM 76    C C2     . C   A 1 3   ? -1.508  -5.665  10.338  1.00 10.00 ? 199 C   B C2     1  
ATOM 77    O O2     . C   A 1 3   ? -1.279  -5.044  11.377  1.00 10.00 ? 199 C   B O2     1  
ATOM 78    N N3     . C   A 1 3   ? -0.444  -6.188  9.673   1.00 10.00 ? 199 C   B N3     1  
ATOM 79    C C4     . C   A 1 3   ? -0.670  -6.863  8.565   1.00 10.00 ? 199 C   B C4     1  
ATOM 80    N N4     . C   A 1 3   ? 0.388   -7.335  7.965   1.00 10.00 ? 199 C   B N4     1  
ATOM 81    C C5     . C   A 1 3   ? -1.957  -7.033  7.999   1.00 10.00 ? 199 C   B C5     1  
ATOM 82    C C6     . C   A 1 3   ? -3.014  -6.505  8.666   1.00 10.00 ? 199 C   B C6     1  
ATOM 83    H "H5'"  . C   A 1 3   ? -8.253  -5.905  10.894  1.00 10.00 ? 199 C   B "H5'"  1  
ATOM 84    H "H5''" . C   A 1 3   ? -7.243  -6.538  9.582   1.00 10.00 ? 199 C   B "H5''" 1  
ATOM 85    H "H4'"  . C   A 1 3   ? -6.242  -5.732  12.352  1.00 10.00 ? 199 C   B "H4'"  1  
ATOM 86    H "H3'"  . C   A 1 3   ? -6.916  -3.996  10.157  1.00 10.00 ? 199 C   B "H3'"  1  
ATOM 87    H "H2'"  . C   A 1 3   ? -5.019  -4.562  8.933   1.00 10.00 ? 199 C   B "H2'"  1  
ATOM 88    H "HO2'" . C   A 1 3   ? -4.317  -2.550  10.797  1.00 10.00 ? 199 C   B "HO2'" 1  
ATOM 89    H "H1'"  . C   A 1 3   ? -3.617  -4.914  11.605  1.00 10.00 ? 199 C   B "H1'"  1  
ATOM 90    H H41    . C   A 1 3   ? 1.255   -7.250  8.454   1.00 10.00 ? 199 C   B H41    1  
ATOM 91    H H42    . C   A 1 3   ? 0.305   -7.859  7.102   1.00 10.00 ? 199 C   B H42    1  
ATOM 92    H H5     . C   A 1 3   ? -2.094  -7.588  7.092   1.00 10.00 ? 199 C   B H5     1  
ATOM 93    H H6     . C   A 1 3   ? -4.020  -6.624  8.285   1.00 10.00 ? 199 C   B H6     1  
ATOM 94    P P      . A   A 1 4   ? -7.280  -2.832  12.648  1.00 10.00 ? 200 A   B P      1  
ATOM 95    O OP1    . A   A 1 4   ? -6.847  -2.165  13.900  1.00 10.00 ? 200 A   B OP1    1  
ATOM 96    O OP2    . A   A 1 4   ? -8.273  -3.927  12.731  1.00 10.00 ? 200 A   B OP2    1  
ATOM 97    O "O5'"  . A   A 1 4   ? -7.858  -1.715  11.649  1.00 10.00 ? 200 A   B "O5'"  1  
ATOM 98    C "C5'"  . A   A 1 4   ? -7.203  -0.463  11.506  1.00 10.00 ? 200 A   B "C5'"  1  
ATOM 99    C "C4'"  . A   A 1 4   ? -7.804  0.426   10.404  1.00 10.00 ? 200 A   B "C4'"  1  
ATOM 100   O "O4'"  . A   A 1 4   ? -7.596  -0.161  9.128   1.00 10.00 ? 200 A   B "O4'"  1  
ATOM 101   C "C3'"  . A   A 1 4   ? -9.312  0.708   10.536  1.00 10.00 ? 200 A   B "C3'"  1  
ATOM 102   O "O3'"  . A   A 1 4   ? -9.683  1.964   9.978   1.00 10.00 ? 200 A   B "O3'"  1  
ATOM 103   C "C2'"  . A   A 1 4   ? -9.920  -0.409  9.695   1.00 10.00 ? 200 A   B "C2'"  1  
ATOM 104   O "O2'"  . A   A 1 4   ? -11.165 -0.060  9.096   1.00 10.00 ? 200 A   B "O2'"  1  
ATOM 105   C "C1'"  . A   A 1 4   ? -8.823  -0.708  8.660   1.00 10.00 ? 200 A   B "C1'"  1  
ATOM 106   N N9     . A   A 1 4   ? -8.689  -2.159  8.373   1.00 10.00 ? 200 A   B N9     1  
ATOM 107   C C8     . A   A 1 4   ? -9.139  -3.247  9.091   1.00 10.00 ? 200 A   B C8     1  
ATOM 108   N N7     . A   A 1 4   ? -8.919  -4.404  8.520   1.00 10.00 ? 200 A   B N7     1  
ATOM 109   C C5     . A   A 1 4   ? -8.297  -4.045  7.315   1.00 10.00 ? 200 A   B C5     1  
ATOM 110   C C6     . A   A 1 4   ? -7.791  -4.762  6.205   1.00 10.00 ? 200 A   B C6     1  
ATOM 111   N N6     . A   A 1 4   ? -7.789  -6.079  6.147   1.00 10.00 ? 200 A   B N6     1  
ATOM 112   N N1     . A   A 1 4   ? -7.264  -4.134  5.147   1.00 10.00 ? 200 A   B N1     1  
ATOM 113   C C2     . A   A 1 4   ? -7.209  -2.803  5.198   1.00 10.00 ? 200 A   B C2     1  
ATOM 114   N N3     . A   A 1 4   ? -7.617  -2.000  6.176   1.00 10.00 ? 200 A   B N3     1  
ATOM 115   C C4     . A   A 1 4   ? -8.158  -2.687  7.219   1.00 10.00 ? 200 A   B C4     1  
ATOM 116   H "H5'"  . A   A 1 4   ? -6.154  -0.632  11.261  1.00 10.00 ? 200 A   B "H5'"  1  
ATOM 117   H "H5''" . A   A 1 4   ? -7.252  0.078   12.452  1.00 10.00 ? 200 A   B "H5''" 1  
ATOM 118   H "H4'"  . A   A 1 4   ? -7.264  1.370   10.448  1.00 10.00 ? 200 A   B "H4'"  1  
ATOM 119   H "H3'"  . A   A 1 4   ? -9.653  0.610   11.569  1.00 10.00 ? 200 A   B "H3'"  1  
ATOM 120   H "H2'"  . A   A 1 4   ? -10.070 -1.251  10.370  1.00 10.00 ? 200 A   B "H2'"  1  
ATOM 121   H "HO2'" . A   A 1 4   ? -11.164 0.910   8.981   1.00 10.00 ? 200 A   B "HO2'" 1  
ATOM 122   H "H1'"  . A   A 1 4   ? -9.061  -0.190  7.729   1.00 10.00 ? 200 A   B "H1'"  1  
ATOM 123   H H8     . A   A 1 4   ? -9.604  -3.159  10.066  1.00 10.00 ? 200 A   B H8     1  
ATOM 124   H H61    . A   A 1 4   ? -7.387  -6.573  5.361   1.00 10.00 ? 200 A   B H61    1  
ATOM 125   H H62    . A   A 1 4   ? -8.145  -6.584  6.939   1.00 10.00 ? 200 A   B H62    1  
ATOM 126   H H2     . A   A 1 4   ? -6.778  -2.279  4.356   1.00 10.00 ? 200 A   B H2     1  
ATOM 127   P P      . U   A 1 5   ? -9.465  3.332   10.776  1.00 10.00 ? 201 U   B P      1  
ATOM 128   O OP1    . U   A 1 5   ? -8.566  3.093   11.932  1.00 10.00 ? 201 U   B OP1    1  
ATOM 129   O OP2    . U   A 1 5   ? -10.795 3.940   11.013  1.00 10.00 ? 201 U   B OP2    1  
ATOM 130   O "O5'"  . U   A 1 5   ? -8.693  4.232   9.697   1.00 10.00 ? 201 U   B "O5'"  1  
ATOM 131   C "C5'"  . U   A 1 5   ? -7.426  3.856   9.177   1.00 10.00 ? 201 U   B "C5'"  1  
ATOM 132   C "C4'"  . U   A 1 5   ? -6.672  5.028   8.521   1.00 10.00 ? 201 U   B "C4'"  1  
ATOM 133   O "O4'"  . U   A 1 5   ? -7.099  5.332   7.196   1.00 10.00 ? 201 U   B "O4'"  1  
ATOM 134   C "C3'"  . U   A 1 5   ? -6.757  6.314   9.353   1.00 10.00 ? 201 U   B "C3'"  1  
ATOM 135   O "O3'"  . U   A 1 5   ? -5.538  7.060   9.318   1.00 10.00 ? 201 U   B "O3'"  1  
ATOM 136   C "C2'"  . U   A 1 5   ? -7.925  7.015   8.647   1.00 10.00 ? 201 U   B "C2'"  1  
ATOM 137   O "O2'"  . U   A 1 5   ? -7.963  8.407   8.903   1.00 10.00 ? 201 U   B "O2'"  1  
ATOM 138   C "C1'"  . U   A 1 5   ? -7.728  6.611   7.176   1.00 10.00 ? 201 U   B "C1'"  1  
ATOM 139   N N1     . U   A 1 5   ? -9.013  6.490   6.431   1.00 10.00 ? 201 U   B N1     1  
ATOM 140   C C2     . U   A 1 5   ? -9.225  7.284   5.297   1.00 10.00 ? 201 U   B C2     1  
ATOM 141   O O2     . U   A 1 5   ? -8.437  8.138   4.903   1.00 10.00 ? 201 U   B O2     1  
ATOM 142   N N3     . U   A 1 5   ? -10.394 7.092   4.592   1.00 10.00 ? 201 U   B N3     1  
ATOM 143   C C4     . U   A 1 5   ? -11.414 6.251   4.976   1.00 10.00 ? 201 U   B C4     1  
ATOM 144   O O4     . U   A 1 5   ? -12.486 6.249   4.382   1.00 10.00 ? 201 U   B O4     1  
ATOM 145   C C5     . U   A 1 5   ? -11.113 5.419   6.120   1.00 10.00 ? 201 U   B C5     1  
ATOM 146   C C6     . U   A 1 5   ? -9.951  5.556   6.809   1.00 10.00 ? 201 U   B C6     1  
ATOM 147   H "H5'"  . U   A 1 5   ? -7.539  3.044   8.456   1.00 10.00 ? 201 U   B "H5'"  1  
ATOM 148   H "H5''" . U   A 1 5   ? -6.803  3.499   9.998   1.00 10.00 ? 201 U   B "H5''" 1  
ATOM 149   H "H4'"  . U   A 1 5   ? -5.642  4.705   8.459   1.00 10.00 ? 201 U   B "H4'"  1  
ATOM 150   H "H3'"  . U   A 1 5   ? -7.038  6.098   10.387  1.00 10.00 ? 201 U   B "H3'"  1  
ATOM 151   H "H2'"  . U   A 1 5   ? -8.851  6.576   9.017   1.00 10.00 ? 201 U   B "H2'"  1  
ATOM 152   H "HO2'" . U   A 1 5   ? -7.902  8.552   9.864   1.00 10.00 ? 201 U   B "HO2'" 1  
ATOM 153   H "H1'"  . U   A 1 5   ? -7.070  7.338   6.691   1.00 10.00 ? 201 U   B "H1'"  1  
ATOM 154   H H3     . U   A 1 5   ? -10.481 7.566   3.707   1.00 10.00 ? 201 U   B H3     1  
ATOM 155   H H5     . U   A 1 5   ? -11.838 4.676   6.416   1.00 10.00 ? 201 U   B H5     1  
ATOM 156   H H6     . U   A 1 5   ? -9.745  4.914   7.656   1.00 10.00 ? 201 U   B H6     1  
ATOM 157   P P      . G   A 1 6   ? -4.314  6.665   10.292  1.00 10.00 ? 202 G   B P      1  
ATOM 158   O OP1    . G   A 1 6   ? -4.627  5.389   10.981  1.00 10.00 ? 202 G   B OP1    1  
ATOM 159   O OP2    . G   A 1 6   ? -3.954  7.842   11.115  1.00 10.00 ? 202 G   B OP2    1  
ATOM 160   O "O5'"  . G   A 1 6   ? -3.087  6.392   9.303   1.00 10.00 ? 202 G   B "O5'"  1  
ATOM 161   C "C5'"  . G   A 1 6   ? -3.052  5.231   8.499   1.00 10.00 ? 202 G   B "C5'"  1  
ATOM 162   C "C4'"  . G   A 1 6   ? -1.846  5.115   7.567   1.00 10.00 ? 202 G   B "C4'"  1  
ATOM 163   O "O4'"  . G   A 1 6   ? -2.172  5.748   6.332   1.00 10.00 ? 202 G   B "O4'"  1  
ATOM 164   C "C3'"  . G   A 1 6   ? -0.572  5.728   8.152   1.00 10.00 ? 202 G   B "C3'"  1  
ATOM 165   O "O3'"  . G   A 1 6   ? 0.542   4.888   7.943   1.00 10.00 ? 202 G   B "O3'"  1  
ATOM 166   C "C2'"  . G   A 1 6   ? -0.601  7.040   7.371   1.00 10.00 ? 202 G   B "C2'"  1  
ATOM 167   O "O2'"  . G   A 1 6   ? 0.615   7.777   7.345   1.00 10.00 ? 202 G   B "O2'"  1  
ATOM 168   C "C1'"  . G   A 1 6   ? -1.113  6.626   6.009   1.00 10.00 ? 202 G   B "C1'"  1  
ATOM 169   N N9     . G   A 1 6   ? -1.517  7.812   5.227   1.00 10.00 ? 202 G   B N9     1  
ATOM 170   C C8     . G   A 1 6   ? -0.816  8.391   4.204   1.00 10.00 ? 202 G   B C8     1  
ATOM 171   N N7     . G   A 1 6   ? -1.319  9.518   3.776   1.00 10.00 ? 202 G   B N7     1  
ATOM 172   C C5     . G   A 1 6   ? -2.464  9.691   4.563   1.00 10.00 ? 202 G   B C5     1  
ATOM 173   C C6     . G   A 1 6   ? -3.465  10.730  4.584   1.00 10.00 ? 202 G   B C6     1  
ATOM 174   O O6     . G   A 1 6   ? -3.525  11.771  3.929   1.00 10.00 ? 202 G   B O6     1  
ATOM 175   N N1     . G   A 1 6   ? -4.490  10.496  5.473   1.00 10.00 ? 202 G   B N1     1  
ATOM 176   C C2     . G   A 1 6   ? -4.515  9.430   6.313   1.00 10.00 ? 202 G   B C2     1  
ATOM 177   N N2     . G   A 1 6   ? -5.547  9.285   7.091   1.00 10.00 ? 202 G   B N2     1  
ATOM 178   N N3     . G   A 1 6   ? -3.570  8.503   6.402   1.00 10.00 ? 202 G   B N3     1  
ATOM 179   C C4     . G   A 1 6   ? -2.581  8.657   5.468   1.00 10.00 ? 202 G   B C4     1  
ATOM 180   H "H5'"  . G   A 1 6   ? -3.919  5.253   7.852   1.00 10.00 ? 202 G   B "H5'"  1  
ATOM 181   H "H5''" . G   A 1 6   ? -3.079  4.348   9.141   1.00 10.00 ? 202 G   B "H5''" 1  
ATOM 182   H "H4'"  . G   A 1 6   ? -1.638  4.073   7.363   1.00 10.00 ? 202 G   B "H4'"  1  
ATOM 183   H "H3'"  . G   A 1 6   ? -0.657  5.912   9.212   1.00 10.00 ? 202 G   B "H3'"  1  
ATOM 184   H "H2'"  . G   A 1 6   ? -1.415  7.630   7.777   1.00 10.00 ? 202 G   B "H2'"  1  
ATOM 185   H "HO2'" . G   A 1 6   ? 1.258   7.266   6.824   1.00 10.00 ? 202 G   B "HO2'" 1  
ATOM 186   H "H1'"  . G   A 1 6   ? -0.342  6.081   5.485   1.00 10.00 ? 202 G   B "H1'"  1  
ATOM 187   H H8     . G   A 1 6   ? 0.087   7.937   3.808   1.00 10.00 ? 202 G   B H8     1  
ATOM 188   H H1     . G   A 1 6   ? -5.281  11.117  5.373   1.00 10.00 ? 202 G   B H1     1  
ATOM 189   H H21    . G   A 1 6   ? -6.387  9.844   6.998   1.00 10.00 ? 202 G   B H21    1  
ATOM 190   H H22    . G   A 1 6   ? -5.527  8.523   7.759   1.00 10.00 ? 202 G   B H22    1  
ATOM 191   P P      . U   A 1 7   ? 1.157   4.056   9.177   1.00 10.00 ? 203 U   B P      1  
ATOM 192   O OP1    . U   A 1 7   ? 0.479   2.743   9.293   1.00 10.00 ? 203 U   B OP1    1  
ATOM 193   O OP2    . U   A 1 7   ? 1.251   4.923   10.375  1.00 10.00 ? 203 U   B OP2    1  
ATOM 194   O "O5'"  . U   A 1 7   ? 2.643   3.774   8.664   1.00 10.00 ? 203 U   B "O5'"  1  
ATOM 195   C "C5'"  . U   A 1 7   ? 3.544   4.842   8.425   1.00 10.00 ? 203 U   B "C5'"  1  
ATOM 196   C "C4'"  . U   A 1 7   ? 3.446   5.470   7.018   1.00 10.00 ? 203 U   B "C4'"  1  
ATOM 197   O "O4'"  . U   A 1 7   ? 4.769   5.683   6.531   1.00 10.00 ? 203 U   B "O4'"  1  
ATOM 198   C "C3'"  . U   A 1 7   ? 2.733   4.718   5.876   1.00 10.00 ? 203 U   B "C3'"  1  
ATOM 199   O "O3'"  . U   A 1 7   ? 1.998   5.649   5.090   1.00 10.00 ? 203 U   B "O3'"  1  
ATOM 200   C "C2'"  . U   A 1 7   ? 3.853   4.099   5.019   1.00 10.00 ? 203 U   B "C2'"  1  
ATOM 201   O "O2'"  . U   A 1 7   ? 3.855   4.545   3.663   1.00 10.00 ? 203 U   B "O2'"  1  
ATOM 202   C "C1'"  . U   A 1 7   ? 5.133   4.572   5.714   1.00 10.00 ? 203 U   B "C1'"  1  
ATOM 203   N N1     . U   A 1 7   ? 5.815   3.476   6.469   1.00 10.00 ? 203 U   B N1     1  
ATOM 204   C C2     . U   A 1 7   ? 7.217   3.420   6.418   1.00 10.00 ? 203 U   B C2     1  
ATOM 205   O O2     . U   A 1 7   ? 7.918   4.301   5.913   1.00 10.00 ? 203 U   B O2     1  
ATOM 206   N N3     . U   A 1 7   ? 7.826   2.301   6.952   1.00 10.00 ? 203 U   B N3     1  
ATOM 207   C C4     . U   A 1 7   ? 7.174   1.228   7.515   1.00 10.00 ? 203 U   B C4     1  
ATOM 208   O O4     . U   A 1 7   ? 7.820   0.270   7.932   1.00 10.00 ? 203 U   B O4     1  
ATOM 209   C C5     . U   A 1 7   ? 5.734   1.362   7.559   1.00 10.00 ? 203 U   B C5     1  
ATOM 210   C C6     . U   A 1 7   ? 5.102   2.454   7.065   1.00 10.00 ? 203 U   B C6     1  
ATOM 211   H "H5'"  . U   A 1 7   ? 4.556   4.473   8.584   1.00 10.00 ? 203 U   B "H5'"  1  
ATOM 212   H "H5''" . U   A 1 7   ? 3.397   5.633   9.165   1.00 10.00 ? 203 U   B "H5''" 1  
ATOM 213   H "H4'"  . U   A 1 7   ? 2.903   6.404   7.153   1.00 10.00 ? 203 U   B "H4'"  1  
ATOM 214   H "H3'"  . U   A 1 7   ? 2.071   3.939   6.253   1.00 10.00 ? 203 U   B "H3'"  1  
ATOM 215   H "HO3'" . U   A 1 7   ? 2.507   5.711   4.261   1.00 10.00 ? 203 U   B "HO3'" 1  
ATOM 216   H "H2'"  . U   A 1 7   ? 3.783   3.007   5.040   1.00 10.00 ? 203 U   B "H2'"  1  
ATOM 217   H "HO2'" . U   A 1 7   ? 3.426   3.852   3.120   1.00 10.00 ? 203 U   B "HO2'" 1  
ATOM 218   H "H1'"  . U   A 1 7   ? 5.816   4.928   4.937   1.00 10.00 ? 203 U   B "H1'"  1  
ATOM 219   H H3     . U   A 1 7   ? 8.826   2.253   6.911   1.00 10.00 ? 203 U   B H3     1  
ATOM 220   H H5     . U   A 1 7   ? 5.147   0.565   7.985   1.00 10.00 ? 203 U   B H5     1  
ATOM 221   H H6     . U   A 1 7   ? 4.018   2.515   7.144   1.00 10.00 ? 203 U   B H6     1  
ATOM 222   N N      . ASN B 2 22  ? -2.967  34.649  -12.770 1.00 10.00 ? 109 ASN A N      1  
ATOM 223   C CA     . ASN B 2 22  ? -3.047  33.421  -11.935 1.00 10.00 ? 109 ASN A CA     1  
ATOM 224   C C      . ASN B 2 22  ? -1.660  32.780  -11.779 1.00 10.00 ? 109 ASN A C      1  
ATOM 225   O O      . ASN B 2 22  ? -0.844  32.833  -12.700 1.00 10.00 ? 109 ASN A O      1  
ATOM 226   C CB     . ASN B 2 22  ? -4.073  32.412  -12.508 1.00 10.00 ? 109 ASN A CB     1  
ATOM 227   C CG     . ASN B 2 22  ? -4.177  31.150  -11.649 1.00 10.00 ? 109 ASN A CG     1  
ATOM 228   O OD1    . ASN B 2 22  ? -4.166  31.204  -10.427 1.00 10.00 ? 109 ASN A OD1    1  
ATOM 229   N ND2    . ASN B 2 22  ? -4.222  29.974  -12.238 1.00 10.00 ? 109 ASN A ND2    1  
ATOM 230   H H      . ASN B 2 22  ? -2.343  35.322  -12.352 1.00 10.00 ? 109 ASN A H      1  
ATOM 231   H HA     . ASN B 2 22  ? -3.384  33.707  -10.938 1.00 10.00 ? 109 ASN A HA     1  
ATOM 232   H HB2    . ASN B 2 22  ? -5.058  32.877  -12.543 1.00 10.00 ? 109 ASN A HB2    1  
ATOM 233   H HB3    . ASN B 2 22  ? -3.781  32.135  -13.522 1.00 10.00 ? 109 ASN A HB3    1  
ATOM 234   H HD21   . ASN B 2 22  ? -4.225  29.866  -13.242 1.00 10.00 ? 109 ASN A HD21   1  
ATOM 235   H HD22   . ASN B 2 22  ? -4.194  29.159  -11.628 1.00 10.00 ? 109 ASN A HD22   1  
ATOM 236   N N      . THR B 2 23  ? -1.389  32.169  -10.620 1.00 10.00 ? 110 THR A N      1  
ATOM 237   C CA     . THR B 2 23  ? -0.117  31.496  -10.267 1.00 10.00 ? 110 THR A CA     1  
ATOM 238   C C      . THR B 2 23  ? -0.285  30.082  -9.680  1.00 10.00 ? 110 THR A C      1  
ATOM 239   O O      . THR B 2 23  ? 0.718   29.440  -9.360  1.00 10.00 ? 110 THR A O      1  
ATOM 240   C CB     . THR B 2 23  ? 0.721   32.358  -9.300  1.00 10.00 ? 110 THR A CB     1  
ATOM 241   O OG1    . THR B 2 23  ? -0.022  32.697  -8.143  1.00 10.00 ? 110 THR A OG1    1  
ATOM 242   C CG2    . THR B 2 23  ? 1.212   33.660  -9.939  1.00 10.00 ? 110 THR A CG2    1  
ATOM 243   H H      . THR B 2 23  ? -2.117  32.170  -9.914  1.00 10.00 ? 110 THR A H      1  
ATOM 244   H HA     . THR B 2 23  ? 0.478   31.365  -11.172 1.00 10.00 ? 110 THR A HA     1  
ATOM 245   H HB     . THR B 2 23  ? 1.602   31.792  -8.993  1.00 10.00 ? 110 THR A HB     1  
ATOM 246   H HG1    . THR B 2 23  ? -0.637  33.411  -8.387  1.00 10.00 ? 110 THR A HG1    1  
ATOM 247   H HG21   . THR B 2 23  ? 1.787   33.432  -10.837 1.00 10.00 ? 110 THR A HG21   1  
ATOM 248   H HG22   . THR B 2 23  ? 0.373   34.302  -10.204 1.00 10.00 ? 110 THR A HG22   1  
ATOM 249   H HG23   . THR B 2 23  ? 1.854   34.189  -9.236  1.00 10.00 ? 110 THR A HG23   1  
ATOM 250   N N      . GLU B 2 24  ? -1.515  29.556  -9.554  1.00 10.00 ? 111 GLU A N      1  
ATOM 251   C CA     . GLU B 2 24  ? -1.803  28.264  -8.899  1.00 10.00 ? 111 GLU A CA     1  
ATOM 252   C C      . GLU B 2 24  ? -2.728  27.351  -9.735  1.00 10.00 ? 111 GLU A C      1  
ATOM 253   O O      . GLU B 2 24  ? -3.603  27.820  -10.469 1.00 10.00 ? 111 GLU A O      1  
ATOM 254   C CB     . GLU B 2 24  ? -2.393  28.549  -7.501  1.00 10.00 ? 111 GLU A CB     1  
ATOM 255   C CG     . GLU B 2 24  ? -2.642  27.316  -6.623  1.00 10.00 ? 111 GLU A CG     1  
ATOM 256   C CD     . GLU B 2 24  ? -1.356  26.514  -6.351  1.00 10.00 ? 111 GLU A CD     1  
ATOM 257   O OE1    . GLU B 2 24  ? -0.965  25.688  -7.211  1.00 10.00 ? 111 GLU A OE1    1  
ATOM 258   O OE2    . GLU B 2 24  ? -0.727  26.708  -5.281  1.00 10.00 ? 111 GLU A OE2    1  
ATOM 259   H H      . GLU B 2 24  ? -2.309  30.095  -9.877  1.00 10.00 ? 111 GLU A H      1  
ATOM 260   H HA     . GLU B 2 24  ? -0.866  27.725  -8.765  1.00 10.00 ? 111 GLU A HA     1  
ATOM 261   H HB2    . GLU B 2 24  ? -1.713  29.211  -6.965  1.00 10.00 ? 111 GLU A HB2    1  
ATOM 262   H HB3    . GLU B 2 24  ? -3.340  29.077  -7.626  1.00 10.00 ? 111 GLU A HB3    1  
ATOM 263   H HG2    . GLU B 2 24  ? -3.071  27.656  -5.677  1.00 10.00 ? 111 GLU A HG2    1  
ATOM 264   H HG3    . GLU B 2 24  ? -3.393  26.676  -7.091  1.00 10.00 ? 111 GLU A HG3    1  
ATOM 265   N N      . ASN B 2 25  ? -2.553  26.032  -9.607  1.00 10.00 ? 112 ASN A N      1  
ATOM 266   C CA     . ASN B 2 25  ? -3.388  25.006  -10.231 1.00 10.00 ? 112 ASN A CA     1  
ATOM 267   C C      . ASN B 2 25  ? -4.718  24.831  -9.465  1.00 10.00 ? 112 ASN A C      1  
ATOM 268   O O      . ASN B 2 25  ? -4.762  24.230  -8.388  1.00 10.00 ? 112 ASN A O      1  
ATOM 269   C CB     . ASN B 2 25  ? -2.583  23.695  -10.330 1.00 10.00 ? 112 ASN A CB     1  
ATOM 270   C CG     . ASN B 2 25  ? -3.290  22.630  -11.161 1.00 10.00 ? 112 ASN A CG     1  
ATOM 271   O OD1    . ASN B 2 25  ? -4.506  22.503  -11.171 1.00 10.00 ? 112 ASN A OD1    1  
ATOM 272   N ND2    . ASN B 2 25  ? -2.554  21.830  -11.900 1.00 10.00 ? 112 ASN A ND2    1  
ATOM 273   H H      . ASN B 2 25  ? -1.857  25.725  -8.928  1.00 10.00 ? 112 ASN A H      1  
ATOM 274   H HA     . ASN B 2 25  ? -3.621  25.325  -11.251 1.00 10.00 ? 112 ASN A HA     1  
ATOM 275   H HB2    . ASN B 2 25  ? -1.619  23.914  -10.793 1.00 10.00 ? 112 ASN A HB2    1  
ATOM 276   H HB3    . ASN B 2 25  ? -2.402  23.295  -9.332  1.00 10.00 ? 112 ASN A HB3    1  
ATOM 277   H HD21   . ASN B 2 25  ? -1.549  21.916  -11.925 1.00 10.00 ? 112 ASN A HD21   1  
ATOM 278   H HD22   . ASN B 2 25  ? -3.044  21.146  -12.456 1.00 10.00 ? 112 ASN A HD22   1  
ATOM 279   N N      . LYS B 2 26  ? -5.815  25.339  -10.040 1.00 10.00 ? 113 LYS A N      1  
ATOM 280   C CA     . LYS B 2 26  ? -7.187  25.303  -9.489  1.00 10.00 ? 113 LYS A CA     1  
ATOM 281   C C      . LYS B 2 26  ? -7.781  23.887  -9.305  1.00 10.00 ? 113 LYS A C      1  
ATOM 282   O O      . LYS B 2 26  ? -8.792  23.735  -8.615  1.00 10.00 ? 113 LYS A O      1  
ATOM 283   C CB     . LYS B 2 26  ? -8.067  26.187  -10.397 1.00 10.00 ? 113 LYS A CB     1  
ATOM 284   C CG     . LYS B 2 26  ? -9.400  26.610  -9.762  1.00 10.00 ? 113 LYS A CG     1  
ATOM 285   C CD     . LYS B 2 26  ? -10.094 27.679  -10.619 1.00 10.00 ? 113 LYS A CD     1  
ATOM 286   C CE     . LYS B 2 26  ? -11.408 28.109  -9.960  1.00 10.00 ? 113 LYS A CE     1  
ATOM 287   N NZ     . LYS B 2 26  ? -12.082 29.184  -10.734 1.00 10.00 ? 113 LYS A NZ     1  
ATOM 288   H H      . LYS B 2 26  ? -5.665  25.827  -10.915 1.00 10.00 ? 113 LYS A H      1  
ATOM 289   H HA     . LYS B 2 26  ? -7.160  25.755  -8.496  1.00 10.00 ? 113 LYS A HA     1  
ATOM 290   H HB2    . LYS B 2 26  ? -7.513  27.097  -10.631 1.00 10.00 ? 113 LYS A HB2    1  
ATOM 291   H HB3    . LYS B 2 26  ? -8.265  25.665  -11.335 1.00 10.00 ? 113 LYS A HB3    1  
ATOM 292   H HG2    . LYS B 2 26  ? -10.063 25.748  -9.670  1.00 10.00 ? 113 LYS A HG2    1  
ATOM 293   H HG3    . LYS B 2 26  ? -9.212  27.021  -8.769  1.00 10.00 ? 113 LYS A HG3    1  
ATOM 294   H HD2    . LYS B 2 26  ? -9.438  28.547  -10.713 1.00 10.00 ? 113 LYS A HD2    1  
ATOM 295   H HD3    . LYS B 2 26  ? -10.293 27.273  -11.613 1.00 10.00 ? 113 LYS A HD3    1  
ATOM 296   H HE2    . LYS B 2 26  ? -12.063 27.236  -9.885  1.00 10.00 ? 113 LYS A HE2    1  
ATOM 297   H HE3    . LYS B 2 26  ? -11.194 28.459  -8.945  1.00 10.00 ? 113 LYS A HE3    1  
ATOM 298   H HZ1    . LYS B 2 26  ? -11.504 30.011  -10.795 1.00 10.00 ? 113 LYS A HZ1    1  
ATOM 299   H HZ2    . LYS B 2 26  ? -12.289 28.884  -11.676 1.00 10.00 ? 113 LYS A HZ2    1  
ATOM 300   H HZ3    . LYS B 2 26  ? -12.953 29.456  -10.300 1.00 10.00 ? 113 LYS A HZ3    1  
ATOM 301   N N      . SER B 2 27  ? -7.154  22.853  -9.871  1.00 10.00 ? 114 SER A N      1  
ATOM 302   C CA     . SER B 2 27  ? -7.660  21.467  -9.960  1.00 10.00 ? 114 SER A CA     1  
ATOM 303   C C      . SER B 2 27  ? -6.685  20.407  -9.405  1.00 10.00 ? 114 SER A C      1  
ATOM 304   O O      . SER B 2 27  ? -6.871  19.213  -9.642  1.00 10.00 ? 114 SER A O      1  
ATOM 305   C CB     . SER B 2 27  ? -8.014  21.149  -11.420 1.00 10.00 ? 114 SER A CB     1  
ATOM 306   O OG     . SER B 2 27  ? -8.944  22.086  -11.949 1.00 10.00 ? 114 SER A OG     1  
ATOM 307   H H      . SER B 2 27  ? -6.323  23.069  -10.407 1.00 10.00 ? 114 SER A H      1  
ATOM 308   H HA     . SER B 2 27  ? -8.575  21.375  -9.373  1.00 10.00 ? 114 SER A HA     1  
ATOM 309   H HB2    . SER B 2 27  ? -7.102  21.174  -12.019 1.00 10.00 ? 114 SER A HB2    1  
ATOM 310   H HB3    . SER B 2 27  ? -8.442  20.146  -11.486 1.00 10.00 ? 114 SER A HB3    1  
ATOM 311   H HG     . SER B 2 27  ? -9.798  21.975  -11.488 1.00 10.00 ? 114 SER A HG     1  
ATOM 312   N N      . GLN B 2 28  ? -5.637  20.818  -8.681  1.00 10.00 ? 115 GLN A N      1  
ATOM 313   C CA     . GLN B 2 28  ? -4.542  19.957  -8.205  1.00 10.00 ? 115 GLN A CA     1  
ATOM 314   C C      . GLN B 2 28  ? -5.027  18.698  -7.437  1.00 10.00 ? 115 GLN A C      1  
ATOM 315   O O      . GLN B 2 28  ? -5.736  18.842  -6.434  1.00 10.00 ? 115 GLN A O      1  
ATOM 316   C CB     . GLN B 2 28  ? -3.609  20.788  -7.305  1.00 10.00 ? 115 GLN A CB     1  
ATOM 317   C CG     . GLN B 2 28  ? -2.267  20.082  -7.042  1.00 10.00 ? 115 GLN A CG     1  
ATOM 318   C CD     . GLN B 2 28  ? -1.707  20.429  -5.667  1.00 10.00 ? 115 GLN A CD     1  
ATOM 319   O OE1    . GLN B 2 28  ? -1.063  21.452  -5.464  1.00 10.00 ? 115 GLN A OE1    1  
ATOM 320   N NE2    . GLN B 2 28  ? -1.926  19.591  -4.671  1.00 10.00 ? 115 GLN A NE2    1  
ATOM 321   H H      . GLN B 2 28  ? -5.564  21.813  -8.516  1.00 10.00 ? 115 GLN A H      1  
ATOM 322   H HA     . GLN B 2 28  ? -3.963  19.659  -9.077  1.00 10.00 ? 115 GLN A HA     1  
ATOM 323   H HB2    . GLN B 2 28  ? -3.398  21.748  -7.776  1.00 10.00 ? 115 GLN A HB2    1  
ATOM 324   H HB3    . GLN B 2 28  ? -4.115  20.984  -6.358  1.00 10.00 ? 115 GLN A HB3    1  
ATOM 325   H HG2    . GLN B 2 28  ? -2.377  18.999  -7.102  1.00 10.00 ? 115 GLN A HG2    1  
ATOM 326   H HG3    . GLN B 2 28  ? -1.555  20.380  -7.812  1.00 10.00 ? 115 GLN A HG3    1  
ATOM 327   H HE21   . GLN B 2 28  ? -2.455  18.735  -4.830  1.00 10.00 ? 115 GLN A HE21   1  
ATOM 328   H HE22   . GLN B 2 28  ? -1.548  19.823  -3.765  1.00 10.00 ? 115 GLN A HE22   1  
ATOM 329   N N      . PRO B 2 29  ? -4.629  17.474  -7.848  1.00 10.00 ? 116 PRO A N      1  
ATOM 330   C CA     . PRO B 2 29  ? -4.779  16.242  -7.063  1.00 10.00 ? 116 PRO A CA     1  
ATOM 331   C C      . PRO B 2 29  ? -4.217  16.303  -5.627  1.00 10.00 ? 116 PRO A C      1  
ATOM 332   O O      . PRO B 2 29  ? -3.406  17.169  -5.288  1.00 10.00 ? 116 PRO A O      1  
ATOM 333   C CB     . PRO B 2 29  ? -4.067  15.157  -7.879  1.00 10.00 ? 116 PRO A CB     1  
ATOM 334   C CG     . PRO B 2 29  ? -4.222  15.651  -9.313  1.00 10.00 ? 116 PRO A CG     1  
ATOM 335   C CD     . PRO B 2 29  ? -4.043  17.157  -9.144  1.00 10.00 ? 116 PRO A CD     1  
ATOM 336   H HA     . PRO B 2 29  ? -5.839  15.996  -7.015  1.00 10.00 ? 116 PRO A HA     1  
ATOM 337   H HB2    . PRO B 2 29  ? -3.009  15.130  -7.617  1.00 10.00 ? 116 PRO A HB2    1  
ATOM 338   H HB3    . PRO B 2 29  ? -4.518  14.179  -7.741  1.00 10.00 ? 116 PRO A HB3    1  
ATOM 339   H HG2    . PRO B 2 29  ? -3.479  15.222  -9.982  1.00 10.00 ? 116 PRO A HG2    1  
ATOM 340   H HG3    . PRO B 2 29  ? -5.230  15.435  -9.673  1.00 10.00 ? 116 PRO A HG3    1  
ATOM 341   H HD2    . PRO B 2 29  ? -2.981  17.403  -9.131  1.00 10.00 ? 116 PRO A HD2    1  
ATOM 342   H HD3    . PRO B 2 29  ? -4.548  17.682  -9.956  1.00 10.00 ? 116 PRO A HD3    1  
ATOM 343   N N      . LYS B 2 30  ? -4.631  15.336  -4.802  1.00 10.00 ? 117 LYS A N      1  
ATOM 344   C CA     . LYS B 2 30  ? -4.306  15.059  -3.401  1.00 10.00 ? 117 LYS A CA     1  
ATOM 345   C C      . LYS B 2 30  ? -4.968  13.731  -3.048  1.00 10.00 ? 117 LYS A C      1  
ATOM 346   O O      . LYS B 2 30  ? -5.527  13.076  -3.934  1.00 10.00 ? 117 LYS A O      1  
ATOM 347   C CB     . LYS B 2 30  ? -4.658  16.228  -2.470  1.00 10.00 ? 117 LYS A CB     1  
ATOM 348   C CG     . LYS B 2 30  ? -6.126  16.705  -2.427  1.00 10.00 ? 117 LYS A CG     1  
ATOM 349   C CD     . LYS B 2 30  ? -7.034  15.891  -1.478  1.00 10.00 ? 117 LYS A CD     1  
ATOM 350   C CE     . LYS B 2 30  ? -7.944  14.892  -2.206  1.00 10.00 ? 117 LYS A CE     1  
ATOM 351   N NZ     . LYS B 2 30  ? -8.566  13.927  -1.261  1.00 10.00 ? 117 LYS A NZ     1  
ATOM 352   H H      . LYS B 2 30  ? -5.155  14.547  -5.161  1.00 10.00 ? 117 LYS A H      1  
ATOM 353   H HA     . LYS B 2 30  ? -3.231  14.913  -3.329  1.00 10.00 ? 117 LYS A HA     1  
ATOM 354   H HB2    . LYS B 2 30  ? -4.335  15.988  -1.459  1.00 10.00 ? 117 LYS A HB2    1  
ATOM 355   H HB3    . LYS B 2 30  ? -4.021  17.046  -2.791  1.00 10.00 ? 117 LYS A HB3    1  
ATOM 356   H HG2    . LYS B 2 30  ? -6.112  17.733  -2.059  1.00 10.00 ? 117 LYS A HG2    1  
ATOM 357   H HG3    . LYS B 2 30  ? -6.544  16.733  -3.433  1.00 10.00 ? 117 LYS A HG3    1  
ATOM 358   H HD2    . LYS B 2 30  ? -6.427  15.375  -0.733  1.00 10.00 ? 117 LYS A HD2    1  
ATOM 359   H HD3    . LYS B 2 30  ? -7.677  16.590  -0.942  1.00 10.00 ? 117 LYS A HD3    1  
ATOM 360   H HE2    . LYS B 2 30  ? -8.720  15.457  -2.731  1.00 10.00 ? 117 LYS A HE2    1  
ATOM 361   H HE3    . LYS B 2 30  ? -7.370  14.353  -2.964  1.00 10.00 ? 117 LYS A HE3    1  
ATOM 362   H HZ1    . LYS B 2 30  ? -7.884  13.267  -0.897  1.00 10.00 ? 117 LYS A HZ1    1  
ATOM 363   H HZ2    . LYS B 2 30  ? -9.018  14.397  -0.490  1.00 10.00 ? 117 LYS A HZ2    1  
ATOM 364   H HZ3    . LYS B 2 30  ? -9.284  13.365  -1.725  1.00 10.00 ? 117 LYS A HZ3    1  
ATOM 365   N N      . ARG B 2 31  ? -4.827  13.251  -1.819  1.00 10.00 ? 118 ARG A N      1  
ATOM 366   C CA     . ARG B 2 31  ? -4.703  11.798  -1.641  1.00 10.00 ? 118 ARG A CA     1  
ATOM 367   C C      . ARG B 2 31  ? -5.925  11.055  -1.105  1.00 10.00 ? 118 ARG A C      1  
ATOM 368   O O      . ARG B 2 31  ? -6.918  11.662  -0.703  1.00 10.00 ? 118 ARG A O      1  
ATOM 369   C CB     . ARG B 2 31  ? -3.317  11.516  -1.052  1.00 10.00 ? 118 ARG A CB     1  
ATOM 370   C CG     . ARG B 2 31  ? -3.095  11.999  0.386   1.00 10.00 ? 118 ARG A CG     1  
ATOM 371   C CD     . ARG B 2 31  ? -1.669  11.674  0.847   1.00 10.00 ? 118 ARG A CD     1  
ATOM 372   N NE     . ARG B 2 31  ? -1.405  12.276  2.163   1.00 10.00 ? 118 ARG A NE     1  
ATOM 373   C CZ     . ARG B 2 31  ? -0.253  12.403  2.790   1.00 10.00 ? 118 ARG A CZ     1  
ATOM 374   N NH1    . ARG B 2 31  ? 0.850   11.864  2.360   1.00 10.00 ? 118 ARG A NH1    1  
ATOM 375   N NH2    . ARG B 2 31  ? -0.188  13.096  3.893   1.00 10.00 ? 118 ARG A NH2    1  
ATOM 376   H H      . ARG B 2 31  ? -4.417  13.861  -1.124  1.00 10.00 ? 118 ARG A H      1  
ATOM 377   H HA     . ARG B 2 31  ? -4.650  11.366  -2.639  1.00 10.00 ? 118 ARG A HA     1  
ATOM 378   H HB2    . ARG B 2 31  ? -3.093  10.450  -1.102  1.00 10.00 ? 118 ARG A HB2    1  
ATOM 379   H HB3    . ARG B 2 31  ? -2.644  12.059  -1.728  1.00 10.00 ? 118 ARG A HB3    1  
ATOM 380   H HG2    . ARG B 2 31  ? -3.250  13.076  0.436   1.00 10.00 ? 118 ARG A HG2    1  
ATOM 381   H HG3    . ARG B 2 31  ? -3.807  11.513  1.052   1.00 10.00 ? 118 ARG A HG3    1  
ATOM 382   H HD2    . ARG B 2 31  ? -1.544  10.591  0.904   1.00 10.00 ? 118 ARG A HD2    1  
ATOM 383   H HD3    . ARG B 2 31  ? -0.957  12.072  0.119   1.00 10.00 ? 118 ARG A HD3    1  
ATOM 384   H HE     . ARG B 2 31  ? -2.221  12.521  2.711   1.00 10.00 ? 118 ARG A HE     1  
ATOM 385   H HH11   . ARG B 2 31  ? 0.748   11.063  1.734   1.00 10.00 ? 118 ARG A HH11   1  
ATOM 386   H HH12   . ARG B 2 31  ? 1.688   11.913  2.906   1.00 10.00 ? 118 ARG A HH12   1  
ATOM 387   H HH21   . ARG B 2 31  ? -1.019  13.528  4.259   1.00 10.00 ? 118 ARG A HH21   1  
ATOM 388   H HH22   . ARG B 2 31  ? 0.688   13.203  4.375   1.00 10.00 ? 118 ARG A HH22   1  
ATOM 389   N N      . LEU B 2 32  ? -5.864  9.741   -1.289  1.00 10.00 ? 119 LEU A N      1  
ATOM 390   C CA     . LEU B 2 32  ? -6.955  8.820   -1.605  1.00 10.00 ? 119 LEU A CA     1  
ATOM 391   C C      . LEU B 2 32  ? -6.651  7.476   -0.920  1.00 10.00 ? 119 LEU A C      1  
ATOM 392   O O      . LEU B 2 32  ? -5.592  6.904   -1.175  1.00 10.00 ? 119 LEU A O      1  
ATOM 393   C CB     . LEU B 2 32  ? -6.971  8.707   -3.155  1.00 10.00 ? 119 LEU A CB     1  
ATOM 394   C CG     . LEU B 2 32  ? -7.929  7.680   -3.775  1.00 10.00 ? 119 LEU A CG     1  
ATOM 395   C CD1    . LEU B 2 32  ? -9.388  7.968   -3.448  1.00 10.00 ? 119 LEU A CD1    1  
ATOM 396   C CD2    . LEU B 2 32  ? -7.844  7.712   -5.293  1.00 10.00 ? 119 LEU A CD2    1  
ATOM 397   H H      . LEU B 2 32  ? -4.969  9.423   -1.640  1.00 10.00 ? 119 LEU A H      1  
ATOM 398   H HA     . LEU B 2 32  ? -7.906  9.217   -1.245  1.00 10.00 ? 119 LEU A HA     1  
ATOM 399   H HB2    . LEU B 2 32  ? -7.159  9.697   -3.580  1.00 10.00 ? 119 LEU A HB2    1  
ATOM 400   H HB3    . LEU B 2 32  ? -5.986  8.402   -3.491  1.00 10.00 ? 119 LEU A HB3    1  
ATOM 401   H HG     . LEU B 2 32  ? -7.623  6.685   -3.456  1.00 10.00 ? 119 LEU A HG     1  
ATOM 402   H HD11   . LEU B 2 32  ? -9.528  8.020   -2.377  1.00 10.00 ? 119 LEU A HD11   1  
ATOM 403   H HD12   . LEU B 2 32  ? -9.693  8.921   -3.893  1.00 10.00 ? 119 LEU A HD12   1  
ATOM 404   H HD13   . LEU B 2 32  ? -10.008 7.164   -3.844  1.00 10.00 ? 119 LEU A HD13   1  
ATOM 405   H HD21   . LEU B 2 32  ? -8.115  8.702   -5.653  1.00 10.00 ? 119 LEU A HD21   1  
ATOM 406   H HD22   . LEU B 2 32  ? -6.835  7.462   -5.616  1.00 10.00 ? 119 LEU A HD22   1  
ATOM 407   H HD23   . LEU B 2 32  ? -8.533  6.984   -5.713  1.00 10.00 ? 119 LEU A HD23   1  
ATOM 408   N N      . HIS B 2 33  ? -7.522  6.998   -0.028  1.00 10.00 ? 120 HIS A N      1  
ATOM 409   C CA     . HIS B 2 33  ? -7.358  5.760   0.758   1.00 10.00 ? 120 HIS A CA     1  
ATOM 410   C C      . HIS B 2 33  ? -7.849  4.548   -0.051  1.00 10.00 ? 120 HIS A C      1  
ATOM 411   O O      . HIS B 2 33  ? -8.903  4.599   -0.681  1.00 10.00 ? 120 HIS A O      1  
ATOM 412   C CB     . HIS B 2 33  ? -8.175  5.929   2.057   1.00 10.00 ? 120 HIS A CB     1  
ATOM 413   C CG     . HIS B 2 33  ? -8.375  4.685   2.887   1.00 10.00 ? 120 HIS A CG     1  
ATOM 414   N ND1    . HIS B 2 33  ? -9.578  3.994   3.056   1.00 10.00 ? 120 HIS A ND1    1  
ATOM 415   C CD2    . HIS B 2 33  ? -7.444  4.157   3.726   1.00 10.00 ? 120 HIS A CD2    1  
ATOM 416   C CE1    . HIS B 2 33  ? -9.336  3.062   3.995   1.00 10.00 ? 120 HIS A CE1    1  
ATOM 417   N NE2    . HIS B 2 33  ? -8.055  3.127   4.402   1.00 10.00 ? 120 HIS A NE2    1  
ATOM 418   H H      . HIS B 2 33  ? -8.439  7.428   0.007   1.00 10.00 ? 120 HIS A H      1  
ATOM 419   H HA     . HIS B 2 33  ? -6.291  5.602   0.995   1.00 10.00 ? 120 HIS A HA     1  
ATOM 420   H HB2    . HIS B 2 33  ? -7.681  6.659   2.704   1.00 10.00 ? 120 HIS A HB2    1  
ATOM 421   H HB3    . HIS B 2 33  ? -9.162  6.324   1.815   1.00 10.00 ? 120 HIS A HB3    1  
ATOM 422   H HD2    . HIS B 2 33  ? -6.437  4.521   3.853   1.00 10.00 ? 120 HIS A HD2    1  
ATOM 423   H HE1    . HIS B 2 33  ? -10.072 2.375   4.397   1.00 10.00 ? 120 HIS A HE1    1  
ATOM 424   H HE2    . HIS B 2 33  ? -7.630  2.536   5.109   1.00 10.00 ? 120 HIS A HE2    1  
ATOM 425   N N      . VAL B 2 34  ? -7.085  3.457   -0.061  1.00 10.00 ? 121 VAL A N      1  
ATOM 426   C CA     . VAL B 2 34  ? -7.193  2.348   -1.028  1.00 10.00 ? 121 VAL A CA     1  
ATOM 427   C C      . VAL B 2 34  ? -7.087  1.018   -0.284  1.00 10.00 ? 121 VAL A C      1  
ATOM 428   O O      . VAL B 2 34  ? -5.991  0.518   -0.041  1.00 10.00 ? 121 VAL A O      1  
ATOM 429   C CB     . VAL B 2 34  ? -6.099  2.511   -2.105  1.00 10.00 ? 121 VAL A CB     1  
ATOM 430   C CG1    . VAL B 2 34  ? -6.045  1.405   -3.157  1.00 10.00 ? 121 VAL A CG1    1  
ATOM 431   C CG2    . VAL B 2 34  ? -6.292  3.817   -2.879  1.00 10.00 ? 121 VAL A CG2    1  
ATOM 432   H H      . VAL B 2 34  ? -6.224  3.499   0.476   1.00 10.00 ? 121 VAL A H      1  
ATOM 433   H HA     . VAL B 2 34  ? -8.162  2.367   -1.519  1.00 10.00 ? 121 VAL A HA     1  
ATOM 434   H HB     . VAL B 2 34  ? -5.123  2.544   -1.622  1.00 10.00 ? 121 VAL A HB     1  
ATOM 435   H HG11   . VAL B 2 34  ? -5.921  0.437   -2.685  1.00 10.00 ? 121 VAL A HG11   1  
ATOM 436   H HG12   . VAL B 2 34  ? -6.945  1.405   -3.768  1.00 10.00 ? 121 VAL A HG12   1  
ATOM 437   H HG13   . VAL B 2 34  ? -5.177  1.605   -3.786  1.00 10.00 ? 121 VAL A HG13   1  
ATOM 438   H HG21   . VAL B 2 34  ? -7.306  3.883   -3.266  1.00 10.00 ? 121 VAL A HG21   1  
ATOM 439   H HG22   . VAL B 2 34  ? -6.099  4.663   -2.229  1.00 10.00 ? 121 VAL A HG22   1  
ATOM 440   H HG23   . VAL B 2 34  ? -5.582  3.858   -3.701  1.00 10.00 ? 121 VAL A HG23   1  
ATOM 441   N N      . SER B 2 35  ? -8.229  0.478   0.144   1.00 10.00 ? 122 SER A N      1  
ATOM 442   C CA     . SER B 2 35  ? -8.330  -0.591  1.147   1.00 10.00 ? 122 SER A CA     1  
ATOM 443   C C      . SER B 2 35  ? -8.640  -1.982  0.594   1.00 10.00 ? 122 SER A C      1  
ATOM 444   O O      . SER B 2 35  ? -9.018  -2.136  -0.569  1.00 10.00 ? 122 SER A O      1  
ATOM 445   C CB     . SER B 2 35  ? -9.395  -0.226  2.189   1.00 10.00 ? 122 SER A CB     1  
ATOM 446   O OG     . SER B 2 35  ? -8.922  -0.590  3.472   1.00 10.00 ? 122 SER A OG     1  
ATOM 447   H H      . SER B 2 35  ? -9.090  0.946   -0.121  1.00 10.00 ? 122 SER A H      1  
ATOM 448   H HA     . SER B 2 35  ? -7.376  -0.666  1.656   1.00 10.00 ? 122 SER A HA     1  
ATOM 449   H HB2    . SER B 2 35  ? -9.617  0.839   2.155   1.00 10.00 ? 122 SER A HB2    1  
ATOM 450   H HB3    . SER B 2 35  ? -10.318 -0.765  1.983   1.00 10.00 ? 122 SER A HB3    1  
ATOM 451   H HG     . SER B 2 35  ? -9.631  -0.440  4.125   1.00 10.00 ? 122 SER A HG     1  
ATOM 452   N N      . ASN B 2 36  ? -8.528  -2.992  1.466   1.00 10.00 ? 123 ASN A N      1  
ATOM 453   C CA     . ASN B 2 36  ? -8.856  -4.408  1.235   1.00 10.00 ? 123 ASN A CA     1  
ATOM 454   C C      . ASN B 2 36  ? -8.052  -5.044  0.087   1.00 10.00 ? 123 ASN A C      1  
ATOM 455   O O      . ASN B 2 36  ? -8.423  -6.092  -0.435  1.00 10.00 ? 123 ASN A O      1  
ATOM 456   C CB     . ASN B 2 36  ? -10.386 -4.540  1.096   1.00 10.00 ? 123 ASN A CB     1  
ATOM 457   C CG     . ASN B 2 36  ? -10.874 -5.977  1.206   1.00 10.00 ? 123 ASN A CG     1  
ATOM 458   O OD1    . ASN B 2 36  ? -10.708 -6.639  2.221   1.00 10.00 ? 123 ASN A OD1    1  
ATOM 459   N ND2    . ASN B 2 36  ? -11.518 -6.497  0.186   1.00 10.00 ? 123 ASN A ND2    1  
ATOM 460   H H      . ASN B 2 36  ? -8.090  -2.744  2.343   1.00 10.00 ? 123 ASN A H      1  
ATOM 461   H HA     . ASN B 2 36  ? -8.558  -4.969  2.124   1.00 10.00 ? 123 ASN A HA     1  
ATOM 462   H HB2    . ASN B 2 36  ? -10.868 -3.969  1.890   1.00 10.00 ? 123 ASN A HB2    1  
ATOM 463   H HB3    . ASN B 2 36  ? -10.695 -4.121  0.138   1.00 10.00 ? 123 ASN A HB3    1  
ATOM 464   H HD21   . ASN B 2 36  ? -11.589 -5.966  -0.678  1.00 10.00 ? 123 ASN A HD21   1  
ATOM 465   H HD22   . ASN B 2 36  ? -11.856 -7.440  0.275   1.00 10.00 ? 123 ASN A HD22   1  
ATOM 466   N N      . ILE B 2 37  ? -6.938  -4.424  -0.303  1.00 10.00 ? 124 ILE A N      1  
ATOM 467   C CA     . ILE B 2 37  ? -6.096  -4.841  -1.427  1.00 10.00 ? 124 ILE A CA     1  
ATOM 468   C C      . ILE B 2 37  ? -5.434  -6.199  -1.131  1.00 10.00 ? 124 ILE A C      1  
ATOM 469   O O      . ILE B 2 37  ? -5.163  -6.486  0.041   1.00 10.00 ? 124 ILE A O      1  
ATOM 470   C CB     . ILE B 2 37  ? -5.042  -3.751  -1.735  1.00 10.00 ? 124 ILE A CB     1  
ATOM 471   C CG1    . ILE B 2 37  ? -3.845  -3.792  -0.756  1.00 10.00 ? 124 ILE A CG1    1  
ATOM 472   C CG2    . ILE B 2 37  ? -5.703  -2.358  -1.735  1.00 10.00 ? 124 ILE A CG2    1  
ATOM 473   C CD1    . ILE B 2 37  ? -2.953  -2.556  -0.818  1.00 10.00 ? 124 ILE A CD1    1  
ATOM 474   H H      . ILE B 2 37  ? -6.671  -3.599  0.219   1.00 10.00 ? 124 ILE A H      1  
ATOM 475   H HA     . ILE B 2 37  ? -6.742  -4.939  -2.297  1.00 10.00 ? 124 ILE A HA     1  
ATOM 476   H HB     . ILE B 2 37  ? -4.659  -3.935  -2.740  1.00 10.00 ? 124 ILE A HB     1  
ATOM 477   H HG12   . ILE B 2 37  ? -4.208  -3.899  0.266   1.00 10.00 ? 124 ILE A HG12   1  
ATOM 478   H HG13   . ILE B 2 37  ? -3.229  -4.661  -0.991  1.00 10.00 ? 124 ILE A HG13   1  
ATOM 479   H HG21   . ILE B 2 37  ? -6.661  -2.388  -2.252  1.00 10.00 ? 124 ILE A HG21   1  
ATOM 480   H HG22   . ILE B 2 37  ? -5.846  -2.016  -0.704  1.00 10.00 ? 124 ILE A HG22   1  
ATOM 481   H HG23   . ILE B 2 37  ? -5.060  -1.645  -2.249  1.00 10.00 ? 124 ILE A HG23   1  
ATOM 482   H HD11   . ILE B 2 37  ? -2.678  -2.357  -1.853  1.00 10.00 ? 124 ILE A HD11   1  
ATOM 483   H HD12   . ILE B 2 37  ? -3.491  -1.702  -0.410  1.00 10.00 ? 124 ILE A HD12   1  
ATOM 484   H HD13   . ILE B 2 37  ? -2.072  -2.735  -0.206  1.00 10.00 ? 124 ILE A HD13   1  
ATOM 485   N N      . PRO B 2 38  ? -5.131  -7.034  -2.141  1.00 10.00 ? 125 PRO A N      1  
ATOM 486   C CA     . PRO B 2 38  ? -4.333  -8.249  -1.960  1.00 10.00 ? 125 PRO A CA     1  
ATOM 487   C C      . PRO B 2 38  ? -2.980  -7.952  -1.306  1.00 10.00 ? 125 PRO A C      1  
ATOM 488   O O      . PRO B 2 38  ? -2.244  -7.094  -1.784  1.00 10.00 ? 125 PRO A O      1  
ATOM 489   C CB     . PRO B 2 38  ? -4.134  -8.833  -3.368  1.00 10.00 ? 125 PRO A CB     1  
ATOM 490   C CG     . PRO B 2 38  ? -5.301  -8.252  -4.151  1.00 10.00 ? 125 PRO A CG     1  
ATOM 491   C CD     . PRO B 2 38  ? -5.518  -6.877  -3.532  1.00 10.00 ? 125 PRO A CD     1  
ATOM 492   H HA     . PRO B 2 38  ? -4.897  -8.956  -1.352  1.00 10.00 ? 125 PRO A HA     1  
ATOM 493   H HB2    . PRO B 2 38  ? -3.202  -8.481  -3.810  1.00 10.00 ? 125 PRO A HB2    1  
ATOM 494   H HB3    . PRO B 2 38  ? -4.163  -9.923  -3.361  1.00 10.00 ? 125 PRO A HB3    1  
ATOM 495   H HG2    . PRO B 2 38  ? -5.080  -8.177  -5.211  1.00 10.00 ? 125 PRO A HG2    1  
ATOM 496   H HG3    . PRO B 2 38  ? -6.173  -8.877  -3.983  1.00 10.00 ? 125 PRO A HG3    1  
ATOM 497   H HD2    . PRO B 2 38  ? -4.869  -6.144  -4.015  1.00 10.00 ? 125 PRO A HD2    1  
ATOM 498   H HD3    . PRO B 2 38  ? -6.566  -6.593  -3.637  1.00 10.00 ? 125 PRO A HD3    1  
ATOM 499   N N      . PHE B 2 39  ? -2.606  -8.686  -0.257  1.00 10.00 ? 126 PHE A N      1  
ATOM 500   C CA     . PHE B 2 39  ? -1.323  -8.534  0.454   1.00 10.00 ? 126 PHE A CA     1  
ATOM 501   C C      . PHE B 2 39  ? -0.028  -8.684  -0.383  1.00 10.00 ? 126 PHE A C      1  
ATOM 502   O O      . PHE B 2 39  ? 1.069   -8.460  0.139   1.00 10.00 ? 126 PHE A O      1  
ATOM 503   C CB     . PHE B 2 39  ? -1.285  -9.545  1.603   1.00 10.00 ? 126 PHE A CB     1  
ATOM 504   C CG     . PHE B 2 39  ? -2.103  -9.202  2.829   1.00 10.00 ? 126 PHE A CG     1  
ATOM 505   C CD1    . PHE B 2 39  ? -2.066  -7.904  3.389   1.00 10.00 ? 126 PHE A CD1    1  
ATOM 506   C CD2    . PHE B 2 39  ? -2.830  -10.225 3.469   1.00 10.00 ? 126 PHE A CD2    1  
ATOM 507   C CE1    . PHE B 2 39  ? -2.836  -7.641  4.536   1.00 10.00 ? 126 PHE A CE1    1  
ATOM 508   C CE2    . PHE B 2 39  ? -3.558  -9.959  4.639   1.00 10.00 ? 126 PHE A CE2    1  
ATOM 509   C CZ     . PHE B 2 39  ? -3.587  -8.655  5.153   1.00 10.00 ? 126 PHE A CZ     1  
ATOM 510   H H      . PHE B 2 39  ? -3.312  -9.291  0.144   1.00 10.00 ? 126 PHE A H      1  
ATOM 511   H HA     . PHE B 2 39  ? -1.282  -7.524  0.856   1.00 10.00 ? 126 PHE A HA     1  
ATOM 512   H HB2    . PHE B 2 39  ? -1.586  -10.520 1.219   1.00 10.00 ? 126 PHE A HB2    1  
ATOM 513   H HB3    . PHE B 2 39  ? -0.262  -9.652  1.941   1.00 10.00 ? 126 PHE A HB3    1  
ATOM 514   H HD1    . PHE B 2 39  ? -1.451  -7.111  2.963   1.00 10.00 ? 126 PHE A HD1    1  
ATOM 515   H HD2    . PHE B 2 39  ? -2.827  -11.228 3.068   1.00 10.00 ? 126 PHE A HD2    1  
ATOM 516   H HE1    . PHE B 2 39  ? -2.846  -6.663  4.978   1.00 10.00 ? 126 PHE A HE1    1  
ATOM 517   H HE2    . PHE B 2 39  ? -4.096  -10.750 5.144   1.00 10.00 ? 126 PHE A HE2    1  
ATOM 518   H HZ     . PHE B 2 39  ? -4.177  -8.430  6.031   1.00 10.00 ? 126 PHE A HZ     1  
ATOM 519   N N      . ARG B 2 40  ? -0.129  -9.074  -1.661  1.00 10.00 ? 127 ARG A N      1  
ATOM 520   C CA     . ARG B 2 40  ? 0.985   -9.120  -2.625  1.00 10.00 ? 127 ARG A CA     1  
ATOM 521   C C      . ARG B 2 40  ? 1.196   -7.786  -3.366  1.00 10.00 ? 127 ARG A C      1  
ATOM 522   O O      . ARG B 2 40  ? 2.191   -7.647  -4.078  1.00 10.00 ? 127 ARG A O      1  
ATOM 523   C CB     . ARG B 2 40  ? 0.769   -10.294 -3.605  1.00 10.00 ? 127 ARG A CB     1  
ATOM 524   C CG     . ARG B 2 40  ? 1.185   -11.664 -3.029  1.00 10.00 ? 127 ARG A CG     1  
ATOM 525   C CD     . ARG B 2 40  ? 0.333   -12.153 -1.847  1.00 10.00 ? 127 ARG A CD     1  
ATOM 526   N NE     . ARG B 2 40  ? 0.758   -13.487 -1.380  1.00 10.00 ? 127 ARG A NE     1  
ATOM 527   C CZ     . ARG B 2 40  ? 0.377   -14.671 -1.830  1.00 10.00 ? 127 ARG A CZ     1  
ATOM 528   N NH1    . ARG B 2 40  ? -0.462  -14.803 -2.820  1.00 10.00 ? 127 ARG A NH1    1  
ATOM 529   N NH2    . ARG B 2 40  ? 0.843   -15.759 -1.289  1.00 10.00 ? 127 ARG A NH2    1  
ATOM 530   H H      . ARG B 2 40  ? -1.067  -9.251  -1.992  1.00 10.00 ? 127 ARG A H      1  
ATOM 531   H HA     . ARG B 2 40  ? 1.926   -9.289  -2.094  1.00 10.00 ? 127 ARG A HA     1  
ATOM 532   H HB2    . ARG B 2 40  ? -0.274  -10.324 -3.930  1.00 10.00 ? 127 ARG A HB2    1  
ATOM 533   H HB3    . ARG B 2 40  ? 1.386   -10.132 -4.491  1.00 10.00 ? 127 ARG A HB3    1  
ATOM 534   H HG2    . ARG B 2 40  ? 1.124   -12.402 -3.829  1.00 10.00 ? 127 ARG A HG2    1  
ATOM 535   H HG3    . ARG B 2 40  ? 2.226   -11.606 -2.712  1.00 10.00 ? 127 ARG A HG3    1  
ATOM 536   H HD2    . ARG B 2 40  ? 0.459   -11.457 -1.017  1.00 10.00 ? 127 ARG A HD2    1  
ATOM 537   H HD3    . ARG B 2 40  ? -0.722  -12.162 -2.130  1.00 10.00 ? 127 ARG A HD3    1  
ATOM 538   H HE     . ARG B 2 40  ? 1.402   -13.505 -0.603  1.00 10.00 ? 127 ARG A HE     1  
ATOM 539   H HH11   . ARG B 2 40  ? -0.828  -13.977 -3.264  1.00 10.00 ? 127 ARG A HH11   1  
ATOM 540   H HH12   . ARG B 2 40  ? -0.735  -15.715 -3.150  1.00 10.00 ? 127 ARG A HH12   1  
ATOM 541   H HH21   . ARG B 2 40  ? 1.500   -15.706 -0.529  1.00 10.00 ? 127 ARG A HH21   1  
ATOM 542   H HH22   . ARG B 2 40  ? 0.560   -16.661 -1.630  1.00 10.00 ? 127 ARG A HH22   1  
ATOM 543   N N      . PHE B 2 41  ? 0.298   -6.808  -3.206  1.00 10.00 ? 128 PHE A N      1  
ATOM 544   C CA     . PHE B 2 41  ? 0.416   -5.463  -3.784  1.00 10.00 ? 128 PHE A CA     1  
ATOM 545   C C      . PHE B 2 41  ? 1.666   -4.687  -3.333  1.00 10.00 ? 128 PHE A C      1  
ATOM 546   O O      . PHE B 2 41  ? 2.244   -4.924  -2.268  1.00 10.00 ? 128 PHE A O      1  
ATOM 547   C CB     . PHE B 2 41  ? -0.846  -4.643  -3.459  1.00 10.00 ? 128 PHE A CB     1  
ATOM 548   C CG     . PHE B 2 41  ? -1.940  -4.696  -4.511  1.00 10.00 ? 128 PHE A CG     1  
ATOM 549   C CD1    . PHE B 2 41  ? -2.203  -5.864  -5.255  1.00 10.00 ? 128 PHE A CD1    1  
ATOM 550   C CD2    . PHE B 2 41  ? -2.666  -3.522  -4.786  1.00 10.00 ? 128 PHE A CD2    1  
ATOM 551   C CE1    . PHE B 2 41  ? -3.133  -5.832  -6.310  1.00 10.00 ? 128 PHE A CE1    1  
ATOM 552   C CE2    . PHE B 2 41  ? -3.605  -3.498  -5.827  1.00 10.00 ? 128 PHE A CE2    1  
ATOM 553   C CZ     . PHE B 2 41  ? -3.817  -4.644  -6.609  1.00 10.00 ? 128 PHE A CZ     1  
ATOM 554   H H      . PHE B 2 41  ? -0.519  -7.001  -2.634  1.00 10.00 ? 128 PHE A H      1  
ATOM 555   H HA     . PHE B 2 41  ? 0.487   -5.565  -4.870  1.00 10.00 ? 128 PHE A HA     1  
ATOM 556   H HB2    . PHE B 2 41  ? -1.249  -4.930  -2.490  1.00 10.00 ? 128 PHE A HB2    1  
ATOM 557   H HB3    . PHE B 2 41  ? -0.560  -3.595  -3.355  1.00 10.00 ? 128 PHE A HB3    1  
ATOM 558   H HD1    . PHE B 2 41  ? -1.673  -6.783  -5.053  1.00 10.00 ? 128 PHE A HD1    1  
ATOM 559   H HD2    . PHE B 2 41  ? -2.491  -2.625  -4.210  1.00 10.00 ? 128 PHE A HD2    1  
ATOM 560   H HE1    . PHE B 2 41  ? -3.312  -6.722  -6.899  1.00 10.00 ? 128 PHE A HE1    1  
ATOM 561   H HE2    . PHE B 2 41  ? -4.148  -2.588  -6.034  1.00 10.00 ? 128 PHE A HE2    1  
ATOM 562   H HZ     . PHE B 2 41  ? -4.507  -4.604  -7.441  1.00 10.00 ? 128 PHE A HZ     1  
ATOM 563   N N      . ARG B 2 42  ? 2.020   -3.684  -4.145  1.00 10.00 ? 129 ARG A N      1  
ATOM 564   C CA     . ARG B 2 42  ? 3.061   -2.677  -3.904  1.00 10.00 ? 129 ARG A CA     1  
ATOM 565   C C      . ARG B 2 42  ? 2.610   -1.292  -4.366  1.00 10.00 ? 129 ARG A C      1  
ATOM 566   O O      . ARG B 2 42  ? 1.592   -1.108  -5.037  1.00 10.00 ? 129 ARG A O      1  
ATOM 567   C CB     . ARG B 2 42  ? 4.370   -3.057  -4.619  1.00 10.00 ? 129 ARG A CB     1  
ATOM 568   C CG     . ARG B 2 42  ? 4.924   -4.427  -4.201  1.00 10.00 ? 129 ARG A CG     1  
ATOM 569   C CD     . ARG B 2 42  ? 6.289   -4.660  -4.858  1.00 10.00 ? 129 ARG A CD     1  
ATOM 570   N NE     . ARG B 2 42  ? 6.782   -6.033  -4.627  1.00 10.00 ? 129 ARG A NE     1  
ATOM 571   C CZ     . ARG B 2 42  ? 7.435   -6.502  -3.577  1.00 10.00 ? 129 ARG A CZ     1  
ATOM 572   N NH1    . ARG B 2 42  ? 7.769   -5.748  -2.567  1.00 10.00 ? 129 ARG A NH1    1  
ATOM 573   N NH2    . ARG B 2 42  ? 7.767   -7.760  -3.522  1.00 10.00 ? 129 ARG A NH2    1  
ATOM 574   H H      . ARG B 2 42  ? 1.451   -3.556  -4.972  1.00 10.00 ? 129 ARG A H      1  
ATOM 575   H HA     . ARG B 2 42  ? 3.272   -2.616  -2.838  1.00 10.00 ? 129 ARG A HA     1  
ATOM 576   H HB2    . ARG B 2 42  ? 4.199   -3.066  -5.698  1.00 10.00 ? 129 ARG A HB2    1  
ATOM 577   H HB3    . ARG B 2 42  ? 5.115   -2.281  -4.400  1.00 10.00 ? 129 ARG A HB3    1  
ATOM 578   H HG2    . ARG B 2 42  ? 5.031   -4.477  -3.119  1.00 10.00 ? 129 ARG A HG2    1  
ATOM 579   H HG3    . ARG B 2 42  ? 4.243   -5.213  -4.526  1.00 10.00 ? 129 ARG A HG3    1  
ATOM 580   H HD2    . ARG B 2 42  ? 6.175   -4.497  -5.931  1.00 10.00 ? 129 ARG A HD2    1  
ATOM 581   H HD3    . ARG B 2 42  ? 7.003   -3.924  -4.481  1.00 10.00 ? 129 ARG A HD3    1  
ATOM 582   H HE     . ARG B 2 42  ? 6.589   -6.710  -5.348  1.00 10.00 ? 129 ARG A HE     1  
ATOM 583   H HH11   . ARG B 2 42  ? 7.542   -4.769  -2.590  1.00 10.00 ? 129 ARG A HH11   1  
ATOM 584   H HH12   . ARG B 2 42  ? 8.263   -6.131  -1.781  1.00 10.00 ? 129 ARG A HH12   1  
ATOM 585   H HH21   . ARG B 2 42  ? 7.532   -8.379  -4.280  1.00 10.00 ? 129 ARG A HH21   1  
ATOM 586   H HH22   . ARG B 2 42  ? 8.262   -8.119  -2.724  1.00 10.00 ? 129 ARG A HH22   1  
ATOM 587   N N      . ASP B 2 43  ? 3.459   -0.327  -4.052  1.00 10.00 ? 130 ASP A N      1  
ATOM 588   C CA     . ASP B 2 43  ? 3.442   1.029   -4.576  1.00 10.00 ? 130 ASP A CA     1  
ATOM 589   C C      . ASP B 2 43  ? 3.374   1.061   -6.130  1.00 10.00 ? 130 ASP A C      1  
ATOM 590   O O      . ASP B 2 43  ? 2.379   1.572   -6.655  1.00 10.00 ? 130 ASP A O      1  
ATOM 591   C CB     . ASP B 2 43  ? 4.671   1.761   -3.994  1.00 10.00 ? 130 ASP A CB     1  
ATOM 592   C CG     . ASP B 2 43  ? 4.412   2.595   -2.727  1.00 10.00 ? 130 ASP A CG     1  
ATOM 593   O OD1    . ASP B 2 43  ? 3.249   2.723   -2.291  1.00 10.00 ? 130 ASP A OD1    1  
ATOM 594   O OD2    . ASP B 2 43  ? 5.401   3.106   -2.152  1.00 10.00 ? 130 ASP A OD2    1  
ATOM 595   H H      . ASP B 2 43  ? 4.246   -0.591  -3.479  1.00 10.00 ? 130 ASP A H      1  
ATOM 596   H HA     . ASP B 2 43  ? 2.526   1.510   -4.222  1.00 10.00 ? 130 ASP A HA     1  
ATOM 597   H HB2    . ASP B 2 43  ? 5.439   1.026   -3.743  1.00 10.00 ? 130 ASP A HB2    1  
ATOM 598   H HB3    . ASP B 2 43  ? 5.095   2.385   -4.772  1.00 10.00 ? 130 ASP A HB3    1  
ATOM 599   N N      . PRO B 2 44  ? 4.349   0.504   -6.896  1.00 10.00 ? 131 PRO A N      1  
ATOM 600   C CA     . PRO B 2 44  ? 4.273   0.458   -8.360  1.00 10.00 ? 131 PRO A CA     1  
ATOM 601   C C      . PRO B 2 44  ? 3.014   -0.224  -8.910  1.00 10.00 ? 131 PRO A C      1  
ATOM 602   O O      . PRO B 2 44  ? 2.464   0.218   -9.919  1.00 10.00 ? 131 PRO A O      1  
ATOM 603   C CB     . PRO B 2 44  ? 5.535   -0.271  -8.841  1.00 10.00 ? 131 PRO A CB     1  
ATOM 604   C CG     . PRO B 2 44  ? 6.523   -0.039  -7.704  1.00 10.00 ? 131 PRO A CG     1  
ATOM 605   C CD     . PRO B 2 44  ? 5.620   -0.078  -6.478  1.00 10.00 ? 131 PRO A CD     1  
ATOM 606   H HA     . PRO B 2 44  ? 4.306   1.483   -8.720  1.00 10.00 ? 131 PRO A HA     1  
ATOM 607   H HB2    . PRO B 2 44  ? 5.344   -1.340  -8.943  1.00 10.00 ? 131 PRO A HB2    1  
ATOM 608   H HB3    . PRO B 2 44  ? 5.903   0.140   -9.782  1.00 10.00 ? 131 PRO A HB3    1  
ATOM 609   H HG2    . PRO B 2 44  ? 7.293   -0.809  -7.666  1.00 10.00 ? 131 PRO A HG2    1  
ATOM 610   H HG3    . PRO B 2 44  ? 6.968   0.955   -7.798  1.00 10.00 ? 131 PRO A HG3    1  
ATOM 611   H HD2    . PRO B 2 44  ? 5.466   -1.116  -6.191  1.00 10.00 ? 131 PRO A HD2    1  
ATOM 612   H HD3    . PRO B 2 44  ? 6.096   0.467   -5.670  1.00 10.00 ? 131 PRO A HD3    1  
ATOM 613   N N      . ASP B 2 45  ? 2.521   -1.275  -8.247  1.00 10.00 ? 132 ASP A N      1  
ATOM 614   C CA     . ASP B 2 45  ? 1.275   -1.937  -8.607  1.00 10.00 ? 132 ASP A CA     1  
ATOM 615   C C      . ASP B 2 45  ? 0.083   -0.976  -8.526  1.00 10.00 ? 132 ASP A C      1  
ATOM 616   O O      . ASP B 2 45  ? -0.633  -0.851  -9.522  1.00 10.00 ? 132 ASP A O      1  
ATOM 617   C CB     . ASP B 2 45  ? 1.075   -3.187  -7.746  1.00 10.00 ? 132 ASP A CB     1  
ATOM 618   C CG     . ASP B 2 45  ? 1.943   -4.354  -8.237  1.00 10.00 ? 132 ASP A CG     1  
ATOM 619   O OD1    . ASP B 2 45  ? 1.519   -5.059  -9.184  1.00 10.00 ? 132 ASP A OD1    1  
ATOM 620   O OD2    . ASP B 2 45  ? 3.044   -4.566  -7.681  1.00 10.00 ? 132 ASP A OD2    1  
ATOM 621   H H      . ASP B 2 45  ? 2.977   -1.612  -7.416  1.00 10.00 ? 132 ASP A H      1  
ATOM 622   H HA     . ASP B 2 45  ? 1.338   -2.258  -9.646  1.00 10.00 ? 132 ASP A HA     1  
ATOM 623   H HB2    . ASP B 2 45  ? 1.300   -2.969  -6.704  1.00 10.00 ? 132 ASP A HB2    1  
ATOM 624   H HB3    . ASP B 2 45  ? 0.030   -3.473  -7.791  1.00 10.00 ? 132 ASP A HB3    1  
ATOM 625   N N      . LEU B 2 46  ? -0.119  -0.228  -7.424  1.00 10.00 ? 133 LEU A N      1  
ATOM 626   C CA     . LEU B 2 46  ? -1.178  0.772   -7.400  1.00 10.00 ? 133 LEU A CA     1  
ATOM 627   C C      . LEU B 2 46  ? -0.970  1.894   -8.416  1.00 10.00 ? 133 LEU A C      1  
ATOM 628   O O      . LEU B 2 46  ? -1.935  2.246   -9.089  1.00 10.00 ? 133 LEU A O      1  
ATOM 629   C CB     . LEU B 2 46  ? -1.398  1.335   -5.989  1.00 10.00 ? 133 LEU A CB     1  
ATOM 630   C CG     . LEU B 2 46  ? -2.139  0.368   -5.052  1.00 10.00 ? 133 LEU A CG     1  
ATOM 631   C CD1    . LEU B 2 46  ? -2.227  0.948   -3.644  1.00 10.00 ? 133 LEU A CD1    1  
ATOM 632   C CD2    . LEU B 2 46  ? -3.562  0.108   -5.540  1.00 10.00 ? 133 LEU A CD2    1  
ATOM 633   H H      . LEU B 2 46  ? 0.475   -0.266  -6.606  1.00 10.00 ? 133 LEU A H      1  
ATOM 634   H HA     . LEU B 2 46  ? -2.088  0.276   -7.729  1.00 10.00 ? 133 LEU A HA     1  
ATOM 635   H HB2    . LEU B 2 46  ? -0.464  1.675   -5.542  1.00 10.00 ? 133 LEU A HB2    1  
ATOM 636   H HB3    . LEU B 2 46  ? -1.994  2.223   -6.097  1.00 10.00 ? 133 LEU A HB3    1  
ATOM 637   H HG     . LEU B 2 46  ? -1.617  -0.580  -5.023  1.00 10.00 ? 133 LEU A HG     1  
ATOM 638   H HD11   . LEU B 2 46  ? -1.224  1.126   -3.262  1.00 10.00 ? 133 LEU A HD11   1  
ATOM 639   H HD12   . LEU B 2 46  ? -2.782  1.886   -3.658  1.00 10.00 ? 133 LEU A HD12   1  
ATOM 640   H HD13   . LEU B 2 46  ? -2.736  0.236   -2.994  1.00 10.00 ? 133 LEU A HD13   1  
ATOM 641   H HD21   . LEU B 2 46  ? -4.046  1.043   -5.812  1.00 10.00 ? 133 LEU A HD21   1  
ATOM 642   H HD22   . LEU B 2 46  ? -3.520  -0.537  -6.411  1.00 10.00 ? 133 LEU A HD22   1  
ATOM 643   H HD23   . LEU B 2 46  ? -4.142  -0.402  -4.773  1.00 10.00 ? 133 LEU A HD23   1  
ATOM 644   N N      . ARG B 2 47  ? 0.248   2.433   -8.591  1.00 10.00 ? 134 ARG A N      1  
ATOM 645   C CA     . ARG B 2 47  ? 0.449   3.559   -9.525  1.00 10.00 ? 134 ARG A CA     1  
ATOM 646   C C      . ARG B 2 47  ? 0.155   3.172   -10.977 1.00 10.00 ? 134 ARG A C      1  
ATOM 647   O O      . ARG B 2 47  ? -0.385  3.984   -11.715 1.00 10.00 ? 134 ARG A O      1  
ATOM 648   C CB     . ARG B 2 47  ? 1.815   4.251   -9.326  1.00 10.00 ? 134 ARG A CB     1  
ATOM 649   C CG     . ARG B 2 47  ? 2.965   3.694   -10.172 1.00 10.00 ? 134 ARG A CG     1  
ATOM 650   C CD     . ARG B 2 47  ? 4.300   4.300   -9.724  1.00 10.00 ? 134 ARG A CD     1  
ATOM 651   N NE     . ARG B 2 47  ? 5.428   3.762   -10.509 1.00 10.00 ? 134 ARG A NE     1  
ATOM 652   C CZ     . ARG B 2 47  ? 6.710   4.042   -10.353 1.00 10.00 ? 134 ARG A CZ     1  
ATOM 653   N NH1    . ARG B 2 47  ? 7.136   4.859   -9.431  1.00 10.00 ? 134 ARG A NH1    1  
ATOM 654   N NH2    . ARG B 2 47  ? 7.605   3.499   -11.128 1.00 10.00 ? 134 ARG A NH2    1  
ATOM 655   H H      . ARG B 2 47  ? 1.020   2.048   -8.047  1.00 10.00 ? 134 ARG A H      1  
ATOM 656   H HA     . ARG B 2 47  ? -0.308  4.305   -9.276  1.00 10.00 ? 134 ARG A HA     1  
ATOM 657   H HB2    . ARG B 2 47  ? 1.702   5.306   -9.581  1.00 10.00 ? 134 ARG A HB2    1  
ATOM 658   H HB3    . ARG B 2 47  ? 2.089   4.198   -8.271  1.00 10.00 ? 134 ARG A HB3    1  
ATOM 659   H HG2    . ARG B 2 47  ? 3.004   2.617   -10.064 1.00 10.00 ? 134 ARG A HG2    1  
ATOM 660   H HG3    . ARG B 2 47  ? 2.792   3.932   -11.223 1.00 10.00 ? 134 ARG A HG3    1  
ATOM 661   H HD2    . ARG B 2 47  ? 4.255   5.387   -9.846  1.00 10.00 ? 134 ARG A HD2    1  
ATOM 662   H HD3    . ARG B 2 47  ? 4.453   4.074   -8.665  1.00 10.00 ? 134 ARG A HD3    1  
ATOM 663   H HE     . ARG B 2 47  ? 5.209   3.129   -11.262 1.00 10.00 ? 134 ARG A HE     1  
ATOM 664   H HH11   . ARG B 2 47  ? 6.468   5.303   -8.826  1.00 10.00 ? 134 ARG A HH11   1  
ATOM 665   H HH12   . ARG B 2 47  ? 8.118   5.061   -9.329  1.00 10.00 ? 134 ARG A HH12   1  
ATOM 666   H HH21   . ARG B 2 47  ? 7.333   2.870   -11.866 1.00 10.00 ? 134 ARG A HH21   1  
ATOM 667   H HH22   . ARG B 2 47  ? 8.577   3.717   -11.002 1.00 10.00 ? 134 ARG A HH22   1  
ATOM 668   N N      . GLN B 2 48  ? 0.435   1.930   -11.374 1.00 10.00 ? 135 GLN A N      1  
ATOM 669   C CA     . GLN B 2 48  ? 0.099   1.377   -12.696 1.00 10.00 ? 135 GLN A CA     1  
ATOM 670   C C      . GLN B 2 48  ? -1.402  1.037   -12.859 1.00 10.00 ? 135 GLN A C      1  
ATOM 671   O O      . GLN B 2 48  ? -2.007  1.258   -13.917 1.00 10.00 ? 135 GLN A O      1  
ATOM 672   C CB     . GLN B 2 48  ? 0.984   0.139   -12.890 1.00 10.00 ? 135 GLN A CB     1  
ATOM 673   C CG     . GLN B 2 48  ? 0.891   -0.451  -14.303 1.00 10.00 ? 135 GLN A CG     1  
ATOM 674   C CD     . GLN B 2 48  ? 1.869   -1.611  -14.490 1.00 10.00 ? 135 GLN A CD     1  
ATOM 675   O OE1    . GLN B 2 48  ? 2.964   -1.466  -15.019 1.00 10.00 ? 135 GLN A OE1    1  
ATOM 676   N NE2    . GLN B 2 48  ? 1.518   -2.811  -14.070 1.00 10.00 ? 135 GLN A NE2    1  
ATOM 677   H H      . GLN B 2 48  ? 0.922   1.339   -10.708 1.00 10.00 ? 135 GLN A H      1  
ATOM 678   H HA     . GLN B 2 48  ? 0.371   2.100   -13.462 1.00 10.00 ? 135 GLN A HA     1  
ATOM 679   H HB2    . GLN B 2 48  ? 2.025   0.424   -12.711 1.00 10.00 ? 135 GLN A HB2    1  
ATOM 680   H HB3    . GLN B 2 48  ? 0.705   -0.605  -12.147 1.00 10.00 ? 135 GLN A HB3    1  
ATOM 681   H HG2    . GLN B 2 48  ? -0.122  -0.806  -14.500 1.00 10.00 ? 135 GLN A HG2    1  
ATOM 682   H HG3    . GLN B 2 48  ? 1.131   0.331   -15.024 1.00 10.00 ? 135 GLN A HG3    1  
ATOM 683   H HE21   . GLN B 2 48  ? 0.625   -2.968  -13.625 1.00 10.00 ? 135 GLN A HE21   1  
ATOM 684   H HE22   . GLN B 2 48  ? 2.179   -3.561  -14.209 1.00 10.00 ? 135 GLN A HE22   1  
ATOM 685   N N      . MET B 2 49  ? -2.030  0.530   -11.797 1.00 10.00 ? 136 MET A N      1  
ATOM 686   C CA     . MET B 2 49  ? -3.417  0.073   -11.794 1.00 10.00 ? 136 MET A CA     1  
ATOM 687   C C      . MET B 2 49  ? -4.409  1.229   -11.713 1.00 10.00 ? 136 MET A C      1  
ATOM 688   O O      . MET B 2 49  ? -5.347  1.278   -12.502 1.00 10.00 ? 136 MET A O      1  
ATOM 689   C CB     . MET B 2 49  ? -3.547  -0.839  -10.597 1.00 10.00 ? 136 MET A CB     1  
ATOM 690   C CG     . MET B 2 49  ? -4.916  -1.509  -10.457 1.00 10.00 ? 136 MET A CG     1  
ATOM 691   S SD     . MET B 2 49  ? -5.446  -1.703  -8.735  1.00 10.00 ? 136 MET A SD     1  
ATOM 692   C CE     . MET B 2 49  ? -5.442  0.038   -8.212  1.00 10.00 ? 136 MET A CE     1  
ATOM 693   H H      . MET B 2 49  ? -1.528  0.382   -10.925 1.00 10.00 ? 136 MET A H      1  
ATOM 694   H HA     . MET B 2 49  ? -3.622  -0.502  -12.700 1.00 10.00 ? 136 MET A HA     1  
ATOM 695   H HB2    . MET B 2 49  ? -2.773  -1.580  -10.696 1.00 10.00 ? 136 MET A HB2    1  
ATOM 696   H HB3    . MET B 2 49  ? -3.300  -0.265  -9.708  1.00 10.00 ? 136 MET A HB3    1  
ATOM 697   H HG2    . MET B 2 49  ? -5.677  -0.917  -10.966 1.00 10.00 ? 136 MET A HG2    1  
ATOM 698   H HG3    . MET B 2 49  ? -4.884  -2.488  -10.936 1.00 10.00 ? 136 MET A HG3    1  
ATOM 699   H HE1    . MET B 2 49  ? -4.416  0.411   -8.159  1.00 10.00 ? 136 MET A HE1    1  
ATOM 700   H HE2    . MET B 2 49  ? -5.991  0.639   -8.931  1.00 10.00 ? 136 MET A HE2    1  
ATOM 701   H HE3    . MET B 2 49  ? -5.899  0.126   -7.228  1.00 10.00 ? 136 MET A HE3    1  
ATOM 702   N N      . PHE B 2 50  ? -4.163  2.195   -10.828 1.00 10.00 ? 137 PHE A N      1  
ATOM 703   C CA     . PHE B 2 50  ? -4.705  3.545   -11.001 1.00 10.00 ? 137 PHE A CA     1  
ATOM 704   C C      . PHE B 2 50  ? -4.192  4.171   -12.313 1.00 10.00 ? 137 PHE A C      1  
ATOM 705   O O      . PHE B 2 50  ? -4.878  4.985   -12.926 1.00 10.00 ? 137 PHE A O      1  
ATOM 706   C CB     . PHE B 2 50  ? -4.353  4.452   -9.813  1.00 10.00 ? 137 PHE A CB     1  
ATOM 707   C CG     . PHE B 2 50  ? -5.282  4.306   -8.633  1.00 10.00 ? 137 PHE A CG     1  
ATOM 708   C CD1    . PHE B 2 50  ? -6.443  5.096   -8.573  1.00 10.00 ? 137 PHE A CD1    1  
ATOM 709   C CD2    . PHE B 2 50  ? -5.002  3.396   -7.599  1.00 10.00 ? 137 PHE A CD2    1  
ATOM 710   C CE1    . PHE B 2 50  ? -7.314  5.001   -7.478  1.00 10.00 ? 137 PHE A CE1    1  
ATOM 711   C CE2    . PHE B 2 50  ? -5.884  3.292   -6.510  1.00 10.00 ? 137 PHE A CE2    1  
ATOM 712   C CZ     . PHE B 2 50  ? -7.023  4.110   -6.435  1.00 10.00 ? 137 PHE A CZ     1  
ATOM 713   H H      . PHE B 2 50  ? -3.388  2.047   -10.188 1.00 10.00 ? 137 PHE A H      1  
ATOM 714   H HA     . PHE B 2 50  ? -5.789  3.469   -11.052 1.00 10.00 ? 137 PHE A HA     1  
ATOM 715   H HB2    . PHE B 2 50  ? -3.321  4.297   -9.503  1.00 10.00 ? 137 PHE A HB2    1  
ATOM 716   H HB3    . PHE B 2 50  ? -4.425  5.488   -10.145 1.00 10.00 ? 137 PHE A HB3    1  
ATOM 717   H HD1    . PHE B 2 50  ? -6.683  5.763   -9.381  1.00 10.00 ? 137 PHE A HD1    1  
ATOM 718   H HD2    . PHE B 2 50  ? -4.117  2.779   -7.639  1.00 10.00 ? 137 PHE A HD2    1  
ATOM 719   H HE1    . PHE B 2 50  ? -8.220  5.588   -7.471  1.00 10.00 ? 137 PHE A HE1    1  
ATOM 720   H HE2    . PHE B 2 50  ? -5.687  2.597   -5.714  1.00 10.00 ? 137 PHE A HE2    1  
ATOM 721   H HZ     . PHE B 2 50  ? -7.680  4.052   -5.581  1.00 10.00 ? 137 PHE A HZ     1  
ATOM 722   N N      . GLY B 2 51  ? -2.987  3.792   -12.762 1.00 10.00 ? 138 GLY A N      1  
ATOM 723   C CA     . GLY B 2 51  ? -2.340  4.275   -13.992 1.00 10.00 ? 138 GLY A CA     1  
ATOM 724   C C      . GLY B 2 51  ? -3.125  4.027   -15.280 1.00 10.00 ? 138 GLY A C      1  
ATOM 725   O O      . GLY B 2 51  ? -2.958  4.787   -16.236 1.00 10.00 ? 138 GLY A O      1  
ATOM 726   H H      . GLY B 2 51  ? -2.401  3.262   -12.116 1.00 10.00 ? 138 GLY A H      1  
ATOM 727   H HA2    . GLY B 2 51  ? -2.163  5.346   -13.897 1.00 10.00 ? 138 GLY A HA2    1  
ATOM 728   H HA3    . GLY B 2 51  ? -1.367  3.798   -14.100 1.00 10.00 ? 138 GLY A HA3    1  
ATOM 729   N N      . GLN B 2 52  ? -4.035  3.043   -15.292 1.00 10.00 ? 139 GLN A N      1  
ATOM 730   C CA     . GLN B 2 52  ? -5.090  2.969   -16.330 1.00 10.00 ? 139 GLN A CA     1  
ATOM 731   C C      . GLN B 2 52  ? -5.851  4.295   -16.537 1.00 10.00 ? 139 GLN A C      1  
ATOM 732   O O      . GLN B 2 52  ? -6.151  4.665   -17.676 1.00 10.00 ? 139 GLN A O      1  
ATOM 733   C CB     . GLN B 2 52  ? -6.088  1.824   -16.076 1.00 10.00 ? 139 GLN A CB     1  
ATOM 734   C CG     . GLN B 2 52  ? -7.200  2.092   -15.044 1.00 10.00 ? 139 GLN A CG     1  
ATOM 735   C CD     . GLN B 2 52  ? -7.992  0.823   -14.734 1.00 10.00 ? 139 GLN A CD     1  
ATOM 736   O OE1    . GLN B 2 52  ? -8.956  0.473   -15.404 1.00 10.00 ? 139 GLN A OE1    1  
ATOM 737   N NE2    . GLN B 2 52  ? -7.609  0.077   -13.721 1.00 10.00 ? 139 GLN A NE2    1  
ATOM 738   H H      . GLN B 2 52  ? -3.888  2.323   -14.584 1.00 10.00 ? 139 GLN A H      1  
ATOM 739   H HA     . GLN B 2 52  ? -4.586  2.743   -17.271 1.00 10.00 ? 139 GLN A HA     1  
ATOM 740   H HB2    . GLN B 2 52  ? -6.594  1.643   -17.023 1.00 10.00 ? 139 GLN A HB2    1  
ATOM 741   H HB3    . GLN B 2 52  ? -5.540  0.927   -15.801 1.00 10.00 ? 139 GLN A HB3    1  
ATOM 742   H HG2    . GLN B 2 52  ? -6.773  2.496   -14.132 1.00 10.00 ? 139 GLN A HG2    1  
ATOM 743   H HG3    . GLN B 2 52  ? -7.893  2.836   -15.443 1.00 10.00 ? 139 GLN A HG3    1  
ATOM 744   H HE21   . GLN B 2 52  ? -6.814  0.388   -13.170 1.00 10.00 ? 139 GLN A HE21   1  
ATOM 745   H HE22   . GLN B 2 52  ? -8.133  -0.754  -13.500 1.00 10.00 ? 139 GLN A HE22   1  
ATOM 746   N N      . PHE B 2 53  ? -6.158  5.015   -15.451 1.00 10.00 ? 140 PHE A N      1  
ATOM 747   C CA     . PHE B 2 53  ? -6.738  6.362   -15.466 1.00 10.00 ? 140 PHE A CA     1  
ATOM 748   C C      . PHE B 2 53  ? -5.661  7.464   -15.532 1.00 10.00 ? 140 PHE A C      1  
ATOM 749   O O      . PHE B 2 53  ? -5.832  8.469   -16.225 1.00 10.00 ? 140 PHE A O      1  
ATOM 750   C CB     . PHE B 2 53  ? -7.644  6.551   -14.236 1.00 10.00 ? 140 PHE A CB     1  
ATOM 751   C CG     . PHE B 2 53  ? -9.024  5.952   -14.404 1.00 10.00 ? 140 PHE A CG     1  
ATOM 752   C CD1    . PHE B 2 53  ? -9.897  6.524   -15.350 1.00 10.00 ? 140 PHE A CD1    1  
ATOM 753   C CD2    . PHE B 2 53  ? -9.464  4.867   -13.615 1.00 10.00 ? 140 PHE A CD2    1  
ATOM 754   C CE1    . PHE B 2 53  ? -11.184 5.995   -15.541 1.00 10.00 ? 140 PHE A CE1    1  
ATOM 755   C CE2    . PHE B 2 53  ? -10.747 4.333   -13.817 1.00 10.00 ? 140 PHE A CE2    1  
ATOM 756   C CZ     . PHE B 2 53  ? -11.606 4.892   -14.782 1.00 10.00 ? 140 PHE A CZ     1  
ATOM 757   H H      . PHE B 2 53  ? -5.878  4.640   -14.553 1.00 10.00 ? 140 PHE A H      1  
ATOM 758   H HA     . PHE B 2 53  ? -7.349  6.437   -16.367 1.00 10.00 ? 140 PHE A HA     1  
ATOM 759   H HB2    . PHE B 2 53  ? -7.161  6.136   -13.350 1.00 10.00 ? 140 PHE A HB2    1  
ATOM 760   H HB3    . PHE B 2 53  ? -7.773  7.621   -14.059 1.00 10.00 ? 140 PHE A HB3    1  
ATOM 761   H HD1    . PHE B 2 53  ? -9.578  7.387   -15.921 1.00 10.00 ? 140 PHE A HD1    1  
ATOM 762   H HD2    . PHE B 2 53  ? -8.868  4.444   -12.815 1.00 10.00 ? 140 PHE A HD2    1  
ATOM 763   H HE1    . PHE B 2 53  ? -11.846 6.440   -16.273 1.00 10.00 ? 140 PHE A HE1    1  
ATOM 764   H HE2    . PHE B 2 53  ? -11.068 3.507   -13.202 1.00 10.00 ? 140 PHE A HE2    1  
ATOM 765   H HZ     . PHE B 2 53  ? -12.595 4.487   -14.939 1.00 10.00 ? 140 PHE A HZ     1  
ATOM 766   N N      . GLY B 2 54  ? -4.529  7.261   -14.843 1.00 10.00 ? 141 GLY A N      1  
ATOM 767   C CA     . GLY B 2 54  ? -3.278  8.006   -15.035 1.00 10.00 ? 141 GLY A CA     1  
ATOM 768   C C      . GLY B 2 54  ? -3.273  9.450   -14.535 1.00 10.00 ? 141 GLY A C      1  
ATOM 769   O O      . GLY B 2 54  ? -2.795  10.357  -15.219 1.00 10.00 ? 141 GLY A O      1  
ATOM 770   H H      . GLY B 2 54  ? -4.513  6.424   -14.273 1.00 10.00 ? 141 GLY A H      1  
ATOM 771   H HA2    . GLY B 2 54  ? -2.503  7.507   -14.460 1.00 10.00 ? 141 GLY A HA2    1  
ATOM 772   H HA3    . GLY B 2 54  ? -3.000  7.992   -16.090 1.00 10.00 ? 141 GLY A HA3    1  
ATOM 773   N N      . LYS B 2 55  ? -3.764  9.635   -13.307 1.00 10.00 ? 142 LYS A N      1  
ATOM 774   C CA     . LYS B 2 55  ? -3.831  10.910  -12.567 1.00 10.00 ? 142 LYS A CA     1  
ATOM 775   C C      . LYS B 2 55  ? -2.994  10.930  -11.277 1.00 10.00 ? 142 LYS A C      1  
ATOM 776   O O      . LYS B 2 55  ? -3.092  11.855  -10.474 1.00 10.00 ? 142 LYS A O      1  
ATOM 777   C CB     . LYS B 2 55  ? -5.312  11.232  -12.320 1.00 10.00 ? 142 LYS A CB     1  
ATOM 778   C CG     . LYS B 2 55  ? -5.969  11.579  -13.662 1.00 10.00 ? 142 LYS A CG     1  
ATOM 779   C CD     . LYS B 2 55  ? -7.325  12.288  -13.508 1.00 10.00 ? 142 LYS A CD     1  
ATOM 780   C CE     . LYS B 2 55  ? -7.653  13.111  -14.763 1.00 10.00 ? 142 LYS A CE     1  
ATOM 781   N NZ     . LYS B 2 55  ? -7.750  12.274  -15.987 1.00 10.00 ? 142 LYS A NZ     1  
ATOM 782   H H      . LYS B 2 55  ? -4.205  8.819   -12.902 1.00 10.00 ? 142 LYS A H      1  
ATOM 783   H HA     . LYS B 2 55  ? -3.404  11.709  -13.176 1.00 10.00 ? 142 LYS A HA     1  
ATOM 784   H HB2    . LYS B 2 55  ? -5.798  10.363  -11.881 1.00 10.00 ? 142 LYS A HB2    1  
ATOM 785   H HB3    . LYS B 2 55  ? -5.395  12.085  -11.648 1.00 10.00 ? 142 LYS A HB3    1  
ATOM 786   H HG2    . LYS B 2 55  ? -5.280  12.232  -14.202 1.00 10.00 ? 142 LYS A HG2    1  
ATOM 787   H HG3    . LYS B 2 55  ? -6.102  10.661  -14.237 1.00 10.00 ? 142 LYS A HG3    1  
ATOM 788   H HD2    . LYS B 2 55  ? -8.109  11.550  -13.322 1.00 10.00 ? 142 LYS A HD2    1  
ATOM 789   H HD3    . LYS B 2 55  ? -7.289  12.975  -12.662 1.00 10.00 ? 142 LYS A HD3    1  
ATOM 790   H HE2    . LYS B 2 55  ? -8.601  13.629  -14.601 1.00 10.00 ? 142 LYS A HE2    1  
ATOM 791   H HE3    . LYS B 2 55  ? -6.876  13.871  -14.894 1.00 10.00 ? 142 LYS A HE3    1  
ATOM 792   H HZ1    . LYS B 2 55  ? -6.902  11.749  -16.150 1.00 10.00 ? 142 LYS A HZ1    1  
ATOM 793   H HZ2    . LYS B 2 55  ? -8.519  11.608  -15.899 1.00 10.00 ? 142 LYS A HZ2    1  
ATOM 794   H HZ3    . LYS B 2 55  ? -7.936  12.839  -16.806 1.00 10.00 ? 142 LYS A HZ3    1  
ATOM 795   N N      . ILE B 2 56  ? -2.170  9.902   -11.085 1.00 10.00 ? 143 ILE A N      1  
ATOM 796   C CA     . ILE B 2 56  ? -1.310  9.711   -9.910  1.00 10.00 ? 143 ILE A CA     1  
ATOM 797   C C      . ILE B 2 56  ? -0.112  10.678  -9.911  1.00 10.00 ? 143 ILE A C      1  
ATOM 798   O O      . ILE B 2 56  ? 0.672   10.704  -10.862 1.00 10.00 ? 143 ILE A O      1  
ATOM 799   C CB     . ILE B 2 56  ? -0.784  8.260   -9.750  1.00 10.00 ? 143 ILE A CB     1  
ATOM 800   C CG1    . ILE B 2 56  ? -1.804  7.131   -9.917  1.00 10.00 ? 143 ILE A CG1    1  
ATOM 801   C CG2    . ILE B 2 56  ? -0.236  8.147   -8.320  1.00 10.00 ? 143 ILE A CG2    1  
ATOM 802   C CD1    . ILE B 2 56  ? -2.023  6.781   -11.387 1.00 10.00 ? 143 ILE A CD1    1  
ATOM 803   H H      . ILE B 2 56  ? -2.148  9.274   -11.871 1.00 10.00 ? 143 ILE A H      1  
ATOM 804   H HA     . ILE B 2 56  ? -1.925  9.935   -9.040  1.00 10.00 ? 143 ILE A HA     1  
ATOM 805   H HB     . ILE B 2 56  ? 0.018   8.048   -10.458 1.00 10.00 ? 143 ILE A HB     1  
ATOM 806   H HG12   . ILE B 2 56  ? -1.424  6.240   -9.419  1.00 10.00 ? 143 ILE A HG12   1  
ATOM 807   H HG13   . ILE B 2 56  ? -2.743  7.361   -9.433  1.00 10.00 ? 143 ILE A HG13   1  
ATOM 808   H HG21   . ILE B 2 56  ? 0.686   8.715   -8.218  1.00 10.00 ? 143 ILE A HG21   1  
ATOM 809   H HG22   . ILE B 2 56  ? -0.981  8.514   -7.609  1.00 10.00 ? 143 ILE A HG22   1  
ATOM 810   H HG23   . ILE B 2 56  ? -0.013  7.111   -8.076  1.00 10.00 ? 143 ILE A HG23   1  
ATOM 811   H HD11   . ILE B 2 56  ? -2.676  7.498   -11.876 1.00 10.00 ? 143 ILE A HD11   1  
ATOM 812   H HD12   . ILE B 2 56  ? -1.076  6.716   -11.920 1.00 10.00 ? 143 ILE A HD12   1  
ATOM 813   H HD13   . ILE B 2 56  ? -2.494  5.819   -11.413 1.00 10.00 ? 143 ILE A HD13   1  
ATOM 814   N N      . LEU B 2 57  ? 0.056   11.423  -8.815  1.00 10.00 ? 144 LEU A N      1  
ATOM 815   C CA     . LEU B 2 57  ? 1.270   12.174  -8.471  1.00 10.00 ? 144 LEU A CA     1  
ATOM 816   C C      . LEU B 2 57  ? 2.245   11.305  -7.649  1.00 10.00 ? 144 LEU A C      1  
ATOM 817   O O      . LEU B 2 57  ? 3.435   11.257  -7.962  1.00 10.00 ? 144 LEU A O      1  
ATOM 818   C CB     . LEU B 2 57  ? 0.885   13.451  -7.689  1.00 10.00 ? 144 LEU A CB     1  
ATOM 819   C CG     . LEU B 2 57  ? 0.458   14.673  -8.528  1.00 10.00 ? 144 LEU A CG     1  
ATOM 820   C CD1    . LEU B 2 57  ? 1.629   15.274  -9.310  1.00 10.00 ? 144 LEU A CD1    1  
ATOM 821   C CD2    . LEU B 2 57  ? -0.678  14.391  -9.512  1.00 10.00 ? 144 LEU A CD2    1  
ATOM 822   H H      . LEU B 2 57  ? -0.690  11.383  -8.128  1.00 10.00 ? 144 LEU A H      1  
ATOM 823   H HA     . LEU B 2 57  ? 1.797   12.456  -9.384  1.00 10.00 ? 144 LEU A HA     1  
ATOM 824   H HB2    . LEU B 2 57  ? 0.080   13.211  -6.996  1.00 10.00 ? 144 LEU A HB2    1  
ATOM 825   H HB3    . LEU B 2 57  ? 1.736   13.758  -7.079  1.00 10.00 ? 144 LEU A HB3    1  
ATOM 826   H HG     . LEU B 2 57  ? 0.105   15.437  -7.831  1.00 10.00 ? 144 LEU A HG     1  
ATOM 827   H HD11   . LEU B 2 57  ? 2.443   15.514  -8.623  1.00 10.00 ? 144 LEU A HD11   1  
ATOM 828   H HD12   . LEU B 2 57  ? 1.989   14.577  -10.068 1.00 10.00 ? 144 LEU A HD12   1  
ATOM 829   H HD13   . LEU B 2 57  ? 1.306   16.191  -9.798  1.00 10.00 ? 144 LEU A HD13   1  
ATOM 830   H HD21   . LEU B 2 57  ? -0.331  13.742  -10.313 1.00 10.00 ? 144 LEU A HD21   1  
ATOM 831   H HD22   . LEU B 2 57  ? -1.504  13.903  -8.993  1.00 10.00 ? 144 LEU A HD22   1  
ATOM 832   H HD23   . LEU B 2 57  ? -1.026  15.329  -9.942  1.00 10.00 ? 144 LEU A HD23   1  
ATOM 833   N N      . ASP B 2 58  ? 1.748   10.606  -6.619  1.00 10.00 ? 145 ASP A N      1  
ATOM 834   C CA     . ASP B 2 58  ? 2.512   9.734   -5.713  1.00 10.00 ? 145 ASP A CA     1  
ATOM 835   C C      . ASP B 2 58  ? 1.658   8.575   -5.165  1.00 10.00 ? 145 ASP A C      1  
ATOM 836   O O      . ASP B 2 58  ? 0.430   8.654   -5.170  1.00 10.00 ? 145 ASP A O      1  
ATOM 837   C CB     . ASP B 2 58  ? 3.047   10.575  -4.537  1.00 10.00 ? 145 ASP A CB     1  
ATOM 838   C CG     . ASP B 2 58  ? 4.365   11.293  -4.870  1.00 10.00 ? 145 ASP A CG     1  
ATOM 839   O OD1    . ASP B 2 58  ? 5.401   10.604  -5.035  1.00 10.00 ? 145 ASP A OD1    1  
ATOM 840   O OD2    . ASP B 2 58  ? 4.383   12.548  -4.919  1.00 10.00 ? 145 ASP A OD2    1  
ATOM 841   H H      . ASP B 2 58  ? 0.748   10.626  -6.468  1.00 10.00 ? 145 ASP A H      1  
ATOM 842   H HA     . ASP B 2 58  ? 3.347   9.297   -6.254  1.00 10.00 ? 145 ASP A HA     1  
ATOM 843   H HB2    . ASP B 2 58  ? 2.287   11.296  -4.224  1.00 10.00 ? 145 ASP A HB2    1  
ATOM 844   H HB3    . ASP B 2 58  ? 3.230   9.921   -3.684  1.00 10.00 ? 145 ASP A HB3    1  
ATOM 845   N N      . VAL B 2 59  ? 2.305   7.530   -4.635  1.00 10.00 ? 146 VAL A N      1  
ATOM 846   C CA     . VAL B 2 59  ? 1.689   6.389   -3.922  1.00 10.00 ? 146 VAL A CA     1  
ATOM 847   C C      . VAL B 2 59  ? 2.391   6.092   -2.596  1.00 10.00 ? 146 VAL A C      1  
ATOM 848   O O      . VAL B 2 59  ? 3.525   6.515   -2.357  1.00 10.00 ? 146 VAL A O      1  
ATOM 849   C CB     . VAL B 2 59  ? 1.662   5.090   -4.748  1.00 10.00 ? 146 VAL A CB     1  
ATOM 850   C CG1    . VAL B 2 59  ? 0.633   5.143   -5.851  1.00 10.00 ? 146 VAL A CG1    1  
ATOM 851   C CG2    . VAL B 2 59  ? 3.030   4.786   -5.366  1.00 10.00 ? 146 VAL A CG2    1  
ATOM 852   H H      . VAL B 2 59  ? 3.315   7.570   -4.627  1.00 10.00 ? 146 VAL A H      1  
ATOM 853   H HA     . VAL B 2 59  ? 0.662   6.644   -3.679  1.00 10.00 ? 146 VAL A HA     1  
ATOM 854   H HB     . VAL B 2 59  ? 1.308   4.274   -4.115  1.00 10.00 ? 146 VAL A HB     1  
ATOM 855   H HG11   . VAL B 2 59  ? -0.331  5.244   -5.375  1.00 10.00 ? 146 VAL A HG11   1  
ATOM 856   H HG12   . VAL B 2 59  ? 0.845   5.986   -6.499  1.00 10.00 ? 146 VAL A HG12   1  
ATOM 857   H HG13   . VAL B 2 59  ? 0.641   4.213   -6.413  1.00 10.00 ? 146 VAL A HG13   1  
ATOM 858   H HG21   . VAL B 2 59  ? 3.292   5.561   -6.087  1.00 10.00 ? 146 VAL A HG21   1  
ATOM 859   H HG22   . VAL B 2 59  ? 3.791   4.746   -4.588  1.00 10.00 ? 146 VAL A HG22   1  
ATOM 860   H HG23   . VAL B 2 59  ? 2.996   3.835   -5.885  1.00 10.00 ? 146 VAL A HG23   1  
ATOM 861   N N      . GLU B 2 60  ? 1.673   5.398   -1.716  1.00 10.00 ? 147 GLU A N      1  
ATOM 862   C CA     . GLU B 2 60  ? 1.931   5.351   -0.282  1.00 10.00 ? 147 GLU A CA     1  
ATOM 863   C C      . GLU B 2 60  ? 1.228   4.135   0.367   1.00 10.00 ? 147 GLU A C      1  
ATOM 864   O O      . GLU B 2 60  ? 0.294   4.281   1.151   1.00 10.00 ? 147 GLU A O      1  
ATOM 865   C CB     . GLU B 2 60  ? 1.458   6.721   0.246   1.00 10.00 ? 147 GLU A CB     1  
ATOM 866   C CG     . GLU B 2 60  ? 1.766   7.042   1.708   1.00 10.00 ? 147 GLU A CG     1  
ATOM 867   C CD     . GLU B 2 60  ? 1.784   8.572   1.946   1.00 10.00 ? 147 GLU A CD     1  
ATOM 868   O OE1    . GLU B 2 60  ? 1.021   9.322   1.287   1.00 10.00 ? 147 GLU A OE1    1  
ATOM 869   O OE2    . GLU B 2 60  ? 2.584   9.043   2.791   1.00 10.00 ? 147 GLU A OE2    1  
ATOM 870   H H      . GLU B 2 60  ? 0.733   5.131   -1.993  1.00 10.00 ? 147 GLU A H      1  
ATOM 871   H HA     . GLU B 2 60  ? 3.002   5.255   -0.103  1.00 10.00 ? 147 GLU A HA     1  
ATOM 872   H HB2    . GLU B 2 60  ? 1.965   7.492   -0.327  1.00 10.00 ? 147 GLU A HB2    1  
ATOM 873   H HB3    . GLU B 2 60  ? 0.390   6.825   0.038   1.00 10.00 ? 147 GLU A HB3    1  
ATOM 874   H HG2    . GLU B 2 60  ? 1.029   6.563   2.351   1.00 10.00 ? 147 GLU A HG2    1  
ATOM 875   H HG3    . GLU B 2 60  ? 2.749   6.628   1.948   1.00 10.00 ? 147 GLU A HG3    1  
ATOM 876   N N      . ILE B 2 61  ? 1.638   2.908   0.026   1.00 10.00 ? 148 ILE A N      1  
ATOM 877   C CA     . ILE B 2 61  ? 1.250   1.663   0.727   1.00 10.00 ? 148 ILE A CA     1  
ATOM 878   C C      . ILE B 2 61  ? 1.625   1.734   2.210   1.00 10.00 ? 148 ILE A C      1  
ATOM 879   O O      . ILE B 2 61  ? 2.655   2.311   2.566   1.00 10.00 ? 148 ILE A O      1  
ATOM 880   C CB     . ILE B 2 61  ? 1.874   0.438   0.029   1.00 10.00 ? 148 ILE A CB     1  
ATOM 881   C CG1    . ILE B 2 61  ? 1.095   0.124   -1.264  1.00 10.00 ? 148 ILE A CG1    1  
ATOM 882   C CG2    . ILE B 2 61  ? 1.963   -0.816  0.919   1.00 10.00 ? 148 ILE A CG2    1  
ATOM 883   C CD1    . ILE B 2 61  ? -0.141  -0.761  -1.088  1.00 10.00 ? 148 ILE A CD1    1  
ATOM 884   H H      . ILE B 2 61  ? 2.335   2.848   -0.716  1.00 10.00 ? 148 ILE A H      1  
ATOM 885   H HA     . ILE B 2 61  ? 0.173   1.555   0.673   1.00 10.00 ? 148 ILE A HA     1  
ATOM 886   H HB     . ILE B 2 61  ? 2.897   0.699   -0.252  1.00 10.00 ? 148 ILE A HB     1  
ATOM 887   H HG12   . ILE B 2 61  ? 0.806   1.050   -1.764  1.00 10.00 ? 148 ILE A HG12   1  
ATOM 888   H HG13   . ILE B 2 61  ? 1.759   -0.402  -1.928  1.00 10.00 ? 148 ILE A HG13   1  
ATOM 889   H HG21   . ILE B 2 61  ? 2.651   -0.634  1.738   1.00 10.00 ? 148 ILE A HG21   1  
ATOM 890   H HG22   . ILE B 2 61  ? 0.987   -1.077  1.331   1.00 10.00 ? 148 ILE A HG22   1  
ATOM 891   H HG23   . ILE B 2 61  ? 2.348   -1.653  0.337   1.00 10.00 ? 148 ILE A HG23   1  
ATOM 892   H HD11   . ILE B 2 61  ? 0.158   -1.744  -0.726  1.00 10.00 ? 148 ILE A HD11   1  
ATOM 893   H HD12   . ILE B 2 61  ? -0.827  -0.308  -0.373  1.00 10.00 ? 148 ILE A HD12   1  
ATOM 894   H HD13   . ILE B 2 61  ? -0.622  -0.882  -2.058  1.00 10.00 ? 148 ILE A HD13   1  
ATOM 895   N N      . ILE B 2 62  ? 0.817   1.130   3.092   1.00 10.00 ? 149 ILE A N      1  
ATOM 896   C CA     . ILE B 2 62  ? 0.949   1.348   4.536   1.00 10.00 ? 149 ILE A CA     1  
ATOM 897   C C      . ILE B 2 62  ? 1.953   0.405   5.211   1.00 10.00 ? 149 ILE A C      1  
ATOM 898   O O      . ILE B 2 62  ? 2.464   0.726   6.278   1.00 10.00 ? 149 ILE A O      1  
ATOM 899   C CB     . ILE B 2 62  ? -0.479  1.365   5.115   1.00 10.00 ? 149 ILE A CB     1  
ATOM 900   C CG1    . ILE B 2 62  ? -1.337  2.445   4.425   1.00 10.00 ? 149 ILE A CG1    1  
ATOM 901   C CG2    . ILE B 2 62  ? -0.514  1.652   6.609   1.00 10.00 ? 149 ILE A CG2    1  
ATOM 902   C CD1    . ILE B 2 62  ? -0.702  3.831   4.326   1.00 10.00 ? 149 ILE A CD1    1  
ATOM 903   H H      . ILE B 2 62  ? 0.007   0.584   2.819   1.00 10.00 ? 149 ILE A H      1  
ATOM 904   H HA     . ILE B 2 62  ? 1.371   2.329   4.711   1.00 10.00 ? 149 ILE A HA     1  
ATOM 905   H HB     . ILE B 2 62  ? -0.947  0.390   4.953   1.00 10.00 ? 149 ILE A HB     1  
ATOM 906   H HG12   . ILE B 2 62  ? -1.625  2.133   3.432   1.00 10.00 ? 149 ILE A HG12   1  
ATOM 907   H HG13   . ILE B 2 62  ? -2.243  2.542   4.993   1.00 10.00 ? 149 ILE A HG13   1  
ATOM 908   H HG21   . ILE B 2 62  ? -0.081  0.829   7.138   1.00 10.00 ? 149 ILE A HG21   1  
ATOM 909   H HG22   . ILE B 2 62  ? 0.057   2.551   6.815   1.00 10.00 ? 149 ILE A HG22   1  
ATOM 910   H HG23   . ILE B 2 62  ? -1.538  1.770   6.964   1.00 10.00 ? 149 ILE A HG23   1  
ATOM 911   H HD11   . ILE B 2 62  ? -0.323  4.113   5.303   1.00 10.00 ? 149 ILE A HD11   1  
ATOM 912   H HD12   . ILE B 2 62  ? 0.130   3.826   3.626   1.00 10.00 ? 149 ILE A HD12   1  
ATOM 913   H HD13   . ILE B 2 62  ? -1.441  4.550   3.986   1.00 10.00 ? 149 ILE A HD13   1  
ATOM 914   N N      . PHE B 2 63  ? 2.274   -0.680  4.505   1.00 10.00 ? 150 PHE A N      1  
ATOM 915   C CA     . PHE B 2 63  ? 3.221   -1.800  4.682   1.00 10.00 ? 150 PHE A CA     1  
ATOM 916   C C      . PHE B 2 63  ? 3.515   -2.309  6.116   1.00 10.00 ? 150 PHE A C      1  
ATOM 917   O O      . PHE B 2 63  ? 3.755   -1.547  7.051   1.00 10.00 ? 150 PHE A O      1  
ATOM 918   C CB     . PHE B 2 63  ? 4.564   -1.487  3.977   1.00 10.00 ? 150 PHE A CB     1  
ATOM 919   C CG     . PHE B 2 63  ? 4.740   -2.095  2.590   1.00 10.00 ? 150 PHE A CG     1  
ATOM 920   C CD1    . PHE B 2 63  ? 4.472   -3.463  2.371   1.00 10.00 ? 150 PHE A CD1    1  
ATOM 921   C CD2    . PHE B 2 63  ? 5.185   -1.302  1.513   1.00 10.00 ? 150 PHE A CD2    1  
ATOM 922   C CE1    . PHE B 2 63  ? 4.576   -4.015  1.087   1.00 10.00 ? 150 PHE A CE1    1  
ATOM 923   C CE2    . PHE B 2 63  ? 5.300   -1.854  0.224   1.00 10.00 ? 150 PHE A CE2    1  
ATOM 924   C CZ     . PHE B 2 63  ? 4.977   -3.206  0.009   1.00 10.00 ? 150 PHE A CZ     1  
ATOM 925   H H      . PHE B 2 63  ? 1.772   -0.614  3.634   1.00 10.00 ? 150 PHE A H      1  
ATOM 926   H HA     . PHE B 2 63  ? 2.752   -2.619  4.135   1.00 10.00 ? 150 PHE A HA     1  
ATOM 927   H HB2    . PHE B 2 63  ? 4.694   -0.406  3.916   1.00 10.00 ? 150 PHE A HB2    1  
ATOM 928   H HB3    . PHE B 2 63  ? 5.387   -1.863  4.588   1.00 10.00 ? 150 PHE A HB3    1  
ATOM 929   H HD1    . PHE B 2 63  ? 4.171   -4.099  3.187   1.00 10.00 ? 150 PHE A HD1    1  
ATOM 930   H HD2    . PHE B 2 63  ? 5.411   -0.256  1.672   1.00 10.00 ? 150 PHE A HD2    1  
ATOM 931   H HE1    . PHE B 2 63  ? 4.345   -5.059  0.921   1.00 10.00 ? 150 PHE A HE1    1  
ATOM 932   H HE2    . PHE B 2 63  ? 5.625   -1.232  -0.602  1.00 10.00 ? 150 PHE A HE2    1  
ATOM 933   H HZ     . PHE B 2 63  ? 5.043   -3.638  -0.975  1.00 10.00 ? 150 PHE A HZ     1  
ATOM 934   N N      . ASN B 2 64  ? 3.630   -3.629  6.279   1.00 10.00 ? 151 ASN A N      1  
ATOM 935   C CA     . ASN B 2 64  ? 4.194   -4.290  7.460   1.00 10.00 ? 151 ASN A CA     1  
ATOM 936   C C      . ASN B 2 64  ? 5.230   -5.344  7.006   1.00 10.00 ? 151 ASN A C      1  
ATOM 937   O O      . ASN B 2 64  ? 5.345   -5.637  5.815   1.00 10.00 ? 151 ASN A O      1  
ATOM 938   C CB     . ASN B 2 64  ? 3.017   -4.868  8.278   1.00 10.00 ? 151 ASN A CB     1  
ATOM 939   C CG     . ASN B 2 64  ? 3.347   -5.217  9.726   1.00 10.00 ? 151 ASN A CG     1  
ATOM 940   O OD1    . ASN B 2 64  ? 4.478   -5.138  10.182  1.00 10.00 ? 151 ASN A OD1    1  
ATOM 941   N ND2    . ASN B 2 64  ? 2.370   -5.617  10.505  1.00 10.00 ? 151 ASN A ND2    1  
ATOM 942   H H      . ASN B 2 64  ? 3.457   -4.260  5.499   1.00 10.00 ? 151 ASN A H      1  
ATOM 943   H HA     . ASN B 2 64  ? 4.720   -3.555  8.071   1.00 10.00 ? 151 ASN A HA     1  
ATOM 944   H HB2    . ASN B 2 64  ? 2.218   -4.131  8.309   1.00 10.00 ? 151 ASN A HB2    1  
ATOM 945   H HB3    . ASN B 2 64  ? 2.638   -5.758  7.776   1.00 10.00 ? 151 ASN A HB3    1  
ATOM 946   H HD21   . ASN B 2 64  ? 1.403   -5.670  10.193  1.00 10.00 ? 151 ASN A HD21   1  
ATOM 947   H HD22   . ASN B 2 64  ? 2.609   -5.826  11.462  1.00 10.00 ? 151 ASN A HD22   1  
ATOM 948   N N      . GLU B 2 65  ? 5.971   -5.950  7.937   1.00 10.00 ? 152 GLU A N      1  
ATOM 949   C CA     . GLU B 2 65  ? 7.014   -6.949  7.641   1.00 10.00 ? 152 GLU A CA     1  
ATOM 950   C C      . GLU B 2 65  ? 6.478   -8.186  6.894   1.00 10.00 ? 152 GLU A C      1  
ATOM 951   O O      . GLU B 2 65  ? 7.206   -8.813  6.119   1.00 10.00 ? 152 GLU A O      1  
ATOM 952   C CB     . GLU B 2 65  ? 7.696   -7.395  8.947   1.00 10.00 ? 152 GLU A CB     1  
ATOM 953   C CG     . GLU B 2 65  ? 8.411   -6.268  9.707   1.00 10.00 ? 152 GLU A CG     1  
ATOM 954   C CD     . GLU B 2 65  ? 9.540   -5.619  8.880   1.00 10.00 ? 152 GLU A CD     1  
ATOM 955   O OE1    . GLU B 2 65  ? 10.522  -6.321  8.529   1.00 10.00 ? 152 GLU A OE1    1  
ATOM 956   O OE2    . GLU B 2 65  ? 9.457   -4.406  8.572   1.00 10.00 ? 152 GLU A OE2    1  
ATOM 957   H H      . GLU B 2 65  ? 5.815   -5.665  8.900   1.00 10.00 ? 152 GLU A H      1  
ATOM 958   H HA     . GLU B 2 65  ? 7.768   -6.490  6.997   1.00 10.00 ? 152 GLU A HA     1  
ATOM 959   H HB2    . GLU B 2 65  ? 6.940   -7.828  9.604   1.00 10.00 ? 152 GLU A HB2    1  
ATOM 960   H HB3    . GLU B 2 65  ? 8.423   -8.175  8.719   1.00 10.00 ? 152 GLU A HB3    1  
ATOM 961   H HG2    . GLU B 2 65  ? 7.679   -5.514  10.006  1.00 10.00 ? 152 GLU A HG2    1  
ATOM 962   H HG3    . GLU B 2 65  ? 8.834   -6.688  10.623  1.00 10.00 ? 152 GLU A HG3    1  
ATOM 963   N N      . ARG B 2 66  ? 5.196   -8.521  7.101   1.00 10.00 ? 153 ARG A N      1  
ATOM 964   C CA     . ARG B 2 66  ? 4.480   -9.615  6.426   1.00 10.00 ? 153 ARG A CA     1  
ATOM 965   C C      . ARG B 2 66  ? 4.007   -9.282  5.000   1.00 10.00 ? 153 ARG A C      1  
ATOM 966   O O      . ARG B 2 66  ? 3.860   -10.205 4.200   1.00 10.00 ? 153 ARG A O      1  
ATOM 967   C CB     . ARG B 2 66  ? 3.276   -10.045 7.289   1.00 10.00 ? 153 ARG A CB     1  
ATOM 968   C CG     . ARG B 2 66  ? 3.635   -10.719 8.624   1.00 10.00 ? 153 ARG A CG     1  
ATOM 969   C CD     . ARG B 2 66  ? 4.194   -12.139 8.455   1.00 10.00 ? 153 ARG A CD     1  
ATOM 970   N NE     . ARG B 2 66  ? 3.172   -13.085 7.958   1.00 10.00 ? 153 ARG A NE     1  
ATOM 971   C CZ     . ARG B 2 66  ? 3.130   -13.743 6.815   1.00 10.00 ? 153 ARG A CZ     1  
ATOM 972   N NH1    . ARG B 2 66  ? 4.030   -13.599 5.883   1.00 10.00 ? 153 ARG A NH1    1  
ATOM 973   N NH2    . ARG B 2 66  ? 2.158   -14.573 6.587   1.00 10.00 ? 153 ARG A NH2    1  
ATOM 974   H H      . ARG B 2 66  ? 4.703   -7.955  7.780   1.00 10.00 ? 153 ARG A H      1  
ATOM 975   H HA     . ARG B 2 66  ? 5.159   -10.463 6.318   1.00 10.00 ? 153 ARG A HA     1  
ATOM 976   H HB2    . ARG B 2 66  ? 2.669   -9.167  7.504   1.00 10.00 ? 153 ARG A HB2    1  
ATOM 977   H HB3    . ARG B 2 66  ? 2.660   -10.740 6.724   1.00 10.00 ? 153 ARG A HB3    1  
ATOM 978   H HG2    . ARG B 2 66  ? 4.367   -10.113 9.158   1.00 10.00 ? 153 ARG A HG2    1  
ATOM 979   H HG3    . ARG B 2 66  ? 2.735   -10.776 9.238   1.00 10.00 ? 153 ARG A HG3    1  
ATOM 980   H HD2    . ARG B 2 66  ? 5.060   -12.111 7.796   1.00 10.00 ? 153 ARG A HD2    1  
ATOM 981   H HD3    . ARG B 2 66  ? 4.534   -12.485 9.431   1.00 10.00 ? 153 ARG A HD3    1  
ATOM 982   H HE     . ARG B 2 66  ? 2.371   -13.255 8.552   1.00 10.00 ? 153 ARG A HE     1  
ATOM 983   H HH11   . ARG B 2 66  ? 4.798   -12.973 6.038   1.00 10.00 ? 153 ARG A HH11   1  
ATOM 984   H HH12   . ARG B 2 66  ? 3.971   -14.118 5.022   1.00 10.00 ? 153 ARG A HH12   1  
ATOM 985   H HH21   . ARG B 2 66  ? 1.499   -14.741 7.339   1.00 10.00 ? 153 ARG A HH21   1  
ATOM 986   H HH22   . ARG B 2 66  ? 2.107   -15.110 5.739   1.00 10.00 ? 153 ARG A HH22   1  
ATOM 987   N N      . GLY B 2 67  ? 3.746   -8.014  4.662   1.00 10.00 ? 154 GLY A N      1  
ATOM 988   C CA     . GLY B 2 67  ? 3.087   -7.612  3.407   1.00 10.00 ? 154 GLY A CA     1  
ATOM 989   C C      . GLY B 2 67  ? 2.315   -6.302  3.553   1.00 10.00 ? 154 GLY A C      1  
ATOM 990   O O      . GLY B 2 67  ? 2.540   -5.554  4.503   1.00 10.00 ? 154 GLY A O      1  
ATOM 991   H H      . GLY B 2 67  ? 3.950   -7.272  5.325   1.00 10.00 ? 154 GLY A H      1  
ATOM 992   H HA2    . GLY B 2 67  ? 3.846   -7.474  2.636   1.00 10.00 ? 154 GLY A HA2    1  
ATOM 993   H HA3    . GLY B 2 67  ? 2.396   -8.385  3.069   1.00 10.00 ? 154 GLY A HA3    1  
ATOM 994   N N      . SER B 2 68  ? 1.423   -5.986  2.610   1.00 10.00 ? 155 SER A N      1  
ATOM 995   C CA     . SER B 2 68  ? 0.873   -4.635  2.358   1.00 10.00 ? 155 SER A CA     1  
ATOM 996   C C      . SER B 2 68  ? 0.113   -3.905  3.479   1.00 10.00 ? 155 SER A C      1  
ATOM 997   O O      . SER B 2 68  ? -0.425  -2.824  3.247   1.00 10.00 ? 155 SER A O      1  
ATOM 998   C CB     . SER B 2 68  ? -0.009  -4.646  1.099   1.00 10.00 ? 155 SER A CB     1  
ATOM 999   O OG     . SER B 2 68  ? 0.504   -5.482  0.079   1.00 10.00 ? 155 SER A OG     1  
ATOM 1000  H H      . SER B 2 68  ? 1.331   -6.622  1.825   1.00 10.00 ? 155 SER A H      1  
ATOM 1001  H HA     . SER B 2 68  ? 1.728   -4.013  2.159   1.00 10.00 ? 155 SER A HA     1  
ATOM 1002  H HB2    . SER B 2 68  ? -1.001  -5.011  1.367   1.00 10.00 ? 155 SER A HB2    1  
ATOM 1003  H HB3    . SER B 2 68  ? -0.106  -3.628  0.722   1.00 10.00 ? 155 SER A HB3    1  
ATOM 1004  H HG     . SER B 2 68  ? 1.255   -5.041  -0.360  1.00 10.00 ? 155 SER A HG     1  
ATOM 1005  N N      . LYS B 2 69  ? -0.011  -4.492  4.672   1.00 10.00 ? 156 LYS A N      1  
ATOM 1006  C CA     . LYS B 2 69  ? -0.910  -4.143  5.805   1.00 10.00 ? 156 LYS A CA     1  
ATOM 1007  C C      . LYS B 2 69  ? -2.417  -4.102  5.471   1.00 10.00 ? 156 LYS A C      1  
ATOM 1008  O O      . LYS B 2 69  ? -3.260  -4.065  6.362   1.00 10.00 ? 156 LYS A O      1  
ATOM 1009  C CB     . LYS B 2 69  ? -0.422  -2.851  6.489   1.00 10.00 ? 156 LYS A CB     1  
ATOM 1010  C CG     . LYS B 2 69  ? -0.674  -2.869  8.011   1.00 10.00 ? 156 LYS A CG     1  
ATOM 1011  C CD     . LYS B 2 69  ? -0.323  -1.556  8.730   1.00 10.00 ? 156 LYS A CD     1  
ATOM 1012  C CE     . LYS B 2 69  ? 1.074   -1.062  8.334   1.00 10.00 ? 156 LYS A CE     1  
ATOM 1013  N NZ     . LYS B 2 69  ? 1.524   0.115   9.126   1.00 10.00 ? 156 LYS A NZ     1  
ATOM 1014  H H      . LYS B 2 69  ? 0.609   -5.286  4.751   1.00 10.00 ? 156 LYS A H      1  
ATOM 1015  H HA     . LYS B 2 69  ? -0.808  -4.945  6.536   1.00 10.00 ? 156 LYS A HA     1  
ATOM 1016  H HB2    . LYS B 2 69  ? 0.650   -2.757  6.315   1.00 10.00 ? 156 LYS A HB2    1  
ATOM 1017  H HB3    . LYS B 2 69  ? -0.914  -1.989  6.038   1.00 10.00 ? 156 LYS A HB3    1  
ATOM 1018  H HG2    . LYS B 2 69  ? -1.725  -3.087  8.208   1.00 10.00 ? 156 LYS A HG2    1  
ATOM 1019  H HG3    . LYS B 2 69  ? -0.078  -3.669  8.443   1.00 10.00 ? 156 LYS A HG3    1  
ATOM 1020  H HD2    . LYS B 2 69  ? -1.069  -0.800  8.481   1.00 10.00 ? 156 LYS A HD2    1  
ATOM 1021  H HD3    . LYS B 2 69  ? -0.362  -1.733  9.808   1.00 10.00 ? 156 LYS A HD3    1  
ATOM 1022  H HE2    . LYS B 2 69  ? 1.788   -1.879  8.450   1.00 10.00 ? 156 LYS A HE2    1  
ATOM 1023  H HE3    . LYS B 2 69  ? 1.044   -0.795  7.263   1.00 10.00 ? 156 LYS A HE3    1  
ATOM 1024  H HZ1    . LYS B 2 69  ? 0.892   0.912   9.064   1.00 10.00 ? 156 LYS A HZ1    1  
ATOM 1025  H HZ2    . LYS B 2 69  ? 1.637   -0.109  10.105  1.00 10.00 ? 156 LYS A HZ2    1  
ATOM 1026  H HZ3    . LYS B 2 69  ? 2.413   0.443   8.771   1.00 10.00 ? 156 LYS A HZ3    1  
ATOM 1027  N N      . GLY B 2 70  ? -2.757  -4.191  4.184   1.00 10.00 ? 157 GLY A N      1  
ATOM 1028  C CA     . GLY B 2 70  ? -4.093  -4.378  3.627   1.00 10.00 ? 157 GLY A CA     1  
ATOM 1029  C C      . GLY B 2 70  ? -4.662  -3.133  2.951   1.00 10.00 ? 157 GLY A C      1  
ATOM 1030  O O      . GLY B 2 70  ? -5.706  -3.214  2.303   1.00 10.00 ? 157 GLY A O      1  
ATOM 1031  H H      . GLY B 2 70  ? -1.986  -4.119  3.538   1.00 10.00 ? 157 GLY A H      1  
ATOM 1032  H HA2    . GLY B 2 70  ? -4.044  -5.175  2.884   1.00 10.00 ? 157 GLY A HA2    1  
ATOM 1033  H HA3    . GLY B 2 70  ? -4.777  -4.694  4.412   1.00 10.00 ? 157 GLY A HA3    1  
ATOM 1034  N N      . PHE B 2 71  ? -3.982  -1.991  3.058   1.00 10.00 ? 158 PHE A N      1  
ATOM 1035  C CA     . PHE B 2 71  ? -4.321  -0.759  2.363   1.00 10.00 ? 158 PHE A CA     1  
ATOM 1036  C C      . PHE B 2 71  ? -3.084  0.045   1.944   1.00 10.00 ? 158 PHE A C      1  
ATOM 1037  O O      . PHE B 2 71  ? -1.957  -0.122  2.437   1.00 10.00 ? 158 PHE A O      1  
ATOM 1038  C CB     . PHE B 2 71  ? -5.341  0.076   3.176   1.00 10.00 ? 158 PHE A CB     1  
ATOM 1039  C CG     . PHE B 2 71  ? -4.871  0.957   4.319   1.00 10.00 ? 158 PHE A CG     1  
ATOM 1040  C CD1    . PHE B 2 71  ? -4.656  0.384   5.584   1.00 10.00 ? 158 PHE A CD1    1  
ATOM 1041  C CD2    . PHE B 2 71  ? -4.811  2.360   4.162   1.00 10.00 ? 158 PHE A CD2    1  
ATOM 1042  C CE1    . PHE B 2 71  ? -4.384  1.207   6.685   1.00 10.00 ? 158 PHE A CE1    1  
ATOM 1043  C CE2    . PHE B 2 71  ? -4.576  3.201   5.273   1.00 10.00 ? 158 PHE A CE2    1  
ATOM 1044  C CZ     . PHE B 2 71  ? -4.341  2.605   6.523   1.00 10.00 ? 158 PHE A CZ     1  
ATOM 1045  H H      . PHE B 2 71  ? -3.076  -2.013  3.497   1.00 10.00 ? 158 PHE A H      1  
ATOM 1046  H HA     . PHE B 2 71  ? -4.819  -1.047  1.439   1.00 10.00 ? 158 PHE A HA     1  
ATOM 1047  H HB2    . PHE B 2 71  ? -5.895  0.702   2.492   1.00 10.00 ? 158 PHE A HB2    1  
ATOM 1048  H HB3    . PHE B 2 71  ? -6.104  -0.577  3.571   1.00 10.00 ? 158 PHE A HB3    1  
ATOM 1049  H HD1    . PHE B 2 71  ? -4.732  -0.686  5.718   1.00 10.00 ? 158 PHE A HD1    1  
ATOM 1050  H HD2    . PHE B 2 71  ? -4.986  2.795   3.189   1.00 10.00 ? 158 PHE A HD2    1  
ATOM 1051  H HE1    . PHE B 2 71  ? -4.216  0.757   7.654   1.00 10.00 ? 158 PHE A HE1    1  
ATOM 1052  H HE2    . PHE B 2 71  ? -4.520  4.291   5.181   1.00 10.00 ? 158 PHE A HE2    1  
ATOM 1053  H HZ     . PHE B 2 71  ? -4.086  3.221   7.361   1.00 10.00 ? 158 PHE A HZ     1  
ATOM 1054  N N      . GLY B 2 72  ? -3.330  0.953   1.012   1.00 10.00 ? 159 GLY A N      1  
ATOM 1055  C CA     . GLY B 2 72  ? -2.426  2.019   0.624   1.00 10.00 ? 159 GLY A CA     1  
ATOM 1056  C C      . GLY B 2 72  ? -3.164  3.350   0.552   1.00 10.00 ? 159 GLY A C      1  
ATOM 1057  O O      . GLY B 2 72  ? -4.382  3.447   0.710   1.00 10.00 ? 159 GLY A O      1  
ATOM 1058  H H      . GLY B 2 72  ? -4.280  1.003   0.657   1.00 10.00 ? 159 GLY A H      1  
ATOM 1059  H HA2    . GLY B 2 72  ? -1.643  2.134   1.366   1.00 10.00 ? 159 GLY A HA2    1  
ATOM 1060  H HA3    . GLY B 2 72  ? -1.953  1.788   -0.335  1.00 10.00 ? 159 GLY A HA3    1  
ATOM 1061  N N      . PHE B 2 73  ? -2.391  4.383   0.297   1.00 10.00 ? 160 PHE A N      1  
ATOM 1062  C CA     . PHE B 2 73  ? -2.786  5.719   -0.097  1.00 10.00 ? 160 PHE A CA     1  
ATOM 1063  C C      . PHE B 2 73  ? -2.177  6.019   -1.481  1.00 10.00 ? 160 PHE A C      1  
ATOM 1064  O O      . PHE B 2 73  ? -1.127  5.483   -1.849  1.00 10.00 ? 160 PHE A O      1  
ATOM 1065  C CB     . PHE B 2 73  ? -2.325  6.690   1.002   1.00 10.00 ? 160 PHE A CB     1  
ATOM 1066  C CG     . PHE B 2 73  ? -3.454  7.193   1.872   1.00 10.00 ? 160 PHE A CG     1  
ATOM 1067  C CD1    . PHE B 2 73  ? -3.887  6.506   3.033   1.00 10.00 ? 160 PHE A CD1    1  
ATOM 1068  C CD2    . PHE B 2 73  ? -4.066  8.401   1.507   1.00 10.00 ? 160 PHE A CD2    1  
ATOM 1069  C CE1    . PHE B 2 73  ? -4.913  7.047   3.820   1.00 10.00 ? 160 PHE A CE1    1  
ATOM 1070  C CE2    . PHE B 2 73  ? -5.084  8.941   2.296   1.00 10.00 ? 160 PHE A CE2    1  
ATOM 1071  C CZ     . PHE B 2 73  ? -5.508  8.263   3.448   1.00 10.00 ? 160 PHE A CZ     1  
ATOM 1072  H H      . PHE B 2 73  ? -1.396  4.232   0.335   1.00 10.00 ? 160 PHE A H      1  
ATOM 1073  H HA     . PHE B 2 73  ? -3.870  5.758   -0.174  1.00 10.00 ? 160 PHE A HA     1  
ATOM 1074  H HB2    . PHE B 2 73  ? -1.563  6.232   1.640   1.00 10.00 ? 160 PHE A HB2    1  
ATOM 1075  H HB3    . PHE B 2 73  ? -1.851  7.551   0.529   1.00 10.00 ? 160 PHE A HB3    1  
ATOM 1076  H HD1    . PHE B 2 73  ? -3.447  5.586   3.384   1.00 10.00 ? 160 PHE A HD1    1  
ATOM 1077  H HD2    . PHE B 2 73  ? -3.735  8.932   0.630   1.00 10.00 ? 160 PHE A HD2    1  
ATOM 1078  H HE1    . PHE B 2 73  ? -5.197  6.543   4.738   1.00 10.00 ? 160 PHE A HE1    1  
ATOM 1079  H HE2    . PHE B 2 73  ? -5.503  9.895   2.025   1.00 10.00 ? 160 PHE A HE2    1  
ATOM 1080  H HZ     . PHE B 2 73  ? -6.264  8.701   4.076   1.00 10.00 ? 160 PHE A HZ     1  
ATOM 1081  N N      . VAL B 2 74  ? -2.832  6.865   -2.269  1.00 10.00 ? 161 VAL A N      1  
ATOM 1082  C CA     . VAL B 2 74  ? -2.360  7.359   -3.578  1.00 10.00 ? 161 VAL A CA     1  
ATOM 1083  C C      . VAL B 2 74  ? -2.844  8.789   -3.804  1.00 10.00 ? 161 VAL A C      1  
ATOM 1084  O O      . VAL B 2 74  ? -3.798  9.218   -3.168  1.00 10.00 ? 161 VAL A O      1  
ATOM 1085  C CB     . VAL B 2 74  ? -2.744  6.358   -4.690  1.00 10.00 ? 161 VAL A CB     1  
ATOM 1086  C CG1    . VAL B 2 74  ? -4.199  6.020   -4.835  1.00 10.00 ? 161 VAL A CG1    1  
ATOM 1087  C CG2    . VAL B 2 74  ? -2.367  6.792   -6.103  1.00 10.00 ? 161 VAL A CG2    1  
ATOM 1088  H H      . VAL B 2 74  ? -3.747  7.172   -1.952  1.00 10.00 ? 161 VAL A H      1  
ATOM 1089  H HA     . VAL B 2 74  ? -1.273  7.428   -3.563  1.00 10.00 ? 161 VAL A HA     1  
ATOM 1090  H HB     . VAL B 2 74  ? -2.274  5.402   -4.455  1.00 10.00 ? 161 VAL A HB     1  
ATOM 1091  H HG11   . VAL B 2 74  ? -4.625  5.845   -3.856  1.00 10.00 ? 161 VAL A HG11   1  
ATOM 1092  H HG12   . VAL B 2 74  ? -4.705  6.832   -5.362  1.00 10.00 ? 161 VAL A HG12   1  
ATOM 1093  H HG13   . VAL B 2 74  ? -4.197  5.098   -5.419  1.00 10.00 ? 161 VAL A HG13   1  
ATOM 1094  H HG21   . VAL B 2 74  ? -2.989  7.627   -6.433  1.00 10.00 ? 161 VAL A HG21   1  
ATOM 1095  H HG22   . VAL B 2 74  ? -1.328  7.074   -6.097  1.00 10.00 ? 161 VAL A HG22   1  
ATOM 1096  H HG23   . VAL B 2 74  ? -2.523  5.970   -6.803  1.00 10.00 ? 161 VAL A HG23   1  
ATOM 1097  N N      . THR B 2 75  ? -2.174  9.569   -4.651  1.00 10.00 ? 162 THR A N      1  
ATOM 1098  C CA     . THR B 2 75  ? -2.320  11.041  -4.701  1.00 10.00 ? 162 THR A CA     1  
ATOM 1099  C C      . THR B 2 75  ? -2.908  11.455  -6.039  1.00 10.00 ? 162 THR A C      1  
ATOM 1100  O O      . THR B 2 75  ? -2.210  11.449  -7.052  1.00 10.00 ? 162 THR A O      1  
ATOM 1101  C CB     . THR B 2 75  ? -0.985  11.744  -4.425  1.00 10.00 ? 162 THR A CB     1  
ATOM 1102  O OG1    . THR B 2 75  ? -0.431  11.273  -3.218  1.00 10.00 ? 162 THR A OG1    1  
ATOM 1103  C CG2    . THR B 2 75  ? -1.116  13.264  -4.276  1.00 10.00 ? 162 THR A CG2    1  
ATOM 1104  H H      . THR B 2 75  ? -1.406  9.120   -5.157  1.00 10.00 ? 162 THR A H      1  
ATOM 1105  H HA     . THR B 2 75  ? -3.015  11.354  -3.928  1.00 10.00 ? 162 THR A HA     1  
ATOM 1106  H HB     . THR B 2 75  ? -0.309  11.506  -5.244  1.00 10.00 ? 162 THR A HB     1  
ATOM 1107  H HG1    . THR B 2 75  ? -0.193  10.340  -3.350  1.00 10.00 ? 162 THR A HG1    1  
ATOM 1108  H HG21   . THR B 2 75  ? -1.622  13.706  -5.137  1.00 10.00 ? 162 THR A HG21   1  
ATOM 1109  H HG22   . THR B 2 75  ? -1.670  13.514  -3.371  1.00 10.00 ? 162 THR A HG22   1  
ATOM 1110  H HG23   . THR B 2 75  ? -0.118  13.698  -4.202  1.00 10.00 ? 162 THR A HG23   1  
ATOM 1111  N N      . PHE B 2 76  ? -4.221  11.690  -6.061  1.00 10.00 ? 163 PHE A N      1  
ATOM 1112  C CA     . PHE B 2 76  ? -5.033  11.330  -7.225  1.00 10.00 ? 163 PHE A CA     1  
ATOM 1113  C C      . PHE B 2 76  ? -6.326  12.114  -7.459  1.00 10.00 ? 163 PHE A C      1  
ATOM 1114  O O      . PHE B 2 76  ? -6.771  12.327  -8.585  1.00 10.00 ? 163 PHE A O      1  
ATOM 1115  C CB     . PHE B 2 76  ? -5.404  9.864   -7.015  1.00 10.00 ? 163 PHE A CB     1  
ATOM 1116  C CG     . PHE B 2 76  ? -6.003  9.221   -8.242  1.00 10.00 ? 163 PHE A CG     1  
ATOM 1117  C CD1    . PHE B 2 76  ? -5.135  8.724   -9.220  1.00 10.00 ? 163 PHE A CD1    1  
ATOM 1118  C CD2    . PHE B 2 76  ? -7.394  9.133   -8.431  1.00 10.00 ? 163 PHE A CD2    1  
ATOM 1119  C CE1    . PHE B 2 76  ? -5.634  8.092   -10.366 1.00 10.00 ? 163 PHE A CE1    1  
ATOM 1120  C CE2    . PHE B 2 76  ? -7.902  8.534   -9.597  1.00 10.00 ? 163 PHE A CE2    1  
ATOM 1121  C CZ     . PHE B 2 76  ? -7.026  8.017   -10.569 1.00 10.00 ? 163 PHE A CZ     1  
ATOM 1122  H H      . PHE B 2 76  ? -4.696  11.724  -5.167  1.00 10.00 ? 163 PHE A H      1  
ATOM 1123  H HA     . PHE B 2 76  ? -4.442  11.424  -8.112  1.00 10.00 ? 163 PHE A HA     1  
ATOM 1124  H HB2    . PHE B 2 76  ? -4.500  9.315   -6.741  1.00 10.00 ? 163 PHE A HB2    1  
ATOM 1125  H HB3    . PHE B 2 76  ? -6.092  9.803   -6.171  1.00 10.00 ? 163 PHE A HB3    1  
ATOM 1126  H HD1    . PHE B 2 76  ? -4.077  8.851   -9.065  1.00 10.00 ? 163 PHE A HD1    1  
ATOM 1127  H HD2    . PHE B 2 76  ? -8.080  9.539   -7.704  1.00 10.00 ? 163 PHE A HD2    1  
ATOM 1128  H HE1    . PHE B 2 76  ? -4.933  7.654   -11.061 1.00 10.00 ? 163 PHE A HE1    1  
ATOM 1129  H HE2    . PHE B 2 76  ? -8.971  8.471   -9.720  1.00 10.00 ? 163 PHE A HE2    1  
ATOM 1130  H HZ     . PHE B 2 76  ? -7.423  7.538   -11.452 1.00 10.00 ? 163 PHE A HZ     1  
ATOM 1131  N N      . GLU B 2 77  ? -6.956  12.493  -6.365  1.00 10.00 ? 164 GLU A N      1  
ATOM 1132  C CA     . GLU B 2 77  ? -8.333  12.916  -6.242  1.00 10.00 ? 164 GLU A CA     1  
ATOM 1133  C C      . GLU B 2 77  ? -8.371  14.425  -6.336  1.00 10.00 ? 164 GLU A C      1  
ATOM 1134  O O      . GLU B 2 77  ? -7.958  15.111  -5.396  1.00 10.00 ? 164 GLU A O      1  
ATOM 1135  C CB     . GLU B 2 77  ? -8.899  12.446  -4.895  1.00 10.00 ? 164 GLU A CB     1  
ATOM 1136  C CG     . GLU B 2 77  ? -10.389 12.780  -4.744  1.00 10.00 ? 164 GLU A CG     1  
ATOM 1137  C CD     . GLU B 2 77  ? -10.997 12.086  -3.517  1.00 10.00 ? 164 GLU A CD     1  
ATOM 1138  O OE1    . GLU B 2 77  ? -10.532 12.351  -2.383  1.00 10.00 ? 164 GLU A OE1    1  
ATOM 1139  O OE2    . GLU B 2 77  ? -11.953 11.295  -3.695  1.00 10.00 ? 164 GLU A OE2    1  
ATOM 1140  H H      . GLU B 2 77  ? -6.401  12.538  -5.539  1.00 10.00 ? 164 GLU A H      1  
ATOM 1141  H HA     . GLU B 2 77  ? -8.938  12.461  -7.026  1.00 10.00 ? 164 GLU A HA     1  
ATOM 1142  H HB2    . GLU B 2 77  ? -8.775  11.377  -4.839  1.00 10.00 ? 164 GLU A HB2    1  
ATOM 1143  H HB3    . GLU B 2 77  ? -8.334  12.881  -4.076  1.00 10.00 ? 164 GLU A HB3    1  
ATOM 1144  H HG2    . GLU B 2 77  ? -10.511 13.860  -4.655  1.00 10.00 ? 164 GLU A HG2    1  
ATOM 1145  H HG3    . GLU B 2 77  ? -10.908 12.456  -5.651  1.00 10.00 ? 164 GLU A HG3    1  
ATOM 1146  N N      . ASN B 2 78  ? -8.903  14.946  -7.435  1.00 10.00 ? 165 ASN A N      1  
ATOM 1147  C CA     . ASN B 2 78  ? -9.701  16.163  -7.318  1.00 10.00 ? 165 ASN A CA     1  
ATOM 1148  C C      . ASN B 2 78  ? -10.872 16.275  -8.315  1.00 10.00 ? 165 ASN A C      1  
ATOM 1149  O O      . ASN B 2 78  ? -12.006 16.525  -7.905  1.00 10.00 ? 165 ASN A O      1  
ATOM 1150  C CB     . ASN B 2 78  ? -8.788  17.410  -7.341  1.00 10.00 ? 165 ASN A CB     1  
ATOM 1151  C CG     . ASN B 2 78  ? -8.983  18.267  -6.100  1.00 10.00 ? 165 ASN A CG     1  
ATOM 1152  O OD1    . ASN B 2 78  ? -9.330  19.439  -6.166  1.00 10.00 ? 165 ASN A OD1    1  
ATOM 1153  N ND2    . ASN B 2 78  ? -8.795  17.696  -4.928  1.00 10.00 ? 165 ASN A ND2    1  
ATOM 1154  H H      . ASN B 2 78  ? -9.067  14.297  -8.189  1.00 10.00 ? 165 ASN A H      1  
ATOM 1155  H HA     . ASN B 2 78  ? -10.148 16.072  -6.328  1.00 10.00 ? 165 ASN A HA     1  
ATOM 1156  H HB2    . ASN B 2 78  ? -7.743  17.118  -7.388  1.00 10.00 ? 165 ASN A HB2    1  
ATOM 1157  H HB3    . ASN B 2 78  ? -9.000  18.018  -8.219  1.00 10.00 ? 165 ASN A HB3    1  
ATOM 1158  H HD21   . ASN B 2 78  ? -8.514  16.712  -4.909  1.00 10.00 ? 165 ASN A HD21   1  
ATOM 1159  H HD22   . ASN B 2 78  ? -8.900  18.260  -4.101  1.00 10.00 ? 165 ASN A HD22   1  
ATOM 1160  N N      . SER B 2 79  ? -10.602 16.108  -9.613  1.00 10.00 ? 166 SER A N      1  
ATOM 1161  C CA     . SER B 2 79  ? -11.579 16.294  -10.701 1.00 10.00 ? 166 SER A CA     1  
ATOM 1162  C C      . SER B 2 79  ? -12.696 15.237  -10.729 1.00 10.00 ? 166 SER A C      1  
ATOM 1163  O O      . SER B 2 79  ? -12.575 14.163  -10.134 1.00 10.00 ? 166 SER A O      1  
ATOM 1164  C CB     . SER B 2 79  ? -10.843 16.271  -12.053 1.00 10.00 ? 166 SER A CB     1  
ATOM 1165  O OG     . SER B 2 79  ? -9.801  17.236  -12.066 1.00 10.00 ? 166 SER A OG     1  
ATOM 1166  H H      . SER B 2 79  ? -9.633  15.984  -9.873  1.00 10.00 ? 166 SER A H      1  
ATOM 1167  H HA     . SER B 2 79  ? -12.039 17.272  -10.579 1.00 10.00 ? 166 SER A HA     1  
ATOM 1168  H HB2    . SER B 2 79  ? -10.422 15.277  -12.216 1.00 10.00 ? 166 SER A HB2    1  
ATOM 1169  H HB3    . SER B 2 79  ? -11.550 16.485  -12.857 1.00 10.00 ? 166 SER A HB3    1  
ATOM 1170  H HG     . SER B 2 79  ? -9.396  17.241  -12.955 1.00 10.00 ? 166 SER A HG     1  
ATOM 1171  N N      . ALA B 2 80  ? -13.761 15.482  -11.507 1.00 10.00 ? 167 ALA A N      1  
ATOM 1172  C CA     . ALA B 2 80  ? -14.834 14.505  -11.739 1.00 10.00 ? 167 ALA A CA     1  
ATOM 1173  C C      . ALA B 2 80  ? -14.337 13.192  -12.370 1.00 10.00 ? 167 ALA A C      1  
ATOM 1174  O O      . ALA B 2 80  ? -14.874 12.130  -12.065 1.00 10.00 ? 167 ALA A O      1  
ATOM 1175  C CB     . ALA B 2 80  ? -15.910 15.122  -12.639 1.00 10.00 ? 167 ALA A CB     1  
ATOM 1176  H H      . ALA B 2 80  ? -13.832 16.385  -11.956 1.00 10.00 ? 167 ALA A H      1  
ATOM 1177  H HA     . ALA B 2 80  ? -15.289 14.256  -10.780 1.00 10.00 ? 167 ALA A HA     1  
ATOM 1178  H HB1    . ALA B 2 80  ? -16.344 16.001  -12.162 1.00 10.00 ? 167 ALA A HB1    1  
ATOM 1179  H HB2    . ALA B 2 80  ? -15.482 15.394  -13.606 1.00 10.00 ? 167 ALA A HB2    1  
ATOM 1180  H HB3    . ALA B 2 80  ? -16.691 14.377  -12.806 1.00 10.00 ? 167 ALA A HB3    1  
ATOM 1181  N N      . ASP B 2 81  ? -13.304 13.233  -13.219 1.00 10.00 ? 168 ASP A N      1  
ATOM 1182  C CA     . ASP B 2 81  ? -12.703 12.012  -13.762 1.00 10.00 ? 168 ASP A CA     1  
ATOM 1183  C C      . ASP B 2 81  ? -11.993 11.172  -12.685 1.00 10.00 ? 168 ASP A C      1  
ATOM 1184  O O      . ASP B 2 81  ? -12.055 9.947   -12.727 1.00 10.00 ? 168 ASP A O      1  
ATOM 1185  C CB     . ASP B 2 81  ? -11.744 12.358  -14.904 1.00 10.00 ? 168 ASP A CB     1  
ATOM 1186  C CG     . ASP B 2 81  ? -11.289 11.087  -15.638 1.00 10.00 ? 168 ASP A CG     1  
ATOM 1187  O OD1    . ASP B 2 81  ? -12.159 10.352  -16.160 1.00 10.00 ? 168 ASP A OD1    1  
ATOM 1188  O OD2    . ASP B 2 81  ? -10.063 10.845  -15.715 1.00 10.00 ? 168 ASP A OD2    1  
ATOM 1189  H H      . ASP B 2 81  ? -12.943 14.139  -13.488 1.00 10.00 ? 168 ASP A H      1  
ATOM 1190  H HA     . ASP B 2 81  ? -13.504 11.405  -14.176 1.00 10.00 ? 168 ASP A HA     1  
ATOM 1191  H HB2    . ASP B 2 81  ? -12.257 13.010  -15.613 1.00 10.00 ? 168 ASP A HB2    1  
ATOM 1192  H HB3    . ASP B 2 81  ? -10.882 12.895  -14.500 1.00 10.00 ? 168 ASP A HB3    1  
ATOM 1193  N N      . ALA B 2 82  ? -11.369 11.812  -11.690 1.00 10.00 ? 169 ALA A N      1  
ATOM 1194  C CA     . ALA B 2 82  ? -10.787 11.135  -10.529 1.00 10.00 ? 169 ALA A CA     1  
ATOM 1195  C C      . ALA B 2 82  ? -11.859 10.574  -9.573  1.00 10.00 ? 169 ALA A C      1  
ATOM 1196  O O      . ALA B 2 82  ? -11.689 9.478   -9.039  1.00 10.00 ? 169 ALA A O      1  
ATOM 1197  C CB     . ALA B 2 82  ? -9.851  12.106  -9.805  1.00 10.00 ? 169 ALA A CB     1  
ATOM 1198  H H      . ALA B 2 82  ? -11.412 12.820  -11.687 1.00 10.00 ? 169 ALA A H      1  
ATOM 1199  H HA     . ALA B 2 82  ? -10.183 10.301  -10.888 1.00 10.00 ? 169 ALA A HA     1  
ATOM 1200  H HB1    . ALA B 2 82  ? -9.107  12.494  -10.502 1.00 10.00 ? 169 ALA A HB1    1  
ATOM 1201  H HB2    . ALA B 2 82  ? -10.419 12.929  -9.373  1.00 10.00 ? 169 ALA A HB2    1  
ATOM 1202  H HB3    . ALA B 2 82  ? -9.336  11.566  -9.011  1.00 10.00 ? 169 ALA A HB3    1  
ATOM 1203  N N      . ASP B 2 83  ? -12.985 11.280  -9.389  1.00 10.00 ? 170 ASP A N      1  
ATOM 1204  C CA     . ASP B 2 83  ? -14.183 10.754  -8.717  1.00 10.00 ? 170 ASP A CA     1  
ATOM 1205  C C      . ASP B 2 83  ? -14.703 9.497   -9.431  1.00 10.00 ? 170 ASP A C      1  
ATOM 1206  O O      . ASP B 2 83  ? -14.741 8.424   -8.833  1.00 10.00 ? 170 ASP A O      1  
ATOM 1207  C CB     . ASP B 2 83  ? -15.264 11.847  -8.629  1.00 10.00 ? 170 ASP A CB     1  
ATOM 1208  C CG     . ASP B 2 83  ? -16.511 11.390  -7.857  1.00 10.00 ? 170 ASP A CG     1  
ATOM 1209  O OD1    . ASP B 2 83  ? -17.446 10.837  -8.479  1.00 10.00 ? 170 ASP A OD1    1  
ATOM 1210  O OD2    . ASP B 2 83  ? -16.556 11.584  -6.620  1.00 10.00 ? 170 ASP A OD2    1  
ATOM 1211  H H      . ASP B 2 83  ? -13.020 12.203  -9.809  1.00 10.00 ? 170 ASP A H      1  
ATOM 1212  H HA     . ASP B 2 83  ? -13.908 10.469  -7.701  1.00 10.00 ? 170 ASP A HA     1  
ATOM 1213  H HB2    . ASP B 2 83  ? -14.840 12.722  -8.137  1.00 10.00 ? 170 ASP A HB2    1  
ATOM 1214  H HB3    . ASP B 2 83  ? -15.569 12.136  -9.632  1.00 10.00 ? 170 ASP A HB3    1  
ATOM 1215  N N      . ARG B 2 84  ? -15.013 9.593   -10.731 1.00 10.00 ? 171 ARG A N      1  
ATOM 1216  C CA     . ARG B 2 84  ? -15.410 8.482   -11.614 1.00 10.00 ? 171 ARG A CA     1  
ATOM 1217  C C      . ARG B 2 84  ? -14.455 7.291   -11.520 1.00 10.00 ? 171 ARG A C      1  
ATOM 1218  O O      . ARG B 2 84  ? -14.888 6.150   -11.373 1.00 10.00 ? 171 ARG A O      1  
ATOM 1219  C CB     . ARG B 2 84  ? -15.541 9.038   -13.045 1.00 10.00 ? 171 ARG A CB     1  
ATOM 1220  C CG     . ARG B 2 84  ? -15.942 7.990   -14.102 1.00 10.00 ? 171 ARG A CG     1  
ATOM 1221  C CD     . ARG B 2 84  ? -14.752 7.361   -14.846 1.00 10.00 ? 171 ARG A CD     1  
ATOM 1222  N NE     . ARG B 2 84  ? -14.193 8.266   -15.873 1.00 10.00 ? 171 ARG A NE     1  
ATOM 1223  C CZ     . ARG B 2 84  ? -14.563 8.382   -17.136 1.00 10.00 ? 171 ARG A CZ     1  
ATOM 1224  N NH1    . ARG B 2 84  ? -15.537 7.688   -17.655 1.00 10.00 ? 171 ARG A NH1    1  
ATOM 1225  N NH2    . ARG B 2 84  ? -13.943 9.224   -17.904 1.00 10.00 ? 171 ARG A NH2    1  
ATOM 1226  H H      . ARG B 2 84  ? -14.948 10.525  -11.133 1.00 10.00 ? 171 ARG A H      1  
ATOM 1227  H HA     . ARG B 2 84  ? -16.385 8.120   -11.292 1.00 10.00 ? 171 ARG A HA     1  
ATOM 1228  H HB2    . ARG B 2 84  ? -16.315 9.793   -13.006 1.00 10.00 ? 171 ARG A HB2    1  
ATOM 1229  H HB3    . ARG B 2 84  ? -14.639 9.567   -13.351 1.00 10.00 ? 171 ARG A HB3    1  
ATOM 1230  H HG2    . ARG B 2 84  ? -16.518 7.199   -13.625 1.00 10.00 ? 171 ARG A HG2    1  
ATOM 1231  H HG3    . ARG B 2 84  ? -16.591 8.466   -14.837 1.00 10.00 ? 171 ARG A HG3    1  
ATOM 1232  H HD2    . ARG B 2 84  ? -13.965 7.099   -14.139 1.00 10.00 ? 171 ARG A HD2    1  
ATOM 1233  H HD3    . ARG B 2 84  ? -15.085 6.434   -15.319 1.00 10.00 ? 171 ARG A HD3    1  
ATOM 1234  H HE     . ARG B 2 84  ? -13.414 8.872   -15.630 1.00 10.00 ? 171 ARG A HE     1  
ATOM 1235  H HH11   . ARG B 2 84  ? -16.045 7.039   -17.078 1.00 10.00 ? 171 ARG A HH11   1  
ATOM 1236  H HH12   . ARG B 2 84  ? -15.795 7.808   -18.622 1.00 10.00 ? 171 ARG A HH12   1  
ATOM 1237  H HH21   . ARG B 2 84  ? -13.194 9.759   -17.462 1.00 10.00 ? 171 ARG A HH21   1  
ATOM 1238  H HH22   . ARG B 2 84  ? -14.195 9.367   -18.866 1.00 10.00 ? 171 ARG A HH22   1  
ATOM 1239  N N      . ALA B 2 85  ? -13.160 7.565   -11.586 1.00 10.00 ? 172 ALA A N      1  
ATOM 1240  C CA     . ALA B 2 85  ? -12.101 6.570   -11.418 1.00 10.00 ? 172 ALA A CA     1  
ATOM 1241  C C      . ALA B 2 85  ? -12.133 5.861   -10.049 1.00 10.00 ? 172 ALA A C      1  
ATOM 1242  O O      . ALA B 2 85  ? -12.170 4.632   -10.029 1.00 10.00 ? 172 ALA A O      1  
ATOM 1243  C CB     . ALA B 2 85  ? -10.752 7.213   -11.703 1.00 10.00 ? 172 ALA A CB     1  
ATOM 1244  H H      . ALA B 2 85  ? -12.944 8.531   -11.821 1.00 10.00 ? 172 ALA A H      1  
ATOM 1245  H HA     . ALA B 2 85  ? -12.260 5.794   -12.168 1.00 10.00 ? 172 ALA A HA     1  
ATOM 1246  H HB1    . ALA B 2 85  ? -10.717 7.508   -12.751 1.00 10.00 ? 172 ALA A HB1    1  
ATOM 1247  H HB2    . ALA B 2 85  ? -10.617 8.086   -11.076 1.00 10.00 ? 172 ALA A HB2    1  
ATOM 1248  H HB3    . ALA B 2 85  ? -9.962  6.488   -11.507 1.00 10.00 ? 172 ALA A HB3    1  
ATOM 1249  N N      . ARG B 2 86  ? -12.201 6.585   -8.920  1.00 10.00 ? 173 ARG A N      1  
ATOM 1250  C CA     . ARG B 2 86  ? -12.504 6.001   -7.595  1.00 10.00 ? 173 ARG A CA     1  
ATOM 1251  C C      . ARG B 2 86  ? -13.717 5.086   -7.684  1.00 10.00 ? 173 ARG A C      1  
ATOM 1252  O O      . ARG B 2 86  ? -13.604 3.904   -7.389  1.00 10.00 ? 173 ARG A O      1  
ATOM 1253  C CB     . ARG B 2 86  ? -12.658 7.119   -6.529  1.00 10.00 ? 173 ARG A CB     1  
ATOM 1254  C CG     . ARG B 2 86  ? -13.659 6.794   -5.395  1.00 10.00 ? 173 ARG A CG     1  
ATOM 1255  C CD     . ARG B 2 86  ? -13.484 7.635   -4.122  1.00 10.00 ? 173 ARG A CD     1  
ATOM 1256  N NE     . ARG B 2 86  ? -13.585 9.085   -4.335  1.00 10.00 ? 173 ARG A NE     1  
ATOM 1257  C CZ     . ARG B 2 86  ? -14.577 9.796   -4.828  1.00 10.00 ? 173 ARG A CZ     1  
ATOM 1258  N NH1    . ARG B 2 86  ? -15.720 9.315   -5.221  1.00 10.00 ? 173 ARG A NH1    1  
ATOM 1259  N NH2    . ARG B 2 86  ? -14.418 11.074  -4.942  1.00 10.00 ? 173 ARG A NH2    1  
ATOM 1260  H H      . ARG B 2 86  ? -12.164 7.597   -9.006  1.00 10.00 ? 173 ARG A H      1  
ATOM 1261  H HA     . ARG B 2 86  ? -11.698 5.321   -7.289  1.00 10.00 ? 173 ARG A HA     1  
ATOM 1262  H HB2    . ARG B 2 86  ? -11.675 7.311   -6.106  1.00 10.00 ? 173 ARG A HB2    1  
ATOM 1263  H HB3    . ARG B 2 86  ? -12.986 8.043   -7.003  1.00 10.00 ? 173 ARG A HB3    1  
ATOM 1264  H HG2    . ARG B 2 86  ? -14.672 6.928   -5.768  1.00 10.00 ? 173 ARG A HG2    1  
ATOM 1265  H HG3    . ARG B 2 86  ? -13.561 5.752   -5.105  1.00 10.00 ? 173 ARG A HG3    1  
ATOM 1266  H HD2    . ARG B 2 86  ? -14.230 7.323   -3.391  1.00 10.00 ? 173 ARG A HD2    1  
ATOM 1267  H HD3    . ARG B 2 86  ? -12.495 7.421   -3.712  1.00 10.00 ? 173 ARG A HD3    1  
ATOM 1268  H HE     . ARG B 2 86  ? -12.801 9.668   -4.042  1.00 10.00 ? 173 ARG A HE     1  
ATOM 1269  H HH11   . ARG B 2 86  ? -15.959 8.338   -5.132  1.00 10.00 ? 173 ARG A HH11   1  
ATOM 1270  H HH12   . ARG B 2 86  ? -16.351 9.974   -5.663  1.00 10.00 ? 173 ARG A HH12   1  
ATOM 1271  H HH21   . ARG B 2 86  ? -13.556 11.473  -4.569  1.00 10.00 ? 173 ARG A HH21   1  
ATOM 1272  H HH22   . ARG B 2 86  ? -15.146 11.610  -5.402  1.00 10.00 ? 173 ARG A HH22   1  
ATOM 1273  N N      . GLU B 2 87  ? -14.854 5.596   -8.132  1.00 10.00 ? 174 GLU A N      1  
ATOM 1274  C CA     . GLU B 2 87  ? -16.109 4.856   -8.198  1.00 10.00 ? 174 GLU A CA     1  
ATOM 1275  C C      . GLU B 2 87  ? -16.040 3.590   -9.069  1.00 10.00 ? 174 GLU A C      1  
ATOM 1276  O O      . GLU B 2 87  ? -16.785 2.639   -8.829  1.00 10.00 ? 174 GLU A O      1  
ATOM 1277  C CB     . GLU B 2 87  ? -17.199 5.795   -8.714  1.00 10.00 ? 174 GLU A CB     1  
ATOM 1278  C CG     . GLU B 2 87  ? -17.447 7.023   -7.831  1.00 10.00 ? 174 GLU A CG     1  
ATOM 1279  C CD     . GLU B 2 87  ? -18.234 6.698   -6.547  1.00 10.00 ? 174 GLU A CD     1  
ATOM 1280  O OE1    . GLU B 2 87  ? -19.453 6.405   -6.622  1.00 10.00 ? 174 GLU A OE1    1  
ATOM 1281  O OE2    . GLU B 2 87  ? -17.623 6.753   -5.451  1.00 10.00 ? 174 GLU A OE2    1  
ATOM 1282  H H      . GLU B 2 87  ? -14.872 6.586   -8.357  1.00 10.00 ? 174 GLU A H      1  
ATOM 1283  H HA     . GLU B 2 87  ? -16.357 4.520   -7.195  1.00 10.00 ? 174 GLU A HA     1  
ATOM 1284  H HB2    . GLU B 2 87  ? -16.924 6.137   -9.711  1.00 10.00 ? 174 GLU A HB2    1  
ATOM 1285  H HB3    . GLU B 2 87  ? -18.123 5.238   -8.812  1.00 10.00 ? 174 GLU A HB3    1  
ATOM 1286  H HG2    . GLU B 2 87  ? -16.506 7.480   -7.542  1.00 10.00 ? 174 GLU A HG2    1  
ATOM 1287  H HG3    . GLU B 2 87  ? -17.967 7.760   -8.443  1.00 10.00 ? 174 GLU A HG3    1  
ATOM 1288  N N      . LYS B 2 88  ? -15.120 3.549   -10.041 1.00 10.00 ? 175 LYS A N      1  
ATOM 1289  C CA     . LYS B 2 88  ? -14.782 2.380   -10.846 1.00 10.00 ? 175 LYS A CA     1  
ATOM 1290  C C      . LYS B 2 88  ? -13.873 1.384   -10.088 1.00 10.00 ? 175 LYS A C      1  
ATOM 1291  O O      . LYS B 2 88  ? -14.201 0.197   -10.065 1.00 10.00 ? 175 LYS A O      1  
ATOM 1292  C CB     . LYS B 2 88  ? -14.230 2.944   -12.169 1.00 10.00 ? 175 LYS A CB     1  
ATOM 1293  C CG     . LYS B 2 88  ? -13.382 1.982   -12.987 1.00 10.00 ? 175 LYS A CG     1  
ATOM 1294  C CD     . LYS B 2 88  ? -14.092 0.720   -13.505 1.00 10.00 ? 175 LYS A CD     1  
ATOM 1295  C CE     . LYS B 2 88  ? -15.178 1.061   -14.533 1.00 10.00 ? 175 LYS A CE     1  
ATOM 1296  N NZ     . LYS B 2 88  ? -15.835 -0.167  -15.055 1.00 10.00 ? 175 LYS A NZ     1  
ATOM 1297  H H      . LYS B 2 88  ? -14.572 4.380   -10.248 1.00 10.00 ? 175 LYS A H      1  
ATOM 1298  H HA     . LYS B 2 88  ? -15.700 1.837   -11.072 1.00 10.00 ? 175 LYS A HA     1  
ATOM 1299  H HB2    . LYS B 2 88  ? -15.060 3.310   -12.775 1.00 10.00 ? 175 LYS A HB2    1  
ATOM 1300  H HB3    . LYS B 2 88  ? -13.590 3.799   -11.956 1.00 10.00 ? 175 LYS A HB3    1  
ATOM 1301  H HG2    . LYS B 2 88  ? -12.958 2.533   -13.827 1.00 10.00 ? 175 LYS A HG2    1  
ATOM 1302  H HG3    . LYS B 2 88  ? -12.569 1.710   -12.328 1.00 10.00 ? 175 LYS A HG3    1  
ATOM 1303  H HD2    . LYS B 2 88  ? -13.344 0.076   -13.968 1.00 10.00 ? 175 LYS A HD2    1  
ATOM 1304  H HD3    . LYS B 2 88  ? -14.541 0.177   -12.674 1.00 10.00 ? 175 LYS A HD3    1  
ATOM 1305  H HE2    . LYS B 2 88  ? -15.919 1.714   -14.061 1.00 10.00 ? 175 LYS A HE2    1  
ATOM 1306  H HE3    . LYS B 2 88  ? -14.723 1.615   -15.360 1.00 10.00 ? 175 LYS A HE3    1  
ATOM 1307  H HZ1    . LYS B 2 88  ? -15.168 -0.772  -15.514 1.00 10.00 ? 175 LYS A HZ1    1  
ATOM 1308  H HZ2    . LYS B 2 88  ? -16.272 -0.696  -14.313 1.00 10.00 ? 175 LYS A HZ2    1  
ATOM 1309  H HZ3    . LYS B 2 88  ? -16.555 0.062   -15.731 1.00 10.00 ? 175 LYS A HZ3    1  
ATOM 1310  N N      . LEU B 2 89  ? -12.758 1.797   -9.461  1.00 10.00 ? 176 LEU A N      1  
ATOM 1311  C CA     . LEU B 2 89  ? -11.842 0.888   -8.776  1.00 10.00 ? 176 LEU A CA     1  
ATOM 1312  C C      . LEU B 2 89  ? -12.344 0.424   -7.396  1.00 10.00 ? 176 LEU A C      1  
ATOM 1313  O O      . LEU B 2 89  ? -11.941 -0.625  -6.898  1.00 10.00 ? 176 LEU A O      1  
ATOM 1314  C CB     . LEU B 2 89  ? -10.451 1.528   -8.688  1.00 10.00 ? 176 LEU A CB     1  
ATOM 1315  C CG     . LEU B 2 89  ? -9.864  2.115   -9.984  1.00 10.00 ? 176 LEU A CG     1  
ATOM 1316  C CD1    . LEU B 2 89  ? -8.413  2.515   -9.770  1.00 10.00 ? 176 LEU A CD1    1  
ATOM 1317  C CD2    . LEU B 2 89  ? -9.860  1.135   -11.161 1.00 10.00 ? 176 LEU A CD2    1  
ATOM 1318  H H      . LEU B 2 89  ? -12.449 2.758   -9.443  1.00 10.00 ? 176 LEU A H      1  
ATOM 1319  H HA     . LEU B 2 89  ? -11.735 0.001   -9.385  1.00 10.00 ? 176 LEU A HA     1  
ATOM 1320  H HB2    . LEU B 2 89  ? -10.413 2.275   -7.904  1.00 10.00 ? 176 LEU A HB2    1  
ATOM 1321  H HB3    . LEU B 2 89  ? -9.812  0.735   -8.375  1.00 10.00 ? 176 LEU A HB3    1  
ATOM 1322  H HG     . LEU B 2 89  ? -10.410 3.020   -10.225 1.00 10.00 ? 176 LEU A HG     1  
ATOM 1323  H HD11   . LEU B 2 89  ? -8.352  3.155   -8.898  1.00 10.00 ? 176 LEU A HD11   1  
ATOM 1324  H HD12   . LEU B 2 89  ? -7.803  1.632   -9.606  1.00 10.00 ? 176 LEU A HD12   1  
ATOM 1325  H HD13   . LEU B 2 89  ? -8.044  3.058   -10.637 1.00 10.00 ? 176 LEU A HD13   1  
ATOM 1326  H HD21   . LEU B 2 89  ? -9.224  0.280   -10.933 1.00 10.00 ? 176 LEU A HD21   1  
ATOM 1327  H HD22   . LEU B 2 89  ? -10.864 0.767   -11.352 1.00 10.00 ? 176 LEU A HD22   1  
ATOM 1328  H HD23   . LEU B 2 89  ? -9.491  1.633   -12.055 1.00 10.00 ? 176 LEU A HD23   1  
ATOM 1329  N N      . HIS B 2 90  ? -13.269 1.169   -6.794  1.00 10.00 ? 177 HIS A N      1  
ATOM 1330  C CA     . HIS B 2 90  ? -14.012 0.833   -5.582  1.00 10.00 ? 177 HIS A CA     1  
ATOM 1331  C C      . HIS B 2 90  ? -15.039 -0.277  -5.882  1.00 10.00 ? 177 HIS A C      1  
ATOM 1332  O O      . HIS B 2 90  ? -16.169 -0.004  -6.291  1.00 10.00 ? 177 HIS A O      1  
ATOM 1333  C CB     . HIS B 2 90  ? -14.633 2.146   -5.066  1.00 10.00 ? 177 HIS A CB     1  
ATOM 1334  C CG     . HIS B 2 90  ? -15.017 2.207   -3.626  1.00 10.00 ? 177 HIS A CG     1  
ATOM 1335  N ND1    . HIS B 2 90  ? -15.016 1.143   -2.736  1.00 10.00 ? 177 HIS A ND1    1  
ATOM 1336  C CD2    . HIS B 2 90  ? -15.078 3.376   -2.933  1.00 10.00 ? 177 HIS A CD2    1  
ATOM 1337  C CE1    . HIS B 2 90  ? -15.074 1.707   -1.522  1.00 10.00 ? 177 HIS A CE1    1  
ATOM 1338  N NE2    . HIS B 2 90  ? -15.133 3.043   -1.601  1.00 10.00 ? 177 HIS A NE2    1  
ATOM 1339  H H      . HIS B 2 90  ? -13.501 2.049   -7.243  1.00 10.00 ? 177 HIS A H      1  
ATOM 1340  H HA     . HIS B 2 90  ? -13.317 0.457   -4.829  1.00 10.00 ? 177 HIS A HA     1  
ATOM 1341  H HB2    . HIS B 2 90  ? -13.888 2.920   -5.175  1.00 10.00 ? 177 HIS A HB2    1  
ATOM 1342  H HB3    . HIS B 2 90  ? -15.476 2.457   -5.669  1.00 10.00 ? 177 HIS A HB3    1  
ATOM 1343  H HD2    . HIS B 2 90  ? -14.911 4.358   -3.362  1.00 10.00 ? 177 HIS A HD2    1  
ATOM 1344  H HE1    . HIS B 2 90  ? -14.946 1.173   -0.608  1.00 10.00 ? 177 HIS A HE1    1  
ATOM 1345  H HE2    . HIS B 2 90  ? -15.093 3.663   -0.794  1.00 10.00 ? 177 HIS A HE2    1  
ATOM 1346  N N      . GLY B 2 91  ? -14.606 -1.537  -5.774  1.00 10.00 ? 178 GLY A N      1  
ATOM 1347  C CA     . GLY B 2 91  ? -15.303 -2.735  -6.261  1.00 10.00 ? 178 GLY A CA     1  
ATOM 1348  C C      . GLY B 2 91  ? -14.608 -3.449  -7.433  1.00 10.00 ? 178 GLY A C      1  
ATOM 1349  O O      . GLY B 2 91  ? -15.124 -4.457  -7.916  1.00 10.00 ? 178 GLY A O      1  
ATOM 1350  H H      . GLY B 2 91  ? -13.692 -1.683  -5.355  1.00 10.00 ? 178 GLY A H      1  
ATOM 1351  H HA2    . GLY B 2 91  ? -15.380 -3.442  -5.438  1.00 10.00 ? 178 GLY A HA2    1  
ATOM 1352  H HA3    . GLY B 2 91  ? -16.319 -2.489  -6.574  1.00 10.00 ? 178 GLY A HA3    1  
ATOM 1353  N N      . THR B 2 92  ? -13.441 -2.976  -7.894  1.00 10.00 ? 179 THR A N      1  
ATOM 1354  C CA     . THR B 2 92  ? -12.582 -3.684  -8.862  1.00 10.00 ? 179 THR A CA     1  
ATOM 1355  C C      . THR B 2 92  ? -11.996 -4.937  -8.223  1.00 10.00 ? 179 THR A C      1  
ATOM 1356  O O      . THR B 2 92  ? -11.290 -4.857  -7.213  1.00 10.00 ? 179 THR A O      1  
ATOM 1357  C CB     . THR B 2 92  ? -11.474 -2.771  -9.421  1.00 10.00 ? 179 THR A CB     1  
ATOM 1358  O OG1    . THR B 2 92  ? -12.015 -2.090  -10.536 1.00 10.00 ? 179 THR A OG1    1  
ATOM 1359  C CG2    . THR B 2 92  ? -10.191 -3.441  -9.916  1.00 10.00 ? 179 THR A CG2    1  
ATOM 1360  H H      . THR B 2 92  ? -13.045 -2.173  -7.413  1.00 10.00 ? 179 THR A H      1  
ATOM 1361  H HA     . THR B 2 92  ? -13.200 -4.002  -9.703  1.00 10.00 ? 179 THR A HA     1  
ATOM 1362  H HB     . THR B 2 92  ? -11.170 -2.063  -8.656  1.00 10.00 ? 179 THR A HB     1  
ATOM 1363  H HG1    . THR B 2 92  ? -12.849 -1.672  -10.260 1.00 10.00 ? 179 THR A HG1    1  
ATOM 1364  H HG21   . THR B 2 92  ? -9.645  -3.867  -9.072  1.00 10.00 ? 179 THR A HG21   1  
ATOM 1365  H HG22   . THR B 2 92  ? -10.422 -4.217  -10.645 1.00 10.00 ? 179 THR A HG22   1  
ATOM 1366  H HG23   . THR B 2 92  ? -9.555  -2.682  -10.372 1.00 10.00 ? 179 THR A HG23   1  
ATOM 1367  N N      . VAL B 2 93  ? -12.323 -6.093  -8.809  1.00 10.00 ? 180 VAL A N      1  
ATOM 1368  C CA     . VAL B 2 93  ? -11.809 -7.411  -8.416  1.00 10.00 ? 180 VAL A CA     1  
ATOM 1369  C C      . VAL B 2 93  ? -10.468 -7.680  -9.102  1.00 10.00 ? 180 VAL A C      1  
ATOM 1370  O O      . VAL B 2 93  ? -10.392 -7.810  -10.324 1.00 10.00 ? 180 VAL A O      1  
ATOM 1371  C CB     . VAL B 2 93  ? -12.822 -8.536  -8.679  1.00 10.00 ? 180 VAL A CB     1  
ATOM 1372  C CG1    . VAL B 2 93  ? -12.300 -9.908  -8.226  1.00 10.00 ? 180 VAL A CG1    1  
ATOM 1373  C CG2    . VAL B 2 93  ? -14.104 -8.264  -7.880  1.00 10.00 ? 180 VAL A CG2    1  
ATOM 1374  H H      . VAL B 2 93  ? -12.935 -6.049  -9.612  1.00 10.00 ? 180 VAL A H      1  
ATOM 1375  H HA     . VAL B 2 93  ? -11.654 -7.397  -7.347  1.00 10.00 ? 180 VAL A HA     1  
ATOM 1376  H HB     . VAL B 2 93  ? -13.053 -8.584  -9.738  1.00 10.00 ? 180 VAL A HB     1  
ATOM 1377  H HG11   . VAL B 2 93  ? -11.400 -10.173 -8.777  1.00 10.00 ? 180 VAL A HG11   1  
ATOM 1378  H HG12   . VAL B 2 93  ? -12.087 -9.896  -7.157  1.00 10.00 ? 180 VAL A HG12   1  
ATOM 1379  H HG13   . VAL B 2 93  ? -13.050 -10.673 -8.427  1.00 10.00 ? 180 VAL A HG13   1  
ATOM 1380  H HG21   . VAL B 2 93  ? -13.853 -8.206  -6.822  1.00 10.00 ? 180 VAL A HG21   1  
ATOM 1381  H HG22   . VAL B 2 93  ? -14.559 -7.315  -8.175  1.00 10.00 ? 180 VAL A HG22   1  
ATOM 1382  H HG23   . VAL B 2 93  ? -14.825 -9.064  -8.040  1.00 10.00 ? 180 VAL A HG23   1  
ATOM 1383  N N      . VAL B 2 94  ? -9.411  -7.762  -8.299  1.00 10.00 ? 181 VAL A N      1  
ATOM 1384  C CA     . VAL B 2 94  ? -8.025  -8.043  -8.699  1.00 10.00 ? 181 VAL A CA     1  
ATOM 1385  C C      . VAL B 2 94  ? -7.444  -9.108  -7.768  1.00 10.00 ? 181 VAL A C      1  
ATOM 1386  O O      . VAL B 2 94  ? -7.706  -9.088  -6.568  1.00 10.00 ? 181 VAL A O      1  
ATOM 1387  C CB     . VAL B 2 94  ? -7.223  -6.726  -8.685  1.00 10.00 ? 181 VAL A CB     1  
ATOM 1388  C CG1    . VAL B 2 94  ? -6.977  -6.206  -7.263  1.00 10.00 ? 181 VAL A CG1    1  
ATOM 1389  C CG2    . VAL B 2 94  ? -5.882  -6.865  -9.410  1.00 10.00 ? 181 VAL A CG2    1  
ATOM 1390  H H      . VAL B 2 94  ? -9.573  -7.595  -7.310  1.00 10.00 ? 181 VAL A H      1  
ATOM 1391  H HA     . VAL B 2 94  ? -8.017  -8.433  -9.717  1.00 10.00 ? 181 VAL A HA     1  
ATOM 1392  H HB     . VAL B 2 94  ? -7.802  -5.972  -9.225  1.00 10.00 ? 181 VAL A HB     1  
ATOM 1393  H HG11   . VAL B 2 94  ? -7.909  -6.203  -6.701  1.00 10.00 ? 181 VAL A HG11   1  
ATOM 1394  H HG12   . VAL B 2 94  ? -6.250  -6.846  -6.762  1.00 10.00 ? 181 VAL A HG12   1  
ATOM 1395  H HG13   . VAL B 2 94  ? -6.617  -5.181  -7.312  1.00 10.00 ? 181 VAL A HG13   1  
ATOM 1396  H HG21   . VAL B 2 94  ? -5.237  -7.579  -8.895  1.00 10.00 ? 181 VAL A HG21   1  
ATOM 1397  H HG22   . VAL B 2 94  ? -6.049  -7.202  -10.432 1.00 10.00 ? 181 VAL A HG22   1  
ATOM 1398  H HG23   . VAL B 2 94  ? -5.384  -5.895  -9.449  1.00 10.00 ? 181 VAL A HG23   1  
ATOM 1399  N N      . GLU B 2 95  ? -6.715  -10.089 -8.301  1.00 10.00 ? 182 GLU A N      1  
ATOM 1400  C CA     . GLU B 2 95  ? -6.264  -11.288 -7.567  1.00 10.00 ? 182 GLU A CA     1  
ATOM 1401  C C      . GLU B 2 95  ? -7.381  -12.041 -6.792  1.00 10.00 ? 182 GLU A C      1  
ATOM 1402  O O      . GLU B 2 95  ? -7.119  -12.740 -5.810  1.00 10.00 ? 182 GLU A O      1  
ATOM 1403  C CB     . GLU B 2 95  ? -5.058  -10.958 -6.660  1.00 10.00 ? 182 GLU A CB     1  
ATOM 1404  C CG     . GLU B 2 95  ? -3.868  -10.271 -7.340  1.00 10.00 ? 182 GLU A CG     1  
ATOM 1405  C CD     . GLU B 2 95  ? -3.282  -11.135 -8.474  1.00 10.00 ? 182 GLU A CD     1  
ATOM 1406  O OE1    . GLU B 2 95  ? -2.457  -12.038 -8.189  1.00 10.00 ? 182 GLU A OE1    1  
ATOM 1407  O OE2    . GLU B 2 95  ? -3.650  -10.929 -9.657  1.00 10.00 ? 182 GLU A OE2    1  
ATOM 1408  H H      . GLU B 2 95  ? -6.501  -10.038 -9.288  1.00 10.00 ? 182 GLU A H      1  
ATOM 1409  H HA     . GLU B 2 95  ? -5.913  -11.993 -8.314  1.00 10.00 ? 182 GLU A HA     1  
ATOM 1410  H HB2    . GLU B 2 95  ? -5.400  -10.331 -5.846  1.00 10.00 ? 182 GLU A HB2    1  
ATOM 1411  H HB3    . GLU B 2 95  ? -4.686  -11.874 -6.212  1.00 10.00 ? 182 GLU A HB3    1  
ATOM 1412  H HG2    . GLU B 2 95  ? -4.175  -9.294  -7.720  1.00 10.00 ? 182 GLU A HG2    1  
ATOM 1413  H HG3    . GLU B 2 95  ? -3.096  -10.092 -6.586  1.00 10.00 ? 182 GLU A HG3    1  
ATOM 1414  N N      . GLY B 2 96  ? -8.643  -11.894 -7.219  1.00 10.00 ? 183 GLY A N      1  
ATOM 1415  C CA     . GLY B 2 96  ? -9.822  -12.412 -6.514  1.00 10.00 ? 183 GLY A CA     1  
ATOM 1416  C C      . GLY B 2 96  ? -10.188 -11.604 -5.256  1.00 10.00 ? 183 GLY A C      1  
ATOM 1417  O O      . GLY B 2 96  ? -10.514 -12.184 -4.215  1.00 10.00 ? 183 GLY A O      1  
ATOM 1418  H H      . GLY B 2 96  ? -8.775  -11.341 -8.054  1.00 10.00 ? 183 GLY A H      1  
ATOM 1419  H HA2    . GLY B 2 96  ? -10.673 -12.399 -7.193  1.00 10.00 ? 183 GLY A HA2    1  
ATOM 1420  H HA3    . GLY B 2 96  ? -9.643  -13.447 -6.220  1.00 10.00 ? 183 GLY A HA3    1  
ATOM 1421  N N      . ARG B 2 97  ? -10.094 -10.270 -5.311  1.00 10.00 ? 184 ARG A N      1  
ATOM 1422  C CA     . ARG B 2 97  ? -10.280 -9.339  -4.191  1.00 10.00 ? 184 ARG A CA     1  
ATOM 1423  C C      . ARG B 2 97  ? -10.828 -8.014  -4.669  1.00 10.00 ? 184 ARG A C      1  
ATOM 1424  O O      . ARG B 2 97  ? -10.243 -7.418  -5.570  1.00 10.00 ? 184 ARG A O      1  
ATOM 1425  C CB     . ARG B 2 97  ? -8.915  -9.019  -3.576  1.00 10.00 ? 184 ARG A CB     1  
ATOM 1426  C CG     . ARG B 2 97  ? -9.031  -8.639  -2.105  1.00 10.00 ? 184 ARG A CG     1  
ATOM 1427  C CD     . ARG B 2 97  ? -9.248  -9.834  -1.164  1.00 10.00 ? 184 ARG A CD     1  
ATOM 1428  N NE     . ARG B 2 97  ? -7.998  -10.584 -0.936  1.00 10.00 ? 184 ARG A NE     1  
ATOM 1429  C CZ     . ARG B 2 97  ? -7.559  -11.690 -1.506  1.00 10.00 ? 184 ARG A CZ     1  
ATOM 1430  N NH1    . ARG B 2 97  ? -8.207  -12.330 -2.437  1.00 10.00 ? 184 ARG A NH1    1  
ATOM 1431  N NH2    . ARG B 2 97  ? -6.412  -12.174 -1.132  1.00 10.00 ? 184 ARG A NH2    1  
ATOM 1432  H H      . ARG B 2 97  ? -9.803  -9.839  -6.175  1.00 10.00 ? 184 ARG A H      1  
ATOM 1433  H HA     . ARG B 2 97  ? -10.960 -9.774  -3.453  1.00 10.00 ? 184 ARG A HA     1  
ATOM 1434  H HB2    . ARG B 2 97  ? -8.242  -9.839  -3.722  1.00 10.00 ? 184 ARG A HB2    1  
ATOM 1435  H HB3    . ARG B 2 97  ? -8.447  -8.183  -4.095  1.00 10.00 ? 184 ARG A HB3    1  
ATOM 1436  H HG2    . ARG B 2 97  ? -8.106  -8.147  -1.832  1.00 10.00 ? 184 ARG A HG2    1  
ATOM 1437  H HG3    . ARG B 2 97  ? -9.849  -7.917  -1.997  1.00 10.00 ? 184 ARG A HG3    1  
ATOM 1438  H HD2    . ARG B 2 97  ? -9.590  -9.443  -0.202  1.00 10.00 ? 184 ARG A HD2    1  
ATOM 1439  H HD3    . ARG B 2 97  ? -10.030 -10.491 -1.548  1.00 10.00 ? 184 ARG A HD3    1  
ATOM 1440  H HE     . ARG B 2 97  ? -7.367  -10.220 -0.234  1.00 10.00 ? 184 ARG A HE     1  
ATOM 1441  H HH11   . ARG B 2 97  ? -9.106  -11.999 -2.765  1.00 10.00 ? 184 ARG A HH11   1  
ATOM 1442  H HH12   . ARG B 2 97  ? -7.795  -13.133 -2.878  1.00 10.00 ? 184 ARG A HH12   1  
ATOM 1443  H HH21   . ARG B 2 97  ? -5.920  -11.701 -0.381  1.00 10.00 ? 184 ARG A HH21   1  
ATOM 1444  H HH22   . ARG B 2 97  ? -6.052  -13.026 -1.525  1.00 10.00 ? 184 ARG A HH22   1  
ATOM 1445  N N      . LYS B 2 98  ? -11.877 -7.508  -4.031  1.00 10.00 ? 185 LYS A N      1  
ATOM 1446  C CA     . LYS B 2 98  ? -12.324 -6.149  -4.269  1.00 10.00 ? 185 LYS A CA     1  
ATOM 1447  C C      . LYS B 2 98  ? -11.475 -5.109  -3.539  1.00 10.00 ? 185 LYS A C      1  
ATOM 1448  O O      . LYS B 2 98  ? -11.434 -5.119  -2.306  1.00 10.00 ? 185 LYS A O      1  
ATOM 1449  C CB     . LYS B 2 98  ? -13.799 -6.007  -3.880  1.00 10.00 ? 185 LYS A CB     1  
ATOM 1450  C CG     . LYS B 2 98  ? -14.782 -6.656  -4.851  1.00 10.00 ? 185 LYS A CG     1  
ATOM 1451  C CD     . LYS B 2 98  ? -16.242 -6.370  -4.464  1.00 10.00 ? 185 LYS A CD     1  
ATOM 1452  C CE     . LYS B 2 98  ? -17.221 -6.862  -5.539  1.00 10.00 ? 185 LYS A CE     1  
ATOM 1453  N NZ     . LYS B 2 98  ? -17.311 -8.348  -5.595  1.00 10.00 ? 185 LYS A NZ     1  
ATOM 1454  H H      . LYS B 2 98  ? -12.333 -8.030  -3.305  1.00 10.00 ? 185 LYS A H      1  
ATOM 1455  H HA     . LYS B 2 98  ? -12.164 -5.992  -5.322  1.00 10.00 ? 185 LYS A HA     1  
ATOM 1456  H HB2    . LYS B 2 98  ? -13.966 -6.376  -2.868  1.00 10.00 ? 185 LYS A HB2    1  
ATOM 1457  H HB3    . LYS B 2 98  ? -14.007 -4.957  -3.908  1.00 10.00 ? 185 LYS A HB3    1  
ATOM 1458  H HG2    . LYS B 2 98  ? -14.597 -6.229  -5.836  1.00 10.00 ? 185 LYS A HG2    1  
ATOM 1459  H HG3    . LYS B 2 98  ? -14.619 -7.734  -4.853  1.00 10.00 ? 185 LYS A HG3    1  
ATOM 1460  H HD2    . LYS B 2 98  ? -16.468 -6.842  -3.506  1.00 10.00 ? 185 LYS A HD2    1  
ATOM 1461  H HD3    . LYS B 2 98  ? -16.376 -5.292  -4.350  1.00 10.00 ? 185 LYS A HD3    1  
ATOM 1462  H HE2    . LYS B 2 98  ? -18.210 -6.446  -5.316  1.00 10.00 ? 185 LYS A HE2    1  
ATOM 1463  H HE3    . LYS B 2 98  ? -16.907 -6.465  -6.508  1.00 10.00 ? 185 LYS A HE3    1  
ATOM 1464  H HZ1    . LYS B 2 98  ? -16.426 -8.771  -5.831  1.00 10.00 ? 185 LYS A HZ1    1  
ATOM 1465  H HZ2    . LYS B 2 98  ? -17.613 -8.730  -4.709  1.00 10.00 ? 185 LYS A HZ2    1  
ATOM 1466  H HZ3    . LYS B 2 98  ? -17.981 -8.640  -6.294  1.00 10.00 ? 185 LYS A HZ3    1  
ATOM 1467  N N      . ILE B 2 99  ? -10.846 -4.193  -4.275  1.00 10.00 ? 186 ILE A N      1  
ATOM 1468  C CA     . ILE B 2 99  ? -10.320 -2.949  -3.683  1.00 10.00 ? 186 ILE A CA     1  
ATOM 1469  C C      . ILE B 2 99  ? -11.487 -2.061  -3.216  1.00 10.00 ? 186 ILE A C      1  
ATOM 1470  O O      . ILE B 2 99  ? -12.531 -2.004  -3.866  1.00 10.00 ? 186 ILE A O      1  
ATOM 1471  C CB     . ILE B 2 99  ? -9.403  -2.193  -4.675  1.00 10.00 ? 186 ILE A CB     1  
ATOM 1472  C CG1    . ILE B 2 99  ? -8.185  -3.063  -5.051  1.00 10.00 ? 186 ILE A CG1    1  
ATOM 1473  C CG2    . ILE B 2 99  ? -8.936  -0.851  -4.089  1.00 10.00 ? 186 ILE A CG2    1  
ATOM 1474  C CD1    . ILE B 2 99  ? -7.112  -2.305  -5.840  1.00 10.00 ? 186 ILE A CD1    1  
ATOM 1475  H H      . ILE B 2 99  ? -10.923 -4.275  -5.285  1.00 10.00 ? 186 ILE A H      1  
ATOM 1476  H HA     . ILE B 2 99  ? -9.728  -3.207  -2.803  1.00 10.00 ? 186 ILE A HA     1  
ATOM 1477  H HB     . ILE B 2 99  ? -9.961  -1.971  -5.582  1.00 10.00 ? 186 ILE A HB     1  
ATOM 1478  H HG12   . ILE B 2 99  ? -7.726  -3.466  -4.150  1.00 10.00 ? 186 ILE A HG12   1  
ATOM 1479  H HG13   . ILE B 2 99  ? -8.527  -3.897  -5.659  1.00 10.00 ? 186 ILE A HG13   1  
ATOM 1480  H HG21   . ILE B 2 99  ? -9.794  -0.233  -3.859  1.00 10.00 ? 186 ILE A HG21   1  
ATOM 1481  H HG22   . ILE B 2 99  ? -8.344  -1.009  -3.188  1.00 10.00 ? 186 ILE A HG22   1  
ATOM 1482  H HG23   . ILE B 2 99  ? -8.353  -0.297  -4.823  1.00 10.00 ? 186 ILE A HG23   1  
ATOM 1483  H HD11   . ILE B 2 99  ? -7.585  -1.663  -6.593  1.00 10.00 ? 186 ILE A HD11   1  
ATOM 1484  H HD12   . ILE B 2 99  ? -6.511  -1.691  -5.165  1.00 10.00 ? 186 ILE A HD12   1  
ATOM 1485  H HD13   . ILE B 2 99  ? -6.455  -3.027  -6.320  1.00 10.00 ? 186 ILE A HD13   1  
ATOM 1486  N N      . GLU B 2 100 ? -11.291 -1.328  -2.118  1.00 10.00 ? 187 GLU A N      1  
ATOM 1487  C CA     . GLU B 2 100 ? -12.219 -0.331  -1.570  1.00 10.00 ? 187 GLU A CA     1  
ATOM 1488  C C      . GLU B 2 100 ? -11.569 1.064   -1.520  1.00 10.00 ? 187 GLU A C      1  
ATOM 1489  O O      . GLU B 2 100 ? -10.820 1.345   -0.579  1.00 10.00 ? 187 GLU A O      1  
ATOM 1490  C CB     . GLU B 2 100 ? -12.687 -0.766  -0.170  1.00 10.00 ? 187 GLU A CB     1  
ATOM 1491  C CG     . GLU B 2 100 ? -13.426 -2.105  -0.160  1.00 10.00 ? 187 GLU A CG     1  
ATOM 1492  C CD     . GLU B 2 100 ? -14.106 -2.349  1.201   1.00 10.00 ? 187 GLU A CD     1  
ATOM 1493  O OE1    . GLU B 2 100 ? -13.430 -2.823  2.147   1.00 10.00 ? 187 GLU A OE1    1  
ATOM 1494  O OE2    . GLU B 2 100 ? -15.321 -2.063  1.332   1.00 10.00 ? 187 GLU A OE2    1  
ATOM 1495  H H      . GLU B 2 100 ? -10.411 -1.468  -1.628  1.00 10.00 ? 187 GLU A H      1  
ATOM 1496  H HA     . GLU B 2 100 ? -13.093 -0.278  -2.209  1.00 10.00 ? 187 GLU A HA     1  
ATOM 1497  H HB2    . GLU B 2 100 ? -11.823 -0.856  0.482   1.00 10.00 ? 187 GLU A HB2    1  
ATOM 1498  H HB3    . GLU B 2 100 ? -13.338 0.003   0.241   1.00 10.00 ? 187 GLU A HB3    1  
ATOM 1499  H HG2    . GLU B 2 100 ? -14.171 -2.099  -0.959  1.00 10.00 ? 187 GLU A HG2    1  
ATOM 1500  H HG3    . GLU B 2 100 ? -12.705 -2.900  -0.362  1.00 10.00 ? 187 GLU A HG3    1  
ATOM 1501  N N      . VAL B 2 101 ? -11.800 1.942   -2.514  1.00 10.00 ? 188 VAL A N      1  
ATOM 1502  C CA     . VAL B 2 101 ? -11.124 3.260   -2.581  1.00 10.00 ? 188 VAL A CA     1  
ATOM 1503  C C      . VAL B 2 101 ? -11.949 4.400   -1.991  1.00 10.00 ? 188 VAL A C      1  
ATOM 1504  O O      . VAL B 2 101 ? -12.762 5.041   -2.648  1.00 10.00 ? 188 VAL A O      1  
ATOM 1505  C CB     . VAL B 2 101 ? -10.436 3.609   -3.921  1.00 10.00 ? 188 VAL A CB     1  
ATOM 1506  C CG1    . VAL B 2 101 ? -9.850  2.381   -4.617  1.00 10.00 ? 188 VAL A CG1    1  
ATOM 1507  C CG2    . VAL B 2 101 ? -11.171 4.432   -4.948  1.00 10.00 ? 188 VAL A CG2    1  
ATOM 1508  H H      . VAL B 2 101 ? -12.468 1.694   -3.229  1.00 10.00 ? 188 VAL A H      1  
ATOM 1509  H HA     . VAL B 2 101 ? -10.295 3.158   -1.897  1.00 10.00 ? 188 VAL A HA     1  
ATOM 1510  H HB     . VAL B 2 101 ? -9.633  4.287   -3.697  1.00 10.00 ? 188 VAL A HB     1  
ATOM 1511  H HG11   . VAL B 2 101 ? -9.149  1.908   -3.934  1.00 10.00 ? 188 VAL A HG11   1  
ATOM 1512  H HG12   . VAL B 2 101 ? -10.647 1.691   -4.893  1.00 10.00 ? 188 VAL A HG12   1  
ATOM 1513  H HG13   . VAL B 2 101 ? -9.324  2.665   -5.525  1.00 10.00 ? 188 VAL A HG13   1  
ATOM 1514  H HG21   . VAL B 2 101 ? -12.099 3.945   -5.207  1.00 10.00 ? 188 VAL A HG21   1  
ATOM 1515  H HG22   . VAL B 2 101 ? -11.339 5.428   -4.533  1.00 10.00 ? 188 VAL A HG22   1  
ATOM 1516  H HG23   . VAL B 2 101 ? -10.526 4.545   -5.816  1.00 10.00 ? 188 VAL A HG23   1  
ATOM 1517  N N      . ASN B 2 102 ? -11.769 4.660   -0.705  1.00 10.00 ? 189 ASN A N      1  
ATOM 1518  C CA     . ASN B 2 102 ? -12.467 5.746   -0.031  1.00 10.00 ? 189 ASN A CA     1  
ATOM 1519  C C      . ASN B 2 102 ? -11.741 7.080   -0.240  1.00 10.00 ? 189 ASN A C      1  
ATOM 1520  O O      . ASN B 2 102 ? -10.511 7.138   -0.321  1.00 10.00 ? 189 ASN A O      1  
ATOM 1521  C CB     . ASN B 2 102 ? -12.567 5.420   1.459   1.00 10.00 ? 189 ASN A CB     1  
ATOM 1522  C CG     . ASN B 2 102 ? -13.187 4.060   1.721   1.00 10.00 ? 189 ASN A CG     1  
ATOM 1523  O OD1    . ASN B 2 102 ? -14.316 3.777   1.334   1.00 10.00 ? 189 ASN A OD1    1  
ATOM 1524  N ND2    . ASN B 2 102 ? -12.460 3.172   2.358   1.00 10.00 ? 189 ASN A ND2    1  
ATOM 1525  H H      . ASN B 2 102 ? -10.954 4.236   -0.278  1.00 10.00 ? 189 ASN A H      1  
ATOM 1526  H HA     . ASN B 2 102 ? -13.479 5.833   -0.431  1.00 10.00 ? 189 ASN A HA     1  
ATOM 1527  H HB2    . ASN B 2 102 ? -11.575 5.464   1.904   1.00 10.00 ? 189 ASN A HB2    1  
ATOM 1528  H HB3    . ASN B 2 102 ? -13.188 6.176   1.935   1.00 10.00 ? 189 ASN A HB3    1  
ATOM 1529  H HD21   . ASN B 2 102 ? -11.513 3.416   2.625   1.00 10.00 ? 189 ASN A HD21   1  
ATOM 1530  H HD22   . ASN B 2 102 ? -12.856 2.265   2.534   1.00 10.00 ? 189 ASN A HD22   1  
ATOM 1531  N N      . ASN B 2 103 ? -12.489 8.186   -0.228  1.00 10.00 ? 190 ASN A N      1  
ATOM 1532  C CA     . ASN B 2 103 ? -11.879 9.499   -0.026  1.00 10.00 ? 190 ASN A CA     1  
ATOM 1533  C C      . ASN B 2 103 ? -11.202 9.568   1.373   1.00 10.00 ? 190 ASN A C      1  
ATOM 1534  O O      . ASN B 2 103 ? -11.395 8.684   2.219   1.00 10.00 ? 190 ASN A O      1  
ATOM 1535  C CB     . ASN B 2 103 ? -12.937 10.597  -0.228  1.00 10.00 ? 190 ASN A CB     1  
ATOM 1536  C CG     . ASN B 2 103 ? -13.999 10.600  0.860   1.00 10.00 ? 190 ASN A CG     1  
ATOM 1537  O OD1    . ASN B 2 103 ? -14.880 9.752   0.906   1.00 10.00 ? 190 ASN A OD1    1  
ATOM 1538  N ND2    . ASN B 2 103 ? -13.962 11.543  1.775   1.00 10.00 ? 190 ASN A ND2    1  
ATOM 1539  H H      . ASN B 2 103 ? -13.487 8.096   -0.111  1.00 10.00 ? 190 ASN A H      1  
ATOM 1540  H HA     . ASN B 2 103 ? -11.117 9.600   -0.806  1.00 10.00 ? 190 ASN A HA     1  
ATOM 1541  H HB2    . ASN B 2 103 ? -12.443 11.568  -0.255  1.00 10.00 ? 190 ASN A HB2    1  
ATOM 1542  H HB3    . ASN B 2 103 ? -13.430 10.451  -1.189  1.00 10.00 ? 190 ASN A HB3    1  
ATOM 1543  H HD21   . ASN B 2 103 ? -13.264 12.273  1.753   1.00 10.00 ? 190 ASN A HD21   1  
ATOM 1544  H HD22   . ASN B 2 103 ? -14.676 11.519  2.488   1.00 10.00 ? 190 ASN A HD22   1  
ATOM 1545  N N      . ALA B 2 104 ? -10.401 10.608  1.635   1.00 10.00 ? 191 ALA A N      1  
ATOM 1546  C CA     . ALA B 2 104 ? -9.500  10.616  2.791   1.00 10.00 ? 191 ALA A CA     1  
ATOM 1547  C C      . ALA B 2 104 ? -9.633  11.809  3.747   1.00 10.00 ? 191 ALA A C      1  
ATOM 1548  O O      . ALA B 2 104 ? -9.884  12.952  3.355   1.00 10.00 ? 191 ALA A O      1  
ATOM 1549  C CB     . ALA B 2 104 ? -8.066  10.504  2.275   1.00 10.00 ? 191 ALA A CB     1  
ATOM 1550  H H      . ALA B 2 104 ? -10.280 11.318  0.929   1.00 10.00 ? 191 ALA A H      1  
ATOM 1551  H HA     . ALA B 2 104 ? -9.670  9.722   3.388   1.00 10.00 ? 191 ALA A HA     1  
ATOM 1552  H HB1    . ALA B 2 104 ? -7.962  9.618   1.649   1.00 10.00 ? 191 ALA A HB1    1  
ATOM 1553  H HB2    . ALA B 2 104 ? -7.806  11.399  1.713   1.00 10.00 ? 191 ALA A HB2    1  
ATOM 1554  H HB3    . ALA B 2 104 ? -7.390  10.422  3.130   1.00 10.00 ? 191 ALA A HB3    1  
ATOM 1555  N N      . THR B 2 105 ? -9.357  11.510  5.015   1.00 10.00 ? 192 THR A N      1  
ATOM 1556  C CA     . THR B 2 105 ? -8.780  12.382  6.056   1.00 10.00 ? 192 THR A CA     1  
ATOM 1557  C C      . THR B 2 105 ? -7.321  12.722  5.703   1.00 10.00 ? 192 THR A C      1  
ATOM 1558  O O      . THR B 2 105 ? -6.727  12.047  4.863   1.00 10.00 ? 192 THR A O      1  
ATOM 1559  C CB     . THR B 2 105 ? -8.764  11.588  7.376   1.00 10.00 ? 192 THR A CB     1  
ATOM 1560  O OG1    . THR B 2 105 ? -8.167  10.351  7.099   1.00 10.00 ? 192 THR A OG1    1  
ATOM 1561  C CG2    . THR B 2 105 ? -10.161 11.316  7.935   1.00 10.00 ? 192 THR A CG2    1  
ATOM 1562  H H      . THR B 2 105 ? -9.146  10.532  5.189   1.00 10.00 ? 192 THR A H      1  
ATOM 1563  H HA     . THR B 2 105 ? -9.360  13.298  6.164   1.00 10.00 ? 192 THR A HA     1  
ATOM 1564  H HB     . THR B 2 105 ? -8.163  12.086  8.133   1.00 10.00 ? 192 THR A HB     1  
ATOM 1565  H HG1    . THR B 2 105 ? -8.276  9.763   7.875   1.00 10.00 ? 192 THR A HG1    1  
ATOM 1566  H HG21   . THR B 2 105 ? -10.647 12.257  8.193   1.00 10.00 ? 192 THR A HG21   1  
ATOM 1567  H HG22   . THR B 2 105 ? -10.769 10.786  7.200   1.00 10.00 ? 192 THR A HG22   1  
ATOM 1568  H HG23   . THR B 2 105 ? -10.083 10.700  8.832   1.00 10.00 ? 192 THR A HG23   1  
ATOM 1569  N N      . ALA B 2 106 ? -6.679  13.700  6.350   1.00 10.00 ? 193 ALA A N      1  
ATOM 1570  C CA     . ALA B 2 106 ? -5.247  13.972  6.133   1.00 10.00 ? 193 ALA A CA     1  
ATOM 1571  C C      . ALA B 2 106 ? -4.549  14.697  7.302   1.00 10.00 ? 193 ALA A C      1  
ATOM 1572  O O      . ALA B 2 106 ? -4.327  15.907  7.262   1.00 10.00 ? 193 ALA A O      1  
ATOM 1573  C CB     . ALA B 2 106 ? -5.071  14.701  4.792   1.00 10.00 ? 193 ALA A CB     1  
ATOM 1574  H H      . ALA B 2 106 ? -7.186  14.256  7.024   1.00 10.00 ? 193 ALA A H      1  
ATOM 1575  H HA     . ALA B 2 106 ? -4.719  13.028  6.026   1.00 10.00 ? 193 ALA A HA     1  
ATOM 1576  H HB1    . ALA B 2 106 ? -5.382  14.036  3.983   1.00 10.00 ? 193 ALA A HB1    1  
ATOM 1577  H HB2    . ALA B 2 106 ? -5.665  15.611  4.773   1.00 10.00 ? 193 ALA A HB2    1  
ATOM 1578  H HB3    . ALA B 2 106 ? -4.020  14.945  4.640   1.00 10.00 ? 193 ALA A HB3    1  
ATOM 1579  N N      . ARG B 2 107 ? -4.151  13.996  8.372   1.00 10.00 ? 194 ARG A N      1  
ATOM 1580  C CA     . ARG B 2 107 ? -4.441  12.593  8.758   1.00 10.00 ? 194 ARG A CA     1  
ATOM 1581  C C      . ARG B 2 107 ? -5.239  12.501  10.076  1.00 10.00 ? 194 ARG A C      1  
ATOM 1582  O O      . ARG B 2 107 ? -5.908  11.502  10.336  1.00 10.00 ? 194 ARG A O      1  
ATOM 1583  C CB     . ARG B 2 107 ? -3.103  11.813  8.792   1.00 10.00 ? 194 ARG A CB     1  
ATOM 1584  C CG     . ARG B 2 107 ? -3.166  10.446  9.482   1.00 10.00 ? 194 ARG A CG     1  
ATOM 1585  C CD     . ARG B 2 107 ? -1.853  9.677   9.332   1.00 10.00 ? 194 ARG A CD     1  
ATOM 1586  N NE     . ARG B 2 107 ? -0.822  10.107  10.291  1.00 10.00 ? 194 ARG A NE     1  
ATOM 1587  C CZ     . ARG B 2 107 ? -0.684  9.681   11.534  1.00 10.00 ? 194 ARG A CZ     1  
ATOM 1588  N NH1    . ARG B 2 107 ? -1.537  8.867   12.098  1.00 10.00 ? 194 ARG A NH1    1  
ATOM 1589  N NH2    . ARG B 2 107 ? 0.336   10.068  12.248  1.00 10.00 ? 194 ARG A NH2    1  
ATOM 1590  H H      . ARG B 2 107 ? -3.574  14.557  8.986   1.00 10.00 ? 194 ARG A H      1  
ATOM 1591  H HA     . ARG B 2 107 ? -5.083  12.107  8.021   1.00 10.00 ? 194 ARG A HA     1  
ATOM 1592  H HB2    . ARG B 2 107 ? -2.778  11.669  7.762   1.00 10.00 ? 194 ARG A HB2    1  
ATOM 1593  H HB3    . ARG B 2 107 ? -2.334  12.388  9.301   1.00 10.00 ? 194 ARG A HB3    1  
ATOM 1594  H HG2    . ARG B 2 107 ? -3.384  10.572  10.544  1.00 10.00 ? 194 ARG A HG2    1  
ATOM 1595  H HG3    . ARG B 2 107 ? -3.964  9.856   9.041   1.00 10.00 ? 194 ARG A HG3    1  
ATOM 1596  H HD2    . ARG B 2 107 ? -2.057  8.624   9.501   1.00 10.00 ? 194 ARG A HD2    1  
ATOM 1597  H HD3    . ARG B 2 107 ? -1.484  9.785   8.313   1.00 10.00 ? 194 ARG A HD3    1  
ATOM 1598  H HE     . ARG B 2 107 ? -0.102  10.724  9.952   1.00 10.00 ? 194 ARG A HE     1  
ATOM 1599  H HH11   . ARG B 2 107 ? -2.368  8.568   11.582  1.00 10.00 ? 194 ARG A HH11   1  
ATOM 1600  H HH12   . ARG B 2 107 ? -1.405  8.557   13.042  1.00 10.00 ? 194 ARG A HH12   1  
ATOM 1601  H HH21   . ARG B 2 107 ? 1.027   10.686  11.856  1.00 10.00 ? 194 ARG A HH21   1  
ATOM 1602  H HH22   . ARG B 2 107 ? 0.448   9.732   13.189  1.00 10.00 ? 194 ARG A HH22   1  
ATOM 1603  N N      . VAL B 2 108 ? -5.226  13.572  10.866  1.00 10.00 ? 195 VAL A N      1  
ATOM 1604  C CA     . VAL B 2 108 ? -6.008  13.747  12.105  1.00 10.00 ? 195 VAL A CA     1  
ATOM 1605  C C      . VAL B 2 108 ? -7.512  13.773  11.790  1.00 10.00 ? 195 VAL A C      1  
ATOM 1606  O O      . VAL B 2 108 ? -7.930  14.308  10.759  1.00 10.00 ? 195 VAL A O      1  
ATOM 1607  C CB     . VAL B 2 108 ? -5.573  15.033  12.844  1.00 10.00 ? 195 VAL A CB     1  
ATOM 1608  C CG1    . VAL B 2 108 ? -6.330  15.254  14.161  1.00 10.00 ? 195 VAL A CG1    1  
ATOM 1609  C CG2    . VAL B 2 108 ? -4.077  14.982  13.193  1.00 10.00 ? 195 VAL A CG2    1  
ATOM 1610  H H      . VAL B 2 108 ? -4.721  14.352  10.483  1.00 10.00 ? 195 VAL A H      1  
ATOM 1611  H HA     . VAL B 2 108 ? -5.807  12.902  12.763  1.00 10.00 ? 195 VAL A HA     1  
ATOM 1612  H HB     . VAL B 2 108 ? -5.748  15.892  12.197  1.00 10.00 ? 195 VAL A HB     1  
ATOM 1613  H HG11   . VAL B 2 108 ? -7.383  15.445  13.965  1.00 10.00 ? 195 VAL A HG11   1  
ATOM 1614  H HG12   . VAL B 2 108 ? -6.230  14.377  14.802  1.00 10.00 ? 195 VAL A HG12   1  
ATOM 1615  H HG13   . VAL B 2 108 ? -5.930  16.126  14.676  1.00 10.00 ? 195 VAL A HG13   1  
ATOM 1616  H HG21   . VAL B 2 108 ? -3.872  14.122  13.831  1.00 10.00 ? 195 VAL A HG21   1  
ATOM 1617  H HG22   . VAL B 2 108 ? -3.469  14.911  12.291  1.00 10.00 ? 195 VAL A HG22   1  
ATOM 1618  H HG23   . VAL B 2 108 ? -3.788  15.891  13.722  1.00 10.00 ? 195 VAL A HG23   1  
ATOM 1619  N N      . MET B 2 109 ? -8.324  13.187  12.678  1.00 10.00 ? 196 MET A N      1  
ATOM 1620  C CA     . MET B 2 109 ? -9.786  13.028  12.556  1.00 10.00 ? 196 MET A CA     1  
ATOM 1621  C C      . MET B 2 109 ? -10.526 13.177  13.898  1.00 10.00 ? 196 MET A C      1  
ATOM 1622  O O      . MET B 2 109 ? -11.695 13.626  13.875  1.00 10.00 ? 196 MET A O      1  
ATOM 1623  C CB     . MET B 2 109 ? -10.097 11.690  11.860  1.00 10.00 ? 196 MET A CB     1  
ATOM 1624  C CG     . MET B 2 109 ? -9.738  10.452  12.694  1.00 10.00 ? 196 MET A CG     1  
ATOM 1625  S SD     . MET B 2 109 ? -9.794  8.870   11.799  1.00 10.00 ? 196 MET A SD     1  
ATOM 1626  C CE     . MET B 2 109 ? -11.538 8.797   11.305  1.00 10.00 ? 196 MET A CE     1  
ATOM 1627  O OXT    . MET B 2 109 ? -9.938  12.866  14.960  1.00 10.00 ? 196 MET A OXT    1  
ATOM 1628  H H      . MET B 2 109 ? -7.905  12.808  13.516  1.00 10.00 ? 196 MET A H      1  
ATOM 1629  H HA     . MET B 2 109 ? -10.165 13.826  11.914  1.00 10.00 ? 196 MET A HA     1  
ATOM 1630  H HB2    . MET B 2 109 ? -11.157 11.658  11.621  1.00 10.00 ? 196 MET A HB2    1  
ATOM 1631  H HB3    . MET B 2 109 ? -9.539  11.650  10.924  1.00 10.00 ? 196 MET A HB3    1  
ATOM 1632  H HG2    . MET B 2 109 ? -8.727  10.570  13.075  1.00 10.00 ? 196 MET A HG2    1  
ATOM 1633  H HG3    . MET B 2 109 ? -10.418 10.393  13.544  1.00 10.00 ? 196 MET A HG3    1  
ATOM 1634  H HE1    . MET B 2 109 ? -12.172 8.884   12.188  1.00 10.00 ? 196 MET A HE1    1  
ATOM 1635  H HE2    . MET B 2 109 ? -11.765 9.604   10.609  1.00 10.00 ? 196 MET A HE2    1  
ATOM 1636  H HE3    . MET B 2 109 ? -11.734 7.843   10.814  1.00 10.00 ? 196 MET A HE3    1  
ATOM 1637  O "O5'"  . U   A 1 1   ? -1.169  -14.840 8.151   1.00 0.00  ? 197 U   B "O5'"  2  
ATOM 1638  C "C5'"  . U   A 1 1   ? -0.864  -14.234 9.404   1.00 0.00  ? 197 U   B "C5'"  2  
ATOM 1639  C "C4'"  . U   A 1 1   ? -0.992  -12.699 9.394   1.00 0.00  ? 197 U   B "C4'"  2  
ATOM 1640  O "O4'"  . U   A 1 1   ? 0.045   -12.080 8.634   1.00 0.00  ? 197 U   B "O4'"  2  
ATOM 1641  C "C3'"  . U   A 1 1   ? -2.303  -12.154 8.819   1.00 0.00  ? 197 U   B "C3'"  2  
ATOM 1642  O "O3'"  . U   A 1 1   ? -3.428  -12.277 9.672   1.00 0.00  ? 197 U   B "O3'"  2  
ATOM 1643  C "C2'"  . U   A 1 1   ? -1.897  -10.696 8.582   1.00 0.00  ? 197 U   B "C2'"  2  
ATOM 1644  O "O2'"  . U   A 1 1   ? -1.832  -9.945  9.796   1.00 0.00  ? 197 U   B "O2'"  2  
ATOM 1645  C "C1'"  . U   A 1 1   ? -0.461  -10.875 8.053   1.00 0.00  ? 197 U   B "C1'"  2  
ATOM 1646  N N1     . U   A 1 1   ? -0.353  -10.926 6.560   1.00 0.00  ? 197 U   B N1     2  
ATOM 1647  C C2     . U   A 1 1   ? 0.127   -9.779  5.915   1.00 0.00  ? 197 U   B C2     2  
ATOM 1648  O O2     . U   A 1 1   ? 0.254   -8.694  6.477   1.00 0.00  ? 197 U   B O2     2  
ATOM 1649  N N3     . U   A 1 1   ? 0.536   -9.911  4.607   1.00 0.00  ? 197 U   B N3     2  
ATOM 1650  C C4     . U   A 1 1   ? 0.547   -11.088 3.889   1.00 0.00  ? 197 U   B C4     2  
ATOM 1651  O O4     . U   A 1 1   ? 1.054   -11.137 2.770   1.00 0.00  ? 197 U   B O4     2  
ATOM 1652  C C5     . U   A 1 1   ? -0.089  -12.193 4.558   1.00 0.00  ? 197 U   B C5     2  
ATOM 1653  C C6     . U   A 1 1   ? -0.510  -12.100 5.851   1.00 0.00  ? 197 U   B C6     2  
ATOM 1654  H "H5'"  . U   A 1 1   ? 0.158   -14.483 9.692   1.00 0.00  ? 197 U   B "H5'"  2  
ATOM 1655  H "H5''" . U   A 1 1   ? -1.534  -14.633 10.165  1.00 0.00  ? 197 U   B "H5''" 2  
ATOM 1656  H "H4'"  . U   A 1 1   ? -0.905  -12.349 10.425  1.00 0.00  ? 197 U   B "H4'"  2  
ATOM 1657  H "H3'"  . U   A 1 1   ? -2.500  -12.624 7.855   1.00 0.00  ? 197 U   B "H3'"  2  
ATOM 1658  H "H2'"  . U   A 1 1   ? -2.583  -10.213 7.884   1.00 0.00  ? 197 U   B "H2'"  2  
ATOM 1659  H "HO2'" . U   A 1 1   ? -2.608  -10.167 10.340  1.00 0.00  ? 197 U   B "HO2'" 2  
ATOM 1660  H "H1'"  . U   A 1 1   ? 0.155   -10.039 8.408   1.00 0.00  ? 197 U   B "H1'"  2  
ATOM 1661  H H3     . U   A 1 1   ? 0.878   -9.087  4.152   1.00 0.00  ? 197 U   B H3     2  
ATOM 1662  H H5     . U   A 1 1   ? -0.199  -13.105 3.998   1.00 0.00  ? 197 U   B H5     2  
ATOM 1663  H H6     . U   A 1 1   ? -0.930  -12.970 6.339   1.00 0.00  ? 197 U   B H6     2  
ATOM 1664  H "HO5'" . U   A 1 1   ? -2.135  -14.973 8.081   1.00 0.00  ? 197 U   B "HO5'" 2  
ATOM 1665  P P      . G   A 1 2   ? -4.894  -12.437 9.045   1.00 0.00  ? 198 G   B P      2  
ATOM 1666  O OP1    . G   A 1 2   ? -5.866  -12.412 10.165  1.00 0.00  ? 198 G   B OP1    2  
ATOM 1667  O OP2    . G   A 1 2   ? -4.884  -13.607 8.136   1.00 0.00  ? 198 G   B OP2    2  
ATOM 1668  O "O5'"  . G   A 1 2   ? -5.091  -11.113 8.145   1.00 0.00  ? 198 G   B "O5'"  2  
ATOM 1669  C "C5'"  . G   A 1 2   ? -5.239  -9.824  8.726   1.00 0.00  ? 198 G   B "C5'"  2  
ATOM 1670  C "C4'"  . G   A 1 2   ? -6.603  -9.148  8.465   1.00 0.00  ? 198 G   B "C4'"  2  
ATOM 1671  O "O4'"  . G   A 1 2   ? -6.701  -8.754  7.097   1.00 0.00  ? 198 G   B "O4'"  2  
ATOM 1672  C "C3'"  . G   A 1 2   ? -7.867  -9.975  8.750   1.00 0.00  ? 198 G   B "C3'"  2  
ATOM 1673  O "O3'"  . G   A 1 2   ? -8.993  -9.130  8.974   1.00 0.00  ? 198 G   B "O3'"  2  
ATOM 1674  C "C2'"  . G   A 1 2   ? -8.044  -10.686 7.404   1.00 0.00  ? 198 G   B "C2'"  2  
ATOM 1675  O "O2'"  . G   A 1 2   ? -9.366  -11.171 7.189   1.00 0.00  ? 198 G   B "O2'"  2  
ATOM 1676  C "C1'"  . G   A 1 2   ? -7.650  -9.581  6.424   1.00 0.00  ? 198 G   B "C1'"  2  
ATOM 1677  N N9     . G   A 1 2   ? -7.123  -10.086 5.127   1.00 0.00  ? 198 G   B N9     2  
ATOM 1678  C C8     . G   A 1 2   ? -6.896  -11.382 4.716   1.00 0.00  ? 198 G   B C8     2  
ATOM 1679  N N7     . G   A 1 2   ? -6.421  -11.489 3.501   1.00 0.00  ? 198 G   B N7     2  
ATOM 1680  C C5     . G   A 1 2   ? -6.351  -10.162 3.055   1.00 0.00  ? 198 G   B C5     2  
ATOM 1681  C C6     . G   A 1 2   ? -5.905  -9.591  1.807   1.00 0.00  ? 198 G   B C6     2  
ATOM 1682  O O6     . G   A 1 2   ? -5.427  -10.138 0.812   1.00 0.00  ? 198 G   B O6     2  
ATOM 1683  N N1     . G   A 1 2   ? -6.066  -8.224  1.747   1.00 0.00  ? 198 G   B N1     2  
ATOM 1684  C C2     . G   A 1 2   ? -6.557  -7.476  2.757   1.00 0.00  ? 198 G   B C2     2  
ATOM 1685  N N2     . G   A 1 2   ? -6.653  -6.198  2.526   1.00 0.00  ? 198 G   B N2     2  
ATOM 1686  N N3     . G   A 1 2   ? -6.967  -7.946  3.928   1.00 0.00  ? 198 G   B N3     2  
ATOM 1687  C C4     . G   A 1 2   ? -6.827  -9.305  4.028   1.00 0.00  ? 198 G   B C4     2  
ATOM 1688  H "H5'"  . G   A 1 2   ? -4.468  -9.167  8.333   1.00 0.00  ? 198 G   B "H5'"  2  
ATOM 1689  H "H5''" . G   A 1 2   ? -5.031  -9.885  9.791   1.00 0.00  ? 198 G   B "H5''" 2  
ATOM 1690  H "H4'"  . G   A 1 2   ? -6.617  -8.255  9.088   1.00 0.00  ? 198 G   B "H4'"  2  
ATOM 1691  H "H3'"  . G   A 1 2   ? -7.727  -10.697 9.555   1.00 0.00  ? 198 G   B "H3'"  2  
ATOM 1692  H "H2'"  . G   A 1 2   ? -7.334  -11.511 7.352   1.00 0.00  ? 198 G   B "H2'"  2  
ATOM 1693  H "HO2'" . G   A 1 2   ? -9.984  -10.548 7.619   1.00 0.00  ? 198 G   B "HO2'" 2  
ATOM 1694  H "H1'"  . G   A 1 2   ? -8.536  -8.979  6.217   1.00 0.00  ? 198 G   B "H1'"  2  
ATOM 1695  H H8     . G   A 1 2   ? -7.072  -12.233 5.361   1.00 0.00  ? 198 G   B H8     2  
ATOM 1696  H H1     . G   A 1 2   ? -5.812  -7.728  0.909   1.00 0.00  ? 198 G   B H1     2  
ATOM 1697  H H21    . G   A 1 2   ? -6.290  -5.834  1.658   1.00 0.00  ? 198 G   B H21    2  
ATOM 1698  H H22    . G   A 1 2   ? -6.961  -5.590  3.275   1.00 0.00  ? 198 G   B H22    2  
ATOM 1699  P P      . C   A 1 3   ? -9.432  -8.682  10.449  1.00 0.00  ? 199 C   B P      2  
ATOM 1700  O OP1    . C   A 1 3   ? -9.429  -9.886  11.318  1.00 0.00  ? 199 C   B OP1    2  
ATOM 1701  O OP2    . C   A 1 3   ? -10.684 -7.897  10.328  1.00 0.00  ? 199 C   B OP2    2  
ATOM 1702  O "O5'"  . C   A 1 3   ? -8.255  -7.705  10.949  1.00 0.00  ? 199 C   B "O5'"  2  
ATOM 1703  C "C5'"  . C   A 1 3   ? -8.063  -6.412  10.391  1.00 0.00  ? 199 C   B "C5'"  2  
ATOM 1704  C "C4'"  . C   A 1 3   ? -6.915  -5.707  11.126  1.00 0.00  ? 199 C   B "C4'"  2  
ATOM 1705  O "O4'"  . C   A 1 3   ? -5.666  -6.358  10.875  1.00 0.00  ? 199 C   B "O4'"  2  
ATOM 1706  C "C3'"  . C   A 1 3   ? -6.748  -4.234  10.695  1.00 0.00  ? 199 C   B "C3'"  2  
ATOM 1707  O "O3'"  . C   A 1 3   ? -6.706  -3.387  11.840  1.00 0.00  ? 199 C   B "O3'"  2  
ATOM 1708  C "C2'"  . C   A 1 3   ? -5.387  -4.250  9.987   1.00 0.00  ? 199 C   B "C2'"  2  
ATOM 1709  O "O2'"  . C   A 1 3   ? -4.704  -3.003  10.017  1.00 0.00  ? 199 C   B "O2'"  2  
ATOM 1710  C "C1'"  . C   A 1 3   ? -4.685  -5.343  10.787  1.00 0.00  ? 199 C   B "C1'"  2  
ATOM 1711  N N1     . C   A 1 3   ? -3.420  -5.828  10.169  1.00 0.00  ? 199 C   B N1     2  
ATOM 1712  C C2     . C   A 1 3   ? -2.223  -5.667  10.884  1.00 0.00  ? 199 C   B C2     2  
ATOM 1713  O O2     . C   A 1 3   ? -2.193  -5.148  12.004  1.00 0.00  ? 199 C   B O2     2  
ATOM 1714  N N3     . C   A 1 3   ? -1.045  -6.077  10.356  1.00 0.00  ? 199 C   B N3     2  
ATOM 1715  C C4     . C   A 1 3   ? -1.053  -6.636  9.163   1.00 0.00  ? 199 C   B C4     2  
ATOM 1716  N N4     . C   A 1 3   ? 0.118   -6.963  8.704   1.00 0.00  ? 199 C   B N4     2  
ATOM 1717  C C5     . C   A 1 3   ? -2.227  -6.809  8.380   1.00 0.00  ? 199 C   B C5     2  
ATOM 1718  C C6     . C   A 1 3   ? -3.400  -6.387  8.914   1.00 0.00  ? 199 C   B C6     2  
ATOM 1719  H "H5'"  . C   A 1 3   ? -8.974  -5.825  10.524  1.00 0.00  ? 199 C   B "H5'"  2  
ATOM 1720  H "H5''" . C   A 1 3   ? -7.839  -6.476  9.325   1.00 0.00  ? 199 C   B "H5''" 2  
ATOM 1721  H "H4'"  . C   A 1 3   ? -7.128  -5.731  12.197  1.00 0.00  ? 199 C   B "H4'"  2  
ATOM 1722  H "H3'"  . C   A 1 3   ? -7.519  -3.922  9.998   1.00 0.00  ? 199 C   B "H3'"  2  
ATOM 1723  H "H2'"  . C   A 1 3   ? -5.527  -4.579  8.954   1.00 0.00  ? 199 C   B "H2'"  2  
ATOM 1724  H "HO2'" . C   A 1 3   ? -4.917  -2.571  10.865  1.00 0.00  ? 199 C   B "HO2'" 2  
ATOM 1725  H "H1'"  . C   A 1 3   ? -4.487  -4.949  11.789  1.00 0.00  ? 199 C   B "H1'"  2  
ATOM 1726  H H41    . C   A 1 3   ? 0.897   -6.814  9.315   1.00 0.00  ? 199 C   B H41    2  
ATOM 1727  H H42    . C   A 1 3   ? 0.195   -7.425  7.806   1.00 0.00  ? 199 C   B H42    2  
ATOM 1728  H H5     . C   A 1 3   ? -2.193  -7.261  7.401   1.00 0.00  ? 199 C   B H5     2  
ATOM 1729  H H6     . C   A 1 3   ? -4.328  -6.493  8.363   1.00 0.00  ? 199 C   B H6     2  
ATOM 1730  P P      . A   A 1 4   ? -8.056  -2.764  12.446  1.00 0.00  ? 200 A   B P      2  
ATOM 1731  O OP1    . A   A 1 4   ? -7.740  -2.157  13.762  1.00 0.00  ? 200 A   B OP1    2  
ATOM 1732  O OP2    . A   A 1 4   ? -9.127  -3.782  12.363  1.00 0.00  ? 200 A   B OP2    2  
ATOM 1733  O "O5'"  . A   A 1 4   ? -8.416  -1.590  11.406  1.00 0.00  ? 200 A   B "O5'"  2  
ATOM 1734  C "C5'"  . A   A 1 4   ? -7.611  -0.423  11.336  1.00 0.00  ? 200 A   B "C5'"  2  
ATOM 1735  C "C4'"  . A   A 1 4   ? -7.968  0.500   10.160  1.00 0.00  ? 200 A   B "C4'"  2  
ATOM 1736  O "O4'"  . A   A 1 4   ? -7.651  -0.125  8.925   1.00 0.00  ? 200 A   B "O4'"  2  
ATOM 1737  C "C3'"  . A   A 1 4   ? -9.448  0.924   10.105  1.00 0.00  ? 200 A   B "C3'"  2  
ATOM 1738  O "O3'"  . A   A 1 4   ? -9.624  2.223   9.553   1.00 0.00  ? 200 A   B "O3'"  2  
ATOM 1739  C "C2'"  . A   A 1 4   ? -10.045 -0.117  9.161   1.00 0.00  ? 200 A   B "C2'"  2  
ATOM 1740  O "O2'"  . A   A 1 4   ? -11.152 0.366   8.409   1.00 0.00  ? 200 A   B "O2'"  2  
ATOM 1741  C "C1'"  . A   A 1 4   ? -8.852  -0.514  8.273   1.00 0.00  ? 200 A   B "C1'"  2  
ATOM 1742  N N9     . A   A 1 4   ? -8.843  -1.967  7.960   1.00 0.00  ? 200 A   B N9     2  
ATOM 1743  C C8     . A   A 1 4   ? -9.460  -3.016  8.611   1.00 0.00  ? 200 A   B C8     2  
ATOM 1744  N N7     . A   A 1 4   ? -9.279  -4.187  8.057   1.00 0.00  ? 200 A   B N7     2  
ATOM 1745  C C5     . A   A 1 4   ? -8.502  -3.879  6.930   1.00 0.00  ? 200 A   B C5     2  
ATOM 1746  C C6     . A   A 1 4   ? -7.937  -4.639  5.876   1.00 0.00  ? 200 A   B C6     2  
ATOM 1747  N N6     . A   A 1 4   ? -8.043  -5.953  5.797   1.00 0.00  ? 200 A   B N6     2  
ATOM 1748  N N1     . A   A 1 4   ? -7.252  -4.055  4.885   1.00 0.00  ? 200 A   B N1     2  
ATOM 1749  C C2     . A   A 1 4   ? -7.093  -2.736  4.959   1.00 0.00  ? 200 A   B C2     2  
ATOM 1750  N N3     . A   A 1 4   ? -7.540  -1.899  5.887   1.00 0.00  ? 200 A   B N3     2  
ATOM 1751  C C4     . A   A 1 4   ? -8.245  -2.538  6.860   1.00 0.00  ? 200 A   B C4     2  
ATOM 1752  H "H5'"  . A   A 1 4   ? -6.562  -0.712  11.233  1.00 0.00  ? 200 A   B "H5'"  2  
ATOM 1753  H "H5''" . A   A 1 4   ? -7.717  0.139   12.265  1.00 0.00  ? 200 A   B "H5''" 2  
ATOM 1754  H "H4'"  . A   A 1 4   ? -7.347  1.388   10.264  1.00 0.00  ? 200 A   B "H4'"  2  
ATOM 1755  H "H3'"  . A   A 1 4   ? -9.921  0.847   11.084  1.00 0.00  ? 200 A   B "H3'"  2  
ATOM 1756  H "H2'"  . A   A 1 4   ? -10.366 -0.948  9.788   1.00 0.00  ? 200 A   B "H2'"  2  
ATOM 1757  H "HO2'" . A   A 1 4   ? -11.034 1.332   8.319   1.00 0.00  ? 200 A   B "HO2'" 2  
ATOM 1758  H "H1'"  . A   A 1 4   ? -8.898  0.052   7.340   1.00 0.00  ? 200 A   B "H1'"  2  
ATOM 1759  H H8     . A   A 1 4   ? -10.019 -2.888  9.530   1.00 0.00  ? 200 A   B H8     2  
ATOM 1760  H H61    . A   A 1 4   ? -7.569  -6.478  5.077   1.00 0.00  ? 200 A   B H61    2  
ATOM 1761  H H62    . A   A 1 4   ? -8.531  -6.422  6.546   1.00 0.00  ? 200 A   B H62    2  
ATOM 1762  H H2     . A   A 1 4   ? -6.535  -2.242  4.176   1.00 0.00  ? 200 A   B H2     2  
ATOM 1763  P P      . U   A 1 5   ? -9.375  3.532   10.430  1.00 0.00  ? 201 U   B P      2  
ATOM 1764  O OP1    . U   A 1 5   ? -8.593  3.184   11.637  1.00 0.00  ? 201 U   B OP1    2  
ATOM 1765  O OP2    . U   A 1 5   ? -10.672 4.235   10.582  1.00 0.00  ? 201 U   B OP2    2  
ATOM 1766  O "O5'"  . U   A 1 5   ? -8.450  4.403   9.458   1.00 0.00  ? 201 U   B "O5'"  2  
ATOM 1767  C "C5'"  . U   A 1 5   ? -7.181  3.948   9.018   1.00 0.00  ? 201 U   B "C5'"  2  
ATOM 1768  C "C4'"  . U   A 1 5   ? -6.356  5.075   8.377   1.00 0.00  ? 201 U   B "C4'"  2  
ATOM 1769  O "O4'"  . U   A 1 5   ? -6.810  5.416   7.073   1.00 0.00  ? 201 U   B "O4'"  2  
ATOM 1770  C "C3'"  . U   A 1 5   ? -6.369  6.355   9.230   1.00 0.00  ? 201 U   B "C3'"  2  
ATOM 1771  O "O3'"  . U   A 1 5   ? -5.126  7.042   9.163   1.00 0.00  ? 201 U   B "O3'"  2  
ATOM 1772  C "C2'"  . U   A 1 5   ? -7.484  7.147   8.550   1.00 0.00  ? 201 U   B "C2'"  2  
ATOM 1773  O "O2'"  . U   A 1 5   ? -7.435  8.544   8.801   1.00 0.00  ? 201 U   B "O2'"  2  
ATOM 1774  C "C1'"  . U   A 1 5   ? -7.286  6.759   7.084   1.00 0.00  ? 201 U   B "C1'"  2  
ATOM 1775  N N1     . U   A 1 5   ? -8.558  6.847   6.327   1.00 0.00  ? 201 U   B N1     2  
ATOM 1776  C C2     . U   A 1 5   ? -8.666  7.790   5.301   1.00 0.00  ? 201 U   B C2     2  
ATOM 1777  O O2     . U   A 1 5   ? -7.769  8.571   4.993   1.00 0.00  ? 201 U   B O2     2  
ATOM 1778  N N3     . U   A 1 5   ? -9.855  7.849   4.612   1.00 0.00  ? 201 U   B N3     2  
ATOM 1779  C C4     . U   A 1 5   ? -10.984 7.123   4.932   1.00 0.00  ? 201 U   B C4     2  
ATOM 1780  O O4     . U   A 1 5   ? -12.047 7.340   4.367   1.00 0.00  ? 201 U   B O4     2  
ATOM 1781  C C5     . U   A 1 5   ? -10.796 6.147   5.986   1.00 0.00  ? 201 U   B C5     2  
ATOM 1782  C C6     . U   A 1 5   ? -9.618  6.038   6.652   1.00 0.00  ? 201 U   B C6     2  
ATOM 1783  H "H5'"  . U   A 1 5   ? -7.302  3.131   8.305   1.00 0.00  ? 201 U   B "H5'"  2  
ATOM 1784  H "H5''" . U   A 1 5   ? -6.623  3.579   9.879   1.00 0.00  ? 201 U   B "H5''" 2  
ATOM 1785  H "H4'"  . U   A 1 5   ? -5.346  4.701   8.279   1.00 0.00  ? 201 U   B "H4'"  2  
ATOM 1786  H "H3'"  . U   A 1 5   ? -6.662  6.144   10.257  1.00 0.00  ? 201 U   B "H3'"  2  
ATOM 1787  H "H2'"  . U   A 1 5   ? -8.442  6.765   8.903   1.00 0.00  ? 201 U   B "H2'"  2  
ATOM 1788  H "HO2'" . U   A 1 5   ? -7.420  8.696   9.763   1.00 0.00  ? 201 U   B "HO2'" 2  
ATOM 1789  H "H1'"  . U   A 1 5   ? -6.534  7.420   6.639   1.00 0.00  ? 201 U   B "H1'"  2  
ATOM 1790  H H3     . U   A 1 5   ? -9.865  8.451   3.803   1.00 0.00  ? 201 U   B H3     2  
ATOM 1791  H H5     . U   A 1 5   ? -11.614 5.495   6.236   1.00 0.00  ? 201 U   B H5     2  
ATOM 1792  H H6     . U   A 1 5   ? -9.485  5.310   7.446   1.00 0.00  ? 201 U   B H6     2  
ATOM 1793  P P      . G   A 1 6   ? -3.936  6.708   10.181  1.00 0.00  ? 202 G   B P      2  
ATOM 1794  O OP1    . G   A 1 6   ? -4.256  5.452   10.903  1.00 0.00  ? 202 G   B OP1    2  
ATOM 1795  O OP2    . G   A 1 6   ? -3.668  7.942   10.961  1.00 0.00  ? 202 G   B OP2    2  
ATOM 1796  O "O5'"  . G   A 1 6   ? -2.681  6.423   9.206   1.00 0.00  ? 202 G   B "O5'"  2  
ATOM 1797  C "C5'"  . G   A 1 6   ? -2.665  5.253   8.395   1.00 0.00  ? 202 G   B "C5'"  2  
ATOM 1798  C "C4'"  . G   A 1 6   ? -1.483  5.087   7.429   1.00 0.00  ? 202 G   B "C4'"  2  
ATOM 1799  O "O4'"  . G   A 1 6   ? -1.805  5.725   6.191   1.00 0.00  ? 202 G   B "O4'"  2  
ATOM 1800  C "C3'"  . G   A 1 6   ? -0.183  5.654   7.991   1.00 0.00  ? 202 G   B "C3'"  2  
ATOM 1801  O "O3'"  . G   A 1 6   ? 0.919   4.797   7.822   1.00 0.00  ? 202 G   B "O3'"  2  
ATOM 1802  C "C2'"  . G   A 1 6   ? -0.153  6.949   7.194   1.00 0.00  ? 202 G   B "C2'"  2  
ATOM 1803  O "O2'"  . G   A 1 6   ? 1.102   7.632   7.165   1.00 0.00  ? 202 G   B "O2'"  2  
ATOM 1804  C "C1'"  . G   A 1 6   ? -0.740  6.593   5.849   1.00 0.00  ? 202 G   B "C1'"  2  
ATOM 1805  N N9     . G   A 1 6   ? -1.156  7.850   5.173   1.00 0.00  ? 202 G   B N9     2  
ATOM 1806  C C8     . G   A 1 6   ? -0.478  8.515   4.186   1.00 0.00  ? 202 G   B C8     2  
ATOM 1807  N N7     . G   A 1 6   ? -0.950  9.706   3.904   1.00 0.00  ? 202 G   B N7     2  
ATOM 1808  C C5     . G   A 1 6   ? -2.052  9.835   4.763   1.00 0.00  ? 202 G   B C5     2  
ATOM 1809  C C6     . G   A 1 6   ? -3.010  10.900  4.954   1.00 0.00  ? 202 G   B C6     2  
ATOM 1810  O O6     . G   A 1 6   ? -3.077  12.004  4.418   1.00 0.00  ? 202 G   B O6     2  
ATOM 1811  N N1     . G   A 1 6   ? -3.996  10.613  5.872   1.00 0.00  ? 202 G   B N1     2  
ATOM 1812  C C2     . G   A 1 6   ? -3.996  9.479   6.617   1.00 0.00  ? 202 G   B C2     2  
ATOM 1813  N N2     . G   A 1 6   ? -4.975  9.322   7.452   1.00 0.00  ? 202 G   B N2     2  
ATOM 1814  N N3     . G   A 1 6   ? -3.102  8.504   6.528   1.00 0.00  ? 202 G   B N3     2  
ATOM 1815  C C4     . G   A 1 6   ? -2.169  8.711   5.556   1.00 0.00  ? 202 G   B C4     2  
ATOM 1816  H "H5'"  . G   A 1 6   ? -3.554  5.274   7.772   1.00 0.00  ? 202 G   B "H5'"  2  
ATOM 1817  H "H5''" . G   A 1 6   ? -2.703  4.378   9.044   1.00 0.00  ? 202 G   B "H5''" 2  
ATOM 1818  H "H4'"  . G   A 1 6   ? -1.317  4.037   7.226   1.00 0.00  ? 202 G   B "H4'"  2  
ATOM 1819  H "H3'"  . G   A 1 6   ? -0.277  5.855   9.041   1.00 0.00  ? 202 G   B "H3'"  2  
ATOM 1820  H "H2'"  . G   A 1 6   ? -0.932  7.555   7.637   1.00 0.00  ? 202 G   B "H2'"  2  
ATOM 1821  H "HO2'" . G   A 1 6   ? 1.114   8.262   6.421   1.00 0.00  ? 202 G   B "HO2'" 2  
ATOM 1822  H "H1'"  . G   A 1 6   ? -0.008  6.057   5.256   1.00 0.00  ? 202 G   B "H1'"  2  
ATOM 1823  H H8     . G   A 1 6   ? 0.391   8.067   3.723   1.00 0.00  ? 202 G   B H8     2  
ATOM 1824  H H1     . G   A 1 6   ? -4.770  11.265  5.940   1.00 0.00  ? 202 G   B H1     2  
ATOM 1825  H H21    . G   A 1 6   ? -5.793  9.922   7.424   1.00 0.00  ? 202 G   B H21    2  
ATOM 1826  H H22    . G   A 1 6   ? -4.990  8.478   8.012   1.00 0.00  ? 202 G   B H22    2  
ATOM 1827  P P      . U   A 1 7   ? 1.591   4.123   9.119   1.00 0.00  ? 203 U   B P      2  
ATOM 1828  O OP1    . U   A 1 7   ? 0.972   2.797   9.351   1.00 0.00  ? 203 U   B OP1    2  
ATOM 1829  O OP2    . U   A 1 7   ? 1.637   5.098   10.238  1.00 0.00  ? 203 U   B OP2    2  
ATOM 1830  O "O5'"  . U   A 1 7   ? 3.085   3.896   8.615   1.00 0.00  ? 203 U   B "O5'"  2  
ATOM 1831  C "C5'"  . U   A 1 7   ? 3.894   5.003   8.243   1.00 0.00  ? 203 U   B "C5'"  2  
ATOM 1832  C "C4'"  . U   A 1 7   ? 3.808   5.396   6.751   1.00 0.00  ? 203 U   B "C4'"  2  
ATOM 1833  O "O4'"  . U   A 1 7   ? 5.134   5.596   6.268   1.00 0.00  ? 203 U   B "O4'"  2  
ATOM 1834  C "C3'"  . U   A 1 7   ? 3.176   4.421   5.738   1.00 0.00  ? 203 U   B "C3'"  2  
ATOM 1835  O "O3'"  . U   A 1 7   ? 2.462   5.164   4.763   1.00 0.00  ? 203 U   B "O3'"  2  
ATOM 1836  C "C2'"  . U   A 1 7   ? 4.357   3.705   5.055   1.00 0.00  ? 203 U   B "C2'"  2  
ATOM 1837  O "O2'"  . U   A 1 7   ? 4.405   3.875   3.639   1.00 0.00  ? 203 U   B "O2'"  2  
ATOM 1838  C "C1'"  . U   A 1 7   ? 5.586   4.378   5.672   1.00 0.00  ? 203 U   B "C1'"  2  
ATOM 1839  N N1     . U   A 1 7   ? 6.315   3.478   6.621   1.00 0.00  ? 203 U   B N1     2  
ATOM 1840  C C2     . U   A 1 7   ? 7.719   3.533   6.627   1.00 0.00  ? 203 U   B C2     2  
ATOM 1841  O O2     . U   A 1 7   ? 8.373   4.361   5.989   1.00 0.00  ? 203 U   B O2     2  
ATOM 1842  N N3     . U   A 1 7   ? 8.385   2.586   7.379   1.00 0.00  ? 203 U   B N3     2  
ATOM 1843  C C4     . U   A 1 7   ? 7.795   1.586   8.115   1.00 0.00  ? 203 U   B C4     2  
ATOM 1844  O O4     . U   A 1 7   ? 8.491   0.787   8.733   1.00 0.00  ? 203 U   B O4     2  
ATOM 1845  C C5     . U   A 1 7   ? 6.348   1.591   8.077   1.00 0.00  ? 203 U   B C5     2  
ATOM 1846  C C6     . U   A 1 7   ? 5.656   2.516   7.366   1.00 0.00  ? 203 U   B C6     2  
ATOM 1847  H "H5'"  . U   A 1 7   ? 4.926   4.763   8.491   1.00 0.00  ? 203 U   B "H5'"  2  
ATOM 1848  H "H5''" . U   A 1 7   ? 3.641   5.879   8.845   1.00 0.00  ? 203 U   B "H5''" 2  
ATOM 1849  H "H4'"  . U   A 1 7   ? 3.218   6.312   6.712   1.00 0.00  ? 203 U   B "H4'"  2  
ATOM 1850  H "H3'"  . U   A 1 7   ? 2.516   3.703   6.220   1.00 0.00  ? 203 U   B "H3'"  2  
ATOM 1851  H "HO3'" . U   A 1 7   ? 3.001   5.061   3.958   1.00 0.00  ? 203 U   B "HO3'" 2  
ATOM 1852  H "H2'"  . U   A 1 7   ? 4.332   2.635   5.285   1.00 0.00  ? 203 U   B "H2'"  2  
ATOM 1853  H "HO2'" . U   A 1 7   ? 3.840   3.191   3.219   1.00 0.00  ? 203 U   B "HO2'" 2  
ATOM 1854  H "H1'"  . U   A 1 7   ? 6.269   4.625   4.858   1.00 0.00  ? 203 U   B "H1'"  2  
ATOM 1855  H H3     . U   A 1 7   ? 9.389   2.615   7.380   1.00 0.00  ? 203 U   B H3     2  
ATOM 1856  H H5     . U   A 1 7   ? 5.804   0.841   8.626   1.00 0.00  ? 203 U   B H5     2  
ATOM 1857  H H6     . U   A 1 7   ? 4.568   2.496   7.403   1.00 0.00  ? 203 U   B H6     2  
ATOM 1858  N N      . ASN B 2 22  ? 1.068   28.123  -16.357 1.00 0.00  ? 109 ASN A N      2  
ATOM 1859  C CA     . ASN B 2 22  ? 2.018   27.020  -16.668 1.00 0.00  ? 109 ASN A CA     2  
ATOM 1860  C C      . ASN B 2 22  ? 1.437   25.666  -16.235 1.00 0.00  ? 109 ASN A C      2  
ATOM 1861  O O      . ASN B 2 22  ? 0.631   25.600  -15.306 1.00 0.00  ? 109 ASN A O      2  
ATOM 1862  C CB     . ASN B 2 22  ? 3.410   27.276  -16.040 1.00 0.00  ? 109 ASN A CB     2  
ATOM 1863  C CG     . ASN B 2 22  ? 4.468   26.291  -16.541 1.00 0.00  ? 109 ASN A CG     2  
ATOM 1864  O OD1    . ASN B 2 22  ? 4.459   25.882  -17.692 1.00 0.00  ? 109 ASN A OD1    2  
ATOM 1865  N ND2    . ASN B 2 22  ? 5.394   25.859  -15.708 1.00 0.00  ? 109 ASN A ND2    2  
ATOM 1866  H H      . ASN B 2 22  ? 0.179   27.961  -16.806 1.00 0.00  ? 109 ASN A H      2  
ATOM 1867  H HA     . ASN B 2 22  ? 2.141   26.983  -17.751 1.00 0.00  ? 109 ASN A HA     2  
ATOM 1868  H HB2    . ASN B 2 22  ? 3.752   28.281  -16.301 1.00 0.00  ? 109 ASN A HB2    2  
ATOM 1869  H HB3    . ASN B 2 22  ? 3.335   27.211  -14.952 1.00 0.00  ? 109 ASN A HB3    2  
ATOM 1870  H HD21   . ASN B 2 22  ? 5.457   26.197  -14.759 1.00 0.00  ? 109 ASN A HD21   2  
ATOM 1871  H HD22   . ASN B 2 22  ? 6.084   25.218  -16.074 1.00 0.00  ? 109 ASN A HD22   2  
ATOM 1872  N N      . THR B 2 23  ? 1.837   24.571  -16.893 1.00 0.00  ? 110 THR A N      2  
ATOM 1873  C CA     . THR B 2 23  ? 1.323   23.197  -16.675 1.00 0.00  ? 110 THR A CA     2  
ATOM 1874  C C      . THR B 2 23  ? 1.603   22.607  -15.286 1.00 0.00  ? 110 THR A C      2  
ATOM 1875  O O      . THR B 2 23  ? 0.952   21.638  -14.892 1.00 0.00  ? 110 THR A O      2  
ATOM 1876  C CB     . THR B 2 23  ? 1.877   22.231  -17.733 1.00 0.00  ? 110 THR A CB     2  
ATOM 1877  O OG1    . THR B 2 23  ? 3.288   22.302  -17.763 1.00 0.00  ? 110 THR A OG1    2  
ATOM 1878  C CG2    . THR B 2 23  ? 1.363   22.561  -19.138 1.00 0.00  ? 110 THR A CG2    2  
ATOM 1879  H H      . THR B 2 23  ? 2.556   24.667  -17.603 1.00 0.00  ? 110 THR A H      2  
ATOM 1880  H HA     . THR B 2 23  ? 0.238   23.211  -16.785 1.00 0.00  ? 110 THR A HA     2  
ATOM 1881  H HB     . THR B 2 23  ? 1.569   21.214  -17.485 1.00 0.00  ? 110 THR A HB     2  
ATOM 1882  H HG1    . THR B 2 23  ? 3.605   21.639  -18.403 1.00 0.00  ? 110 THR A HG1    2  
ATOM 1883  H HG21   . THR B 2 23  ? 0.273   22.535  -19.143 1.00 0.00  ? 110 THR A HG21   2  
ATOM 1884  H HG22   . THR B 2 23  ? 1.695   23.547  -19.450 1.00 0.00  ? 110 THR A HG22   2  
ATOM 1885  H HG23   . THR B 2 23  ? 1.737   21.822  -19.847 1.00 0.00  ? 110 THR A HG23   2  
ATOM 1886  N N      . GLU B 2 24  ? 2.499   23.205  -14.493 1.00 0.00  ? 111 GLU A N      2  
ATOM 1887  C CA     . GLU B 2 24  ? 2.791   22.827  -13.097 1.00 0.00  ? 111 GLU A CA     2  
ATOM 1888  C C      . GLU B 2 24  ? 1.567   22.827  -12.153 1.00 0.00  ? 111 GLU A C      2  
ATOM 1889  O O      . GLU B 2 24  ? 1.589   22.156  -11.118 1.00 0.00  ? 111 GLU A O      2  
ATOM 1890  C CB     . GLU B 2 24  ? 3.921   23.715  -12.548 1.00 0.00  ? 111 GLU A CB     2  
ATOM 1891  C CG     . GLU B 2 24  ? 3.578   25.214  -12.443 1.00 0.00  ? 111 GLU A CG     2  
ATOM 1892  C CD     . GLU B 2 24  ? 3.561   25.708  -10.985 1.00 0.00  ? 111 GLU A CD     2  
ATOM 1893  O OE1    . GLU B 2 24  ? 4.639   26.055  -10.446 1.00 0.00  ? 111 GLU A OE1    2  
ATOM 1894  O OE2    . GLU B 2 24  ? 2.467   25.781  -10.372 1.00 0.00  ? 111 GLU A OE2    2  
ATOM 1895  H H      . GLU B 2 24  ? 3.029   23.957  -14.907 1.00 0.00  ? 111 GLU A H      2  
ATOM 1896  H HA     . GLU B 2 24  ? 3.167   21.802  -13.104 1.00 0.00  ? 111 GLU A HA     2  
ATOM 1897  H HB2    . GLU B 2 24  ? 4.224   23.340  -11.570 1.00 0.00  ? 111 GLU A HB2    2  
ATOM 1898  H HB3    . GLU B 2 24  ? 4.785   23.608  -13.209 1.00 0.00  ? 111 GLU A HB3    2  
ATOM 1899  H HG2    . GLU B 2 24  ? 4.332   25.776  -12.999 1.00 0.00  ? 111 GLU A HG2    2  
ATOM 1900  H HG3    . GLU B 2 24  ? 2.618   25.419  -12.924 1.00 0.00  ? 111 GLU A HG3    2  
ATOM 1901  N N      . ASN B 2 25  ? 0.464   23.487  -12.536 1.00 0.00  ? 112 ASN A N      2  
ATOM 1902  C CA     . ASN B 2 25  ? -0.842  23.433  -11.865 1.00 0.00  ? 112 ASN A CA     2  
ATOM 1903  C C      . ASN B 2 25  ? -1.452  22.009  -11.783 1.00 0.00  ? 112 ASN A C      2  
ATOM 1904  O O      . ASN B 2 25  ? -2.351  21.763  -10.975 1.00 0.00  ? 112 ASN A O      2  
ATOM 1905  C CB     . ASN B 2 25  ? -1.772  24.424  -12.592 1.00 0.00  ? 112 ASN A CB     2  
ATOM 1906  C CG     . ASN B 2 25  ? -3.100  24.629  -11.879 1.00 0.00  ? 112 ASN A CG     2  
ATOM 1907  O OD1    . ASN B 2 25  ? -4.147  24.154  -12.301 1.00 0.00  ? 112 ASN A OD1    2  
ATOM 1908  N ND2    . ASN B 2 25  ? -3.109  25.359  -10.784 1.00 0.00  ? 112 ASN A ND2    2  
ATOM 1909  H H      . ASN B 2 25  ? 0.535   24.029  -13.387 1.00 0.00  ? 112 ASN A H      2  
ATOM 1910  H HA     . ASN B 2 25  ? -0.708  23.776  -10.838 1.00 0.00  ? 112 ASN A HA     2  
ATOM 1911  H HB2    . ASN B 2 25  ? -1.280  25.395  -12.669 1.00 0.00  ? 112 ASN A HB2    2  
ATOM 1912  H HB3    . ASN B 2 25  ? -1.966  24.061  -13.601 1.00 0.00  ? 112 ASN A HB3    2  
ATOM 1913  H HD21   . ASN B 2 25  ? -2.266  25.778  -10.427 1.00 0.00  ? 112 ASN A HD21   2  
ATOM 1914  H HD22   . ASN B 2 25  ? -3.999  25.512  -10.338 1.00 0.00  ? 112 ASN A HD22   2  
ATOM 1915  N N      . LYS B 2 26  ? -0.923  21.044  -12.554 1.00 0.00  ? 113 LYS A N      2  
ATOM 1916  C CA     . LYS B 2 26  ? -1.229  19.599  -12.516 1.00 0.00  ? 113 LYS A CA     2  
ATOM 1917  C C      . LYS B 2 26  ? -1.047  18.941  -11.131 1.00 0.00  ? 113 LYS A C      2  
ATOM 1918  O O      . LYS B 2 26  ? -1.561  17.849  -10.910 1.00 0.00  ? 113 LYS A O      2  
ATOM 1919  C CB     . LYS B 2 26  ? -0.380  18.911  -13.609 1.00 0.00  ? 113 LYS A CB     2  
ATOM 1920  C CG     . LYS B 2 26  ? -0.692  17.421  -13.831 1.00 0.00  ? 113 LYS A CG     2  
ATOM 1921  C CD     . LYS B 2 26  ? 0.069   16.878  -15.046 1.00 0.00  ? 113 LYS A CD     2  
ATOM 1922  C CE     . LYS B 2 26  ? -0.228  15.387  -15.231 1.00 0.00  ? 113 LYS A CE     2  
ATOM 1923  N NZ     . LYS B 2 26  ? 0.487   14.826  -16.408 1.00 0.00  ? 113 LYS A NZ     2  
ATOM 1924  H H      . LYS B 2 26  ? -0.212  21.349  -13.213 1.00 0.00  ? 113 LYS A H      2  
ATOM 1925  H HA     . LYS B 2 26  ? -2.282  19.469  -12.778 1.00 0.00  ? 113 LYS A HA     2  
ATOM 1926  H HB2    . LYS B 2 26  ? -0.558  19.433  -14.551 1.00 0.00  ? 113 LYS A HB2    2  
ATOM 1927  H HB3    . LYS B 2 26  ? 0.676   19.015  -13.357 1.00 0.00  ? 113 LYS A HB3    2  
ATOM 1928  H HG2    . LYS B 2 26  ? -0.388  16.850  -12.955 1.00 0.00  ? 113 LYS A HG2    2  
ATOM 1929  H HG3    . LYS B 2 26  ? -1.766  17.301  -13.991 1.00 0.00  ? 113 LYS A HG3    2  
ATOM 1930  H HD2    . LYS B 2 26  ? -0.245  17.422  -15.939 1.00 0.00  ? 113 LYS A HD2    2  
ATOM 1931  H HD3    . LYS B 2 26  ? 1.139   17.019  -14.898 1.00 0.00  ? 113 LYS A HD3    2  
ATOM 1932  H HE2    . LYS B 2 26  ? 0.076   14.852  -14.327 1.00 0.00  ? 113 LYS A HE2    2  
ATOM 1933  H HE3    . LYS B 2 26  ? -1.306  15.255  -15.350 1.00 0.00  ? 113 LYS A HE3    2  
ATOM 1934  H HZ1    . LYS B 2 26  ? 0.207   15.286  -17.263 1.00 0.00  ? 113 LYS A HZ1    2  
ATOM 1935  H HZ2    . LYS B 2 26  ? 1.489   14.926  -16.310 1.00 0.00  ? 113 LYS A HZ2    2  
ATOM 1936  H HZ3    . LYS B 2 26  ? 0.289   13.840  -16.520 1.00 0.00  ? 113 LYS A HZ3    2  
ATOM 1937  N N      . SER B 2 27  ? -0.387  19.605  -10.178 1.00 0.00  ? 114 SER A N      2  
ATOM 1938  C CA     . SER B 2 27  ? -0.254  19.190  -8.768  1.00 0.00  ? 114 SER A CA     2  
ATOM 1939  C C      . SER B 2 27  ? -1.559  19.205  -7.945  1.00 0.00  ? 114 SER A C      2  
ATOM 1940  O O      . SER B 2 27  ? -1.575  18.691  -6.825  1.00 0.00  ? 114 SER A O      2  
ATOM 1941  C CB     . SER B 2 27  ? 0.781   20.088  -8.077  1.00 0.00  ? 114 SER A CB     2  
ATOM 1942  O OG     . SER B 2 27  ? 0.339   21.436  -8.075  1.00 0.00  ? 114 SER A OG     2  
ATOM 1943  H H      . SER B 2 27  ? 0.018   20.496  -10.433 1.00 0.00  ? 114 SER A H      2  
ATOM 1944  H HA     . SER B 2 27  ? 0.133   18.171  -8.746  1.00 0.00  ? 114 SER A HA     2  
ATOM 1945  H HB2    . SER B 2 27  ? 0.933   19.746  -7.049  1.00 0.00  ? 114 SER A HB2    2  
ATOM 1946  H HB3    . SER B 2 27  ? 1.729   20.015  -8.614  1.00 0.00  ? 114 SER A HB3    2  
ATOM 1947  H HG     . SER B 2 27  ? 1.033   21.988  -7.663  1.00 0.00  ? 114 SER A HG     2  
ATOM 1948  N N      . GLN B 2 28  ? -2.660  19.764  -8.466  1.00 0.00  ? 115 GLN A N      2  
ATOM 1949  C CA     . GLN B 2 28  ? -3.946  19.929  -7.762  1.00 0.00  ? 115 GLN A CA     2  
ATOM 1950  C C      . GLN B 2 28  ? -4.639  18.648  -7.219  1.00 0.00  ? 115 GLN A C      2  
ATOM 1951  O O      . GLN B 2 28  ? -5.320  18.766  -6.201  1.00 0.00  ? 115 GLN A O      2  
ATOM 1952  C CB     . GLN B 2 28  ? -4.900  20.733  -8.667  1.00 0.00  ? 115 GLN A CB     2  
ATOM 1953  C CG     . GLN B 2 28  ? -6.158  21.268  -7.960  1.00 0.00  ? 115 GLN A CG     2  
ATOM 1954  C CD     . GLN B 2 28  ? -5.842  22.245  -6.825  1.00 0.00  ? 115 GLN A CD     2  
ATOM 1955  O OE1    . GLN B 2 28  ? -5.866  21.918  -5.643  1.00 0.00  ? 115 GLN A OE1    2  
ATOM 1956  N NE2    . GLN B 2 28  ? -5.523  23.486  -7.130  1.00 0.00  ? 115 GLN A NE2    2  
ATOM 1957  H H      . GLN B 2 28  ? -2.555  20.217  -9.368  1.00 0.00  ? 115 GLN A H      2  
ATOM 1958  H HA     . GLN B 2 28  ? -3.728  20.543  -6.888  1.00 0.00  ? 115 GLN A HA     2  
ATOM 1959  H HB2    . GLN B 2 28  ? -4.361  21.587  -9.079  1.00 0.00  ? 115 GLN A HB2    2  
ATOM 1960  H HB3    . GLN B 2 28  ? -5.215  20.104  -9.502  1.00 0.00  ? 115 GLN A HB3    2  
ATOM 1961  H HG2    . GLN B 2 28  ? -6.773  21.786  -8.696  1.00 0.00  ? 115 GLN A HG2    2  
ATOM 1962  H HG3    . GLN B 2 28  ? -6.752  20.438  -7.576  1.00 0.00  ? 115 GLN A HG3    2  
ATOM 1963  H HE21   . GLN B 2 28  ? -5.506  23.795  -8.090  1.00 0.00  ? 115 GLN A HE21   2  
ATOM 1964  H HE22   . GLN B 2 28  ? -5.321  24.114  -6.366  1.00 0.00  ? 115 GLN A HE22   2  
ATOM 1965  N N      . PRO B 2 29  ? -4.540  17.439  -7.818  1.00 0.00  ? 116 PRO A N      2  
ATOM 1966  C CA     . PRO B 2 29  ? -5.104  16.203  -7.251  1.00 0.00  ? 116 PRO A CA     2  
ATOM 1967  C C      . PRO B 2 29  ? -4.518  15.823  -5.873  1.00 0.00  ? 116 PRO A C      2  
ATOM 1968  O O      . PRO B 2 29  ? -3.305  15.916  -5.685  1.00 0.00  ? 116 PRO A O      2  
ATOM 1969  C CB     . PRO B 2 29  ? -4.818  15.121  -8.295  1.00 0.00  ? 116 PRO A CB     2  
ATOM 1970  C CG     . PRO B 2 29  ? -4.640  15.885  -9.601  1.00 0.00  ? 116 PRO A CG     2  
ATOM 1971  C CD     . PRO B 2 29  ? -3.974  17.163  -9.126  1.00 0.00  ? 116 PRO A CD     2  
ATOM 1972  H HA     . PRO B 2 29  ? -6.182  16.322  -7.159  1.00 0.00  ? 116 PRO A HA     2  
ATOM 1973  H HB2    . PRO B 2 29  ? -3.894  14.595  -8.053  1.00 0.00  ? 116 PRO A HB2    2  
ATOM 1974  H HB3    . PRO B 2 29  ? -5.638  14.421  -8.387  1.00 0.00  ? 116 PRO A HB3    2  
ATOM 1975  H HG2    . PRO B 2 29  ? -4.023  15.337  -10.313 1.00 0.00  ? 116 PRO A HG2    2  
ATOM 1976  H HG3    . PRO B 2 29  ? -5.618  16.113  -10.028 1.00 0.00  ? 116 PRO A HG3    2  
ATOM 1977  H HD2    . PRO B 2 29  ? -2.905  16.984  -9.009  1.00 0.00  ? 116 PRO A HD2    2  
ATOM 1978  H HD3    . PRO B 2 29  ? -4.164  17.968  -9.835  1.00 0.00  ? 116 PRO A HD3    2  
ATOM 1979  N N      . LYS B 2 30  ? -5.371  15.352  -4.939  1.00 0.00  ? 117 LYS A N      2  
ATOM 1980  C CA     . LYS B 2 30  ? -5.128  14.927  -3.543  1.00 0.00  ? 117 LYS A CA     2  
ATOM 1981  C C      . LYS B 2 30  ? -6.414  14.677  -2.761  1.00 0.00  ? 117 LYS A C      2  
ATOM 1982  O O      . LYS B 2 30  ? -7.346  15.477  -2.797  1.00 0.00  ? 117 LYS A O      2  
ATOM 1983  C CB     . LYS B 2 30  ? -4.197  15.865  -2.736  1.00 0.00  ? 117 LYS A CB     2  
ATOM 1984  C CG     . LYS B 2 30  ? -4.768  17.184  -2.171  1.00 0.00  ? 117 LYS A CG     2  
ATOM 1985  C CD     . LYS B 2 30  ? -5.213  18.172  -3.252  1.00 0.00  ? 117 LYS A CD     2  
ATOM 1986  C CE     . LYS B 2 30  ? -5.803  19.477  -2.700  1.00 0.00  ? 117 LYS A CE     2  
ATOM 1987  N NZ     . LYS B 2 30  ? -4.777  20.350  -2.072  1.00 0.00  ? 117 LYS A NZ     2  
ATOM 1988  H H      . LYS B 2 30  ? -6.336  15.215  -5.219  1.00 0.00  ? 117 LYS A H      2  
ATOM 1989  H HA     . LYS B 2 30  ? -4.675  13.950  -3.570  1.00 0.00  ? 117 LYS A HA     2  
ATOM 1990  H HB2    . LYS B 2 30  ? -3.890  15.281  -1.880  1.00 0.00  ? 117 LYS A HB2    2  
ATOM 1991  H HB3    . LYS B 2 30  ? -3.284  16.084  -3.284  1.00 0.00  ? 117 LYS A HB3    2  
ATOM 1992  H HG2    . LYS B 2 30  ? -5.603  16.967  -1.506  1.00 0.00  ? 117 LYS A HG2    2  
ATOM 1993  H HG3    . LYS B 2 30  ? -3.990  17.651  -1.569  1.00 0.00  ? 117 LYS A HG3    2  
ATOM 1994  H HD2    . LYS B 2 30  ? -4.359  18.396  -3.891  1.00 0.00  ? 117 LYS A HD2    2  
ATOM 1995  H HD3    . LYS B 2 30  ? -5.988  17.703  -3.854  1.00 0.00  ? 117 LYS A HD3    2  
ATOM 1996  H HE2    . LYS B 2 30  ? -6.269  20.012  -3.536  1.00 0.00  ? 117 LYS A HE2    2  
ATOM 1997  H HE3    . LYS B 2 30  ? -6.590  19.233  -1.980  1.00 0.00  ? 117 LYS A HE3    2  
ATOM 1998  H HZ1    . LYS B 2 30  ? -4.345  19.909  -1.273  1.00 0.00  ? 117 LYS A HZ1    2  
ATOM 1999  H HZ2    . LYS B 2 30  ? -4.055  20.588  -2.735  1.00 0.00  ? 117 LYS A HZ2    2  
ATOM 2000  H HZ3    . LYS B 2 30  ? -5.191  21.219  -1.757  1.00 0.00  ? 117 LYS A HZ3    2  
ATOM 2001  N N      . ARG B 2 31  ? -6.480  13.589  -1.997  1.00 0.00  ? 118 ARG A N      2  
ATOM 2002  C CA     . ARG B 2 31  ? -5.783  12.284  -2.040  1.00 0.00  ? 118 ARG A CA     2  
ATOM 2003  C C      . ARG B 2 31  ? -6.701  11.179  -1.494  1.00 0.00  ? 118 ARG A C      2  
ATOM 2004  O O      . ARG B 2 31  ? -7.818  11.450  -1.059  1.00 0.00  ? 118 ARG A O      2  
ATOM 2005  C CB     . ARG B 2 31  ? -4.400  12.336  -1.355  1.00 0.00  ? 118 ARG A CB     2  
ATOM 2006  C CG     . ARG B 2 31  ? -4.382  12.857  0.083   1.00 0.00  ? 118 ARG A CG     2  
ATOM 2007  C CD     . ARG B 2 31  ? -2.928  12.856  0.569   1.00 0.00  ? 118 ARG A CD     2  
ATOM 2008  N NE     . ARG B 2 31  ? -2.815  13.327  1.959   1.00 0.00  ? 118 ARG A NE     2  
ATOM 2009  C CZ     . ARG B 2 31  ? -2.471  14.517  2.410   1.00 0.00  ? 118 ARG A CZ     2  
ATOM 2010  N NH1    . ARG B 2 31  ? -2.214  15.528  1.627   1.00 0.00  ? 118 ARG A NH1    2  
ATOM 2011  N NH2    . ARG B 2 31  ? -2.377  14.699  3.695   1.00 0.00  ? 118 ARG A NH2    2  
ATOM 2012  H H      . ARG B 2 31  ? -7.321  13.602  -1.473  1.00 0.00  ? 118 ARG A H      2  
ATOM 2013  H HA     . ARG B 2 31  ? -5.632  12.005  -3.082  1.00 0.00  ? 118 ARG A HA     2  
ATOM 2014  H HB2    . ARG B 2 31  ? -3.960  11.338  -1.363  1.00 0.00  ? 118 ARG A HB2    2  
ATOM 2015  H HB3    . ARG B 2 31  ? -3.740  12.966  -1.949  1.00 0.00  ? 118 ARG A HB3    2  
ATOM 2016  H HG2    . ARG B 2 31  ? -4.783  13.871  0.126   1.00 0.00  ? 118 ARG A HG2    2  
ATOM 2017  H HG3    . ARG B 2 31  ? -4.982  12.207  0.718   1.00 0.00  ? 118 ARG A HG3    2  
ATOM 2018  H HD2    . ARG B 2 31  ? -2.554  11.834  0.516   1.00 0.00  ? 118 ARG A HD2    2  
ATOM 2019  H HD3    . ARG B 2 31  ? -2.316  13.468  -0.097  1.00 0.00  ? 118 ARG A HD3    2  
ATOM 2020  H HE     . ARG B 2 31  ? -2.966  12.643  2.692   1.00 0.00  ? 118 ARG A HE     2  
ATOM 2021  H HH11   . ARG B 2 31  ? -2.270  15.399  0.632   1.00 0.00  ? 118 ARG A HH11   2  
ATOM 2022  H HH12   . ARG B 2 31  ? -1.942  16.421  2.005   1.00 0.00  ? 118 ARG A HH12   2  
ATOM 2023  H HH21   . ARG B 2 31  ? -2.556  13.896  4.285   1.00 0.00  ? 118 ARG A HH21   2  
ATOM 2024  H HH22   . ARG B 2 31  ? -2.111  15.586  4.080   1.00 0.00  ? 118 ARG A HH22   2  
ATOM 2025  N N      . LEU B 2 32  ? -6.250  9.937   -1.596  1.00 0.00  ? 119 LEU A N      2  
ATOM 2026  C CA     . LEU B 2 32  ? -7.081  8.745   -1.754  1.00 0.00  ? 119 LEU A CA     2  
ATOM 2027  C C      . LEU B 2 32  ? -6.570  7.612   -0.847  1.00 0.00  ? 119 LEU A C      2  
ATOM 2028  O O      . LEU B 2 32  ? -5.415  7.211   -0.957  1.00 0.00  ? 119 LEU A O      2  
ATOM 2029  C CB     . LEU B 2 32  ? -7.012  8.383   -3.255  1.00 0.00  ? 119 LEU A CB     2  
ATOM 2030  C CG     . LEU B 2 32  ? -8.107  7.423   -3.728  1.00 0.00  ? 119 LEU A CG     2  
ATOM 2031  C CD1    . LEU B 2 32  ? -9.438  8.149   -3.889  1.00 0.00  ? 119 LEU A CD1    2  
ATOM 2032  C CD2    . LEU B 2 32  ? -7.784  6.830   -5.091  1.00 0.00  ? 119 LEU A CD2    2  
ATOM 2033  H H      . LEU B 2 32  ? -5.295  9.822   -1.917  1.00 0.00  ? 119 LEU A H      2  
ATOM 2034  H HA     . LEU B 2 32  ? -8.112  8.978   -1.481  1.00 0.00  ? 119 LEU A HA     2  
ATOM 2035  H HB2    . LEU B 2 32  ? -7.087  9.292   -3.850  1.00 0.00  ? 119 LEU A HB2    2  
ATOM 2036  H HB3    . LEU B 2 32  ? -6.041  7.932   -3.463  1.00 0.00  ? 119 LEU A HB3    2  
ATOM 2037  H HG     . LEU B 2 32  ? -8.180  6.599   -3.027  1.00 0.00  ? 119 LEU A HG     2  
ATOM 2038  H HD11   . LEU B 2 32  ? -9.722  8.646   -2.966  1.00 0.00  ? 119 LEU A HD11   2  
ATOM 2039  H HD12   . LEU B 2 32  ? -9.368  8.901   -4.679  1.00 0.00  ? 119 LEU A HD12   2  
ATOM 2040  H HD13   . LEU B 2 32  ? -10.206 7.427   -4.142  1.00 0.00  ? 119 LEU A HD13   2  
ATOM 2041  H HD21   . LEU B 2 32  ? -7.558  7.618   -5.800  1.00 0.00  ? 119 LEU A HD21   2  
ATOM 2042  H HD22   . LEU B 2 32  ? -6.931  6.164   -5.004  1.00 0.00  ? 119 LEU A HD22   2  
ATOM 2043  H HD23   . LEU B 2 32  ? -8.629  6.248   -5.451  1.00 0.00  ? 119 LEU A HD23   2  
ATOM 2044  N N      . HIS B 2 33  ? -7.419  7.104   0.043   1.00 0.00  ? 120 HIS A N      2  
ATOM 2045  C CA     . HIS B 2 33  ? -7.180  5.955   0.931   1.00 0.00  ? 120 HIS A CA     2  
ATOM 2046  C C      . HIS B 2 33  ? -7.760  4.697   0.265   1.00 0.00  ? 120 HIS A C      2  
ATOM 2047  O O      . HIS B 2 33  ? -8.929  4.656   -0.117  1.00 0.00  ? 120 HIS A O      2  
ATOM 2048  C CB     . HIS B 2 33  ? -7.875  6.254   2.275   1.00 0.00  ? 120 HIS A CB     2  
ATOM 2049  C CG     . HIS B 2 33  ? -8.112  5.063   3.161   1.00 0.00  ? 120 HIS A CG     2  
ATOM 2050  N ND1    . HIS B 2 33  ? -9.349  4.480   3.429   1.00 0.00  ? 120 HIS A ND1    2  
ATOM 2051  C CD2    . HIS B 2 33  ? -7.160  4.436   3.898   1.00 0.00  ? 120 HIS A CD2    2  
ATOM 2052  C CE1    . HIS B 2 33  ? -9.110  3.521   4.340   1.00 0.00  ? 120 HIS A CE1    2  
ATOM 2053  N NE2    . HIS B 2 33  ? -7.802  3.469   4.637   1.00 0.00  ? 120 HIS A NE2    2  
ATOM 2054  H H      . HIS B 2 33  ? -8.381  7.420   -0.031  1.00 0.00  ? 120 HIS A H      2  
ATOM 2055  H HA     . HIS B 2 33  ? -6.095  5.796   1.075   1.00 0.00  ? 120 HIS A HA     2  
ATOM 2056  H HB2    . HIS B 2 33  ? -7.284  6.969   2.852   1.00 0.00  ? 120 HIS A HB2    2  
ATOM 2057  H HB3    . HIS B 2 33  ? -8.840  6.716   2.075   1.00 0.00  ? 120 HIS A HB3    2  
ATOM 2058  H HD2    . HIS B 2 33  ? -6.114  4.678   3.917   1.00 0.00  ? 120 HIS A HD2    2  
ATOM 2059  H HE1    . HIS B 2 33  ? -9.849  2.839   4.740   1.00 0.00  ? 120 HIS A HE1    2  
ATOM 2060  H HE2    . HIS B 2 33  ? -7.370  2.813   5.280   1.00 0.00  ? 120 HIS A HE2    2  
ATOM 2061  N N      . VAL B 2 34  ? -6.925  3.681   0.064   1.00 0.00  ? 121 VAL A N      2  
ATOM 2062  C CA     . VAL B 2 34  ? -7.091  2.620   -0.942  1.00 0.00  ? 121 VAL A CA     2  
ATOM 2063  C C      . VAL B 2 34  ? -7.035  1.269   -0.242  1.00 0.00  ? 121 VAL A C      2  
ATOM 2064  O O      . VAL B 2 34  ? -5.973  0.664   -0.103  1.00 0.00  ? 121 VAL A O      2  
ATOM 2065  C CB     . VAL B 2 34  ? -6.039  2.863   -2.051  1.00 0.00  ? 121 VAL A CB     2  
ATOM 2066  C CG1    . VAL B 2 34  ? -5.786  1.780   -3.099  1.00 0.00  ? 121 VAL A CG1    2  
ATOM 2067  C CG2    . VAL B 2 34  ? -6.445  4.123   -2.826  1.00 0.00  ? 121 VAL A CG2    2  
ATOM 2068  H H      . VAL B 2 34  ? -5.993  3.765   0.458   1.00 0.00  ? 121 VAL A H      2  
ATOM 2069  H HA     . VAL B 2 34  ? -8.077  2.682   -1.397  1.00 0.00  ? 121 VAL A HA     2  
ATOM 2070  H HB     . VAL B 2 34  ? -5.073  3.056   -1.586  1.00 0.00  ? 121 VAL A HB     2  
ATOM 2071  H HG11   . VAL B 2 34  ? -5.527  0.841   -2.619  1.00 0.00  ? 121 VAL A HG11   2  
ATOM 2072  H HG12   . VAL B 2 34  ? -6.665  1.629   -3.734  1.00 0.00  ? 121 VAL A HG12   2  
ATOM 2073  H HG13   . VAL B 2 34  ? -4.921  2.117   -3.689  1.00 0.00  ? 121 VAL A HG13   2  
ATOM 2074  H HG21   . VAL B 2 34  ? -7.494  4.075   -3.107  1.00 0.00  ? 121 VAL A HG21   2  
ATOM 2075  H HG22   . VAL B 2 34  ? -6.268  5.006   -2.216  1.00 0.00  ? 121 VAL A HG22   2  
ATOM 2076  H HG23   . VAL B 2 34  ? -5.861  4.213   -3.735  1.00 0.00  ? 121 VAL A HG23   2  
ATOM 2077  N N      . SER B 2 35  ? -8.196  0.860   0.283   1.00 0.00  ? 122 SER A N      2  
ATOM 2078  C CA     . SER B 2 35  ? -8.396  -0.280  1.184   1.00 0.00  ? 122 SER A CA     2  
ATOM 2079  C C      . SER B 2 35  ? -8.663  -1.608  0.474   1.00 0.00  ? 122 SER A C      2  
ATOM 2080  O O      . SER B 2 35  ? -9.048  -1.641  -0.692  1.00 0.00  ? 122 SER A O      2  
ATOM 2081  C CB     . SER B 2 35  ? -9.581  -0.010  2.117   1.00 0.00  ? 122 SER A CB     2  
ATOM 2082  O OG     . SER B 2 35  ? -9.181  0.898   3.113   1.00 0.00  ? 122 SER A OG     2  
ATOM 2083  H H      . SER B 2 35  ? -9.019  1.405   0.045   1.00 0.00  ? 122 SER A H      2  
ATOM 2084  H HA     . SER B 2 35  ? -7.516  -0.399  1.804   1.00 0.00  ? 122 SER A HA     2  
ATOM 2085  H HB2    . SER B 2 35  ? -10.426 0.391   1.558   1.00 0.00  ? 122 SER A HB2    2  
ATOM 2086  H HB3    . SER B 2 35  ? -9.899  -0.931  2.610   1.00 0.00  ? 122 SER A HB3    2  
ATOM 2087  H HG     . SER B 2 35  ? -8.910  1.727   2.680   1.00 0.00  ? 122 SER A HG     2  
ATOM 2088  N N      . ASN B 2 36  ? -8.541  -2.709  1.224   1.00 0.00  ? 123 ASN A N      2  
ATOM 2089  C CA     . ASN B 2 36  ? -8.882  -4.085  0.838   1.00 0.00  ? 123 ASN A CA     2  
ATOM 2090  C C      . ASN B 2 36  ? -8.235  -4.521  -0.488  1.00 0.00  ? 123 ASN A C      2  
ATOM 2091  O O      . ASN B 2 36  ? -8.822  -5.230  -1.300  1.00 0.00  ? 123 ASN A O      2  
ATOM 2092  C CB     . ASN B 2 36  ? -10.405 -4.287  0.922   1.00 0.00  ? 123 ASN A CB     2  
ATOM 2093  C CG     . ASN B 2 36  ? -10.781 -5.760  0.909   1.00 0.00  ? 123 ASN A CG     2  
ATOM 2094  O OD1    . ASN B 2 36  ? -10.294 -6.563  1.693   1.00 0.00  ? 123 ASN A OD1    2  
ATOM 2095  N ND2    . ASN B 2 36  ? -11.651 -6.177  0.022   1.00 0.00  ? 123 ASN A ND2    2  
ATOM 2096  H H      . ASN B 2 36  ? -8.045  -2.583  2.097   1.00 0.00  ? 123 ASN A H      2  
ATOM 2097  H HA     . ASN B 2 36  ? -8.442  -4.739  1.591   1.00 0.00  ? 123 ASN A HA     2  
ATOM 2098  H HB2    . ASN B 2 36  ? -10.773 -3.868  1.858   1.00 0.00  ? 123 ASN A HB2    2  
ATOM 2099  H HB3    . ASN B 2 36  ? -10.887 -3.768  0.096   1.00 0.00  ? 123 ASN A HB3    2  
ATOM 2100  H HD21   . ASN B 2 36  ? -11.954 -5.524  -0.698  1.00 0.00  ? 123 ASN A HD21   2  
ATOM 2101  H HD22   . ASN B 2 36  ? -11.955 -7.135  0.048   1.00 0.00  ? 123 ASN A HD22   2  
ATOM 2102  N N      . ILE B 2 37  ? -6.987  -4.102  -0.687  1.00 0.00  ? 124 ILE A N      2  
ATOM 2103  C CA     . ILE B 2 37  ? -6.113  -4.583  -1.766  1.00 0.00  ? 124 ILE A CA     2  
ATOM 2104  C C      . ILE B 2 37  ? -5.568  -5.981  -1.397  1.00 0.00  ? 124 ILE A C      2  
ATOM 2105  O O      . ILE B 2 37  ? -5.536  -6.307  -0.205  1.00 0.00  ? 124 ILE A O      2  
ATOM 2106  C CB     . ILE B 2 37  ? -4.978  -3.561  -2.017  1.00 0.00  ? 124 ILE A CB     2  
ATOM 2107  C CG1    . ILE B 2 37  ? -3.836  -3.717  -0.994  1.00 0.00  ? 124 ILE A CG1    2  
ATOM 2108  C CG2    . ILE B 2 37  ? -5.529  -2.122  -2.016  1.00 0.00  ? 124 ILE A CG2    2  
ATOM 2109  C CD1    . ILE B 2 37  ? -2.868  -2.546  -0.972  1.00 0.00  ? 124 ILE A CD1    2  
ATOM 2110  H H      . ILE B 2 37  ? -6.580  -3.527  0.043   1.00 0.00  ? 124 ILE A H      2  
ATOM 2111  H HA     . ILE B 2 37  ? -6.713  -4.662  -2.671  1.00 0.00  ? 124 ILE A HA     2  
ATOM 2112  H HB     . ILE B 2 37  ? -4.560  -3.758  -3.008  1.00 0.00  ? 124 ILE A HB     2  
ATOM 2113  H HG12   . ILE B 2 37  ? -4.245  -3.842  0.007   1.00 0.00  ? 124 ILE A HG12   2  
ATOM 2114  H HG13   . ILE B 2 37  ? -3.267  -4.609  -1.242  1.00 0.00  ? 124 ILE A HG13   2  
ATOM 2115  H HG21   . ILE B 2 37  ? -6.454  -2.070  -2.583  1.00 0.00  ? 124 ILE A HG21   2  
ATOM 2116  H HG22   . ILE B 2 37  ? -5.709  -1.791  -0.987  1.00 0.00  ? 124 ILE A HG22   2  
ATOM 2117  H HG23   . ILE B 2 37  ? -4.808  -1.448  -2.478  1.00 0.00  ? 124 ILE A HG23   2  
ATOM 2118  H HD11   . ILE B 2 37  ? -2.550  -2.322  -1.992  1.00 0.00  ? 124 ILE A HD11   2  
ATOM 2119  H HD12   . ILE B 2 37  ? -3.353  -1.676  -0.530  1.00 0.00  ? 124 ILE A HD12   2  
ATOM 2120  H HD13   . ILE B 2 37  ? -2.017  -2.821  -0.361  1.00 0.00  ? 124 ILE A HD13   2  
ATOM 2121  N N      . PRO B 2 38  ? -5.122  -6.817  -2.352  1.00 0.00  ? 125 PRO A N      2  
ATOM 2122  C CA     . PRO B 2 38  ? -4.447  -8.088  -2.044  1.00 0.00  ? 125 PRO A CA     2  
ATOM 2123  C C      . PRO B 2 38  ? -3.194  -7.876  -1.179  1.00 0.00  ? 125 PRO A C      2  
ATOM 2124  O O      . PRO B 2 38  ? -2.445  -6.927  -1.405  1.00 0.00  ? 125 PRO A O      2  
ATOM 2125  C CB     . PRO B 2 38  ? -4.066  -8.692  -3.407  1.00 0.00  ? 125 PRO A CB     2  
ATOM 2126  C CG     . PRO B 2 38  ? -4.987  -7.983  -4.395  1.00 0.00  ? 125 PRO A CG     2  
ATOM 2127  C CD     . PRO B 2 38  ? -5.216  -6.608  -3.786  1.00 0.00  ? 125 PRO A CD     2  
ATOM 2128  H HA     . PRO B 2 38  ? -5.145  -8.750  -1.534  1.00 0.00  ? 125 PRO A HA     2  
ATOM 2129  H HB2    . PRO B 2 38  ? -3.028  -8.457  -3.655  1.00 0.00  ? 125 PRO A HB2    2  
ATOM 2130  H HB3    . PRO B 2 38  ? -4.220  -9.771  -3.418  1.00 0.00  ? 125 PRO A HB3    2  
ATOM 2131  H HG2    . PRO B 2 38  ? -4.566  -7.928  -5.385  1.00 0.00  ? 125 PRO A HG2    2  
ATOM 2132  H HG3    . PRO B 2 38  ? -5.925  -8.510  -4.470  1.00 0.00  ? 125 PRO A HG3    2  
ATOM 2133  H HD2    . PRO B 2 38  ? -4.433  -5.921  -4.111  1.00 0.00  ? 125 PRO A HD2    2  
ATOM 2134  H HD3    . PRO B 2 38  ? -6.193  -6.225  -4.089  1.00 0.00  ? 125 PRO A HD3    2  
ATOM 2135  N N      . PHE B 2 39  ? -2.886  -8.751  -0.218  1.00 0.00  ? 126 PHE A N      2  
ATOM 2136  C CA     . PHE B 2 39  ? -1.701  -8.528  0.631   1.00 0.00  ? 126 PHE A CA     2  
ATOM 2137  C C      . PHE B 2 39  ? -0.346  -8.533  -0.103  1.00 0.00  ? 126 PHE A C      2  
ATOM 2138  O O      . PHE B 2 39  ? 0.610   -7.920  0.377   1.00 0.00  ? 126 PHE A O      2  
ATOM 2139  C CB     . PHE B 2 39  ? -1.642  -9.540  1.773   1.00 0.00  ? 126 PHE A CB     2  
ATOM 2140  C CG     . PHE B 2 39  ? -2.463  -9.241  3.007   1.00 0.00  ? 126 PHE A CG     2  
ATOM 2141  C CD1    . PHE B 2 39  ? -2.567  -7.927  3.515   1.00 0.00  ? 126 PHE A CD1    2  
ATOM 2142  C CD2    . PHE B 2 39  ? -3.003  -10.321 3.732   1.00 0.00  ? 126 PHE A CD2    2  
ATOM 2143  C CE1    . PHE B 2 39  ? -3.268  -7.713  4.712   1.00 0.00  ? 126 PHE A CE1    2  
ATOM 2144  C CE2    . PHE B 2 39  ? -3.665  -10.099 4.950   1.00 0.00  ? 126 PHE A CE2    2  
ATOM 2145  C CZ     . PHE B 2 39  ? -3.816  -8.788  5.421   1.00 0.00  ? 126 PHE A CZ     2  
ATOM 2146  H H      . PHE B 2 39  ? -3.546  -9.491  0.005   1.00 0.00  ? 126 PHE A H      2  
ATOM 2147  H HA     . PHE B 2 39  ? -1.793  -7.531  1.048   1.00 0.00  ? 126 PHE A HA     2  
ATOM 2148  H HB2    . PHE B 2 39  ? -1.873  -10.539 1.402   1.00 0.00  ? 126 PHE A HB2    2  
ATOM 2149  H HB3    . PHE B 2 39  ? -0.617  -9.554  2.119   1.00 0.00  ? 126 PHE A HB3    2  
ATOM 2150  H HD1    . PHE B 2 39  ? -2.073  -7.077  3.042   1.00 0.00  ? 126 PHE A HD1    2  
ATOM 2151  H HD2    . PHE B 2 39  ? -2.891  -11.336 3.371   1.00 0.00  ? 126 PHE A HD2    2  
ATOM 2152  H HE1    . PHE B 2 39  ? -3.370  -6.723  5.119   1.00 0.00  ? 126 PHE A HE1    2  
ATOM 2153  H HE2    . PHE B 2 39  ? -4.074  -10.930 5.510   1.00 0.00  ? 126 PHE A HE2    2  
ATOM 2154  H HZ     . PHE B 2 39  ? -4.344  -8.597  6.335   1.00 0.00  ? 126 PHE A HZ     2  
ATOM 2155  N N      . ARG B 2 40  ? -0.262  -9.196  -1.265  1.00 0.00  ? 127 ARG A N      2  
ATOM 2156  C CA     . ARG B 2 40  ? 0.920   -9.213  -2.148  1.00 0.00  ? 127 ARG A CA     2  
ATOM 2157  C C      . ARG B 2 40  ? 1.030   -7.966  -3.045  1.00 0.00  ? 127 ARG A C      2  
ATOM 2158  O O      . ARG B 2 40  ? 2.039   -7.799  -3.730  1.00 0.00  ? 127 ARG A O      2  
ATOM 2159  C CB     . ARG B 2 40  ? 0.906   -10.497 -3.006  1.00 0.00  ? 127 ARG A CB     2  
ATOM 2160  C CG     . ARG B 2 40  ? 1.263   -11.785 -2.245  1.00 0.00  ? 127 ARG A CG     2  
ATOM 2161  C CD     . ARG B 2 40  ? 0.196   -12.264 -1.251  1.00 0.00  ? 127 ARG A CD     2  
ATOM 2162  N NE     . ARG B 2 40  ? 0.423   -13.673 -0.873  1.00 0.00  ? 127 ARG A NE     2  
ATOM 2163  C CZ     . ARG B 2 40  ? 1.131   -14.156 0.133   1.00 0.00  ? 127 ARG A CZ     2  
ATOM 2164  N NH1    . ARG B 2 40  ? 1.653   -13.407 1.064   1.00 0.00  ? 127 ARG A NH1    2  
ATOM 2165  N NH2    . ARG B 2 40  ? 1.335   -15.438 0.225   1.00 0.00  ? 127 ARG A NH2    2  
ATOM 2166  H H      . ARG B 2 40  ? -1.101  -9.678  -1.555  1.00 0.00  ? 127 ARG A H      2  
ATOM 2167  H HA     . ARG B 2 40  ? 1.828   -9.216  -1.545  1.00 0.00  ? 127 ARG A HA     2  
ATOM 2168  H HB2    . ARG B 2 40  ? -0.069  -10.616 -3.488  1.00 0.00  ? 127 ARG A HB2    2  
ATOM 2169  H HB3    . ARG B 2 40  ? 1.644   -10.386 -3.799  1.00 0.00  ? 127 ARG A HB3    2  
ATOM 2170  H HG2    . ARG B 2 40  ? 1.410   -12.567 -2.988  1.00 0.00  ? 127 ARG A HG2    2  
ATOM 2171  H HG3    . ARG B 2 40  ? 2.209   -11.645 -1.717  1.00 0.00  ? 127 ARG A HG3    2  
ATOM 2172  H HD2    . ARG B 2 40  ? 0.196   -11.626 -0.365  1.00 0.00  ? 127 ARG A HD2    2  
ATOM 2173  H HD3    . ARG B 2 40  ? -0.784  -12.180 -1.734  1.00 0.00  ? 127 ARG A HD3    2  
ATOM 2174  H HE     . ARG B 2 40  ? 0.046   -14.368 -1.497  1.00 0.00  ? 127 ARG A HE     2  
ATOM 2175  H HH11   . ARG B 2 40  ? 1.442   -12.421 1.118   1.00 0.00  ? 127 ARG A HH11   2  
ATOM 2176  H HH12   . ARG B 2 40  ? 2.191   -13.825 1.800   1.00 0.00  ? 127 ARG A HH12   2  
ATOM 2177  H HH21   . ARG B 2 40  ? 0.962   -16.063 -0.469  1.00 0.00  ? 127 ARG A HH21   2  
ATOM 2178  H HH22   . ARG B 2 40  ? 1.869   -15.816 0.991   1.00 0.00  ? 127 ARG A HH22   2  
ATOM 2179  N N      . PHE B 2 41  ? 0.005   -7.108  -3.068  1.00 0.00  ? 128 PHE A N      2  
ATOM 2180  C CA     . PHE B 2 41  ? -0.041  -5.888  -3.882  1.00 0.00  ? 128 PHE A CA     2  
ATOM 2181  C C      . PHE B 2 41  ? 0.935   -4.810  -3.371  1.00 0.00  ? 128 PHE A C      2  
ATOM 2182  O O      . PHE B 2 41  ? 1.376   -4.837  -2.216  1.00 0.00  ? 128 PHE A O      2  
ATOM 2183  C CB     . PHE B 2 41  ? -1.486  -5.375  -3.918  1.00 0.00  ? 128 PHE A CB     2  
ATOM 2184  C CG     . PHE B 2 41  ? -1.934  -4.873  -5.266  1.00 0.00  ? 128 PHE A CG     2  
ATOM 2185  C CD1    . PHE B 2 41  ? -2.446  -5.787  -6.201  1.00 0.00  ? 128 PHE A CD1    2  
ATOM 2186  C CD2    . PHE B 2 41  ? -1.880  -3.506  -5.576  1.00 0.00  ? 128 PHE A CD2    2  
ATOM 2187  C CE1    . PHE B 2 41  ? -2.930  -5.341  -7.437  1.00 0.00  ? 128 PHE A CE1    2  
ATOM 2188  C CE2    . PHE B 2 41  ? -2.344  -3.059  -6.826  1.00 0.00  ? 128 PHE A CE2    2  
ATOM 2189  C CZ     . PHE B 2 41  ? -2.876  -3.973  -7.754  1.00 0.00  ? 128 PHE A CZ     2  
ATOM 2190  H H      . PHE B 2 41  ? -0.762  -7.273  -2.432  1.00 0.00  ? 128 PHE A H      2  
ATOM 2191  H HA     . PHE B 2 41  ? 0.257   -6.156  -4.897  1.00 0.00  ? 128 PHE A HA     2  
ATOM 2192  H HB2    . PHE B 2 41  ? -2.164  -6.190  -3.680  1.00 0.00  ? 128 PHE A HB2    2  
ATOM 2193  H HB3    . PHE B 2 41  ? -1.631  -4.602  -3.160  1.00 0.00  ? 128 PHE A HB3    2  
ATOM 2194  H HD1    . PHE B 2 41  ? -2.487  -6.843  -5.967  1.00 0.00  ? 128 PHE A HD1    2  
ATOM 2195  H HD2    . PHE B 2 41  ? -1.489  -2.811  -4.851  1.00 0.00  ? 128 PHE A HD2    2  
ATOM 2196  H HE1    . PHE B 2 41  ? -3.349  -6.064  -8.124  1.00 0.00  ? 128 PHE A HE1    2  
ATOM 2197  H HE2    . PHE B 2 41  ? -2.295  -2.011  -7.069  1.00 0.00  ? 128 PHE A HE2    2  
ATOM 2198  H HZ     . PHE B 2 41  ? -3.243  -3.624  -8.712  1.00 0.00  ? 128 PHE A HZ     2  
ATOM 2199  N N      . ARG B 2 42  ? 1.300   -3.863  -4.248  1.00 0.00  ? 129 ARG A N      2  
ATOM 2200  C CA     . ARG B 2 42  ? 2.475   -2.985  -4.092  1.00 0.00  ? 129 ARG A CA     2  
ATOM 2201  C C      . ARG B 2 42  ? 2.206   -1.554  -4.559  1.00 0.00  ? 129 ARG A C      2  
ATOM 2202  O O      . ARG B 2 42  ? 1.260   -1.282  -5.295  1.00 0.00  ? 129 ARG A O      2  
ATOM 2203  C CB     . ARG B 2 42  ? 3.681   -3.588  -4.835  1.00 0.00  ? 129 ARG A CB     2  
ATOM 2204  C CG     . ARG B 2 42  ? 3.875   -5.102  -4.671  1.00 0.00  ? 129 ARG A CG     2  
ATOM 2205  C CD     . ARG B 2 42  ? 5.153   -5.520  -5.397  1.00 0.00  ? 129 ARG A CD     2  
ATOM 2206  N NE     . ARG B 2 42  ? 5.281   -6.987  -5.465  1.00 0.00  ? 129 ARG A NE     2  
ATOM 2207  C CZ     . ARG B 2 42  ? 4.695   -7.803  -6.322  1.00 0.00  ? 129 ARG A CZ     2  
ATOM 2208  N NH1    . ARG B 2 42  ? 3.886   -7.390  -7.256  1.00 0.00  ? 129 ARG A NH1    2  
ATOM 2209  N NH2    . ARG B 2 42  ? 4.923   -9.086  -6.259  1.00 0.00  ? 129 ARG A NH2    2  
ATOM 2210  H H      . ARG B 2 42  ? 0.841   -3.866  -5.149  1.00 0.00  ? 129 ARG A H      2  
ATOM 2211  H HA     . ARG B 2 42  ? 2.779   -2.915  -3.053  1.00 0.00  ? 129 ARG A HA     2  
ATOM 2212  H HB2    . ARG B 2 42  ? 3.589   -3.365  -5.897  1.00 0.00  ? 129 ARG A HB2    2  
ATOM 2213  H HB3    . ARG B 2 42  ? 4.585   -3.114  -4.454  1.00 0.00  ? 129 ARG A HB3    2  
ATOM 2214  H HG2    . ARG B 2 42  ? 3.948   -5.361  -3.616  1.00 0.00  ? 129 ARG A HG2    2  
ATOM 2215  H HG3    . ARG B 2 42  ? 3.030   -5.627  -5.113  1.00 0.00  ? 129 ARG A HG3    2  
ATOM 2216  H HD2    . ARG B 2 42  ? 5.139   -5.095  -6.398  1.00 0.00  ? 129 ARG A HD2    2  
ATOM 2217  H HD3    . ARG B 2 42  ? 6.011   -5.098  -4.869  1.00 0.00  ? 129 ARG A HD3    2  
ATOM 2218  H HE     . ARG B 2 42  ? 5.885   -7.425  -4.786  1.00 0.00  ? 129 ARG A HE     2  
ATOM 2219  H HH11   . ARG B 2 42  ? 3.655   -6.398  -7.336  1.00 0.00  ? 129 ARG A HH11   2  
ATOM 2220  H HH12   . ARG B 2 42  ? 3.461   -8.034  -7.898  1.00 0.00  ? 129 ARG A HH12   2  
ATOM 2221  H HH21   . ARG B 2 42  ? 5.546   -9.456  -5.561  1.00 0.00  ? 129 ARG A HH21   2  
ATOM 2222  H HH22   . ARG B 2 42  ? 4.480   -9.713  -6.908  1.00 0.00  ? 129 ARG A HH22   2  
ATOM 2223  N N      . ASP B 2 43  ? 3.103   -0.653  -4.175  1.00 0.00  ? 130 ASP A N      2  
ATOM 2224  C CA     . ASP B 2 43  ? 3.225   0.723   -4.663  1.00 0.00  ? 130 ASP A CA     2  
ATOM 2225  C C      . ASP B 2 43  ? 3.288   0.826   -6.216  1.00 0.00  ? 130 ASP A C      2  
ATOM 2226  O O      . ASP B 2 43  ? 2.450   1.522   -6.802  1.00 0.00  ? 130 ASP A O      2  
ATOM 2227  C CB     . ASP B 2 43  ? 4.441   1.336   -3.948  1.00 0.00  ? 130 ASP A CB     2  
ATOM 2228  C CG     . ASP B 2 43  ? 4.771   2.762   -4.401  1.00 0.00  ? 130 ASP A CG     2  
ATOM 2229  O OD1    . ASP B 2 43  ? 5.222   2.942   -5.557  1.00 0.00  ? 130 ASP A OD1    2  
ATOM 2230  O OD2    . ASP B 2 43  ? 4.620   3.692   -3.580  1.00 0.00  ? 130 ASP A OD2    2  
ATOM 2231  H H      . ASP B 2 43  ? 3.834   -0.990  -3.565  1.00 0.00  ? 130 ASP A H      2  
ATOM 2232  H HA     . ASP B 2 43  ? 2.337   1.270   -4.337  1.00 0.00  ? 130 ASP A HA     2  
ATOM 2233  H HB2    . ASP B 2 43  ? 4.244   1.329   -2.875  1.00 0.00  ? 130 ASP A HB2    2  
ATOM 2234  H HB3    . ASP B 2 43  ? 5.319   0.711   -4.099  1.00 0.00  ? 130 ASP A HB3    2  
ATOM 2235  N N      . PRO B 2 44  ? 4.210   0.122   -6.915  1.00 0.00  ? 131 PRO A N      2  
ATOM 2236  C CA     . PRO B 2 44  ? 4.298   0.168   -8.379  1.00 0.00  ? 131 PRO A CA     2  
ATOM 2237  C C      . PRO B 2 44  ? 3.053   -0.434  -9.052  1.00 0.00  ? 131 PRO A C      2  
ATOM 2238  O O      . PRO B 2 44  ? 2.565   0.101   -10.050 1.00 0.00  ? 131 PRO A O      2  
ATOM 2239  C CB     . PRO B 2 44  ? 5.586   -0.575  -8.752  1.00 0.00  ? 131 PRO A CB     2  
ATOM 2240  C CG     . PRO B 2 44  ? 5.815   -1.524  -7.582  1.00 0.00  ? 131 PRO A CG     2  
ATOM 2241  C CD     . PRO B 2 44  ? 5.258   -0.746  -6.392  1.00 0.00  ? 131 PRO A CD     2  
ATOM 2242  H HA     . PRO B 2 44  ? 4.411   1.199   -8.700  1.00 0.00  ? 131 PRO A HA     2  
ATOM 2243  H HB2    . PRO B 2 44  ? 5.495   -1.114  -9.695  1.00 0.00  ? 131 PRO A HB2    2  
ATOM 2244  H HB3    . PRO B 2 44  ? 6.409   0.136   -8.805  1.00 0.00  ? 131 PRO A HB3    2  
ATOM 2245  H HG2    . PRO B 2 44  ? 5.235   -2.438  -7.730  1.00 0.00  ? 131 PRO A HG2    2  
ATOM 2246  H HG3    . PRO B 2 44  ? 6.874   -1.762  -7.454  1.00 0.00  ? 131 PRO A HG3    2  
ATOM 2247  H HD2    . PRO B 2 44  ? 4.879   -1.433  -5.651  1.00 0.00  ? 131 PRO A HD2    2  
ATOM 2248  H HD3    . PRO B 2 44  ? 6.037   -0.158  -5.923  1.00 0.00  ? 131 PRO A HD3    2  
ATOM 2249  N N      . ASP B 2 45  ? 2.490   -1.504  -8.483  1.00 0.00  ? 132 ASP A N      2  
ATOM 2250  C CA     . ASP B 2 45  ? 1.239   -2.099  -8.929  1.00 0.00  ? 132 ASP A CA     2  
ATOM 2251  C C      . ASP B 2 45  ? 0.059   -1.124  -8.813  1.00 0.00  ? 132 ASP A C      2  
ATOM 2252  O O      . ASP B 2 45  ? -0.693  -0.987  -9.778  1.00 0.00  ? 132 ASP A O      2  
ATOM 2253  C CB     . ASP B 2 45  ? 0.996   -3.397  -8.158  1.00 0.00  ? 132 ASP A CB     2  
ATOM 2254  C CG     . ASP B 2 45  ? 1.940   -4.520  -8.614  1.00 0.00  ? 132 ASP A CG     2  
ATOM 2255  O OD1    . ASP B 2 45  ? 1.751   -5.056  -9.731  1.00 0.00  ? 132 ASP A OD1    2  
ATOM 2256  O OD2    . ASP B 2 45  ? 2.865   -4.879  -7.849  1.00 0.00  ? 132 ASP A OD2    2  
ATOM 2257  H H      . ASP B 2 45  ? 2.900   -1.912  -7.658  1.00 0.00  ? 132 ASP A H      2  
ATOM 2258  H HA     . ASP B 2 45  ? 1.318   -2.341  -9.989  1.00 0.00  ? 132 ASP A HA     2  
ATOM 2259  H HB2    . ASP B 2 45  ? 1.099   -3.216  -7.087  1.00 0.00  ? 132 ASP A HB2    2  
ATOM 2260  H HB3    . ASP B 2 45  ? -0.023  -3.712  -8.339  1.00 0.00  ? 132 ASP A HB3    2  
ATOM 2261  N N      . LEU B 2 46  ? -0.079  -0.373  -7.710  1.00 0.00  ? 133 LEU A N      2  
ATOM 2262  C CA     . LEU B 2 46  ? -1.111  0.645   -7.604  1.00 0.00  ? 133 LEU A CA     2  
ATOM 2263  C C      . LEU B 2 46  ? -0.918  1.767   -8.618  1.00 0.00  ? 133 LEU A C      2  
ATOM 2264  O O      . LEU B 2 46  ? -1.895  2.127   -9.273  1.00 0.00  ? 133 LEU A O      2  
ATOM 2265  C CB     . LEU B 2 46  ? -1.183  1.212   -6.176  1.00 0.00  ? 133 LEU A CB     2  
ATOM 2266  C CG     . LEU B 2 46  ? -1.977  0.348   -5.188  1.00 0.00  ? 133 LEU A CG     2  
ATOM 2267  C CD1    . LEU B 2 46  ? -1.861  0.940   -3.787  1.00 0.00  ? 133 LEU A CD1    2  
ATOM 2268  C CD2    . LEU B 2 46  ? -3.457  0.278   -5.550  1.00 0.00  ? 133 LEU A CD2    2  
ATOM 2269  H H      . LEU B 2 46  ? 0.535   -0.463  -6.913  1.00 0.00  ? 133 LEU A H      2  
ATOM 2270  H HA     . LEU B 2 46  ? -2.054  0.169   -7.868  1.00 0.00  ? 133 LEU A HA     2  
ATOM 2271  H HB2    . LEU B 2 46  ? -0.184  1.403   -5.792  1.00 0.00  ? 133 LEU A HB2    2  
ATOM 2272  H HB3    . LEU B 2 46  ? -1.656  2.182   -6.235  1.00 0.00  ? 133 LEU A HB3    2  
ATOM 2273  H HG     . LEU B 2 46  ? -1.579  -0.658  -5.189  1.00 0.00  ? 133 LEU A HG     2  
ATOM 2274  H HD11   . LEU B 2 46  ? -0.810  0.988   -3.503  1.00 0.00  ? 133 LEU A HD11   2  
ATOM 2275  H HD12   . LEU B 2 46  ? -2.287  1.943   -3.773  1.00 0.00  ? 133 LEU A HD12   2  
ATOM 2276  H HD13   . LEU B 2 46  ? -2.394  0.309   -3.076  1.00 0.00  ? 133 LEU A HD13   2  
ATOM 2277  H HD21   . LEU B 2 46  ? -3.815  1.268   -5.810  1.00 0.00  ? 133 LEU A HD21   2  
ATOM 2278  H HD22   . LEU B 2 46  ? -3.599  -0.376  -6.402  1.00 0.00  ? 133 LEU A HD22   2  
ATOM 2279  H HD23   . LEU B 2 46  ? -4.037  -0.124  -4.720  1.00 0.00  ? 133 LEU A HD23   2  
ATOM 2280  N N      . ARG B 2 47  ? 0.297   2.307   -8.805  1.00 0.00  ? 134 ARG A N      2  
ATOM 2281  C CA     . ARG B 2 47  ? 0.486   3.388   -9.795  1.00 0.00  ? 134 ARG A CA     2  
ATOM 2282  C C      . ARG B 2 47  ? 0.224   2.942   -11.232 1.00 0.00  ? 134 ARG A C      2  
ATOM 2283  O O      . ARG B 2 47  ? -0.269  3.732   -12.023 1.00 0.00  ? 134 ARG A O      2  
ATOM 2284  C CB     . ARG B 2 47  ? 1.774   4.169   -9.601  1.00 0.00  ? 134 ARG A CB     2  
ATOM 2285  C CG     . ARG B 2 47  ? 2.985   3.457   -10.163 1.00 0.00  ? 134 ARG A CG     2  
ATOM 2286  C CD     . ARG B 2 47  ? 4.181   4.386   -10.044 1.00 0.00  ? 134 ARG A CD     2  
ATOM 2287  N NE     . ARG B 2 47  ? 4.841   4.325   -8.723  1.00 0.00  ? 134 ARG A NE     2  
ATOM 2288  C CZ     . ARG B 2 47  ? 5.850   5.071   -8.309  1.00 0.00  ? 134 ARG A CZ     2  
ATOM 2289  N NH1    . ARG B 2 47  ? 6.407   5.977   -9.067  1.00 0.00  ? 134 ARG A NH1    2  
ATOM 2290  N NH2    . ARG B 2 47  ? 6.326   4.922   -7.110  1.00 0.00  ? 134 ARG A NH2    2  
ATOM 2291  H H      . ARG B 2 47  ? 1.077   1.921   -8.282  1.00 0.00  ? 134 ARG A H      2  
ATOM 2292  H HA     . ARG B 2 47  ? -0.243  4.152   -9.602  1.00 0.00  ? 134 ARG A HA     2  
ATOM 2293  H HB2    . ARG B 2 47  ? 1.659   5.126   -10.113 1.00 0.00  ? 134 ARG A HB2    2  
ATOM 2294  H HB3    . ARG B 2 47  ? 1.917   4.366   -8.543  1.00 0.00  ? 134 ARG A HB3    2  
ATOM 2295  H HG2    . ARG B 2 47  ? 3.154   2.537   -9.622  1.00 0.00  ? 134 ARG A HG2    2  
ATOM 2296  H HG3    . ARG B 2 47  ? 2.828   3.233   -11.223 1.00 0.00  ? 134 ARG A HG3    2  
ATOM 2297  H HD2    . ARG B 2 47  ? 4.839   4.045   -10.815 1.00 0.00  ? 134 ARG A HD2    2  
ATOM 2298  H HD3    . ARG B 2 47  ? 3.889   5.411   -10.283 1.00 0.00  ? 134 ARG A HD3    2  
ATOM 2299  H HE     . ARG B 2 47  ? 4.503   3.660   -8.040  1.00 0.00  ? 134 ARG A HE     2  
ATOM 2300  H HH11   . ARG B 2 47  ? 6.068   6.105   -10.008 1.00 0.00  ? 134 ARG A HH11   2  
ATOM 2301  H HH12   . ARG B 2 47  ? 7.179   6.529   -8.731  1.00 0.00  ? 134 ARG A HH12   2  
ATOM 2302  H HH21   . ARG B 2 47  ? 5.912   4.211   -6.500  1.00 0.00  ? 134 ARG A HH21   2  
ATOM 2303  H HH22   . ARG B 2 47  ? 7.090   5.480   -6.777  1.00 0.00  ? 134 ARG A HH22   2  
ATOM 2304  N N      . GLN B 2 48  ? 0.470   1.678   -11.567 1.00 0.00  ? 135 GLN A N      2  
ATOM 2305  C CA     . GLN B 2 48  ? 0.115   1.101   -12.866 1.00 0.00  ? 135 GLN A CA     2  
ATOM 2306  C C      . GLN B 2 48  ? -1.410  0.886   -13.027 1.00 0.00  ? 135 GLN A C      2  
ATOM 2307  O O      . GLN B 2 48  ? -2.021  1.220   -14.050 1.00 0.00  ? 135 GLN A O      2  
ATOM 2308  C CB     . GLN B 2 48  ? 0.914   -0.200  -12.991 1.00 0.00  ? 135 GLN A CB     2  
ATOM 2309  C CG     . GLN B 2 48  ? 0.864   -0.779  -14.407 1.00 0.00  ? 135 GLN A CG     2  
ATOM 2310  C CD     . GLN B 2 48  ? 1.732   -2.028  -14.535 1.00 0.00  ? 135 GLN A CD     2  
ATOM 2311  O OE1    . GLN B 2 48  ? 2.886   -1.980  -14.946 1.00 0.00  ? 135 GLN A OE1    2  
ATOM 2312  N NE2    . GLN B 2 48  ? 1.222   -3.193  -14.193 1.00 0.00  ? 135 GLN A NE2    2  
ATOM 2313  H H      . GLN B 2 48  ? 0.927   1.094   -10.873 1.00 0.00  ? 135 GLN A H      2  
ATOM 2314  H HA     . GLN B 2 48  ? 0.446   1.775   -13.655 1.00 0.00  ? 135 GLN A HA     2  
ATOM 2315  H HB2    . GLN B 2 48  ? 1.958   0.003   -12.759 1.00 0.00  ? 135 GLN A HB2    2  
ATOM 2316  H HB3    . GLN B 2 48  ? 0.541   -0.911  -12.258 1.00 0.00  ? 135 GLN A HB3    2  
ATOM 2317  H HG2    . GLN B 2 48  ? -0.163  -1.017  -14.681 1.00 0.00  ? 135 GLN A HG2    2  
ATOM 2318  H HG3    . GLN B 2 48  ? 1.245   -0.015  -15.086 1.00 0.00  ? 135 GLN A HG3    2  
ATOM 2319  H HE21   . GLN B 2 48  ? 0.276   -3.273  -13.848 1.00 0.00  ? 135 GLN A HE21   2  
ATOM 2320  H HE22   . GLN B 2 48  ? 1.820   -4.003  -14.278 1.00 0.00  ? 135 GLN A HE22   2  
ATOM 2321  N N      . MET B 2 49  ? -2.053  0.366   -11.977 1.00 0.00  ? 136 MET A N      2  
ATOM 2322  C CA     . MET B 2 49  ? -3.461  -0.000  -11.957 1.00 0.00  ? 136 MET A CA     2  
ATOM 2323  C C      . MET B 2 49  ? -4.362  1.226   -11.919 1.00 0.00  ? 136 MET A C      2  
ATOM 2324  O O      . MET B 2 49  ? -5.209  1.371   -12.794 1.00 0.00  ? 136 MET A O      2  
ATOM 2325  C CB     . MET B 2 49  ? -3.654  -0.863  -10.726 1.00 0.00  ? 136 MET A CB     2  
ATOM 2326  C CG     . MET B 2 49  ? -5.075  -1.408  -10.562 1.00 0.00  ? 136 MET A CG     2  
ATOM 2327  S SD     . MET B 2 49  ? -5.575  -1.597  -8.838  1.00 0.00  ? 136 MET A SD     2  
ATOM 2328  C CE     . MET B 2 49  ? -5.432  0.134   -8.297  1.00 0.00  ? 136 MET A CE     2  
ATOM 2329  H H      . MET B 2 49  ? -1.552  0.159   -11.113 1.00 0.00  ? 136 MET A H      2  
ATOM 2330  H HA     . MET B 2 49  ? -3.700  -0.585  -12.848 1.00 0.00  ? 136 MET A HA     2  
ATOM 2331  H HB2    . MET B 2 49  ? -2.946  -1.668  -10.808 1.00 0.00  ? 136 MET A HB2    2  
ATOM 2332  H HB3    . MET B 2 49  ? -3.350  -0.294  -9.858  1.00 0.00  ? 136 MET A HB3    2  
ATOM 2333  H HG2    . MET B 2 49  ? -5.789  -0.733  -11.034 1.00 0.00  ? 136 MET A HG2    2  
ATOM 2334  H HG3    . MET B 2 49  ? -5.149  -2.370  -11.073 1.00 0.00  ? 136 MET A HG3    2  
ATOM 2335  H HE1    . MET B 2 49  ? -4.385  0.446   -8.301  1.00 0.00  ? 136 MET A HE1    2  
ATOM 2336  H HE2    . MET B 2 49  ? -5.990  0.779   -8.975  1.00 0.00  ? 136 MET A HE2    2  
ATOM 2337  H HE3    . MET B 2 49  ? -5.820  0.237   -7.284  1.00 0.00  ? 136 MET A HE3    2  
ATOM 2338  N N      . PHE B 2 50  ? -4.140  2.144   -10.975 1.00 0.00  ? 137 PHE A N      2  
ATOM 2339  C CA     . PHE B 2 50  ? -4.652  3.510   -11.091 1.00 0.00  ? 137 PHE A CA     2  
ATOM 2340  C C      . PHE B 2 50  ? -4.119  4.192   -12.361 1.00 0.00  ? 137 PHE A C      2  
ATOM 2341  O O      . PHE B 2 50  ? -4.786  5.058   -12.926 1.00 0.00  ? 137 PHE A O      2  
ATOM 2342  C CB     . PHE B 2 50  ? -4.306  4.354   -9.859  1.00 0.00  ? 137 PHE A CB     2  
ATOM 2343  C CG     . PHE B 2 50  ? -5.230  4.144   -8.685  1.00 0.00  ? 137 PHE A CG     2  
ATOM 2344  C CD1    . PHE B 2 50  ? -6.480  4.785   -8.671  1.00 0.00  ? 137 PHE A CD1    2  
ATOM 2345  C CD2    . PHE B 2 50  ? -4.848  3.340   -7.600  1.00 0.00  ? 137 PHE A CD2    2  
ATOM 2346  C CE1    . PHE B 2 50  ? -7.339  4.658   -7.571  1.00 0.00  ? 137 PHE A CE1    2  
ATOM 2347  C CE2    . PHE B 2 50  ? -5.722  3.191   -6.513  1.00 0.00  ? 137 PHE A CE2    2  
ATOM 2348  C CZ     . PHE B 2 50  ? -6.954  3.857   -6.486  1.00 0.00  ? 137 PHE A CZ     2  
ATOM 2349  H H      . PHE B 2 50  ? -3.417  1.950   -10.290 1.00 0.00  ? 137 PHE A H      2  
ATOM 2350  H HA     . PHE B 2 50  ? -5.741  3.460   -11.150 1.00 0.00  ? 137 PHE A HA     2  
ATOM 2351  H HB2    . PHE B 2 50  ? -3.270  4.196   -9.564  1.00 0.00  ? 137 PHE A HB2    2  
ATOM 2352  H HB3    . PHE B 2 50  ? -4.404  5.403   -10.126 1.00 0.00  ? 137 PHE A HB3    2  
ATOM 2353  H HD1    . PHE B 2 50  ? -6.798  5.368   -9.521  1.00 0.00  ? 137 PHE A HD1    2  
ATOM 2354  H HD2    . PHE B 2 50  ? -3.886  2.847   -7.602  1.00 0.00  ? 137 PHE A HD2    2  
ATOM 2355  H HE1    . PHE B 2 50  ? -8.303  5.148   -7.575  1.00 0.00  ? 137 PHE A HE1    2  
ATOM 2356  H HE2    . PHE B 2 50  ? -5.457  2.575   -5.679  1.00 0.00  ? 137 PHE A HE2    2  
ATOM 2357  H HZ     . PHE B 2 50  ? -7.595  3.756   -5.625  1.00 0.00  ? 137 PHE A HZ     2  
ATOM 2358  N N      . GLY B 2 51  ? -2.942  3.785   -12.850 1.00 0.00  ? 138 GLY A N      2  
ATOM 2359  C CA     . GLY B 2 51  ? -2.341  4.256   -14.107 1.00 0.00  ? 138 GLY A CA     2  
ATOM 2360  C C      . GLY B 2 51  ? -3.186  4.004   -15.357 1.00 0.00  ? 138 GLY A C      2  
ATOM 2361  O O      . GLY B 2 51  ? -3.057  4.757   -16.324 1.00 0.00  ? 138 GLY A O      2  
ATOM 2362  H H      . GLY B 2 51  ? -2.385  3.139   -12.286 1.00 0.00  ? 138 GLY A H      2  
ATOM 2363  H HA2    . GLY B 2 51  ? -2.142  5.325   -14.025 1.00 0.00  ? 138 GLY A HA2    2  
ATOM 2364  H HA3    . GLY B 2 51  ? -1.386  3.754   -14.257 1.00 0.00  ? 138 GLY A HA3    2  
ATOM 2365  N N      . GLN B 2 52  ? -4.115  3.039   -15.314 1.00 0.00  ? 139 GLN A N      2  
ATOM 2366  C CA     . GLN B 2 52  ? -5.234  2.978   -16.287 1.00 0.00  ? 139 GLN A CA     2  
ATOM 2367  C C      . GLN B 2 52  ? -5.956  4.325   -16.490 1.00 0.00  ? 139 GLN A C      2  
ATOM 2368  O O      . GLN B 2 52  ? -6.350  4.655   -17.612 1.00 0.00  ? 139 GLN A O      2  
ATOM 2369  C CB     . GLN B 2 52  ? -6.267  1.882   -15.950 1.00 0.00  ? 139 GLN A CB     2  
ATOM 2370  C CG     . GLN B 2 52  ? -7.358  2.238   -14.913 1.00 0.00  ? 139 GLN A CG     2  
ATOM 2371  C CD     . GLN B 2 52  ? -8.159  1.020   -14.448 1.00 0.00  ? 139 GLN A CD     2  
ATOM 2372  O OE1    . GLN B 2 52  ? -9.337  0.845   -14.742 1.00 0.00  ? 139 GLN A OE1    2  
ATOM 2373  N NE2    . GLN B 2 52  ? -7.559  0.138   -13.682 1.00 0.00  ? 139 GLN A NE2    2  
ATOM 2374  H H      . GLN B 2 52  ? -3.947  2.319   -14.609 1.00 0.00  ? 139 GLN A H      2  
ATOM 2375  H HA     . GLN B 2 52  ? -4.793  2.713   -17.250 1.00 0.00  ? 139 GLN A HA     2  
ATOM 2376  H HB2    . GLN B 2 52  ? -6.793  1.668   -16.881 1.00 0.00  ? 139 GLN A HB2    2  
ATOM 2377  H HB3    . GLN B 2 52  ? -5.735  0.986   -15.638 1.00 0.00  ? 139 GLN A HB3    2  
ATOM 2378  H HG2    . GLN B 2 52  ? -6.907  2.709   -14.044 1.00 0.00  ? 139 GLN A HG2    2  
ATOM 2379  H HG3    . GLN B 2 52  ? -8.052  2.945   -15.362 1.00 0.00  ? 139 GLN A HG3    2  
ATOM 2380  H HE21   . GLN B 2 52  ? -6.614  0.356   -13.376 1.00 0.00  ? 139 GLN A HE21   2  
ATOM 2381  H HE22   . GLN B 2 52  ? -8.055  -0.679  -13.367 1.00 0.00  ? 139 GLN A HE22   2  
ATOM 2382  N N      . PHE B 2 53  ? -6.127  5.099   -15.413 1.00 0.00  ? 140 PHE A N      2  
ATOM 2383  C CA     . PHE B 2 53  ? -6.758  6.422   -15.396 1.00 0.00  ? 140 PHE A CA     2  
ATOM 2384  C C      . PHE B 2 53  ? -5.748  7.587   -15.320 1.00 0.00  ? 140 PHE A C      2  
ATOM 2385  O O      . PHE B 2 53  ? -6.073  8.707   -15.723 1.00 0.00  ? 140 PHE A O      2  
ATOM 2386  C CB     . PHE B 2 53  ? -7.746  6.491   -14.218 1.00 0.00  ? 140 PHE A CB     2  
ATOM 2387  C CG     . PHE B 2 53  ? -9.050  5.758   -14.473 1.00 0.00  ? 140 PHE A CG     2  
ATOM 2388  C CD1    . PHE B 2 53  ? -9.898  6.193   -15.512 1.00 0.00  ? 140 PHE A CD1    2  
ATOM 2389  C CD2    . PHE B 2 53  ? -9.456  4.686   -13.652 1.00 0.00  ? 140 PHE A CD2    2  
ATOM 2390  C CE1    . PHE B 2 53  ? -11.125 5.550   -15.744 1.00 0.00  ? 140 PHE A CE1    2  
ATOM 2391  C CE2    . PHE B 2 53  ? -10.678 4.039   -13.892 1.00 0.00  ? 140 PHE A CE2    2  
ATOM 2392  C CZ     . PHE B 2 53  ? -11.514 4.473   -14.935 1.00 0.00  ? 140 PHE A CZ     2  
ATOM 2393  H H      . PHE B 2 53  ? -5.781  4.747   -14.529 1.00 0.00  ? 140 PHE A H      2  
ATOM 2394  H HA     . PHE B 2 53  ? -7.313  6.524   -16.326 1.00 0.00  ? 140 PHE A HA     2  
ATOM 2395  H HB2    . PHE B 2 53  ? -7.272  6.101   -13.315 1.00 0.00  ? 140 PHE A HB2    2  
ATOM 2396  H HB3    . PHE B 2 53  ? -7.989  7.534   -14.021 1.00 0.00  ? 140 PHE A HB3    2  
ATOM 2397  H HD1    . PHE B 2 53  ? -9.620  7.034   -16.130 1.00 0.00  ? 140 PHE A HD1    2  
ATOM 2398  H HD2    . PHE B 2 53  ? -8.870  4.371   -12.803 1.00 0.00  ? 140 PHE A HD2    2  
ATOM 2399  H HE1    . PHE B 2 53  ? -11.769 5.888   -16.547 1.00 0.00  ? 140 PHE A HE1    2  
ATOM 2400  H HE2    . PHE B 2 53  ? -10.969 3.227   -13.244 1.00 0.00  ? 140 PHE A HE2    2  
ATOM 2401  H HZ     . PHE B 2 53  ? -12.469 3.995   -15.115 1.00 0.00  ? 140 PHE A HZ     2  
ATOM 2402  N N      . GLY B 2 54  ? -4.532  7.319   -14.832 1.00 0.00  ? 141 GLY A N      2  
ATOM 2403  C CA     . GLY B 2 54  ? -3.314  8.131   -14.970 1.00 0.00  ? 141 GLY A CA     2  
ATOM 2404  C C      . GLY B 2 54  ? -3.350  9.515   -14.330 1.00 0.00  ? 141 GLY A C      2  
ATOM 2405  O O      . GLY B 2 54  ? -3.201  10.533  -15.009 1.00 0.00  ? 141 GLY A O      2  
ATOM 2406  H H      . GLY B 2 54  ? -4.433  6.391   -14.440 1.00 0.00  ? 141 GLY A H      2  
ATOM 2407  H HA2    . GLY B 2 54  ? -2.507  7.602   -14.467 1.00 0.00  ? 141 GLY A HA2    2  
ATOM 2408  H HA3    . GLY B 2 54  ? -3.061  8.233   -16.025 1.00 0.00  ? 141 GLY A HA3    2  
ATOM 2409  N N      . LYS B 2 55  ? -3.505  9.533   -13.001 1.00 0.00  ? 142 LYS A N      2  
ATOM 2410  C CA     . LYS B 2 55  ? -3.697  10.734  -12.164 1.00 0.00  ? 142 LYS A CA     2  
ATOM 2411  C C      . LYS B 2 55  ? -2.804  10.778  -10.914 1.00 0.00  ? 142 LYS A C      2  
ATOM 2412  O O      . LYS B 2 55  ? -3.003  11.609  -10.033 1.00 0.00  ? 142 LYS A O      2  
ATOM 2413  C CB     . LYS B 2 55  ? -5.179  10.813  -11.768 1.00 0.00  ? 142 LYS A CB     2  
ATOM 2414  C CG     . LYS B 2 55  ? -6.135  10.554  -12.939 1.00 0.00  ? 142 LYS A CG     2  
ATOM 2415  C CD     . LYS B 2 55  ? -7.553  11.045  -12.646 1.00 0.00  ? 142 LYS A CD     2  
ATOM 2416  C CE     . LYS B 2 55  ? -8.569  10.537  -13.681 1.00 0.00  ? 142 LYS A CE     2  
ATOM 2417  N NZ     . LYS B 2 55  ? -8.153  10.781  -15.087 1.00 0.00  ? 142 LYS A NZ     2  
ATOM 2418  H H      . LYS B 2 55  ? -3.686  8.625   -12.593 1.00 0.00  ? 142 LYS A H      2  
ATOM 2419  H HA     . LYS B 2 55  ? -3.453  11.625  -12.745 1.00 0.00  ? 142 LYS A HA     2  
ATOM 2420  H HB2    . LYS B 2 55  ? -5.368  10.059  -11.009 1.00 0.00  ? 142 LYS A HB2    2  
ATOM 2421  H HB3    . LYS B 2 55  ? -5.376  11.799  -11.352 1.00 0.00  ? 142 LYS A HB3    2  
ATOM 2422  H HG2    . LYS B 2 55  ? -5.747  11.065  -13.821 1.00 0.00  ? 142 LYS A HG2    2  
ATOM 2423  H HG3    . LYS B 2 55  ? -6.170  9.479   -13.129 1.00 0.00  ? 142 LYS A HG3    2  
ATOM 2424  H HD2    . LYS B 2 55  ? -7.859  10.685  -11.662 1.00 0.00  ? 142 LYS A HD2    2  
ATOM 2425  H HD3    . LYS B 2 55  ? -7.555  12.138  -12.639 1.00 0.00  ? 142 LYS A HD3    2  
ATOM 2426  H HE2    . LYS B 2 55  ? -8.739  9.469   -13.524 1.00 0.00  ? 142 LYS A HE2    2  
ATOM 2427  H HE3    . LYS B 2 55  ? -9.520  11.043  -13.492 1.00 0.00  ? 142 LYS A HE3    2  
ATOM 2428  H HZ1    . LYS B 2 55  ? -7.850  11.734  -15.225 1.00 0.00  ? 142 LYS A HZ1    2  
ATOM 2429  H HZ2    . LYS B 2 55  ? -7.403  10.158  -15.376 1.00 0.00  ? 142 LYS A HZ2    2  
ATOM 2430  H HZ3    . LYS B 2 55  ? -8.952  10.640  -15.708 1.00 0.00  ? 142 LYS A HZ3    2  
ATOM 2431  N N      . ILE B 2 56  ? -1.865  9.840   -10.817 1.00 0.00  ? 143 ILE A N      2  
ATOM 2432  C CA     . ILE B 2 56  ? -1.066  9.496   -9.628  1.00 0.00  ? 143 ILE A CA     2  
ATOM 2433  C C      . ILE B 2 56  ? 0.144   10.424  -9.511  1.00 0.00  ? 143 ILE A C      2  
ATOM 2434  O O      . ILE B 2 56  ? 1.170   10.221  -10.167 1.00 0.00  ? 143 ILE A O      2  
ATOM 2435  C CB     . ILE B 2 56  ? -0.666  7.996   -9.654  1.00 0.00  ? 143 ILE A CB     2  
ATOM 2436  C CG1    . ILE B 2 56  ? -1.924  7.130   -9.842  1.00 0.00  ? 143 ILE A CG1    2  
ATOM 2437  C CG2    . ILE B 2 56  ? 0.038   7.542   -8.365  1.00 0.00  ? 143 ILE A CG2    2  
ATOM 2438  C CD1    . ILE B 2 56  ? -2.104  6.731   -11.311 1.00 0.00  ? 143 ILE A CD1    2  
ATOM 2439  H H      . ILE B 2 56  ? -1.761  9.284   -11.652 1.00 0.00  ? 143 ILE A H      2  
ATOM 2440  H HA     . ILE B 2 56  ? -1.689  9.654   -8.746  1.00 0.00  ? 143 ILE A HA     2  
ATOM 2441  H HB     . ILE B 2 56  ? 0.020   7.803   -10.483 1.00 0.00  ? 143 ILE A HB     2  
ATOM 2442  H HG12   . ILE B 2 56  ? -1.866  6.234   -9.223  1.00 0.00  ? 143 ILE A HG12   2  
ATOM 2443  H HG13   . ILE B 2 56  ? -2.798  7.677   -9.502  1.00 0.00  ? 143 ILE A HG13   2  
ATOM 2444  H HG21   . ILE B 2 56  ? 0.904   8.166   -8.142  1.00 0.00  ? 143 ILE A HG21   2  
ATOM 2445  H HG22   . ILE B 2 56  ? -0.652  7.563   -7.526  1.00 0.00  ? 143 ILE A HG22   2  
ATOM 2446  H HG23   . ILE B 2 56  ? 0.371   6.513   -8.470  1.00 0.00  ? 143 ILE A HG23   2  
ATOM 2447  H HD11   . ILE B 2 56  ? -1.739  7.500   -11.989 1.00 0.00  ? 143 ILE A HD11   2  
ATOM 2448  H HD12   . ILE B 2 56  ? -1.541  5.820   -11.498 1.00 0.00  ? 143 ILE A HD12   2  
ATOM 2449  H HD13   . ILE B 2 56  ? -3.158  6.573   -11.519 1.00 0.00  ? 143 ILE A HD13   2  
ATOM 2450  N N      . LEU B 2 57  ? 0.021   11.463  -8.681  1.00 0.00  ? 144 LEU A N      2  
ATOM 2451  C CA     . LEU B 2 57  ? 1.134   12.339  -8.302  1.00 0.00  ? 144 LEU A CA     2  
ATOM 2452  C C      . LEU B 2 57  ? 2.090   11.597  -7.347  1.00 0.00  ? 144 LEU A C      2  
ATOM 2453  O O      . LEU B 2 57  ? 3.306   11.754  -7.447  1.00 0.00  ? 144 LEU A O      2  
ATOM 2454  C CB     . LEU B 2 57  ? 0.599   13.632  -7.649  1.00 0.00  ? 144 LEU A CB     2  
ATOM 2455  C CG     . LEU B 2 57  ? 0.025   14.726  -8.576  1.00 0.00  ? 144 LEU A CG     2  
ATOM 2456  C CD1    . LEU B 2 57  ? 1.074   15.308  -9.523  1.00 0.00  ? 144 LEU A CD1    2  
ATOM 2457  C CD2    . LEU B 2 57  ? -1.171  14.270  -9.411  1.00 0.00  ? 144 LEU A CD2    2  
ATOM 2458  H H      . LEU B 2 57  ? -0.858  11.560  -8.184  1.00 0.00  ? 144 LEU A H      2  
ATOM 2459  H HA     . LEU B 2 57  ? 1.708   12.596  -9.195  1.00 0.00  ? 144 LEU A HA     2  
ATOM 2460  H HB2    . LEU B 2 57  ? -0.166  13.358  -6.924  1.00 0.00  ? 144 LEU A HB2    2  
ATOM 2461  H HB3    . LEU B 2 57  ? 1.418   14.087  -7.090  1.00 0.00  ? 144 LEU A HB3    2  
ATOM 2462  H HG     . LEU B 2 57  ? -0.318  15.540  -7.935  1.00 0.00  ? 144 LEU A HG     2  
ATOM 2463  H HD11   . LEU B 2 57  ? 1.923   15.670  -8.944  1.00 0.00  ? 144 LEU A HD11   2  
ATOM 2464  H HD12   . LEU B 2 57  ? 1.412   14.557  -10.234 1.00 0.00  ? 144 LEU A HD12   2  
ATOM 2465  H HD13   . LEU B 2 57  ? 0.641   16.142  -10.077 1.00 0.00  ? 144 LEU A HD13   2  
ATOM 2466  H HD21   . LEU B 2 57  ? -0.856  13.553  -10.168 1.00 0.00  ? 144 LEU A HD21   2  
ATOM 2467  H HD22   . LEU B 2 57  ? -1.913  13.807  -8.763  1.00 0.00  ? 144 LEU A HD22   2  
ATOM 2468  H HD23   . LEU B 2 57  ? -1.618  15.130  -9.908  1.00 0.00  ? 144 LEU A HD23   2  
ATOM 2469  N N      . ASP B 2 58  ? 1.541   10.756  -6.462  1.00 0.00  ? 145 ASP A N      2  
ATOM 2470  C CA     . ASP B 2 58  ? 2.267   9.844   -5.573  1.00 0.00  ? 145 ASP A CA     2  
ATOM 2471  C C      . ASP B 2 58  ? 1.417   8.618   -5.181  1.00 0.00  ? 145 ASP A C      2  
ATOM 2472  O O      . ASP B 2 58  ? 0.186   8.641   -5.272  1.00 0.00  ? 145 ASP A O      2  
ATOM 2473  C CB     . ASP B 2 58  ? 2.704   10.593  -4.296  1.00 0.00  ? 145 ASP A CB     2  
ATOM 2474  C CG     . ASP B 2 58  ? 4.041   11.341  -4.457  1.00 0.00  ? 145 ASP A CG     2  
ATOM 2475  O OD1    . ASP B 2 58  ? 5.081   10.675  -4.678  1.00 0.00  ? 145 ASP A OD1    2  
ATOM 2476  O OD2    . ASP B 2 58  ? 4.066   12.584  -4.292  1.00 0.00  ? 145 ASP A OD2    2  
ATOM 2477  H H      . ASP B 2 58  ? 0.537   10.654  -6.482  1.00 0.00  ? 145 ASP A H      2  
ATOM 2478  H HA     . ASP B 2 58  ? 3.139   9.475   -6.107  1.00 0.00  ? 145 ASP A HA     2  
ATOM 2479  H HB2    . ASP B 2 58  ? 1.915   11.284  -3.994  1.00 0.00  ? 145 ASP A HB2    2  
ATOM 2480  H HB3    . ASP B 2 58  ? 2.826   9.877   -3.482  1.00 0.00  ? 145 ASP A HB3    2  
ATOM 2481  N N      . VAL B 2 59  ? 2.089   7.572   -4.690  1.00 0.00  ? 146 VAL A N      2  
ATOM 2482  C CA     . VAL B 2 59  ? 1.554   6.336   -4.072  1.00 0.00  ? 146 VAL A CA     2  
ATOM 2483  C C      . VAL B 2 59  ? 2.307   6.013   -2.777  1.00 0.00  ? 146 VAL A C      2  
ATOM 2484  O O      . VAL B 2 59  ? 3.422   6.495   -2.561  1.00 0.00  ? 146 VAL A O      2  
ATOM 2485  C CB     . VAL B 2 59  ? 1.641   5.105   -5.003  1.00 0.00  ? 146 VAL A CB     2  
ATOM 2486  C CG1    . VAL B 2 59  ? 0.325   4.858   -5.719  1.00 0.00  ? 146 VAL A CG1    2  
ATOM 2487  C CG2    . VAL B 2 59  ? 2.786   5.173   -6.019  1.00 0.00  ? 146 VAL A CG2    2  
ATOM 2488  H H      . VAL B 2 59  ? 3.094   7.675   -4.627  1.00 0.00  ? 146 VAL A H      2  
ATOM 2489  H HA     . VAL B 2 59  ? 0.512   6.491   -3.803  1.00 0.00  ? 146 VAL A HA     2  
ATOM 2490  H HB     . VAL B 2 59  ? 1.766   4.213   -4.395  1.00 0.00  ? 146 VAL A HB     2  
ATOM 2491  H HG11   . VAL B 2 59  ? -0.376  4.490   -4.970  1.00 0.00  ? 146 VAL A HG11   2  
ATOM 2492  H HG12   . VAL B 2 59  ? -0.034  5.786   -6.155  1.00 0.00  ? 146 VAL A HG12   2  
ATOM 2493  H HG13   . VAL B 2 59  ? 0.444   4.093   -6.485  1.00 0.00  ? 146 VAL A HG13   2  
ATOM 2494  H HG21   . VAL B 2 59  ? 2.576   5.929   -6.774  1.00 0.00  ? 146 VAL A HG21   2  
ATOM 2495  H HG22   . VAL B 2 59  ? 3.714   5.420   -5.509  1.00 0.00  ? 146 VAL A HG22   2  
ATOM 2496  H HG23   . VAL B 2 59  ? 2.900   4.201   -6.490  1.00 0.00  ? 146 VAL A HG23   2  
ATOM 2497  N N      . GLU B 2 60  ? 1.676   5.229   -1.896  1.00 0.00  ? 147 GLU A N      2  
ATOM 2498  C CA     . GLU B 2 60  ? 2.118   5.024   -0.512  1.00 0.00  ? 147 GLU A CA     2  
ATOM 2499  C C      . GLU B 2 60  ? 1.426   3.808   0.156   1.00 0.00  ? 147 GLU A C      2  
ATOM 2500  O O      . GLU B 2 60  ? 0.379   3.952   0.785   1.00 0.00  ? 147 GLU A O      2  
ATOM 2501  C CB     . GLU B 2 60  ? 1.801   6.333   0.244   1.00 0.00  ? 147 GLU A CB     2  
ATOM 2502  C CG     . GLU B 2 60  ? 2.384   6.389   1.660   1.00 0.00  ? 147 GLU A CG     2  
ATOM 2503  C CD     . GLU B 2 60  ? 3.809   6.981   1.651   1.00 0.00  ? 147 GLU A CD     2  
ATOM 2504  O OE1    . GLU B 2 60  ? 4.754   6.316   1.164   1.00 0.00  ? 147 GLU A OE1    2  
ATOM 2505  O OE2    . GLU B 2 60  ? 3.990   8.137   2.110   1.00 0.00  ? 147 GLU A OE2    2  
ATOM 2506  H H      . GLU B 2 60  ? 0.715   4.984   -2.120  1.00 0.00  ? 147 GLU A H      2  
ATOM 2507  H HA     . GLU B 2 60  ? 3.196   4.862   -0.499  1.00 0.00  ? 147 GLU A HA     2  
ATOM 2508  H HB2    . GLU B 2 60  ? 2.182   7.195   -0.307  1.00 0.00  ? 147 GLU A HB2    2  
ATOM 2509  H HB3    . GLU B 2 60  ? 0.718   6.440   0.260   1.00 0.00  ? 147 GLU A HB3    2  
ATOM 2510  H HG2    . GLU B 2 60  ? 1.734   7.024   2.265   1.00 0.00  ? 147 GLU A HG2    2  
ATOM 2511  H HG3    . GLU B 2 60  ? 2.383   5.396   2.106   1.00 0.00  ? 147 GLU A HG3    2  
ATOM 2512  N N      . ILE B 2 61  ? 1.964   2.591   0.028   1.00 0.00  ? 148 ILE A N      2  
ATOM 2513  C CA     . ILE B 2 61  ? 1.448   1.393   0.738   1.00 0.00  ? 148 ILE A CA     2  
ATOM 2514  C C      . ILE B 2 61  ? 1.775   1.434   2.235   1.00 0.00  ? 148 ILE A C      2  
ATOM 2515  O O      . ILE B 2 61  ? 2.853   1.905   2.609   1.00 0.00  ? 148 ILE A O      2  
ATOM 2516  C CB     . ILE B 2 61  ? 2.002   0.120   0.066   1.00 0.00  ? 148 ILE A CB     2  
ATOM 2517  C CG1    . ILE B 2 61  ? 1.182   -0.143  -1.207  1.00 0.00  ? 148 ILE A CG1    2  
ATOM 2518  C CG2    . ILE B 2 61  ? 2.032   -1.127  0.973   1.00 0.00  ? 148 ILE A CG2    2  
ATOM 2519  C CD1    . ILE B 2 61  ? -0.124  -0.891  -0.978  1.00 0.00  ? 148 ILE A CD1    2  
ATOM 2520  H H      . ILE B 2 61  ? 2.820   2.511   -0.500  1.00 0.00  ? 148 ILE A H      2  
ATOM 2521  H HA     . ILE B 2 61  ? 0.362   1.378   0.663   1.00 0.00  ? 148 ILE A HA     2  
ATOM 2522  H HB     . ILE B 2 61  ? 3.030   0.319   -0.235  1.00 0.00  ? 148 ILE A HB     2  
ATOM 2523  H HG12   . ILE B 2 61  ? 0.981   0.791   -1.733  1.00 0.00  ? 148 ILE A HG12   2  
ATOM 2524  H HG13   . ILE B 2 61  ? 1.771   -0.758  -1.864  1.00 0.00  ? 148 ILE A HG13   2  
ATOM 2525  H HG21   . ILE B 2 61  ? 2.750   -0.985  1.772   1.00 0.00  ? 148 ILE A HG21   2  
ATOM 2526  H HG22   . ILE B 2 61  ? 1.053   -1.319  1.415   1.00 0.00  ? 148 ILE A HG22   2  
ATOM 2527  H HG23   . ILE B 2 61  ? 2.337   -1.997  0.395   1.00 0.00  ? 148 ILE A HG23   2  
ATOM 2528  H HD11   . ILE B 2 61  ? 0.097   -1.897  -0.610  1.00 0.00  ? 148 ILE A HD11   2  
ATOM 2529  H HD12   . ILE B 2 61  ? -0.739  -0.371  -0.245  1.00 0.00  ? 148 ILE A HD12   2  
ATOM 2530  H HD13   . ILE B 2 61  ? -0.647  -0.978  -1.928  1.00 0.00  ? 148 ILE A HD13   2  
ATOM 2531  N N      . ILE B 2 62  ? 0.907   0.901   3.109   1.00 0.00  ? 149 ILE A N      2  
ATOM 2532  C CA     . ILE B 2 62  ? 1.132   0.973   4.548   1.00 0.00  ? 149 ILE A CA     2  
ATOM 2533  C C      . ILE B 2 62  ? 1.806   -0.350  4.977   1.00 0.00  ? 149 ILE A C      2  
ATOM 2534  O O      . ILE B 2 62  ? 1.182   -1.198  5.608   1.00 0.00  ? 149 ILE A O      2  
ATOM 2535  C CB     . ILE B 2 62  ? -0.208  1.267   5.238   1.00 0.00  ? 149 ILE A CB     2  
ATOM 2536  C CG1    . ILE B 2 62  ? -1.060  2.359   4.550   1.00 0.00  ? 149 ILE A CG1    2  
ATOM 2537  C CG2    . ILE B 2 62  ? 0.101   1.729   6.656   1.00 0.00  ? 149 ILE A CG2    2  
ATOM 2538  C CD1    . ILE B 2 62  ? -0.369  3.671   4.176   1.00 0.00  ? 149 ILE A CD1    2  
ATOM 2539  H H      . ILE B 2 62  ? 0.058   0.393   2.872   1.00 0.00  ? 149 ILE A H      2  
ATOM 2540  H HA     . ILE B 2 62  ? 1.770   1.826   4.822   1.00 0.00  ? 149 ILE A HA     2  
ATOM 2541  H HB     . ILE B 2 62  ? -0.808  0.357   5.283   1.00 0.00  ? 149 ILE A HB     2  
ATOM 2542  H HG12   . ILE B 2 62  ? -1.529  1.955   3.657   1.00 0.00  ? 149 ILE A HG12   2  
ATOM 2543  H HG13   . ILE B 2 62  ? -1.848  2.615   5.236   1.00 0.00  ? 149 ILE A HG13   2  
ATOM 2544  H HG21   . ILE B 2 62  ? 0.890   1.125   7.090   1.00 0.00  ? 149 ILE A HG21   2  
ATOM 2545  H HG22   . ILE B 2 62  ? 0.490   2.736   6.635   1.00 0.00  ? 149 ILE A HG22   2  
ATOM 2546  H HG23   . ILE B 2 62  ? -0.801  1.706   7.267   1.00 0.00  ? 149 ILE A HG23   2  
ATOM 2547  H HD11   . ILE B 2 62  ? 0.082   4.102   5.065   1.00 0.00  ? 149 ILE A HD11   2  
ATOM 2548  H HD12   . ILE B 2 62  ? 0.401   3.516   3.426   1.00 0.00  ? 149 ILE A HD12   2  
ATOM 2549  H HD13   . ILE B 2 62  ? -1.104  4.378   3.784   1.00 0.00  ? 149 ILE A HD13   2  
ATOM 2550  N N      . PHE B 2 63  ? 3.042   -0.597  4.529   1.00 0.00  ? 150 PHE A N      2  
ATOM 2551  C CA     . PHE B 2 63  ? 3.689   -1.921  4.625   1.00 0.00  ? 150 PHE A CA     2  
ATOM 2552  C C      . PHE B 2 63  ? 3.897   -2.420  6.081   1.00 0.00  ? 150 PHE A C      2  
ATOM 2553  O O      . PHE B 2 63  ? 3.956   -1.625  7.024   1.00 0.00  ? 150 PHE A O      2  
ATOM 2554  C CB     . PHE B 2 63  ? 5.048   -1.902  3.885   1.00 0.00  ? 150 PHE A CB     2  
ATOM 2555  C CG     . PHE B 2 63  ? 5.001   -2.370  2.438   1.00 0.00  ? 150 PHE A CG     2  
ATOM 2556  C CD1    . PHE B 2 63  ? 4.583   -3.686  2.153   1.00 0.00  ? 150 PHE A CD1    2  
ATOM 2557  C CD2    . PHE B 2 63  ? 5.384   -1.522  1.383   1.00 0.00  ? 150 PHE A CD2    2  
ATOM 2558  C CE1    . PHE B 2 63  ? 4.508   -4.140  0.826   1.00 0.00  ? 150 PHE A CE1    2  
ATOM 2559  C CE2    . PHE B 2 63  ? 5.317   -1.977  0.054   1.00 0.00  ? 150 PHE A CE2    2  
ATOM 2560  C CZ     . PHE B 2 63  ? 4.873   -3.285  -0.224  1.00 0.00  ? 150 PHE A CZ     2  
ATOM 2561  H H      . PHE B 2 63  ? 3.479   0.125   3.972   1.00 0.00  ? 150 PHE A H      2  
ATOM 2562  H HA     . PHE B 2 63  ? 3.024   -2.623  4.105   1.00 0.00  ? 150 PHE A HA     2  
ATOM 2563  H HB2    . PHE B 2 63  ? 5.475   -0.900  3.939   1.00 0.00  ? 150 PHE A HB2    2  
ATOM 2564  H HB3    . PHE B 2 63  ? 5.745   -2.566  4.396   1.00 0.00  ? 150 PHE A HB3    2  
ATOM 2565  H HD1    . PHE B 2 63  ? 4.322   -4.354  2.960   1.00 0.00  ? 150 PHE A HD1    2  
ATOM 2566  H HD2    . PHE B 2 63  ? 5.719   -0.515  1.588   1.00 0.00  ? 150 PHE A HD2    2  
ATOM 2567  H HE1    . PHE B 2 63  ? 4.172   -5.146  0.617   1.00 0.00  ? 150 PHE A HE1    2  
ATOM 2568  H HE2    . PHE B 2 63  ? 5.603   -1.317  -0.757  1.00 0.00  ? 150 PHE A HE2    2  
ATOM 2569  H HZ     . PHE B 2 63  ? 4.811   -3.640  -1.243  1.00 0.00  ? 150 PHE A HZ     2  
ATOM 2570  N N      . ASN B 2 64  ? 4.087   -3.735  6.263   1.00 0.00  ? 151 ASN A N      2  
ATOM 2571  C CA     . ASN B 2 64  ? 4.389   -4.430  7.517   1.00 0.00  ? 151 ASN A CA     2  
ATOM 2572  C C      . ASN B 2 64  ? 5.425   -5.548  7.245   1.00 0.00  ? 151 ASN A C      2  
ATOM 2573  O O      . ASN B 2 64  ? 5.646   -5.932  6.094   1.00 0.00  ? 151 ASN A O      2  
ATOM 2574  C CB     . ASN B 2 64  ? 3.039   -4.952  8.053   1.00 0.00  ? 151 ASN A CB     2  
ATOM 2575  C CG     . ASN B 2 64  ? 3.089   -5.804  9.309   1.00 0.00  ? 151 ASN A CG     2  
ATOM 2576  O OD1    . ASN B 2 64  ? 3.445   -6.968  9.286   1.00 0.00  ? 151 ASN A OD1    2  
ATOM 2577  N ND2    . ASN B 2 64  ? 2.652   -5.296  10.435  1.00 0.00  ? 151 ASN A ND2    2  
ATOM 2578  H H      . ASN B 2 64  ? 4.006   -4.377  5.475   1.00 0.00  ? 151 ASN A H      2  
ATOM 2579  H HA     . ASN B 2 64  ? 4.823   -3.736  8.240   1.00 0.00  ? 151 ASN A HA     2  
ATOM 2580  H HB2    . ASN B 2 64  ? 2.408   -4.092  8.261   1.00 0.00  ? 151 ASN A HB2    2  
ATOM 2581  H HB3    . ASN B 2 64  ? 2.550   -5.545  7.280   1.00 0.00  ? 151 ASN A HB3    2  
ATOM 2582  H HD21   . ASN B 2 64  ? 2.297   -4.354  10.483  1.00 0.00  ? 151 ASN A HD21   2  
ATOM 2583  H HD22   . ASN B 2 64  ? 2.634   -5.911  11.233  1.00 0.00  ? 151 ASN A HD22   2  
ATOM 2584  N N      . GLU B 2 65  ? 6.045   -6.106  8.288   1.00 0.00  ? 152 GLU A N      2  
ATOM 2585  C CA     . GLU B 2 65  ? 6.980   -7.242  8.182   1.00 0.00  ? 152 GLU A CA     2  
ATOM 2586  C C      . GLU B 2 65  ? 6.371   -8.478  7.482   1.00 0.00  ? 152 GLU A C      2  
ATOM 2587  O O      . GLU B 2 65  ? 7.084   -9.222  6.805   1.00 0.00  ? 152 GLU A O      2  
ATOM 2588  C CB     . GLU B 2 65  ? 7.473   -7.644  9.583   1.00 0.00  ? 152 GLU A CB     2  
ATOM 2589  C CG     . GLU B 2 65  ? 8.274   -6.560  10.322  1.00 0.00  ? 152 GLU A CG     2  
ATOM 2590  C CD     . GLU B 2 65  ? 9.594   -6.219  9.603   1.00 0.00  ? 152 GLU A CD     2  
ATOM 2591  O OE1    . GLU B 2 65  ? 10.577  -6.992  9.723   1.00 0.00  ? 152 GLU A OE1    2  
ATOM 2592  O OE2    . GLU B 2 65  ? 9.663   -5.171  8.913   1.00 0.00  ? 152 GLU A OE2    2  
ATOM 2593  H H      . GLU B 2 65  ? 5.826   -5.762  9.213   1.00 0.00  ? 152 GLU A H      2  
ATOM 2594  H HA     . GLU B 2 65  ? 7.842   -6.937  7.586   1.00 0.00  ? 152 GLU A HA     2  
ATOM 2595  H HB2    . GLU B 2 65  ? 6.611   -7.918  10.191  1.00 0.00  ? 152 GLU A HB2    2  
ATOM 2596  H HB3    . GLU B 2 65  ? 8.106   -8.528  9.488   1.00 0.00  ? 152 GLU A HB3    2  
ATOM 2597  H HG2    . GLU B 2 65  ? 7.656   -5.665  10.436  1.00 0.00  ? 152 GLU A HG2    2  
ATOM 2598  H HG3    . GLU B 2 65  ? 8.496   -6.924  11.326  1.00 0.00  ? 152 GLU A HG3    2  
ATOM 2599  N N      . ARG B 2 66  ? 5.053   -8.687  7.619   1.00 0.00  ? 153 ARG A N      2  
ATOM 2600  C CA     . ARG B 2 66  ? 4.280   -9.760  6.973   1.00 0.00  ? 153 ARG A CA     2  
ATOM 2601  C C      . ARG B 2 66  ? 3.934   -9.498  5.495   1.00 0.00  ? 153 ARG A C      2  
ATOM 2602  O O      . ARG B 2 66  ? 3.610   -10.459 4.795   1.00 0.00  ? 153 ARG A O      2  
ATOM 2603  C CB     . ARG B 2 66  ? 2.993   -10.014 7.784   1.00 0.00  ? 153 ARG A CB     2  
ATOM 2604  C CG     . ARG B 2 66  ? 3.213   -10.665 9.160   1.00 0.00  ? 153 ARG A CG     2  
ATOM 2605  C CD     . ARG B 2 66  ? 3.513   -12.163 9.034   1.00 0.00  ? 153 ARG A CD     2  
ATOM 2606  N NE     . ARG B 2 66  ? 3.574   -12.821 10.356  1.00 0.00  ? 153 ARG A NE     2  
ATOM 2607  C CZ     . ARG B 2 66  ? 3.472   -14.114 10.601  1.00 0.00  ? 153 ARG A CZ     2  
ATOM 2608  N NH1    . ARG B 2 66  ? 3.292   -14.993 9.655   1.00 0.00  ? 153 ARG A NH1    2  
ATOM 2609  N NH2    . ARG B 2 66  ? 3.541   -14.561 11.824  1.00 0.00  ? 153 ARG A NH2    2  
ATOM 2610  H H      . ARG B 2 66  ? 4.560   -8.033  8.221   1.00 0.00  ? 153 ARG A H      2  
ATOM 2611  H HA     . ARG B 2 66  ? 4.877   -10.674 6.975   1.00 0.00  ? 153 ARG A HA     2  
ATOM 2612  H HB2    . ARG B 2 66  ? 2.460   -9.072  7.926   1.00 0.00  ? 153 ARG A HB2    2  
ATOM 2613  H HB3    . ARG B 2 66  ? 2.327   -10.668 7.222   1.00 0.00  ? 153 ARG A HB3    2  
ATOM 2614  H HG2    . ARG B 2 66  ? 4.023   -10.163 9.691   1.00 0.00  ? 153 ARG A HG2    2  
ATOM 2615  H HG3    . ARG B 2 66  ? 2.295   -10.547 9.740   1.00 0.00  ? 153 ARG A HG3    2  
ATOM 2616  H HD2    . ARG B 2 66  ? 2.725   -12.621 8.433   1.00 0.00  ? 153 ARG A HD2    2  
ATOM 2617  H HD3    . ARG B 2 66  ? 4.467   -12.292 8.521   1.00 0.00  ? 153 ARG A HD3    2  
ATOM 2618  H HE     . ARG B 2 66  ? 3.728   -12.231 11.156  1.00 0.00  ? 153 ARG A HE     2  
ATOM 2619  H HH11   . ARG B 2 66  ? 3.238   -14.670 8.706   1.00 0.00  ? 153 ARG A HH11   2  
ATOM 2620  H HH12   . ARG B 2 66  ? 3.210   -15.972 9.866   1.00 0.00  ? 153 ARG A HH12   2  
ATOM 2621  H HH21   . ARG B 2 66  ? 3.676   -13.925 12.597  1.00 0.00  ? 153 ARG A HH21   2  
ATOM 2622  H HH22   . ARG B 2 66  ? 3.466   -15.546 12.007  1.00 0.00  ? 153 ARG A HH22   2  
ATOM 2623  N N      . GLY B 2 67  ? 3.987   -8.254  5.000   1.00 0.00  ? 154 GLY A N      2  
ATOM 2624  C CA     . GLY B 2 67  ? 3.511   -7.864  3.660   1.00 0.00  ? 154 GLY A CA     2  
ATOM 2625  C C      . GLY B 2 67  ? 2.744   -6.543  3.730   1.00 0.00  ? 154 GLY A C      2  
ATOM 2626  O O      . GLY B 2 67  ? 2.961   -5.759  4.654   1.00 0.00  ? 154 GLY A O      2  
ATOM 2627  H H      . GLY B 2 67  ? 4.269   -7.483  5.602   1.00 0.00  ? 154 GLY A H      2  
ATOM 2628  H HA2    . GLY B 2 67  ? 4.369   -7.735  2.999   1.00 0.00  ? 154 GLY A HA2    2  
ATOM 2629  H HA3    . GLY B 2 67  ? 2.855   -8.628  3.236   1.00 0.00  ? 154 GLY A HA3    2  
ATOM 2630  N N      . SER B 2 68  ? 1.841   -6.261  2.785   1.00 0.00  ? 155 SER A N      2  
ATOM 2631  C CA     . SER B 2 68  ? 0.893   -5.145  2.965   1.00 0.00  ? 155 SER A CA     2  
ATOM 2632  C C      . SER B 2 68  ? 0.060   -5.290  4.250   1.00 0.00  ? 155 SER A C      2  
ATOM 2633  O O      . SER B 2 68  ? -0.265  -6.407  4.650   1.00 0.00  ? 155 SER A O      2  
ATOM 2634  C CB     . SER B 2 68  ? 0.001   -4.988  1.735   1.00 0.00  ? 155 SER A CB     2  
ATOM 2635  O OG     . SER B 2 68  ? -0.807  -3.839  1.906   1.00 0.00  ? 155 SER A OG     2  
ATOM 2636  H H      . SER B 2 68  ? 1.725   -6.888  1.996   1.00 0.00  ? 155 SER A H      2  
ATOM 2637  H HA     . SER B 2 68  ? 1.445   -4.226  3.062   1.00 0.00  ? 155 SER A HA     2  
ATOM 2638  H HB2    . SER B 2 68  ? 0.625   -4.871  0.846   1.00 0.00  ? 155 SER A HB2    2  
ATOM 2639  H HB3    . SER B 2 68  ? -0.629  -5.865  1.621   1.00 0.00  ? 155 SER A HB3    2  
ATOM 2640  H HG     . SER B 2 68  ? -1.042  -3.501  1.025   1.00 0.00  ? 155 SER A HG     2  
ATOM 2641  N N      . LYS B 2 69  ? -0.343  -4.172  4.874   1.00 0.00  ? 156 LYS A N      2  
ATOM 2642  C CA     . LYS B 2 69  ? -1.440  -4.135  5.866   1.00 0.00  ? 156 LYS A CA     2  
ATOM 2643  C C      . LYS B 2 69  ? -2.835  -4.219  5.241   1.00 0.00  ? 156 LYS A C      2  
ATOM 2644  O O      . LYS B 2 69  ? -3.833  -4.265  5.957   1.00 0.00  ? 156 LYS A O      2  
ATOM 2645  C CB     . LYS B 2 69  ? -1.321  -2.881  6.749   1.00 0.00  ? 156 LYS A CB     2  
ATOM 2646  C CG     . LYS B 2 69  ? -0.225  -3.128  7.798   1.00 0.00  ? 156 LYS A CG     2  
ATOM 2647  C CD     . LYS B 2 69  ? -0.280  -2.171  8.987   1.00 0.00  ? 156 LYS A CD     2  
ATOM 2648  C CE     . LYS B 2 69  ? 0.118   -0.770  8.544   1.00 0.00  ? 156 LYS A CE     2  
ATOM 2649  N NZ     . LYS B 2 69  ? 0.091   0.187   9.683   1.00 0.00  ? 156 LYS A NZ     2  
ATOM 2650  H H      . LYS B 2 69  ? 0.010   -3.293  4.514   1.00 0.00  ? 156 LYS A H      2  
ATOM 2651  H HA     . LYS B 2 69  ? -1.356  -5.016  6.504   1.00 0.00  ? 156 LYS A HA     2  
ATOM 2652  H HB2    . LYS B 2 69  ? -1.105  -2.003  6.122   1.00 0.00  ? 156 LYS A HB2    2  
ATOM 2653  H HB3    . LYS B 2 69  ? -2.265  -2.712  7.269   1.00 0.00  ? 156 LYS A HB3    2  
ATOM 2654  H HG2    . LYS B 2 69  ? -0.341  -4.133  8.197   1.00 0.00  ? 156 LYS A HG2    2  
ATOM 2655  H HG3    . LYS B 2 69  ? 0.748   -3.071  7.315   1.00 0.00  ? 156 LYS A HG3    2  
ATOM 2656  H HD2    . LYS B 2 69  ? -1.287  -2.166  9.404   1.00 0.00  ? 156 LYS A HD2    2  
ATOM 2657  H HD3    . LYS B 2 69  ? 0.414   -2.523  9.752   1.00 0.00  ? 156 LYS A HD3    2  
ATOM 2658  H HE2    . LYS B 2 69  ? 1.121   -0.814  8.105   1.00 0.00  ? 156 LYS A HE2    2  
ATOM 2659  H HE3    . LYS B 2 69  ? -0.551  -0.448  7.734   1.00 0.00  ? 156 LYS A HE3    2  
ATOM 2660  H HZ1    . LYS B 2 69  ? -0.832  0.287   10.076  1.00 0.00  ? 156 LYS A HZ1    2  
ATOM 2661  H HZ2    . LYS B 2 69  ? 0.716   -0.103  10.422  1.00 0.00  ? 156 LYS A HZ2    2  
ATOM 2662  H HZ3    . LYS B 2 69  ? 0.401   1.120   9.398   1.00 0.00  ? 156 LYS A HZ3    2  
ATOM 2663  N N      . GLY B 2 70  ? -2.909  -4.268  3.913   1.00 0.00  ? 157 GLY A N      2  
ATOM 2664  C CA     . GLY B 2 70  ? -4.141  -4.426  3.147   1.00 0.00  ? 157 GLY A CA     2  
ATOM 2665  C C      . GLY B 2 70  ? -4.713  -3.116  2.610   1.00 0.00  ? 157 GLY A C      2  
ATOM 2666  O O      . GLY B 2 70  ? -5.747  -3.130  1.942   1.00 0.00  ? 157 GLY A O      2  
ATOM 2667  H H      . GLY B 2 70  ? -2.036  -4.204  3.399   1.00 0.00  ? 157 GLY A H      2  
ATOM 2668  H HA2    . GLY B 2 70  ? -3.949  -5.088  2.302   1.00 0.00  ? 157 GLY A HA2    2  
ATOM 2669  H HA3    . GLY B 2 70  ? -4.896  -4.890  3.779   1.00 0.00  ? 157 GLY A HA3    2  
ATOM 2670  N N      . PHE B 2 71  ? -4.047  -1.989  2.880   1.00 0.00  ? 158 PHE A N      2  
ATOM 2671  C CA     . PHE B 2 71  ? -4.311  -0.702  2.254   1.00 0.00  ? 158 PHE A CA     2  
ATOM 2672  C C      . PHE B 2 71  ? -3.021  0.037   1.880   1.00 0.00  ? 158 PHE A C      2  
ATOM 2673  O O      . PHE B 2 71  ? -1.919  -0.193  2.402   1.00 0.00  ? 158 PHE A O      2  
ATOM 2674  C CB     . PHE B 2 71  ? -5.274  0.173   3.096   1.00 0.00  ? 158 PHE A CB     2  
ATOM 2675  C CG     . PHE B 2 71  ? -4.737  1.018   4.238   1.00 0.00  ? 158 PHE A CG     2  
ATOM 2676  C CD1    . PHE B 2 71  ? -4.512  0.424   5.490   1.00 0.00  ? 158 PHE A CD1    2  
ATOM 2677  C CD2    . PHE B 2 71  ? -4.614  2.416   4.091   1.00 0.00  ? 158 PHE A CD2    2  
ATOM 2678  C CE1    . PHE B 2 71  ? -4.163  1.225   6.587   1.00 0.00  ? 158 PHE A CE1    2  
ATOM 2679  C CE2    . PHE B 2 71  ? -4.282  3.232   5.193   1.00 0.00  ? 158 PHE A CE2    2  
ATOM 2680  C CZ     . PHE B 2 71  ? -4.046  2.620   6.434   1.00 0.00  ? 158 PHE A CZ     2  
ATOM 2681  H H      . PHE B 2 71  ? -3.159  -2.083  3.341   1.00 0.00  ? 158 PHE A H      2  
ATOM 2682  H HA     . PHE B 2 71  ? -4.821  -0.918  1.317   1.00 0.00  ? 158 PHE A HA     2  
ATOM 2683  H HB2    . PHE B 2 71  ? -5.790  0.840   2.424   1.00 0.00  ? 158 PHE A HB2    2  
ATOM 2684  H HB3    . PHE B 2 71  ? -6.072  -0.433  3.498   1.00 0.00  ? 158 PHE A HB3    2  
ATOM 2685  H HD1    . PHE B 2 71  ? -4.637  -0.642  5.618   1.00 0.00  ? 158 PHE A HD1    2  
ATOM 2686  H HD2    . PHE B 2 71  ? -4.812  2.869   3.133   1.00 0.00  ? 158 PHE A HD2    2  
ATOM 2687  H HE1    . PHE B 2 71  ? -3.999  0.754   7.543   1.00 0.00  ? 158 PHE A HE1    2  
ATOM 2688  H HE2    . PHE B 2 71  ? -4.175  4.317   5.102   1.00 0.00  ? 158 PHE A HE2    2  
ATOM 2689  H HZ     . PHE B 2 71  ? -3.724  3.220   7.257   1.00 0.00  ? 158 PHE A HZ     2  
ATOM 2690  N N      . GLY B 2 72  ? -3.209  0.968   0.954   1.00 0.00  ? 159 GLY A N      2  
ATOM 2691  C CA     . GLY B 2 72  ? -2.279  2.021   0.611   1.00 0.00  ? 159 GLY A CA     2  
ATOM 2692  C C      . GLY B 2 72  ? -3.018  3.354   0.508   1.00 0.00  ? 159 GLY A C      2  
ATOM 2693  O O      . GLY B 2 72  ? -4.211  3.478   0.782   1.00 0.00  ? 159 GLY A O      2  
ATOM 2694  H H      . GLY B 2 72  ? -4.157  1.057   0.595   1.00 0.00  ? 159 GLY A H      2  
ATOM 2695  H HA2    . GLY B 2 72  ? -1.532  2.123   1.396   1.00 0.00  ? 159 GLY A HA2    2  
ATOM 2696  H HA3    . GLY B 2 72  ? -1.773  1.781   -0.333  1.00 0.00  ? 159 GLY A HA3    2  
ATOM 2697  N N      . PHE B 2 73  ? -2.273  4.362   0.106   1.00 0.00  ? 160 PHE A N      2  
ATOM 2698  C CA     . PHE B 2 73  ? -2.663  5.717   -0.206  1.00 0.00  ? 160 PHE A CA     2  
ATOM 2699  C C      . PHE B 2 73  ? -2.167  6.055   -1.620  1.00 0.00  ? 160 PHE A C      2  
ATOM 2700  O O      . PHE B 2 73  ? -1.154  5.526   -2.082  1.00 0.00  ? 160 PHE A O      2  
ATOM 2701  C CB     . PHE B 2 73  ? -2.050  6.632   0.866   1.00 0.00  ? 160 PHE A CB     2  
ATOM 2702  C CG     . PHE B 2 73  ? -3.059  7.243   1.805   1.00 0.00  ? 160 PHE A CG     2  
ATOM 2703  C CD1    . PHE B 2 73  ? -3.573  6.526   2.912   1.00 0.00  ? 160 PHE A CD1    2  
ATOM 2704  C CD2    . PHE B 2 73  ? -3.448  8.575   1.585   1.00 0.00  ? 160 PHE A CD2    2  
ATOM 2705  C CE1    . PHE B 2 73  ? -4.476  7.148   3.786   1.00 0.00  ? 160 PHE A CE1    2  
ATOM 2706  C CE2    . PHE B 2 73  ? -4.334  9.195   2.474   1.00 0.00  ? 160 PHE A CE2    2  
ATOM 2707  C CZ     . PHE B 2 73  ? -4.862  8.477   3.559   1.00 0.00  ? 160 PHE A CZ     2  
ATOM 2708  H H      . PHE B 2 73  ? -1.287  4.181   0.052   1.00 0.00  ? 160 PHE A H      2  
ATOM 2709  H HA     . PHE B 2 73  ? -3.746  5.789   -0.179  1.00 0.00  ? 160 PHE A HA     2  
ATOM 2710  H HB2    . PHE B 2 73  ? -1.315  6.090   1.468   1.00 0.00  ? 160 PHE A HB2    2  
ATOM 2711  H HB3    . PHE B 2 73  ? -1.509  7.440   0.374   1.00 0.00  ? 160 PHE A HB3    2  
ATOM 2712  H HD1    . PHE B 2 73  ? -3.276  5.511   3.132   1.00 0.00  ? 160 PHE A HD1    2  
ATOM 2713  H HD2    . PHE B 2 73  ? -3.045  9.136   0.755   1.00 0.00  ? 160 PHE A HD2    2  
ATOM 2714  H HE1    . PHE B 2 73  ? -4.836  6.615   4.656   1.00 0.00  ? 160 PHE A HE1    2  
ATOM 2715  H HE2    . PHE B 2 73  ? -4.571  10.238  2.329   1.00 0.00  ? 160 PHE A HE2    2  
ATOM 2716  H HZ     . PHE B 2 73  ? -5.526  8.971   4.252   1.00 0.00  ? 160 PHE A HZ     2  
ATOM 2717  N N      . VAL B 2 74  ? -2.867  6.948   -2.314  1.00 0.00  ? 161 VAL A N      2  
ATOM 2718  C CA     . VAL B 2 74  ? -2.445  7.537   -3.596  1.00 0.00  ? 161 VAL A CA     2  
ATOM 2719  C C      . VAL B 2 74  ? -2.996  8.962   -3.718  1.00 0.00  ? 161 VAL A C      2  
ATOM 2720  O O      . VAL B 2 74  ? -3.937  9.345   -3.033  1.00 0.00  ? 161 VAL A O      2  
ATOM 2721  C CB     . VAL B 2 74  ? -2.742  6.596   -4.799  1.00 0.00  ? 161 VAL A CB     2  
ATOM 2722  C CG1    . VAL B 2 74  ? -3.934  5.691   -4.702  1.00 0.00  ? 161 VAL A CG1    2  
ATOM 2723  C CG2    . VAL B 2 74  ? -2.951  7.247   -6.170  1.00 0.00  ? 161 VAL A CG2    2  
ATOM 2724  H H      . VAL B 2 74  ? -3.720  7.302   -1.886  1.00 0.00  ? 161 VAL A H      2  
ATOM 2725  H HA     . VAL B 2 74  ? -1.363  7.655   -3.561  1.00 0.00  ? 161 VAL A HA     2  
ATOM 2726  H HB     . VAL B 2 74  ? -1.950  5.866   -4.843  1.00 0.00  ? 161 VAL A HB     2  
ATOM 2727  H HG11   . VAL B 2 74  ? -3.791  5.018   -3.859  1.00 0.00  ? 161 VAL A HG11   2  
ATOM 2728  H HG12   . VAL B 2 74  ? -4.819  6.319   -4.631  1.00 0.00  ? 161 VAL A HG12   2  
ATOM 2729  H HG13   . VAL B 2 74  ? -3.945  5.097   -5.616  1.00 0.00  ? 161 VAL A HG13   2  
ATOM 2730  H HG21   . VAL B 2 74  ? -3.975  7.609   -6.239  1.00 0.00  ? 161 VAL A HG21   2  
ATOM 2731  H HG22   . VAL B 2 74  ? -2.263  8.065   -6.329  1.00 0.00  ? 161 VAL A HG22   2  
ATOM 2732  H HG23   . VAL B 2 74  ? -2.802  6.506   -6.955  1.00 0.00  ? 161 VAL A HG23   2  
ATOM 2733  N N      . THR B 2 75  ? -2.375  9.787   -4.550  1.00 0.00  ? 162 THR A N      2  
ATOM 2734  C CA     . THR B 2 75  ? -2.575  11.246  -4.614  1.00 0.00  ? 162 THR A CA     2  
ATOM 2735  C C      . THR B 2 75  ? -3.125  11.597  -5.988  1.00 0.00  ? 162 THR A C      2  
ATOM 2736  O O      . THR B 2 75  ? -2.391  11.563  -6.977  1.00 0.00  ? 162 THR A O      2  
ATOM 2737  C CB     . THR B 2 75  ? -1.251  11.952  -4.353  1.00 0.00  ? 162 THR A CB     2  
ATOM 2738  O OG1    . THR B 2 75  ? -0.737  11.576  -3.090  1.00 0.00  ? 162 THR A OG1    2  
ATOM 2739  C CG2    . THR B 2 75  ? -1.352  13.473  -4.335  1.00 0.00  ? 162 THR A CG2    2  
ATOM 2740  H H      . THR B 2 75  ? -1.647  9.363   -5.126  1.00 0.00  ? 162 THR A H      2  
ATOM 2741  H HA     . THR B 2 75  ? -3.280  11.569  -3.851  1.00 0.00  ? 162 THR A HA     2  
ATOM 2742  H HB     . THR B 2 75  ? -0.586  11.626  -5.144  1.00 0.00  ? 162 THR A HB     2  
ATOM 2743  H HG1    . THR B 2 75  ? -0.552  10.622  -3.119  1.00 0.00  ? 162 THR A HG1    2  
ATOM 2744  H HG21   . THR B 2 75  ? -1.744  13.834  -5.284  1.00 0.00  ? 162 THR A HG21   2  
ATOM 2745  H HG22   . THR B 2 75  ? -2.007  13.798  -3.525  1.00 0.00  ? 162 THR A HG22   2  
ATOM 2746  H HG23   . THR B 2 75  ? -0.362  13.901  -4.180  1.00 0.00  ? 162 THR A HG23   2  
ATOM 2747  N N      . PHE B 2 76  ? -4.445  11.787  -6.054  1.00 0.00  ? 163 PHE A N      2  
ATOM 2748  C CA     . PHE B 2 76  ? -5.221  11.212  -7.162  1.00 0.00  ? 163 PHE A CA     2  
ATOM 2749  C C      . PHE B 2 76  ? -6.375  12.047  -7.712  1.00 0.00  ? 163 PHE A C      2  
ATOM 2750  O O      . PHE B 2 76  ? -6.746  11.992  -8.882  1.00 0.00  ? 163 PHE A O      2  
ATOM 2751  C CB     . PHE B 2 76  ? -5.834  9.938   -6.619  1.00 0.00  ? 163 PHE A CB     2  
ATOM 2752  C CG     . PHE B 2 76  ? -6.467  9.122   -7.739  1.00 0.00  ? 163 PHE A CG     2  
ATOM 2753  C CD1    . PHE B 2 76  ? -5.644  8.476   -8.680  1.00 0.00  ? 163 PHE A CD1    2  
ATOM 2754  C CD2    . PHE B 2 76  ? -7.863  9.145   -7.947  1.00 0.00  ? 163 PHE A CD2    2  
ATOM 2755  C CE1    . PHE B 2 76  ? -6.201  7.874   -9.824  1.00 0.00  ? 163 PHE A CE1    2  
ATOM 2756  C CE2    . PHE B 2 76  ? -8.423  8.511   -9.068  1.00 0.00  ? 163 PHE A CE2    2  
ATOM 2757  C CZ     . PHE B 2 76  ? -7.592  7.888   -10.015 1.00 0.00  ? 163 PHE A CZ     2  
ATOM 2758  H H      . PHE B 2 76  ? -4.909  11.791  -5.162  1.00 0.00  ? 163 PHE A H      2  
ATOM 2759  H HA     . PHE B 2 76  ? -4.564  10.917  -7.953  1.00 0.00  ? 163 PHE A HA     2  
ATOM 2760  H HB2    . PHE B 2 76  ? -5.035  9.394   -6.111  1.00 0.00  ? 163 PHE A HB2    2  
ATOM 2761  H HB3    . PHE B 2 76  ? -6.595  10.242  -5.894  1.00 0.00  ? 163 PHE A HB3    2  
ATOM 2762  H HD1    . PHE B 2 76  ? -4.574  8.488   -8.543  1.00 0.00  ? 163 PHE A HD1    2  
ATOM 2763  H HD2    . PHE B 2 76  ? -8.512  9.689   -7.270  1.00 0.00  ? 163 PHE A HD2    2  
ATOM 2764  H HE1    . PHE B 2 76  ? -5.568  7.410   -10.569 1.00 0.00  ? 163 PHE A HE1    2  
ATOM 2765  H HE2    . PHE B 2 76  ? -9.492  8.519   -9.214  1.00 0.00  ? 163 PHE A HE2    2  
ATOM 2766  H HZ     . PHE B 2 76  ? -8.019  7.420   -10.891 1.00 0.00  ? 163 PHE A HZ     2  
ATOM 2767  N N      . GLU B 2 77  ? -7.008  12.759  -6.798  1.00 0.00  ? 164 GLU A N      2  
ATOM 2768  C CA     . GLU B 2 77  ? -8.426  13.059  -6.767  1.00 0.00  ? 164 GLU A CA     2  
ATOM 2769  C C      . GLU B 2 77  ? -8.571  14.562  -6.750  1.00 0.00  ? 164 GLU A C      2  
ATOM 2770  O O      . GLU B 2 77  ? -8.129  15.206  -5.801  1.00 0.00  ? 164 GLU A O      2  
ATOM 2771  C CB     . GLU B 2 77  ? -9.079  12.443  -5.517  1.00 0.00  ? 164 GLU A CB     2  
ATOM 2772  C CG     . GLU B 2 77  ? -10.609 12.349  -5.673  1.00 0.00  ? 164 GLU A CG     2  
ATOM 2773  C CD     . GLU B 2 77  ? -11.311 11.686  -4.471  1.00 0.00  ? 164 GLU A CD     2  
ATOM 2774  O OE1    . GLU B 2 77  ? -10.655 11.372  -3.452  1.00 0.00  ? 164 GLU A OE1    2  
ATOM 2775  O OE2    . GLU B 2 77  ? -12.546 11.490  -4.543  1.00 0.00  ? 164 GLU A OE2    2  
ATOM 2776  H H      . GLU B 2 77  ? -6.502  12.902  -5.960  1.00 0.00  ? 164 GLU A H      2  
ATOM 2777  H HA     . GLU B 2 77  ? -8.912  12.632  -7.640  1.00 0.00  ? 164 GLU A HA     2  
ATOM 2778  H HB2    . GLU B 2 77  ? -8.678  11.451  -5.373  1.00 0.00  ? 164 GLU A HB2    2  
ATOM 2779  H HB3    . GLU B 2 77  ? -8.829  13.023  -4.629  1.00 0.00  ? 164 GLU A HB3    2  
ATOM 2780  H HG2    . GLU B 2 77  ? -11.004 13.356  -5.806  1.00 0.00  ? 164 GLU A HG2    2  
ATOM 2781  H HG3    . GLU B 2 77  ? -10.831 11.779  -6.579  1.00 0.00  ? 164 GLU A HG3    2  
ATOM 2782  N N      . ASN B 2 78  ? -9.180  15.120  -7.786  1.00 0.00  ? 165 ASN A N      2  
ATOM 2783  C CA     . ASN B 2 78  ? -9.977  16.332  -7.608  1.00 0.00  ? 165 ASN A CA     2  
ATOM 2784  C C      . ASN B 2 78  ? -11.142 16.453  -8.607  1.00 0.00  ? 165 ASN A C      2  
ATOM 2785  O O      . ASN B 2 78  ? -12.274 16.736  -8.210  1.00 0.00  ? 165 ASN A O      2  
ATOM 2786  C CB     . ASN B 2 78  ? -9.069  17.588  -7.598  1.00 0.00  ? 165 ASN A CB     2  
ATOM 2787  C CG     . ASN B 2 78  ? -9.190  18.378  -6.303  1.00 0.00  ? 165 ASN A CG     2  
ATOM 2788  O OD1    . ASN B 2 78  ? -9.522  19.555  -6.297  1.00 0.00  ? 165 ASN A OD1    2  
ATOM 2789  N ND2    . ASN B 2 78  ? -8.942  17.756  -5.169  1.00 0.00  ? 165 ASN A ND2    2  
ATOM 2790  H H      . ASN B 2 78  ? -9.371  14.477  -8.537  1.00 0.00  ? 165 ASN A H      2  
ATOM 2791  H HA     . ASN B 2 78  ? -10.433 16.217  -6.625  1.00 0.00  ? 165 ASN A HA     2  
ATOM 2792  H HB2    . ASN B 2 78  ? -8.026  17.309  -7.728  1.00 0.00  ? 165 ASN A HB2    2  
ATOM 2793  H HB3    . ASN B 2 78  ? -9.334  18.241  -8.429  1.00 0.00  ? 165 ASN A HB3    2  
ATOM 2794  H HD21   . ASN B 2 78  ? -8.677  16.767  -5.188  1.00 0.00  ? 165 ASN A HD21   2  
ATOM 2795  H HD22   . ASN B 2 78  ? -9.024  18.271  -4.310  1.00 0.00  ? 165 ASN A HD22   2  
ATOM 2796  N N      . SER B 2 79  ? -10.868 16.233  -9.897  1.00 0.00  ? 166 SER A N      2  
ATOM 2797  C CA     . SER B 2 79  ? -11.848 16.344  -10.991 1.00 0.00  ? 166 SER A CA     2  
ATOM 2798  C C      . SER B 2 79  ? -12.924 15.246  -10.963 1.00 0.00  ? 166 SER A C      2  
ATOM 2799  O O      . SER B 2 79  ? -12.724 14.181  -10.375 1.00 0.00  ? 166 SER A O      2  
ATOM 2800  C CB     . SER B 2 79  ? -11.115 16.274  -12.341 1.00 0.00  ? 166 SER A CB     2  
ATOM 2801  O OG     . SER B 2 79  ? -10.103 17.267  -12.413 1.00 0.00  ? 166 SER A OG     2  
ATOM 2802  H H      . SER B 2 79  ? -9.904  16.081  -10.157 1.00 0.00  ? 166 SER A H      2  
ATOM 2803  H HA     . SER B 2 79  ? -12.342 17.313  -10.906 1.00 0.00  ? 166 SER A HA     2  
ATOM 2804  H HB2    . SER B 2 79  ? -10.666 15.284  -12.464 1.00 0.00  ? 166 SER A HB2    2  
ATOM 2805  H HB3    . SER B 2 79  ? -11.832 16.427  -13.152 1.00 0.00  ? 166 SER A HB3    2  
ATOM 2806  H HG     . SER B 2 79  ? -9.702  17.234  -13.303 1.00 0.00  ? 166 SER A HG     2  
ATOM 2807  N N      . ALA B 2 80  ? -14.031 15.453  -11.684 1.00 0.00  ? 167 ALA A N      2  
ATOM 2808  C CA     . ALA B 2 80  ? -15.077 14.439  -11.861 1.00 0.00  ? 167 ALA A CA     2  
ATOM 2809  C C      . ALA B 2 80  ? -14.557 13.138  -12.486 1.00 0.00  ? 167 ALA A C      2  
ATOM 2810  O O      . ALA B 2 80  ? -15.002 12.060  -12.108 1.00 0.00  ? 167 ALA A O      2  
ATOM 2811  C CB     . ALA B 2 80  ? -16.203 15.002  -12.728 1.00 0.00  ? 167 ALA A CB     2  
ATOM 2812  H H      . ALA B 2 80  ? -14.150 16.353  -12.132 1.00 0.00  ? 167 ALA A H      2  
ATOM 2813  H HA     . ALA B 2 80  ? -15.492 14.194  -10.881 1.00 0.00  ? 167 ALA A HA     2  
ATOM 2814  H HB1    . ALA B 2 80  ? -16.660 15.863  -12.241 1.00 0.00  ? 167 ALA A HB1    2  
ATOM 2815  H HB2    . ALA B 2 80  ? -15.813 15.284  -13.707 1.00 0.00  ? 167 ALA A HB2    2  
ATOM 2816  H HB3    . ALA B 2 80  ? -16.954 14.219  -12.864 1.00 0.00  ? 167 ALA A HB3    2  
ATOM 2817  N N      . ASP B 2 81  ? -13.598 13.214  -13.416 1.00 0.00  ? 168 ASP A N      2  
ATOM 2818  C CA     . ASP B 2 81  ? -12.999 12.022  -14.027 1.00 0.00  ? 168 ASP A CA     2  
ATOM 2819  C C      . ASP B 2 81  ? -12.175 11.191  -13.022 1.00 0.00  ? 168 ASP A C      2  
ATOM 2820  O O      . ASP B 2 81  ? -12.130 9.967   -13.124 1.00 0.00  ? 168 ASP A O      2  
ATOM 2821  C CB     . ASP B 2 81  ? -12.158 12.436  -15.242 1.00 0.00  ? 168 ASP A CB     2  
ATOM 2822  C CG     . ASP B 2 81  ? -11.831 11.231  -16.143 1.00 0.00  ? 168 ASP A CG     2  
ATOM 2823  O OD1    . ASP B 2 81  ? -12.762 10.659  -16.756 1.00 0.00  ? 168 ASP A OD1    2  
ATOM 2824  O OD2    . ASP B 2 81  ? -10.634 10.876  -16.258 1.00 0.00  ? 168 ASP A OD2    2  
ATOM 2825  H H      . ASP B 2 81  ? -13.311 14.131  -13.727 1.00 0.00  ? 168 ASP A H      2  
ATOM 2826  H HA     . ASP B 2 81  ? -13.810 11.388  -14.386 1.00 0.00  ? 168 ASP A HA     2  
ATOM 2827  H HB2    . ASP B 2 81  ? -12.717 13.166  -15.830 1.00 0.00  ? 168 ASP A HB2    2  
ATOM 2828  H HB3    . ASP B 2 81  ? -11.242 12.920  -14.897 1.00 0.00  ? 168 ASP A HB3    2  
ATOM 2829  N N      . ALA B 2 82  ? -11.572 11.832  -12.013 1.00 0.00  ? 169 ALA A N      2  
ATOM 2830  C CA     . ALA B 2 82  ? -10.930 11.156  -10.884 1.00 0.00  ? 169 ALA A CA     2  
ATOM 2831  C C      . ALA B 2 82  ? -11.957 10.543  -9.914  1.00 0.00  ? 169 ALA A C      2  
ATOM 2832  O O      . ALA B 2 82  ? -11.794 9.400   -9.500  1.00 0.00  ? 169 ALA A O      2  
ATOM 2833  C CB     . ALA B 2 82  ? -9.998  12.131  -10.164 1.00 0.00  ? 169 ALA A CB     2  
ATOM 2834  H H      . ALA B 2 82  ? -11.703 12.829  -11.952 1.00 0.00  ? 169 ALA A H      2  
ATOM 2835  H HA     . ALA B 2 82  ? -10.321 10.336  -11.276 1.00 0.00  ? 169 ALA A HA     2  
ATOM 2836  H HB1    . ALA B 2 82  ? -9.338  12.623  -10.876 1.00 0.00  ? 169 ALA A HB1    2  
ATOM 2837  H HB2    . ALA B 2 82  ? -10.578 12.884  -9.628  1.00 0.00  ? 169 ALA A HB2    2  
ATOM 2838  H HB3    . ALA B 2 82  ? -9.391  11.565  -9.459  1.00 0.00  ? 169 ALA A HB3    2  
ATOM 2839  N N      . ASP B 2 83  ? -13.039 11.257  -9.584  1.00 0.00  ? 170 ASP A N      2  
ATOM 2840  C CA     . ASP B 2 83  ? -14.158 10.700  -8.804  1.00 0.00  ? 170 ASP A CA     2  
ATOM 2841  C C      . ASP B 2 83  ? -14.772 9.470   -9.493  1.00 0.00  ? 170 ASP A C      2  
ATOM 2842  O O      . ASP B 2 83  ? -14.933 8.427   -8.865  1.00 0.00  ? 170 ASP A O      2  
ATOM 2843  C CB     . ASP B 2 83  ? -15.220 11.781  -8.564  1.00 0.00  ? 170 ASP A CB     2  
ATOM 2844  C CG     . ASP B 2 83  ? -16.387 11.251  -7.716  1.00 0.00  ? 170 ASP A CG     2  
ATOM 2845  O OD1    . ASP B 2 83  ? -16.197 11.018  -6.501  1.00 0.00  ? 170 ASP A OD1    2  
ATOM 2846  O OD2    . ASP B 2 83  ? -17.505 11.100  -8.265  1.00 0.00  ? 170 ASP A OD2    2  
ATOM 2847  H H      . ASP B 2 83  ? -13.091 12.212  -9.927  1.00 0.00  ? 170 ASP A H      2  
ATOM 2848  H HA     . ASP B 2 83  ? -13.779 10.383  -7.831  1.00 0.00  ? 170 ASP A HA     2  
ATOM 2849  H HB2    . ASP B 2 83  ? -14.760 12.628  -8.054  1.00 0.00  ? 170 ASP A HB2    2  
ATOM 2850  H HB3    . ASP B 2 83  ? -15.602 12.127  -9.524  1.00 0.00  ? 170 ASP A HB3    2  
ATOM 2851  N N      . ARG B 2 84  ? -15.044 9.552   -10.799 1.00 0.00  ? 171 ARG A N      2  
ATOM 2852  C CA     . ARG B 2 84  ? -15.514 8.457   -11.660 1.00 0.00  ? 171 ARG A CA     2  
ATOM 2853  C C      . ARG B 2 84  ? -14.556 7.262   -11.654 1.00 0.00  ? 171 ARG A C      2  
ATOM 2854  O O      . ARG B 2 84  ? -14.984 6.125   -11.467 1.00 0.00  ? 171 ARG A O      2  
ATOM 2855  C CB     . ARG B 2 84  ? -15.733 9.032   -13.069 1.00 0.00  ? 171 ARG A CB     2  
ATOM 2856  C CG     . ARG B 2 84  ? -16.294 7.999   -14.057 1.00 0.00  ? 171 ARG A CG     2  
ATOM 2857  C CD     . ARG B 2 84  ? -16.531 8.631   -15.432 1.00 0.00  ? 171 ARG A CD     2  
ATOM 2858  N NE     . ARG B 2 84  ? -17.147 7.661   -16.361 1.00 0.00  ? 171 ARG A NE     2  
ATOM 2859  C CZ     . ARG B 2 84  ? -17.282 7.783   -17.668 1.00 0.00  ? 171 ARG A CZ     2  
ATOM 2860  N NH1    . ARG B 2 84  ? -16.835 8.824   -18.317 1.00 0.00  ? 171 ARG A NH1    2  
ATOM 2861  N NH2    . ARG B 2 84  ? -17.874 6.847   -18.359 1.00 0.00  ? 171 ARG A NH2    2  
ATOM 2862  H H      . ARG B 2 84  ? -14.909 10.469  -11.217 1.00 0.00  ? 171 ARG A H      2  
ATOM 2863  H HA     . ARG B 2 84  ? -16.469 8.099   -11.273 1.00 0.00  ? 171 ARG A HA     2  
ATOM 2864  H HB2    . ARG B 2 84  ? -16.438 9.851   -12.981 1.00 0.00  ? 171 ARG A HB2    2  
ATOM 2865  H HB3    . ARG B 2 84  ? -14.805 9.462   -13.451 1.00 0.00  ? 171 ARG A HB3    2  
ATOM 2866  H HG2    . ARG B 2 84  ? -15.589 7.172   -14.167 1.00 0.00  ? 171 ARG A HG2    2  
ATOM 2867  H HG3    . ARG B 2 84  ? -17.240 7.616   -13.671 1.00 0.00  ? 171 ARG A HG3    2  
ATOM 2868  H HD2    . ARG B 2 84  ? -17.192 9.492   -15.321 1.00 0.00  ? 171 ARG A HD2    2  
ATOM 2869  H HD3    . ARG B 2 84  ? -15.570 8.968   -15.834 1.00 0.00  ? 171 ARG A HD3    2  
ATOM 2870  H HE     . ARG B 2 84  ? -17.533 6.819   -15.965 1.00 0.00  ? 171 ARG A HE     2  
ATOM 2871  H HH11   . ARG B 2 84  ? -16.377 9.557   -17.799 1.00 0.00  ? 171 ARG A HH11   2  
ATOM 2872  H HH12   . ARG B 2 84  ? -16.943 8.898   -19.316 1.00 0.00  ? 171 ARG A HH12   2  
ATOM 2873  H HH21   . ARG B 2 84  ? -18.231 6.024   -17.902 1.00 0.00  ? 171 ARG A HH21   2  
ATOM 2874  H HH22   . ARG B 2 84  ? -17.975 6.941   -19.354 1.00 0.00  ? 171 ARG A HH22   2  
ATOM 2875  N N      . ALA B 2 85  ? -13.263 7.521   -11.819 1.00 0.00  ? 172 ALA A N      2  
ATOM 2876  C CA     . ALA B 2 85  ? -12.208 6.511   -11.704 1.00 0.00  ? 172 ALA A CA     2  
ATOM 2877  C C      . ALA B 2 85  ? -12.204 5.798   -10.338 1.00 0.00  ? 172 ALA A C      2  
ATOM 2878  O O      . ALA B 2 85  ? -12.274 4.570   -10.286 1.00 0.00  ? 172 ALA A O      2  
ATOM 2879  C CB     . ALA B 2 85  ? -10.860 7.156   -12.013 1.00 0.00  ? 172 ALA A CB     2  
ATOM 2880  H H      . ALA B 2 85  ? -13.043 8.480   -12.065 1.00 0.00  ? 172 ALA A H      2  
ATOM 2881  H HA     . ALA B 2 85  ? -12.390 5.746   -12.458 1.00 0.00  ? 172 ALA A HA     2  
ATOM 2882  H HB1    . ALA B 2 85  ? -10.836 7.455   -13.061 1.00 0.00  ? 172 ALA A HB1    2  
ATOM 2883  H HB2    . ALA B 2 85  ? -10.692 8.024   -11.382 1.00 0.00  ? 172 ALA A HB2    2  
ATOM 2884  H HB3    . ALA B 2 85  ? -10.077 6.424   -11.824 1.00 0.00  ? 172 ALA A HB3    2  
ATOM 2885  N N      . ARG B 2 86  ? -12.204 6.547   -9.228  1.00 0.00  ? 173 ARG A N      2  
ATOM 2886  C CA     . ARG B 2 86  ? -12.472 6.058   -7.861  1.00 0.00  ? 173 ARG A CA     2  
ATOM 2887  C C      . ARG B 2 86  ? -13.705 5.165   -7.829  1.00 0.00  ? 173 ARG A C      2  
ATOM 2888  O O      . ARG B 2 86  ? -13.585 4.002   -7.472  1.00 0.00  ? 173 ARG A O      2  
ATOM 2889  C CB     . ARG B 2 86  ? -12.530 7.278   -6.911  1.00 0.00  ? 173 ARG A CB     2  
ATOM 2890  C CG     . ARG B 2 86  ? -13.513 7.197   -5.735  1.00 0.00  ? 173 ARG A CG     2  
ATOM 2891  C CD     . ARG B 2 86  ? -13.249 8.340   -4.750  1.00 0.00  ? 173 ARG A CD     2  
ATOM 2892  N NE     . ARG B 2 86  ? -13.978 8.118   -3.491  1.00 0.00  ? 173 ARG A NE     2  
ATOM 2893  C CZ     . ARG B 2 86  ? -14.644 9.020   -2.797  1.00 0.00  ? 173 ARG A CZ     2  
ATOM 2894  N NH1    . ARG B 2 86  ? -14.593 10.293  -3.065  1.00 0.00  ? 173 ARG A NH1    2  
ATOM 2895  N NH2    . ARG B 2 86  ? -15.382 8.649   -1.785  1.00 0.00  ? 173 ARG A NH2    2  
ATOM 2896  H H      . ARG B 2 86  ? -12.135 7.554   -9.369  1.00 0.00  ? 173 ARG A H      2  
ATOM 2897  H HA     . ARG B 2 86  ? -11.671 5.377   -7.534  1.00 0.00  ? 173 ARG A HA     2  
ATOM 2898  H HB2    . ARG B 2 86  ? -11.526 7.428   -6.528  1.00 0.00  ? 173 ARG A HB2    2  
ATOM 2899  H HB3    . ARG B 2 86  ? -12.786 8.173   -7.474  1.00 0.00  ? 173 ARG A HB3    2  
ATOM 2900  H HG2    . ARG B 2 86  ? -14.537 7.285   -6.099  1.00 0.00  ? 173 ARG A HG2    2  
ATOM 2901  H HG3    . ARG B 2 86  ? -13.416 6.247   -5.226  1.00 0.00  ? 173 ARG A HG3    2  
ATOM 2902  H HD2    . ARG B 2 86  ? -12.185 8.402   -4.529  1.00 0.00  ? 173 ARG A HD2    2  
ATOM 2903  H HD3    . ARG B 2 86  ? -13.565 9.270   -5.225  1.00 0.00  ? 173 ARG A HD3    2  
ATOM 2904  H HE     . ARG B 2 86  ? -13.951 7.176   -3.126  1.00 0.00  ? 173 ARG A HE     2  
ATOM 2905  H HH11   . ARG B 2 86  ? -13.900 10.620  -3.743  1.00 0.00  ? 173 ARG A HH11   2  
ATOM 2906  H HH12   . ARG B 2 86  ? -15.142 10.961  -2.560  1.00 0.00  ? 173 ARG A HH12   2  
ATOM 2907  H HH21   . ARG B 2 86  ? -15.526 7.669   -1.597  1.00 0.00  ? 173 ARG A HH21   2  
ATOM 2908  H HH22   . ARG B 2 86  ? -15.922 9.333   -1.280  1.00 0.00  ? 173 ARG A HH22   2  
ATOM 2909  N N      . GLU B 2 87  ? -14.865 5.653   -8.245  1.00 0.00  ? 174 GLU A N      2  
ATOM 2910  C CA     . GLU B 2 87  ? -16.118 4.895   -8.255  1.00 0.00  ? 174 GLU A CA     2  
ATOM 2911  C C      . GLU B 2 87  ? -16.056 3.594   -9.075  1.00 0.00  ? 174 GLU A C      2  
ATOM 2912  O O      . GLU B 2 87  ? -16.755 2.632   -8.744  1.00 0.00  ? 174 GLU A O      2  
ATOM 2913  C CB     . GLU B 2 87  ? -17.227 5.800   -8.793  1.00 0.00  ? 174 GLU A CB     2  
ATOM 2914  C CG     . GLU B 2 87  ? -17.594 6.970   -7.877  1.00 0.00  ? 174 GLU A CG     2  
ATOM 2915  C CD     . GLU B 2 87  ? -18.611 6.550   -6.799  1.00 0.00  ? 174 GLU A CD     2  
ATOM 2916  O OE1    . GLU B 2 87  ? -18.197 5.994   -5.753  1.00 0.00  ? 174 GLU A OE1    2  
ATOM 2917  O OE2    . GLU B 2 87  ? -19.833 6.769   -6.993  1.00 0.00  ? 174 GLU A OE2    2  
ATOM 2918  H H      . GLU B 2 87  ? -14.896 6.630   -8.508  1.00 0.00  ? 174 GLU A H      2  
ATOM 2919  H HA     . GLU B 2 87  ? -16.351 4.594   -7.238  1.00 0.00  ? 174 GLU A HA     2  
ATOM 2920  H HB2    . GLU B 2 87  ? -16.917 6.203   -9.756  1.00 0.00  ? 174 GLU A HB2    2  
ATOM 2921  H HB3    . GLU B 2 87  ? -18.114 5.207   -8.974  1.00 0.00  ? 174 GLU A HB3    2  
ATOM 2922  H HG2    . GLU B 2 87  ? -16.703 7.391   -7.406  1.00 0.00  ? 174 GLU A HG2    2  
ATOM 2923  H HG3    . GLU B 2 87  ? -18.008 7.748   -8.519  1.00 0.00  ? 174 GLU A HG3    2  
ATOM 2924  N N      . LYS B 2 88  ? -15.196 3.522   -10.102 1.00 0.00  ? 175 LYS A N      2  
ATOM 2925  C CA     . LYS B 2 88  ? -14.878 2.299   -10.834 1.00 0.00  ? 175 LYS A CA     2  
ATOM 2926  C C      . LYS B 2 88  ? -14.022 1.339   -9.981  1.00 0.00  ? 175 LYS A C      2  
ATOM 2927  O O      . LYS B 2 88  ? -14.424 0.185   -9.821  1.00 0.00  ? 175 LYS A O      2  
ATOM 2928  C CB     . LYS B 2 88  ? -14.305 2.731   -12.197 1.00 0.00  ? 175 LYS A CB     2  
ATOM 2929  C CG     . LYS B 2 88  ? -13.314 1.782   -12.862 1.00 0.00  ? 175 LYS A CG     2  
ATOM 2930  C CD     . LYS B 2 88  ? -13.903 0.417   -13.256 1.00 0.00  ? 175 LYS A CD     2  
ATOM 2931  C CE     . LYS B 2 88  ? -13.072 -0.325  -14.315 1.00 0.00  ? 175 LYS A CE     2  
ATOM 2932  N NZ     . LYS B 2 88  ? -11.687 -0.632  -13.864 1.00 0.00  ? 175 LYS A NZ     2  
ATOM 2933  H H      . LYS B 2 88  ? -14.660 4.349   -10.363 1.00 0.00  ? 175 LYS A H      2  
ATOM 2934  H HA     . LYS B 2 88  ? -15.805 1.761   -11.034 1.00 0.00  ? 175 LYS A HA     2  
ATOM 2935  H HB2    . LYS B 2 88  ? -15.138 2.908   -12.880 1.00 0.00  ? 175 LYS A HB2    2  
ATOM 2936  H HB3    . LYS B 2 88  ? -13.791 3.685   -12.092 1.00 0.00  ? 175 LYS A HB3    2  
ATOM 2937  H HG2    . LYS B 2 88  ? -12.946 2.279   -13.758 1.00 0.00  ? 175 LYS A HG2    2  
ATOM 2938  H HG3    . LYS B 2 88  ? -12.487 1.671   -12.171 1.00 0.00  ? 175 LYS A HG3    2  
ATOM 2939  H HD2    . LYS B 2 88  ? -14.005 -0.217  -12.376 1.00 0.00  ? 175 LYS A HD2    2  
ATOM 2940  H HD3    . LYS B 2 88  ? -14.900 0.576   -13.675 1.00 0.00  ? 175 LYS A HD3    2  
ATOM 2941  H HE2    . LYS B 2 88  ? -13.588 -1.257  -14.551 1.00 0.00  ? 175 LYS A HE2    2  
ATOM 2942  H HE3    . LYS B 2 88  ? -13.042 0.274   -15.232 1.00 0.00  ? 175 LYS A HE3    2  
ATOM 2943  H HZ1    . LYS B 2 88  ? -11.098 0.193   -13.879 1.00 0.00  ? 175 LYS A HZ1    2  
ATOM 2944  H HZ2    . LYS B 2 88  ? -11.670 -1.045  -12.940 1.00 0.00  ? 175 LYS A HZ2    2  
ATOM 2945  H HZ3    . LYS B 2 88  ? -11.253 -1.287  -14.501 1.00 0.00  ? 175 LYS A HZ3    2  
ATOM 2946  N N      . LEU B 2 89  ? -12.882 1.762   -9.413  1.00 0.00  ? 176 LEU A N      2  
ATOM 2947  C CA     . LEU B 2 89  ? -11.968 0.897   -8.675  1.00 0.00  ? 176 LEU A CA     2  
ATOM 2948  C C      . LEU B 2 89  ? -12.431 0.539   -7.256  1.00 0.00  ? 176 LEU A C      2  
ATOM 2949  O O      . LEU B 2 89  ? -12.011 -0.476  -6.703  1.00 0.00  ? 176 LEU A O      2  
ATOM 2950  C CB     . LEU B 2 89  ? -10.580 1.549   -8.647  1.00 0.00  ? 176 LEU A CB     2  
ATOM 2951  C CG     . LEU B 2 89  ? -10.025 2.014   -10.003 1.00 0.00  ? 176 LEU A CG     2  
ATOM 2952  C CD1    . LEU B 2 89  ? -8.636  2.613   -9.865  1.00 0.00  ? 176 LEU A CD1    2  
ATOM 2953  C CD2    . LEU B 2 89  ? -9.925  0.877   -11.021 1.00 0.00  ? 176 LEU A CD2    2  
ATOM 2954  H H      . LEU B 2 89  ? -12.539 2.706   -9.514  1.00 0.00  ? 176 LEU A H      2  
ATOM 2955  H HA     . LEU B 2 89  ? -11.882 -0.038  -9.213  1.00 0.00  ? 176 LEU A HA     2  
ATOM 2956  H HB2    . LEU B 2 89  ? -10.555 2.368   -7.932  1.00 0.00  ? 176 LEU A HB2    2  
ATOM 2957  H HB3    . LEU B 2 89  ? -9.923  0.799   -8.265  1.00 0.00  ? 176 LEU A HB3    2  
ATOM 2958  H HG     . LEU B 2 89  ? -10.657 2.810   -10.370 1.00 0.00  ? 176 LEU A HG     2  
ATOM 2959  H HD11   . LEU B 2 89  ? -8.751  3.554   -9.341  1.00 0.00  ? 176 LEU A HD11   2  
ATOM 2960  H HD12   . LEU B 2 89  ? -7.983  1.947   -9.299  1.00 0.00  ? 176 LEU A HD12   2  
ATOM 2961  H HD13   . LEU B 2 89  ? -8.206  2.816   -10.844 1.00 0.00  ? 176 LEU A HD13   2  
ATOM 2962  H HD21   . LEU B 2 89  ? -9.210  0.129   -10.681 1.00 0.00  ? 176 LEU A HD21   2  
ATOM 2963  H HD22   . LEU B 2 89  ? -10.896 0.404   -11.152 1.00 0.00  ? 176 LEU A HD22   2  
ATOM 2964  H HD23   . LEU B 2 89  ? -9.598  1.282   -11.977 1.00 0.00  ? 176 LEU A HD23   2  
ATOM 2965  N N      . HIS B 2 90  ? -13.340 1.331   -6.692  1.00 0.00  ? 177 HIS A N      2  
ATOM 2966  C CA     . HIS B 2 90  ? -14.100 1.093   -5.461  1.00 0.00  ? 177 HIS A CA     2  
ATOM 2967  C C      . HIS B 2 90  ? -15.155 -0.001  -5.701  1.00 0.00  ? 177 HIS A C      2  
ATOM 2968  O O      . HIS B 2 90  ? -16.358 0.254   -5.790  1.00 0.00  ? 177 HIS A O      2  
ATOM 2969  C CB     . HIS B 2 90  ? -14.677 2.453   -5.031  1.00 0.00  ? 177 HIS A CB     2  
ATOM 2970  C CG     . HIS B 2 90  ? -15.043 2.628   -3.596  1.00 0.00  ? 177 HIS A CG     2  
ATOM 2971  N ND1    . HIS B 2 90  ? -15.074 1.626   -2.636  1.00 0.00  ? 177 HIS A ND1    2  
ATOM 2972  C CD2    . HIS B 2 90  ? -15.062 3.841   -2.981  1.00 0.00  ? 177 HIS A CD2    2  
ATOM 2973  C CE1    . HIS B 2 90  ? -15.104 2.268   -1.461  1.00 0.00  ? 177 HIS A CE1    2  
ATOM 2974  N NE2    . HIS B 2 90  ? -15.123 3.597   -1.628  1.00 0.00  ? 177 HIS A NE2    2  
ATOM 2975  H H      . HIS B 2 90  ? -13.563 2.172   -7.210  1.00 0.00  ? 177 HIS A H      2  
ATOM 2976  H HA     . HIS B 2 90  ? -13.423 0.735   -4.686  1.00 0.00  ? 177 HIS A HA     2  
ATOM 2977  H HB2    . HIS B 2 90  ? -13.914 3.195   -5.195  1.00 0.00  ? 177 HIS A HB2    2  
ATOM 2978  H HB3    . HIS B 2 90  ? -15.510 2.750   -5.651  1.00 0.00  ? 177 HIS A HB3    2  
ATOM 2979  H HD2    . HIS B 2 90  ? -14.878 4.790   -3.472  1.00 0.00  ? 177 HIS A HD2    2  
ATOM 2980  H HE1    . HIS B 2 90  ? -15.008 1.786   -0.512  1.00 0.00  ? 177 HIS A HE1    2  
ATOM 2981  H HE2    . HIS B 2 90  ? -15.087 4.272   -0.870  1.00 0.00  ? 177 HIS A HE2    2  
ATOM 2982  N N      . GLY B 2 91  ? -14.666 -1.224  -5.915  1.00 0.00  ? 178 GLY A N      2  
ATOM 2983  C CA     . GLY B 2 91  ? -15.385 -2.342  -6.540  1.00 0.00  ? 178 GLY A CA     2  
ATOM 2984  C C      . GLY B 2 91  ? -14.561 -3.202  -7.521  1.00 0.00  ? 178 GLY A C      2  
ATOM 2985  O O      . GLY B 2 91  ? -15.111 -4.145  -8.089  1.00 0.00  ? 178 GLY A O      2  
ATOM 2986  H H      . GLY B 2 91  ? -13.673 -1.325  -5.715  1.00 0.00  ? 178 GLY A H      2  
ATOM 2987  H HA2    . GLY B 2 91  ? -15.769 -2.982  -5.754  1.00 0.00  ? 178 GLY A HA2    2  
ATOM 2988  H HA3    . GLY B 2 91  ? -16.240 -1.955  -7.094  1.00 0.00  ? 178 GLY A HA3    2  
ATOM 2989  N N      . THR B 2 92  ? -13.268 -2.918  -7.727  1.00 0.00  ? 179 THR A N      2  
ATOM 2990  C CA     . THR B 2 92  ? -12.367 -3.663  -8.625  1.00 0.00  ? 179 THR A CA     2  
ATOM 2991  C C      . THR B 2 92  ? -11.774 -4.863  -7.897  1.00 0.00  ? 179 THR A C      2  
ATOM 2992  O O      . THR B 2 92  ? -10.932 -4.706  -7.011  1.00 0.00  ? 179 THR A O      2  
ATOM 2993  C CB     . THR B 2 92  ? -11.269 -2.748  -9.215  1.00 0.00  ? 179 THR A CB     2  
ATOM 2994  O OG1    . THR B 2 92  ? -11.787 -2.142  -10.384 1.00 0.00  ? 179 THR A OG1    2  
ATOM 2995  C CG2    . THR B 2 92  ? -9.955  -3.400  -9.655  1.00 0.00  ? 179 THR A CG2    2  
ATOM 2996  H H      . THR B 2 92  ? -12.846 -2.192  -7.160  1.00 0.00  ? 179 THR A H      2  
ATOM 2997  H HA     . THR B 2 92  ? -12.949 -4.052  -9.464  1.00 0.00  ? 179 THR A HA     2  
ATOM 2998  H HB     . THR B 2 92  ? -11.009 -1.982  -8.488  1.00 0.00  ? 179 THR A HB     2  
ATOM 2999  H HG1    . THR B 2 92  ? -11.976 -2.847  -11.028 1.00 0.00  ? 179 THR A HG1    2  
ATOM 3000  H HG21   . THR B 2 92  ? -9.390  -3.718  -8.780  1.00 0.00  ? 179 THR A HG21   2  
ATOM 3001  H HG22   . THR B 2 92  ? -10.149 -4.251  -10.306 1.00 0.00  ? 179 THR A HG22   2  
ATOM 3002  H HG23   . THR B 2 92  ? -9.345  -2.665  -10.179 1.00 0.00  ? 179 THR A HG23   2  
ATOM 3003  N N      . VAL B 2 93  ? -12.227 -6.070  -8.262  1.00 0.00  ? 180 VAL A N      2  
ATOM 3004  C CA     . VAL B 2 93  ? -11.534 -7.324  -7.925  1.00 0.00  ? 180 VAL A CA     2  
ATOM 3005  C C      . VAL B 2 93  ? -10.254 -7.437  -8.764  1.00 0.00  ? 180 VAL A C      2  
ATOM 3006  O O      . VAL B 2 93  ? -10.316 -7.575  -9.987  1.00 0.00  ? 180 VAL A O      2  
ATOM 3007  C CB     . VAL B 2 93  ? -12.395 -8.590  -8.096  1.00 0.00  ? 180 VAL A CB     2  
ATOM 3008  C CG1    . VAL B 2 93  ? -11.761 -9.760  -7.328  1.00 0.00  ? 180 VAL A CG1    2  
ATOM 3009  C CG2    . VAL B 2 93  ? -13.827 -8.421  -7.579  1.00 0.00  ? 180 VAL A CG2    2  
ATOM 3010  H H      . VAL B 2 93  ? -12.988 -6.099  -8.927  1.00 0.00  ? 180 VAL A H      2  
ATOM 3011  H HA     . VAL B 2 93  ? -11.271 -7.275  -6.878  1.00 0.00  ? 180 VAL A HA     2  
ATOM 3012  H HB     . VAL B 2 93  ? -12.433 -8.865  -9.144  1.00 0.00  ? 180 VAL A HB     2  
ATOM 3013  H HG11   . VAL B 2 93  ? -10.748 -9.944  -7.687  1.00 0.00  ? 180 VAL A HG11   2  
ATOM 3014  H HG12   . VAL B 2 93  ? -11.736 -9.544  -6.260  1.00 0.00  ? 180 VAL A HG12   2  
ATOM 3015  H HG13   . VAL B 2 93  ? -12.349 -10.663 -7.490  1.00 0.00  ? 180 VAL A HG13   2  
ATOM 3016  H HG21   . VAL B 2 93  ? -13.811 -8.120  -6.531  1.00 0.00  ? 180 VAL A HG21   2  
ATOM 3017  H HG22   . VAL B 2 93  ? -14.355 -7.665  -8.161  1.00 0.00  ? 180 VAL A HG22   2  
ATOM 3018  H HG23   . VAL B 2 93  ? -14.373 -9.359  -7.671  1.00 0.00  ? 180 VAL A HG23   2  
ATOM 3019  N N      . VAL B 2 94  ? -9.093  -7.374  -8.115  1.00 0.00  ? 181 VAL A N      2  
ATOM 3020  C CA     . VAL B 2 94  ? -7.763  -7.637  -8.691  1.00 0.00  ? 181 VAL A CA     2  
ATOM 3021  C C      . VAL B 2 94  ? -7.073  -8.730  -7.870  1.00 0.00  ? 181 VAL A C      2  
ATOM 3022  O O      . VAL B 2 94  ? -7.321  -8.827  -6.670  1.00 0.00  ? 181 VAL A O      2  
ATOM 3023  C CB     . VAL B 2 94  ? -6.948  -6.328  -8.770  1.00 0.00  ? 181 VAL A CB     2  
ATOM 3024  C CG1    . VAL B 2 94  ? -6.494  -5.823  -7.399  1.00 0.00  ? 181 VAL A CG1    2  
ATOM 3025  C CG2    . VAL B 2 94  ? -5.736  -6.476  -9.690  1.00 0.00  ? 181 VAL A CG2    2  
ATOM 3026  H H      . VAL B 2 94  ? -9.133  -7.238  -7.105  1.00 0.00  ? 181 VAL A H      2  
ATOM 3027  H HA     . VAL B 2 94  ? -7.883  -8.019  -9.705  1.00 0.00  ? 181 VAL A HA     2  
ATOM 3028  H HB     . VAL B 2 94  ? -7.586  -5.564  -9.210  1.00 0.00  ? 181 VAL A HB     2  
ATOM 3029  H HG11   . VAL B 2 94  ? -7.360  -5.694  -6.749  1.00 0.00  ? 181 VAL A HG11   2  
ATOM 3030  H HG12   . VAL B 2 94  ? -5.804  -6.533  -6.945  1.00 0.00  ? 181 VAL A HG12   2  
ATOM 3031  H HG13   . VAL B 2 94  ? -6.000  -4.859  -7.514  1.00 0.00  ? 181 VAL A HG13   2  
ATOM 3032  H HG21   . VAL B 2 94  ? -5.035  -7.201  -9.289  1.00 0.00  ? 181 VAL A HG21   2  
ATOM 3033  H HG22   . VAL B 2 94  ? -6.061  -6.799  -10.680 1.00 0.00  ? 181 VAL A HG22   2  
ATOM 3034  H HG23   . VAL B 2 94  ? -5.238  -5.511  -9.786  1.00 0.00  ? 181 VAL A HG23   2  
ATOM 3035  N N      . GLU B 2 95  ? -6.242  -9.575  -8.494  1.00 0.00  ? 182 GLU A N      2  
ATOM 3036  C CA     . GLU B 2 95  ? -5.754  -10.872 -7.977  1.00 0.00  ? 182 GLU A CA     2  
ATOM 3037  C C      . GLU B 2 95  ? -6.896  -11.835 -7.575  1.00 0.00  ? 182 GLU A C      2  
ATOM 3038  O O      . GLU B 2 95  ? -7.172  -12.821 -8.263  1.00 0.00  ? 182 GLU A O      2  
ATOM 3039  C CB     . GLU B 2 95  ? -4.751  -10.677 -6.822  1.00 0.00  ? 182 GLU A CB     2  
ATOM 3040  C CG     . GLU B 2 95  ? -3.423  -10.003 -7.199  1.00 0.00  ? 182 GLU A CG     2  
ATOM 3041  C CD     . GLU B 2 95  ? -2.648  -10.806 -8.261  1.00 0.00  ? 182 GLU A CD     2  
ATOM 3042  O OE1    . GLU B 2 95  ? -2.013  -11.827 -7.905  1.00 0.00  ? 182 GLU A OE1    2  
ATOM 3043  O OE2    . GLU B 2 95  ? -2.681  -10.431 -9.458  1.00 0.00  ? 182 GLU A OE2    2  
ATOM 3044  H H      . GLU B 2 95  ? -6.076  -9.391  -9.473  1.00 0.00  ? 182 GLU A H      2  
ATOM 3045  H HA     . GLU B 2 95  ? -5.222  -11.373 -8.786  1.00 0.00  ? 182 GLU A HA     2  
ATOM 3046  H HB2    . GLU B 2 95  ? -5.218  -10.094 -6.039  1.00 0.00  ? 182 GLU A HB2    2  
ATOM 3047  H HB3    . GLU B 2 95  ? -4.542  -11.638 -6.364  1.00 0.00  ? 182 GLU A HB3    2  
ATOM 3048  H HG2    . GLU B 2 95  ? -3.618  -8.988  -7.552  1.00 0.00  ? 182 GLU A HG2    2  
ATOM 3049  H HG3    . GLU B 2 95  ? -2.819  -9.923  -6.288  1.00 0.00  ? 182 GLU A HG3    2  
ATOM 3050  N N      . GLY B 2 96  ? -7.564  -11.535 -6.461  1.00 0.00  ? 183 GLY A N      2  
ATOM 3051  C CA     . GLY B 2 96  ? -8.753  -12.181 -5.901  1.00 0.00  ? 183 GLY A CA     2  
ATOM 3052  C C      . GLY B 2 96  ? -9.380  -11.344 -4.773  1.00 0.00  ? 183 GLY A C      2  
ATOM 3053  O O      . GLY B 2 96  ? -9.914  -11.906 -3.815  1.00 0.00  ? 183 GLY A O      2  
ATOM 3054  H H      . GLY B 2 96  ? -7.247  -10.674 -6.022  1.00 0.00  ? 183 GLY A H      2  
ATOM 3055  H HA2    . GLY B 2 96  ? -9.505  -12.318 -6.679  1.00 0.00  ? 183 GLY A HA2    2  
ATOM 3056  H HA3    . GLY B 2 96  ? -8.479  -13.160 -5.506  1.00 0.00  ? 183 GLY A HA3    2  
ATOM 3057  N N      . ARG B 2 97  ? -9.260  -10.006 -4.839  1.00 0.00  ? 184 ARG A N      2  
ATOM 3058  C CA     . ARG B 2 97  ? -9.550  -9.056  -3.765  1.00 0.00  ? 184 ARG A CA     2  
ATOM 3059  C C      . ARG B 2 97  ? -10.133 -7.769  -4.307  1.00 0.00  ? 184 ARG A C      2  
ATOM 3060  O O      . ARG B 2 97  ? -9.614  -7.224  -5.280  1.00 0.00  ? 184 ARG A O      2  
ATOM 3061  C CB     . ARG B 2 97  ? -8.252  -8.659  -3.057  1.00 0.00  ? 184 ARG A CB     2  
ATOM 3062  C CG     . ARG B 2 97  ? -8.529  -8.318  -1.595  1.00 0.00  ? 184 ARG A CG     2  
ATOM 3063  C CD     . ARG B 2 97  ? -8.757  -9.524  -0.675  1.00 0.00  ? 184 ARG A CD     2  
ATOM 3064  N NE     . ARG B 2 97  ? -9.236  -9.072  0.643   1.00 0.00  ? 184 ARG A NE     2  
ATOM 3065  C CZ     . ARG B 2 97  ? -9.560  -9.809  1.688   1.00 0.00  ? 184 ARG A CZ     2  
ATOM 3066  N NH1    . ARG B 2 97  ? -9.414  -11.101 1.707   1.00 0.00  ? 184 ARG A NH1    2  
ATOM 3067  N NH2    . ARG B 2 97  ? -10.040 -9.232  2.750   1.00 0.00  ? 184 ARG A NH2    2  
ATOM 3068  H H      . ARG B 2 97  ? -8.889  -9.581  -5.682  1.00 0.00  ? 184 ARG A H      2  
ATOM 3069  H HA     . ARG B 2 97  ? -10.259 -9.507  -3.065  1.00 0.00  ? 184 ARG A HA     2  
ATOM 3070  H HB2    . ARG B 2 97  ? -7.488  -9.413  -3.197  1.00 0.00  ? 184 ARG A HB2    2  
ATOM 3071  H HB3    . ARG B 2 97  ? -7.850  -7.761  -3.526  1.00 0.00  ? 184 ARG A HB3    2  
ATOM 3072  H HG2    . ARG B 2 97  ? -7.674  -7.765  -1.221  1.00 0.00  ? 184 ARG A HG2    2  
ATOM 3073  H HG3    . ARG B 2 97  ? -9.413  -7.672  -1.579  1.00 0.00  ? 184 ARG A HG3    2  
ATOM 3074  H HD2    . ARG B 2 97  ? -9.503  -10.188 -1.118  1.00 0.00  ? 184 ARG A HD2    2  
ATOM 3075  H HD3    . ARG B 2 97  ? -7.822  -10.078 -0.572  1.00 0.00  ? 184 ARG A HD3    2  
ATOM 3076  H HE     . ARG B 2 97  ? -9.407  -8.083  0.781   1.00 0.00  ? 184 ARG A HE     2  
ATOM 3077  H HH11   . ARG B 2 97  ? -9.037  -11.556 0.894   1.00 0.00  ? 184 ARG A HH11   2  
ATOM 3078  H HH12   . ARG B 2 97  ? -9.661  -11.645 2.517   1.00 0.00  ? 184 ARG A HH12   2  
ATOM 3079  H HH21   . ARG B 2 97  ? -10.183 -8.228  2.722   1.00 0.00  ? 184 ARG A HH21   2  
ATOM 3080  H HH22   . ARG B 2 97  ? -10.320 -9.765  3.553   1.00 0.00  ? 184 ARG A HH22   2  
ATOM 3081  N N      . LYS B 2 98  ? -11.158 -7.256  -3.640  1.00 0.00  ? 185 LYS A N      2  
ATOM 3082  C CA     . LYS B 2 98  ? -11.901 -6.086  -4.098  1.00 0.00  ? 185 LYS A CA     2  
ATOM 3083  C C      . LYS B 2 98  ? -11.476 -4.775  -3.426  1.00 0.00  ? 185 LYS A C      2  
ATOM 3084  O O      . LYS B 2 98  ? -11.840 -4.544  -2.271  1.00 0.00  ? 185 LYS A O      2  
ATOM 3085  C CB     . LYS B 2 98  ? -13.406 -6.370  -3.959  1.00 0.00  ? 185 LYS A CB     2  
ATOM 3086  C CG     . LYS B 2 98  ? -14.254 -5.436  -4.834  1.00 0.00  ? 185 LYS A CG     2  
ATOM 3087  C CD     . LYS B 2 98  ? -15.748 -5.543  -4.496  1.00 0.00  ? 185 LYS A CD     2  
ATOM 3088  C CE     . LYS B 2 98  ? -16.082 -4.802  -3.193  1.00 0.00  ? 185 LYS A CE     2  
ATOM 3089  N NZ     . LYS B 2 98  ? -17.533 -4.854  -2.886  1.00 0.00  ? 185 LYS A NZ     2  
ATOM 3090  H H      . LYS B 2 98  ? -11.485 -7.801  -2.859  1.00 0.00  ? 185 LYS A H      2  
ATOM 3091  H HA     . LYS B 2 98  ? -11.631 -5.998  -5.136  1.00 0.00  ? 185 LYS A HA     2  
ATOM 3092  H HB2    . LYS B 2 98  ? -13.609 -7.399  -4.257  1.00 0.00  ? 185 LYS A HB2    2  
ATOM 3093  H HB3    . LYS B 2 98  ? -13.693 -6.268  -2.912  1.00 0.00  ? 185 LYS A HB3    2  
ATOM 3094  H HG2    . LYS B 2 98  ? -13.927 -4.404  -4.720  1.00 0.00  ? 185 LYS A HG2    2  
ATOM 3095  H HG3    . LYS B 2 98  ? -14.107 -5.718  -5.877  1.00 0.00  ? 185 LYS A HG3    2  
ATOM 3096  H HD2    . LYS B 2 98  ? -16.326 -5.108  -5.312  1.00 0.00  ? 185 LYS A HD2    2  
ATOM 3097  H HD3    . LYS B 2 98  ? -16.032 -6.593  -4.408  1.00 0.00  ? 185 LYS A HD3    2  
ATOM 3098  H HE2    . LYS B 2 98  ? -15.514 -5.251  -2.372  1.00 0.00  ? 185 LYS A HE2    2  
ATOM 3099  H HE3    . LYS B 2 98  ? -15.758 -3.761  -3.290  1.00 0.00  ? 185 LYS A HE3    2  
ATOM 3100  H HZ1    . LYS B 2 98  ? -18.082 -4.427  -3.621  1.00 0.00  ? 185 LYS A HZ1    2  
ATOM 3101  H HZ2    . LYS B 2 98  ? -17.850 -5.808  -2.771  1.00 0.00  ? 185 LYS A HZ2    2  
ATOM 3102  H HZ3    . LYS B 2 98  ? -17.744 -4.358  -2.030  1.00 0.00  ? 185 LYS A HZ3    2  
ATOM 3103  N N      . ILE B 2 99  ? -10.730 -3.924  -4.140  1.00 0.00  ? 186 ILE A N      2  
ATOM 3104  C CA     . ILE B 2 99  ? -10.299 -2.613  -3.623  1.00 0.00  ? 186 ILE A CA     2  
ATOM 3105  C C      . ILE B 2 99  ? -11.515 -1.737  -3.264  1.00 0.00  ? 186 ILE A C      2  
ATOM 3106  O O      . ILE B 2 99  ? -12.539 -1.744  -3.952  1.00 0.00  ? 186 ILE A O      2  
ATOM 3107  C CB     . ILE B 2 99  ? -9.339  -1.862  -4.590  1.00 0.00  ? 186 ILE A CB     2  
ATOM 3108  C CG1    . ILE B 2 99  ? -8.167  -2.767  -5.023  1.00 0.00  ? 186 ILE A CG1    2  
ATOM 3109  C CG2    . ILE B 2 99  ? -8.806  -0.569  -3.946  1.00 0.00  ? 186 ILE A CG2    2  
ATOM 3110  C CD1    . ILE B 2 99  ? -7.092  -2.035  -5.830  1.00 0.00  ? 186 ILE A CD1    2  
ATOM 3111  H H      . ILE B 2 99  ? -10.517 -4.185  -5.099  1.00 0.00  ? 186 ILE A H      2  
ATOM 3112  H HA     . ILE B 2 99  ? -9.746  -2.806  -2.707  1.00 0.00  ? 186 ILE A HA     2  
ATOM 3113  H HB     . ILE B 2 99  ? -9.879  -1.558  -5.484  1.00 0.00  ? 186 ILE A HB     2  
ATOM 3114  H HG12   . ILE B 2 99  ? -7.708  -3.199  -4.139  1.00 0.00  ? 186 ILE A HG12   2  
ATOM 3115  H HG13   . ILE B 2 99  ? -8.557  -3.580  -5.637  1.00 0.00  ? 186 ILE A HG13   2  
ATOM 3116  H HG21   . ILE B 2 99  ? -9.630  0.075   -3.663  1.00 0.00  ? 186 ILE A HG21   2  
ATOM 3117  H HG22   . ILE B 2 99  ? -8.210  -0.798  -3.064  1.00 0.00  ? 186 ILE A HG22   2  
ATOM 3118  H HG23   . ILE B 2 99  ? -8.212  -0.007  -4.665  1.00 0.00  ? 186 ILE A HG23   2  
ATOM 3119  H HD11   . ILE B 2 99  ? -7.574  -1.406  -6.591  1.00 0.00  ? 186 ILE A HD11   2  
ATOM 3120  H HD12   . ILE B 2 99  ? -6.481  -1.410  -5.171  1.00 0.00  ? 186 ILE A HD12   2  
ATOM 3121  H HD13   . ILE B 2 99  ? -6.434  -2.765  -6.296  1.00 0.00  ? 186 ILE A HD13   2  
ATOM 3122  N N      . GLU B 2 100 ? -11.375 -0.957  -2.195  1.00 0.00  ? 187 GLU A N      2  
ATOM 3123  C CA     . GLU B 2 100 ? -12.317 0.050   -1.705  1.00 0.00  ? 187 GLU A CA     2  
ATOM 3124  C C      . GLU B 2 100 ? -11.620 1.420   -1.606  1.00 0.00  ? 187 GLU A C      2  
ATOM 3125  O O      . GLU B 2 100 ? -10.784 1.611   -0.721  1.00 0.00  ? 187 GLU A O      2  
ATOM 3126  C CB     . GLU B 2 100 ? -12.893 -0.402  -0.350  1.00 0.00  ? 187 GLU A CB     2  
ATOM 3127  C CG     . GLU B 2 100 ? -13.876 -1.573  -0.493  1.00 0.00  ? 187 GLU A CG     2  
ATOM 3128  C CD     . GLU B 2 100 ? -14.485 -1.941  0.871   1.00 0.00  ? 187 GLU A CD     2  
ATOM 3129  O OE1    . GLU B 2 100 ? -15.512 -1.333  1.263   1.00 0.00  ? 187 GLU A OE1    2  
ATOM 3130  O OE2    . GLU B 2 100 ? -13.953 -2.848  1.556   1.00 0.00  ? 187 GLU A OE2    2  
ATOM 3131  H H      . GLU B 2 100 ? -10.500 -1.059  -1.688  1.00 0.00  ? 187 GLU A H      2  
ATOM 3132  H HA     . GLU B 2 100 ? -13.138 0.132   -2.413  1.00 0.00  ? 187 GLU A HA     2  
ATOM 3133  H HB2    . GLU B 2 100 ? -12.080 -0.704  0.311   1.00 0.00  ? 187 GLU A HB2    2  
ATOM 3134  H HB3    . GLU B 2 100 ? -13.408 0.434   0.115   1.00 0.00  ? 187 GLU A HB3    2  
ATOM 3135  H HG2    . GLU B 2 100 ? -14.665 -1.293  -1.193  1.00 0.00  ? 187 GLU A HG2    2  
ATOM 3136  H HG3    . GLU B 2 100 ? -13.354 -2.433  -0.915  1.00 0.00  ? 187 GLU A HG3    2  
ATOM 3137  N N      . VAL B 2 101 ? -11.896 2.362   -2.528  1.00 0.00  ? 188 VAL A N      2  
ATOM 3138  C CA     . VAL B 2 101 ? -11.155 3.641   -2.634  1.00 0.00  ? 188 VAL A CA     2  
ATOM 3139  C C      . VAL B 2 101 ? -11.915 4.835   -2.042  1.00 0.00  ? 188 VAL A C      2  
ATOM 3140  O O      . VAL B 2 101 ? -12.713 5.526   -2.674  1.00 0.00  ? 188 VAL A O      2  
ATOM 3141  C CB     . VAL B 2 101 ? -10.478 3.899   -4.009  1.00 0.00  ? 188 VAL A CB     2  
ATOM 3142  C CG1    . VAL B 2 101 ? -9.948  2.625   -4.677  1.00 0.00  ? 188 VAL A CG1    2  
ATOM 3143  C CG2    . VAL B 2 101 ? -11.216 4.708   -5.040  1.00 0.00  ? 188 VAL A CG2    2  
ATOM 3144  H H      . VAL B 2 101 ? -12.642 2.185   -3.183  1.00 0.00  ? 188 VAL A H      2  
ATOM 3145  H HA     . VAL B 2 101 ? -10.316 3.526   -1.962  1.00 0.00  ? 188 VAL A HA     2  
ATOM 3146  H HB     . VAL B 2 101 ? -9.645  4.559   -3.845  1.00 0.00  ? 188 VAL A HB     2  
ATOM 3147  H HG11   . VAL B 2 101 ? -9.155  2.210   -4.055  1.00 0.00  ? 188 VAL A HG11   2  
ATOM 3148  H HG12   . VAL B 2 101 ? -10.743 1.897   -4.816  1.00 0.00  ? 188 VAL A HG12   2  
ATOM 3149  H HG13   . VAL B 2 101 ? -9.540  2.846   -5.660  1.00 0.00  ? 188 VAL A HG13   2  
ATOM 3150  H HG21   . VAL B 2 101 ? -12.144 4.231   -5.296  1.00 0.00  ? 188 VAL A HG21   2  
ATOM 3151  H HG22   . VAL B 2 101 ? -11.371 5.702   -4.629  1.00 0.00  ? 188 VAL A HG22   2  
ATOM 3152  H HG23   . VAL B 2 101 ? -10.576 4.810   -5.915  1.00 0.00  ? 188 VAL A HG23   2  
ATOM 3153  N N      . ASN B 2 102 ? -11.676 5.073   -0.761  1.00 0.00  ? 189 ASN A N      2  
ATOM 3154  C CA     . ASN B 2 102 ? -12.180 6.242   -0.058  1.00 0.00  ? 189 ASN A CA     2  
ATOM 3155  C C      . ASN B 2 102 ? -11.380 7.493   -0.442  1.00 0.00  ? 189 ASN A C      2  
ATOM 3156  O O      . ASN B 2 102 ? -10.183 7.423   -0.730  1.00 0.00  ? 189 ASN A O      2  
ATOM 3157  C CB     . ASN B 2 102 ? -12.066 5.993   1.450   1.00 0.00  ? 189 ASN A CB     2  
ATOM 3158  C CG     . ASN B 2 102 ? -12.836 4.768   1.908   1.00 0.00  ? 189 ASN A CG     2  
ATOM 3159  O OD1    . ASN B 2 102 ? -14.005 4.578   1.594   1.00 0.00  ? 189 ASN A OD1    2  
ATOM 3160  N ND2    . ASN B 2 102 ? -12.204 3.887   2.648   1.00 0.00  ? 189 ASN A ND2    2  
ATOM 3161  H H      . ASN B 2 102 ? -10.907 4.558   -0.354  1.00 0.00  ? 189 ASN A H      2  
ATOM 3162  H HA     . ASN B 2 102 ? -13.228 6.401   -0.312  1.00 0.00  ? 189 ASN A HA     2  
ATOM 3163  H HB2    . ASN B 2 102 ? -11.017 5.887   1.713   1.00 0.00  ? 189 ASN A HB2    2  
ATOM 3164  H HB3    . ASN B 2 102 ? -12.453 6.861   1.977   1.00 0.00  ? 189 ASN A HB3    2  
ATOM 3165  H HD21   . ASN B 2 102 ? -11.234 4.049   2.899   1.00 0.00  ? 189 ASN A HD21   2  
ATOM 3166  H HD22   . ASN B 2 102 ? -12.705 3.066   2.944   1.00 0.00  ? 189 ASN A HD22   2  
ATOM 3167  N N      . ASN B 2 103 ? -12.005 8.667   -0.334  1.00 0.00  ? 190 ASN A N      2  
ATOM 3168  C CA     . ASN B 2 103 ? -11.237 9.903   -0.216  1.00 0.00  ? 190 ASN A CA     2  
ATOM 3169  C C      . ASN B 2 103 ? -10.460 9.881   1.129   1.00 0.00  ? 190 ASN A C      2  
ATOM 3170  O O      . ASN B 2 103 ? -10.886 9.240   2.100   1.00 0.00  ? 190 ASN A O      2  
ATOM 3171  C CB     . ASN B 2 103 ? -12.223 11.079  -0.316  1.00 0.00  ? 190 ASN A CB     2  
ATOM 3172  C CG     . ASN B 2 103 ? -11.573 12.445  -0.175  1.00 0.00  ? 190 ASN A CG     2  
ATOM 3173  O OD1    . ASN B 2 103 ? -11.846 13.200  0.748   1.00 0.00  ? 190 ASN A OD1    2  
ATOM 3174  N ND2    . ASN B 2 103 ? -10.719 12.826  -1.091  1.00 0.00  ? 190 ASN A ND2    2  
ATOM 3175  H H      . ASN B 2 103 ? -12.974 8.669   -0.050  1.00 0.00  ? 190 ASN A H      2  
ATOM 3176  H HA     . ASN B 2 103 ? -10.532 9.936   -1.055  1.00 0.00  ? 190 ASN A HA     2  
ATOM 3177  H HB2    . ASN B 2 103 ? -12.714 11.046  -1.285  1.00 0.00  ? 190 ASN A HB2    2  
ATOM 3178  H HB3    . ASN B 2 103 ? -12.983 10.981  0.460   1.00 0.00  ? 190 ASN A HB3    2  
ATOM 3179  H HD21   . ASN B 2 103 ? -10.567 12.230  -1.909  1.00 0.00  ? 190 ASN A HD21   2  
ATOM 3180  H HD22   . ASN B 2 103 ? -10.305 13.739  -1.012  1.00 0.00  ? 190 ASN A HD22   2  
ATOM 3181  N N      . ALA B 2 104 ? -9.311  10.549  1.227   1.00 0.00  ? 191 ALA A N      2  
ATOM 3182  C CA     . ALA B 2 104 ? -8.601  10.584  2.501   1.00 0.00  ? 191 ALA A CA     2  
ATOM 3183  C C      . ALA B 2 104 ? -9.268  11.492  3.542   1.00 0.00  ? 191 ALA A C      2  
ATOM 3184  O O      . ALA B 2 104 ? -10.016 12.425  3.246   1.00 0.00  ? 191 ALA A O      2  
ATOM 3185  C CB     . ALA B 2 104 ? -7.137  10.973  2.324   1.00 0.00  ? 191 ALA A CB     2  
ATOM 3186  H H      . ALA B 2 104 ? -8.950  11.062  0.427   1.00 0.00  ? 191 ALA A H      2  
ATOM 3187  H HA     . ALA B 2 104 ? -8.595  9.573   2.898   1.00 0.00  ? 191 ALA A HA     2  
ATOM 3188  H HB1    . ALA B 2 104 ? -6.688  10.271  1.625   1.00 0.00  ? 191 ALA A HB1    2  
ATOM 3189  H HB2    . ALA B 2 104 ? -7.063  11.991  1.946   1.00 0.00  ? 191 ALA A HB2    2  
ATOM 3190  H HB3    . ALA B 2 104 ? -6.621  10.901  3.296   1.00 0.00  ? 191 ALA A HB3    2  
ATOM 3191  N N      . THR B 2 105 ? -8.876  11.244  4.782   1.00 0.00  ? 192 THR A N      2  
ATOM 3192  C CA     . THR B 2 105 ? -8.982  12.119  5.943   1.00 0.00  ? 192 THR A CA     2  
ATOM 3193  C C      . THR B 2 105 ? -7.563  12.176  6.510   1.00 0.00  ? 192 THR A C      2  
ATOM 3194  O O      . THR B 2 105 ? -6.869  11.155  6.554   1.00 0.00  ? 192 THR A O      2  
ATOM 3195  C CB     . THR B 2 105 ? -10.069 11.559  6.887   1.00 0.00  ? 192 THR A CB     2  
ATOM 3196  O OG1    . THR B 2 105 ? -11.158 12.456  6.941   1.00 0.00  ? 192 THR A OG1    2  
ATOM 3197  C CG2    . THR B 2 105 ? -9.635  11.282  8.317   1.00 0.00  ? 192 THR A CG2    2  
ATOM 3198  H H      . THR B 2 105 ? -8.265  10.441  4.909   1.00 0.00  ? 192 THR A H      2  
ATOM 3199  H HA     . THR B 2 105 ? -9.265  13.125  5.623   1.00 0.00  ? 192 THR A HA     2  
ATOM 3200  H HB     . THR B 2 105 ? -10.425 10.606  6.488   1.00 0.00  ? 192 THR A HB     2  
ATOM 3201  H HG1    . THR B 2 105 ? -11.551 12.494  6.050   1.00 0.00  ? 192 THR A HG1    2  
ATOM 3202  H HG21   . THR B 2 105 ? -8.872  10.510  8.282   1.00 0.00  ? 192 THR A HG21   2  
ATOM 3203  H HG22   . THR B 2 105 ? -9.245  12.186  8.785   1.00 0.00  ? 192 THR A HG22   2  
ATOM 3204  H HG23   . THR B 2 105 ? -10.488 10.903  8.884   1.00 0.00  ? 192 THR A HG23   2  
ATOM 3205  N N      . ALA B 2 106 ? -7.033  13.366  6.795   1.00 0.00  ? 193 ALA A N      2  
ATOM 3206  C CA     . ALA B 2 106 ? -5.600  13.444  7.087   1.00 0.00  ? 193 ALA A CA     2  
ATOM 3207  C C      . ALA B 2 106 ? -5.225  12.945  8.497   1.00 0.00  ? 193 ALA A C      2  
ATOM 3208  O O      . ALA B 2 106 ? -6.078  12.726  9.363   1.00 0.00  ? 193 ALA A O      2  
ATOM 3209  C CB     . ALA B 2 106 ? -5.015  14.781  6.688   1.00 0.00  ? 193 ALA A CB     2  
ATOM 3210  H H      . ALA B 2 106 ? -7.585  14.211  6.736   1.00 0.00  ? 193 ALA A H      2  
ATOM 3211  H HA     . ALA B 2 106 ? -5.110  12.767  6.397   1.00 0.00  ? 193 ALA A HA     2  
ATOM 3212  H HB1    . ALA B 2 106 ? -5.283  14.968  5.648   1.00 0.00  ? 193 ALA A HB1    2  
ATOM 3213  H HB2    . ALA B 2 106 ? -5.373  15.574  7.344   1.00 0.00  ? 193 ALA A HB2    2  
ATOM 3214  H HB3    . ALA B 2 106 ? -3.931  14.679  6.731   1.00 0.00  ? 193 ALA A HB3    2  
ATOM 3215  N N      . ARG B 2 107 ? -3.932  12.652  8.660   1.00 0.00  ? 194 ARG A N      2  
ATOM 3216  C CA     . ARG B 2 107 ? -3.437  11.619  9.574   1.00 0.00  ? 194 ARG A CA     2  
ATOM 3217  C C      . ARG B 2 107 ? -3.634  11.944  11.059  1.00 0.00  ? 194 ARG A C      2  
ATOM 3218  O O      . ARG B 2 107 ? -3.540  13.105  11.465  1.00 0.00  ? 194 ARG A O      2  
ATOM 3219  C CB     . ARG B 2 107 ? -1.965  11.358  9.235   1.00 0.00  ? 194 ARG A CB     2  
ATOM 3220  C CG     . ARG B 2 107 ? -1.535  9.972   9.704   1.00 0.00  ? 194 ARG A CG     2  
ATOM 3221  C CD     . ARG B 2 107 ? -0.149  9.622   9.185   1.00 0.00  ? 194 ARG A CD     2  
ATOM 3222  N NE     . ARG B 2 107 ? 0.932   10.365  9.858   1.00 0.00  ? 194 ARG A NE     2  
ATOM 3223  C CZ     . ARG B 2 107 ? 2.214   10.047  9.865   1.00 0.00  ? 194 ARG A CZ     2  
ATOM 3224  N NH1    . ARG B 2 107 ? 2.678   9.029   9.199   1.00 0.00  ? 194 ARG A NH1    2  
ATOM 3225  N NH2    . ARG B 2 107 ? 3.068   10.756  10.547  1.00 0.00  ? 194 ARG A NH2    2  
ATOM 3226  H H      . ARG B 2 107 ? -3.304  12.967  7.932   1.00 0.00  ? 194 ARG A H      2  
ATOM 3227  H HA     . ARG B 2 107 ? -4.008  10.711  9.365   1.00 0.00  ? 194 ARG A HA     2  
ATOM 3228  H HB2    . ARG B 2 107 ? -1.841  11.393  8.152   1.00 0.00  ? 194 ARG A HB2    2  
ATOM 3229  H HB3    . ARG B 2 107 ? -1.330  12.126  9.681   1.00 0.00  ? 194 ARG A HB3    2  
ATOM 3230  H HG2    . ARG B 2 107 ? -1.548  9.906   10.790  1.00 0.00  ? 194 ARG A HG2    2  
ATOM 3231  H HG3    . ARG B 2 107 ? -2.229  9.248   9.285   1.00 0.00  ? 194 ARG A HG3    2  
ATOM 3232  H HD2    . ARG B 2 107 ? -0.008  8.555   9.364   1.00 0.00  ? 194 ARG A HD2    2  
ATOM 3233  H HD3    . ARG B 2 107 ? -0.141  9.810   8.106   1.00 0.00  ? 194 ARG A HD3    2  
ATOM 3234  H HE     . ARG B 2 107 ? 0.675   11.170  10.406  1.00 0.00  ? 194 ARG A HE     2  
ATOM 3235  H HH11   . ARG B 2 107 ? 2.036   8.485   8.632   1.00 0.00  ? 194 ARG A HH11   2  
ATOM 3236  H HH12   . ARG B 2 107 ? 3.654   8.797   9.210   1.00 0.00  ? 194 ARG A HH12   2  
ATOM 3237  H HH21   . ARG B 2 107 ? 2.760   11.550  11.083  1.00 0.00  ? 194 ARG A HH21   2  
ATOM 3238  H HH22   . ARG B 2 107 ? 4.043   10.507  10.555  1.00 0.00  ? 194 ARG A HH22   2  
ATOM 3239  N N      . VAL B 2 108 ? -3.854  10.912  11.880  1.00 0.00  ? 195 VAL A N      2  
ATOM 3240  C CA     . VAL B 2 108 ? -3.945  11.022  13.346  1.00 0.00  ? 195 VAL A CA     2  
ATOM 3241  C C      . VAL B 2 108 ? -2.566  11.348  13.935  1.00 0.00  ? 195 VAL A C      2  
ATOM 3242  O O      . VAL B 2 108 ? -1.634  10.543  13.850  1.00 0.00  ? 195 VAL A O      2  
ATOM 3243  C CB     . VAL B 2 108 ? -4.529  9.734   13.970  1.00 0.00  ? 195 VAL A CB     2  
ATOM 3244  C CG1    . VAL B 2 108 ? -4.690  9.874   15.489  1.00 0.00  ? 195 VAL A CG1    2  
ATOM 3245  C CG2    . VAL B 2 108 ? -5.918  9.422   13.390  1.00 0.00  ? 195 VAL A CG2    2  
ATOM 3246  H H      . VAL B 2 108 ? -3.870  9.983   11.467  1.00 0.00  ? 195 VAL A H      2  
ATOM 3247  H HA     . VAL B 2 108 ? -4.626  11.837  13.590  1.00 0.00  ? 195 VAL A HA     2  
ATOM 3248  H HB     . VAL B 2 108 ? -3.866  8.895   13.763  1.00 0.00  ? 195 VAL A HB     2  
ATOM 3249  H HG11   . VAL B 2 108 ? -3.717  10.009  15.961  1.00 0.00  ? 195 VAL A HG11   2  
ATOM 3250  H HG12   . VAL B 2 108 ? -5.332  10.722  15.725  1.00 0.00  ? 195 VAL A HG12   2  
ATOM 3251  H HG13   . VAL B 2 108 ? -5.133  8.967   15.897  1.00 0.00  ? 195 VAL A HG13   2  
ATOM 3252  H HG21   . VAL B 2 108 ? -6.594  10.263  13.560  1.00 0.00  ? 195 VAL A HG21   2  
ATOM 3253  H HG22   . VAL B 2 108 ? -5.845  9.228   12.322  1.00 0.00  ? 195 VAL A HG22   2  
ATOM 3254  H HG23   . VAL B 2 108 ? -6.325  8.530   13.866  1.00 0.00  ? 195 VAL A HG23   2  
ATOM 3255  N N      . MET B 2 109 ? -2.422  12.556  14.502  1.00 0.00  ? 196 MET A N      2  
ATOM 3256  C CA     . MET B 2 109 ? -1.204  13.044  15.180  1.00 0.00  ? 196 MET A CA     2  
ATOM 3257  C C      . MET B 2 109 ? -0.858  12.226  16.438  1.00 0.00  ? 196 MET A C      2  
ATOM 3258  O O      . MET B 2 109 ? -1.759  11.984  17.274  1.00 0.00  ? 196 MET A O      2  
ATOM 3259  C CB     . MET B 2 109 ? -1.351  14.536  15.531  1.00 0.00  ? 196 MET A CB     2  
ATOM 3260  C CG     . MET B 2 109 ? -1.412  15.427  14.286  1.00 0.00  ? 196 MET A CG     2  
ATOM 3261  S SD     . MET B 2 109 ? -1.474  17.202  14.651  1.00 0.00  ? 196 MET A SD     2  
ATOM 3262  C CE     . MET B 2 109 ? -1.520  17.850  12.959  1.00 0.00  ? 196 MET A CE     2  
ATOM 3263  O OXT    . MET B 2 109 ? 0.327   11.858  16.600  1.00 0.00  ? 196 MET A OXT    2  
ATOM 3264  H H      . MET B 2 109 ? -3.236  13.155  14.505  1.00 0.00  ? 196 MET A H      2  
ATOM 3265  H HA     . MET B 2 109 ? -0.362  12.938  14.499  1.00 0.00  ? 196 MET A HA     2  
ATOM 3266  H HB2    . MET B 2 109 ? -2.248  14.691  16.133  1.00 0.00  ? 196 MET A HB2    2  
ATOM 3267  H HB3    . MET B 2 109 ? -0.488  14.842  16.123  1.00 0.00  ? 196 MET A HB3    2  
ATOM 3268  H HG2    . MET B 2 109 ? -0.527  15.236  13.678  1.00 0.00  ? 196 MET A HG2    2  
ATOM 3269  H HG3    . MET B 2 109 ? -2.295  15.164  13.699  1.00 0.00  ? 196 MET A HG3    2  
ATOM 3270  H HE1    . MET B 2 109 ? -0.631  17.527  12.418  1.00 0.00  ? 196 MET A HE1    2  
ATOM 3271  H HE2    . MET B 2 109 ? -2.405  17.481  12.444  1.00 0.00  ? 196 MET A HE2    2  
ATOM 3272  H HE3    . MET B 2 109 ? -1.551  18.939  12.985  1.00 0.00  ? 196 MET A HE3    2  
ATOM 3273  O "O5'"  . U   A 1 1   ? -2.876  -14.291 6.783   1.00 0.00  ? 197 U   B "O5'"  3  
ATOM 3274  C "C5'"  . U   A 1 1   ? -2.328  -14.434 8.089   1.00 0.00  ? 197 U   B "C5'"  3  
ATOM 3275  C "C4'"  . U   A 1 1   ? -1.743  -13.134 8.675   1.00 0.00  ? 197 U   B "C4'"  3  
ATOM 3276  O "O4'"  . U   A 1 1   ? -0.460  -12.810 8.153   1.00 0.00  ? 197 U   B "O4'"  3  
ATOM 3277  C "C3'"  . U   A 1 1   ? -2.618  -11.893 8.471   1.00 0.00  ? 197 U   B "C3'"  3  
ATOM 3278  O "O3'"  . U   A 1 1   ? -2.830  -11.211 9.701   1.00 0.00  ? 197 U   B "O3'"  3  
ATOM 3279  C "C2'"  . U   A 1 1   ? -1.808  -11.010 7.511   1.00 0.00  ? 197 U   B "C2'"  3  
ATOM 3280  O "O2'"  . U   A 1 1   ? -1.284  -9.856  8.166   1.00 0.00  ? 197 U   B "O2'"  3  
ATOM 3281  C "C1'"  . U   A 1 1   ? -0.588  -11.859 7.099   1.00 0.00  ? 197 U   B "C1'"  3  
ATOM 3282  N N1     . U   A 1 1   ? -0.529  -12.550 5.767   1.00 0.00  ? 197 U   B N1     3  
ATOM 3283  C C2     . U   A 1 1   ? 0.651   -13.259 5.470   1.00 0.00  ? 197 U   B C2     3  
ATOM 3284  O O2     . U   A 1 1   ? 1.598   -13.400 6.249   1.00 0.00  ? 197 U   B O2     3  
ATOM 3285  N N3     . U   A 1 1   ? 0.760   -13.814 4.213   1.00 0.00  ? 197 U   B N3     3  
ATOM 3286  C C4     . U   A 1 1   ? -0.168  -13.717 3.211   1.00 0.00  ? 197 U   B C4     3  
ATOM 3287  O O4     . U   A 1 1   ? 0.048   -14.247 2.124   1.00 0.00  ? 197 U   B O4     3  
ATOM 3288  C C5     . U   A 1 1   ? -1.348  -12.964 3.562   1.00 0.00  ? 197 U   B C5     3  
ATOM 3289  C C6     . U   A 1 1   ? -1.502  -12.410 4.798   1.00 0.00  ? 197 U   B C6     3  
ATOM 3290  H "H5'"  . U   A 1 1   ? -1.551  -15.198 8.080   1.00 0.00  ? 197 U   B "H5'"  3  
ATOM 3291  H "H5''" . U   A 1 1   ? -3.122  -14.774 8.757   1.00 0.00  ? 197 U   B "H5''" 3  
ATOM 3292  H "H4'"  . U   A 1 1   ? -1.627  -13.304 9.745   1.00 0.00  ? 197 U   B "H4'"  3  
ATOM 3293  H "H3'"  . U   A 1 1   ? -3.564  -12.157 7.992   1.00 0.00  ? 197 U   B "H3'"  3  
ATOM 3294  H "H2'"  . U   A 1 1   ? -2.478  -10.693 6.707   1.00 0.00  ? 197 U   B "H2'"  3  
ATOM 3295  H "HO2'" . U   A 1 1   ? -1.922  -9.625  8.867   1.00 0.00  ? 197 U   B "HO2'" 3  
ATOM 3296  H "H1'"  . U   A 1 1   ? 0.280   -11.191 7.111   1.00 0.00  ? 197 U   B "H1'"  3  
ATOM 3297  H H3     . U   A 1 1   ? 1.603   -14.314 3.999   1.00 0.00  ? 197 U   B H3     3  
ATOM 3298  H H5     . U   A 1 1   ? -2.119  -12.868 2.813   1.00 0.00  ? 197 U   B H5     3  
ATOM 3299  H H6     . U   A 1 1   ? -2.418  -11.888 5.022   1.00 0.00  ? 197 U   B H6     3  
ATOM 3300  H "HO5'" . U   A 1 1   ? -3.248  -15.146 6.490   1.00 0.00  ? 197 U   B "HO5'" 3  
ATOM 3301  P P      . G   A 1 2   ? -4.142  -11.458 10.570  1.00 0.00  ? 198 G   B P      3  
ATOM 3302  O OP1    . G   A 1 2   ? -3.761  -11.260 11.989  1.00 0.00  ? 198 G   B OP1    3  
ATOM 3303  O OP2    . G   A 1 2   ? -4.775  -12.736 10.165  1.00 0.00  ? 198 G   B OP2    3  
ATOM 3304  O "O5'"  . G   A 1 2   ? -5.095  -10.245 10.122  1.00 0.00  ? 198 G   B "O5'"  3  
ATOM 3305  C "C5'"  . G   A 1 2   ? -5.315  -9.909  8.761   1.00 0.00  ? 198 G   B "C5'"  3  
ATOM 3306  C "C4'"  . G   A 1 2   ? -6.684  -9.206  8.632   1.00 0.00  ? 198 G   B "C4'"  3  
ATOM 3307  O "O4'"  . G   A 1 2   ? -6.937  -8.854  7.273   1.00 0.00  ? 198 G   B "O4'"  3  
ATOM 3308  C "C3'"  . G   A 1 2   ? -7.866  -10.098 9.054   1.00 0.00  ? 198 G   B "C3'"  3  
ATOM 3309  O "O3'"  . G   A 1 2   ? -9.012  -9.323  9.401   1.00 0.00  ? 198 G   B "O3'"  3  
ATOM 3310  C "C2'"  . G   A 1 2   ? -8.125  -10.832 7.740   1.00 0.00  ? 198 G   B "C2'"  3  
ATOM 3311  O "O2'"  . G   A 1 2   ? -9.405  -11.456 7.675   1.00 0.00  ? 198 G   B "O2'"  3  
ATOM 3312  C "C1'"  . G   A 1 2   ? -7.959  -9.691  6.734   1.00 0.00  ? 198 G   B "C1'"  3  
ATOM 3313  N N9     . G   A 1 2   ? -7.634  -10.183 5.368   1.00 0.00  ? 198 G   B N9     3  
ATOM 3314  C C8     . G   A 1 2   ? -7.631  -11.478 4.902   1.00 0.00  ? 198 G   B C8     3  
ATOM 3315  N N7     . G   A 1 2   ? -7.276  -11.604 3.650   1.00 0.00  ? 198 G   B N7     3  
ATOM 3316  C C5     . G   A 1 2   ? -7.050  -10.283 3.238   1.00 0.00  ? 198 G   B C5     3  
ATOM 3317  C C6     . G   A 1 2   ? -6.612  -9.735  1.978   1.00 0.00  ? 198 G   B C6     3  
ATOM 3318  O O6     . G   A 1 2   ? -6.307  -10.316 0.933   1.00 0.00  ? 198 G   B O6     3  
ATOM 3319  N N1     . G   A 1 2   ? -6.543  -8.360  1.976   1.00 0.00  ? 198 G   B N1     3  
ATOM 3320  C C2     . G   A 1 2   ? -6.826  -7.588  3.049   1.00 0.00  ? 198 G   B C2     3  
ATOM 3321  N N2     . G   A 1 2   ? -6.681  -6.299  2.897   1.00 0.00  ? 198 G   B N2     3  
ATOM 3322  N N3     . G   A 1 2   ? -7.246  -8.041  4.224   1.00 0.00  ? 198 G   B N3     3  
ATOM 3323  C C4     . G   A 1 2   ? -7.326  -9.406  4.270   1.00 0.00  ? 198 G   B C4     3  
ATOM 3324  H "H5'"  . G   A 1 2   ? -5.258  -10.787 8.112   1.00 0.00  ? 198 G   B "H5'"  3  
ATOM 3325  H "H5''" . G   A 1 2   ? -4.521  -9.238  8.430   1.00 0.00  ? 198 G   B "H5''" 3  
ATOM 3326  H "H4'"  . G   A 1 2   ? -6.659  -8.313  9.257   1.00 0.00  ? 198 G   B "H4'"  3  
ATOM 3327  H "H3'"  . G   A 1 2   ? -7.600  -10.820 9.824   1.00 0.00  ? 198 G   B "H3'"  3  
ATOM 3328  H "H2'"  . G   A 1 2   ? -7.338  -11.575 7.596   1.00 0.00  ? 198 G   B "H2'"  3  
ATOM 3329  H "HO2'" . G   A 1 2   ? -10.044 -10.879 8.138   1.00 0.00  ? 198 G   B "HO2'" 3  
ATOM 3330  H "H1'"  . G   A 1 2   ? -8.895  -9.133  6.696   1.00 0.00  ? 198 G   B "H1'"  3  
ATOM 3331  H H8     . G   A 1 2   ? -7.874  -12.319 5.541   1.00 0.00  ? 198 G   B H8     3  
ATOM 3332  H H1     . G   A 1 2   ? -6.229  -7.904  1.139   1.00 0.00  ? 198 G   B H1     3  
ATOM 3333  H H21    . G   A 1 2   ? -6.273  -5.947  2.043   1.00 0.00  ? 198 G   B H21    3  
ATOM 3334  H H22    . G   A 1 2   ? -6.886  -5.685  3.675   1.00 0.00  ? 198 G   B H22    3  
ATOM 3335  P P      . C   A 1 3   ? -9.330  -8.932  10.923  1.00 0.00  ? 199 C   B P      3  
ATOM 3336  O OP1    . C   A 1 3   ? -9.177  -10.144 11.760  1.00 0.00  ? 199 C   B OP1    3  
ATOM 3337  O OP2    . C   A 1 3   ? -10.633 -8.224  10.938  1.00 0.00  ? 199 C   B OP2    3  
ATOM 3338  O "O5'"  . C   A 1 3   ? -8.179  -7.890  11.334  1.00 0.00  ? 199 C   B "O5'"  3  
ATOM 3339  C "C5'"  . C   A 1 3   ? -8.112  -6.585  10.773  1.00 0.00  ? 199 C   B "C5'"  3  
ATOM 3340  C "C4'"  . C   A 1 3   ? -7.001  -5.778  11.457  1.00 0.00  ? 199 C   B "C4'"  3  
ATOM 3341  O "O4'"  . C   A 1 3   ? -5.707  -6.311  11.181  1.00 0.00  ? 199 C   B "O4'"  3  
ATOM 3342  C "C3'"  . C   A 1 3   ? -6.991  -4.314  10.981  1.00 0.00  ? 199 C   B "C3'"  3  
ATOM 3343  O "O3'"  . C   A 1 3   ? -6.935  -3.453  12.112  1.00 0.00  ? 199 C   B "O3'"  3  
ATOM 3344  C "C2'"  . C   A 1 3   ? -5.709  -4.249  10.138  1.00 0.00  ? 199 C   B "C2'"  3  
ATOM 3345  O "O2'"  . C   A 1 3   ? -5.129  -2.952  10.016  1.00 0.00  ? 199 C   B "O2'"  3  
ATOM 3346  C "C1'"  . C   A 1 3   ? -4.839  -5.217  10.932  1.00 0.00  ? 199 C   B "C1'"  3  
ATOM 3347  N N1     . C   A 1 3   ? -3.604  -5.665  10.233  1.00 0.00  ? 199 C   B N1     3  
ATOM 3348  C C2     . C   A 1 3   ? -2.360  -5.430  10.843  1.00 0.00  ? 199 C   B C2     3  
ATOM 3349  O O2     . C   A 1 3   ? -2.259  -4.781  11.889  1.00 0.00  ? 199 C   B O2     3  
ATOM 3350  N N3     . C   A 1 3   ? -1.218  -5.929  10.298  1.00 0.00  ? 199 C   B N3     3  
ATOM 3351  C C4     . C   A 1 3   ? -1.312  -6.630  9.189   1.00 0.00  ? 199 C   B C4     3  
ATOM 3352  N N4     . C   A 1 3   ? -0.212  -7.168  8.748   1.00 0.00  ? 199 C   B N4     3  
ATOM 3353  C C5     . C   A 1 3   ? -2.530  -6.849  8.497   1.00 0.00  ? 199 C   B C5     3  
ATOM 3354  C C6     . C   A 1 3   ? -3.663  -6.348  9.043   1.00 0.00  ? 199 C   B C6     3  
ATOM 3355  H "H5'"  . C   A 1 3   ? -9.065  -6.075  10.939  1.00 0.00  ? 199 C   B "H5'"  3  
ATOM 3356  H "H5''" . C   A 1 3   ? -7.927  -6.633  9.699   1.00 0.00  ? 199 C   B "H5''" 3  
ATOM 3357  H "H4'"  . C   A 1 3   ? -7.177  -5.794  12.533  1.00 0.00  ? 199 C   B "H4'"  3  
ATOM 3358  H "H3'"  . C   A 1 3   ? -7.848  -4.095  10.355  1.00 0.00  ? 199 C   B "H3'"  3  
ATOM 3359  H "H2'"  . C   A 1 3   ? -5.915  -4.663  9.147   1.00 0.00  ? 199 C   B "H2'"  3  
ATOM 3360  H "HO2'" . C   A 1 3   ? -5.798  -2.329  9.678   1.00 0.00  ? 199 C   B "HO2'" 3  
ATOM 3361  H "H1'"  . C   A 1 3   ? -4.584  -4.731  11.880  1.00 0.00  ? 199 C   B "H1'"  3  
ATOM 3362  H H41    . C   A 1 3   ? 0.623   -7.040  9.294   1.00 0.00  ? 199 C   B H41    3  
ATOM 3363  H H42    . C   A 1 3   ? -0.313  -7.905  8.069   1.00 0.00  ? 199 C   B H42    3  
ATOM 3364  H H5     . C   A 1 3   ? -2.562  -7.393  7.570   1.00 0.00  ? 199 C   B H5     3  
ATOM 3365  H H6     . C   A 1 3   ? -4.622  -6.500  8.562   1.00 0.00  ? 199 C   B H6     3  
ATOM 3366  P P      . A   A 1 4   ? -8.279  -2.809  12.702  1.00 0.00  ? 200 A   B P      3  
ATOM 3367  O OP1    . A   A 1 4   ? -7.971  -2.220  14.029  1.00 0.00  ? 200 A   B OP1    3  
ATOM 3368  O OP2    . A   A 1 4   ? -9.376  -3.799  12.594  1.00 0.00  ? 200 A   B OP2    3  
ATOM 3369  O "O5'"  . A   A 1 4   ? -8.576  -1.622  11.663  1.00 0.00  ? 200 A   B "O5'"  3  
ATOM 3370  C "C5'"  . A   A 1 4   ? -7.719  -0.493  11.605  1.00 0.00  ? 200 A   B "C5'"  3  
ATOM 3371  C "C4'"  . A   A 1 4   ? -8.014  0.429   10.413  1.00 0.00  ? 200 A   B "C4'"  3  
ATOM 3372  O "O4'"  . A   A 1 4   ? -7.706  -0.226  9.190   1.00 0.00  ? 200 A   B "O4'"  3  
ATOM 3373  C "C3'"  . A   A 1 4   ? -9.470  0.917   10.343  1.00 0.00  ? 200 A   B "C3'"  3  
ATOM 3374  O "O3'"  . A   A 1 4   ? -9.576  2.237   9.823   1.00 0.00  ? 200 A   B "O3'"  3  
ATOM 3375  C "C2'"  . A   A 1 4   ? -10.096 -0.083  9.371   1.00 0.00  ? 200 A   B "C2'"  3  
ATOM 3376  O "O2'"  . A   A 1 4   ? -11.143 0.481   8.584   1.00 0.00  ? 200 A   B "O2'"  3  
ATOM 3377  C "C1'"  . A   A 1 4   ? -8.912  -0.558  8.517   1.00 0.00  ? 200 A   B "C1'"  3  
ATOM 3378  N N9     . A   A 1 4   ? -8.966  -2.012  8.213   1.00 0.00  ? 200 A   B N9     3  
ATOM 3379  C C8     . A   A 1 4   ? -9.619  -3.030  8.874   1.00 0.00  ? 200 A   B C8     3  
ATOM 3380  N N7     . A   A 1 4   ? -9.496  -4.209  8.316   1.00 0.00  ? 200 A   B N7     3  
ATOM 3381  C C5     . A   A 1 4   ? -8.716  -3.937  7.182   1.00 0.00  ? 200 A   B C5     3  
ATOM 3382  C C6     . A   A 1 4   ? -8.206  -4.719  6.117   1.00 0.00  ? 200 A   B C6     3  
ATOM 3383  N N6     . A   A 1 4   ? -8.383  -6.023  6.031   1.00 0.00  ? 200 A   B N6     3  
ATOM 3384  N N1     . A   A 1 4   ? -7.502  -4.167  5.121   1.00 0.00  ? 200 A   B N1     3  
ATOM 3385  C C2     . A   A 1 4   ? -7.287  -2.855  5.189   1.00 0.00  ? 200 A   B C2     3  
ATOM 3386  N N3     . A   A 1 4   ? -7.672  -2.003  6.134   1.00 0.00  ? 200 A   B N3     3  
ATOM 3387  C C4     . A   A 1 4   ? -8.398  -2.608  7.111   1.00 0.00  ? 200 A   B C4     3  
ATOM 3388  H "H5'"  . A   A 1 4   ? -6.681  -0.820  11.535  1.00 0.00  ? 200 A   B "H5'"  3  
ATOM 3389  H "H5''" . A   A 1 4   ? -7.825  0.087   12.524  1.00 0.00  ? 200 A   B "H5''" 3  
ATOM 3390  H "H4'"  . A   A 1 4   ? -7.353  1.288   10.514  1.00 0.00  ? 200 A   B "H4'"  3  
ATOM 3391  H "H3'"  . A   A 1 4   ? -9.962  0.841   11.313  1.00 0.00  ? 200 A   B "H3'"  3  
ATOM 3392  H "H2'"  . A   A 1 4   ? -10.493 -0.896  9.976   1.00 0.00  ? 200 A   B "H2'"  3  
ATOM 3393  H "HO2'" . A   A 1 4   ? -10.972 1.439   8.532   1.00 0.00  ? 200 A   B "HO2'" 3  
ATOM 3394  H "H1'"  . A   A 1 4   ? -8.923  -0.003  7.573   1.00 0.00  ? 200 A   B "H1'"  3  
ATOM 3395  H H8     . A   A 1 4   ? -10.155 -2.881  9.805   1.00 0.00  ? 200 A   B H8     3  
ATOM 3396  H H61    . A   A 1 4   ? -7.936  -6.572  5.307   1.00 0.00  ? 200 A   B H61    3  
ATOM 3397  H H62    . A   A 1 4   ? -8.895  -6.470  6.772   1.00 0.00  ? 200 A   B H62    3  
ATOM 3398  H H2     . A   A 1 4   ? -6.720  -2.398  4.390   1.00 0.00  ? 200 A   B H2     3  
ATOM 3399  P P      . U   A 1 5   ? -9.279  3.507   10.752  1.00 0.00  ? 201 U   B P      3  
ATOM 3400  O OP1    . U   A 1 5   ? -8.479  3.089   11.930  1.00 0.00  ? 201 U   B OP1    3  
ATOM 3401  O OP2    . U   A 1 5   ? -10.556 4.229   10.964  1.00 0.00  ? 201 U   B OP2    3  
ATOM 3402  O "O5'"  . U   A 1 5   ? -8.352  4.402   9.803   1.00 0.00  ? 201 U   B "O5'"  3  
ATOM 3403  C "C5'"  . U   A 1 5   ? -7.135  3.917   9.258   1.00 0.00  ? 201 U   B "C5'"  3  
ATOM 3404  C "C4'"  . U   A 1 5   ? -6.284  5.024   8.611   1.00 0.00  ? 201 U   B "C4'"  3  
ATOM 3405  O "O4'"  . U   A 1 5   ? -6.681  5.394   7.292   1.00 0.00  ? 201 U   B "O4'"  3  
ATOM 3406  C "C3'"  . U   A 1 5   ? -6.259  6.305   9.459   1.00 0.00  ? 201 U   B "C3'"  3  
ATOM 3407  O "O3'"  . U   A 1 5   ? -4.977  6.935   9.405   1.00 0.00  ? 201 U   B "O3'"  3  
ATOM 3408  C "C2'"  . U   A 1 5   ? -7.383  7.111   8.783   1.00 0.00  ? 201 U   B "C2'"  3  
ATOM 3409  O "O2'"  . U   A 1 5   ? -7.261  8.505   9.035   1.00 0.00  ? 201 U   B "O2'"  3  
ATOM 3410  C "C1'"  . U   A 1 5   ? -7.282  6.691   7.306   1.00 0.00  ? 201 U   B "C1'"  3  
ATOM 3411  N N1     . U   A 1 5   ? -8.591  6.609   6.595   1.00 0.00  ? 201 U   B N1     3  
ATOM 3412  C C2     . U   A 1 5   ? -8.790  7.402   5.459   1.00 0.00  ? 201 U   B C2     3  
ATOM 3413  O O2     . U   A 1 5   ? -7.983  8.241   5.072   1.00 0.00  ? 201 U   B O2     3  
ATOM 3414  N N3     . U   A 1 5   ? -9.968  7.236   4.754   1.00 0.00  ? 201 U   B N3     3  
ATOM 3415  C C4     . U   A 1 5   ? -11.003 6.414   5.142   1.00 0.00  ? 201 U   B C4     3  
ATOM 3416  O O4     . U   A 1 5   ? -12.070 6.424   4.543   1.00 0.00  ? 201 U   B O4     3  
ATOM 3417  C C5     . U   A 1 5   ? -10.717 5.586   6.291   1.00 0.00  ? 201 U   B C5     3  
ATOM 3418  C C6     . U   A 1 5   ? -9.551  5.699   6.975   1.00 0.00  ? 201 U   B C6     3  
ATOM 3419  H "H5'"  . U   A 1 5   ? -7.342  3.138   8.520   1.00 0.00  ? 201 U   B "H5'"  3  
ATOM 3420  H "H5''" . U   A 1 5   ? -6.542  3.475   10.061  1.00 0.00  ? 201 U   B "H5''" 3  
ATOM 3421  H "H4'"  . U   A 1 5   ? -5.291  4.607   8.540   1.00 0.00  ? 201 U   B "H4'"  3  
ATOM 3422  H "H3'"  . U   A 1 5   ? -6.533  6.098   10.494  1.00 0.00  ? 201 U   B "H3'"  3  
ATOM 3423  H "H2'"  . U   A 1 5   ? -8.334  6.761   9.185   1.00 0.00  ? 201 U   B "H2'"  3  
ATOM 3424  H "HO2'" . U   A 1 5   ? -7.928  8.984   8.497   1.00 0.00  ? 201 U   B "HO2'" 3  
ATOM 3425  H "H1'"  . U   A 1 5   ? -6.637  7.412   6.790   1.00 0.00  ? 201 U   B "H1'"  3  
ATOM 3426  H H3     . U   A 1 5   ? -10.060 7.720   3.871   1.00 0.00  ? 201 U   B H3     3  
ATOM 3427  H H5     . U   A 1 5   ? -11.453 4.854   6.589   1.00 0.00  ? 201 U   B H5     3  
ATOM 3428  H H6     . U   A 1 5   ? -9.360  5.055   7.819   1.00 0.00  ? 201 U   B H6     3  
ATOM 3429  P P      . G   A 1 6   ? -3.751  6.381   10.288  1.00 0.00  ? 202 G   B P      3  
ATOM 3430  O OP1    . G   A 1 6   ? -4.133  5.103   10.932  1.00 0.00  ? 202 G   B OP1    3  
ATOM 3431  O OP2    . G   A 1 6   ? -3.241  7.476   11.143  1.00 0.00  ? 202 G   B OP2    3  
ATOM 3432  O "O5'"  . G   A 1 6   ? -2.596  6.072   9.219   1.00 0.00  ? 202 G   B "O5'"  3  
ATOM 3433  C "C5'"  . G   A 1 6   ? -2.617  4.902   8.418   1.00 0.00  ? 202 G   B "C5'"  3  
ATOM 3434  C "C4'"  . G   A 1 6   ? -1.442  4.769   7.438   1.00 0.00  ? 202 G   B "C4'"  3  
ATOM 3435  O "O4'"  . G   A 1 6   ? -1.776  5.448   6.231   1.00 0.00  ? 202 G   B "O4'"  3  
ATOM 3436  C "C3'"  . G   A 1 6   ? -0.149  5.330   8.019   1.00 0.00  ? 202 G   B "C3'"  3  
ATOM 3437  O "O3'"  . G   A 1 6   ? 0.972   4.499   7.797   1.00 0.00  ? 202 G   B "O3'"  3  
ATOM 3438  C "C2'"  . G   A 1 6   ? -0.155  6.673   7.301   1.00 0.00  ? 202 G   B "C2'"  3  
ATOM 3439  O "O2'"  . G   A 1 6   ? 1.073   7.400   7.282   1.00 0.00  ? 202 G   B "O2'"  3  
ATOM 3440  C "C1'"  . G   A 1 6   ? -0.711  6.328   5.941   1.00 0.00  ? 202 G   B "C1'"  3  
ATOM 3441  N N9     . G   A 1 6   ? -1.134  7.560   5.240   1.00 0.00  ? 202 G   B N9     3  
ATOM 3442  C C8     . G   A 1 6   ? -0.475  8.167   4.208   1.00 0.00  ? 202 G   B C8     3  
ATOM 3443  N N7     . G   A 1 6   ? -0.996  9.305   3.839   1.00 0.00  ? 202 G   B N7     3  
ATOM 3444  C C5     . G   A 1 6   ? -2.089  9.466   4.687   1.00 0.00  ? 202 G   B C5     3  
ATOM 3445  C C6     . G   A 1 6   ? -3.067  10.518  4.776   1.00 0.00  ? 202 G   B C6     3  
ATOM 3446  O O6     . G   A 1 6   ? -3.155  11.547  4.105   1.00 0.00  ? 202 G   B O6     3  
ATOM 3447  N N1     . G   A 1 6   ? -4.019  10.317  5.761   1.00 0.00  ? 202 G   B N1     3  
ATOM 3448  C C2     . G   A 1 6   ? -3.962  9.266   6.626   1.00 0.00  ? 202 G   B C2     3  
ATOM 3449  N N2     . G   A 1 6   ? -4.844  9.223   7.579   1.00 0.00  ? 202 G   B N2     3  
ATOM 3450  N N3     . G   A 1 6   ? -3.059  8.290   6.600   1.00 0.00  ? 202 G   B N3     3  
ATOM 3451  C C4     . G   A 1 6   ? -2.156  8.422   5.584   1.00 0.00  ? 202 G   B C4     3  
ATOM 3452  H "H5'"  . G   A 1 6   ? -3.517  4.926   7.810   1.00 0.00  ? 202 G   B "H5'"  3  
ATOM 3453  H "H5''" . G   A 1 6   ? -2.628  4.026   9.066   1.00 0.00  ? 202 G   B "H5''" 3  
ATOM 3454  H "H4'"  . G   A 1 6   ? -1.253  3.735   7.194   1.00 0.00  ? 202 G   B "H4'"  3  
ATOM 3455  H "H3'"  . G   A 1 6   ? -0.249  5.459   9.078   1.00 0.00  ? 202 G   B "H3'"  3  
ATOM 3456  H "H2'"  . G   A 1 6   ? -0.946  7.248   7.767   1.00 0.00  ? 202 G   B "H2'"  3  
ATOM 3457  H "HO2'" . G   A 1 6   ? 1.660   7.003   6.618   1.00 0.00  ? 202 G   B "HO2'" 3  
ATOM 3458  H "H1'"  . G   A 1 6   ? 0.039   5.801   5.368   1.00 0.00  ? 202 G   B "H1'"  3  
ATOM 3459  H H8     . G   A 1 6   ? 0.409   7.729   3.765   1.00 0.00  ? 202 G   B H8     3  
ATOM 3460  H H1     . G   A 1 6   ? -4.796  10.971  5.797   1.00 0.00  ? 202 G   B H1     3  
ATOM 3461  H H21    . G   A 1 6   ? -5.604  9.888   7.618   1.00 0.00  ? 202 G   B H21    3  
ATOM 3462  H H22    . G   A 1 6   ? -4.829  8.428   8.209   1.00 0.00  ? 202 G   B H22    3  
ATOM 3463  P P      . U   A 1 7   ? 1.667   3.785   9.061   1.00 0.00  ? 203 U   B P      3  
ATOM 3464  O OP1    . U   A 1 7   ? 1.157   2.401   9.181   1.00 0.00  ? 203 U   B OP1    3  
ATOM 3465  O OP2    . U   A 1 7   ? 1.615   4.693   10.236  1.00 0.00  ? 203 U   B OP2    3  
ATOM 3466  O "O5'"  . U   A 1 7   ? 3.185   3.694   8.608   1.00 0.00  ? 203 U   B "O5'"  3  
ATOM 3467  C "C5'"  . U   A 1 7   ? 3.919   4.862   8.295   1.00 0.00  ? 203 U   B "C5'"  3  
ATOM 3468  C "C4'"  . U   A 1 7   ? 3.889   5.224   6.794   1.00 0.00  ? 203 U   B "C4'"  3  
ATOM 3469  O "O4'"  . U   A 1 7   ? 5.225   5.467   6.360   1.00 0.00  ? 203 U   B "O4'"  3  
ATOM 3470  C "C3'"  . U   A 1 7   ? 3.333   4.219   5.766   1.00 0.00  ? 203 U   B "C3'"  3  
ATOM 3471  O "O3'"  . U   A 1 7   ? 2.665   4.953   4.749   1.00 0.00  ? 203 U   B "O3'"  3  
ATOM 3472  C "C2'"  . U   A 1 7   ? 4.568   3.498   5.185   1.00 0.00  ? 203 U   B "C2'"  3  
ATOM 3473  O "O2'"  . U   A 1 7   ? 4.675   3.578   3.764   1.00 0.00  ? 203 U   B "O2'"  3  
ATOM 3474  C "C1'"  . U   A 1 7   ? 5.747   4.256   5.809   1.00 0.00  ? 203 U   B "C1'"  3  
ATOM 3475  N N1     . U   A 1 7   ? 6.512   3.450   6.814   1.00 0.00  ? 203 U   B N1     3  
ATOM 3476  C C2     . U   A 1 7   ? 7.904   3.615   6.866   1.00 0.00  ? 203 U   B C2     3  
ATOM 3477  O O2     . U   A 1 7   ? 8.520   4.463   6.215   1.00 0.00  ? 203 U   B O2     3  
ATOM 3478  N N3     . U   A 1 7   ? 8.614   2.763   7.693   1.00 0.00  ? 203 U   B N3     3  
ATOM 3479  C C4     . U   A 1 7   ? 8.076   1.751   8.454   1.00 0.00  ? 203 U   B C4     3  
ATOM 3480  O O4     . U   A 1 7   ? 8.805   1.034   9.137   1.00 0.00  ? 203 U   B O4     3  
ATOM 3481  C C5     . U   A 1 7   ? 6.636   1.643   8.362   1.00 0.00  ? 203 U   B C5     3  
ATOM 3482  C C6     . U   A 1 7   ? 5.904   2.476   7.583   1.00 0.00  ? 203 U   B C6     3  
ATOM 3483  H "H5'"  . U   A 1 7   ? 4.952   4.711   8.608   1.00 0.00  ? 203 U   B "H5'"  3  
ATOM 3484  H "H5''" . U   A 1 7   ? 3.548   5.716   8.869   1.00 0.00  ? 203 U   B "H5''" 3  
ATOM 3485  H "H4'"  . U   A 1 7   ? 3.269   6.113   6.719   1.00 0.00  ? 203 U   B "H4'"  3  
ATOM 3486  H "H3'"  . U   A 1 7   ? 2.648   3.505   6.216   1.00 0.00  ? 203 U   B "H3'"  3  
ATOM 3487  H "HO3'" . U   A 1 7   ? 3.298   4.998   4.010   1.00 0.00  ? 203 U   B "HO3'" 3  
ATOM 3488  H "H2'"  . U   A 1 7   ? 4.567   2.452   5.499   1.00 0.00  ? 203 U   B "H2'"  3  
ATOM 3489  H "HO2'" . U   A 1 7   ? 3.988   3.007   3.356   1.00 0.00  ? 203 U   B "HO2'" 3  
ATOM 3490  H "H1'"  . U   A 1 7   ? 6.436   4.516   4.997   1.00 0.00  ? 203 U   B "H1'"  3  
ATOM 3491  H H3     . U   A 1 7   ? 9.612   2.876   7.729   1.00 0.00  ? 203 U   B H3     3  
ATOM 3492  H H5     . U   A 1 7   ? 6.127   0.879   8.926   1.00 0.00  ? 203 U   B H5     3  
ATOM 3493  H H6     . U   A 1 7   ? 4.820   2.370   7.582   1.00 0.00  ? 203 U   B H6     3  
ATOM 3494  N N      . ASN B 2 22  ? -10.004 28.021  -10.949 1.00 0.00  ? 109 ASN A N      3  
ATOM 3495  C CA     . ASN B 2 22  ? -9.495  26.629  -11.024 1.00 0.00  ? 109 ASN A CA     3  
ATOM 3496  C C      . ASN B 2 22  ? -8.688  26.413  -12.310 1.00 0.00  ? 109 ASN A C      3  
ATOM 3497  O O      . ASN B 2 22  ? -9.019  26.978  -13.354 1.00 0.00  ? 109 ASN A O      3  
ATOM 3498  C CB     . ASN B 2 22  ? -10.635 25.590  -10.918 1.00 0.00  ? 109 ASN A CB     3  
ATOM 3499  C CG     . ASN B 2 22  ? -10.104 24.154  -10.970 1.00 0.00  ? 109 ASN A CG     3  
ATOM 3500  O OD1    . ASN B 2 22  ? -9.204  23.787  -10.230 1.00 0.00  ? 109 ASN A OD1    3  
ATOM 3501  N ND2    . ASN B 2 22  ? -10.600 23.317  -11.860 1.00 0.00  ? 109 ASN A ND2    3  
ATOM 3502  H H      . ASN B 2 22  ? -9.242  28.682  -10.983 1.00 0.00  ? 109 ASN A H      3  
ATOM 3503  H HA     . ASN B 2 22  ? -8.818  26.468  -10.181 1.00 0.00  ? 109 ASN A HA     3  
ATOM 3504  H HB2    . ASN B 2 22  ? -11.157 25.721  -9.968  1.00 0.00  ? 109 ASN A HB2    3  
ATOM 3505  H HB3    . ASN B 2 22  ? -11.354 25.744  -11.728 1.00 0.00  ? 109 ASN A HB3    3  
ATOM 3506  H HD21   . ASN B 2 22  ? -11.347 23.577  -12.485 1.00 0.00  ? 109 ASN A HD21   3  
ATOM 3507  H HD22   . ASN B 2 22  ? -10.179 22.398  -11.932 1.00 0.00  ? 109 ASN A HD22   3  
ATOM 3508  N N      . THR B 2 23  ? -7.652  25.571  -12.242 1.00 0.00  ? 110 THR A N      3  
ATOM 3509  C CA     . THR B 2 23  ? -6.824  25.135  -13.384 1.00 0.00  ? 110 THR A CA     3  
ATOM 3510  C C      . THR B 2 23  ? -6.543  23.633  -13.268 1.00 0.00  ? 110 THR A C      3  
ATOM 3511  O O      . THR B 2 23  ? -6.250  23.137  -12.180 1.00 0.00  ? 110 THR A O      3  
ATOM 3512  C CB     . THR B 2 23  ? -5.492  25.913  -13.420 1.00 0.00  ? 110 THR A CB     3  
ATOM 3513  O OG1    . THR B 2 23  ? -5.718  27.310  -13.366 1.00 0.00  ? 110 THR A OG1    3  
ATOM 3514  C CG2    . THR B 2 23  ? -4.678  25.651  -14.691 1.00 0.00  ? 110 THR A CG2    3  
ATOM 3515  H H      . THR B 2 23  ? -7.464  25.110  -11.360 1.00 0.00  ? 110 THR A H      3  
ATOM 3516  H HA     . THR B 2 23  ? -7.357  25.316  -14.316 1.00 0.00  ? 110 THR A HA     3  
ATOM 3517  H HB     . THR B 2 23  ? -4.888  25.629  -12.557 1.00 0.00  ? 110 THR A HB     3  
ATOM 3518  H HG1    . THR B 2 23  ? -6.291  27.550  -14.117 1.00 0.00  ? 110 THR A HG1    3  
ATOM 3519  H HG21   . THR B 2 23  ? -4.388  24.602  -14.749 1.00 0.00  ? 110 THR A HG21   3  
ATOM 3520  H HG22   . THR B 2 23  ? -5.260  25.913  -15.576 1.00 0.00  ? 110 THR A HG22   3  
ATOM 3521  H HG23   . THR B 2 23  ? -3.766  26.253  -14.670 1.00 0.00  ? 110 THR A HG23   3  
ATOM 3522  N N      . GLU B 2 24  ? -6.610  22.901  -14.381 1.00 0.00  ? 111 GLU A N      3  
ATOM 3523  C CA     . GLU B 2 24  ? -6.248  21.477  -14.460 1.00 0.00  ? 111 GLU A CA     3  
ATOM 3524  C C      . GLU B 2 24  ? -4.714  21.311  -14.388 1.00 0.00  ? 111 GLU A C      3  
ATOM 3525  O O      . GLU B 2 24  ? -4.024  21.220  -15.408 1.00 0.00  ? 111 GLU A O      3  
ATOM 3526  C CB     . GLU B 2 24  ? -6.854  20.842  -15.725 1.00 0.00  ? 111 GLU A CB     3  
ATOM 3527  C CG     . GLU B 2 24  ? -8.390  20.857  -15.749 1.00 0.00  ? 111 GLU A CG     3  
ATOM 3528  C CD     . GLU B 2 24  ? -9.008  20.041  -14.593 1.00 0.00  ? 111 GLU A CD     3  
ATOM 3529  O OE1    . GLU B 2 24  ? -9.041  18.790  -14.685 1.00 0.00  ? 111 GLU A OE1    3  
ATOM 3530  O OE2    . GLU B 2 24  ? -9.474  20.646  -13.597 1.00 0.00  ? 111 GLU A OE2    3  
ATOM 3531  H H      . GLU B 2 24  ? -6.871  23.365  -15.241 1.00 0.00  ? 111 GLU A H      3  
ATOM 3532  H HA     . GLU B 2 24  ? -6.662  20.955  -13.597 1.00 0.00  ? 111 GLU A HA     3  
ATOM 3533  H HB2    . GLU B 2 24  ? -6.492  21.375  -16.607 1.00 0.00  ? 111 GLU A HB2    3  
ATOM 3534  H HB3    . GLU B 2 24  ? -6.513  19.806  -15.799 1.00 0.00  ? 111 GLU A HB3    3  
ATOM 3535  H HG2    . GLU B 2 24  ? -8.748  21.891  -15.718 1.00 0.00  ? 111 GLU A HG2    3  
ATOM 3536  H HG3    . GLU B 2 24  ? -8.723  20.436  -16.700 1.00 0.00  ? 111 GLU A HG3    3  
ATOM 3537  N N      . ASN B 2 25  ? -4.179  21.329  -13.166 1.00 0.00  ? 112 ASN A N      3  
ATOM 3538  C CA     . ASN B 2 25  ? -2.749  21.395  -12.843 1.00 0.00  ? 112 ASN A CA     3  
ATOM 3539  C C      . ASN B 2 25  ? -2.391  20.451  -11.676 1.00 0.00  ? 112 ASN A C      3  
ATOM 3540  O O      . ASN B 2 25  ? -3.245  20.115  -10.849 1.00 0.00  ? 112 ASN A O      3  
ATOM 3541  C CB     . ASN B 2 25  ? -2.445  22.875  -12.518 1.00 0.00  ? 112 ASN A CB     3  
ATOM 3542  C CG     . ASN B 2 25  ? -1.006  23.122  -12.097 1.00 0.00  ? 112 ASN A CG     3  
ATOM 3543  O OD1    . ASN B 2 25  ? -0.667  23.080  -10.923 1.00 0.00  ? 112 ASN A OD1    3  
ATOM 3544  N ND2    . ASN B 2 25  ? -0.107  23.335  -13.025 1.00 0.00  ? 112 ASN A ND2    3  
ATOM 3545  H H      . ASN B 2 25  ? -4.824  21.456  -12.396 1.00 0.00  ? 112 ASN A H      3  
ATOM 3546  H HA     . ASN B 2 25  ? -2.164  21.084  -13.712 1.00 0.00  ? 112 ASN A HA     3  
ATOM 3547  H HB2    . ASN B 2 25  ? -2.667  23.495  -13.386 1.00 0.00  ? 112 ASN A HB2    3  
ATOM 3548  H HB3    . ASN B 2 25  ? -3.092  23.203  -11.701 1.00 0.00  ? 112 ASN A HB3    3  
ATOM 3549  H HD21   . ASN B 2 25  ? -0.353  23.395  -14.003 1.00 0.00  ? 112 ASN A HD21   3  
ATOM 3550  H HD22   . ASN B 2 25  ? 0.833   23.530  -12.711 1.00 0.00  ? 112 ASN A HD22   3  
ATOM 3551  N N      . LYS B 2 26  ? -1.107  20.082  -11.560 1.00 0.00  ? 113 LYS A N      3  
ATOM 3552  C CA     . LYS B 2 26  ? -0.527  19.240  -10.492 1.00 0.00  ? 113 LYS A CA     3  
ATOM 3553  C C      . LYS B 2 26  ? -0.819  19.714  -9.058  1.00 0.00  ? 113 LYS A C      3  
ATOM 3554  O O      . LYS B 2 26  ? -0.778  18.904  -8.132  1.00 0.00  ? 113 LYS A O      3  
ATOM 3555  C CB     . LYS B 2 26  ? 0.997   19.142  -10.697 1.00 0.00  ? 113 LYS A CB     3  
ATOM 3556  C CG     . LYS B 2 26  ? 1.376   18.324  -11.946 1.00 0.00  ? 113 LYS A CG     3  
ATOM 3557  C CD     . LYS B 2 26  ? 2.876   17.989  -12.002 1.00 0.00  ? 113 LYS A CD     3  
ATOM 3558  C CE     . LYS B 2 26  ? 3.808   19.210  -12.095 1.00 0.00  ? 113 LYS A CE     3  
ATOM 3559  N NZ     . LYS B 2 26  ? 3.733   19.884  -13.420 1.00 0.00  ? 113 LYS A NZ     3  
ATOM 3560  H H      . LYS B 2 26  ? -0.482  20.414  -12.284 1.00 0.00  ? 113 LYS A H      3  
ATOM 3561  H HA     . LYS B 2 26  ? -0.956  18.238  -10.566 1.00 0.00  ? 113 LYS A HA     3  
ATOM 3562  H HB2    . LYS B 2 26  ? 1.417   20.147  -10.770 1.00 0.00  ? 113 LYS A HB2    3  
ATOM 3563  H HB3    . LYS B 2 26  ? 1.436   18.661  -9.822  1.00 0.00  ? 113 LYS A HB3    3  
ATOM 3564  H HG2    . LYS B 2 26  ? 0.824   17.385  -11.929 1.00 0.00  ? 113 LYS A HG2    3  
ATOM 3565  H HG3    . LYS B 2 26  ? 1.084   18.864  -12.847 1.00 0.00  ? 113 LYS A HG3    3  
ATOM 3566  H HD2    . LYS B 2 26  ? 3.133   17.428  -11.103 1.00 0.00  ? 113 LYS A HD2    3  
ATOM 3567  H HD3    . LYS B 2 26  ? 3.059   17.331  -12.852 1.00 0.00  ? 113 LYS A HD3    3  
ATOM 3568  H HE2    . LYS B 2 26  ? 3.568   19.912  -11.292 1.00 0.00  ? 113 LYS A HE2    3  
ATOM 3569  H HE3    . LYS B 2 26  ? 4.835   18.865  -11.929 1.00 0.00  ? 113 LYS A HE3    3  
ATOM 3570  H HZ1    . LYS B 2 26  ? 3.984   19.249  -14.166 1.00 0.00  ? 113 LYS A HZ1    3  
ATOM 3571  H HZ2    . LYS B 2 26  ? 2.807   20.241  -13.608 1.00 0.00  ? 113 LYS A HZ2    3  
ATOM 3572  H HZ3    . LYS B 2 26  ? 4.375   20.665  -13.464 1.00 0.00  ? 113 LYS A HZ3    3  
ATOM 3573  N N      . SER B 2 27  ? -1.143  20.995  -8.869  1.00 0.00  ? 114 SER A N      3  
ATOM 3574  C CA     . SER B 2 27  ? -1.531  21.586  -7.576  1.00 0.00  ? 114 SER A CA     3  
ATOM 3575  C C      . SER B 2 27  ? -2.904  21.119  -7.050  1.00 0.00  ? 114 SER A C      3  
ATOM 3576  O O      . SER B 2 27  ? -3.155  21.230  -5.848  1.00 0.00  ? 114 SER A O      3  
ATOM 3577  C CB     . SER B 2 27  ? -1.555  23.117  -7.679  1.00 0.00  ? 114 SER A CB     3  
ATOM 3578  O OG     . SER B 2 27  ? -0.300  23.629  -8.093  1.00 0.00  ? 114 SER A OG     3  
ATOM 3579  H H      . SER B 2 27  ? -1.088  21.593  -9.684  1.00 0.00  ? 114 SER A H      3  
ATOM 3580  H HA     . SER B 2 27  ? -0.784  21.313  -6.830  1.00 0.00  ? 114 SER A HA     3  
ATOM 3581  H HB2    . SER B 2 27  ? -2.329  23.432  -8.379  1.00 0.00  ? 114 SER A HB2    3  
ATOM 3582  H HB3    . SER B 2 27  ? -1.795  23.535  -6.701  1.00 0.00  ? 114 SER A HB3    3  
ATOM 3583  H HG     . SER B 2 27  ? -0.228  23.495  -9.060  1.00 0.00  ? 114 SER A HG     3  
ATOM 3584  N N      . GLN B 2 28  ? -3.803  20.622  -7.914  1.00 0.00  ? 115 GLN A N      3  
ATOM 3585  C CA     . GLN B 2 28  ? -5.188  20.287  -7.543  1.00 0.00  ? 115 GLN A CA     3  
ATOM 3586  C C      . GLN B 2 28  ? -5.389  18.839  -7.019  1.00 0.00  ? 115 GLN A C      3  
ATOM 3587  O O      . GLN B 2 28  ? -6.106  18.689  -6.026  1.00 0.00  ? 115 GLN A O      3  
ATOM 3588  C CB     . GLN B 2 28  ? -6.139  20.663  -8.700  1.00 0.00  ? 115 GLN A CB     3  
ATOM 3589  C CG     . GLN B 2 28  ? -7.631  20.631  -8.331  1.00 0.00  ? 115 GLN A CG     3  
ATOM 3590  C CD     . GLN B 2 28  ? -8.009  21.662  -7.260  1.00 0.00  ? 115 GLN A CD     3  
ATOM 3591  O OE1    . GLN B 2 28  ? -7.922  21.426  -6.062  1.00 0.00  ? 115 GLN A OE1    3  
ATOM 3592  N NE2    . GLN B 2 28  ? -8.444  22.843  -7.638  1.00 0.00  ? 115 GLN A NE2    3  
ATOM 3593  H H      . GLN B 2 28  ? -3.536  20.540  -8.890  1.00 0.00  ? 115 GLN A H      3  
ATOM 3594  H HA     . GLN B 2 28  ? -5.458  20.938  -6.710  1.00 0.00  ? 115 GLN A HA     3  
ATOM 3595  H HB2    . GLN B 2 28  ? -5.899  21.672  -9.040  1.00 0.00  ? 115 GLN A HB2    3  
ATOM 3596  H HB3    . GLN B 2 28  ? -5.980  19.991  -9.543  1.00 0.00  ? 115 GLN A HB3    3  
ATOM 3597  H HG2    . GLN B 2 28  ? -8.211  20.832  -9.234  1.00 0.00  ? 115 GLN A HG2    3  
ATOM 3598  H HG3    . GLN B 2 28  ? -7.895  19.636  -7.983  1.00 0.00  ? 115 GLN A HG3    3  
ATOM 3599  H HE21   . GLN B 2 28  ? -8.577  23.070  -8.621  1.00 0.00  ? 115 GLN A HE21   3  
ATOM 3600  H HE22   . GLN B 2 28  ? -8.692  23.499  -6.914  1.00 0.00  ? 115 GLN A HE22   3  
ATOM 3601  N N      . PRO B 2 29  ? -4.798  17.770  -7.604  1.00 0.00  ? 116 PRO A N      3  
ATOM 3602  C CA     . PRO B 2 29  ? -4.814  16.420  -7.024  1.00 0.00  ? 116 PRO A CA     3  
ATOM 3603  C C      . PRO B 2 29  ? -4.369  16.360  -5.552  1.00 0.00  ? 116 PRO A C      3  
ATOM 3604  O O      . PRO B 2 29  ? -3.449  17.063  -5.126  1.00 0.00  ? 116 PRO A O      3  
ATOM 3605  C CB     . PRO B 2 29  ? -3.912  15.568  -7.923  1.00 0.00  ? 116 PRO A CB     3  
ATOM 3606  C CG     . PRO B 2 29  ? -4.089  16.239  -9.280  1.00 0.00  ? 116 PRO A CG     3  
ATOM 3607  C CD     . PRO B 2 29  ? -4.150  17.717  -8.909  1.00 0.00  ? 116 PRO A CD     3  
ATOM 3608  H HA     . PRO B 2 29  ? -5.829  16.036  -7.103  1.00 0.00  ? 116 PRO A HA     3  
ATOM 3609  H HB2    . PRO B 2 29  ? -2.873  15.654  -7.602  1.00 0.00  ? 116 PRO A HB2    3  
ATOM 3610  H HB3    . PRO B 2 29  ? -4.222  14.524  -7.937  1.00 0.00  ? 116 PRO A HB3    3  
ATOM 3611  H HG2    . PRO B 2 29  ? -3.267  16.030  -9.960  1.00 0.00  ? 116 PRO A HG2    3  
ATOM 3612  H HG3    . PRO B 2 29  ? -5.039  15.935  -9.722  1.00 0.00  ? 116 PRO A HG3    3  
ATOM 3613  H HD2    . PRO B 2 29  ? -3.139  18.111  -8.831  1.00 0.00  ? 116 PRO A HD2    3  
ATOM 3614  H HD3    . PRO B 2 29  ? -4.714  18.253  -9.668  1.00 0.00  ? 116 PRO A HD3    3  
ATOM 3615  N N      . LYS B 2 30  ? -5.030  15.482  -4.789  1.00 0.00  ? 117 LYS A N      3  
ATOM 3616  C CA     . LYS B 2 30  ? -4.899  15.192  -3.358  1.00 0.00  ? 117 LYS A CA     3  
ATOM 3617  C C      . LYS B 2 30  ? -5.689  13.912  -3.057  1.00 0.00  ? 117 LYS A C      3  
ATOM 3618  O O      . LYS B 2 30  ? -6.146  13.247  -3.992  1.00 0.00  ? 117 LYS A O      3  
ATOM 3619  C CB     . LYS B 2 30  ? -5.245  16.416  -2.492  1.00 0.00  ? 117 LYS A CB     3  
ATOM 3620  C CG     . LYS B 2 30  ? -6.635  17.027  -2.722  1.00 0.00  ? 117 LYS A CG     3  
ATOM 3621  C CD     . LYS B 2 30  ? -6.782  18.344  -1.951  1.00 0.00  ? 117 LYS A CD     3  
ATOM 3622  C CE     . LYS B 2 30  ? -8.107  19.031  -2.316  1.00 0.00  ? 117 LYS A CE     3  
ATOM 3623  N NZ     . LYS B 2 30  ? -8.277  20.323  -1.604  1.00 0.00  ? 117 LYS A NZ     3  
ATOM 3624  H H      . LYS B 2 30  ? -5.650  14.820  -5.233  1.00 0.00  ? 117 LYS A H      3  
ATOM 3625  H HA     . LYS B 2 30  ? -3.856  14.961  -3.156  1.00 0.00  ? 117 LYS A HA     3  
ATOM 3626  H HB2    . LYS B 2 30  ? -5.140  16.137  -1.448  1.00 0.00  ? 117 LYS A HB2    3  
ATOM 3627  H HB3    . LYS B 2 30  ? -4.492  17.180  -2.686  1.00 0.00  ? 117 LYS A HB3    3  
ATOM 3628  H HG2    . LYS B 2 30  ? -6.767  17.230  -3.782  1.00 0.00  ? 117 LYS A HG2    3  
ATOM 3629  H HG3    . LYS B 2 30  ? -7.403  16.325  -2.390  1.00 0.00  ? 117 LYS A HG3    3  
ATOM 3630  H HD2    . LYS B 2 30  ? -6.750  18.145  -0.881  1.00 0.00  ? 117 LYS A HD2    3  
ATOM 3631  H HD3    . LYS B 2 30  ? -5.956  19.009  -2.211  1.00 0.00  ? 117 LYS A HD3    3  
ATOM 3632  H HE2    . LYS B 2 30  ? -8.124  19.205  -3.396  1.00 0.00  ? 117 LYS A HE2    3  
ATOM 3633  H HE3    . LYS B 2 30  ? -8.933  18.358  -2.073  1.00 0.00  ? 117 LYS A HE3    3  
ATOM 3634  H HZ1    . LYS B 2 30  ? -8.280  20.195  -0.602  1.00 0.00  ? 117 LYS A HZ1    3  
ATOM 3635  H HZ2    . LYS B 2 30  ? -7.535  20.969  -1.837  1.00 0.00  ? 117 LYS A HZ2    3  
ATOM 3636  H HZ3    . LYS B 2 30  ? -9.151  20.763  -1.863  1.00 0.00  ? 117 LYS A HZ3    3  
ATOM 3637  N N      . ARG B 2 31  ? -5.676  13.445  -1.811  1.00 0.00  ? 118 ARG A N      3  
ATOM 3638  C CA     . ARG B 2 31  ? -5.334  12.032  -1.581  1.00 0.00  ? 118 ARG A CA     3  
ATOM 3639  C C      . ARG B 2 31  ? -6.423  11.118  -1.009  1.00 0.00  ? 118 ARG A C      3  
ATOM 3640  O O      . ARG B 2 31  ? -7.493  11.552  -0.590  1.00 0.00  ? 118 ARG A O      3  
ATOM 3641  C CB     . ARG B 2 31  ? -3.938  11.959  -0.972  1.00 0.00  ? 118 ARG A CB     3  
ATOM 3642  C CG     . ARG B 2 31  ? -3.814  12.617  0.399   1.00 0.00  ? 118 ARG A CG     3  
ATOM 3643  C CD     . ARG B 2 31  ? -2.350  12.980  0.629   1.00 0.00  ? 118 ARG A CD     3  
ATOM 3644  N NE     . ARG B 2 31  ? -1.578  11.887  1.246   1.00 0.00  ? 118 ARG A NE     3  
ATOM 3645  C CZ     . ARG B 2 31  ? -0.433  11.368  0.834   1.00 0.00  ? 118 ARG A CZ     3  
ATOM 3646  N NH1    . ARG B 2 31  ? 0.095   11.582  -0.336  1.00 0.00  ? 118 ARG A NH1    3  
ATOM 3647  N NH2    . ARG B 2 31  ? 0.221   10.589  1.633   1.00 0.00  ? 118 ARG A NH2    3  
ATOM 3648  H H      . ARG B 2 31  ? -5.407  14.106  -1.100  1.00 0.00  ? 118 ARG A H      3  
ATOM 3649  H HA     . ARG B 2 31  ? -5.154  11.595  -2.548  1.00 0.00  ? 118 ARG A HA     3  
ATOM 3650  H HB2    . ARG B 2 31  ? -3.586  10.932  -0.899  1.00 0.00  ? 118 ARG A HB2    3  
ATOM 3651  H HB3    . ARG B 2 31  ? -3.309  12.492  -1.692  1.00 0.00  ? 118 ARG A HB3    3  
ATOM 3652  H HG2    . ARG B 2 31  ? -4.389  13.544  0.426   1.00 0.00  ? 118 ARG A HG2    3  
ATOM 3653  H HG3    . ARG B 2 31  ? -4.186  11.956  1.182   1.00 0.00  ? 118 ARG A HG3    3  
ATOM 3654  H HD2    . ARG B 2 31  ? -1.885  13.325  -0.298  1.00 0.00  ? 118 ARG A HD2    3  
ATOM 3655  H HD3    . ARG B 2 31  ? -2.374  13.827  1.298   1.00 0.00  ? 118 ARG A HD3    3  
ATOM 3656  H HE     . ARG B 2 31  ? -1.882  11.594  2.165   1.00 0.00  ? 118 ARG A HE     3  
ATOM 3657  H HH11   . ARG B 2 31  ? -0.434  12.029  -1.072  1.00 0.00  ? 118 ARG A HH11   3  
ATOM 3658  H HH12   . ARG B 2 31  ? 0.972   11.148  -0.558  1.00 0.00  ? 118 ARG A HH12   3  
ATOM 3659  H HH21   . ARG B 2 31  ? -0.200  10.334  2.514   1.00 0.00  ? 118 ARG A HH21   3  
ATOM 3660  H HH22   . ARG B 2 31  ? 1.105   10.134  1.412   1.00 0.00  ? 118 ARG A HH22   3  
ATOM 3661  N N      . LEU B 2 32  ? -6.147  9.822   -1.139  1.00 0.00  ? 119 LEU A N      3  
ATOM 3662  C CA     . LEU B 2 32  ? -7.098  8.753   -1.441  1.00 0.00  ? 119 LEU A CA     3  
ATOM 3663  C C      . LEU B 2 32  ? -6.630  7.466   -0.740  1.00 0.00  ? 119 LEU A C      3  
ATOM 3664  O O      . LEU B 2 32  ? -5.529  6.997   -1.017  1.00 0.00  ? 119 LEU A O      3  
ATOM 3665  C CB     . LEU B 2 32  ? -7.104  8.637   -2.987  1.00 0.00  ? 119 LEU A CB     3  
ATOM 3666  C CG     . LEU B 2 32  ? -8.031  7.601   -3.639  1.00 0.00  ? 119 LEU A CG     3  
ATOM 3667  C CD1    . LEU B 2 32  ? -9.474  7.777   -3.182  1.00 0.00  ? 119 LEU A CD1    3  
ATOM 3668  C CD2    . LEU B 2 32  ? -8.028  7.790   -5.154  1.00 0.00  ? 119 LEU A CD2    3  
ATOM 3669  H H      . LEU B 2 32  ? -5.212  9.629   -1.481  1.00 0.00  ? 119 LEU A H      3  
ATOM 3670  H HA     . LEU B 2 32  ? -8.096  9.016   -1.084  1.00 0.00  ? 119 LEU A HA     3  
ATOM 3671  H HB2    . LEU B 2 32  ? -7.341  9.622   -3.399  1.00 0.00  ? 119 LEU A HB2    3  
ATOM 3672  H HB3    . LEU B 2 32  ? -6.102  8.388   -3.327  1.00 0.00  ? 119 LEU A HB3    3  
ATOM 3673  H HG     . LEU B 2 32  ? -7.666  6.598   -3.417  1.00 0.00  ? 119 LEU A HG     3  
ATOM 3674  H HD11   . LEU B 2 32  ? -9.586  7.313   -2.212  1.00 0.00  ? 119 LEU A HD11   3  
ATOM 3675  H HD12   . LEU B 2 32  ? -9.738  8.835   -3.126  1.00 0.00  ? 119 LEU A HD12   3  
ATOM 3676  H HD13   . LEU B 2 32  ? -10.154 7.290   -3.870  1.00 0.00  ? 119 LEU A HD13   3  
ATOM 3677  H HD21   . LEU B 2 32  ? -8.403  8.782   -5.404  1.00 0.00  ? 119 LEU A HD21   3  
ATOM 3678  H HD22   . LEU B 2 32  ? -7.017  7.671   -5.539  1.00 0.00  ? 119 LEU A HD22   3  
ATOM 3679  H HD23   . LEU B 2 32  ? -8.664  7.040   -5.620  1.00 0.00  ? 119 LEU A HD23   3  
ATOM 3680  N N      . HIS B 2 33  ? -7.420  6.935   0.194   1.00 0.00  ? 120 HIS A N      3  
ATOM 3681  C CA     . HIS B 2 33  ? -7.179  5.691   0.945   1.00 0.00  ? 120 HIS A CA     3  
ATOM 3682  C C      . HIS B 2 33  ? -7.696  4.492   0.135   1.00 0.00  ? 120 HIS A C      3  
ATOM 3683  O O      . HIS B 2 33  ? -8.733  4.570   -0.524  1.00 0.00  ? 120 HIS A O      3  
ATOM 3684  C CB     . HIS B 2 33  ? -7.923  5.828   2.294   1.00 0.00  ? 120 HIS A CB     3  
ATOM 3685  C CG     . HIS B 2 33  ? -8.138  4.571   3.096   1.00 0.00  ? 120 HIS A CG     3  
ATOM 3686  N ND1    . HIS B 2 33  ? -9.360  3.932   3.309   1.00 0.00  ? 120 HIS A ND1    3  
ATOM 3687  C CD2    . HIS B 2 33  ? -7.199  4.003   3.895   1.00 0.00  ? 120 HIS A CD2    3  
ATOM 3688  C CE1    . HIS B 2 33  ? -9.122  2.987   4.235   1.00 0.00  ? 120 HIS A CE1    3  
ATOM 3689  N NE2    . HIS B 2 33  ? -7.825  2.993   4.590   1.00 0.00  ? 120 HIS A NE2    3  
ATOM 3690  H H      . HIS B 2 33  ? -8.368  7.295   0.232   1.00 0.00  ? 120 HIS A H      3  
ATOM 3691  H HA     . HIS B 2 33  ? -6.099  5.547   1.110   1.00 0.00  ? 120 HIS A HA     3  
ATOM 3692  H HB2    . HIS B 2 33  ? -7.376  6.520   2.941   1.00 0.00  ? 120 HIS A HB2    3  
ATOM 3693  H HB3    . HIS B 2 33  ? -8.906  6.265   2.113   1.00 0.00  ? 120 HIS A HB3    3  
ATOM 3694  H HD2    . HIS B 2 33  ? -6.177  4.337   4.001   1.00 0.00  ? 120 HIS A HD2    3  
ATOM 3695  H HE1    . HIS B 2 33  ? -9.874  2.336   4.667   1.00 0.00  ? 120 HIS A HE1    3  
ATOM 3696  H HE2    . HIS B 2 33  ? -7.404  2.381   5.279   1.00 0.00  ? 120 HIS A HE2    3  
ATOM 3697  N N      . VAL B 2 34  ? -6.955  3.384   0.137   1.00 0.00  ? 121 VAL A N      3  
ATOM 3698  C CA     . VAL B 2 34  ? -7.040  2.326   -0.888  1.00 0.00  ? 121 VAL A CA     3  
ATOM 3699  C C      . VAL B 2 34  ? -7.046  0.958   -0.217  1.00 0.00  ? 121 VAL A C      3  
ATOM 3700  O O      . VAL B 2 34  ? -5.992  0.349   -0.034  1.00 0.00  ? 121 VAL A O      3  
ATOM 3701  C CB     . VAL B 2 34  ? -5.873  2.469   -1.886  1.00 0.00  ? 121 VAL A CB     3  
ATOM 3702  C CG1    . VAL B 2 34  ? -6.036  1.562   -3.094  1.00 0.00  ? 121 VAL A CG1    3  
ATOM 3703  C CG2    . VAL B 2 34  ? -5.724  3.886   -2.447  1.00 0.00  ? 121 VAL A CG2    3  
ATOM 3704  H H      . VAL B 2 34  ? -6.105  3.403   0.688   1.00 0.00  ? 121 VAL A H      3  
ATOM 3705  H HA     . VAL B 2 34  ? -7.974  2.417   -1.442  1.00 0.00  ? 121 VAL A HA     3  
ATOM 3706  H HB     . VAL B 2 34  ? -4.935  2.213   -1.395  1.00 0.00  ? 121 VAL A HB     3  
ATOM 3707  H HG11   . VAL B 2 34  ? -6.052  0.519   -2.788  1.00 0.00  ? 121 VAL A HG11   3  
ATOM 3708  H HG12   . VAL B 2 34  ? -6.945  1.809   -3.637  1.00 0.00  ? 121 VAL A HG12   3  
ATOM 3709  H HG13   . VAL B 2 34  ? -5.179  1.726   -3.741  1.00 0.00  ? 121 VAL A HG13   3  
ATOM 3710  H HG21   . VAL B 2 34  ? -6.661  4.225   -2.891  1.00 0.00  ? 121 VAL A HG21   3  
ATOM 3711  H HG22   . VAL B 2 34  ? -5.432  4.562   -1.650  1.00 0.00  ? 121 VAL A HG22   3  
ATOM 3712  H HG23   . VAL B 2 34  ? -4.934  3.905   -3.196  1.00 0.00  ? 121 VAL A HG23   3  
ATOM 3713  N N      . SER B 2 35  ? -8.221  0.503   0.226   1.00 0.00  ? 122 SER A N      3  
ATOM 3714  C CA     . SER B 2 35  ? -8.367  -0.595  1.192   1.00 0.00  ? 122 SER A CA     3  
ATOM 3715  C C      . SER B 2 35  ? -8.617  -1.975  0.585   1.00 0.00  ? 122 SER A C      3  
ATOM 3716  O O      . SER B 2 35  ? -8.937  -2.114  -0.597  1.00 0.00  ? 122 SER A O      3  
ATOM 3717  C CB     . SER B 2 35  ? -9.504  -0.282  2.172   1.00 0.00  ? 122 SER A CB     3  
ATOM 3718  O OG     . SER B 2 35  ? -9.111  -0.688  3.470   1.00 0.00  ? 122 SER A OG     3  
ATOM 3719  H H      . SER B 2 35  ? -9.053  1.040   -0.001  1.00 0.00  ? 122 SER A H      3  
ATOM 3720  H HA     . SER B 2 35  ? -7.443  -0.654  1.754   1.00 0.00  ? 122 SER A HA     3  
ATOM 3721  H HB2    . SER B 2 35  ? -9.740  0.781   2.161   1.00 0.00  ? 122 SER A HB2    3  
ATOM 3722  H HB3    . SER B 2 35  ? -10.401 -0.827  1.892   1.00 0.00  ? 122 SER A HB3    3  
ATOM 3723  H HG     . SER B 2 35  ? -9.860  -0.551  4.075   1.00 0.00  ? 122 SER A HG     3  
ATOM 3724  N N      . ASN B 2 36  ? -8.529  -2.997  1.444   1.00 0.00  ? 123 ASN A N      3  
ATOM 3725  C CA     . ASN B 2 36  ? -8.930  -4.397  1.246   1.00 0.00  ? 123 ASN A CA     3  
ATOM 3726  C C      . ASN B 2 36  ? -8.077  -5.172  0.226   1.00 0.00  ? 123 ASN A C      3  
ATOM 3727  O O      . ASN B 2 36  ? -8.389  -6.315  -0.106  1.00 0.00  ? 123 ASN A O      3  
ATOM 3728  C CB     . ASN B 2 36  ? -10.445 -4.437  0.963   1.00 0.00  ? 123 ASN A CB     3  
ATOM 3729  C CG     . ASN B 2 36  ? -11.032 -5.833  1.064   1.00 0.00  ? 123 ASN A CG     3  
ATOM 3730  O OD1    . ASN B 2 36  ? -10.882 -6.516  2.066   1.00 0.00  ? 123 ASN A OD1    3  
ATOM 3731  N ND2    . ASN B 2 36  ? -11.699 -6.311  0.042   1.00 0.00  ? 123 ASN A ND2    3  
ATOM 3732  H H      . ASN B 2 36  ? -8.125  -2.752  2.339   1.00 0.00  ? 123 ASN A H      3  
ATOM 3733  H HA     . ASN B 2 36  ? -8.765  -4.915  2.193   1.00 0.00  ? 123 ASN A HA     3  
ATOM 3734  H HB2    . ASN B 2 36  ? -10.966 -3.812  1.690   1.00 0.00  ? 123 ASN A HB2    3  
ATOM 3735  H HB3    . ASN B 2 36  ? -10.635 -4.031  -0.030  1.00 0.00  ? 123 ASN A HB3    3  
ATOM 3736  H HD21   . ASN B 2 36  ? -11.759 -5.764  -0.812  1.00 0.00  ? 123 ASN A HD21   3  
ATOM 3737  H HD22   . ASN B 2 36  ? -12.135 -7.212  0.125   1.00 0.00  ? 123 ASN A HD22   3  
ATOM 3738  N N      . ILE B 2 37  ? -6.978  -4.578  -0.244  1.00 0.00  ? 124 ILE A N      3  
ATOM 3739  C CA     . ILE B 2 37  ? -6.124  -5.062  -1.339  1.00 0.00  ? 124 ILE A CA     3  
ATOM 3740  C C      . ILE B 2 37  ? -5.432  -6.402  -1.000  1.00 0.00  ? 124 ILE A C      3  
ATOM 3741  O O      . ILE B 2 37  ? -5.276  -6.695  0.186   1.00 0.00  ? 124 ILE A O      3  
ATOM 3742  C CB     . ILE B 2 37  ? -5.097  -3.968  -1.724  1.00 0.00  ? 124 ILE A CB     3  
ATOM 3743  C CG1    . ILE B 2 37  ? -3.896  -3.954  -0.751  1.00 0.00  ? 124 ILE A CG1    3  
ATOM 3744  C CG2    . ILE B 2 37  ? -5.779  -2.590  -1.806  1.00 0.00  ? 124 ILE A CG2    3  
ATOM 3745  C CD1    . ILE B 2 37  ? -3.023  -2.710  -0.877  1.00 0.00  ? 124 ILE A CD1    3  
ATOM 3746  H H      . ILE B 2 37  ? -6.768  -3.675  0.160   1.00 0.00  ? 124 ILE A H      3  
ATOM 3747  H HA     . ILE B 2 37  ? -6.785  -5.210  -2.189  1.00 0.00  ? 124 ILE A HA     3  
ATOM 3748  H HB     . ILE B 2 37  ? -4.713  -4.195  -2.717  1.00 0.00  ? 124 ILE A HB     3  
ATOM 3749  H HG12   . ILE B 2 37  ? -4.248  -4.016  0.276   1.00 0.00  ? 124 ILE A HG12   3  
ATOM 3750  H HG13   . ILE B 2 37  ? -3.269  -4.825  -0.948  1.00 0.00  ? 124 ILE A HG13   3  
ATOM 3751  H HG21   . ILE B 2 37  ? -6.741  -2.680  -2.304  1.00 0.00  ? 124 ILE A HG21   3  
ATOM 3752  H HG22   . ILE B 2 37  ? -5.919  -2.181  -0.804  1.00 0.00  ? 124 ILE A HG22   3  
ATOM 3753  H HG23   . ILE B 2 37  ? -5.160  -1.899  -2.381  1.00 0.00  ? 124 ILE A HG23   3  
ATOM 3754  H HD11   . ILE B 2 37  ? -2.760  -2.548  -1.923  1.00 0.00  ? 124 ILE A HD11   3  
ATOM 3755  H HD12   . ILE B 2 37  ? -3.567  -1.839  -0.509  1.00 0.00  ? 124 ILE A HD12   3  
ATOM 3756  H HD13   . ILE B 2 37  ? -2.133  -2.855  -0.266  1.00 0.00  ? 124 ILE A HD13   3  
ATOM 3757  N N      . PRO B 2 38  ? -4.960  -7.197  -1.985  1.00 0.00  ? 125 PRO A N      3  
ATOM 3758  C CA     . PRO B 2 38  ? -4.410  -8.567  -1.826  1.00 0.00  ? 125 PRO A CA     3  
ATOM 3759  C C      . PRO B 2 38  ? -3.192  -8.844  -0.917  1.00 0.00  ? 125 PRO A C      3  
ATOM 3760  O O      . PRO B 2 38  ? -2.563  -9.892  -1.070  1.00 0.00  ? 125 PRO A O      3  
ATOM 3761  C CB     . PRO B 2 38  ? -4.061  -9.021  -3.255  1.00 0.00  ? 125 PRO A CB     3  
ATOM 3762  C CG     . PRO B 2 38  ? -5.058  -8.267  -4.110  1.00 0.00  ? 125 PRO A CG     3  
ATOM 3763  C CD     . PRO B 2 38  ? -5.175  -6.926  -3.404  1.00 0.00  ? 125 PRO A CD     3  
ATOM 3764  H HA     . PRO B 2 38  ? -5.224  -9.177  -1.433  1.00 0.00  ? 125 PRO A HA     3  
ATOM 3765  H HB2    . PRO B 2 38  ? -3.052  -8.705  -3.524  1.00 0.00  ? 125 PRO A HB2    3  
ATOM 3766  H HB3    . PRO B 2 38  ? -4.171  -10.101 -3.374  1.00 0.00  ? 125 PRO A HB3    3  
ATOM 3767  H HG2    . PRO B 2 38  ? -4.746  -8.164  -5.143  1.00 0.00  ? 125 PRO A HG2    3  
ATOM 3768  H HG3    . PRO B 2 38  ? -6.002  -8.792  -4.079  1.00 0.00  ? 125 PRO A HG3    3  
ATOM 3769  H HD2    . PRO B 2 38  ? -4.404  -6.249  -3.768  1.00 0.00  ? 125 PRO A HD2    3  
ATOM 3770  H HD3    . PRO B 2 38  ? -6.163  -6.514  -3.613  1.00 0.00  ? 125 PRO A HD3    3  
ATOM 3771  N N      . PHE B 2 39  ? -2.805  -7.940  -0.017  1.00 0.00  ? 126 PHE A N      3  
ATOM 3772  C CA     . PHE B 2 39  ? -1.600  -7.937  0.838   1.00 0.00  ? 126 PHE A CA     3  
ATOM 3773  C C      . PHE B 2 39  ? -0.237  -7.913  0.126   1.00 0.00  ? 126 PHE A C      3  
ATOM 3774  O O      . PHE B 2 39  ? 0.616   -7.101  0.482   1.00 0.00  ? 126 PHE A O      3  
ATOM 3775  C CB     . PHE B 2 39  ? -1.635  -9.075  1.875   1.00 0.00  ? 126 PHE A CB     3  
ATOM 3776  C CG     . PHE B 2 39  ? -2.593  -8.892  3.031   1.00 0.00  ? 126 PHE A CG     3  
ATOM 3777  C CD1    . PHE B 2 39  ? -2.587  -7.695  3.774   1.00 0.00  ? 126 PHE A CD1    3  
ATOM 3778  C CD2    . PHE B 2 39  ? -3.401  -9.966  3.442   1.00 0.00  ? 126 PHE A CD2    3  
ATOM 3779  C CE1    . PHE B 2 39  ? -3.379  -7.590  4.929   1.00 0.00  ? 126 PHE A CE1    3  
ATOM 3780  C CE2    . PHE B 2 39  ? -4.152  -9.872  4.624   1.00 0.00  ? 126 PHE A CE2    3  
ATOM 3781  C CZ     . PHE B 2 39  ? -4.147  -8.679  5.360   1.00 0.00  ? 126 PHE A CZ     3  
ATOM 3782  H H      . PHE B 2 39  ? -3.488  -7.202  0.115   1.00 0.00  ? 126 PHE A H      3  
ATOM 3783  H HA     . PHE B 2 39  ? -1.628  -7.006  1.389   1.00 0.00  ? 126 PHE A HA     3  
ATOM 3784  H HB2    . PHE B 2 39  ? -1.836  -10.024 1.379   1.00 0.00  ? 126 PHE A HB2    3  
ATOM 3785  H HB3    . PHE B 2 39  ? -0.645  -9.167  2.322   1.00 0.00  ? 126 PHE A HB3    3  
ATOM 3786  H HD1    . PHE B 2 39  ? -1.956  -6.858  3.485   1.00 0.00  ? 126 PHE A HD1    3  
ATOM 3787  H HD2    . PHE B 2 39  ? -3.410  -10.882 2.871   1.00 0.00  ? 126 PHE A HD2    3  
ATOM 3788  H HE1    . PHE B 2 39  ? -3.384  -6.687  5.516   1.00 0.00  ? 126 PHE A HE1    3  
ATOM 3789  H HE2    . PHE B 2 39  ? -4.731  -10.715 4.975   1.00 0.00  ? 126 PHE A HE2    3  
ATOM 3790  H HZ     . PHE B 2 39  ? -4.736  -8.586  6.256   1.00 0.00  ? 126 PHE A HZ     3  
ATOM 3791  N N      . ARG B 2 40  ? -0.023  -8.773  -0.877  1.00 0.00  ? 127 ARG A N      3  
ATOM 3792  C CA     . ARG B 2 40  ? 1.171   -8.827  -1.740  1.00 0.00  ? 127 ARG A CA     3  
ATOM 3793  C C      . ARG B 2 40  ? 1.264   -7.619  -2.686  1.00 0.00  ? 127 ARG A C      3  
ATOM 3794  O O      . ARG B 2 40  ? 2.319   -7.359  -3.265  1.00 0.00  ? 127 ARG A O      3  
ATOM 3795  C CB     . ARG B 2 40  ? 1.172   -10.136 -2.561  1.00 0.00  ? 127 ARG A CB     3  
ATOM 3796  C CG     . ARG B 2 40  ? 1.252   -11.443 -1.747  1.00 0.00  ? 127 ARG A CG     3  
ATOM 3797  C CD     . ARG B 2 40  ? -0.087  -11.876 -1.130  1.00 0.00  ? 127 ARG A CD     3  
ATOM 3798  N NE     . ARG B 2 40  ? -0.031  -13.235 -0.571  1.00 0.00  ? 127 ARG A NE     3  
ATOM 3799  C CZ     . ARG B 2 40  ? -0.276  -14.386 -1.165  1.00 0.00  ? 127 ARG A CZ     3  
ATOM 3800  N NH1    . ARG B 2 40  ? -0.542  -14.486 -2.435  1.00 0.00  ? 127 ARG A NH1    3  
ATOM 3801  N NH2    . ARG B 2 40  ? -0.258  -15.478 -0.459  1.00 0.00  ? 127 ARG A NH2    3  
ATOM 3802  H H      . ARG B 2 40  ? -0.795  -9.409  -1.060  1.00 0.00  ? 127 ARG A H      3  
ATOM 3803  H HA     . ARG B 2 40  ? 2.071   -8.804  -1.117  1.00 0.00  ? 127 ARG A HA     3  
ATOM 3804  H HB2    . ARG B 2 40  ? 0.292   -10.163 -3.206  1.00 0.00  ? 127 ARG A HB2    3  
ATOM 3805  H HB3    . ARG B 2 40  ? 2.048   -10.114 -3.214  1.00 0.00  ? 127 ARG A HB3    3  
ATOM 3806  H HG2    . ARG B 2 40  ? 1.583   -12.232 -2.422  1.00 0.00  ? 127 ARG A HG2    3  
ATOM 3807  H HG3    . ARG B 2 40  ? 2.000   -11.338 -0.958  1.00 0.00  ? 127 ARG A HG3    3  
ATOM 3808  H HD2    . ARG B 2 40  ? -0.336  -11.196 -0.315  1.00 0.00  ? 127 ARG A HD2    3  
ATOM 3809  H HD3    . ARG B 2 40  ? -0.875  -11.814 -1.884  1.00 0.00  ? 127 ARG A HD3    3  
ATOM 3810  H HE     . ARG B 2 40  ? 0.148   -13.324 0.422   1.00 0.00  ? 127 ARG A HE     3  
ATOM 3811  H HH11   . ARG B 2 40  ? -0.558  -13.654 -3.000  1.00 0.00  ? 127 ARG A HH11   3  
ATOM 3812  H HH12   . ARG B 2 40  ? -0.731  -15.380 -2.855  1.00 0.00  ? 127 ARG A HH12   3  
ATOM 3813  H HH21   . ARG B 2 40  ? -0.085  -15.385 0.536   1.00 0.00  ? 127 ARG A HH21   3  
ATOM 3814  H HH22   . ARG B 2 40  ? -0.450  -16.376 -0.866  1.00 0.00  ? 127 ARG A HH22   3  
ATOM 3815  N N      . PHE B 2 41  ? 0.159   -6.896  -2.852  1.00 0.00  ? 128 PHE A N      3  
ATOM 3816  C CA     . PHE B 2 41  ? -0.009  -5.740  -3.735  1.00 0.00  ? 128 PHE A CA     3  
ATOM 3817  C C      . PHE B 2 41  ? 0.984   -4.607  -3.418  1.00 0.00  ? 128 PHE A C      3  
ATOM 3818  O O      . PHE B 2 41  ? 1.157   -4.229  -2.254  1.00 0.00  ? 128 PHE A O      3  
ATOM 3819  C CB     . PHE B 2 41  ? -1.467  -5.270  -3.620  1.00 0.00  ? 128 PHE A CB     3  
ATOM 3820  C CG     . PHE B 2 41  ? -2.057  -4.852  -4.944  1.00 0.00  ? 128 PHE A CG     3  
ATOM 3821  C CD1    . PHE B 2 41  ? -2.596  -5.826  -5.803  1.00 0.00  ? 128 PHE A CD1    3  
ATOM 3822  C CD2    . PHE B 2 41  ? -2.047  -3.501  -5.330  1.00 0.00  ? 128 PHE A CD2    3  
ATOM 3823  C CE1    . PHE B 2 41  ? -3.140  -5.451  -7.039  1.00 0.00  ? 128 PHE A CE1    3  
ATOM 3824  C CE2    . PHE B 2 41  ? -2.595  -3.124  -6.570  1.00 0.00  ? 128 PHE A CE2    3  
ATOM 3825  C CZ     . PHE B 2 41  ? -3.142  -4.100  -7.424  1.00 0.00  ? 128 PHE A CZ     3  
ATOM 3826  H H      . PHE B 2 41  ? -0.639  -7.204  -2.325  1.00 0.00  ? 128 PHE A H      3  
ATOM 3827  H HA     . PHE B 2 41  ? 0.168   -6.076  -4.758  1.00 0.00  ? 128 PHE A HA     3  
ATOM 3828  H HB2    . PHE B 2 41  ? -2.091  -6.078  -3.231  1.00 0.00  ? 128 PHE A HB2    3  
ATOM 3829  H HB3    . PHE B 2 41  ? -1.534  -4.448  -2.909  1.00 0.00  ? 128 PHE A HB3    3  
ATOM 3830  H HD1    . PHE B 2 41  ? -2.583  -6.869  -5.523  1.00 0.00  ? 128 PHE A HD1    3  
ATOM 3831  H HD2    . PHE B 2 41  ? -1.609  -2.761  -4.676  1.00 0.00  ? 128 PHE A HD2    3  
ATOM 3832  H HE1    . PHE B 2 41  ? -3.557  -6.205  -7.692  1.00 0.00  ? 128 PHE A HE1    3  
ATOM 3833  H HE2    . PHE B 2 41  ? -2.562  -2.092  -6.878  1.00 0.00  ? 128 PHE A HE2    3  
ATOM 3834  H HZ     . PHE B 2 41  ? -3.556  -3.810  -8.379  1.00 0.00  ? 128 PHE A HZ     3  
ATOM 3835  N N      . ARG B 2 42  ? 1.659   -4.078  -4.447  1.00 0.00  ? 129 ARG A N      3  
ATOM 3836  C CA     . ARG B 2 42  ? 2.758   -3.104  -4.320  1.00 0.00  ? 129 ARG A CA     3  
ATOM 3837  C C      . ARG B 2 42  ? 2.334   -1.649  -4.573  1.00 0.00  ? 129 ARG A C      3  
ATOM 3838  O O      . ARG B 2 42  ? 1.300   -1.330  -5.156  1.00 0.00  ? 129 ARG A O      3  
ATOM 3839  C CB     . ARG B 2 42  ? 3.924   -3.530  -5.237  1.00 0.00  ? 129 ARG A CB     3  
ATOM 3840  C CG     . ARG B 2 42  ? 4.445   -4.970  -5.066  1.00 0.00  ? 129 ARG A CG     3  
ATOM 3841  C CD     . ARG B 2 42  ? 4.997   -5.247  -3.659  1.00 0.00  ? 129 ARG A CD     3  
ATOM 3842  N NE     . ARG B 2 42  ? 6.096   -6.234  -3.680  1.00 0.00  ? 129 ARG A NE     3  
ATOM 3843  C CZ     . ARG B 2 42  ? 6.034   -7.547  -3.816  1.00 0.00  ? 129 ARG A CZ     3  
ATOM 3844  N NH1    . ARG B 2 42  ? 4.908   -8.199  -3.892  1.00 0.00  ? 129 ARG A NH1    3  
ATOM 3845  N NH2    . ARG B 2 42  ? 7.131   -8.244  -3.882  1.00 0.00  ? 129 ARG A NH2    3  
ATOM 3846  H H      . ARG B 2 42  ? 1.474   -4.461  -5.376  1.00 0.00  ? 129 ARG A H      3  
ATOM 3847  H HA     . ARG B 2 42  ? 3.143   -3.104  -3.302  1.00 0.00  ? 129 ARG A HA     3  
ATOM 3848  H HB2    . ARG B 2 42  ? 3.632   -3.386  -6.278  1.00 0.00  ? 129 ARG A HB2    3  
ATOM 3849  H HB3    . ARG B 2 42  ? 4.771   -2.879  -5.041  1.00 0.00  ? 129 ARG A HB3    3  
ATOM 3850  H HG2    . ARG B 2 42  ? 3.663   -5.692  -5.297  1.00 0.00  ? 129 ARG A HG2    3  
ATOM 3851  H HG3    . ARG B 2 42  ? 5.251   -5.109  -5.787  1.00 0.00  ? 129 ARG A HG3    3  
ATOM 3852  H HD2    . ARG B 2 42  ? 5.392   -4.319  -3.244  1.00 0.00  ? 129 ARG A HD2    3  
ATOM 3853  H HD3    . ARG B 2 42  ? 4.184   -5.577  -3.009  1.00 0.00  ? 129 ARG A HD3    3  
ATOM 3854  H HE     . ARG B 2 42  ? 7.030   -5.863  -3.611  1.00 0.00  ? 129 ARG A HE     3  
ATOM 3855  H HH11   . ARG B 2 42  ? 4.033   -7.696  -3.782  1.00 0.00  ? 129 ARG A HH11   3  
ATOM 3856  H HH12   . ARG B 2 42  ? 4.899   -9.197  -4.002  1.00 0.00  ? 129 ARG A HH12   3  
ATOM 3857  H HH21   . ARG B 2 42  ? 8.027   -7.786  -3.832  1.00 0.00  ? 129 ARG A HH21   3  
ATOM 3858  H HH22   . ARG B 2 42  ? 7.095   -9.244  -3.987  1.00 0.00  ? 129 ARG A HH22   3  
ATOM 3859  N N      . ASP B 2 43  ? 3.215   -0.755  -4.154  1.00 0.00  ? 130 ASP A N      3  
ATOM 3860  C CA     . ASP B 2 43  ? 3.192   0.686   -4.402  1.00 0.00  ? 130 ASP A CA     3  
ATOM 3861  C C      . ASP B 2 43  ? 3.184   1.012   -5.928  1.00 0.00  ? 130 ASP A C      3  
ATOM 3862  O O      . ASP B 2 43  ? 2.223   1.640   -6.409  1.00 0.00  ? 130 ASP A O      3  
ATOM 3863  C CB     . ASP B 2 43  ? 4.359   1.242   -3.567  1.00 0.00  ? 130 ASP A CB     3  
ATOM 3864  C CG     . ASP B 2 43  ? 4.531   2.753   -3.657  1.00 0.00  ? 130 ASP A CG     3  
ATOM 3865  O OD1    . ASP B 2 43  ? 3.914   3.452   -2.824  1.00 0.00  ? 130 ASP A OD1    3  
ATOM 3866  O OD2    . ASP B 2 43  ? 5.314   3.212   -4.523  1.00 0.00  ? 130 ASP A OD2    3  
ATOM 3867  H H      . ASP B 2 43  ? 4.018   -1.119  -3.663  1.00 0.00  ? 130 ASP A H      3  
ATOM 3868  H HA     . ASP B 2 43  ? 2.270   1.099   -3.987  1.00 0.00  ? 130 ASP A HA     3  
ATOM 3869  H HB2    . ASP B 2 43  ? 4.176   0.969   -2.535  1.00 0.00  ? 130 ASP A HB2    3  
ATOM 3870  H HB3    . ASP B 2 43  ? 5.299   0.750   -3.792  1.00 0.00  ? 130 ASP A HB3    3  
ATOM 3871  N N      . PRO B 2 44  ? 4.146   0.487   -6.731  1.00 0.00  ? 131 PRO A N      3  
ATOM 3872  C CA     . PRO B 2 44  ? 4.060   0.435   -8.193  1.00 0.00  ? 131 PRO A CA     3  
ATOM 3873  C C      . PRO B 2 44  ? 2.728   -0.092  -8.736  1.00 0.00  ? 131 PRO A C      3  
ATOM 3874  O O      . PRO B 2 44  ? 2.177   0.506   -9.662  1.00 0.00  ? 131 PRO A O      3  
ATOM 3875  C CB     . PRO B 2 44  ? 5.210   -0.464  -8.661  1.00 0.00  ? 131 PRO A CB     3  
ATOM 3876  C CG     . PRO B 2 44  ? 6.255   -0.301  -7.567  1.00 0.00  ? 131 PRO A CG     3  
ATOM 3877  C CD     . PRO B 2 44  ? 5.408   -0.110  -6.310  1.00 0.00  ? 131 PRO A CD     3  
ATOM 3878  H HA     . PRO B 2 44  ? 4.226   1.440   -8.574  1.00 0.00  ? 131 PRO A HA     3  
ATOM 3879  H HB2    . PRO B 2 44  ? 4.895   -1.509  -8.685  1.00 0.00  ? 131 PRO A HB2    3  
ATOM 3880  H HB3    . PRO B 2 44  ? 5.593   -0.155  -9.634  1.00 0.00  ? 131 PRO A HB3    3  
ATOM 3881  H HG2    . PRO B 2 44  ? 6.902   -1.175  -7.491  1.00 0.00  ? 131 PRO A HG2    3  
ATOM 3882  H HG3    . PRO B 2 44  ? 6.837   0.604   -7.752  1.00 0.00  ? 131 PRO A HG3    3  
ATOM 3883  H HD2    . PRO B 2 44  ? 5.223   -1.057  -5.823  1.00 0.00  ? 131 PRO A HD2    3  
ATOM 3884  H HD3    . PRO B 2 44  ? 5.955   0.521   -5.626  1.00 0.00  ? 131 PRO A HD3    3  
ATOM 3885  N N      . ASP B 2 45  ? 2.185   -1.184  -8.173  1.00 0.00  ? 132 ASP A N      3  
ATOM 3886  C CA     . ASP B 2 45  ? 0.934   -1.766  -8.629  1.00 0.00  ? 132 ASP A CA     3  
ATOM 3887  C C      . ASP B 2 45  ? -0.224  -0.779  -8.481  1.00 0.00  ? 132 ASP A C      3  
ATOM 3888  O O      . ASP B 2 45  ? -0.968  -0.619  -9.444  1.00 0.00  ? 132 ASP A O      3  
ATOM 3889  C CB     . ASP B 2 45  ? 0.604   -3.069  -7.892  1.00 0.00  ? 132 ASP A CB     3  
ATOM 3890  C CG     . ASP B 2 45  ? 1.589   -4.231  -8.087  1.00 0.00  ? 132 ASP A CG     3  
ATOM 3891  O OD1    . ASP B 2 45  ? 2.270   -4.307  -9.136  1.00 0.00  ? 132 ASP A OD1    3  
ATOM 3892  O OD2    . ASP B 2 45  ? 1.649   -5.097  -7.183  1.00 0.00  ? 132 ASP A OD2    3  
ATOM 3893  H H      . ASP B 2 45  ? 2.617   -1.656  -7.398  1.00 0.00  ? 132 ASP A H      3  
ATOM 3894  H HA     . ASP B 2 45  ? 1.018   -1.993  -9.693  1.00 0.00  ? 132 ASP A HA     3  
ATOM 3895  H HB2    . ASP B 2 45  ? 0.468   -2.877  -6.831  1.00 0.00  ? 132 ASP A HB2    3  
ATOM 3896  H HB3    . ASP B 2 45  ? -0.352  -3.396  -8.267  1.00 0.00  ? 132 ASP A HB3    3  
ATOM 3897  N N      . LEU B 2 46  ? -0.382  -0.066  -7.352  1.00 0.00  ? 133 LEU A N      3  
ATOM 3898  C CA     . LEU B 2 46  ? -1.439  0.927   -7.257  1.00 0.00  ? 133 LEU A CA     3  
ATOM 3899  C C      . LEU B 2 46  ? -1.224  2.100   -8.199  1.00 0.00  ? 133 LEU A C      3  
ATOM 3900  O O      . LEU B 2 46  ? -2.199  2.512   -8.830  1.00 0.00  ? 133 LEU A O      3  
ATOM 3901  C CB     . LEU B 2 46  ? -1.650  1.410   -5.818  1.00 0.00  ? 133 LEU A CB     3  
ATOM 3902  C CG     . LEU B 2 46  ? -2.419  0.389   -4.964  1.00 0.00  ? 133 LEU A CG     3  
ATOM 3903  C CD1    . LEU B 2 46  ? -2.438  0.826   -3.500  1.00 0.00  ? 133 LEU A CD1    3  
ATOM 3904  C CD2    . LEU B 2 46  ? -3.851  0.213   -5.474  1.00 0.00  ? 133 LEU A CD2    3  
ATOM 3905  H H      . LEU B 2 46  ? 0.258   -0.124  -6.570  1.00 0.00  ? 133 LEU A H      3  
ATOM 3906  H HA     . LEU B 2 46  ? -2.353  0.456   -7.604  1.00 0.00  ? 133 LEU A HA     3  
ATOM 3907  H HB2    . LEU B 2 46  ? -0.720  1.710   -5.343  1.00 0.00  ? 133 LEU A HB2    3  
ATOM 3908  H HB3    . LEU B 2 46  ? -2.233  2.312   -5.870  1.00 0.00  ? 133 LEU A HB3    3  
ATOM 3909  H HG     . LEU B 2 46  ? -1.937  -0.579  -5.034  1.00 0.00  ? 133 LEU A HG     3  
ATOM 3910  H HD11   . LEU B 2 46  ? -1.415  0.861   -3.129  1.00 0.00  ? 133 LEU A HD11   3  
ATOM 3911  H HD12   . LEU B 2 46  ? -2.884  1.815   -3.406  1.00 0.00  ? 133 LEU A HD12   3  
ATOM 3912  H HD13   . LEU B 2 46  ? -3.003  0.104   -2.910  1.00 0.00  ? 133 LEU A HD13   3  
ATOM 3913  H HD21   . LEU B 2 46  ? -4.302  1.179   -5.716  1.00 0.00  ? 133 LEU A HD21   3  
ATOM 3914  H HD22   . LEU B 2 46  ? -3.833  -0.392  -6.373  1.00 0.00  ? 133 LEU A HD22   3  
ATOM 3915  H HD23   . LEU B 2 46  ? -4.453  -0.313  -4.735  1.00 0.00  ? 133 LEU A HD23   3  
ATOM 3916  N N      . ARG B 2 47  ? 0.009   2.603   -8.368  1.00 0.00  ? 134 ARG A N      3  
ATOM 3917  C CA     . ARG B 2 47  ? 0.204   3.682   -9.356  1.00 0.00  ? 134 ARG A CA     3  
ATOM 3918  C C      . ARG B 2 47  ? -0.131  3.258   -10.791 1.00 0.00  ? 134 ARG A C      3  
ATOM 3919  O O      . ARG B 2 47  ? -0.634  4.077   -11.549 1.00 0.00  ? 134 ARG A O      3  
ATOM 3920  C CB     . ARG B 2 47  ? 1.506   4.443   -9.167  1.00 0.00  ? 134 ARG A CB     3  
ATOM 3921  C CG     . ARG B 2 47  ? 2.658   3.998   -10.057 1.00 0.00  ? 134 ARG A CG     3  
ATOM 3922  C CD     . ARG B 2 47  ? 3.642   5.157   -10.188 1.00 0.00  ? 134 ARG A CD     3  
ATOM 3923  N NE     . ARG B 2 47  ? 3.105   6.281   -10.999 1.00 0.00  ? 134 ARG A NE     3  
ATOM 3924  C CZ     . ARG B 2 47  ? 2.875   7.537   -10.643 1.00 0.00  ? 134 ARG A CZ     3  
ATOM 3925  N NH1    . ARG B 2 47  ? 3.154   7.995   -9.457  1.00 0.00  ? 134 ARG A NH1    3  
ATOM 3926  N NH2    . ARG B 2 47  ? 2.343   8.372   -11.487 1.00 0.00  ? 134 ARG A NH2    3  
ATOM 3927  H H      . ARG B 2 47  ? 0.784   2.181   -7.863  1.00 0.00  ? 134 ARG A H      3  
ATOM 3928  H HA     . ARG B 2 47  ? -0.513  4.459   -9.150  1.00 0.00  ? 134 ARG A HA     3  
ATOM 3929  H HB2    . ARG B 2 47  ? 1.272   5.490   -9.373  1.00 0.00  ? 134 ARG A HB2    3  
ATOM 3930  H HB3    . ARG B 2 47  ? 1.821   4.389   -8.126  1.00 0.00  ? 134 ARG A HB3    3  
ATOM 3931  H HG2    . ARG B 2 47  ? 3.143   3.134   -9.595  1.00 0.00  ? 134 ARG A HG2    3  
ATOM 3932  H HG3    . ARG B 2 47  ? 2.328   3.716   -11.057 1.00 0.00  ? 134 ARG A HG3    3  
ATOM 3933  H HD2    . ARG B 2 47  ? 3.973   5.479   -9.199  1.00 0.00  ? 134 ARG A HD2    3  
ATOM 3934  H HD3    . ARG B 2 47  ? 4.474   4.732   -10.712 1.00 0.00  ? 134 ARG A HD3    3  
ATOM 3935  H HE     . ARG B 2 47  ? 2.881   6.064   -11.958 1.00 0.00  ? 134 ARG A HE     3  
ATOM 3936  H HH11   . ARG B 2 47  ? 3.608   7.391   -8.800  1.00 0.00  ? 134 ARG A HH11   3  
ATOM 3937  H HH12   . ARG B 2 47  ? 3.040   8.974   -9.250  1.00 0.00  ? 134 ARG A HH12   3  
ATOM 3938  H HH21   . ARG B 2 47  ? 2.138   8.085   -12.430 1.00 0.00  ? 134 ARG A HH21   3  
ATOM 3939  H HH22   . ARG B 2 47  ? 2.064   9.300   -11.185 1.00 0.00  ? 134 ARG A HH22   3  
ATOM 3940  N N      . GLN B 2 48  ? 0.071   1.990   -11.148 1.00 0.00  ? 135 GLN A N      3  
ATOM 3941  C CA     . GLN B 2 48  ? -0.281  1.407   -12.452 1.00 0.00  ? 135 GLN A CA     3  
ATOM 3942  C C      . GLN B 2 48  ? -1.788  1.087   -12.600 1.00 0.00  ? 135 GLN A C      3  
ATOM 3943  O O      . GLN B 2 48  ? -2.382  1.277   -13.668 1.00 0.00  ? 135 GLN A O      3  
ATOM 3944  C CB     . GLN B 2 48  ? 0.588   0.153   -12.619 1.00 0.00  ? 135 GLN A CB     3  
ATOM 3945  C CG     . GLN B 2 48  ? 0.496   -0.461  -14.018 1.00 0.00  ? 135 GLN A CG     3  
ATOM 3946  C CD     . GLN B 2 48  ? 1.408   -1.681  -14.158 1.00 0.00  ? 135 GLN A CD     3  
ATOM 3947  O OE1    . GLN B 2 48  ? 0.998   -2.819  -13.976 1.00 0.00  ? 135 GLN A OE1    3  
ATOM 3948  N NE2    . GLN B 2 48  ? 2.670   -1.498  -14.489 1.00 0.00  ? 135 GLN A NE2    3  
ATOM 3949  H H      . GLN B 2 48  ? 0.543   1.403   -10.468 1.00 0.00  ? 135 GLN A H      3  
ATOM 3950  H HA     . GLN B 2 48  ? -0.005  2.104   -13.239 1.00 0.00  ? 135 GLN A HA     3  
ATOM 3951  H HB2    . GLN B 2 48  ? 1.630   0.426   -12.443 1.00 0.00  ? 135 GLN A HB2    3  
ATOM 3952  H HB3    . GLN B 2 48  ? 0.296   -0.579  -11.870 1.00 0.00  ? 135 GLN A HB3    3  
ATOM 3953  H HG2    . GLN B 2 48  ? -0.530  -0.767  -14.224 1.00 0.00  ? 135 GLN A HG2    3  
ATOM 3954  H HG3    . GLN B 2 48  ? 0.788   0.295   -14.749 1.00 0.00  ? 135 GLN A HG3    3  
ATOM 3955  H HE21   . GLN B 2 48  ? 3.039   -0.573  -14.644 1.00 0.00  ? 135 GLN A HE21   3  
ATOM 3956  H HE22   . GLN B 2 48  ? 3.253   -2.319  -14.564 1.00 0.00  ? 135 GLN A HE22   3  
ATOM 3957  N N      . MET B 2 49  ? -2.430  0.643   -11.519 1.00 0.00  ? 136 MET A N      3  
ATOM 3958  C CA     . MET B 2 49  ? -3.827  0.208   -11.469 1.00 0.00  ? 136 MET A CA     3  
ATOM 3959  C C      . MET B 2 49  ? -4.777  1.398   -11.447 1.00 0.00  ? 136 MET A C      3  
ATOM 3960  O O      . MET B 2 49  ? -5.707  1.454   -12.249 1.00 0.00  ? 136 MET A O      3  
ATOM 3961  C CB     . MET B 2 49  ? -3.947  -0.669  -10.231 1.00 0.00  ? 136 MET A CB     3  
ATOM 3962  C CG     . MET B 2 49  ? -5.275  -1.404  -10.027 1.00 0.00  ? 136 MET A CG     3  
ATOM 3963  S SD     . MET B 2 49  ? -6.685  -0.386  -9.517  1.00 0.00  ? 136 MET A SD     3  
ATOM 3964  C CE     . MET B 2 49  ? -5.970  0.477   -8.093  1.00 0.00  ? 136 MET A CE     3  
ATOM 3965  H H      . MET B 2 49  ? -1.908  0.508   -10.657 1.00 0.00  ? 136 MET A H      3  
ATOM 3966  H HA     . MET B 2 49  ? -4.053  -0.397  -12.349 1.00 0.00  ? 136 MET A HA     3  
ATOM 3967  H HB2    . MET B 2 49  ? -3.165  -1.399  -10.355 1.00 0.00  ? 136 MET A HB2    3  
ATOM 3968  H HB3    . MET B 2 49  ? -3.686  -0.105  -9.341  1.00 0.00  ? 136 MET A HB3    3  
ATOM 3969  H HG2    . MET B 2 49  ? -5.535  -1.924  -10.948 1.00 0.00  ? 136 MET A HG2    3  
ATOM 3970  H HG3    . MET B 2 49  ? -5.119  -2.158  -9.258  1.00 0.00  ? 136 MET A HG3    3  
ATOM 3971  H HE1    . MET B 2 49  ? -5.630  -0.257  -7.369  1.00 0.00  ? 136 MET A HE1    3  
ATOM 3972  H HE2    . MET B 2 49  ? -5.116  1.083   -8.397  1.00 0.00  ? 136 MET A HE2    3  
ATOM 3973  H HE3    . MET B 2 49  ? -6.719  1.121   -7.632  1.00 0.00  ? 136 MET A HE3    3  
ATOM 3974  N N      . PHE B 2 50  ? -4.476  2.405   -10.624 1.00 0.00  ? 137 PHE A N      3  
ATOM 3975  C CA     . PHE B 2 50  ? -4.979  3.759   -10.863 1.00 0.00  ? 137 PHE A CA     3  
ATOM 3976  C C      . PHE B 2 50  ? -4.437  4.318   -12.196 1.00 0.00  ? 137 PHE A C      3  
ATOM 3977  O O      . PHE B 2 50  ? -5.099  5.118   -12.857 1.00 0.00  ? 137 PHE A O      3  
ATOM 3978  C CB     . PHE B 2 50  ? -4.637  4.694   -9.694  1.00 0.00  ? 137 PHE A CB     3  
ATOM 3979  C CG     . PHE B 2 50  ? -5.536  4.525   -8.491  1.00 0.00  ? 137 PHE A CG     3  
ATOM 3980  C CD1    . PHE B 2 50  ? -6.804  5.136   -8.487  1.00 0.00  ? 137 PHE A CD1    3  
ATOM 3981  C CD2    . PHE B 2 50  ? -5.132  3.756   -7.386  1.00 0.00  ? 137 PHE A CD2    3  
ATOM 3982  C CE1    . PHE B 2 50  ? -7.670  4.980   -7.395  1.00 0.00  ? 137 PHE A CE1    3  
ATOM 3983  C CE2    . PHE B 2 50  ? -5.988  3.620   -6.282  1.00 0.00  ? 137 PHE A CE2    3  
ATOM 3984  C CZ     . PHE B 2 50  ? -7.244  4.244   -6.276  1.00 0.00  ? 137 PHE A CZ     3  
ATOM 3985  H H      . PHE B 2 50  ? -3.706  2.256   -9.976  1.00 0.00  ? 137 PHE A H      3  
ATOM 3986  H HA     . PHE B 2 50  ? -6.060  3.706   -10.929 1.00 0.00  ? 137 PHE A HA     3  
ATOM 3987  H HB2    . PHE B 2 50  ? -3.593  4.574   -9.407  1.00 0.00  ? 137 PHE A HB2    3  
ATOM 3988  H HB3    . PHE B 2 50  ? -4.759  5.724   -10.034 1.00 0.00  ? 137 PHE A HB3    3  
ATOM 3989  H HD1    . PHE B 2 50  ? -7.132  5.695   -9.348  1.00 0.00  ? 137 PHE A HD1    3  
ATOM 3990  H HD2    . PHE B 2 50  ? -4.162  3.283   -7.375  1.00 0.00  ? 137 PHE A HD2    3  
ATOM 3991  H HE1    . PHE B 2 50  ? -8.664  5.405   -7.438  1.00 0.00  ? 137 PHE A HE1    3  
ATOM 3992  H HE2    . PHE B 2 50  ? -5.674  3.047   -5.428  1.00 0.00  ? 137 PHE A HE2    3  
ATOM 3993  H HZ     . PHE B 2 50  ? -7.884  4.144   -5.415  1.00 0.00  ? 137 PHE A HZ     3  
ATOM 3994  N N      . GLY B 2 51  ? -3.233  3.899   -12.610 1.00 0.00  ? 138 GLY A N      3  
ATOM 3995  C CA     . GLY B 2 51  ? -2.534  4.351   -13.823 1.00 0.00  ? 138 GLY A CA     3  
ATOM 3996  C C      . GLY B 2 51  ? -3.261  4.101   -15.142 1.00 0.00  ? 138 GLY A C      3  
ATOM 3997  O O      . GLY B 2 51  ? -3.033  4.843   -16.096 1.00 0.00  ? 138 GLY A O      3  
ATOM 3998  H H      . GLY B 2 51  ? -2.671  3.375   -11.934 1.00 0.00  ? 138 GLY A H      3  
ATOM 3999  H HA2    . GLY B 2 51  ? -2.340  5.417   -13.736 1.00 0.00  ? 138 GLY A HA2    3  
ATOM 4000  H HA3    . GLY B 2 51  ? -1.570  3.848   -13.887 1.00 0.00  ? 138 GLY A HA3    3  
ATOM 4001  N N      . GLN B 2 52  ? -4.192  3.140   -15.195 1.00 0.00  ? 139 GLN A N      3  
ATOM 4002  C CA     . GLN B 2 52  ? -5.170  3.058   -16.298 1.00 0.00  ? 139 GLN A CA     3  
ATOM 4003  C C      . GLN B 2 52  ? -5.931  4.376   -16.550 1.00 0.00  ? 139 GLN A C      3  
ATOM 4004  O O      . GLN B 2 52  ? -6.205  4.724   -17.701 1.00 0.00  ? 139 GLN A O      3  
ATOM 4005  C CB     . GLN B 2 52  ? -6.161  1.899   -16.113 1.00 0.00  ? 139 GLN A CB     3  
ATOM 4006  C CG     . GLN B 2 52  ? -7.285  2.133   -15.088 1.00 0.00  ? 139 GLN A CG     3  
ATOM 4007  C CD     . GLN B 2 52  ? -8.051  0.840   -14.804 1.00 0.00  ? 139 GLN A CD     3  
ATOM 4008  O OE1    . GLN B 2 52  ? -8.961  0.449   -15.525 1.00 0.00  ? 139 GLN A OE1    3  
ATOM 4009  N NE2    . GLN B 2 52  ? -7.710  0.127   -13.755 1.00 0.00  ? 139 GLN A NE2    3  
ATOM 4010  H H      . GLN B 2 52  ? -4.124  2.437   -14.462 1.00 0.00  ? 139 GLN A H      3  
ATOM 4011  H HA     . GLN B 2 52  ? -4.606  2.846   -17.207 1.00 0.00  ? 139 GLN A HA     3  
ATOM 4012  H HB2    . GLN B 2 52  ? -6.643  1.737   -17.079 1.00 0.00  ? 139 GLN A HB2    3  
ATOM 4013  H HB3    . GLN B 2 52  ? -5.602  1.003   -15.847 1.00 0.00  ? 139 GLN A HB3    3  
ATOM 4014  H HG2    . GLN B 2 52  ? -6.876  2.527   -14.162 1.00 0.00  ? 139 GLN A HG2    3  
ATOM 4015  H HG3    . GLN B 2 52  ? -7.993  2.865   -15.480 1.00 0.00  ? 139 GLN A HG3    3  
ATOM 4016  H HE21   . GLN B 2 52  ? -6.985  0.481   -13.135 1.00 0.00  ? 139 GLN A HE21   3  
ATOM 4017  H HE22   . GLN B 2 52  ? -8.222  -0.716  -13.561 1.00 0.00  ? 139 GLN A HE22   3  
ATOM 4018  N N      . PHE B 2 53  ? -6.259  5.116   -15.482 1.00 0.00  ? 140 PHE A N      3  
ATOM 4019  C CA     . PHE B 2 53  ? -6.861  6.450   -15.539 1.00 0.00  ? 140 PHE A CA     3  
ATOM 4020  C C      . PHE B 2 53  ? -5.803  7.570   -15.595 1.00 0.00  ? 140 PHE A C      3  
ATOM 4021  O O      . PHE B 2 53  ? -6.020  8.598   -16.242 1.00 0.00  ? 140 PHE A O      3  
ATOM 4022  C CB     . PHE B 2 53  ? -7.814  6.623   -14.342 1.00 0.00  ? 140 PHE A CB     3  
ATOM 4023  C CG     . PHE B 2 53  ? -9.145  5.924   -14.544 1.00 0.00  ? 140 PHE A CG     3  
ATOM 4024  C CD1    . PHE B 2 53  ? -10.049 6.455   -15.482 1.00 0.00  ? 140 PHE A CD1    3  
ATOM 4025  C CD2    . PHE B 2 53  ? -9.510  4.790   -13.787 1.00 0.00  ? 140 PHE A CD2    3  
ATOM 4026  C CE1    . PHE B 2 53  ? -11.300 5.847   -15.689 1.00 0.00  ? 140 PHE A CE1    3  
ATOM 4027  C CE2    . PHE B 2 53  ? -10.752 4.177   -14.005 1.00 0.00  ? 140 PHE A CE2    3  
ATOM 4028  C CZ     . PHE B 2 53  ? -11.647 4.701   -14.954 1.00 0.00  ? 140 PHE A CZ     3  
ATOM 4029  H H      . PHE B 2 53  ? -5.998  4.756   -14.570 1.00 0.00  ? 140 PHE A H      3  
ATOM 4030  H HA     . PHE B 2 53  ? -7.449  6.503   -16.455 1.00 0.00  ? 140 PHE A HA     3  
ATOM 4031  H HB2    . PHE B 2 53  ? -7.339  6.259   -13.431 1.00 0.00  ? 140 PHE A HB2    3  
ATOM 4032  H HB3    . PHE B 2 53  ? -8.009  7.687   -14.188 1.00 0.00  ? 140 PHE A HB3    3  
ATOM 4033  H HD1    . PHE B 2 53  ? -9.788  7.351   -16.028 1.00 0.00  ? 140 PHE A HD1    3  
ATOM 4034  H HD2    . PHE B 2 53  ? -8.897  4.397   -12.989 1.00 0.00  ? 140 PHE A HD2    3  
ATOM 4035  H HE1    . PHE B 2 53  ? -11.994 6.263   -16.406 1.00 0.00  ? 140 PHE A HE1    3  
ATOM 4036  H HE2    . PHE B 2 53  ? -11.021 3.317   -13.411 1.00 0.00  ? 140 PHE A HE2    3  
ATOM 4037  H HZ     . PHE B 2 53  ? -12.614 4.242   -15.111 1.00 0.00  ? 140 PHE A HZ     3  
ATOM 4038  N N      . GLY B 2 54  ? -4.643  7.350   -14.966 1.00 0.00  ? 141 GLY A N      3  
ATOM 4039  C CA     . GLY B 2 54  ? -3.371  8.044   -15.224 1.00 0.00  ? 141 GLY A CA     3  
ATOM 4040  C C      . GLY B 2 54  ? -3.273  9.482   -14.718 1.00 0.00  ? 141 GLY A C      3  
ATOM 4041  O O      . GLY B 2 54  ? -2.851  10.384  -15.444 1.00 0.00  ? 141 GLY A O      3  
ATOM 4042  H H      . GLY B 2 54  ? -4.612  6.497   -14.424 1.00 0.00  ? 141 GLY A H      3  
ATOM 4043  H HA2    . GLY B 2 54  ? -2.593  7.505   -14.696 1.00 0.00  ? 141 GLY A HA2    3  
ATOM 4044  H HA3    . GLY B 2 54  ? -3.158  8.025   -16.292 1.00 0.00  ? 141 GLY A HA3    3  
ATOM 4045  N N      . LYS B 2 55  ? -3.642  9.672   -13.446 1.00 0.00  ? 142 LYS A N      3  
ATOM 4046  C CA     . LYS B 2 55  ? -3.773  10.971  -12.753 1.00 0.00  ? 142 LYS A CA     3  
ATOM 4047  C C      . LYS B 2 55  ? -3.025  11.037  -11.407 1.00 0.00  ? 142 LYS A C      3  
ATOM 4048  O O      . LYS B 2 55  ? -3.234  11.950  -10.612 1.00 0.00  ? 142 LYS A O      3  
ATOM 4049  C CB     . LYS B 2 55  ? -5.279  11.273  -12.633 1.00 0.00  ? 142 LYS A CB     3  
ATOM 4050  C CG     . LYS B 2 55  ? -5.900  11.339  -14.034 1.00 0.00  ? 142 LYS A CG     3  
ATOM 4051  C CD     . LYS B 2 55  ? -7.273  12.010  -14.128 1.00 0.00  ? 142 LYS A CD     3  
ATOM 4052  C CE     . LYS B 2 55  ? -7.595  12.279  -15.607 1.00 0.00  ? 142 LYS A CE     3  
ATOM 4053  N NZ     . LYS B 2 55  ? -7.736  11.028  -16.400 1.00 0.00  ? 142 LYS A NZ     3  
ATOM 4054  H H      . LYS B 2 55  ? -4.023  8.849   -12.998 1.00 0.00  ? 142 LYS A H      3  
ATOM 4055  H HA     . LYS B 2 55  ? -3.319  11.756  -13.361 1.00 0.00  ? 142 LYS A HA     3  
ATOM 4056  H HB2    . LYS B 2 55  ? -5.757  10.474  -12.069 1.00 0.00  ? 142 LYS A HB2    3  
ATOM 4057  H HB3    . LYS B 2 55  ? -5.422  12.226  -12.121 1.00 0.00  ? 142 LYS A HB3    3  
ATOM 4058  H HG2    . LYS B 2 55  ? -5.202  11.879  -14.676 1.00 0.00  ? 142 LYS A HG2    3  
ATOM 4059  H HG3    . LYS B 2 55  ? -6.006  10.323  -14.406 1.00 0.00  ? 142 LYS A HG3    3  
ATOM 4060  H HD2    . LYS B 2 55  ? -8.039  11.374  -13.678 1.00 0.00  ? 142 LYS A HD2    3  
ATOM 4061  H HD3    . LYS B 2 55  ? -7.239  12.963  -13.597 1.00 0.00  ? 142 LYS A HD3    3  
ATOM 4062  H HE2    . LYS B 2 55  ? -8.518  12.860  -15.669 1.00 0.00  ? 142 LYS A HE2    3  
ATOM 4063  H HE3    . LYS B 2 55  ? -6.794  12.895  -16.023 1.00 0.00  ? 142 LYS A HE3    3  
ATOM 4064  H HZ1    . LYS B 2 55  ? -6.972  10.378  -16.262 1.00 0.00  ? 142 LYS A HZ1    3  
ATOM 4065  H HZ2    . LYS B 2 55  ? -8.608  10.554  -16.159 1.00 0.00  ? 142 LYS A HZ2    3  
ATOM 4066  H HZ3    . LYS B 2 55  ? -7.785  11.234  -17.388 1.00 0.00  ? 142 LYS A HZ3    3  
ATOM 4067  N N      . ILE B 2 56  ? -2.162  10.051  -11.154 1.00 0.00  ? 143 ILE A N      3  
ATOM 4068  C CA     . ILE B 2 56  ? -1.414  9.868   -9.901  1.00 0.00  ? 143 ILE A CA     3  
ATOM 4069  C C      . ILE B 2 56  ? -0.191  10.792  -9.819  1.00 0.00  ? 143 ILE A C      3  
ATOM 4070  O O      . ILE B 2 56  ? 0.750   10.668  -10.610 1.00 0.00  ? 143 ILE A O      3  
ATOM 4071  C CB     . ILE B 2 56  ? -0.953  8.406   -9.681  1.00 0.00  ? 143 ILE A CB     3  
ATOM 4072  C CG1    . ILE B 2 56  ? -2.044  7.336   -9.809  1.00 0.00  ? 143 ILE A CG1    3  
ATOM 4073  C CG2    . ILE B 2 56  ? -0.392  8.320   -8.261  1.00 0.00  ? 143 ILE A CG2    3  
ATOM 4074  C CD1    . ILE B 2 56  ? -2.236  6.910   -11.263 1.00 0.00  ? 143 ILE A CD1    3  
ATOM 4075  H H      . ILE B 2 56  ? -2.013  9.425   -11.928 1.00 0.00  ? 143 ILE A H      3  
ATOM 4076  H HA     . ILE B 2 56  ? -2.088  10.127  -9.084  1.00 0.00  ? 143 ILE A HA     3  
ATOM 4077  H HB     . ILE B 2 56  ? -0.165  8.128   -10.382 1.00 0.00  ? 143 ILE A HB     3  
ATOM 4078  H HG12   . ILE B 2 56  ? -1.748  6.453   -9.245  1.00 0.00  ? 143 ILE A HG12   3  
ATOM 4079  H HG13   . ILE B 2 56  ? -2.979  7.670   -9.375  1.00 0.00  ? 143 ILE A HG13   3  
ATOM 4080  H HG21   . ILE B 2 56  ? 0.555   8.849   -8.180  1.00 0.00  ? 143 ILE A HG21   3  
ATOM 4081  H HG22   . ILE B 2 56  ? -1.110  8.749   -7.559  1.00 0.00  ? 143 ILE A HG22   3  
ATOM 4082  H HG23   . ILE B 2 56  ? -0.214  7.284   -8.008  1.00 0.00  ? 143 ILE A HG23   3  
ATOM 4083  H HD11   . ILE B 2 56  ? -2.782  7.659   -11.828 1.00 0.00  ? 143 ILE A HD11   3  
ATOM 4084  H HD12   . ILE B 2 56  ? -1.277  6.715   -11.745 1.00 0.00  ? 143 ILE A HD12   3  
ATOM 4085  H HD13   . ILE B 2 56  ? -2.805  5.999   -11.259 1.00 0.00  ? 143 ILE A HD13   3  
ATOM 4086  N N      . LEU B 2 57  ? -0.167  11.649  -8.796  1.00 0.00  ? 144 LEU A N      3  
ATOM 4087  C CA     . LEU B 2 57  ? 1.024   12.395  -8.385  1.00 0.00  ? 144 LEU A CA     3  
ATOM 4088  C C      . LEU B 2 57  ? 1.955   11.479  -7.571  1.00 0.00  ? 144 LEU A C      3  
ATOM 4089  O O      . LEU B 2 57  ? 3.108   11.270  -7.954  1.00 0.00  ? 144 LEU A O      3  
ATOM 4090  C CB     . LEU B 2 57  ? 0.599   13.647  -7.583  1.00 0.00  ? 144 LEU A CB     3  
ATOM 4091  C CG     . LEU B 2 57  ? 0.319   14.911  -8.416  1.00 0.00  ? 144 LEU A CG     3  
ATOM 4092  C CD1    . LEU B 2 57  ? 1.606   15.493  -8.998  1.00 0.00  ? 144 LEU A CD1    3  
ATOM 4093  C CD2    . LEU B 2 57  ? -0.672  14.690  -9.559  1.00 0.00  ? 144 LEU A CD2    3  
ATOM 4094  H H      . LEU B 2 57  ? -0.959  11.647  -8.166  1.00 0.00  ? 144 LEU A H      3  
ATOM 4095  H HA     . LEU B 2 57  ? 1.582   12.705  -9.265  1.00 0.00  ? 144 LEU A HA     3  
ATOM 4096  H HB2    . LEU B 2 57  ? -0.287  13.411  -6.992  1.00 0.00  ? 144 LEU A HB2    3  
ATOM 4097  H HB3    . LEU B 2 57  ? 1.392   13.895  -6.876  1.00 0.00  ? 144 LEU A HB3    3  
ATOM 4098  H HG     . LEU B 2 57  ? -0.107  15.658  -7.747  1.00 0.00  ? 144 LEU A HG     3  
ATOM 4099  H HD11   . LEU B 2 57  ? 2.310   15.699  -8.192  1.00 0.00  ? 144 LEU A HD11   3  
ATOM 4100  H HD12   . LEU B 2 57  ? 2.064   14.802  -9.705  1.00 0.00  ? 144 LEU A HD12   3  
ATOM 4101  H HD13   . LEU B 2 57  ? 1.379   16.422  -9.510  1.00 0.00  ? 144 LEU A HD13   3  
ATOM 4102  H HD21   . LEU B 2 57  ? -0.242  14.037  -10.318 1.00 0.00  ? 144 LEU A HD21   3  
ATOM 4103  H HD22   . LEU B 2 57  ? -1.585  14.234  -9.168  1.00 0.00  ? 144 LEU A HD22   3  
ATOM 4104  H HD23   . LEU B 2 57  ? -0.915  15.650  -10.016 1.00 0.00  ? 144 LEU A HD23   3  
ATOM 4105  N N      . ASP B 2 58  ? 1.444   10.899  -6.482  1.00 0.00  ? 145 ASP A N      3  
ATOM 4106  C CA     . ASP B 2 58  ? 2.201   10.069  -5.538  1.00 0.00  ? 145 ASP A CA     3  
ATOM 4107  C C      . ASP B 2 58  ? 1.401   8.863   -5.017  1.00 0.00  ? 145 ASP A C      3  
ATOM 4108  O O      . ASP B 2 58  ? 0.170   8.908   -4.976  1.00 0.00  ? 145 ASP A O      3  
ATOM 4109  C CB     . ASP B 2 58  ? 2.645   10.940  -4.351  1.00 0.00  ? 145 ASP A CB     3  
ATOM 4110  C CG     . ASP B 2 58  ? 3.846   11.835  -4.695  1.00 0.00  ? 145 ASP A CG     3  
ATOM 4111  O OD1    . ASP B 2 58  ? 4.984   11.311  -4.766  1.00 0.00  ? 145 ASP A OD1    3  
ATOM 4112  O OD2    . ASP B 2 58  ? 3.664   13.065  -4.858  1.00 0.00  ? 145 ASP A OD2    3  
ATOM 4113  H H      . ASP B 2 58  ? 0.463   11.048  -6.280  1.00 0.00  ? 145 ASP A H      3  
ATOM 4114  H HA     . ASP B 2 58  ? 3.078   9.681   -6.049  1.00 0.00  ? 145 ASP A HA     3  
ATOM 4115  H HB2    . ASP B 2 58  ? 1.803   11.550  -4.015  1.00 0.00  ? 145 ASP A HB2    3  
ATOM 4116  H HB3    . ASP B 2 58  ? 2.918   10.296  -3.517  1.00 0.00  ? 145 ASP A HB3    3  
ATOM 4117  N N      . VAL B 2 59  ? 2.099   7.817   -4.557  1.00 0.00  ? 146 VAL A N      3  
ATOM 4118  C CA     . VAL B 2 59  ? 1.562   6.624   -3.861  1.00 0.00  ? 146 VAL A CA     3  
ATOM 4119  C C      . VAL B 2 59  ? 2.361   6.270   -2.609  1.00 0.00  ? 146 VAL A C      3  
ATOM 4120  O O      . VAL B 2 59  ? 3.491   6.734   -2.417  1.00 0.00  ? 146 VAL A O      3  
ATOM 4121  C CB     . VAL B 2 59  ? 1.509   5.364   -4.748  1.00 0.00  ? 146 VAL A CB     3  
ATOM 4122  C CG1    . VAL B 2 59  ? 0.360   5.426   -5.707  1.00 0.00  ? 146 VAL A CG1    3  
ATOM 4123  C CG2    . VAL B 2 59  ? 2.798   5.153   -5.548  1.00 0.00  ? 146 VAL A CG2    3  
ATOM 4124  H H      . VAL B 2 59  ? 3.108   7.892   -4.588  1.00 0.00  ? 146 VAL A H      3  
ATOM 4125  H HA     . VAL B 2 59  ? 0.551   6.841   -3.531  1.00 0.00  ? 146 VAL A HA     3  
ATOM 4126  H HB     . VAL B 2 59  ? 1.248   4.501   -4.133  1.00 0.00  ? 146 VAL A HB     3  
ATOM 4127  H HG11   . VAL B 2 59  ? -0.524  5.484   -5.092  1.00 0.00  ? 146 VAL A HG11   3  
ATOM 4128  H HG12   . VAL B 2 59  ? 0.471   6.301   -6.328  1.00 0.00  ? 146 VAL A HG12   3  
ATOM 4129  H HG13   . VAL B 2 59  ? 0.315   4.517   -6.303  1.00 0.00  ? 146 VAL A HG13   3  
ATOM 4130  H HG21   . VAL B 2 59  ? 2.873   5.903   -6.336  1.00 0.00  ? 146 VAL A HG21   3  
ATOM 4131  H HG22   . VAL B 2 59  ? 3.660   5.249   -4.892  1.00 0.00  ? 146 VAL A HG22   3  
ATOM 4132  H HG23   . VAL B 2 59  ? 2.796   4.160   -5.989  1.00 0.00  ? 146 VAL A HG23   3  
ATOM 4133  N N      . GLU B 2 60  ? 1.735   5.477   -1.736  1.00 0.00  ? 147 GLU A N      3  
ATOM 4134  C CA     . GLU B 2 60  ? 2.180   5.222   -0.369  1.00 0.00  ? 147 GLU A CA     3  
ATOM 4135  C C      . GLU B 2 60  ? 1.450   4.007   0.255   1.00 0.00  ? 147 GLU A C      3  
ATOM 4136  O O      . GLU B 2 60  ? 0.399   4.136   0.880   1.00 0.00  ? 147 GLU A O      3  
ATOM 4137  C CB     . GLU B 2 60  ? 1.948   6.535   0.390   1.00 0.00  ? 147 GLU A CB     3  
ATOM 4138  C CG     . GLU B 2 60  ? 2.409   6.511   1.853   1.00 0.00  ? 147 GLU A CG     3  
ATOM 4139  C CD     . GLU B 2 60  ? 2.964   7.883   2.289   1.00 0.00  ? 147 GLU A CD     3  
ATOM 4140  O OE1    . GLU B 2 60  ? 2.377   8.928   1.922   1.00 0.00  ? 147 GLU A OE1    3  
ATOM 4141  O OE2    . GLU B 2 60  ? 4.008   7.932   2.983   1.00 0.00  ? 147 GLU A OE2    3  
ATOM 4142  H H      . GLU B 2 60  ? 0.786   5.198   -1.972  1.00 0.00  ? 147 GLU A H      3  
ATOM 4143  H HA     . GLU B 2 60  ? 3.248   5.006   -0.366  1.00 0.00  ? 147 GLU A HA     3  
ATOM 4144  H HB2    . GLU B 2 60  ? 2.522   7.312   -0.114  1.00 0.00  ? 147 GLU A HB2    3  
ATOM 4145  H HB3    . GLU B 2 60  ? 0.895   6.808   0.293   1.00 0.00  ? 147 GLU A HB3    3  
ATOM 4146  H HG2    . GLU B 2 60  ? 1.569   6.220   2.484   1.00 0.00  ? 147 GLU A HG2    3  
ATOM 4147  H HG3    . GLU B 2 60  ? 3.194   5.758   1.963   1.00 0.00  ? 147 GLU A HG3    3  
ATOM 4148  N N      . ILE B 2 61  ? 1.973   2.796   0.044   1.00 0.00  ? 148 ILE A N      3  
ATOM 4149  C CA     . ILE B 2 61  ? 1.476   1.525   0.623   1.00 0.00  ? 148 ILE A CA     3  
ATOM 4150  C C      . ILE B 2 61  ? 1.810   1.406   2.126   1.00 0.00  ? 148 ILE A C      3  
ATOM 4151  O O      . ILE B 2 61  ? 2.853   1.908   2.560   1.00 0.00  ? 148 ILE A O      3  
ATOM 4152  C CB     . ILE B 2 61  ? 2.044   0.369   -0.239  1.00 0.00  ? 148 ILE A CB     3  
ATOM 4153  C CG1    . ILE B 2 61  ? 1.003   -0.081  -1.280  1.00 0.00  ? 148 ILE A CG1    3  
ATOM 4154  C CG2    . ILE B 2 61  ? 2.593   -0.833  0.523   1.00 0.00  ? 148 ILE A CG2    3  
ATOM 4155  C CD1    . ILE B 2 61  ? -0.121  -0.953  -0.712  1.00 0.00  ? 148 ILE A CD1    3  
ATOM 4156  H H      . ILE B 2 61  ? 2.813   2.773   -0.516  1.00 0.00  ? 148 ILE A H      3  
ATOM 4157  H HA     . ILE B 2 61  ? 0.394   1.518   0.548   1.00 0.00  ? 148 ILE A HA     3  
ATOM 4158  H HB     . ILE B 2 61  ? 2.894   0.758   -0.795  1.00 0.00  ? 148 ILE A HB     3  
ATOM 4159  H HG12   . ILE B 2 61  ? 0.575   0.800   -1.759  1.00 0.00  ? 148 ILE A HG12   3  
ATOM 4160  H HG13   . ILE B 2 61  ? 1.503   -0.661  -2.049  1.00 0.00  ? 148 ILE A HG13   3  
ATOM 4161  H HG21   . ILE B 2 61  ? 3.452   -0.535  1.127   1.00 0.00  ? 148 ILE A HG21   3  
ATOM 4162  H HG22   . ILE B 2 61  ? 1.820   -1.256  1.170   1.00 0.00  ? 148 ILE A HG22   3  
ATOM 4163  H HG23   . ILE B 2 61  ? 2.936   -1.595  -0.185  1.00 0.00  ? 148 ILE A HG23   3  
ATOM 4164  H HD11   . ILE B 2 61  ? 0.281   -1.901  -0.344  1.00 0.00  ? 148 ILE A HD11   3  
ATOM 4165  H HD12   . ILE B 2 61  ? -0.620  -0.439  0.105   1.00 0.00  ? 148 ILE A HD12   3  
ATOM 4166  H HD13   . ILE B 2 61  ? -0.835  -1.153  -1.506  1.00 0.00  ? 148 ILE A HD13   3  
ATOM 4167  N N      . ILE B 2 62  ? 0.979   0.744   2.958   1.00 0.00  ? 149 ILE A N      3  
ATOM 4168  C CA     . ILE B 2 62  ? 1.113   0.788   4.407   1.00 0.00  ? 149 ILE A CA     3  
ATOM 4169  C C      . ILE B 2 62  ? 1.757   -0.550  4.799   1.00 0.00  ? 149 ILE A C      3  
ATOM 4170  O O      . ILE B 2 62  ? 1.062   -1.521  5.081   1.00 0.00  ? 149 ILE A O      3  
ATOM 4171  C CB     . ILE B 2 62  ? -0.294  1.070   4.984   1.00 0.00  ? 149 ILE A CB     3  
ATOM 4172  C CG1    . ILE B 2 62  ? -0.975  2.291   4.327   1.00 0.00  ? 149 ILE A CG1    3  
ATOM 4173  C CG2    . ILE B 2 62  ? -0.232  1.326   6.486   1.00 0.00  ? 149 ILE A CG2    3  
ATOM 4174  C CD1    . ILE B 2 62  ? -0.138  3.564   4.222   1.00 0.00  ? 149 ILE A CD1    3  
ATOM 4175  H H      . ILE B 2 62  ? 0.142   0.204   2.740   1.00 0.00  ? 149 ILE A H      3  
ATOM 4176  H HA     . ILE B 2 62  ? 1.746   1.616   4.746   1.00 0.00  ? 149 ILE A HA     3  
ATOM 4177  H HB     . ILE B 2 62  ? -0.937  0.202   4.811   1.00 0.00  ? 149 ILE A HB     3  
ATOM 4178  H HG12   . ILE B 2 62  ? -1.321  2.033   3.335   1.00 0.00  ? 149 ILE A HG12   3  
ATOM 4179  H HG13   . ILE B 2 62  ? -1.849  2.537   4.907   1.00 0.00  ? 149 ILE A HG13   3  
ATOM 4180  H HG21   . ILE B 2 62  ? 0.058   0.425   6.988   1.00 0.00  ? 149 ILE A HG21   3  
ATOM 4181  H HG22   . ILE B 2 62  ? 0.486   2.112   6.708   1.00 0.00  ? 149 ILE A HG22   3  
ATOM 4182  H HG23   . ILE B 2 62  ? -1.214  1.594   6.872   1.00 0.00  ? 149 ILE A HG23   3  
ATOM 4183  H HD11   . ILE B 2 62  ? 0.270   3.807   5.200   1.00 0.00  ? 149 ILE A HD11   3  
ATOM 4184  H HD12   . ILE B 2 62  ? 0.681   3.440   3.519   1.00 0.00  ? 149 ILE A HD12   3  
ATOM 4185  H HD13   . ILE B 2 62  ? -0.770  4.377   3.869   1.00 0.00  ? 149 ILE A HD13   3  
ATOM 4186  N N      . PHE B 2 63  ? 3.083   -0.674  4.681   1.00 0.00  ? 150 PHE A N      3  
ATOM 4187  C CA     . PHE B 2 63  ? 3.777   -1.974  4.761   1.00 0.00  ? 150 PHE A CA     3  
ATOM 4188  C C      . PHE B 2 63  ? 4.181   -2.388  6.188   1.00 0.00  ? 150 PHE A C      3  
ATOM 4189  O O      . PHE B 2 63  ? 4.297   -1.558  7.092   1.00 0.00  ? 150 PHE A O      3  
ATOM 4190  C CB     . PHE B 2 63  ? 5.001   -1.978  3.812   1.00 0.00  ? 150 PHE A CB     3  
ATOM 4191  C CG     . PHE B 2 63  ? 4.912   -2.875  2.581   1.00 0.00  ? 150 PHE A CG     3  
ATOM 4192  C CD1    . PHE B 2 63  ? 3.671   -3.216  2.012   1.00 0.00  ? 150 PHE A CD1    3  
ATOM 4193  C CD2    . PHE B 2 63  ? 6.093   -3.323  1.953   1.00 0.00  ? 150 PHE A CD2    3  
ATOM 4194  C CE1    . PHE B 2 63  ? 3.593   -3.978  0.836   1.00 0.00  ? 150 PHE A CE1    3  
ATOM 4195  C CE2    . PHE B 2 63  ? 6.021   -4.066  0.759   1.00 0.00  ? 150 PHE A CE2    3  
ATOM 4196  C CZ     . PHE B 2 63  ? 4.771   -4.376  0.199   1.00 0.00  ? 150 PHE A CZ     3  
ATOM 4197  H H      . PHE B 2 63  ? 3.598   0.134   4.370   1.00 0.00  ? 150 PHE A H      3  
ATOM 4198  H HA     . PHE B 2 63  ? 3.078   -2.738  4.422   1.00 0.00  ? 150 PHE A HA     3  
ATOM 4199  H HB2    . PHE B 2 63  ? 5.203   -0.962  3.467   1.00 0.00  ? 150 PHE A HB2    3  
ATOM 4200  H HB3    . PHE B 2 63  ? 5.883   -2.282  4.376   1.00 0.00  ? 150 PHE A HB3    3  
ATOM 4201  H HD1    . PHE B 2 63  ? 2.751   -2.845  2.418   1.00 0.00  ? 150 PHE A HD1    3  
ATOM 4202  H HD2    . PHE B 2 63  ? 7.059   -3.068  2.369   1.00 0.00  ? 150 PHE A HD2    3  
ATOM 4203  H HE1    . PHE B 2 63  ? 2.632   -4.209  0.395   1.00 0.00  ? 150 PHE A HE1    3  
ATOM 4204  H HE2    . PHE B 2 63  ? 6.932   -4.378  0.260   1.00 0.00  ? 150 PHE A HE2    3  
ATOM 4205  H HZ     . PHE B 2 63  ? 4.688   -4.894  -0.738  1.00 0.00  ? 150 PHE A HZ     3  
ATOM 4206  N N      . ASN B 2 64  ? 4.416   -3.691  6.375   1.00 0.00  ? 151 ASN A N      3  
ATOM 4207  C CA     . ASN B 2 64  ? 5.001   -4.343  7.547   1.00 0.00  ? 151 ASN A CA     3  
ATOM 4208  C C      . ASN B 2 64  ? 5.776   -5.610  7.107   1.00 0.00  ? 151 ASN A C      3  
ATOM 4209  O O      . ASN B 2 64  ? 5.903   -5.890  5.913   1.00 0.00  ? 151 ASN A O      3  
ATOM 4210  C CB     . ASN B 2 64  ? 3.894   -4.655  8.575   1.00 0.00  ? 151 ASN A CB     3  
ATOM 4211  C CG     . ASN B 2 64  ? 2.931   -5.743  8.128   1.00 0.00  ? 151 ASN A CG     3  
ATOM 4212  O OD1    . ASN B 2 64  ? 3.091   -6.910  8.454   1.00 0.00  ? 151 ASN A OD1    3  
ATOM 4213  N ND2    . ASN B 2 64  ? 1.906   -5.400  7.388   1.00 0.00  ? 151 ASN A ND2    3  
ATOM 4214  H H      . ASN B 2 64  ? 4.270   -4.327  5.586   1.00 0.00  ? 151 ASN A H      3  
ATOM 4215  H HA     . ASN B 2 64  ? 5.720   -3.662  8.002   1.00 0.00  ? 151 ASN A HA     3  
ATOM 4216  H HB2    . ASN B 2 64  ? 4.354   -4.972  9.512   1.00 0.00  ? 151 ASN A HB2    3  
ATOM 4217  H HB3    . ASN B 2 64  ? 3.336   -3.749  8.798   1.00 0.00  ? 151 ASN A HB3    3  
ATOM 4218  H HD21   . ASN B 2 64  ? 1.798   -4.460  7.054   1.00 0.00  ? 151 ASN A HD21   3  
ATOM 4219  H HD22   . ASN B 2 64  ? 1.251   -6.125  7.135   1.00 0.00  ? 151 ASN A HD22   3  
ATOM 4220  N N      . GLU B 2 65  ? 6.282   -6.397  8.060   1.00 0.00  ? 152 GLU A N      3  
ATOM 4221  C CA     . GLU B 2 65  ? 7.040   -7.635  7.800   1.00 0.00  ? 152 GLU A CA     3  
ATOM 4222  C C      . GLU B 2 65  ? 6.292   -8.643  6.901   1.00 0.00  ? 152 GLU A C      3  
ATOM 4223  O O      . GLU B 2 65  ? 6.917   -9.316  6.075   1.00 0.00  ? 152 GLU A O      3  
ATOM 4224  C CB     . GLU B 2 65  ? 7.412   -8.276  9.149   1.00 0.00  ? 152 GLU A CB     3  
ATOM 4225  C CG     . GLU B 2 65  ? 8.332   -9.500  9.017   1.00 0.00  ? 152 GLU A CG     3  
ATOM 4226  C CD     . GLU B 2 65  ? 8.754   -10.028 10.399  1.00 0.00  ? 152 GLU A CD     3  
ATOM 4227  O OE1    . GLU B 2 65  ? 8.016   -10.854 10.989  1.00 0.00  ? 152 GLU A OE1    3  
ATOM 4228  O OE2    . GLU B 2 65  ? 9.835   -9.635  10.904  1.00 0.00  ? 152 GLU A OE2    3  
ATOM 4229  H H      . GLU B 2 65  ? 6.160   -6.109  9.020   1.00 0.00  ? 152 GLU A H      3  
ATOM 4230  H HA     . GLU B 2 65  ? 7.967   -7.370  7.289   1.00 0.00  ? 152 GLU A HA     3  
ATOM 4231  H HB2    . GLU B 2 65  ? 7.921   -7.528  9.757   1.00 0.00  ? 152 GLU A HB2    3  
ATOM 4232  H HB3    . GLU B 2 65  ? 6.494   -8.574  9.663   1.00 0.00  ? 152 GLU A HB3    3  
ATOM 4233  H HG2    . GLU B 2 65  ? 7.809   -10.294 8.473   1.00 0.00  ? 152 GLU A HG2    3  
ATOM 4234  H HG3    . GLU B 2 65  ? 9.218   -9.223  8.435   1.00 0.00  ? 152 GLU A HG3    3  
ATOM 4235  N N      . ARG B 2 66  ? 4.959   -8.743  7.027   1.00 0.00  ? 153 ARG A N      3  
ATOM 4236  C CA     . ARG B 2 66  ? 4.123   -9.714  6.293   1.00 0.00  ? 153 ARG A CA     3  
ATOM 4237  C C      . ARG B 2 66  ? 3.674   -9.247  4.896   1.00 0.00  ? 153 ARG A C      3  
ATOM 4238  O O      . ARG B 2 66  ? 3.066   -10.037 4.170   1.00 0.00  ? 153 ARG A O      3  
ATOM 4239  C CB     . ARG B 2 66  ? 2.904   -10.139 7.132   1.00 0.00  ? 153 ARG A CB     3  
ATOM 4240  C CG     . ARG B 2 66  ? 3.223   -10.461 8.603   1.00 0.00  ? 153 ARG A CG     3  
ATOM 4241  C CD     . ARG B 2 66  ? 1.960   -11.025 9.258   1.00 0.00  ? 153 ARG A CD     3  
ATOM 4242  N NE     . ARG B 2 66  ? 2.066   -11.138 10.725  1.00 0.00  ? 153 ARG A NE     3  
ATOM 4243  C CZ     . ARG B 2 66  ? 1.051   -11.201 11.572  1.00 0.00  ? 153 ARG A CZ     3  
ATOM 4244  N NH1    . ARG B 2 66  ? -0.188  -11.134 11.176  1.00 0.00  ? 153 ARG A NH1    3  
ATOM 4245  N NH2    . ARG B 2 66  ? 1.267   -11.340 12.847  1.00 0.00  ? 153 ARG A NH2    3  
ATOM 4246  H H      . ARG B 2 66  ? 4.512   -8.123  7.699   1.00 0.00  ? 153 ARG A H      3  
ATOM 4247  H HA     . ARG B 2 66  ? 4.710   -10.620 6.129   1.00 0.00  ? 153 ARG A HA     3  
ATOM 4248  H HB2    . ARG B 2 66  ? 2.117   -9.382  7.088   1.00 0.00  ? 153 ARG A HB2    3  
ATOM 4249  H HB3    . ARG B 2 66  ? 2.502   -11.037 6.671   1.00 0.00  ? 153 ARG A HB3    3  
ATOM 4250  H HG2    . ARG B 2 66  ? 4.024   -11.200 8.659   1.00 0.00  ? 153 ARG A HG2    3  
ATOM 4251  H HG3    . ARG B 2 66  ? 3.523   -9.552  9.127   1.00 0.00  ? 153 ARG A HG3    3  
ATOM 4252  H HD2    . ARG B 2 66  ? 1.136   -10.359 9.008   1.00 0.00  ? 153 ARG A HD2    3  
ATOM 4253  H HD3    . ARG B 2 66  ? 1.766   -12.013 8.841   1.00 0.00  ? 153 ARG A HD3    3  
ATOM 4254  H HE     . ARG B 2 66  ? 2.990   -11.213 11.124  1.00 0.00  ? 153 ARG A HE     3  
ATOM 4255  H HH11   . ARG B 2 66  ? -0.383  -11.025 10.193  1.00 0.00  ? 153 ARG A HH11   3  
ATOM 4256  H HH12   . ARG B 2 66  ? -0.954  -11.171 11.827  1.00 0.00  ? 153 ARG A HH12   3  
ATOM 4257  H HH21   . ARG B 2 66  ? 2.208   -11.394 13.202  1.00 0.00  ? 153 ARG A HH21   3  
ATOM 4258  H HH22   . ARG B 2 66  ? 0.492   -11.398 13.487  1.00 0.00  ? 153 ARG A HH22   3  
ATOM 4259  N N      . GLY B 2 67  ? 3.943   -7.995  4.507   1.00 0.00  ? 154 GLY A N      3  
ATOM 4260  C CA     . GLY B 2 67  ? 3.433   -7.368  3.278   1.00 0.00  ? 154 GLY A CA     3  
ATOM 4261  C C      . GLY B 2 67  ? 2.685   -6.083  3.623   1.00 0.00  ? 154 GLY A C      3  
ATOM 4262  O O      . GLY B 2 67  ? 3.090   -5.355  4.528   1.00 0.00  ? 154 GLY A O      3  
ATOM 4263  H H      . GLY B 2 67  ? 4.419   -7.372  5.152   1.00 0.00  ? 154 GLY A H      3  
ATOM 4264  H HA2    . GLY B 2 67  ? 4.266   -7.118  2.623   1.00 0.00  ? 154 GLY A HA2    3  
ATOM 4265  H HA3    . GLY B 2 67  ? 2.761   -8.042  2.744   1.00 0.00  ? 154 GLY A HA3    3  
ATOM 4266  N N      . SER B 2 68  ? 1.586   -5.781  2.932   1.00 0.00  ? 155 SER A N      3  
ATOM 4267  C CA     . SER B 2 68  ? 0.695   -4.690  3.349   1.00 0.00  ? 155 SER A CA     3  
ATOM 4268  C C      . SER B 2 68  ? 0.001   -4.966  4.696   1.00 0.00  ? 155 SER A C      3  
ATOM 4269  O O      . SER B 2 68  ? -0.206  -6.108  5.107   1.00 0.00  ? 155 SER A O      3  
ATOM 4270  C CB     . SER B 2 68  ? -0.315  -4.378  2.239   1.00 0.00  ? 155 SER A CB     3  
ATOM 4271  O OG     . SER B 2 68  ? -1.075  -3.230  2.566   1.00 0.00  ? 155 SER A OG     3  
ATOM 4272  H H      . SER B 2 68  ? 1.318   -6.378  2.155   1.00 0.00  ? 155 SER A H      3  
ATOM 4273  H HA     . SER B 2 68  ? 1.289   -3.799  3.489   1.00 0.00  ? 155 SER A HA     3  
ATOM 4274  H HB2    . SER B 2 68  ? 0.205   -4.215  1.295   1.00 0.00  ? 155 SER A HB2    3  
ATOM 4275  H HB3    . SER B 2 68  ? -0.991  -5.222  2.126   1.00 0.00  ? 155 SER A HB3    3  
ATOM 4276  H HG     . SER B 2 68  ? -0.646  -2.438  2.192   1.00 0.00  ? 155 SER A HG     3  
ATOM 4277  N N      . LYS B 2 69  ? -0.429  -3.887  5.360   1.00 0.00  ? 156 LYS A N      3  
ATOM 4278  C CA     . LYS B 2 69  ? -1.500  -3.834  6.373   1.00 0.00  ? 156 LYS A CA     3  
ATOM 4279  C C      . LYS B 2 69  ? -2.905  -4.053  5.791   1.00 0.00  ? 156 LYS A C      3  
ATOM 4280  O O      . LYS B 2 69  ? -3.886  -4.110  6.532   1.00 0.00  ? 156 LYS A O      3  
ATOM 4281  C CB     . LYS B 2 69  ? -1.382  -2.475  7.099   1.00 0.00  ? 156 LYS A CB     3  
ATOM 4282  C CG     . LYS B 2 69  ? -0.602  -2.703  8.413   1.00 0.00  ? 156 LYS A CG     3  
ATOM 4283  C CD     . LYS B 2 69  ? 0.116   -1.483  9.004   1.00 0.00  ? 156 LYS A CD     3  
ATOM 4284  C CE     . LYS B 2 69  ? 1.444   -1.243  8.271   1.00 0.00  ? 156 LYS A CE     3  
ATOM 4285  N NZ     . LYS B 2 69  ? 2.231   -0.148  8.898   1.00 0.00  ? 156 LYS A NZ     3  
ATOM 4286  H H      . LYS B 2 69  ? -0.119  -2.995  4.982   1.00 0.00  ? 156 LYS A H      3  
ATOM 4287  H HA     . LYS B 2 69  ? -1.370  -4.651  7.088   1.00 0.00  ? 156 LYS A HA     3  
ATOM 4288  H HB2    . LYS B 2 69  ? -0.913  -1.732  6.438   1.00 0.00  ? 156 LYS A HB2    3  
ATOM 4289  H HB3    . LYS B 2 69  ? -2.367  -2.086  7.351   1.00 0.00  ? 156 LYS A HB3    3  
ATOM 4290  H HG2    . LYS B 2 69  ? -1.314  -3.073  9.152   1.00 0.00  ? 156 LYS A HG2    3  
ATOM 4291  H HG3    . LYS B 2 69  ? 0.148   -3.479  8.271   1.00 0.00  ? 156 LYS A HG3    3  
ATOM 4292  H HD2    . LYS B 2 69  ? -0.528  -0.607  8.951   1.00 0.00  ? 156 LYS A HD2    3  
ATOM 4293  H HD3    . LYS B 2 69  ? 0.328   -1.690  10.053  1.00 0.00  ? 156 LYS A HD3    3  
ATOM 4294  H HE2    . LYS B 2 69  ? 2.028   -2.167  8.292   1.00 0.00  ? 156 LYS A HE2    3  
ATOM 4295  H HE3    . LYS B 2 69  ? 1.243   -1.016  7.214   1.00 0.00  ? 156 LYS A HE3    3  
ATOM 4296  H HZ1    . LYS B 2 69  ? 1.727   0.745   8.891   1.00 0.00  ? 156 LYS A HZ1    3  
ATOM 4297  H HZ2    . LYS B 2 69  ? 2.434   -0.351  9.864   1.00 0.00  ? 156 LYS A HZ2    3  
ATOM 4298  H HZ3    . LYS B 2 69  ? 3.113   -0.029  8.415   1.00 0.00  ? 156 LYS A HZ3    3  
ATOM 4299  N N      . GLY B 2 70  ? -2.992  -4.210  4.470   1.00 0.00  ? 157 GLY A N      3  
ATOM 4300  C CA     . GLY B 2 70  ? -4.196  -4.464  3.686   1.00 0.00  ? 157 GLY A CA     3  
ATOM 4301  C C      . GLY B 2 70  ? -4.672  -3.241  2.901   1.00 0.00  ? 157 GLY A C      3  
ATOM 4302  O O      . GLY B 2 70  ? -5.742  -3.291  2.296   1.00 0.00  ? 157 GLY A O      3  
ATOM 4303  H H      . GLY B 2 70  ? -2.133  -4.079  3.955   1.00 0.00  ? 157 GLY A H      3  
ATOM 4304  H HA2    . GLY B 2 70  ? -3.998  -5.271  2.978   1.00 0.00  ? 157 GLY A HA2    3  
ATOM 4305  H HA3    . GLY B 2 70  ? -5.003  -4.781  4.345   1.00 0.00  ? 157 GLY A HA3    3  
ATOM 4306  N N      . PHE B 2 71  ? -3.906  -2.147  2.923   1.00 0.00  ? 158 PHE A N      3  
ATOM 4307  C CA     . PHE B 2 71  ? -4.252  -0.891  2.277   1.00 0.00  ? 158 PHE A CA     3  
ATOM 4308  C C      . PHE B 2 71  ? -3.022  -0.066  1.871   1.00 0.00  ? 158 PHE A C      3  
ATOM 4309  O O      . PHE B 2 71  ? -1.889  -0.263  2.335   1.00 0.00  ? 158 PHE A O      3  
ATOM 4310  C CB     . PHE B 2 71  ? -5.239  -0.084  3.153   1.00 0.00  ? 158 PHE A CB     3  
ATOM 4311  C CG     . PHE B 2 71  ? -4.699  0.737   4.300   1.00 0.00  ? 158 PHE A CG     3  
ATOM 4312  C CD1    . PHE B 2 71  ? -4.414  0.113   5.527   1.00 0.00  ? 158 PHE A CD1    3  
ATOM 4313  C CD2    . PHE B 2 71  ? -4.606  2.141   4.186   1.00 0.00  ? 158 PHE A CD2    3  
ATOM 4314  C CE1    . PHE B 2 71  ? -4.032  0.890   6.631   1.00 0.00  ? 158 PHE A CE1    3  
ATOM 4315  C CE2    . PHE B 2 71  ? -4.258  2.934   5.299   1.00 0.00  ? 158 PHE A CE2    3  
ATOM 4316  C CZ     . PHE B 2 71  ? -3.955  2.290   6.508   1.00 0.00  ? 158 PHE A CZ     3  
ATOM 4317  H H      . PHE B 2 71  ? -2.951  -2.242  3.242   1.00 0.00  ? 158 PHE A H      3  
ATOM 4318  H HA     . PHE B 2 71  ? -4.771  -1.153  1.358   1.00 0.00  ? 158 PHE A HA     3  
ATOM 4319  H HB2    . PHE B 2 71  ? -5.815  0.574   2.517   1.00 0.00  ? 158 PHE A HB2    3  
ATOM 4320  H HB3    . PHE B 2 71  ? -5.986  -0.753  3.556   1.00 0.00  ? 158 PHE A HB3    3  
ATOM 4321  H HD1    . PHE B 2 71  ? -4.504  -0.962  5.630   1.00 0.00  ? 158 PHE A HD1    3  
ATOM 4322  H HD2    . PHE B 2 71  ? -4.830  2.614   3.240   1.00 0.00  ? 158 PHE A HD2    3  
ATOM 4323  H HE1    . PHE B 2 71  ? -3.804  0.410   7.571   1.00 0.00  ? 158 PHE A HE1    3  
ATOM 4324  H HE2    . PHE B 2 71  ? -4.181  4.022   5.229   1.00 0.00  ? 158 PHE A HE2    3  
ATOM 4325  H HZ     . PHE B 2 71  ? -3.616  2.875   7.340   1.00 0.00  ? 158 PHE A HZ     3  
ATOM 4326  N N      . GLY B 2 72  ? -3.297  0.895   0.996   1.00 0.00  ? 159 GLY A N      3  
ATOM 4327  C CA     . GLY B 2 72  ? -2.390  1.940   0.556   1.00 0.00  ? 159 GLY A CA     3  
ATOM 4328  C C      . GLY B 2 72  ? -3.070  3.306   0.528   1.00 0.00  ? 159 GLY A C      3  
ATOM 4329  O O      . GLY B 2 72  ? -4.236  3.474   0.889   1.00 0.00  ? 159 GLY A O      3  
ATOM 4330  H H      . GLY B 2 72  ? -4.258  0.934   0.667   1.00 0.00  ? 159 GLY A H      3  
ATOM 4331  H HA2    . GLY B 2 72  ? -1.543  2.005   1.233   1.00 0.00  ? 159 GLY A HA2    3  
ATOM 4332  H HA3    . GLY B 2 72  ? -2.016  1.701   -0.441  1.00 0.00  ? 159 GLY A HA3    3  
ATOM 4333  N N      . PHE B 2 73  ? -2.310  4.285   0.075   1.00 0.00  ? 160 PHE A N      3  
ATOM 4334  C CA     . PHE B 2 73  ? -2.667  5.675   -0.124  1.00 0.00  ? 160 PHE A CA     3  
ATOM 4335  C C      . PHE B 2 73  ? -2.143  6.144   -1.492  1.00 0.00  ? 160 PHE A C      3  
ATOM 4336  O O      . PHE B 2 73  ? -1.086  5.695   -1.946  1.00 0.00  ? 160 PHE A O      3  
ATOM 4337  C CB     . PHE B 2 73  ? -2.090  6.485   1.050   1.00 0.00  ? 160 PHE A CB     3  
ATOM 4338  C CG     . PHE B 2 73  ? -3.154  7.046   1.960   1.00 0.00  ? 160 PHE A CG     3  
ATOM 4339  C CD1    . PHE B 2 73  ? -3.684  8.308   1.650   1.00 0.00  ? 160 PHE A CD1    3  
ATOM 4340  C CD2    . PHE B 2 73  ? -3.599  6.358   3.112   1.00 0.00  ? 160 PHE A CD2    3  
ATOM 4341  C CE1    . PHE B 2 73  ? -4.634  8.893   2.491   1.00 0.00  ? 160 PHE A CE1    3  
ATOM 4342  C CE2    . PHE B 2 73  ? -4.563  6.937   3.947   1.00 0.00  ? 160 PHE A CE2    3  
ATOM 4343  C CZ     . PHE B 2 73  ? -5.080  8.203   3.632   1.00 0.00  ? 160 PHE A CZ     3  
ATOM 4344  H H      . PHE B 2 73  ? -1.338  4.075   -0.070  1.00 0.00  ? 160 PHE A H      3  
ATOM 4345  H HA     . PHE B 2 73  ? -3.749  5.763   -0.119  1.00 0.00  ? 160 PHE A HA     3  
ATOM 4346  H HB2    . PHE B 2 73  ? -1.405  5.882   1.647   1.00 0.00  ? 160 PHE A HB2    3  
ATOM 4347  H HB3    . PHE B 2 73  ? -1.504  7.314   0.652   1.00 0.00  ? 160 PHE A HB3    3  
ATOM 4348  H HD1    . PHE B 2 73  ? -3.337  8.847   0.781   1.00 0.00  ? 160 PHE A HD1    3  
ATOM 4349  H HD2    . PHE B 2 73  ? -3.206  5.399   3.419   1.00 0.00  ? 160 PHE A HD2    3  
ATOM 4350  H HE1    . PHE B 2 73  ? -4.976  9.888   2.267   1.00 0.00  ? 160 PHE A HE1    3  
ATOM 4351  H HE2    . PHE B 2 73  ? -4.857  6.427   4.859   1.00 0.00  ? 160 PHE A HE2    3  
ATOM 4352  H HZ     . PHE B 2 73  ? -5.785  8.676   4.292   1.00 0.00  ? 160 PHE A HZ     3  
ATOM 4353  N N      . VAL B 2 74  ? -2.871  7.039   -2.168  1.00 0.00  ? 161 VAL A N      3  
ATOM 4354  C CA     . VAL B 2 74  ? -2.501  7.618   -3.474  1.00 0.00  ? 161 VAL A CA     3  
ATOM 4355  C C      . VAL B 2 74  ? -3.037  9.046   -3.635  1.00 0.00  ? 161 VAL A C      3  
ATOM 4356  O O      . VAL B 2 74  ? -3.947  9.447   -2.918  1.00 0.00  ? 161 VAL A O      3  
ATOM 4357  C CB     . VAL B 2 74  ? -2.898  6.643   -4.607  1.00 0.00  ? 161 VAL A CB     3  
ATOM 4358  C CG1    . VAL B 2 74  ? -4.337  6.265   -4.757  1.00 0.00  ? 161 VAL A CG1    3  
ATOM 4359  C CG2    . VAL B 2 74  ? -2.516  7.084   -6.023  1.00 0.00  ? 161 VAL A CG2    3  
ATOM 4360  H H      . VAL B 2 74  ? -3.763  7.306   -1.764  1.00 0.00  ? 161 VAL A H      3  
ATOM 4361  H HA     . VAL B 2 74  ? -1.419  7.708   -3.501  1.00 0.00  ? 161 VAL A HA     3  
ATOM 4362  H HB     . VAL B 2 74  ? -2.428  5.684   -4.378  1.00 0.00  ? 161 VAL A HB     3  
ATOM 4363  H HG11   . VAL B 2 74  ? -4.777  6.122   -3.780  1.00 0.00  ? 161 VAL A HG11   3  
ATOM 4364  H HG12   . VAL B 2 74  ? -4.857  7.024   -5.338  1.00 0.00  ? 161 VAL A HG12   3  
ATOM 4365  H HG13   . VAL B 2 74  ? -4.277  5.313   -5.290  1.00 0.00  ? 161 VAL A HG13   3  
ATOM 4366  H HG21   . VAL B 2 74  ? -3.132  7.918   -6.362  1.00 0.00  ? 161 VAL A HG21   3  
ATOM 4367  H HG22   . VAL B 2 74  ? -1.482  7.376   -6.009  1.00 0.00  ? 161 VAL A HG22   3  
ATOM 4368  H HG23   . VAL B 2 74  ? -2.655  6.266   -6.731  1.00 0.00  ? 161 VAL A HG23   3  
ATOM 4369  N N      . THR B 2 75  ? -2.458  9.848   -4.529  1.00 0.00  ? 162 THR A N      3  
ATOM 4370  C CA     . THR B 2 75  ? -2.671  11.315  -4.602  1.00 0.00  ? 162 THR A CA     3  
ATOM 4371  C C      . THR B 2 75  ? -3.227  11.704  -5.966  1.00 0.00  ? 162 THR A C      3  
ATOM 4372  O O      . THR B 2 75  ? -2.509  11.636  -6.966  1.00 0.00  ? 162 THR A O      3  
ATOM 4373  C CB     . THR B 2 75  ? -1.366  12.054  -4.301  1.00 0.00  ? 162 THR A CB     3  
ATOM 4374  O OG1    . THR B 2 75  ? -0.863  11.638  -3.051  1.00 0.00  ? 162 THR A OG1    3  
ATOM 4375  C CG2    . THR B 2 75  ? -1.510  13.573  -4.200  1.00 0.00  ? 162 THR A CG2    3  
ATOM 4376  H H      . THR B 2 75  ? -1.693  9.434   -5.065  1.00 0.00  ? 162 THR A H      3  
ATOM 4377  H HA     . THR B 2 75  ? -3.395  11.617  -3.847  1.00 0.00  ? 162 THR A HA     3  
ATOM 4378  H HB     . THR B 2 75  ? -0.647  11.810  -5.082  1.00 0.00  ? 162 THR A HB     3  
ATOM 4379  H HG1    . THR B 2 75  ? -0.598  10.707  -3.153  1.00 0.00  ? 162 THR A HG1    3  
ATOM 4380  H HG21   . THR B 2 75  ? -1.968  13.981  -5.100  1.00 0.00  ? 162 THR A HG21   3  
ATOM 4381  H HG22   . THR B 2 75  ? -2.106  13.840  -3.328  1.00 0.00  ? 162 THR A HG22   3  
ATOM 4382  H HG23   . THR B 2 75  ? -0.516  14.009  -4.091  1.00 0.00  ? 162 THR A HG23   3  
ATOM 4383  N N      . PHE B 2 76  ? -4.537  11.981  -6.019  1.00 0.00  ? 163 PHE A N      3  
ATOM 4384  C CA     . PHE B 2 76  ? -5.337  11.582  -7.181  1.00 0.00  ? 163 PHE A CA     3  
ATOM 4385  C C      . PHE B 2 76  ? -6.618  12.371  -7.490  1.00 0.00  ? 163 PHE A C      3  
ATOM 4386  O O      . PHE B 2 76  ? -6.874  12.767  -8.623  1.00 0.00  ? 163 PHE A O      3  
ATOM 4387  C CB     . PHE B 2 76  ? -5.691  10.111  -6.951  1.00 0.00  ? 163 PHE A CB     3  
ATOM 4388  C CG     . PHE B 2 76  ? -6.217  9.422   -8.189  1.00 0.00  ? 163 PHE A CG     3  
ATOM 4389  C CD1    . PHE B 2 76  ? -5.303  9.056   -9.187  1.00 0.00  ? 163 PHE A CD1    3  
ATOM 4390  C CD2    . PHE B 2 76  ? -7.582  9.132   -8.351  1.00 0.00  ? 163 PHE A CD2    3  
ATOM 4391  C CE1    . PHE B 2 76  ? -5.736  8.346   -10.316 1.00 0.00  ? 163 PHE A CE1    3  
ATOM 4392  C CE2    . PHE B 2 76  ? -8.020  8.448   -9.498  1.00 0.00  ? 163 PHE A CE2    3  
ATOM 4393  C CZ     . PHE B 2 76  ? -7.099  8.053   -10.483 1.00 0.00  ? 163 PHE A CZ     3  
ATOM 4394  H H      . PHE B 2 76  ? -5.028  12.088  -5.142  1.00 0.00  ? 163 PHE A H      3  
ATOM 4395  H HA     . PHE B 2 76  ? -4.727  11.646  -8.057  1.00 0.00  ? 163 PHE A HA     3  
ATOM 4396  H HB2    . PHE B 2 76  ? -4.793  9.580   -6.631  1.00 0.00  ? 163 PHE A HB2    3  
ATOM 4397  H HB3    . PHE B 2 76  ? -6.420  10.043  -6.144  1.00 0.00  ? 163 PHE A HB3    3  
ATOM 4398  H HD1    . PHE B 2 76  ? -4.262  9.316   -9.065  1.00 0.00  ? 163 PHE A HD1    3  
ATOM 4399  H HD2    . PHE B 2 76  ? -8.296  9.435   -7.600  1.00 0.00  ? 163 PHE A HD2    3  
ATOM 4400  H HE1    . PHE B 2 76  ? -5.006  8.009   -11.033 1.00 0.00  ? 163 PHE A HE1    3  
ATOM 4401  H HE2    . PHE B 2 76  ? -9.062  8.209   -9.602  1.00 0.00  ? 163 PHE A HE2    3  
ATOM 4402  H HZ     . PHE B 2 76  ? -7.435  7.510   -11.354 1.00 0.00  ? 163 PHE A HZ     3  
ATOM 4403  N N      . GLU B 2 77  ? -7.464  12.514  -6.478  1.00 0.00  ? 164 GLU A N      3  
ATOM 4404  C CA     . GLU B 2 77  ? -8.925  12.314  -6.532  1.00 0.00  ? 164 GLU A CA     3  
ATOM 4405  C C      . GLU B 2 77  ? -9.730  13.404  -7.267  1.00 0.00  ? 164 GLU A C      3  
ATOM 4406  O O      . GLU B 2 77  ? -10.906 13.216  -7.572  1.00 0.00  ? 164 GLU A O      3  
ATOM 4407  C CB     . GLU B 2 77  ? -9.400  12.156  -5.068  1.00 0.00  ? 164 GLU A CB     3  
ATOM 4408  C CG     . GLU B 2 77  ? -10.907 11.900  -4.882  1.00 0.00  ? 164 GLU A CG     3  
ATOM 4409  C CD     . GLU B 2 77  ? -11.283 11.548  -3.429  1.00 0.00  ? 164 GLU A CD     3  
ATOM 4410  O OE1    . GLU B 2 77  ? -10.806 12.224  -2.488  1.00 0.00  ? 164 GLU A OE1    3  
ATOM 4411  O OE2    . GLU B 2 77  ? -12.107 10.624  -3.236  1.00 0.00  ? 164 GLU A OE2    3  
ATOM 4412  H H      . GLU B 2 77  ? -6.997  12.321  -5.609  1.00 0.00  ? 164 GLU A H      3  
ATOM 4413  H HA     . GLU B 2 77  ? -9.141  11.379  -7.047  1.00 0.00  ? 164 GLU A HA     3  
ATOM 4414  H HB2    . GLU B 2 77  ? -8.860  11.313  -4.632  1.00 0.00  ? 164 GLU A HB2    3  
ATOM 4415  H HB3    . GLU B 2 77  ? -9.127  13.053  -4.513  1.00 0.00  ? 164 GLU A HB3    3  
ATOM 4416  H HG2    . GLU B 2 77  ? -11.468 12.798  -5.154  1.00 0.00  ? 164 GLU A HG2    3  
ATOM 4417  H HG3    . GLU B 2 77  ? -11.206 11.090  -5.552  1.00 0.00  ? 164 GLU A HG3    3  
ATOM 4418  N N      . ASN B 2 78  ? -9.132  14.571  -7.515  1.00 0.00  ? 165 ASN A N      3  
ATOM 4419  C CA     . ASN B 2 78  ? -9.910  15.814  -7.464  1.00 0.00  ? 165 ASN A CA     3  
ATOM 4420  C C      . ASN B 2 78  ? -10.598 16.277  -8.772  1.00 0.00  ? 165 ASN A C      3  
ATOM 4421  O O      . ASN B 2 78  ? -11.476 17.141  -8.699  1.00 0.00  ? 165 ASN A O      3  
ATOM 4422  C CB     . ASN B 2 78  ? -9.074  16.930  -6.800  1.00 0.00  ? 165 ASN A CB     3  
ATOM 4423  C CG     . ASN B 2 78  ? -9.358  17.034  -5.311  1.00 0.00  ? 165 ASN A CG     3  
ATOM 4424  O OD1    . ASN B 2 78  ? -9.784  18.059  -4.800  1.00 0.00  ? 165 ASN A OD1    3  
ATOM 4425  N ND2    . ASN B 2 78  ? -9.172  15.966  -4.564  1.00 0.00  ? 165 ASN A ND2    3  
ATOM 4426  H H      . ASN B 2 78  ? -8.127  14.573  -7.411  1.00 0.00  ? 165 ASN A H      3  
ATOM 4427  H HA     . ASN B 2 78  ? -10.738 15.605  -6.785  1.00 0.00  ? 165 ASN A HA     3  
ATOM 4428  H HB2    . ASN B 2 78  ? -8.009  16.772  -6.957  1.00 0.00  ? 165 ASN A HB2    3  
ATOM 4429  H HB3    . ASN B 2 78  ? -9.334  17.892  -7.245  1.00 0.00  ? 165 ASN A HB3    3  
ATOM 4430  H HD21   . ASN B 2 78  ? -8.840  15.102  -4.955  1.00 0.00  ? 165 ASN A HD21   3  
ATOM 4431  H HD22   . ASN B 2 78  ? -9.433  16.038  -3.592  1.00 0.00  ? 165 ASN A HD22   3  
ATOM 4432  N N      . SER B 2 79  ? -10.274 15.723  -9.947  1.00 0.00  ? 166 SER A N      3  
ATOM 4433  C CA     . SER B 2 79  ? -11.104 15.908  -11.156 1.00 0.00  ? 166 SER A CA     3  
ATOM 4434  C C      . SER B 2 79  ? -12.395 15.080  -11.104 1.00 0.00  ? 166 SER A C      3  
ATOM 4435  O O      . SER B 2 79  ? -12.491 14.090  -10.373 1.00 0.00  ? 166 SER A O      3  
ATOM 4436  C CB     . SER B 2 79  ? -10.329 15.554  -12.432 1.00 0.00  ? 166 SER A CB     3  
ATOM 4437  O OG     . SER B 2 79  ? -9.768  14.259  -12.370 1.00 0.00  ? 166 SER A OG     3  
ATOM 4438  H H      . SER B 2 79  ? -9.581  14.988  -9.958  1.00 0.00  ? 166 SER A H      3  
ATOM 4439  H HA     . SER B 2 79  ? -11.388 16.960  -11.234 1.00 0.00  ? 166 SER A HA     3  
ATOM 4440  H HB2    . SER B 2 79  ? -11.008 15.585  -13.288 1.00 0.00  ? 166 SER A HB2    3  
ATOM 4441  H HB3    . SER B 2 79  ? -9.533  16.288  -12.578 1.00 0.00  ? 166 SER A HB3    3  
ATOM 4442  H HG     . SER B 2 79  ? -9.106  14.188  -13.081 1.00 0.00  ? 166 SER A HG     3  
ATOM 4443  N N      . ALA B 2 80  ? -13.374 15.420  -11.949 1.00 0.00  ? 167 ALA A N      3  
ATOM 4444  C CA     . ALA B 2 80  ? -14.524 14.550  -12.202 1.00 0.00  ? 167 ALA A CA     3  
ATOM 4445  C C      . ALA B 2 80  ? -14.088 13.164  -12.704 1.00 0.00  ? 167 ALA A C      3  
ATOM 4446  O O      . ALA B 2 80  ? -14.658 12.151  -12.298 1.00 0.00  ? 167 ALA A O      3  
ATOM 4447  C CB     . ALA B 2 80  ? -15.457 15.213  -13.220 1.00 0.00  ? 167 ALA A CB     3  
ATOM 4448  H H      . ALA B 2 80  ? -13.271 16.262  -12.500 1.00 0.00  ? 167 ALA A H      3  
ATOM 4449  H HA     . ALA B 2 80  ? -15.072 14.407  -11.267 1.00 0.00  ? 167 ALA A HA     3  
ATOM 4450  H HB1    . ALA B 2 80  ? -15.830 16.159  -12.822 1.00 0.00  ? 167 ALA A HB1    3  
ATOM 4451  H HB2    . ALA B 2 80  ? -14.932 15.387  -14.159 1.00 0.00  ? 167 ALA A HB2    3  
ATOM 4452  H HB3    . ALA B 2 80  ? -16.299 14.544  -13.413 1.00 0.00  ? 167 ALA A HB3    3  
ATOM 4453  N N      . ASP B 2 81  ? -13.062 13.110  -13.564 1.00 0.00  ? 168 ASP A N      3  
ATOM 4454  C CA     . ASP B 2 81  ? -12.548 11.844  -14.083 1.00 0.00  ? 168 ASP A CA     3  
ATOM 4455  C C      . ASP B 2 81  ? -11.815 11.006  -13.022 1.00 0.00  ? 168 ASP A C      3  
ATOM 4456  O O      . ASP B 2 81  ? -11.944 9.784   -13.020 1.00 0.00  ? 168 ASP A O      3  
ATOM 4457  C CB     . ASP B 2 81  ? -11.681 12.059  -15.324 1.00 0.00  ? 168 ASP A CB     3  
ATOM 4458  C CG     . ASP B 2 81  ? -11.478 10.723  -16.058 1.00 0.00  ? 168 ASP A CG     3  
ATOM 4459  O OD1    . ASP B 2 81  ? -12.471 10.176  -16.596 1.00 0.00  ? 168 ASP A OD1    3  
ATOM 4460  O OD2    . ASP B 2 81  ? -10.327 10.230  -16.107 1.00 0.00  ? 168 ASP A OD2    3  
ATOM 4461  H H      . ASP B 2 81  ? -12.657 13.980  -13.878 1.00 0.00  ? 168 ASP A H      3  
ATOM 4462  H HA     . ASP B 2 81  ? -13.411 11.272  -14.405 1.00 0.00  ? 168 ASP A HA     3  
ATOM 4463  H HB2    . ASP B 2 81  ? -12.184 12.756  -16.000 1.00 0.00  ? 168 ASP A HB2    3  
ATOM 4464  H HB3    . ASP B 2 81  ? -10.724 12.494  -15.034 1.00 0.00  ? 168 ASP A HB3    3  
ATOM 4465  N N      . ALA B 2 82  ? -11.092 11.632  -12.086 1.00 0.00  ? 169 ALA A N      3  
ATOM 4466  C CA     . ALA B 2 82  ? -10.485 10.944  -10.945 1.00 0.00  ? 169 ALA A CA     3  
ATOM 4467  C C      . ALA B 2 82  ? -11.523 10.472  -9.900  1.00 0.00  ? 169 ALA A C      3  
ATOM 4468  O O      . ALA B 2 82  ? -11.355 9.406   -9.310  1.00 0.00  ? 169 ALA A O      3  
ATOM 4469  C CB     . ALA B 2 82  ? -9.438  11.861  -10.320 1.00 0.00  ? 169 ALA A CB     3  
ATOM 4470  H H      . ALA B 2 82  ? -10.985 12.638  -12.140 1.00 0.00  ? 169 ALA A H      3  
ATOM 4471  H HA     . ALA B 2 82  ? -9.962  10.060  -11.309 1.00 0.00  ? 169 ALA A HA     3  
ATOM 4472  H HB1    . ALA B 2 82  ? -8.650  12.070  -11.042 1.00 0.00  ? 169 ALA A HB1    3  
ATOM 4473  H HB2    . ALA B 2 82  ? -9.898  12.796  -10.008 1.00 0.00  ? 169 ALA A HB2    3  
ATOM 4474  H HB3    . ALA B 2 82  ? -8.992  11.366  -9.459  1.00 0.00  ? 169 ALA A HB3    3  
ATOM 4475  N N      . ASP B 2 83  ? -12.626 11.202  -9.705  1.00 0.00  ? 170 ASP A N      3  
ATOM 4476  C CA     . ASP B 2 83  ? -13.775 10.734  -8.914  1.00 0.00  ? 170 ASP A CA     3  
ATOM 4477  C C      . ASP B 2 83  ? -14.433 9.511   -9.576  1.00 0.00  ? 170 ASP A C      3  
ATOM 4478  O O      . ASP B 2 83  ? -14.522 8.449   -8.968  1.00 0.00  ? 170 ASP A O      3  
ATOM 4479  C CB     . ASP B 2 83  ? -14.787 11.868  -8.714  1.00 0.00  ? 170 ASP A CB     3  
ATOM 4480  C CG     . ASP B 2 83  ? -15.913 11.450  -7.756  1.00 0.00  ? 170 ASP A CG     3  
ATOM 4481  O OD1    . ASP B 2 83  ? -15.678 11.419  -6.527  1.00 0.00  ? 170 ASP A OD1    3  
ATOM 4482  O OD2    . ASP B 2 83  ? -17.042 11.171  -8.230  1.00 0.00  ? 170 ASP A OD2    3  
ATOM 4483  H H      . ASP B 2 83  ? -12.661 12.122  -10.130 1.00 0.00  ? 170 ASP A H      3  
ATOM 4484  H HA     . ASP B 2 83  ? -13.417 10.429  -7.929  1.00 0.00  ? 170 ASP A HA     3  
ATOM 4485  H HB2    . ASP B 2 83  ? -14.275 12.739  -8.301  1.00 0.00  ? 170 ASP A HB2    3  
ATOM 4486  H HB3    . ASP B 2 83  ? -15.214 12.142  -9.678  1.00 0.00  ? 170 ASP A HB3    3  
ATOM 4487  N N      . ARG B 2 84  ? -14.819 9.628   -10.854 1.00 0.00  ? 171 ARG A N      3  
ATOM 4488  C CA     . ARG B 2 84  ? -15.292 8.539   -11.733 1.00 0.00  ? 171 ARG A CA     3  
ATOM 4489  C C      . ARG B 2 84  ? -14.405 7.296   -11.642 1.00 0.00  ? 171 ARG A C      3  
ATOM 4490  O O      . ARG B 2 84  ? -14.897 6.190   -11.429 1.00 0.00  ? 171 ARG A O      3  
ATOM 4491  C CB     . ARG B 2 84  ? -15.368 9.108   -13.160 1.00 0.00  ? 171 ARG A CB     3  
ATOM 4492  C CG     . ARG B 2 84  ? -15.649 8.089   -14.272 1.00 0.00  ? 171 ARG A CG     3  
ATOM 4493  C CD     . ARG B 2 84  ? -15.655 8.797   -15.634 1.00 0.00  ? 171 ARG A CD     3  
ATOM 4494  N NE     . ARG B 2 84  ? -15.836 7.836   -16.741 1.00 0.00  ? 171 ARG A NE     3  
ATOM 4495  C CZ     . ARG B 2 84  ? -15.011 7.565   -17.739 1.00 0.00  ? 171 ARG A CZ     3  
ATOM 4496  N NH1    . ARG B 2 84  ? -13.855 8.146   -17.904 1.00 0.00  ? 171 ARG A NH1    3  
ATOM 4497  N NH2    . ARG B 2 84  ? -15.349 6.678   -18.631 1.00 0.00  ? 171 ARG A NH2    3  
ATOM 4498  H H      . ARG B 2 84  ? -14.704 10.550  -11.262 1.00 0.00  ? 171 ARG A H      3  
ATOM 4499  H HA     . ARG B 2 84  ? -16.292 8.233   -11.423 1.00 0.00  ? 171 ARG A HA     3  
ATOM 4500  H HB2    . ARG B 2 84  ? -16.143 9.868   -13.170 1.00 0.00  ? 171 ARG A HB2    3  
ATOM 4501  H HB3    . ARG B 2 84  ? -14.440 9.623   -13.393 1.00 0.00  ? 171 ARG A HB3    3  
ATOM 4502  H HG2    . ARG B 2 84  ? -14.870 7.323   -14.280 1.00 0.00  ? 171 ARG A HG2    3  
ATOM 4503  H HG3    . ARG B 2 84  ? -16.617 7.615   -14.098 1.00 0.00  ? 171 ARG A HG3    3  
ATOM 4504  H HD2    . ARG B 2 84  ? -16.468 9.524   -15.654 1.00 0.00  ? 171 ARG A HD2    3  
ATOM 4505  H HD3    . ARG B 2 84  ? -14.723 9.343   -15.750 1.00 0.00  ? 171 ARG A HD3    3  
ATOM 4506  H HE     . ARG B 2 84  ? -16.705 7.325   -16.752 1.00 0.00  ? 171 ARG A HE     3  
ATOM 4507  H HH11   . ARG B 2 84  ? -13.528 8.875   -17.267 1.00 0.00  ? 171 ARG A HH11   3  
ATOM 4508  H HH12   . ARG B 2 84  ? -13.278 7.912   -18.692 1.00 0.00  ? 171 ARG A HH12   3  
ATOM 4509  H HH21   . ARG B 2 84  ? -16.232 6.197   -18.565 1.00 0.00  ? 171 ARG A HH21   3  
ATOM 4510  H HH22   . ARG B 2 84  ? -14.734 6.471   -19.399 1.00 0.00  ? 171 ARG A HH22   3  
ATOM 4511  N N      . ALA B 2 85  ? -13.097 7.497   -11.765 1.00 0.00  ? 172 ALA A N      3  
ATOM 4512  C CA     . ALA B 2 85  ? -12.075 6.470   -11.595 1.00 0.00  ? 172 ALA A CA     3  
ATOM 4513  C C      . ALA B 2 85  ? -12.135 5.772   -10.227 1.00 0.00  ? 172 ALA A C      3  
ATOM 4514  O O      . ALA B 2 85  ? -12.334 4.561   -10.195 1.00 0.00  ? 172 ALA A O      3  
ATOM 4515  C CB     . ALA B 2 85  ? -10.705 7.078   -11.867 1.00 0.00  ? 172 ALA A CB     3  
ATOM 4516  H H      . ALA B 2 85  ? -12.841 8.436   -12.047 1.00 0.00  ? 172 ALA A H      3  
ATOM 4517  H HA     . ALA B 2 85  ? -12.246 5.703   -12.352 1.00 0.00  ? 172 ALA A HA     3  
ATOM 4518  H HB1    . ALA B 2 85  ? -10.667 7.398   -12.905 1.00 0.00  ? 172 ALA A HB1    3  
ATOM 4519  H HB2    . ALA B 2 85  ? -10.537 7.928   -11.222 1.00 0.00  ? 172 ALA A HB2    3  
ATOM 4520  H HB3    . ALA B 2 85  ? -9.934  6.329   -11.687 1.00 0.00  ? 172 ALA A HB3    3  
ATOM 4521  N N      . ARG B 2 86  ? -12.033 6.503   -9.107  1.00 0.00  ? 173 ARG A N      3  
ATOM 4522  C CA     . ARG B 2 86  ? -12.322 5.995   -7.746  1.00 0.00  ? 173 ARG A CA     3  
ATOM 4523  C C      . ARG B 2 86  ? -13.572 5.123   -7.748  1.00 0.00  ? 173 ARG A C      3  
ATOM 4524  O O      . ARG B 2 86  ? -13.496 3.959   -7.381  1.00 0.00  ? 173 ARG A O      3  
ATOM 4525  C CB     . ARG B 2 86  ? -12.392 7.185   -6.750  1.00 0.00  ? 173 ARG A CB     3  
ATOM 4526  C CG     . ARG B 2 86  ? -13.510 7.099   -5.695  1.00 0.00  ? 173 ARG A CG     3  
ATOM 4527  C CD     . ARG B 2 86  ? -13.593 8.291   -4.748  1.00 0.00  ? 173 ARG A CD     3  
ATOM 4528  N NE     . ARG B 2 86  ? -14.981 8.409   -4.274  1.00 0.00  ? 173 ARG A NE     3  
ATOM 4529  C CZ     . ARG B 2 86  ? -15.532 9.349   -3.547  1.00 0.00  ? 173 ARG A CZ     3  
ATOM 4530  N NH1    . ARG B 2 86  ? -14.849 10.297  -2.970  1.00 0.00  ? 173 ARG A NH1    3  
ATOM 4531  N NH2    . ARG B 2 86  ? -16.824 9.319   -3.401  1.00 0.00  ? 173 ARG A NH2    3  
ATOM 4532  H H      . ARG B 2 86  ? -11.875 7.500   -9.224  1.00 0.00  ? 173 ARG A H      3  
ATOM 4533  H HA     . ARG B 2 86  ? -11.536 5.303   -7.416  1.00 0.00  ? 173 ARG A HA     3  
ATOM 4534  H HB2    . ARG B 2 86  ? -11.434 7.273   -6.248  1.00 0.00  ? 173 ARG A HB2    3  
ATOM 4535  H HB3    . ARG B 2 86  ? -12.543 8.112   -7.301  1.00 0.00  ? 173 ARG A HB3    3  
ATOM 4536  H HG2    . ARG B 2 86  ? -14.463 7.079   -6.214  1.00 0.00  ? 173 ARG A HG2    3  
ATOM 4537  H HG3    . ARG B 2 86  ? -13.422 6.183   -5.112  1.00 0.00  ? 173 ARG A HG3    3  
ATOM 4538  H HD2    . ARG B 2 86  ? -12.907 8.145   -3.912  1.00 0.00  ? 173 ARG A HD2    3  
ATOM 4539  H HD3    . ARG B 2 86  ? -13.322 9.202   -5.284  1.00 0.00  ? 173 ARG A HD3    3  
ATOM 4540  H HE     . ARG B 2 86  ? -15.671 7.775   -4.673  1.00 0.00  ? 173 ARG A HE     3  
ATOM 4541  H HH11   . ARG B 2 86  ? -13.836 10.320  -3.118  1.00 0.00  ? 173 ARG A HH11   3  
ATOM 4542  H HH12   . ARG B 2 86  ? -15.307 11.016  -2.443  1.00 0.00  ? 173 ARG A HH12   3  
ATOM 4543  H HH21   . ARG B 2 86  ? -17.311 8.601   -3.937  1.00 0.00  ? 173 ARG A HH21   3  
ATOM 4544  H HH22   . ARG B 2 86  ? -17.323 10.016  -2.876  1.00 0.00  ? 173 ARG A HH22   3  
ATOM 4545  N N      . GLU B 2 87  ? -14.705 5.645   -8.200  1.00 0.00  ? 174 GLU A N      3  
ATOM 4546  C CA     . GLU B 2 87  ? -15.995 4.963   -8.158  1.00 0.00  ? 174 GLU A CA     3  
ATOM 4547  C C      . GLU B 2 87  ? -16.031 3.689   -9.020  1.00 0.00  ? 174 GLU A C      3  
ATOM 4548  O O      . GLU B 2 87  ? -16.781 2.759   -8.712  1.00 0.00  ? 174 GLU A O      3  
ATOM 4549  C CB     . GLU B 2 87  ? -17.078 5.953   -8.599  1.00 0.00  ? 174 GLU A CB     3  
ATOM 4550  C CG     . GLU B 2 87  ? -17.228 7.187   -7.693  1.00 0.00  ? 174 GLU A CG     3  
ATOM 4551  C CD     . GLU B 2 87  ? -17.948 6.916   -6.356  1.00 0.00  ? 174 GLU A CD     3  
ATOM 4552  O OE1    . GLU B 2 87  ? -19.097 6.411   -6.364  1.00 0.00  ? 174 GLU A OE1    3  
ATOM 4553  O OE2    . GLU B 2 87  ? -17.376 7.230   -5.282  1.00 0.00  ? 174 GLU A OE2    3  
ATOM 4554  H H      . GLU B 2 87  ? -14.686 6.621   -8.470  1.00 0.00  ? 174 GLU A H      3  
ATOM 4555  H HA     . GLU B 2 87  ? -16.189 4.645   -7.134  1.00 0.00  ? 174 GLU A HA     3  
ATOM 4556  H HB2    . GLU B 2 87  ? -16.843 6.302   -9.607  1.00 0.00  ? 174 GLU A HB2    3  
ATOM 4557  H HB3    . GLU B 2 87  ? -18.028 5.436   -8.657  1.00 0.00  ? 174 GLU A HB3    3  
ATOM 4558  H HG2    . GLU B 2 87  ? -16.253 7.611   -7.474  1.00 0.00  ? 174 GLU A HG2    3  
ATOM 4559  H HG3    . GLU B 2 87  ? -17.757 7.940   -8.274  1.00 0.00  ? 174 GLU A HG3    3  
ATOM 4560  N N      . LYS B 2 88  ? -15.182 3.604   -10.054 1.00 0.00  ? 175 LYS A N      3  
ATOM 4561  C CA     . LYS B 2 88  ? -14.902 2.382   -10.811 1.00 0.00  ? 175 LYS A CA     3  
ATOM 4562  C C      . LYS B 2 88  ? -14.026 1.397   -10.000 1.00 0.00  ? 175 LYS A C      3  
ATOM 4563  O O      . LYS B 2 88  ? -14.439 0.249   -9.821  1.00 0.00  ? 175 LYS A O      3  
ATOM 4564  C CB     . LYS B 2 88  ? -14.362 2.820   -12.190 1.00 0.00  ? 175 LYS A CB     3  
ATOM 4565  C CG     . LYS B 2 88  ? -13.391 1.868   -12.874 1.00 0.00  ? 175 LYS A CG     3  
ATOM 4566  C CD     . LYS B 2 88  ? -14.001 0.525   -13.295 1.00 0.00  ? 175 LYS A CD     3  
ATOM 4567  C CE     . LYS B 2 88  ? -12.906 -0.385  -13.868 1.00 0.00  ? 175 LYS A CE     3  
ATOM 4568  N NZ     . LYS B 2 88  ? -13.453 -1.700  -14.284 1.00 0.00  ? 175 LYS A NZ     3  
ATOM 4569  H H      . LYS B 2 88  ? -14.612 4.418   -10.290 1.00 0.00  ? 175 LYS A H      3  
ATOM 4570  H HA     . LYS B 2 88  ? -15.842 1.858   -10.982 1.00 0.00  ? 175 LYS A HA     3  
ATOM 4571  H HB2    . LYS B 2 88  ? -15.210 3.002   -12.853 1.00 0.00  ? 175 LYS A HB2    3  
ATOM 4572  H HB3    . LYS B 2 88  ? -13.838 3.767   -12.087 1.00 0.00  ? 175 LYS A HB3    3  
ATOM 4573  H HG2    . LYS B 2 88  ? -12.998 2.368   -13.758 1.00 0.00  ? 175 LYS A HG2    3  
ATOM 4574  H HG3    . LYS B 2 88  ? -12.569 1.724   -12.182 1.00 0.00  ? 175 LYS A HG3    3  
ATOM 4575  H HD2    . LYS B 2 88  ? -14.471 0.034   -12.443 1.00 0.00  ? 175 LYS A HD2    3  
ATOM 4576  H HD3    . LYS B 2 88  ? -14.766 0.707   -14.055 1.00 0.00  ? 175 LYS A HD3    3  
ATOM 4577  H HE2    . LYS B 2 88  ? -12.447 0.118   -14.724 1.00 0.00  ? 175 LYS A HE2    3  
ATOM 4578  H HE3    . LYS B 2 88  ? -12.132 -0.532  -13.108 1.00 0.00  ? 175 LYS A HE3    3  
ATOM 4579  H HZ1    . LYS B 2 88  ? -13.849 -2.194  -13.496 1.00 0.00  ? 175 LYS A HZ1    3  
ATOM 4580  H HZ2    . LYS B 2 88  ? -14.170 -1.596  -14.989 1.00 0.00  ? 175 LYS A HZ2    3  
ATOM 4581  H HZ3    . LYS B 2 88  ? -12.728 -2.282  -14.679 1.00 0.00  ? 175 LYS A HZ3    3  
ATOM 4582  N N      . LEU B 2 89  ? -12.845 1.789   -9.497  1.00 0.00  ? 176 LEU A N      3  
ATOM 4583  C CA     . LEU B 2 89  ? -11.891 0.900   -8.841  1.00 0.00  ? 176 LEU A CA     3  
ATOM 4584  C C      . LEU B 2 89  ? -12.314 0.464   -7.430  1.00 0.00  ? 176 LEU A C      3  
ATOM 4585  O O      . LEU B 2 89  ? -11.877 -0.578  -6.941  1.00 0.00  ? 176 LEU A O      3  
ATOM 4586  C CB     . LEU B 2 89  ? -10.507 1.565   -8.826  1.00 0.00  ? 176 LEU A CB     3  
ATOM 4587  C CG     . LEU B 2 89  ? -9.997  2.153   -10.149 1.00 0.00  ? 176 LEU A CG     3  
ATOM 4588  C CD1    . LEU B 2 89  ? -8.648  2.822   -9.977  1.00 0.00  ? 176 LEU A CD1    3  
ATOM 4589  C CD2    . LEU B 2 89  ? -9.868  1.110   -11.261 1.00 0.00  ? 176 LEU A CD2    3  
ATOM 4590  H H      . LEU B 2 89  ? -12.502 2.733   -9.596  1.00 0.00  ? 176 LEU A H      3  
ATOM 4591  H HA     . LEU B 2 89  ? -11.829 -0.005  -9.434  1.00 0.00  ? 176 LEU A HA     3  
ATOM 4592  H HB2    . LEU B 2 89  ? -10.473 2.330   -8.061  1.00 0.00  ? 176 LEU A HB2    3  
ATOM 4593  H HB3    . LEU B 2 89  ? -9.826  0.802   -8.526  1.00 0.00  ? 176 LEU A HB3    3  
ATOM 4594  H HG     . LEU B 2 89  ? -10.665 2.946   -10.440 1.00 0.00  ? 176 LEU A HG     3  
ATOM 4595  H HD11   . LEU B 2 89  ? -8.787  3.675   -9.321  1.00 0.00  ? 176 LEU A HD11   3  
ATOM 4596  H HD12   . LEU B 2 89  ? -7.926  2.138   -9.541  1.00 0.00  ? 176 LEU A HD12   3  
ATOM 4597  H HD13   . LEU B 2 89  ? -8.280  3.170   -10.942 1.00 0.00  ? 176 LEU A HD13   3  
ATOM 4598  H HD21   . LEU B 2 89  ? -9.107  0.376   -10.995 1.00 0.00  ? 176 LEU A HD21   3  
ATOM 4599  H HD22   . LEU B 2 89  ? -10.816 0.600   -11.413 1.00 0.00  ? 176 LEU A HD22   3  
ATOM 4600  H HD23   . LEU B 2 89  ? -9.588  1.597   -12.195 1.00 0.00  ? 176 LEU A HD23   3  
ATOM 4601  N N      . HIS B 2 90  ? -13.212 1.215   -6.797  1.00 0.00  ? 177 HIS A N      3  
ATOM 4602  C CA     . HIS B 2 90  ? -13.958 0.892   -5.578  1.00 0.00  ? 177 HIS A CA     3  
ATOM 4603  C C      . HIS B 2 90  ? -15.017 -0.188  -5.882  1.00 0.00  ? 177 HIS A C      3  
ATOM 4604  O O      . HIS B 2 90  ? -16.224 0.066   -5.924  1.00 0.00  ? 177 HIS A O      3  
ATOM 4605  C CB     . HIS B 2 90  ? -14.529 2.223   -5.063  1.00 0.00  ? 177 HIS A CB     3  
ATOM 4606  C CG     . HIS B 2 90  ? -14.917 2.300   -3.624  1.00 0.00  ? 177 HIS A CG     3  
ATOM 4607  N ND1    . HIS B 2 90  ? -14.945 1.242   -2.724  1.00 0.00  ? 177 HIS A ND1    3  
ATOM 4608  C CD2    . HIS B 2 90  ? -14.956 3.475   -2.940  1.00 0.00  ? 177 HIS A CD2    3  
ATOM 4609  C CE1    . HIS B 2 90  ? -14.988 1.815   -1.516  1.00 0.00  ? 177 HIS A CE1    3  
ATOM 4610  N NE2    . HIS B 2 90  ? -15.019 3.152   -1.607  1.00 0.00  ? 177 HIS A NE2    3  
ATOM 4611  H H      . HIS B 2 90  ? -13.447 2.090   -7.251  1.00 0.00  ? 177 HIS A H      3  
ATOM 4612  H HA     . HIS B 2 90  ? -13.276 0.486   -4.834  1.00 0.00  ? 177 HIS A HA     3  
ATOM 4613  H HB2    . HIS B 2 90  ? -13.751 2.964   -5.164  1.00 0.00  ? 177 HIS A HB2    3  
ATOM 4614  H HB3    . HIS B 2 90  ? -15.351 2.571   -5.672  1.00 0.00  ? 177 HIS A HB3    3  
ATOM 4615  H HD2    . HIS B 2 90  ? -14.781 4.454   -3.372  1.00 0.00  ? 177 HIS A HD2    3  
ATOM 4616  H HE1    . HIS B 2 90  ? -14.866 1.283   -0.600  1.00 0.00  ? 177 HIS A HE1    3  
ATOM 4617  H HE2    . HIS B 2 90  ? -14.970 3.787   -0.814  1.00 0.00  ? 177 HIS A HE2    3  
ATOM 4618  N N      . GLY B 2 91  ? -14.528 -1.389  -6.202  1.00 0.00  ? 178 GLY A N      3  
ATOM 4619  C CA     . GLY B 2 91  ? -15.251 -2.436  -6.936  1.00 0.00  ? 178 GLY A CA     3  
ATOM 4620  C C      . GLY B 2 91  ? -14.389 -3.281  -7.894  1.00 0.00  ? 178 GLY A C      3  
ATOM 4621  O O      . GLY B 2 91  ? -14.883 -4.270  -8.438  1.00 0.00  ? 178 GLY A O      3  
ATOM 4622  H H      . GLY B 2 91  ? -13.531 -1.488  -6.050  1.00 0.00  ? 178 GLY A H      3  
ATOM 4623  H HA2    . GLY B 2 91  ? -15.732 -3.105  -6.227  1.00 0.00  ? 178 GLY A HA2    3  
ATOM 4624  H HA3    . GLY B 2 91  ? -16.036 -1.979  -7.536  1.00 0.00  ? 178 GLY A HA3    3  
ATOM 4625  N N      . THR B 2 92  ? -13.114 -2.929  -8.107  1.00 0.00  ? 179 THR A N      3  
ATOM 4626  C CA     . THR B 2 92  ? -12.164 -3.662  -8.962  1.00 0.00  ? 179 THR A CA     3  
ATOM 4627  C C      . THR B 2 92  ? -11.684 -4.926  -8.257  1.00 0.00  ? 179 THR A C      3  
ATOM 4628  O O      . THR B 2 92  ? -10.904 -4.856  -7.302  1.00 0.00  ? 179 THR A O      3  
ATOM 4629  C CB     . THR B 2 92  ? -10.997 -2.756  -9.414  1.00 0.00  ? 179 THR A CB     3  
ATOM 4630  O OG1    . THR B 2 92  ? -11.441 -2.063  -10.560 1.00 0.00  ? 179 THR A OG1    3  
ATOM 4631  C CG2    . THR B 2 92  ? -9.692  -3.427  -9.842  1.00 0.00  ? 179 THR A CG2    3  
ATOM 4632  H H      . THR B 2 92  ? -12.743 -2.147  -7.583  1.00 0.00  ? 179 THR A H      3  
ATOM 4633  H HA     . THR B 2 92  ? -12.682 -3.974  -9.872  1.00 0.00  ? 179 THR A HA     3  
ATOM 4634  H HB     . THR B 2 92  ? -10.752 -2.055  -8.618  1.00 0.00  ? 179 THR A HB     3  
ATOM 4635  H HG1    . THR B 2 92  ? -10.665 -1.649  -10.971 1.00 0.00  ? 179 THR A HG1    3  
ATOM 4636  H HG21   . THR B 2 92  ? -9.228  -3.905  -8.984  1.00 0.00  ? 179 THR A HG21   3  
ATOM 4637  H HG22   . THR B 2 92  ? -9.881  -4.160  -10.628 1.00 0.00  ? 179 THR A HG22   3  
ATOM 4638  H HG23   . THR B 2 92  ? -9.003  -2.659  -10.201 1.00 0.00  ? 179 THR A HG23   3  
ATOM 4639  N N      . VAL B 2 93  ? -12.183 -6.081  -8.711  1.00 0.00  ? 180 VAL A N      3  
ATOM 4640  C CA     . VAL B 2 93  ? -11.704 -7.422  -8.348  1.00 0.00  ? 180 VAL A CA     3  
ATOM 4641  C C      . VAL B 2 93  ? -10.416 -7.724  -9.122  1.00 0.00  ? 180 VAL A C      3  
ATOM 4642  O O      . VAL B 2 93  ? -10.475 -8.076  -10.302 1.00 0.00  ? 180 VAL A O      3  
ATOM 4643  C CB     . VAL B 2 93  ? -12.767 -8.512  -8.590  1.00 0.00  ? 180 VAL A CB     3  
ATOM 4644  C CG1    . VAL B 2 93  ? -12.306 -9.858  -8.014  1.00 0.00  ? 180 VAL A CG1    3  
ATOM 4645  C CG2    . VAL B 2 93  ? -14.110 -8.170  -7.930  1.00 0.00  ? 180 VAL A CG2    3  
ATOM 4646  H H      . VAL B 2 93  ? -12.884 -6.015  -9.438  1.00 0.00  ? 180 VAL A H      3  
ATOM 4647  H HA     . VAL B 2 93  ? -11.492 -7.428  -7.289  1.00 0.00  ? 180 VAL A HA     3  
ATOM 4648  H HB     . VAL B 2 93  ? -12.926 -8.641  -9.657  1.00 0.00  ? 180 VAL A HB     3  
ATOM 4649  H HG11   . VAL B 2 93  ? -11.378 -10.172 -8.495  1.00 0.00  ? 180 VAL A HG11   3  
ATOM 4650  H HG12   . VAL B 2 93  ? -12.163 -9.774  -6.937  1.00 0.00  ? 180 VAL A HG12   3  
ATOM 4651  H HG13   . VAL B 2 93  ? -13.061 -10.622 -8.205  1.00 0.00  ? 180 VAL A HG13   3  
ATOM 4652  H HG21   . VAL B 2 93  ? -13.970 -8.030  -6.860  1.00 0.00  ? 180 VAL A HG21   3  
ATOM 4653  H HG22   . VAL B 2 93  ? -14.524 -7.263  -8.368  1.00 0.00  ? 180 VAL A HG22   3  
ATOM 4654  H HG23   . VAL B 2 93  ? -14.827 -8.979  -8.097  1.00 0.00  ? 180 VAL A HG23   3  
ATOM 4655  N N      . VAL B 2 94  ? -9.246  -7.546  -8.498  1.00 0.00  ? 181 VAL A N      3  
ATOM 4656  C CA     . VAL B 2 94  ? -7.929  -7.676  -9.163  1.00 0.00  ? 181 VAL A CA     3  
ATOM 4657  C C      . VAL B 2 94  ? -7.337  -9.090  -9.053  1.00 0.00  ? 181 VAL A C      3  
ATOM 4658  O O      . VAL B 2 94  ? -7.445  -9.862  -10.005 1.00 0.00  ? 181 VAL A O      3  
ATOM 4659  C CB     . VAL B 2 94  ? -6.994  -6.496  -8.816  1.00 0.00  ? 181 VAL A CB     3  
ATOM 4660  C CG1    . VAL B 2 94  ? -6.714  -6.290  -7.321  1.00 0.00  ? 181 VAL A CG1    3  
ATOM 4661  C CG2    . VAL B 2 94  ? -5.680  -6.579  -9.597  1.00 0.00  ? 181 VAL A CG2    3  
ATOM 4662  H H      . VAL B 2 94  ? -9.289  -7.225  -7.534  1.00 0.00  ? 181 VAL A H      3  
ATOM 4663  H HA     . VAL B 2 94  ? -8.099  -7.554  -10.231 1.00 0.00  ? 181 VAL A HA     3  
ATOM 4664  H HB     . VAL B 2 94  ? -7.497  -5.588  -9.157  1.00 0.00  ? 181 VAL A HB     3  
ATOM 4665  H HG11   . VAL B 2 94  ? -7.650  -6.209  -6.772  1.00 0.00  ? 181 VAL A HG11   3  
ATOM 4666  H HG12   . VAL B 2 94  ? -6.109  -7.099  -6.921  1.00 0.00  ? 181 VAL A HG12   3  
ATOM 4667  H HG13   . VAL B 2 94  ? -6.170  -5.355  -7.190  1.00 0.00  ? 181 VAL A HG13   3  
ATOM 4668  H HG21   . VAL B 2 94  ? -5.084  -7.426  -9.256  1.00 0.00  ? 181 VAL A HG21   3  
ATOM 4669  H HG22   . VAL B 2 94  ? -5.883  -6.691  -10.663 1.00 0.00  ? 181 VAL A HG22   3  
ATOM 4670  H HG23   . VAL B 2 94  ? -5.120  -5.657  -9.453  1.00 0.00  ? 181 VAL A HG23   3  
ATOM 4671  N N      . GLU B 2 95  ? -6.782  -9.490  -7.904  1.00 0.00  ? 182 GLU A N      3  
ATOM 4672  C CA     . GLU B 2 95  ? -6.225  -10.846 -7.678  1.00 0.00  ? 182 GLU A CA     3  
ATOM 4673  C C      . GLU B 2 95  ? -7.285  -11.818 -7.109  1.00 0.00  ? 182 GLU A C      3  
ATOM 4674  O O      . GLU B 2 95  ? -6.988  -12.679 -6.277  1.00 0.00  ? 182 GLU A O      3  
ATOM 4675  C CB     . GLU B 2 95  ? -4.990  -10.776 -6.757  1.00 0.00  ? 182 GLU A CB     3  
ATOM 4676  C CG     . GLU B 2 95  ? -3.815  -9.939  -7.281  1.00 0.00  ? 182 GLU A CG     3  
ATOM 4677  C CD     . GLU B 2 95  ? -3.151  -10.599 -8.508  1.00 0.00  ? 182 GLU A CD     3  
ATOM 4678  O OE1    . GLU B 2 95  ? -2.293  -11.498 -8.328  1.00 0.00  ? 182 GLU A OE1    3  
ATOM 4679  O OE2    . GLU B 2 95  ? -3.477  -10.224 -9.659  1.00 0.00  ? 182 GLU A OE2    3  
ATOM 4680  H H      . GLU B 2 95  ? -6.740  -8.821  -7.149  1.00 0.00  ? 182 GLU A H      3  
ATOM 4681  H HA     . GLU B 2 95  ? -5.910  -11.262 -8.637  1.00 0.00  ? 182 GLU A HA     3  
ATOM 4682  H HB2    . GLU B 2 95  ? -5.299  -10.380 -5.793  1.00 0.00  ? 182 GLU A HB2    3  
ATOM 4683  H HB3    . GLU B 2 95  ? -4.611  -11.786 -6.591  1.00 0.00  ? 182 GLU A HB3    3  
ATOM 4684  H HG2    . GLU B 2 95  ? -4.152  -8.928  -7.523  1.00 0.00  ? 182 GLU A HG2    3  
ATOM 4685  H HG3    . GLU B 2 95  ? -3.080  -9.847  -6.478  1.00 0.00  ? 182 GLU A HG3    3  
ATOM 4686  N N      . GLY B 2 96  ? -8.554  -11.637 -7.491  1.00 0.00  ? 183 GLY A N      3  
ATOM 4687  C CA     . GLY B 2 96  ? -9.708  -12.225 -6.798  1.00 0.00  ? 183 GLY A CA     3  
ATOM 4688  C C      . GLY B 2 96  ? -10.079 -11.464 -5.512  1.00 0.00  ? 183 GLY A C      3  
ATOM 4689  O O      . GLY B 2 96  ? -10.597 -12.058 -4.564  1.00 0.00  ? 183 GLY A O      3  
ATOM 4690  H H      . GLY B 2 96  ? -8.710  -10.990 -8.254  1.00 0.00  ? 183 GLY A H      3  
ATOM 4691  H HA2    . GLY B 2 96  ? -10.567 -12.217 -7.467  1.00 0.00  ? 183 GLY A HA2    3  
ATOM 4692  H HA3    . GLY B 2 96  ? -9.494  -13.260 -6.535  1.00 0.00  ? 183 GLY A HA3    3  
ATOM 4693  N N      . ARG B 2 97  ? -9.782  -10.155 -5.463  1.00 0.00  ? 184 ARG A N      3  
ATOM 4694  C CA     . ARG B 2 97  ? -9.951  -9.256  -4.315  1.00 0.00  ? 184 ARG A CA     3  
ATOM 4695  C C      . ARG B 2 97  ? -10.467 -7.913  -4.763  1.00 0.00  ? 184 ARG A C      3  
ATOM 4696  O O      . ARG B 2 97  ? -9.880  -7.316  -5.665  1.00 0.00  ? 184 ARG A O      3  
ATOM 4697  C CB     . ARG B 2 97  ? -8.595  -8.980  -3.670  1.00 0.00  ? 184 ARG A CB     3  
ATOM 4698  C CG     . ARG B 2 97  ? -8.707  -8.510  -2.220  1.00 0.00  ? 184 ARG A CG     3  
ATOM 4699  C CD     . ARG B 2 97  ? -9.080  -9.634  -1.247  1.00 0.00  ? 184 ARG A CD     3  
ATOM 4700  N NE     . ARG B 2 97  ? -9.416  -9.098  0.084   1.00 0.00  ? 184 ARG A NE     3  
ATOM 4701  C CZ     . ARG B 2 97  ? -9.801  -9.800  1.135   1.00 0.00  ? 184 ARG A CZ     3  
ATOM 4702  N NH1    . ARG B 2 97  ? -9.844  -11.102 1.123   1.00 0.00  ? 184 ARG A NH1    3  
ATOM 4703  N NH2    . ARG B 2 97  ? -10.150 -9.210  2.239   1.00 0.00  ? 184 ARG A NH2    3  
ATOM 4704  H H      . ARG B 2 97  ? -9.420  -9.731  -6.303  1.00 0.00  ? 184 ARG A H      3  
ATOM 4705  H HA     . ARG B 2 97  ? -10.642 -9.703  -3.599  1.00 0.00  ? 184 ARG A HA     3  
ATOM 4706  H HB2    . ARG B 2 97  ? -7.977  -9.853  -3.753  1.00 0.00  ? 184 ARG A HB2    3  
ATOM 4707  H HB3    . ARG B 2 97  ? -8.079  -8.204  -4.235  1.00 0.00  ? 184 ARG A HB3    3  
ATOM 4708  H HG2    . ARG B 2 97  ? -7.741  -8.108  -1.931  1.00 0.00  ? 184 ARG A HG2    3  
ATOM 4709  H HG3    . ARG B 2 97  ? -9.446  -7.707  -2.166  1.00 0.00  ? 184 ARG A HG3    3  
ATOM 4710  H HD2    . ARG B 2 97  ? -9.939  -10.185 -1.631  1.00 0.00  ? 184 ARG A HD2    3  
ATOM 4711  H HD3    . ARG B 2 97  ? -8.234  -10.318 -1.163  1.00 0.00  ? 184 ARG A HD3    3  
ATOM 4712  H HE     . ARG B 2 97  ? -9.327  -8.098  0.209   1.00 0.00  ? 184 ARG A HE     3  
ATOM 4713  H HH11   . ARG B 2 97  ? -9.549  -11.587 0.292   1.00 0.00  ? 184 ARG A HH11   3  
ATOM 4714  H HH12   . ARG B 2 97  ? -10.109 -11.621 1.943   1.00 0.00  ? 184 ARG A HH12   3  
ATOM 4715  H HH21   . ARG B 2 97  ? -10.250 -8.200  2.263   1.00 0.00  ? 184 ARG A HH21   3  
ATOM 4716  H HH22   . ARG B 2 97  ? -10.471 -9.751  3.023   1.00 0.00  ? 184 ARG A HH22   3  
ATOM 4717  N N      . LYS B 2 98  ? -11.509 -7.423  -4.106  1.00 0.00  ? 185 LYS A N      3  
ATOM 4718  C CA     . LYS B 2 98  ? -12.082 -6.120  -4.417  1.00 0.00  ? 185 LYS A CA     3  
ATOM 4719  C C      . LYS B 2 98  ? -11.404 -4.979  -3.659  1.00 0.00  ? 185 LYS A C      3  
ATOM 4720  O O      . LYS B 2 98  ? -11.509 -4.917  -2.434  1.00 0.00  ? 185 LYS A O      3  
ATOM 4721  C CB     . LYS B 2 98  ? -13.605 -6.182  -4.200  1.00 0.00  ? 185 LYS A CB     3  
ATOM 4722  C CG     . LYS B 2 98  ? -14.333 -4.894  -4.619  1.00 0.00  ? 185 LYS A CG     3  
ATOM 4723  C CD     . LYS B 2 98  ? -14.837 -4.058  -3.428  1.00 0.00  ? 185 LYS A CD     3  
ATOM 4724  C CE     . LYS B 2 98  ? -16.058 -4.722  -2.766  1.00 0.00  ? 185 LYS A CE     3  
ATOM 4725  N NZ     . LYS B 2 98  ? -16.659 -3.861  -1.715  1.00 0.00  ? 185 LYS A NZ     3  
ATOM 4726  H H      . LYS B 2 98  ? -11.910 -8.008  -3.389  1.00 0.00  ? 185 LYS A H      3  
ATOM 4727  H HA     . LYS B 2 98  ? -11.858 -5.978  -5.464  1.00 0.00  ? 185 LYS A HA     3  
ATOM 4728  H HB2    . LYS B 2 98  ? -13.999 -7.004  -4.799  1.00 0.00  ? 185 LYS A HB2    3  
ATOM 4729  H HB3    . LYS B 2 98  ? -13.811 -6.414  -3.154  1.00 0.00  ? 185 LYS A HB3    3  
ATOM 4730  H HG2    . LYS B 2 98  ? -13.662 -4.290  -5.228  1.00 0.00  ? 185 LYS A HG2    3  
ATOM 4731  H HG3    . LYS B 2 98  ? -15.189 -5.161  -5.243  1.00 0.00  ? 185 LYS A HG3    3  
ATOM 4732  H HD2    . LYS B 2 98  ? -14.034 -3.934  -2.702  1.00 0.00  ? 185 LYS A HD2    3  
ATOM 4733  H HD3    . LYS B 2 98  ? -15.123 -3.072  -3.799  1.00 0.00  ? 185 LYS A HD3    3  
ATOM 4734  H HE2    . LYS B 2 98  ? -16.802 -4.926  -3.543  1.00 0.00  ? 185 LYS A HE2    3  
ATOM 4735  H HE3    . LYS B 2 98  ? -15.760 -5.681  -2.335  1.00 0.00  ? 185 LYS A HE3    3  
ATOM 4736  H HZ1    . LYS B 2 98  ? -16.027 -3.700  -0.929  1.00 0.00  ? 185 LYS A HZ1    3  
ATOM 4737  H HZ2    . LYS B 2 98  ? -16.927 -2.959  -2.081  1.00 0.00  ? 185 LYS A HZ2    3  
ATOM 4738  H HZ3    . LYS B 2 98  ? -17.491 -4.287  -1.327  1.00 0.00  ? 185 LYS A HZ3    3  
ATOM 4739  N N      . ILE B 2 99  ? -10.720 -4.075  -4.371  1.00 0.00  ? 186 ILE A N      3  
ATOM 4740  C CA     . ILE B 2 99  ? -10.209 -2.821  -3.776  1.00 0.00  ? 186 ILE A CA     3  
ATOM 4741  C C      . ILE B 2 99  ? -11.383 -1.930  -3.322  1.00 0.00  ? 186 ILE A C      3  
ATOM 4742  O O      . ILE B 2 99  ? -12.421 -1.860  -3.984  1.00 0.00  ? 186 ILE A O      3  
ATOM 4743  C CB     . ILE B 2 99  ? -9.280  -2.048  -4.750  1.00 0.00  ? 186 ILE A CB     3  
ATOM 4744  C CG1    . ILE B 2 99  ? -8.110  -2.928  -5.241  1.00 0.00  ? 186 ILE A CG1    3  
ATOM 4745  C CG2    . ILE B 2 99  ? -8.718  -0.787  -4.061  1.00 0.00  ? 186 ILE A CG2    3  
ATOM 4746  C CD1    . ILE B 2 99  ? -7.054  -2.151  -6.036  1.00 0.00  ? 186 ILE A CD1    3  
ATOM 4747  H H      . ILE B 2 99  ? -10.666 -4.215  -5.373  1.00 0.00  ? 186 ILE A H      3  
ATOM 4748  H HA     . ILE B 2 99  ? -9.625  -3.081  -2.892  1.00 0.00  ? 186 ILE A HA     3  
ATOM 4749  H HB     . ILE B 2 99  ? -9.861  -1.731  -5.616  1.00 0.00  ? 186 ILE A HB     3  
ATOM 4750  H HG12   . ILE B 2 99  ? -7.623  -3.378  -4.380  1.00 0.00  ? 186 ILE A HG12   3  
ATOM 4751  H HG13   . ILE B 2 99  ? -8.505  -3.721  -5.876  1.00 0.00  ? 186 ILE A HG13   3  
ATOM 4752  H HG21   . ILE B 2 99  ? -9.527  -0.141  -3.744  1.00 0.00  ? 186 ILE A HG21   3  
ATOM 4753  H HG22   . ILE B 2 99  ? -8.114  -1.052  -3.195  1.00 0.00  ? 186 ILE A HG22   3  
ATOM 4754  H HG23   . ILE B 2 99  ? -8.130  -0.194  -4.760  1.00 0.00  ? 186 ILE A HG23   3  
ATOM 4755  H HD11   . ILE B 2 99  ? -7.551  -1.449  -6.720  1.00 0.00  ? 186 ILE A HD11   3  
ATOM 4756  H HD12   . ILE B 2 99  ? -6.415  -1.598  -5.343  1.00 0.00  ? 186 ILE A HD12   3  
ATOM 4757  H HD13   . ILE B 2 99  ? -6.426  -2.841  -6.597  1.00 0.00  ? 186 ILE A HD13   3  
ATOM 4758  N N      . GLU B 2 100 ? -11.194 -1.205  -2.218  1.00 0.00  ? 187 GLU A N      3  
ATOM 4759  C CA     . GLU B 2 100 ? -12.142 -0.239  -1.649  1.00 0.00  ? 187 GLU A CA     3  
ATOM 4760  C C      . GLU B 2 100 ? -11.523 1.167   -1.514  1.00 0.00  ? 187 GLU A C      3  
ATOM 4761  O O      . GLU B 2 100 ? -10.792 1.424   -0.554  1.00 0.00  ? 187 GLU A O      3  
ATOM 4762  C CB     . GLU B 2 100 ? -12.667 -0.760  -0.301  1.00 0.00  ? 187 GLU A CB     3  
ATOM 4763  C CG     . GLU B 2 100 ? -13.394 -2.096  -0.464  1.00 0.00  ? 187 GLU A CG     3  
ATOM 4764  C CD     . GLU B 2 100 ? -14.170 -2.545  0.783   1.00 0.00  ? 187 GLU A CD     3  
ATOM 4765  O OE1    . GLU B 2 100 ? -13.695 -2.357  1.927   1.00 0.00  ? 187 GLU A OE1    3  
ATOM 4766  O OE2    . GLU B 2 100 ? -15.268 -3.128  0.599   1.00 0.00  ? 187 GLU A OE2    3  
ATOM 4767  H H      . GLU B 2 100 ? -10.322 -1.358  -1.720  1.00 0.00  ? 187 GLU A H      3  
ATOM 4768  H HA     . GLU B 2 100 ? -12.994 -0.160  -2.317  1.00 0.00  ? 187 GLU A HA     3  
ATOM 4769  H HB2    . GLU B 2 100 ? -11.834 -0.897  0.382   1.00 0.00  ? 187 GLU A HB2    3  
ATOM 4770  H HB3    . GLU B 2 100 ? -13.348 -0.030  0.119   1.00 0.00  ? 187 GLU A HB3    3  
ATOM 4771  H HG2    . GLU B 2 100 ? -14.090 -1.987  -1.301  1.00 0.00  ? 187 GLU A HG2    3  
ATOM 4772  H HG3    . GLU B 2 100 ? -12.658 -2.861  -0.711  1.00 0.00  ? 187 GLU A HG3    3  
ATOM 4773  N N      . VAL B 2 101 ? -11.765 2.074   -2.476  1.00 0.00  ? 188 VAL A N      3  
ATOM 4774  C CA     . VAL B 2 101 ? -11.059 3.373   -2.557  1.00 0.00  ? 188 VAL A CA     3  
ATOM 4775  C C      . VAL B 2 101 ? -11.829 4.534   -1.901  1.00 0.00  ? 188 VAL A C      3  
ATOM 4776  O O      . VAL B 2 101 ? -12.662 5.219   -2.499  1.00 0.00  ? 188 VAL A O      3  
ATOM 4777  C CB     . VAL B 2 101 ? -10.421 3.684   -3.941  1.00 0.00  ? 188 VAL A CB     3  
ATOM 4778  C CG1    . VAL B 2 101 ? -9.992  2.435   -4.728  1.00 0.00  ? 188 VAL A CG1    3  
ATOM 4779  C CG2    . VAL B 2 101 ? -11.148 4.604   -4.891  1.00 0.00  ? 188 VAL A CG2    3  
ATOM 4780  H H      . VAL B 2 101 ? -12.429 1.839   -3.197  1.00 0.00  ? 188 VAL A H      3  
ATOM 4781  H HA     . VAL B 2 101 ? -10.203 3.235   -1.914  1.00 0.00  ? 188 VAL A HA     3  
ATOM 4782  H HB     . VAL B 2 101 ? -9.541  4.278   -3.766  1.00 0.00  ? 188 VAL A HB     3  
ATOM 4783  H HG11   . VAL B 2 101 ? -9.204  1.934   -4.172  1.00 0.00  ? 188 VAL A HG11   3  
ATOM 4784  H HG12   . VAL B 2 101 ? -10.834 1.760   -4.891  1.00 0.00  ? 188 VAL A HG12   3  
ATOM 4785  H HG13   . VAL B 2 101 ? -9.595  2.700   -5.709  1.00 0.00  ? 188 VAL A HG13   3  
ATOM 4786  H HG21   . VAL B 2 101 ? -12.095 4.179   -5.177  1.00 0.00  ? 188 VAL A HG21   3  
ATOM 4787  H HG22   . VAL B 2 101 ? -11.288 5.570   -4.408  1.00 0.00  ? 188 VAL A HG22   3  
ATOM 4788  H HG23   . VAL B 2 101 ? -10.505 4.757   -5.756  1.00 0.00  ? 188 VAL A HG23   3  
ATOM 4789  N N      . ASN B 2 102 ? -11.595 4.743   -0.611  1.00 0.00  ? 189 ASN A N      3  
ATOM 4790  C CA     . ASN B 2 102 ? -12.247 5.792   0.172   1.00 0.00  ? 189 ASN A CA     3  
ATOM 4791  C C      . ASN B 2 102 ? -11.508 7.128   0.055   1.00 0.00  ? 189 ASN A C      3  
ATOM 4792  O O      . ASN B 2 102 ? -10.277 7.168   0.049   1.00 0.00  ? 189 ASN A O      3  
ATOM 4793  C CB     . ASN B 2 102 ? -12.269 5.379   1.645   1.00 0.00  ? 189 ASN A CB     3  
ATOM 4794  C CG     . ASN B 2 102 ? -12.924 4.030   1.883   1.00 0.00  ? 189 ASN A CG     3  
ATOM 4795  O OD1    . ASN B 2 102 ? -14.053 3.777   1.487   1.00 0.00  ? 189 ASN A OD1    3  
ATOM 4796  N ND2    . ASN B 2 102 ? -12.224 3.117   2.515   1.00 0.00  ? 189 ASN A ND2    3  
ATOM 4797  H H      . ASN B 2 102 ? -10.798 4.254   -0.227  1.00 0.00  ? 189 ASN A H      3  
ATOM 4798  H HA     . ASN B 2 102 ? -13.276 5.931   -0.170  1.00 0.00  ? 189 ASN A HA     3  
ATOM 4799  H HB2    . ASN B 2 102 ? -11.246 5.369   2.007   1.00 0.00  ? 189 ASN A HB2    3  
ATOM 4800  H HB3    . ASN B 2 102 ? -12.796 6.143   2.213   1.00 0.00  ? 189 ASN A HB3    3  
ATOM 4801  H HD21   . ASN B 2 102 ? -11.278 3.338   2.812   1.00 0.00  ? 189 ASN A HD21   3  
ATOM 4802  H HD22   . ASN B 2 102 ? -12.638 2.215   2.658   1.00 0.00  ? 189 ASN A HD22   3  
ATOM 4803  N N      . ASN B 2 103 ? -12.238 8.242   0.088   1.00 0.00  ? 190 ASN A N      3  
ATOM 4804  C CA     . ASN B 2 103 ? -11.604 9.551   0.243   1.00 0.00  ? 190 ASN A CA     3  
ATOM 4805  C C      . ASN B 2 103 ? -10.828 9.608   1.584   1.00 0.00  ? 190 ASN A C      3  
ATOM 4806  O O      . ASN B 2 103 ? -11.182 8.902   2.535   1.00 0.00  ? 190 ASN A O      3  
ATOM 4807  C CB     . ASN B 2 103 ? -12.664 10.663  0.157   1.00 0.00  ? 190 ASN A CB     3  
ATOM 4808  C CG     . ASN B 2 103 ? -13.617 10.678  1.341   1.00 0.00  ? 190 ASN A CG     3  
ATOM 4809  O OD1    . ASN B 2 103 ? -14.537 9.876   1.439   1.00 0.00  ? 190 ASN A OD1    3  
ATOM 4810  N ND2    . ASN B 2 103 ? -13.444 11.589  2.272   1.00 0.00  ? 190 ASN A ND2    3  
ATOM 4811  H H      . ASN B 2 103 ? -13.237 8.150   0.203   1.00 0.00  ? 190 ASN A H      3  
ATOM 4812  H HA     . ASN B 2 103 ? -10.903 9.652   -0.595  1.00 0.00  ? 190 ASN A HA     3  
ATOM 4813  H HB2    . ASN B 2 103 ? -12.162 11.624  0.087   1.00 0.00  ? 190 ASN A HB2    3  
ATOM 4814  H HB3    . ASN B 2 103 ? -13.248 10.527  -0.749  1.00 0.00  ? 190 ASN A HB3    3  
ATOM 4815  H HD21   . ASN B 2 103 ? -12.699 12.267  2.222   1.00 0.00  ? 190 ASN A HD21   3  
ATOM 4816  H HD22   . ASN B 2 103 ? -14.095 11.587  3.044   1.00 0.00  ? 190 ASN A HD22   3  
ATOM 4817  N N      . ALA B 2 104 ? -9.784  10.433  1.693   1.00 0.00  ? 191 ALA A N      3  
ATOM 4818  C CA     . ALA B 2 104 ? -8.958  10.417  2.901   1.00 0.00  ? 191 ALA A CA     3  
ATOM 4819  C C      . ALA B 2 104 ? -9.352  11.432  3.981   1.00 0.00  ? 191 ALA A C      3  
ATOM 4820  O O      . ALA B 2 104 ? -9.720  12.578  3.713   1.00 0.00  ? 191 ALA A O      3  
ATOM 4821  C CB     . ALA B 2 104 ? -7.488  10.568  2.541   1.00 0.00  ? 191 ALA A CB     3  
ATOM 4822  H H      . ALA B 2 104 ? -9.504  11.012  0.910   1.00 0.00  ? 191 ALA A H      3  
ATOM 4823  H HA     . ALA B 2 104 ? -9.046  9.428   3.342   1.00 0.00  ? 191 ALA A HA     3  
ATOM 4824  H HB1    . ALA B 2 104 ? -7.221  9.737   1.887   1.00 0.00  ? 191 ALA A HB1    3  
ATOM 4825  H HB2    . ALA B 2 104 ? -7.317  11.523  2.049   1.00 0.00  ? 191 ALA A HB2    3  
ATOM 4826  H HB3    . ALA B 2 104 ? -6.891  10.523  3.460   1.00 0.00  ? 191 ALA A HB3    3  
ATOM 4827  N N      . THR B 2 105 ? -9.154  11.001  5.222   1.00 0.00  ? 192 THR A N      3  
ATOM 4828  C CA     . THR B 2 105 ? -8.909  11.821  6.411   1.00 0.00  ? 192 THR A CA     3  
ATOM 4829  C C      . THR B 2 105 ? -7.401  12.087  6.485   1.00 0.00  ? 192 THR A C      3  
ATOM 4830  O O      . THR B 2 105 ? -6.624  11.249  6.952   1.00 0.00  ? 192 THR A O      3  
ATOM 4831  C CB     . THR B 2 105 ? -9.426  11.093  7.666   1.00 0.00  ? 192 THR A CB     3  
ATOM 4832  O OG1    . THR B 2 105 ? -9.204  9.698   7.612   1.00 0.00  ? 192 THR A OG1    3  
ATOM 4833  C CG2    . THR B 2 105 ? -10.941 11.213  7.767   1.00 0.00  ? 192 THR A CG2    3  
ATOM 4834  H H      . THR B 2 105 ? -8.882  10.027  5.336   1.00 0.00  ? 192 THR A H      3  
ATOM 4835  H HA     . THR B 2 105 ? -9.421  12.779  6.324   1.00 0.00  ? 192 THR A HA     3  
ATOM 4836  H HB     . THR B 2 105 ? -8.963  11.505  8.560   1.00 0.00  ? 192 THR A HB     3  
ATOM 4837  H HG1    . THR B 2 105 ? -9.839  9.291   8.227   1.00 0.00  ? 192 THR A HG1    3  
ATOM 4838  H HG21   . THR B 2 105 ? -11.229 12.264  7.799   1.00 0.00  ? 192 THR A HG21   3  
ATOM 4839  H HG22   . THR B 2 105 ? -11.396 10.722  6.903   1.00 0.00  ? 192 THR A HG22   3  
ATOM 4840  H HG23   . THR B 2 105 ? -11.276 10.717  8.678   1.00 0.00  ? 192 THR A HG23   3  
ATOM 4841  N N      . ALA B 2 106 ? -6.920  13.189  5.897   1.00 0.00  ? 193 ALA A N      3  
ATOM 4842  C CA     . ALA B 2 106 ? -5.474  13.369  5.748   1.00 0.00  ? 193 ALA A CA     3  
ATOM 4843  C C      . ALA B 2 106 ? -4.737  13.644  7.076   1.00 0.00  ? 193 ALA A C      3  
ATOM 4844  O O      . ALA B 2 106 ? -5.298  14.233  8.006   1.00 0.00  ? 193 ALA A O      3  
ATOM 4845  C CB     . ALA B 2 106 ? -5.138  14.329  4.626   1.00 0.00  ? 193 ALA A CB     3  
ATOM 4846  H H      . ALA B 2 106 ? -7.548  13.866  5.491   1.00 0.00  ? 193 ALA A H      3  
ATOM 4847  H HA     . ALA B 2 106 ? -5.105  12.428  5.375   1.00 0.00  ? 193 ALA A HA     3  
ATOM 4848  H HB1    . ALA B 2 106 ? -5.631  13.971  3.723   1.00 0.00  ? 193 ALA A HB1    3  
ATOM 4849  H HB2    . ALA B 2 106 ? -5.444  15.343  4.877   1.00 0.00  ? 193 ALA A HB2    3  
ATOM 4850  H HB3    . ALA B 2 106 ? -4.064  14.263  4.469   1.00 0.00  ? 193 ALA A HB3    3  
ATOM 4851  N N      . ARG B 2 107 ? -3.502  13.131  7.191   1.00 0.00  ? 194 ARG A N      3  
ATOM 4852  C CA     . ARG B 2 107 ? -2.955  12.697  8.495   1.00 0.00  ? 194 ARG A CA     3  
ATOM 4853  C C      . ARG B 2 107 ? -2.532  13.833  9.441   1.00 0.00  ? 194 ARG A C      3  
ATOM 4854  O O      . ARG B 2 107 ? -2.480  13.625  10.653  1.00 0.00  ? 194 ARG A O      3  
ATOM 4855  C CB     . ARG B 2 107 ? -1.790  11.701  8.298   1.00 0.00  ? 194 ARG A CB     3  
ATOM 4856  C CG     . ARG B 2 107 ? -1.770  10.665  9.435   1.00 0.00  ? 194 ARG A CG     3  
ATOM 4857  C CD     . ARG B 2 107 ? -0.601  9.682   9.338   1.00 0.00  ? 194 ARG A CD     3  
ATOM 4858  N NE     . ARG B 2 107 ? -0.798  8.591   10.306  1.00 0.00  ? 194 ARG A NE     3  
ATOM 4859  C CZ     . ARG B 2 107 ? 0.019   7.618   10.655  1.00 0.00  ? 194 ARG A CZ     3  
ATOM 4860  N NH1    . ARG B 2 107 ? 1.214   7.466   10.172  1.00 0.00  ? 194 ARG A NH1    3  
ATOM 4861  N NH2    . ARG B 2 107 ? -0.396  6.713   11.490  1.00 0.00  ? 194 ARG A NH2    3  
ATOM 4862  H H      . ARG B 2 107 ? -3.075  12.762  6.350   1.00 0.00  ? 194 ARG A H      3  
ATOM 4863  H HA     . ARG B 2 107 ? -3.765  12.162  8.991   1.00 0.00  ? 194 ARG A HA     3  
ATOM 4864  H HB2    . ARG B 2 107 ? -1.914  11.163  7.360   1.00 0.00  ? 194 ARG A HB2    3  
ATOM 4865  H HB3    . ARG B 2 107 ? -0.838  12.230  8.256   1.00 0.00  ? 194 ARG A HB3    3  
ATOM 4866  H HG2    . ARG B 2 107 ? -1.709  11.170  10.398  1.00 0.00  ? 194 ARG A HG2    3  
ATOM 4867  H HG3    . ARG B 2 107 ? -2.706  10.103  9.409   1.00 0.00  ? 194 ARG A HG3    3  
ATOM 4868  H HD2    . ARG B 2 107 ? -0.557  9.280   8.323   1.00 0.00  ? 194 ARG A HD2    3  
ATOM 4869  H HD3    . ARG B 2 107 ? 0.330   10.207  9.549   1.00 0.00  ? 194 ARG A HD3    3  
ATOM 4870  H HE     . ARG B 2 107 ? -1.740  8.454   10.670  1.00 0.00  ? 194 ARG A HE     3  
ATOM 4871  H HH11   . ARG B 2 107 ? 1.423   7.972   9.324   1.00 0.00  ? 194 ARG A HH11   3  
ATOM 4872  H HH12   . ARG B 2 107 ? 1.608   6.537   10.300  1.00 0.00  ? 194 ARG A HH12   3  
ATOM 4873  H HH21   . ARG B 2 107 ? -1.375  6.748   11.751  1.00 0.00  ? 194 ARG A HH21   3  
ATOM 4874  H HH22   . ARG B 2 107 ? 0.179   5.904   11.667  1.00 0.00  ? 194 ARG A HH22   3  
ATOM 4875  N N      . VAL B 2 108 ? -2.218  15.017  8.908   1.00 0.00  ? 195 VAL A N      3  
ATOM 4876  C CA     . VAL B 2 108 ? -1.596  16.138  9.640   1.00 0.00  ? 195 VAL A CA     3  
ATOM 4877  C C      . VAL B 2 108 ? -2.322  17.470  9.408   1.00 0.00  ? 195 VAL A C      3  
ATOM 4878  O O      . VAL B 2 108 ? -2.201  18.096  8.352   1.00 0.00  ? 195 VAL A O      3  
ATOM 4879  C CB     . VAL B 2 108 ? -0.072  16.190  9.374   1.00 0.00  ? 195 VAL A CB     3  
ATOM 4880  C CG1    . VAL B 2 108 ? 0.344   16.292  7.898   1.00 0.00  ? 195 VAL A CG1    3  
ATOM 4881  C CG2    . VAL B 2 108 ? 0.603   17.315  10.169  1.00 0.00  ? 195 VAL A CG2    3  
ATOM 4882  H H      . VAL B 2 108 ? -2.327  15.094  7.910   1.00 0.00  ? 195 VAL A H      3  
ATOM 4883  H HA     . VAL B 2 108 ? -1.691  15.936  10.707  1.00 0.00  ? 195 VAL A HA     3  
ATOM 4884  H HB     . VAL B 2 108 ? 0.340   15.251  9.748   1.00 0.00  ? 195 VAL A HB     3  
ATOM 4885  H HG11   . VAL B 2 108 ? -0.091  15.476  7.324   1.00 0.00  ? 195 VAL A HG11   3  
ATOM 4886  H HG12   . VAL B 2 108 ? 0.032   17.250  7.475   1.00 0.00  ? 195 VAL A HG12   3  
ATOM 4887  H HG13   . VAL B 2 108 ? 1.428   16.217  7.823   1.00 0.00  ? 195 VAL A HG13   3  
ATOM 4888  H HG21   . VAL B 2 108 ? 0.277   18.289  9.798   1.00 0.00  ? 195 VAL A HG21   3  
ATOM 4889  H HG22   . VAL B 2 108 ? 0.345   17.225  11.224  1.00 0.00  ? 195 VAL A HG22   3  
ATOM 4890  H HG23   . VAL B 2 108 ? 1.686   17.241  10.071  1.00 0.00  ? 195 VAL A HG23   3  
ATOM 4891  N N      . MET B 2 109 ? -3.100  17.887  10.415  1.00 0.00  ? 196 MET A N      3  
ATOM 4892  C CA     . MET B 2 109 ? -3.809  19.175  10.538  1.00 0.00  ? 196 MET A CA     3  
ATOM 4893  C C      . MET B 2 109 ? -3.721  19.718  11.972  1.00 0.00  ? 196 MET A C      3  
ATOM 4894  O O      . MET B 2 109 ? -3.968  18.947  12.927  1.00 0.00  ? 196 MET A O      3  
ATOM 4895  C CB     . MET B 2 109 ? -5.285  19.031  10.113  1.00 0.00  ? 196 MET A CB     3  
ATOM 4896  C CG     . MET B 2 109 ? -5.478  18.893  8.597   1.00 0.00  ? 196 MET A CG     3  
ATOM 4897  S SD     . MET B 2 109 ? -5.028  20.376  7.649   1.00 0.00  ? 196 MET A SD     3  
ATOM 4898  C CE     . MET B 2 109 ? -5.285  19.746  5.973   1.00 0.00  ? 196 MET A CE     3  
ATOM 4899  O OXT    . MET B 2 109 ? -3.386  20.914  12.136  1.00 0.00  ? 196 MET A OXT    3  
ATOM 4900  H H      . MET B 2 109 ? -3.146  17.279  11.225  1.00 0.00  ? 196 MET A H      3  
ATOM 4901  H HA     . MET B 2 109 ? -3.332  19.912  9.894   1.00 0.00  ? 196 MET A HA     3  
ATOM 4902  H HB2    . MET B 2 109 ? -5.724  18.161  10.608  1.00 0.00  ? 196 MET A HB2    3  
ATOM 4903  H HB3    . MET B 2 109 ? -5.837  19.912  10.441  1.00 0.00  ? 196 MET A HB3    3  
ATOM 4904  H HG2    . MET B 2 109 ? -4.891  18.047  8.237   1.00 0.00  ? 196 MET A HG2    3  
ATOM 4905  H HG3    . MET B 2 109 ? -6.526  18.671  8.401   1.00 0.00  ? 196 MET A HG3    3  
ATOM 4906  H HE1    . MET B 2 109 ? -4.629  18.895  5.795   1.00 0.00  ? 196 MET A HE1    3  
ATOM 4907  H HE2    . MET B 2 109 ? -6.321  19.429  5.856   1.00 0.00  ? 196 MET A HE2    3  
ATOM 4908  H HE3    . MET B 2 109 ? -5.064  20.529  5.248   1.00 0.00  ? 196 MET A HE3    3  
ATOM 4909  O "O5'"  . U   A 1 1   ? -0.204  -14.899 7.921   1.00 0.00  ? 197 U   B "O5'"  4  
ATOM 4910  C "C5'"  . U   A 1 1   ? 0.190   -14.266 9.138   1.00 0.00  ? 197 U   B "C5'"  4  
ATOM 4911  C "C4'"  . U   A 1 1   ? 0.027   -12.737 9.113   1.00 0.00  ? 197 U   B "C4'"  4  
ATOM 4912  O "O4'"  . U   A 1 1   ? 0.963   -12.114 8.234   1.00 0.00  ? 197 U   B "O4'"  4  
ATOM 4913  C "C3'"  . U   A 1 1   ? -1.350  -12.223 8.679   1.00 0.00  ? 197 U   B "C3'"  4  
ATOM 4914  O "O3'"  . U   A 1 1   ? -2.374  -12.337 9.651   1.00 0.00  ? 197 U   B "O3'"  4  
ATOM 4915  C "C2'"  . U   A 1 1   ? -1.002  -10.761 8.374   1.00 0.00  ? 197 U   B "C2'"  4  
ATOM 4916  O "O2'"  . U   A 1 1   ? -0.806  -9.998  9.562   1.00 0.00  ? 197 U   B "O2'"  4  
ATOM 4917  C "C1'"  . U   A 1 1   ? 0.369   -10.929 7.690   1.00 0.00  ? 197 U   B "C1'"  4  
ATOM 4918  N N1     . U   A 1 1   ? 0.304   -11.026 6.198   1.00 0.00  ? 197 U   B N1     4  
ATOM 4919  C C2     . U   A 1 1   ? 0.738   -9.915  5.463   1.00 0.00  ? 197 U   B C2     4  
ATOM 4920  O O2     . U   A 1 1   ? 0.952   -8.814  5.967   1.00 0.00  ? 197 U   B O2     4  
ATOM 4921  N N3     . U   A 1 1   ? 0.996   -10.104 4.122   1.00 0.00  ? 197 U   B N3     4  
ATOM 4922  C C4     . U   A 1 1   ? 0.846   -11.288 3.439   1.00 0.00  ? 197 U   B C4     4  
ATOM 4923  O O4     . U   A 1 1   ? 1.174   -11.389 2.262   1.00 0.00  ? 197 U   B O4     4  
ATOM 4924  C C5     . U   A 1 1   ? 0.251   -12.342 4.216   1.00 0.00  ? 197 U   B C5     4  
ATOM 4925  C C6     . U   A 1 1   ? 0.011   -12.209 5.547   1.00 0.00  ? 197 U   B C6     4  
ATOM 4926  H "H5'"  . U   A 1 1   ? 1.240   -14.489 9.334   1.00 0.00  ? 197 U   B "H5'"  4  
ATOM 4927  H "H5''" . U   A 1 1   ? -0.400  -14.672 9.960   1.00 0.00  ? 197 U   B "H5''" 4  
ATOM 4928  H "H4'"  . U   A 1 1   ? 0.215   -12.362 10.119  1.00 0.00  ? 197 U   B "H4'"  4  
ATOM 4929  H "H3'"  . U   A 1 1   ? -1.649  -12.720 7.756   1.00 0.00  ? 197 U   B "H3'"  4  
ATOM 4930  H "H2'"  . U   A 1 1   ? -1.766  -10.298 7.747   1.00 0.00  ? 197 U   B "H2'"  4  
ATOM 4931  H "HO2'" . U   A 1 1   ? -1.495  -10.248 10.205  1.00 0.00  ? 197 U   B "HO2'" 4  
ATOM 4932  H "H1'"  . U   A 1 1   ? 1.009   -10.078 7.944   1.00 0.00  ? 197 U   B "H1'"  4  
ATOM 4933  H H3     . U   A 1 1   ? 1.350   -9.321  3.608   1.00 0.00  ? 197 U   B H3     4  
ATOM 4934  H H5     . U   A 1 1   ? 0.024   -13.250 3.686   1.00 0.00  ? 197 U   B H5     4  
ATOM 4935  H H6     . U   A 1 1   ? -0.374  -13.053 6.103   1.00 0.00  ? 197 U   B H6     4  
ATOM 4936  H "HO5'" . U   A 1 1   ? -1.168  -15.065 7.938   1.00 0.00  ? 197 U   B "HO5'" 4  
ATOM 4937  P P      . G   A 1 2   ? -3.899  -12.513 9.190   1.00 0.00  ? 198 G   B P      4  
ATOM 4938  O OP1    . G   A 1 2   ? -4.742  -12.507 10.407  1.00 0.00  ? 198 G   B OP1    4  
ATOM 4939  O OP2    . G   A 1 2   ? -3.969  -13.683 8.281   1.00 0.00  ? 198 G   B OP2    4  
ATOM 4940  O "O5'"  . G   A 1 2   ? -4.220  -11.192 8.321   1.00 0.00  ? 198 G   B "O5'"  4  
ATOM 4941  C "C5'"  . G   A 1 2   ? -4.315  -9.903  8.912   1.00 0.00  ? 198 G   B "C5'"  4  
ATOM 4942  C "C4'"  . G   A 1 2   ? -5.720  -9.250  8.845   1.00 0.00  ? 198 G   B "C4'"  4  
ATOM 4943  O "O4'"  . G   A 1 2   ? -6.010  -8.822  7.514   1.00 0.00  ? 198 G   B "O4'"  4  
ATOM 4944  C "C3'"  . G   A 1 2   ? -6.912  -10.125 9.261   1.00 0.00  ? 198 G   B "C3'"  4  
ATOM 4945  O "O3'"  . G   A 1 2   ? -8.023  -9.321  9.655   1.00 0.00  ? 198 G   B "O3'"  4  
ATOM 4946  C "C2'"  . G   A 1 2   ? -7.240  -10.808 7.929   1.00 0.00  ? 198 G   B "C2'"  4  
ATOM 4947  O "O2'"  . G   A 1 2   ? -8.568  -11.325 7.857   1.00 0.00  ? 198 G   B "O2'"  4  
ATOM 4948  C "C1'"  . G   A 1 2   ? -6.997  -9.674  6.929   1.00 0.00  ? 198 G   B "C1'"  4  
ATOM 4949  N N9     . G   A 1 2   ? -6.602  -10.141 5.568   1.00 0.00  ? 198 G   B N9     4  
ATOM 4950  C C8     . G   A 1 2   ? -6.389  -11.422 5.107   1.00 0.00  ? 198 G   B C8     4  
ATOM 4951  N N7     . G   A 1 2   ? -6.040  -11.491 3.847   1.00 0.00  ? 198 G   B N7     4  
ATOM 4952  C C5     . G   A 1 2   ? -6.039  -10.153 3.428   1.00 0.00  ? 198 G   B C5     4  
ATOM 4953  C C6     . G   A 1 2   ? -5.726  -9.543  2.158   1.00 0.00  ? 198 G   B C6     4  
ATOM 4954  O O6     . G   A 1 2   ? -5.323  -10.058 1.113   1.00 0.00  ? 198 G   B O6     4  
ATOM 4955  N N1     . G   A 1 2   ? -5.936  -8.178  2.145   1.00 0.00  ? 198 G   B N1     4  
ATOM 4956  C C2     . G   A 1 2   ? -6.358  -7.470  3.213   1.00 0.00  ? 198 G   B C2     4  
ATOM 4957  N N2     . G   A 1 2   ? -6.527  -6.189  3.028   1.00 0.00  ? 198 G   B N2     4  
ATOM 4958  N N3     . G   A 1 2   ? -6.634  -7.980  4.407   1.00 0.00  ? 198 G   B N3     4  
ATOM 4959  C C4     . G   A 1 2   ? -6.447  -9.333  4.462   1.00 0.00  ? 198 G   B C4     4  
ATOM 4960  H "H5'"  . G   A 1 2   ? -3.613  -9.233  8.416   1.00 0.00  ? 198 G   B "H5'"  4  
ATOM 4961  H "H5''" . G   A 1 2   ? -3.963  -9.952  9.938   1.00 0.00  ? 198 G   B "H5''" 4  
ATOM 4962  H "H4'"  . G   A 1 2   ? -5.680  -8.370  9.486   1.00 0.00  ? 198 G   B "H4'"  4  
ATOM 4963  H "H3'"  . G   A 1 2   ? -6.653  -10.857 10.024  1.00 0.00  ? 198 G   B "H3'"  4  
ATOM 4964  H "H2'"  . G   A 1 2   ? -6.527  -11.613 7.767   1.00 0.00  ? 198 G   B "H2'"  4  
ATOM 4965  H "HO2'" . G   A 1 2   ? -9.147  -10.729 8.373   1.00 0.00  ? 198 G   B "HO2'" 4  
ATOM 4966  H "H1'"  . G   A 1 2   ? -7.925  -9.107  6.831   1.00 0.00  ? 198 G   B "H1'"  4  
ATOM 4967  H H8     . G   A 1 2   ? -6.491  -12.293 5.744   1.00 0.00  ? 198 G   B H8     4  
ATOM 4968  H H1     . G   A 1 2   ? -5.769  -7.669  1.293   1.00 0.00  ? 198 G   B H1     4  
ATOM 4969  H H21    . G   A 1 2   ? -6.237  -5.760  2.162   1.00 0.00  ? 198 G   B H21    4  
ATOM 4970  H H22    . G   A 1 2   ? -6.800  -5.615  3.818   1.00 0.00  ? 198 G   B H22    4  
ATOM 4971  P P      . C   A 1 3   ? -8.264  -8.890  11.181  1.00 0.00  ? 199 C   B P      4  
ATOM 4972  O OP1    . C   A 1 3   ? -8.048  -10.075 12.047  1.00 0.00  ? 199 C   B OP1    4  
ATOM 4973  O OP2    . C   A 1 3   ? -9.574  -8.197  11.248  1.00 0.00  ? 199 C   B OP2    4  
ATOM 4974  O "O5'"  . C   A 1 3   ? -7.104  -7.824  11.502  1.00 0.00  ? 199 C   B "O5'"  4  
ATOM 4975  C "C5'"  . C   A 1 3   ? -7.080  -6.537  10.895  1.00 0.00  ? 199 C   B "C5'"  4  
ATOM 4976  C "C4'"  . C   A 1 3   ? -5.905  -5.726  11.460  1.00 0.00  ? 199 C   B "C4'"  4  
ATOM 4977  O "O4'"  . C   A 1 3   ? -4.657  -6.315  11.101  1.00 0.00  ? 199 C   B "O4'"  4  
ATOM 4978  C "C3'"  . C   A 1 3   ? -5.891  -4.272  10.946  1.00 0.00  ? 199 C   B "C3'"  4  
ATOM 4979  O "O3'"  . C   A 1 3   ? -5.780  -3.354  12.034  1.00 0.00  ? 199 C   B "O3'"  4  
ATOM 4980  C "C2'"  . C   A 1 3   ? -4.623  -4.243  10.077  1.00 0.00  ? 199 C   B "C2'"  4  
ATOM 4981  O "O2'"  . C   A 1 3   ? -4.020  -2.957  10.002  1.00 0.00  ? 199 C   B "O2'"  4  
ATOM 4982  C "C1'"  . C   A 1 3   ? -3.758  -5.262  10.816  1.00 0.00  ? 199 C   B "C1'"  4  
ATOM 4983  N N1     . C   A 1 3   ? -2.577  -5.763  10.053  1.00 0.00  ? 199 C   B N1     4  
ATOM 4984  C C2     . C   A 1 3   ? -1.304  -5.641  10.629  1.00 0.00  ? 199 C   B C2     4  
ATOM 4985  O O2     . C   A 1 3   ? -1.130  -5.092  11.720  1.00 0.00  ? 199 C   B O2     4  
ATOM 4986  N N3     . C   A 1 3   ? -0.211  -6.136  9.995   1.00 0.00  ? 199 C   B N3     4  
ATOM 4987  C C4     . C   A 1 3   ? -0.375  -6.729  8.831   1.00 0.00  ? 199 C   B C4     4  
ATOM 4988  N N4     . C   A 1 3   ? 0.714   -7.173  8.277   1.00 0.00  ? 199 C   B N4     4  
ATOM 4989  C C5     . C   A 1 3   ? -1.627  -6.844  8.175   1.00 0.00  ? 199 C   B C5     4  
ATOM 4990  C C6     . C   A 1 3   ? -2.714  -6.351  8.817   1.00 0.00  ? 199 C   B C6     4  
ATOM 4991  H "H5'"  . C   A 1 3   ? -8.008  -6.010  11.113  1.00 0.00  ? 199 C   B "H5'"  4  
ATOM 4992  H "H5''" . C   A 1 3   ? -6.980  -6.628  9.812   1.00 0.00  ? 199 C   B "H5''" 4  
ATOM 4993  H "H4'"  . C   A 1 3   ? -5.995  -5.712  12.546  1.00 0.00  ? 199 C   B "H4'"  4  
ATOM 4994  H "H3'"  . C   A 1 3   ? -6.754  -4.050  10.331  1.00 0.00  ? 199 C   B "H3'"  4  
ATOM 4995  H "H2'"  . C   A 1 3   ? -4.863  -4.610  9.079   1.00 0.00  ? 199 C   B "H2'"  4  
ATOM 4996  H "HO2'" . C   A 1 3   ? -4.191  -2.504  10.849  1.00 0.00  ? 199 C   B "HO2'" 4  
ATOM 4997  H "H1'"  . C   A 1 3   ? -3.435  -4.806  11.756  1.00 0.00  ? 199 C   B "H1'"  4  
ATOM 4998  H H41    . C   A 1 3   ? 1.535   -7.107  8.847   1.00 0.00  ? 199 C   B H41    4  
ATOM 4999  H H42    . C   A 1 3   ? 0.680   -7.636  7.374   1.00 0.00  ? 199 C   B H42    4  
ATOM 5000  H H5     . C   A 1 3   ? -1.711  -7.314  7.208   1.00 0.00  ? 199 C   B H5     4  
ATOM 5001  H H6     . C   A 1 3   ? -3.698  -6.422  8.366   1.00 0.00  ? 199 C   B H6     4  
ATOM 5002  P P      . A   A 1 4   ? -7.090  -2.820  12.793  1.00 0.00  ? 200 A   B P      4  
ATOM 5003  O OP1    . A   A 1 4   ? -6.653  -2.155  14.042  1.00 0.00  ? 200 A   B OP1    4  
ATOM 5004  O OP2    . A   A 1 4   ? -8.074  -3.924  12.880  1.00 0.00  ? 200 A   B OP2    4  
ATOM 5005  O "O5'"  . A   A 1 4   ? -7.693  -1.709  11.798  1.00 0.00  ? 200 A   B "O5'"  4  
ATOM 5006  C "C5'"  . A   A 1 4   ? -7.060  -0.447  11.650  1.00 0.00  ? 200 A   B "C5'"  4  
ATOM 5007  C "C4'"  . A   A 1 4   ? -7.673  0.428   10.539  1.00 0.00  ? 200 A   B "C4'"  4  
ATOM 5008  O "O4'"  . A   A 1 4   ? -7.471  -0.176  9.268   1.00 0.00  ? 200 A   B "O4'"  4  
ATOM 5009  C "C3'"  . A   A 1 4   ? -9.180  0.710   10.680  1.00 0.00  ? 200 A   B "C3'"  4  
ATOM 5010  O "O3'"  . A   A 1 4   ? -9.560  1.956   10.102  1.00 0.00  ? 200 A   B "O3'"  4  
ATOM 5011  C "C2'"  . A   A 1 4   ? -9.787  -0.423  9.860   1.00 0.00  ? 200 A   B "C2'"  4  
ATOM 5012  O "O2'"  . A   A 1 4   ? -11.049 -0.096  9.284   1.00 0.00  ? 200 A   B "O2'"  4  
ATOM 5013  C "C1'"  . A   A 1 4   ? -8.703  -0.718  8.809   1.00 0.00  ? 200 A   B "C1'"  4  
ATOM 5014  N N9     . A   A 1 4   ? -8.573  -2.171  8.532   1.00 0.00  ? 200 A   B N9     4  
ATOM 5015  C C8     . A   A 1 4   ? -8.965  -3.253  9.293   1.00 0.00  ? 200 A   B C8     4  
ATOM 5016  N N7     . A   A 1 4   ? -8.739  -4.416  8.741   1.00 0.00  ? 200 A   B N7     4  
ATOM 5017  C C5     . A   A 1 4   ? -8.164  -4.070  7.512   1.00 0.00  ? 200 A   B C5     4  
ATOM 5018  C C6     . A   A 1 4   ? -7.658  -4.805  6.414   1.00 0.00  ? 200 A   B C6     4  
ATOM 5019  N N6     . A   A 1 4   ? -7.606  -6.121  6.407   1.00 0.00  ? 200 A   B N6     4  
ATOM 5020  N N1     . A   A 1 4   ? -7.192  -4.197  5.318   1.00 0.00  ? 200 A   B N1     4  
ATOM 5021  C C2     . A   A 1 4   ? -7.199  -2.863  5.316   1.00 0.00  ? 200 A   B C2     4  
ATOM 5022  N N3     . A   A 1 4   ? -7.607  -2.042  6.277   1.00 0.00  ? 200 A   B N3     4  
ATOM 5023  C C4     . A   A 1 4   ? -8.079  -2.713  7.365   1.00 0.00  ? 200 A   B C4     4  
ATOM 5024  H "H5'"  . A   A 1 4   ? -6.002  -0.600  11.426  1.00 0.00  ? 200 A   B "H5'"  4  
ATOM 5025  H "H5''" . A   A 1 4   ? -7.126  0.100   12.592  1.00 0.00  ? 200 A   B "H5''" 4  
ATOM 5026  H "H4'"  . A   A 1 4   ? -7.131  1.373   10.568  1.00 0.00  ? 200 A   B "H4'"  4  
ATOM 5027  H "H3'"  . A   A 1 4   ? -9.507  0.632   11.720  1.00 0.00  ? 200 A   B "H3'"  4  
ATOM 5028  H "H2'"  . A   A 1 4   ? -9.912  -1.257  10.546  1.00 0.00  ? 200 A   B "H2'"  4  
ATOM 5029  H "HO2'" . A   A 1 4   ? -11.051 0.869   9.134   1.00 0.00  ? 200 A   B "HO2'" 4  
ATOM 5030  H "H1'"  . A   A 1 4   ? -8.954  -0.197  7.881   1.00 0.00  ? 200 A   B "H1'"  4  
ATOM 5031  H H8     . A   A 1 4   ? -9.400  -3.154  10.282  1.00 0.00  ? 200 A   B H8     4  
ATOM 5032  H H61    . A   A 1 4   ? -7.189  -6.629  5.636   1.00 0.00  ? 200 A   B H61    4  
ATOM 5033  H H62    . A   A 1 4   ? -7.939  -6.606  7.223   1.00 0.00  ? 200 A   B H62    4  
ATOM 5034  H H2     . A   A 1 4   ? -6.832  -2.358  4.430   1.00 0.00  ? 200 A   B H2     4  
ATOM 5035  P P      . U   A 1 5   ? -9.330  3.342   10.865  1.00 0.00  ? 201 U   B P      4  
ATOM 5036  O OP1    . U   A 1 5   ? -8.411  3.129   12.008  1.00 0.00  ? 201 U   B OP1    4  
ATOM 5037  O OP2    . U   A 1 5   ? -10.654 3.957   11.108  1.00 0.00  ? 201 U   B OP2    4  
ATOM 5038  O "O5'"  . U   A 1 5   ? -8.575  4.214   9.753   1.00 0.00  ? 201 U   B "O5'"  4  
ATOM 5039  C "C5'"  . U   A 1 5   ? -7.324  3.810   9.216   1.00 0.00  ? 201 U   B "C5'"  4  
ATOM 5040  C "C4'"  . U   A 1 5   ? -6.532  4.968   8.590   1.00 0.00  ? 201 U   B "C4'"  4  
ATOM 5041  O "O4'"  . U   A 1 5   ? -6.943  5.324   7.273   1.00 0.00  ? 201 U   B "O4'"  4  
ATOM 5042  C "C3'"  . U   A 1 5   ? -6.574  6.228   9.468   1.00 0.00  ? 201 U   B "C3'"  4  
ATOM 5043  O "O3'"  . U   A 1 5   ? -5.320  6.912   9.465   1.00 0.00  ? 201 U   B "O3'"  4  
ATOM 5044  C "C2'"  . U   A 1 5   ? -7.707  7.000   8.775   1.00 0.00  ? 201 U   B "C2'"  4  
ATOM 5045  O "O2'"  . U   A 1 5   ? -7.655  8.390   9.057   1.00 0.00  ? 201 U   B "O2'"  4  
ATOM 5046  C "C1'"  . U   A 1 5   ? -7.550  6.615   7.295   1.00 0.00  ? 201 U   B "C1'"  4  
ATOM 5047  N N1     . U   A 1 5   ? -8.830  6.546   6.537   1.00 0.00  ? 201 U   B N1     4  
ATOM 5048  C C2     . U   A 1 5   ? -8.980  7.353   5.402   1.00 0.00  ? 201 U   B C2     4  
ATOM 5049  O O2     . U   A 1 5   ? -8.157  8.191   5.055   1.00 0.00  ? 201 U   B O2     4  
ATOM 5050  N N3     . U   A 1 5   ? -10.128 7.205   4.648   1.00 0.00  ? 201 U   B N3     4  
ATOM 5051  C C4     . U   A 1 5   ? -11.172 6.370   4.981   1.00 0.00  ? 201 U   B C4     4  
ATOM 5052  O O4     . U   A 1 5   ? -12.200 6.353   4.316   1.00 0.00  ? 201 U   B O4     4  
ATOM 5053  C C5     . U   A 1 5   ? -10.953 5.552   6.156   1.00 0.00  ? 201 U   B C5     4  
ATOM 5054  C C6     . U   A 1 5   ? -9.817  5.654   6.892   1.00 0.00  ? 201 U   B C6     4  
ATOM 5055  H "H5'"  . U   A 1 5   ? -7.459  3.014   8.481   1.00 0.00  ? 201 U   B "H5'"  4  
ATOM 5056  H "H5''" . U   A 1 5   ? -6.708  3.416   10.025  1.00 0.00  ? 201 U   B "H5''" 4  
ATOM 5057  H "H4'"  . U   A 1 5   ? -5.517  4.605   8.518   1.00 0.00  ? 201 U   B "H4'"  4  
ATOM 5058  H "H3'"  . U   A 1 5   ? -6.874  5.999   10.492  1.00 0.00  ? 201 U   B "H3'"  4  
ATOM 5059  H "H2'"  . U   A 1 5   ? -8.656  6.607   9.148   1.00 0.00  ? 201 U   B "H2'"  4  
ATOM 5060  H "HO2'" . U   A 1 5   ? -8.323  8.848   8.501   1.00 0.00  ? 201 U   B "HO2'" 4  
ATOM 5061  H "H1'"  . U   A 1 5   ? -6.892  7.345   6.818   1.00 0.00  ? 201 U   B "H1'"  4  
ATOM 5062  H H3     . U   A 1 5   ? -10.169 7.720   3.780   1.00 0.00  ? 201 U   B H3     4  
ATOM 5063  H H5     . U   A 1 5   ? -11.717 4.839   6.427   1.00 0.00  ? 201 U   B H5     4  
ATOM 5064  H H6     . U   A 1 5   ? -9.666  5.016   7.755   1.00 0.00  ? 201 U   B H6     4  
ATOM 5065  P P      . G   A 1 6   ? -4.109  6.408   10.397  1.00 0.00  ? 202 G   B P      4  
ATOM 5066  O OP1    . G   A 1 6   ? -4.465  5.110   11.020  1.00 0.00  ? 202 G   B OP1    4  
ATOM 5067  O OP2    . G   A 1 6   ? -3.682  7.523   11.273  1.00 0.00  ? 202 G   B OP2    4  
ATOM 5068  O "O5'"  . G   A 1 6   ? -2.901  6.151   9.380   1.00 0.00  ? 202 G   B "O5'"  4  
ATOM 5069  C "C5'"  . G   A 1 6   ? -2.911  5.040   8.506   1.00 0.00  ? 202 G   B "C5'"  4  
ATOM 5070  C "C4'"  . G   A 1 6   ? -1.720  4.925   7.557   1.00 0.00  ? 202 G   B "C4'"  4  
ATOM 5071  O "O4'"  . G   A 1 6   ? -2.016  5.600   6.333   1.00 0.00  ? 202 G   B "O4'"  4  
ATOM 5072  C "C3'"  . G   A 1 6   ? -0.420  5.462   8.133   1.00 0.00  ? 202 G   B "C3'"  4  
ATOM 5073  O "O3'"  . G   A 1 6   ? 0.605   4.579   7.740   1.00 0.00  ? 202 G   B "O3'"  4  
ATOM 5074  C "C2'"  . G   A 1 6   ? -0.482  6.844   7.477   1.00 0.00  ? 202 G   B "C2'"  4  
ATOM 5075  O "O2'"  . G   A 1 6   ? 0.690   7.652   7.523   1.00 0.00  ? 202 G   B "O2'"  4  
ATOM 5076  C "C1'"  . G   A 1 6   ? -0.967  6.518   6.089   1.00 0.00  ? 202 G   B "C1'"  4  
ATOM 5077  N N9     . G   A 1 6   ? -1.397  7.759   5.402   1.00 0.00  ? 202 G   B N9     4  
ATOM 5078  C C8     . G   A 1 6   ? -0.706  8.443   4.441   1.00 0.00  ? 202 G   B C8     4  
ATOM 5079  N N7     . G   A 1 6   ? -1.225  9.596   4.115   1.00 0.00  ? 202 G   B N7     4  
ATOM 5080  C C5     . G   A 1 6   ? -2.362  9.685   4.932   1.00 0.00  ? 202 G   B C5     4  
ATOM 5081  C C6     . G   A 1 6   ? -3.349  10.722  5.095   1.00 0.00  ? 202 G   B C6     4  
ATOM 5082  O O6     . G   A 1 6   ? -3.393  11.837  4.576   1.00 0.00  ? 202 G   B O6     4  
ATOM 5083  N N1     . G   A 1 6   ? -4.350  10.419  5.998   1.00 0.00  ? 202 G   B N1     4  
ATOM 5084  C C2     . G   A 1 6   ? -4.310  9.308   6.781   1.00 0.00  ? 202 G   B C2     4  
ATOM 5085  N N2     . G   A 1 6   ? -5.214  9.203   7.706   1.00 0.00  ? 202 G   B N2     4  
ATOM 5086  N N3     . G   A 1 6   ? -3.391  8.356   6.716   1.00 0.00  ? 202 G   B N3     4  
ATOM 5087  C C4     . G   A 1 6   ? -2.459  8.573   5.740   1.00 0.00  ? 202 G   B C4     4  
ATOM 5088  H "H5'"  . G   A 1 6   ? -3.785  5.124   7.866   1.00 0.00  ? 202 G   B "H5'"  4  
ATOM 5089  H "H5''" . G   A 1 6   ? -2.966  4.124   9.099   1.00 0.00  ? 202 G   B "H5''" 4  
ATOM 5090  H "H4'"  . G   A 1 6   ? -1.531  3.890   7.325   1.00 0.00  ? 202 G   B "H4'"  4  
ATOM 5091  H "H3'"  . G   A 1 6   ? -0.427  5.519   9.210   1.00 0.00  ? 202 G   B "H3'"  4  
ATOM 5092  H "H2'"  . G   A 1 6   ? -1.316  7.366   7.935   1.00 0.00  ? 202 G   B "H2'"  4  
ATOM 5093  H "HO2'" . G   A 1 6   ? 1.284   7.374   6.804   1.00 0.00  ? 202 G   B "HO2'" 4  
ATOM 5094  H "H1'"  . G   A 1 6   ? -0.159  6.026   5.557   1.00 0.00  ? 202 G   B "H1'"  4  
ATOM 5095  H H8     . G   A 1 6   ? 0.204   8.031   4.024   1.00 0.00  ? 202 G   B H8     4  
ATOM 5096  H H1     . G   A 1 6   ? -5.120  11.074  6.082   1.00 0.00  ? 202 G   B H1     4  
ATOM 5097  H H21    . G   A 1 6   ? -5.995  9.846   7.734   1.00 0.00  ? 202 G   B H21    4  
ATOM 5098  H H22    . G   A 1 6   ? -5.207  8.384   8.309   1.00 0.00  ? 202 G   B H22    4  
ATOM 5099  P P      . U   A 1 7   ? 1.385   3.741   8.851   1.00 0.00  ? 203 U   B P      4  
ATOM 5100  O OP1    . U   A 1 7   ? 2.267   2.735   8.216   1.00 0.00  ? 203 U   B OP1    4  
ATOM 5101  O OP2    . U   A 1 7   ? 0.441   3.295   9.899   1.00 0.00  ? 203 U   B OP2    4  
ATOM 5102  O "O5'"  . U   A 1 7   ? 2.282   4.933   9.400   1.00 0.00  ? 203 U   B "O5'"  4  
ATOM 5103  C "C5'"  . U   A 1 7   ? 3.518   5.249   8.787   1.00 0.00  ? 203 U   B "C5'"  4  
ATOM 5104  C "C4'"  . U   A 1 7   ? 3.492   5.764   7.326   1.00 0.00  ? 203 U   B "C4'"  4  
ATOM 5105  O "O4'"  . U   A 1 7   ? 4.829   6.134   7.005   1.00 0.00  ? 203 U   B "O4'"  4  
ATOM 5106  C "C3'"  . U   A 1 7   ? 3.050   4.954   6.081   1.00 0.00  ? 203 U   B "C3'"  4  
ATOM 5107  O "O3'"  . U   A 1 7   ? 2.520   5.886   5.139   1.00 0.00  ? 203 U   B "O3'"  4  
ATOM 5108  C "C2'"  . U   A 1 7   ? 4.324   4.225   5.645   1.00 0.00  ? 203 U   B "C2'"  4  
ATOM 5109  O "O2'"  . U   A 1 7   ? 4.504   4.047   4.245   1.00 0.00  ? 203 U   B "O2'"  4  
ATOM 5110  C "C1'"  . U   A 1 7   ? 5.445   5.059   6.290   1.00 0.00  ? 203 U   B "C1'"  4  
ATOM 5111  N N1     . U   A 1 7   ? 6.376   4.249   7.145   1.00 0.00  ? 203 U   B N1     4  
ATOM 5112  C C2     . U   A 1 7   ? 7.735   4.593   7.123   1.00 0.00  ? 203 U   B C2     4  
ATOM 5113  O O2     . U   A 1 7   ? 8.188   5.576   6.530   1.00 0.00  ? 203 U   B O2     4  
ATOM 5114  N N3     . U   A 1 7   ? 8.612   3.764   7.796   1.00 0.00  ? 203 U   B N3     4  
ATOM 5115  C C4     . U   A 1 7   ? 8.274   2.617   8.474   1.00 0.00  ? 203 U   B C4     4  
ATOM 5116  O O4     . U   A 1 7   ? 9.142   1.943   9.024   1.00 0.00  ? 203 U   B O4     4  
ATOM 5117  C C5     . U   A 1 7   ? 6.860   2.320   8.466   1.00 0.00  ? 203 U   B C5     4  
ATOM 5118  C C6     . U   A 1 7   ? 5.965   3.116   7.829   1.00 0.00  ? 203 U   B C6     4  
ATOM 5119  H "H5'"  . U   A 1 7   ? 4.161   4.392   8.882   1.00 0.00  ? 203 U   B "H5'"  4  
ATOM 5120  H "H5''" . U   A 1 7   ? 3.972   6.040   9.384   1.00 0.00  ? 203 U   B "H5''" 4  
ATOM 5121  H "H4'"  . U   A 1 7   ? 2.839   6.628   7.365   1.00 0.00  ? 203 U   B "H4'"  4  
ATOM 5122  H "H3'"  . U   A 1 7   ? 2.299   4.206   6.289   1.00 0.00  ? 203 U   B "H3'"  4  
ATOM 5123  H "HO3'" . U   A 1 7   ? 3.139   5.959   4.383   1.00 0.00  ? 203 U   B "HO3'" 4  
ATOM 5124  H "H2'"  . U   A 1 7   ? 4.266   3.225   6.088   1.00 0.00  ? 203 U   B "H2'"  4  
ATOM 5125  H "HO2'" . U   A 1 7   ? 4.323   4.885   3.758   1.00 0.00  ? 203 U   B "HO2'" 4  
ATOM 5126  H "H1'"  . U   A 1 7   ? 6.027   5.496   5.477   1.00 0.00  ? 203 U   B "H1'"  4  
ATOM 5127  H H3     . U   A 1 7   ? 9.584   4.004   7.778   1.00 0.00  ? 203 U   B H3     4  
ATOM 5128  H H5     . U   A 1 7   ? 6.500   1.444   8.979   1.00 0.00  ? 203 U   B H5     4  
ATOM 5129  H H6     . U   A 1 7   ? 4.911   2.851   7.893   1.00 0.00  ? 203 U   B H6     4  
ATOM 5130  N N      . ASN B 2 22  ? 5.120   22.656  -14.637 1.00 0.00  ? 109 ASN A N      4  
ATOM 5131  C CA     . ASN B 2 22  ? 3.887   22.076  -14.040 1.00 0.00  ? 109 ASN A CA     4  
ATOM 5132  C C      . ASN B 2 22  ? 2.838   23.167  -13.825 1.00 0.00  ? 109 ASN A C      4  
ATOM 5133  O O      . ASN B 2 22  ? 3.116   24.162  -13.155 1.00 0.00  ? 109 ASN A O      4  
ATOM 5134  C CB     . ASN B 2 22  ? 4.170   21.341  -12.711 1.00 0.00  ? 109 ASN A CB     4  
ATOM 5135  C CG     . ASN B 2 22  ? 5.012   20.086  -12.918 1.00 0.00  ? 109 ASN A CG     4  
ATOM 5136  O OD1    . ASN B 2 22  ? 4.702   19.248  -13.753 1.00 0.00  ? 109 ASN A OD1    4  
ATOM 5137  N ND2    . ASN B 2 22  ? 6.093   19.906  -12.189 1.00 0.00  ? 109 ASN A ND2    4  
ATOM 5138  H H      . ASN B 2 22  ? 4.913   23.099  -15.519 1.00 0.00  ? 109 ASN A H      4  
ATOM 5139  H HA     . ASN B 2 22  ? 3.472   21.350  -14.741 1.00 0.00  ? 109 ASN A HA     4  
ATOM 5140  H HB2    . ASN B 2 22  ? 4.664   22.018  -12.010 1.00 0.00  ? 109 ASN A HB2    4  
ATOM 5141  H HB3    . ASN B 2 22  ? 3.222   21.032  -12.265 1.00 0.00  ? 109 ASN A HB3    4  
ATOM 5142  H HD21   . ASN B 2 22  ? 6.373   20.562  -11.471 1.00 0.00  ? 109 ASN A HD21   4  
ATOM 5143  H HD22   . ASN B 2 22  ? 6.634   19.065  -12.344 1.00 0.00  ? 109 ASN A HD22   4  
ATOM 5144  N N      . THR B 2 23  ? 1.638   22.998  -14.389 1.00 0.00  ? 110 THR A N      4  
ATOM 5145  C CA     . THR B 2 23  ? 0.489   23.891  -14.137 1.00 0.00  ? 110 THR A CA     4  
ATOM 5146  C C      . THR B 2 23  ? -0.141  23.641  -12.764 1.00 0.00  ? 110 THR A C      4  
ATOM 5147  O O      . THR B 2 23  ? 0.047   22.588  -12.144 1.00 0.00  ? 110 THR A O      4  
ATOM 5148  C CB     . THR B 2 23  ? -0.604  23.702  -15.209 1.00 0.00  ? 110 THR A CB     4  
ATOM 5149  O OG1    . THR B 2 23  ? -1.061  22.363  -15.216 1.00 0.00  ? 110 THR A OG1    4  
ATOM 5150  C CG2    . THR B 2 23  ? -0.104  24.043  -16.611 1.00 0.00  ? 110 THR A CG2    4  
ATOM 5151  H H      . THR B 2 23  ? 1.440   22.163  -14.923 1.00 0.00  ? 110 THR A H      4  
ATOM 5152  H HA     . THR B 2 23  ? 0.818   24.931  -14.167 1.00 0.00  ? 110 THR A HA     4  
ATOM 5153  H HB     . THR B 2 23  ? -1.443  24.358  -14.981 1.00 0.00  ? 110 THR A HB     4  
ATOM 5154  H HG1    . THR B 2 23  ? -1.578  22.239  -16.031 1.00 0.00  ? 110 THR A HG1    4  
ATOM 5155  H HG21   . THR B 2 23  ? 0.290   25.059  -16.621 1.00 0.00  ? 110 THR A HG21   4  
ATOM 5156  H HG22   . THR B 2 23  ? 0.680   23.351  -16.918 1.00 0.00  ? 110 THR A HG22   4  
ATOM 5157  H HG23   . THR B 2 23  ? -0.932  23.983  -17.321 1.00 0.00  ? 110 THR A HG23   4  
ATOM 5158  N N      . GLU B 2 24  ? -0.968  24.581  -12.303 1.00 0.00  ? 111 GLU A N      4  
ATOM 5159  C CA     . GLU B 2 24  ? -1.864  24.382  -11.155 1.00 0.00  ? 111 GLU A CA     4  
ATOM 5160  C C      . GLU B 2 24  ? -2.831  23.204  -11.373 1.00 0.00  ? 111 GLU A C      4  
ATOM 5161  O O      . GLU B 2 24  ? -3.094  22.446  -10.441 1.00 0.00  ? 111 GLU A O      4  
ATOM 5162  C CB     . GLU B 2 24  ? -2.602  25.688  -10.800 1.00 0.00  ? 111 GLU A CB     4  
ATOM 5163  C CG     . GLU B 2 24  ? -3.700  26.157  -11.778 1.00 0.00  ? 111 GLU A CG     4  
ATOM 5164  C CD     . GLU B 2 24  ? -3.204  26.364  -13.223 1.00 0.00  ? 111 GLU A CD     4  
ATOM 5165  O OE1    . GLU B 2 24  ? -2.139  26.998  -13.424 1.00 0.00  ? 111 GLU A OE1    4  
ATOM 5166  O OE2    . GLU B 2 24  ? -3.851  25.843  -14.161 1.00 0.00  ? 111 GLU A OE2    4  
ATOM 5167  H H      . GLU B 2 24  ? -1.060  25.448  -12.825 1.00 0.00  ? 111 GLU A H      4  
ATOM 5168  H HA     . GLU B 2 24  ? -1.247  24.124  -10.293 1.00 0.00  ? 111 GLU A HA     4  
ATOM 5169  H HB2    . GLU B 2 24  ? -3.070  25.550  -9.823  1.00 0.00  ? 111 GLU A HB2    4  
ATOM 5170  H HB3    . GLU B 2 24  ? -1.864  26.484  -10.692 1.00 0.00  ? 111 GLU A HB3    4  
ATOM 5171  H HG2    . GLU B 2 24  ? -4.515  25.431  -11.758 1.00 0.00  ? 111 GLU A HG2    4  
ATOM 5172  H HG3    . GLU B 2 24  ? -4.108  27.101  -11.409 1.00 0.00  ? 111 GLU A HG3    4  
ATOM 5173  N N      . ASN B 2 25  ? -3.301  22.986  -12.608 1.00 0.00  ? 112 ASN A N      4  
ATOM 5174  C CA     . ASN B 2 25  ? -4.194  21.883  -12.952 1.00 0.00  ? 112 ASN A CA     4  
ATOM 5175  C C      . ASN B 2 25  ? -3.522  20.499  -12.856 1.00 0.00  ? 112 ASN A C      4  
ATOM 5176  O O      . ASN B 2 25  ? -4.162  19.534  -12.433 1.00 0.00  ? 112 ASN A O      4  
ATOM 5177  C CB     . ASN B 2 25  ? -4.803  22.150  -14.336 1.00 0.00  ? 112 ASN A CB     4  
ATOM 5178  C CG     . ASN B 2 25  ? -5.877  21.139  -14.699 1.00 0.00  ? 112 ASN A CG     4  
ATOM 5179  O OD1    . ASN B 2 25  ? -5.779  20.430  -15.689 1.00 0.00  ? 112 ASN A OD1    4  
ATOM 5180  N ND2    . ASN B 2 25  ? -6.931  21.038  -13.920 1.00 0.00  ? 112 ASN A ND2    4  
ATOM 5181  H H      . ASN B 2 25  ? -3.052  23.650  -13.329 1.00 0.00  ? 112 ASN A H      4  
ATOM 5182  H HA     . ASN B 2 25  ? -4.998  21.882  -12.223 1.00 0.00  ? 112 ASN A HA     4  
ATOM 5183  H HB2    . ASN B 2 25  ? -5.255  23.142  -14.348 1.00 0.00  ? 112 ASN A HB2    4  
ATOM 5184  H HB3    . ASN B 2 25  ? -4.022  22.119  -15.095 1.00 0.00  ? 112 ASN A HB3    4  
ATOM 5185  H HD21   . ASN B 2 25  ? -7.004  21.575  -13.061 1.00 0.00  ? 112 ASN A HD21   4  
ATOM 5186  H HD22   . ASN B 2 25  ? -7.631  20.358  -14.168 1.00 0.00  ? 112 ASN A HD22   4  
ATOM 5187  N N      . LYS B 2 26  ? -2.227  20.400  -13.186 1.00 0.00  ? 113 LYS A N      4  
ATOM 5188  C CA     . LYS B 2 26  ? -1.392  19.214  -12.915 1.00 0.00  ? 113 LYS A CA     4  
ATOM 5189  C C      . LYS B 2 26  ? -1.164  19.031  -11.405 1.00 0.00  ? 113 LYS A C      4  
ATOM 5190  O O      . LYS B 2 26  ? -1.256  17.912  -10.903 1.00 0.00  ? 113 LYS A O      4  
ATOM 5191  C CB     . LYS B 2 26  ? -0.080  19.341  -13.718 1.00 0.00  ? 113 LYS A CB     4  
ATOM 5192  C CG     . LYS B 2 26  ? 0.737   18.041  -13.862 1.00 0.00  ? 113 LYS A CG     4  
ATOM 5193  C CD     . LYS B 2 26  ? 1.683   17.751  -12.684 1.00 0.00  ? 113 LYS A CD     4  
ATOM 5194  C CE     . LYS B 2 26  ? 2.555   16.504  -12.898 1.00 0.00  ? 113 LYS A CE     4  
ATOM 5195  N NZ     . LYS B 2 26  ? 3.525   16.661  -14.015 1.00 0.00  ? 113 LYS A NZ     4  
ATOM 5196  H H      . LYS B 2 26  ? -1.792  21.221  -13.597 1.00 0.00  ? 113 LYS A H      4  
ATOM 5197  H HA     . LYS B 2 26  ? -1.926  18.331  -13.263 1.00 0.00  ? 113 LYS A HA     4  
ATOM 5198  H HB2    . LYS B 2 26  ? -0.348  19.647  -14.732 1.00 0.00  ? 113 LYS A HB2    4  
ATOM 5199  H HB3    . LYS B 2 26  ? 0.546   20.127  -13.299 1.00 0.00  ? 113 LYS A HB3    4  
ATOM 5200  H HG2    . LYS B 2 26  ? 0.061   17.197  -14.007 1.00 0.00  ? 113 LYS A HG2    4  
ATOM 5201  H HG3    . LYS B 2 26  ? 1.338   18.145  -14.766 1.00 0.00  ? 113 LYS A HG3    4  
ATOM 5202  H HD2    . LYS B 2 26  ? 2.323   18.616  -12.510 1.00 0.00  ? 113 LYS A HD2    4  
ATOM 5203  H HD3    . LYS B 2 26  ? 1.096   17.583  -11.784 1.00 0.00  ? 113 LYS A HD3    4  
ATOM 5204  H HE2    . LYS B 2 26  ? 3.100   16.313  -11.969 1.00 0.00  ? 113 LYS A HE2    4  
ATOM 5205  H HE3    . LYS B 2 26  ? 1.901   15.644  -13.079 1.00 0.00  ? 113 LYS A HE3    4  
ATOM 5206  H HZ1    . LYS B 2 26  ? 3.059   16.706  -14.910 1.00 0.00  ? 113 LYS A HZ1    4  
ATOM 5207  H HZ2    . LYS B 2 26  ? 4.072   17.512  -13.908 1.00 0.00  ? 113 LYS A HZ2    4  
ATOM 5208  H HZ3    . LYS B 2 26  ? 4.169   15.882  -14.042 1.00 0.00  ? 113 LYS A HZ3    4  
ATOM 5209  N N      . SER B 2 27  ? -0.883  20.120  -10.682 1.00 0.00  ? 114 SER A N      4  
ATOM 5210  C CA     . SER B 2 27  ? -0.519  20.132  -9.256  1.00 0.00  ? 114 SER A CA     4  
ATOM 5211  C C      . SER B 2 27  ? -1.675  19.831  -8.276  1.00 0.00  ? 114 SER A C      4  
ATOM 5212  O O      . SER B 2 27  ? -1.451  19.206  -7.238  1.00 0.00  ? 114 SER A O      4  
ATOM 5213  C CB     . SER B 2 27  ? 0.099   21.495  -8.924  1.00 0.00  ? 114 SER A CB     4  
ATOM 5214  O OG     . SER B 2 27  ? 0.730   21.471  -7.657  1.00 0.00  ? 114 SER A OG     4  
ATOM 5215  H H      . SER B 2 27  ? -0.809  20.982  -11.208 1.00 0.00  ? 114 SER A H      4  
ATOM 5216  H HA     . SER B 2 27  ? 0.249   19.375  -9.100  1.00 0.00  ? 114 SER A HA     4  
ATOM 5217  H HB2    . SER B 2 27  ? 0.843   21.743  -9.682  1.00 0.00  ? 114 SER A HB2    4  
ATOM 5218  H HB3    . SER B 2 27  ? -0.678  22.261  -8.933  1.00 0.00  ? 114 SER A HB3    4  
ATOM 5219  H HG     . SER B 2 27  ? 1.128   22.347  -7.487  1.00 0.00  ? 114 SER A HG     4  
ATOM 5220  N N      . GLN B 2 28  ? -2.909  20.262  -8.575  1.00 0.00  ? 115 GLN A N      4  
ATOM 5221  C CA     . GLN B 2 28  ? -4.037  20.284  -7.621  1.00 0.00  ? 115 GLN A CA     4  
ATOM 5222  C C      . GLN B 2 28  ? -4.542  18.942  -7.011  1.00 0.00  ? 115 GLN A C      4  
ATOM 5223  O O      . GLN B 2 28  ? -5.131  19.022  -5.926  1.00 0.00  ? 115 GLN A O      4  
ATOM 5224  C CB     . GLN B 2 28  ? -5.210  21.116  -8.190  1.00 0.00  ? 115 GLN A CB     4  
ATOM 5225  C CG     . GLN B 2 28  ? -5.913  20.504  -9.412  1.00 0.00  ? 115 GLN A CG     4  
ATOM 5226  C CD     . GLN B 2 28  ? -7.063  21.378  -9.924  1.00 0.00  ? 115 GLN A CD     4  
ATOM 5227  O OE1    . GLN B 2 28  ? -7.024  21.959  -11.002 1.00 0.00  ? 115 GLN A OE1    4  
ATOM 5228  N NE2    . GLN B 2 28  ? -8.149  21.493  -9.196  1.00 0.00  ? 115 GLN A NE2    4  
ATOM 5229  H H      . GLN B 2 28  ? -3.013  20.810  -9.422  1.00 0.00  ? 115 GLN A H      4  
ATOM 5230  H HA     . GLN B 2 28  ? -3.671  20.853  -6.763  1.00 0.00  ? 115 GLN A HA     4  
ATOM 5231  H HB2    . GLN B 2 28  ? -5.945  21.249  -7.395  1.00 0.00  ? 115 GLN A HB2    4  
ATOM 5232  H HB3    . GLN B 2 28  ? -4.844  22.107  -8.455  1.00 0.00  ? 115 GLN A HB3    4  
ATOM 5233  H HG2    . GLN B 2 28  ? -5.189  20.388  -10.213 1.00 0.00  ? 115 GLN A HG2    4  
ATOM 5234  H HG3    . GLN B 2 28  ? -6.311  19.521  -9.156  1.00 0.00  ? 115 GLN A HG3    4  
ATOM 5235  H HE21   . GLN B 2 28  ? -8.249  20.962  -8.333  1.00 0.00  ? 115 GLN A HE21   4  
ATOM 5236  H HE22   . GLN B 2 28  ? -8.894  22.068  -9.557  1.00 0.00  ? 115 GLN A HE22   4  
ATOM 5237  N N      . PRO B 2 29  ? -4.374  17.736  -7.608  1.00 0.00  ? 116 PRO A N      4  
ATOM 5238  C CA     . PRO B 2 29  ? -4.797  16.472  -6.990  1.00 0.00  ? 116 PRO A CA     4  
ATOM 5239  C C      . PRO B 2 29  ? -4.248  16.220  -5.573  1.00 0.00  ? 116 PRO A C      4  
ATOM 5240  O O      . PRO B 2 29  ? -3.199  16.736  -5.175  1.00 0.00  ? 116 PRO A O      4  
ATOM 5241  C CB     . PRO B 2 29  ? -4.368  15.367  -7.958  1.00 0.00  ? 116 PRO A CB     4  
ATOM 5242  C CG     . PRO B 2 29  ? -4.401  16.072  -9.306  1.00 0.00  ? 116 PRO A CG     4  
ATOM 5243  C CD     . PRO B 2 29  ? -3.896  17.467  -8.957  1.00 0.00  ? 116 PRO A CD     4  
ATOM 5244  H HA     . PRO B 2 29  ? -5.886  16.482  -6.933  1.00 0.00  ? 116 PRO A HA     4  
ATOM 5245  H HB2    . PRO B 2 29  ? -3.350  15.053  -7.732  1.00 0.00  ? 116 PRO A HB2    4  
ATOM 5246  H HB3    . PRO B 2 29  ? -5.050  14.519  -7.930  1.00 0.00  ? 116 PRO A HB3    4  
ATOM 5247  H HG2    . PRO B 2 29  ? -3.762  15.577  -10.039 1.00 0.00  ? 116 PRO A HG2    4  
ATOM 5248  H HG3    . PRO B 2 29  ? -5.431  16.129  -9.667  1.00 0.00  ? 116 PRO A HG3    4  
ATOM 5249  H HD2    . PRO B 2 29  ? -2.807  17.452  -8.950  1.00 0.00  ? 116 PRO A HD2    4  
ATOM 5250  H HD3    . PRO B 2 29  ? -4.265  18.193  -9.680  1.00 0.00  ? 116 PRO A HD3    4  
ATOM 5251  N N      . LYS B 2 30  ? -4.963  15.384  -4.814  1.00 0.00  ? 117 LYS A N      4  
ATOM 5252  C CA     . LYS B 2 30  ? -4.803  15.066  -3.396  1.00 0.00  ? 117 LYS A CA     4  
ATOM 5253  C C      . LYS B 2 30  ? -5.558  13.769  -3.115  1.00 0.00  ? 117 LYS A C      4  
ATOM 5254  O O      . LYS B 2 30  ? -5.967  13.085  -4.056  1.00 0.00  ? 117 LYS A O      4  
ATOM 5255  C CB     . LYS B 2 30  ? -5.221  16.257  -2.523  1.00 0.00  ? 117 LYS A CB     4  
ATOM 5256  C CG     . LYS B 2 30  ? -6.693  16.668  -2.692  1.00 0.00  ? 117 LYS A CG     4  
ATOM 5257  C CD     . LYS B 2 30  ? -6.995  18.054  -2.113  1.00 0.00  ? 117 LYS A CD     4  
ATOM 5258  C CE     . LYS B 2 30  ? -6.736  18.088  -0.602  1.00 0.00  ? 117 LYS A CE     4  
ATOM 5259  N NZ     . LYS B 2 30  ? -7.066  19.417  -0.022  1.00 0.00  ? 117 LYS A NZ     4  
ATOM 5260  H H      . LYS B 2 30  ? -5.722  14.845  -5.216  1.00 0.00  ? 117 LYS A H      4  
ATOM 5261  H HA     . LYS B 2 30  ? -3.755  14.880  -3.198  1.00 0.00  ? 117 LYS A HA     4  
ATOM 5262  H HB2    . LYS B 2 30  ? -5.025  16.019  -1.477  1.00 0.00  ? 117 LYS A HB2    4  
ATOM 5263  H HB3    . LYS B 2 30  ? -4.561  17.081  -2.794  1.00 0.00  ? 117 LYS A HB3    4  
ATOM 5264  H HG2    . LYS B 2 30  ? -6.937  16.696  -3.752  1.00 0.00  ? 117 LYS A HG2    4  
ATOM 5265  H HG3    . LYS B 2 30  ? -7.343  15.931  -2.216  1.00 0.00  ? 117 LYS A HG3    4  
ATOM 5266  H HD2    . LYS B 2 30  ? -6.369  18.798  -2.614  1.00 0.00  ? 117 LYS A HD2    4  
ATOM 5267  H HD3    . LYS B 2 30  ? -8.045  18.292  -2.304  1.00 0.00  ? 117 LYS A HD3    4  
ATOM 5268  H HE2    . LYS B 2 30  ? -7.337  17.305  -0.129  1.00 0.00  ? 117 LYS A HE2    4  
ATOM 5269  H HE3    . LYS B 2 30  ? -5.686  17.851  -0.425  1.00 0.00  ? 117 LYS A HE3    4  
ATOM 5270  H HZ1    . LYS B 2 30  ? -6.508  20.151  -0.438  1.00 0.00  ? 117 LYS A HZ1    4  
ATOM 5271  H HZ2    . LYS B 2 30  ? -8.041  19.649  -0.167  1.00 0.00  ? 117 LYS A HZ2    4  
ATOM 5272  H HZ3    . LYS B 2 30  ? -6.892  19.432  0.972   1.00 0.00  ? 117 LYS A HZ3    4  
ATOM 5273  N N      . ARG B 2 31  ? -5.561  13.311  -1.868  1.00 0.00  ? 118 ARG A N      4  
ATOM 5274  C CA     . ARG B 2 31  ? -5.223  11.898  -1.661  1.00 0.00  ? 118 ARG A CA     4  
ATOM 5275  C C      . ARG B 2 31  ? -6.304  11.011  -1.049  1.00 0.00  ? 118 ARG A C      4  
ATOM 5276  O O      . ARG B 2 31  ? -7.333  11.462  -0.547  1.00 0.00  ? 118 ARG A O      4  
ATOM 5277  C CB     . ARG B 2 31  ? -3.804  11.838  -1.087  1.00 0.00  ? 118 ARG A CB     4  
ATOM 5278  C CG     . ARG B 2 31  ? -3.652  12.293  0.371   1.00 0.00  ? 118 ARG A CG     4  
ATOM 5279  C CD     . ARG B 2 31  ? -2.168  12.220  0.750   1.00 0.00  ? 118 ARG A CD     4  
ATOM 5280  N NE     . ARG B 2 31  ? -1.959  12.518  2.175   1.00 0.00  ? 118 ARG A NE     4  
ATOM 5281  C CZ     . ARG B 2 31  ? -0.881  13.016  2.748   1.00 0.00  ? 118 ARG A CZ     4  
ATOM 5282  N NH1    . ARG B 2 31  ? 0.179   13.363  2.074   1.00 0.00  ? 118 ARG A NH1    4  
ATOM 5283  N NH2    . ARG B 2 31  ? -0.868  13.178  4.038   1.00 0.00  ? 118 ARG A NH2    4  
ATOM 5284  H H      . ARG B 2 31  ? -5.308  13.969  -1.145  1.00 0.00  ? 118 ARG A H      4  
ATOM 5285  H HA     . ARG B 2 31  ? -5.117  11.446  -2.649  1.00 0.00  ? 118 ARG A HA     4  
ATOM 5286  H HB2    . ARG B 2 31  ? -3.415  10.824  -1.166  1.00 0.00  ? 118 ARG A HB2    4  
ATOM 5287  H HB3    . ARG B 2 31  ? -3.214  12.493  -1.741  1.00 0.00  ? 118 ARG A HB3    4  
ATOM 5288  H HG2    . ARG B 2 31  ? -4.002  13.318  0.488   1.00 0.00  ? 118 ARG A HG2    4  
ATOM 5289  H HG3    . ARG B 2 31  ? -4.231  11.635  1.016   1.00 0.00  ? 118 ARG A HG3    4  
ATOM 5290  H HD2    . ARG B 2 31  ? -1.794  11.215  0.542   1.00 0.00  ? 118 ARG A HD2    4  
ATOM 5291  H HD3    . ARG B 2 31  ? -1.617  12.926  0.128   1.00 0.00  ? 118 ARG A HD3    4  
ATOM 5292  H HE     . ARG B 2 31  ? -2.686  12.256  2.828   1.00 0.00  ? 118 ARG A HE     4  
ATOM 5293  H HH11   . ARG B 2 31  ? 0.176   13.228  1.080   1.00 0.00  ? 118 ARG A HH11   4  
ATOM 5294  H HH12   . ARG B 2 31  ? 0.997   13.727  2.535   1.00 0.00  ? 118 ARG A HH12   4  
ATOM 5295  H HH21   . ARG B 2 31  ? -1.678  12.863  4.550   1.00 0.00  ? 118 ARG A HH21   4  
ATOM 5296  H HH22   . ARG B 2 31  ? -0.059  13.544  4.509   1.00 0.00  ? 118 ARG A HH22   4  
ATOM 5297  N N      . LEU B 2 32  ? -6.083  9.720   -1.264  1.00 0.00  ? 119 LEU A N      4  
ATOM 5298  C CA     . LEU B 2 32  ? -7.085  8.716   -1.609  1.00 0.00  ? 119 LEU A CA     4  
ATOM 5299  C C      . LEU B 2 32  ? -6.687  7.413   -0.903  1.00 0.00  ? 119 LEU A C      4  
ATOM 5300  O O      . LEU B 2 32  ? -5.598  6.903   -1.152  1.00 0.00  ? 119 LEU A O      4  
ATOM 5301  C CB     . LEU B 2 32  ? -7.068  8.623   -3.159  1.00 0.00  ? 119 LEU A CB     4  
ATOM 5302  C CG     . LEU B 2 32  ? -8.022  7.628   -3.821  1.00 0.00  ? 119 LEU A CG     4  
ATOM 5303  C CD1    . LEU B 2 32  ? -9.478  8.029   -3.584  1.00 0.00  ? 119 LEU A CD1    4  
ATOM 5304  C CD2    . LEU B 2 32  ? -7.870  7.614   -5.339  1.00 0.00  ? 119 LEU A CD2    4  
ATOM 5305  H H      . LEU B 2 32  ? -5.172  9.525   -1.667  1.00 0.00  ? 119 LEU A H      4  
ATOM 5306  H HA     . LEU B 2 32  ? -8.070  9.036   -1.263  1.00 0.00  ? 119 LEU A HA     4  
ATOM 5307  H HB2    . LEU B 2 32  ? -7.267  9.613   -3.569  1.00 0.00  ? 119 LEU A HB2    4  
ATOM 5308  H HB3    . LEU B 2 32  ? -6.072  8.329   -3.475  1.00 0.00  ? 119 LEU A HB3    4  
ATOM 5309  H HG     . LEU B 2 32  ? -7.778  6.625   -3.467  1.00 0.00  ? 119 LEU A HG     4  
ATOM 5310  H HD11   . LEU B 2 32  ? -9.685  8.104   -2.526  1.00 0.00  ? 119 LEU A HD11   4  
ATOM 5311  H HD12   . LEU B 2 32  ? -9.683  9.000   -4.054  1.00 0.00  ? 119 LEU A HD12   4  
ATOM 5312  H HD13   . LEU B 2 32  ? -10.129 7.274   -4.016  1.00 0.00  ? 119 LEU A HD13   4  
ATOM 5313  H HD21   . LEU B 2 32  ? -8.119  8.593   -5.738  1.00 0.00  ? 119 LEU A HD21   4  
ATOM 5314  H HD22   . LEU B 2 32  ? -6.849  7.356   -5.609  1.00 0.00  ? 119 LEU A HD22   4  
ATOM 5315  H HD23   . LEU B 2 32  ? -8.542  6.873   -5.772  1.00 0.00  ? 119 LEU A HD23   4  
ATOM 5316  N N      . HIS B 2 33  ? -7.513  6.929   0.027   1.00 0.00  ? 120 HIS A N      4  
ATOM 5317  C CA     . HIS B 2 33  ? -7.317  5.715   0.832   1.00 0.00  ? 120 HIS A CA     4  
ATOM 5318  C C      . HIS B 2 33  ? -7.858  4.493   0.073   1.00 0.00  ? 120 HIS A C      4  
ATOM 5319  O O      . HIS B 2 33  ? -8.941  4.527   -0.506  1.00 0.00  ? 120 HIS A O      4  
ATOM 5320  C CB     . HIS B 2 33  ? -8.057  5.917   2.169   1.00 0.00  ? 120 HIS A CB     4  
ATOM 5321  C CG     . HIS B 2 33  ? -8.334  4.673   2.974   1.00 0.00  ? 120 HIS A CG     4  
ATOM 5322  N ND1    . HIS B 2 33  ? -9.575  4.050   3.098   1.00 0.00  ? 120 HIS A ND1    4  
ATOM 5323  C CD2    . HIS B 2 33  ? -7.446  4.057   3.800   1.00 0.00  ? 120 HIS A CD2    4  
ATOM 5324  C CE1    . HIS B 2 33  ? -9.408  3.072   4.002   1.00 0.00  ? 120 HIS A CE1    4  
ATOM 5325  N NE2    . HIS B 2 33  ? -8.133  3.040   4.427   1.00 0.00  ? 120 HIS A NE2    4  
ATOM 5326  H H      . HIS B 2 33  ? -8.439  7.336   0.057   1.00 0.00  ? 120 HIS A H      4  
ATOM 5327  H HA     . HIS B 2 33  ? -6.244  5.557   1.017   1.00 0.00  ? 120 HIS A HA     4  
ATOM 5328  H HB2    . HIS B 2 33  ? -7.484  6.594   2.810   1.00 0.00  ? 120 HIS A HB2    4  
ATOM 5329  H HB3    . HIS B 2 33  ? -9.020  6.388   1.967   1.00 0.00  ? 120 HIS A HB3    4  
ATOM 5330  H HD2    . HIS B 2 33  ? -6.420  4.353   3.956   1.00 0.00  ? 120 HIS A HD2    4  
ATOM 5331  H HE1    . HIS B 2 33  ? -10.200 2.423   4.360   1.00 0.00  ? 120 HIS A HE1    4  
ATOM 5332  H HE2    . HIS B 2 33  ? -7.766  2.390   5.112   1.00 0.00  ? 120 HIS A HE2    4  
ATOM 5333  N N      . VAL B 2 34  ? -7.076  3.415   0.044   1.00 0.00  ? 121 VAL A N      4  
ATOM 5334  C CA     . VAL B 2 34  ? -7.151  2.331   -0.949  1.00 0.00  ? 121 VAL A CA     4  
ATOM 5335  C C      . VAL B 2 34  ? -7.179  0.990   -0.224  1.00 0.00  ? 121 VAL A C      4  
ATOM 5336  O O      . VAL B 2 34  ? -6.135  0.373   -0.013  1.00 0.00  ? 121 VAL A O      4  
ATOM 5337  C CB     . VAL B 2 34  ? -5.948  2.441   -1.914  1.00 0.00  ? 121 VAL A CB     4  
ATOM 5338  C CG1    . VAL B 2 34  ? -6.014  1.493   -3.104  1.00 0.00  ? 121 VAL A CG1    4  
ATOM 5339  C CG2    . VAL B 2 34  ? -5.817  3.837   -2.522  1.00 0.00  ? 121 VAL A CG2    4  
ATOM 5340  H H      . VAL B 2 34  ? -6.206  3.482   0.563   1.00 0.00  ? 121 VAL A H      4  
ATOM 5341  H HA     . VAL B 2 34  ? -8.067  2.407   -1.526  1.00 0.00  ? 121 VAL A HA     4  
ATOM 5342  H HB     . VAL B 2 34  ? -5.026  2.231   -1.378  1.00 0.00  ? 121 VAL A HB     4  
ATOM 5343  H HG11   . VAL B 2 34  ? -6.077  0.460   -2.768  1.00 0.00  ? 121 VAL A HG11   4  
ATOM 5344  H HG12   . VAL B 2 34  ? -6.864  1.741   -3.739  1.00 0.00  ? 121 VAL A HG12   4  
ATOM 5345  H HG13   . VAL B 2 34  ? -5.092  1.626   -3.672  1.00 0.00  ? 121 VAL A HG13   4  
ATOM 5346  H HG21   . VAL B 2 34  ? -6.754  4.145   -2.990  1.00 0.00  ? 121 VAL A HG21   4  
ATOM 5347  H HG22   . VAL B 2 34  ? -5.540  4.540   -1.746  1.00 0.00  ? 121 VAL A HG22   4  
ATOM 5348  H HG23   . VAL B 2 34  ? -5.018  3.838   -3.257  1.00 0.00  ? 121 VAL A HG23   4  
ATOM 5349  N N      . SER B 2 35  ? -8.359  0.581   0.250   1.00 0.00  ? 122 SER A N      4  
ATOM 5350  C CA     . SER B 2 35  ? -8.506  -0.504  1.230   1.00 0.00  ? 122 SER A CA     4  
ATOM 5351  C C      . SER B 2 35  ? -8.733  -1.893  0.632   1.00 0.00  ? 122 SER A C      4  
ATOM 5352  O O      . SER B 2 35  ? -9.106  -2.033  -0.535  1.00 0.00  ? 122 SER A O      4  
ATOM 5353  C CB     . SER B 2 35  ? -9.658  -0.188  2.193   1.00 0.00  ? 122 SER A CB     4  
ATOM 5354  O OG     . SER B 2 35  ? -9.300  -0.630  3.492   1.00 0.00  ? 122 SER A OG     4  
ATOM 5355  H H      . SER B 2 35  ? -9.179  1.135   0.022   1.00 0.00  ? 122 SER A H      4  
ATOM 5356  H HA     . SER B 2 35  ? -7.593  -0.548  1.806   1.00 0.00  ? 122 SER A HA     4  
ATOM 5357  H HB2    . SER B 2 35  ? -9.861  0.882   2.206   1.00 0.00  ? 122 SER A HB2    4  
ATOM 5358  H HB3    . SER B 2 35  ? -10.561 -0.706  1.879   1.00 0.00  ? 122 SER A HB3    4  
ATOM 5359  H HG     . SER B 2 35  ? -10.049 -0.467  4.098   1.00 0.00  ? 122 SER A HG     4  
ATOM 5360  N N      . ASN B 2 36  ? -8.560  -2.917  1.479   1.00 0.00  ? 123 ASN A N      4  
ATOM 5361  C CA     . ASN B 2 36  ? -8.917  -4.329  1.268   1.00 0.00  ? 123 ASN A CA     4  
ATOM 5362  C C      . ASN B 2 36  ? -8.128  -5.039  0.153   1.00 0.00  ? 123 ASN A C      4  
ATOM 5363  O O      . ASN B 2 36  ? -8.436  -6.179  -0.195  1.00 0.00  ? 123 ASN A O      4  
ATOM 5364  C CB     . ASN B 2 36  ? -10.451 -4.419  1.116   1.00 0.00  ? 123 ASN A CB     4  
ATOM 5365  C CG     . ASN B 2 36  ? -10.975 -5.842  1.160   1.00 0.00  ? 123 ASN A CG     4  
ATOM 5366  O OD1    . ASN B 2 36  ? -10.708 -6.597  2.083   1.00 0.00  ? 123 ASN A OD1    4  
ATOM 5367  N ND2    . ASN B 2 36  ? -11.723 -6.260  0.170   1.00 0.00  ? 123 ASN A ND2    4  
ATOM 5368  H H      . ASN B 2 36  ? -8.158  -2.669  2.373   1.00 0.00  ? 123 ASN A H      4  
ATOM 5369  H HA     . ASN B 2 36  ? -8.639  -4.885  2.167   1.00 0.00  ? 123 ASN A HA     4  
ATOM 5370  H HB2    . ASN B 2 36  ? -10.925 -3.876  1.935   1.00 0.00  ? 123 ASN A HB2    4  
ATOM 5371  H HB3    . ASN B 2 36  ? -10.748 -3.957  0.178   1.00 0.00  ? 123 ASN A HB3    4  
ATOM 5372  H HD21   . ASN B 2 36  ? -11.880 -5.648  -0.628  1.00 0.00  ? 123 ASN A HD21   4  
ATOM 5373  H HD22   . ASN B 2 36  ? -12.126 -7.183  0.235   1.00 0.00  ? 123 ASN A HD22   4  
ATOM 5374  N N      . ILE B 2 37  ? -7.086  -4.391  -0.373  1.00 0.00  ? 124 ILE A N      4  
ATOM 5375  C CA     . ILE B 2 37  ? -6.230  -4.862  -1.468  1.00 0.00  ? 124 ILE A CA     4  
ATOM 5376  C C      . ILE B 2 37  ? -5.597  -6.228  -1.133  1.00 0.00  ? 124 ILE A C      4  
ATOM 5377  O O      . ILE B 2 37  ? -5.325  -6.481  0.046   1.00 0.00  ? 124 ILE A O      4  
ATOM 5378  C CB     . ILE B 2 37  ? -5.151  -3.798  -1.785  1.00 0.00  ? 124 ILE A CB     4  
ATOM 5379  C CG1    . ILE B 2 37  ? -4.001  -3.779  -0.753  1.00 0.00  ? 124 ILE A CG1    4  
ATOM 5380  C CG2    . ILE B 2 37  ? -5.799  -2.406  -1.867  1.00 0.00  ? 124 ILE A CG2    4  
ATOM 5381  C CD1    . ILE B 2 37  ? -3.097  -2.551  -0.859  1.00 0.00  ? 124 ILE A CD1    4  
ATOM 5382  H H      . ILE B 2 37  ? -6.884  -3.483  0.022   1.00 0.00  ? 124 ILE A H      4  
ATOM 5383  H HA     . ILE B 2 37  ? -6.872  -4.969  -2.340  1.00 0.00  ? 124 ILE A HA     4  
ATOM 5384  H HB     . ILE B 2 37  ? -4.728  -4.035  -2.762  1.00 0.00  ? 124 ILE A HB     4  
ATOM 5385  H HG12   . ILE B 2 37  ? -4.413  -3.808  0.254   1.00 0.00  ? 124 ILE A HG12   4  
ATOM 5386  H HG13   . ILE B 2 37  ? -3.383  -4.664  -0.892  1.00 0.00  ? 124 ILE A HG13   4  
ATOM 5387  H HG21   . ILE B 2 37  ? -6.747  -2.468  -2.393  1.00 0.00  ? 124 ILE A HG21   4  
ATOM 5388  H HG22   . ILE B 2 37  ? -5.949  -2.017  -0.855  1.00 0.00  ? 124 ILE A HG22   4  
ATOM 5389  H HG23   . ILE B 2 37  ? -5.147  -1.720  -2.402  1.00 0.00  ? 124 ILE A HG23   4  
ATOM 5390  H HD11   . ILE B 2 37  ? -2.765  -2.421  -1.888  1.00 0.00  ? 124 ILE A HD11   4  
ATOM 5391  H HD12   . ILE B 2 37  ? -3.636  -1.660  -0.535  1.00 0.00  ? 124 ILE A HD12   4  
ATOM 5392  H HD13   . ILE B 2 37  ? -2.242  -2.684  -0.204  1.00 0.00  ? 124 ILE A HD13   4  
ATOM 5393  N N      . PRO B 2 38  ? -5.325  -7.105  -2.119  1.00 0.00  ? 125 PRO A N      4  
ATOM 5394  C CA     . PRO B 2 38  ? -4.563  -8.337  -1.900  1.00 0.00  ? 125 PRO A CA     4  
ATOM 5395  C C      . PRO B 2 38  ? -3.222  -8.034  -1.234  1.00 0.00  ? 125 PRO A C      4  
ATOM 5396  O O      . PRO B 2 38  ? -2.504  -7.146  -1.694  1.00 0.00  ? 125 PRO A O      4  
ATOM 5397  C CB     . PRO B 2 38  ? -4.341  -8.951  -3.288  1.00 0.00  ? 125 PRO A CB     4  
ATOM 5398  C CG     . PRO B 2 38  ? -5.496  -8.380  -4.094  1.00 0.00  ? 125 PRO A CG     4  
ATOM 5399  C CD     . PRO B 2 38  ? -5.681  -6.978  -3.522  1.00 0.00  ? 125 PRO A CD     4  
ATOM 5400  H HA     . PRO B 2 38  ? -5.151  -9.018  -1.285  1.00 0.00  ? 125 PRO A HA     4  
ATOM 5401  H HB2    . PRO B 2 38  ? -3.399  -8.610  -3.716  1.00 0.00  ? 125 PRO A HB2    4  
ATOM 5402  H HB3    . PRO B 2 38  ? -4.371  -10.039 -3.255  1.00 0.00  ? 125 PRO A HB3    4  
ATOM 5403  H HG2    . PRO B 2 38  ? -5.285  -8.361  -5.157  1.00 0.00  ? 125 PRO A HG2    4  
ATOM 5404  H HG3    . PRO B 2 38  ? -6.379  -8.977  -3.903  1.00 0.00  ? 125 PRO A HG3    4  
ATOM 5405  H HD2    . PRO B 2 38  ? -5.000  -6.280  -4.015  1.00 0.00  ? 125 PRO A HD2    4  
ATOM 5406  H HD3    . PRO B 2 38  ? -6.717  -6.659  -3.650  1.00 0.00  ? 125 PRO A HD3    4  
ATOM 5407  N N      . PHE B 2 39  ? -2.837  -8.771  -0.192  1.00 0.00  ? 126 PHE A N      4  
ATOM 5408  C CA     . PHE B 2 39  ? -1.587  -8.509  0.539   1.00 0.00  ? 126 PHE A CA     4  
ATOM 5409  C C      . PHE B 2 39  ? -0.290  -8.486  -0.298  1.00 0.00  ? 126 PHE A C      4  
ATOM 5410  O O      . PHE B 2 39  ? 0.718   -7.925  0.143   1.00 0.00  ? 126 PHE A O      4  
ATOM 5411  C CB     . PHE B 2 39  ? -1.434  -9.528  1.674   1.00 0.00  ? 126 PHE A CB     4  
ATOM 5412  C CG     . PHE B 2 39  ? -2.164  -9.242  2.969   1.00 0.00  ? 126 PHE A CG     4  
ATOM 5413  C CD1    . PHE B 2 39  ? -2.284  -7.929  3.472   1.00 0.00  ? 126 PHE A CD1    4  
ATOM 5414  C CD2    . PHE B 2 39  ? -2.614  -10.331 3.740   1.00 0.00  ? 126 PHE A CD2    4  
ATOM 5415  C CE1    . PHE B 2 39  ? -2.903  -7.719  4.716   1.00 0.00  ? 126 PHE A CE1    4  
ATOM 5416  C CE2    . PHE B 2 39  ? -3.186  -10.119 5.003   1.00 0.00  ? 126 PHE A CE2    4  
ATOM 5417  C CZ     . PHE B 2 39  ? -3.346  -8.809  5.477   1.00 0.00  ? 126 PHE A CZ     4  
ATOM 5418  H H      . PHE B 2 39  ? -3.522  -9.406  0.206   1.00 0.00  ? 126 PHE A H      4  
ATOM 5419  H HA     . PHE B 2 39  ? -1.668  -7.515  0.960   1.00 0.00  ? 126 PHE A HA     4  
ATOM 5420  H HB2    . PHE B 2 39  ? -1.702  -10.522 1.308   1.00 0.00  ? 126 PHE A HB2    4  
ATOM 5421  H HB3    . PHE B 2 39  ? -0.388  -9.572  1.940   1.00 0.00  ? 126 PHE A HB3    4  
ATOM 5422  H HD1    . PHE B 2 39  ? -1.862  -7.067  2.962   1.00 0.00  ? 126 PHE A HD1    4  
ATOM 5423  H HD2    . PHE B 2 39  ? -2.498  -11.344 3.377   1.00 0.00  ? 126 PHE A HD2    4  
ATOM 5424  H HE1    . PHE B 2 39  ? -3.016  -6.724  5.120   1.00 0.00  ? 126 PHE A HE1    4  
ATOM 5425  H HE2    . PHE B 2 39  ? -3.520  -10.956 5.600   1.00 0.00  ? 126 PHE A HE2    4  
ATOM 5426  H HZ     . PHE B 2 39  ? -3.806  -8.623  6.429   1.00 0.00  ? 126 PHE A HZ     4  
ATOM 5427  N N      . ARG B 2 40  ? -0.310  -9.061  -1.507  1.00 0.00  ? 127 ARG A N      4  
ATOM 5428  C CA     . ARG B 2 40  ? 0.788   -9.037  -2.489  1.00 0.00  ? 127 ARG A CA     4  
ATOM 5429  C C      . ARG B 2 40  ? 0.985   -7.662  -3.158  1.00 0.00  ? 127 ARG A C      4  
ATOM 5430  O O      . ARG B 2 40  ? 2.018   -7.457  -3.799  1.00 0.00  ? 127 ARG A O      4  
ATOM 5431  C CB     . ARG B 2 40  ? 0.548   -10.122 -3.557  1.00 0.00  ? 127 ARG A CB     4  
ATOM 5432  C CG     . ARG B 2 40  ? 0.870   -11.560 -3.108  1.00 0.00  ? 127 ARG A CG     4  
ATOM 5433  C CD     . ARG B 2 40  ? 0.014   -12.060 -1.936  1.00 0.00  ? 127 ARG A CD     4  
ATOM 5434  N NE     . ARG B 2 40  ? 0.095   -13.528 -1.796  1.00 0.00  ? 127 ARG A NE     4  
ATOM 5435  C CZ     . ARG B 2 40  ? 0.109   -14.243 -0.682  1.00 0.00  ? 127 ARG A CZ     4  
ATOM 5436  N NH1    . ARG B 2 40  ? 0.178   -13.714 0.507   1.00 0.00  ? 127 ARG A NH1    4  
ATOM 5437  N NH2    . ARG B 2 40  ? 0.047   -15.543 -0.748  1.00 0.00  ? 127 ARG A NH2    4  
ATOM 5438  H H      . ARG B 2 40  ? -1.192  -9.470  -1.775  1.00 0.00  ? 127 ARG A H      4  
ATOM 5439  H HA     . ARG B 2 40  ? 1.731   -9.249  -1.984  1.00 0.00  ? 127 ARG A HA     4  
ATOM 5440  H HB2    . ARG B 2 40  ? -0.484  -10.072 -3.902  1.00 0.00  ? 127 ARG A HB2    4  
ATOM 5441  H HB3    . ARG B 2 40  ? 1.187   -9.914  -4.417  1.00 0.00  ? 127 ARG A HB3    4  
ATOM 5442  H HG2    . ARG B 2 40  ? 0.701   -12.213 -3.968  1.00 0.00  ? 127 ARG A HG2    4  
ATOM 5443  H HG3    . ARG B 2 40  ? 1.922   -11.627 -2.833  1.00 0.00  ? 127 ARG A HG3    4  
ATOM 5444  H HD2    . ARG B 2 40  ? 0.347   -11.564 -1.021  1.00 0.00  ? 127 ARG A HD2    4  
ATOM 5445  H HD3    . ARG B 2 40  ? -1.028  -11.790 -2.127  1.00 0.00  ? 127 ARG A HD3    4  
ATOM 5446  H HE     . ARG B 2 40  ? 0.065   -14.065 -2.647  1.00 0.00  ? 127 ARG A HE     4  
ATOM 5447  H HH11   . ARG B 2 40  ? 0.324   -12.721 0.613   1.00 0.00  ? 127 ARG A HH11   4  
ATOM 5448  H HH12   . ARG B 2 40  ? 0.201   -14.304 1.320   1.00 0.00  ? 127 ARG A HH12   4  
ATOM 5449  H HH21   . ARG B 2 40  ? -0.005  -16.004 -1.643  1.00 0.00  ? 127 ARG A HH21   4  
ATOM 5450  H HH22   . ARG B 2 40  ? 0.045   -16.097 0.092   1.00 0.00  ? 127 ARG A HH22   4  
ATOM 5451  N N      . PHE B 2 41  ? 0.035   -6.728  -3.032  1.00 0.00  ? 128 PHE A N      4  
ATOM 5452  C CA     . PHE B 2 41  ? 0.139   -5.367  -3.576  1.00 0.00  ? 128 PHE A CA     4  
ATOM 5453  C C      . PHE B 2 41  ? 1.349   -4.578  -3.049  1.00 0.00  ? 128 PHE A C      4  
ATOM 5454  O O      . PHE B 2 41  ? 1.828   -4.773  -1.928  1.00 0.00  ? 128 PHE A O      4  
ATOM 5455  C CB     . PHE B 2 41  ? -1.157  -4.580  -3.328  1.00 0.00  ? 128 PHE A CB     4  
ATOM 5456  C CG     . PHE B 2 41  ? -2.121  -4.555  -4.501  1.00 0.00  ? 128 PHE A CG     4  
ATOM 5457  C CD1    . PHE B 2 41  ? -2.333  -5.694  -5.303  1.00 0.00  ? 128 PHE A CD1    4  
ATOM 5458  C CD2    . PHE B 2 41  ? -2.785  -3.354  -4.811  1.00 0.00  ? 128 PHE A CD2    4  
ATOM 5459  C CE1    . PHE B 2 41  ? -3.144  -5.605  -6.450  1.00 0.00  ? 128 PHE A CE1    4  
ATOM 5460  C CE2    . PHE B 2 41  ? -3.609  -3.273  -5.943  1.00 0.00  ? 128 PHE A CE2    4  
ATOM 5461  C CZ     . PHE B 2 41  ? -3.762  -4.388  -6.784  1.00 0.00  ? 128 PHE A CZ     4  
ATOM 5462  H H      . PHE B 2 41  ? -0.809  -6.980  -2.534  1.00 0.00  ? 128 PHE A H      4  
ATOM 5463  H HA     . PHE B 2 41  ? 0.276   -5.454  -4.654  1.00 0.00  ? 128 PHE A HA     4  
ATOM 5464  H HB2    . PHE B 2 41  ? -1.667  -4.958  -2.449  1.00 0.00  ? 128 PHE A HB2    4  
ATOM 5465  H HB3    . PHE B 2 41  ? -0.892  -3.543  -3.105  1.00 0.00  ? 128 PHE A HB3    4  
ATOM 5466  H HD1    . PHE B 2 41  ? -1.861  -6.638  -5.069  1.00 0.00  ? 128 PHE A HD1    4  
ATOM 5467  H HD2    . PHE B 2 41  ? -2.651  -2.481  -4.190  1.00 0.00  ? 128 PHE A HD2    4  
ATOM 5468  H HE1    . PHE B 2 41  ? -3.290  -6.478  -7.076  1.00 0.00  ? 128 PHE A HE1    4  
ATOM 5469  H HE2    . PHE B 2 41  ? -4.117  -2.349  -6.167  1.00 0.00  ? 128 PHE A HE2    4  
ATOM 5470  H HZ     . PHE B 2 41  ? -4.376  -4.312  -7.670  1.00 0.00  ? 128 PHE A HZ     4  
ATOM 5471  N N      . ARG B 2 42  ? 1.817   -3.648  -3.889  1.00 0.00  ? 129 ARG A N      4  
ATOM 5472  C CA     . ARG B 2 42  ? 3.018   -2.814  -3.725  1.00 0.00  ? 129 ARG A CA     4  
ATOM 5473  C C      . ARG B 2 42  ? 2.736   -1.374  -4.164  1.00 0.00  ? 129 ARG A C      4  
ATOM 5474  O O      . ARG B 2 42  ? 1.754   -1.090  -4.856  1.00 0.00  ? 129 ARG A O      4  
ATOM 5475  C CB     . ARG B 2 42  ? 4.183   -3.407  -4.513  1.00 0.00  ? 129 ARG A CB     4  
ATOM 5476  C CG     . ARG B 2 42  ? 4.576   -4.752  -3.902  1.00 0.00  ? 129 ARG A CG     4  
ATOM 5477  C CD     . ARG B 2 42  ? 5.663   -5.424  -4.710  1.00 0.00  ? 129 ARG A CD     4  
ATOM 5478  N NE     . ARG B 2 42  ? 5.142   -5.825  -6.028  1.00 0.00  ? 129 ARG A NE     4  
ATOM 5479  C CZ     . ARG B 2 42  ? 5.556   -6.754  -6.862  1.00 0.00  ? 129 ARG A CZ     4  
ATOM 5480  N NH1    . ARG B 2 42  ? 6.590   -7.511  -6.621  1.00 0.00  ? 129 ARG A NH1    4  
ATOM 5481  N NH2    . ARG B 2 42  ? 4.896   -6.916  -7.970  1.00 0.00  ? 129 ARG A NH2    4  
ATOM 5482  H H      . ARG B 2 42  ? 1.306   -3.538  -4.755  1.00 0.00  ? 129 ARG A H      4  
ATOM 5483  H HA     . ARG B 2 42  ? 3.365   -2.841  -2.695  1.00 0.00  ? 129 ARG A HA     4  
ATOM 5484  H HB2    . ARG B 2 42  ? 3.916   -3.503  -5.564  1.00 0.00  ? 129 ARG A HB2    4  
ATOM 5485  H HB3    . ARG B 2 42  ? 5.049   -2.753  -4.424  1.00 0.00  ? 129 ARG A HB3    4  
ATOM 5486  H HG2    . ARG B 2 42  ? 4.937   -4.598  -2.885  1.00 0.00  ? 129 ARG A HG2    4  
ATOM 5487  H HG3    . ARG B 2 42  ? 3.732   -5.434  -3.870  1.00 0.00  ? 129 ARG A HG3    4  
ATOM 5488  H HD2    . ARG B 2 42  ? 6.525   -4.762  -4.818  1.00 0.00  ? 129 ARG A HD2    4  
ATOM 5489  H HD3    . ARG B 2 42  ? 5.923   -6.275  -4.097  1.00 0.00  ? 129 ARG A HD3    4  
ATOM 5490  H HE     . ARG B 2 42  ? 4.319   -5.339  -6.380  1.00 0.00  ? 129 ARG A HE     4  
ATOM 5491  H HH11   . ARG B 2 42  ? 7.108   -7.380  -5.770  1.00 0.00  ? 129 ARG A HH11   4  
ATOM 5492  H HH12   . ARG B 2 42  ? 6.869   -8.221  -7.280  1.00 0.00  ? 129 ARG A HH12   4  
ATOM 5493  H HH21   . ARG B 2 42  ? 4.094   -6.297  -8.109  1.00 0.00  ? 129 ARG A HH21   4  
ATOM 5494  H HH22   . ARG B 2 42  ? 5.155   -7.601  -8.656  1.00 0.00  ? 129 ARG A HH22   4  
ATOM 5495  N N      . ASP B 2 43  ? 3.640   -0.472  -3.813  1.00 0.00  ? 130 ASP A N      4  
ATOM 5496  C CA     . ASP B 2 43  ? 3.615   0.940   -4.201  1.00 0.00  ? 130 ASP A CA     4  
ATOM 5497  C C      . ASP B 2 43  ? 3.484   1.145   -5.736  1.00 0.00  ? 130 ASP A C      4  
ATOM 5498  O O      . ASP B 2 43  ? 2.509   1.764   -6.185  1.00 0.00  ? 130 ASP A O      4  
ATOM 5499  C CB     . ASP B 2 43  ? 4.869   1.616   -3.600  1.00 0.00  ? 130 ASP A CB     4  
ATOM 5500  C CG     . ASP B 2 43  ? 4.602   2.943   -2.876  1.00 0.00  ? 130 ASP A CG     4  
ATOM 5501  O OD1    . ASP B 2 43  ? 3.597   3.029   -2.136  1.00 0.00  ? 130 ASP A OD1    4  
ATOM 5502  O OD2    . ASP B 2 43  ? 5.443   3.864   -2.995  1.00 0.00  ? 130 ASP A OD2    4  
ATOM 5503  H H      . ASP B 2 43  ? 4.406   -0.796  -3.242  1.00 0.00  ? 130 ASP A H      4  
ATOM 5504  H HA     . ASP B 2 43  ? 2.726   1.381   -3.745  1.00 0.00  ? 130 ASP A HA     4  
ATOM 5505  H HB2    . ASP B 2 43  ? 5.341   0.946   -2.876  1.00 0.00  ? 130 ASP A HB2    4  
ATOM 5506  H HB3    . ASP B 2 43  ? 5.599   1.787   -4.391  1.00 0.00  ? 130 ASP A HB3    4  
ATOM 5507  N N      . PRO B 2 44  ? 4.388   0.585   -6.578  1.00 0.00  ? 131 PRO A N      4  
ATOM 5508  C CA     . PRO B 2 44  ? 4.303   0.761   -8.022  1.00 0.00  ? 131 PRO A CA     4  
ATOM 5509  C C      . PRO B 2 44  ? 3.174   -0.066  -8.655  1.00 0.00  ? 131 PRO A C      4  
ATOM 5510  O O      . PRO B 2 44  ? 2.679   0.294   -9.723  1.00 0.00  ? 131 PRO A O      4  
ATOM 5511  C CB     . PRO B 2 44  ? 5.676   0.372   -8.565  1.00 0.00  ? 131 PRO A CB     4  
ATOM 5512  C CG     . PRO B 2 44  ? 6.137   -0.713  -7.596  1.00 0.00  ? 131 PRO A CG     4  
ATOM 5513  C CD     . PRO B 2 44  ? 5.498   -0.309  -6.265  1.00 0.00  ? 131 PRO A CD     4  
ATOM 5514  H HA     . PRO B 2 44  ? 4.128   1.812   -8.242  1.00 0.00  ? 131 PRO A HA     4  
ATOM 5515  H HB2    . PRO B 2 44  ? 5.630   0.013   -9.593  1.00 0.00  ? 131 PRO A HB2    4  
ATOM 5516  H HB3    . PRO B 2 44  ? 6.349   1.230   -8.496  1.00 0.00  ? 131 PRO A HB3    4  
ATOM 5517  H HG2    . PRO B 2 44  ? 5.744   -1.680  -7.914  1.00 0.00  ? 131 PRO A HG2    4  
ATOM 5518  H HG3    . PRO B 2 44  ? 7.225   -0.750  -7.524  1.00 0.00  ? 131 PRO A HG3    4  
ATOM 5519  H HD2    . PRO B 2 44  ? 5.129   -1.203  -5.786  1.00 0.00  ? 131 PRO A HD2    4  
ATOM 5520  H HD3    . PRO B 2 44  ? 6.228   0.174   -5.621  1.00 0.00  ? 131 PRO A HD3    4  
ATOM 5521  N N      . ASP B 2 45  ? 2.699   -1.129  -7.993  1.00 0.00  ? 132 ASP A N      4  
ATOM 5522  C CA     . ASP B 2 45  ? 1.486   -1.828  -8.400  1.00 0.00  ? 132 ASP A CA     4  
ATOM 5523  C C      . ASP B 2 45  ? 0.261   -0.908  -8.292  1.00 0.00  ? 132 ASP A C      4  
ATOM 5524  O O      . ASP B 2 45  ? -0.497  -0.834  -9.260  1.00 0.00  ? 132 ASP A O      4  
ATOM 5525  C CB     . ASP B 2 45  ? 1.326   -3.131  -7.603  1.00 0.00  ? 132 ASP A CB     4  
ATOM 5526  C CG     . ASP B 2 45  ? 2.087   -4.305  -8.241  1.00 0.00  ? 132 ASP A CG     4  
ATOM 5527  O OD1    . ASP B 2 45  ? 1.782   -4.675  -9.399  1.00 0.00  ? 132 ASP A OD1    4  
ATOM 5528  O OD2    . ASP B 2 45  ? 2.985   -4.881  -7.581  1.00 0.00  ? 132 ASP A OD2    4  
ATOM 5529  H H      . ASP B 2 45  ? 3.086   -1.376  -7.098  1.00 0.00  ? 132 ASP A H      4  
ATOM 5530  H HA     . ASP B 2 45  ? 1.573   -2.088  -9.453  1.00 0.00  ? 132 ASP A HA     4  
ATOM 5531  H HB2    . ASP B 2 45  ? 1.658   -2.987  -6.578  1.00 0.00  ? 132 ASP A HB2    4  
ATOM 5532  H HB3    . ASP B 2 45  ? 0.272   -3.380  -7.560  1.00 0.00  ? 132 ASP A HB3    4  
ATOM 5533  N N      . LEU B 2 46  ? 0.070   -0.131  -7.207  1.00 0.00  ? 133 LEU A N      4  
ATOM 5534  C CA     . LEU B 2 46  ? -1.008  0.853   -7.189  1.00 0.00  ? 133 LEU A CA     4  
ATOM 5535  C C      . LEU B 2 46  ? -0.791  1.996   -8.173  1.00 0.00  ? 133 LEU A C      4  
ATOM 5536  O O      . LEU B 2 46  ? -1.756  2.380   -8.834  1.00 0.00  ? 133 LEU A O      4  
ATOM 5537  C CB     . LEU B 2 46  ? -1.279  1.398   -5.779  1.00 0.00  ? 133 LEU A CB     4  
ATOM 5538  C CG     . LEU B 2 46  ? -2.105  0.444   -4.906  1.00 0.00  ? 133 LEU A CG     4  
ATOM 5539  C CD1    . LEU B 2 46  ? -2.245  0.987   -3.490  1.00 0.00  ? 133 LEU A CD1    4  
ATOM 5540  C CD2    . LEU B 2 46  ? -3.512  0.263   -5.457  1.00 0.00  ? 133 LEU A CD2    4  
ATOM 5541  H H      . LEU B 2 46  ? 0.685   -0.128  -6.407  1.00 0.00  ? 133 LEU A H      4  
ATOM 5542  H HA     . LEU B 2 46  ? -1.905  0.352   -7.545  1.00 0.00  ? 133 LEU A HA     4  
ATOM 5543  H HB2    . LEU B 2 46  ? -0.366  1.705   -5.275  1.00 0.00  ? 133 LEU A HB2    4  
ATOM 5544  H HB3    . LEU B 2 46  ? -1.838  2.310   -5.894  1.00 0.00  ? 133 LEU A HB3    4  
ATOM 5545  H HG     . LEU B 2 46  ? -1.638  -0.535  -4.889  1.00 0.00  ? 133 LEU A HG     4  
ATOM 5546  H HD11   . LEU B 2 46  ? -1.257  1.112   -3.055  1.00 0.00  ? 133 LEU A HD11   4  
ATOM 5547  H HD12   . LEU B 2 46  ? -2.748  1.953   -3.508  1.00 0.00  ? 133 LEU A HD12   4  
ATOM 5548  H HD13   . LEU B 2 46  ? -2.819  0.282   -2.890  1.00 0.00  ? 133 LEU A HD13   4  
ATOM 5549  H HD21   . LEU B 2 46  ? -3.960  1.232   -5.661  1.00 0.00  ? 133 LEU A HD21   4  
ATOM 5550  H HD22   . LEU B 2 46  ? -3.453  -0.300  -6.380  1.00 0.00  ? 133 LEU A HD22   4  
ATOM 5551  H HD23   . LEU B 2 46  ? -4.131  -0.294  -4.752  1.00 0.00  ? 133 LEU A HD23   4  
ATOM 5552  N N      . ARG B 2 47  ? 0.436   2.516   -8.331  1.00 0.00  ? 134 ARG A N      4  
ATOM 5553  C CA     . ARG B 2 47  ? 0.656   3.622   -9.288  1.00 0.00  ? 134 ARG A CA     4  
ATOM 5554  C C      . ARG B 2 47  ? 0.339   3.205   -10.729 1.00 0.00  ? 134 ARG A C      4  
ATOM 5555  O O      . ARG B 2 47  ? -0.193  4.004   -11.485 1.00 0.00  ? 134 ARG A O      4  
ATOM 5556  C CB     . ARG B 2 47  ? 2.034   4.291   -9.106  1.00 0.00  ? 134 ARG A CB     4  
ATOM 5557  C CG     . ARG B 2 47  ? 3.140   3.786   -10.040 1.00 0.00  ? 134 ARG A CG     4  
ATOM 5558  C CD     . ARG B 2 47  ? 4.492   4.412   -9.678  1.00 0.00  ? 134 ARG A CD     4  
ATOM 5559  N NE     . ARG B 2 47  ? 5.572   3.941   -10.571 1.00 0.00  ? 134 ARG A NE     4  
ATOM 5560  C CZ     . ARG B 2 47  ? 5.897   4.406   -11.765 1.00 0.00  ? 134 ARG A CZ     4  
ATOM 5561  N NH1    . ARG B 2 47  ? 5.259   5.392   -12.328 1.00 0.00  ? 134 ARG A NH1    4  
ATOM 5562  N NH2    . ARG B 2 47  ? 6.886   3.879   -12.429 1.00 0.00  ? 134 ARG A NH2    4  
ATOM 5563  H H      . ARG B 2 47  ? 1.196   2.134   -7.773  1.00 0.00  ? 134 ARG A H      4  
ATOM 5564  H HA     . ARG B 2 47  ? -0.084  4.387   -9.050  1.00 0.00  ? 134 ARG A HA     4  
ATOM 5565  H HB2    . ARG B 2 47  ? 1.915   5.363   -9.278  1.00 0.00  ? 134 ARG A HB2    4  
ATOM 5566  H HB3    . ARG B 2 47  ? 2.359   4.158   -8.075  1.00 0.00  ? 134 ARG A HB3    4  
ATOM 5567  H HG2    . ARG B 2 47  ? 3.206   2.707   -9.958  1.00 0.00  ? 134 ARG A HG2    4  
ATOM 5568  H HG3    . ARG B 2 47  ? 2.889   4.037   -11.072 1.00 0.00  ? 134 ARG A HG3    4  
ATOM 5569  H HD2    . ARG B 2 47  ? 4.413   5.501   -9.726  1.00 0.00  ? 134 ARG A HD2    4  
ATOM 5570  H HD3    . ARG B 2 47  ? 4.744   4.144   -8.651  1.00 0.00  ? 134 ARG A HD3    4  
ATOM 5571  H HE     . ARG B 2 47  ? 6.155   3.195   -10.230 1.00 0.00  ? 134 ARG A HE     4  
ATOM 5572  H HH11   . ARG B 2 47  ? 4.496   5.826   -11.837 1.00 0.00  ? 134 ARG A HH11   4  
ATOM 5573  H HH12   . ARG B 2 47  ? 5.527   5.732   -13.237 1.00 0.00  ? 134 ARG A HH12   4  
ATOM 5574  H HH21   . ARG B 2 47  ? 7.412   3.107   -12.049 1.00 0.00  ? 134 ARG A HH21   4  
ATOM 5575  H HH22   . ARG B 2 47  ? 7.136   4.238   -13.335 1.00 0.00  ? 134 ARG A HH22   4  
ATOM 5576  N N      . GLN B 2 48  ? 0.579   1.947   -11.099 1.00 0.00  ? 135 GLN A N      4  
ATOM 5577  C CA     . GLN B 2 48  ? 0.219   1.363   -12.398 1.00 0.00  ? 135 GLN A CA     4  
ATOM 5578  C C      . GLN B 2 48  ? -1.293  1.062   -12.532 1.00 0.00  ? 135 GLN A C      4  
ATOM 5579  O O      . GLN B 2 48  ? -1.896  1.264   -13.593 1.00 0.00  ? 135 GLN A O      4  
ATOM 5580  C CB     . GLN B 2 48  ? 1.072   0.098   -12.573 1.00 0.00  ? 135 GLN A CB     4  
ATOM 5581  C CG     . GLN B 2 48  ? 0.935   -0.531  -13.963 1.00 0.00  ? 135 GLN A CG     4  
ATOM 5582  C CD     . GLN B 2 48  ? 1.873   -1.723  -14.138 1.00 0.00  ? 135 GLN A CD     4  
ATOM 5583  O OE1    . GLN B 2 48  ? 3.015   -1.594  -14.561 1.00 0.00  ? 135 GLN A OE1    4  
ATOM 5584  N NE2    . GLN B 2 48  ? 1.443   -2.926  -13.820 1.00 0.00  ? 135 GLN A NE2    4  
ATOM 5585  H H      . GLN B 2 48  ? 1.068   1.366   -10.427 1.00 0.00  ? 135 GLN A H      4  
ATOM 5586  H HA     . GLN B 2 48  ? 0.492   2.055   -13.188 1.00 0.00  ? 135 GLN A HA     4  
ATOM 5587  H HB2    . GLN B 2 48  ? 2.121   0.359   -12.424 1.00 0.00  ? 135 GLN A HB2    4  
ATOM 5588  H HB3    . GLN B 2 48  ? 0.792   -0.616  -11.799 1.00 0.00  ? 135 GLN A HB3    4  
ATOM 5589  H HG2    . GLN B 2 48  ? -0.092  -0.850  -14.132 1.00 0.00  ? 135 GLN A HG2    4  
ATOM 5590  H HG3    . GLN B 2 48  ? 1.187   0.224   -14.709 1.00 0.00  ? 135 GLN A HG3    4  
ATOM 5591  H HE21   . GLN B 2 48  ? 0.514   -3.071  -13.457 1.00 0.00  ? 135 GLN A HE21   4  
ATOM 5592  H HE22   . GLN B 2 48  ? 2.084   -3.693  -13.943 1.00 0.00  ? 135 GLN A HE22   4  
ATOM 5593  N N      . MET B 2 49  ? -1.936  0.607   -11.455 1.00 0.00  ? 136 MET A N      4  
ATOM 5594  C CA     . MET B 2 49  ? -3.329  0.165   -11.441 1.00 0.00  ? 136 MET A CA     4  
ATOM 5595  C C      . MET B 2 49  ? -4.289  1.346   -11.461 1.00 0.00  ? 136 MET A C      4  
ATOM 5596  O O      . MET B 2 49  ? -5.160  1.402   -12.325 1.00 0.00  ? 136 MET A O      4  
ATOM 5597  C CB     . MET B 2 49  ? -3.478  -0.718  -10.213 1.00 0.00  ? 136 MET A CB     4  
ATOM 5598  C CG     . MET B 2 49  ? -4.812  -1.454  -10.060 1.00 0.00  ? 136 MET A CG     4  
ATOM 5599  S SD     . MET B 2 49  ? -6.237  -0.442  -9.584  1.00 0.00  ? 136 MET A SD     4  
ATOM 5600  C CE     . MET B 2 49  ? -5.578  0.343   -8.090  1.00 0.00  ? 136 MET A CE     4  
ATOM 5601  H H      . MET B 2 49  ? -1.442  0.476   -10.576 1.00 0.00  ? 136 MET A H      4  
ATOM 5602  H HA     . MET B 2 49  ? -3.518  -0.446  -12.324 1.00 0.00  ? 136 MET A HA     4  
ATOM 5603  H HB2    . MET B 2 49  ? -2.690  -1.443  -10.326 1.00 0.00  ? 136 MET A HB2    4  
ATOM 5604  H HB3    . MET B 2 49  ? -3.247  -0.158  -9.312  1.00 0.00  ? 136 MET A HB3    4  
ATOM 5605  H HG2    . MET B 2 49  ? -5.041  -1.975  -10.991 1.00 0.00  ? 136 MET A HG2    4  
ATOM 5606  H HG3    . MET B 2 49  ? -4.680  -2.215  -9.289  1.00 0.00  ? 136 MET A HG3    4  
ATOM 5607  H HE1    . MET B 2 49  ? -5.299  -0.429  -7.378  1.00 0.00  ? 136 MET A HE1    4  
ATOM 5608  H HE2    . MET B 2 49  ? -4.691  0.934   -8.334  1.00 0.00  ? 136 MET A HE2    4  
ATOM 5609  H HE3    . MET B 2 49  ? -6.331  0.990   -7.640  1.00 0.00  ? 136 MET A HE3    4  
ATOM 5610  N N      . PHE B 2 50  ? -4.058  2.341   -10.602 1.00 0.00  ? 137 PHE A N      4  
ATOM 5611  C CA     . PHE B 2 50  ? -4.576  3.692   -10.827 1.00 0.00  ? 137 PHE A CA     4  
ATOM 5612  C C      . PHE B 2 50  ? -4.013  4.297   -12.127 1.00 0.00  ? 137 PHE A C      4  
ATOM 5613  O O      . PHE B 2 50  ? -4.688  5.081   -12.792 1.00 0.00  ? 137 PHE A O      4  
ATOM 5614  C CB     . PHE B 2 50  ? -4.256  4.589   -9.626  1.00 0.00  ? 137 PHE A CB     4  
ATOM 5615  C CG     . PHE B 2 50  ? -5.210  4.402   -8.468  1.00 0.00  ? 137 PHE A CG     4  
ATOM 5616  C CD1    . PHE B 2 50  ? -6.483  4.997   -8.515  1.00 0.00  ? 137 PHE A CD1    4  
ATOM 5617  C CD2    . PHE B 2 50  ? -4.849  3.626   -7.354  1.00 0.00  ? 137 PHE A CD2    4  
ATOM 5618  C CE1    . PHE B 2 50  ? -7.383  4.849   -7.448  1.00 0.00  ? 137 PHE A CE1    4  
ATOM 5619  C CE2    . PHE B 2 50  ? -5.756  3.470   -6.290  1.00 0.00  ? 137 PHE A CE2    4  
ATOM 5620  C CZ     . PHE B 2 50  ? -7.010  4.100   -6.322  1.00 0.00  ? 137 PHE A CZ     4  
ATOM 5621  H H      . PHE B 2 50  ? -3.320  2.186   -9.921  1.00 0.00  ? 137 PHE A H      4  
ATOM 5622  H HA     . PHE B 2 50  ? -5.660  3.644   -10.938 1.00 0.00  ? 137 PHE A HA     4  
ATOM 5623  H HB2    . PHE B 2 50  ? -3.229  4.433   -9.297  1.00 0.00  ? 137 PHE A HB2    4  
ATOM 5624  H HB3    . PHE B 2 50  ? -4.322  5.627   -9.939  1.00 0.00  ? 137 PHE A HB3    4  
ATOM 5625  H HD1    . PHE B 2 50  ? -6.783  5.556   -9.389  1.00 0.00  ? 137 PHE A HD1    4  
ATOM 5626  H HD2    . PHE B 2 50  ? -3.874  3.161   -7.312  1.00 0.00  ? 137 PHE A HD2    4  
ATOM 5627  H HE1    . PHE B 2 50  ? -8.372  5.284   -7.521  1.00 0.00  ? 137 PHE A HE1    4  
ATOM 5628  H HE2    . PHE B 2 50  ? -5.474  2.891   -5.430  1.00 0.00  ? 137 PHE A HE2    4  
ATOM 5629  H HZ     . PHE B 2 50  ? -7.681  3.995   -5.481  1.00 0.00  ? 137 PHE A HZ     4  
ATOM 5630  N N      . GLY B 2 51  ? -2.797  3.904   -12.529 1.00 0.00  ? 138 GLY A N      4  
ATOM 5631  C CA     . GLY B 2 51  ? -2.136  4.311   -13.781 1.00 0.00  ? 138 GLY A CA     4  
ATOM 5632  C C      . GLY B 2 51  ? -2.917  4.016   -15.066 1.00 0.00  ? 138 GLY A C      4  
ATOM 5633  O O      . GLY B 2 51  ? -2.734  4.738   -16.047 1.00 0.00  ? 138 GLY A O      4  
ATOM 5634  H H      . GLY B 2 51  ? -2.241  3.350   -11.875 1.00 0.00  ? 138 GLY A H      4  
ATOM 5635  H HA2    . GLY B 2 51  ? -1.934  5.380   -13.745 1.00 0.00  ? 138 GLY A HA2    4  
ATOM 5636  H HA3    . GLY B 2 51  ? -1.173  3.805   -13.860 1.00 0.00  ? 138 GLY A HA3    4  
ATOM 5637  N N      . GLN B 2 52  ? -3.836  3.039   -15.057 1.00 0.00  ? 139 GLN A N      4  
ATOM 5638  C CA     . GLN B 2 52  ? -4.843  2.900   -16.129 1.00 0.00  ? 139 GLN A CA     4  
ATOM 5639  C C      . GLN B 2 52  ? -5.610  4.204   -16.425 1.00 0.00  ? 139 GLN A C      4  
ATOM 5640  O O      . GLN B 2 52  ? -5.892  4.507   -17.588 1.00 0.00  ? 139 GLN A O      4  
ATOM 5641  C CB     . GLN B 2 52  ? -5.834  1.751   -15.862 1.00 0.00  ? 139 GLN A CB     4  
ATOM 5642  C CG     . GLN B 2 52  ? -6.995  2.059   -14.898 1.00 0.00  ? 139 GLN A CG     4  
ATOM 5643  C CD     . GLN B 2 52  ? -7.778  0.801   -14.528 1.00 0.00  ? 139 GLN A CD     4  
ATOM 5644  O OE1    . GLN B 2 52  ? -8.766  0.435   -15.152 1.00 0.00  ? 139 GLN A OE1    4  
ATOM 5645  N NE2    . GLN B 2 52  ? -7.364  0.086   -13.507 1.00 0.00  ? 139 GLN A NE2    4  
ATOM 5646  H H      . GLN B 2 52  ? -3.724  2.352   -14.314 1.00 0.00  ? 139 GLN A H      4  
ATOM 5647  H HA     . GLN B 2 52  ? -4.301  2.645   -17.040 1.00 0.00  ? 139 GLN A HA     4  
ATOM 5648  H HB2    . GLN B 2 52  ? -6.292  1.506   -16.821 1.00 0.00  ? 139 GLN A HB2    4  
ATOM 5649  H HB3    . GLN B 2 52  ? -5.280  0.882   -15.507 1.00 0.00  ? 139 GLN A HB3    4  
ATOM 5650  H HG2    . GLN B 2 52  ? -6.620  2.531   -13.992 1.00 0.00  ? 139 GLN A HG2    4  
ATOM 5651  H HG3    . GLN B 2 52  ? -7.683  2.761   -15.371 1.00 0.00  ? 139 GLN A HG3    4  
ATOM 5652  H HE21   . GLN B 2 52  ? -6.566  0.422   -12.976 1.00 0.00  ? 139 GLN A HE21   4  
ATOM 5653  H HE22   . GLN B 2 52  ? -7.892  -0.730  -13.240 1.00 0.00  ? 139 GLN A HE22   4  
ATOM 5654  N N      . PHE B 2 53  ? -5.928  4.985   -15.385 1.00 0.00  ? 140 PHE A N      4  
ATOM 5655  C CA     . PHE B 2 53  ? -6.558  6.302   -15.485 1.00 0.00  ? 140 PHE A CA     4  
ATOM 5656  C C      . PHE B 2 53  ? -5.525  7.446   -15.521 1.00 0.00  ? 140 PHE A C      4  
ATOM 5657  O O      . PHE B 2 53  ? -5.740  8.457   -16.193 1.00 0.00  ? 140 PHE A O      4  
ATOM 5658  C CB     . PHE B 2 53  ? -7.553  6.487   -14.326 1.00 0.00  ? 140 PHE A CB     4  
ATOM 5659  C CG     . PHE B 2 53  ? -8.862  5.747   -14.536 1.00 0.00  ? 140 PHE A CG     4  
ATOM 5660  C CD1    . PHE B 2 53  ? -9.704  6.135   -15.596 1.00 0.00  ? 140 PHE A CD1    4  
ATOM 5661  C CD2    . PHE B 2 53  ? -9.271  4.709   -13.672 1.00 0.00  ? 140 PHE A CD2    4  
ATOM 5662  C CE1    . PHE B 2 53  ? -10.933 5.486   -15.809 1.00 0.00  ? 140 PHE A CE1    4  
ATOM 5663  C CE2    . PHE B 2 53  ? -10.498 4.064   -13.883 1.00 0.00  ? 140 PHE A CE2    4  
ATOM 5664  C CZ     . PHE B 2 53  ? -11.330 4.450   -14.951 1.00 0.00  ? 140 PHE A CZ     4  
ATOM 5665  H H      . PHE B 2 53  ? -5.652  4.664   -14.465 1.00 0.00  ? 140 PHE A H      4  
ATOM 5666  H HA     . PHE B 2 53  ? -7.110  6.325   -16.426 1.00 0.00  ? 140 PHE A HA     4  
ATOM 5667  H HB2    . PHE B 2 53  ? -7.092  6.170   -13.389 1.00 0.00  ? 140 PHE A HB2    4  
ATOM 5668  H HB3    . PHE B 2 53  ? -7.786  7.548   -14.223 1.00 0.00  ? 140 PHE A HB3    4  
ATOM 5669  H HD1    . PHE B 2 53  ? -9.413  6.943   -16.253 1.00 0.00  ? 140 PHE A HD1    4  
ATOM 5670  H HD2    . PHE B 2 53  ? -8.700  4.422   -12.801 1.00 0.00  ? 140 PHE A HD2    4  
ATOM 5671  H HE1    . PHE B 2 53  ? -11.572 5.792   -16.623 1.00 0.00  ? 140 PHE A HE1    4  
ATOM 5672  H HE2    . PHE B 2 53  ? -10.796 3.287   -13.190 1.00 0.00  ? 140 PHE A HE2    4  
ATOM 5673  H HZ     . PHE B 2 53  ? -12.288 3.976   -15.110 1.00 0.00  ? 140 PHE A HZ     4  
ATOM 5674  N N      . GLY B 2 54  ? -4.384  7.273   -14.845 1.00 0.00  ? 141 GLY A N      4  
ATOM 5675  C CA     . GLY B 2 54  ? -3.166  8.080   -15.006 1.00 0.00  ? 141 GLY A CA     4  
ATOM 5676  C C      . GLY B 2 54  ? -3.272  9.525   -14.528 1.00 0.00  ? 141 GLY A C      4  
ATOM 5677  O O      . GLY B 2 54  ? -3.053  10.471  -15.289 1.00 0.00  ? 141 GLY A O      4  
ATOM 5678  H H      . GLY B 2 54  ? -4.327  6.431   -14.285 1.00 0.00  ? 141 GLY A H      4  
ATOM 5679  H HA2    . GLY B 2 54  ? -2.382  7.631   -14.403 1.00 0.00  ? 141 GLY A HA2    4  
ATOM 5680  H HA3    . GLY B 2 54  ? -2.855  8.073   -16.051 1.00 0.00  ? 141 GLY A HA3    4  
ATOM 5681  N N      . LYS B 2 55  ? -3.566  9.671   -13.232 1.00 0.00  ? 142 LYS A N      4  
ATOM 5682  C CA     . LYS B 2 55  ? -3.771  10.946  -12.510 1.00 0.00  ? 142 LYS A CA     4  
ATOM 5683  C C      . LYS B 2 55  ? -2.846  11.118  -11.295 1.00 0.00  ? 142 LYS A C      4  
ATOM 5684  O O      . LYS B 2 55  ? -3.022  12.037  -10.495 1.00 0.00  ? 142 LYS A O      4  
ATOM 5685  C CB     . LYS B 2 55  ? -5.244  11.012  -12.079 1.00 0.00  ? 142 LYS A CB     4  
ATOM 5686  C CG     . LYS B 2 55  ? -6.233  10.635  -13.195 1.00 0.00  ? 142 LYS A CG     4  
ATOM 5687  C CD     . LYS B 2 55  ? -7.661  11.118  -12.910 1.00 0.00  ? 142 LYS A CD     4  
ATOM 5688  C CE     . LYS B 2 55  ? -7.840  12.621  -13.173 1.00 0.00  ? 142 LYS A CE     4  
ATOM 5689  N NZ     . LYS B 2 55  ? -7.741  12.944  -14.620 1.00 0.00  ? 142 LYS A NZ     4  
ATOM 5690  H H      . LYS B 2 55  ? -3.791  8.809   -12.754 1.00 0.00  ? 142 LYS A H      4  
ATOM 5691  H HA     . LYS B 2 55  ? -3.567  11.785  -13.178 1.00 0.00  ? 142 LYS A HA     4  
ATOM 5692  H HB2    . LYS B 2 55  ? -5.384  10.310  -11.260 1.00 0.00  ? 142 LYS A HB2    4  
ATOM 5693  H HB3    . LYS B 2 55  ? -5.456  12.018  -11.719 1.00 0.00  ? 142 LYS A HB3    4  
ATOM 5694  H HG2    . LYS B 2 55  ? -5.877  11.037  -14.142 1.00 0.00  ? 142 LYS A HG2    4  
ATOM 5695  H HG3    . LYS B 2 55  ? -6.259  9.547   -13.277 1.00 0.00  ? 142 LYS A HG3    4  
ATOM 5696  H HD2    . LYS B 2 55  ? -8.359  10.558  -13.537 1.00 0.00  ? 142 LYS A HD2    4  
ATOM 5697  H HD3    . LYS B 2 55  ? -7.901  10.901  -11.868 1.00 0.00  ? 142 LYS A HD3    4  
ATOM 5698  H HE2    . LYS B 2 55  ? -8.828  12.915  -12.809 1.00 0.00  ? 142 LYS A HE2    4  
ATOM 5699  H HE3    . LYS B 2 55  ? -7.095  13.182  -12.604 1.00 0.00  ? 142 LYS A HE3    4  
ATOM 5700  H HZ1    . LYS B 2 55  ? -6.829  12.723  -14.991 1.00 0.00  ? 142 LYS A HZ1    4  
ATOM 5701  H HZ2    . LYS B 2 55  ? -8.431  12.409  -15.153 1.00 0.00  ? 142 LYS A HZ2    4  
ATOM 5702  H HZ3    . LYS B 2 55  ? -7.914  13.926  -14.793 1.00 0.00  ? 142 LYS A HZ3    4  
ATOM 5703  N N      . ILE B 2 56  ? -1.904  10.187  -11.125 1.00 0.00  ? 143 ILE A N      4  
ATOM 5704  C CA     . ILE B 2 56  ? -1.149  9.931   -9.890  1.00 0.00  ? 143 ILE A CA     4  
ATOM 5705  C C      . ILE B 2 56  ? 0.055   10.867  -9.744  1.00 0.00  ? 143 ILE A C      4  
ATOM 5706  O O      . ILE B 2 56  ? 0.979   10.838  -10.559 1.00 0.00  ? 143 ILE A O      4  
ATOM 5707  C CB     . ILE B 2 56  ? -0.706  8.450   -9.749  1.00 0.00  ? 143 ILE A CB     4  
ATOM 5708  C CG1    . ILE B 2 56  ? -1.826  7.440   -10.032 1.00 0.00  ? 143 ILE A CG1    4  
ATOM 5709  C CG2    . ILE B 2 56  ? -0.293  8.236   -8.289  1.00 0.00  ? 143 ILE A CG2    4  
ATOM 5710  C CD1    . ILE B 2 56  ? -1.899  7.047   -11.511 1.00 0.00  ? 143 ILE A CD1    4  
ATOM 5711  H H      . ILE B 2 56  ? -1.798  9.570   -11.912 1.00 0.00  ? 143 ILE A H      4  
ATOM 5712  H HA     . ILE B 2 56  ? -1.830  10.140  -9.065  1.00 0.00  ? 143 ILE A HA     4  
ATOM 5713  H HB     . ILE B 2 56  ? 0.134   8.201   -10.402 1.00 0.00  ? 143 ILE A HB     4  
ATOM 5714  H HG12   . ILE B 2 56  ? -1.683  6.526   -9.458  1.00 0.00  ? 143 ILE A HG12   4  
ATOM 5715  H HG13   . ILE B 2 56  ? -2.758  7.880   -9.704  1.00 0.00  ? 143 ILE A HG13   4  
ATOM 5716  H HG21   . ILE B 2 56  ? 0.616   8.791   -8.055  1.00 0.00  ? 143 ILE A HG21   4  
ATOM 5717  H HG22   . ILE B 2 56  ? -1.105  8.562   -7.634  1.00 0.00  ? 143 ILE A HG22   4  
ATOM 5718  H HG23   . ILE B 2 56  ? -0.104  7.180   -8.106  1.00 0.00  ? 143 ILE A HG23   4  
ATOM 5719  H HD11   . ILE B 2 56  ? -1.731  7.894   -12.169 1.00 0.00  ? 143 ILE A HD11   4  
ATOM 5720  H HD12   . ILE B 2 56  ? -1.127  6.313   -11.725 1.00 0.00  ? 143 ILE A HD12   4  
ATOM 5721  H HD13   . ILE B 2 56  ? -2.879  6.631   -11.714 1.00 0.00  ? 143 ILE A HD13   4  
ATOM 5722  N N      . LEU B 2 57  ? 0.045   11.678  -8.684  1.00 0.00  ? 144 LEU A N      4  
ATOM 5723  C CA     . LEU B 2 57  ? 1.172   12.508  -8.255  1.00 0.00  ? 144 LEU A CA     4  
ATOM 5724  C C      . LEU B 2 57  ? 2.140   11.694  -7.376  1.00 0.00  ? 144 LEU A C      4  
ATOM 5725  O O      . LEU B 2 57  ? 3.355   11.766  -7.569  1.00 0.00  ? 144 LEU A O      4  
ATOM 5726  C CB     . LEU B 2 57  ? 0.638   13.741  -7.492  1.00 0.00  ? 144 LEU A CB     4  
ATOM 5727  C CG     . LEU B 2 57  ? 0.156   14.932  -8.345  1.00 0.00  ? 144 LEU A CG     4  
ATOM 5728  C CD1    . LEU B 2 57  ? 1.316   15.653  -9.034  1.00 0.00  ? 144 LEU A CD1    4  
ATOM 5729  C CD2    . LEU B 2 57  ? -0.875  14.553  -9.408  1.00 0.00  ? 144 LEU A CD2    4  
ATOM 5730  H H      . LEU B 2 57  ? -0.776  11.629  -8.090  1.00 0.00  ? 144 LEU A H      4  
ATOM 5731  H HA     . LEU B 2 57  ? 1.734   12.850  -9.126  1.00 0.00  ? 144 LEU A HA     4  
ATOM 5732  H HB2    . LEU B 2 57  ? -0.185  13.427  -6.854  1.00 0.00  ? 144 LEU A HB2    4  
ATOM 5733  H HB3    . LEU B 2 57  ? 1.425   14.112  -6.830  1.00 0.00  ? 144 LEU A HB3    4  
ATOM 5734  H HG     . LEU B 2 57  ? -0.314  15.646  -7.667  1.00 0.00  ? 144 LEU A HG     4  
ATOM 5735  H HD11   . LEU B 2 57  ? 2.053   15.954  -8.291  1.00 0.00  ? 144 LEU A HD11   4  
ATOM 5736  H HD12   . LEU B 2 57  ? 1.790   15.003  -9.767  1.00 0.00  ? 144 LEU A HD12   4  
ATOM 5737  H HD13   . LEU B 2 57  ? 0.939   16.542  -9.538  1.00 0.00  ? 144 LEU A HD13   4  
ATOM 5738  H HD21   . LEU B 2 57  ? -0.414  13.959  -10.195 1.00 0.00  ? 144 LEU A HD21   4  
ATOM 5739  H HD22   . LEU B 2 57  ? -1.678  13.978  -8.948  1.00 0.00  ? 144 LEU A HD22   4  
ATOM 5740  H HD23   . LEU B 2 57  ? -1.292  15.456  -9.849  1.00 0.00  ? 144 LEU A HD23   4  
ATOM 5741  N N      . ASP B 2 58  ? 1.609   10.903  -6.434  1.00 0.00  ? 145 ASP A N      4  
ATOM 5742  C CA     . ASP B 2 58  ? 2.357   10.041  -5.504  1.00 0.00  ? 145 ASP A CA     4  
ATOM 5743  C C      . ASP B 2 58  ? 1.538   8.812   -5.055  1.00 0.00  ? 145 ASP A C      4  
ATOM 5744  O O      . ASP B 2 58  ? 0.313   8.792   -5.179  1.00 0.00  ? 145 ASP A O      4  
ATOM 5745  C CB     . ASP B 2 58  ? 2.768   10.861  -4.262  1.00 0.00  ? 145 ASP A CB     4  
ATOM 5746  C CG     . ASP B 2 58  ? 4.048   11.681  -4.481  1.00 0.00  ? 145 ASP A CG     4  
ATOM 5747  O OD1    . ASP B 2 58  ? 5.135   11.073  -4.621  1.00 0.00  ? 145 ASP A OD1    4  
ATOM 5748  O OD2    . ASP B 2 58  ? 3.982   12.936  -4.453  1.00 0.00  ? 145 ASP A OD2    4  
ATOM 5749  H H      . ASP B 2 58  ? 0.602   10.839  -6.380  1.00 0.00  ? 145 ASP A H      4  
ATOM 5750  H HA     . ASP B 2 58  ? 3.247   9.675   -6.010  1.00 0.00  ? 145 ASP A HA     4  
ATOM 5751  H HB2    . ASP B 2 58  ? 1.946   11.513  -3.965  1.00 0.00  ? 145 ASP A HB2    4  
ATOM 5752  H HB3    . ASP B 2 58  ? 2.946   10.182  -3.426  1.00 0.00  ? 145 ASP A HB3    4  
ATOM 5753  N N      . VAL B 2 59  ? 2.218   7.803   -4.491  1.00 0.00  ? 146 VAL A N      4  
ATOM 5754  C CA     . VAL B 2 59  ? 1.647   6.610   -3.824  1.00 0.00  ? 146 VAL A CA     4  
ATOM 5755  C C      . VAL B 2 59  ? 2.362   6.300   -2.506  1.00 0.00  ? 146 VAL A C      4  
ATOM 5756  O O      . VAL B 2 59  ? 3.463   6.798   -2.242  1.00 0.00  ? 146 VAL A O      4  
ATOM 5757  C CB     . VAL B 2 59  ? 1.685   5.342   -4.698  1.00 0.00  ? 146 VAL A CB     4  
ATOM 5758  C CG1    . VAL B 2 59  ? 0.632   5.363   -5.780  1.00 0.00  ? 146 VAL A CG1    4  
ATOM 5759  C CG2    . VAL B 2 59  ? 3.051   5.147   -5.363  1.00 0.00  ? 146 VAL A CG2    4  
ATOM 5760  H H      . VAL B 2 59  ? 3.218   7.920   -4.400  1.00 0.00  ? 146 VAL A H      4  
ATOM 5761  H HA     . VAL B 2 59  ? 0.609   6.809   -3.573  1.00 0.00  ? 146 VAL A HA     4  
ATOM 5762  H HB     . VAL B 2 59  ? 1.398   4.482   -4.089  1.00 0.00  ? 146 VAL A HB     4  
ATOM 5763  H HG11   . VAL B 2 59  ? -0.327  5.364   -5.279  1.00 0.00  ? 146 VAL A HG11   4  
ATOM 5764  H HG12   . VAL B 2 59  ? 0.761   6.248   -6.390  1.00 0.00  ? 146 VAL A HG12   4  
ATOM 5765  H HG13   . VAL B 2 59  ? 0.709   4.464   -6.387  1.00 0.00  ? 146 VAL A HG13   4  
ATOM 5766  H HG21   . VAL B 2 59  ? 3.203   5.917   -6.118  1.00 0.00  ? 146 VAL A HG21   4  
ATOM 5767  H HG22   . VAL B 2 59  ? 3.847   5.216   -4.627  1.00 0.00  ? 146 VAL A HG22   4  
ATOM 5768  H HG23   . VAL B 2 59  ? 3.097   4.176   -5.841  1.00 0.00  ? 146 VAL A HG23   4  
ATOM 5769  N N      . GLU B 2 60  ? 1.699   5.513   -1.660  1.00 0.00  ? 147 GLU A N      4  
ATOM 5770  C CA     . GLU B 2 60  ? 1.991   5.359   -0.239  1.00 0.00  ? 147 GLU A CA     4  
ATOM 5771  C C      . GLU B 2 60  ? 1.286   4.100   0.330   1.00 0.00  ? 147 GLU A C      4  
ATOM 5772  O O      . GLU B 2 60  ? 0.291   4.192   1.046   1.00 0.00  ? 147 GLU A O      4  
ATOM 5773  C CB     . GLU B 2 60  ? 1.509   6.673   0.405   1.00 0.00  ? 147 GLU A CB     4  
ATOM 5774  C CG     . GLU B 2 60  ? 1.810   6.865   1.895   1.00 0.00  ? 147 GLU A CG     4  
ATOM 5775  C CD     . GLU B 2 60  ? 3.314   7.059   2.170   1.00 0.00  ? 147 GLU A CD     4  
ATOM 5776  O OE1    . GLU B 2 60  ? 3.897   8.082   1.734   1.00 0.00  ? 147 GLU A OE1    4  
ATOM 5777  O OE2    . GLU B 2 60  ? 3.921   6.203   2.860   1.00 0.00  ? 147 GLU A OE2    4  
ATOM 5778  H H      . GLU B 2 60  ? 0.771   5.222   -1.956  1.00 0.00  ? 147 GLU A H      4  
ATOM 5779  H HA     . GLU B 2 60  ? 3.066   5.248   -0.089  1.00 0.00  ? 147 GLU A HA     4  
ATOM 5780  H HB2    . GLU B 2 60  ? 1.965   7.518   -0.107  1.00 0.00  ? 147 GLU A HB2    4  
ATOM 5781  H HB3    . GLU B 2 60  ? 0.441   6.755   0.209   1.00 0.00  ? 147 GLU A HB3    4  
ATOM 5782  H HG2    . GLU B 2 60  ? 1.283   7.766   2.218   1.00 0.00  ? 147 GLU A HG2    4  
ATOM 5783  H HG3    . GLU B 2 60  ? 1.412   6.031   2.473   1.00 0.00  ? 147 GLU A HG3    4  
ATOM 5784  N N      . ILE B 2 61  ? 1.750   2.889   -0.002  1.00 0.00  ? 148 ILE A N      4  
ATOM 5785  C CA     . ILE B 2 61  ? 1.298   1.634   0.641   1.00 0.00  ? 148 ILE A CA     4  
ATOM 5786  C C      . ILE B 2 61  ? 1.619   1.647   2.139   1.00 0.00  ? 148 ILE A C      4  
ATOM 5787  O O      . ILE B 2 61  ? 2.675   2.131   2.551   1.00 0.00  ? 148 ILE A O      4  
ATOM 5788  C CB     . ILE B 2 61  ? 1.900   0.402   -0.069  1.00 0.00  ? 148 ILE A CB     4  
ATOM 5789  C CG1    . ILE B 2 61  ? 1.035   0.065   -1.300  1.00 0.00  ? 148 ILE A CG1    4  
ATOM 5790  C CG2    . ILE B 2 61  ? 2.059   -0.847  0.829   1.00 0.00  ? 148 ILE A CG2    4  
ATOM 5791  C CD1    . ILE B 2 61  ? -0.227  -0.754  -1.010  1.00 0.00  ? 148 ILE A CD1    4  
ATOM 5792  H H      . ILE B 2 61  ? 2.515   2.860   -0.677  1.00 0.00  ? 148 ILE A H      4  
ATOM 5793  H HA     . ILE B 2 61  ? 0.218   1.576   0.554   1.00 0.00  ? 148 ILE A HA     4  
ATOM 5794  H HB     . ILE B 2 61  ? 2.899   0.666   -0.423  1.00 0.00  ? 148 ILE A HB     4  
ATOM 5795  H HG12   . ILE B 2 61  ? 0.775   0.979   -1.833  1.00 0.00  ? 148 ILE A HG12   4  
ATOM 5796  H HG13   . ILE B 2 61  ? 1.625   -0.524  -1.976  1.00 0.00  ? 148 ILE A HG13   4  
ATOM 5797  H HG21   . ILE B 2 61  ? 2.777   -0.643  1.622   1.00 0.00  ? 148 ILE A HG21   4  
ATOM 5798  H HG22   . ILE B 2 61  ? 1.114   -1.121  1.291   1.00 0.00  ? 148 ILE A HG22   4  
ATOM 5799  H HG23   . ILE B 2 61  ? 2.433   -1.683  0.239   1.00 0.00  ? 148 ILE A HG23   4  
ATOM 5800  H HD11   . ILE B 2 61  ? 0.049   -1.734  -0.618  1.00 0.00  ? 148 ILE A HD11   4  
ATOM 5801  H HD12   . ILE B 2 61  ? -0.854  -0.248  -0.278  1.00 0.00  ? 148 ILE A HD12   4  
ATOM 5802  H HD13   . ILE B 2 61  ? -0.774  -0.905  -1.934  1.00 0.00  ? 148 ILE A HD13   4  
ATOM 5803  N N      . ILE B 2 62  ? 0.734   1.073   2.964   1.00 0.00  ? 149 ILE A N      4  
ATOM 5804  C CA     . ILE B 2 62  ? 0.851   0.999   4.399   1.00 0.00  ? 149 ILE A CA     4  
ATOM 5805  C C      . ILE B 2 62  ? 1.407   -0.414  4.591   1.00 0.00  ? 149 ILE A C      4  
ATOM 5806  O O      . ILE B 2 62  ? 0.727   -1.382  4.252   1.00 0.00  ? 149 ILE A O      4  
ATOM 5807  C CB     . ILE B 2 62  ? -0.559  1.299   4.956   1.00 0.00  ? 149 ILE A CB     4  
ATOM 5808  C CG1    . ILE B 2 62  ? -1.130  2.625   4.392   1.00 0.00  ? 149 ILE A CG1    4  
ATOM 5809  C CG2    . ILE B 2 62  ? -0.547  1.350   6.478   1.00 0.00  ? 149 ILE A CG2    4  
ATOM 5810  C CD1    . ILE B 2 62  ? -0.181  3.827   4.353   1.00 0.00  ? 149 ILE A CD1    4  
ATOM 5811  H H      . ILE B 2 62  ? -0.045  0.486   2.692   1.00 0.00  ? 149 ILE A H      4  
ATOM 5812  H HA     . ILE B 2 62  ? 1.536   1.750   4.810   1.00 0.00  ? 149 ILE A HA     4  
ATOM 5813  H HB     . ILE B 2 62  ? -1.247  0.504   4.666   1.00 0.00  ? 149 ILE A HB     4  
ATOM 5814  H HG12   . ILE B 2 62  ? -1.511  2.456   3.389   1.00 0.00  ? 149 ILE A HG12   4  
ATOM 5815  H HG13   . ILE B 2 62  ? -1.972  2.926   4.998   1.00 0.00  ? 149 ILE A HG13   4  
ATOM 5816  H HG21   . ILE B 2 62  ? -0.590  0.336   6.841   1.00 0.00  ? 149 ILE A HG21   4  
ATOM 5817  H HG22   . ILE B 2 62  ? 0.343   1.872   6.823   1.00 0.00  ? 149 ILE A HG22   4  
ATOM 5818  H HG23   . ILE B 2 62  ? -1.439  1.836   6.855   1.00 0.00  ? 149 ILE A HG23   4  
ATOM 5819  H HD11   . ILE B 2 62  ? 0.200   4.013   5.348   1.00 0.00  ? 149 ILE A HD11   4  
ATOM 5820  H HD12   . ILE B 2 62  ? 0.656   3.660   3.681   1.00 0.00  ? 149 ILE A HD12   4  
ATOM 5821  H HD13   . ILE B 2 62  ? -0.732  4.698   3.995   1.00 0.00  ? 149 ILE A HD13   4  
ATOM 5822  N N      . PHE B 2 63  ? 2.694   -0.544  4.927   1.00 0.00  ? 150 PHE A N      4  
ATOM 5823  C CA     . PHE B 2 63  ? 3.477   -1.781  4.741   1.00 0.00  ? 150 PHE A CA     4  
ATOM 5824  C C      . PHE B 2 63  ? 3.758   -2.527  6.060   1.00 0.00  ? 150 PHE A C      4  
ATOM 5825  O O      . PHE B 2 63  ? 3.737   -1.926  7.135   1.00 0.00  ? 150 PHE A O      4  
ATOM 5826  C CB     . PHE B 2 63  ? 4.822   -1.438  4.048   1.00 0.00  ? 150 PHE A CB     4  
ATOM 5827  C CG     . PHE B 2 63  ? 4.974   -1.917  2.613   1.00 0.00  ? 150 PHE A CG     4  
ATOM 5828  C CD1    . PHE B 2 63  ? 4.745   -3.269  2.292   1.00 0.00  ? 150 PHE A CD1    4  
ATOM 5829  C CD2    . PHE B 2 63  ? 5.377   -1.026  1.596   1.00 0.00  ? 150 PHE A CD2    4  
ATOM 5830  C CE1    . PHE B 2 63  ? 4.853   -3.719  0.966   1.00 0.00  ? 150 PHE A CE1    4  
ATOM 5831  C CE2    . PHE B 2 63  ? 5.487   -1.476  0.265   1.00 0.00  ? 150 PHE A CE2    4  
ATOM 5832  C CZ     . PHE B 2 63  ? 5.213   -2.820  -0.050  1.00 0.00  ? 150 PHE A CZ     4  
ATOM 5833  H H      . PHE B 2 63  ? 3.201   0.301   5.150   1.00 0.00  ? 150 PHE A H      4  
ATOM 5834  H HA     . PHE B 2 63  ? 2.913   -2.451  4.084   1.00 0.00  ? 150 PHE A HA     4  
ATOM 5835  H HB2    . PHE B 2 63  ? 4.986   -0.360  4.081   1.00 0.00  ? 150 PHE A HB2    4  
ATOM 5836  H HB3    . PHE B 2 63  ? 5.641   -1.889  4.614   1.00 0.00  ? 150 PHE A HB3    4  
ATOM 5837  H HD1    . PHE B 2 63  ? 4.487   -3.969  3.066   1.00 0.00  ? 150 PHE A HD1    4  
ATOM 5838  H HD2    . PHE B 2 63  ? 5.580   0.010   1.828   1.00 0.00  ? 150 PHE A HD2    4  
ATOM 5839  H HE1    . PHE B 2 63  ? 4.664   -4.755  0.723   1.00 0.00  ? 150 PHE A HE1    4  
ATOM 5840  H HE2    . PHE B 2 63  ? 5.779   -0.787  -0.515  1.00 0.00  ? 150 PHE A HE2    4  
ATOM 5841  H HZ     . PHE B 2 63  ? 5.292   -3.179  -1.066  1.00 0.00  ? 150 PHE A HZ     4  
ATOM 5842  N N      . ASN B 2 64  ? 4.110   -3.814  5.984   1.00 0.00  ? 151 ASN A N      4  
ATOM 5843  C CA     . ASN B 2 64  ? 4.654   -4.637  7.065   1.00 0.00  ? 151 ASN A CA     4  
ATOM 5844  C C      . ASN B 2 64  ? 5.820   -5.487  6.501   1.00 0.00  ? 151 ASN A C      4  
ATOM 5845  O O      . ASN B 2 64  ? 5.931   -5.664  5.285   1.00 0.00  ? 151 ASN A O      4  
ATOM 5846  C CB     . ASN B 2 64  ? 3.478   -5.475  7.609   1.00 0.00  ? 151 ASN A CB     4  
ATOM 5847  C CG     . ASN B 2 64  ? 3.791   -6.242  8.883   1.00 0.00  ? 151 ASN A CG     4  
ATOM 5848  O OD1    . ASN B 2 64  ? 4.544   -7.201  8.890   1.00 0.00  ? 151 ASN A OD1    4  
ATOM 5849  N ND2    . ASN B 2 64  ? 3.183   -5.897  9.991   1.00 0.00  ? 151 ASN A ND2    4  
ATOM 5850  H H      . ASN B 2 64  ? 4.067   -4.324  5.104   1.00 0.00  ? 151 ASN A H      4  
ATOM 5851  H HA     . ASN B 2 64  ? 5.046   -3.996  7.858   1.00 0.00  ? 151 ASN A HA     4  
ATOM 5852  H HB2    . ASN B 2 64  ? 2.627   -4.819  7.796   1.00 0.00  ? 151 ASN A HB2    4  
ATOM 5853  H HB3    . ASN B 2 64  ? 3.168   -6.194  6.849   1.00 0.00  ? 151 ASN A HB3    4  
ATOM 5854  H HD21   . ASN B 2 64  ? 2.526   -5.131  10.027  1.00 0.00  ? 151 ASN A HD21   4  
ATOM 5855  H HD22   . ASN B 2 64  ? 3.407   -6.426  10.822  1.00 0.00  ? 151 ASN A HD22   4  
ATOM 5856  N N      . GLU B 2 65  ? 6.666   -6.072  7.352   1.00 0.00  ? 152 GLU A N      4  
ATOM 5857  C CA     . GLU B 2 65  ? 7.667   -7.072  6.932   1.00 0.00  ? 152 GLU A CA     4  
ATOM 5858  C C      . GLU B 2 65  ? 7.026   -8.316  6.277   1.00 0.00  ? 152 GLU A C      4  
ATOM 5859  O O      . GLU B 2 65  ? 7.636   -8.951  5.412   1.00 0.00  ? 152 GLU A O      4  
ATOM 5860  C CB     . GLU B 2 65  ? 8.521   -7.500  8.135   1.00 0.00  ? 152 GLU A CB     4  
ATOM 5861  C CG     . GLU B 2 65  ? 9.375   -6.353  8.695   1.00 0.00  ? 152 GLU A CG     4  
ATOM 5862  C CD     . GLU B 2 65  ? 10.289  -6.851  9.829   1.00 0.00  ? 152 GLU A CD     4  
ATOM 5863  O OE1    . GLU B 2 65  ? 9.866   -6.834  11.011  1.00 0.00  ? 152 GLU A OE1    4  
ATOM 5864  O OE2    . GLU B 2 65  ? 11.441  -7.262  9.551   1.00 0.00  ? 152 GLU A OE2    4  
ATOM 5865  H H      . GLU B 2 65  ? 6.519   -5.926  8.341   1.00 0.00  ? 152 GLU A H      4  
ATOM 5866  H HA     . GLU B 2 65  ? 8.334   -6.624  6.191   1.00 0.00  ? 152 GLU A HA     4  
ATOM 5867  H HB2    . GLU B 2 65  ? 7.876   -7.893  8.923   1.00 0.00  ? 152 GLU A HB2    4  
ATOM 5868  H HB3    . GLU B 2 65  ? 9.189   -8.296  7.815   1.00 0.00  ? 152 GLU A HB3    4  
ATOM 5869  H HG2    . GLU B 2 65  ? 9.981   -5.936  7.887   1.00 0.00  ? 152 GLU A HG2    4  
ATOM 5870  H HG3    . GLU B 2 65  ? 8.730   -5.552  9.062   1.00 0.00  ? 152 GLU A HG3    4  
ATOM 5871  N N      . ARG B 2 66  ? 5.777   -8.637  6.650   1.00 0.00  ? 153 ARG A N      4  
ATOM 5872  C CA     . ARG B 2 66  ? 4.946   -9.704  6.068   1.00 0.00  ? 153 ARG A CA     4  
ATOM 5873  C C      . ARG B 2 66  ? 4.410   -9.402  4.657   1.00 0.00  ? 153 ARG A C      4  
ATOM 5874  O O      . ARG B 2 66  ? 4.046   -10.348 3.960   1.00 0.00  ? 153 ARG A O      4  
ATOM 5875  C CB     . ARG B 2 66  ? 3.781   -10.017 7.035   1.00 0.00  ? 153 ARG A CB     4  
ATOM 5876  C CG     . ARG B 2 66  ? 4.201   -10.700 8.346   1.00 0.00  ? 153 ARG A CG     4  
ATOM 5877  C CD     . ARG B 2 66  ? 4.514   -12.188 8.133   1.00 0.00  ? 153 ARG A CD     4  
ATOM 5878  N NE     . ARG B 2 66  ? 4.813   -12.858 9.413   1.00 0.00  ? 153 ARG A NE     4  
ATOM 5879  C CZ     . ARG B 2 66  ? 4.688   -14.146 9.689   1.00 0.00  ? 153 ARG A CZ     4  
ATOM 5880  N NH1    . ARG B 2 66  ? 4.260   -15.009 8.810   1.00 0.00  ? 153 ARG A NH1    4  
ATOM 5881  N NH2    . ARG B 2 66  ? 4.993   -14.602 10.870  1.00 0.00  ? 153 ARG A NH2    4  
ATOM 5882  H H      . ARG B 2 66  ? 5.390   -8.077  7.408   1.00 0.00  ? 153 ARG A H      4  
ATOM 5883  H HA     . ARG B 2 66  ? 5.554   -10.604 5.961   1.00 0.00  ? 153 ARG A HA     4  
ATOM 5884  H HB2    . ARG B 2 66  ? 3.252   -9.094  7.281   1.00 0.00  ? 153 ARG A HB2    4  
ATOM 5885  H HB3    . ARG B 2 66  ? 3.058   -10.669 6.543   1.00 0.00  ? 153 ARG A HB3    4  
ATOM 5886  H HG2    . ARG B 2 66  ? 5.067   -10.194 8.778   1.00 0.00  ? 153 ARG A HG2    4  
ATOM 5887  H HG3    . ARG B 2 66  ? 3.368   -10.621 9.047   1.00 0.00  ? 153 ARG A HG3    4  
ATOM 5888  H HD2    . ARG B 2 66  ? 3.643   -12.652 7.667   1.00 0.00  ? 153 ARG A HD2    4  
ATOM 5889  H HD3    . ARG B 2 66  ? 5.376   -12.286 7.469   1.00 0.00  ? 153 ARG A HD3    4  
ATOM 5890  H HE     . ARG B 2 66  ? 5.152   -12.284 10.171  1.00 0.00  ? 153 ARG A HE     4  
ATOM 5891  H HH11   . ARG B 2 66  ? 4.033   -14.685 7.886   1.00 0.00  ? 153 ARG A HH11   4  
ATOM 5892  H HH12   . ARG B 2 66  ? 4.172   -15.986 9.042   1.00 0.00  ? 153 ARG A HH12   4  
ATOM 5893  H HH21   . ARG B 2 66  ? 5.335   -13.978 11.584  1.00 0.00  ? 153 ARG A HH21   4  
ATOM 5894  H HH22   . ARG B 2 66  ? 4.908   -15.585 11.072  1.00 0.00  ? 153 ARG A HH22   4  
ATOM 5895  N N      . GLY B 2 67  ? 4.342   -8.139  4.214   1.00 0.00  ? 154 GLY A N      4  
ATOM 5896  C CA     . GLY B 2 67  ? 3.707   -7.721  2.950   1.00 0.00  ? 154 GLY A CA     4  
ATOM 5897  C C      . GLY B 2 67  ? 2.908   -6.433  3.154   1.00 0.00  ? 154 GLY A C      4  
ATOM 5898  O O      . GLY B 2 67  ? 3.145   -5.721  4.130   1.00 0.00  ? 154 GLY A O      4  
ATOM 5899  H H      . GLY B 2 67  ? 4.635   -7.375  4.821   1.00 0.00  ? 154 GLY A H      4  
ATOM 5900  H HA2    . GLY B 2 67  ? 4.476   -7.537  2.198   1.00 0.00  ? 154 GLY A HA2    4  
ATOM 5901  H HA3    . GLY B 2 67  ? 3.034   -8.493  2.576   1.00 0.00  ? 154 GLY A HA3    4  
ATOM 5902  N N      . SER B 2 68  ? 1.959   -6.101  2.274   1.00 0.00  ? 155 SER A N      4  
ATOM 5903  C CA     . SER B 2 68  ? 0.996   -5.027  2.568   1.00 0.00  ? 155 SER A CA     4  
ATOM 5904  C C      . SER B 2 68  ? 0.325   -5.220  3.936   1.00 0.00  ? 155 SER A C      4  
ATOM 5905  O O      . SER B 2 68  ? 0.055   -6.343  4.358   1.00 0.00  ? 155 SER A O      4  
ATOM 5906  C CB     . SER B 2 68  ? -0.053  -4.896  1.462   1.00 0.00  ? 155 SER A CB     4  
ATOM 5907  O OG     . SER B 2 68  ? -0.969  -3.864  1.789   1.00 0.00  ? 155 SER A OG     4  
ATOM 5908  H H      . SER B 2 68  ? 1.821   -6.680  1.451   1.00 0.00  ? 155 SER A H      4  
ATOM 5909  H HA     . SER B 2 68  ? 1.524   -4.087  2.604   1.00 0.00  ? 155 SER A HA     4  
ATOM 5910  H HB2    . SER B 2 68  ? 0.438   -4.675  0.510   1.00 0.00  ? 155 SER A HB2    4  
ATOM 5911  H HB3    . SER B 2 68  ? -0.596  -5.829  1.375   1.00 0.00  ? 155 SER A HB3    4  
ATOM 5912  H HG     . SER B 2 68  ? -0.592  -3.009  1.514   1.00 0.00  ? 155 SER A HG     4  
ATOM 5913  N N      . LYS B 2 69  ? 0.024   -4.114  4.622   1.00 0.00  ? 156 LYS A N      4  
ATOM 5914  C CA     . LYS B 2 69  ? -0.809  -4.064  5.833   1.00 0.00  ? 156 LYS A CA     4  
ATOM 5915  C C      . LYS B 2 69  ? -2.312  -4.153  5.516   1.00 0.00  ? 156 LYS A C      4  
ATOM 5916  O O      . LYS B 2 69  ? -3.142  -4.215  6.420   1.00 0.00  ? 156 LYS A O      4  
ATOM 5917  C CB     . LYS B 2 69  ? -0.442  -2.780  6.590   1.00 0.00  ? 156 LYS A CB     4  
ATOM 5918  C CG     . LYS B 2 69  ? -0.529  -2.915  8.116   1.00 0.00  ? 156 LYS A CG     4  
ATOM 5919  C CD     . LYS B 2 69  ? -0.215  -1.599  8.848   1.00 0.00  ? 156 LYS A CD     4  
ATOM 5920  C CE     . LYS B 2 69  ? 1.070   -0.906  8.346   1.00 0.00  ? 156 LYS A CE     4  
ATOM 5921  N NZ     . LYS B 2 69  ? 1.375   0.295   9.168   1.00 0.00  ? 156 LYS A NZ     4  
ATOM 5922  H H      . LYS B 2 69  ? 0.304   -3.223  4.218   1.00 0.00  ? 156 LYS A H      4  
ATOM 5923  H HA     . LYS B 2 69  ? -0.564  -4.922  6.458   1.00 0.00  ? 156 LYS A HA     4  
ATOM 5924  H HB2    . LYS B 2 69  ? 0.605   -2.563  6.376   1.00 0.00  ? 156 LYS A HB2    4  
ATOM 5925  H HB3    . LYS B 2 69  ? -1.049  -1.947  6.223   1.00 0.00  ? 156 LYS A HB3    4  
ATOM 5926  H HG2    . LYS B 2 69  ? -1.529  -3.246  8.395   1.00 0.00  ? 156 LYS A HG2    4  
ATOM 5927  H HG3    . LYS B 2 69  ? 0.188   -3.670  8.436   1.00 0.00  ? 156 LYS A HG3    4  
ATOM 5928  H HD2    . LYS B 2 69  ? -1.061  -0.920  8.728   1.00 0.00  ? 156 LYS A HD2    4  
ATOM 5929  H HD3    . LYS B 2 69  ? -0.111  -1.818  9.913   1.00 0.00  ? 156 LYS A HD3    4  
ATOM 5930  H HE2    . LYS B 2 69  ? 1.901   -1.612  8.402   1.00 0.00  ? 156 LYS A HE2    4  
ATOM 5931  H HE3    . LYS B 2 69  ? 0.953   -0.629  7.281   1.00 0.00  ? 156 LYS A HE3    4  
ATOM 5932  H HZ1    . LYS B 2 69  ? 0.551   0.859   9.322   1.00 0.00  ? 156 LYS A HZ1    4  
ATOM 5933  H HZ2    . LYS B 2 69  ? 1.745   0.045   10.072  1.00 0.00  ? 156 LYS A HZ2    4  
ATOM 5934  H HZ3    . LYS B 2 69  ? 2.044   0.917   8.715   1.00 0.00  ? 156 LYS A HZ3    4  
ATOM 5935  N N      . GLY B 2 70  ? -2.661  -4.196  4.224   1.00 0.00  ? 157 GLY A N      4  
ATOM 5936  C CA     . GLY B 2 70  ? -4.002  -4.435  3.679   1.00 0.00  ? 157 GLY A CA     4  
ATOM 5937  C C      . GLY B 2 70  ? -4.629  -3.226  2.979   1.00 0.00  ? 157 GLY A C      4  
ATOM 5938  O O      . GLY B 2 70  ? -5.731  -3.333  2.440   1.00 0.00  ? 157 GLY A O      4  
ATOM 5939  H H      . GLY B 2 70  ? -1.901  -4.130  3.553   1.00 0.00  ? 157 GLY A H      4  
ATOM 5940  H HA2    . GLY B 2 70  ? -3.928  -5.239  2.946   1.00 0.00  ? 157 GLY A HA2    4  
ATOM 5941  H HA3    . GLY B 2 70  ? -4.672  -4.764  4.472   1.00 0.00  ? 157 GLY A HA3    4  
ATOM 5942  N N      . PHE B 2 71  ? -3.938  -2.085  2.967   1.00 0.00  ? 158 PHE A N      4  
ATOM 5943  C CA     . PHE B 2 71  ? -4.345  -0.862  2.291   1.00 0.00  ? 158 PHE A CA     4  
ATOM 5944  C C      . PHE B 2 71  ? -3.136  -0.022  1.857   1.00 0.00  ? 158 PHE A C      4  
ATOM 5945  O O      . PHE B 2 71  ? -1.997  -0.202  2.314   1.00 0.00  ? 158 PHE A O      4  
ATOM 5946  C CB     . PHE B 2 71  ? -5.337  -0.055  3.159   1.00 0.00  ? 158 PHE A CB     4  
ATOM 5947  C CG     . PHE B 2 71  ? -4.810  0.800   4.296   1.00 0.00  ? 158 PHE A CG     4  
ATOM 5948  C CD1    . PHE B 2 71  ? -4.519  0.203   5.534   1.00 0.00  ? 158 PHE A CD1    4  
ATOM 5949  C CD2    . PHE B 2 71  ? -4.759  2.206   4.161   1.00 0.00  ? 158 PHE A CD2    4  
ATOM 5950  C CE1    . PHE B 2 71  ? -4.184  1.006   6.633   1.00 0.00  ? 158 PHE A CE1    4  
ATOM 5951  C CE2    . PHE B 2 71  ? -4.443  3.019   5.270   1.00 0.00  ? 158 PHE A CE2    4  
ATOM 5952  C CZ     . PHE B 2 71  ? -4.144  2.403   6.494   1.00 0.00  ? 158 PHE A CZ     4  
ATOM 5953  H H      . PHE B 2 71  ? -2.980  -2.114  3.265   1.00 0.00  ? 158 PHE A H      4  
ATOM 5954  H HA     . PHE B 2 71  ? -4.874  -1.159  1.387   1.00 0.00  ? 158 PHE A HA     4  
ATOM 5955  H HB2    . PHE B 2 71  ? -5.920  0.585   2.518   1.00 0.00  ? 158 PHE A HB2    4  
ATOM 5956  H HB3    . PHE B 2 71  ? -6.073  -0.727  3.574   1.00 0.00  ? 158 PHE A HB3    4  
ATOM 5957  H HD1    . PHE B 2 71  ? -4.581  -0.869  5.652   1.00 0.00  ? 158 PHE A HD1    4  
ATOM 5958  H HD2    . PHE B 2 71  ? -4.997  2.659   3.209   1.00 0.00  ? 158 PHE A HD2    4  
ATOM 5959  H HE1    . PHE B 2 71  ? -3.966  0.541   7.583   1.00 0.00  ? 158 PHE A HE1    4  
ATOM 5960  H HE2    . PHE B 2 71  ? -4.383  4.107   5.196   1.00 0.00  ? 158 PHE A HE2    4  
ATOM 5961  H HZ     . PHE B 2 71  ? -3.847  3.014   7.323   1.00 0.00  ? 158 PHE A HZ     4  
ATOM 5962  N N      . GLY B 2 72  ? -3.408  0.929   0.973   1.00 0.00  ? 159 GLY A N      4  
ATOM 5963  C CA     . GLY B 2 72  ? -2.486  1.985   0.586   1.00 0.00  ? 159 GLY A CA     4  
ATOM 5964  C C      . GLY B 2 72  ? -3.174  3.350   0.558   1.00 0.00  ? 159 GLY A C      4  
ATOM 5965  O O      . GLY B 2 72  ? -4.363  3.498   0.840   1.00 0.00  ? 159 GLY A O      4  
ATOM 5966  H H      . GLY B 2 72  ? -4.365  0.979   0.639   1.00 0.00  ? 159 GLY A H      4  
ATOM 5967  H HA2    . GLY B 2 72  ? -1.679  2.048   1.308   1.00 0.00  ? 159 GLY A HA2    4  
ATOM 5968  H HA3    . GLY B 2 72  ? -2.040  1.759   -0.393  1.00 0.00  ? 159 GLY A HA3    4  
ATOM 5969  N N      . PHE B 2 73  ? -2.392  4.352   0.208   1.00 0.00  ? 160 PHE A N      4  
ATOM 5970  C CA     . PHE B 2 73  ? -2.753  5.727   -0.062  1.00 0.00  ? 160 PHE A CA     4  
ATOM 5971  C C      . PHE B 2 73  ? -2.159  6.134   -1.426  1.00 0.00  ? 160 PHE A C      4  
ATOM 5972  O O      . PHE B 2 73  ? -1.098  5.648   -1.826  1.00 0.00  ? 160 PHE A O      4  
ATOM 5973  C CB     . PHE B 2 73  ? -2.235  6.597   1.100   1.00 0.00  ? 160 PHE A CB     4  
ATOM 5974  C CG     . PHE B 2 73  ? -3.315  7.140   2.009   1.00 0.00  ? 160 PHE A CG     4  
ATOM 5975  C CD1    . PHE B 2 73  ? -3.811  6.410   3.115   1.00 0.00  ? 160 PHE A CD1    4  
ATOM 5976  C CD2    . PHE B 2 73  ? -3.777  8.446   1.776   1.00 0.00  ? 160 PHE A CD2    4  
ATOM 5977  C CE1    . PHE B 2 73  ? -4.769  6.985   3.964   1.00 0.00  ? 160 PHE A CE1    4  
ATOM 5978  C CE2    . PHE B 2 73  ? -4.713  9.024   2.639   1.00 0.00  ? 160 PHE A CE2    4  
ATOM 5979  C CZ     . PHE B 2 73  ? -5.221  8.290   3.722   1.00 0.00  ? 160 PHE A CZ     4  
ATOM 5980  H H      . PHE B 2 73  ? -1.407  4.155   0.147   1.00 0.00  ? 160 PHE A H      4  
ATOM 5981  H HA     . PHE B 2 73  ? -3.834  5.803   -0.114  1.00 0.00  ? 160 PHE A HA     4  
ATOM 5982  H HB2    . PHE B 2 73  ? -1.518  6.044   1.707   1.00 0.00  ? 160 PHE A HB2    4  
ATOM 5983  H HB3    . PHE B 2 73  ? -1.697  7.446   0.681   1.00 0.00  ? 160 PHE A HB3    4  
ATOM 5984  H HD1    . PHE B 2 73  ? -3.466  5.423   3.383   1.00 0.00  ? 160 PHE A HD1    4  
ATOM 5985  H HD2    . PHE B 2 73  ? -3.390  9.025   0.950   1.00 0.00  ? 160 PHE A HD2    4  
ATOM 5986  H HE1    . PHE B 2 73  ? -5.115  6.437   4.832   1.00 0.00  ? 160 PHE A HE1    4  
ATOM 5987  H HE2    . PHE B 2 73  ? -5.012  10.046  2.480   1.00 0.00  ? 160 PHE A HE2    4  
ATOM 5988  H HZ     . PHE B 2 73  ? -5.925  8.747   4.401   1.00 0.00  ? 160 PHE A HZ     4  
ATOM 5989  N N      . VAL B 2 74  ? -2.842  7.006   -2.170  1.00 0.00  ? 161 VAL A N      4  
ATOM 5990  C CA     . VAL B 2 74  ? -2.405  7.517   -3.485  1.00 0.00  ? 161 VAL A CA     4  
ATOM 5991  C C      . VAL B 2 74  ? -2.953  8.928   -3.731  1.00 0.00  ? 161 VAL A C      4  
ATOM 5992  O O      . VAL B 2 74  ? -3.911  9.327   -3.080  1.00 0.00  ? 161 VAL A O      4  
ATOM 5993  C CB     . VAL B 2 74  ? -2.752  6.483   -4.581  1.00 0.00  ? 161 VAL A CB     4  
ATOM 5994  C CG1    . VAL B 2 74  ? -4.188  6.071   -4.703  1.00 0.00  ? 161 VAL A CG1    4  
ATOM 5995  C CG2    . VAL B 2 74  ? -2.422  6.898   -6.009  1.00 0.00  ? 161 VAL A CG2    4  
ATOM 5996  H H      . VAL B 2 74  ? -3.761  7.280   -1.833  1.00 0.00  ? 161 VAL A H      4  
ATOM 5997  H HA     . VAL B 2 74  ? -1.323  7.624   -3.473  1.00 0.00  ? 161 VAL A HA     4  
ATOM 5998  H HB     . VAL B 2 74  ? -2.241  5.548   -4.331  1.00 0.00  ? 161 VAL A HB     4  
ATOM 5999  H HG11   . VAL B 2 74  ? -4.634  5.988   -3.723  1.00 0.00  ? 161 VAL A HG11   4  
ATOM 6000  H HG12   . VAL B 2 74  ? -4.727  6.784   -5.326  1.00 0.00  ? 161 VAL A HG12   4  
ATOM 6001  H HG13   . VAL B 2 74  ? -4.116  5.093   -5.180  1.00 0.00  ? 161 VAL A HG13   4  
ATOM 6002  H HG21   . VAL B 2 74  ? -3.062  7.726   -6.325  1.00 0.00  ? 161 VAL A HG21   4  
ATOM 6003  H HG22   . VAL B 2 74  ? -1.385  7.184   -6.046  1.00 0.00  ? 161 VAL A HG22   4  
ATOM 6004  H HG23   . VAL B 2 74  ? -2.597  6.065   -6.690  1.00 0.00  ? 161 VAL A HG23   4  
ATOM 6005  N N      . THR B 2 75  ? -2.346  9.716   -4.623  1.00 0.00  ? 162 THR A N      4  
ATOM 6006  C CA     . THR B 2 75  ? -2.560  11.183  -4.682  1.00 0.00  ? 162 THR A CA     4  
ATOM 6007  C C      . THR B 2 75  ? -3.100  11.567  -6.051  1.00 0.00  ? 162 THR A C      4  
ATOM 6008  O O      . THR B 2 75  ? -2.375  11.513  -7.044  1.00 0.00  ? 162 THR A O      4  
ATOM 6009  C CB     . THR B 2 75  ? -1.274  11.946  -4.357  1.00 0.00  ? 162 THR A CB     4  
ATOM 6010  O OG1    . THR B 2 75  ? -0.781  11.540  -3.099  1.00 0.00  ? 162 THR A OG1    4  
ATOM 6011  C CG2    . THR B 2 75  ? -1.460  13.466  -4.273  1.00 0.00  ? 162 THR A CG2    4  
ATOM 6012  H H      . THR B 2 75  ? -1.580  9.302   -5.163  1.00 0.00  ? 162 THR A H      4  
ATOM 6013  H HA     . THR B 2 75  ? -3.292  11.477  -3.938  1.00 0.00  ? 162 THR A HA     4  
ATOM 6014  H HB     . THR B 2 75  ? -0.553  11.703  -5.133  1.00 0.00  ? 162 THR A HB     4  
ATOM 6015  H HG1    . THR B 2 75  ? 0.053   12.010  -2.934  1.00 0.00  ? 162 THR A HG1    4  
ATOM 6016  H HG21   . THR B 2 75  ? -1.958  13.853  -5.162  1.00 0.00  ? 162 THR A HG21   4  
ATOM 6017  H HG22   . THR B 2 75  ? -2.044  13.731  -3.393  1.00 0.00  ? 162 THR A HG22   4  
ATOM 6018  H HG23   . THR B 2 75  ? -0.481  13.944  -4.189  1.00 0.00  ? 162 THR A HG23   4  
ATOM 6019  N N      . PHE B 2 76  ? -4.410  11.832  -6.115  1.00 0.00  ? 163 PHE A N      4  
ATOM 6020  C CA     . PHE B 2 76  ? -5.216  11.371  -7.244  1.00 0.00  ? 163 PHE A CA     4  
ATOM 6021  C C      . PHE B 2 76  ? -6.481  12.161  -7.574  1.00 0.00  ? 163 PHE A C      4  
ATOM 6022  O O      . PHE B 2 76  ? -6.817  12.420  -8.728  1.00 0.00  ? 163 PHE A O      4  
ATOM 6023  C CB     . PHE B 2 76  ? -5.630  9.940   -6.899  1.00 0.00  ? 163 PHE A CB     4  
ATOM 6024  C CG     . PHE B 2 76  ? -6.256  9.212   -8.071  1.00 0.00  ? 163 PHE A CG     4  
ATOM 6025  C CD1    . PHE B 2 76  ? -5.406  8.552   -8.964  1.00 0.00  ? 163 PHE A CD1    4  
ATOM 6026  C CD2    . PHE B 2 76  ? -7.638  9.259   -8.339  1.00 0.00  ? 163 PHE A CD2    4  
ATOM 6027  C CE1    . PHE B 2 76  ? -5.909  7.957   -10.132 1.00 0.00  ? 163 PHE A CE1    4  
ATOM 6028  C CE2    . PHE B 2 76  ? -8.152  8.642   -9.493  1.00 0.00  ? 163 PHE A CE2    4  
ATOM 6029  C CZ     . PHE B 2 76  ? -7.285  8.006   -10.400 1.00 0.00  ? 163 PHE A CZ     4  
ATOM 6030  H H      . PHE B 2 76  ? -4.897  11.947  -5.235  1.00 0.00  ? 163 PHE A H      4  
ATOM 6031  H HA     . PHE B 2 76  ? -4.613  11.354  -8.128  1.00 0.00  ? 163 PHE A HA     4  
ATOM 6032  H HB2    . PHE B 2 76  ? -4.740  9.396   -6.561  1.00 0.00  ? 163 PHE A HB2    4  
ATOM 6033  H HB3    . PHE B 2 76  ? -6.332  9.989   -6.063  1.00 0.00  ? 163 PHE A HB3    4  
ATOM 6034  H HD1    . PHE B 2 76  ? -4.359  8.538   -8.725  1.00 0.00  ? 163 PHE A HD1    4  
ATOM 6035  H HD2    . PHE B 2 76  ? -8.312  9.779   -7.673  1.00 0.00  ? 163 PHE A HD2    4  
ATOM 6036  H HE1    . PHE B 2 76  ? -5.233  7.466   -10.812 1.00 0.00  ? 163 PHE A HE1    4  
ATOM 6037  H HE2    . PHE B 2 76  ? -9.213  8.664   -9.684  1.00 0.00  ? 163 PHE A HE2    4  
ATOM 6038  H HZ     . PHE B 2 76  ? -7.681  7.548   -11.297 1.00 0.00  ? 163 PHE A HZ     4  
ATOM 6039  N N      . GLU B 2 77  ? -7.220  12.475  -6.526  1.00 0.00  ? 164 GLU A N      4  
ATOM 6040  C CA     . GLU B 2 77  ? -8.566  12.991  -6.499  1.00 0.00  ? 164 GLU A CA     4  
ATOM 6041  C C      . GLU B 2 77  ? -8.478  14.489  -6.704  1.00 0.00  ? 164 GLU A C      4  
ATOM 6042  O O      . GLU B 2 77  ? -7.908  15.193  -5.870  1.00 0.00  ? 164 GLU A O      4  
ATOM 6043  C CB     . GLU B 2 77  ? -9.252  12.686  -5.156  1.00 0.00  ? 164 GLU A CB     4  
ATOM 6044  C CG     . GLU B 2 77  ? -10.779 12.758  -5.307  1.00 0.00  ? 164 GLU A CG     4  
ATOM 6045  C CD     . GLU B 2 77  ? -11.516 12.308  -4.033  1.00 0.00  ? 164 GLU A CD     4  
ATOM 6046  O OE1    . GLU B 2 77  ? -11.418 13.007  -2.995  1.00 0.00  ? 164 GLU A OE1    4  
ATOM 6047  O OE2    . GLU B 2 77  ? -12.224 11.274  -4.079  1.00 0.00  ? 164 GLU A OE2    4  
ATOM 6048  H H      . GLU B 2 77  ? -6.705  12.534  -5.677  1.00 0.00  ? 164 GLU A H      4  
ATOM 6049  H HA     . GLU B 2 77  ? -9.145  12.510  -7.283  1.00 0.00  ? 164 GLU A HA     4  
ATOM 6050  H HB2    . GLU B 2 77  ? -8.968  11.693  -4.844  1.00 0.00  ? 164 GLU A HB2    4  
ATOM 6051  H HB3    . GLU B 2 77  ? -8.918  13.376  -4.377  1.00 0.00  ? 164 GLU A HB3    4  
ATOM 6052  H HG2    . GLU B 2 77  ? -11.065 13.783  -5.555  1.00 0.00  ? 164 GLU A HG2    4  
ATOM 6053  H HG3    . GLU B 2 77  ? -11.077 12.124  -6.143  1.00 0.00  ? 164 GLU A HG3    4  
ATOM 6054  N N      . ASN B 2 78  ? -9.045  14.978  -7.797  1.00 0.00  ? 165 ASN A N      4  
ATOM 6055  C CA     . ASN B 2 78  ? -9.647  16.307  -7.772  1.00 0.00  ? 165 ASN A CA     4  
ATOM 6056  C C      . ASN B 2 78  ? -10.897 16.425  -8.666  1.00 0.00  ? 165 ASN A C      4  
ATOM 6057  O O      . ASN B 2 78  ? -11.996 16.674  -8.168  1.00 0.00  ? 165 ASN A O      4  
ATOM 6058  C CB     . ASN B 2 78  ? -8.579  17.387  -8.076  1.00 0.00  ? 165 ASN A CB     4  
ATOM 6059  C CG     . ASN B 2 78  ? -8.424  18.383  -6.936  1.00 0.00  ? 165 ASN A CG     4  
ATOM 6060  O OD1    . ASN B 2 78  ? -8.472  19.590  -7.124  1.00 0.00  ? 165 ASN A OD1    4  
ATOM 6061  N ND2    . ASN B 2 78  ? -8.236  17.919  -5.723  1.00 0.00  ? 165 ASN A ND2    4  
ATOM 6062  H H      . ASN B 2 78  ? -9.333  14.275  -8.456  1.00 0.00  ? 165 ASN A H      4  
ATOM 6063  H HA     . ASN B 2 78  ? -9.991  16.418  -6.744  1.00 0.00  ? 165 ASN A HA     4  
ATOM 6064  H HB2    . ASN B 2 78  ? -7.610  16.928  -8.256  1.00 0.00  ? 165 ASN A HB2    4  
ATOM 6065  H HB3    . ASN B 2 78  ? -8.849  17.944  -8.974  1.00 0.00  ? 165 ASN A HB3    4  
ATOM 6066  H HD21   . ASN B 2 78  ? -8.175  16.908  -5.573  1.00 0.00  ? 165 ASN A HD21   4  
ATOM 6067  H HD22   . ASN B 2 78  ? -8.085  18.594  -4.993  1.00 0.00  ? 165 ASN A HD22   4  
ATOM 6068  N N      . SER B 2 79  ? -10.723 16.266  -9.981  1.00 0.00  ? 166 SER A N      4  
ATOM 6069  C CA     . SER B 2 79  ? -11.772 16.415  -11.007 1.00 0.00  ? 166 SER A CA     4  
ATOM 6070  C C      . SER B 2 79  ? -12.814 15.281  -10.981 1.00 0.00  ? 166 SER A C      4  
ATOM 6071  O O      . SER B 2 79  ? -12.580 14.217  -10.405 1.00 0.00  ? 166 SER A O      4  
ATOM 6072  C CB     . SER B 2 79  ? -11.114 16.459  -12.396 1.00 0.00  ? 166 SER A CB     4  
ATOM 6073  O OG     . SER B 2 79  ? -10.082 17.434  -12.457 1.00 0.00  ? 166 SER A OG     4  
ATOM 6074  H H      . SER B 2 79  ? -9.778  16.112  -10.308 1.00 0.00  ? 166 SER A H      4  
ATOM 6075  H HA     . SER B 2 79  ? -12.289 17.360  -10.839 1.00 0.00  ? 166 SER A HA     4  
ATOM 6076  H HB2    . SER B 2 79  ? -10.687 15.480  -12.616 1.00 0.00  ? 166 SER A HB2    4  
ATOM 6077  H HB3    . SER B 2 79  ? -11.866 16.687  -13.154 1.00 0.00  ? 166 SER A HB3    4  
ATOM 6078  H HG     . SER B 2 79  ? -10.481 18.321  -12.350 1.00 0.00  ? 166 SER A HG     4  
ATOM 6079  N N      . ALA B 2 80  ? -13.935 15.456  -11.693 1.00 0.00  ? 167 ALA A N      4  
ATOM 6080  C CA     . ALA B 2 80  ? -14.951 14.408  -11.869 1.00 0.00  ? 167 ALA A CA     4  
ATOM 6081  C C      . ALA B 2 80  ? -14.401 13.130  -12.525 1.00 0.00  ? 167 ALA A C      4  
ATOM 6082  O O      . ALA B 2 80  ? -14.849 12.035  -12.201 1.00 0.00  ? 167 ALA A O      4  
ATOM 6083  C CB     . ALA B 2 80  ? -16.110 14.956  -12.707 1.00 0.00  ? 167 ALA A CB     4  
ATOM 6084  H H      . ALA B 2 80  ? -14.093 16.351  -12.132 1.00 0.00  ? 167 ALA A H      4  
ATOM 6085  H HA     . ALA B 2 80  ? -15.341 14.135  -10.888 1.00 0.00  ? 167 ALA A HA     4  
ATOM 6086  H HB1    . ALA B 2 80  ? -16.562 15.814  -12.210 1.00 0.00  ? 167 ALA A HB1    4  
ATOM 6087  H HB2    . ALA B 2 80  ? -15.752 15.246  -13.696 1.00 0.00  ? 167 ALA A HB2    4  
ATOM 6088  H HB3    . ALA B 2 80  ? -16.859 14.167  -12.825 1.00 0.00  ? 167 ALA A HB3    4  
ATOM 6089  N N      . ASP B 2 81  ? -13.408 13.253  -13.412 1.00 0.00  ? 168 ASP A N      4  
ATOM 6090  C CA     . ASP B 2 81  ? -12.705 12.117  -14.017 1.00 0.00  ? 168 ASP A CA     4  
ATOM 6091  C C      . ASP B 2 81  ? -11.965 11.254  -12.969 1.00 0.00  ? 168 ASP A C      4  
ATOM 6092  O O      . ASP B 2 81  ? -11.956 10.025  -13.070 1.00 0.00  ? 168 ASP A O      4  
ATOM 6093  C CB     . ASP B 2 81  ? -11.742 12.668  -15.073 1.00 0.00  ? 168 ASP A CB     4  
ATOM 6094  C CG     . ASP B 2 81  ? -11.037 11.557  -15.870 1.00 0.00  ? 168 ASP A CG     4  
ATOM 6095  O OD1    . ASP B 2 81  ? -11.727 10.779  -16.572 1.00 0.00  ? 168 ASP A OD1    4  
ATOM 6096  O OD2    . ASP B 2 81  ? -9.786  11.499  -15.810 1.00 0.00  ? 168 ASP A OD2    4  
ATOM 6097  H H      . ASP B 2 81  ? -13.141 14.192  -13.672 1.00 0.00  ? 168 ASP A H      4  
ATOM 6098  H HA     . ASP B 2 81  ? -13.434 11.477  -14.518 1.00 0.00  ? 168 ASP A HA     4  
ATOM 6099  H HB2    . ASP B 2 81  ? -12.304 13.294  -15.768 1.00 0.00  ? 168 ASP A HB2    4  
ATOM 6100  H HB3    . ASP B 2 81  ? -11.001 13.300  -14.576 1.00 0.00  ? 168 ASP A HB3    4  
ATOM 6101  N N      . ALA B 2 82  ? -11.401 11.879  -11.926 1.00 0.00  ? 169 ALA A N      4  
ATOM 6102  C CA     . ALA B 2 82  ? -10.802 11.176  -10.791 1.00 0.00  ? 169 ALA A CA     4  
ATOM 6103  C C      . ALA B 2 82  ? -11.863 10.510  -9.897  1.00 0.00  ? 169 ALA A C      4  
ATOM 6104  O O      . ALA B 2 82  ? -11.685 9.364   -9.483  1.00 0.00  ? 169 ALA A O      4  
ATOM 6105  C CB     . ALA B 2 82  ? -9.942  12.148  -9.983  1.00 0.00  ? 169 ALA A CB     4  
ATOM 6106  H H      . ALA B 2 82  ? -11.521 12.881  -11.858 1.00 0.00  ? 169 ALA A H      4  
ATOM 6107  H HA     . ALA B 2 82  ? -10.154 10.389  -11.172 1.00 0.00  ? 169 ALA A HA     4  
ATOM 6108  H HB1    . ALA B 2 82  ? -9.245  12.672  -10.635 1.00 0.00  ? 169 ALA A HB1    4  
ATOM 6109  H HB2    . ALA B 2 82  ? -10.567 12.873  -9.462  1.00 0.00  ? 169 ALA A HB2    4  
ATOM 6110  H HB3    . ALA B 2 82  ? -9.369  11.577  -9.256  1.00 0.00  ? 169 ALA A HB3    4  
ATOM 6111  N N      . ASP B 2 83  ? -12.976 11.192  -9.611  1.00 0.00  ? 170 ASP A N      4  
ATOM 6112  C CA     . ASP B 2 83  ? -14.113 10.615  -8.882  1.00 0.00  ? 170 ASP A CA     4  
ATOM 6113  C C      . ASP B 2 83  ? -14.702 9.397   -9.616  1.00 0.00  ? 170 ASP A C      4  
ATOM 6114  O O      . ASP B 2 83  ? -14.880 8.342   -9.015  1.00 0.00  ? 170 ASP A O      4  
ATOM 6115  C CB     . ASP B 2 83  ? -15.184 11.688  -8.643  1.00 0.00  ? 170 ASP A CB     4  
ATOM 6116  C CG     . ASP B 2 83  ? -16.349 11.145  -7.794  1.00 0.00  ? 170 ASP A CG     4  
ATOM 6117  O OD1    . ASP B 2 83  ? -16.154 10.915  -6.579  1.00 0.00  ? 170 ASP A OD1    4  
ATOM 6118  O OD2    . ASP B 2 83  ? -17.467 10.970  -8.342  1.00 0.00  ? 170 ASP A OD2    4  
ATOM 6119  H H      . ASP B 2 83  ? -13.036 12.144  -9.954  1.00 0.00  ? 170 ASP A H      4  
ATOM 6120  H HA     . ASP B 2 83  ? -13.758 10.270  -7.909  1.00 0.00  ? 170 ASP A HA     4  
ATOM 6121  H HB2    . ASP B 2 83  ? -14.728 12.538  -8.130  1.00 0.00  ? 170 ASP A HB2    4  
ATOM 6122  H HB3    . ASP B 2 83  ? -15.565 12.036  -9.602  1.00 0.00  ? 170 ASP A HB3    4  
ATOM 6123  N N      . ARG B 2 84  ? -14.934 9.508   -10.928 1.00 0.00  ? 171 ARG A N      4  
ATOM 6124  C CA     . ARG B 2 84  ? -15.348 8.431   -11.842 1.00 0.00  ? 171 ARG A CA     4  
ATOM 6125  C C      . ARG B 2 84  ? -14.393 7.236   -11.793 1.00 0.00  ? 171 ARG A C      4  
ATOM 6126  O O      . ARG B 2 84  ? -14.829 6.097   -11.627 1.00 0.00  ? 171 ARG A O      4  
ATOM 6127  C CB     . ARG B 2 84  ? -15.479 9.030   -13.252 1.00 0.00  ? 171 ARG A CB     4  
ATOM 6128  C CG     . ARG B 2 84  ? -15.901 8.006   -14.315 1.00 0.00  ? 171 ARG A CG     4  
ATOM 6129  C CD     . ARG B 2 84  ? -16.051 8.678   -15.684 1.00 0.00  ? 171 ARG A CD     4  
ATOM 6130  N NE     . ARG B 2 84  ? -16.478 7.708   -16.711 1.00 0.00  ? 171 ARG A NE     4  
ATOM 6131  C CZ     . ARG B 2 84  ? -16.636 7.930   -18.006 1.00 0.00  ? 171 ARG A CZ     4  
ATOM 6132  N NH1    . ARG B 2 84  ? -16.407 9.099   -18.542 1.00 0.00  ? 171 ARG A NH1    4  
ATOM 6133  N NH2    . ARG B 2 84  ? -17.035 6.974   -18.798 1.00 0.00  ? 171 ARG A NH2    4  
ATOM 6134  H H      . ARG B 2 84  ? -14.780 10.432  -11.326 1.00 0.00  ? 171 ARG A H      4  
ATOM 6135  H HA     . ARG B 2 84  ? -16.324 8.061   -11.522 1.00 0.00  ? 171 ARG A HA     4  
ATOM 6136  H HB2    . ARG B 2 84  ? -16.222 9.816   -13.208 1.00 0.00  ? 171 ARG A HB2    4  
ATOM 6137  H HB3    . ARG B 2 84  ? -14.544 9.509   -13.545 1.00 0.00  ? 171 ARG A HB3    4  
ATOM 6138  H HG2    . ARG B 2 84  ? -15.147 7.221   -14.396 1.00 0.00  ? 171 ARG A HG2    4  
ATOM 6139  H HG3    . ARG B 2 84  ? -16.856 7.564   -14.025 1.00 0.00  ? 171 ARG A HG3    4  
ATOM 6140  H HD2    . ARG B 2 84  ? -16.792 9.475   -15.603 1.00 0.00  ? 171 ARG A HD2    4  
ATOM 6141  H HD3    . ARG B 2 84  ? -15.090 9.114   -15.965 1.00 0.00  ? 171 ARG A HD3    4  
ATOM 6142  H HE     . ARG B 2 84  ? -16.671 6.767   -16.406 1.00 0.00  ? 171 ARG A HE     4  
ATOM 6143  H HH11   . ARG B 2 84  ? -16.091 9.849   -17.951 1.00 0.00  ? 171 ARG A HH11   4  
ATOM 6144  H HH12   . ARG B 2 84  ? -16.533 9.248   -19.528 1.00 0.00  ? 171 ARG A HH12   4  
ATOM 6145  H HH21   . ARG B 2 84  ? -17.230 6.054   -18.431 1.00 0.00  ? 171 ARG A HH21   4  
ATOM 6146  H HH22   . ARG B 2 84  ? -17.152 7.147   -19.783 1.00 0.00  ? 171 ARG A HH22   4  
ATOM 6147  N N      . ALA B 2 85  ? -13.095 7.496   -11.904 1.00 0.00  ? 172 ALA A N      4  
ATOM 6148  C CA     . ALA B 2 85  ? -12.047 6.481   -11.753 1.00 0.00  ? 172 ALA A CA     4  
ATOM 6149  C C      . ALA B 2 85  ? -12.095 5.751   -10.393 1.00 0.00  ? 172 ALA A C      4  
ATOM 6150  O O      . ALA B 2 85  ? -12.206 4.526   -10.367 1.00 0.00  ? 172 ALA A O      4  
ATOM 6151  C CB     . ALA B 2 85  ? -10.692 7.131   -12.013 1.00 0.00  ? 172 ALA A CB     4  
ATOM 6152  H H      . ALA B 2 85  ? -12.866 8.458   -12.135 1.00 0.00  ? 172 ALA A H      4  
ATOM 6153  H HA     . ALA B 2 85  ? -12.202 5.721   -12.520 1.00 0.00  ? 172 ALA A HA     4  
ATOM 6154  H HB1    . ALA B 2 85  ? -10.631 7.410   -13.064 1.00 0.00  ? 172 ALA A HB1    4  
ATOM 6155  H HB2    . ALA B 2 85  ? -10.570 8.017   -11.396 1.00 0.00  ? 172 ALA A HB2    4  
ATOM 6156  H HB3    . ALA B 2 85  ? -9.907  6.414   -11.780 1.00 0.00  ? 172 ALA A HB3    4  
ATOM 6157  N N      . ARG B 2 86  ? -12.088 6.481   -9.270  1.00 0.00  ? 173 ARG A N      4  
ATOM 6158  C CA     . ARG B 2 86  ? -12.399 5.982   -7.913  1.00 0.00  ? 173 ARG A CA     4  
ATOM 6159  C C      . ARG B 2 86  ? -13.631 5.083   -7.926  1.00 0.00  ? 173 ARG A C      4  
ATOM 6160  O O      . ARG B 2 86  ? -13.516 3.917   -7.575  1.00 0.00  ? 173 ARG A O      4  
ATOM 6161  C CB     . ARG B 2 86  ? -12.509 7.198   -6.964  1.00 0.00  ? 173 ARG A CB     4  
ATOM 6162  C CG     . ARG B 2 86  ? -13.514 7.079   -5.807  1.00 0.00  ? 173 ARG A CG     4  
ATOM 6163  C CD     . ARG B 2 86  ? -13.281 8.172   -4.758  1.00 0.00  ? 173 ARG A CD     4  
ATOM 6164  N NE     . ARG B 2 86  ? -14.013 7.862   -3.522  1.00 0.00  ? 173 ARG A NE     4  
ATOM 6165  C CZ     . ARG B 2 86  ? -14.521 8.722   -2.663  1.00 0.00  ? 173 ARG A CZ     4  
ATOM 6166  N NH1    . ARG B 2 86  ? -14.341 10.004  -2.764  1.00 0.00  ? 173 ARG A NH1    4  
ATOM 6167  N NH2    . ARG B 2 86  ? -15.207 8.309   -1.637  1.00 0.00  ? 173 ARG A NH2    4  
ATOM 6168  H H      . ARG B 2 86  ? -11.982 7.484   -9.392  1.00 0.00  ? 173 ARG A H      4  
ATOM 6169  H HA     . ARG B 2 86  ? -11.601 5.313   -7.548  1.00 0.00  ? 173 ARG A HA     4  
ATOM 6170  H HB2    . ARG B 2 86  ? -11.512 7.385   -6.565  1.00 0.00  ? 173 ARG A HB2    4  
ATOM 6171  H HB3    . ARG B 2 86  ? -12.786 8.084   -7.527  1.00 0.00  ? 173 ARG A HB3    4  
ATOM 6172  H HG2    . ARG B 2 86  ? -14.530 7.183   -6.189  1.00 0.00  ? 173 ARG A HG2    4  
ATOM 6173  H HG3    . ARG B 2 86  ? -13.430 6.106   -5.334  1.00 0.00  ? 173 ARG A HG3    4  
ATOM 6174  H HD2    . ARG B 2 86  ? -12.216 8.234   -4.526  1.00 0.00  ? 173 ARG A HD2    4  
ATOM 6175  H HD3    . ARG B 2 86  ? -13.601 9.133   -5.172  1.00 0.00  ? 173 ARG A HD3    4  
ATOM 6176  H HE     . ARG B 2 86  ? -14.050 6.886   -3.263  1.00 0.00  ? 173 ARG A HE     4  
ATOM 6177  H HH11   . ARG B 2 86  ? -13.653 10.363  -3.430  1.00 0.00  ? 173 ARG A HH11   4  
ATOM 6178  H HH12   . ARG B 2 86  ? -14.704 10.605  -2.047  1.00 0.00  ? 173 ARG A HH12   4  
ATOM 6179  H HH21   . ARG B 2 86  ? -15.493 7.346   -1.567  1.00 0.00  ? 173 ARG A HH21   4  
ATOM 6180  H HH22   . ARG B 2 86  ? -15.521 8.989   -0.961  1.00 0.00  ? 173 ARG A HH22   4  
ATOM 6181  N N      . GLU B 2 87  ? -14.777 5.571   -8.376  1.00 0.00  ? 174 GLU A N      4  
ATOM 6182  C CA     . GLU B 2 87  ? -16.029 4.814   -8.428  1.00 0.00  ? 174 GLU A CA     4  
ATOM 6183  C C      . GLU B 2 87  ? -15.948 3.524   -9.257  1.00 0.00  ? 174 GLU A C      4  
ATOM 6184  O O      . GLU B 2 87  ? -16.641 2.553   -8.940  1.00 0.00  ? 174 GLU A O      4  
ATOM 6185  C CB     . GLU B 2 87  ? -17.125 5.720   -8.995  1.00 0.00  ? 174 GLU A CB     4  
ATOM 6186  C CG     . GLU B 2 87  ? -17.543 6.856   -8.057  1.00 0.00  ? 174 GLU A CG     4  
ATOM 6187  C CD     . GLU B 2 87  ? -18.579 6.385   -7.021  1.00 0.00  ? 174 GLU A CD     4  
ATOM 6188  O OE1    . GLU B 2 87  ? -18.177 5.863   -5.952  1.00 0.00  ? 174 GLU A OE1    4  
ATOM 6189  O OE2    . GLU B 2 87  ? -19.801 6.528   -7.268  1.00 0.00  ? 174 GLU A OE2    4  
ATOM 6190  H H      . GLU B 2 87  ? -14.804 6.549   -8.641  1.00 0.00  ? 174 GLU A H      4  
ATOM 6191  H HA     . GLU B 2 87  ? -16.291 4.511   -7.418  1.00 0.00  ? 174 GLU A HA     4  
ATOM 6192  H HB2    . GLU B 2 87  ? -16.778 6.149   -9.932  1.00 0.00  ? 174 GLU A HB2    4  
ATOM 6193  H HB3    . GLU B 2 87  ? -17.998 5.120   -9.223  1.00 0.00  ? 174 GLU A HB3    4  
ATOM 6194  H HG2    . GLU B 2 87  ? -16.680 7.285   -7.548  1.00 0.00  ? 174 GLU A HG2    4  
ATOM 6195  H HG3    . GLU B 2 87  ? -17.958 7.642   -8.689  1.00 0.00  ? 174 GLU A HG3    4  
ATOM 6196  N N      . LYS B 2 88  ? -15.083 3.472   -10.280 1.00 0.00  ? 175 LYS A N      4  
ATOM 6197  C CA     . LYS B 2 88  ? -14.761 2.252   -11.021 1.00 0.00  ? 175 LYS A CA     4  
ATOM 6198  C C      . LYS B 2 88  ? -13.935 1.274   -10.155 1.00 0.00  ? 175 LYS A C      4  
ATOM 6199  O O      . LYS B 2 88  ? -14.352 0.123   -10.003 1.00 0.00  ? 175 LYS A O      4  
ATOM 6200  C CB     . LYS B 2 88  ? -14.148 2.668   -12.376 1.00 0.00  ? 175 LYS A CB     4  
ATOM 6201  C CG     . LYS B 2 88  ? -13.102 1.726   -12.962 1.00 0.00  ? 175 LYS A CG     4  
ATOM 6202  C CD     . LYS B 2 88  ? -13.633 0.360   -13.413 1.00 0.00  ? 175 LYS A CD     4  
ATOM 6203  C CE     . LYS B 2 88  ? -12.459 -0.504  -13.897 1.00 0.00  ? 175 LYS A CE     4  
ATOM 6204  N NZ     . LYS B 2 88  ? -12.922 -1.827  -14.390 1.00 0.00  ? 175 LYS A NZ     4  
ATOM 6205  H H      . LYS B 2 88  ? -14.544 4.304   -10.520 1.00 0.00  ? 175 LYS A H      4  
ATOM 6206  H HA     . LYS B 2 88  ? -15.692 1.728   -11.245 1.00 0.00  ? 175 LYS A HA     4  
ATOM 6207  H HB2    . LYS B 2 88  ? -14.953 2.805   -13.099 1.00 0.00  ? 175 LYS A HB2    4  
ATOM 6208  H HB3    . LYS B 2 88  ? -13.657 3.635   -12.269 1.00 0.00  ? 175 LYS A HB3    4  
ATOM 6209  H HG2    . LYS B 2 88  ? -12.655 2.220   -13.823 1.00 0.00  ? 175 LYS A HG2    4  
ATOM 6210  H HG3    . LYS B 2 88  ? -12.327 1.614   -12.213 1.00 0.00  ? 175 LYS A HG3    4  
ATOM 6211  H HD2    . LYS B 2 88  ? -14.139 -0.141  -12.589 1.00 0.00  ? 175 LYS A HD2    4  
ATOM 6212  H HD3    . LYS B 2 88  ? -14.344 0.506   -14.228 1.00 0.00  ? 175 LYS A HD3    4  
ATOM 6213  H HE2    . LYS B 2 88  ? -11.935 0.031   -14.695 1.00 0.00  ? 175 LYS A HE2    4  
ATOM 6214  H HE3    . LYS B 2 88  ? -11.760 -0.642  -13.066 1.00 0.00  ? 175 LYS A HE3    4  
ATOM 6215  H HZ1    . LYS B 2 88  ? -13.399 -2.342  -13.662 1.00 0.00  ? 175 LYS A HZ1    4  
ATOM 6216  H HZ2    . LYS B 2 88  ? -13.554 -1.729  -15.174 1.00 0.00  ? 175 LYS A HZ2    4  
ATOM 6217  H HZ3    . LYS B 2 88  ? -12.138 -2.385  -14.705 1.00 0.00  ? 175 LYS A HZ3    4  
ATOM 6218  N N      . LEU B 2 89  ? -12.795 1.687   -9.580  1.00 0.00  ? 176 LEU A N      4  
ATOM 6219  C CA     . LEU B 2 89  ? -11.890 0.806   -8.850  1.00 0.00  ? 176 LEU A CA     4  
ATOM 6220  C C      . LEU B 2 89  ? -12.402 0.415   -7.453  1.00 0.00  ? 176 LEU A C      4  
ATOM 6221  O O      . LEU B 2 89  ? -12.010 -0.613  -6.902  1.00 0.00  ? 176 LEU A O      4  
ATOM 6222  C CB     . LEU B 2 89  ? -10.517 1.477   -8.754  1.00 0.00  ? 176 LEU A CB     4  
ATOM 6223  C CG     . LEU B 2 89  ? -9.894  2.019   -10.052 1.00 0.00  ? 176 LEU A CG     4  
ATOM 6224  C CD1    . LEU B 2 89  ? -8.531  2.636   -9.788  1.00 0.00  ? 176 LEU A CD1    4  
ATOM 6225  C CD2    . LEU B 2 89  ? -9.716  0.946   -11.126 1.00 0.00  ? 176 LEU A CD2    4  
ATOM 6226  H H      . LEU B 2 89  ? -12.454 2.634   -9.659  1.00 0.00  ? 176 LEU A H      4  
ATOM 6227  H HA     . LEU B 2 89  ? -11.778 -0.111  -9.417  1.00 0.00  ? 176 LEU A HA     4  
ATOM 6228  H HB2    . LEU B 2 89  ? -10.559 2.276   -8.029  1.00 0.00  ? 176 LEU A HB2    4  
ATOM 6229  H HB3    . LEU B 2 89  ? -9.861  0.737   -8.354  1.00 0.00  ? 176 LEU A HB3    4  
ATOM 6230  H HG     . LEU B 2 89  ? -10.519 2.828   -10.408 1.00 0.00  ? 176 LEU A HG     4  
ATOM 6231  H HD11   . LEU B 2 89  ? -8.684  3.504   -9.160  1.00 0.00  ? 176 LEU A HD11   4  
ATOM 6232  H HD12   . LEU B 2 89  ? -7.879  1.928   -9.282  1.00 0.00  ? 176 LEU A HD12   4  
ATOM 6233  H HD13   . LEU B 2 89  ? -8.074  2.958   -10.722 1.00 0.00  ? 176 LEU A HD13   4  
ATOM 6234  H HD21   . LEU B 2 89  ? -8.988  0.210   -10.789 1.00 0.00  ? 176 LEU A HD21   4  
ATOM 6235  H HD22   . LEU B 2 89  ? -10.656 0.438   -11.322 1.00 0.00  ? 176 LEU A HD22   4  
ATOM 6236  H HD23   . LEU B 2 89  ? -9.370  1.409   -12.052 1.00 0.00  ? 176 LEU A HD23   4  
ATOM 6237  N N      . HIS B 2 90  ? -13.319 1.199   -6.890  1.00 0.00  ? 177 HIS A N      4  
ATOM 6238  C CA     . HIS B 2 90  ? -14.107 0.931   -5.685  1.00 0.00  ? 177 HIS A CA     4  
ATOM 6239  C C      . HIS B 2 90  ? -15.174 -0.140  -5.982  1.00 0.00  ? 177 HIS A C      4  
ATOM 6240  O O      . HIS B 2 90  ? -16.375 0.131   -6.050  1.00 0.00  ? 177 HIS A O      4  
ATOM 6241  C CB     . HIS B 2 90  ? -14.670 2.284   -5.221  1.00 0.00  ? 177 HIS A CB     4  
ATOM 6242  C CG     . HIS B 2 90  ? -15.094 2.383   -3.794  1.00 0.00  ? 177 HIS A CG     4  
ATOM 6243  N ND1    . HIS B 2 90  ? -15.135 1.331   -2.887  1.00 0.00  ? 177 HIS A ND1    4  
ATOM 6244  C CD2    . HIS B 2 90  ? -15.139 3.563   -3.122  1.00 0.00  ? 177 HIS A CD2    4  
ATOM 6245  C CE1    . HIS B 2 90  ? -15.199 1.917   -1.686  1.00 0.00  ? 177 HIS A CE1    4  
ATOM 6246  N NE2    . HIS B 2 90  ? -15.221 3.251   -1.786  1.00 0.00  ? 177 HIS A NE2    4  
ATOM 6247  H H      . HIS B 2 90  ? -13.518 2.061   -7.388  1.00 0.00  ? 177 HIS A H      4  
ATOM 6248  H HA     . HIS B 2 90  ? -13.448 0.541   -4.910  1.00 0.00  ? 177 HIS A HA     4  
ATOM 6249  H HB2    . HIS B 2 90  ? -13.879 3.014   -5.316  1.00 0.00  ? 177 HIS A HB2    4  
ATOM 6250  H HB3    . HIS B 2 90  ? -15.474 2.625   -5.856  1.00 0.00  ? 177 HIS A HB3    4  
ATOM 6251  H HD2    . HIS B 2 90  ? -14.940 4.532   -3.559  1.00 0.00  ? 177 HIS A HD2    4  
ATOM 6252  H HE1    . HIS B 2 90  ? -15.081 1.389   -0.765  1.00 0.00  ? 177 HIS A HE1    4  
ATOM 6253  H HE2    . HIS B 2 90  ? -15.134 3.877   -0.984  1.00 0.00  ? 177 HIS A HE2    4  
ATOM 6254  N N      . GLY B 2 91  ? -14.702 -1.357  -6.260  1.00 0.00  ? 178 GLY A N      4  
ATOM 6255  C CA     . GLY B 2 91  ? -15.418 -2.404  -6.998  1.00 0.00  ? 178 GLY A CA     4  
ATOM 6256  C C      . GLY B 2 91  ? -14.570 -3.177  -8.027  1.00 0.00  ? 178 GLY A C      4  
ATOM 6257  O O      . GLY B 2 91  ? -15.109 -4.032  -8.733  1.00 0.00  ? 178 GLY A O      4  
ATOM 6258  H H      . GLY B 2 91  ? -13.706 -1.458  -6.096  1.00 0.00  ? 178 GLY A H      4  
ATOM 6259  H HA2    . GLY B 2 91  ? -15.832 -3.121  -6.288  1.00 0.00  ? 178 GLY A HA2    4  
ATOM 6260  H HA3    . GLY B 2 91  ? -16.251 -1.957  -7.542  1.00 0.00  ? 178 GLY A HA3    4  
ATOM 6261  N N      . THR B 2 92  ? -13.259 -2.918  -8.128  1.00 0.00  ? 179 THR A N      4  
ATOM 6262  C CA     . THR B 2 92  ? -12.303 -3.692  -8.940  1.00 0.00  ? 179 THR A CA     4  
ATOM 6263  C C      . THR B 2 92  ? -12.040 -4.993  -8.207  1.00 0.00  ? 179 THR A C      4  
ATOM 6264  O O      . THR B 2 92  ? -11.425 -4.968  -7.141  1.00 0.00  ? 179 THR A O      4  
ATOM 6265  C CB     . THR B 2 92  ? -11.004 -2.894  -9.195  1.00 0.00  ? 179 THR A CB     4  
ATOM 6266  O OG1    . THR B 2 92  ? -11.169 -2.193  -10.408 1.00 0.00  ? 179 THR A OG1    4  
ATOM 6267  C CG2    . THR B 2 92  ? -9.676  -3.648  -9.348  1.00 0.00  ? 179 THR A CG2    4  
ATOM 6268  H H      . THR B 2 92  ? -12.846 -2.298  -7.442  1.00 0.00  ? 179 THR A H      4  
ATOM 6269  H HA     . THR B 2 92  ? -12.753 -3.931  -9.904  1.00 0.00  ? 179 THR A HA     4  
ATOM 6270  H HB     . THR B 2 92  ? -10.859 -2.179  -8.389  1.00 0.00  ? 179 THR A HB     4  
ATOM 6271  H HG1    . THR B 2 92  ? -11.055 -2.828  -11.134 1.00 0.00  ? 179 THR A HG1    4  
ATOM 6272  H HG21   . THR B 2 92  ? -9.395  -4.155  -8.426  1.00 0.00  ? 179 THR A HG21   4  
ATOM 6273  H HG22   . THR B 2 92  ? -9.735  -4.377  -10.152 1.00 0.00  ? 179 THR A HG22   4  
ATOM 6274  H HG23   . THR B 2 92  ? -8.903  -2.909  -9.565  1.00 0.00  ? 179 THR A HG23   4  
ATOM 6275  N N      . VAL B 2 93  ? -12.548 -6.112  -8.745  1.00 0.00  ? 180 VAL A N      4  
ATOM 6276  C CA     . VAL B 2 93  ? -12.203 -7.449  -8.251  1.00 0.00  ? 180 VAL A CA     4  
ATOM 6277  C C      . VAL B 2 93  ? -10.810 -7.827  -8.763  1.00 0.00  ? 180 VAL A C      4  
ATOM 6278  O O      . VAL B 2 93  ? -10.599 -8.045  -9.957  1.00 0.00  ? 180 VAL A O      4  
ATOM 6279  C CB     . VAL B 2 93  ? -13.249 -8.538  -8.541  1.00 0.00  ? 180 VAL A CB     4  
ATOM 6280  C CG1    . VAL B 2 93  ? -12.913 -9.875  -7.864  1.00 0.00  ? 180 VAL A CG1    4  
ATOM 6281  C CG2    . VAL B 2 93  ? -14.632 -8.103  -8.032  1.00 0.00  ? 180 VAL A CG2    4  
ATOM 6282  H H      . VAL B 2 93  ? -13.113 -6.028  -9.579  1.00 0.00  ? 180 VAL A H      4  
ATOM 6283  H HA     . VAL B 2 93  ? -12.183 -7.338  -7.181  1.00 0.00  ? 180 VAL A HA     4  
ATOM 6284  H HB     . VAL B 2 93  ? -13.280 -8.719  -9.607  1.00 0.00  ? 180 VAL A HB     4  
ATOM 6285  H HG11   . VAL B 2 93  ? -11.921 -10.218 -8.159  1.00 0.00  ? 180 VAL A HG11   4  
ATOM 6286  H HG12   . VAL B 2 93  ? -12.957 -9.777  -6.779  1.00 0.00  ? 180 VAL A HG12   4  
ATOM 6287  H HG13   . VAL B 2 93  ? -13.637 -10.630 -8.173  1.00 0.00  ? 180 VAL A HG13   4  
ATOM 6288  H HG21   . VAL B 2 93  ? -14.580 -7.884  -6.961  1.00 0.00  ? 180 VAL A HG21   4  
ATOM 6289  H HG22   . VAL B 2 93  ? -14.964 -7.209  -8.557  1.00 0.00  ? 180 VAL A HG22   4  
ATOM 6290  H HG23   . VAL B 2 93  ? -15.358 -8.901  -8.201  1.00 0.00  ? 180 VAL A HG23   4  
ATOM 6291  N N      . VAL B 2 94  ? -9.842  -7.789  -7.854  1.00 0.00  ? 181 VAL A N      4  
ATOM 6292  C CA     . VAL B 2 94  ? -8.395  -7.718  -8.096  1.00 0.00  ? 181 VAL A CA     4  
ATOM 6293  C C      . VAL B 2 94  ? -7.786  -9.087  -8.394  1.00 0.00  ? 181 VAL A C      4  
ATOM 6294  O O      . VAL B 2 94  ? -7.357  -9.352  -9.516  1.00 0.00  ? 181 VAL A O      4  
ATOM 6295  C CB     . VAL B 2 94  ? -7.676  -7.037  -6.903  1.00 0.00  ? 181 VAL A CB     4  
ATOM 6296  C CG1    . VAL B 2 94  ? -6.455  -6.259  -7.364  1.00 0.00  ? 181 VAL A CG1    4  
ATOM 6297  C CG2    . VAL B 2 94  ? -8.537  -6.101  -6.058  1.00 0.00  ? 181 VAL A CG2    4  
ATOM 6298  H H      . VAL B 2 94  ? -10.180 -7.636  -6.911  1.00 0.00  ? 181 VAL A H      4  
ATOM 6299  H HA     . VAL B 2 94  ? -8.225  -7.123  -8.988  1.00 0.00  ? 181 VAL A HA     4  
ATOM 6300  H HB     . VAL B 2 94  ? -7.338  -7.785  -6.210  1.00 0.00  ? 181 VAL A HB     4  
ATOM 6301  H HG11   . VAL B 2 94  ? -5.750  -6.937  -7.844  1.00 0.00  ? 181 VAL A HG11   4  
ATOM 6302  H HG12   . VAL B 2 94  ? -6.759  -5.469  -8.053  1.00 0.00  ? 181 VAL A HG12   4  
ATOM 6303  H HG13   . VAL B 2 94  ? -5.985  -5.801  -6.495  1.00 0.00  ? 181 VAL A HG13   4  
ATOM 6304  H HG21   . VAL B 2 94  ? -9.012  -5.382  -6.711  1.00 0.00  ? 181 VAL A HG21   4  
ATOM 6305  H HG22   . VAL B 2 94  ? -9.300  -6.656  -5.524  1.00 0.00  ? 181 VAL A HG22   4  
ATOM 6306  H HG23   . VAL B 2 94  ? -7.925  -5.589  -5.317  1.00 0.00  ? 181 VAL A HG23   4  
ATOM 6307  N N      . GLU B 2 95  ? -7.757  -9.961  -7.387  1.00 0.00  ? 182 GLU A N      4  
ATOM 6308  C CA     . GLU B 2 95  ? -7.076  -11.263 -7.391  1.00 0.00  ? 182 GLU A CA     4  
ATOM 6309  C C      . GLU B 2 95  ? -7.977  -12.366 -6.790  1.00 0.00  ? 182 GLU A C      4  
ATOM 6310  O O      . GLU B 2 95  ? -7.504  -13.352 -6.219  1.00 0.00  ? 182 GLU A O      4  
ATOM 6311  C CB     . GLU B 2 95  ? -5.742  -11.137 -6.620  1.00 0.00  ? 182 GLU A CB     4  
ATOM 6312  C CG     . GLU B 2 95  ? -4.666  -10.228 -7.235  1.00 0.00  ? 182 GLU A CG     4  
ATOM 6313  C CD     . GLU B 2 95  ? -4.065  -10.793 -8.543  1.00 0.00  ? 182 GLU A CD     4  
ATOM 6314  O OE1    . GLU B 2 95  ? -3.581  -11.952 -8.543  1.00 0.00  ? 182 GLU A OE1    4  
ATOM 6315  O OE2    . GLU B 2 95  ? -4.023  -10.069 -9.564  1.00 0.00  ? 182 GLU A OE2    4  
ATOM 6316  H H      . GLU B 2 95  ? -8.140  -9.647  -6.509  1.00 0.00  ? 182 GLU A H      4  
ATOM 6317  H HA     . GLU B 2 95  ? -6.884  -11.540 -8.424  1.00 0.00  ? 182 GLU A HA     4  
ATOM 6318  H HB2    . GLU B 2 95  ? -5.964  -10.775 -5.617  1.00 0.00  ? 182 GLU A HB2    4  
ATOM 6319  H HB3    . GLU B 2 95  ? -5.301  -12.123 -6.509  1.00 0.00  ? 182 GLU A HB3    4  
ATOM 6320  H HG2    . GLU B 2 95  ? -5.085  -9.234  -7.402  1.00 0.00  ? 182 GLU A HG2    4  
ATOM 6321  H HG3    . GLU B 2 95  ? -3.863  -10.127 -6.495  1.00 0.00  ? 182 GLU A HG3    4  
ATOM 6322  N N      . GLY B 2 96  ? -9.294  -12.154 -6.848  1.00 0.00  ? 183 GLY A N      4  
ATOM 6323  C CA     . GLY B 2 96  ? -10.275 -12.779 -5.955  1.00 0.00  ? 183 GLY A CA     4  
ATOM 6324  C C      . GLY B 2 96  ? -10.402 -12.011 -4.629  1.00 0.00  ? 183 GLY A C      4  
ATOM 6325  O O      . GLY B 2 96  ? -10.426 -12.599 -3.546  1.00 0.00  ? 183 GLY A O      4  
ATOM 6326  H H      . GLY B 2 96  ? -9.593  -11.386 -7.437  1.00 0.00  ? 183 GLY A H      4  
ATOM 6327  H HA2    . GLY B 2 96  ? -11.240 -12.773 -6.457  1.00 0.00  ? 183 GLY A HA2    4  
ATOM 6328  H HA3    . GLY B 2 96  ? -10.005 -13.814 -5.747  1.00 0.00  ? 183 GLY A HA3    4  
ATOM 6329  N N      . ARG B 2 97  ? -10.431 -10.676 -4.731  1.00 0.00  ? 184 ARG A N      4  
ATOM 6330  C CA     . ARG B 2 97  ? -10.469 -9.638  -3.691  1.00 0.00  ? 184 ARG A CA     4  
ATOM 6331  C C      . ARG B 2 97  ? -11.172 -8.434  -4.312  1.00 0.00  ? 184 ARG A C      4  
ATOM 6332  O O      . ARG B 2 97  ? -11.239 -8.403  -5.529  1.00 0.00  ? 184 ARG A O      4  
ATOM 6333  C CB     . ARG B 2 97  ? -9.016  -9.250  -3.372  1.00 0.00  ? 184 ARG A CB     4  
ATOM 6334  C CG     . ARG B 2 97  ? -8.856  -8.648  -1.979  1.00 0.00  ? 184 ARG A CG     4  
ATOM 6335  C CD     . ARG B 2 97  ? -8.853  -9.697  -0.862  1.00 0.00  ? 184 ARG A CD     4  
ATOM 6336  N NE     . ARG B 2 97  ? -9.015  -9.059  0.456   1.00 0.00  ? 184 ARG A NE     4  
ATOM 6337  C CZ     . ARG B 2 97  ? -9.129  -9.674  1.620   1.00 0.00  ? 184 ARG A CZ     4  
ATOM 6338  N NH1    . ARG B 2 97  ? -8.943  -10.957 1.747   1.00 0.00  ? 184 ARG A NH1    4  
ATOM 6339  N NH2    . ARG B 2 97  ? -9.427  -9.005  2.692   1.00 0.00  ? 184 ARG A NH2    4  
ATOM 6340  H H      . ARG B 2 97  ? -10.551 -10.263 -5.650  1.00 0.00  ? 184 ARG A H      4  
ATOM 6341  H HA     . ARG B 2 97  ? -11.014 -9.989  -2.811  1.00 0.00  ? 184 ARG A HA     4  
ATOM 6342  H HB2    . ARG B 2 97  ? -8.344  -10.096 -3.483  1.00 0.00  ? 184 ARG A HB2    4  
ATOM 6343  H HB3    . ARG B 2 97  ? -8.683  -8.513  -4.103  1.00 0.00  ? 184 ARG A HB3    4  
ATOM 6344  H HG2    . ARG B 2 97  ? -7.906  -8.133  -1.972  1.00 0.00  ? 184 ARG A HG2    4  
ATOM 6345  H HG3    . ARG B 2 97  ? -9.641  -7.911  -1.807  1.00 0.00  ? 184 ARG A HG3    4  
ATOM 6346  H HD2    . ARG B 2 97  ? -9.674  -10.400 -1.023  1.00 0.00  ? 184 ARG A HD2    4  
ATOM 6347  H HD3    . ARG B 2 97  ? -7.910  -10.247 -0.901  1.00 0.00  ? 184 ARG A HD3    4  
ATOM 6348  H HE     . ARG B 2 97  ? -9.090  -8.048  0.472   1.00 0.00  ? 184 ARG A HE     4  
ATOM 6349  H HH11   . ARG B 2 97  ? -8.688  -11.491 0.934   1.00 0.00  ? 184 ARG A HH11   4  
ATOM 6350  H HH12   . ARG B 2 97  ? -9.018  -11.412 2.642   1.00 0.00  ? 184 ARG A HH12   4  
ATOM 6351  H HH21   . ARG B 2 97  ? -9.732  -8.040  2.600   1.00 0.00  ? 184 ARG A HH21   4  
ATOM 6352  H HH22   . ARG B 2 97  ? -9.541  -9.472  3.574   1.00 0.00  ? 184 ARG A HH22   4  
ATOM 6353  N N      . LYS B 2 98  ? -11.567 -7.394  -3.581  1.00 0.00  ? 185 LYS A N      4  
ATOM 6354  C CA     . LYS B 2 98  ? -12.096 -6.136  -4.155  1.00 0.00  ? 185 LYS A CA     4  
ATOM 6355  C C      . LYS B 2 98  ? -11.497 -4.889  -3.491  1.00 0.00  ? 185 LYS A C      4  
ATOM 6356  O O      . LYS B 2 98  ? -11.593 -4.767  -2.268  1.00 0.00  ? 185 LYS A O      4  
ATOM 6357  C CB     . LYS B 2 98  ? -13.637 -6.201  -4.143  1.00 0.00  ? 185 LYS A CB     4  
ATOM 6358  C CG     . LYS B 2 98  ? -14.352 -4.931  -4.641  1.00 0.00  ? 185 LYS A CG     4  
ATOM 6359  C CD     . LYS B 2 98  ? -14.870 -4.027  -3.508  1.00 0.00  ? 185 LYS A CD     4  
ATOM 6360  C CE     . LYS B 2 98  ? -16.105 -4.646  -2.828  1.00 0.00  ? 185 LYS A CE     4  
ATOM 6361  N NZ     . LYS B 2 98  ? -16.742 -3.721  -1.851  1.00 0.00  ? 185 LYS A NZ     4  
ATOM 6362  H H      . LYS B 2 98  ? -11.462 -7.502  -2.587  1.00 0.00  ? 185 LYS A H      4  
ATOM 6363  H HA     . LYS B 2 98  ? -11.791 -6.078  -5.194  1.00 0.00  ? 185 LYS A HA     4  
ATOM 6364  H HB2    . LYS B 2 98  ? -13.931 -7.023  -4.798  1.00 0.00  ? 185 LYS A HB2    4  
ATOM 6365  H HB3    . LYS B 2 98  ? -13.988 -6.461  -3.146  1.00 0.00  ? 185 LYS A HB3    4  
ATOM 6366  H HG2    . LYS B 2 98  ? -13.686 -4.371  -5.294  1.00 0.00  ? 185 LYS A HG2    4  
ATOM 6367  H HG3    . LYS B 2 98  ? -15.206 -5.239  -5.248  1.00 0.00  ? 185 LYS A HG3    4  
ATOM 6368  H HD2    . LYS B 2 98  ? -14.084 -3.859  -2.769  1.00 0.00  ? 185 LYS A HD2    4  
ATOM 6369  H HD3    . LYS B 2 98  ? -15.150 -3.066  -3.941  1.00 0.00  ? 185 LYS A HD3    4  
ATOM 6370  H HE2    . LYS B 2 98  ? -16.831 -4.911  -3.602  1.00 0.00  ? 185 LYS A HE2    4  
ATOM 6371  H HE3    . LYS B 2 98  ? -15.814 -5.572  -2.325  1.00 0.00  ? 185 LYS A HE3    4  
ATOM 6372  H HZ1    . LYS B 2 98  ? -16.142 -3.525  -1.048  1.00 0.00  ? 185 LYS A HZ1    4  
ATOM 6373  H HZ2    . LYS B 2 98  ? -16.986 -2.838  -2.277  1.00 0.00  ? 185 LYS A HZ2    4  
ATOM 6374  H HZ3    . LYS B 2 98  ? -17.589 -4.127  -1.473  1.00 0.00  ? 185 LYS A HZ3    4  
ATOM 6375  N N      . ILE B 2 99  ? -10.875 -3.989  -4.270  1.00 0.00  ? 186 ILE A N      4  
ATOM 6376  C CA     . ILE B 2 99  ? -10.371 -2.702  -3.723  1.00 0.00  ? 186 ILE A CA     4  
ATOM 6377  C C      . ILE B 2 99  ? -11.553 -1.818  -3.290  1.00 0.00  ? 186 ILE A C      4  
ATOM 6378  O O      . ILE B 2 99  ? -12.576 -1.753  -3.971  1.00 0.00  ? 186 ILE A O      4  
ATOM 6379  C CB     . ILE B 2 99  ? -9.445  -1.909  -4.692  1.00 0.00  ? 186 ILE A CB     4  
ATOM 6380  C CG1    . ILE B 2 99  ? -8.327  -2.788  -5.279  1.00 0.00  ? 186 ILE A CG1    4  
ATOM 6381  C CG2    . ILE B 2 99  ? -8.836  -0.693  -3.969  1.00 0.00  ? 186 ILE A CG2    4  
ATOM 6382  C CD1    . ILE B 2 99  ? -7.153  -2.069  -5.960  1.00 0.00  ? 186 ILE A CD1    4  
ATOM 6383  H H      . ILE B 2 99  ? -10.874 -4.156  -5.269  1.00 0.00  ? 186 ILE A H      4  
ATOM 6384  H HA     . ILE B 2 99  ? -9.782  -2.933  -2.833  1.00 0.00  ? 186 ILE A HA     4  
ATOM 6385  H HB     . ILE B 2 99  ? -10.042 -1.536  -5.520  1.00 0.00  ? 186 ILE A HB     4  
ATOM 6386  H HG12   . ILE B 2 99  ? -7.913  -3.419  -4.496  1.00 0.00  ? 186 ILE A HG12   4  
ATOM 6387  H HG13   . ILE B 2 99  ? -8.791  -3.409  -6.035  1.00 0.00  ? 186 ILE A HG13   4  
ATOM 6388  H HG21   . ILE B 2 99  ? -9.619  -0.041  -3.598  1.00 0.00  ? 186 ILE A HG21   4  
ATOM 6389  H HG22   . ILE B 2 99  ? -8.225  -1.014  -3.129  1.00 0.00  ? 186 ILE A HG22   4  
ATOM 6390  H HG23   . ILE B 2 99  ? -8.235  -0.099  -4.655  1.00 0.00  ? 186 ILE A HG23   4  
ATOM 6391  H HD11   . ILE B 2 99  ? -7.530  -1.329  -6.663  1.00 0.00  ? 186 ILE A HD11   4  
ATOM 6392  H HD12   . ILE B 2 99  ? -6.520  -1.590  -5.213  1.00 0.00  ? 186 ILE A HD12   4  
ATOM 6393  H HD13   . ILE B 2 99  ? -6.550  -2.798  -6.504  1.00 0.00  ? 186 ILE A HD13   4  
ATOM 6394  N N      . GLU B 2 100 ? -11.388 -1.102  -2.178  1.00 0.00  ? 187 GLU A N      4  
ATOM 6395  C CA     . GLU B 2 100 ? -12.336 -0.116  -1.652  1.00 0.00  ? 187 GLU A CA     4  
ATOM 6396  C C      . GLU B 2 100 ? -11.681 1.273   -1.556  1.00 0.00  ? 187 GLU A C      4  
ATOM 6397  O O      . GLU B 2 100 ? -10.930 1.529   -0.611  1.00 0.00  ? 187 GLU A O      4  
ATOM 6398  C CB     . GLU B 2 100 ? -12.891 -0.593  -0.295  1.00 0.00  ? 187 GLU A CB     4  
ATOM 6399  C CG     . GLU B 2 100 ? -13.593 -1.947  -0.439  1.00 0.00  ? 187 GLU A CG     4  
ATOM 6400  C CD     . GLU B 2 100 ? -14.461 -2.336  0.770   1.00 0.00  ? 187 GLU A CD     4  
ATOM 6401  O OE1    . GLU B 2 100 ? -14.060 -2.110  1.938   1.00 0.00  ? 187 GLU A OE1    4  
ATOM 6402  O OE2    . GLU B 2 100 ? -15.550 -2.913  0.535   1.00 0.00  ? 187 GLU A OE2    4  
ATOM 6403  H H      . GLU B 2 100 ? -10.533 -1.268  -1.658  1.00 0.00  ? 187 GLU A H      4  
ATOM 6404  H HA     . GLU B 2 100 ? -13.176 -0.035  -2.338  1.00 0.00  ? 187 GLU A HA     4  
ATOM 6405  H HB2    . GLU B 2 100 ? -12.080 -0.691  0.423   1.00 0.00  ? 187 GLU A HB2    4  
ATOM 6406  H HB3    . GLU B 2 100 ? -13.595 0.148   0.084   1.00 0.00  ? 187 GLU A HB3    4  
ATOM 6407  H HG2    . GLU B 2 100 ? -14.226 -1.899  -1.329  1.00 0.00  ? 187 GLU A HG2    4  
ATOM 6408  H HG3    . GLU B 2 100 ? -12.833 -2.715  -0.585  1.00 0.00  ? 187 GLU A HG3    4  
ATOM 6409  N N      . VAL B 2 101 ? -11.913 2.158   -2.543  1.00 0.00  ? 188 VAL A N      4  
ATOM 6410  C CA     . VAL B 2 101 ? -11.220 3.463   -2.643  1.00 0.00  ? 188 VAL A CA     4  
ATOM 6411  C C      . VAL B 2 101 ? -12.031 4.627   -2.058  1.00 0.00  ? 188 VAL A C      4  
ATOM 6412  O O      . VAL B 2 101 ? -12.842 5.278   -2.717  1.00 0.00  ? 188 VAL A O      4  
ATOM 6413  C CB     . VAL B 2 101 ? -10.526 3.757   -4.003  1.00 0.00  ? 188 VAL A CB     4  
ATOM 6414  C CG1    . VAL B 2 101 ? -9.995  2.503   -4.705  1.00 0.00  ? 188 VAL A CG1    4  
ATOM 6415  C CG2    . VAL B 2 101 ? -11.229 4.629   -5.010  1.00 0.00  ? 188 VAL A CG2    4  
ATOM 6416  H H      . VAL B 2 101 ? -12.585 1.914   -3.259  1.00 0.00  ? 188 VAL A H      4  
ATOM 6417  H HA     . VAL B 2 101 ? -10.393 3.357   -1.961  1.00 0.00  ? 188 VAL A HA     4  
ATOM 6418  H HB     . VAL B 2 101 ? -9.683  4.399   -3.806  1.00 0.00  ? 188 VAL A HB     4  
ATOM 6419  H HG11   . VAL B 2 101 ? -9.227  2.055   -4.079  1.00 0.00  ? 188 VAL A HG11   4  
ATOM 6420  H HG12   . VAL B 2 101 ? -10.792 1.785   -4.889  1.00 0.00  ? 188 VAL A HG12   4  
ATOM 6421  H HG13   . VAL B 2 101 ? -9.547  2.755   -5.665  1.00 0.00  ? 188 VAL A HG13   4  
ATOM 6422  H HG21   . VAL B 2 101 ? -12.168 4.185   -5.303  1.00 0.00  ? 188 VAL A HG21   4  
ATOM 6423  H HG22   . VAL B 2 101 ? -11.384 5.615   -4.564  1.00 0.00  ? 188 VAL A HG22   4  
ATOM 6424  H HG23   . VAL B 2 101 ? -10.572 4.765   -5.867  1.00 0.00  ? 188 VAL A HG23   4  
ATOM 6425  N N      . ASN B 2 102 ? -11.850 4.890   -0.771  1.00 0.00  ? 189 ASN A N      4  
ATOM 6426  C CA     . ASN B 2 102 ? -12.458 6.056   -0.129  1.00 0.00  ? 189 ASN A CA     4  
ATOM 6427  C C      . ASN B 2 102 ? -11.562 7.287   -0.304  1.00 0.00  ? 189 ASN A C      4  
ATOM 6428  O O      . ASN B 2 102 ? -10.338 7.183   -0.378  1.00 0.00  ? 189 ASN A O      4  
ATOM 6429  C CB     . ASN B 2 102 ? -12.661 5.779   1.362   1.00 0.00  ? 189 ASN A CB     4  
ATOM 6430  C CG     . ASN B 2 102 ? -13.735 4.751   1.675   1.00 0.00  ? 189 ASN A CG     4  
ATOM 6431  O OD1    . ASN B 2 102 ? -14.477 4.269   0.825   1.00 0.00  ? 189 ASN A OD1    4  
ATOM 6432  N ND2    . ASN B 2 102 ? -13.880 4.418   2.936   1.00 0.00  ? 189 ASN A ND2    4  
ATOM 6433  H H      . ASN B 2 102 ? -11.061 4.427   -0.330  1.00 0.00  ? 189 ASN A H      4  
ATOM 6434  H HA     . ASN B 2 102 ? -13.430 6.272   -0.573  1.00 0.00  ? 189 ASN A HA     4  
ATOM 6435  H HB2    . ASN B 2 102 ? -11.713 5.458   1.791   1.00 0.00  ? 189 ASN A HB2    4  
ATOM 6436  H HB3    . ASN B 2 102 ? -12.944 6.708   1.857   1.00 0.00  ? 189 ASN A HB3    4  
ATOM 6437  H HD21   . ASN B 2 102 ? -13.299 4.900   3.616   1.00 0.00  ? 189 ASN A HD21   4  
ATOM 6438  H HD22   . ASN B 2 102 ? -14.597 3.761   3.200   1.00 0.00  ? 189 ASN A HD22   4  
ATOM 6439  N N      . ASN B 2 103 ? -12.155 8.480   -0.257  1.00 0.00  ? 190 ASN A N      4  
ATOM 6440  C CA     . ASN B 2 103 ? -11.360 9.681   -0.015  1.00 0.00  ? 190 ASN A CA     4  
ATOM 6441  C C      . ASN B 2 103 ? -10.736 9.631   1.401   1.00 0.00  ? 190 ASN A C      4  
ATOM 6442  O O      . ASN B 2 103 ? -11.120 8.813   2.249   1.00 0.00  ? 190 ASN A O      4  
ATOM 6443  C CB     . ASN B 2 103 ? -12.198 10.954  -0.223  1.00 0.00  ? 190 ASN A CB     4  
ATOM 6444  C CG     . ASN B 2 103 ? -13.464 10.992  0.615   1.00 0.00  ? 190 ASN A CG     4  
ATOM 6445  O OD1    . ASN B 2 103 ? -14.504 10.478  0.224   1.00 0.00  ? 190 ASN A OD1    4  
ATOM 6446  N ND2    . ASN B 2 103 ? -13.429 11.595  1.782   1.00 0.00  ? 190 ASN A ND2    4  
ATOM 6447  H H      . ASN B 2 103 ? -13.152 8.500   -0.110  1.00 0.00  ? 190 ASN A H      4  
ATOM 6448  H HA     . ASN B 2 103 ? -10.556 9.666   -0.761  1.00 0.00  ? 190 ASN A HA     4  
ATOM 6449  H HB2    . ASN B 2 103 ? -11.597 11.833  0.003   1.00 0.00  ? 190 ASN A HB2    4  
ATOM 6450  H HB3    . ASN B 2 103 ? -12.477 11.027  -1.270  1.00 0.00  ? 190 ASN A HB3    4  
ATOM 6451  H HD21   . ASN B 2 103 ? -12.594 12.049  2.121   1.00 0.00  ? 190 ASN A HD21   4  
ATOM 6452  H HD22   . ASN B 2 103 ? -14.289 11.617  2.305   1.00 0.00  ? 190 ASN A HD22   4  
ATOM 6453  N N      . ALA B 2 104 ? -9.770  10.506  1.677   1.00 0.00  ? 191 ALA A N      4  
ATOM 6454  C CA     . ALA B 2 104 ? -9.054  10.456  2.944   1.00 0.00  ? 191 ALA A CA     4  
ATOM 6455  C C      . ALA B 2 104 ? -9.577  11.410  4.020   1.00 0.00  ? 191 ALA A C      4  
ATOM 6456  O O      . ALA B 2 104 ? -9.862  12.587  3.779   1.00 0.00  ? 191 ALA A O      4  
ATOM 6457  C CB     . ALA B 2 104 ? -7.572  10.663  2.696   1.00 0.00  ? 191 ALA A CB     4  
ATOM 6458  H H      . ALA B 2 104 ? -9.456  11.156  0.967   1.00 0.00  ? 191 ALA A H      4  
ATOM 6459  H HA     . ALA B 2 104 ? -9.145  9.451   3.342   1.00 0.00  ? 191 ALA A HA     4  
ATOM 6460  H HB1    . ALA B 2 104 ? -7.240  9.858   2.040   1.00 0.00  ? 191 ALA A HB1    4  
ATOM 6461  H HB2    . ALA B 2 104 ? -7.395  11.631  2.230   1.00 0.00  ? 191 ALA A HB2    4  
ATOM 6462  H HB3    . ALA B 2 104 ? -7.039  10.606  3.649   1.00 0.00  ? 191 ALA A HB3    4  
ATOM 6463  N N      . THR B 2 105 ? -9.581  10.902  5.250   1.00 0.00  ? 192 THR A N      4  
ATOM 6464  C CA     . THR B 2 105 ? -9.381  11.667  6.482   1.00 0.00  ? 192 THR A CA     4  
ATOM 6465  C C      . THR B 2 105 ? -7.884  11.978  6.590   1.00 0.00  ? 192 THR A C      4  
ATOM 6466  O O      . THR B 2 105 ? -7.084  11.156  7.046   1.00 0.00  ? 192 THR A O      4  
ATOM 6467  C CB     . THR B 2 105 ? -9.895  10.864  7.690   1.00 0.00  ? 192 THR A CB     4  
ATOM 6468  O OG1    . THR B 2 105 ? -9.609  9.489   7.584   1.00 0.00  ? 192 THR A OG1    4  
ATOM 6469  C CG2    . THR B 2 105 ? -11.415 10.901  7.758   1.00 0.00  ? 192 THR A CG2    4  
ATOM 6470  H H      . THR B 2 105 ? -9.337  9.922   5.346   1.00 0.00  ? 192 THR A H      4  
ATOM 6471  H HA     . THR B 2 105 ? -9.922  12.615  6.438   1.00 0.00  ? 192 THR A HA     4  
ATOM 6472  H HB     . THR B 2 105 ? -9.476  11.263  8.614   1.00 0.00  ? 192 THR A HB     4  
ATOM 6473  H HG1    . THR B 2 105 ? -10.240 9.021   8.156   1.00 0.00  ? 192 THR A HG1    4  
ATOM 6474  H HG21   . THR B 2 105 ? -11.764 11.930  7.811   1.00 0.00  ? 192 THR A HG21   4  
ATOM 6475  H HG22   . THR B 2 105 ? -11.826 10.415  6.873   1.00 0.00  ? 192 THR A HG22   4  
ATOM 6476  H HG23   . THR B 2 105 ? -11.747 10.364  8.648   1.00 0.00  ? 192 THR A HG23   4  
ATOM 6477  N N      . ALA B 2 106 ? -7.437  13.111  6.044   1.00 0.00  ? 193 ALA A N      4  
ATOM 6478  C CA     . ALA B 2 106 ? -5.999  13.351  5.939   1.00 0.00  ? 193 ALA A CA     4  
ATOM 6479  C C      . ALA B 2 106 ? -5.312  13.579  7.305   1.00 0.00  ? 193 ALA A C      4  
ATOM 6480  O O      . ALA B 2 106 ? -5.927  14.084  8.248   1.00 0.00  ? 193 ALA A O      4  
ATOM 6481  C CB     . ALA B 2 106 ? -5.677  14.402  4.901   1.00 0.00  ? 193 ALA A CB     4  
ATOM 6482  H H      . ALA B 2 106 ? -8.087  13.763  5.627   1.00 0.00  ? 193 ALA A H      4  
ATOM 6483  H HA     . ALA B 2 106 ? -5.592  12.447  5.509   1.00 0.00  ? 193 ALA A HA     4  
ATOM 6484  H HB1    . ALA B 2 106 ? -6.143  14.108  3.964   1.00 0.00  ? 193 ALA A HB1    4  
ATOM 6485  H HB2    . ALA B 2 106 ? -6.014  15.388  5.223   1.00 0.00  ? 193 ALA A HB2    4  
ATOM 6486  H HB3    . ALA B 2 106 ? -4.598  14.371  4.767   1.00 0.00  ? 193 ALA A HB3    4  
ATOM 6487  N N      . ARG B 2 107 ? -4.048  13.139  7.421   1.00 0.00  ? 194 ARG A N      4  
ATOM 6488  C CA     . ARG B 2 107 ? -3.431  12.819  8.725   1.00 0.00  ? 194 ARG A CA     4  
ATOM 6489  C C      . ARG B 2 107 ? -3.057  14.046  9.578   1.00 0.00  ? 194 ARG A C      4  
ATOM 6490  O O      . ARG B 2 107 ? -2.958  13.918  10.797  1.00 0.00  ? 194 ARG A O      4  
ATOM 6491  C CB     . ARG B 2 107 ? -2.240  11.849  8.546   1.00 0.00  ? 194 ARG A CB     4  
ATOM 6492  C CG     . ARG B 2 107 ? -2.203  10.818  9.682   1.00 0.00  ? 194 ARG A CG     4  
ATOM 6493  C CD     . ARG B 2 107 ? -1.072  9.801   9.506   1.00 0.00  ? 194 ARG A CD     4  
ATOM 6494  N NE     . ARG B 2 107 ? -1.268  8.679   10.436  1.00 0.00  ? 194 ARG A NE     4  
ATOM 6495  C CZ     . ARG B 2 107 ? -0.409  7.779   10.865  1.00 0.00  ? 194 ARG A CZ     4  
ATOM 6496  N NH1    . ARG B 2 107 ? 0.813   7.705   10.427  1.00 0.00  ? 194 ARG A NH1    4  
ATOM 6497  N NH2    . ARG B 2 107 ? -0.810  6.911   11.743  1.00 0.00  ? 194 ARG A NH2    4  
ATOM 6498  H H      . ARG B 2 107 ? -3.598  12.812  6.572   1.00 0.00  ? 194 ARG A H      4  
ATOM 6499  H HA     . ARG B 2 107 ? -4.199  12.287  9.290   1.00 0.00  ? 194 ARG A HA     4  
ATOM 6500  H HB2    . ARG B 2 107 ? -2.342  11.303  7.611   1.00 0.00  ? 194 ARG A HB2    4  
ATOM 6501  H HB3    . ARG B 2 107 ? -1.295  12.390  8.514   1.00 0.00  ? 194 ARG A HB3    4  
ATOM 6502  H HG2    . ARG B 2 107 ? -2.077  11.324  10.641  1.00 0.00  ? 194 ARG A HG2    4  
ATOM 6503  H HG3    . ARG B 2 107 ? -3.155  10.282  9.693   1.00 0.00  ? 194 ARG A HG3    4  
ATOM 6504  H HD2    . ARG B 2 107 ? -1.077  9.435   8.481   1.00 0.00  ? 194 ARG A HD2    4  
ATOM 6505  H HD3    . ARG B 2 107 ? -0.115  10.292  9.699   1.00 0.00  ? 194 ARG A HD3    4  
ATOM 6506  H HE     . ARG B 2 107 ? -2.221  8.502   10.757  1.00 0.00  ? 194 ARG A HE     4  
ATOM 6507  H HH11   . ARG B 2 107 ? 0.990   8.179   9.552   1.00 0.00  ? 194 ARG A HH11   4  
ATOM 6508  H HH12   . ARG B 2 107 ? 1.402   6.934   10.698  1.00 0.00  ? 194 ARG A HH12   4  
ATOM 6509  H HH21   . ARG B 2 107 ? -1.797  6.932   11.968  1.00 0.00  ? 194 ARG A HH21   4  
ATOM 6510  H HH22   . ARG B 2 107 ? -0.206  6.185   12.088  1.00 0.00  ? 194 ARG A HH22   4  
ATOM 6511  N N      . VAL B 2 108 ? -2.929  15.207  8.926   1.00 0.00  ? 195 VAL A N      4  
ATOM 6512  C CA     . VAL B 2 108 ? -2.630  16.568  9.436   1.00 0.00  ? 195 VAL A CA     4  
ATOM 6513  C C      . VAL B 2 108 ? -1.383  16.677  10.345  1.00 0.00  ? 195 VAL A C      4  
ATOM 6514  O O      . VAL B 2 108 ? -0.684  15.692  10.603  1.00 0.00  ? 195 VAL A O      4  
ATOM 6515  C CB     . VAL B 2 108 ? -3.924  17.231  9.973   1.00 0.00  ? 195 VAL A CB     4  
ATOM 6516  C CG1    . VAL B 2 108 ? -4.293  16.873  11.416  1.00 0.00  ? 195 VAL A CG1    4  
ATOM 6517  C CG2    . VAL B 2 108 ? -3.924  18.762  9.834   1.00 0.00  ? 195 VAL A CG2    4  
ATOM 6518  H H      . VAL B 2 108 ? -3.057  15.117  7.930   1.00 0.00  ? 195 VAL A H      4  
ATOM 6519  H HA     . VAL B 2 108 ? -2.355  17.134  8.546   1.00 0.00  ? 195 VAL A HA     4  
ATOM 6520  H HB     . VAL B 2 108 ? -4.745  16.891  9.340   1.00 0.00  ? 195 VAL A HB     4  
ATOM 6521  H HG11   . VAL B 2 108 ? -4.481  15.806  11.499  1.00 0.00  ? 195 VAL A HG11   4  
ATOM 6522  H HG12   . VAL B 2 108 ? -3.493  17.156  12.097  1.00 0.00  ? 195 VAL A HG12   4  
ATOM 6523  H HG13   . VAL B 2 108 ? -5.208  17.395  11.703  1.00 0.00  ? 195 VAL A HG13   4  
ATOM 6524  H HG21   . VAL B 2 108 ? -3.304  19.228  10.601  1.00 0.00  ? 195 VAL A HG21   4  
ATOM 6525  H HG22   . VAL B 2 108 ? -3.577  19.049  8.840   1.00 0.00  ? 195 VAL A HG22   4  
ATOM 6526  H HG23   . VAL B 2 108 ? -4.943  19.128  9.962   1.00 0.00  ? 195 VAL A HG23   4  
ATOM 6527  N N      . MET B 2 109 ? -1.026  17.905  10.751  1.00 0.00  ? 196 MET A N      4  
ATOM 6528  C CA     . MET B 2 109 ? 0.116   18.239  11.618  1.00 0.00  ? 196 MET A CA     4  
ATOM 6529  C C      . MET B 2 109 ? -0.051  17.731  13.060  1.00 0.00  ? 196 MET A C      4  
ATOM 6530  O O      . MET B 2 109 ? 0.908   17.127  13.591  1.00 0.00  ? 196 MET A O      4  
ATOM 6531  C CB     . MET B 2 109 ? 0.353   19.761  11.614  1.00 0.00  ? 196 MET A CB     4  
ATOM 6532  C CG     . MET B 2 109 ? 0.771   20.280  10.230  1.00 0.00  ? 196 MET A CG     4  
ATOM 6533  S SD     . MET B 2 109 ? 1.033   22.073  10.132  1.00 0.00  ? 196 MET A SD     4  
ATOM 6534  C CE     . MET B 2 109 ? 2.535   22.255  11.131  1.00 0.00  ? 196 MET A CE     4  
ATOM 6535  O OXT    . MET B 2 109 ? -1.126  17.956  13.663  1.00 0.00  ? 196 MET A OXT    4  
ATOM 6536  H H      . MET B 2 109 ? -1.636  18.659  10.471  1.00 0.00  ? 196 MET A H      4  
ATOM 6537  H HA     . MET B 2 109 ? 1.007   17.760  11.218  1.00 0.00  ? 196 MET A HA     4  
ATOM 6538  H HB2    . MET B 2 109 ? -0.556  20.270  11.927  1.00 0.00  ? 196 MET A HB2    4  
ATOM 6539  H HB3    . MET B 2 109 ? 1.140   19.988  12.331  1.00 0.00  ? 196 MET A HB3    4  
ATOM 6540  H HG2    . MET B 2 109 ? 1.690   19.776  9.927   1.00 0.00  ? 196 MET A HG2    4  
ATOM 6541  H HG3    . MET B 2 109 ? -0.007  20.025  9.513   1.00 0.00  ? 196 MET A HG3    4  
ATOM 6542  H HE1    . MET B 2 109 ? 2.336   21.968  12.164  1.00 0.00  ? 196 MET A HE1    4  
ATOM 6543  H HE2    . MET B 2 109 ? 3.328   21.620  10.724  1.00 0.00  ? 196 MET A HE2    4  
ATOM 6544  H HE3    . MET B 2 109 ? 2.863   23.294  11.108  1.00 0.00  ? 196 MET A HE3    4  
ATOM 6545  O "O5'"  . U   A 1 1   ? -0.370  -14.904 7.460   1.00 0.00  ? 197 U   B "O5'"  5  
ATOM 6546  C "C5'"  . U   A 1 1   ? -0.064  -14.554 8.806   1.00 0.00  ? 197 U   B "C5'"  5  
ATOM 6547  C "C4'"  . U   A 1 1   ? -0.133  -13.043 9.100   1.00 0.00  ? 197 U   B "C4'"  5  
ATOM 6548  O "O4'"  . U   A 1 1   ? 0.968   -12.343 8.529   1.00 0.00  ? 197 U   B "O4'"  5  
ATOM 6549  C "C3'"  . U   A 1 1   ? -1.430  -12.368 8.629   1.00 0.00  ? 197 U   B "C3'"  5  
ATOM 6550  O "O3'"  . U   A 1 1   ? -2.346  -12.200 9.704   1.00 0.00  ? 197 U   B "O3'"  5  
ATOM 6551  C "C2'"  . U   A 1 1   ? -0.901  -11.055 8.024   1.00 0.00  ? 197 U   B "C2'"  5  
ATOM 6552  O "O2'"  . U   A 1 1   ? -0.655  -10.029 8.990   1.00 0.00  ? 197 U   B "O2'"  5  
ATOM 6553  C "C1'"  . U   A 1 1   ? 0.481   -11.501 7.489   1.00 0.00  ? 197 U   B "C1'"  5  
ATOM 6554  N N1     . U   A 1 1   ? 0.546   -12.240 6.172   1.00 0.00  ? 197 U   B N1     5  
ATOM 6555  C C2     . U   A 1 1   ? 1.792   -12.757 5.746   1.00 0.00  ? 197 U   B C2     5  
ATOM 6556  O O2     . U   A 1 1   ? 2.801   -12.847 6.446   1.00 0.00  ? 197 U   B O2     5  
ATOM 6557  N N3     . U   A 1 1   ? 1.878   -13.209 4.442   1.00 0.00  ? 197 U   B N3     5  
ATOM 6558  C C4     . U   A 1 1   ? 0.848   -13.269 3.539   1.00 0.00  ? 197 U   B C4     5  
ATOM 6559  O O4     . U   A 1 1   ? 1.035   -13.688 2.398   1.00 0.00  ? 197 U   B O4     5  
ATOM 6560  C C5     . U   A 1 1   ? -0.416  -12.822 4.062   1.00 0.00  ? 197 U   B C5     5  
ATOM 6561  C C6     . U   A 1 1   ? -0.543  -12.335 5.325   1.00 0.00  ? 197 U   B C6     5  
ATOM 6562  H "H5'"  . U   A 1 1   ? 0.943   -14.893 9.034   1.00 0.00  ? 197 U   B "H5'"  5  
ATOM 6563  H "H5''" . U   A 1 1   ? -0.763  -15.062 9.474   1.00 0.00  ? 197 U   B "H5''" 5  
ATOM 6564  H "H4'"  . U   A 1 1   ? -0.062  -12.914 10.181  1.00 0.00  ? 197 U   B "H4'"  5  
ATOM 6565  H "H3'"  . U   A 1 1   ? -1.866  -12.961 7.822   1.00 0.00  ? 197 U   B "H3'"  5  
ATOM 6566  H "H2'"  . U   A 1 1   ? -1.579  -10.673 7.259   1.00 0.00  ? 197 U   B "H2'"  5  
ATOM 6567  H "HO2'" . U   A 1 1   ? -1.419  -9.429  9.022   1.00 0.00  ? 197 U   B "HO2'" 5  
ATOM 6568  H "H1'"  . U   A 1 1   ? 1.118   -10.615 7.410   1.00 0.00  ? 197 U   B "H1'"  5  
ATOM 6569  H H3     . U   A 1 1   ? 2.776   -13.529 4.127   1.00 0.00  ? 197 U   B H3     5  
ATOM 6570  H H5     . U   A 1 1   ? -1.268  -12.895 3.405   1.00 0.00  ? 197 U   B H5     5  
ATOM 6571  H H6     . U   A 1 1   ? -1.520  -12.042 5.677   1.00 0.00  ? 197 U   B H6     5  
ATOM 6572  H "HO5'" . U   A 1 1   ? -0.315  -15.876 7.355   1.00 0.00  ? 197 U   B "HO5'" 5  
ATOM 6573  P P      . G   A 1 2   ? -3.915  -12.506 9.563   1.00 0.00  ? 198 G   B P      5  
ATOM 6574  O OP1    . G   A 1 2   ? -4.286  -13.429 10.663  1.00 0.00  ? 198 G   B OP1    5  
ATOM 6575  O OP2    . G   A 1 2   ? -4.237  -12.888 8.166   1.00 0.00  ? 198 G   B OP2    5  
ATOM 6576  O "O5'"  . G   A 1 2   ? -4.626  -11.099 9.865   1.00 0.00  ? 198 G   B "O5'"  5  
ATOM 6577  C "C5'"  . G   A 1 2   ? -4.565  -10.014 8.956   1.00 0.00  ? 198 G   B "C5'"  5  
ATOM 6578  C "C4'"  . G   A 1 2   ? -5.760  -9.051  9.138   1.00 0.00  ? 198 G   B "C4'"  5  
ATOM 6579  O "O4'"  . G   A 1 2   ? -6.164  -8.539  7.872   1.00 0.00  ? 198 G   B "O4'"  5  
ATOM 6580  C "C3'"  . G   A 1 2   ? -7.053  -9.695  9.680   1.00 0.00  ? 198 G   B "C3'"  5  
ATOM 6581  O "O3'"  . G   A 1 2   ? -7.985  -8.699  10.103  1.00 0.00  ? 198 G   B "O3'"  5  
ATOM 6582  C "C2'"  . G   A 1 2   ? -7.543  -10.389 8.403   1.00 0.00  ? 198 G   B "C2'"  5  
ATOM 6583  O "O2'"  . G   A 1 2   ? -8.919  -10.743 8.448   1.00 0.00  ? 198 G   B "O2'"  5  
ATOM 6584  C "C1'"  . G   A 1 2   ? -7.219  -9.340  7.330   1.00 0.00  ? 198 G   B "C1'"  5  
ATOM 6585  N N9     . G   A 1 2   ? -6.872  -9.905  5.994   1.00 0.00  ? 198 G   B N9     5  
ATOM 6586  C C8     . G   A 1 2   ? -6.680  -11.214 5.611   1.00 0.00  ? 198 G   B C8     5  
ATOM 6587  N N7     . G   A 1 2   ? -6.345  -11.366 4.354   1.00 0.00  ? 198 G   B N7     5  
ATOM 6588  C C5     . G   A 1 2   ? -6.327  -10.058 3.852   1.00 0.00  ? 198 G   B C5     5  
ATOM 6589  C C6     . G   A 1 2   ? -6.000  -9.538  2.548   1.00 0.00  ? 198 G   B C6     5  
ATOM 6590  O O6     . G   A 1 2   ? -5.611  -10.127 1.539   1.00 0.00  ? 198 G   B O6     5  
ATOM 6591  N N1     . G   A 1 2   ? -6.161  -8.170  2.450   1.00 0.00  ? 198 G   B N1     5  
ATOM 6592  C C2     . G   A 1 2   ? -6.574  -7.392  3.470   1.00 0.00  ? 198 G   B C2     5  
ATOM 6593  N N2     . G   A 1 2   ? -6.710  -6.123  3.190   1.00 0.00  ? 198 G   B N2     5  
ATOM 6594  N N3     . G   A 1 2   ? -6.872  -7.815  4.694   1.00 0.00  ? 198 G   B N3     5  
ATOM 6595  C C4     . G   A 1 2   ? -6.716  -9.168  4.836   1.00 0.00  ? 198 G   B C4     5  
ATOM 6596  H "H5'"  . G   A 1 2   ? -4.553  -10.395 7.933   1.00 0.00  ? 198 G   B "H5'"  5  
ATOM 6597  H "H5''" . G   A 1 2   ? -3.633  -9.468  9.101   1.00 0.00  ? 198 G   B "H5''" 5  
ATOM 6598  H "H4'"  . G   A 1 2   ? -5.436  -8.248  9.795   1.00 0.00  ? 198 G   B "H4'"  5  
ATOM 6599  H "H3'"  . G   A 1 2   ? -6.867  -10.423 10.469  1.00 0.00  ? 198 G   B "H3'"  5  
ATOM 6600  H "H2'"  . G   A 1 2   ? -6.932  -11.281 8.259   1.00 0.00  ? 198 G   B "H2'"  5  
ATOM 6601  H "HO2'" . G   A 1 2   ? -9.394  -10.038 8.928   1.00 0.00  ? 198 G   B "HO2'" 5  
ATOM 6602  H "H1'"  . G   A 1 2   ? -8.094  -8.698  7.211   1.00 0.00  ? 198 G   B "H1'"  5  
ATOM 6603  H H8     . G   A 1 2   ? -6.778  -12.049 6.291   1.00 0.00  ? 198 G   B H8     5  
ATOM 6604  H H1     . G   A 1 2   ? -5.951  -7.716  1.578   1.00 0.00  ? 198 G   B H1     5  
ATOM 6605  H H21    . G   A 1 2   ? -6.394  -5.775  2.296   1.00 0.00  ? 198 G   B H21    5  
ATOM 6606  H H22    . G   A 1 2   ? -7.004  -5.500  3.930   1.00 0.00  ? 198 G   B H22    5  
ATOM 6607  P P      . C   A 1 3   ? -7.999  -8.166  11.615  1.00 0.00  ? 199 C   B P      5  
ATOM 6608  O OP1    . C   A 1 3   ? -8.037  -9.347  12.516  1.00 0.00  ? 199 C   B OP1    5  
ATOM 6609  O OP2    . C   A 1 3   ? -9.075  -7.152  11.730  1.00 0.00  ? 199 C   B OP2    5  
ATOM 6610  O "O5'"  . C   A 1 3   ? -6.581  -7.437  11.824  1.00 0.00  ? 199 C   B "O5'"  5  
ATOM 6611  C "C5'"  . C   A 1 3   ? -6.281  -6.188  11.219  1.00 0.00  ? 199 C   B "C5'"  5  
ATOM 6612  C "C4'"  . C   A 1 3   ? -4.899  -5.703  11.681  1.00 0.00  ? 199 C   B "C4'"  5  
ATOM 6613  O "O4'"  . C   A 1 3   ? -3.835  -6.487  11.134  1.00 0.00  ? 199 C   B "O4'"  5  
ATOM 6614  C "C3'"  . C   A 1 3   ? -4.645  -4.241  11.267  1.00 0.00  ? 199 C   B "C3'"  5  
ATOM 6615  O "O3'"  . C   A 1 3   ? -4.286  -3.444  12.391  1.00 0.00  ? 199 C   B "O3'"  5  
ATOM 6616  C "C2'"  . C   A 1 3   ? -3.446  -4.371  10.315  1.00 0.00  ? 199 C   B "C2'"  5  
ATOM 6617  O "O2'"  . C   A 1 3   ? -2.617  -3.218  10.301  1.00 0.00  ? 199 C   B "O2'"  5  
ATOM 6618  C "C1'"  . C   A 1 3   ? -2.750  -5.606  10.883  1.00 0.00  ? 199 C   B "C1'"  5  
ATOM 6619  N N1     . C   A 1 3   ? -1.750  -6.174  9.934   1.00 0.00  ? 199 C   B N1     5  
ATOM 6620  C C2     . C   A 1 3   ? -0.377  -6.012  10.200  1.00 0.00  ? 199 C   B C2     5  
ATOM 6621  O O2     . C   A 1 3   ? 0.028   -5.563  11.274  1.00 0.00  ? 199 C   B O2     5  
ATOM 6622  N N3     . C   A 1 3   ? 0.557   -6.331  9.263   1.00 0.00  ? 199 C   B N3     5  
ATOM 6623  C C4     . C   A 1 3   ? 0.136   -6.838  8.122   1.00 0.00  ? 199 C   B C4     5  
ATOM 6624  N N4     . C   A 1 3   ? 1.032   -7.005  7.194   1.00 0.00  ? 199 C   B N4     5  
ATOM 6625  C C5     . C   A 1 3   ? -1.226  -7.084  7.820   1.00 0.00  ? 199 C   B C5     5  
ATOM 6626  C C6     . C   A 1 3   ? -2.151  -6.734  8.746   1.00 0.00  ? 199 C   B C6     5  
ATOM 6627  H "H5'"  . C   A 1 3   ? -7.025  -5.450  11.524  1.00 0.00  ? 199 C   B "H5'"  5  
ATOM 6628  H "H5''" . C   A 1 3   ? -6.305  -6.273  10.133  1.00 0.00  ? 199 C   B "H5''" 5  
ATOM 6629  H "H4'"  . C   A 1 3   ? -4.859  -5.772  12.768  1.00 0.00  ? 199 C   B "H4'"  5  
ATOM 6630  H "H3'"  . C   A 1 3   ? -5.497  -3.820  10.729  1.00 0.00  ? 199 C   B "H3'"  5  
ATOM 6631  H "H2'"  . C   A 1 3   ? -3.820  -4.583  9.309   1.00 0.00  ? 199 C   B "H2'"  5  
ATOM 6632  H "HO2'" . C   A 1 3   ? -2.660  -2.817  11.188  1.00 0.00  ? 199 C   B "HO2'" 5  
ATOM 6633  H "H1'"  . C   A 1 3   ? -2.267  -5.335  11.827  1.00 0.00  ? 199 C   B "H1'"  5  
ATOM 6634  H H41    . C   A 1 3   ? 1.964   -6.712  7.393   1.00 0.00  ? 199 C   B H41    5  
ATOM 6635  H H42    . C   A 1 3   ? 0.680   -7.088  6.248   1.00 0.00  ? 199 C   B H42    5  
ATOM 6636  H H5     . C   A 1 3   ? -1.516  -7.512  6.876   1.00 0.00  ? 199 C   B H5     5  
ATOM 6637  H H6     . C   A 1 3   ? -3.211  -6.880  8.555   1.00 0.00  ? 199 C   B H6     5  
ATOM 6638  P P      . A   A 1 4   ? -5.412  -2.803  13.337  1.00 0.00  ? 200 A   B P      5  
ATOM 6639  O OP1    . A   A 1 4   ? -4.734  -1.977  14.369  1.00 0.00  ? 200 A   B OP1    5  
ATOM 6640  O OP2    . A   A 1 4   ? -6.340  -3.871  13.771  1.00 0.00  ? 200 A   B OP2    5  
ATOM 6641  O "O5'"  . A   A 1 4   ? -6.210  -1.830  12.335  1.00 0.00  ? 200 A   B "O5'"  5  
ATOM 6642  C "C5'"  . A   A 1 4   ? -5.611  -0.647  11.828  1.00 0.00  ? 200 A   B "C5'"  5  
ATOM 6643  C "C4'"  . A   A 1 4   ? -6.465  0.025   10.742  1.00 0.00  ? 200 A   B "C4'"  5  
ATOM 6644  O "O4'"  . A   A 1 4   ? -6.451  -0.773  9.559   1.00 0.00  ? 200 A   B "O4'"  5  
ATOM 6645  C "C3'"  . A   A 1 4   ? -7.934  0.247   11.162  1.00 0.00  ? 200 A   B "C3'"  5  
ATOM 6646  O "O3'"  . A   A 1 4   ? -8.501  1.460   10.679  1.00 0.00  ? 200 A   B "O3'"  5  
ATOM 6647  C "C2'"  . A   A 1 4   ? -8.623  -0.917  10.477  1.00 0.00  ? 200 A   B "C2'"  5  
ATOM 6648  O "O2'"  . A   A 1 4   ? -10.016 -0.717  10.243  1.00 0.00  ? 200 A   B "O2'"  5  
ATOM 6649  C "C1'"  . A   A 1 4   ? -7.796  -1.049  9.202   1.00 0.00  ? 200 A   B "C1'"  5  
ATOM 6650  N N9     . A   A 1 4   ? -7.943  -2.397  8.618   1.00 0.00  ? 200 A   B N9     5  
ATOM 6651  C C8     . A   A 1 4   ? -8.397  -3.541  9.228   1.00 0.00  ? 200 A   B C8     5  
ATOM 6652  N N7     . A   A 1 4   ? -8.672  -4.518  8.404   1.00 0.00  ? 200 A   B N7     5  
ATOM 6653  C C5     . A   A 1 4   ? -8.360  -3.966  7.147   1.00 0.00  ? 200 A   B C5     5  
ATOM 6654  C C6     . A   A 1 4   ? -8.466  -4.401  5.804   1.00 0.00  ? 200 A   B C6     5  
ATOM 6655  N N6     . A   A 1 4   ? -8.979  -5.555  5.426   1.00 0.00  ? 200 A   B N6     5  
ATOM 6656  N N1     . A   A 1 4   ? -8.060  -3.637  4.785   1.00 0.00  ? 200 A   B N1     5  
ATOM 6657  C C2     . A   A 1 4   ? -7.598  -2.425  5.081   1.00 0.00  ? 200 A   B C2     5  
ATOM 6658  N N3     . A   A 1 4   ? -7.492  -1.856  6.272   1.00 0.00  ? 200 A   B N3     5  
ATOM 6659  C C4     . A   A 1 4   ? -7.880  -2.691  7.278   1.00 0.00  ? 200 A   B C4     5  
ATOM 6660  H "H5'"  . A   A 1 4   ? -4.635  -0.887  11.400  1.00 0.00  ? 200 A   B "H5'"  5  
ATOM 6661  H "H5''" . A   A 1 4   ? -5.465  0.063   12.642  1.00 0.00  ? 200 A   B "H5''" 5  
ATOM 6662  H "H4'"  . A   A 1 4   ? -6.005  0.984   10.519  1.00 0.00  ? 200 A   B "H4'"  5  
ATOM 6663  H "H3'"  . A   A 1 4   ? -8.082  0.096   12.227  1.00 0.00  ? 200 A   B "H3'"  5  
ATOM 6664  H "H2'"  . A   A 1 4   ? -8.475  -1.777  11.129  1.00 0.00  ? 200 A   B "H2'"  5  
ATOM 6665  H "HO2'" . A   A 1 4   ? -10.149 0.239   10.109  1.00 0.00  ? 200 A   B "HO2'" 5  
ATOM 6666  H "H1'"  . A   A 1 4   ? -8.141  -0.300  8.485   1.00 0.00  ? 200 A   B "H1'"  5  
ATOM 6667  H H8     . A   A 1 4   ? -8.533  -3.573  10.305  1.00 0.00  ? 200 A   B H8     5  
ATOM 6668  H H61    . A   A 1 4   ? -9.073  -5.757  4.447   1.00 0.00  ? 200 A   B H61    5  
ATOM 6669  H H62    . A   A 1 4   ? -9.288  -6.199  6.138   1.00 0.00  ? 200 A   B H62    5  
ATOM 6670  H H2     . A   A 1 4   ? -7.281  -1.800  4.256   1.00 0.00  ? 200 A   B H2     5  
ATOM 6671  P P      . U   A 1 5   ? -8.142  2.876   11.324  1.00 0.00  ? 201 U   B P      5  
ATOM 6672  O OP1    . U   A 1 5   ? -7.810  2.684   12.754  1.00 0.00  ? 201 U   B OP1    5  
ATOM 6673  O OP2    . U   A 1 5   ? -9.209  3.835   10.948  1.00 0.00  ? 201 U   B OP2    5  
ATOM 6674  O "O5'"  . U   A 1 5   ? -6.804  3.294   10.548  1.00 0.00  ? 201 U   B "O5'"  5  
ATOM 6675  C "C5'"  . U   A 1 5   ? -6.795  3.475   9.140   1.00 0.00  ? 201 U   B "C5'"  5  
ATOM 6676  C "C4'"  . U   A 1 5   ? -6.026  4.728   8.734   1.00 0.00  ? 201 U   B "C4'"  5  
ATOM 6677  O "O4'"  . U   A 1 5   ? -6.399  5.129   7.412   1.00 0.00  ? 201 U   B "O4'"  5  
ATOM 6678  C "C3'"  . U   A 1 5   ? -6.225  5.965   9.623   1.00 0.00  ? 201 U   B "C3'"  5  
ATOM 6679  O "O3'"  . U   A 1 5   ? -5.120  6.871   9.550   1.00 0.00  ? 201 U   B "O3'"  5  
ATOM 6680  C "C2'"  . U   A 1 5   ? -7.462  6.574   8.974   1.00 0.00  ? 201 U   B "C2'"  5  
ATOM 6681  O "O2'"  . U   A 1 5   ? -7.624  7.938   9.324   1.00 0.00  ? 201 U   B "O2'"  5  
ATOM 6682  C "C1'"  . U   A 1 5   ? -7.212  6.306   7.477   1.00 0.00  ? 201 U   B "C1'"  5  
ATOM 6683  N N1     . U   A 1 5   ? -8.496  6.143   6.721   1.00 0.00  ? 201 U   B N1     5  
ATOM 6684  C C2     . U   A 1 5   ? -8.753  6.979   5.622   1.00 0.00  ? 201 U   B C2     5  
ATOM 6685  O O2     . U   A 1 5   ? -8.008  7.889   5.264   1.00 0.00  ? 201 U   B O2     5  
ATOM 6686  N N3     . U   A 1 5   ? -9.920  6.764   4.915   1.00 0.00  ? 201 U   B N3     5  
ATOM 6687  C C4     . U   A 1 5   ? -10.906 5.875   5.270   1.00 0.00  ? 201 U   B C4     5  
ATOM 6688  O O4     . U   A 1 5   ? -11.961 5.832   4.651   1.00 0.00  ? 201 U   B O4     5  
ATOM 6689  C C5     . U   A 1 5   ? -10.597 5.064   6.422   1.00 0.00  ? 201 U   B C5     5  
ATOM 6690  C C6     . U   A 1 5   ? -9.439  5.217   7.110   1.00 0.00  ? 201 U   B C6     5  
ATOM 6691  H "H5'"  . U   A 1 5   ? -7.793  3.568   8.754   1.00 0.00  ? 201 U   B "H5'"  5  
ATOM 6692  H "H5''" . U   A 1 5   ? -6.343  2.606   8.662   1.00 0.00  ? 201 U   B "H5''" 5  
ATOM 6693  H "H4'"  . U   A 1 5   ? -4.999  4.418   8.780   1.00 0.00  ? 201 U   B "H4'"  5  
ATOM 6694  H "H3'"  . U   A 1 5   ? -6.446  5.705   10.657  1.00 0.00  ? 201 U   B "H3'"  5  
ATOM 6695  H "H2'"  . U   A 1 5   ? -8.326  6.007   9.322   1.00 0.00  ? 201 U   B "H2'"  5  
ATOM 6696  H "HO2'" . U   A 1 5   ? -6.778  8.243   9.701   1.00 0.00  ? 201 U   B "HO2'" 5  
ATOM 6697  H "H1'"  . U   A 1 5   ? -6.633  7.135   7.055   1.00 0.00  ? 201 U   B "H1'"  5  
ATOM 6698  H H3     . U   A 1 5   ? -10.070 7.289   4.065   1.00 0.00  ? 201 U   B H3     5  
ATOM 6699  H H5     . U   A 1 5   ? -11.321 4.318   6.722   1.00 0.00  ? 201 U   B H5     5  
ATOM 6700  H H6     . U   A 1 5   ? -9.268  4.601   7.981   1.00 0.00  ? 201 U   B H6     5  
ATOM 6701  P P      . G   A 1 6   ? -3.749  6.574   10.339  1.00 0.00  ? 202 G   B P      5  
ATOM 6702  O OP1    . G   A 1 6   ? -3.892  5.345   11.153  1.00 0.00  ? 202 G   B OP1    5  
ATOM 6703  O OP2    . G   A 1 6   ? -3.318  7.818   11.010  1.00 0.00  ? 202 G   B OP2    5  
ATOM 6704  O "O5'"  . G   A 1 6   ? -2.664  6.297   9.193   1.00 0.00  ? 202 G   B "O5'"  5  
ATOM 6705  C "C5'"  . G   A 1 6   ? -2.688  5.103   8.429   1.00 0.00  ? 202 G   B "C5'"  5  
ATOM 6706  C "C4'"  . G   A 1 6   ? -1.449  4.878   7.557   1.00 0.00  ? 202 G   B "C4'"  5  
ATOM 6707  O "O4'"  . G   A 1 6   ? -1.619  5.544   6.314   1.00 0.00  ? 202 G   B "O4'"  5  
ATOM 6708  C "C3'"  . G   A 1 6   ? -0.167  5.366   8.233   1.00 0.00  ? 202 G   B "C3'"  5  
ATOM 6709  O "O3'"  . G   A 1 6   ? 0.863   4.416   8.045   1.00 0.00  ? 202 G   B "O3'"  5  
ATOM 6710  C "C2'"  . G   A 1 6   ? -0.039  6.704   7.508   1.00 0.00  ? 202 G   B "C2'"  5  
ATOM 6711  O "O2'"  . G   A 1 6   ? 1.233   7.340   7.605   1.00 0.00  ? 202 G   B "O2'"  5  
ATOM 6712  C "C1'"  . G   A 1 6   ? -0.486  6.357   6.106   1.00 0.00  ? 202 G   B "C1'"  5  
ATOM 6713  N N9     . G   A 1 6   ? -0.801  7.573   5.324   1.00 0.00  ? 202 G   B N9     5  
ATOM 6714  C C8     . G   A 1 6   ? -0.054  8.125   4.324   1.00 0.00  ? 202 G   B C8     5  
ATOM 6715  N N7     . G   A 1 6   ? -0.569  9.208   3.801   1.00 0.00  ? 202 G   B N7     5  
ATOM 6716  C C5     . G   A 1 6   ? -1.754  9.394   4.529   1.00 0.00  ? 202 G   B C5     5  
ATOM 6717  C C6     . G   A 1 6   ? -2.783  10.402  4.452   1.00 0.00  ? 202 G   B C6     5  
ATOM 6718  O O6     . G   A 1 6   ? -2.857  11.366  3.690   1.00 0.00  ? 202 G   B O6     5  
ATOM 6719  N N1     . G   A 1 6   ? -3.809  10.229  5.361   1.00 0.00  ? 202 G   B N1     5  
ATOM 6720  C C2     . G   A 1 6   ? -3.835  9.212   6.266   1.00 0.00  ? 202 G   B C2     5  
ATOM 6721  N N2     . G   A 1 6   ? -4.837  9.112   7.094   1.00 0.00  ? 202 G   B N2     5  
ATOM 6722  N N3     . G   A 1 6   ? -2.884  8.301   6.412   1.00 0.00  ? 202 G   B N3     5  
ATOM 6723  C C4     . G   A 1 6   ? -1.879  8.416   5.493   1.00 0.00  ? 202 G   B C4     5  
ATOM 6724  H "H5'"  . G   A 1 6   ? -3.560  5.128   7.771   1.00 0.00  ? 202 G   B "H5'"  5  
ATOM 6725  H "H5''" . G   A 1 6   ? -2.770  4.252   9.111   1.00 0.00  ? 202 G   B "H5''" 5  
ATOM 6726  H "H4'"  . G   A 1 6   ? -1.331  3.820   7.352   1.00 0.00  ? 202 G   B "H4'"  5  
ATOM 6727  H "H3'"  . G   A 1 6   ? -0.303  5.526   9.288   1.00 0.00  ? 202 G   B "H3'"  5  
ATOM 6728  H "H2'"  . G   A 1 6   ? -0.834  7.335   7.895   1.00 0.00  ? 202 G   B "H2'"  5  
ATOM 6729  H "HO2'" . G   A 1 6   ? 1.210   8.201   7.150   1.00 0.00  ? 202 G   B "HO2'" 5  
ATOM 6730  H "H1'"  . G   A 1 6   ? 0.289   5.778   5.619   1.00 0.00  ? 202 G   B "H1'"  5  
ATOM 6731  H H8     . G   A 1 6   ? 0.880   7.670   4.012   1.00 0.00  ? 202 G   B H8     5  
ATOM 6732  H H1     . G   A 1 6   ? -4.593  10.861  5.273   1.00 0.00  ? 202 G   B H1     5  
ATOM 6733  H H21    . G   A 1 6   ? -5.688  9.659   7.026   1.00 0.00  ? 202 G   B H21    5  
ATOM 6734  H H22    . G   A 1 6   ? -4.759  8.361   7.766   1.00 0.00  ? 202 G   B H22    5  
ATOM 6735  P P      . U   A 1 7   ? 1.605   3.753   9.309   1.00 0.00  ? 203 U   B P      5  
ATOM 6736  O OP1    . U   A 1 7   ? 1.273   2.312   9.364   1.00 0.00  ? 203 U   B OP1    5  
ATOM 6737  O OP2    . U   A 1 7   ? 1.448   4.582   10.527  1.00 0.00  ? 203 U   B OP2    5  
ATOM 6738  O "O5'"  . U   A 1 7   ? 3.127   3.863   8.849   1.00 0.00  ? 203 U   B "O5'"  5  
ATOM 6739  C "C5'"  . U   A 1 7   ? 3.658   5.099   8.397   1.00 0.00  ? 203 U   B "C5'"  5  
ATOM 6740  C "C4'"  . U   A 1 7   ? 3.751   5.201   6.859   1.00 0.00  ? 203 U   B "C4'"  5  
ATOM 6741  O "O4'"  . U   A 1 7   ? 5.119   5.314   6.475   1.00 0.00  ? 203 U   B "O4'"  5  
ATOM 6742  C "C3'"  . U   A 1 7   ? 3.250   4.018   6.014   1.00 0.00  ? 203 U   B "C3'"  5  
ATOM 6743  O "O3'"  . U   A 1 7   ? 2.946   4.495   4.708   1.00 0.00  ? 203 U   B "O3'"  5  
ATOM 6744  C "C2'"  . U   A 1 7   ? 4.436   3.058   6.010   1.00 0.00  ? 203 U   B "C2'"  5  
ATOM 6745  O "O2'"  . U   A 1 7   ? 4.520   2.242   4.852   1.00 0.00  ? 203 U   B "O2'"  5  
ATOM 6746  C "C1'"  . U   A 1 7   ? 5.635   4.014   6.168   1.00 0.00  ? 203 U   B "C1'"  5  
ATOM 6747  N N1     . U   A 1 7   ? 6.621   3.545   7.186   1.00 0.00  ? 203 U   B N1     5  
ATOM 6748  C C2     . U   A 1 7   ? 7.985   3.617   6.867   1.00 0.00  ? 203 U   B C2     5  
ATOM 6749  O O2     . U   A 1 7   ? 8.423   4.139   5.840   1.00 0.00  ? 203 U   B O2     5  
ATOM 6750  N N3     . U   A 1 7   ? 8.874   3.055   7.764   1.00 0.00  ? 203 U   B N3     5  
ATOM 6751  C C4     . U   A 1 7   ? 8.535   2.423   8.939   1.00 0.00  ? 203 U   B C4     5  
ATOM 6752  O O4     . U   A 1 7   ? 9.408   1.935   9.654   1.00 0.00  ? 203 U   B O4     5  
ATOM 6753  C C5     . U   A 1 7   ? 7.115   2.398   9.213   1.00 0.00  ? 203 U   B C5     5  
ATOM 6754  C C6     . U   A 1 7   ? 6.216   2.952   8.363   1.00 0.00  ? 203 U   B C6     5  
ATOM 6755  H "H5'"  . U   A 1 7   ? 4.655   5.222   8.818   1.00 0.00  ? 203 U   B "H5'"  5  
ATOM 6756  H "H5''" . U   A 1 7   ? 3.057   5.929   8.778   1.00 0.00  ? 203 U   B "H5''" 5  
ATOM 6757  H "H4'"  . U   A 1 7   ? 3.169   6.078   6.566   1.00 0.00  ? 203 U   B "H4'"  5  
ATOM 6758  H "H3'"  . U   A 1 7   ? 2.393   3.523   6.460   1.00 0.00  ? 203 U   B "H3'"  5  
ATOM 6759  H "HO3'" . U   A 1 7   ? 3.710   5.011   4.395   1.00 0.00  ? 203 U   B "HO3'" 5  
ATOM 6760  H "H2'"  . U   A 1 7   ? 4.311   2.409   6.877   1.00 0.00  ? 203 U   B "H2'"  5  
ATOM 6761  H "HO2'" . U   A 1 7   ? 3.995   2.661   4.141   1.00 0.00  ? 203 U   B "HO2'" 5  
ATOM 6762  H "H1'"  . U   A 1 7   ? 6.132   4.069   5.195   1.00 0.00  ? 203 U   B "H1'"  5  
ATOM 6763  H H3     . U   A 1 7   ? 9.852   3.097   7.541   1.00 0.00  ? 203 U   B H3     5  
ATOM 6764  H H5     . U   A 1 7   ? 6.753   1.926   10.112  1.00 0.00  ? 203 U   B H5     5  
ATOM 6765  H H6     . U   A 1 7   ? 5.163   2.918   8.620   1.00 0.00  ? 203 U   B H6     5  
ATOM 6766  N N      . ASN B 2 22  ? -6.956  30.696  -15.084 1.00 0.00  ? 109 ASN A N      5  
ATOM 6767  C CA     . ASN B 2 22  ? -5.541  30.830  -14.665 1.00 0.00  ? 109 ASN A CA     5  
ATOM 6768  C C      . ASN B 2 22  ? -5.263  29.970  -13.425 1.00 0.00  ? 109 ASN A C      5  
ATOM 6769  O O      . ASN B 2 22  ? -4.848  28.820  -13.575 1.00 0.00  ? 109 ASN A O      5  
ATOM 6770  C CB     . ASN B 2 22  ? -5.119  32.313  -14.518 1.00 0.00  ? 109 ASN A CB     5  
ATOM 6771  C CG     . ASN B 2 22  ? -3.627  32.463  -14.216 1.00 0.00  ? 109 ASN A CG     5  
ATOM 6772  O OD1    . ASN B 2 22  ? -2.799  31.673  -14.651 1.00 0.00  ? 109 ASN A OD1    5  
ATOM 6773  N ND2    . ASN B 2 22  ? -3.228  33.470  -13.464 1.00 0.00  ? 109 ASN A ND2    5  
ATOM 6774  H H      . ASN B 2 22  ? -7.191  29.725  -15.235 1.00 0.00  ? 109 ASN A H      5  
ATOM 6775  H HA     . ASN B 2 22  ? -4.923  30.406  -15.458 1.00 0.00  ? 109 ASN A HA     5  
ATOM 6776  H HB2    . ASN B 2 22  ? -5.319  32.834  -15.454 1.00 0.00  ? 109 ASN A HB2    5  
ATOM 6777  H HB3    . ASN B 2 22  ? -5.701  32.795  -13.730 1.00 0.00  ? 109 ASN A HB3    5  
ATOM 6778  H HD21   . ASN B 2 22  ? -3.878  34.150  -13.093 1.00 0.00  ? 109 ASN A HD21   5  
ATOM 6779  H HD22   . ASN B 2 22  ? -2.237  33.558  -13.290 1.00 0.00  ? 109 ASN A HD22   5  
ATOM 6780  N N      . THR B 2 23  ? -5.504  30.479  -12.211 1.00 0.00  ? 110 THR A N      5  
ATOM 6781  C CA     . THR B 2 23  ? -5.257  29.798  -10.917 1.00 0.00  ? 110 THR A CA     5  
ATOM 6782  C C      . THR B 2 23  ? -6.484  29.757  -9.995  1.00 0.00  ? 110 THR A C      5  
ATOM 6783  O O      . THR B 2 23  ? -6.504  28.996  -9.027  1.00 0.00  ? 110 THR A O      5  
ATOM 6784  C CB     . THR B 2 23  ? -4.095  30.464  -10.157 1.00 0.00  ? 110 THR A CB     5  
ATOM 6785  O OG1    . THR B 2 23  ? -4.339  31.851  -10.020 1.00 0.00  ? 110 THR A OG1    5  
ATOM 6786  C CG2    . THR B 2 23  ? -2.753  30.289  -10.867 1.00 0.00  ? 110 THR A CG2    5  
ATOM 6787  H H      . THR B 2 23  ? -5.827  31.438  -12.157 1.00 0.00  ? 110 THR A H      5  
ATOM 6788  H HA     . THR B 2 23  ? -4.973  28.761  -11.092 1.00 0.00  ? 110 THR A HA     5  
ATOM 6789  H HB     . THR B 2 23  ? -4.016  30.016  -9.165  1.00 0.00  ? 110 THR A HB     5  
ATOM 6790  H HG1    . THR B 2 23  ? -3.630  32.218  -9.460  1.00 0.00  ? 110 THR A HG1    5  
ATOM 6791  H HG21   . THR B 2 23  ? -2.550  29.225  -11.008 1.00 0.00  ? 110 THR A HG21   5  
ATOM 6792  H HG22   . THR B 2 23  ? -2.765  30.783  -11.837 1.00 0.00  ? 110 THR A HG22   5  
ATOM 6793  H HG23   . THR B 2 23  ? -1.958  30.722  -10.258 1.00 0.00  ? 110 THR A HG23   5  
ATOM 6794  N N      . GLU B 2 24  ? -7.538  30.515  -10.310 1.00 0.00  ? 111 GLU A N      5  
ATOM 6795  C CA     . GLU B 2 24  ? -8.792  30.652  -9.552  1.00 0.00  ? 111 GLU A CA     5  
ATOM 6796  C C      . GLU B 2 24  ? -9.591  29.346  -9.358  1.00 0.00  ? 111 GLU A C      5  
ATOM 6797  O O      . GLU B 2 24  ? -10.421 29.260  -8.451  1.00 0.00  ? 111 GLU A O      5  
ATOM 6798  C CB     . GLU B 2 24  ? -9.662  31.747  -10.202 1.00 0.00  ? 111 GLU A CB     5  
ATOM 6799  C CG     . GLU B 2 24  ? -10.280 31.408  -11.576 1.00 0.00  ? 111 GLU A CG     5  
ATOM 6800  C CD     . GLU B 2 24  ? -9.248  31.091  -12.675 1.00 0.00  ? 111 GLU A CD     5  
ATOM 6801  O OE1    . GLU B 2 24  ? -8.202  31.777  -12.773 1.00 0.00  ? 111 GLU A OE1    5  
ATOM 6802  O OE2    . GLU B 2 24  ? -9.443  30.127  -13.450 1.00 0.00  ? 111 GLU A OE2    5  
ATOM 6803  H H      . GLU B 2 24  ? -7.447  31.097  -11.139 1.00 0.00  ? 111 GLU A H      5  
ATOM 6804  H HA     . GLU B 2 24  ? -8.536  31.004  -8.552  1.00 0.00  ? 111 GLU A HA     5  
ATOM 6805  H HB2    . GLU B 2 24  ? -10.479 31.973  -9.519  1.00 0.00  ? 111 GLU A HB2    5  
ATOM 6806  H HB3    . GLU B 2 24  ? -9.069  32.659  -10.296 1.00 0.00  ? 111 GLU A HB3    5  
ATOM 6807  H HG2    . GLU B 2 24  ? -10.958 30.560  -11.447 1.00 0.00  ? 111 GLU A HG2    5  
ATOM 6808  H HG3    . GLU B 2 24  ? -10.881 32.261  -11.893 1.00 0.00  ? 111 GLU A HG3    5  
ATOM 6809  N N      . ASN B 2 25  ? -9.321  28.316  -10.170 1.00 0.00  ? 112 ASN A N      5  
ATOM 6810  C CA     . ASN B 2 25  ? -9.847  26.956  -10.012 1.00 0.00  ? 112 ASN A CA     5  
ATOM 6811  C C      . ASN B 2 25  ? -9.501  26.345  -8.633  1.00 0.00  ? 112 ASN A C      5  
ATOM 6812  O O      . ASN B 2 25  ? -10.389 25.827  -7.953  1.00 0.00  ? 112 ASN A O      5  
ATOM 6813  C CB     . ASN B 2 25  ? -9.302  26.097  -11.173 1.00 0.00  ? 112 ASN A CB     5  
ATOM 6814  C CG     . ASN B 2 25  ? -9.502  24.609  -10.925 1.00 0.00  ? 112 ASN A CG     5  
ATOM 6815  O OD1    . ASN B 2 25  ? -10.611 24.101  -10.874 1.00 0.00  ? 112 ASN A OD1    5  
ATOM 6816  N ND2    . ASN B 2 25  ? -8.431  23.875  -10.722 1.00 0.00  ? 112 ASN A ND2    5  
ATOM 6817  H H      . ASN B 2 25  ? -8.662  28.493  -10.914 1.00 0.00  ? 112 ASN A H      5  
ATOM 6818  H HA     . ASN B 2 25  ? -10.937 26.980  -10.083 1.00 0.00  ? 112 ASN A HA     5  
ATOM 6819  H HB2    . ASN B 2 25  ? -9.820  26.368  -12.093 1.00 0.00  ? 112 ASN A HB2    5  
ATOM 6820  H HB3    . ASN B 2 25  ? -8.236  26.289  -11.311 1.00 0.00  ? 112 ASN A HB3    5  
ATOM 6821  H HD21   . ASN B 2 25  ? -7.508  24.274  -10.777 1.00 0.00  ? 112 ASN A HD21   5  
ATOM 6822  H HD22   . ASN B 2 25  ? -8.555  22.906  -10.440 1.00 0.00  ? 112 ASN A HD22   5  
ATOM 6823  N N      . LYS B 2 26  ? -8.216  26.393  -8.244  1.00 0.00  ? 113 LYS A N      5  
ATOM 6824  C CA     . LYS B 2 26  ? -7.553  25.785  -7.062  1.00 0.00  ? 113 LYS A CA     5  
ATOM 6825  C C      . LYS B 2 26  ? -7.677  24.257  -6.892  1.00 0.00  ? 113 LYS A C      5  
ATOM 6826  O O      . LYS B 2 26  ? -6.691  23.619  -6.518  1.00 0.00  ? 113 LYS A O      5  
ATOM 6827  C CB     . LYS B 2 26  ? -7.963  26.532  -5.778  1.00 0.00  ? 113 LYS A CB     5  
ATOM 6828  C CG     . LYS B 2 26  ? -7.578  28.020  -5.816  1.00 0.00  ? 113 LYS A CG     5  
ATOM 6829  C CD     . LYS B 2 26  ? -7.920  28.717  -4.495  1.00 0.00  ? 113 LYS A CD     5  
ATOM 6830  C CE     . LYS B 2 26  ? -7.514  30.197  -4.558  1.00 0.00  ? 113 LYS A CE     5  
ATOM 6831  N NZ     . LYS B 2 26  ? -7.818  30.904  -3.286  1.00 0.00  ? 113 LYS A NZ     5  
ATOM 6832  H H      . LYS B 2 26  ? -7.622  26.949  -8.848  1.00 0.00  ? 113 LYS A H      5  
ATOM 6833  H HA     . LYS B 2 26  ? -6.481  25.955  -7.183  1.00 0.00  ? 113 LYS A HA     5  
ATOM 6834  H HB2    . LYS B 2 26  ? -9.040  26.438  -5.621  1.00 0.00  ? 113 LYS A HB2    5  
ATOM 6835  H HB3    . LYS B 2 26  ? -7.456  26.069  -4.930  1.00 0.00  ? 113 LYS A HB3    5  
ATOM 6836  H HG2    . LYS B 2 26  ? -6.505  28.108  -5.998  1.00 0.00  ? 113 LYS A HG2    5  
ATOM 6837  H HG3    . LYS B 2 26  ? -8.116  28.518  -6.622  1.00 0.00  ? 113 LYS A HG3    5  
ATOM 6838  H HD2    . LYS B 2 26  ? -8.998  28.635  -4.314  1.00 0.00  ? 113 LYS A HD2    5  
ATOM 6839  H HD3    . LYS B 2 26  ? -7.385  28.228  -3.678  1.00 0.00  ? 113 LYS A HD3    5  
ATOM 6840  H HE2    . LYS B 2 26  ? -6.443  30.252  -4.771  1.00 0.00  ? 113 LYS A HE2    5  
ATOM 6841  H HE3    . LYS B 2 26  ? -8.044  30.672  -5.388  1.00 0.00  ? 113 LYS A HE3    5  
ATOM 6842  H HZ1    . LYS B 2 26  ? -8.805  30.871  -3.074  1.00 0.00  ? 113 LYS A HZ1    5  
ATOM 6843  H HZ2    . LYS B 2 26  ? -7.315  30.502  -2.508  1.00 0.00  ? 113 LYS A HZ2    5  
ATOM 6844  H HZ3    . LYS B 2 26  ? -7.552  31.878  -3.340  1.00 0.00  ? 113 LYS A HZ3    5  
ATOM 6845  N N      . SER B 2 27  ? -8.841  23.664  -7.167  1.00 0.00  ? 114 SER A N      5  
ATOM 6846  C CA     . SER B 2 27  ? -9.146  22.230  -7.058  1.00 0.00  ? 114 SER A CA     5  
ATOM 6847  C C      . SER B 2 27  ? -8.221  21.359  -7.924  1.00 0.00  ? 114 SER A C      5  
ATOM 6848  O O      . SER B 2 27  ? -8.180  21.496  -9.151  1.00 0.00  ? 114 SER A O      5  
ATOM 6849  C CB     . SER B 2 27  ? -10.611 21.979  -7.425  1.00 0.00  ? 114 SER A CB     5  
ATOM 6850  O OG     . SER B 2 27  ? -10.955 20.634  -7.141  1.00 0.00  ? 114 SER A OG     5  
ATOM 6851  H H      . SER B 2 27  ? -9.582  24.294  -7.447  1.00 0.00  ? 114 SER A H      5  
ATOM 6852  H HA     . SER B 2 27  ? -9.015  21.939  -6.015  1.00 0.00  ? 114 SER A HA     5  
ATOM 6853  H HB2    . SER B 2 27  ? -11.243 22.648  -6.842  1.00 0.00  ? 114 SER A HB2    5  
ATOM 6854  H HB3    . SER B 2 27  ? -10.770 22.187  -8.487  1.00 0.00  ? 114 SER A HB3    5  
ATOM 6855  H HG     . SER B 2 27  ? -11.899 20.504  -7.358  1.00 0.00  ? 114 SER A HG     5  
ATOM 6856  N N      . GLN B 2 28  ? -7.449  20.484  -7.276  1.00 0.00  ? 115 GLN A N      5  
ATOM 6857  C CA     . GLN B 2 28  ? -6.408  19.635  -7.876  1.00 0.00  ? 115 GLN A CA     5  
ATOM 6858  C C      . GLN B 2 28  ? -6.252  18.308  -7.096  1.00 0.00  ? 115 GLN A C      5  
ATOM 6859  O O      . GLN B 2 28  ? -6.703  18.237  -5.946  1.00 0.00  ? 115 GLN A O      5  
ATOM 6860  C CB     . GLN B 2 28  ? -5.094  20.441  -7.914  1.00 0.00  ? 115 GLN A CB     5  
ATOM 6861  C CG     . GLN B 2 28  ? -4.524  20.773  -6.523  1.00 0.00  ? 115 GLN A CG     5  
ATOM 6862  C CD     . GLN B 2 28  ? -3.451  21.854  -6.600  1.00 0.00  ? 115 GLN A CD     5  
ATOM 6863  O OE1    . GLN B 2 28  ? -2.258  21.589  -6.699  1.00 0.00  ? 115 GLN A OE1    5  
ATOM 6864  N NE2    . GLN B 2 28  ? -3.831  23.113  -6.555  1.00 0.00  ? 115 GLN A NE2    5  
ATOM 6865  H H      . GLN B 2 28  ? -7.571  20.408  -6.273  1.00 0.00  ? 115 GLN A H      5  
ATOM 6866  H HA     . GLN B 2 28  ? -6.706  19.399  -8.900  1.00 0.00  ? 115 GLN A HA     5  
ATOM 6867  H HB2    . GLN B 2 28  ? -4.341  19.894  -8.478  1.00 0.00  ? 115 GLN A HB2    5  
ATOM 6868  H HB3    . GLN B 2 28  ? -5.281  21.371  -8.451  1.00 0.00  ? 115 GLN A HB3    5  
ATOM 6869  H HG2    . GLN B 2 28  ? -5.316  21.122  -5.861  1.00 0.00  ? 115 GLN A HG2    5  
ATOM 6870  H HG3    . GLN B 2 28  ? -4.096  19.875  -6.080  1.00 0.00  ? 115 GLN A HG3    5  
ATOM 6871  H HE21   . GLN B 2 28  ? -4.819  23.340  -6.476  1.00 0.00  ? 115 GLN A HE21   5  
ATOM 6872  H HE22   . GLN B 2 28  ? -3.120  23.826  -6.601  1.00 0.00  ? 115 GLN A HE22   5  
ATOM 6873  N N      . PRO B 2 29  ? -5.625  17.257  -7.675  1.00 0.00  ? 116 PRO A N      5  
ATOM 6874  C CA     . PRO B 2 29  ? -5.388  15.966  -7.017  1.00 0.00  ? 116 PRO A CA     5  
ATOM 6875  C C      . PRO B 2 29  ? -4.822  16.057  -5.589  1.00 0.00  ? 116 PRO A C      5  
ATOM 6876  O O      . PRO B 2 29  ? -3.880  16.803  -5.309  1.00 0.00  ? 116 PRO A O      5  
ATOM 6877  C CB     . PRO B 2 29  ? -4.452  15.201  -7.956  1.00 0.00  ? 116 PRO A CB     5  
ATOM 6878  C CG     . PRO B 2 29  ? -4.903  15.698  -9.325  1.00 0.00  ? 116 PRO A CG     5  
ATOM 6879  C CD     . PRO B 2 29  ? -5.182  17.178  -9.063  1.00 0.00  ? 116 PRO A CD     5  
ATOM 6880  H HA     . PRO B 2 29  ? -6.341  15.439  -6.990  1.00 0.00  ? 116 PRO A HA     5  
ATOM 6881  H HB2    . PRO B 2 29  ? -3.418  15.499  -7.780  1.00 0.00  ? 116 PRO A HB2    5  
ATOM 6882  H HB3    . PRO B 2 29  ? -4.570  14.122  -7.860  1.00 0.00  ? 116 PRO A HB3    5  
ATOM 6883  H HG2    . PRO B 2 29  ? -4.138  15.558  -10.089 1.00 0.00  ? 116 PRO A HG2    5  
ATOM 6884  H HG3    . PRO B 2 29  ? -5.825  15.190  -9.611  1.00 0.00  ? 116 PRO A HG3    5  
ATOM 6885  H HD2    . PRO B 2 29  ? -4.260  17.746  -9.188  1.00 0.00  ? 116 PRO A HD2    5  
ATOM 6886  H HD3    . PRO B 2 29  ? -5.949  17.533  -9.753  1.00 0.00  ? 116 PRO A HD3    5  
ATOM 6887  N N      . LYS B 2 30  ? -5.420  15.260  -4.694  1.00 0.00  ? 117 LYS A N      5  
ATOM 6888  C CA     . LYS B 2 30  ? -5.122  15.034  -3.279  1.00 0.00  ? 117 LYS A CA     5  
ATOM 6889  C C      . LYS B 2 30  ? -5.818  13.728  -2.875  1.00 0.00  ? 117 LYS A C      5  
ATOM 6890  O O      . LYS B 2 30  ? -6.410  13.062  -3.732  1.00 0.00  ? 117 LYS A O      5  
ATOM 6891  C CB     . LYS B 2 30  ? -5.458  16.257  -2.407  1.00 0.00  ? 117 LYS A CB     5  
ATOM 6892  C CG     . LYS B 2 30  ? -6.918  16.727  -2.442  1.00 0.00  ? 117 LYS A CG     5  
ATOM 6893  C CD     . LYS B 2 30  ? -7.100  17.952  -1.531  1.00 0.00  ? 117 LYS A CD     5  
ATOM 6894  C CE     . LYS B 2 30  ? -8.552  18.436  -1.548  1.00 0.00  ? 117 LYS A CE     5  
ATOM 6895  N NZ     . LYS B 2 30  ? -8.746  19.610  -0.661  1.00 0.00  ? 117 LYS A NZ     5  
ATOM 6896  H H      . LYS B 2 30  ? -6.051  14.548  -5.036  1.00 0.00  ? 117 LYS A H      5  
ATOM 6897  H HA     . LYS B 2 30  ? -4.055  14.869  -3.175  1.00 0.00  ? 117 LYS A HA     5  
ATOM 6898  H HB2    . LYS B 2 30  ? -5.186  16.026  -1.379  1.00 0.00  ? 117 LYS A HB2    5  
ATOM 6899  H HB3    . LYS B 2 30  ? -4.809  17.073  -2.736  1.00 0.00  ? 117 LYS A HB3    5  
ATOM 6900  H HG2    . LYS B 2 30  ? -7.191  16.994  -3.462  1.00 0.00  ? 117 LYS A HG2    5  
ATOM 6901  H HG3    . LYS B 2 30  ? -7.564  15.919  -2.093  1.00 0.00  ? 117 LYS A HG3    5  
ATOM 6902  H HD2    . LYS B 2 30  ? -6.824  17.684  -0.508  1.00 0.00  ? 117 LYS A HD2    5  
ATOM 6903  H HD3    . LYS B 2 30  ? -6.447  18.752  -1.881  1.00 0.00  ? 117 LYS A HD3    5  
ATOM 6904  H HE2    . LYS B 2 30  ? -8.822  18.697  -2.577  1.00 0.00  ? 117 LYS A HE2    5  
ATOM 6905  H HE3    . LYS B 2 30  ? -9.203  17.617  -1.232  1.00 0.00  ? 117 LYS A HE3    5  
ATOM 6906  H HZ1    . LYS B 2 30  ? -8.533  19.385  0.300   1.00 0.00  ? 117 LYS A HZ1    5  
ATOM 6907  H HZ2    . LYS B 2 30  ? -8.159  20.384  -0.942  1.00 0.00  ? 117 LYS A HZ2    5  
ATOM 6908  H HZ3    . LYS B 2 30  ? -9.705  19.927  -0.687  1.00 0.00  ? 117 LYS A HZ3    5  
ATOM 6909  N N      . ARG B 2 31  ? -5.581  13.249  -1.659  1.00 0.00  ? 118 ARG A N      5  
ATOM 6910  C CA     . ARG B 2 31  ? -5.259  11.819  -1.525  1.00 0.00  ? 118 ARG A CA     5  
ATOM 6911  C C      . ARG B 2 31  ? -6.337  10.903  -0.947  1.00 0.00  ? 118 ARG A C      5  
ATOM 6912  O O      . ARG B 2 31  ? -7.384  11.349  -0.483  1.00 0.00  ? 118 ARG A O      5  
ATOM 6913  C CB     . ARG B 2 31  ? -3.823  11.662  -1.056  1.00 0.00  ? 118 ARG A CB     5  
ATOM 6914  C CG     . ARG B 2 31  ? -3.528  12.195  0.336   1.00 0.00  ? 118 ARG A CG     5  
ATOM 6915  C CD     . ARG B 2 31  ? -2.013  12.314  0.475   1.00 0.00  ? 118 ARG A CD     5  
ATOM 6916  N NE     . ARG B 2 31  ? -1.370  11.081  0.967   1.00 0.00  ? 118 ARG A NE     5  
ATOM 6917  C CZ     . ARG B 2 31  ? -0.673  10.181  0.296   1.00 0.00  ? 118 ARG A CZ     5  
ATOM 6918  N NH1    . ARG B 2 31  ? -0.578  10.143  -1.002  1.00 0.00  ? 118 ARG A NH1    5  
ATOM 6919  N NH2    . ARG B 2 31  ? -0.024  9.261   0.938   1.00 0.00  ? 118 ARG A NH2    5  
ATOM 6920  H H      . ARG B 2 31  ? -5.192  13.897  -0.989  1.00 0.00  ? 118 ARG A H      5  
ATOM 6921  H HA     . ARG B 2 31  ? -5.168  11.432  -2.527  1.00 0.00  ? 118 ARG A HA     5  
ATOM 6922  H HB2    . ARG B 2 31  ? -3.510  10.620  -1.108  1.00 0.00  ? 118 ARG A HB2    5  
ATOM 6923  H HB3    . ARG B 2 31  ? -3.251  12.244  -1.788  1.00 0.00  ? 118 ARG A HB3    5  
ATOM 6924  H HG2    . ARG B 2 31  ? -3.967  13.185  0.452   1.00 0.00  ? 118 ARG A HG2    5  
ATOM 6925  H HG3    . ARG B 2 31  ? -3.944  11.534  1.098   1.00 0.00  ? 118 ARG A HG3    5  
ATOM 6926  H HD2    . ARG B 2 31  ? -1.550  12.645  -0.456  1.00 0.00  ? 118 ARG A HD2    5  
ATOM 6927  H HD3    . ARG B 2 31  ? -1.867  13.108  1.190   1.00 0.00  ? 118 ARG A HD3    5  
ATOM 6928  H HE     . ARG B 2 31  ? -1.409  10.940  1.969   1.00 0.00  ? 118 ARG A HE     5  
ATOM 6929  H HH11   . ARG B 2 31  ? -1.003  10.856  -1.585  1.00 0.00  ? 118 ARG A HH11   5  
ATOM 6930  H HH12   . ARG B 2 31  ? -0.038  9.424   -1.445  1.00 0.00  ? 118 ARG A HH12   5  
ATOM 6931  H HH21   . ARG B 2 31  ? -0.083  9.245   1.951   1.00 0.00  ? 118 ARG A HH21   5  
ATOM 6932  H HH22   . ARG B 2 31  ? 0.534   8.585   0.452   1.00 0.00  ? 118 ARG A HH22   5  
ATOM 6933  N N      . LEU B 2 32  ? -6.102  9.608   -1.140  1.00 0.00  ? 119 LEU A N      5  
ATOM 6934  C CA     . LEU B 2 32  ? -7.104  8.585   -1.422  1.00 0.00  ? 119 LEU A CA     5  
ATOM 6935  C C      . LEU B 2 32  ? -6.672  7.256   -0.782  1.00 0.00  ? 119 LEU A C      5  
ATOM 6936  O O      . LEU B 2 32  ? -5.643  6.700   -1.158  1.00 0.00  ? 119 LEU A O      5  
ATOM 6937  C CB     . LEU B 2 32  ? -7.232  8.500   -2.965  1.00 0.00  ? 119 LEU A CB     5  
ATOM 6938  C CG     . LEU B 2 32  ? -8.207  7.444   -3.504  1.00 0.00  ? 119 LEU A CG     5  
ATOM 6939  C CD1    . LEU B 2 32  ? -9.647  7.655   -3.029  1.00 0.00  ? 119 LEU A CD1    5  
ATOM 6940  C CD2    . LEU B 2 32  ? -8.232  7.454   -5.029  1.00 0.00  ? 119 LEU A CD2    5  
ATOM 6941  H H      . LEU B 2 32  ? -5.197  9.409   -1.547  1.00 0.00  ? 119 LEU A H      5  
ATOM 6942  H HA     . LEU B 2 32  ? -8.056  8.885   -0.985  1.00 0.00  ? 119 LEU A HA     5  
ATOM 6943  H HB2    . LEU B 2 32  ? -7.492  9.485   -3.356  1.00 0.00  ? 119 LEU A HB2    5  
ATOM 6944  H HB3    . LEU B 2 32  ? -6.258  8.238   -3.377  1.00 0.00  ? 119 LEU A HB3    5  
ATOM 6945  H HG     . LEU B 2 32  ? -7.837  6.466   -3.200  1.00 0.00  ? 119 LEU A HG     5  
ATOM 6946  H HD11   . LEU B 2 32  ? -9.700  8.346   -2.195  1.00 0.00  ? 119 LEU A HD11   5  
ATOM 6947  H HD12   . LEU B 2 32  ? -10.278 8.064   -3.818  1.00 0.00  ? 119 LEU A HD12   5  
ATOM 6948  H HD13   . LEU B 2 32  ? -10.058 6.699   -2.705  1.00 0.00  ? 119 LEU A HD13   5  
ATOM 6949  H HD21   . LEU B 2 32  ? -8.600  8.418   -5.370  1.00 0.00  ? 119 LEU A HD21   5  
ATOM 6950  H HD22   . LEU B 2 32  ? -7.236  7.276   -5.425  1.00 0.00  ? 119 LEU A HD22   5  
ATOM 6951  H HD23   . LEU B 2 32  ? -8.893  6.666   -5.385  1.00 0.00  ? 119 LEU A HD23   5  
ATOM 6952  N N      . HIS B 2 33  ? -7.428  6.781   0.210   1.00 0.00  ? 120 HIS A N      5  
ATOM 6953  C CA     . HIS B 2 33  ? -7.190  5.546   0.969   1.00 0.00  ? 120 HIS A CA     5  
ATOM 6954  C C      . HIS B 2 33  ? -7.751  4.348   0.185   1.00 0.00  ? 120 HIS A C      5  
ATOM 6955  O O      . HIS B 2 33  ? -8.905  4.342   -0.237  1.00 0.00  ? 120 HIS A O      5  
ATOM 6956  C CB     . HIS B 2 33  ? -7.899  5.713   2.330   1.00 0.00  ? 120 HIS A CB     5  
ATOM 6957  C CG     . HIS B 2 33  ? -8.067  4.474   3.173   1.00 0.00  ? 120 HIS A CG     5  
ATOM 6958  N ND1    . HIS B 2 33  ? -9.206  3.666   3.220   1.00 0.00  ? 120 HIS A ND1    5  
ATOM 6959  C CD2    . HIS B 2 33  ? -7.212  4.086   4.160   1.00 0.00  ? 120 HIS A CD2    5  
ATOM 6960  C CE1    . HIS B 2 33  ? -9.006  2.806   4.233   1.00 0.00  ? 120 HIS A CE1    5  
ATOM 6961  N NE2    . HIS B 2 33  ? -7.809  3.025   4.803   1.00 0.00  ? 120 HIS A NE2    5  
ATOM 6962  H H      . HIS B 2 33  ? -8.334  7.222   0.338   1.00 0.00  ? 120 HIS A H      5  
ATOM 6963  H HA     . HIS B 2 33  ? -6.106  5.385   1.107   1.00 0.00  ? 120 HIS A HA     5  
ATOM 6964  H HB2    . HIS B 2 33  ? -7.353  6.436   2.935   1.00 0.00  ? 120 HIS A HB2    5  
ATOM 6965  H HB3    . HIS B 2 33  ? -8.894  6.126   2.153   1.00 0.00  ? 120 HIS A HB3    5  
ATOM 6966  H HD2    . HIS B 2 33  ? -6.282  4.569   4.420   1.00 0.00  ? 120 HIS A HD2    5  
ATOM 6967  H HE1    . HIS B 2 33  ? -9.712  2.047   4.547   1.00 0.00  ? 120 HIS A HE1    5  
ATOM 6968  H HE2    . HIS B 2 33  ? -7.425  2.507   5.586   1.00 0.00  ? 120 HIS A HE2    5  
ATOM 6969  N N      . VAL B 2 34  ? -6.913  3.343   -0.054  1.00 0.00  ? 121 VAL A N      5  
ATOM 6970  C CA     . VAL B 2 34  ? -7.111  2.282   -1.055  1.00 0.00  ? 121 VAL A CA     5  
ATOM 6971  C C      . VAL B 2 34  ? -6.962  0.936   -0.366  1.00 0.00  ? 121 VAL A C      5  
ATOM 6972  O O      . VAL B 2 34  ? -5.846  0.493   -0.121  1.00 0.00  ? 121 VAL A O      5  
ATOM 6973  C CB     . VAL B 2 34  ? -6.104  2.505   -2.196  1.00 0.00  ? 121 VAL A CB     5  
ATOM 6974  C CG1    . VAL B 2 34  ? -5.991  1.375   -3.214  1.00 0.00  ? 121 VAL A CG1    5  
ATOM 6975  C CG2    . VAL B 2 34  ? -6.505  3.746   -2.992  1.00 0.00  ? 121 VAL A CG2    5  
ATOM 6976  H H      . VAL B 2 34  ? -5.983  3.428   0.346   1.00 0.00  ? 121 VAL A H      5  
ATOM 6977  H HA     . VAL B 2 34  ? -8.118  2.328   -1.472  1.00 0.00  ? 121 VAL A HA     5  
ATOM 6978  H HB     . VAL B 2 34  ? -5.109  2.661   -1.778  1.00 0.00  ? 121 VAL A HB     5  
ATOM 6979  H HG11   . VAL B 2 34  ? -5.687  0.452   -2.727  1.00 0.00  ? 121 VAL A HG11   5  
ATOM 6980  H HG12   . VAL B 2 34  ? -6.936  1.231   -3.735  1.00 0.00  ? 121 VAL A HG12   5  
ATOM 6981  H HG13   . VAL B 2 34  ? -5.214  1.658   -3.924  1.00 0.00  ? 121 VAL A HG13   5  
ATOM 6982  H HG21   . VAL B 2 34  ? -7.522  3.637   -3.360  1.00 0.00  ? 121 VAL A HG21   5  
ATOM 6983  H HG22   . VAL B 2 34  ? -6.447  4.633   -2.367  1.00 0.00  ? 121 VAL A HG22   5  
ATOM 6984  H HG23   . VAL B 2 34  ? -5.832  3.871   -3.836  1.00 0.00  ? 121 VAL A HG23   5  
ATOM 6985  N N      . SER B 2 35  ? -8.085  0.334   0.024   1.00 0.00  ? 122 SER A N      5  
ATOM 6986  C CA     . SER B 2 35  ? -8.209  -0.646  1.113   1.00 0.00  ? 122 SER A CA     5  
ATOM 6987  C C      . SER B 2 35  ? -8.822  -1.988  0.702   1.00 0.00  ? 122 SER A C      5  
ATOM 6988  O O      . SER B 2 35  ? -9.321  -2.151  -0.415  1.00 0.00  ? 122 SER A O      5  
ATOM 6989  C CB     . SER B 2 35  ? -9.002  -0.026  2.272   1.00 0.00  ? 122 SER A CB     5  
ATOM 6990  O OG     . SER B 2 35  ? -10.282 0.423   1.879   1.00 0.00  ? 122 SER A OG     5  
ATOM 6991  H H      . SER B 2 35  ? -8.947  0.727   -0.337  1.00 0.00  ? 122 SER A H      5  
ATOM 6992  H HA     . SER B 2 35  ? -7.215  -0.868  1.488   1.00 0.00  ? 122 SER A HA     5  
ATOM 6993  H HB2    . SER B 2 35  ? -9.148  -0.764  3.059   1.00 0.00  ? 122 SER A HB2    5  
ATOM 6994  H HB3    . SER B 2 35  ? -8.425  0.808   2.668   1.00 0.00  ? 122 SER A HB3    5  
ATOM 6995  H HG     . SER B 2 35  ? -10.196 1.026   1.121   1.00 0.00  ? 122 SER A HG     5  
ATOM 6996  N N      . ASN B 2 36  ? -8.743  -2.970  1.614   1.00 0.00  ? 123 ASN A N      5  
ATOM 6997  C CA     . ASN B 2 36  ? -9.110  -4.383  1.437   1.00 0.00  ? 123 ASN A CA     5  
ATOM 6998  C C      . ASN B 2 36  ? -8.287  -5.112  0.358   1.00 0.00  ? 123 ASN A C      5  
ATOM 6999  O O      . ASN B 2 36  ? -8.576  -6.257  0.013   1.00 0.00  ? 123 ASN A O      5  
ATOM 7000  C CB     . ASN B 2 36  ? -10.639 -4.486  1.263   1.00 0.00  ? 123 ASN A CB     5  
ATOM 7001  C CG     . ASN B 2 36  ? -11.139 -5.916  1.306   1.00 0.00  ? 123 ASN A CG     5  
ATOM 7002  O OD1    . ASN B 2 36  ? -10.880 -6.653  2.247   1.00 0.00  ? 123 ASN A OD1    5  
ATOM 7003  N ND2    . ASN B 2 36  ? -11.832 -6.366  0.287   1.00 0.00  ? 123 ASN A ND2    5  
ATOM 7004  H H      . ASN B 2 36  ? -8.216  -2.762  2.452   1.00 0.00  ? 123 ASN A H      5  
ATOM 7005  H HA     . ASN B 2 36  ? -8.838  -4.914  2.352   1.00 0.00  ? 123 ASN A HA     5  
ATOM 7006  H HB2    . ASN B 2 36  ? -11.136 -3.936  2.060   1.00 0.00  ? 123 ASN A HB2    5  
ATOM 7007  H HB3    . ASN B 2 36  ? -10.928 -4.035  0.315   1.00 0.00  ? 123 ASN A HB3    5  
ATOM 7008  H HD21   . ASN B 2 36  ? -12.005 -5.737  -0.497  1.00 0.00  ? 123 ASN A HD21   5  
ATOM 7009  H HD22   . ASN B 2 36  ? -12.218 -7.293  0.332   1.00 0.00  ? 123 ASN A HD22   5  
ATOM 7010  N N      . ILE B 2 37  ? -7.226  -4.473  -0.137  1.00 0.00  ? 124 ILE A N      5  
ATOM 7011  C CA     . ILE B 2 37  ? -6.376  -4.961  -1.222  1.00 0.00  ? 124 ILE A CA     5  
ATOM 7012  C C      . ILE B 2 37  ? -5.677  -6.276  -0.825  1.00 0.00  ? 124 ILE A C      5  
ATOM 7013  O O      . ILE B 2 37  ? -5.418  -6.475  0.367   1.00 0.00  ? 124 ILE A O      5  
ATOM 7014  C CB     . ILE B 2 37  ? -5.365  -3.860  -1.631  1.00 0.00  ? 124 ILE A CB     5  
ATOM 7015  C CG1    . ILE B 2 37  ? -4.151  -3.782  -0.680  1.00 0.00  ? 124 ILE A CG1    5  
ATOM 7016  C CG2    . ILE B 2 37  ? -6.059  -2.486  -1.711  1.00 0.00  ? 124 ILE A CG2    5  
ATOM 7017  C CD1    . ILE B 2 37  ? -3.273  -2.551  -0.889  1.00 0.00  ? 124 ILE A CD1    5  
ATOM 7018  H H      . ILE B 2 37  ? -6.985  -3.579  0.265   1.00 0.00  ? 124 ILE A H      5  
ATOM 7019  H HA     . ILE B 2 37  ? -7.032  -5.147  -2.072  1.00 0.00  ? 124 ILE A HA     5  
ATOM 7020  H HB     . ILE B 2 37  ? -4.995  -4.105  -2.626  1.00 0.00  ? 124 ILE A HB     5  
ATOM 7021  H HG12   . ILE B 2 37  ? -4.491  -3.784  0.354   1.00 0.00  ? 124 ILE A HG12   5  
ATOM 7022  H HG13   . ILE B 2 37  ? -3.528  -4.662  -0.829  1.00 0.00  ? 124 ILE A HG13   5  
ATOM 7023  H HG21   . ILE B 2 37  ? -7.044  -2.581  -2.168  1.00 0.00  ? 124 ILE A HG21   5  
ATOM 7024  H HG22   . ILE B 2 37  ? -6.146  -2.065  -0.704  1.00 0.00  ? 124 ILE A HG22   5  
ATOM 7025  H HG23   . ILE B 2 37  ? -5.459  -1.809  -2.317  1.00 0.00  ? 124 ILE A HG23   5  
ATOM 7026  H HD11   . ILE B 2 37  ? -3.041  -2.451  -1.949  1.00 0.00  ? 124 ILE A HD11   5  
ATOM 7027  H HD12   . ILE B 2 37  ? -3.809  -1.663  -0.564  1.00 0.00  ? 124 ILE A HD12   5  
ATOM 7028  H HD13   . ILE B 2 37  ? -2.363  -2.661  -0.303  1.00 0.00  ? 124 ILE A HD13   5  
ATOM 7029  N N      . PRO B 2 38  ? -5.332  -7.154  -1.780  1.00 0.00  ? 125 PRO A N      5  
ATOM 7030  C CA     . PRO B 2 38  ? -4.466  -8.308  -1.531  1.00 0.00  ? 125 PRO A CA     5  
ATOM 7031  C C      . PRO B 2 38  ? -3.156  -7.888  -0.868  1.00 0.00  ? 125 PRO A C      5  
ATOM 7032  O O      . PRO B 2 38  ? -2.474  -7.003  -1.376  1.00 0.00  ? 125 PRO A O      5  
ATOM 7033  C CB     . PRO B 2 38  ? -4.197  -8.933  -2.908  1.00 0.00  ? 125 PRO A CB     5  
ATOM 7034  C CG     . PRO B 2 38  ? -5.405  -8.486  -3.718  1.00 0.00  ? 125 PRO A CG     5  
ATOM 7035  C CD     . PRO B 2 38  ? -5.701  -7.091  -3.182  1.00 0.00  ? 125 PRO A CD     5  
ATOM 7036  H HA     . PRO B 2 38  ? -4.996  -9.022  -0.902  1.00 0.00  ? 125 PRO A HA     5  
ATOM 7037  H HB2    . PRO B 2 38  ? -3.291  -8.522  -3.356  1.00 0.00  ? 125 PRO A HB2    5  
ATOM 7038  H HB3    . PRO B 2 38  ? -4.135  -10.023 -2.853  1.00 0.00  ? 125 PRO A HB3    5  
ATOM 7039  H HG2    . PRO B 2 38  ? -5.215  -8.467  -4.785  1.00 0.00  ? 125 PRO A HG2    5  
ATOM 7040  H HG3    . PRO B 2 38  ? -6.229  -9.158  -3.492  1.00 0.00  ? 125 PRO A HG3    5  
ATOM 7041  H HD2    . PRO B 2 38  ? -5.080  -6.354  -3.691  1.00 0.00  ? 125 PRO A HD2    5  
ATOM 7042  H HD3    . PRO B 2 38  ? -6.754  -6.856  -3.322  1.00 0.00  ? 125 PRO A HD3    5  
ATOM 7043  N N      . PHE B 2 39  ? -2.748  -8.537  0.224   1.00 0.00  ? 126 PHE A N      5  
ATOM 7044  C CA     . PHE B 2 39  ? -1.499  -8.204  0.932   1.00 0.00  ? 126 PHE A CA     5  
ATOM 7045  C C      . PHE B 2 39  ? -0.214  -8.172  0.081   1.00 0.00  ? 126 PHE A C      5  
ATOM 7046  O O      . PHE B 2 39  ? 0.772   -7.548  0.485   1.00 0.00  ? 126 PHE A O      5  
ATOM 7047  C CB     . PHE B 2 39  ? -1.305  -9.174  2.101   1.00 0.00  ? 126 PHE A CB     5  
ATOM 7048  C CG     . PHE B 2 39  ? -2.209  -8.947  3.293   1.00 0.00  ? 126 PHE A CG     5  
ATOM 7049  C CD1    . PHE B 2 39  ? -2.480  -7.647  3.773   1.00 0.00  ? 126 PHE A CD1    5  
ATOM 7050  C CD2    . PHE B 2 39  ? -2.700  -10.067 3.986   1.00 0.00  ? 126 PHE A CD2    5  
ATOM 7051  C CE1    . PHE B 2 39  ? -3.233  -7.490  4.947   1.00 0.00  ? 126 PHE A CE1    5  
ATOM 7052  C CE2    . PHE B 2 39  ? -3.389  -9.906  5.196   1.00 0.00  ? 126 PHE A CE2    5  
ATOM 7053  C CZ     . PHE B 2 39  ? -3.650  -8.613  5.671   1.00 0.00  ? 126 PHE A CZ     5  
ATOM 7054  H H      . PHE B 2 39  ? -3.418  -9.161  0.662   1.00 0.00  ? 126 PHE A H      5  
ATOM 7055  H HA     . PHE B 2 39  ? -1.601  -7.197  1.316   1.00 0.00  ? 126 PHE A HA     5  
ATOM 7056  H HB2    . PHE B 2 39  ? -1.435  -10.194 1.730   1.00 0.00  ? 126 PHE A HB2    5  
ATOM 7057  H HB3    . PHE B 2 39  ? -0.281  -9.103  2.472   1.00 0.00  ? 126 PHE A HB3    5  
ATOM 7058  H HD1    . PHE B 2 39  ? -2.072  -6.762  3.291   1.00 0.00  ? 126 PHE A HD1    5  
ATOM 7059  H HD2    . PHE B 2 39  ? -2.519  -11.059 3.608   1.00 0.00  ? 126 PHE A HD2    5  
ATOM 7060  H HE1    . PHE B 2 39  ? -3.447  -6.510  5.338   1.00 0.00  ? 126 PHE A HE1    5  
ATOM 7061  H HE2    . PHE B 2 39  ? -3.723  -10.773 5.757   1.00 0.00  ? 126 PHE A HE2    5  
ATOM 7062  H HZ     . PHE B 2 39  ? -4.169  -8.469  6.600   1.00 0.00  ? 126 PHE A HZ     5  
ATOM 7063  N N      . ARG B 2 40  ? -0.219  -8.816  -1.093  1.00 0.00  ? 127 ARG A N      5  
ATOM 7064  C CA     . ARG B 2 40  ? 0.886   -8.865  -2.064  1.00 0.00  ? 127 ARG A CA     5  
ATOM 7065  C C      . ARG B 2 40  ? 0.968   -7.619  -2.965  1.00 0.00  ? 127 ARG A C      5  
ATOM 7066  O O      . ARG B 2 40  ? 1.927   -7.494  -3.727  1.00 0.00  ? 127 ARG A O      5  
ATOM 7067  C CB     . ARG B 2 40  ? 0.790   -10.166 -2.893  1.00 0.00  ? 127 ARG A CB     5  
ATOM 7068  C CG     . ARG B 2 40  ? 1.062   -11.450 -2.083  1.00 0.00  ? 127 ARG A CG     5  
ATOM 7069  C CD     . ARG B 2 40  ? -0.123  -11.953 -1.236  1.00 0.00  ? 127 ARG A CD     5  
ATOM 7070  N NE     . ARG B 2 40  ? 0.233   -13.146 -0.445  1.00 0.00  ? 127 ARG A NE     5  
ATOM 7071  C CZ     . ARG B 2 40  ? 0.179   -14.417 -0.792  1.00 0.00  ? 127 ARG A CZ     5  
ATOM 7072  N NH1    . ARG B 2 40  ? -0.208  -14.814 -1.972  1.00 0.00  ? 127 ARG A NH1    5  
ATOM 7073  N NH2    . ARG B 2 40  ? 0.529   -15.317 0.075   1.00 0.00  ? 127 ARG A NH2    5  
ATOM 7074  H H      . ARG B 2 40  ? -1.086  -9.271  -1.333  1.00 0.00  ? 127 ARG A H      5  
ATOM 7075  H HA     . ARG B 2 40  ? 1.832   -8.889  -1.519  1.00 0.00  ? 127 ARG A HA     5  
ATOM 7076  H HB2    . ARG B 2 40  ? -0.186  -10.233 -3.379  1.00 0.00  ? 127 ARG A HB2    5  
ATOM 7077  H HB3    . ARG B 2 40  ? 1.546   -10.125 -3.677  1.00 0.00  ? 127 ARG A HB3    5  
ATOM 7078  H HG2    . ARG B 2 40  ? 1.319   -12.239 -2.790  1.00 0.00  ? 127 ARG A HG2    5  
ATOM 7079  H HG3    . ARG B 2 40  ? 1.925   -11.289 -1.435  1.00 0.00  ? 127 ARG A HG3    5  
ATOM 7080  H HD2    . ARG B 2 40  ? -0.411  -11.180 -0.524  1.00 0.00  ? 127 ARG A HD2    5  
ATOM 7081  H HD3    . ARG B 2 40  ? -0.981  -12.144 -1.889  1.00 0.00  ? 127 ARG A HD3    5  
ATOM 7082  H HE     . ARG B 2 40  ? 0.556   -13.000 0.502   1.00 0.00  ? 127 ARG A HE     5  
ATOM 7083  H HH11   . ARG B 2 40  ? -0.478  -14.129 -2.656  1.00 0.00  ? 127 ARG A HH11   5  
ATOM 7084  H HH12   . ARG B 2 40  ? -0.222  -15.792 -2.205  1.00 0.00  ? 127 ARG A HH12   5  
ATOM 7085  H HH21   . ARG B 2 40  ? 0.812   -15.001 0.997   1.00 0.00  ? 127 ARG A HH21   5  
ATOM 7086  H HH22   . ARG B 2 40  ? 0.503   -16.298 -0.151  1.00 0.00  ? 127 ARG A HH22   5  
ATOM 7087  N N      . PHE B 2 41  ? 0.008   -6.688  -2.875  1.00 0.00  ? 128 PHE A N      5  
ATOM 7088  C CA     . PHE B 2 41  ? 0.059   -5.371  -3.529  1.00 0.00  ? 128 PHE A CA     5  
ATOM 7089  C C      . PHE B 2 41  ? 1.288   -4.546  -3.120  1.00 0.00  ? 128 PHE A C      5  
ATOM 7090  O O      . PHE B 2 41  ? 1.878   -4.726  -2.050  1.00 0.00  ? 128 PHE A O      5  
ATOM 7091  C CB     . PHE B 2 41  ? -1.218  -4.568  -3.226  1.00 0.00  ? 128 PHE A CB     5  
ATOM 7092  C CG     . PHE B 2 41  ? -2.279  -4.625  -4.307  1.00 0.00  ? 128 PHE A CG     5  
ATOM 7093  C CD1    . PHE B 2 41  ? -2.614  -5.838  -4.942  1.00 0.00  ? 128 PHE A CD1    5  
ATOM 7094  C CD2    . PHE B 2 41  ? -2.914  -3.432  -4.706  1.00 0.00  ? 128 PHE A CD2    5  
ATOM 7095  C CE1    . PHE B 2 41  ? -3.554  -5.847  -5.989  1.00 0.00  ? 128 PHE A CE1    5  
ATOM 7096  C CE2    . PHE B 2 41  ? -3.864  -3.449  -5.740  1.00 0.00  ? 128 PHE A CE2    5  
ATOM 7097  C CZ     . PHE B 2 41  ? -4.169  -4.650  -6.392  1.00 0.00  ? 128 PHE A CZ     5  
ATOM 7098  H H      . PHE B 2 41  ? -0.770  -6.875  -2.256  1.00 0.00  ? 128 PHE A H      5  
ATOM 7099  H HA     . PHE B 2 41  ? 0.128   -5.524  -4.607  1.00 0.00  ? 128 PHE A HA     5  
ATOM 7100  H HB2    . PHE B 2 41  ? -1.641  -4.871  -2.273  1.00 0.00  ? 128 PHE A HB2    5  
ATOM 7101  H HB3    . PHE B 2 41  ? -0.948  -3.520  -3.096  1.00 0.00  ? 128 PHE A HB3    5  
ATOM 7102  H HD1    . PHE B 2 41  ? -2.148  -6.765  -4.644  1.00 0.00  ? 128 PHE A HD1    5  
ATOM 7103  H HD2    . PHE B 2 41  ? -2.669  -2.494  -4.233  1.00 0.00  ? 128 PHE A HD2    5  
ATOM 7104  H HE1    . PHE B 2 41  ? -3.795  -6.773  -6.491  1.00 0.00  ? 128 PHE A HE1    5  
ATOM 7105  H HE2    . PHE B 2 41  ? -4.350  -2.531  -6.032  1.00 0.00  ? 128 PHE A HE2    5  
ATOM 7106  H HZ     . PHE B 2 41  ? -4.879  -4.648  -7.205  1.00 0.00  ? 128 PHE A HZ     5  
ATOM 7107  N N      . ARG B 2 42  ? 1.654   -3.605  -3.997  1.00 0.00  ? 129 ARG A N      5  
ATOM 7108  C CA     . ARG B 2 42  ? 2.846   -2.749  -3.907  1.00 0.00  ? 129 ARG A CA     5  
ATOM 7109  C C      . ARG B 2 42  ? 2.529   -1.326  -4.364  1.00 0.00  ? 129 ARG A C      5  
ATOM 7110  O O      . ARG B 2 42  ? 1.554   -1.067  -5.069  1.00 0.00  ? 129 ARG A O      5  
ATOM 7111  C CB     . ARG B 2 42  ? 4.008   -3.374  -4.704  1.00 0.00  ? 129 ARG A CB     5  
ATOM 7112  C CG     . ARG B 2 42  ? 4.196   -4.882  -4.476  1.00 0.00  ? 129 ARG A CG     5  
ATOM 7113  C CD     . ARG B 2 42  ? 5.486   -5.376  -5.127  1.00 0.00  ? 129 ARG A CD     5  
ATOM 7114  N NE     . ARG B 2 42  ? 5.517   -6.849  -5.164  1.00 0.00  ? 129 ARG A NE     5  
ATOM 7115  C CZ     . ARG B 2 42  ? 6.488   -7.625  -5.615  1.00 0.00  ? 129 ARG A CZ     5  
ATOM 7116  N NH1    . ARG B 2 42  ? 7.600   -7.138  -6.094  1.00 0.00  ? 129 ARG A NH1    5  
ATOM 7117  N NH2    . ARG B 2 42  ? 6.356   -8.922  -5.599  1.00 0.00  ? 129 ARG A NH2    5  
ATOM 7118  H H      . ARG B 2 42  ? 1.063   -3.486  -4.812  1.00 0.00  ? 129 ARG A H      5  
ATOM 7119  H HA     . ARG B 2 42  ? 3.185   -2.667  -2.878  1.00 0.00  ? 129 ARG A HA     5  
ATOM 7120  H HB2    . ARG B 2 42  ? 3.852   -3.204  -5.769  1.00 0.00  ? 129 ARG A HB2    5  
ATOM 7121  H HB3    . ARG B 2 42  ? 4.934   -2.880  -4.404  1.00 0.00  ? 129 ARG A HB3    5  
ATOM 7122  H HG2    . ARG B 2 42  ? 4.235   -5.095  -3.407  1.00 0.00  ? 129 ARG A HG2    5  
ATOM 7123  H HG3    . ARG B 2 42  ? 3.356   -5.415  -4.926  1.00 0.00  ? 129 ARG A HG3    5  
ATOM 7124  H HD2    . ARG B 2 42  ? 5.525   -4.968  -6.138  1.00 0.00  ? 129 ARG A HD2    5  
ATOM 7125  H HD3    . ARG B 2 42  ? 6.337   -4.994  -4.559  1.00 0.00  ? 129 ARG A HD3    5  
ATOM 7126  H HE     . ARG B 2 42  ? 4.699   -7.333  -4.824  1.00 0.00  ? 129 ARG A HE     5  
ATOM 7127  H HH11   . ARG B 2 42  ? 7.720   -6.141  -6.112  1.00 0.00  ? 129 ARG A HH11   5  
ATOM 7128  H HH12   . ARG B 2 42  ? 8.326   -7.745  -6.434  1.00 0.00  ? 129 ARG A HH12   5  
ATOM 7129  H HH21   . ARG B 2 42  ? 5.513   -9.344  -5.245  1.00 0.00  ? 129 ARG A HH21   5  
ATOM 7130  H HH22   . ARG B 2 42  ? 7.096   -9.512  -5.938  1.00 0.00  ? 129 ARG A HH22   5  
ATOM 7131  N N      . ASP B 2 43  ? 3.414   -0.413  -3.987  1.00 0.00  ? 130 ASP A N      5  
ATOM 7132  C CA     . ASP B 2 43  ? 3.466   0.978   -4.440  1.00 0.00  ? 130 ASP A CA     5  
ATOM 7133  C C      . ASP B 2 43  ? 3.427   1.100   -5.988  1.00 0.00  ? 130 ASP A C      5  
ATOM 7134  O O      . ASP B 2 43  ? 2.496   1.737   -6.507  1.00 0.00  ? 130 ASP A O      5  
ATOM 7135  C CB     . ASP B 2 43  ? 4.706   1.609   -3.785  1.00 0.00  ? 130 ASP A CB     5  
ATOM 7136  C CG     . ASP B 2 43  ? 5.044   3.026   -4.267  1.00 0.00  ? 130 ASP A CG     5  
ATOM 7137  O OD1    . ASP B 2 43  ? 5.427   3.186   -5.452  1.00 0.00  ? 130 ASP A OD1    5  
ATOM 7138  O OD2    . ASP B 2 43  ? 4.985   3.961   -3.436  1.00 0.00  ? 130 ASP A OD2    5  
ATOM 7139  H H      . ASP B 2 43  ? 4.188   -0.757  -3.438  1.00 0.00  ? 130 ASP A H      5  
ATOM 7140  H HA     . ASP B 2 43  ? 2.574   1.480   -4.045  1.00 0.00  ? 130 ASP A HA     5  
ATOM 7141  H HB2    . ASP B 2 43  ? 4.545   1.613   -2.707  1.00 0.00  ? 130 ASP A HB2    5  
ATOM 7142  H HB3    . ASP B 2 43  ? 5.579   0.978   -3.955  1.00 0.00  ? 130 ASP A HB3    5  
ATOM 7143  N N      . PRO B 2 44  ? 4.348   0.447   -6.746  1.00 0.00  ? 131 PRO A N      5  
ATOM 7144  C CA     . PRO B 2 44  ? 4.332   0.469   -8.211  1.00 0.00  ? 131 PRO A CA     5  
ATOM 7145  C C      . PRO B 2 44  ? 3.046   -0.133  -8.781  1.00 0.00  ? 131 PRO A C      5  
ATOM 7146  O O      . PRO B 2 44  ? 2.508   0.378   -9.765  1.00 0.00  ? 131 PRO A O      5  
ATOM 7147  C CB     . PRO B 2 44  ? 5.585   -0.278  -8.676  1.00 0.00  ? 131 PRO A CB     5  
ATOM 7148  C CG     . PRO B 2 44  ? 5.925   -1.195  -7.506  1.00 0.00  ? 131 PRO A CG     5  
ATOM 7149  C CD     . PRO B 2 44  ? 5.441   -0.408  -6.292  1.00 0.00  ? 131 PRO A CD     5  
ATOM 7150  H HA     . PRO B 2 44  ? 4.416   1.488   -8.566  1.00 0.00  ? 131 PRO A HA     5  
ATOM 7151  H HB2    . PRO B 2 44  ? 5.412   -0.845  -9.590  1.00 0.00  ? 131 PRO A HB2    5  
ATOM 7152  H HB3    . PRO B 2 44  ? 6.398   0.435   -8.824  1.00 0.00  ? 131 PRO A HB3    5  
ATOM 7153  H HG2    . PRO B 2 44  ? 5.353   -2.118  -7.597  1.00 0.00  ? 131 PRO A HG2    5  
ATOM 7154  H HG3    . PRO B 2 44  ? 6.995   -1.410  -7.452  1.00 0.00  ? 131 PRO A HG3    5  
ATOM 7155  H HD2    . PRO B 2 44  ? 5.122   -1.104  -5.534  1.00 0.00  ? 131 PRO A HD2    5  
ATOM 7156  H HD3    . PRO B 2 44  ? 6.239   0.194   -5.873  1.00 0.00  ? 131 PRO A HD3    5  
ATOM 7157  N N      . ASP B 2 45  ? 2.511   -1.169  -8.127  1.00 0.00  ? 132 ASP A N      5  
ATOM 7158  C CA     . ASP B 2 45  ? 1.223   -1.770  -8.465  1.00 0.00  ? 132 ASP A CA     5  
ATOM 7159  C C      . ASP B 2 45  ? 0.093   -0.730  -8.444  1.00 0.00  ? 132 ASP A C      5  
ATOM 7160  O O      . ASP B 2 45  ? -0.555  -0.544  -9.470  1.00 0.00  ? 132 ASP A O      5  
ATOM 7161  C CB     . ASP B 2 45  ? 0.925   -2.984  -7.566  1.00 0.00  ? 132 ASP A CB     5  
ATOM 7162  C CG     . ASP B 2 45  ? 0.630   -4.245  -8.396  1.00 0.00  ? 132 ASP A CG     5  
ATOM 7163  O OD1    . ASP B 2 45  ? -0.372  -4.262  -9.149  1.00 0.00  ? 132 ASP A OD1    5  
ATOM 7164  O OD2    . ASP B 2 45  ? 1.407   -5.224  -8.293  1.00 0.00  ? 132 ASP A OD2    5  
ATOM 7165  H H      . ASP B 2 45  ? 2.981   -1.480  -7.294  1.00 0.00  ? 132 ASP A H      5  
ATOM 7166  H HA     . ASP B 2 45  ? 1.296   -2.123  -9.494  1.00 0.00  ? 132 ASP A HA     5  
ATOM 7167  H HB2    . ASP B 2 45  ? 1.782   -3.182  -6.921  1.00 0.00  ? 132 ASP A HB2    5  
ATOM 7168  H HB3    . ASP B 2 45  ? 0.076   -2.773  -6.916  1.00 0.00  ? 132 ASP A HB3    5  
ATOM 7169  N N      . LEU B 2 46  ? -0.131  0.010   -7.343  1.00 0.00  ? 133 LEU A N      5  
ATOM 7170  C CA     . LEU B 2 46  ? -1.189  1.007   -7.307  1.00 0.00  ? 133 LEU A CA     5  
ATOM 7171  C C      . LEU B 2 46  ? -0.962  2.170   -8.262  1.00 0.00  ? 133 LEU A C      5  
ATOM 7172  O O      . LEU B 2 46  ? -1.929  2.547   -8.924  1.00 0.00  ? 133 LEU A O      5  
ATOM 7173  C CB     . LEU B 2 46  ? -1.465  1.491   -5.878  1.00 0.00  ? 133 LEU A CB     5  
ATOM 7174  C CG     . LEU B 2 46  ? -2.187  0.444   -5.013  1.00 0.00  ? 133 LEU A CG     5  
ATOM 7175  C CD1    . LEU B 2 46  ? -2.324  0.941   -3.575  1.00 0.00  ? 133 LEU A CD1    5  
ATOM 7176  C CD2    . LEU B 2 46  ? -3.579  0.152   -5.569  1.00 0.00  ? 133 LEU A CD2    5  
ATOM 7177  H H      . LEU B 2 46  ? 0.418   -0.074  -6.499  1.00 0.00  ? 133 LEU A H      5  
ATOM 7178  H HA     . LEU B 2 46  ? -2.086  0.523   -7.683  1.00 0.00  ? 133 LEU A HA     5  
ATOM 7179  H HB2    . LEU B 2 46  ? -0.559  1.851   -5.393  1.00 0.00  ? 133 LEU A HB2    5  
ATOM 7180  H HB3    . LEU B 2 46  ? -2.092  2.361   -5.958  1.00 0.00  ? 133 LEU A HB3    5  
ATOM 7181  H HG     . LEU B 2 46  ? -1.632  -0.490  -5.021  1.00 0.00  ? 133 LEU A HG     5  
ATOM 7182  H HD11   . LEU B 2 46  ? -1.333  1.105   -3.149  1.00 0.00  ? 133 LEU A HD11   5  
ATOM 7183  H HD12   . LEU B 2 46  ? -2.887  1.873   -3.552  1.00 0.00  ? 133 LEU A HD12   5  
ATOM 7184  H HD13   . LEU B 2 46  ? -2.844  0.185   -2.985  1.00 0.00  ? 133 LEU A HD13   5  
ATOM 7185  H HD21   . LEU B 2 46  ? -4.084  1.076   -5.844  1.00 0.00  ? 133 LEU A HD21   5  
ATOM 7186  H HD22   . LEU B 2 46  ? -3.476  -0.472  -6.452  1.00 0.00  ? 133 LEU A HD22   5  
ATOM 7187  H HD23   . LEU B 2 46  ? -4.174  -0.398  -4.838  1.00 0.00  ? 133 LEU A HD23   5  
ATOM 7188  N N      . ARG B 2 47  ? 0.256   2.712   -8.423  1.00 0.00  ? 134 ARG A N      5  
ATOM 7189  C CA     . ARG B 2 47  ? 0.432   3.798   -9.417  1.00 0.00  ? 134 ARG A CA     5  
ATOM 7190  C C      . ARG B 2 47  ? 0.181   3.344   -10.850 1.00 0.00  ? 134 ARG A C      5  
ATOM 7191  O O      . ARG B 2 47  ? -0.299  4.137   -11.648 1.00 0.00  ? 134 ARG A O      5  
ATOM 7192  C CB     . ARG B 2 47  ? 1.741   4.573   -9.286  1.00 0.00  ? 134 ARG A CB     5  
ATOM 7193  C CG     . ARG B 2 47  ? 2.997   3.714   -9.386  1.00 0.00  ? 134 ARG A CG     5  
ATOM 7194  C CD     . ARG B 2 47  ? 4.217   4.606   -9.122  1.00 0.00  ? 134 ARG A CD     5  
ATOM 7195  N NE     . ARG B 2 47  ? 5.216   3.944   -8.258  1.00 0.00  ? 134 ARG A NE     5  
ATOM 7196  C CZ     . ARG B 2 47  ? 6.418   3.500   -8.556  1.00 0.00  ? 134 ARG A CZ     5  
ATOM 7197  N NH1    . ARG B 2 47  ? 6.911   3.534   -9.761  1.00 0.00  ? 134 ARG A NH1    5  
ATOM 7198  N NH2    . ARG B 2 47  ? 7.140   2.990   -7.607  1.00 0.00  ? 134 ARG A NH2    5  
ATOM 7199  H H      . ARG B 2 47  ? 1.036   2.301   -7.916  1.00 0.00  ? 134 ARG A H      5  
ATOM 7200  H HA     . ARG B 2 47  ? -0.337  4.539   -9.221  1.00 0.00  ? 134 ARG A HA     5  
ATOM 7201  H HB2    . ARG B 2 47  ? 1.775   5.340   -10.061 1.00 0.00  ? 134 ARG A HB2    5  
ATOM 7202  H HB3    . ARG B 2 47  ? 1.728   5.082   -8.326  1.00 0.00  ? 134 ARG A HB3    5  
ATOM 7203  H HG2    . ARG B 2 47  ? 2.924   2.951   -8.628  1.00 0.00  ? 134 ARG A HG2    5  
ATOM 7204  H HG3    . ARG B 2 47  ? 3.063   3.238   -10.374 1.00 0.00  ? 134 ARG A HG3    5  
ATOM 7205  H HD2    . ARG B 2 47  ? 4.622   4.918   -10.080 1.00 0.00  ? 134 ARG A HD2    5  
ATOM 7206  H HD3    . ARG B 2 47  ? 3.902   5.515   -8.612  1.00 0.00  ? 134 ARG A HD3    5  
ATOM 7207  H HE     . ARG B 2 47  ? 4.994   3.832   -7.272  1.00 0.00  ? 134 ARG A HE     5  
ATOM 7208  H HH11   . ARG B 2 47  ? 6.356   3.924   -10.503 1.00 0.00  ? 134 ARG A HH11   5  
ATOM 7209  H HH12   . ARG B 2 47  ? 7.836   3.191   -9.946  1.00 0.00  ? 134 ARG A HH12   5  
ATOM 7210  H HH21   . ARG B 2 47  ? 6.716   2.983   -6.678  1.00 0.00  ? 134 ARG A HH21   5  
ATOM 7211  H HH22   . ARG B 2 47  ? 8.073   2.648   -7.760  1.00 0.00  ? 134 ARG A HH22   5  
ATOM 7212  N N      . GLN B 2 48  ? 0.419   2.077   -11.170 1.00 0.00  ? 135 GLN A N      5  
ATOM 7213  C CA     . GLN B 2 48  ? 0.142   1.502   -12.488 1.00 0.00  ? 135 GLN A CA     5  
ATOM 7214  C C      . GLN B 2 48  ? -1.334  1.075   -12.677 1.00 0.00  ? 135 GLN A C      5  
ATOM 7215  O O      . GLN B 2 48  ? -1.893  1.177   -13.774 1.00 0.00  ? 135 GLN A O      5  
ATOM 7216  C CB     . GLN B 2 48  ? 1.141   0.357   -12.656 1.00 0.00  ? 135 GLN A CB     5  
ATOM 7217  C CG     . GLN B 2 48  ? 1.307   -0.138  -14.095 1.00 0.00  ? 135 GLN A CG     5  
ATOM 7218  C CD     . GLN B 2 48  ? 0.524   -1.415  -14.403 1.00 0.00  ? 135 GLN A CD     5  
ATOM 7219  O OE1    . GLN B 2 48  ? 1.052   -2.518  -14.380 1.00 0.00  ? 135 GLN A OE1    5  
ATOM 7220  N NE2    . GLN B 2 48  ? -0.754  -1.324  -14.713 1.00 0.00  ? 135 GLN A NE2    5  
ATOM 7221  H H      . GLN B 2 48  ? 0.865   1.494   -10.470 1.00 0.00  ? 135 GLN A H      5  
ATOM 7222  H HA     . GLN B 2 48  ? 0.376   2.243   -13.250 1.00 0.00  ? 135 GLN A HA     5  
ATOM 7223  H HB2    . GLN B 2 48  ? 2.122   0.730   -12.352 1.00 0.00  ? 135 GLN A HB2    5  
ATOM 7224  H HB3    . GLN B 2 48  ? 0.882   -0.451  -11.973 1.00 0.00  ? 135 GLN A HB3    5  
ATOM 7225  H HG2    . GLN B 2 48  ? 1.034   0.643   -14.807 1.00 0.00  ? 135 GLN A HG2    5  
ATOM 7226  H HG3    . GLN B 2 48  ? 2.373   -0.334  -14.222 1.00 0.00  ? 135 GLN A HG3    5  
ATOM 7227  H HE21   . GLN B 2 48  ? -1.229  -0.428  -14.716 1.00 0.00  ? 135 GLN A HE21   5  
ATOM 7228  H HE22   . GLN B 2 48  ? -1.238  -2.182  -14.922 1.00 0.00  ? 135 GLN A HE22   5  
ATOM 7229  N N      . MET B 2 49  ? -2.000  0.642   -11.605 1.00 0.00  ? 136 MET A N      5  
ATOM 7230  C CA     . MET B 2 49  ? -3.372  0.141   -11.605 1.00 0.00  ? 136 MET A CA     5  
ATOM 7231  C C      . MET B 2 49  ? -4.382  1.282   -11.565 1.00 0.00  ? 136 MET A C      5  
ATOM 7232  O O      . MET B 2 49  ? -5.278  1.324   -12.402 1.00 0.00  ? 136 MET A O      5  
ATOM 7233  C CB     . MET B 2 49  ? -3.476  -0.798  -10.411 1.00 0.00  ? 136 MET A CB     5  
ATOM 7234  C CG     . MET B 2 49  ? -4.773  -1.608  -10.299 1.00 0.00  ? 136 MET A CG     5  
ATOM 7235  S SD     . MET B 2 49  ? -6.246  -0.693  -9.759  1.00 0.00  ? 136 MET A SD     5  
ATOM 7236  C CE     . MET B 2 49  ? -5.609  0.022   -8.220  1.00 0.00  ? 136 MET A CE     5  
ATOM 7237  H H      . MET B 2 49  ? -1.519  0.549   -10.712 1.00 0.00  ? 136 MET A H      5  
ATOM 7238  H HA     . MET B 2 49  ? -3.542  -0.436  -12.514 1.00 0.00  ? 136 MET A HA     5  
ATOM 7239  H HB2    . MET B 2 49  ? -2.650  -1.476  -10.533 1.00 0.00  ? 136 MET A HB2    5  
ATOM 7240  H HB3    . MET B 2 49  ? -3.279  -0.260  -9.488  1.00 0.00  ? 136 MET A HB3    5  
ATOM 7241  H HG2    . MET B 2 49  ? -4.979  -2.075  -11.262 1.00 0.00  ? 136 MET A HG2    5  
ATOM 7242  H HG3    . MET B 2 49  ? -4.603  -2.405  -9.574  1.00 0.00  ? 136 MET A HG3    5  
ATOM 7243  H HE1    . MET B 2 49  ? -5.262  -0.777  -7.572  1.00 0.00  ? 136 MET A HE1    5  
ATOM 7244  H HE2    . MET B 2 49  ? -4.770  0.691   -8.432  1.00 0.00  ? 136 MET A HE2    5  
ATOM 7245  H HE3    . MET B 2 49  ? -6.394  0.585   -7.718  1.00 0.00  ? 136 MET A HE3    5  
ATOM 7246  N N      . PHE B 2 50  ? -4.163  2.276   -10.701 1.00 0.00  ? 137 PHE A N      5  
ATOM 7247  C CA     . PHE B 2 50  ? -4.693  3.622   -10.948 1.00 0.00  ? 137 PHE A CA     5  
ATOM 7248  C C      . PHE B 2 50  ? -4.128  4.206   -12.258 1.00 0.00  ? 137 PHE A C      5  
ATOM 7249  O O      . PHE B 2 50  ? -4.814  4.957   -12.953 1.00 0.00  ? 137 PHE A O      5  
ATOM 7250  C CB     . PHE B 2 50  ? -4.438  4.569   -9.765  1.00 0.00  ? 137 PHE A CB     5  
ATOM 7251  C CG     . PHE B 2 50  ? -5.389  4.372   -8.603  1.00 0.00  ? 137 PHE A CG     5  
ATOM 7252  C CD1    . PHE B 2 50  ? -5.133  3.413   -7.608  1.00 0.00  ? 137 PHE A CD1    5  
ATOM 7253  C CD2    . PHE B 2 50  ? -6.566  5.134   -8.545  1.00 0.00  ? 137 PHE A CD2    5  
ATOM 7254  C CE1    . PHE B 2 50  ? -6.072  3.212   -6.581  1.00 0.00  ? 137 PHE A CE1    5  
ATOM 7255  C CE2    . PHE B 2 50  ? -7.497  4.943   -7.514  1.00 0.00  ? 137 PHE A CE2    5  
ATOM 7256  C CZ     . PHE B 2 50  ? -7.243  3.982   -6.524  1.00 0.00  ? 137 PHE A CZ     5  
ATOM 7257  H H      . PHE B 2 50  ? -3.400  2.145   -10.046 1.00 0.00  ? 137 PHE A H      5  
ATOM 7258  H HA     . PHE B 2 50  ? -5.770  3.536   -11.066 1.00 0.00  ? 137 PHE A HA     5  
ATOM 7259  H HB2    . PHE B 2 50  ? -3.406  4.494   -9.432  1.00 0.00  ? 137 PHE A HB2    5  
ATOM 7260  H HB3    . PHE B 2 50  ? -4.585  5.591   -10.110 1.00 0.00  ? 137 PHE A HB3    5  
ATOM 7261  H HD1    . PHE B 2 50  ? -4.229  2.824   -7.645  1.00 0.00  ? 137 PHE A HD1    5  
ATOM 7262  H HD2    . PHE B 2 50  ? -6.782  5.839   -9.325  1.00 0.00  ? 137 PHE A HD2    5  
ATOM 7263  H HE1    . PHE B 2 50  ? -5.902  2.456   -5.834  1.00 0.00  ? 137 PHE A HE1    5  
ATOM 7264  H HE2    . PHE B 2 50  ? -8.432  5.487   -7.528  1.00 0.00  ? 137 PHE A HE2    5  
ATOM 7265  H HZ     . PHE B 2 50  ? -7.956  3.826   -5.730  1.00 0.00  ? 137 PHE A HZ     5  
ATOM 7266  N N      . GLY B 2 51  ? -2.901  3.831   -12.641 1.00 0.00  ? 138 GLY A N      5  
ATOM 7267  C CA     . GLY B 2 51  ? -2.220  4.235   -13.885 1.00 0.00  ? 138 GLY A CA     5  
ATOM 7268  C C      . GLY B 2 51  ? -2.958  3.925   -15.186 1.00 0.00  ? 138 GLY A C      5  
ATOM 7269  O O      . GLY B 2 51  ? -2.751  4.642   -16.165 1.00 0.00  ? 138 GLY A O      5  
ATOM 7270  H H      . GLY B 2 51  ? -2.327  3.336   -11.957 1.00 0.00  ? 138 GLY A H      5  
ATOM 7271  H HA2    . GLY B 2 51  ? -2.028  5.306   -13.845 1.00 0.00  ? 138 GLY A HA2    5  
ATOM 7272  H HA3    . GLY B 2 51  ? -1.250  3.742   -13.942 1.00 0.00  ? 138 GLY A HA3    5  
ATOM 7273  N N      . GLN B 2 52  ? -3.868  2.941   -15.199 1.00 0.00  ? 139 GLN A N      5  
ATOM 7274  C CA     . GLN B 2 52  ? -4.862  2.804   -16.286 1.00 0.00  ? 139 GLN A CA     5  
ATOM 7275  C C      . GLN B 2 52  ? -5.601  4.115   -16.612 1.00 0.00  ? 139 GLN A C      5  
ATOM 7276  O O      . GLN B 2 52  ? -5.887  4.394   -17.778 1.00 0.00  ? 139 GLN A O      5  
ATOM 7277  C CB     . GLN B 2 52  ? -5.884  1.684   -16.014 1.00 0.00  ? 139 GLN A CB     5  
ATOM 7278  C CG     . GLN B 2 52  ? -7.029  2.019   -15.041 1.00 0.00  ? 139 GLN A CG     5  
ATOM 7279  C CD     . GLN B 2 52  ? -7.843  0.779   -14.672 1.00 0.00  ? 139 GLN A CD     5  
ATOM 7280  O OE1    . GLN B 2 52  ? -8.878  0.468   -15.253 1.00 0.00  ? 139 GLN A OE1    5  
ATOM 7281  N NE2    . GLN B 2 52  ? -7.415  0.025   -13.686 1.00 0.00  ? 139 GLN A NE2    5  
ATOM 7282  H H      . GLN B 2 52  ? -3.752  2.247   -14.461 1.00 0.00  ? 139 GLN A H      5  
ATOM 7283  H HA     . GLN B 2 52  ? -4.312  2.521   -17.187 1.00 0.00  ? 139 GLN A HA     5  
ATOM 7284  H HB2    . GLN B 2 52  ? -6.353  1.462   -16.973 1.00 0.00  ? 139 GLN A HB2    5  
ATOM 7285  H HB3    . GLN B 2 52  ? -5.352  0.800   -15.667 1.00 0.00  ? 139 GLN A HB3    5  
ATOM 7286  H HG2    . GLN B 2 52  ? -6.635  2.480   -14.137 1.00 0.00  ? 139 GLN A HG2    5  
ATOM 7287  H HG3    . GLN B 2 52  ? -7.705  2.735   -15.517 1.00 0.00  ? 139 GLN A HG3    5  
ATOM 7288  H HE21   . GLN B 2 52  ? -6.600  0.338   -13.160 1.00 0.00  ? 139 GLN A HE21   5  
ATOM 7289  H HE22   . GLN B 2 52  ? -7.916  -0.811  -13.447 1.00 0.00  ? 139 GLN A HE22   5  
ATOM 7290  N N      . PHE B 2 53  ? -5.894  4.922   -15.583 1.00 0.00  ? 140 PHE A N      5  
ATOM 7291  C CA     . PHE B 2 53  ? -6.456  6.265   -15.691 1.00 0.00  ? 140 PHE A CA     5  
ATOM 7292  C C      . PHE B 2 53  ? -5.361  7.354   -15.703 1.00 0.00  ? 140 PHE A C      5  
ATOM 7293  O O      . PHE B 2 53  ? -5.456  8.332   -16.446 1.00 0.00  ? 140 PHE A O      5  
ATOM 7294  C CB     . PHE B 2 53  ? -7.463  6.478   -14.546 1.00 0.00  ? 140 PHE A CB     5  
ATOM 7295  C CG     . PHE B 2 53  ? -8.772  5.740   -14.752 1.00 0.00  ? 140 PHE A CG     5  
ATOM 7296  C CD1    . PHE B 2 53  ? -9.647  6.197   -15.754 1.00 0.00  ? 140 PHE A CD1    5  
ATOM 7297  C CD2    . PHE B 2 53  ? -9.155  4.652   -13.934 1.00 0.00  ? 140 PHE A CD2    5  
ATOM 7298  C CE1    . PHE B 2 53  ? -10.885 5.568   -15.963 1.00 0.00  ? 140 PHE A CE1    5  
ATOM 7299  C CE2    . PHE B 2 53  ? -10.387 4.018   -14.153 1.00 0.00  ? 140 PHE A CE2    5  
ATOM 7300  C CZ     . PHE B 2 53  ? -11.253 4.475   -15.164 1.00 0.00  ? 140 PHE A CZ     5  
ATOM 7301  H H      . PHE B 2 53  ? -5.637  4.602   -14.658 1.00 0.00  ? 140 PHE A H      5  
ATOM 7302  H HA     . PHE B 2 53  ? -6.997  6.315   -16.637 1.00 0.00  ? 140 PHE A HA     5  
ATOM 7303  H HB2    . PHE B 2 53  ? -7.014  6.176   -13.598 1.00 0.00  ? 140 PHE A HB2    5  
ATOM 7304  H HB3    . PHE B 2 53  ? -7.680  7.546   -14.463 1.00 0.00  ? 140 PHE A HB3    5  
ATOM 7305  H HD1    . PHE B 2 53  ? -9.382  7.060   -16.352 1.00 0.00  ? 140 PHE A HD1    5  
ATOM 7306  H HD2    . PHE B 2 53  ? -8.566  4.318   -13.088 1.00 0.00  ? 140 PHE A HD2    5  
ATOM 7307  H HE1    . PHE B 2 53  ? -11.556 5.929   -16.732 1.00 0.00  ? 140 PHE A HE1    5  
ATOM 7308  H HE2    . PHE B 2 53  ? -10.670 3.194   -13.514 1.00 0.00  ? 140 PHE A HE2    5  
ATOM 7309  H HZ     . PHE B 2 53  ? -12.213 4.005   -15.324 1.00 0.00  ? 140 PHE A HZ     5  
ATOM 7310  N N      . GLY B 2 54  ? -4.292  7.173   -14.914 1.00 0.00  ? 141 GLY A N      5  
ATOM 7311  C CA     . GLY B 2 54  ? -3.002  7.877   -15.046 1.00 0.00  ? 141 GLY A CA     5  
ATOM 7312  C C      . GLY B 2 54  ? -2.936  9.327   -14.574 1.00 0.00  ? 141 GLY A C      5  
ATOM 7313  O O      . GLY B 2 54  ? -2.000  10.062  -14.895 1.00 0.00  ? 141 GLY A O      5  
ATOM 7314  H H      . GLY B 2 54  ? -4.335  6.357   -14.310 1.00 0.00  ? 141 GLY A H      5  
ATOM 7315  H HA2    . GLY B 2 54  ? -2.304  7.369   -14.393 1.00 0.00  ? 141 GLY A HA2    5  
ATOM 7316  H HA3    . GLY B 2 54  ? -2.640  7.810   -16.071 1.00 0.00  ? 141 GLY A HA3    5  
ATOM 7317  N N      . LYS B 2 55  ? -3.919  9.723   -13.771 1.00 0.00  ? 142 LYS A N      5  
ATOM 7318  C CA     . LYS B 2 55  ? -4.089  11.042  -13.138 1.00 0.00  ? 142 LYS A CA     5  
ATOM 7319  C C      . LYS B 2 55  ? -3.187  11.273  -11.912 1.00 0.00  ? 142 LYS A C      5  
ATOM 7320  O O      . LYS B 2 55  ? -2.938  12.416  -11.532 1.00 0.00  ? 142 LYS A O      5  
ATOM 7321  C CB     . LYS B 2 55  ? -5.555  11.115  -12.712 1.00 0.00  ? 142 LYS A CB     5  
ATOM 7322  C CG     . LYS B 2 55  ? -6.546  10.897  -13.865 1.00 0.00  ? 142 LYS A CG     5  
ATOM 7323  C CD     . LYS B 2 55  ? -6.589  12.031  -14.905 1.00 0.00  ? 142 LYS A CD     5  
ATOM 7324  C CE     . LYS B 2 55  ? -7.023  11.476  -16.269 1.00 0.00  ? 142 LYS A CE     5  
ATOM 7325  N NZ     . LYS B 2 55  ? -7.179  12.545  -17.288 1.00 0.00  ? 142 LYS A NZ     5  
ATOM 7326  H H      . LYS B 2 55  ? -4.650  9.033   -13.648 1.00 0.00  ? 142 LYS A H      5  
ATOM 7327  H HA     . LYS B 2 55  ? -3.885  11.831  -13.854 1.00 0.00  ? 142 LYS A HA     5  
ATOM 7328  H HB2    . LYS B 2 55  ? -5.702  10.306  -12.001 1.00 0.00  ? 142 LYS A HB2    5  
ATOM 7329  H HB3    . LYS B 2 55  ? -5.759  12.066  -12.223 1.00 0.00  ? 142 LYS A HB3    5  
ATOM 7330  H HG2    . LYS B 2 55  ? -6.339  9.950   -14.361 1.00 0.00  ? 142 LYS A HG2    5  
ATOM 7331  H HG3    . LYS B 2 55  ? -7.517  10.777  -13.411 1.00 0.00  ? 142 LYS A HG3    5  
ATOM 7332  H HD2    . LYS B 2 55  ? -7.276  12.806  -14.569 1.00 0.00  ? 142 LYS A HD2    5  
ATOM 7333  H HD3    . LYS B 2 55  ? -5.601  12.478  -15.022 1.00 0.00  ? 142 LYS A HD3    5  
ATOM 7334  H HE2    . LYS B 2 55  ? -6.264  10.762  -16.602 1.00 0.00  ? 142 LYS A HE2    5  
ATOM 7335  H HE3    . LYS B 2 55  ? -7.960  10.924  -16.154 1.00 0.00  ? 142 LYS A HE3    5  
ATOM 7336  H HZ1    . LYS B 2 55  ? -7.996  13.130  -17.094 1.00 0.00  ? 142 LYS A HZ1    5  
ATOM 7337  H HZ2    . LYS B 2 55  ? -6.366  13.140  -17.334 1.00 0.00  ? 142 LYS A HZ2    5  
ATOM 7338  H HZ3    . LYS B 2 55  ? -7.323  12.153  -18.208 1.00 0.00  ? 142 LYS A HZ3    5  
ATOM 7339  N N      . ILE B 2 56  ? -2.727  10.176  -11.305 1.00 0.00  ? 143 ILE A N      5  
ATOM 7340  C CA     . ILE B 2 56  ? -1.910  10.071  -10.077 1.00 0.00  ? 143 ILE A CA     5  
ATOM 7341  C C      . ILE B 2 56  ? -0.742  11.072  -10.011 1.00 0.00  ? 143 ILE A C      5  
ATOM 7342  O O      . ILE B 2 56  ? 0.077   11.145  -10.931 1.00 0.00  ? 143 ILE A O      5  
ATOM 7343  C CB     . ILE B 2 56  ? -1.358  8.633   -9.847  1.00 0.00  ? 143 ILE A CB     5  
ATOM 7344  C CG1    . ILE B 2 56  ? -2.371  7.491   -10.019 1.00 0.00  ? 143 ILE A CG1    5  
ATOM 7345  C CG2    . ILE B 2 56  ? -0.855  8.548   -8.406  1.00 0.00  ? 143 ILE A CG2    5  
ATOM 7346  C CD1    . ILE B 2 56  ? -2.488  7.060   -11.482 1.00 0.00  ? 143 ILE A CD1    5  
ATOM 7347  H H      . ILE B 2 56  ? -3.145  9.355   -11.717 1.00 0.00  ? 143 ILE A H      5  
ATOM 7348  H HA     . ILE B 2 56  ? -2.580  10.301  -9.249  1.00 0.00  ? 143 ILE A HA     5  
ATOM 7349  H HB     . ILE B 2 56  ? -0.525  8.418   -10.520 1.00 0.00  ? 143 ILE A HB     5  
ATOM 7350  H HG12   . ILE B 2 56  ? -2.054  6.610   -9.461  1.00 0.00  ? 143 ILE A HG12   5  
ATOM 7351  H HG13   . ILE B 2 56  ? -3.322  7.796   -9.596  1.00 0.00  ? 143 ILE A HG13   5  
ATOM 7352  H HG21   . ILE B 2 56  ? 0.051   9.135   -8.287  1.00 0.00  ? 143 ILE A HG21   5  
ATOM 7353  H HG22   . ILE B 2 56  ? -1.635  8.894   -7.718  1.00 0.00  ? 143 ILE A HG22   5  
ATOM 7354  H HG23   . ILE B 2 56  ? -0.603  7.521   -8.162  1.00 0.00  ? 143 ILE A HG23   5  
ATOM 7355  H HD11   . ILE B 2 56  ? -2.154  7.843   -12.158 1.00 0.00  ? 143 ILE A HD11   5  
ATOM 7356  H HD12   . ILE B 2 56  ? -1.843  6.197   -11.639 1.00 0.00  ? 143 ILE A HD12   5  
ATOM 7357  H HD13   . ILE B 2 56  ? -3.517  6.807   -11.717 1.00 0.00  ? 143 ILE A HD13   5  
ATOM 7358  N N      . LEU B 2 57  ? -0.630  11.779  -8.881  1.00 0.00  ? 144 LEU A N      5  
ATOM 7359  C CA     . LEU B 2 57  ? 0.515   12.630  -8.512  1.00 0.00  ? 144 LEU A CA     5  
ATOM 7360  C C      . LEU B 2 57  ? 1.543   11.889  -7.636  1.00 0.00  ? 144 LEU A C      5  
ATOM 7361  O O      . LEU B 2 57  ? 2.743   12.123  -7.776  1.00 0.00  ? 144 LEU A O      5  
ATOM 7362  C CB     . LEU B 2 57  ? -0.003  13.900  -7.797  1.00 0.00  ? 144 LEU A CB     5  
ATOM 7363  C CG     . LEU B 2 57  ? -0.304  15.111  -8.701  1.00 0.00  ? 144 LEU A CG     5  
ATOM 7364  C CD1    . LEU B 2 57  ? 0.973   15.742  -9.264  1.00 0.00  ? 144 LEU A CD1    5  
ATOM 7365  C CD2    . LEU B 2 57  ? -1.240  14.791  -9.866  1.00 0.00  ? 144 LEU A CD2    5  
ATOM 7366  H H      . LEU B 2 57  ? -1.381  11.670  -8.206  1.00 0.00  ? 144 LEU A H      5  
ATOM 7367  H HA     . LEU B 2 57  ? 1.046   12.929  -9.418  1.00 0.00  ? 144 LEU A HA     5  
ATOM 7368  H HB2    . LEU B 2 57  ? -0.905  13.652  -7.237  1.00 0.00  ? 144 LEU A HB2    5  
ATOM 7369  H HB3    . LEU B 2 57  ? 0.740   14.219  -7.064  1.00 0.00  ? 144 LEU A HB3    5  
ATOM 7370  H HG     . LEU B 2 57  ? -0.795  15.861  -8.082  1.00 0.00  ? 144 LEU A HG     5  
ATOM 7371  H HD11   . LEU B 2 57  ? 1.644   16.002  -8.444  1.00 0.00  ? 144 LEU A HD11   5  
ATOM 7372  H HD12   . LEU B 2 57  ? 1.480   15.051  -9.938  1.00 0.00  ? 144 LEU A HD12   5  
ATOM 7373  H HD13   . LEU B 2 57  ? 0.723   16.648  -9.813  1.00 0.00  ? 144 LEU A HD13   5  
ATOM 7374  H HD21   . LEU B 2 57  ? -0.736  14.162  -10.598 1.00 0.00  ? 144 LEU A HD21   5  
ATOM 7375  H HD22   . LEU B 2 57  ? -2.120  14.268  -9.498  1.00 0.00  ? 144 LEU A HD22   5  
ATOM 7376  H HD23   . LEU B 2 57  ? -1.552  15.719  -10.350 1.00 0.00  ? 144 LEU A HD23   5  
ATOM 7377  N N      . ASP B 2 58  ? 1.092   11.003  -6.740  1.00 0.00  ? 145 ASP A N      5  
ATOM 7378  C CA     . ASP B 2 58  ? 1.936   10.225  -5.816  1.00 0.00  ? 145 ASP A CA     5  
ATOM 7379  C C      . ASP B 2 58  ? 1.237   8.953   -5.299  1.00 0.00  ? 145 ASP A C      5  
ATOM 7380  O O      . ASP B 2 58  ? 0.010   8.868   -5.348  1.00 0.00  ? 145 ASP A O      5  
ATOM 7381  C CB     . ASP B 2 58  ? 2.324   11.107  -4.611  1.00 0.00  ? 145 ASP A CB     5  
ATOM 7382  C CG     . ASP B 2 58  ? 3.849   11.254  -4.471  1.00 0.00  ? 145 ASP A CG     5  
ATOM 7383  O OD1    . ASP B 2 58  ? 4.555   10.217  -4.464  1.00 0.00  ? 145 ASP A OD1    5  
ATOM 7384  O OD2    . ASP B 2 58  ? 4.342   12.400  -4.340  1.00 0.00  ? 145 ASP A OD2    5  
ATOM 7385  H H      . ASP B 2 58  ? 0.096   10.833  -6.702  1.00 0.00  ? 145 ASP A H      5  
ATOM 7386  H HA     . ASP B 2 58  ? 2.832   9.914   -6.354  1.00 0.00  ? 145 ASP A HA     5  
ATOM 7387  H HB2    . ASP B 2 58  ? 1.852   12.086  -4.702  1.00 0.00  ? 145 ASP A HB2    5  
ATOM 7388  H HB3    . ASP B 2 58  ? 1.936   10.670  -3.690  1.00 0.00  ? 145 ASP A HB3    5  
ATOM 7389  N N      . VAL B 2 59  ? 1.995   7.999   -4.740  1.00 0.00  ? 146 VAL A N      5  
ATOM 7390  C CA     . VAL B 2 59  ? 1.489   6.781   -4.073  1.00 0.00  ? 146 VAL A CA     5  
ATOM 7391  C C      . VAL B 2 59  ? 2.272   6.380   -2.825  1.00 0.00  ? 146 VAL A C      5  
ATOM 7392  O O      . VAL B 2 59  ? 3.369   6.869   -2.550  1.00 0.00  ? 146 VAL A O      5  
ATOM 7393  C CB     . VAL B 2 59  ? 1.452   5.549   -4.999  1.00 0.00  ? 146 VAL A CB     5  
ATOM 7394  C CG1    . VAL B 2 59  ? 0.292   5.615   -5.949  1.00 0.00  ? 146 VAL A CG1    5  
ATOM 7395  C CG2    . VAL B 2 59  ? 2.752   5.332   -5.779  1.00 0.00  ? 146 VAL A CG2    5  
ATOM 7396  H H      . VAL B 2 59  ? 2.995   8.150   -4.697  1.00 0.00  ? 146 VAL A H      5  
ATOM 7397  H HA     . VAL B 2 59  ? 0.473   6.976   -3.739  1.00 0.00  ? 146 VAL A HA     5  
ATOM 7398  H HB     . VAL B 2 59  ? 1.196   4.671   -4.408  1.00 0.00  ? 146 VAL A HB     5  
ATOM 7399  H HG11   . VAL B 2 59  ? -0.578  5.698   -5.315  1.00 0.00  ? 146 VAL A HG11   5  
ATOM 7400  H HG12   . VAL B 2 59  ? 0.405   6.478   -6.592  1.00 0.00  ? 146 VAL A HG12   5  
ATOM 7401  H HG13   . VAL B 2 59  ? 0.226   4.697   -6.525  1.00 0.00  ? 146 VAL A HG13   5  
ATOM 7402  H HG21   . VAL B 2 59  ? 2.880   6.128   -6.512  1.00 0.00  ? 146 VAL A HG21   5  
ATOM 7403  H HG22   . VAL B 2 59  ? 3.596   5.349   -5.091  1.00 0.00  ? 146 VAL A HG22   5  
ATOM 7404  H HG23   . VAL B 2 59  ? 2.721   4.369   -6.285  1.00 0.00  ? 146 VAL A HG23   5  
ATOM 7405  N N      . GLU B 2 60  ? 1.666   5.464   -2.072  1.00 0.00  ? 147 GLU A N      5  
ATOM 7406  C CA     . GLU B 2 60  ? 2.147   4.850   -0.845  1.00 0.00  ? 147 GLU A CA     5  
ATOM 7407  C C      . GLU B 2 60  ? 1.426   3.502   -0.606  1.00 0.00  ? 147 GLU A C      5  
ATOM 7408  O O      . GLU B 2 60  ? 0.283   3.311   -1.038  1.00 0.00  ? 147 GLU A O      5  
ATOM 7409  C CB     . GLU B 2 60  ? 1.822   5.858   0.268   1.00 0.00  ? 147 GLU A CB     5  
ATOM 7410  C CG     . GLU B 2 60  ? 2.250   5.469   1.685   1.00 0.00  ? 147 GLU A CG     5  
ATOM 7411  C CD     . GLU B 2 60  ? 3.785   5.416   1.819   1.00 0.00  ? 147 GLU A CD     5  
ATOM 7412  O OE1    . GLU B 2 60  ? 4.419   4.501   1.240   1.00 0.00  ? 147 GLU A OE1    5  
ATOM 7413  O OE2    . GLU B 2 60  ? 4.365   6.302   2.493   1.00 0.00  ? 147 GLU A OE2    5  
ATOM 7414  H H      . GLU B 2 60  ? 0.695   5.272   -2.289  1.00 0.00  ? 147 GLU A H      5  
ATOM 7415  H HA     . GLU B 2 60  ? 3.220   4.677   -0.913  1.00 0.00  ? 147 GLU A HA     5  
ATOM 7416  H HB2    . GLU B 2 60  ? 2.299   6.811   0.035   1.00 0.00  ? 147 GLU A HB2    5  
ATOM 7417  H HB3    . GLU B 2 60  ? 0.745   6.016   0.233   1.00 0.00  ? 147 GLU A HB3    5  
ATOM 7418  H HG2    . GLU B 2 60  ? 1.841   6.216   2.370   1.00 0.00  ? 147 GLU A HG2    5  
ATOM 7419  H HG3    . GLU B 2 60  ? 1.803   4.511   1.953   1.00 0.00  ? 147 GLU A HG3    5  
ATOM 7420  N N      . ILE B 2 61  ? 2.051   2.589   0.144   1.00 0.00  ? 148 ILE A N      5  
ATOM 7421  C CA     . ILE B 2 61  ? 1.450   1.389   0.757   1.00 0.00  ? 148 ILE A CA     5  
ATOM 7422  C C      . ILE B 2 61  ? 1.767   1.409   2.252   1.00 0.00  ? 148 ILE A C      5  
ATOM 7423  O O      . ILE B 2 61  ? 2.831   1.889   2.642   1.00 0.00  ? 148 ILE A O      5  
ATOM 7424  C CB     . ILE B 2 61  ? 1.968   0.106   0.067   1.00 0.00  ? 148 ILE A CB     5  
ATOM 7425  C CG1    . ILE B 2 61  ? 1.173   -0.153  -1.227  1.00 0.00  ? 148 ILE A CG1    5  
ATOM 7426  C CG2    . ILE B 2 61  ? 1.956   -1.148  0.966   1.00 0.00  ? 148 ILE A CG2    5  
ATOM 7427  C CD1    . ILE B 2 61  ? -0.151  -0.888  -1.037  1.00 0.00  ? 148 ILE A CD1    5  
ATOM 7428  H H      . ILE B 2 61  ? 2.954   2.860   0.511   1.00 0.00  ? 148 ILE A H      5  
ATOM 7429  H HA     . ILE B 2 61  ? 0.369   1.424   0.656   1.00 0.00  ? 148 ILE A HA     5  
ATOM 7430  H HB     . ILE B 2 61  ? 3.007   0.280   -0.217  1.00 0.00  ? 148 ILE A HB     5  
ATOM 7431  H HG12   . ILE B 2 61  ? 0.995   0.781   -1.756  1.00 0.00  ? 148 ILE A HG12   5  
ATOM 7432  H HG13   . ILE B 2 61  ? 1.774   -0.772  -1.871  1.00 0.00  ? 148 ILE A HG13   5  
ATOM 7433  H HG21   . ILE B 2 61  ? 2.664   -1.031  1.781   1.00 0.00  ? 148 ILE A HG21   5  
ATOM 7434  H HG22   . ILE B 2 61  ? 0.968   -1.320  1.387   1.00 0.00  ? 148 ILE A HG22   5  
ATOM 7435  H HG23   . ILE B 2 61  ? 2.250   -2.024  0.386   1.00 0.00  ? 148 ILE A HG23   5  
ATOM 7436  H HD11   . ILE B 2 61  ? 0.038   -1.900  -0.664  1.00 0.00  ? 148 ILE A HD11   5  
ATOM 7437  H HD12   . ILE B 2 61  ? -0.773  -0.356  -0.320  1.00 0.00  ? 148 ILE A HD12   5  
ATOM 7438  H HD13   . ILE B 2 61  ? -0.651  -0.953  -2.000  1.00 0.00  ? 148 ILE A HD13   5  
ATOM 7439  N N      . ILE B 2 62  ? 0.884   0.874   3.104   1.00 0.00  ? 149 ILE A N      5  
ATOM 7440  C CA     . ILE B 2 62  ? 1.065   0.878   4.547   1.00 0.00  ? 149 ILE A CA     5  
ATOM 7441  C C      . ILE B 2 62  ? 1.798   -0.435  4.820   1.00 0.00  ? 149 ILE A C      5  
ATOM 7442  O O      . ILE B 2 62  ? 1.186   -1.464  5.087   1.00 0.00  ? 149 ILE A O      5  
ATOM 7443  C CB     . ILE B 2 62  ? -0.330  1.089   5.168   1.00 0.00  ? 149 ILE A CB     5  
ATOM 7444  C CG1    . ILE B 2 62  ? -0.994  2.354   4.568   1.00 0.00  ? 149 ILE A CG1    5  
ATOM 7445  C CG2    . ILE B 2 62  ? -0.276  1.248   6.687   1.00 0.00  ? 149 ILE A CG2    5  
ATOM 7446  C CD1    . ILE B 2 62  ? -0.099  3.586   4.428   1.00 0.00  ? 149 ILE A CD1    5  
ATOM 7447  H H      . ILE B 2 62  ? 0.054   0.353   2.843   1.00 0.00  ? 149 ILE A H      5  
ATOM 7448  H HA     . ILE B 2 62  ? 1.680   1.717   4.890   1.00 0.00  ? 149 ILE A HA     5  
ATOM 7449  H HB     . ILE B 2 62  ? -0.968  0.235   4.944   1.00 0.00  ? 149 ILE A HB     5  
ATOM 7450  H HG12   . ILE B 2 62  ? -1.425  2.124   3.596   1.00 0.00  ? 149 ILE A HG12   5  
ATOM 7451  H HG13   . ILE B 2 62  ? -1.802  2.642   5.217   1.00 0.00  ? 149 ILE A HG13   5  
ATOM 7452  H HG21   . ILE B 2 62  ? -0.007  0.312   7.144   1.00 0.00  ? 149 ILE A HG21   5  
ATOM 7453  H HG22   . ILE B 2 62  ? 0.447   2.016   6.955   1.00 0.00  ? 149 ILE A HG22   5  
ATOM 7454  H HG23   . ILE B 2 62  ? -1.257  1.517   7.075   1.00 0.00  ? 149 ILE A HG23   5  
ATOM 7455  H HD11   . ILE B 2 62  ? 0.411   3.766   5.373   1.00 0.00  ? 149 ILE A HD11   5  
ATOM 7456  H HD12   . ILE B 2 62  ? 0.645   3.447   3.654   1.00 0.00  ? 149 ILE A HD12   5  
ATOM 7457  H HD13   . ILE B 2 62  ? -0.711  4.443   4.150   1.00 0.00  ? 149 ILE A HD13   5  
ATOM 7458  N N      . PHE B 2 63  ? 3.108   -0.461  4.564   1.00 0.00  ? 150 PHE A N      5  
ATOM 7459  C CA     . PHE B 2 63  ? 3.864   -1.709  4.446   1.00 0.00  ? 150 PHE A CA     5  
ATOM 7460  C C      . PHE B 2 63  ? 4.268   -2.268  5.825   1.00 0.00  ? 150 PHE A C      5  
ATOM 7461  O O      . PHE B 2 63  ? 4.487   -1.516  6.781   1.00 0.00  ? 150 PHE A O      5  
ATOM 7462  C CB     . PHE B 2 63  ? 5.133   -1.495  3.584   1.00 0.00  ? 150 PHE A CB     5  
ATOM 7463  C CG     . PHE B 2 63  ? 5.077   -2.153  2.216   1.00 0.00  ? 150 PHE A CG     5  
ATOM 7464  C CD1    . PHE B 2 63  ? 4.770   -3.525  2.109   1.00 0.00  ? 150 PHE A CD1    5  
ATOM 7465  C CD2    . PHE B 2 63  ? 5.289   -1.396  1.043   1.00 0.00  ? 150 PHE A CD2    5  
ATOM 7466  C CE1    . PHE B 2 63  ? 4.607   -4.120  0.847   1.00 0.00  ? 150 PHE A CE1    5  
ATOM 7467  C CE2    . PHE B 2 63  ? 5.154   -1.999  -0.222  1.00 0.00  ? 150 PHE A CE2    5  
ATOM 7468  C CZ     . PHE B 2 63  ? 4.794   -3.356  -0.317  1.00 0.00  ? 150 PHE A CZ     5  
ATOM 7469  H H      . PHE B 2 63  ? 3.560   0.413   4.316   1.00 0.00  ? 150 PHE A H      5  
ATOM 7470  H HA     . PHE B 2 63  ? 3.213   -2.426  3.928   1.00 0.00  ? 150 PHE A HA     5  
ATOM 7471  H HB2    . PHE B 2 63  ? 5.329   -0.428  3.467   1.00 0.00  ? 150 PHE A HB2    5  
ATOM 7472  H HB3    . PHE B 2 63  ? 6.003   -1.909  4.096   1.00 0.00  ? 150 PHE A HB3    5  
ATOM 7473  H HD1    . PHE B 2 63  ? 4.634   -4.123  2.992   1.00 0.00  ? 150 PHE A HD1    5  
ATOM 7474  H HD2    . PHE B 2 63  ? 5.531   -0.343  1.110   1.00 0.00  ? 150 PHE A HD2    5  
ATOM 7475  H HE1    . PHE B 2 63  ? 4.334   -5.163  0.774   1.00 0.00  ? 150 PHE A HE1    5  
ATOM 7476  H HE2    . PHE B 2 63  ? 5.308   -1.412  -1.116  1.00 0.00  ? 150 PHE A HE2    5  
ATOM 7477  H HZ     . PHE B 2 63  ? 4.659   -3.823  -1.281  1.00 0.00  ? 150 PHE A HZ     5  
ATOM 7478  N N      . ASN B 2 64  ? 4.453   -3.585  5.907   1.00 0.00  ? 151 ASN A N      5  
ATOM 7479  C CA     . ASN B 2 64  ? 5.105   -4.302  6.998   1.00 0.00  ? 151 ASN A CA     5  
ATOM 7480  C C      . ASN B 2 64  ? 6.060   -5.348  6.376   1.00 0.00  ? 151 ASN A C      5  
ATOM 7481  O O      . ASN B 2 64  ? 5.974   -5.643  5.183   1.00 0.00  ? 151 ASN A O      5  
ATOM 7482  C CB     . ASN B 2 64  ? 3.987   -4.919  7.870   1.00 0.00  ? 151 ASN A CB     5  
ATOM 7483  C CG     . ASN B 2 64  ? 4.427   -5.467  9.220   1.00 0.00  ? 151 ASN A CG     5  
ATOM 7484  O OD1    . ASN B 2 64  ? 5.589   -5.429  9.599   1.00 0.00  ? 151 ASN A OD1    5  
ATOM 7485  N ND2    . ASN B 2 64  ? 3.512   -6.013  9.987   1.00 0.00  ? 151 ASN A ND2    5  
ATOM 7486  H H      . ASN B 2 64  ? 4.207   -4.186  5.124   1.00 0.00  ? 151 ASN A H      5  
ATOM 7487  H HA     . ASN B 2 64  ? 5.698   -3.606  7.593   1.00 0.00  ? 151 ASN A HA     5  
ATOM 7488  H HB2    . ASN B 2 64  ? 3.234   -4.160  8.067   1.00 0.00  ? 151 ASN A HB2    5  
ATOM 7489  H HB3    . ASN B 2 64  ? 3.515   -5.723  7.303   1.00 0.00  ? 151 ASN A HB3    5  
ATOM 7490  H HD21   . ASN B 2 64  ? 2.528   -6.029  9.733   1.00 0.00  ? 151 ASN A HD21   5  
ATOM 7491  H HD22   . ASN B 2 64  ? 3.809   -6.348  10.889  1.00 0.00  ? 151 ASN A HD22   5  
ATOM 7492  N N      . GLU B 2 65  ? 6.932   -5.973  7.167   1.00 0.00  ? 152 GLU A N      5  
ATOM 7493  C CA     . GLU B 2 65  ? 7.801   -7.072  6.703   1.00 0.00  ? 152 GLU A CA     5  
ATOM 7494  C C      . GLU B 2 65  ? 6.981   -8.281  6.190   1.00 0.00  ? 152 GLU A C      5  
ATOM 7495  O O      . GLU B 2 65  ? 7.445   -9.055  5.348   1.00 0.00  ? 152 GLU A O      5  
ATOM 7496  C CB     . GLU B 2 65  ? 8.740   -7.473  7.855   1.00 0.00  ? 152 GLU A CB     5  
ATOM 7497  C CG     . GLU B 2 65  ? 9.953   -8.314  7.432   1.00 0.00  ? 152 GLU A CG     5  
ATOM 7498  C CD     . GLU B 2 65  ? 10.941  -7.519  6.551   1.00 0.00  ? 152 GLU A CD     5  
ATOM 7499  O OE1    . GLU B 2 65  ? 11.760  -6.742  7.100   1.00 0.00  ? 152 GLU A OE1    5  
ATOM 7500  O OE2    . GLU B 2 65  ? 10.913  -7.664  5.305   1.00 0.00  ? 152 GLU A OE2    5  
ATOM 7501  H H      . GLU B 2 65  ? 6.935   -5.712  8.148   1.00 0.00  ? 152 GLU A H      5  
ATOM 7502  H HA     . GLU B 2 65  ? 8.401   -6.703  5.868   1.00 0.00  ? 152 GLU A HA     5  
ATOM 7503  H HB2    . GLU B 2 65  ? 9.113   -6.572  8.342   1.00 0.00  ? 152 GLU A HB2    5  
ATOM 7504  H HB3    . GLU B 2 65  ? 8.169   -8.037  8.597   1.00 0.00  ? 152 GLU A HB3    5  
ATOM 7505  H HG2    . GLU B 2 65  ? 10.469  -8.646  8.337   1.00 0.00  ? 152 GLU A HG2    5  
ATOM 7506  H HG3    . GLU B 2 65  ? 9.617   -9.216  6.915   1.00 0.00  ? 152 GLU A HG3    5  
ATOM 7507  N N      . ARG B 2 66  ? 5.732   -8.416  6.667   1.00 0.00  ? 153 ARG A N      5  
ATOM 7508  C CA     . ARG B 2 66  ? 4.753   -9.446  6.274   1.00 0.00  ? 153 ARG A CA     5  
ATOM 7509  C C      . ARG B 2 66  ? 4.004   -9.161  4.957   1.00 0.00  ? 153 ARG A C      5  
ATOM 7510  O O      . ARG B 2 66  ? 3.318   -10.056 4.461   1.00 0.00  ? 153 ARG A O      5  
ATOM 7511  C CB     . ARG B 2 66  ? 3.747   -9.679  7.424   1.00 0.00  ? 153 ARG A CB     5  
ATOM 7512  C CG     . ARG B 2 66  ? 4.350   -9.869  8.830   1.00 0.00  ? 153 ARG A CG     5  
ATOM 7513  C CD     . ARG B 2 66  ? 5.245   -11.111 8.916   1.00 0.00  ? 153 ARG A CD     5  
ATOM 7514  N NE     . ARG B 2 66  ? 5.856   -11.248 10.254  1.00 0.00  ? 153 ARG A NE     5  
ATOM 7515  C CZ     . ARG B 2 66  ? 6.471   -12.310 10.744  1.00 0.00  ? 153 ARG A CZ     5  
ATOM 7516  N NH1    . ARG B 2 66  ? 6.585   -13.418 10.065  1.00 0.00  ? 153 ARG A NH1    5  
ATOM 7517  N NH2    . ARG B 2 66  ? 6.992   -12.276 11.936  1.00 0.00  ? 153 ARG A NH2    5  
ATOM 7518  H H      . ARG B 2 66  ? 5.474   -7.735  7.368   1.00 0.00  ? 153 ARG A H      5  
ATOM 7519  H HA     . ARG B 2 66  ? 5.289   -10.382 6.099   1.00 0.00  ? 153 ARG A HA     5  
ATOM 7520  H HB2    . ARG B 2 66  ? 3.019   -8.869  7.463   1.00 0.00  ? 153 ARG A HB2    5  
ATOM 7521  H HB3    . ARG B 2 66  ? 3.185   -10.572 7.193   1.00 0.00  ? 153 ARG A HB3    5  
ATOM 7522  H HG2    . ARG B 2 66  ? 4.923   -8.984  9.112   1.00 0.00  ? 153 ARG A HG2    5  
ATOM 7523  H HG3    . ARG B 2 66  ? 3.525   -9.983  9.538   1.00 0.00  ? 153 ARG A HG3    5  
ATOM 7524  H HD2    . ARG B 2 66  ? 4.631   -11.988 8.692   1.00 0.00  ? 153 ARG A HD2    5  
ATOM 7525  H HD3    . ARG B 2 66  ? 6.041   -11.032 8.174   1.00 0.00  ? 153 ARG A HD3    5  
ATOM 7526  H HE     . ARG B 2 66  ? 5.821   -10.447 10.862  1.00 0.00  ? 153 ARG A HE     5  
ATOM 7527  H HH11   . ARG B 2 66  ? 6.186   -13.461 9.142   1.00 0.00  ? 153 ARG A HH11   5  
ATOM 7528  H HH12   . ARG B 2 66  ? 7.050   -14.221 10.456  1.00 0.00  ? 153 ARG A HH12   5  
ATOM 7529  H HH21   . ARG B 2 66  ? 6.934   -11.440 12.491  1.00 0.00  ? 153 ARG A HH21   5  
ATOM 7530  H HH22   . ARG B 2 66  ? 7.461   -13.086 12.307  1.00 0.00  ? 153 ARG A HH22   5  
ATOM 7531  N N      . GLY B 2 67  ? 4.105   -7.953  4.390   1.00 0.00  ? 154 GLY A N      5  
ATOM 7532  C CA     . GLY B 2 67  ? 3.330   -7.503  3.220   1.00 0.00  ? 154 GLY A CA     5  
ATOM 7533  C C      . GLY B 2 67  ? 2.612   -6.185  3.510   1.00 0.00  ? 154 GLY A C      5  
ATOM 7534  O O      . GLY B 2 67  ? 2.935   -5.511  4.490   1.00 0.00  ? 154 GLY A O      5  
ATOM 7535  H H      . GLY B 2 67  ? 4.654   -7.236  4.852   1.00 0.00  ? 154 GLY A H      5  
ATOM 7536  H HA2    . GLY B 2 67  ? 4.002   -7.352  2.378   1.00 0.00  ? 154 GLY A HA2    5  
ATOM 7537  H HA3    . GLY B 2 67  ? 2.584   -8.249  2.940   1.00 0.00  ? 154 GLY A HA3    5  
ATOM 7538  N N      . SER B 2 68  ? 1.633   -5.799  2.690   1.00 0.00  ? 155 SER A N      5  
ATOM 7539  C CA     . SER B 2 68  ? 0.732   -4.686  3.037   1.00 0.00  ? 155 SER A CA     5  
ATOM 7540  C C      . SER B 2 68  ? 0.030   -4.925  4.386   1.00 0.00  ? 155 SER A C      5  
ATOM 7541  O O      . SER B 2 68  ? -0.202  -6.068  4.786   1.00 0.00  ? 155 SER A O      5  
ATOM 7542  C CB     . SER B 2 68  ? -0.288  -4.454  1.915   1.00 0.00  ? 155 SER A CB     5  
ATOM 7543  O OG     . SER B 2 68  ? -1.159  -3.380  2.242   1.00 0.00  ? 155 SER A OG     5  
ATOM 7544  H H      . SER B 2 68  ? 1.416   -6.385  1.888   1.00 0.00  ? 155 SER A H      5  
ATOM 7545  H HA     . SER B 2 68  ? 1.320   -3.783  3.115   1.00 0.00  ? 155 SER A HA     5  
ATOM 7546  H HB2    . SER B 2 68  ? 0.228   -4.228  0.982   1.00 0.00  ? 155 SER A HB2    5  
ATOM 7547  H HB3    . SER B 2 68  ? -0.882  -5.351  1.779   1.00 0.00  ? 155 SER A HB3    5  
ATOM 7548  H HG     . SER B 2 68  ? -0.810  -2.559  1.852   1.00 0.00  ? 155 SER A HG     5  
ATOM 7549  N N      . LYS B 2 69  ? -0.354  -3.846  5.077   1.00 0.00  ? 156 LYS A N      5  
ATOM 7550  C CA     . LYS B 2 69  ? -1.326  -3.825  6.189   1.00 0.00  ? 156 LYS A CA     5  
ATOM 7551  C C      . LYS B 2 69  ? -2.788  -3.933  5.736   1.00 0.00  ? 156 LYS A C      5  
ATOM 7552  O O      . LYS B 2 69  ? -3.697  -3.987  6.564   1.00 0.00  ? 156 LYS A O      5  
ATOM 7553  C CB     . LYS B 2 69  ? -1.063  -2.579  7.052   1.00 0.00  ? 156 LYS A CB     5  
ATOM 7554  C CG     . LYS B 2 69  ? 0.052   -2.943  8.055   1.00 0.00  ? 156 LYS A CG     5  
ATOM 7555  C CD     . LYS B 2 69  ? 0.619   -1.784  8.883   1.00 0.00  ? 156 LYS A CD     5  
ATOM 7556  C CE     . LYS B 2 69  ? 1.842   -1.187  8.182   1.00 0.00  ? 156 LYS A CE     5  
ATOM 7557  N NZ     . LYS B 2 69  ? 2.499   -0.136  8.993   1.00 0.00  ? 156 LYS A NZ     5  
ATOM 7558  H H      . LYS B 2 69  ? -0.006  -2.950  4.746   1.00 0.00  ? 156 LYS A H      5  
ATOM 7559  H HA     . LYS B 2 69  ? -1.166  -4.708  6.806   1.00 0.00  ? 156 LYS A HA     5  
ATOM 7560  H HB2    . LYS B 2 69  ? -0.796  -1.730  6.413   1.00 0.00  ? 156 LYS A HB2    5  
ATOM 7561  H HB3    . LYS B 2 69  ? -1.956  -2.307  7.615   1.00 0.00  ? 156 LYS A HB3    5  
ATOM 7562  H HG2    . LYS B 2 69  ? -0.366  -3.670  8.750   1.00 0.00  ? 156 LYS A HG2    5  
ATOM 7563  H HG3    . LYS B 2 69  ? 0.872   -3.440  7.532   1.00 0.00  ? 156 LYS A HG3    5  
ATOM 7564  H HD2    . LYS B 2 69  ? -0.148  -1.027  9.057   1.00 0.00  ? 156 LYS A HD2    5  
ATOM 7565  H HD3    . LYS B 2 69  ? 0.936   -2.176  9.851   1.00 0.00  ? 156 LYS A HD3    5  
ATOM 7566  H HE2    . LYS B 2 69  ? 2.552   -1.995  7.994   1.00 0.00  ? 156 LYS A HE2    5  
ATOM 7567  H HE3    . LYS B 2 69  ? 1.544   -0.798  7.201   1.00 0.00  ? 156 LYS A HE3    5  
ATOM 7568  H HZ1    . LYS B 2 69  ? 1.902   0.686   9.105   1.00 0.00  ? 156 LYS A HZ1    5  
ATOM 7569  H HZ2    . LYS B 2 69  ? 2.729   -0.473  9.916   1.00 0.00  ? 156 LYS A HZ2    5  
ATOM 7570  H HZ3    . LYS B 2 69  ? 3.357   0.167   8.551   1.00 0.00  ? 156 LYS A HZ3    5  
ATOM 7571  N N      . GLY B 2 70  ? -3.010  -4.018  4.420   1.00 0.00  ? 157 GLY A N      5  
ATOM 7572  C CA     . GLY B 2 70  ? -4.305  -4.220  3.771   1.00 0.00  ? 157 GLY A CA     5  
ATOM 7573  C C      . GLY B 2 70  ? -4.805  -2.998  3.004   1.00 0.00  ? 157 GLY A C      5  
ATOM 7574  O O      . GLY B 2 70  ? -5.902  -3.029  2.442   1.00 0.00  ? 157 GLY A O      5  
ATOM 7575  H H      . GLY B 2 70  ? -2.197  -3.939  3.821   1.00 0.00  ? 157 GLY A H      5  
ATOM 7576  H HA2    . GLY B 2 70  ? -4.211  -5.046  3.062   1.00 0.00  ? 157 GLY A HA2    5  
ATOM 7577  H HA3    . GLY B 2 70  ? -5.055  -4.483  4.515   1.00 0.00  ? 157 GLY A HA3    5  
ATOM 7578  N N      . PHE B 2 71  ? -4.018  -1.921  2.980   1.00 0.00  ? 158 PHE A N      5  
ATOM 7579  C CA     . PHE B 2 71  ? -4.301  -0.694  2.258   1.00 0.00  ? 158 PHE A CA     5  
ATOM 7580  C C      . PHE B 2 71  ? -3.026  0.058   1.838   1.00 0.00  ? 158 PHE A C      5  
ATOM 7581  O O      . PHE B 2 71  ? -1.912  -0.156  2.340   1.00 0.00  ? 158 PHE A O      5  
ATOM 7582  C CB     . PHE B 2 71  ? -5.280  0.190   3.062   1.00 0.00  ? 158 PHE A CB     5  
ATOM 7583  C CG     . PHE B 2 71  ? -4.748  0.970   4.246   1.00 0.00  ? 158 PHE A CG     5  
ATOM 7584  C CD1    . PHE B 2 71  ? -4.585  0.325   5.483   1.00 0.00  ? 158 PHE A CD1    5  
ATOM 7585  C CD2    . PHE B 2 71  ? -4.546  2.364   4.145   1.00 0.00  ? 158 PHE A CD2    5  
ATOM 7586  C CE1    . PHE B 2 71  ? -4.188  1.061   6.609   1.00 0.00  ? 158 PHE A CE1    5  
ATOM 7587  C CE2    . PHE B 2 71  ? -4.200  3.113   5.286   1.00 0.00  ? 158 PHE A CE2    5  
ATOM 7588  C CZ     . PHE B 2 71  ? -3.987  2.446   6.504   1.00 0.00  ? 158 PHE A CZ     5  
ATOM 7589  H H      . PHE B 2 71  ? -3.075  -2.037  3.307   1.00 0.00  ? 158 PHE A H      5  
ATOM 7590  H HA     . PHE B 2 71  ? -4.803  -0.999  1.343   1.00 0.00  ? 158 PHE A HA     5  
ATOM 7591  H HB2    . PHE B 2 71  ? -5.772  0.884   2.392   1.00 0.00  ? 158 PHE A HB2    5  
ATOM 7592  H HB3    . PHE B 2 71  ? -6.084  -0.431  3.424   1.00 0.00  ? 158 PHE A HB3    5  
ATOM 7593  H HD1    . PHE B 2 71  ? -4.766  -0.737  5.575   1.00 0.00  ? 158 PHE A HD1    5  
ATOM 7594  H HD2    . PHE B 2 71  ? -4.677  2.857   3.192   1.00 0.00  ? 158 PHE A HD2    5  
ATOM 7595  H HE1    . PHE B 2 71  ? -4.044  0.548   7.551   1.00 0.00  ? 158 PHE A HE1    5  
ATOM 7596  H HE2    . PHE B 2 71  ? -4.030  4.189   5.250   1.00 0.00  ? 158 PHE A HE2    5  
ATOM 7597  H HZ     . PHE B 2 71  ? -3.594  3.004   7.336   1.00 0.00  ? 158 PHE A HZ     5  
ATOM 7598  N N      . GLY B 2 72  ? -3.234  0.976   0.904   1.00 0.00  ? 159 GLY A N      5  
ATOM 7599  C CA     . GLY B 2 72  ? -2.308  2.007   0.464   1.00 0.00  ? 159 GLY A CA     5  
ATOM 7600  C C      . GLY B 2 72  ? -3.026  3.350   0.308   1.00 0.00  ? 159 GLY A C      5  
ATOM 7601  O O      . GLY B 2 72  ? -4.174  3.523   0.728   1.00 0.00  ? 159 GLY A O      5  
ATOM 7602  H H      . GLY B 2 72  ? -4.186  1.038   0.554   1.00 0.00  ? 159 GLY A H      5  
ATOM 7603  H HA2    . GLY B 2 72  ? -1.536  2.141   1.220   1.00 0.00  ? 159 GLY A HA2    5  
ATOM 7604  H HA3    . GLY B 2 72  ? -1.834  1.707   -0.475  1.00 0.00  ? 159 GLY A HA3    5  
ATOM 7605  N N      . PHE B 2 73  ? -2.310  4.327   -0.225  1.00 0.00  ? 160 PHE A N      5  
ATOM 7606  C CA     . PHE B 2 73  ? -2.638  5.742   -0.170  1.00 0.00  ? 160 PHE A CA     5  
ATOM 7607  C C      . PHE B 2 73  ? -2.097  6.470   -1.417  1.00 0.00  ? 160 PHE A C      5  
ATOM 7608  O O      . PHE B 2 73  ? -0.887  6.542   -1.627  1.00 0.00  ? 160 PHE A O      5  
ATOM 7609  C CB     . PHE B 2 73  ? -2.090  6.305   1.158   1.00 0.00  ? 160 PHE A CB     5  
ATOM 7610  C CG     . PHE B 2 73  ? -3.167  6.932   2.016   1.00 0.00  ? 160 PHE A CG     5  
ATOM 7611  C CD1    . PHE B 2 73  ? -3.782  8.113   1.567   1.00 0.00  ? 160 PHE A CD1    5  
ATOM 7612  C CD2    . PHE B 2 73  ? -3.567  6.346   3.237   1.00 0.00  ? 160 PHE A CD2    5  
ATOM 7613  C CE1    . PHE B 2 73  ? -4.801  8.700   2.328   1.00 0.00  ? 160 PHE A CE1    5  
ATOM 7614  C CE2    . PHE B 2 73  ? -4.589  6.934   3.994   1.00 0.00  ? 160 PHE A CE2    5  
ATOM 7615  C CZ     . PHE B 2 73  ? -5.204  8.109   3.537   1.00 0.00  ? 160 PHE A CZ     5  
ATOM 7616  H H      . PHE B 2 73  ? -1.397  4.087   -0.567  1.00 0.00  ? 160 PHE A H      5  
ATOM 7617  H HA     . PHE B 2 73  ? -3.721  5.835   -0.156  1.00 0.00  ? 160 PHE A HA     5  
ATOM 7618  H HB2    . PHE B 2 73  ? -1.597  5.520   1.734   1.00 0.00  ? 160 PHE A HB2    5  
ATOM 7619  H HB3    . PHE B 2 73  ? -1.336  7.059   0.950   1.00 0.00  ? 160 PHE A HB3    5  
ATOM 7620  H HD1    . PHE B 2 73  ? -3.475  8.574   0.639   1.00 0.00  ? 160 PHE A HD1    5  
ATOM 7621  H HD2    . PHE B 2 73  ? -3.107  5.457   3.642   1.00 0.00  ? 160 PHE A HD2    5  
ATOM 7622  H HE1    . PHE B 2 73  ? -5.252  9.622   1.990   1.00 0.00  ? 160 PHE A HE1    5  
ATOM 7623  H HE2    . PHE B 2 73  ? -4.871  6.504   4.944   1.00 0.00  ? 160 PHE A HE2    5  
ATOM 7624  H HZ     . PHE B 2 73  ? -5.965  8.568   4.143   1.00 0.00  ? 160 PHE A HZ     5  
ATOM 7625  N N      . VAL B 2 74  ? -2.971  6.974   -2.288  1.00 0.00  ? 161 VAL A N      5  
ATOM 7626  C CA     . VAL B 2 74  ? -2.629  7.536   -3.615  1.00 0.00  ? 161 VAL A CA     5  
ATOM 7627  C C      . VAL B 2 74  ? -3.192  8.950   -3.791  1.00 0.00  ? 161 VAL A C      5  
ATOM 7628  O O      . VAL B 2 74  ? -4.149  9.311   -3.119  1.00 0.00  ? 161 VAL A O      5  
ATOM 7629  C CB     . VAL B 2 74  ? -3.027  6.526   -4.717  1.00 0.00  ? 161 VAL A CB     5  
ATOM 7630  C CG1    . VAL B 2 74  ? -4.455  6.078   -4.766  1.00 0.00  ? 161 VAL A CG1    5  
ATOM 7631  C CG2    . VAL B 2 74  ? -2.778  6.995   -6.149  1.00 0.00  ? 161 VAL A CG2    5  
ATOM 7632  H H      . VAL B 2 74  ? -3.955  6.905   -2.042  1.00 0.00  ? 161 VAL A H      5  
ATOM 7633  H HA     . VAL B 2 74  ? -1.549  7.656   -3.680  1.00 0.00  ? 161 VAL A HA     5  
ATOM 7634  H HB     . VAL B 2 74  ? -2.484  5.597   -4.524  1.00 0.00  ? 161 VAL A HB     5  
ATOM 7635  H HG11   . VAL B 2 74  ? -4.780  5.841   -3.764  1.00 0.00  ? 161 VAL A HG11   5  
ATOM 7636  H HG12   . VAL B 2 74  ? -5.057  6.863   -5.224  1.00 0.00  ? 161 VAL A HG12   5  
ATOM 7637  H HG13   . VAL B 2 74  ? -4.432  5.173   -5.380  1.00 0.00  ? 161 VAL A HG13   5  
ATOM 7638  H HG21   . VAL B 2 74  ? -3.470  7.798   -6.421  1.00 0.00  ? 161 VAL A HG21   5  
ATOM 7639  H HG22   . VAL B 2 74  ? -1.762  7.350   -6.216  1.00 0.00  ? 161 VAL A HG22   5  
ATOM 7640  H HG23   . VAL B 2 74  ? -2.929  6.171   -6.847  1.00 0.00  ? 161 VAL A HG23   5  
ATOM 7641  N N      . THR B 2 75  ? -2.604  9.790   -4.644  1.00 0.00  ? 162 THR A N      5  
ATOM 7642  C CA     . THR B 2 75  ? -2.872  11.244  -4.685  1.00 0.00  ? 162 THR A CA     5  
ATOM 7643  C C      . THR B 2 75  ? -3.574  11.601  -5.981  1.00 0.00  ? 162 THR A C      5  
ATOM 7644  O O      . THR B 2 75  ? -2.959  11.572  -7.050  1.00 0.00  ? 162 THR A O      5  
ATOM 7645  C CB     . THR B 2 75  ? -1.584  12.053  -4.513  1.00 0.00  ? 162 THR A CB     5  
ATOM 7646  O OG1    . THR B 2 75  ? -0.965  11.727  -3.291  1.00 0.00  ? 162 THR A OG1    5  
ATOM 7647  C CG2    . THR B 2 75  ? -1.789  13.565  -4.457  1.00 0.00  ? 162 THR A CG2    5  
ATOM 7648  H H      . THR B 2 75  ? -1.842  9.419   -5.208  1.00 0.00  ? 162 THR A H      5  
ATOM 7649  H HA     . THR B 2 75  ? -3.537  11.514  -3.870  1.00 0.00  ? 162 THR A HA     5  
ATOM 7650  H HB     . THR B 2 75  ? -0.930  11.801  -5.339  1.00 0.00  ? 162 THR A HB     5  
ATOM 7651  H HG1    . THR B 2 75  ? -0.117  12.205  -3.269  1.00 0.00  ? 162 THR A HG1    5  
ATOM 7652  H HG21   . THR B 2 75  ? -2.381  13.915  -5.300  1.00 0.00  ? 162 THR A HG21   5  
ATOM 7653  H HG22   . THR B 2 75  ? -2.283  13.840  -3.528  1.00 0.00  ? 162 THR A HG22   5  
ATOM 7654  H HG23   . THR B 2 75  ? -0.821  14.069  -4.490  1.00 0.00  ? 162 THR A HG23   5  
ATOM 7655  N N      . PHE B 2 76  ? -4.890  11.816  -5.891  1.00 0.00  ? 163 PHE A N      5  
ATOM 7656  C CA     . PHE B 2 76  ? -5.777  11.420  -6.980  1.00 0.00  ? 163 PHE A CA     5  
ATOM 7657  C C      . PHE B 2 76  ? -7.070  12.226  -7.137  1.00 0.00  ? 163 PHE A C      5  
ATOM 7658  O O      . PHE B 2 76  ? -7.272  12.937  -8.115  1.00 0.00  ? 163 PHE A O      5  
ATOM 7659  C CB     . PHE B 2 76  ? -6.056  9.925   -6.801  1.00 0.00  ? 163 PHE A CB     5  
ATOM 7660  C CG     . PHE B 2 76  ? -6.553  9.266   -8.065  1.00 0.00  ? 163 PHE A CG     5  
ATOM 7661  C CD1    . PHE B 2 76  ? -5.639  9.033   -9.100  1.00 0.00  ? 163 PHE A CD1    5  
ATOM 7662  C CD2    . PHE B 2 76  ? -7.898  8.891   -8.223  1.00 0.00  ? 163 PHE A CD2    5  
ATOM 7663  C CE1    . PHE B 2 76  ? -6.048  8.379   -10.275 1.00 0.00  ? 163 PHE A CE1    5  
ATOM 7664  C CE2    . PHE B 2 76  ? -8.306  8.239   -9.399  1.00 0.00  ? 163 PHE A CE2    5  
ATOM 7665  C CZ     . PHE B 2 76  ? -7.389  8.001   -10.437 1.00 0.00  ? 163 PHE A CZ     5  
ATOM 7666  H H      . PHE B 2 76  ? -5.302  11.888  -4.969  1.00 0.00  ? 163 PHE A H      5  
ATOM 7667  H HA     . PHE B 2 76  ? -5.255  11.520  -7.904  1.00 0.00  ? 163 PHE A HA     5  
ATOM 7668  H HB2    . PHE B 2 76  ? -5.121  9.432   -6.519  1.00 0.00  ? 163 PHE A HB2    5  
ATOM 7669  H HB3    . PHE B 2 76  ? -6.756  9.771   -5.984  1.00 0.00  ? 163 PHE A HB3    5  
ATOM 7670  H HD1    . PHE B 2 76  ? -4.622  9.361   -8.969  1.00 0.00  ? 163 PHE A HD1    5  
ATOM 7671  H HD2    . PHE B 2 76  ? -8.619  9.110   -7.452  1.00 0.00  ? 163 PHE A HD2    5  
ATOM 7672  H HE1    . PHE B 2 76  ? -5.329  8.156   -11.048 1.00 0.00  ? 163 PHE A HE1    5  
ATOM 7673  H HE2    . PHE B 2 76  ? -9.327  7.911   -9.495  1.00 0.00  ? 163 PHE A HE2    5  
ATOM 7674  H HZ     . PHE B 2 76  ? -7.698  7.493   -11.341 1.00 0.00  ? 163 PHE A HZ     5  
ATOM 7675  N N      . GLU B 2 77  ? -7.954  12.072  -6.161  1.00 0.00  ? 164 GLU A N      5  
ATOM 7676  C CA     . GLU B 2 77  ? -9.416  11.891  -6.241  1.00 0.00  ? 164 GLU A CA     5  
ATOM 7677  C C      . GLU B 2 77  ? -10.184 13.061  -6.866  1.00 0.00  ? 164 GLU A C      5  
ATOM 7678  O O      . GLU B 2 77  ? -11.334 12.914  -7.279  1.00 0.00  ? 164 GLU A O      5  
ATOM 7679  C CB     . GLU B 2 77  ? -9.883  11.627  -4.791  1.00 0.00  ? 164 GLU A CB     5  
ATOM 7680  C CG     . GLU B 2 77  ? -11.396 11.456  -4.572  1.00 0.00  ? 164 GLU A CG     5  
ATOM 7681  C CD     . GLU B 2 77  ? -11.750 11.113  -3.109  1.00 0.00  ? 164 GLU A CD     5  
ATOM 7682  O OE1    . GLU B 2 77  ? -11.219 11.760  -2.177  1.00 0.00  ? 164 GLU A OE1    5  
ATOM 7683  O OE2    . GLU B 2 77  ? -12.611 10.224  -2.893  1.00 0.00  ? 164 GLU A OE2    5  
ATOM 7684  H H      . GLU B 2 77  ? -7.504  11.726  -5.338  1.00 0.00  ? 164 GLU A H      5  
ATOM 7685  H HA     . GLU B 2 77  ? -9.642  11.008  -6.841  1.00 0.00  ? 164 GLU A HA     5  
ATOM 7686  H HB2    . GLU B 2 77  ? -9.392  10.721  -4.434  1.00 0.00  ? 164 GLU A HB2    5  
ATOM 7687  H HB3    . GLU B 2 77  ? -9.540  12.461  -4.172  1.00 0.00  ? 164 GLU A HB3    5  
ATOM 7688  H HG2    . GLU B 2 77  ? -11.905 12.387  -4.822  1.00 0.00  ? 164 GLU A HG2    5  
ATOM 7689  H HG3    . GLU B 2 77  ? -11.762 10.676  -5.243  1.00 0.00  ? 164 GLU A HG3    5  
ATOM 7690  N N      . ASN B 2 78  ? -9.570  14.241  -6.888  1.00 0.00  ? 165 ASN A N      5  
ATOM 7691  C CA     . ASN B 2 78  ? -10.331 15.485  -6.838  1.00 0.00  ? 165 ASN A CA     5  
ATOM 7692  C C      . ASN B 2 78  ? -10.837 16.001  -8.202  1.00 0.00  ? 165 ASN A C      5  
ATOM 7693  O O      . ASN B 2 78  ? -11.830 16.729  -8.245  1.00 0.00  ? 165 ASN A O      5  
ATOM 7694  C CB     . ASN B 2 78  ? -9.533  16.549  -6.064  1.00 0.00  ? 165 ASN A CB     5  
ATOM 7695  C CG     . ASN B 2 78  ? -9.884  16.560  -4.584  1.00 0.00  ? 165 ASN A CG     5  
ATOM 7696  O OD1    . ASN B 2 78  ? -10.349 17.549  -4.037  1.00 0.00  ? 165 ASN A OD1    5  
ATOM 7697  N ND2    . ASN B 2 78  ? -9.696  15.464  -3.883  1.00 0.00  ? 165 ASN A ND2    5  
ATOM 7698  H H      . ASN B 2 78  ? -8.579  14.207  -6.703  1.00 0.00  ? 165 ASN A H      5  
ATOM 7699  H HA     . ASN B 2 78  ? -11.212 15.239  -6.251  1.00 0.00  ? 165 ASN A HA     5  
ATOM 7700  H HB2    . ASN B 2 78  ? -8.466  16.384  -6.178  1.00 0.00  ? 165 ASN A HB2    5  
ATOM 7701  H HB3    . ASN B 2 78  ? -9.769  17.539  -6.460  1.00 0.00  ? 165 ASN A HB3    5  
ATOM 7702  H HD21   . ASN B 2 78  ? -9.326  14.629  -4.303  1.00 0.00  ? 165 ASN A HD21   5  
ATOM 7703  H HD22   . ASN B 2 78  ? -9.996  15.476  -2.921  1.00 0.00  ? 165 ASN A HD22   5  
ATOM 7704  N N      . SER B 2 79  ? -10.196 15.622  -9.313  1.00 0.00  ? 166 SER A N      5  
ATOM 7705  C CA     . SER B 2 79  ? -10.671 15.916  -10.678 1.00 0.00  ? 166 SER A CA     5  
ATOM 7706  C C      . SER B 2 79  ? -11.903 15.069  -11.046 1.00 0.00  ? 166 SER A C      5  
ATOM 7707  O O      . SER B 2 79  ? -12.111 14.004  -10.468 1.00 0.00  ? 166 SER A O      5  
ATOM 7708  C CB     . SER B 2 79  ? -9.560  15.632  -11.700 1.00 0.00  ? 166 SER A CB     5  
ATOM 7709  O OG     . SER B 2 79  ? -8.409  16.414  -11.415 1.00 0.00  ? 166 SER A OG     5  
ATOM 7710  H H      . SER B 2 79  ? -9.381  15.034  -9.196  1.00 0.00  ? 166 SER A H      5  
ATOM 7711  H HA     . SER B 2 79  ? -10.943 16.971  -10.734 1.00 0.00  ? 166 SER A HA     5  
ATOM 7712  H HB2    . SER B 2 79  ? -9.303  14.571  -11.676 1.00 0.00  ? 166 SER A HB2    5  
ATOM 7713  H HB3    . SER B 2 79  ? -9.926  15.874  -12.702 1.00 0.00  ? 166 SER A HB3    5  
ATOM 7714  H HG     . SER B 2 79  ? -7.751  16.269  -12.121 1.00 0.00  ? 166 SER A HG     5  
ATOM 7715  N N      . ALA B 2 80  ? -12.678 15.456  -12.069 1.00 0.00  ? 167 ALA A N      5  
ATOM 7716  C CA     . ALA B 2 80  ? -13.785 14.623  -12.570 1.00 0.00  ? 167 ALA A CA     5  
ATOM 7717  C C      . ALA B 2 80  ? -13.310 13.250  -13.071 1.00 0.00  ? 167 ALA A C      5  
ATOM 7718  O O      . ALA B 2 80  ? -13.915 12.227  -12.752 1.00 0.00  ? 167 ALA A O      5  
ATOM 7719  C CB     . ALA B 2 80  ? -14.525 15.338  -13.704 1.00 0.00  ? 167 ALA A CB     5  
ATOM 7720  H H      . ALA B 2 80  ? -12.493 16.347  -12.507 1.00 0.00  ? 167 ALA A H      5  
ATOM 7721  H HA     . ALA B 2 80  ? -14.492 14.451  -11.754 1.00 0.00  ? 167 ALA A HA     5  
ATOM 7722  H HB1    . ALA B 2 80  ? -14.996 16.246  -13.333 1.00 0.00  ? 167 ALA A HB1    5  
ATOM 7723  H HB2    . ALA B 2 80  ? -13.835 15.578  -14.511 1.00 0.00  ? 167 ALA A HB2    5  
ATOM 7724  H HB3    . ALA B 2 80  ? -15.286 14.658  -14.097 1.00 0.00  ? 167 ALA A HB3    5  
ATOM 7725  N N      . ASP B 2 81  ? -12.206 13.226  -13.830 1.00 0.00  ? 168 ASP A N      5  
ATOM 7726  C CA     . ASP B 2 81  ? -11.595 11.994  -14.337 1.00 0.00  ? 168 ASP A CA     5  
ATOM 7727  C C      . ASP B 2 81  ? -11.169 11.069  -13.187 1.00 0.00  ? 168 ASP A C      5  
ATOM 7728  O O      . ASP B 2 81  ? -11.392 9.860   -13.237 1.00 0.00  ? 168 ASP A O      5  
ATOM 7729  C CB     . ASP B 2 81  ? -10.366 12.322  -15.195 1.00 0.00  ? 168 ASP A CB     5  
ATOM 7730  C CG     . ASP B 2 81  ? -10.653 13.071  -16.508 1.00 0.00  ? 168 ASP A CG     5  
ATOM 7731  O OD1    . ASP B 2 81  ? -11.777 12.989  -17.054 1.00 0.00  ? 168 ASP A OD1    5  
ATOM 7732  O OD2    . ASP B 2 81  ? -9.705  13.720  -17.013 1.00 0.00  ? 168 ASP A OD2    5  
ATOM 7733  H H      . ASP B 2 81  ? -11.805 14.111  -14.097 1.00 0.00  ? 168 ASP A H      5  
ATOM 7734  H HA     . ASP B 2 81  ? -12.320 11.464  -14.949 1.00 0.00  ? 168 ASP A HA     5  
ATOM 7735  H HB2    . ASP B 2 81  ? -9.670  12.915  -14.595 1.00 0.00  ? 168 ASP A HB2    5  
ATOM 7736  H HB3    . ASP B 2 81  ? -9.875  11.383  -15.449 1.00 0.00  ? 168 ASP A HB3    5  
ATOM 7737  N N      . ALA B 2 82  ? -10.580 11.649  -12.138 1.00 0.00  ? 169 ALA A N      5  
ATOM 7738  C CA     . ALA B 2 82  ? -10.173 10.939  -10.935 1.00 0.00  ? 169 ALA A CA     5  
ATOM 7739  C C      . ALA B 2 82  ? -11.370 10.444  -10.099 1.00 0.00  ? 169 ALA A C      5  
ATOM 7740  O O      . ALA B 2 82  ? -11.340 9.319   -9.613  1.00 0.00  ? 169 ALA A O      5  
ATOM 7741  C CB     . ALA B 2 82  ? -9.264  11.852  -10.122 1.00 0.00  ? 169 ALA A CB     5  
ATOM 7742  H H      . ALA B 2 82  ? -10.470 12.650  -12.161 1.00 0.00  ? 169 ALA A H      5  
ATOM 7743  H HA     . ALA B 2 82  ? -9.590  10.064  -11.229 1.00 0.00  ? 169 ALA A HA     5  
ATOM 7744  H HB1    . ALA B 2 82  ? -8.399  12.148  -10.719 1.00 0.00  ? 169 ALA A HB1    5  
ATOM 7745  H HB2    . ALA B 2 82  ? -9.809  12.739  -9.801  1.00 0.00  ? 169 ALA A HB2    5  
ATOM 7746  H HB3    . ALA B 2 82  ? -8.918  11.308  -9.246  1.00 0.00  ? 169 ALA A HB3    5  
ATOM 7747  N N      . ASP B 2 83  ? -12.448 11.223  -9.963  1.00 0.00  ? 170 ASP A N      5  
ATOM 7748  C CA     . ASP B 2 83  ? -13.695 10.784  -9.322  1.00 0.00  ? 170 ASP A CA     5  
ATOM 7749  C C      . ASP B 2 83  ? -14.308 9.595   -10.079 1.00 0.00  ? 170 ASP A C      5  
ATOM 7750  O O      . ASP B 2 83  ? -14.537 8.541   -9.492  1.00 0.00  ? 170 ASP A O      5  
ATOM 7751  C CB     . ASP B 2 83  ? -14.694 11.943  -9.227  1.00 0.00  ? 170 ASP A CB     5  
ATOM 7752  C CG     . ASP B 2 83  ? -15.955 11.530  -8.443  1.00 0.00  ? 170 ASP A CG     5  
ATOM 7753  O OD1    . ASP B 2 83  ? -15.874 11.383  -7.200  1.00 0.00  ? 170 ASP A OD1    5  
ATOM 7754  O OD2    . ASP B 2 83  ? -17.032 11.376  -9.066  1.00 0.00  ? 170 ASP A OD2    5  
ATOM 7755  H H      . ASP B 2 83  ? -12.388 12.175  -10.306 1.00 0.00  ? 170 ASP A H      5  
ATOM 7756  H HA     . ASP B 2 83  ? -13.462 10.450  -8.310  1.00 0.00  ? 170 ASP A HA     5  
ATOM 7757  H HB2    . ASP B 2 83  ? -14.218 12.784  -8.721  1.00 0.00  ? 170 ASP A HB2    5  
ATOM 7758  H HB3    . ASP B 2 83  ? -14.980 12.262  -10.229 1.00 0.00  ? 170 ASP A HB3    5  
ATOM 7759  N N      . ARG B 2 84  ? -14.495 9.722   -11.396 1.00 0.00  ? 171 ARG A N      5  
ATOM 7760  C CA     . ARG B 2 84  ? -14.937 8.657   -12.309 1.00 0.00  ? 171 ARG A CA     5  
ATOM 7761  C C      . ARG B 2 84  ? -14.088 7.388   -12.137 1.00 0.00  ? 171 ARG A C      5  
ATOM 7762  O O      . ARG B 2 84  ? -14.624 6.292   -11.952 1.00 0.00  ? 171 ARG A O      5  
ATOM 7763  C CB     . ARG B 2 84  ? -14.929 9.270   -13.729 1.00 0.00  ? 171 ARG A CB     5  
ATOM 7764  C CG     . ARG B 2 84  ? -15.581 8.474   -14.876 1.00 0.00  ? 171 ARG A CG     5  
ATOM 7765  C CD     . ARG B 2 84  ? -14.925 7.136   -15.248 1.00 0.00  ? 171 ARG A CD     5  
ATOM 7766  N NE     . ARG B 2 84  ? -15.589 6.001   -14.572 1.00 0.00  ? 171 ARG A NE     5  
ATOM 7767  C CZ     . ARG B 2 84  ? -16.584 5.254   -15.013 1.00 0.00  ? 171 ARG A CZ     5  
ATOM 7768  N NH1    . ARG B 2 84  ? -17.063 5.365   -16.222 1.00 0.00  ? 171 ARG A NH1    5  
ATOM 7769  N NH2    . ARG B 2 84  ? -17.133 4.375   -14.222 1.00 0.00  ? 171 ARG A NH2    5  
ATOM 7770  H H      . ARG B 2 84  ? -14.254 10.627  -11.797 1.00 0.00  ? 171 ARG A H      5  
ATOM 7771  H HA     . ARG B 2 84  ? -15.960 8.385   -12.053 1.00 0.00  ? 171 ARG A HA     5  
ATOM 7772  H HB2    . ARG B 2 84  ? -15.488 10.202  -13.663 1.00 0.00  ? 171 ARG A HB2    5  
ATOM 7773  H HB3    . ARG B 2 84  ? -13.926 9.589   -14.015 1.00 0.00  ? 171 ARG A HB3    5  
ATOM 7774  H HG2    . ARG B 2 84  ? -16.635 8.312   -14.647 1.00 0.00  ? 171 ARG A HG2    5  
ATOM 7775  H HG3    . ARG B 2 84  ? -15.543 9.116   -15.758 1.00 0.00  ? 171 ARG A HG3    5  
ATOM 7776  H HD2    . ARG B 2 84  ? -14.979 7.009   -16.330 1.00 0.00  ? 171 ARG A HD2    5  
ATOM 7777  H HD3    . ARG B 2 84  ? -13.863 7.163   -14.981 1.00 0.00  ? 171 ARG A HD3    5  
ATOM 7778  H HE     . ARG B 2 84  ? -15.309 5.816   -13.618 1.00 0.00  ? 171 ARG A HE     5  
ATOM 7779  H HH11   . ARG B 2 84  ? -16.650 6.035   -16.847 1.00 0.00  ? 171 ARG A HH11   5  
ATOM 7780  H HH12   . ARG B 2 84  ? -17.822 4.785   -16.537 1.00 0.00  ? 171 ARG A HH12   5  
ATOM 7781  H HH21   . ARG B 2 84  ? -16.834 4.301   -13.265 1.00 0.00  ? 171 ARG A HH21   5  
ATOM 7782  H HH22   . ARG B 2 84  ? -17.899 3.809   -14.550 1.00 0.00  ? 171 ARG A HH22   5  
ATOM 7783  N N      . ALA B 2 85  ? -12.770 7.532   -12.157 1.00 0.00  ? 172 ALA A N      5  
ATOM 7784  C CA     . ALA B 2 85  ? -11.810 6.450   -11.939 1.00 0.00  ? 172 ALA A CA     5  
ATOM 7785  C C      . ALA B 2 85  ? -11.923 5.764   -10.562 1.00 0.00  ? 172 ALA A C      5  
ATOM 7786  O O      . ALA B 2 85  ? -12.112 4.553   -10.505 1.00 0.00  ? 172 ALA A O      5  
ATOM 7787  C CB     . ALA B 2 85  ? -10.412 6.998   -12.171 1.00 0.00  ? 172 ALA A CB     5  
ATOM 7788  H H      . ALA B 2 85  ? -12.432 8.461   -12.392 1.00 0.00  ? 172 ALA A H      5  
ATOM 7789  H HA     . ALA B 2 85  ? -12.000 5.682   -12.688 1.00 0.00  ? 172 ALA A HA     5  
ATOM 7790  H HB1    . ALA B 2 85  ? -10.317 7.281   -13.220 1.00 0.00  ? 172 ALA A HB1    5  
ATOM 7791  H HB2    . ALA B 2 85  ? -10.239 7.872   -11.554 1.00 0.00  ? 172 ALA A HB2    5  
ATOM 7792  H HB3    . ALA B 2 85  ? -9.688  6.223   -11.928 1.00 0.00  ? 172 ALA A HB3    5  
ATOM 7793  N N      . ARG B 2 86  ? -11.871 6.516   -9.455  1.00 0.00  ? 173 ARG A N      5  
ATOM 7794  C CA     . ARG B 2 86  ? -12.212 6.087   -8.078  1.00 0.00  ? 173 ARG A CA     5  
ATOM 7795  C C      . ARG B 2 86  ? -13.506 5.287   -8.076  1.00 0.00  ? 173 ARG A C      5  
ATOM 7796  O O      . ARG B 2 86  ? -13.495 4.146   -7.637  1.00 0.00  ? 173 ARG A O      5  
ATOM 7797  C CB     . ARG B 2 86  ? -12.270 7.371   -7.215  1.00 0.00  ? 173 ARG A CB     5  
ATOM 7798  C CG     . ARG B 2 86  ? -13.015 7.314   -5.871  1.00 0.00  ? 173 ARG A CG     5  
ATOM 7799  C CD     . ARG B 2 86  ? -14.222 8.257   -5.796  1.00 0.00  ? 173 ARG A CD     5  
ATOM 7800  N NE     . ARG B 2 86  ? -14.380 8.735   -4.420  1.00 0.00  ? 173 ARG A NE     5  
ATOM 7801  C CZ     . ARG B 2 86  ? -15.279 8.451   -3.503  1.00 0.00  ? 173 ARG A CZ     5  
ATOM 7802  N NH1    . ARG B 2 86  ? -16.345 7.729   -3.718  1.00 0.00  ? 173 ARG A NH1    5  
ATOM 7803  N NH2    . ARG B 2 86  ? -15.070 8.928   -2.314  1.00 0.00  ? 173 ARG A NH2    5  
ATOM 7804  H H      . ARG B 2 86  ? -11.719 7.510   -9.607  1.00 0.00  ? 173 ARG A H      5  
ATOM 7805  H HA     . ARG B 2 86  ? -11.458 5.391   -7.665  1.00 0.00  ? 173 ARG A HA     5  
ATOM 7806  H HB2    . ARG B 2 86  ? -11.244 7.681   -7.022  1.00 0.00  ? 173 ARG A HB2    5  
ATOM 7807  H HB3    . ARG B 2 86  ? -12.711 8.169   -7.806  1.00 0.00  ? 173 ARG A HB3    5  
ATOM 7808  H HG2    . ARG B 2 86  ? -13.369 6.311   -5.648  1.00 0.00  ? 173 ARG A HG2    5  
ATOM 7809  H HG3    . ARG B 2 86  ? -12.304 7.602   -5.101  1.00 0.00  ? 173 ARG A HG3    5  
ATOM 7810  H HD2    . ARG B 2 86  ? -14.052 9.125   -6.434  1.00 0.00  ? 173 ARG A HD2    5  
ATOM 7811  H HD3    . ARG B 2 86  ? -15.111 7.731   -6.143  1.00 0.00  ? 173 ARG A HD3    5  
ATOM 7812  H HE     . ARG B 2 86  ? -13.627 9.314   -4.053  1.00 0.00  ? 173 ARG A HE     5  
ATOM 7813  H HH11   . ARG B 2 86  ? -16.578 7.399   -4.657  1.00 0.00  ? 173 ARG A HH11   5  
ATOM 7814  H HH12   . ARG B 2 86  ? -16.997 7.565   -2.973  1.00 0.00  ? 173 ARG A HH12   5  
ATOM 7815  H HH21   . ARG B 2 86  ? -14.210 9.467   -2.213  1.00 0.00  ? 173 ARG A HH21   5  
ATOM 7816  H HH22   . ARG B 2 86  ? -15.713 8.795   -1.554  1.00 0.00  ? 173 ARG A HH22   5  
ATOM 7817  N N      . GLU B 2 87  ? -14.601 5.817   -8.611  1.00 0.00  ? 174 GLU A N      5  
ATOM 7818  C CA     . GLU B 2 87  ? -15.893 5.131   -8.675  1.00 0.00  ? 174 GLU A CA     5  
ATOM 7819  C C      . GLU B 2 87  ? -15.861 3.823   -9.483  1.00 0.00  ? 174 GLU A C      5  
ATOM 7820  O O      . GLU B 2 87  ? -16.610 2.897   -9.162  1.00 0.00  ? 174 GLU A O      5  
ATOM 7821  C CB     . GLU B 2 87  ? -16.927 6.091   -9.269  1.00 0.00  ? 174 GLU A CB     5  
ATOM 7822  C CG     . GLU B 2 87  ? -17.213 7.315   -8.388  1.00 0.00  ? 174 GLU A CG     5  
ATOM 7823  C CD     . GLU B 2 87  ? -18.092 6.970   -7.174  1.00 0.00  ? 174 GLU A CD     5  
ATOM 7824  O OE1    . GLU B 2 87  ? -19.339 6.899   -7.311  1.00 0.00  ? 174 GLU A OE1    5  
ATOM 7825  O OE2    . GLU B 2 87  ? -17.529 6.770   -6.067  1.00 0.00  ? 174 GLU A OE2    5  
ATOM 7826  H H      . GLU B 2 87  ? -14.557 6.767   -8.966  1.00 0.00  ? 174 GLU A H      5  
ATOM 7827  H HA     . GLU B 2 87  ? -16.193 4.861   -7.663  1.00 0.00  ? 174 GLU A HA     5  
ATOM 7828  H HB2    . GLU B 2 87  ? -16.573 6.438   -10.239 1.00 0.00  ? 174 GLU A HB2    5  
ATOM 7829  H HB3    . GLU B 2 87  ? -17.854 5.555   -9.433  1.00 0.00  ? 174 GLU A HB3    5  
ATOM 7830  H HG2    . GLU B 2 87  ? -16.285 7.751   -8.025  1.00 0.00  ? 174 GLU A HG2    5  
ATOM 7831  H HG3    . GLU B 2 87  ? -17.684 8.065   -9.026  1.00 0.00  ? 174 GLU A HG3    5  
ATOM 7832  N N      . LYS B 2 88  ? -14.980 3.705   -10.488 1.00 0.00  ? 175 LYS A N      5  
ATOM 7833  C CA     . LYS B 2 88  ? -14.683 2.442   -11.169 1.00 0.00  ? 175 LYS A CA     5  
ATOM 7834  C C      . LYS B 2 88  ? -13.880 1.477   -10.265 1.00 0.00  ? 175 LYS A C      5  
ATOM 7835  O O      . LYS B 2 88  ? -14.291 0.324   -10.112 1.00 0.00  ? 175 LYS A O      5  
ATOM 7836  C CB     . LYS B 2 88  ? -14.045 2.794   -12.532 1.00 0.00  ? 175 LYS A CB     5  
ATOM 7837  C CG     . LYS B 2 88  ? -13.093 1.754   -13.116 1.00 0.00  ? 175 LYS A CG     5  
ATOM 7838  C CD     . LYS B 2 88  ? -13.790 0.438   -13.512 1.00 0.00  ? 175 LYS A CD     5  
ATOM 7839  C CE     . LYS B 2 88  ? -12.857 -0.591  -14.176 1.00 0.00  ? 175 LYS A CE     5  
ATOM 7840  N NZ     . LYS B 2 88  ? -11.822 -1.131  -13.253 1.00 0.00  ? 175 LYS A NZ     5  
ATOM 7841  H H      . LYS B 2 88  ? -14.408 4.509   -10.751 1.00 0.00  ? 175 LYS A H      5  
ATOM 7842  H HA     . LYS B 2 88  ? -15.622 1.924   -11.374 1.00 0.00  ? 175 LYS A HA     5  
ATOM 7843  H HB2    . LYS B 2 88  ? -14.836 2.995   -13.253 1.00 0.00  ? 175 LYS A HB2    5  
ATOM 7844  H HB3    . LYS B 2 88  ? -13.474 3.717   -12.439 1.00 0.00  ? 175 LYS A HB3    5  
ATOM 7845  H HG2    . LYS B 2 88  ? -12.622 2.190   -13.993 1.00 0.00  ? 175 LYS A HG2    5  
ATOM 7846  H HG3    . LYS B 2 88  ? -12.329 1.604   -12.367 1.00 0.00  ? 175 LYS A HG3    5  
ATOM 7847  H HD2    . LYS B 2 88  ? -14.263 -0.023  -12.645 1.00 0.00  ? 175 LYS A HD2    5  
ATOM 7848  H HD3    . LYS B 2 88  ? -14.579 0.673   -14.228 1.00 0.00  ? 175 LYS A HD3    5  
ATOM 7849  H HE2    . LYS B 2 88  ? -13.476 -1.419  -14.540 1.00 0.00  ? 175 LYS A HE2    5  
ATOM 7850  H HE3    . LYS B 2 88  ? -12.380 -0.130  -15.045 1.00 0.00  ? 175 LYS A HE3    5  
ATOM 7851  H HZ1    . LYS B 2 88  ? -11.145 -0.422  -13.009 1.00 0.00  ? 175 LYS A HZ1    5  
ATOM 7852  H HZ2    . LYS B 2 88  ? -12.217 -1.495  -12.388 1.00 0.00  ? 175 LYS A HZ2    5  
ATOM 7853  H HZ3    . LYS B 2 88  ? -11.316 -1.885  -13.692 1.00 0.00  ? 175 LYS A HZ3    5  
ATOM 7854  N N      . LEU B 2 89  ? -12.748 1.879   -9.672  1.00 0.00  ? 176 LEU A N      5  
ATOM 7855  C CA     . LEU B 2 89  ? -11.868 1.002   -8.906  1.00 0.00  ? 176 LEU A CA     5  
ATOM 7856  C C      . LEU B 2 89  ? -12.412 0.631   -7.511  1.00 0.00  ? 176 LEU A C      5  
ATOM 7857  O O      . LEU B 2 89  ? -12.050 -0.406  -6.955  1.00 0.00  ? 176 LEU A O      5  
ATOM 7858  C CB     . LEU B 2 89  ? -10.485 1.656   -8.819  1.00 0.00  ? 176 LEU A CB     5  
ATOM 7859  C CG     . LEU B 2 89  ? -9.810  2.068   -10.136 1.00 0.00  ? 176 LEU A CG     5  
ATOM 7860  C CD1    . LEU B 2 89  ? -8.384  2.539   -9.905  1.00 0.00  ? 176 LEU A CD1    5  
ATOM 7861  C CD2    . LEU B 2 89  ? -9.732  0.932   -11.155 1.00 0.00  ? 176 LEU A CD2    5  
ATOM 7862  H H      . LEU B 2 89  ? -12.385 2.815   -9.767  1.00 0.00  ? 176 LEU A H      5  
ATOM 7863  H HA     . LEU B 2 89  ? -11.752 0.077   -9.450  1.00 0.00  ? 176 LEU A HA     5  
ATOM 7864  H HB2    . LEU B 2 89  ? -10.528 2.522   -8.175  1.00 0.00  ? 176 LEU A HB2    5  
ATOM 7865  H HB3    . LEU B 2 89  ? -9.860  0.937   -8.338  1.00 0.00  ? 176 LEU A HB3    5  
ATOM 7866  H HG     . LEU B 2 89  ? -10.346 2.923   -10.538 1.00 0.00  ? 176 LEU A HG     5  
ATOM 7867  H HD11   . LEU B 2 89  ? -8.431  3.435   -9.301  1.00 0.00  ? 176 LEU A HD11   5  
ATOM 7868  H HD12   . LEU B 2 89  ? -7.807  1.780   -9.381  1.00 0.00  ? 176 LEU A HD12   5  
ATOM 7869  H HD13   . LEU B 2 89  ? -7.910  2.778   -10.857 1.00 0.00  ? 176 LEU A HD13   5  
ATOM 7870  H HD21   . LEU B 2 89  ? -9.086  0.145   -10.780 1.00 0.00  ? 176 LEU A HD21   5  
ATOM 7871  H HD22   . LEU B 2 89  ? -10.719 0.517   -11.326 1.00 0.00  ? 176 LEU A HD22   5  
ATOM 7872  H HD23   . LEU B 2 89  ? -9.338  1.316   -12.095 1.00 0.00  ? 176 LEU A HD23   5  
ATOM 7873  N N      . HIS B 2 90  ? -13.311 1.440   -6.957  1.00 0.00  ? 177 HIS A N      5  
ATOM 7874  C CA     . HIS B 2 90  ? -14.063 1.200   -5.721  1.00 0.00  ? 177 HIS A CA     5  
ATOM 7875  C C      . HIS B 2 90  ? -15.167 0.165   -5.974  1.00 0.00  ? 177 HIS A C      5  
ATOM 7876  O O      . HIS B 2 90  ? -16.324 0.503   -6.244  1.00 0.00  ? 177 HIS A O      5  
ATOM 7877  C CB     . HIS B 2 90  ? -14.575 2.560   -5.235  1.00 0.00  ? 177 HIS A CB     5  
ATOM 7878  C CG     . HIS B 2 90  ? -14.951 2.667   -3.796  1.00 0.00  ? 177 HIS A CG     5  
ATOM 7879  N ND1    . HIS B 2 90  ? -14.993 1.625   -2.882  1.00 0.00  ? 177 HIS A ND1    5  
ATOM 7880  C CD2    . HIS B 2 90  ? -15.024 3.854   -3.134  1.00 0.00  ? 177 HIS A CD2    5  
ATOM 7881  C CE1    . HIS B 2 90  ? -15.103 2.214   -1.684  1.00 0.00  ? 177 HIS A CE1    5  
ATOM 7882  N NE2    . HIS B 2 90  ? -15.154 3.549   -1.800  1.00 0.00  ? 177 HIS A NE2    5  
ATOM 7883  H H      . HIS B 2 90  ? -13.505 2.305   -7.451  1.00 0.00  ? 177 HIS A H      5  
ATOM 7884  H HA     . HIS B 2 90  ? -13.389 0.795   -4.965  1.00 0.00  ? 177 HIS A HA     5  
ATOM 7885  H HB2    . HIS B 2 90  ? -13.772 3.270   -5.363  1.00 0.00  ? 177 HIS A HB2    5  
ATOM 7886  H HB3    . HIS B 2 90  ? -15.397 2.921   -5.841  1.00 0.00  ? 177 HIS A HB3    5  
ATOM 7887  H HD2    . HIS B 2 90  ? -14.843 4.826   -3.578  1.00 0.00  ? 177 HIS A HD2    5  
ATOM 7888  H HE1    . HIS B 2 90  ? -15.048 1.694   -0.749  1.00 0.00  ? 177 HIS A HE1    5  
ATOM 7889  H HE2    . HIS B 2 90  ? -15.173 4.196   -1.020  1.00 0.00  ? 177 HIS A HE2    5  
ATOM 7890  N N      . GLY B 2 91  ? -14.770 -1.111  -5.985  1.00 0.00  ? 178 GLY A N      5  
ATOM 7891  C CA     . GLY B 2 91  ? -15.539 -2.230  -6.541  1.00 0.00  ? 178 GLY A CA     5  
ATOM 7892  C C      . GLY B 2 91  ? -14.777 -3.102  -7.554  1.00 0.00  ? 178 GLY A C      5  
ATOM 7893  O O      . GLY B 2 91  ? -15.378 -3.991  -8.159  1.00 0.00  ? 178 GLY A O      5  
ATOM 7894  H H      . GLY B 2 91  ? -13.822 -1.272  -5.655  1.00 0.00  ? 178 GLY A H      5  
ATOM 7895  H HA2    . GLY B 2 91  ? -15.867 -2.857  -5.721  1.00 0.00  ? 178 GLY A HA2    5  
ATOM 7896  H HA3    . GLY B 2 91  ? -16.428 -1.855  -7.047  1.00 0.00  ? 178 GLY A HA3    5  
ATOM 7897  N N      . THR B 2 92  ? -13.473 -2.876  -7.765  1.00 0.00  ? 179 THR A N      5  
ATOM 7898  C CA     . THR B 2 92  ? -12.633 -3.610  -8.727  1.00 0.00  ? 179 THR A CA     5  
ATOM 7899  C C      . THR B 2 92  ? -12.053 -4.861  -8.073  1.00 0.00  ? 179 THR A C      5  
ATOM 7900  O O      . THR B 2 92  ? -11.200 -4.778  -7.186  1.00 0.00  ? 179 THR A O      5  
ATOM 7901  C CB     . THR B 2 92  ? -11.561 -2.679  -9.341  1.00 0.00  ? 179 THR A CB     5  
ATOM 7902  O OG1    . THR B 2 92  ? -12.160 -2.032  -10.453 1.00 0.00  ? 179 THR A OG1    5  
ATOM 7903  C CG2    . THR B 2 92  ? -10.287 -3.329  -9.873  1.00 0.00  ? 179 THR A CG2    5  
ATOM 7904  H H      . THR B 2 92  ? -13.002 -2.219  -7.151  1.00 0.00  ? 179 THR A H      5  
ATOM 7905  H HA     . THR B 2 92  ? -13.251 -3.954  -9.558  1.00 0.00  ? 179 THR A HA     5  
ATOM 7906  H HB     . THR B 2 92  ? -11.241 -1.936  -8.610  1.00 0.00  ? 179 THR A HB     5  
ATOM 7907  H HG1    . THR B 2 92  ? -12.991 -1.631  -10.137 1.00 0.00  ? 179 THR A HG1    5  
ATOM 7908  H HG21   . THR B 2 92  ? -9.700  -3.711  -9.038  1.00 0.00  ? 179 THR A HG21   5  
ATOM 7909  H HG22   . THR B 2 92  ? -10.532 -4.126  -10.572 1.00 0.00  ? 179 THR A HG22   5  
ATOM 7910  H HG23   . THR B 2 92  ? -9.684  -2.568  -10.372 1.00 0.00  ? 179 THR A HG23   5  
ATOM 7911  N N      . VAL B 2 93  ? -12.568 -6.029  -8.477  1.00 0.00  ? 180 VAL A N      5  
ATOM 7912  C CA     . VAL B 2 93  ? -12.023 -7.355  -8.143  1.00 0.00  ? 180 VAL A CA     5  
ATOM 7913  C C      . VAL B 2 93  ? -10.757 -7.617  -8.971  1.00 0.00  ? 180 VAL A C      5  
ATOM 7914  O O      . VAL B 2 93  ? -10.811 -7.580  -10.202 1.00 0.00  ? 180 VAL A O      5  
ATOM 7915  C CB     . VAL B 2 93  ? -13.038 -8.497  -8.348  1.00 0.00  ? 180 VAL A CB     5  
ATOM 7916  C CG1    . VAL B 2 93  ? -12.513 -9.804  -7.742  1.00 0.00  ? 180 VAL A CG1    5  
ATOM 7917  C CG2    . VAL B 2 93  ? -14.394 -8.204  -7.691  1.00 0.00  ? 180 VAL A CG2    5  
ATOM 7918  H H      . VAL B 2 93  ? -13.333 -5.980  -9.134  1.00 0.00  ? 180 VAL A H      5  
ATOM 7919  H HA     . VAL B 2 93  ? -11.775 -7.338  -7.092  1.00 0.00  ? 180 VAL A HA     5  
ATOM 7920  H HB     . VAL B 2 93  ? -13.193 -8.657  -9.411  1.00 0.00  ? 180 VAL A HB     5  
ATOM 7921  H HG11   . VAL B 2 93  ? -11.570 -10.086 -8.210  1.00 0.00  ? 180 VAL A HG11   5  
ATOM 7922  H HG12   . VAL B 2 93  ? -12.376 -9.691  -6.667  1.00 0.00  ? 180 VAL A HG12   5  
ATOM 7923  H HG13   . VAL B 2 93  ? -13.226 -10.609 -7.926  1.00 0.00  ? 180 VAL A HG13   5  
ATOM 7924  H HG21   . VAL B 2 93  ? -14.269 -8.049  -6.622  1.00 0.00  ? 180 VAL A HG21   5  
ATOM 7925  H HG22   . VAL B 2 93  ? -14.850 -7.317  -8.135  1.00 0.00  ? 180 VAL A HG22   5  
ATOM 7926  H HG23   . VAL B 2 93  ? -15.066 -9.048  -7.851  1.00 0.00  ? 180 VAL A HG23   5  
ATOM 7927  N N      . VAL B 2 94  ? -9.619  -7.850  -8.310  1.00 0.00  ? 181 VAL A N      5  
ATOM 7928  C CA     . VAL B 2 94  ? -8.276  -7.838  -8.934  1.00 0.00  ? 181 VAL A CA     5  
ATOM 7929  C C      . VAL B 2 94  ? -7.431  -9.111  -8.715  1.00 0.00  ? 181 VAL A C      5  
ATOM 7930  O O      . VAL B 2 94  ? -6.752  -9.543  -9.645  1.00 0.00  ? 181 VAL A O      5  
ATOM 7931  C CB     . VAL B 2 94  ? -7.553  -6.526  -8.566  1.00 0.00  ? 181 VAL A CB     5  
ATOM 7932  C CG1    . VAL B 2 94  ? -7.401  -6.302  -7.058  1.00 0.00  ? 181 VAL A CG1    5  
ATOM 7933  C CG2    . VAL B 2 94  ? -6.190  -6.390  -9.248  1.00 0.00  ? 181 VAL A CG2    5  
ATOM 7934  H H      . VAL B 2 94  ? -9.687  -7.796  -7.299  1.00 0.00  ? 181 VAL A H      5  
ATOM 7935  H HA     . VAL B 2 94  ? -8.411  -7.789  -10.013 1.00 0.00  ? 181 VAL A HA     5  
ATOM 7936  H HB     . VAL B 2 94  ? -8.176  -5.711  -8.938  1.00 0.00  ? 181 VAL A HB     5  
ATOM 7937  H HG11   . VAL B 2 94  ? -8.379  -6.306  -6.577  1.00 0.00  ? 181 VAL A HG11   5  
ATOM 7938  H HG12   . VAL B 2 94  ? -6.767  -7.071  -6.618  1.00 0.00  ? 181 VAL A HG12   5  
ATOM 7939  H HG13   . VAL B 2 94  ? -6.970  -5.321  -6.878  1.00 0.00  ? 181 VAL A HG13   5  
ATOM 7940  H HG21   . VAL B 2 94  ? -5.468  -7.084  -8.811  1.00 0.00  ? 181 VAL A HG21   5  
ATOM 7941  H HG22   . VAL B 2 94  ? -6.294  -6.597  -10.314 1.00 0.00  ? 181 VAL A HG22   5  
ATOM 7942  H HG23   . VAL B 2 94  ? -5.820  -5.368  -9.137  1.00 0.00  ? 181 VAL A HG23   5  
ATOM 7943  N N      . GLU B 2 95  ? -7.524  -9.778  -7.559  1.00 0.00  ? 182 GLU A N      5  
ATOM 7944  C CA     . GLU B 2 95  ? -6.913  -11.104 -7.291  1.00 0.00  ? 182 GLU A CA     5  
ATOM 7945  C C      . GLU B 2 95  ? -7.925  -12.093 -6.668  1.00 0.00  ? 182 GLU A C      5  
ATOM 7946  O O      . GLU B 2 95  ? -7.589  -12.905 -5.801  1.00 0.00  ? 182 GLU A O      5  
ATOM 7947  C CB     . GLU B 2 95  ? -5.662  -10.966 -6.393  1.00 0.00  ? 182 GLU A CB     5  
ATOM 7948  C CG     . GLU B 2 95  ? -4.504  -10.121 -6.945  1.00 0.00  ? 182 GLU A CG     5  
ATOM 7949  C CD     . GLU B 2 95  ? -3.880  -10.677 -8.248  1.00 0.00  ? 182 GLU A CD     5  
ATOM 7950  O OE1    . GLU B 2 95  ? -3.946  -11.906 -8.507  1.00 0.00  ? 182 GLU A OE1    5  
ATOM 7951  O OE2    . GLU B 2 95  ? -3.266  -9.886  -9.007  1.00 0.00  ? 182 GLU A OE2    5  
ATOM 7952  H H      . GLU B 2 95  ? -8.036  -9.327  -6.818  1.00 0.00  ? 182 GLU A H      5  
ATOM 7953  H HA     . GLU B 2 95  ? -6.608  -11.562 -8.231  1.00 0.00  ? 182 GLU A HA     5  
ATOM 7954  H HB2    . GLU B 2 95  ? -5.978  -10.542 -5.442  1.00 0.00  ? 182 GLU A HB2    5  
ATOM 7955  H HB3    . GLU B 2 95  ? -5.263  -11.957 -6.176  1.00 0.00  ? 182 GLU A HB3    5  
ATOM 7956  H HG2    . GLU B 2 95  ? -4.859  -9.099  -7.106  1.00 0.00  ? 182 GLU A HG2    5  
ATOM 7957  H HG3    . GLU B 2 95  ? -3.727  -10.085 -6.170  1.00 0.00  ? 182 GLU A HG3    5  
ATOM 7958  N N      . GLY B 2 96  ? -9.204  -11.978 -7.046  1.00 0.00  ? 183 GLY A N      5  
ATOM 7959  C CA     . GLY B 2 96  ? -10.320 -12.553 -6.281  1.00 0.00  ? 183 GLY A CA     5  
ATOM 7960  C C      . GLY B 2 96  ? -10.571 -11.797 -4.965  1.00 0.00  ? 183 GLY A C      5  
ATOM 7961  O O      . GLY B 2 96  ? -11.010 -12.380 -3.970  1.00 0.00  ? 183 GLY A O      5  
ATOM 7962  H H      . GLY B 2 96  ? -9.401  -11.364 -7.825  1.00 0.00  ? 183 GLY A H      5  
ATOM 7963  H HA2    . GLY B 2 96  ? -11.228 -12.509 -6.881  1.00 0.00  ? 183 GLY A HA2    5  
ATOM 7964  H HA3    . GLY B 2 96  ? -10.113 -13.601 -6.055  1.00 0.00  ? 183 GLY A HA3    5  
ATOM 7965  N N      . ARG B 2 97  ? -10.259 -10.492 -4.963  1.00 0.00  ? 184 ARG A N      5  
ATOM 7966  C CA     . ARG B 2 97  ? -10.310 -9.526  -3.860  1.00 0.00  ? 184 ARG A CA     5  
ATOM 7967  C C      . ARG B 2 97  ? -10.735 -8.196  -4.432  1.00 0.00  ? 184 ARG A C      5  
ATOM 7968  O O      . ARG B 2 97  ? -10.253 -7.845  -5.509  1.00 0.00  ? 184 ARG A O      5  
ATOM 7969  C CB     . ARG B 2 97  ? -8.897  -9.304  -3.315  1.00 0.00  ? 184 ARG A CB     5  
ATOM 7970  C CG     . ARG B 2 97  ? -8.884  -8.712  -1.900  1.00 0.00  ? 184 ARG A CG     5  
ATOM 7971  C CD     . ARG B 2 97  ? -9.172  -9.754  -0.816  1.00 0.00  ? 184 ARG A CD     5  
ATOM 7972  N NE     . ARG B 2 97  ? -9.298  -9.127  0.512   1.00 0.00  ? 184 ARG A NE     5  
ATOM 7973  C CZ     . ARG B 2 97  ? -9.350  -9.748  1.675   1.00 0.00  ? 184 ARG A CZ     5  
ATOM 7974  N NH1    . ARG B 2 97  ? -9.156  -11.030 1.793   1.00 0.00  ? 184 ARG A NH1    5  
ATOM 7975  N NH2    . ARG B 2 97  ? -9.604  -9.087  2.764   1.00 0.00  ? 184 ARG A NH2    5  
ATOM 7976  H H      . ARG B 2 97  ? -10.018 -10.086 -5.853  1.00 0.00  ? 184 ARG A H      5  
ATOM 7977  H HA     . ARG B 2 97  ? -11.007 -9.861  -3.086  1.00 0.00  ? 184 ARG A HA     5  
ATOM 7978  H HB2    . ARG B 2 97  ? -8.348  -10.226 -3.342  1.00 0.00  ? 184 ARG A HB2    5  
ATOM 7979  H HB3    . ARG B 2 97  ? -8.363  -8.623  -3.979  1.00 0.00  ? 184 ARG A HB3    5  
ATOM 7980  H HG2    . ARG B 2 97  ? -7.894  -8.306  -1.728  1.00 0.00  ? 184 ARG A HG2    5  
ATOM 7981  H HG3    . ARG B 2 97  ? -9.605  -7.896  -1.846  1.00 0.00  ? 184 ARG A HG3    5  
ATOM 7982  H HD2    . ARG B 2 97  ? -10.100 -10.274 -1.050  1.00 0.00  ? 184 ARG A HD2    5  
ATOM 7983  H HD3    . ARG B 2 97  ? -8.351  -10.476 -0.814  1.00 0.00  ? 184 ARG A HD3    5  
ATOM 7984  H HE     . ARG B 2 97  ? -9.351  -8.114  0.541   1.00 0.00  ? 184 ARG A HE     5  
ATOM 7985  H HH11   . ARG B 2 97  ? -8.951  -11.568 0.968   1.00 0.00  ? 184 ARG A HH11   5  
ATOM 7986  H HH12   . ARG B 2 97  ? -9.180  -11.478 2.694   1.00 0.00  ? 184 ARG A HH12   5  
ATOM 7987  H HH21   . ARG B 2 97  ? -9.927  -8.126  2.677   1.00 0.00  ? 184 ARG A HH21   5  
ATOM 7988  H HH22   . ARG B 2 97  ? -9.685  -9.560  3.646   1.00 0.00  ? 184 ARG A HH22   5  
ATOM 7989  N N      . LYS B 2 98  ? -11.559 -7.448  -3.710  1.00 0.00  ? 185 LYS A N      5  
ATOM 7990  C CA     . LYS B 2 98  ? -12.137 -6.200  -4.200  1.00 0.00  ? 185 LYS A CA     5  
ATOM 7991  C C      . LYS B 2 98  ? -11.565 -4.972  -3.491  1.00 0.00  ? 185 LYS A C      5  
ATOM 7992  O O      . LYS B 2 98  ? -11.601 -4.908  -2.262  1.00 0.00  ? 185 LYS A O      5  
ATOM 7993  C CB     . LYS B 2 98  ? -13.665 -6.310  -4.078  1.00 0.00  ? 185 LYS A CB     5  
ATOM 7994  C CG     . LYS B 2 98  ? -14.418 -5.373  -5.027  1.00 0.00  ? 185 LYS A CG     5  
ATOM 7995  C CD     . LYS B 2 98  ? -15.940 -5.500  -4.843  1.00 0.00  ? 185 LYS A CD     5  
ATOM 7996  C CE     . LYS B 2 98  ? -16.407 -4.817  -3.547  1.00 0.00  ? 185 LYS A CE     5  
ATOM 7997  N NZ     . LYS B 2 98  ? -17.878 -4.914  -3.373  1.00 0.00  ? 185 LYS A NZ     5  
ATOM 7998  H H      . LYS B 2 98  ? -11.864 -7.832  -2.829  1.00 0.00  ? 185 LYS A H      5  
ATOM 7999  H HA     . LYS B 2 98  ? -11.846 -6.127  -5.241  1.00 0.00  ? 185 LYS A HA     5  
ATOM 8000  H HB2    . LYS B 2 98  ? -13.968 -7.331  -4.316  1.00 0.00  ? 185 LYS A HB2    5  
ATOM 8001  H HB3    . LYS B 2 98  ? -13.956 -6.110  -3.046  1.00 0.00  ? 185 LYS A HB3    5  
ATOM 8002  H HG2    . LYS B 2 98  ? -14.106 -4.341  -4.866  1.00 0.00  ? 185 LYS A HG2    5  
ATOM 8003  H HG3    . LYS B 2 98  ? -14.163 -5.648  -6.050  1.00 0.00  ? 185 LYS A HG3    5  
ATOM 8004  H HD2    . LYS B 2 98  ? -16.439 -5.040  -5.694  1.00 0.00  ? 185 LYS A HD2    5  
ATOM 8005  H HD3    . LYS B 2 98  ? -16.216 -6.555  -4.826  1.00 0.00  ? 185 LYS A HD3    5  
ATOM 8006  H HE2    . LYS B 2 98  ? -15.903 -5.277  -2.695  1.00 0.00  ? 185 LYS A HE2    5  
ATOM 8007  H HE3    . LYS B 2 98  ? -16.102 -3.766  -3.569  1.00 0.00  ? 185 LYS A HE3    5  
ATOM 8008  H HZ1    . LYS B 2 98  ? -18.373 -4.483  -4.142  1.00 0.00  ? 185 LYS A HZ1    5  
ATOM 8009  H HZ2    . LYS B 2 98  ? -18.182 -5.879  -3.311  1.00 0.00  ? 185 LYS A HZ2    5  
ATOM 8010  H HZ3    . LYS B 2 98  ? -18.176 -4.451  -2.524  1.00 0.00  ? 185 LYS A HZ3    5  
ATOM 8011  N N      . ILE B 2 99  ? -11.020 -4.024  -4.257  1.00 0.00  ? 186 ILE A N      5  
ATOM 8012  C CA     . ILE B 2 99  ? -10.512 -2.751  -3.718  1.00 0.00  ? 186 ILE A CA     5  
ATOM 8013  C C      . ILE B 2 99  ? -11.676 -1.834  -3.290  1.00 0.00  ? 186 ILE A C      5  
ATOM 8014  O O      . ILE B 2 99  ? -12.595 -1.573  -4.070  1.00 0.00  ? 186 ILE A O      5  
ATOM 8015  C CB     . ILE B 2 99  ? -9.599  -2.009  -4.725  1.00 0.00  ? 186 ILE A CB     5  
ATOM 8016  C CG1    . ILE B 2 99  ? -8.434  -2.885  -5.232  1.00 0.00  ? 186 ILE A CG1    5  
ATOM 8017  C CG2    . ILE B 2 99  ? -9.018  -0.747  -4.058  1.00 0.00  ? 186 ILE A CG2    5  
ATOM 8018  C CD1    . ILE B 2 99  ? -7.381  -2.108  -6.037  1.00 0.00  ? 186 ILE A CD1    5  
ATOM 8019  H H      . ILE B 2 99  ? -11.024 -4.175  -5.259  1.00 0.00  ? 186 ILE A H      5  
ATOM 8020  H HA     . ILE B 2 99  ? -9.910  -2.971  -2.836  1.00 0.00  ? 186 ILE A HA     5  
ATOM 8021  H HB     . ILE B 2 99  ? -10.196 -1.704  -5.585  1.00 0.00  ? 186 ILE A HB     5  
ATOM 8022  H HG12   . ILE B 2 99  ? -7.936  -3.345  -4.381  1.00 0.00  ? 186 ILE A HG12   5  
ATOM 8023  H HG13   . ILE B 2 99  ? -8.840  -3.676  -5.867  1.00 0.00  ? 186 ILE A HG13   5  
ATOM 8024  H HG21   . ILE B 2 99  ? -9.805  -0.138  -3.628  1.00 0.00  ? 186 ILE A HG21   5  
ATOM 8025  H HG22   . ILE B 2 99  ? -8.313  -1.026  -3.274  1.00 0.00  ? 186 ILE A HG22   5  
ATOM 8026  H HG23   . ILE B 2 99  ? -8.519  -0.135  -4.806  1.00 0.00  ? 186 ILE A HG23   5  
ATOM 8027  H HD11   . ILE B 2 99  ? -7.874  -1.400  -6.711  1.00 0.00  ? 186 ILE A HD11   5  
ATOM 8028  H HD12   . ILE B 2 99  ? -6.724  -1.562  -5.352  1.00 0.00  ? 186 ILE A HD12   5  
ATOM 8029  H HD13   . ILE B 2 99  ? -6.775  -2.802  -6.615  1.00 0.00  ? 186 ILE A HD13   5  
ATOM 8030  N N      . GLU B 2 100 ? -11.586 -1.286  -2.080  1.00 0.00  ? 187 GLU A N      5  
ATOM 8031  C CA     . GLU B 2 100 ? -12.359 -0.146  -1.578  1.00 0.00  ? 187 GLU A CA     5  
ATOM 8032  C C      . GLU B 2 100 ? -11.530 1.158   -1.681  1.00 0.00  ? 187 GLU A C      5  
ATOM 8033  O O      . GLU B 2 100 ? -10.527 1.283   -0.978  1.00 0.00  ? 187 GLU A O      5  
ATOM 8034  C CB     . GLU B 2 100 ? -12.715 -0.404  -0.097  1.00 0.00  ? 187 GLU A CB     5  
ATOM 8035  C CG     . GLU B 2 100 ? -14.049 -1.109  0.161   1.00 0.00  ? 187 GLU A CG     5  
ATOM 8036  C CD     . GLU B 2 100 ? -14.145 -2.527  -0.426  1.00 0.00  ? 187 GLU A CD     5  
ATOM 8037  O OE1    . GLU B 2 100 ? -13.679 -3.487  0.233   1.00 0.00  ? 187 GLU A OE1    5  
ATOM 8038  O OE2    . GLU B 2 100 ? -14.756 -2.701  -1.509  1.00 0.00  ? 187 GLU A OE2    5  
ATOM 8039  H H      . GLU B 2 100 ? -10.801 -1.585  -1.508  1.00 0.00  ? 187 GLU A H      5  
ATOM 8040  H HA     . GLU B 2 100 ? -13.278 -0.035  -2.147  1.00 0.00  ? 187 GLU A HA     5  
ATOM 8041  H HB2    . GLU B 2 100 ? -11.922 -0.984  0.376   1.00 0.00  ? 187 GLU A HB2    5  
ATOM 8042  H HB3    . GLU B 2 100 ? -12.772 0.555   0.419   1.00 0.00  ? 187 GLU A HB3    5  
ATOM 8043  H HG2    . GLU B 2 100 ? -14.168 -1.162  1.248   1.00 0.00  ? 187 GLU A HG2    5  
ATOM 8044  H HG3    . GLU B 2 100 ? -14.856 -0.487  -0.231  1.00 0.00  ? 187 GLU A HG3    5  
ATOM 8045  N N      . VAL B 2 101 ? -11.909 2.137   -2.522  1.00 0.00  ? 188 VAL A N      5  
ATOM 8046  C CA     . VAL B 2 101 ? -11.168 3.426   -2.664  1.00 0.00  ? 188 VAL A CA     5  
ATOM 8047  C C      . VAL B 2 101 ? -11.889 4.583   -1.957  1.00 0.00  ? 188 VAL A C      5  
ATOM 8048  O O      . VAL B 2 101 ? -12.645 5.371   -2.525  1.00 0.00  ? 188 VAL A O      5  
ATOM 8049  C CB     . VAL B 2 101 ? -10.584 3.723   -4.078  1.00 0.00  ? 188 VAL A CB     5  
ATOM 8050  C CG1    . VAL B 2 101 ? -10.318 2.463   -4.905  1.00 0.00  ? 188 VAL A CG1    5  
ATOM 8051  C CG2    . VAL B 2 101 ? -11.198 4.798   -4.939  1.00 0.00  ? 188 VAL A CG2    5  
ATOM 8052  H H      . VAL B 2 101 ? -12.781 2.023   -3.022  1.00 0.00  ? 188 VAL A H      5  
ATOM 8053  H HA     . VAL B 2 101 ? -10.276 3.294   -2.066  1.00 0.00  ? 188 VAL A HA     5  
ATOM 8054  H HB     . VAL B 2 101 ? -9.629  4.191   -3.945  1.00 0.00  ? 188 VAL A HB     5  
ATOM 8055  H HG11   . VAL B 2 101 ? -9.556  1.883   -4.392  1.00 0.00  ? 188 VAL A HG11   5  
ATOM 8056  H HG12   . VAL B 2 101 ? -11.221 1.868   -5.027  1.00 0.00  ? 188 VAL A HG12   5  
ATOM 8057  H HG13   . VAL B 2 101 ? -9.935  2.717   -5.890  1.00 0.00  ? 188 VAL A HG13   5  
ATOM 8058  H HG21   . VAL B 2 101 ? -12.211 4.544   -5.184  1.00 0.00  ? 188 VAL A HG21   5  
ATOM 8059  H HG22   . VAL B 2 101 ? -11.167 5.745   -4.394  1.00 0.00  ? 188 VAL A HG22   5  
ATOM 8060  H HG23   . VAL B 2 101 ? -10.595 4.900   -5.837  1.00 0.00  ? 188 VAL A HG23   5  
ATOM 8061  N N      . ASN B 2 102 ? -11.695 4.655   -0.649  1.00 0.00  ? 189 ASN A N      5  
ATOM 8062  C CA     . ASN B 2 102 ? -12.304 5.654   0.216   1.00 0.00  ? 189 ASN A CA     5  
ATOM 8063  C C      . ASN B 2 102 ? -11.596 7.010   0.104   1.00 0.00  ? 189 ASN A C      5  
ATOM 8064  O O      . ASN B 2 102 ? -10.375 7.085   -0.061  1.00 0.00  ? 189 ASN A O      5  
ATOM 8065  C CB     . ASN B 2 102 ? -12.229 5.163   1.665   1.00 0.00  ? 189 ASN A CB     5  
ATOM 8066  C CG     . ASN B 2 102 ? -12.799 3.772   1.862   1.00 0.00  ? 189 ASN A CG     5  
ATOM 8067  O OD1    . ASN B 2 102 ? -13.942 3.481   1.532   1.00 0.00  ? 189 ASN A OD1    5  
ATOM 8068  N ND2    . ASN B 2 102 ? -12.007 2.864   2.378   1.00 0.00  ? 189 ASN A ND2    5  
ATOM 8069  H H      . ASN B 2 102 ? -10.940 4.083   -0.288  1.00 0.00  ? 189 ASN A H      5  
ATOM 8070  H HA     . ASN B 2 102 ? -13.353 5.778   -0.059  1.00 0.00  ? 189 ASN A HA     5  
ATOM 8071  H HB2    . ASN B 2 102 ? -11.185 5.174   1.985   1.00 0.00  ? 189 ASN A HB2    5  
ATOM 8072  H HB3    . ASN B 2 102 ? -12.776 5.862   2.293   1.00 0.00  ? 189 ASN A HB3    5  
ATOM 8073  H HD21   . ASN B 2 102 ? -11.058 3.125   2.627   1.00 0.00  ? 189 ASN A HD21   5  
ATOM 8074  H HD22   . ASN B 2 102 ? -12.317 1.910   2.443   1.00 0.00  ? 189 ASN A HD22   5  
ATOM 8075  N N      . ASN B 2 103 ? -12.343 8.097   0.306   1.00 0.00  ? 190 ASN A N      5  
ATOM 8076  C CA     . ASN B 2 103 ? -11.738 9.404   0.560   1.00 0.00  ? 190 ASN A CA     5  
ATOM 8077  C C      . ASN B 2 103 ? -10.914 9.381   1.876   1.00 0.00  ? 190 ASN A C      5  
ATOM 8078  O O      . ASN B 2 103 ? -10.986 8.417   2.649   1.00 0.00  ? 190 ASN A O      5  
ATOM 8079  C CB     . ASN B 2 103 ? -12.838 10.480  0.593   1.00 0.00  ? 190 ASN A CB     5  
ATOM 8080  C CG     . ASN B 2 103 ? -13.793 10.309  1.762   1.00 0.00  ? 190 ASN A CG     5  
ATOM 8081  O OD1    . ASN B 2 103 ? -14.654 9.437   1.761   1.00 0.00  ? 190 ASN A OD1    5  
ATOM 8082  N ND2    . ASN B 2 103 ? -13.681 11.124  2.788   1.00 0.00  ? 190 ASN A ND2    5  
ATOM 8083  H H      . ASN B 2 103 ? -13.328 7.978   0.502   1.00 0.00  ? 190 ASN A H      5  
ATOM 8084  H HA     . ASN B 2 103 ? -11.070 9.587   -0.290  1.00 0.00  ? 190 ASN A HA     5  
ATOM 8085  H HB2    . ASN B 2 103 ? -12.370 11.465  0.643   1.00 0.00  ? 190 ASN A HB2    5  
ATOM 8086  H HB3    . ASN B 2 103 ? -13.415 10.441  -0.329  1.00 0.00  ? 190 ASN A HB3    5  
ATOM 8087  H HD21   . ASN B 2 103 ? -12.994 11.864  2.800   1.00 0.00  ? 190 ASN A HD21   5  
ATOM 8088  H HD22   . ASN B 2 103 ? -14.329 10.995  3.551   1.00 0.00  ? 190 ASN A HD22   5  
ATOM 8089  N N      . ALA B 2 104 ? -10.146 10.437  2.168   1.00 0.00  ? 191 ALA A N      5  
ATOM 8090  C CA     . ALA B 2 104 ? -9.155  10.400  3.252   1.00 0.00  ? 191 ALA A CA     5  
ATOM 8091  C C      . ALA B 2 104 ? -9.217  11.540  4.284   1.00 0.00  ? 191 ALA A C      5  
ATOM 8092  O O      . ALA B 2 104 ? -9.586  12.681  3.996   1.00 0.00  ? 191 ALA A O      5  
ATOM 8093  C CB     . ALA B 2 104 ? -7.773  10.342  2.613   1.00 0.00  ? 191 ALA A CB     5  
ATOM 8094  H H      . ALA B 2 104 ? -10.117 11.212  1.524   1.00 0.00  ? 191 ALA A H      5  
ATOM 8095  H HA     . ALA B 2 104 ? -9.277  9.479   3.817   1.00 0.00  ? 191 ALA A HA     5  
ATOM 8096  H HB1    . ALA B 2 104 ? -7.700  9.455   1.982   1.00 0.00  ? 191 ALA A HB1    5  
ATOM 8097  H HB2    . ALA B 2 104 ? -7.596  11.244  2.030   1.00 0.00  ? 191 ALA A HB2    5  
ATOM 8098  H HB3    . ALA B 2 104 ? -7.019  10.295  3.394   1.00 0.00  ? 191 ALA A HB3    5  
ATOM 8099  N N      . THR B 2 105 ? -8.753  11.201  5.484   1.00 0.00  ? 192 THR A N      5  
ATOM 8100  C CA     . THR B 2 105 ? -8.175  12.071  6.522   1.00 0.00  ? 192 THR A CA     5  
ATOM 8101  C C      . THR B 2 105 ? -6.720  12.434  6.179   1.00 0.00  ? 192 THR A C      5  
ATOM 8102  O O      . THR B 2 105 ? -6.128  11.833  5.277   1.00 0.00  ? 192 THR A O      5  
ATOM 8103  C CB     . THR B 2 105 ? -8.151  11.283  7.839   1.00 0.00  ? 192 THR A CB     5  
ATOM 8104  O OG1    . THR B 2 105 ? -7.466  10.079  7.607   1.00 0.00  ? 192 THR A OG1    5  
ATOM 8105  C CG2    . THR B 2 105 ? -9.545  10.950  8.372   1.00 0.00  ? 192 THR A CG2    5  
ATOM 8106  H H      . THR B 2 105 ? -8.484  10.230  5.607   1.00 0.00  ? 192 THR A H      5  
ATOM 8107  H HA     . THR B 2 105 ? -8.759  12.983  6.643   1.00 0.00  ? 192 THR A HA     5  
ATOM 8108  H HB     . THR B 2 105 ? -7.610  11.840  8.598   1.00 0.00  ? 192 THR A HB     5  
ATOM 8109  H HG1    . THR B 2 105 ? -7.684  9.467   8.338   1.00 0.00  ? 192 THR A HG1    5  
ATOM 8110  H HG21   . THR B 2 105 ? -10.111 11.869  8.518   1.00 0.00  ? 192 THR A HG21   5  
ATOM 8111  H HG22   . THR B 2 105 ? -10.081 10.308  7.671   1.00 0.00  ? 192 THR A HG22   5  
ATOM 8112  H HG23   . THR B 2 105 ? -9.459  10.439  9.332   1.00 0.00  ? 192 THR A HG23   5  
ATOM 8113  N N      . ALA B 2 106 ? -6.080  13.352  6.915   1.00 0.00  ? 193 ALA A N      5  
ATOM 8114  C CA     . ALA B 2 106 ? -4.630  13.606  6.788   1.00 0.00  ? 193 ALA A CA     5  
ATOM 8115  C C      . ALA B 2 106 ? -3.970  14.127  8.092   1.00 0.00  ? 193 ALA A C      5  
ATOM 8116  O O      . ALA B 2 106 ? -3.620  15.302  8.204   1.00 0.00  ? 193 ALA A O      5  
ATOM 8117  C CB     . ALA B 2 106 ? -4.388  14.515  5.574   1.00 0.00  ? 193 ALA A CB     5  
ATOM 8118  H H      . ALA B 2 106 ? -6.609  13.844  7.629   1.00 0.00  ? 193 ALA A H      5  
ATOM 8119  H HA     . ALA B 2 106 ? -4.129  12.665  6.564   1.00 0.00  ? 193 ALA A HA     5  
ATOM 8120  H HB1    . ALA B 2 106 ? -4.723  13.997  4.674   1.00 0.00  ? 193 ALA A HB1    5  
ATOM 8121  H HB2    . ALA B 2 106 ? -4.924  15.456  5.682   1.00 0.00  ? 193 ALA A HB2    5  
ATOM 8122  H HB3    . ALA B 2 106 ? -3.322  14.716  5.473   1.00 0.00  ? 193 ALA A HB3    5  
ATOM 8123  N N      . ARG B 2 107 ? -3.758  13.281  9.112   1.00 0.00  ? 194 ARG A N      5  
ATOM 8124  C CA     . ARG B 2 107 ? -4.232  11.883  9.268   1.00 0.00  ? 194 ARG A CA     5  
ATOM 8125  C C      . ARG B 2 107 ? -5.411  11.740  10.249  1.00 0.00  ? 194 ARG A C      5  
ATOM 8126  O O      . ARG B 2 107 ? -5.911  10.640  10.475  1.00 0.00  ? 194 ARG A O      5  
ATOM 8127  C CB     . ARG B 2 107 ? -3.071  10.942  9.643   1.00 0.00  ? 194 ARG A CB     5  
ATOM 8128  C CG     . ARG B 2 107 ? -1.890  10.986  8.667   1.00 0.00  ? 194 ARG A CG     5  
ATOM 8129  C CD     . ARG B 2 107 ? -0.973  9.779   8.867   1.00 0.00  ? 194 ARG A CD     5  
ATOM 8130  N NE     . ARG B 2 107 ? -0.018  9.951   9.975   1.00 0.00  ? 194 ARG A NE     5  
ATOM 8131  C CZ     . ARG B 2 107 ? 0.228   9.108   10.966  1.00 0.00  ? 194 ARG A CZ     5  
ATOM 8132  N NH1    . ARG B 2 107 ? -0.561  8.119   11.268  1.00 0.00  ? 194 ARG A NH1    5  
ATOM 8133  N NH2    . ARG B 2 107 ? 1.298   9.258   11.694  1.00 0.00  ? 194 ARG A NH2    5  
ATOM 8134  H H      . ARG B 2 107 ? -3.225  13.700  9.868   1.00 0.00  ? 194 ARG A H      5  
ATOM 8135  H HA     . ARG B 2 107 ? -4.629  11.511  8.324   1.00 0.00  ? 194 ARG A HA     5  
ATOM 8136  H HB2    . ARG B 2 107 ? -2.709  11.146  10.647  1.00 0.00  ? 194 ARG A HB2    5  
ATOM 8137  H HB3    . ARG B 2 107 ? -3.469  9.930   9.629   1.00 0.00  ? 194 ARG A HB3    5  
ATOM 8138  H HG2    . ARG B 2 107 ? -2.273  10.947  7.647   1.00 0.00  ? 194 ARG A HG2    5  
ATOM 8139  H HG3    . ARG B 2 107 ? -1.325  11.908  8.784   1.00 0.00  ? 194 ARG A HG3    5  
ATOM 8140  H HD2    . ARG B 2 107 ? -1.589  8.893   9.010   1.00 0.00  ? 194 ARG A HD2    5  
ATOM 8141  H HD3    . ARG B 2 107 ? -0.401  9.642   7.949   1.00 0.00  ? 194 ARG A HD3    5  
ATOM 8142  H HE     . ARG B 2 107 ? 0.634   10.711  9.891   1.00 0.00  ? 194 ARG A HE     5  
ATOM 8143  H HH11   . ARG B 2 107 ? -1.497  8.083   10.868  1.00 0.00  ? 194 ARG A HH11   5  
ATOM 8144  H HH12   . ARG B 2 107 ? -0.333  7.486   12.012  1.00 0.00  ? 194 ARG A HH12   5  
ATOM 8145  H HH21   . ARG B 2 107 ? 1.948   10.003  11.497  1.00 0.00  ? 194 ARG A HH21   5  
ATOM 8146  H HH22   . ARG B 2 107 ? 1.496   8.613   12.439  1.00 0.00  ? 194 ARG A HH22   5  
ATOM 8147  N N      . VAL B 2 108 ? -5.884  12.864  10.792  1.00 0.00  ? 195 VAL A N      5  
ATOM 8148  C CA     . VAL B 2 108 ? -7.088  12.986  11.634  1.00 0.00  ? 195 VAL A CA     5  
ATOM 8149  C C      . VAL B 2 108 ? -8.286  13.541  10.849  1.00 0.00  ? 195 VAL A C      5  
ATOM 8150  O O      . VAL B 2 108 ? -8.132  14.059  9.736   1.00 0.00  ? 195 VAL A O      5  
ATOM 8151  C CB     . VAL B 2 108 ? -6.806  13.845  12.889  1.00 0.00  ? 195 VAL A CB     5  
ATOM 8152  C CG1    . VAL B 2 108 ? -5.803  13.145  13.813  1.00 0.00  ? 195 VAL A CG1    5  
ATOM 8153  C CG2    . VAL B 2 108 ? -6.283  15.248  12.557  1.00 0.00  ? 195 VAL A CG2    5  
ATOM 8154  H H      . VAL B 2 108 ? -5.421  13.712  10.509  1.00 0.00  ? 195 VAL A H      5  
ATOM 8155  H HA     . VAL B 2 108 ? -7.382  11.994  11.981  1.00 0.00  ? 195 VAL A HA     5  
ATOM 8156  H HB     . VAL B 2 108 ? -7.734  13.959  13.448  1.00 0.00  ? 195 VAL A HB     5  
ATOM 8157  H HG11   . VAL B 2 108 ? -6.185  12.163  14.093  1.00 0.00  ? 195 VAL A HG11   5  
ATOM 8158  H HG12   . VAL B 2 108 ? -4.839  13.023  13.313  1.00 0.00  ? 195 VAL A HG12   5  
ATOM 8159  H HG13   . VAL B 2 108 ? -5.666  13.737  14.721  1.00 0.00  ? 195 VAL A HG13   5  
ATOM 8160  H HG21   . VAL B 2 108 ? -5.311  15.200  12.067  1.00 0.00  ? 195 VAL A HG21   5  
ATOM 8161  H HG22   . VAL B 2 108 ? -6.989  15.766  11.908  1.00 0.00  ? 195 VAL A HG22   5  
ATOM 8162  H HG23   . VAL B 2 108 ? -6.181  15.823  13.479  1.00 0.00  ? 195 VAL A HG23   5  
ATOM 8163  N N      . MET B 2 109 ? -9.482  13.416  11.434  1.00 0.00  ? 196 MET A N      5  
ATOM 8164  C CA     . MET B 2 109 ? -10.758 13.974  10.954  1.00 0.00  ? 196 MET A CA     5  
ATOM 8165  C C      . MET B 2 109 ? -10.802 15.513  10.936  1.00 0.00  ? 196 MET A C      5  
ATOM 8166  O O      . MET B 2 109 ? -10.159 16.162  11.793  1.00 0.00  ? 196 MET A O      5  
ATOM 8167  C CB     . MET B 2 109 ? -11.931 13.374  11.757  1.00 0.00  ? 196 MET A CB     5  
ATOM 8168  C CG     . MET B 2 109 ? -11.941 13.658  13.268  1.00 0.00  ? 196 MET A CG     5  
ATOM 8169  S SD     . MET B 2 109 ? -10.728 12.746  14.268  1.00 0.00  ? 196 MET A SD     5  
ATOM 8170  C CE     . MET B 2 109 ? -11.127 13.404  15.911  1.00 0.00  ? 196 MET A CE     5  
ATOM 8171  O OXT    . MET B 2 109 ? -11.500 16.065  10.057  1.00 0.00  ? 196 MET A OXT    5  
ATOM 8172  H H      . MET B 2 109 ? -9.498  12.989  12.349  1.00 0.00  ? 196 MET A H      5  
ATOM 8173  H HA     . MET B 2 109 ? -10.882 13.664  9.919   1.00 0.00  ? 196 MET A HA     5  
ATOM 8174  H HB2    . MET B 2 109 ? -12.856 13.771  11.336  1.00 0.00  ? 196 MET A HB2    5  
ATOM 8175  H HB3    . MET B 2 109 ? -11.952 12.293  11.614  1.00 0.00  ? 196 MET A HB3    5  
ATOM 8176  H HG2    . MET B 2 109 ? -11.806 14.726  13.432  1.00 0.00  ? 196 MET A HG2    5  
ATOM 8177  H HG3    . MET B 2 109 ? -12.933 13.397  13.640  1.00 0.00  ? 196 MET A HG3    5  
ATOM 8178  H HE1    . MET B 2 109 ? -10.974 14.482  15.922  1.00 0.00  ? 196 MET A HE1    5  
ATOM 8179  H HE2    . MET B 2 109 ? -12.162 13.181  16.161  1.00 0.00  ? 196 MET A HE2    5  
ATOM 8180  H HE3    . MET B 2 109 ? -10.474 12.947  16.653  1.00 0.00  ? 196 MET A HE3    5  
ATOM 8181  O "O5'"  . U   A 1 1   ? 0.836   -14.620 10.058  1.00 0.00  ? 197 U   B "O5'"  6  
ATOM 8182  C "C5'"  . U   A 1 1   ? -0.385  -14.169 9.477   1.00 0.00  ? 197 U   B "C5'"  6  
ATOM 8183  C "C4'"  . U   A 1 1   ? -0.399  -12.639 9.337   1.00 0.00  ? 197 U   B "C4'"  6  
ATOM 8184  O "O4'"  . U   A 1 1   ? 0.475   -12.202 8.301   1.00 0.00  ? 197 U   B "O4'"  6  
ATOM 8185  C "C3'"  . U   A 1 1   ? -1.786  -12.103 8.968   1.00 0.00  ? 197 U   B "C3'"  6  
ATOM 8186  O "O3'"  . U   A 1 1   ? -2.638  -12.033 10.109  1.00 0.00  ? 197 U   B "O3'"  6  
ATOM 8187  C "C2'"  . U   A 1 1   ? -1.407  -10.732 8.394   1.00 0.00  ? 197 U   B "C2'"  6  
ATOM 8188  O "O2'"  . U   A 1 1   ? -1.202  -9.792  9.443   1.00 0.00  ? 197 U   B "O2'"  6  
ATOM 8189  C "C1'"  . U   A 1 1   ? -0.048  -11.008 7.726   1.00 0.00  ? 197 U   B "C1'"  6  
ATOM 8190  N N1     . U   A 1 1   ? -0.104  -11.163 6.243   1.00 0.00  ? 197 U   B N1     6  
ATOM 8191  C C2     . U   A 1 1   ? 0.608   -10.239 5.470   1.00 0.00  ? 197 U   B C2     6  
ATOM 8192  O O2     . U   A 1 1   ? 0.992   -9.146  5.883   1.00 0.00  ? 197 U   B O2     6  
ATOM 8193  N N3     . U   A 1 1   ? 0.896   -10.602 4.174   1.00 0.00  ? 197 U   B N3     6  
ATOM 8194  C C4     . U   A 1 1   ? 0.421   -11.711 3.522   1.00 0.00  ? 197 U   B C4     6  
ATOM 8195  O O4     . U   A 1 1   ? 0.737   -11.927 2.354   1.00 0.00  ? 197 U   B O4     6  
ATOM 8196  C C5     . U   A 1 1   ? -0.461  -12.526 4.322   1.00 0.00  ? 197 U   B C5     6  
ATOM 8197  C C6     . U   A 1 1   ? -0.687  -12.260 5.638   1.00 0.00  ? 197 U   B C6     6  
ATOM 8198  H "H5'"  . U   A 1 1   ? -1.215  -14.468 10.123  1.00 0.00  ? 197 U   B "H5'"  6  
ATOM 8199  H "H5''" . U   A 1 1   ? -0.525  -14.624 8.491   1.00 0.00  ? 197 U   B "H5''" 6  
ATOM 8200  H "H4'"  . U   A 1 1   ? -0.095  -12.180 10.280  1.00 0.00  ? 197 U   B "H4'"  6  
ATOM 8201  H "H3'"  . U   A 1 1   ? -2.209  -12.724 8.177   1.00 0.00  ? 197 U   B "H3'"  6  
ATOM 8202  H "H2'"  . U   A 1 1   ? -2.149  -10.373 7.678   1.00 0.00  ? 197 U   B "H2'"  6  
ATOM 8203  H "HO2'" . U   A 1 1   ? -1.890  -9.934  10.117  1.00 0.00  ? 197 U   B "HO2'" 6  
ATOM 8204  H "H1'"  . U   A 1 1   ? 0.633   -10.186 7.965   1.00 0.00  ? 197 U   B "H1'"  6  
ATOM 8205  H H3     . U   A 1 1   ? 1.549   -10.034 3.671   1.00 0.00  ? 197 U   B H3     6  
ATOM 8206  H H5     . U   A 1 1   ? -0.921  -13.363 3.826   1.00 0.00  ? 197 U   B H5     6  
ATOM 8207  H H6     . U   A 1 1   ? -1.311  -12.930 6.219   1.00 0.00  ? 197 U   B H6     6  
ATOM 8208  H "HO5'" . U   A 1 1   ? 0.815   -15.597 10.126  1.00 0.00  ? 197 U   B "HO5'" 6  
ATOM 8209  P P      . G   A 1 2   ? -4.212  -12.344 10.043  1.00 0.00  ? 198 G   B P      6  
ATOM 8210  O OP1    . G   A 1 2   ? -4.572  -12.959 11.344  1.00 0.00  ? 198 G   B OP1    6  
ATOM 8211  O OP2    . G   A 1 2   ? -4.512  -13.093 8.802   1.00 0.00  ? 198 G   B OP2    6  
ATOM 8212  O "O5'"  . G   A 1 2   ? -4.950  -10.916 9.978   1.00 0.00  ? 198 G   B "O5'"  6  
ATOM 8213  C "C5'"  . G   A 1 2   ? -5.040  -10.152 8.786   1.00 0.00  ? 198 G   B "C5'"  6  
ATOM 8214  C "C4'"  . G   A 1 2   ? -6.280  -9.236  8.808   1.00 0.00  ? 198 G   B "C4'"  6  
ATOM 8215  O "O4'"  . G   A 1 2   ? -6.563  -8.762  7.489   1.00 0.00  ? 198 G   B "O4'"  6  
ATOM 8216  C "C3'"  . G   A 1 2   ? -7.574  -9.960  9.223   1.00 0.00  ? 198 G   B "C3'"  6  
ATOM 8217  O "O3'"  . G   A 1 2   ? -8.595  -9.026  9.563   1.00 0.00  ? 198 G   B "O3'"  6  
ATOM 8218  C "C2'"  . G   A 1 2   ? -7.914  -10.667 7.907   1.00 0.00  ? 198 G   B "C2'"  6  
ATOM 8219  O "O2'"  . G   A 1 2   ? -9.272  -11.090 7.825   1.00 0.00  ? 198 G   B "O2'"  6  
ATOM 8220  C "C1'"  . G   A 1 2   ? -7.556  -9.591  6.876   1.00 0.00  ? 198 G   B "C1'"  6  
ATOM 8221  N N9     . G   A 1 2   ? -7.104  -10.120 5.559   1.00 0.00  ? 198 G   B N9     6  
ATOM 8222  C C8     . G   A 1 2   ? -6.910  -11.419 5.149   1.00 0.00  ? 198 G   B C8     6  
ATOM 8223  N N7     . G   A 1 2   ? -6.496  -11.541 3.914   1.00 0.00  ? 198 G   B N7     6  
ATOM 8224  C C5     . G   A 1 2   ? -6.444  -10.220 3.450   1.00 0.00  ? 198 G   B C5     6  
ATOM 8225  C C6     . G   A 1 2   ? -6.053  -9.661  2.176   1.00 0.00  ? 198 G   B C6     6  
ATOM 8226  O O6     . G   A 1 2   ? -5.603  -10.219 1.174   1.00 0.00  ? 198 G   B O6     6  
ATOM 8227  N N1     . G   A 1 2   ? -6.237  -8.296  2.104   1.00 0.00  ? 198 G   B N1     6  
ATOM 8228  C C2     . G   A 1 2   ? -6.666  -7.537  3.131   1.00 0.00  ? 198 G   B C2     6  
ATOM 8229  N N2     . G   A 1 2   ? -6.740  -6.252  2.906   1.00 0.00  ? 198 G   B N2     6  
ATOM 8230  N N3     . G   A 1 2   ? -7.006  -7.997  4.328   1.00 0.00  ? 198 G   B N3     6  
ATOM 8231  C C4     . G   A 1 2   ? -6.870  -9.353  4.435   1.00 0.00  ? 198 G   B C4     6  
ATOM 8232  H "H5'"  . G   A 1 2   ? -5.110  -10.812 7.920   1.00 0.00  ? 198 G   B "H5'"  6  
ATOM 8233  H "H5''" . G   A 1 2   ? -4.146  -9.537  8.673   1.00 0.00  ? 198 G   B "H5''" 6  
ATOM 8234  H "H4'"  . G   A 1 2   ? -6.072  -8.403  9.477   1.00 0.00  ? 198 G   B "H4'"  6  
ATOM 8235  H "H3'"  . G   A 1 2   ? -7.417  -10.690 10.015  1.00 0.00  ? 198 G   B "H3'"  6  
ATOM 8236  H "H2'"  . G   A 1 2   ? -7.247  -11.529 7.810   1.00 0.00  ? 198 G   B "H2'"  6  
ATOM 8237  H "HO2'" . G   A 1 2   ? -9.819  -10.431 8.296   1.00 0.00  ? 198 G   B "HO2'" 6  
ATOM 8238  H "H1'"  . G   A 1 2   ? -8.445  -8.984  6.704   1.00 0.00  ? 198 G   B "H1'"  6  
ATOM 8239  H H8     . G   A 1 2   ? -7.066  -12.267 5.804   1.00 0.00  ? 198 G   B H8     6  
ATOM 8240  H H1     . G   A 1 2   ? -6.031  -7.805  1.251   1.00 0.00  ? 198 G   B H1     6  
ATOM 8241  H H21    . G   A 1 2   ? -6.391  -5.886  2.032   1.00 0.00  ? 198 G   B H21    6  
ATOM 8242  H H22    . G   A 1 2   ? -7.003  -5.631  3.663   1.00 0.00  ? 198 G   B H22    6  
ATOM 8243  P P      . C   A 1 3   ? -8.763  -8.492  11.067  1.00 0.00  ? 199 C   B P      6  
ATOM 8244  O OP1    . C   A 1 3   ? -8.717  -9.660  11.981  1.00 0.00  ? 199 C   B OP1    6  
ATOM 8245  O OP2    . C   A 1 3   ? -9.967  -7.626  11.099  1.00 0.00  ? 199 C   B OP2    6  
ATOM 8246  O "O5'"  . C   A 1 3   ? -7.466  -7.586  11.357  1.00 0.00  ? 199 C   B "O5'"  6  
ATOM 8247  C "C5'"  . C   A 1 3   ? -7.263  -6.339  10.705  1.00 0.00  ? 199 C   B "C5'"  6  
ATOM 8248  C "C4'"  . C   A 1 3   ? -6.015  -5.639  11.262  1.00 0.00  ? 199 C   B "C4'"  6  
ATOM 8249  O "O4'"  . C   A 1 3   ? -4.819  -6.334  10.910  1.00 0.00  ? 199 C   B "O4'"  6  
ATOM 8250  C "C3'"  . C   A 1 3   ? -5.878  -4.195  10.730  1.00 0.00  ? 199 C   B "C3'"  6  
ATOM 8251  O "O3'"  . C   A 1 3   ? -5.760  -3.249  11.794  1.00 0.00  ? 199 C   B "O3'"  6  
ATOM 8252  C "C2'"  . C   A 1 3   ? -4.565  -4.263  9.928   1.00 0.00  ? 199 C   B "C2'"  6  
ATOM 8253  O "O2'"  . C   A 1 3   ? -3.857  -3.032  9.899   1.00 0.00  ? 199 C   B "O2'"  6  
ATOM 8254  C "C1'"  . C   A 1 3   ? -3.816  -5.363  10.676  1.00 0.00  ? 199 C   B "C1'"  6  
ATOM 8255  N N1     . C   A 1 3   ? -2.650  -5.919  9.918   1.00 0.00  ? 199 C   B N1     6  
ATOM 8256  C C2     . C   A 1 3   ? -1.353  -5.742  10.428  1.00 0.00  ? 199 C   B C2     6  
ATOM 8257  O O2     . C   A 1 3   ? -1.153  -5.174  11.502  1.00 0.00  ? 199 C   B O2     6  
ATOM 8258  N N3     . C   A 1 3   ? -0.264  -6.179  9.739   1.00 0.00  ? 199 C   B N3     6  
ATOM 8259  C C4     . C   A 1 3   ? -0.461  -6.798  8.593   1.00 0.00  ? 199 C   B C4     6  
ATOM 8260  N N4     . C   A 1 3   ? 0.614   -7.188  7.968   1.00 0.00  ? 199 C   B N4     6  
ATOM 8261  C C5     . C   A 1 3   ? -1.743  -6.998  8.023   1.00 0.00  ? 199 C   B C5     6  
ATOM 8262  C C6     . C   A 1 3   ? -2.821  -6.544  8.710   1.00 0.00  ? 199 C   B C6     6  
ATOM 8263  H "H5'"  . C   A 1 3   ? -8.129  -5.701  10.886  1.00 0.00  ? 199 C   B "H5'"  6  
ATOM 8264  H "H5''" . C   A 1 3   ? -7.153  -6.485  9.630   1.00 0.00  ? 199 C   B "H5''" 6  
ATOM 8265  H "H4'"  . C   A 1 3   ? -6.094  -5.600  12.348  1.00 0.00  ? 199 C   B "H4'"  6  
ATOM 8266  H "H3'"  . C   A 1 3   ? -6.699  -3.941  10.066  1.00 0.00  ? 199 C   B "H3'"  6  
ATOM 8267  H "H2'"  . C   A 1 3   ? -4.793  -4.602  8.916   1.00 0.00  ? 199 C   B "H2'"  6  
ATOM 8268  H "HO2'" . C   A 1 3   ? -4.048  -2.567  10.735  1.00 0.00  ? 199 C   B "HO2'" 6  
ATOM 8269  H "H1'"  . C   A 1 3   ? -3.480  -4.956  11.635  1.00 0.00  ? 199 C   B "H1'"  6  
ATOM 8270  H H41    . C   A 1 3   ? 1.486   -7.091  8.443   1.00 0.00  ? 199 C   B H41    6  
ATOM 8271  H H42    . C   A 1 3   ? 0.531   -7.656  7.070   1.00 0.00  ? 199 C   B H42    6  
ATOM 8272  H H5     . C   A 1 3   ? -1.844  -7.496  7.076   1.00 0.00  ? 199 C   B H5     6  
ATOM 8273  H H6     . C   A 1 3   ? -3.823  -6.674  8.317   1.00 0.00  ? 199 C   B H6     6  
ATOM 8274  P P      . A   A 1 4   ? -7.054  -2.663  12.558  1.00 0.00  ? 200 A   B P      6  
ATOM 8275  O OP1    . A   A 1 4   ? -6.581  -1.970  13.780  1.00 0.00  ? 200 A   B OP1    6  
ATOM 8276  O OP2    . A   A 1 4   ? -8.052  -3.748  12.695  1.00 0.00  ? 200 A   B OP2    6  
ATOM 8277  O "O5'"  . A   A 1 4   ? -7.668  -1.563  11.554  1.00 0.00  ? 200 A   B "O5'"  6  
ATOM 8278  C "C5'"  . A   A 1 4   ? -7.034  -0.307  11.364  1.00 0.00  ? 200 A   B "C5'"  6  
ATOM 8279  C "C4'"  . A   A 1 4   ? -7.694  0.581   10.290  1.00 0.00  ? 200 A   B "C4'"  6  
ATOM 8280  O "O4'"  . A   A 1 4   ? -7.557  -0.013  9.006   1.00 0.00  ? 200 A   B "O4'"  6  
ATOM 8281  C "C3'"  . A   A 1 4   ? -9.194  0.875   10.486  1.00 0.00  ? 200 A   B "C3'"  6  
ATOM 8282  O "O3'"  . A   A 1 4   ? -9.609  2.096   9.883   1.00 0.00  ? 200 A   B "O3'"  6  
ATOM 8283  C "C2'"  . A   A 1 4   ? -9.837  -0.279  9.726   1.00 0.00  ? 200 A   B "C2'"  6  
ATOM 8284  O "O2'"  . A   A 1 4   ? -11.119 0.036   9.193   1.00 0.00  ? 200 A   B "O2'"  6  
ATOM 8285  C "C1'"  . A   A 1 4   ? -8.802  -0.588  8.633   1.00 0.00  ? 200 A   B "C1'"  6  
ATOM 8286  N N9     . A   A 1 4   ? -8.662  -2.043  8.380   1.00 0.00  ? 200 A   B N9     6  
ATOM 8287  C C8     . A   A 1 4   ? -9.045  -3.109  9.166   1.00 0.00  ? 200 A   B C8     6  
ATOM 8288  N N7     . A   A 1 4   ? -8.844  -4.280  8.626   1.00 0.00  ? 200 A   B N7     6  
ATOM 8289  C C5     . A   A 1 4   ? -8.293  -3.954  7.380   1.00 0.00  ? 200 A   B C5     6  
ATOM 8290  C C6     . A   A 1 4   ? -7.836  -4.707  6.275   1.00 0.00  ? 200 A   B C6     6  
ATOM 8291  N N6     . A   A 1 4   ? -7.823  -6.024  6.271   1.00 0.00  ? 200 A   B N6     6  
ATOM 8292  N N1     . A   A 1 4   ? -7.381  -4.111  5.164   1.00 0.00  ? 200 A   B N1     6  
ATOM 8293  C C2     . A   A 1 4   ? -7.347  -2.780  5.161   1.00 0.00  ? 200 A   B C2     6  
ATOM 8294  N N3     . A   A 1 4   ? -7.723  -1.945  6.121   1.00 0.00  ? 200 A   B N3     6  
ATOM 8295  C C4     . A   A 1 4   ? -8.190  -2.601  7.218   1.00 0.00  ? 200 A   B C4     6  
ATOM 8296  H "H5'"  . A   A 1 4   ? -5.995  -0.471  11.073  1.00 0.00  ? 200 A   B "H5'"  6  
ATOM 8297  H "H5''" . A   A 1 4   ? -7.038  0.237   12.309  1.00 0.00  ? 200 A   B "H5''" 6  
ATOM 8298  H "H4'"  . A   A 1 4   ? -7.147  1.519   10.297  1.00 0.00  ? 200 A   B "H4'"  6  
ATOM 8299  H "H3'"  . A   A 1 4   ? -9.480  0.823   11.539  1.00 0.00  ? 200 A   B "H3'"  6  
ATOM 8300  H "H2'"  . A   A 1 4   ? -9.926  -1.097  10.435  1.00 0.00  ? 200 A   B "H2'"  6  
ATOM 8301  H "HO2'" . A   A 1 4   ? -11.129 0.997   9.023   1.00 0.00  ? 200 A   B "HO2'" 6  
ATOM 8302  H "H1'"  . A   A 1 4   ? -9.111  -0.101  7.704   1.00 0.00  ? 200 A   B "H1'"  6  
ATOM 8303  H H8     . A   A 1 4   ? -9.457  -2.991  10.164  1.00 0.00  ? 200 A   B H8     6  
ATOM 8304  H H61    . A   A 1 4   ? -7.442  -6.548  5.494   1.00 0.00  ? 200 A   B H61    6  
ATOM 8305  H H62    . A   A 1 4   ? -8.123  -6.495  7.106   1.00 0.00  ? 200 A   B H62    6  
ATOM 8306  H H2     . A   A 1 4   ? -6.968  -2.286  4.278   1.00 0.00  ? 200 A   B H2     6  
ATOM 8307  P P      . U   A 1 5   ? -9.381  3.505   10.595  1.00 0.00  ? 201 U   B P      6  
ATOM 8308  O OP1    . U   A 1 5   ? -8.425  3.346   11.719  1.00 0.00  ? 201 U   B OP1    6  
ATOM 8309  O OP2    . U   A 1 5   ? -10.712 4.099   10.860  1.00 0.00  ? 201 U   B OP2    6  
ATOM 8310  O "O5'"  . U   A 1 5   ? -8.678  4.361   9.433   1.00 0.00  ? 201 U   B "O5'"  6  
ATOM 8311  C "C5'"  . U   A 1 5   ? -7.426  3.974   8.892   1.00 0.00  ? 201 U   B "C5'"  6  
ATOM 8312  C "C4'"  . U   A 1 5   ? -6.626  5.135   8.283   1.00 0.00  ? 201 U   B "C4'"  6  
ATOM 8313  O "O4'"  . U   A 1 5   ? -6.990  5.487   6.948   1.00 0.00  ? 201 U   B "O4'"  6  
ATOM 8314  C "C3'"  . U   A 1 5   ? -6.692  6.413   9.131   1.00 0.00  ? 201 U   B "C3'"  6  
ATOM 8315  O "O3'"  . U   A 1 5   ? -5.451  7.116   9.111   1.00 0.00  ? 201 U   B "O3'"  6  
ATOM 8316  C "C2'"  . U   A 1 5   ? -7.822  7.147   8.414   1.00 0.00  ? 201 U   B "C2'"  6  
ATOM 8317  O "O2'"  . U   A 1 5   ? -7.837  8.536   8.673   1.00 0.00  ? 201 U   B "O2'"  6  
ATOM 8318  C "C1'"  . U   A 1 5   ? -7.595  6.780   6.945   1.00 0.00  ? 201 U   B "C1'"  6  
ATOM 8319  N N1     . U   A 1 5   ? -8.866  6.733   6.183   1.00 0.00  ? 201 U   B N1     6  
ATOM 8320  C C2     . U   A 1 5   ? -9.040  7.623   5.116   1.00 0.00  ? 201 U   B C2     6  
ATOM 8321  O O2     . U   A 1 5   ? -8.253  8.527   4.838   1.00 0.00  ? 201 U   B O2     6  
ATOM 8322  N N3     . U   A 1 5   ? -10.188 7.478   4.366   1.00 0.00  ? 201 U   B N3     6  
ATOM 8323  C C4     . U   A 1 5   ? -11.258 6.682   4.710   1.00 0.00  ? 201 U   B C4     6  
ATOM 8324  O O4     . U   A 1 5   ? -12.320 6.762   4.105   1.00 0.00  ? 201 U   B O4     6  
ATOM 8325  C C5     . U   A 1 5   ? -11.022 5.807   5.836   1.00 0.00  ? 201 U   B C5     6  
ATOM 8326  C C6     . U   A 1 5   ? -9.854  5.838   6.523   1.00 0.00  ? 201 U   B C6     6  
ATOM 8327  H "H5'"  . U   A 1 5   ? -7.564  3.185   8.151   1.00 0.00  ? 201 U   B "H5'"  6  
ATOM 8328  H "H5''" . U   A 1 5   ? -6.810  3.572   9.698   1.00 0.00  ? 201 U   B "H5''" 6  
ATOM 8329  H "H4'"  . U   A 1 5   ? -5.612  4.768   8.277   1.00 0.00  ? 201 U   B "H4'"  6  
ATOM 8330  H "H3'"  . U   A 1 5   ? -6.992  6.202   10.158  1.00 0.00  ? 201 U   B "H3'"  6  
ATOM 8331  H "H2'"  . U   A 1 5   ? -8.762  6.715   8.761   1.00 0.00  ? 201 U   B "H2'"  6  
ATOM 8332  H "HO2'" . U   A 1 5   ? -8.736  8.880   8.515   1.00 0.00  ? 201 U   B "HO2'" 6  
ATOM 8333  H "H1'"  . U   A 1 5   ? -6.925  7.523   6.494   1.00 0.00  ? 201 U   B "H1'"  6  
ATOM 8334  H H3     . U   A 1 5   ? -10.232 7.976   3.492   1.00 0.00  ? 201 U   B H3     6  
ATOM 8335  H H5     . U   A 1 5   ? -11.801 5.115   6.118   1.00 0.00  ? 201 U   B H5     6  
ATOM 8336  H H6     . U   A 1 5   ? -9.695  5.160   7.357   1.00 0.00  ? 201 U   B H6     6  
ATOM 8337  P P      . G   A 1 6   ? -4.248  6.649   10.071  1.00 0.00  ? 202 G   B P      6  
ATOM 8338  O OP1    . G   A 1 6   ? -4.601  5.373   10.732  1.00 0.00  ? 202 G   B OP1    6  
ATOM 8339  O OP2    . G   A 1 6   ? -3.847  7.795   10.914  1.00 0.00  ? 202 G   B OP2    6  
ATOM 8340  O "O5'"  . G   A 1 6   ? -3.045  6.355   9.046   1.00 0.00  ? 202 G   B "O5'"  6  
ATOM 8341  C "C5'"  . G   A 1 6   ? -3.072  5.195   8.226   1.00 0.00  ? 202 G   B "C5'"  6  
ATOM 8342  C "C4'"  . G   A 1 6   ? -1.834  4.930   7.363   1.00 0.00  ? 202 G   B "C4'"  6  
ATOM 8343  O "O4'"  . G   A 1 6   ? -1.998  5.548   6.095   1.00 0.00  ? 202 G   B "O4'"  6  
ATOM 8344  C "C3'"  . G   A 1 6   ? -0.551  5.420   8.011   1.00 0.00  ? 202 G   B "C3'"  6  
ATOM 8345  O "O3'"  . G   A 1 6   ? 0.446   4.424   7.899   1.00 0.00  ? 202 G   B "O3'"  6  
ATOM 8346  C "C2'"  . G   A 1 6   ? -0.404  6.733   7.245   1.00 0.00  ? 202 G   B "C2'"  6  
ATOM 8347  O "O2'"  . G   A 1 6   ? 0.860   7.387   7.299   1.00 0.00  ? 202 G   B "O2'"  6  
ATOM 8348  C "C1'"  . G   A 1 6   ? -0.851  6.337   5.860   1.00 0.00  ? 202 G   B "C1'"  6  
ATOM 8349  N N9     . G   A 1 6   ? -1.160  7.545   5.078   1.00 0.00  ? 202 G   B N9     6  
ATOM 8350  C C8     . G   A 1 6   ? -0.410  8.102   4.079   1.00 0.00  ? 202 G   B C8     6  
ATOM 8351  N N7     . G   A 1 6   ? -0.888  9.223   3.605   1.00 0.00  ? 202 G   B N7     6  
ATOM 8352  C C5     . G   A 1 6   ? -2.039  9.427   4.382   1.00 0.00  ? 202 G   B C5     6  
ATOM 8353  C C6     . G   A 1 6   ? -3.018  10.477  4.375   1.00 0.00  ? 202 G   B C6     6  
ATOM 8354  O O6     . G   A 1 6   ? -3.065  11.478  3.668   1.00 0.00  ? 202 G   B O6     6  
ATOM 8355  N N1     . G   A 1 6   ? -4.041  10.303  5.279   1.00 0.00  ? 202 G   B N1     6  
ATOM 8356  C C2     . G   A 1 6   ? -4.085  9.281   6.172   1.00 0.00  ? 202 G   B C2     6  
ATOM 8357  N N2     . G   A 1 6   ? -5.090  9.230   7.009   1.00 0.00  ? 202 G   B N2     6  
ATOM 8358  N N3     . G   A 1 6   ? -3.178  8.322   6.254   1.00 0.00  ? 202 G   B N3     6  
ATOM 8359  C C4     . G   A 1 6   ? -2.193  8.421   5.307   1.00 0.00  ? 202 G   B C4     6  
ATOM 8360  H "H5'"  . G   A 1 6   ? -3.905  5.288   7.533   1.00 0.00  ? 202 G   B "H5'"  6  
ATOM 8361  H "H5''" . G   A 1 6   ? -3.213  4.325   8.868   1.00 0.00  ? 202 G   B "H5''" 6  
ATOM 8362  H "H4'"  . G   A 1 6   ? -1.716  3.867   7.189   1.00 0.00  ? 202 G   B "H4'"  6  
ATOM 8363  H "H3'"  . G   A 1 6   ? -0.714  5.607   9.049   1.00 0.00  ? 202 G   B "H3'"  6  
ATOM 8364  H "H2'"  . G   A 1 6   ? -1.190  7.394   7.611   1.00 0.00  ? 202 G   B "H2'"  6  
ATOM 8365  H "HO2'" . G   A 1 6   ? 0.868   8.152   6.694   1.00 0.00  ? 202 G   B "HO2'" 6  
ATOM 8366  H "H1'"  . G   A 1 6   ? -0.077  5.739   5.393   1.00 0.00  ? 202 G   B "H1'"  6  
ATOM 8367  H H8     . G   A 1 6   ? 0.502   7.623   3.751   1.00 0.00  ? 202 G   B H8     6  
ATOM 8368  H H1     . G   A 1 6   ? -4.830  10.909  5.112   1.00 0.00  ? 202 G   B H1     6  
ATOM 8369  H H21    . G   A 1 6   ? -5.876  9.847   6.954   1.00 0.00  ? 202 G   B H21    6  
ATOM 8370  H H22    . G   A 1 6   ? -5.082  8.463   7.674   1.00 0.00  ? 202 G   B H22    6  
ATOM 8371  P P      . U   A 1 7   ? 1.229   3.948   9.213   1.00 0.00  ? 203 U   B P      6  
ATOM 8372  O OP1    . U   A 1 7   ? 1.903   2.656   8.929   1.00 0.00  ? 203 U   B OP1    6  
ATOM 8373  O OP2    . U   A 1 7   ? 0.363   4.062   10.408  1.00 0.00  ? 203 U   B OP2    6  
ATOM 8374  O "O5'"  . U   A 1 7   ? 2.315   5.110   9.330   1.00 0.00  ? 203 U   B "O5'"  6  
ATOM 8375  C "C5'"  . U   A 1 7   ? 3.547   5.056   8.640   1.00 0.00  ? 203 U   B "C5'"  6  
ATOM 8376  C "C4'"  . U   A 1 7   ? 3.505   5.230   7.103   1.00 0.00  ? 203 U   B "C4'"  6  
ATOM 8377  O "O4'"  . U   A 1 7   ? 4.854   5.419   6.686   1.00 0.00  ? 203 U   B "O4'"  6  
ATOM 8378  C "C3'"  . U   A 1 7   ? 2.964   4.148   6.140   1.00 0.00  ? 203 U   B "C3'"  6  
ATOM 8379  O "O3'"  . U   A 1 7   ? 2.268   4.784   5.076   1.00 0.00  ? 203 U   B "O3'"  6  
ATOM 8380  C "C2'"  . U   A 1 7   ? 4.201   3.425   5.565   1.00 0.00  ? 203 U   B "C2'"  6  
ATOM 8381  O "O2'"  . U   A 1 7   ? 4.349   3.527   4.149   1.00 0.00  ? 203 U   B "O2'"  6  
ATOM 8382  C "C1'"  . U   A 1 7   ? 5.369   4.170   6.219   1.00 0.00  ? 203 U   B "C1'"  6  
ATOM 8383  N N1     . U   A 1 7   ? 6.068   3.359   7.266   1.00 0.00  ? 203 U   B N1     6  
ATOM 8384  C C2     . U   A 1 7   ? 7.466   3.483   7.356   1.00 0.00  ? 203 U   B C2     6  
ATOM 8385  O O2     . U   A 1 7   ? 8.121   4.326   6.738   1.00 0.00  ? 203 U   B O2     6  
ATOM 8386  N N3     . U   A 1 7   ? 8.128   2.581   8.167   1.00 0.00  ? 203 U   B N3     6  
ATOM 8387  C C4     . U   A 1 7   ? 7.544   1.563   8.884   1.00 0.00  ? 203 U   B C4     6  
ATOM 8388  O O4     . U   A 1 7   ? 8.239   0.808   9.560   1.00 0.00  ? 203 U   B O4     6  
ATOM 8389  C C5     . U   A 1 7   ? 6.104   1.506   8.766   1.00 0.00  ? 203 U   B C5     6  
ATOM 8390  C C6     . U   A 1 7   ? 5.413   2.383   7.998   1.00 0.00  ? 203 U   B C6     6  
ATOM 8391  H "H5'"  . U   A 1 7   ? 4.057   4.148   8.926   1.00 0.00  ? 203 U   B "H5'"  6  
ATOM 8392  H "H5''" . U   A 1 7   ? 4.150   5.877   9.028   1.00 0.00  ? 203 U   B "H5''" 6  
ATOM 8393  H "H4'"  . U   A 1 7   ? 2.894   6.115   6.923   1.00 0.00  ? 203 U   B "H4'"  6  
ATOM 8394  H "H3'"  . U   A 1 7   ? 2.313   3.439   6.642   1.00 0.00  ? 203 U   B "H3'"  6  
ATOM 8395  H "HO3'" . U   A 1 7   ? 2.923   4.852   4.360   1.00 0.00  ? 203 U   B "HO3'" 6  
ATOM 8396  H "H2'"  . U   A 1 7   ? 4.183   2.369   5.854   1.00 0.00  ? 203 U   B "H2'"  6  
ATOM 8397  H "HO2'" . U   A 1 7   ? 3.700   2.942   3.704   1.00 0.00  ? 203 U   B "HO2'" 6  
ATOM 8398  H "H1'"  . U   A 1 7   ? 6.098   4.379   5.434   1.00 0.00  ? 203 U   B "H1'"  6  
ATOM 8399  H H3     . U   A 1 7   ? 9.128   2.664   8.224   1.00 0.00  ? 203 U   B H3     6  
ATOM 8400  H H5     . U   A 1 7   ? 5.574   0.743   9.312   1.00 0.00  ? 203 U   B H5     6  
ATOM 8401  H H6     . U   A 1 7   ? 4.325   2.323   7.976   1.00 0.00  ? 203 U   B H6     6  
ATOM 8402  N N      . ASN B 2 22  ? -17.123 25.569  -14.610 1.00 0.00  ? 109 ASN A N      6  
ATOM 8403  C CA     . ASN B 2 22  ? -15.707 25.146  -14.778 1.00 0.00  ? 109 ASN A CA     6  
ATOM 8404  C C      . ASN B 2 22  ? -15.129 24.663  -13.442 1.00 0.00  ? 109 ASN A C      6  
ATOM 8405  O O      . ASN B 2 22  ? -15.205 23.470  -13.171 1.00 0.00  ? 109 ASN A O      6  
ATOM 8406  C CB     . ASN B 2 22  ? -14.862 26.229  -15.494 1.00 0.00  ? 109 ASN A CB     6  
ATOM 8407  C CG     . ASN B 2 22  ? -13.412 25.801  -15.716 1.00 0.00  ? 109 ASN A CG     6  
ATOM 8408  O OD1    . ASN B 2 22  ? -12.497 26.275  -15.058 1.00 0.00  ? 109 ASN A OD1    6  
ATOM 8409  N ND2    . ASN B 2 22  ? -13.143 24.890  -16.632 1.00 0.00  ? 109 ASN A ND2    6  
ATOM 8410  H H      . ASN B 2 22  ? -17.665 24.822  -14.199 1.00 0.00  ? 109 ASN A H      6  
ATOM 8411  H HA     . ASN B 2 22  ? -15.704 24.264  -15.423 1.00 0.00  ? 109 ASN A HA     6  
ATOM 8412  H HB2    . ASN B 2 22  ? -15.299 26.449  -16.471 1.00 0.00  ? 109 ASN A HB2    6  
ATOM 8413  H HB3    . ASN B 2 22  ? -14.866 27.158  -14.920 1.00 0.00  ? 109 ASN A HB3    6  
ATOM 8414  H HD21   . ASN B 2 22  ? -13.850 24.512  -17.246 1.00 0.00  ? 109 ASN A HD21   6  
ATOM 8415  H HD22   . ASN B 2 22  ? -12.173 24.650  -16.773 1.00 0.00  ? 109 ASN A HD22   6  
ATOM 8416  N N      . THR B 2 23  ? -14.587 25.560  -12.605 1.00 0.00  ? 110 THR A N      6  
ATOM 8417  C CA     . THR B 2 23  ? -14.092 25.398  -11.212 1.00 0.00  ? 110 THR A CA     6  
ATOM 8418  C C      . THR B 2 23  ? -13.702 23.969  -10.783 1.00 0.00  ? 110 THR A C      6  
ATOM 8419  O O      . THR B 2 23  ? -12.531 23.604  -10.868 1.00 0.00  ? 110 THR A O      6  
ATOM 8420  C CB     . THR B 2 23  ? -15.083 26.050  -10.220 1.00 0.00  ? 110 THR A CB     6  
ATOM 8421  O OG1    . THR B 2 23  ? -15.416 27.354  -10.663 1.00 0.00  ? 110 THR A OG1    6  
ATOM 8422  C CG2    . THR B 2 23  ? -14.524 26.183  -8.802  1.00 0.00  ? 110 THR A CG2    6  
ATOM 8423  H H      . THR B 2 23  ? -14.574 26.521  -12.923 1.00 0.00  ? 110 THR A H      6  
ATOM 8424  H HA     . THR B 2 23  ? -13.172 25.979  -11.145 1.00 0.00  ? 110 THR A HA     6  
ATOM 8425  H HB     . THR B 2 23  ? -15.998 25.460  -10.186 1.00 0.00  ? 110 THR A HB     6  
ATOM 8426  H HG1    . THR B 2 23  ? -14.649 27.931  -10.495 1.00 0.00  ? 110 THR A HG1    6  
ATOM 8427  H HG21   . THR B 2 23  ? -14.339 25.199  -8.375  1.00 0.00  ? 110 THR A HG21   6  
ATOM 8428  H HG22   . THR B 2 23  ? -13.588 26.746  -8.812  1.00 0.00  ? 110 THR A HG22   6  
ATOM 8429  H HG23   . THR B 2 23  ? -15.250 26.701  -8.172  1.00 0.00  ? 110 THR A HG23   6  
ATOM 8430  N N      . GLU B 2 24  ? -14.647 23.146  -10.315 1.00 0.00  ? 111 GLU A N      6  
ATOM 8431  C CA     . GLU B 2 24  ? -14.383 21.802  -9.766  1.00 0.00  ? 111 GLU A CA     6  
ATOM 8432  C C      . GLU B 2 24  ? -13.857 20.770  -10.786 1.00 0.00  ? 111 GLU A C      6  
ATOM 8433  O O      . GLU B 2 24  ? -13.299 19.746  -10.393 1.00 0.00  ? 111 GLU A O      6  
ATOM 8434  C CB     . GLU B 2 24  ? -15.642 21.275  -9.053  1.00 0.00  ? 111 GLU A CB     6  
ATOM 8435  C CG     . GLU B 2 24  ? -16.842 21.032  -9.982  1.00 0.00  ? 111 GLU A CG     6  
ATOM 8436  C CD     . GLU B 2 24  ? -18.063 20.542  -9.178  1.00 0.00  ? 111 GLU A CD     6  
ATOM 8437  O OE1    . GLU B 2 24  ? -18.869 21.389  -8.715  1.00 0.00  ? 111 GLU A OE1    6  
ATOM 8438  O OE2    . GLU B 2 24  ? -18.226 19.307  -9.002  1.00 0.00  ? 111 GLU A OE2    6  
ATOM 8439  H H      . GLU B 2 24  ? -15.603 23.470  -10.317 1.00 0.00  ? 111 GLU A H      6  
ATOM 8440  H HA     . GLU B 2 24  ? -13.609 21.896  -9.007  1.00 0.00  ? 111 GLU A HA     6  
ATOM 8441  H HB2    . GLU B 2 24  ? -15.392 20.341  -8.552  1.00 0.00  ? 111 GLU A HB2    6  
ATOM 8442  H HB3    . GLU B 2 24  ? -15.936 21.994  -8.285  1.00 0.00  ? 111 GLU A HB3    6  
ATOM 8443  H HG2    . GLU B 2 24  ? -17.096 21.957  -10.504 1.00 0.00  ? 111 GLU A HG2    6  
ATOM 8444  H HG3    . GLU B 2 24  ? -16.572 20.291  -10.736 1.00 0.00  ? 111 GLU A HG3    6  
ATOM 8445  N N      . ASN B 2 25  ? -13.988 21.030  -12.094 1.00 0.00  ? 112 ASN A N      6  
ATOM 8446  C CA     . ASN B 2 25  ? -13.518 20.145  -13.167 1.00 0.00  ? 112 ASN A CA     6  
ATOM 8447  C C      . ASN B 2 25  ? -11.976 20.052  -13.283 1.00 0.00  ? 112 ASN A C      6  
ATOM 8448  O O      . ASN B 2 25  ? -11.463 19.140  -13.933 1.00 0.00  ? 112 ASN A O      6  
ATOM 8449  C CB     . ASN B 2 25  ? -14.154 20.629  -14.483 1.00 0.00  ? 112 ASN A CB     6  
ATOM 8450  C CG     . ASN B 2 25  ? -13.938 19.655  -15.633 1.00 0.00  ? 112 ASN A CG     6  
ATOM 8451  O OD1    . ASN B 2 25  ? -14.399 18.520  -15.609 1.00 0.00  ? 112 ASN A OD1    6  
ATOM 8452  N ND2    . ASN B 2 25  ? -13.257 20.062  -16.682 1.00 0.00  ? 112 ASN A ND2    6  
ATOM 8453  H H      . ASN B 2 25  ? -14.469 21.888  -12.350 1.00 0.00  ? 112 ASN A H      6  
ATOM 8454  H HA     . ASN B 2 25  ? -13.882 19.137  -12.959 1.00 0.00  ? 112 ASN A HA     6  
ATOM 8455  H HB2    . ASN B 2 25  ? -15.231 20.737  -14.347 1.00 0.00  ? 112 ASN A HB2    6  
ATOM 8456  H HB3    . ASN B 2 25  ? -13.747 21.606  -14.745 1.00 0.00  ? 112 ASN A HB3    6  
ATOM 8457  H HD21   . ASN B 2 25  ? -12.869 20.988  -16.733 1.00 0.00  ? 112 ASN A HD21   6  
ATOM 8458  H HD22   . ASN B 2 25  ? -13.127 19.393  -17.427 1.00 0.00  ? 112 ASN A HD22   6  
ATOM 8459  N N      . LYS B 2 26  ? -11.235 20.981  -12.654 1.00 0.00  ? 113 LYS A N      6  
ATOM 8460  C CA     . LYS B 2 26  ? -9.764  21.112  -12.733 1.00 0.00  ? 113 LYS A CA     6  
ATOM 8461  C C      . LYS B 2 26  ? -9.035  21.137  -11.378 1.00 0.00  ? 113 LYS A C      6  
ATOM 8462  O O      . LYS B 2 26  ? -7.819  21.330  -11.347 1.00 0.00  ? 113 LYS A O      6  
ATOM 8463  C CB     . LYS B 2 26  ? -9.407  22.323  -13.618 1.00 0.00  ? 113 LYS A CB     6  
ATOM 8464  C CG     . LYS B 2 26  ? -9.761  23.670  -12.970 1.00 0.00  ? 113 LYS A CG     6  
ATOM 8465  C CD     . LYS B 2 26  ? -9.513  24.848  -13.918 1.00 0.00  ? 113 LYS A CD     6  
ATOM 8466  C CE     . LYS B 2 26  ? -9.831  26.159  -13.189 1.00 0.00  ? 113 LYS A CE     6  
ATOM 8467  N NZ     . LYS B 2 26  ? -9.983  27.288  -14.141 1.00 0.00  ? 113 LYS A NZ     6  
ATOM 8468  H H      . LYS B 2 26  ? -11.759 21.692  -12.157 1.00 0.00  ? 113 LYS A H      6  
ATOM 8469  H HA     . LYS B 2 26  ? -9.368  20.231  -13.241 1.00 0.00  ? 113 LYS A HA     6  
ATOM 8470  H HB2    . LYS B 2 26  ? -8.338  22.308  -13.834 1.00 0.00  ? 113 LYS A HB2    6  
ATOM 8471  H HB3    . LYS B 2 26  ? -9.936  22.233  -14.569 1.00 0.00  ? 113 LYS A HB3    6  
ATOM 8472  H HG2    . LYS B 2 26  ? -10.819 23.673  -12.710 1.00 0.00  ? 113 LYS A HG2    6  
ATOM 8473  H HG3    . LYS B 2 26  ? -9.171  23.805  -12.063 1.00 0.00  ? 113 LYS A HG3    6  
ATOM 8474  H HD2    . LYS B 2 26  ? -8.471  24.851  -14.246 1.00 0.00  ? 113 LYS A HD2    6  
ATOM 8475  H HD3    . LYS B 2 26  ? -10.164 24.738  -14.789 1.00 0.00  ? 113 LYS A HD3    6  
ATOM 8476  H HE2    . LYS B 2 26  ? -10.762 26.030  -12.627 1.00 0.00  ? 113 LYS A HE2    6  
ATOM 8477  H HE3    . LYS B 2 26  ? -9.036  26.367  -12.467 1.00 0.00  ? 113 LYS A HE3    6  
ATOM 8478  H HZ1    . LYS B 2 26  ? -9.163  27.401  -14.724 1.00 0.00  ? 113 LYS A HZ1    6  
ATOM 8479  H HZ2    . LYS B 2 26  ? -10.790 27.122  -14.738 1.00 0.00  ? 113 LYS A HZ2    6  
ATOM 8480  H HZ3    . LYS B 2 26  ? -10.140 28.160  -13.653 1.00 0.00  ? 113 LYS A HZ3    6  
ATOM 8481  N N      . SER B 2 27  ? -9.753  20.956  -10.268 1.00 0.00  ? 114 SER A N      6  
ATOM 8482  C CA     . SER B 2 27  ? -9.210  20.907  -8.900  1.00 0.00  ? 114 SER A CA     6  
ATOM 8483  C C      . SER B 2 27  ? -8.084  19.866  -8.769  1.00 0.00  ? 114 SER A C      6  
ATOM 8484  O O      . SER B 2 27  ? -8.312  18.670  -8.960  1.00 0.00  ? 114 SER A O      6  
ATOM 8485  C CB     . SER B 2 27  ? -10.325 20.608  -7.895  1.00 0.00  ? 114 SER A CB     6  
ATOM 8486  O OG     . SER B 2 27  ? -11.268 21.669  -7.879  1.00 0.00  ? 114 SER A OG     6  
ATOM 8487  H H      . SER B 2 27  ? -10.738 20.773  -10.386 1.00 0.00  ? 114 SER A H      6  
ATOM 8488  H HA     . SER B 2 27  ? -8.798  21.886  -8.652  1.00 0.00  ? 114 SER A HA     6  
ATOM 8489  H HB2    . SER B 2 27  ? -10.821 19.674  -8.168  1.00 0.00  ? 114 SER A HB2    6  
ATOM 8490  H HB3    . SER B 2 27  ? -9.885  20.506  -6.901  1.00 0.00  ? 114 SER A HB3    6  
ATOM 8491  H HG     . SER B 2 27  ? -11.873 21.525  -7.126  1.00 0.00  ? 114 SER A HG     6  
ATOM 8492  N N      . GLN B 2 28  ? -6.859  20.320  -8.478  1.00 0.00  ? 115 GLN A N      6  
ATOM 8493  C CA     . GLN B 2 28  ? -5.655  19.480  -8.480  1.00 0.00  ? 115 GLN A CA     6  
ATOM 8494  C C      . GLN B 2 28  ? -5.765  18.242  -7.555  1.00 0.00  ? 115 GLN A C      6  
ATOM 8495  O O      . GLN B 2 28  ? -6.196  18.394  -6.408  1.00 0.00  ? 115 GLN A O      6  
ATOM 8496  C CB     . GLN B 2 28  ? -4.391  20.317  -8.185  1.00 0.00  ? 115 GLN A CB     6  
ATOM 8497  C CG     . GLN B 2 28  ? -4.243  20.918  -6.769  1.00 0.00  ? 115 GLN A CG     6  
ATOM 8498  C CD     . GLN B 2 28  ? -5.308  21.953  -6.407  1.00 0.00  ? 115 GLN A CD     6  
ATOM 8499  O OE1    . GLN B 2 28  ? -6.034  21.830  -5.429  1.00 0.00  ? 115 GLN A OE1    6  
ATOM 8500  N NE2    . GLN B 2 28  ? -5.459  23.014  -7.172  1.00 0.00  ? 115 GLN A NE2    6  
ATOM 8501  H H      . GLN B 2 28  ? -6.754  21.316  -8.349  1.00 0.00  ? 115 GLN A H      6  
ATOM 8502  H HA     . GLN B 2 28  ? -5.548  19.136  -9.506  1.00 0.00  ? 115 GLN A HA     6  
ATOM 8503  H HB2    . GLN B 2 28  ? -3.529  19.670  -8.356  1.00 0.00  ? 115 GLN A HB2    6  
ATOM 8504  H HB3    . GLN B 2 28  ? -4.332  21.121  -8.920  1.00 0.00  ? 115 GLN A HB3    6  
ATOM 8505  H HG2    . GLN B 2 28  ? -4.255  20.118  -6.029  1.00 0.00  ? 115 GLN A HG2    6  
ATOM 8506  H HG3    . GLN B 2 28  ? -3.270  21.407  -6.707  1.00 0.00  ? 115 GLN A HG3    6  
ATOM 8507  H HE21   . GLN B 2 28  ? -4.844  23.190  -7.954  1.00 0.00  ? 115 GLN A HE21   6  
ATOM 8508  H HE22   . GLN B 2 28  ? -6.132  23.708  -6.877  1.00 0.00  ? 115 GLN A HE22   6  
ATOM 8509  N N      . PRO B 2 29  ? -5.368  17.032  -8.014  1.00 0.00  ? 116 PRO A N      6  
ATOM 8510  C CA     . PRO B 2 29  ? -5.324  15.796  -7.218  1.00 0.00  ? 116 PRO A CA     6  
ATOM 8511  C C      . PRO B 2 29  ? -4.690  15.944  -5.827  1.00 0.00  ? 116 PRO A C      6  
ATOM 8512  O O      . PRO B 2 29  ? -3.617  16.539  -5.694  1.00 0.00  ? 116 PRO A O      6  
ATOM 8513  C CB     . PRO B 2 29  ? -4.490  14.835  -8.071  1.00 0.00  ? 116 PRO A CB     6  
ATOM 8514  C CG     . PRO B 2 29  ? -4.865  15.217  -9.495  1.00 0.00  ? 116 PRO A CG     6  
ATOM 8515  C CD     . PRO B 2 29  ? -4.964  16.737  -9.387  1.00 0.00  ? 116 PRO A CD     6  
ATOM 8516  H HA     . PRO B 2 29  ? -6.349  15.421  -7.102  1.00 0.00  ? 116 PRO A HA     6  
ATOM 8517  H HB2    . PRO B 2 29  ? -3.427  15.027  -7.918  1.00 0.00  ? 116 PRO A HB2    6  
ATOM 8518  H HB3    . PRO B 2 29  ? -4.705  13.797  -7.864  1.00 0.00  ? 116 PRO A HB3    6  
ATOM 8519  H HG2    . PRO B 2 29  ? -4.109  14.910  -10.215 1.00 0.00  ? 116 PRO A HG2    6  
ATOM 8520  H HG3    . PRO B 2 29  ? -5.838  14.797  -9.747  1.00 0.00  ? 116 PRO A HG3    6  
ATOM 8521  H HD2    . PRO B 2 29  ? -3.986  17.185  -9.579  1.00 0.00  ? 116 PRO A HD2    6  
ATOM 8522  H HD3    . PRO B 2 29  ? -5.701  17.103  -10.104 1.00 0.00  ? 116 PRO A HD3    6  
ATOM 8523  N N      . LYS B 2 30  ? -5.326  15.359  -4.798  1.00 0.00  ? 117 LYS A N      6  
ATOM 8524  C CA     . LYS B 2 30  ? -4.945  15.451  -3.380  1.00 0.00  ? 117 LYS A CA     6  
ATOM 8525  C C      . LYS B 2 30  ? -5.735  14.455  -2.518  1.00 0.00  ? 117 LYS A C      6  
ATOM 8526  O O      . LYS B 2 30  ? -6.482  14.776  -1.596  1.00 0.00  ? 117 LYS A O      6  
ATOM 8527  C CB     . LYS B 2 30  ? -4.947  16.899  -2.868  1.00 0.00  ? 117 LYS A CB     6  
ATOM 8528  C CG     . LYS B 2 30  ? -6.290  17.638  -2.977  1.00 0.00  ? 117 LYS A CG     6  
ATOM 8529  C CD     . LYS B 2 30  ? -6.112  19.153  -2.833  1.00 0.00  ? 117 LYS A CD     6  
ATOM 8530  C CE     . LYS B 2 30  ? -7.471  19.852  -2.953  1.00 0.00  ? 117 LYS A CE     6  
ATOM 8531  N NZ     . LYS B 2 30  ? -7.329  21.329  -2.974  1.00 0.00  ? 117 LYS A NZ     6  
ATOM 8532  H H      . LYS B 2 30  ? -6.135  14.774  -4.992  1.00 0.00  ? 117 LYS A H      6  
ATOM 8533  H HA     . LYS B 2 30  ? -3.900  15.145  -3.303  1.00 0.00  ? 117 LYS A HA     6  
ATOM 8534  H HB2    . LYS B 2 30  ? -4.614  16.864  -1.837  1.00 0.00  ? 117 LYS A HB2    6  
ATOM 8535  H HB3    . LYS B 2 30  ? -4.183  17.450  -3.419  1.00 0.00  ? 117 LYS A HB3    6  
ATOM 8536  H HG2    . LYS B 2 30  ? -6.736  17.440  -3.950  1.00 0.00  ? 117 LYS A HG2    6  
ATOM 8537  H HG3    . LYS B 2 30  ? -6.972  17.278  -2.206  1.00 0.00  ? 117 LYS A HG3    6  
ATOM 8538  H HD2    . LYS B 2 30  ? -5.662  19.384  -1.866  1.00 0.00  ? 117 LYS A HD2    6  
ATOM 8539  H HD3    . LYS B 2 30  ? -5.453  19.507  -3.628  1.00 0.00  ? 117 LYS A HD3    6  
ATOM 8540  H HE2    . LYS B 2 30  ? -7.955  19.520  -3.877  1.00 0.00  ? 117 LYS A HE2    6  
ATOM 8541  H HE3    . LYS B 2 30  ? -8.101  19.551  -2.110  1.00 0.00  ? 117 LYS A HE3    6  
ATOM 8542  H HZ1    . LYS B 2 30  ? -6.859  21.670  -2.146  1.00 0.00  ? 117 LYS A HZ1    6  
ATOM 8543  H HZ2    . LYS B 2 30  ? -6.795  21.619  -3.791  1.00 0.00  ? 117 LYS A HZ2    6  
ATOM 8544  H HZ3    . LYS B 2 30  ? -8.230  21.782  -3.024  1.00 0.00  ? 117 LYS A HZ3    6  
ATOM 8545  N N      . ARG B 2 31  ? -5.410  13.213  -2.857  1.00 0.00  ? 118 ARG A N      6  
ATOM 8546  C CA     . ARG B 2 31  ? -5.267  11.981  -2.074  1.00 0.00  ? 118 ARG A CA     6  
ATOM 8547  C C      . ARG B 2 31  ? -6.481  11.176  -1.604  1.00 0.00  ? 118 ARG A C      6  
ATOM 8548  O O      . ARG B 2 31  ? -7.608  11.658  -1.499  1.00 0.00  ? 118 ARG A O      6  
ATOM 8549  C CB     . ARG B 2 31  ? -4.047  12.084  -1.172  1.00 0.00  ? 118 ARG A CB     6  
ATOM 8550  C CG     . ARG B 2 31  ? -4.326  12.782  0.140   1.00 0.00  ? 118 ARG A CG     6  
ATOM 8551  C CD     . ARG B 2 31  ? -3.014  13.248  0.757   1.00 0.00  ? 118 ARG A CD     6  
ATOM 8552  N NE     . ARG B 2 31  ? -2.131  12.136  1.151   1.00 0.00  ? 118 ARG A NE     6  
ATOM 8553  C CZ     . ARG B 2 31  ? -1.062  11.664  0.540   1.00 0.00  ? 118 ARG A CZ     6  
ATOM 8554  N NH1    . ARG B 2 31  ? -0.623  12.182  -0.567  1.00 0.00  ? 118 ARG A NH1    6  
ATOM 8555  N NH2    . ARG B 2 31  ? -0.418  10.643  1.029   1.00 0.00  ? 118 ARG A NH2    6  
ATOM 8556  H H      . ARG B 2 31  ? -4.788  13.265  -3.641  1.00 0.00  ? 118 ARG A H      6  
ATOM 8557  H HA     . ARG B 2 31  ? -4.870  11.309  -2.795  1.00 0.00  ? 118 ARG A HA     6  
ATOM 8558  H HB2    . ARG B 2 31  ? -3.642  11.090  -0.969  1.00 0.00  ? 118 ARG A HB2    6  
ATOM 8559  H HB3    . ARG B 2 31  ? -3.302  12.659  -1.730  1.00 0.00  ? 118 ARG A HB3    6  
ATOM 8560  H HG2    . ARG B 2 31  ? -4.943  13.661  -0.014  1.00 0.00  ? 118 ARG A HG2    6  
ATOM 8561  H HG3    . ARG B 2 31  ? -4.853  12.100  0.798   1.00 0.00  ? 118 ARG A HG3    6  
ATOM 8562  H HD2    . ARG B 2 31  ? -2.505  13.951  0.095   1.00 0.00  ? 118 ARG A HD2    6  
ATOM 8563  H HD3    . ARG B 2 31  ? -3.317  13.789  1.633   1.00 0.00  ? 118 ARG A HD3    6  
ATOM 8564  H HE     . ARG B 2 31  ? -2.356  11.695  2.037   1.00 0.00  ? 118 ARG A HE     6  
ATOM 8565  H HH11   . ARG B 2 31  ? -1.100  12.973  -0.958  1.00 0.00  ? 118 ARG A HH11   6  
ATOM 8566  H HH12   . ARG B 2 31  ? 0.071   11.722  -1.132  1.00 0.00  ? 118 ARG A HH12   6  
ATOM 8567  H HH21   . ARG B 2 31  ? -0.700  10.228  1.911   1.00 0.00  ? 118 ARG A HH21   6  
ATOM 8568  H HH22   . ARG B 2 31  ? 0.417   10.315  0.576   1.00 0.00  ? 118 ARG A HH22   6  
ATOM 8569  N N      . LEU B 2 32  ? -6.207  9.877   -1.471  1.00 0.00  ? 119 LEU A N      6  
ATOM 8570  C CA     . LEU B 2 32  ? -7.108  8.762   -1.752  1.00 0.00  ? 119 LEU A CA     6  
ATOM 8571  C C      . LEU B 2 32  ? -6.622  7.512   -0.984  1.00 0.00  ? 119 LEU A C      6  
ATOM 8572  O O      . LEU B 2 32  ? -5.473  7.105   -1.144  1.00 0.00  ? 119 LEU A O      6  
ATOM 8573  C CB     . LEU B 2 32  ? -7.076  8.561   -3.292  1.00 0.00  ? 119 LEU A CB     6  
ATOM 8574  C CG     . LEU B 2 32  ? -8.031  7.502   -3.859  1.00 0.00  ? 119 LEU A CG     6  
ATOM 8575  C CD1    . LEU B 2 32  ? -9.496  7.848   -3.597  1.00 0.00  ? 119 LEU A CD1    6  
ATOM 8576  C CD2    . LEU B 2 32  ? -7.936  7.399   -5.376  1.00 0.00  ? 119 LEU A CD2    6  
ATOM 8577  H H      . LEU B 2 32  ? -5.230  9.635   -1.584  1.00 0.00  ? 119 LEU A H      6  
ATOM 8578  H HA     . LEU B 2 32  ? -8.114  9.024   -1.419  1.00 0.00  ? 119 LEU A HA     6  
ATOM 8579  H HB2    . LEU B 2 32  ? -7.278  9.518   -3.776  1.00 0.00  ? 119 LEU A HB2    6  
ATOM 8580  H HB3    . LEU B 2 32  ? -6.070  8.263   -3.582  1.00 0.00  ? 119 LEU A HB3    6  
ATOM 8581  H HG     . LEU B 2 32  ? -7.753  6.536   -3.447  1.00 0.00  ? 119 LEU A HG     6  
ATOM 8582  H HD11   . LEU B 2 32  ? -9.650  8.086   -2.556  1.00 0.00  ? 119 LEU A HD11   6  
ATOM 8583  H HD12   . LEU B 2 32  ? -9.803  8.709   -4.193  1.00 0.00  ? 119 LEU A HD12   6  
ATOM 8584  H HD13   . LEU B 2 32  ? -10.119 6.992   -3.843  1.00 0.00  ? 119 LEU A HD13   6  
ATOM 8585  H HD21   . LEU B 2 32  ? -8.218  8.344   -5.828  1.00 0.00  ? 119 LEU A HD21   6  
ATOM 8586  H HD22   . LEU B 2 32  ? -6.927  7.132   -5.686  1.00 0.00  ? 119 LEU A HD22   6  
ATOM 8587  H HD23   . LEU B 2 32  ? -8.617  6.626   -5.726  1.00 0.00  ? 119 LEU A HD23   6  
ATOM 8588  N N      . HIS B 2 33  ? -7.474  6.926   -0.144  1.00 0.00  ? 120 HIS A N      6  
ATOM 8589  C CA     . HIS B 2 33  ? -7.239  5.744   0.706   1.00 0.00  ? 120 HIS A CA     6  
ATOM 8590  C C      . HIS B 2 33  ? -7.777  4.485   -0.000  1.00 0.00  ? 120 HIS A C      6  
ATOM 8591  O O      . HIS B 2 33  ? -8.862  4.498   -0.580  1.00 0.00  ? 120 HIS A O      6  
ATOM 8592  C CB     . HIS B 2 33  ? -8.002  5.997   2.028   1.00 0.00  ? 120 HIS A CB     6  
ATOM 8593  C CG     . HIS B 2 33  ? -8.250  4.805   2.913   1.00 0.00  ? 120 HIS A CG     6  
ATOM 8594  N ND1    . HIS B 2 33  ? -9.493  4.218   3.161   1.00 0.00  ? 120 HIS A ND1    6  
ATOM 8595  C CD2    . HIS B 2 33  ? -7.319  4.226   3.716   1.00 0.00  ? 120 HIS A CD2    6  
ATOM 8596  C CE1    . HIS B 2 33  ? -9.279  3.307   4.127   1.00 0.00  ? 120 HIS A CE1    6  
ATOM 8597  N NE2    . HIS B 2 33  ? -7.981  3.286   4.471   1.00 0.00  ? 120 HIS A NE2    6  
ATOM 8598  H H      . HIS B 2 33  ? -8.438  7.247   -0.185  1.00 0.00  ? 120 HIS A H      6  
ATOM 8599  H HA     . HIS B 2 33  ? -6.156  5.597   0.884   1.00 0.00  ? 120 HIS A HA     6  
ATOM 8600  H HB2    . HIS B 2 33  ? -7.477  6.730   2.643   1.00 0.00  ? 120 HIS A HB2    6  
ATOM 8601  H HB3    . HIS B 2 33  ? -8.979  6.423   1.793   1.00 0.00  ? 120 HIS A HB3    6  
ATOM 8602  H HD2    . HIS B 2 33  ? -6.281  4.499   3.781   1.00 0.00  ? 120 HIS A HD2    6  
ATOM 8603  H HE1    . HIS B 2 33  ? -10.026 2.639   4.543   1.00 0.00  ? 120 HIS A HE1    6  
ATOM 8604  H HE2    . HIS B 2 33  ? -7.569  2.672   5.164   1.00 0.00  ? 120 HIS A HE2    6  
ATOM 8605  N N      . VAL B 2 34  ? -7.003  3.403   -0.003  1.00 0.00  ? 121 VAL A N      6  
ATOM 8606  C CA     . VAL B 2 34  ? -7.113  2.315   -0.996  1.00 0.00  ? 121 VAL A CA     6  
ATOM 8607  C C      . VAL B 2 34  ? -7.113  0.964   -0.287  1.00 0.00  ? 121 VAL A C      6  
ATOM 8608  O O      . VAL B 2 34  ? -6.065  0.352   -0.103  1.00 0.00  ? 121 VAL A O      6  
ATOM 8609  C CB     . VAL B 2 34  ? -5.969  2.468   -2.022  1.00 0.00  ? 121 VAL A CB     6  
ATOM 8610  C CG1    . VAL B 2 34  ? -5.970  1.449   -3.154  1.00 0.00  ? 121 VAL A CG1    6  
ATOM 8611  C CG2    . VAL B 2 34  ? -6.019  3.837   -2.705  1.00 0.00  ? 121 VAL A CG2    6  
ATOM 8612  H H      . VAL B 2 34  ? -6.127  3.462   0.508   1.00 0.00  ? 121 VAL A H      6  
ATOM 8613  H HA     . VAL B 2 34  ? -8.058  2.386   -1.528  1.00 0.00  ? 121 VAL A HA     6  
ATOM 8614  H HB     . VAL B 2 34  ? -5.010  2.382   -1.510  1.00 0.00  ? 121 VAL A HB     6  
ATOM 8615  H HG11   . VAL B 2 34  ? -5.891  0.436   -2.762  1.00 0.00  ? 121 VAL A HG11   6  
ATOM 8616  H HG12   . VAL B 2 34  ? -6.874  1.544   -3.755  1.00 0.00  ? 121 VAL A HG12   6  
ATOM 8617  H HG13   . VAL B 2 34  ? -5.096  1.662   -3.770  1.00 0.00  ? 121 VAL A HG13   6  
ATOM 8618  H HG21   . VAL B 2 34  ? -7.006  4.011   -3.133  1.00 0.00  ? 121 VAL A HG21   6  
ATOM 8619  H HG22   . VAL B 2 34  ? -5.790  4.626   -1.989  1.00 0.00  ? 121 VAL A HG22   6  
ATOM 8620  H HG23   . VAL B 2 34  ? -5.269  3.874   -3.489  1.00 0.00  ? 121 VAL A HG23   6  
ATOM 8621  N N      . SER B 2 35  ? -8.288  0.539   0.180   1.00 0.00  ? 122 SER A N      6  
ATOM 8622  C CA     . SER B 2 35  ? -8.492  -0.554  1.137   1.00 0.00  ? 122 SER A CA     6  
ATOM 8623  C C      . SER B 2 35  ? -8.733  -1.936  0.535   1.00 0.00  ? 122 SER A C      6  
ATOM 8624  O O      . SER B 2 35  ? -9.071  -2.082  -0.639  1.00 0.00  ? 122 SER A O      6  
ATOM 8625  C CB     . SER B 2 35  ? -9.679  -0.222  2.050   1.00 0.00  ? 122 SER A CB     6  
ATOM 8626  O OG     . SER B 2 35  ? -9.222  0.609   3.089   1.00 0.00  ? 122 SER A OG     6  
ATOM 8627  H H      . SER B 2 35  ? -9.106  1.080   -0.086  1.00 0.00  ? 122 SER A H      6  
ATOM 8628  H HA     . SER B 2 35  ? -7.611  -0.631  1.763   1.00 0.00  ? 122 SER A HA     6  
ATOM 8629  H HB2    . SER B 2 35  ? -10.472 0.271   1.486   1.00 0.00  ? 122 SER A HB2    6  
ATOM 8630  H HB3    . SER B 2 35  ? -10.089 -1.129  2.501   1.00 0.00  ? 122 SER A HB3    6  
ATOM 8631  H HG     . SER B 2 35  ? -8.901  1.438   2.694   1.00 0.00  ? 122 SER A HG     6  
ATOM 8632  N N      . ASN B 2 36  ? -8.630  -2.953  1.401   1.00 0.00  ? 123 ASN A N      6  
ATOM 8633  C CA     . ASN B 2 36  ? -9.018  -4.359  1.215   1.00 0.00  ? 123 ASN A CA     6  
ATOM 8634  C C      . ASN B 2 36  ? -8.224  -5.111  0.137   1.00 0.00  ? 123 ASN A C      6  
ATOM 8635  O O      . ASN B 2 36  ? -8.516  -6.273  -0.145  1.00 0.00  ? 123 ASN A O      6  
ATOM 8636  C CB     . ASN B 2 36  ? -10.549 -4.423  1.039   1.00 0.00  ? 123 ASN A CB     6  
ATOM 8637  C CG     . ASN B 2 36  ? -11.092 -5.839  1.116   1.00 0.00  ? 123 ASN A CG     6  
ATOM 8638  O OD1    . ASN B 2 36  ? -10.966 -6.521  2.123   1.00 0.00  ? 123 ASN A OD1    6  
ATOM 8639  N ND2    . ASN B 2 36  ? -11.680 -6.342  0.056   1.00 0.00  ? 123 ASN A ND2    6  
ATOM 8640  H H      . ASN B 2 36  ? -8.178  -2.730  2.279   1.00 0.00  ? 123 ASN A H      6  
ATOM 8641  H HA     . ASN B 2 36  ? -8.772  -4.896  2.132   1.00 0.00  ? 123 ASN A HA     6  
ATOM 8642  H HB2    . ASN B 2 36  ? -11.026 -3.849  1.833   1.00 0.00  ? 123 ASN A HB2    6  
ATOM 8643  H HB3    . ASN B 2 36  ? -10.825 -3.980  0.081   1.00 0.00  ? 123 ASN A HB3    6  
ATOM 8644  H HD21   . ASN B 2 36  ? -11.678 -5.801  -0.806  1.00 0.00  ? 123 ASN A HD21   6  
ATOM 8645  H HD22   . ASN B 2 36  ? -12.087 -7.259  0.111   1.00 0.00  ? 123 ASN A HD22   6  
ATOM 8646  N N      . ILE B 2 37  ? -7.185  -4.488  -0.419  1.00 0.00  ? 124 ILE A N      6  
ATOM 8647  C CA     . ILE B 2 37  ? -6.317  -5.008  -1.482  1.00 0.00  ? 124 ILE A CA     6  
ATOM 8648  C C      . ILE B 2 37  ? -5.683  -6.357  -1.084  1.00 0.00  ? 124 ILE A C      6  
ATOM 8649  O O      . ILE B 2 37  ? -5.442  -6.566  0.110   1.00 0.00  ? 124 ILE A O      6  
ATOM 8650  C CB     . ILE B 2 37  ? -5.235  -3.949  -1.823  1.00 0.00  ? 124 ILE A CB     6  
ATOM 8651  C CG1    . ILE B 2 37  ? -4.063  -3.965  -0.814  1.00 0.00  ? 124 ILE A CG1    6  
ATOM 8652  C CG2    . ILE B 2 37  ? -5.853  -2.539  -1.875  1.00 0.00  ? 124 ILE A CG2    6  
ATOM 8653  C CD1    . ILE B 2 37  ? -3.117  -2.775  -0.943  1.00 0.00  ? 124 ILE A CD1    6  
ATOM 8654  H H      . ILE B 2 37  ? -6.969  -3.567  -0.068  1.00 0.00  ? 124 ILE A H      6  
ATOM 8655  H HA     . ILE B 2 37  ? -6.939  -5.152  -2.363  1.00 0.00  ? 124 ILE A HA     6  
ATOM 8656  H HB     . ILE B 2 37  ? -4.838  -4.176  -2.815  1.00 0.00  ? 124 ILE A HB     6  
ATOM 8657  H HG12   . ILE B 2 37  ? -4.447  -3.977  0.202   1.00 0.00  ? 124 ILE A HG12   6  
ATOM 8658  H HG13   . ILE B 2 37  ? -3.476  -4.870  -0.963  1.00 0.00  ? 124 ILE A HG13   6  
ATOM 8659  H HG21   . ILE B 2 37  ? -6.822  -2.567  -2.366  1.00 0.00  ? 124 ILE A HG21   6  
ATOM 8660  H HG22   . ILE B 2 37  ? -5.963  -2.144  -0.858  1.00 0.00  ? 124 ILE A HG22   6  
ATOM 8661  H HG23   . ILE B 2 37  ? -5.200  -1.874  -2.438  1.00 0.00  ? 124 ILE A HG23   6  
ATOM 8662  H HD11   . ILE B 2 37  ? -2.852  -2.629  -1.993  1.00 0.00  ? 124 ILE A HD11   6  
ATOM 8663  H HD12   . ILE B 2 37  ? -3.616  -1.880  -0.567  1.00 0.00  ? 124 ILE A HD12   6  
ATOM 8664  H HD13   . ILE B 2 37  ? -2.230  -2.971  -0.341  1.00 0.00  ? 124 ILE A HD13   6  
ATOM 8665  N N      . PRO B 2 38  ? -5.363  -7.259  -2.030  1.00 0.00  ? 125 PRO A N      6  
ATOM 8666  C CA     . PRO B 2 38  ? -4.586  -8.473  -1.751  1.00 0.00  ? 125 PRO A CA     6  
ATOM 8667  C C      . PRO B 2 38  ? -3.278  -8.145  -1.033  1.00 0.00  ? 125 PRO A C      6  
ATOM 8668  O O      . PRO B 2 38  ? -2.532  -7.288  -1.493  1.00 0.00  ? 125 PRO A O      6  
ATOM 8669  C CB     . PRO B 2 38  ? -4.295  -9.114  -3.114  1.00 0.00  ? 125 PRO A CB     6  
ATOM 8670  C CG     . PRO B 2 38  ? -5.420  -8.583  -3.982  1.00 0.00  ? 125 PRO A CG     6  
ATOM 8671  C CD     . PRO B 2 38  ? -5.685  -7.183  -3.445  1.00 0.00  ? 125 PRO A CD     6  
ATOM 8672  H HA     . PRO B 2 38  ? -5.190  -9.153  -1.150  1.00 0.00  ? 125 PRO A HA     6  
ATOM 8673  H HB2    . PRO B 2 38  ? -3.341  -8.773  -3.516  1.00 0.00  ? 125 PRO A HB2    6  
ATOM 8674  H HB3    . PRO B 2 38  ? -4.313  -10.203 -3.060  1.00 0.00  ? 125 PRO A HB3    6  
ATOM 8675  H HG2    . PRO B 2 38  ? -5.152  -8.574  -5.031  1.00 0.00  ? 125 PRO A HG2    6  
ATOM 8676  H HG3    . PRO B 2 38  ? -6.285  -9.220  -3.829  1.00 0.00  ? 125 PRO A HG3    6  
ATOM 8677  H HD2    . PRO B 2 38  ? -5.027  -6.462  -3.931  1.00 0.00  ? 125 PRO A HD2    6  
ATOM 8678  H HD3    . PRO B 2 38  ? -6.727  -6.909  -3.608  1.00 0.00  ? 125 PRO A HD3    6  
ATOM 8679  N N      . PHE B 2 39  ? -2.946  -8.832  0.060   1.00 0.00  ? 126 PHE A N      6  
ATOM 8680  C CA     . PHE B 2 39  ? -1.734  -8.540  0.846   1.00 0.00  ? 126 PHE A CA     6  
ATOM 8681  C C      . PHE B 2 39  ? -0.396  -8.529  0.078   1.00 0.00  ? 126 PHE A C      6  
ATOM 8682  O O      . PHE B 2 39  ? 0.574   -7.926  0.553   1.00 0.00  ? 126 PHE A O      6  
ATOM 8683  C CB     . PHE B 2 39  ? -1.634  -9.536  2.008   1.00 0.00  ? 126 PHE A CB     6  
ATOM 8684  C CG     . PHE B 2 39  ? -2.466  -9.235  3.236   1.00 0.00  ? 126 PHE A CG     6  
ATOM 8685  C CD1    . PHE B 2 39  ? -2.597  -7.919  3.727   1.00 0.00  ? 126 PHE A CD1    6  
ATOM 8686  C CD2    . PHE B 2 39  ? -3.005  -10.312 3.967   1.00 0.00  ? 126 PHE A CD2    6  
ATOM 8687  C CE1    . PHE B 2 39  ? -3.310  -7.696  4.916   1.00 0.00  ? 126 PHE A CE1    6  
ATOM 8688  C CE2    . PHE B 2 39  ? -3.659  -10.084 5.189   1.00 0.00  ? 126 PHE A CE2    6  
ATOM 8689  C CZ     . PHE B 2 39  ? -3.822  -8.771  5.655   1.00 0.00  ? 126 PHE A CZ     6  
ATOM 8690  H H      . PHE B 2 39  ? -3.637  -9.470  0.439   1.00 0.00  ? 126 PHE A H      6  
ATOM 8691  H HA     . PHE B 2 39  ? -1.839  -7.532  1.237   1.00 0.00  ? 126 PHE A HA     6  
ATOM 8692  H HB2    . PHE B 2 39  ? -1.879  -10.533 1.632   1.00 0.00  ? 126 PHE A HB2    6  
ATOM 8693  H HB3    . PHE B 2 39  ? -0.607  -9.577  2.345   1.00 0.00  ? 126 PHE A HB3    6  
ATOM 8694  H HD1    . PHE B 2 39  ? -2.126  -7.065  3.249   1.00 0.00  ? 126 PHE A HD1    6  
ATOM 8695  H HD2    . PHE B 2 39  ? -2.892  -11.324 3.609   1.00 0.00  ? 126 PHE A HD2    6  
ATOM 8696  H HE1    . PHE B 2 39  ? -3.424  -6.700  5.303   1.00 0.00  ? 126 PHE A HE1    6  
ATOM 8697  H HE2    . PHE B 2 39  ? -4.034  -10.920 5.761   1.00 0.00  ? 126 PHE A HE2    6  
ATOM 8698  H HZ     . PHE B 2 39  ? -4.324  -8.570  6.583   1.00 0.00  ? 126 PHE A HZ     6  
ATOM 8699  N N      . ARG B 2 40  ? -0.346  -9.168  -1.098  1.00 0.00  ? 127 ARG A N      6  
ATOM 8700  C CA     . ARG B 2 40  ? 0.807   -9.221  -2.016  1.00 0.00  ? 127 ARG A CA     6  
ATOM 8701  C C      . ARG B 2 40  ? 0.981   -7.949  -2.872  1.00 0.00  ? 127 ARG A C      6  
ATOM 8702  O O      . ARG B 2 40  ? 1.980   -7.847  -3.591  1.00 0.00  ? 127 ARG A O      6  
ATOM 8703  C CB     . ARG B 2 40  ? 0.693   -10.477 -2.908  1.00 0.00  ? 127 ARG A CB     6  
ATOM 8704  C CG     . ARG B 2 40  ? 1.008   -11.806 -2.194  1.00 0.00  ? 127 ARG A CG     6  
ATOM 8705  C CD     . ARG B 2 40  ? -0.038  -12.255 -1.162  1.00 0.00  ? 127 ARG A CD     6  
ATOM 8706  N NE     . ARG B 2 40  ? 0.255   -13.610 -0.653  1.00 0.00  ? 127 ARG A NE     6  
ATOM 8707  C CZ     . ARG B 2 40  ? -0.491  -14.333 0.168   1.00 0.00  ? 127 ARG A CZ     6  
ATOM 8708  N NH1    . ARG B 2 40  ? -1.644  -13.914 0.612   1.00 0.00  ? 127 ARG A NH1    6  
ATOM 8709  N NH2    . ARG B 2 40  ? -0.090  -15.512 0.554   1.00 0.00  ? 127 ARG A NH2    6  
ATOM 8710  H H      . ARG B 2 40  ? -1.210  -9.605  -1.386  1.00 0.00  ? 127 ARG A H      6  
ATOM 8711  H HA     . ARG B 2 40  ? 1.726   -9.300  -1.433  1.00 0.00  ? 127 ARG A HA     6  
ATOM 8712  H HB2    . ARG B 2 40  ? -0.302  -10.525 -3.355  1.00 0.00  ? 127 ARG A HB2    6  
ATOM 8713  H HB3    . ARG B 2 40  ? 1.412   -10.384 -3.722  1.00 0.00  ? 127 ARG A HB3    6  
ATOM 8714  H HG2    . ARG B 2 40  ? 1.082   -12.579 -2.958  1.00 0.00  ? 127 ARG A HG2    6  
ATOM 8715  H HG3    . ARG B 2 40  ? 1.979   -11.721 -1.705  1.00 0.00  ? 127 ARG A HG3    6  
ATOM 8716  H HD2    . ARG B 2 40  ? -0.029  -11.564 -0.317  1.00 0.00  ? 127 ARG A HD2    6  
ATOM 8717  H HD3    . ARG B 2 40  ? -1.021  -12.243 -1.641  1.00 0.00  ? 127 ARG A HD3    6  
ATOM 8718  H HE     . ARG B 2 40  ? 1.134   -14.024 -0.918  1.00 0.00  ? 127 ARG A HE     6  
ATOM 8719  H HH11   . ARG B 2 40  ? -1.969  -13.008 0.322   1.00 0.00  ? 127 ARG A HH11   6  
ATOM 8720  H HH12   . ARG B 2 40  ? -2.204  -14.485 1.224   1.00 0.00  ? 127 ARG A HH12   6  
ATOM 8721  H HH21   . ARG B 2 40  ? 0.795   -15.876 0.247   1.00 0.00  ? 127 ARG A HH21   6  
ATOM 8722  H HH22   . ARG B 2 40  ? -0.663  -16.063 1.172   1.00 0.00  ? 127 ARG A HH22   6  
ATOM 8723  N N      . PHE B 2 41  ? 0.048   -6.988  -2.814  1.00 0.00  ? 128 PHE A N      6  
ATOM 8724  C CA     . PHE B 2 41  ? 0.128   -5.705  -3.536  1.00 0.00  ? 128 PHE A CA     6  
ATOM 8725  C C      . PHE B 2 41  ? 1.392   -4.883  -3.238  1.00 0.00  ? 128 PHE A C      6  
ATOM 8726  O O      . PHE B 2 41  ? 2.072   -5.064  -2.225  1.00 0.00  ? 128 PHE A O      6  
ATOM 8727  C CB     . PHE B 2 41  ? -1.119  -4.848  -3.262  1.00 0.00  ? 128 PHE A CB     6  
ATOM 8728  C CG     . PHE B 2 41  ? -1.988  -4.671  -4.483  1.00 0.00  ? 128 PHE A CG     6  
ATOM 8729  C CD1    . PHE B 2 41  ? -2.646  -5.776  -5.053  1.00 0.00  ? 128 PHE A CD1    6  
ATOM 8730  C CD2    . PHE B 2 41  ? -2.092  -3.407  -5.084  1.00 0.00  ? 128 PHE A CD2    6  
ATOM 8731  C CE1    . PHE B 2 41  ? -3.408  -5.612  -6.223  1.00 0.00  ? 128 PHE A CE1    6  
ATOM 8732  C CE2    . PHE B 2 41  ? -2.856  -3.241  -6.249  1.00 0.00  ? 128 PHE A CE2    6  
ATOM 8733  C CZ     . PHE B 2 41  ? -3.515  -4.343  -6.821  1.00 0.00  ? 128 PHE A CZ     6  
ATOM 8734  H H      . PHE B 2 41  ? -0.778  -7.174  -2.257  1.00 0.00  ? 128 PHE A H      6  
ATOM 8735  H HA     . PHE B 2 41  ? 0.153   -5.938  -4.604  1.00 0.00  ? 128 PHE A HA     6  
ATOM 8736  H HB2    . PHE B 2 41  ? -1.715  -5.270  -2.464  1.00 0.00  ? 128 PHE A HB2    6  
ATOM 8737  H HB3    . PHE B 2 41  ? -0.821  -3.863  -2.900  1.00 0.00  ? 128 PHE A HB3    6  
ATOM 8738  H HD1    . PHE B 2 41  ? -2.555  -6.754  -4.597  1.00 0.00  ? 128 PHE A HD1    6  
ATOM 8739  H HD2    . PHE B 2 41  ? -1.572  -2.566  -4.648  1.00 0.00  ? 128 PHE A HD2    6  
ATOM 8740  H HE1    . PHE B 2 41  ? -3.897  -6.462  -6.677  1.00 0.00  ? 128 PHE A HE1    6  
ATOM 8741  H HE2    . PHE B 2 41  ? -2.916  -2.269  -6.714  1.00 0.00  ? 128 PHE A HE2    6  
ATOM 8742  H HZ     . PHE B 2 41  ? -4.089  -4.218  -7.730  1.00 0.00  ? 128 PHE A HZ     6  
ATOM 8743  N N      . ARG B 2 42  ? 1.674   -3.927  -4.136  1.00 0.00  ? 129 ARG A N      6  
ATOM 8744  C CA     . ARG B 2 42  ? 2.847   -3.043  -4.097  1.00 0.00  ? 129 ARG A CA     6  
ATOM 8745  C C      . ARG B 2 42  ? 2.478   -1.596  -4.421  1.00 0.00  ? 129 ARG A C      6  
ATOM 8746  O O      . ARG B 2 42  ? 1.468   -1.298  -5.059  1.00 0.00  ? 129 ARG A O      6  
ATOM 8747  C CB     . ARG B 2 42  ? 3.950   -3.562  -5.040  1.00 0.00  ? 129 ARG A CB     6  
ATOM 8748  C CG     . ARG B 2 42  ? 4.201   -5.075  -4.967  1.00 0.00  ? 129 ARG A CG     6  
ATOM 8749  C CD     . ARG B 2 42  ? 5.436   -5.443  -5.792  1.00 0.00  ? 129 ARG A CD     6  
ATOM 8750  N NE     . ARG B 2 42  ? 5.520   -6.901  -6.024  1.00 0.00  ? 129 ARG A NE     6  
ATOM 8751  C CZ     . ARG B 2 42  ? 6.004   -7.829  -5.211  1.00 0.00  ? 129 ARG A CZ     6  
ATOM 8752  N NH1    . ARG B 2 42  ? 6.509   -7.540  -4.044  1.00 0.00  ? 129 ARG A NH1    6  
ATOM 8753  N NH2    . ARG B 2 42  ? 5.997   -9.081  -5.569  1.00 0.00  ? 129 ARG A NH2    6  
ATOM 8754  H H      . ARG B 2 42  ? 1.024   -3.814  -4.902  1.00 0.00  ? 129 ARG A H      6  
ATOM 8755  H HA     . ARG B 2 42  ? 3.278   -3.029  -3.095  1.00 0.00  ? 129 ARG A HA     6  
ATOM 8756  H HB2    . ARG B 2 42  ? 3.700   -3.299  -6.069  1.00 0.00  ? 129 ARG A HB2    6  
ATOM 8757  H HB3    . ARG B 2 42  ? 4.880   -3.060  -4.776  1.00 0.00  ? 129 ARG A HB3    6  
ATOM 8758  H HG2    . ARG B 2 42  ? 4.354   -5.381  -3.930  1.00 0.00  ? 129 ARG A HG2    6  
ATOM 8759  H HG3    . ARG B 2 42  ? 3.336   -5.603  -5.372  1.00 0.00  ? 129 ARG A HG3    6  
ATOM 8760  H HD2    . ARG B 2 42  ? 5.361   -4.931  -6.752  1.00 0.00  ? 129 ARG A HD2    6  
ATOM 8761  H HD3    . ARG B 2 42  ? 6.336   -5.082  -5.292  1.00 0.00  ? 129 ARG A HD3    6  
ATOM 8762  H HE     . ARG B 2 42  ? 5.157   -7.242  -6.900  1.00 0.00  ? 129 ARG A HE     6  
ATOM 8763  H HH11   . ARG B 2 42  ? 6.538   -6.581  -3.747  1.00 0.00  ? 129 ARG A HH11   6  
ATOM 8764  H HH12   . ARG B 2 42  ? 6.888   -8.264  -3.455  1.00 0.00  ? 129 ARG A HH12   6  
ATOM 8765  H HH21   . ARG B 2 42  ? 5.619   -9.354  -6.461  1.00 0.00  ? 129 ARG A HH21   6  
ATOM 8766  H HH22   . ARG B 2 42  ? 6.369   -9.791  -4.960  1.00 0.00  ? 129 ARG A HH22   6  
ATOM 8767  N N      . ASP B 2 43  ? 3.370   -0.702  -4.019  1.00 0.00  ? 130 ASP A N      6  
ATOM 8768  C CA     . ASP B 2 43  ? 3.388   0.719   -4.368  1.00 0.00  ? 130 ASP A CA     6  
ATOM 8769  C C      . ASP B 2 43  ? 3.487   0.939   -5.908  1.00 0.00  ? 130 ASP A C      6  
ATOM 8770  O O      . ASP B 2 43  ? 2.589   1.579   -6.477  1.00 0.00  ? 130 ASP A O      6  
ATOM 8771  C CB     . ASP B 2 43  ? 4.511   1.335   -3.519  1.00 0.00  ? 130 ASP A CB     6  
ATOM 8772  C CG     . ASP B 2 43  ? 4.816   2.801   -3.834  1.00 0.00  ? 130 ASP A CG     6  
ATOM 8773  O OD1    . ASP B 2 43  ? 5.495   3.074   -4.849  1.00 0.00  ? 130 ASP A OD1    6  
ATOM 8774  O OD2    . ASP B 2 43  ? 4.412   3.668   -3.024  1.00 0.00  ? 130 ASP A OD2    6  
ATOM 8775  H H      . ASP B 2 43  ? 4.162   -1.076  -3.517  1.00 0.00  ? 130 ASP A H      6  
ATOM 8776  H HA     . ASP B 2 43  ? 2.444   1.164   -4.042  1.00 0.00  ? 130 ASP A HA     6  
ATOM 8777  H HB2    . ASP B 2 43  ? 4.216   1.226   -2.478  1.00 0.00  ? 130 ASP A HB2    6  
ATOM 8778  H HB3    . ASP B 2 43  ? 5.427   0.751   -3.594  1.00 0.00  ? 130 ASP A HB3    6  
ATOM 8779  N N      . PRO B 2 44  ? 4.467   0.318   -6.616  1.00 0.00  ? 131 PRO A N      6  
ATOM 8780  C CA     . PRO B 2 44  ? 4.473   0.157   -8.073  1.00 0.00  ? 131 PRO A CA     6  
ATOM 8781  C C      . PRO B 2 44  ? 3.137   -0.303  -8.668  1.00 0.00  ? 131 PRO A C      6  
ATOM 8782  O O      . PRO B 2 44  ? 2.669   0.255   -9.663  1.00 0.00  ? 131 PRO A O      6  
ATOM 8783  C CB     . PRO B 2 44  ? 5.576   -0.863  -8.376  1.00 0.00  ? 131 PRO A CB     6  
ATOM 8784  C CG     . PRO B 2 44  ? 6.575   -0.648  -7.245  1.00 0.00  ? 131 PRO A CG     6  
ATOM 8785  C CD     . PRO B 2 44  ? 5.684   -0.273  -6.064  1.00 0.00  ? 131 PRO A CD     6  
ATOM 8786  H HA     . PRO B 2 44  ? 4.756   1.101   -8.528  1.00 0.00  ? 131 PRO A HA     6  
ATOM 8787  H HB2    . PRO B 2 44  ? 5.186   -1.880  -8.320  1.00 0.00  ? 131 PRO A HB2    6  
ATOM 8788  H HB3    . PRO B 2 44  ? 6.031   -0.690  -9.353  1.00 0.00  ? 131 PRO A HB3    6  
ATOM 8789  H HG2    . PRO B 2 44  ? 7.159   -1.547  -7.042  1.00 0.00  ? 131 PRO A HG2    6  
ATOM 8790  H HG3    . PRO B 2 44  ? 7.226   0.192   -7.487  1.00 0.00  ? 131 PRO A HG3    6  
ATOM 8791  H HD2    . PRO B 2 44  ? 5.436   -1.144  -5.465  1.00 0.00  ? 131 PRO A HD2    6  
ATOM 8792  H HD3    . PRO B 2 44  ? 6.219   0.433   -5.440  1.00 0.00  ? 131 PRO A HD3    6  
ATOM 8793  N N      . ASP B 2 45  ? 2.512   -1.309  -8.045  1.00 0.00  ? 132 ASP A N      6  
ATOM 8794  C CA     . ASP B 2 45  ? 1.229   -1.854  -8.487  1.00 0.00  ? 132 ASP A CA     6  
ATOM 8795  C C      . ASP B 2 45  ? 0.144   -0.774  -8.473  1.00 0.00  ? 132 ASP A C      6  
ATOM 8796  O O      . ASP B 2 45  ? -0.461  -0.527  -9.516  1.00 0.00  ? 132 ASP A O      6  
ATOM 8797  C CB     . ASP B 2 45  ? 0.838   -3.100  -7.674  1.00 0.00  ? 132 ASP A CB     6  
ATOM 8798  C CG     . ASP B 2 45  ? 0.042   -4.121  -8.509  1.00 0.00  ? 132 ASP A CG     6  
ATOM 8799  O OD1    . ASP B 2 45  ? -0.918  -3.736  -9.211  1.00 0.00  ? 132 ASP A OD1    6  
ATOM 8800  O OD2    . ASP B 2 45  ? 0.401   -5.322  -8.470  1.00 0.00  ? 132 ASP A OD2    6  
ATOM 8801  H H      . ASP B 2 45  ? 2.942   -1.679  -7.212  1.00 0.00  ? 132 ASP A H      6  
ATOM 8802  H HA     . ASP B 2 45  ? 1.349   -2.165  -9.523  1.00 0.00  ? 132 ASP A HA     6  
ATOM 8803  H HB2    . ASP B 2 45  ? 1.748   -3.588  -7.316  1.00 0.00  ? 132 ASP A HB2    6  
ATOM 8804  H HB3    . ASP B 2 45  ? 0.249   -2.813  -6.805  1.00 0.00  ? 132 ASP A HB3    6  
ATOM 8805  N N      . LEU B 2 46  ? -0.070  -0.048  -7.361  1.00 0.00  ? 133 LEU A N      6  
ATOM 8806  C CA     . LEU B 2 46  ? -1.076  0.999   -7.337  1.00 0.00  ? 133 LEU A CA     6  
ATOM 8807  C C      . LEU B 2 46  ? -0.785  2.141   -8.304  1.00 0.00  ? 133 LEU A C      6  
ATOM 8808  O O      . LEU B 2 46  ? -1.734  2.584   -8.956  1.00 0.00  ? 133 LEU A O      6  
ATOM 8809  C CB     . LEU B 2 46  ? -1.322  1.511   -5.911  1.00 0.00  ? 133 LEU A CB     6  
ATOM 8810  C CG     . LEU B 2 46  ? -2.107  0.511   -5.047  1.00 0.00  ? 133 LEU A CG     6  
ATOM 8811  C CD1    . LEU B 2 46  ? -2.167  0.966   -3.594  1.00 0.00  ? 133 LEU A CD1    6  
ATOM 8812  C CD2    . LEU B 2 46  ? -3.534  0.334   -5.560  1.00 0.00  ? 133 LEU A CD2    6  
ATOM 8813  H H      . LEU B 2 46  ? 0.452   -0.176  -6.505  1.00 0.00  ? 133 LEU A H      6  
ATOM 8814  H HA     . LEU B 2 46  ? -1.995  0.558   -7.711  1.00 0.00  ? 133 LEU A HA     6  
ATOM 8815  H HB2    . LEU B 2 46  ? -0.394  1.804   -5.429  1.00 0.00  ? 133 LEU A HB2    6  
ATOM 8816  H HB3    . LEU B 2 46  ? -1.903  2.413   -5.996  1.00 0.00  ? 133 LEU A HB3    6  
ATOM 8817  H HG     . LEU B 2 46  ? -1.620  -0.452  -5.102  1.00 0.00  ? 133 LEU A HG     6  
ATOM 8818  H HD11   . LEU B 2 46  ? -1.155  1.072   -3.207  1.00 0.00  ? 133 LEU A HD11   6  
ATOM 8819  H HD12   . LEU B 2 46  ? -2.684  1.923   -3.522  1.00 0.00  ? 133 LEU A HD12   6  
ATOM 8820  H HD13   . LEU B 2 46  ? -2.695  0.215   -3.009  1.00 0.00  ? 133 LEU A HD13   6  
ATOM 8821  H HD21   . LEU B 2 46  ? -4.004  1.300   -5.716  1.00 0.00  ? 133 LEU A HD21   6  
ATOM 8822  H HD22   . LEU B 2 46  ? -3.509  -0.191  -6.507  1.00 0.00  ? 133 LEU A HD22   6  
ATOM 8823  H HD23   . LEU B 2 46  ? -4.118  -0.265  -4.863  1.00 0.00  ? 133 LEU A HD23   6  
ATOM 8824  N N      . ARG B 2 47  ? 0.470   2.592   -8.480  1.00 0.00  ? 134 ARG A N      6  
ATOM 8825  C CA     . ARG B 2 47  ? 0.714   3.655   -9.481  1.00 0.00  ? 134 ARG A CA     6  
ATOM 8826  C C      . ARG B 2 47  ? 0.423   3.189   -10.907 1.00 0.00  ? 134 ARG A C      6  
ATOM 8827  O O      . ARG B 2 47  ? -0.069  3.978   -11.704 1.00 0.00  ? 134 ARG A O      6  
ATOM 8828  C CB     . ARG B 2 47  ? 2.090   4.330   -9.362  1.00 0.00  ? 134 ARG A CB     6  
ATOM 8829  C CG     . ARG B 2 47  ? 3.296   3.409   -9.574  1.00 0.00  ? 134 ARG A CG     6  
ATOM 8830  C CD     . ARG B 2 47  ? 4.597   4.217   -9.488  1.00 0.00  ? 134 ARG A CD     6  
ATOM 8831  N NE     . ARG B 2 47  ? 5.798   3.356   -9.482  1.00 0.00  ? 134 ARG A NE     6  
ATOM 8832  C CZ     . ARG B 2 47  ? 6.379   2.758   -10.505 1.00 0.00  ? 134 ARG A CZ     6  
ATOM 8833  N NH1    . ARG B 2 47  ? 5.918   2.840   -11.722 1.00 0.00  ? 134 ARG A NH1    6  
ATOM 8834  N NH2    . ARG B 2 47  ? 7.454   2.049   -10.320 1.00 0.00  ? 134 ARG A NH2    6  
ATOM 8835  H H      . ARG B 2 47  ? 1.224   2.128   -7.982  1.00 0.00  ? 134 ARG A H      6  
ATOM 8836  H HA     . ARG B 2 47  ? -0.017  4.438   -9.286  1.00 0.00  ? 134 ARG A HA     6  
ATOM 8837  H HB2    . ARG B 2 47  ? 2.133   5.135   -10.097 1.00 0.00  ? 134 ARG A HB2    6  
ATOM 8838  H HB3    . ARG B 2 47  ? 2.166   4.789   -8.379  1.00 0.00  ? 134 ARG A HB3    6  
ATOM 8839  H HG2    . ARG B 2 47  ? 3.286   2.668   -8.782  1.00 0.00  ? 134 ARG A HG2    6  
ATOM 8840  H HG3    . ARG B 2 47  ? 3.227   2.910   -10.545 1.00 0.00  ? 134 ARG A HG3    6  
ATOM 8841  H HD2    . ARG B 2 47  ? 4.648   4.930   -10.314 1.00 0.00  ? 134 ARG A HD2    6  
ATOM 8842  H HD3    . ARG B 2 47  ? 4.584   4.790   -8.559  1.00 0.00  ? 134 ARG A HD3    6  
ATOM 8843  H HE     . ARG B 2 47  ? 6.260   3.237   -8.594  1.00 0.00  ? 134 ARG A HE     6  
ATOM 8844  H HH11   . ARG B 2 47  ? 5.102   3.401   -11.898 1.00 0.00  ? 134 ARG A HH11   6  
ATOM 8845  H HH12   . ARG B 2 47  ? 6.387   2.379   -12.486 1.00 0.00  ? 134 ARG A HH12   6  
ATOM 8846  H HH21   . ARG B 2 47  ? 7.866   1.978   -9.404  1.00 0.00  ? 134 ARG A HH21   6  
ATOM 8847  H HH22   . ARG B 2 47  ? 7.915   1.609   -11.099 1.00 0.00  ? 134 ARG A HH22   6  
ATOM 8848  N N      . GLN B 2 48  ? 0.650   1.916   -11.227 1.00 0.00  ? 135 GLN A N      6  
ATOM 8849  C CA     . GLN B 2 48  ? 0.309   1.326   -12.528 1.00 0.00  ? 135 GLN A CA     6  
ATOM 8850  C C      . GLN B 2 48  ? -1.212  1.083   -12.710 1.00 0.00  ? 135 GLN A C      6  
ATOM 8851  O O      . GLN B 2 48  ? -1.784  1.316   -13.783 1.00 0.00  ? 135 GLN A O      6  
ATOM 8852  C CB     . GLN B 2 48  ? 1.120   0.030   -12.644 1.00 0.00  ? 135 GLN A CB     6  
ATOM 8853  C CG     . GLN B 2 48  ? 1.146   -0.517  -14.072 1.00 0.00  ? 135 GLN A CG     6  
ATOM 8854  C CD     . GLN B 2 48  ? 1.966   -1.803  -14.168 1.00 0.00  ? 135 GLN A CD     6  
ATOM 8855  O OE1    . GLN B 2 48  ? 3.182   -1.786  -14.327 1.00 0.00  ? 135 GLN A OE1    6  
ATOM 8856  N NE2    . GLN B 2 48  ? 1.350   -2.965  -14.072 1.00 0.00  ? 135 GLN A NE2    6  
ATOM 8857  H H      . GLN B 2 48  ? 1.072   1.325   -10.518 1.00 0.00  ? 135 GLN A H      6  
ATOM 8858  H HA     . GLN B 2 48  ? 0.645   2.000   -13.312 1.00 0.00  ? 135 GLN A HA     6  
ATOM 8859  H HB2    . GLN B 2 48  ? 2.153   0.237   -12.357 1.00 0.00  ? 135 GLN A HB2    6  
ATOM 8860  H HB3    . GLN B 2 48  ? 0.716   -0.705  -11.954 1.00 0.00  ? 135 GLN A HB3    6  
ATOM 8861  H HG2    . GLN B 2 48  ? 0.128   -0.705  -14.421 1.00 0.00  ? 135 GLN A HG2    6  
ATOM 8862  H HG3    . GLN B 2 48  ? 1.605   0.238   -14.709 1.00 0.00  ? 135 GLN A HG3    6  
ATOM 8863  H HE21   . GLN B 2 48  ? 0.352   -3.022  -13.948 1.00 0.00  ? 135 GLN A HE21   6  
ATOM 8864  H HE22   . GLN B 2 48  ? 1.916   -3.797  -14.158 1.00 0.00  ? 135 GLN A HE22   6  
ATOM 8865  N N      . MET B 2 49  ? -1.893  0.651   -11.650 1.00 0.00  ? 136 MET A N      6  
ATOM 8866  C CA     . MET B 2 49  ? -3.285  0.210   -11.647 1.00 0.00  ? 136 MET A CA     6  
ATOM 8867  C C      . MET B 2 49  ? -4.244  1.393   -11.640 1.00 0.00  ? 136 MET A C      6  
ATOM 8868  O O      . MET B 2 49  ? -5.126  1.456   -12.492 1.00 0.00  ? 136 MET A O      6  
ATOM 8869  C CB     . MET B 2 49  ? -3.430  -0.685  -10.425 1.00 0.00  ? 136 MET A CB     6  
ATOM 8870  C CG     . MET B 2 49  ? -4.755  -1.441  -10.289 1.00 0.00  ? 136 MET A CG     6  
ATOM 8871  S SD     . MET B 2 49  ? -6.194  -0.443  -9.820  1.00 0.00  ? 136 MET A SD     6  
ATOM 8872  C CE     . MET B 2 49  ? -5.549  0.331   -8.311  1.00 0.00  ? 136 MET A CE     6  
ATOM 8873  H H      . MET B 2 49  ? -1.407  0.495   -10.770 1.00 0.00  ? 136 MET A H      6  
ATOM 8874  H HA     . MET B 2 49  ? -3.479  -0.383  -12.543 1.00 0.00  ? 136 MET A HA     6  
ATOM 8875  H HB2    . MET B 2 49  ? -2.625  -1.396  -10.529 1.00 0.00  ? 136 MET A HB2    6  
ATOM 8876  H HB3    . MET B 2 49  ? -3.212  -0.129  -9.519  1.00 0.00  ? 136 MET A HB3    6  
ATOM 8877  H HG2    . MET B 2 49  ? -4.972  -1.948  -11.231 1.00 0.00  ? 136 MET A HG2    6  
ATOM 8878  H HG3    . MET B 2 49  ? -4.625  -2.209  -9.529  1.00 0.00  ? 136 MET A HG3    6  
ATOM 8879  H HE1    . MET B 2 49  ? -5.269  -0.447  -7.605  1.00 0.00  ? 136 MET A HE1    6  
ATOM 8880  H HE2    . MET B 2 49  ? -4.664  0.936   -8.533  1.00 0.00  ? 136 MET A HE2    6  
ATOM 8881  H HE3    . MET B 2 49  ? -6.316  0.963   -7.865  1.00 0.00  ? 136 MET A HE3    6  
ATOM 8882  N N      . PHE B 2 50  ? -4.005  2.380   -10.774 1.00 0.00  ? 137 PHE A N      6  
ATOM 8883  C CA     . PHE B 2 50  ? -4.526  3.730   -11.001 1.00 0.00  ? 137 PHE A CA     6  
ATOM 8884  C C      . PHE B 2 50  ? -3.947  4.336   -12.290 1.00 0.00  ? 137 PHE A C      6  
ATOM 8885  O O      . PHE B 2 50  ? -4.625  5.108   -12.968 1.00 0.00  ? 137 PHE A O      6  
ATOM 8886  C CB     . PHE B 2 50  ? -4.253  4.638   -9.798  1.00 0.00  ? 137 PHE A CB     6  
ATOM 8887  C CG     . PHE B 2 50  ? -5.217  4.433   -8.648  1.00 0.00  ? 137 PHE A CG     6  
ATOM 8888  C CD1    . PHE B 2 50  ? -6.488  5.033   -8.698  1.00 0.00  ? 137 PHE A CD1    6  
ATOM 8889  C CD2    . PHE B 2 50  ? -4.871  3.640   -7.540  1.00 0.00  ? 137 PHE A CD2    6  
ATOM 8890  C CE1    . PHE B 2 50  ? -7.396  4.880   -7.640  1.00 0.00  ? 137 PHE A CE1    6  
ATOM 8891  C CE2    . PHE B 2 50  ? -5.786  3.478   -6.484  1.00 0.00  ? 137 PHE A CE2    6  
ATOM 8892  C CZ     . PHE B 2 50  ? -7.035  4.117   -6.518  1.00 0.00  ? 137 PHE A CZ     6  
ATOM 8893  H H      . PHE B 2 50  ? -3.255  2.236   -10.103 1.00 0.00  ? 137 PHE A H      6  
ATOM 8894  H HA     . PHE B 2 50  ? -5.605  3.657   -11.121 1.00 0.00  ? 137 PHE A HA     6  
ATOM 8895  H HB2    . PHE B 2 50  ? -3.224  4.526   -9.456  1.00 0.00  ? 137 PHE A HB2    6  
ATOM 8896  H HB3    . PHE B 2 50  ? -4.361  5.670   -10.121 1.00 0.00  ? 137 PHE A HB3    6  
ATOM 8897  H HD1    . PHE B 2 50  ? -6.788  5.604   -9.563  1.00 0.00  ? 137 PHE A HD1    6  
ATOM 8898  H HD2    . PHE B 2 50  ? -3.904  3.164   -7.494  1.00 0.00  ? 137 PHE A HD2    6  
ATOM 8899  H HE1    . PHE B 2 50  ? -8.373  5.336   -7.711  1.00 0.00  ? 137 PHE A HE1    6  
ATOM 8900  H HE2    . PHE B 2 50  ? -5.531  2.882   -5.628  1.00 0.00  ? 137 PHE A HE2    6  
ATOM 8901  H HZ     . PHE B 2 50  ? -7.709  4.020   -5.683  1.00 0.00  ? 137 PHE A HZ     6  
ATOM 8902  N N      . GLY B 2 51  ? -2.719  3.959   -12.671 1.00 0.00  ? 138 GLY A N      6  
ATOM 8903  C CA     . GLY B 2 51  ? -2.043  4.365   -13.916 1.00 0.00  ? 138 GLY A CA     6  
ATOM 8904  C C      . GLY B 2 51  ? -2.813  4.097   -15.210 1.00 0.00  ? 138 GLY A C      6  
ATOM 8905  O O      . GLY B 2 51  ? -2.625  4.843   -16.173 1.00 0.00  ? 138 GLY A O      6  
ATOM 8906  H H      . GLY B 2 51  ? -2.159  3.420   -12.009 1.00 0.00  ? 138 GLY A H      6  
ATOM 8907  H HA2    . GLY B 2 51  ? -1.819  5.430   -13.869 1.00 0.00  ? 138 GLY A HA2    6  
ATOM 8908  H HA3    . GLY B 2 51  ? -1.087  3.846   -13.992 1.00 0.00  ? 138 GLY A HA3    6  
ATOM 8909  N N      . GLN B 2 52  ? -3.733  3.124   -15.226 1.00 0.00  ? 139 GLN A N      6  
ATOM 8910  C CA     . GLN B 2 52  ? -4.734  3.017   -16.309 1.00 0.00  ? 139 GLN A CA     6  
ATOM 8911  C C      . GLN B 2 52  ? -5.486  4.332   -16.601 1.00 0.00  ? 139 GLN A C      6  
ATOM 8912  O O      . GLN B 2 52  ? -5.732  4.662   -17.765 1.00 0.00  ? 139 GLN A O      6  
ATOM 8913  C CB     . GLN B 2 52  ? -5.735  1.872   -16.075 1.00 0.00  ? 139 GLN A CB     6  
ATOM 8914  C CG     . GLN B 2 52  ? -6.896  2.159   -15.104 1.00 0.00  ? 139 GLN A CG     6  
ATOM 8915  C CD     . GLN B 2 52  ? -7.683  0.889   -14.787 1.00 0.00  ? 139 GLN A CD     6  
ATOM 8916  O OE1    . GLN B 2 52  ? -8.643  0.528   -15.459 1.00 0.00  ? 139 GLN A OE1    6  
ATOM 8917  N NE2    . GLN B 2 52  ? -7.302  0.160   -13.763 1.00 0.00  ? 139 GLN A NE2    6  
ATOM 8918  H H      . GLN B 2 52  ? -3.615  2.412   -14.506 1.00 0.00  ? 139 GLN A H      6  
ATOM 8919  H HA     . GLN B 2 52  ? -4.183  2.771   -17.217 1.00 0.00  ? 139 GLN A HA     6  
ATOM 8920  H HB2    . GLN B 2 52  ? -6.188  1.659   -17.044 1.00 0.00  ? 139 GLN A HB2    6  
ATOM 8921  H HB3    . GLN B 2 52  ? -5.192  0.986   -15.743 1.00 0.00  ? 139 GLN A HB3    6  
ATOM 8922  H HG2    . GLN B 2 52  ? -6.517  2.600   -14.185 1.00 0.00  ? 139 GLN A HG2    6  
ATOM 8923  H HG3    . GLN B 2 52  ? -7.582  2.875   -15.558 1.00 0.00  ? 139 GLN A HG3    6  
ATOM 8924  H HE21   . GLN B 2 52  ? -6.530  0.492   -13.188 1.00 0.00  ? 139 GLN A HE21   6  
ATOM 8925  H HE22   . GLN B 2 52  ? -7.821  -0.674  -13.537 1.00 0.00  ? 139 GLN A HE22   6  
ATOM 8926  N N      . PHE B 2 53  ? -5.842  5.087   -15.551 1.00 0.00  ? 140 PHE A N      6  
ATOM 8927  C CA     . PHE B 2 53  ? -6.427  6.426   -15.651 1.00 0.00  ? 140 PHE A CA     6  
ATOM 8928  C C      . PHE B 2 53  ? -5.352  7.531   -15.654 1.00 0.00  ? 140 PHE A C      6  
ATOM 8929  O O      . PHE B 2 53  ? -5.491  8.534   -16.355 1.00 0.00  ? 140 PHE A O      6  
ATOM 8930  C CB     . PHE B 2 53  ? -7.436  6.636   -14.503 1.00 0.00  ? 140 PHE A CB     6  
ATOM 8931  C CG     . PHE B 2 53  ? -8.778  5.959   -14.718 1.00 0.00  ? 140 PHE A CG     6  
ATOM 8932  C CD1    . PHE B 2 53  ? -9.586  6.368   -15.796 1.00 0.00  ? 140 PHE A CD1    6  
ATOM 8933  C CD2    . PHE B 2 53  ? -9.261  4.973   -13.832 1.00 0.00  ? 140 PHE A CD2    6  
ATOM 8934  C CE1    . PHE B 2 53  ? -10.851 5.795   -16.006 1.00 0.00  ? 140 PHE A CE1    6  
ATOM 8935  C CE2    . PHE B 2 53  ? -10.526 4.401   -14.041 1.00 0.00  ? 140 PHE A CE2    6  
ATOM 8936  C CZ     . PHE B 2 53  ? -11.321 4.809   -15.125 1.00 0.00  ? 140 PHE A CZ     6  
ATOM 8937  H H      . PHE B 2 53  ? -5.599  4.747   -14.626 1.00 0.00  ? 140 PHE A H      6  
ATOM 8938  H HA     . PHE B 2 53  ? -6.960  6.474   -16.601 1.00 0.00  ? 140 PHE A HA     6  
ATOM 8939  H HB2    . PHE B 2 53  ? -6.997  6.304   -13.562 1.00 0.00  ? 140 PHE A HB2    6  
ATOM 8940  H HB3    . PHE B 2 53  ? -7.631  7.705   -14.404 1.00 0.00  ? 140 PHE A HB3    6  
ATOM 8941  H HD1    . PHE B 2 53  ? -9.243  7.140   -16.470 1.00 0.00  ? 140 PHE A HD1    6  
ATOM 8942  H HD2    . PHE B 2 53  ? -8.715  4.670   -12.948 1.00 0.00  ? 140 PHE A HD2    6  
ATOM 8943  H HE1    . PHE B 2 53  ? -11.464 6.114   -16.837 1.00 0.00  ? 140 PHE A HE1    6  
ATOM 8944  H HE2    . PHE B 2 53  ? -10.887 3.663   -13.338 1.00 0.00  ? 140 PHE A HE2    6  
ATOM 8945  H HZ     . PHE B 2 53  ? -12.299 4.377   -15.284 1.00 0.00  ? 140 PHE A HZ     6  
ATOM 8946  N N      . GLY B 2 54  ? -4.261  7.340   -14.904 1.00 0.00  ? 141 GLY A N      6  
ATOM 8947  C CA     . GLY B 2 54  ? -2.996  8.085   -15.023 1.00 0.00  ? 141 GLY A CA     6  
ATOM 8948  C C      . GLY B 2 54  ? -2.972  9.509   -14.470 1.00 0.00  ? 141 GLY A C      6  
ATOM 8949  O O      . GLY B 2 54  ? -2.120  10.316  -14.838 1.00 0.00  ? 141 GLY A O      6  
ATOM 8950  H H      . GLY B 2 54  ? -4.257  6.498   -14.333 1.00 0.00  ? 141 GLY A H      6  
ATOM 8951  H HA2    . GLY B 2 54  ? -2.267  7.565   -14.414 1.00 0.00  ? 141 GLY A HA2    6  
ATOM 8952  H HA3    . GLY B 2 54  ? -2.660  8.093   -16.062 1.00 0.00  ? 141 GLY A HA3    6  
ATOM 8953  N N      . LYS B 2 55  ? -3.879  9.789   -13.537 1.00 0.00  ? 142 LYS A N      6  
ATOM 8954  C CA     . LYS B 2 55  ? -4.017  11.052  -12.794 1.00 0.00  ? 142 LYS A CA     6  
ATOM 8955  C C      . LYS B 2 55  ? -3.009  11.239  -11.640 1.00 0.00  ? 142 LYS A C      6  
ATOM 8956  O O      . LYS B 2 55  ? -2.937  12.314  -11.047 1.00 0.00  ? 142 LYS A O      6  
ATOM 8957  C CB     . LYS B 2 55  ? -5.437  11.069  -12.223 1.00 0.00  ? 142 LYS A CB     6  
ATOM 8958  C CG     . LYS B 2 55  ? -6.521  10.835  -13.289 1.00 0.00  ? 142 LYS A CG     6  
ATOM 8959  C CD     . LYS B 2 55  ? -7.912  11.312  -12.843 1.00 0.00  ? 142 LYS A CD     6  
ATOM 8960  C CE     . LYS B 2 55  ? -8.103  12.827  -12.995 1.00 0.00  ? 142 LYS A CE     6  
ATOM 8961  N NZ     . LYS B 2 55  ? -8.166  13.244  -14.421 1.00 0.00  ? 142 LYS A NZ     6  
ATOM 8962  H H      . LYS B 2 55  ? -4.538  9.045   -13.348 1.00 0.00  ? 142 LYS A H      6  
ATOM 8963  H HA     . LYS B 2 55  ? -3.892  11.894  -13.478 1.00 0.00  ? 142 LYS A HA     6  
ATOM 8964  H HB2    . LYS B 2 55  ? -5.490  10.261  -11.500 1.00 0.00  ? 142 LYS A HB2    6  
ATOM 8965  H HB3    . LYS B 2 55  ? -5.600  12.022  -11.724 1.00 0.00  ? 142 LYS A HB3    6  
ATOM 8966  H HG2    . LYS B 2 55  ? -6.230  11.330  -14.214 1.00 0.00  ? 142 LYS A HG2    6  
ATOM 8967  H HG3    . LYS B 2 55  ? -6.584  9.767   -13.490 1.00 0.00  ? 142 LYS A HG3    6  
ATOM 8968  H HD2    . LYS B 2 55  ? -8.672  10.805  -13.438 1.00 0.00  ? 142 LYS A HD2    6  
ATOM 8969  H HD3    . LYS B 2 55  ? -8.060  11.030  -11.801 1.00 0.00  ? 142 LYS A HD3    6  
ATOM 8970  H HE2    . LYS B 2 55  ? -9.039  13.103  -12.502 1.00 0.00  ? 142 LYS A HE2    6  
ATOM 8971  H HE3    . LYS B 2 55  ? -7.284  13.343  -12.484 1.00 0.00  ? 142 LYS A HE3    6  
ATOM 8972  H HZ1    . LYS B 2 55  ? -7.316  13.013  -14.919 1.00 0.00  ? 142 LYS A HZ1    6  
ATOM 8973  H HZ2    . LYS B 2 55  ? -8.935  12.770  -14.902 1.00 0.00  ? 142 LYS A HZ2    6  
ATOM 8974  H HZ3    . LYS B 2 55  ? -8.320  14.237  -14.511 1.00 0.00  ? 142 LYS A HZ3    6  
ATOM 8975  N N      . ILE B 2 56  ? -2.289  10.176  -11.282 1.00 0.00  ? 143 ILE A N      6  
ATOM 8976  C CA     . ILE B 2 56  ? -1.477  10.026  -10.061 1.00 0.00  ? 143 ILE A CA     6  
ATOM 8977  C C      . ILE B 2 56  ? -0.307  11.022  -9.981  1.00 0.00  ? 143 ILE A C      6  
ATOM 8978  O O      . ILE B 2 56  ? 0.520   11.096  -10.894 1.00 0.00  ? 143 ILE A O      6  
ATOM 8979  C CB     . ILE B 2 56  ? -0.939  8.578   -9.865  1.00 0.00  ? 143 ILE A CB     6  
ATOM 8980  C CG1    . ILE B 2 56  ? -1.950  7.461   -10.159 1.00 0.00  ? 143 ILE A CG1    6  
ATOM 8981  C CG2    . ILE B 2 56  ? -0.537  8.438   -8.393  1.00 0.00  ? 143 ILE A CG2    6  
ATOM 8982  C CD1    . ILE B 2 56  ? -1.983  7.089   -11.642 1.00 0.00  ? 143 ILE A CD1    6  
ATOM 8983  H H      . ILE B 2 56  ? -2.435  9.372   -11.868 1.00 0.00  ? 143 ILE A H      6  
ATOM 8984  H HA     . ILE B 2 56  ? -2.151  10.241  -9.231  1.00 0.00  ? 143 ILE A HA     6  
ATOM 8985  H HB     . ILE B 2 56  ? -0.068  8.383   -10.494 1.00 0.00  ? 143 ILE A HB     6  
ATOM 8986  H HG12   . ILE B 2 56  ? -1.697  6.554   -9.608  1.00 0.00  ? 143 ILE A HG12   6  
ATOM 8987  H HG13   . ILE B 2 56  ? -2.923  7.776   -9.809  1.00 0.00  ? 143 ILE A HG13   6  
ATOM 8988  H HG21   . ILE B 2 56  ? 0.340   9.040   -8.176  1.00 0.00  ? 143 ILE A HG21   6  
ATOM 8989  H HG22   . ILE B 2 56  ? -1.369  8.739   -7.750  1.00 0.00  ? 143 ILE A HG22   6  
ATOM 8990  H HG23   . ILE B 2 56  ? -0.293  7.400   -8.184  1.00 0.00  ? 143 ILE A HG23   6  
ATOM 8991  H HD11   . ILE B 2 56  ? -1.640  7.906   -12.266 1.00 0.00  ? 143 ILE A HD11   6  
ATOM 8992  H HD12   . ILE B 2 56  ? -1.314  6.250   -11.805 1.00 0.00  ? 143 ILE A HD12   6  
ATOM 8993  H HD13   . ILE B 2 56  ? -2.995  6.825   -11.932 1.00 0.00  ? 143 ILE A HD13   6  
ATOM 8994  N N      . LEU B 2 57  ? -0.203  11.727  -8.849  1.00 0.00  ? 144 LEU A N      6  
ATOM 8995  C CA     . LEU B 2 57  ? 0.962   12.536  -8.455  1.00 0.00  ? 144 LEU A CA     6  
ATOM 8996  C C      . LEU B 2 57  ? 1.965   11.706  -7.630  1.00 0.00  ? 144 LEU A C      6  
ATOM 8997  O O      . LEU B 2 57  ? 3.166   11.748  -7.896  1.00 0.00  ? 144 LEU A O      6  
ATOM 8998  C CB     . LEU B 2 57  ? 0.485   13.774  -7.661  1.00 0.00  ? 144 LEU A CB     6  
ATOM 8999  C CG     . LEU B 2 57  ? 0.086   15.014  -8.486  1.00 0.00  ? 144 LEU A CG     6  
ATOM 9000  C CD1    . LEU B 2 57  ? 1.305   15.703  -9.107  1.00 0.00  ? 144 LEU A CD1    6  
ATOM 9001  C CD2    . LEU B 2 57  ? -0.923  14.712  -9.596  1.00 0.00  ? 144 LEU A CD2    6  
ATOM 9002  H H      . LEU B 2 57  ? -0.964  11.635  -8.186  1.00 0.00  ? 144 LEU A H      6  
ATOM 9003  H HA     . LEU B 2 57  ? 1.493   12.871  -9.346  1.00 0.00  ? 144 LEU A HA     6  
ATOM 9004  H HB2    . LEU B 2 57  ? -0.366  13.493  -7.041  1.00 0.00  ? 144 LEU A HB2    6  
ATOM 9005  H HB3    . LEU B 2 57  ? 1.276   14.077  -6.975  1.00 0.00  ? 144 LEU A HB3    6  
ATOM 9006  H HG     . LEU B 2 57  ? -0.378  15.727  -7.803  1.00 0.00  ? 144 LEU A HG     6  
ATOM 9007  H HD11   . LEU B 2 57  ? 2.016   15.964  -8.324  1.00 0.00  ? 144 LEU A HD11   6  
ATOM 9008  H HD12   . LEU B 2 57  ? 1.789   15.049  -9.832  1.00 0.00  ? 144 LEU A HD12   6  
ATOM 9009  H HD13   . LEU B 2 57  ? 0.991   16.619  -9.609  1.00 0.00  ? 144 LEU A HD13   6  
ATOM 9010  H HD21   . LEU B 2 57  ? -0.455  14.129  -10.389 1.00 0.00  ? 144 LEU A HD21   6  
ATOM 9011  H HD22   . LEU B 2 57  ? -1.759  14.148  -9.188  1.00 0.00  ? 144 LEU A HD22   6  
ATOM 9012  H HD23   . LEU B 2 57  ? -1.301  15.644  -10.022 1.00 0.00  ? 144 LEU A HD23   6  
ATOM 9013  N N      . ASP B 2 58  ? 1.479   10.940  -6.644  1.00 0.00  ? 145 ASP A N      6  
ATOM 9014  C CA     . ASP B 2 58  ? 2.268   10.096  -5.735  1.00 0.00  ? 145 ASP A CA     6  
ATOM 9015  C C      . ASP B 2 58  ? 1.476   8.872   -5.225  1.00 0.00  ? 145 ASP A C      6  
ATOM 9016  O O      . ASP B 2 58  ? 0.244   8.882   -5.245  1.00 0.00  ? 145 ASP A O      6  
ATOM 9017  C CB     . ASP B 2 58  ? 2.726   10.945  -4.531  1.00 0.00  ? 145 ASP A CB     6  
ATOM 9018  C CG     . ASP B 2 58  ? 4.057   11.667  -4.786  1.00 0.00  ? 145 ASP A CG     6  
ATOM 9019  O OD1    . ASP B 2 58  ? 5.092   10.975  -4.946  1.00 0.00  ? 145 ASP A OD1    6  
ATOM 9020  O OD2    . ASP B 2 58  ? 4.087   12.923  -4.772  1.00 0.00  ? 145 ASP A OD2    6  
ATOM 9021  H H      . ASP B 2 58  ? 0.477   10.910  -6.526  1.00 0.00  ? 145 ASP A H      6  
ATOM 9022  H HA     . ASP B 2 58  ? 3.140   9.721   -6.268  1.00 0.00  ? 145 ASP A HA     6  
ATOM 9023  H HB2    . ASP B 2 58  ? 1.946   11.667  -4.272  1.00 0.00  ? 145 ASP A HB2    6  
ATOM 9024  H HB3    . ASP B 2 58  ? 2.857   10.301  -3.659  1.00 0.00  ? 145 ASP A HB3    6  
ATOM 9025  N N      . VAL B 2 59  ? 2.173   7.851   -4.709  1.00 0.00  ? 146 VAL A N      6  
ATOM 9026  C CA     . VAL B 2 59  ? 1.614   6.634   -4.073  1.00 0.00  ? 146 VAL A CA     6  
ATOM 9027  C C      . VAL B 2 59  ? 2.320   6.253   -2.768  1.00 0.00  ? 146 VAL A C      6  
ATOM 9028  O O      . VAL B 2 59  ? 3.366   6.800   -2.408  1.00 0.00  ? 146 VAL A O      6  
ATOM 9029  C CB     . VAL B 2 59  ? 1.635   5.400   -5.001  1.00 0.00  ? 146 VAL A CB     6  
ATOM 9030  C CG1    . VAL B 2 59  ? 0.506   5.448   -5.996  1.00 0.00  ? 146 VAL A CG1    6  
ATOM 9031  C CG2    . VAL B 2 59  ? 2.965   5.231   -5.741  1.00 0.00  ? 146 VAL A CG2    6  
ATOM 9032  H H      . VAL B 2 59  ? 3.179   7.942   -4.687  1.00 0.00  ? 146 VAL A H      6  
ATOM 9033  H HA     . VAL B 2 59  ? 0.581   6.826   -3.806  1.00 0.00  ? 146 VAL A HA     6  
ATOM 9034  H HB     . VAL B 2 59  ? 1.389   4.506   -4.425  1.00 0.00  ? 146 VAL A HB     6  
ATOM 9035  H HG11   . VAL B 2 59  ? -0.405  5.417   -5.411  1.00 0.00  ? 146 VAL A HG11   6  
ATOM 9036  H HG12   . VAL B 2 59  ? 0.577   6.357   -6.574  1.00 0.00  ? 146 VAL A HG12   6  
ATOM 9037  H HG13   . VAL B 2 59  ? 0.532   4.573   -6.638  1.00 0.00  ? 146 VAL A HG13   6  
ATOM 9038  H HG21   . VAL B 2 59  ? 3.077   6.007   -6.497  1.00 0.00  ? 146 VAL A HG21   6  
ATOM 9039  H HG22   . VAL B 2 59  ? 3.791   5.312   -5.038  1.00 0.00  ? 146 VAL A HG22   6  
ATOM 9040  H HG23   . VAL B 2 59  ? 2.996   4.252   -6.218  1.00 0.00  ? 146 VAL A HG23   6  
ATOM 9041  N N      . GLU B 2 60  ? 1.698   5.310   -2.060  1.00 0.00  ? 147 GLU A N      6  
ATOM 9042  C CA     . GLU B 2 60  ? 2.071   4.772   -0.758  1.00 0.00  ? 147 GLU A CA     6  
ATOM 9043  C C      . GLU B 2 60  ? 1.393   3.396   -0.538  1.00 0.00  ? 147 GLU A C      6  
ATOM 9044  O O      . GLU B 2 60  ? 0.267   3.169   -0.986  1.00 0.00  ? 147 GLU A O      6  
ATOM 9045  C CB     . GLU B 2 60  ? 1.540   5.785   0.265   1.00 0.00  ? 147 GLU A CB     6  
ATOM 9046  C CG     . GLU B 2 60  ? 2.026   5.574   1.703   1.00 0.00  ? 147 GLU A CG     6  
ATOM 9047  C CD     . GLU B 2 60  ? 3.459   6.119   1.873   1.00 0.00  ? 147 GLU A CD     6  
ATOM 9048  O OE1    . GLU B 2 60  ? 4.421   5.470   1.394   1.00 0.00  ? 147 GLU A OE1    6  
ATOM 9049  O OE2    . GLU B 2 60  ? 3.623   7.220   2.451   1.00 0.00  ? 147 GLU A OE2    6  
ATOM 9050  H H      . GLU B 2 60  ? 0.776   5.028   -2.378  1.00 0.00  ? 147 GLU A H      6  
ATOM 9051  H HA     . GLU B 2 60  ? 3.155   4.676   -0.687  1.00 0.00  ? 147 GLU A HA     6  
ATOM 9052  H HB2    . GLU B 2 60  ? 1.820   6.798   -0.029  1.00 0.00  ? 147 GLU A HB2    6  
ATOM 9053  H HB3    . GLU B 2 60  ? 0.454   5.733   0.203   1.00 0.00  ? 147 GLU A HB3    6  
ATOM 9054  H HG2    . GLU B 2 60  ? 1.348   6.109   2.371   1.00 0.00  ? 147 GLU A HG2    6  
ATOM 9055  H HG3    . GLU B 2 60  ? 1.973   4.520   1.975   1.00 0.00  ? 147 GLU A HG3    6  
ATOM 9056  N N      . ILE B 2 61  ? 2.021   2.504   0.232   1.00 0.00  ? 148 ILE A N      6  
ATOM 9057  C CA     . ILE B 2 61  ? 1.402   1.303   0.828   1.00 0.00  ? 148 ILE A CA     6  
ATOM 9058  C C      . ILE B 2 61  ? 1.664   1.309   2.333   1.00 0.00  ? 148 ILE A C      6  
ATOM 9059  O O      . ILE B 2 61  ? 2.706   1.792   2.784   1.00 0.00  ? 148 ILE A O      6  
ATOM 9060  C CB     . ILE B 2 61  ? 1.911   0.014   0.137   1.00 0.00  ? 148 ILE A CB     6  
ATOM 9061  C CG1    . ILE B 2 61  ? 1.090   -0.255  -1.141  1.00 0.00  ? 148 ILE A CG1    6  
ATOM 9062  C CG2    . ILE B 2 61  ? 1.919   -1.236  1.042   1.00 0.00  ? 148 ILE A CG2    6  
ATOM 9063  C CD1    . ILE B 2 61  ? -0.223  -1.003  -0.909  1.00 0.00  ? 148 ILE A CD1    6  
ATOM 9064  H H      . ILE B 2 61  ? 2.936   2.750   0.580   1.00 0.00  ? 148 ILE A H      6  
ATOM 9065  H HA     . ILE B 2 61  ? 0.325   1.352   0.700   1.00 0.00  ? 148 ILE A HA     6  
ATOM 9066  H HB     . ILE B 2 61  ? 2.944   0.188   -0.168  1.00 0.00  ? 148 ILE A HB     6  
ATOM 9067  H HG12   . ILE B 2 61  ? 0.886   0.680   -1.663  1.00 0.00  ? 148 ILE A HG12   6  
ATOM 9068  H HG13   . ILE B 2 61  ? 1.681   -0.864  -1.808  1.00 0.00  ? 148 ILE A HG13   6  
ATOM 9069  H HG21   . ILE B 2 61  ? 2.624   -1.102  1.855   1.00 0.00  ? 148 ILE A HG21   6  
ATOM 9070  H HG22   . ILE B 2 61  ? 0.937   -1.420  1.470   1.00 0.00  ? 148 ILE A HG22   6  
ATOM 9071  H HG23   . ILE B 2 61  ? 2.229   -2.110  0.465   1.00 0.00  ? 148 ILE A HG23   6  
ATOM 9072  H HD11   . ILE B 2 61  ? -0.018  -2.018  -0.562  1.00 0.00  ? 148 ILE A HD11   6  
ATOM 9073  H HD12   . ILE B 2 61  ? -0.812  -0.492  -0.154  1.00 0.00  ? 148 ILE A HD12   6  
ATOM 9074  H HD13   . ILE B 2 61  ? -0.775  -1.053  -1.844  1.00 0.00  ? 148 ILE A HD13   6  
ATOM 9075  N N      . ILE B 2 62  ? 0.743   0.770   3.139   1.00 0.00  ? 149 ILE A N      6  
ATOM 9076  C CA     . ILE B 2 62  ? 0.867   0.783   4.585   1.00 0.00  ? 149 ILE A CA     6  
ATOM 9077  C C      . ILE B 2 62  ? 1.615   -0.518  4.900   1.00 0.00  ? 149 ILE A C      6  
ATOM 9078  O O      . ILE B 2 62  ? 1.017   -1.530  5.240   1.00 0.00  ? 149 ILE A O      6  
ATOM 9079  C CB     . ILE B 2 62  ? -0.556  0.970   5.157   1.00 0.00  ? 149 ILE A CB     6  
ATOM 9080  C CG1    . ILE B 2 62  ? -1.289  2.141   4.458   1.00 0.00  ? 149 ILE A CG1    6  
ATOM 9081  C CG2    . ILE B 2 62  ? -0.547  1.250   6.664   1.00 0.00  ? 149 ILE A CG2    6  
ATOM 9082  C CD1    . ILE B 2 62  ? -0.512  3.447   4.319   1.00 0.00  ? 149 ILE A CD1    6  
ATOM 9083  H H      . ILE B 2 62  ? -0.076  0.250   2.842   1.00 0.00  ? 149 ILE A H      6  
ATOM 9084  H HA     . ILE B 2 62  ? 1.460   1.639   4.936   1.00 0.00  ? 149 ILE A HA     6  
ATOM 9085  H HB     . ILE B 2 62  ? -1.144  0.069   4.977   1.00 0.00  ? 149 ILE A HB     6  
ATOM 9086  H HG12   . ILE B 2 62  ? -1.630  1.842   3.471   1.00 0.00  ? 149 ILE A HG12   6  
ATOM 9087  H HG13   . ILE B 2 62  ? -2.169  2.356   5.034   1.00 0.00  ? 149 ILE A HG13   6  
ATOM 9088  H HG21   . ILE B 2 62  ? -0.307  0.346   7.191   1.00 0.00  ? 149 ILE A HG21   6  
ATOM 9089  H HG22   . ILE B 2 62  ? 0.180   2.024   6.903   1.00 0.00  ? 149 ILE A HG22   6  
ATOM 9090  H HG23   . ILE B 2 62  ? -1.537  1.554   7.006   1.00 0.00  ? 149 ILE A HG23   6  
ATOM 9091  H HD11   . ILE B 2 62  ? -0.122  3.719   5.296   1.00 0.00  ? 149 ILE A HD11   6  
ATOM 9092  H HD12   . ILE B 2 62  ? 0.311   3.353   3.614   1.00 0.00  ? 149 ILE A HD12   6  
ATOM 9093  H HD13   . ILE B 2 62  ? -1.180  4.225   3.956   1.00 0.00  ? 149 ILE A HD13   6  
ATOM 9094  N N      . PHE B 2 63  ? 2.920   -0.565  4.619   1.00 0.00  ? 150 PHE A N      6  
ATOM 9095  C CA     . PHE B 2 63  ? 3.682   -1.821  4.629   1.00 0.00  ? 150 PHE A CA     6  
ATOM 9096  C C      . PHE B 2 63  ? 3.973   -2.306  6.061   1.00 0.00  ? 150 PHE A C      6  
ATOM 9097  O O      . PHE B 2 63  ? 4.130   -1.503  6.986   1.00 0.00  ? 150 PHE A O      6  
ATOM 9098  C CB     . PHE B 2 63  ? 5.004   -1.664  3.844   1.00 0.00  ? 150 PHE A CB     6  
ATOM 9099  C CG     . PHE B 2 63  ? 4.970   -2.280  2.456   1.00 0.00  ? 150 PHE A CG     6  
ATOM 9100  C CD1    . PHE B 2 63  ? 4.660   -3.647  2.307   1.00 0.00  ? 150 PHE A CD1    6  
ATOM 9101  C CD2    . PHE B 2 63  ? 5.233   -1.501  1.314   1.00 0.00  ? 150 PHE A CD2    6  
ATOM 9102  C CE1    . PHE B 2 63  ? 4.543   -4.215  1.028   1.00 0.00  ? 150 PHE A CE1    6  
ATOM 9103  C CE2    . PHE B 2 63  ? 5.128   -2.073  0.033   1.00 0.00  ? 150 PHE A CE2    6  
ATOM 9104  C CZ     . PHE B 2 63  ? 4.765   -3.424  -0.111  1.00 0.00  ? 150 PHE A CZ     6  
ATOM 9105  H H      . PHE B 2 63  ? 3.348   0.271   4.242   1.00 0.00  ? 150 PHE A H      6  
ATOM 9106  H HA     . PHE B 2 63  ? 3.058   -2.562  4.117   1.00 0.00  ? 150 PHE A HA     6  
ATOM 9107  H HB2    . PHE B 2 63  ? 5.271   -0.607  3.778   1.00 0.00  ? 150 PHE A HB2    6  
ATOM 9108  H HB3    . PHE B 2 63  ? 5.812   -2.159  4.387   1.00 0.00  ? 150 PHE A HB3    6  
ATOM 9109  H HD1    . PHE B 2 63  ? 4.490   -4.267  3.176   1.00 0.00  ? 150 PHE A HD1    6  
ATOM 9110  H HD2    . PHE B 2 63  ? 5.486   -0.454  1.414   1.00 0.00  ? 150 PHE A HD2    6  
ATOM 9111  H HE1    . PHE B 2 63  ? 4.275   -5.259  0.918   1.00 0.00  ? 150 PHE A HE1    6  
ATOM 9112  H HE2    . PHE B 2 63  ? 5.304   -1.465  -0.845  1.00 0.00  ? 150 PHE A HE2    6  
ATOM 9113  H HZ     . PHE B 2 63  ? 4.649   -3.862  -1.091  1.00 0.00  ? 150 PHE A HZ     6  
ATOM 9114  N N      . ASN B 2 64  ? 4.123   -3.619  6.236   1.00 0.00  ? 151 ASN A N      6  
ATOM 9115  C CA     . ASN B 2 64  ? 4.627   -4.284  7.438   1.00 0.00  ? 151 ASN A CA     6  
ATOM 9116  C C      . ASN B 2 64  ? 5.647   -5.371  7.014   1.00 0.00  ? 151 ASN A C      6  
ATOM 9117  O O      . ASN B 2 64  ? 5.751   -5.698  5.830   1.00 0.00  ? 151 ASN A O      6  
ATOM 9118  C CB     . ASN B 2 64  ? 3.405   -4.845  8.207   1.00 0.00  ? 151 ASN A CB     6  
ATOM 9119  C CG     . ASN B 2 64  ? 3.676   -5.217  9.655   1.00 0.00  ? 151 ASN A CG     6  
ATOM 9120  O OD1    . ASN B 2 64  ? 4.791   -5.160  10.150  1.00 0.00  ? 151 ASN A OD1    6  
ATOM 9121  N ND2    . ASN B 2 64  ? 2.666   -5.619  10.392  1.00 0.00  ? 151 ASN A ND2    6  
ATOM 9122  H H      . ASN B 2 64  ? 3.952   -4.257  5.458   1.00 0.00  ? 151 ASN A H      6  
ATOM 9123  H HA     . ASN B 2 64  ? 5.147   -3.561  8.069   1.00 0.00  ? 151 ASN A HA     6  
ATOM 9124  H HB2    . ASN B 2 64  ? 2.623   -4.090  8.216   1.00 0.00  ? 151 ASN A HB2    6  
ATOM 9125  H HB3    . ASN B 2 64  ? 3.026   -5.716  7.675   1.00 0.00  ? 151 ASN A HB3    6  
ATOM 9126  H HD21   . ASN B 2 64  ? 1.699   -5.638  10.076  1.00 0.00  ? 151 ASN A HD21   6  
ATOM 9127  H HD22   . ASN B 2 64  ? 2.887   -5.854  11.345  1.00 0.00  ? 151 ASN A HD22   6  
ATOM 9128  N N      . GLU B 2 65  ? 6.377   -5.978  7.954   1.00 0.00  ? 152 GLU A N      6  
ATOM 9129  C CA     . GLU B 2 65  ? 7.369   -7.035  7.655   1.00 0.00  ? 152 GLU A CA     6  
ATOM 9130  C C      . GLU B 2 65  ? 6.766   -8.287  6.978   1.00 0.00  ? 152 GLU A C      6  
ATOM 9131  O O      . GLU B 2 65  ? 7.475   -9.031  6.296   1.00 0.00  ? 152 GLU A O      6  
ATOM 9132  C CB     . GLU B 2 65  ? 8.146   -7.422  8.932   1.00 0.00  ? 152 GLU A CB     6  
ATOM 9133  C CG     . GLU B 2 65  ? 7.260   -7.979  10.056  1.00 0.00  ? 152 GLU A CG     6  
ATOM 9134  C CD     . GLU B 2 65  ? 8.071   -8.666  11.168  1.00 0.00  ? 152 GLU A CD     6  
ATOM 9135  O OE1    . GLU B 2 65  ? 8.912   -8.008  11.827  1.00 0.00  ? 152 GLU A OE1    6  
ATOM 9136  O OE2    . GLU B 2 65  ? 7.842   -9.880  11.400  1.00 0.00  ? 152 GLU A OE2    6  
ATOM 9137  H H      . GLU B 2 65  ? 6.221   -5.697  8.918   1.00 0.00  ? 152 GLU A H      6  
ATOM 9138  H HA     . GLU B 2 65  ? 8.096   -6.626  6.950   1.00 0.00  ? 152 GLU A HA     6  
ATOM 9139  H HB2    . GLU B 2 65  ? 8.890   -8.172  8.664   1.00 0.00  ? 152 GLU A HB2    6  
ATOM 9140  H HB3    . GLU B 2 65  ? 8.673   -6.543  9.299   1.00 0.00  ? 152 GLU A HB3    6  
ATOM 9141  H HG2    . GLU B 2 65  ? 6.666   -7.170  10.482  1.00 0.00  ? 152 GLU A HG2    6  
ATOM 9142  H HG3    . GLU B 2 65  ? 6.573   -8.706  9.630   1.00 0.00  ? 152 GLU A HG3    6  
ATOM 9143  N N      . ARG B 2 66  ? 5.449   -8.504  7.131   1.00 0.00  ? 153 ARG A N      6  
ATOM 9144  C CA     . ARG B 2 66  ? 4.680   -9.615  6.546   1.00 0.00  ? 153 ARG A CA     6  
ATOM 9145  C C      . ARG B 2 66  ? 4.121   -9.319  5.142   1.00 0.00  ? 153 ARG A C      6  
ATOM 9146  O O      . ARG B 2 66  ? 3.779   -10.264 4.429   1.00 0.00  ? 153 ARG A O      6  
ATOM 9147  C CB     . ARG B 2 66  ? 3.546   -10.012 7.522   1.00 0.00  ? 153 ARG A CB     6  
ATOM 9148  C CG     . ARG B 2 66  ? 4.013   -10.451 8.926   1.00 0.00  ? 153 ARG A CG     6  
ATOM 9149  C CD     . ARG B 2 66  ? 4.836   -11.749 8.920   1.00 0.00  ? 153 ARG A CD     6  
ATOM 9150  N NE     . ARG B 2 66  ? 5.855   -11.762 9.991   1.00 0.00  ? 153 ARG A NE     6  
ATOM 9151  C CZ     . ARG B 2 66  ? 6.457   -12.807 10.522  1.00 0.00  ? 153 ARG A CZ     6  
ATOM 9152  N NH1    . ARG B 2 66  ? 6.128   -14.036 10.225  1.00 0.00  ? 153 ARG A NH1    6  
ATOM 9153  N NH2    . ARG B 2 66  ? 7.424   -12.618 11.371  1.00 0.00  ? 153 ARG A NH2    6  
ATOM 9154  H H      . ARG B 2 66  ? 4.974   -7.833  7.721   1.00 0.00  ? 153 ARG A H      6  
ATOM 9155  H HA     . ARG B 2 66  ? 5.342   -10.470 6.404   1.00 0.00  ? 153 ARG A HA     6  
ATOM 9156  H HB2    . ARG B 2 66  ? 2.894   -9.149  7.656   1.00 0.00  ? 153 ARG A HB2    6  
ATOM 9157  H HB3    . ARG B 2 66  ? 2.947   -10.815 7.096   1.00 0.00  ? 153 ARG A HB3    6  
ATOM 9158  H HG2    . ARG B 2 66  ? 4.587   -9.645  9.373   1.00 0.00  ? 153 ARG A HG2    6  
ATOM 9159  H HG3    . ARG B 2 66  ? 3.135   -10.609 9.553   1.00 0.00  ? 153 ARG A HG3    6  
ATOM 9160  H HD2    . ARG B 2 66  ? 4.151   -12.592 9.029   1.00 0.00  ? 153 ARG A HD2    6  
ATOM 9161  H HD3    . ARG B 2 66  ? 5.349   -11.858 7.965   1.00 0.00  ? 153 ARG A HD3    6  
ATOM 9162  H HE     . ARG B 2 66  ? 6.221   -10.877 10.318  1.00 0.00  ? 153 ARG A HE     6  
ATOM 9163  H HH11   . ARG B 2 66  ? 5.386   -14.196 9.570   1.00 0.00  ? 153 ARG A HH11   6  
ATOM 9164  H HH12   . ARG B 2 66  ? 6.601   -14.810 10.657  1.00 0.00  ? 153 ARG A HH12   6  
ATOM 9165  H HH21   . ARG B 2 66  ? 7.708   -11.650 11.545  1.00 0.00  ? 153 ARG A HH21   6  
ATOM 9166  H HH22   . ARG B 2 66  ? 7.922   -13.384 11.790  1.00 0.00  ? 153 ARG A HH22   6  
ATOM 9167  N N      . GLY B 2 67  ? 4.037   -8.054  4.717   1.00 0.00  ? 154 GLY A N      6  
ATOM 9168  C CA     . GLY B 2 67  ? 3.325   -7.622  3.504   1.00 0.00  ? 154 GLY A CA     6  
ATOM 9169  C C      . GLY B 2 67  ? 2.526   -6.342  3.764   1.00 0.00  ? 154 GLY A C      6  
ATOM 9170  O O      . GLY B 2 67  ? 2.828   -5.602  4.704   1.00 0.00  ? 154 GLY A O      6  
ATOM 9171  H H      . GLY B 2 67  ? 4.370   -7.306  5.320   1.00 0.00  ? 154 GLY A H      6  
ATOM 9172  H HA2    . GLY B 2 67  ? 4.046   -7.431  2.709   1.00 0.00  ? 154 GLY A HA2    6  
ATOM 9173  H HA3    . GLY B 2 67  ? 2.634   -8.394  3.166   1.00 0.00  ? 154 GLY A HA3    6  
ATOM 9174  N N      . SER B 2 68  ? 1.521   -6.044  2.933   1.00 0.00  ? 155 SER A N      6  
ATOM 9175  C CA     . SER B 2 68  ? 0.618   -4.916  3.202   1.00 0.00  ? 155 SER A CA     6  
ATOM 9176  C C      . SER B 2 68  ? -0.111  -5.071  4.554   1.00 0.00  ? 155 SER A C      6  
ATOM 9177  O O      . SER B 2 68  ? -0.431  -6.185  4.970   1.00 0.00  ? 155 SER A O      6  
ATOM 9178  C CB     . SER B 2 68  ? -0.378  -4.757  2.048   1.00 0.00  ? 155 SER A CB     6  
ATOM 9179  O OG     . SER B 2 68  ? -1.199  -3.621  2.260   1.00 0.00  ? 155 SER A OG     6  
ATOM 9180  H H      . SER B 2 68  ? 1.325   -6.674  2.164   1.00 0.00  ? 155 SER A H      6  
ATOM 9181  H HA     . SER B 2 68  ? 1.204   -4.010  3.237   1.00 0.00  ? 155 SER A HA     6  
ATOM 9182  H HB2    . SER B 2 68  ? 0.166   -4.642  1.106   1.00 0.00  ? 155 SER A HB2    6  
ATOM 9183  H HB3    . SER B 2 68  ? -1.004  -5.642  1.980   1.00 0.00  ? 155 SER A HB3    6  
ATOM 9184  H HG     . SER B 2 68  ? -0.768  -2.838  1.877   1.00 0.00  ? 155 SER A HG     6  
ATOM 9185  N N      . LYS B 2 69  ? -0.464  -3.960  5.217   1.00 0.00  ? 156 LYS A N      6  
ATOM 9186  C CA     . LYS B 2 69  ? -1.514  -3.889  6.255   1.00 0.00  ? 156 LYS A CA     6  
ATOM 9187  C C      . LYS B 2 69  ? -2.931  -4.077  5.697   1.00 0.00  ? 156 LYS A C      6  
ATOM 9188  O O      . LYS B 2 69  ? -3.894  -4.164  6.455   1.00 0.00  ? 156 LYS A O      6  
ATOM 9189  C CB     . LYS B 2 69  ? -1.371  -2.586  7.067   1.00 0.00  ? 156 LYS A CB     6  
ATOM 9190  C CG     . LYS B 2 69  ? -0.425  -2.868  8.256   1.00 0.00  ? 156 LYS A CG     6  
ATOM 9191  C CD     . LYS B 2 69  ? 0.162   -1.652  8.995   1.00 0.00  ? 156 LYS A CD     6  
ATOM 9192  C CE     . LYS B 2 69  ? 1.442   -1.174  8.297   1.00 0.00  ? 156 LYS A CE     6  
ATOM 9193  N NZ     . LYS B 2 69  ? 2.159   -0.114  9.050   1.00 0.00  ? 156 LYS A NZ     6  
ATOM 9194  H H      . LYS B 2 69  ? -0.067  -3.083  4.893   1.00 0.00  ? 156 LYS A H      6  
ATOM 9195  H HA     . LYS B 2 69  ? -1.384  -4.730  6.932   1.00 0.00  ? 156 LYS A HA     6  
ATOM 9196  H HB2    . LYS B 2 69  ? -1.015  -1.782  6.417   1.00 0.00  ? 156 LYS A HB2    6  
ATOM 9197  H HB3    . LYS B 2 69  ? -2.336  -2.278  7.467   1.00 0.00  ? 156 LYS A HB3    6  
ATOM 9198  H HG2    . LYS B 2 69  ? -0.992  -3.448  8.978   1.00 0.00  ? 156 LYS A HG2    6  
ATOM 9199  H HG3    . LYS B 2 69  ? 0.400   -3.498  7.920   1.00 0.00  ? 156 LYS A HG3    6  
ATOM 9200  H HD2    . LYS B 2 69  ? -0.580  -0.857  9.060   1.00 0.00  ? 156 LYS A HD2    6  
ATOM 9201  H HD3    . LYS B 2 69  ? 0.418   -1.964  10.006  1.00 0.00  ? 156 LYS A HD3    6  
ATOM 9202  H HE2    . LYS B 2 69  ? 2.103   -2.038  8.178   1.00 0.00  ? 156 LYS A HE2    6  
ATOM 9203  H HE3    . LYS B 2 69  ? 1.200   -0.820  7.288   1.00 0.00  ? 156 LYS A HE3    6  
ATOM 9204  H HZ1    . LYS B 2 69  ? 1.706   0.800   8.990   1.00 0.00  ? 156 LYS A HZ1    6  
ATOM 9205  H HZ2    . LYS B 2 69  ? 2.259   -0.350  10.030  1.00 0.00  ? 156 LYS A HZ2    6  
ATOM 9206  H HZ3    . LYS B 2 69  ? 3.085   0.010   8.670   1.00 0.00  ? 156 LYS A HZ3    6  
ATOM 9207  N N      . GLY B 2 70  ? -3.053  -4.195  4.372   1.00 0.00  ? 157 GLY A N      6  
ATOM 9208  C CA     . GLY B 2 70  ? -4.277  -4.461  3.624   1.00 0.00  ? 157 GLY A CA     6  
ATOM 9209  C C      . GLY B 2 70  ? -4.824  -3.231  2.901   1.00 0.00  ? 157 GLY A C      6  
ATOM 9210  O O      . GLY B 2 70  ? -5.888  -3.300  2.284   1.00 0.00  ? 157 GLY A O      6  
ATOM 9211  H H      . GLY B 2 70  ? -2.206  -4.091  3.832   1.00 0.00  ? 157 GLY A H      6  
ATOM 9212  H HA2    . GLY B 2 70  ? -4.078  -5.230  2.876   1.00 0.00  ? 157 GLY A HA2    6  
ATOM 9213  H HA3    . GLY B 2 70  ? -5.039  -4.832  4.305   1.00 0.00  ? 157 GLY A HA3    6  
ATOM 9214  N N      . PHE B 2 71  ? -4.110  -2.107  2.967   1.00 0.00  ? 158 PHE A N      6  
ATOM 9215  C CA     . PHE B 2 71  ? -4.416  -0.872  2.264   1.00 0.00  ? 158 PHE A CA     6  
ATOM 9216  C C      . PHE B 2 71  ? -3.152  -0.111  1.841   1.00 0.00  ? 158 PHE A C      6  
ATOM 9217  O O      . PHE B 2 71  ? -2.032  -0.342  2.320   1.00 0.00  ? 158 PHE A O      6  
ATOM 9218  C CB     . PHE B 2 71  ? -5.404  -0.001  3.077   1.00 0.00  ? 158 PHE A CB     6  
ATOM 9219  C CG     . PHE B 2 71  ? -4.896  0.853   4.219   1.00 0.00  ? 158 PHE A CG     6  
ATOM 9220  C CD1    . PHE B 2 71  ? -4.698  0.270   5.483   1.00 0.00  ? 158 PHE A CD1    6  
ATOM 9221  C CD2    . PHE B 2 71  ? -4.796  2.254   4.064   1.00 0.00  ? 158 PHE A CD2    6  
ATOM 9222  C CE1    . PHE B 2 71  ? -4.393  1.087   6.583   1.00 0.00  ? 158 PHE A CE1    6  
ATOM 9223  C CE2    . PHE B 2 71  ? -4.519  3.083   5.170   1.00 0.00  ? 158 PHE A CE2    6  
ATOM 9224  C CZ     . PHE B 2 71  ? -4.299  2.481   6.421   1.00 0.00  ? 158 PHE A CZ     6  
ATOM 9225  H H      . PHE B 2 71  ? -3.180  -2.179  3.338   1.00 0.00  ? 158 PHE A H      6  
ATOM 9226  H HA     . PHE B 2 71  ? -4.918  -1.165  1.343   1.00 0.00  ? 158 PHE A HA     6  
ATOM 9227  H HB2    . PHE B 2 71  ? -5.941  0.644   2.398   1.00 0.00  ? 158 PHE A HB2    6  
ATOM 9228  H HB3    . PHE B 2 71  ? -6.183  -0.628  3.485   1.00 0.00  ? 158 PHE A HB3    6  
ATOM 9229  H HD1    . PHE B 2 71  ? -4.802  -0.796  5.620   1.00 0.00  ? 158 PHE A HD1    6  
ATOM 9230  H HD2    . PHE B 2 71  ? -4.966  2.699   3.093   1.00 0.00  ? 158 PHE A HD2    6  
ATOM 9231  H HE1    . PHE B 2 71  ? -4.239  0.631   7.550   1.00 0.00  ? 158 PHE A HE1    6  
ATOM 9232  H HE2    . PHE B 2 71  ? -4.428  4.170   5.075   1.00 0.00  ? 158 PHE A HE2    6  
ATOM 9233  H HZ     . PHE B 2 71  ? -4.006  3.100   7.246   1.00 0.00  ? 158 PHE A HZ     6  
ATOM 9234  N N      . GLY B 2 72  ? -3.369  0.830   0.930   1.00 0.00  ? 159 GLY A N      6  
ATOM 9235  C CA     . GLY B 2 72  ? -2.426  1.853   0.511   1.00 0.00  ? 159 GLY A CA     6  
ATOM 9236  C C      . GLY B 2 72  ? -3.100  3.221   0.416   1.00 0.00  ? 159 GLY A C      6  
ATOM 9237  O O      . GLY B 2 72  ? -4.246  3.422   0.825   1.00 0.00  ? 159 GLY A O      6  
ATOM 9238  H H      . GLY B 2 72  ? -4.321  0.907   0.589   1.00 0.00  ? 159 GLY A H      6  
ATOM 9239  H HA2    . GLY B 2 72  ? -1.635  1.943   1.251   1.00 0.00  ? 159 GLY A HA2    6  
ATOM 9240  H HA3    . GLY B 2 72  ? -1.970  1.572   -0.444  1.00 0.00  ? 159 GLY A HA3    6  
ATOM 9241  N N      . PHE B 2 73  ? -2.354  4.175   -0.107  1.00 0.00  ? 160 PHE A N      6  
ATOM 9242  C CA     . PHE B 2 73  ? -2.693  5.578   -0.271  1.00 0.00  ? 160 PHE A CA     6  
ATOM 9243  C C      . PHE B 2 73  ? -2.123  6.071   -1.611  1.00 0.00  ? 160 PHE A C      6  
ATOM 9244  O O      . PHE B 2 73  ? -1.072  5.619   -2.059  1.00 0.00  ? 160 PHE A O      6  
ATOM 9245  C CB     . PHE B 2 73  ? -2.138  6.356   0.936   1.00 0.00  ? 160 PHE A CB     6  
ATOM 9246  C CG     . PHE B 2 73  ? -3.220  7.011   1.759   1.00 0.00  ? 160 PHE A CG     6  
ATOM 9247  C CD1    . PHE B 2 73  ? -3.697  8.269   1.362   1.00 0.00  ? 160 PHE A CD1    6  
ATOM 9248  C CD2    . PHE B 2 73  ? -3.750  6.389   2.911   1.00 0.00  ? 160 PHE A CD2    6  
ATOM 9249  C CE1    . PHE B 2 73  ? -4.699  8.899   2.107   1.00 0.00  ? 160 PHE A CE1    6  
ATOM 9250  C CE2    . PHE B 2 73  ? -4.754  7.020   3.657   1.00 0.00  ? 160 PHE A CE2    6  
ATOM 9251  C CZ     . PHE B 2 73  ? -5.240  8.269   3.242   1.00 0.00  ? 160 PHE A CZ     6  
ATOM 9252  H H      . PHE B 2 73  ? -1.457  3.909   -0.475  1.00 0.00  ? 160 PHE A H      6  
ATOM 9253  H HA     . PHE B 2 73  ? -3.778  5.674   -0.287  1.00 0.00  ? 160 PHE A HA     6  
ATOM 9254  H HB2    . PHE B 2 73  ? -1.559  5.696   1.586   1.00 0.00  ? 160 PHE A HB2    6  
ATOM 9255  H HB3    . PHE B 2 73  ? -1.455  7.133   0.588   1.00 0.00  ? 160 PHE A HB3    6  
ATOM 9256  H HD1    . PHE B 2 73  ? -3.290  8.758   0.487   1.00 0.00  ? 160 PHE A HD1    6  
ATOM 9257  H HD2    . PHE B 2 73  ? -3.394  5.436   3.266   1.00 0.00  ? 160 PHE A HD2    6  
ATOM 9258  H HE1    . PHE B 2 73  ? -5.023  9.885   1.810   1.00 0.00  ? 160 PHE A HE1    6  
ATOM 9259  H HE2    . PHE B 2 73  ? -5.117  6.553   4.563   1.00 0.00  ? 160 PHE A HE2    6  
ATOM 9260  H HZ     . PHE B 2 73  ? -5.998  8.763   3.827   1.00 0.00  ? 160 PHE A HZ     6  
ATOM 9261  N N      . VAL B 2 74  ? -2.812  6.978   -2.291  1.00 0.00  ? 161 VAL A N      6  
ATOM 9262  C CA     . VAL B 2 74  ? -2.414  7.507   -3.609  1.00 0.00  ? 161 VAL A CA     6  
ATOM 9263  C C      . VAL B 2 74  ? -2.968  8.914   -3.804  1.00 0.00  ? 161 VAL A C      6  
ATOM 9264  O O      . VAL B 2 74  ? -3.874  9.314   -3.082  1.00 0.00  ? 161 VAL A O      6  
ATOM 9265  C CB     . VAL B 2 74  ? -2.802  6.488   -4.706  1.00 0.00  ? 161 VAL A CB     6  
ATOM 9266  C CG1    . VAL B 2 74  ? -4.239  6.069   -4.763  1.00 0.00  ? 161 VAL A CG1    6  
ATOM 9267  C CG2    . VAL B 2 74  ? -2.510  6.922   -6.140  1.00 0.00  ? 161 VAL A CG2    6  
ATOM 9268  H H      . VAL B 2 74  ? -3.716  7.250   -1.914  1.00 0.00  ? 161 VAL A H      6  
ATOM 9269  H HA     . VAL B 2 74  ? -1.333  7.625   -3.627  1.00 0.00  ? 161 VAL A HA     6  
ATOM 9270  H HB     . VAL B 2 74  ? -2.282  5.550   -4.488  1.00 0.00  ? 161 VAL A HB     6  
ATOM 9271  H HG11   . VAL B 2 74  ? -4.630  5.953   -3.764  1.00 0.00  ? 161 VAL A HG11   6  
ATOM 9272  H HG12   . VAL B 2 74  ? -4.807  6.801   -5.330  1.00 0.00  ? 161 VAL A HG12   6  
ATOM 9273  H HG13   . VAL B 2 74  ? -4.199  5.105   -5.269  1.00 0.00  ? 161 VAL A HG13   6  
ATOM 9274  H HG21   . VAL B 2 74  ? -3.186  7.717   -6.447  1.00 0.00  ? 161 VAL A HG21   6  
ATOM 9275  H HG22   . VAL B 2 74  ? -1.486  7.262   -6.185  1.00 0.00  ? 161 VAL A HG22   6  
ATOM 9276  H HG23   . VAL B 2 74  ? -2.648  6.079   -6.821  1.00 0.00  ? 161 VAL A HG23   6  
ATOM 9277  N N      . THR B 2 75  ? -2.404  9.706   -4.721  1.00 0.00  ? 162 THR A N      6  
ATOM 9278  C CA     . THR B 2 75  ? -2.596  11.171  -4.765  1.00 0.00  ? 162 THR A CA     6  
ATOM 9279  C C      . THR B 2 75  ? -3.246  11.577  -6.073  1.00 0.00  ? 162 THR A C      6  
ATOM 9280  O O      . THR B 2 75  ? -2.578  11.690  -7.103  1.00 0.00  ? 162 THR A O      6  
ATOM 9281  C CB     . THR B 2 75  ? -1.292  11.929  -4.534  1.00 0.00  ? 162 THR A CB     6  
ATOM 9282  O OG1    . THR B 2 75  ? -0.649  11.437  -3.381  1.00 0.00  ? 162 THR A OG1    6  
ATOM 9283  C CG2    . THR B 2 75  ? -1.503  13.439  -4.329  1.00 0.00  ? 162 THR A CG2    6  
ATOM 9284  H H      . THR B 2 75  ? -1.681  9.290   -5.314  1.00 0.00  ? 162 THR A H      6  
ATOM 9285  H HA     . THR B 2 75  ? -3.253  11.463  -3.958  1.00 0.00  ? 162 THR A HA     6  
ATOM 9286  H HB     . THR B 2 75  ? -0.664  11.735  -5.396  1.00 0.00  ? 162 THR A HB     6  
ATOM 9287  H HG1    . THR B 2 75  ? -0.406  10.512  -3.565  1.00 0.00  ? 162 THR A HG1    6  
ATOM 9288  H HG21   . THR B 2 75  ? -1.977  13.892  -5.199  1.00 0.00  ? 162 THR A HG21   6  
ATOM 9289  H HG22   . THR B 2 75  ? -2.128  13.646  -3.456  1.00 0.00  ? 162 THR A HG22   6  
ATOM 9290  H HG23   . THR B 2 75  ? -0.536  13.920  -4.181  1.00 0.00  ? 162 THR A HG23   6  
ATOM 9291  N N      . PHE B 2 76  ? -4.575  11.681  -6.029  1.00 0.00  ? 163 PHE A N      6  
ATOM 9292  C CA     . PHE B 2 76  ? -5.390  11.306  -7.182  1.00 0.00  ? 163 PHE A CA     6  
ATOM 9293  C C      . PHE B 2 76  ? -6.664  12.117  -7.407  1.00 0.00  ? 163 PHE A C      6  
ATOM 9294  O O      . PHE B 2 76  ? -7.047  12.455  -8.521  1.00 0.00  ? 163 PHE A O      6  
ATOM 9295  C CB     . PHE B 2 76  ? -5.784  9.862   -6.917  1.00 0.00  ? 163 PHE A CB     6  
ATOM 9296  C CG     . PHE B 2 76  ? -6.381  9.187   -8.132  1.00 0.00  ? 163 PHE A CG     6  
ATOM 9297  C CD1    . PHE B 2 76  ? -5.505  8.610   -9.058  1.00 0.00  ? 163 PHE A CD1    6  
ATOM 9298  C CD2    . PHE B 2 76  ? -7.765  9.187   -8.390  1.00 0.00  ? 163 PHE A CD2    6  
ATOM 9299  C CE1    . PHE B 2 76  ? -5.991  8.029   -10.241 1.00 0.00  ? 163 PHE A CE1    6  
ATOM 9300  C CE2    . PHE B 2 76  ? -8.255  8.602   -9.570  1.00 0.00  ? 163 PHE A CE2    6  
ATOM 9301  C CZ     . PHE B 2 76  ? -7.371  8.034   -10.504 1.00 0.00  ? 163 PHE A CZ     6  
ATOM 9302  H H      . PHE B 2 76  ? -4.984  11.489  -5.129  1.00 0.00  ? 163 PHE A H      6  
ATOM 9303  H HA     . PHE B 2 76  ? -4.806  11.366  -8.079  1.00 0.00  ? 163 PHE A HA     6  
ATOM 9304  H HB2    . PHE B 2 76  ? -4.886  9.318   -6.607  1.00 0.00  ? 163 PHE A HB2    6  
ATOM 9305  H HB3    . PHE B 2 76  ? -6.485  9.874   -6.083  1.00 0.00  ? 163 PHE A HB3    6  
ATOM 9306  H HD1    . PHE B 2 76  ? -4.455  8.643   -8.836  1.00 0.00  ? 163 PHE A HD1    6  
ATOM 9307  H HD2    . PHE B 2 76  ? -8.449  9.652   -7.698  1.00 0.00  ? 163 PHE A HD2    6  
ATOM 9308  H HE1    . PHE B 2 76  ? -5.295  7.584   -10.939 1.00 0.00  ? 163 PHE A HE1    6  
ATOM 9309  H HE2    . PHE B 2 76  ? -9.318  8.591   -9.753  1.00 0.00  ? 163 PHE A HE2    6  
ATOM 9310  H HZ     . PHE B 2 76  ? -7.749  7.590   -11.416 1.00 0.00  ? 163 PHE A HZ     6  
ATOM 9311  N N      . GLU B 2 77  ? -7.328  12.386  -6.297  1.00 0.00  ? 164 GLU A N      6  
ATOM 9312  C CA     . GLU B 2 77  ? -8.721  12.738  -6.147  1.00 0.00  ? 164 GLU A CA     6  
ATOM 9313  C C      . GLU B 2 77  ? -8.760  14.240  -5.938  1.00 0.00  ? 164 GLU A C      6  
ATOM 9314  O O      . GLU B 2 77  ? -8.261  14.741  -4.929  1.00 0.00  ? 164 GLU A O      6  
ATOM 9315  C CB     . GLU B 2 77  ? -9.313  11.959  -4.950  1.00 0.00  ? 164 GLU A CB     6  
ATOM 9316  C CG     . GLU B 2 77  ? -10.817 11.674  -5.061  1.00 0.00  ? 164 GLU A CG     6  
ATOM 9317  C CD     . GLU B 2 77  ? -11.661 12.950  -5.188  1.00 0.00  ? 164 GLU A CD     6  
ATOM 9318  O OE1    . GLU B 2 77  ? -12.005 13.564  -4.150  1.00 0.00  ? 164 GLU A OE1    6  
ATOM 9319  O OE2    . GLU B 2 77  ? -11.949 13.347  -6.338  1.00 0.00  ? 164 GLU A OE2    6  
ATOM 9320  H H      . GLU B 2 77  ? -6.821  12.238  -5.461  1.00 0.00  ? 164 GLU A H      6  
ATOM 9321  H HA     . GLU B 2 77  ? -9.276  12.466  -7.041  1.00 0.00  ? 164 GLU A HA     6  
ATOM 9322  H HB2    . GLU B 2 77  ? -8.822  10.990  -4.890  1.00 0.00  ? 164 GLU A HB2    6  
ATOM 9323  H HB3    . GLU B 2 77  ? -9.110  12.486  -4.016  1.00 0.00  ? 164 GLU A HB3    6  
ATOM 9324  H HG2    . GLU B 2 77  ? -10.997 11.016  -5.915  1.00 0.00  ? 164 GLU A HG2    6  
ATOM 9325  H HG3    . GLU B 2 77  ? -11.126 11.134  -4.166  1.00 0.00  ? 164 GLU A HG3    6  
ATOM 9326  N N      . ASN B 2 78  ? -9.335  14.953  -6.899  1.00 0.00  ? 165 ASN A N      6  
ATOM 9327  C CA     . ASN B 2 78  ? -10.246 16.025  -6.510  1.00 0.00  ? 165 ASN A CA     6  
ATOM 9328  C C      . ASN B 2 78  ? -11.354 16.339  -7.536  1.00 0.00  ? 165 ASN A C      6  
ATOM 9329  O O      . ASN B 2 78  ? -12.474 16.678  -7.143  1.00 0.00  ? 165 ASN A O      6  
ATOM 9330  C CB     . ASN B 2 78  ? -9.458  17.295  -6.134  1.00 0.00  ? 165 ASN A CB     6  
ATOM 9331  C CG     . ASN B 2 78  ? -9.806  17.772  -4.740  1.00 0.00  ? 165 ASN A CG     6  
ATOM 9332  O OD1    . ASN B 2 78  ? -10.369 18.836  -4.532  1.00 0.00  ? 165 ASN A OD1    6  
ATOM 9333  N ND2    . ASN B 2 78  ? -9.468  16.985  -3.748  1.00 0.00  ? 165 ASN A ND2    6  
ATOM 9334  H H      . ASN B 2 78  ? -9.586  14.395  -7.701  1.00 0.00  ? 165 ASN A H      6  
ATOM 9335  H HA     . ASN B 2 78  ? -10.740 15.627  -5.621  1.00 0.00  ? 165 ASN A HA     6  
ATOM 9336  H HB2    . ASN B 2 78  ? -8.389  17.110  -6.172  1.00 0.00  ? 165 ASN A HB2    6  
ATOM 9337  H HB3    . ASN B 2 78  ? -9.675  18.087  -6.840  1.00 0.00  ? 165 ASN A HB3    6  
ATOM 9338  H HD21   . ASN B 2 78  ? -8.979  16.120  -3.985  1.00 0.00  ? 165 ASN A HD21   6  
ATOM 9339  H HD22   . ASN B 2 78  ? -9.713  17.229  -2.803  1.00 0.00  ? 165 ASN A HD22   6  
ATOM 9340  N N      . SER B 2 79  ? -11.052 16.259  -8.837  1.00 0.00  ? 166 SER A N      6  
ATOM 9341  C CA     . SER B 2 79  ? -12.021 16.505  -9.920  1.00 0.00  ? 166 SER A CA     6  
ATOM 9342  C C      . SER B 2 79  ? -13.071 15.389  -10.052 1.00 0.00  ? 166 SER A C      6  
ATOM 9343  O O      . SER B 2 79  ? -12.837 14.248  -9.649  1.00 0.00  ? 166 SER A O      6  
ATOM 9344  C CB     . SER B 2 79  ? -11.301 16.629  -11.272 1.00 0.00  ? 166 SER A CB     6  
ATOM 9345  O OG     . SER B 2 79  ? -10.359 17.685  -11.259 1.00 0.00  ? 166 SER A OG     6  
ATOM 9346  H H      . SER B 2 79  ? -10.087 16.100  -9.091  1.00 0.00  ? 166 SER A H      6  
ATOM 9347  H HA     . SER B 2 79  ? -12.537 17.439  -9.708  1.00 0.00  ? 166 SER A HA     6  
ATOM 9348  H HB2    . SER B 2 79  ? -10.798 15.686  -11.504 1.00 0.00  ? 166 SER A HB2    6  
ATOM 9349  H HB3    . SER B 2 79  ? -12.039 16.819  -12.054 1.00 0.00  ? 166 SER A HB3    6  
ATOM 9350  H HG     . SER B 2 79  ? -9.983  17.764  -12.155 1.00 0.00  ? 166 SER A HG     6  
ATOM 9351  N N      . ALA B 2 80  ? -14.196 15.671  -10.724 1.00 0.00  ? 167 ALA A N      6  
ATOM 9352  C CA     . ALA B 2 80  ? -15.218 14.662  -11.037 1.00 0.00  ? 167 ALA A CA     6  
ATOM 9353  C C      . ALA B 2 80  ? -14.657 13.448  -11.793 1.00 0.00  ? 167 ALA A C      6  
ATOM 9354  O O      . ALA B 2 80  ? -15.032 12.316  -11.503 1.00 0.00  ? 167 ALA A O      6  
ATOM 9355  C CB     . ALA B 2 80  ? -16.339 15.299  -11.860 1.00 0.00  ? 167 ALA A CB     6  
ATOM 9356  H H      . ALA B 2 80  ? -14.349 16.625  -11.017 1.00 0.00  ? 167 ALA A H      6  
ATOM 9357  H HA     . ALA B 2 80  ? -15.643 14.295  -10.102 1.00 0.00  ? 167 ALA A HA     6  
ATOM 9358  H HB1    . ALA B 2 80  ? -16.830 16.083  -11.284 1.00 0.00  ? 167 ALA A HB1    6  
ATOM 9359  H HB2    . ALA B 2 80  ? -15.940 15.707  -12.787 1.00 0.00  ? 167 ALA A HB2    6  
ATOM 9360  H HB3    . ALA B 2 80  ? -17.064 14.523  -12.113 1.00 0.00  ? 167 ALA A HB3    6  
ATOM 9361  N N      . ASP B 2 81  ? -13.736 13.664  -12.738 1.00 0.00  ? 168 ASP A N      6  
ATOM 9362  C CA     . ASP B 2 81  ? -13.087 12.586  -13.491 1.00 0.00  ? 168 ASP A CA     6  
ATOM 9363  C C      . ASP B 2 81  ? -12.238 11.650  -12.603 1.00 0.00  ? 168 ASP A C      6  
ATOM 9364  O O      . ASP B 2 81  ? -12.197 10.439  -12.821 1.00 0.00  ? 168 ASP A O      6  
ATOM 9365  C CB     . ASP B 2 81  ? -12.243 13.210  -14.607 1.00 0.00  ? 168 ASP A CB     6  
ATOM 9366  C CG     . ASP B 2 81  ? -11.630 12.134  -15.511 1.00 0.00  ? 168 ASP A CG     6  
ATOM 9367  O OD1    . ASP B 2 81  ? -12.399 11.359  -16.126 1.00 0.00  ? 168 ASP A OD1    6  
ATOM 9368  O OD2    . ASP B 2 81  ? -10.380 12.082  -15.601 1.00 0.00  ? 168 ASP A OD2    6  
ATOM 9369  H H      . ASP B 2 81  ? -13.523 14.625  -12.964 1.00 0.00  ? 168 ASP A H      6  
ATOM 9370  H HA     . ASP B 2 81  ? -13.866 11.984  -13.957 1.00 0.00  ? 168 ASP A HA     6  
ATOM 9371  H HB2    . ASP B 2 81  ? -12.878 13.862  -15.213 1.00 0.00  ? 168 ASP A HB2    6  
ATOM 9372  H HB3    . ASP B 2 81  ? -11.451 13.819  -14.161 1.00 0.00  ? 168 ASP A HB3    6  
ATOM 9373  N N      . ALA B 2 82  ? -11.598 12.198  -11.564 1.00 0.00  ? 169 ALA A N      6  
ATOM 9374  C CA     . ALA B 2 82  ? -10.907 11.415  -10.545 1.00 0.00  ? 169 ALA A CA     6  
ATOM 9375  C C      . ALA B 2 82  ? -11.889 10.633  -9.655  1.00 0.00  ? 169 ALA A C      6  
ATOM 9376  O O      . ALA B 2 82  ? -11.692 9.439   -9.441  1.00 0.00  ? 169 ALA A O      6  
ATOM 9377  C CB     . ALA B 2 82  ? -10.016 12.330  -9.712  1.00 0.00  ? 169 ALA A CB     6  
ATOM 9378  H H      . ALA B 2 82  ? -11.749 13.180  -11.394 1.00 0.00  ? 169 ALA A H      6  
ATOM 9379  H HA     . ALA B 2 82  ? -10.273 10.681  -11.044 1.00 0.00  ? 169 ALA A HA     6  
ATOM 9380  H HB1    . ALA B 2 82  ? -9.342  12.901  -10.350 1.00 0.00  ? 169 ALA A HB1    6  
ATOM 9381  H HB2    . ALA B 2 82  ? -10.619 13.015  -9.120  1.00 0.00  ? 169 ALA A HB2    6  
ATOM 9382  H HB3    . ALA B 2 82  ? -9.421  11.702  -9.051  1.00 0.00  ? 169 ALA A HB3    6  
ATOM 9383  N N      . ASP B 2 83  ? -12.963 11.268  -9.171  1.00 0.00  ? 170 ASP A N      6  
ATOM 9384  C CA     . ASP B 2 83  ? -14.021 10.588  -8.407  1.00 0.00  ? 170 ASP A CA     6  
ATOM 9385  C C      . ASP B 2 83  ? -14.672 9.453   -9.219  1.00 0.00  ? 170 ASP A C      6  
ATOM 9386  O O      . ASP B 2 83  ? -14.863 8.355   -8.703  1.00 0.00  ? 170 ASP A O      6  
ATOM 9387  C CB     . ASP B 2 83  ? -15.066 11.601  -7.927  1.00 0.00  ? 170 ASP A CB     6  
ATOM 9388  C CG     . ASP B 2 83  ? -16.072 10.961  -6.953  1.00 0.00  ? 170 ASP A CG     6  
ATOM 9389  O OD1    . ASP B 2 83  ? -15.676 10.619  -5.813  1.00 0.00  ? 170 ASP A OD1    6  
ATOM 9390  O OD2    . ASP B 2 83  ? -17.259 10.810  -7.322  1.00 0.00  ? 170 ASP A OD2    6  
ATOM 9391  H H      . ASP B 2 83  ? -13.043 12.267  -9.343  1.00 0.00  ? 170 ASP A H      6  
ATOM 9392  H HA     . ASP B 2 83  ? -13.569 10.138  -7.522  1.00 0.00  ? 170 ASP A HA     6  
ATOM 9393  H HB2    . ASP B 2 83  ? -14.560 12.422  -7.417  1.00 0.00  ? 170 ASP A HB2    6  
ATOM 9394  H HB3    . ASP B 2 83  ? -15.592 12.015  -8.788  1.00 0.00  ? 170 ASP A HB3    6  
ATOM 9395  N N      . ARG B 2 84  ? -14.934 9.675   -10.512 1.00 0.00  ? 171 ARG A N      6  
ATOM 9396  C CA     . ARG B 2 84  ? -15.398 8.685   -11.500 1.00 0.00  ? 171 ARG A CA     6  
ATOM 9397  C C      . ARG B 2 84  ? -14.449 7.488   -11.622 1.00 0.00  ? 171 ARG A C      6  
ATOM 9398  O O      . ARG B 2 84  ? -14.875 6.338   -11.519 1.00 0.00  ? 171 ARG A O      6  
ATOM 9399  C CB     . ARG B 2 84  ? -15.604 9.423   -12.835 1.00 0.00  ? 171 ARG A CB     6  
ATOM 9400  C CG     . ARG B 2 84  ? -16.113 8.528   -13.978 1.00 0.00  ? 171 ARG A CG     6  
ATOM 9401  C CD     . ARG B 2 84  ? -16.263 9.322   -15.284 1.00 0.00  ? 171 ARG A CD     6  
ATOM 9402  N NE     . ARG B 2 84  ? -14.967 9.517   -15.974 1.00 0.00  ? 171 ARG A NE     6  
ATOM 9403  C CZ     . ARG B 2 84  ? -14.484 8.838   -16.998 1.00 0.00  ? 171 ARG A CZ     6  
ATOM 9404  N NH1    . ARG B 2 84  ? -15.108 7.826   -17.536 1.00 0.00  ? 171 ARG A NH1    6  
ATOM 9405  N NH2    . ARG B 2 84  ? -13.336 9.173   -17.504 1.00 0.00  ? 171 ARG A NH2    6  
ATOM 9406  H H      . ARG B 2 84  ? -14.778 10.626  -10.833 1.00 0.00  ? 171 ARG A H      6  
ATOM 9407  H HA     . ARG B 2 84  ? -16.358 8.283   -11.172 1.00 0.00  ? 171 ARG A HA     6  
ATOM 9408  H HB2    . ARG B 2 84  ? -16.338 10.201  -12.666 1.00 0.00  ? 171 ARG A HB2    6  
ATOM 9409  H HB3    . ARG B 2 84  ? -14.694 9.939   -13.136 1.00 0.00  ? 171 ARG A HB3    6  
ATOM 9410  H HG2    . ARG B 2 84  ? -15.430 7.693   -14.142 1.00 0.00  ? 171 ARG A HG2    6  
ATOM 9411  H HG3    . ARG B 2 84  ? -17.091 8.132   -13.702 1.00 0.00  ? 171 ARG A HG3    6  
ATOM 9412  H HD2    . ARG B 2 84  ? -16.954 8.787   -15.935 1.00 0.00  ? 171 ARG A HD2    6  
ATOM 9413  H HD3    . ARG B 2 84  ? -16.710 10.296  -15.073 1.00 0.00  ? 171 ARG A HD3    6  
ATOM 9414  H HE     . ARG B 2 84  ? -14.365 10.270  -15.668 1.00 0.00  ? 171 ARG A HE     6  
ATOM 9415  H HH11   . ARG B 2 84  ? -15.998 7.546   -17.159 1.00 0.00  ? 171 ARG A HH11   6  
ATOM 9416  H HH12   . ARG B 2 84  ? -14.715 7.334   -18.321 1.00 0.00  ? 171 ARG A HH12   6  
ATOM 9417  H HH21   . ARG B 2 84  ? -12.853 9.970   -17.083 1.00 0.00  ? 171 ARG A HH21   6  
ATOM 9418  H HH22   . ARG B 2 84  ? -12.942 8.698   -18.295 1.00 0.00  ? 171 ARG A HH22   6  
ATOM 9419  N N      . ALA B 2 85  ? -13.159 7.751   -11.819 1.00 0.00  ? 172 ALA A N      6  
ATOM 9420  C CA     . ALA B 2 85  ? -12.108 6.725   -11.813 1.00 0.00  ? 172 ALA A CA     6  
ATOM 9421  C C      . ALA B 2 85  ? -12.049 5.906   -10.504 1.00 0.00  ? 172 ALA A C      6  
ATOM 9422  O O      . ALA B 2 85  ? -12.094 4.677   -10.541 1.00 0.00  ? 172 ALA A O      6  
ATOM 9423  C CB     . ALA B 2 85  ? -10.774 7.395   -12.149 1.00 0.00  ? 172 ALA A CB     6  
ATOM 9424  H H      . ALA B 2 85  ? -12.935 8.726   -11.975 1.00 0.00  ? 172 ALA A H      6  
ATOM 9425  H HA     . ALA B 2 85  ? -12.324 6.005   -12.605 1.00 0.00  ? 172 ALA A HA     6  
ATOM 9426  H HB1    . ALA B 2 85  ? -10.764 7.669   -13.204 1.00 0.00  ? 172 ALA A HB1    6  
ATOM 9427  H HB2    . ALA B 2 85  ? -10.635 8.291   -11.545 1.00 0.00  ? 172 ALA A HB2    6  
ATOM 9428  H HB3    . ALA B 2 85  ? -9.965  6.697   -11.948 1.00 0.00  ? 172 ALA A HB3    6  
ATOM 9429  N N      . ARG B 2 86  ? -12.035 6.568   -9.339  1.00 0.00  ? 173 ARG A N      6  
ATOM 9430  C CA     . ARG B 2 86  ? -12.284 5.976   -8.008  1.00 0.00  ? 173 ARG A CA     6  
ATOM 9431  C C      . ARG B 2 86  ? -13.502 5.059   -8.018  1.00 0.00  ? 173 ARG A C      6  
ATOM 9432  O O      . ARG B 2 86  ? -13.351 3.872   -7.768  1.00 0.00  ? 173 ARG A O      6  
ATOM 9433  C CB     . ARG B 2 86  ? -12.315 7.124   -6.973  1.00 0.00  ? 173 ARG A CB     6  
ATOM 9434  C CG     . ARG B 2 86  ? -13.384 7.062   -5.874  1.00 0.00  ? 173 ARG A CG     6  
ATOM 9435  C CD     . ARG B 2 86  ? -13.105 8.138   -4.815  1.00 0.00  ? 173 ARG A CD     6  
ATOM 9436  N NE     . ARG B 2 86  ? -14.361 8.682   -4.281  1.00 0.00  ? 173 ARG A NE     6  
ATOM 9437  C CZ     . ARG B 2 86  ? -15.160 8.173   -3.371  1.00 0.00  ? 173 ARG A CZ     6  
ATOM 9438  N NH1    . ARG B 2 86  ? -14.880 7.086   -2.712  1.00 0.00  ? 173 ARG A NH1    6  
ATOM 9439  N NH2    . ARG B 2 86  ? -16.281 8.779   -3.117  1.00 0.00  ? 173 ARG A NH2    6  
ATOM 9440  H H      . ARG B 2 86  ? -11.978 7.580   -9.411  1.00 0.00  ? 173 ARG A H      6  
ATOM 9441  H HA     . ARG B 2 86  ? -11.480 5.288   -7.726  1.00 0.00  ? 173 ARG A HA     6  
ATOM 9442  H HB2    . ARG B 2 86  ? -11.335 7.169   -6.510  1.00 0.00  ? 173 ARG A HB2    6  
ATOM 9443  H HB3    . ARG B 2 86  ? -12.461 8.072   -7.484  1.00 0.00  ? 173 ARG A HB3    6  
ATOM 9444  H HG2    . ARG B 2 86  ? -14.357 7.252   -6.323  1.00 0.00  ? 173 ARG A HG2    6  
ATOM 9445  H HG3    . ARG B 2 86  ? -13.412 6.084   -5.401  1.00 0.00  ? 173 ARG A HG3    6  
ATOM 9446  H HD2    . ARG B 2 86  ? -12.482 7.728   -4.017  1.00 0.00  ? 173 ARG A HD2    6  
ATOM 9447  H HD3    . ARG B 2 86  ? -12.555 8.962   -5.276  1.00 0.00  ? 173 ARG A HD3    6  
ATOM 9448  H HE     . ARG B 2 86  ? -14.748 9.492   -4.766  1.00 0.00  ? 173 ARG A HE     6  
ATOM 9449  H HH11   . ARG B 2 86  ? -14.036 6.568   -2.944  1.00 0.00  ? 173 ARG A HH11   6  
ATOM 9450  H HH12   . ARG B 2 86  ? -15.555 6.694   -2.081  1.00 0.00  ? 173 ARG A HH12   6  
ATOM 9451  H HH21   . ARG B 2 86  ? -16.523 9.580   -3.683  1.00 0.00  ? 173 ARG A HH21   6  
ATOM 9452  H HH22   . ARG B 2 86  ? -16.948 8.396   -2.471  1.00 0.00  ? 173 ARG A HH22   6  
ATOM 9453  N N      . GLU B 2 87  ? -14.677 5.552   -8.368  1.00 0.00  ? 174 GLU A N      6  
ATOM 9454  C CA     . GLU B 2 87  ? -15.917 4.775   -8.426  1.00 0.00  ? 174 GLU A CA     6  
ATOM 9455  C C      . GLU B 2 87  ? -15.850 3.552   -9.351  1.00 0.00  ? 174 GLU A C      6  
ATOM 9456  O O      . GLU B 2 87  ? -16.520 2.549   -9.082  1.00 0.00  ? 174 GLU A O      6  
ATOM 9457  C CB     . GLU B 2 87  ? -17.053 5.696   -8.869  1.00 0.00  ? 174 GLU A CB     6  
ATOM 9458  C CG     . GLU B 2 87  ? -17.465 6.718   -7.810  1.00 0.00  ? 174 GLU A CG     6  
ATOM 9459  C CD     . GLU B 2 87  ? -18.473 6.134   -6.803  1.00 0.00  ? 174 GLU A CD     6  
ATOM 9460  O OE1    . GLU B 2 87  ? -18.049 5.496   -5.810  1.00 0.00  ? 174 GLU A OE1    6  
ATOM 9461  O OE2    . GLU B 2 87  ? -19.703 6.302   -7.003  1.00 0.00  ? 174 GLU A OE2    6  
ATOM 9462  H H      . GLU B 2 87  ? -14.732 6.549   -8.538  1.00 0.00  ? 174 GLU A H      6  
ATOM 9463  H HA     . GLU B 2 87  ? -16.130 4.389   -7.431  1.00 0.00  ? 174 GLU A HA     6  
ATOM 9464  H HB2    . GLU B 2 87  ? -16.750 6.230   -9.769  1.00 0.00  ? 174 GLU A HB2    6  
ATOM 9465  H HB3    . GLU B 2 87  ? -17.916 5.098   -9.127  1.00 0.00  ? 174 GLU A HB3    6  
ATOM 9466  H HG2    . GLU B 2 87  ? -16.591 7.098   -7.278  1.00 0.00  ? 174 GLU A HG2    6  
ATOM 9467  H HG3    . GLU B 2 87  ? -17.902 7.553   -8.352  1.00 0.00  ? 174 GLU A HG3    6  
ATOM 9468  N N      . LYS B 2 88  ? -15.022 3.589   -10.405 1.00 0.00  ? 175 LYS A N      6  
ATOM 9469  C CA     . LYS B 2 88  ? -14.693 2.422   -11.220 1.00 0.00  ? 175 LYS A CA     6  
ATOM 9470  C C      . LYS B 2 88  ? -13.838 1.408   -10.427 1.00 0.00  ? 175 LYS A C      6  
ATOM 9471  O O      . LYS B 2 88  ? -14.240 0.245   -10.342 1.00 0.00  ? 175 LYS A O      6  
ATOM 9472  C CB     . LYS B 2 88  ? -14.119 2.933   -12.560 1.00 0.00  ? 175 LYS A CB     6  
ATOM 9473  C CG     . LYS B 2 88  ? -13.124 2.006   -13.248 1.00 0.00  ? 175 LYS A CG     6  
ATOM 9474  C CD     . LYS B 2 88  ? -13.724 0.688   -13.759 1.00 0.00  ? 175 LYS A CD     6  
ATOM 9475  C CE     . LYS B 2 88  ? -12.611 -0.174  -14.370 1.00 0.00  ? 175 LYS A CE     6  
ATOM 9476  N NZ     . LYS B 2 88  ? -13.151 -1.439  -14.931 1.00 0.00  ? 175 LYS A NZ     6  
ATOM 9477  H H      . LYS B 2 88  ? -14.504 4.445   -10.608 1.00 0.00  ? 175 LYS A H      6  
ATOM 9478  H HA     . LYS B 2 88  ? -15.617 1.894   -11.454 1.00 0.00  ? 175 LYS A HA     6  
ATOM 9479  H HB2    . LYS B 2 88  ? -14.940 3.147   -13.243 1.00 0.00  ? 175 LYS A HB2    6  
ATOM 9480  H HB3    . LYS B 2 88  ? -13.597 3.876   -12.398 1.00 0.00  ? 175 LYS A HB3    6  
ATOM 9481  H HG2    . LYS B 2 88  ? -12.699 2.537   -14.095 1.00 0.00  ? 175 LYS A HG2    6  
ATOM 9482  H HG3    . LYS B 2 88  ? -12.331 1.829   -12.527 1.00 0.00  ? 175 LYS A HG3    6  
ATOM 9483  H HD2    . LYS B 2 88  ? -14.200 0.146   -12.946 1.00 0.00  ? 175 LYS A HD2    6  
ATOM 9484  H HD3    . LYS B 2 88  ? -14.478 0.912   -14.515 1.00 0.00  ? 175 LYS A HD3    6  
ATOM 9485  H HE2    . LYS B 2 88  ? -12.111 0.396   -15.160 1.00 0.00  ? 175 LYS A HE2    6  
ATOM 9486  H HE3    . LYS B 2 88  ? -11.876 -0.394  -13.592 1.00 0.00  ? 175 LYS A HE3    6  
ATOM 9487  H HZ1    . LYS B 2 88  ? -13.605 -1.992  -14.216 1.00 0.00  ? 175 LYS A HZ1    6  
ATOM 9488  H HZ2    . LYS B 2 88  ? -13.827 -1.257  -15.660 1.00 0.00  ? 175 LYS A HZ2    6  
ATOM 9489  H HZ3    . LYS B 2 88  ? -12.416 -2.004  -15.336 1.00 0.00  ? 175 LYS A HZ3    6  
ATOM 9490  N N      . LEU B 2 89  ? -12.691 1.788   -9.838  1.00 0.00  ? 176 LEU A N      6  
ATOM 9491  C CA     . LEU B 2 89  ? -11.795 0.857   -9.155  1.00 0.00  ? 176 LEU A CA     6  
ATOM 9492  C C      . LEU B 2 89  ? -12.283 0.407   -7.765  1.00 0.00  ? 176 LEU A C      6  
ATOM 9493  O O      . LEU B 2 89  ? -11.846 -0.615  -7.241  1.00 0.00  ? 176 LEU A O      6  
ATOM 9494  C CB     . LEU B 2 89  ? -10.389 1.467   -9.073  1.00 0.00  ? 176 LEU A CB     6  
ATOM 9495  C CG     . LEU B 2 89  ? -9.827  2.085   -10.364 1.00 0.00  ? 176 LEU A CG     6  
ATOM 9496  C CD1    . LEU B 2 89  ? -8.452  2.689   -10.134 1.00 0.00  ? 176 LEU A CD1    6  
ATOM 9497  C CD2    . LEU B 2 89  ? -9.704  1.068   -11.499 1.00 0.00  ? 176 LEU A CD2    6  
ATOM 9498  H H      . LEU B 2 89  ? -12.326 2.728   -9.890  1.00 0.00  ? 176 LEU A H      6  
ATOM 9499  H HA     . LEU B 2 89  ? -11.722 -0.038  -9.764  1.00 0.00  ? 176 LEU A HA     6  
ATOM 9500  H HB2    . LEU B 2 89  ? -10.341 2.189   -8.264  1.00 0.00  ? 176 LEU A HB2    6  
ATOM 9501  H HB3    . LEU B 2 89  ? -9.748  0.660   -8.801  1.00 0.00  ? 176 LEU A HB3    6  
ATOM 9502  H HG     . LEU B 2 89  ? -10.467 2.912   -10.649 1.00 0.00  ? 176 LEU A HG     6  
ATOM 9503  H HD11   . LEU B 2 89  ? -8.572  3.518   -9.446  1.00 0.00  ? 176 LEU A HD11   6  
ATOM 9504  H HD12   . LEU B 2 89  ? -7.771  1.953   -9.717  1.00 0.00  ? 176 LEU A HD12   6  
ATOM 9505  H HD13   . LEU B 2 89  ? -8.047  3.069   -11.070 1.00 0.00  ? 176 LEU A HD13   6  
ATOM 9506  H HD21   . LEU B 2 89  ? -8.966  0.307   -11.243 1.00 0.00  ? 176 LEU A HD21   6  
ATOM 9507  H HD22   . LEU B 2 89  ? -10.656 0.577   -11.681 1.00 0.00  ? 176 LEU A HD22   6  
ATOM 9508  H HD23   . LEU B 2 89  ? -9.393  1.577   -12.408 1.00 0.00  ? 176 LEU A HD23   6  
ATOM 9509  N N      . HIS B 2 90  ? -13.209 1.147   -7.164  1.00 0.00  ? 177 HIS A N      6  
ATOM 9510  C CA     . HIS B 2 90  ? -13.907 0.842   -5.918  1.00 0.00  ? 177 HIS A CA     6  
ATOM 9511  C C      . HIS B 2 90  ? -14.929 -0.290  -6.138  1.00 0.00  ? 177 HIS A C      6  
ATOM 9512  O O      . HIS B 2 90  ? -16.088 -0.054  -6.479  1.00 0.00  ? 177 HIS A O      6  
ATOM 9513  C CB     . HIS B 2 90  ? -14.511 2.167   -5.431  1.00 0.00  ? 177 HIS A CB     6  
ATOM 9514  C CG     . HIS B 2 90  ? -14.898 2.264   -3.992  1.00 0.00  ? 177 HIS A CG     6  
ATOM 9515  N ND1    . HIS B 2 90  ? -14.935 1.217   -3.084  1.00 0.00  ? 177 HIS A ND1    6  
ATOM 9516  C CD2    . HIS B 2 90  ? -14.934 3.447   -3.319  1.00 0.00  ? 177 HIS A CD2    6  
ATOM 9517  C CE1    . HIS B 2 90  ? -14.999 1.802   -1.883  1.00 0.00  ? 177 HIS A CE1    6  
ATOM 9518  N NE2    . HIS B 2 90  ? -15.017 3.136   -1.982  1.00 0.00  ? 177 HIS A NE2    6  
ATOM 9519  H H      . HIS B 2 90  ? -13.447 2.013   -7.636  1.00 0.00  ? 177 HIS A H      6  
ATOM 9520  H HA     . HIS B 2 90  ? -13.183 0.500   -5.179  1.00 0.00  ? 177 HIS A HA     6  
ATOM 9521  H HB2    . HIS B 2 90  ? -13.755 2.927   -5.549  1.00 0.00  ? 177 HIS A HB2    6  
ATOM 9522  H HB3    . HIS B 2 90  ? -15.332 2.494   -6.051  1.00 0.00  ? 177 HIS A HB3    6  
ATOM 9523  H HD2    . HIS B 2 90  ? -14.762 4.417   -3.766  1.00 0.00  ? 177 HIS A HD2    6  
ATOM 9524  H HE1    . HIS B 2 90  ? -14.913 1.276   -0.958  1.00 0.00  ? 177 HIS A HE1    6  
ATOM 9525  H HE2    . HIS B 2 90  ? -14.981 3.765   -1.187  1.00 0.00  ? 177 HIS A HE2    6  
ATOM 9526  N N      . GLY B 2 91  ? -14.456 -1.538  -6.027  1.00 0.00  ? 178 GLY A N      6  
ATOM 9527  C CA     . GLY B 2 91  ? -15.128 -2.760  -6.480  1.00 0.00  ? 178 GLY A CA     6  
ATOM 9528  C C      . GLY B 2 91  ? -14.363 -3.549  -7.559  1.00 0.00  ? 178 GLY A C      6  
ATOM 9529  O O      . GLY B 2 91  ? -14.851 -4.592  -7.987  1.00 0.00  ? 178 GLY A O      6  
ATOM 9530  H H      . GLY B 2 91  ? -13.519 -1.643  -5.649  1.00 0.00  ? 178 GLY A H      6  
ATOM 9531  H HA2    . GLY B 2 91  ? -15.265 -3.414  -5.623  1.00 0.00  ? 178 GLY A HA2    6  
ATOM 9532  H HA3    . GLY B 2 91  ? -16.117 -2.524  -6.875  1.00 0.00  ? 178 GLY A HA3    6  
ATOM 9533  N N      . THR B 2 92  ? -13.179 -3.098  -7.997  1.00 0.00  ? 179 THR A N      6  
ATOM 9534  C CA     . THR B 2 92  ? -12.287 -3.836  -8.915  1.00 0.00  ? 179 THR A CA     6  
ATOM 9535  C C      . THR B 2 92  ? -11.750 -5.091  -8.235  1.00 0.00  ? 179 THR A C      6  
ATOM 9536  O O      . THR B 2 92  ? -10.959 -5.010  -7.294  1.00 0.00  ? 179 THR A O      6  
ATOM 9537  C CB     . THR B 2 92  ? -11.147 -2.948  -9.457  1.00 0.00  ? 179 THR A CB     6  
ATOM 9538  O OG1    . THR B 2 92  ? -11.655 -2.241  -10.568 1.00 0.00  ? 179 THR A OG1    6  
ATOM 9539  C CG2    . THR B 2 92  ? -9.880  -3.639  -9.963  1.00 0.00  ? 179 THR A CG2    6  
ATOM 9540  H H      . THR B 2 92  ? -12.819 -2.245  -7.588  1.00 0.00  ? 179 THR A H      6  
ATOM 9541  H HA     . THR B 2 92  ? -12.882 -4.165  -9.769  1.00 0.00  ? 179 THR A HA     6  
ATOM 9542  H HB     . THR B 2 92  ? -10.829 -2.249  -8.683  1.00 0.00  ? 179 THR A HB     6  
ATOM 9543  H HG1    . THR B 2 92  ? -11.765 -2.869  -11.302 1.00 0.00  ? 179 THR A HG1    6  
ATOM 9544  H HG21   . THR B 2 92  ? -9.341  -4.094  -9.133  1.00 0.00  ? 179 THR A HG21   6  
ATOM 9545  H HG22   . THR B 2 92  ? -10.123 -4.397  -10.702 1.00 0.00  ? 179 THR A HG22   6  
ATOM 9546  H HG23   . THR B 2 92  ? -9.221  -2.884  -10.402 1.00 0.00  ? 179 THR A HG23   6  
ATOM 9547  N N      . VAL B 2 93  ? -12.223 -6.251  -8.702  1.00 0.00  ? 180 VAL A N      6  
ATOM 9548  C CA     . VAL B 2 93  ? -11.771 -7.580  -8.278  1.00 0.00  ? 180 VAL A CA     6  
ATOM 9549  C C      . VAL B 2 93  ? -10.448 -7.927  -8.964  1.00 0.00  ? 180 VAL A C      6  
ATOM 9550  O O      . VAL B 2 93  ? -10.407 -8.216  -10.161 1.00 0.00  ? 180 VAL A O      6  
ATOM 9551  C CB     . VAL B 2 93  ? -12.841 -8.663  -8.505  1.00 0.00  ? 180 VAL A CB     6  
ATOM 9552  C CG1    . VAL B 2 93  ? -12.393 -10.034 -7.979  1.00 0.00  ? 180 VAL A CG1    6  
ATOM 9553  C CG2    . VAL B 2 93  ? -14.125 -8.301  -7.751  1.00 0.00  ? 180 VAL A CG2    6  
ATOM 9554  H H      . VAL B 2 93  ? -12.906 -6.200  -9.444  1.00 0.00  ? 180 VAL A H      6  
ATOM 9555  H HA     . VAL B 2 93  ? -11.605 -7.539  -7.211  1.00 0.00  ? 180 VAL A HA     6  
ATOM 9556  H HB     . VAL B 2 93  ? -13.050 -8.751  -9.566  1.00 0.00  ? 180 VAL A HB     6  
ATOM 9557  H HG11   . VAL B 2 93  ? -11.486 -10.362 -8.485  1.00 0.00  ? 180 VAL A HG11   6  
ATOM 9558  H HG12   . VAL B 2 93  ? -12.222 -9.982  -6.905  1.00 0.00  ? 180 VAL A HG12   6  
ATOM 9559  H HG13   . VAL B 2 93  ? -13.172 -10.772 -8.166  1.00 0.00  ? 180 VAL A HG13   6  
ATOM 9560  H HG21   . VAL B 2 93  ? -13.896 -8.202  -6.694  1.00 0.00  ? 180 VAL A HG21   6  
ATOM 9561  H HG22   . VAL B 2 93  ? -14.534 -7.357  -8.107  1.00 0.00  ? 180 VAL A HG22   6  
ATOM 9562  H HG23   . VAL B 2 93  ? -14.878 -9.076  -7.889  1.00 0.00  ? 180 VAL A HG23   6  
ATOM 9563  N N      . VAL B 2 94  ? -9.363  -7.901  -8.190  1.00 0.00  ? 181 VAL A N      6  
ATOM 9564  C CA     . VAL B 2 94  ? -7.999  -8.285  -8.579  1.00 0.00  ? 181 VAL A CA     6  
ATOM 9565  C C      . VAL B 2 94  ? -7.501  -9.380  -7.634  1.00 0.00  ? 181 VAL A C      6  
ATOM 9566  O O      . VAL B 2 94  ? -7.776  -9.339  -6.439  1.00 0.00  ? 181 VAL A O      6  
ATOM 9567  C CB     . VAL B 2 94  ? -7.099  -7.034  -8.589  1.00 0.00  ? 181 VAL A CB     6  
ATOM 9568  C CG1    . VAL B 2 94  ? -6.808  -6.502  -7.185  1.00 0.00  ? 181 VAL A CG1    6  
ATOM 9569  C CG2    . VAL B 2 94  ? -5.778  -7.299  -9.317  1.00 0.00  ? 181 VAL A CG2    6  
ATOM 9570  H H      . VAL B 2 94  ? -9.500  -7.627  -7.220  1.00 0.00  ? 181 VAL A H      6  
ATOM 9571  H HA     . VAL B 2 94  ? -8.018  -8.691  -9.591  1.00 0.00  ? 181 VAL A HA     6  
ATOM 9572  H HB     . VAL B 2 94  ? -7.621  -6.248  -9.139  1.00 0.00  ? 181 VAL A HB     6  
ATOM 9573  H HG11   . VAL B 2 94  ? -7.746  -6.335  -6.654  1.00 0.00  ? 181 VAL A HG11   6  
ATOM 9574  H HG12   . VAL B 2 94  ? -6.209  -7.228  -6.632  1.00 0.00  ? 181 VAL A HG12   6  
ATOM 9575  H HG13   . VAL B 2 94  ? -6.275  -5.559  -7.256  1.00 0.00  ? 181 VAL A HG13   6  
ATOM 9576  H HG21   . VAL B 2 94  ? -5.190  -8.044  -8.783  1.00 0.00  ? 181 VAL A HG21   6  
ATOM 9577  H HG22   . VAL B 2 94  ? -5.976  -7.652  -10.331 1.00 0.00  ? 181 VAL A HG22   6  
ATOM 9578  H HG23   . VAL B 2 94  ? -5.206  -6.367  -9.375  1.00 0.00  ? 181 VAL A HG23   6  
ATOM 9579  N N      . GLU B 2 95  ? -6.841  -10.418 -8.152  1.00 0.00  ? 182 GLU A N      6  
ATOM 9580  C CA     . GLU B 2 95  ? -6.477  -11.644 -7.406  1.00 0.00  ? 182 GLU A CA     6  
ATOM 9581  C C      . GLU B 2 95  ? -7.649  -12.337 -6.654  1.00 0.00  ? 182 GLU A C      6  
ATOM 9582  O O      . GLU B 2 95  ? -7.432  -13.129 -5.734  1.00 0.00  ? 182 GLU A O      6  
ATOM 9583  C CB     . GLU B 2 95  ? -5.281  -11.378 -6.467  1.00 0.00  ? 182 GLU A CB     6  
ATOM 9584  C CG     . GLU B 2 95  ? -4.040  -10.754 -7.119  1.00 0.00  ? 182 GLU A CG     6  
ATOM 9585  C CD     . GLU B 2 95  ? -3.478  -11.635 -8.252  1.00 0.00  ? 182 GLU A CD     6  
ATOM 9586  O OE1    . GLU B 2 95  ? -2.695  -12.574 -7.963  1.00 0.00  ? 182 GLU A OE1    6  
ATOM 9587  O OE2    . GLU B 2 95  ? -3.815  -11.401 -9.438  1.00 0.00  ? 182 GLU A OE2    6  
ATOM 9588  H H      . GLU B 2 95  ? -6.622  -10.391 -9.142  1.00 0.00  ? 182 GLU A H      6  
ATOM 9589  H HA     . GLU B 2 95  ? -6.152  -12.371 -8.145  1.00 0.00  ? 182 GLU A HA     6  
ATOM 9590  H HB2    . GLU B 2 95  ? -5.615  -10.731 -5.659  1.00 0.00  ? 182 GLU A HB2    6  
ATOM 9591  H HB3    . GLU B 2 95  ? -4.975  -12.316 -6.009  1.00 0.00  ? 182 GLU A HB3    6  
ATOM 9592  H HG2    . GLU B 2 95  ? -4.283  -9.757  -7.499  1.00 0.00  ? 182 GLU A HG2    6  
ATOM 9593  H HG3    . GLU B 2 95  ? -3.280  -10.618 -6.346  1.00 0.00  ? 182 GLU A HG3    6  
ATOM 9594  N N      . GLY B 2 96  ? -8.901  -12.045 -7.030  1.00 0.00  ? 183 GLY A N      6  
ATOM 9595  C CA     . GLY B 2 96  ? -10.107 -12.500 -6.325  1.00 0.00  ? 183 GLY A CA     6  
ATOM 9596  C C      . GLY B 2 96  ? -10.475 -11.652 -5.097  1.00 0.00  ? 183 GLY A C      6  
ATOM 9597  O O      . GLY B 2 96  ? -10.994 -12.183 -4.112  1.00 0.00  ? 183 GLY A O      6  
ATOM 9598  H H      . GLY B 2 96  ? -8.998  -11.440 -7.831  1.00 0.00  ? 183 GLY A H      6  
ATOM 9599  H HA2    . GLY B 2 96  ? -10.943 -12.473 -7.023  1.00 0.00  ? 183 GLY A HA2    6  
ATOM 9600  H HA3    . GLY B 2 96  ? -9.974  -13.533 -6.005  1.00 0.00  ? 183 GLY A HA3    6  
ATOM 9601  N N      . ARG B 2 97  ? -10.198 -10.337 -5.132  1.00 0.00  ? 184 ARG A N      6  
ATOM 9602  C CA     . ARG B 2 97  ? -10.319 -9.373  -4.031  1.00 0.00  ? 184 ARG A CA     6  
ATOM 9603  C C      . ARG B 2 97  ? -10.740 -8.018  -4.550  1.00 0.00  ? 184 ARG A C      6  
ATOM 9604  O O      . ARG B 2 97  ? -10.108 -7.488  -5.460  1.00 0.00  ? 184 ARG A O      6  
ATOM 9605  C CB     . ARG B 2 97  ? -8.944  -9.153  -3.404  1.00 0.00  ? 184 ARG A CB     6  
ATOM 9606  C CG     . ARG B 2 97  ? -9.005  -8.608  -1.980  1.00 0.00  ? 184 ARG A CG     6  
ATOM 9607  C CD     . ARG B 2 97  ? -9.319  -9.678  -0.930  1.00 0.00  ? 184 ARG A CD     6  
ATOM 9608  N NE     . ARG B 2 97  ? -9.459  -9.070  0.405   1.00 0.00  ? 184 ARG A NE     6  
ATOM 9609  C CZ     . ARG B 2 97  ? -9.568  -9.702  1.561   1.00 0.00  ? 184 ARG A CZ     6  
ATOM 9610  N NH1    . ARG B 2 97  ? -9.439  -10.993 1.665   1.00 0.00  ? 184 ARG A NH1    6  
ATOM 9611  N NH2    . ARG B 2 97  ? -9.810  -9.034  2.649   1.00 0.00  ? 184 ARG A NH2    6  
ATOM 9612  H H      . ARG B 2 97  ? -9.799  -9.958  -5.981  1.00 0.00  ? 184 ARG A H      6  
ATOM 9613  H HA     . ARG B 2 97  ? -11.033 -9.738  -3.290  1.00 0.00  ? 184 ARG A HA     6  
ATOM 9614  H HB2    . ARG B 2 97  ? -8.377  -10.063 -3.450  1.00 0.00  ? 184 ARG A HB2    6  
ATOM 9615  H HB3    . ARG B 2 97  ? -8.381  -8.439  -4.003  1.00 0.00  ? 184 ARG A HB3    6  
ATOM 9616  H HG2    . ARG B 2 97  ? -8.033  -8.188  -1.749  1.00 0.00  ? 184 ARG A HG2    6  
ATOM 9617  H HG3    . ARG B 2 97  ? -9.749  -7.808  -1.942  1.00 0.00  ? 184 ARG A HG3    6  
ATOM 9618  H HD2    . ARG B 2 97  ? -10.249 -10.188 -1.194  1.00 0.00  ? 184 ARG A HD2    6  
ATOM 9619  H HD3    . ARG B 2 97  ? -8.507  -10.405 -0.924  1.00 0.00  ? 184 ARG A HD3    6  
ATOM 9620  H HE     . ARG B 2 97  ? -9.475  -8.057  0.446   1.00 0.00  ? 184 ARG A HE     6  
ATOM 9621  H HH11   . ARG B 2 97  ? -9.251  -11.533 0.837   1.00 0.00  ? 184 ARG A HH11   6  
ATOM 9622  H HH12   . ARG B 2 97  ? -9.513  -11.452 2.556   1.00 0.00  ? 184 ARG A HH12   6  
ATOM 9623  H HH21   . ARG B 2 97  ? -10.068 -8.054  2.581   1.00 0.00  ? 184 ARG A HH21   6  
ATOM 9624  H HH22   . ARG B 2 97  ? -9.920  -9.508  3.530   1.00 0.00  ? 184 ARG A HH22   6  
ATOM 9625  N N      . LYS B 2 98  ? -11.750 -7.412  -3.939  1.00 0.00  ? 185 LYS A N      6  
ATOM 9626  C CA     . LYS B 2 98  ? -12.120 -6.056  -4.276  1.00 0.00  ? 185 LYS A CA     6  
ATOM 9627  C C      . LYS B 2 98  ? -11.201 -5.017  -3.626  1.00 0.00  ? 185 LYS A C      6  
ATOM 9628  O O      . LYS B 2 98  ? -11.125 -4.967  -2.400  1.00 0.00  ? 185 LYS A O      6  
ATOM 9629  C CB     . LYS B 2 98  ? -13.577 -5.810  -3.868  1.00 0.00  ? 185 LYS A CB     6  
ATOM 9630  C CG     . LYS B 2 98  ? -14.608 -6.555  -4.709  1.00 0.00  ? 185 LYS A CG     6  
ATOM 9631  C CD     . LYS B 2 98  ? -16.040 -6.277  -4.232  1.00 0.00  ? 185 LYS A CD     6  
ATOM 9632  C CE     . LYS B 2 98  ? -17.033 -6.978  -5.167  1.00 0.00  ? 185 LYS A CE     6  
ATOM 9633  N NZ     . LYS B 2 98  ? -18.437 -6.752  -4.738  1.00 0.00  ? 185 LYS A NZ     6  
ATOM 9634  H H      . LYS B 2 98  ? -12.256 -7.881  -3.214  1.00 0.00  ? 185 LYS A H      6  
ATOM 9635  H HA     . LYS B 2 98  ? -11.978 -5.991  -5.344  1.00 0.00  ? 185 LYS A HA     6  
ATOM 9636  H HB2    . LYS B 2 98  ? -13.719 -6.048  -2.812  1.00 0.00  ? 185 LYS A HB2    6  
ATOM 9637  H HB3    . LYS B 2 98  ? -13.763 -4.767  -4.017  1.00 0.00  ? 185 LYS A HB3    6  
ATOM 9638  H HG2    . LYS B 2 98  ? -14.506 -6.205  -5.737  1.00 0.00  ? 185 LYS A HG2    6  
ATOM 9639  H HG3    . LYS B 2 98  ? -14.417 -7.625  -4.639  1.00 0.00  ? 185 LYS A HG3    6  
ATOM 9640  H HD2    . LYS B 2 98  ? -16.154 -6.655  -3.216  1.00 0.00  ? 185 LYS A HD2    6  
ATOM 9641  H HD3    . LYS B 2 98  ? -16.224 -5.203  -4.239  1.00 0.00  ? 185 LYS A HD3    6  
ATOM 9642  H HE2    . LYS B 2 98  ? -16.887 -6.599  -6.185  1.00 0.00  ? 185 LYS A HE2    6  
ATOM 9643  H HE3    . LYS B 2 98  ? -16.810 -8.049  -5.174  1.00 0.00  ? 185 LYS A HE3    6  
ATOM 9644  H HZ1    . LYS B 2 98  ? -18.595 -7.119  -3.809  1.00 0.00  ? 185 LYS A HZ1    6  
ATOM 9645  H HZ2    . LYS B 2 98  ? -18.667 -5.769  -4.724  1.00 0.00  ? 185 LYS A HZ2    6  
ATOM 9646  H HZ3    . LYS B 2 98  ? -19.084 -7.212  -5.363  1.00 0.00  ? 185 LYS A HZ3    6  
ATOM 9647  N N      . ILE B 2 99  ? -10.564 -4.151  -4.420  1.00 0.00  ? 186 ILE A N      6  
ATOM 9648  C CA     . ILE B 2 99  ? -10.067 -2.858  -3.910  1.00 0.00  ? 186 ILE A CA     6  
ATOM 9649  C C      . ILE B 2 99  ? -11.266 -1.972  -3.524  1.00 0.00  ? 186 ILE A C      6  
ATOM 9650  O O      . ILE B 2 99  ? -12.277 -1.945  -4.228  1.00 0.00  ? 186 ILE A O      6  
ATOM 9651  C CB     . ILE B 2 99  ? -9.161  -2.126  -4.934  1.00 0.00  ? 186 ILE A CB     6  
ATOM 9652  C CG1    . ILE B 2 99  ? -7.977  -3.008  -5.381  1.00 0.00  ? 186 ILE A CG1    6  
ATOM 9653  C CG2    . ILE B 2 99  ? -8.639  -0.810  -4.335  1.00 0.00  ? 186 ILE A CG2    6  
ATOM 9654  C CD1    . ILE B 2 99  ? -6.928  -2.261  -6.219  1.00 0.00  ? 186 ILE A CD1    6  
ATOM 9655  H H      . ILE B 2 99  ? -10.652 -4.292  -5.422  1.00 0.00  ? 186 ILE A H      6  
ATOM 9656  H HA     . ILE B 2 99  ? -9.479  -3.040  -3.009  1.00 0.00  ? 186 ILE A HA     6  
ATOM 9657  H HB     . ILE B 2 99  ? -9.752  -1.876  -5.814  1.00 0.00  ? 186 ILE A HB     6  
ATOM 9658  H HG12   . ILE B 2 99  ? -7.479  -3.407  -4.497  1.00 0.00  ? 186 ILE A HG12   6  
ATOM 9659  H HG13   . ILE B 2 99  ? -8.359  -3.843  -5.972  1.00 0.00  ? 186 ILE A HG13   6  
ATOM 9660  H HG21   . ILE B 2 99  ? -9.467  -0.180  -4.029  1.00 0.00  ? 186 ILE A HG21   6  
ATOM 9661  H HG22   . ILE B 2 99  ? -7.999  -0.996  -3.471  1.00 0.00  ? 186 ILE A HG22   6  
ATOM 9662  H HG23   . ILE B 2 99  ? -8.089  -0.241  -5.085  1.00 0.00  ? 186 ILE A HG23   6  
ATOM 9663  H HD11   . ILE B 2 99  ? -7.429  -1.632  -6.964  1.00 0.00  ? 186 ILE A HD11   6  
ATOM 9664  H HD12   . ILE B 2 99  ? -6.308  -1.644  -5.567  1.00 0.00  ? 186 ILE A HD12   6  
ATOM 9665  H HD13   . ILE B 2 99  ? -6.283  -2.982  -6.716  1.00 0.00  ? 186 ILE A HD13   6  
ATOM 9666  N N      . GLU B 2 100 ? -11.145 -1.213  -2.435  1.00 0.00  ? 187 GLU A N      6  
ATOM 9667  C CA     . GLU B 2 100 ? -12.136 -0.240  -1.955  1.00 0.00  ? 187 GLU A CA     6  
ATOM 9668  C C      . GLU B 2 100 ? -11.511 1.164   -1.833  1.00 0.00  ? 187 GLU A C      6  
ATOM 9669  O O      . GLU B 2 100 ? -10.757 1.415   -0.893  1.00 0.00  ? 187 GLU A O      6  
ATOM 9670  C CB     . GLU B 2 100 ? -12.721 -0.729  -0.619  1.00 0.00  ? 187 GLU A CB     6  
ATOM 9671  C CG     . GLU B 2 100 ? -13.644 -1.938  -0.796  1.00 0.00  ? 187 GLU A CG     6  
ATOM 9672  C CD     . GLU B 2 100 ? -14.336 -2.293  0.532   1.00 0.00  ? 187 GLU A CD     6  
ATOM 9673  O OE1    . GLU B 2 100 ? -15.426 -1.738  0.821   1.00 0.00  ? 187 GLU A OE1    6  
ATOM 9674  O OE2    . GLU B 2 100 ? -13.805 -3.133  1.300   1.00 0.00  ? 187 GLU A OE2    6  
ATOM 9675  H H      . GLU B 2 100 ? -10.304 -1.342  -1.882  1.00 0.00  ? 187 GLU A H      6  
ATOM 9676  H HA     . GLU B 2 100 ? -12.947 -0.173  -2.674  1.00 0.00  ? 187 GLU A HA     6  
ATOM 9677  H HB2    . GLU B 2 100 ? -11.911 -0.997  0.060   1.00 0.00  ? 187 GLU A HB2    6  
ATOM 9678  H HB3    . GLU B 2 100 ? -13.293 0.080   -0.163  1.00 0.00  ? 187 GLU A HB3    6  
ATOM 9679  H HG2    . GLU B 2 100 ? -14.396 -1.706  -1.551  1.00 0.00  ? 187 GLU A HG2    6  
ATOM 9680  H HG3    . GLU B 2 100 ? -13.062 -2.793  -1.154  1.00 0.00  ? 187 GLU A HG3    6  
ATOM 9681  N N      . VAL B 2 101 ? -11.775 2.080   -2.785  1.00 0.00  ? 188 VAL A N      6  
ATOM 9682  C CA     . VAL B 2 101 ? -11.071 3.380   -2.886  1.00 0.00  ? 188 VAL A CA     6  
ATOM 9683  C C      . VAL B 2 101 ? -11.864 4.560   -2.298  1.00 0.00  ? 188 VAL A C      6  
ATOM 9684  O O      . VAL B 2 101 ? -12.637 5.269   -2.948  1.00 0.00  ? 188 VAL A O      6  
ATOM 9685  C CB     . VAL B 2 101 ? -10.368 3.642   -4.248  1.00 0.00  ? 188 VAL A CB     6  
ATOM 9686  C CG1    . VAL B 2 101 ? -9.853  2.372   -4.938  1.00 0.00  ? 188 VAL A CG1    6  
ATOM 9687  C CG2    . VAL B 2 101 ? -11.092 4.465   -5.278  1.00 0.00  ? 188 VAL A CG2    6  
ATOM 9688  H H      . VAL B 2 101 ? -12.465 1.853   -3.485  1.00 0.00  ? 188 VAL A H      6  
ATOM 9689  H HA     . VAL B 2 101 ? -10.245 3.270   -2.200  1.00 0.00  ? 188 VAL A HA     6  
ATOM 9690  H HB     . VAL B 2 101 ? -9.519  4.280   -4.066  1.00 0.00  ? 188 VAL A HB     6  
ATOM 9691  H HG11   . VAL B 2 101 ? -9.091  1.926   -4.306  1.00 0.00  ? 188 VAL A HG11   6  
ATOM 9692  H HG12   . VAL B 2 101 ? -10.663 1.662   -5.122  1.00 0.00  ? 188 VAL A HG12   6  
ATOM 9693  H HG13   . VAL B 2 101 ? -9.410  2.598   -5.908  1.00 0.00  ? 188 VAL A HG13   6  
ATOM 9694  H HG21   . VAL B 2 101 ? -12.032 4.004   -5.518  1.00 0.00  ? 188 VAL A HG21   6  
ATOM 9695  H HG22   . VAL B 2 101 ? -11.236 5.466   -4.878  1.00 0.00  ? 188 VAL A HG22   6  
ATOM 9696  H HG23   . VAL B 2 101 ? -10.454 4.542   -6.151  1.00 0.00  ? 188 VAL A HG23   6  
ATOM 9697  N N      . ASN B 2 102 ? -11.701 4.768   -0.998  1.00 0.00  ? 189 ASN A N      6  
ATOM 9698  C CA     . ASN B 2 102 ? -12.311 5.871   -0.259  1.00 0.00  ? 189 ASN A CA     6  
ATOM 9699  C C      . ASN B 2 102 ? -11.521 7.167   -0.460  1.00 0.00  ? 189 ASN A C      6  
ATOM 9700  O O      . ASN B 2 102 ? -10.292 7.148   -0.482  1.00 0.00  ? 189 ASN A O      6  
ATOM 9701  C CB     . ASN B 2 102 ? -12.325 5.529   1.232   1.00 0.00  ? 189 ASN A CB     6  
ATOM 9702  C CG     . ASN B 2 102 ? -12.969 4.189   1.534   1.00 0.00  ? 189 ASN A CG     6  
ATOM 9703  O OD1    . ASN B 2 102 ? -14.088 3.899   1.126   1.00 0.00  ? 189 ASN A OD1    6  
ATOM 9704  N ND2    . ASN B 2 102 ? -12.278 3.331   2.246   1.00 0.00  ? 189 ASN A ND2    6  
ATOM 9705  H H      . ASN B 2 102 ? -10.933 4.257   -0.584  1.00 0.00  ? 189 ASN A H      6  
ATOM 9706  H HA     . ASN B 2 102 ? -13.337 6.023   -0.593  1.00 0.00  ? 189 ASN A HA     6  
ATOM 9707  H HB2    . ASN B 2 102 ? -11.299 5.535   1.592   1.00 0.00  ? 189 ASN A HB2    6  
ATOM 9708  H HB3    . ASN B 2 102 ? -12.862 6.313   1.764   1.00 0.00  ? 189 ASN A HB3    6  
ATOM 9709  H HD21   . ASN B 2 102 ? -11.345 3.580   2.559   1.00 0.00  ? 189 ASN A HD21   6  
ATOM 9710  H HD22   . ASN B 2 102 ? -12.692 2.440   2.457   1.00 0.00  ? 189 ASN A HD22   6  
ATOM 9711  N N      . ASN B 2 103 ? -12.202 8.313   -0.509  1.00 0.00  ? 190 ASN A N      6  
ATOM 9712  C CA     . ASN B 2 103 ? -11.507 9.602   -0.398  1.00 0.00  ? 190 ASN A CA     6  
ATOM 9713  C C      . ASN B 2 103 ? -10.829 9.737   0.995   1.00 0.00  ? 190 ASN A C      6  
ATOM 9714  O O      . ASN B 2 103 ? -11.138 8.981   1.924   1.00 0.00  ? 190 ASN A O      6  
ATOM 9715  C CB     . ASN B 2 103 ? -12.476 10.750  -0.729  1.00 0.00  ? 190 ASN A CB     6  
ATOM 9716  C CG     . ASN B 2 103 ? -13.605 10.899  0.275   1.00 0.00  ? 190 ASN A CG     6  
ATOM 9717  O OD1    . ASN B 2 103 ? -13.437 11.420  1.367   1.00 0.00  ? 190 ASN A OD1    6  
ATOM 9718  N ND2    . ASN B 2 103 ? -14.799 10.458  -0.059  1.00 0.00  ? 190 ASN A ND2    6  
ATOM 9719  H H      . ASN B 2 103 ? -13.201 8.262   -0.385  1.00 0.00  ? 190 ASN A H      6  
ATOM 9720  H HA     . ASN B 2 103 ? -10.720 9.594   -1.158  1.00 0.00  ? 190 ASN A HA     6  
ATOM 9721  H HB2    . ASN B 2 103 ? -11.922 11.690  -0.746  1.00 0.00  ? 190 ASN A HB2    6  
ATOM 9722  H HB3    . ASN B 2 103 ? -12.891 10.599  -1.728  1.00 0.00  ? 190 ASN A HB3    6  
ATOM 9723  H HD21   . ASN B 2 103 ? -14.987 10.088  -0.977  1.00 0.00  ? 190 ASN A HD21   6  
ATOM 9724  H HD22   . ASN B 2 103 ? -15.535 10.578  0.619   1.00 0.00  ? 190 ASN A HD22   6  
ATOM 9725  N N      . ALA B 2 104 ? -9.893  10.679  1.157   1.00 0.00  ? 191 ALA A N      6  
ATOM 9726  C CA     . ALA B 2 104 ? -9.019  10.708  2.336   1.00 0.00  ? 191 ALA A CA     6  
ATOM 9727  C C      . ALA B 2 104 ? -9.145  11.945  3.235   1.00 0.00  ? 191 ALA A C      6  
ATOM 9728  O O      . ALA B 2 104 ? -9.444  13.057  2.794   1.00 0.00  ? 191 ALA A O      6  
ATOM 9729  C CB     . ALA B 2 104 ? -7.572  10.532  1.877   1.00 0.00  ? 191 ALA A CB     6  
ATOM 9730  H H      . ALA B 2 104 ? -9.682  11.304  0.392   1.00 0.00  ? 191 ALA A H      6  
ATOM 9731  H HA     . ALA B 2 104 ? -9.245  9.853   2.968   1.00 0.00  ? 191 ALA A HA     6  
ATOM 9732  H HB1    . ALA B 2 104 ? -7.467  9.579   1.353   1.00 0.00  ? 191 ALA A HB1    6  
ATOM 9733  H HB2    . ALA B 2 104 ? -7.285  11.359  1.225   1.00 0.00  ? 191 ALA A HB2    6  
ATOM 9734  H HB3    . ALA B 2 104 ? -6.921  10.539  2.753   1.00 0.00  ? 191 ALA A HB3    6  
ATOM 9735  N N      . THR B 2 105 ? -8.798  11.732  4.506   1.00 0.00  ? 192 THR A N      6  
ATOM 9736  C CA     . THR B 2 105 ? -8.262  12.741  5.436   1.00 0.00  ? 192 THR A CA     6  
ATOM 9737  C C      . THR B 2 105 ? -6.734  12.830  5.301   1.00 0.00  ? 192 THR A C      6  
ATOM 9738  O O      . THR B 2 105 ? -6.147  11.981  4.634   1.00 0.00  ? 192 THR A O      6  
ATOM 9739  C CB     . THR B 2 105 ? -8.658  12.340  6.861   1.00 0.00  ? 192 THR A CB     6  
ATOM 9740  O OG1    . THR B 2 105 ? -8.621  13.473  7.699   1.00 0.00  ? 192 THR A OG1    6  
ATOM 9741  C CG2    . THR B 2 105 ? -7.774  11.269  7.475   1.00 0.00  ? 192 THR A CG2    6  
ATOM 9742  H H      . THR B 2 105 ? -8.571  10.768  4.723   1.00 0.00  ? 192 THR A H      6  
ATOM 9743  H HA     . THR B 2 105 ? -8.699  13.714  5.212   1.00 0.00  ? 192 THR A HA     6  
ATOM 9744  H HB     . THR B 2 105 ? -9.651  11.899  6.840   1.00 0.00  ? 192 THR A HB     6  
ATOM 9745  H HG1    . THR B 2 105 ? -9.051  13.235  8.540   1.00 0.00  ? 192 THR A HG1    6  
ATOM 9746  H HG21   . THR B 2 105 ? -7.781  10.394  6.824   1.00 0.00  ? 192 THR A HG21   6  
ATOM 9747  H HG22   . THR B 2 105 ? -6.762  11.632  7.632   1.00 0.00  ? 192 THR A HG22   6  
ATOM 9748  H HG23   . THR B 2 105 ? -8.198  11.010  8.442   1.00 0.00  ? 192 THR A HG23   6  
ATOM 9749  N N      . ALA B 2 106 ? -6.050  13.770  5.962   1.00 0.00  ? 193 ALA A N      6  
ATOM 9750  C CA     . ALA B 2 106 ? -4.578  13.826  5.974   1.00 0.00  ? 193 ALA A CA     6  
ATOM 9751  C C      . ALA B 2 106 ? -3.985  14.570  7.190   1.00 0.00  ? 193 ALA A C      6  
ATOM 9752  O O      . ALA B 2 106 ? -3.833  15.796  7.157   1.00 0.00  ? 193 ALA A O      6  
ATOM 9753  C CB     . ALA B 2 106 ? -4.099  14.429  4.644   1.00 0.00  ? 193 ALA A CB     6  
ATOM 9754  H H      . ALA B 2 106 ? -6.578  14.424  6.524   1.00 0.00  ? 193 ALA A H      6  
ATOM 9755  H HA     . ALA B 2 106 ? -4.184  12.813  6.014   1.00 0.00  ? 193 ALA A HA     6  
ATOM 9756  H HB1    . ALA B 2 106 ? -4.445  13.805  3.817   1.00 0.00  ? 193 ALA A HB1    6  
ATOM 9757  H HB2    . ALA B 2 106 ? -4.492  15.438  4.523   1.00 0.00  ? 193 ALA A HB2    6  
ATOM 9758  H HB3    . ALA B 2 106 ? -3.010  14.457  4.624   1.00 0.00  ? 193 ALA A HB3    6  
ATOM 9759  N N      . ARG B 2 107 ? -3.621  13.902  8.292   1.00 0.00  ? 194 ARG A N      6  
ATOM 9760  C CA     . ARG B 2 107 ? -3.872  12.514  8.746   1.00 0.00  ? 194 ARG A CA     6  
ATOM 9761  C C      . ARG B 2 107 ? -4.468  12.586  10.167  1.00 0.00  ? 194 ARG A C      6  
ATOM 9762  O O      . ARG B 2 107 ? -4.119  13.488  10.932  1.00 0.00  ? 194 ARG A O      6  
ATOM 9763  C CB     . ARG B 2 107 ? -2.555  11.690  8.654   1.00 0.00  ? 194 ARG A CB     6  
ATOM 9764  C CG     . ARG B 2 107 ? -2.550  10.398  9.481   1.00 0.00  ? 194 ARG A CG     6  
ATOM 9765  C CD     . ARG B 2 107 ? -1.202  9.668   9.431   1.00 0.00  ? 194 ARG A CD     6  
ATOM 9766  N NE     . ARG B 2 107 ? -1.245  8.517   10.351  1.00 0.00  ? 194 ARG A NE     6  
ATOM 9767  C CZ     . ARG B 2 107 ? -0.345  7.594   10.640  1.00 0.00  ? 194 ARG A CZ     6  
ATOM 9768  N NH1    . ARG B 2 107 ? 0.873   7.617   10.179  1.00 0.00  ? 194 ARG A NH1    6  
ATOM 9769  N NH2    . ARG B 2 107 ? -0.685  6.573   11.370  1.00 0.00  ? 194 ARG A NH2    6  
ATOM 9770  H H      . ARG B 2 107 ? -3.232  14.523  8.993   1.00 0.00  ? 194 ARG A H      6  
ATOM 9771  H HA     . ARG B 2 107 ? -4.617  12.036  8.113   1.00 0.00  ? 194 ARG A HA     6  
ATOM 9772  H HB2    . ARG B 2 107 ? -2.371  11.444  7.607   1.00 0.00  ? 194 ARG A HB2    6  
ATOM 9773  H HB3    . ARG B 2 107 ? -1.711  12.281  8.994   1.00 0.00  ? 194 ARG A HB3    6  
ATOM 9774  H HG2    . ARG B 2 107 ? -2.746  10.647  10.524  1.00 0.00  ? 194 ARG A HG2    6  
ATOM 9775  H HG3    . ARG B 2 107 ? -3.334  9.734   9.120   1.00 0.00  ? 194 ARG A HG3    6  
ATOM 9776  H HD2    . ARG B 2 107 ? -1.029  9.341   8.404   1.00 0.00  ? 194 ARG A HD2    6  
ATOM 9777  H HD3    . ARG B 2 107 ? -0.406  10.350  9.730   1.00 0.00  ? 194 ARG A HD3    6  
ATOM 9778  H HE     . ARG B 2 107 ? -2.175  8.297   10.707  1.00 0.00  ? 194 ARG A HE     6  
ATOM 9779  H HH11   . ARG B 2 107 ? 1.070   8.263   9.434   1.00 0.00  ? 194 ARG A HH11   6  
ATOM 9780  H HH12   . ARG B 2 107 ? 1.450   6.798   10.275  1.00 0.00  ? 194 ARG A HH12   6  
ATOM 9781  H HH21   . ARG B 2 107 ? -1.631  6.517   11.703  1.00 0.00  ? 194 ARG A HH21   6  
ATOM 9782  H HH22   . ARG B 2 107 ? -0.121  5.730   11.327  1.00 0.00  ? 194 ARG A HH22   6  
ATOM 9783  N N      . VAL B 2 108 ? -5.391  11.681  10.511  1.00 0.00  ? 195 VAL A N      6  
ATOM 9784  C CA     . VAL B 2 108 ? -6.227  11.801  11.729  1.00 0.00  ? 195 VAL A CA     6  
ATOM 9785  C C      . VAL B 2 108 ? -5.461  11.633  13.053  1.00 0.00  ? 195 VAL A C      6  
ATOM 9786  O O      . VAL B 2 108 ? -5.792  12.304  14.035  1.00 0.00  ? 195 VAL A O      6  
ATOM 9787  C CB     . VAL B 2 108 ? -7.437  10.845  11.649  1.00 0.00  ? 195 VAL A CB     6  
ATOM 9788  C CG1    . VAL B 2 108 ? -7.077  9.359   11.781  1.00 0.00  ? 195 VAL A CG1    6  
ATOM 9789  C CG2    . VAL B 2 108 ? -8.517  11.198  12.676  1.00 0.00  ? 195 VAL A CG2    6  
ATOM 9790  H H      . VAL B 2 108 ? -5.609  10.950  9.849   1.00 0.00  ? 195 VAL A H      6  
ATOM 9791  H HA     . VAL B 2 108 ? -6.631  12.815  11.738  1.00 0.00  ? 195 VAL A HA     6  
ATOM 9792  H HB     . VAL B 2 108 ? -7.890  10.980  10.671  1.00 0.00  ? 195 VAL A HB     6  
ATOM 9793  H HG11   . VAL B 2 108 ? -6.316  9.086   11.052  1.00 0.00  ? 195 VAL A HG11   6  
ATOM 9794  H HG12   . VAL B 2 108 ? -6.715  9.140   12.786  1.00 0.00  ? 195 VAL A HG12   6  
ATOM 9795  H HG13   . VAL B 2 108 ? -7.963  8.757   11.594  1.00 0.00  ? 195 VAL A HG13   6  
ATOM 9796  H HG21   . VAL B 2 108 ? -8.162  11.008  13.687  1.00 0.00  ? 195 VAL A HG21   6  
ATOM 9797  H HG22   . VAL B 2 108 ? -8.786  12.248  12.580  1.00 0.00  ? 195 VAL A HG22   6  
ATOM 9798  H HG23   . VAL B 2 108 ? -9.408  10.595  12.496  1.00 0.00  ? 195 VAL A HG23   6  
ATOM 9799  N N      . MET B 2 109 ? -4.449  10.757  13.091  1.00 0.00  ? 196 MET A N      6  
ATOM 9800  C CA     . MET B 2 109 ? -3.681  10.384  14.294  1.00 0.00  ? 196 MET A CA     6  
ATOM 9801  C C      . MET B 2 109 ? -2.966  11.569  14.967  1.00 0.00  ? 196 MET A C      6  
ATOM 9802  O O      . MET B 2 109 ? -2.194  12.287  14.289  1.00 0.00  ? 196 MET A O      6  
ATOM 9803  C CB     . MET B 2 109 ? -2.712  9.249   13.935  1.00 0.00  ? 196 MET A CB     6  
ATOM 9804  C CG     . MET B 2 109 ? -2.048  8.655   15.181  1.00 0.00  ? 196 MET A CG     6  
ATOM 9805  S SD     . MET B 2 109 ? -1.005  7.214   14.837  1.00 0.00  ? 196 MET A SD     6  
ATOM 9806  C CE     . MET B 2 109 ? -0.492  6.811   16.529  1.00 0.00  ? 196 MET A CE     6  
ATOM 9807  O OXT    . MET B 2 109 ? -3.166  11.763  16.189  1.00 0.00  ? 196 MET A OXT    6  
ATOM 9808  H H      . MET B 2 109 ? -4.262  10.250  12.236  1.00 0.00  ? 196 MET A H      6  
ATOM 9809  H HA     . MET B 2 109 ? -4.389  9.994   15.026  1.00 0.00  ? 196 MET A HA     6  
ATOM 9810  H HB2    . MET B 2 109 ? -3.268  8.450   13.440  1.00 0.00  ? 196 MET A HB2    6  
ATOM 9811  H HB3    . MET B 2 109 ? -1.941  9.609   13.252  1.00 0.00  ? 196 MET A HB3    6  
ATOM 9812  H HG2    . MET B 2 109 ? -1.433  9.423   15.655  1.00 0.00  ? 196 MET A HG2    6  
ATOM 9813  H HG3    . MET B 2 109 ? -2.827  8.354   15.882  1.00 0.00  ? 196 MET A HG3    6  
ATOM 9814  H HE1    . MET B 2 109 ? 0.048   7.654   16.960  1.00 0.00  ? 196 MET A HE1    6  
ATOM 9815  H HE2    . MET B 2 109 ? -1.370  6.595   17.142  1.00 0.00  ? 196 MET A HE2    6  
ATOM 9816  H HE3    . MET B 2 109 ? 0.156   5.935   16.514  1.00 0.00  ? 196 MET A HE3    6  
ATOM 9817  O "O5'"  . U   A 1 1   ? 0.081   -15.552 8.709   1.00 0.00  ? 197 U   B "O5'"  7  
ATOM 9818  C "C5'"  . U   A 1 1   ? -1.001  -14.730 8.278   1.00 0.00  ? 197 U   B "C5'"  7  
ATOM 9819  C "C4'"  . U   A 1 1   ? -0.732  -13.240 8.536   1.00 0.00  ? 197 U   B "C4'"  7  
ATOM 9820  O "O4'"  . U   A 1 1   ? 0.277   -12.723 7.673   1.00 0.00  ? 197 U   B "O4'"  7  
ATOM 9821  C "C3'"  . U   A 1 1   ? -1.977  -12.388 8.285   1.00 0.00  ? 197 U   B "C3'"  7  
ATOM 9822  O "O3'"  . U   A 1 1   ? -2.853  -12.410 9.402   1.00 0.00  ? 197 U   B "O3'"  7  
ATOM 9823  C "C2'"  . U   A 1 1   ? -1.337  -11.017 8.049   1.00 0.00  ? 197 U   B "C2'"  7  
ATOM 9824  O "O2'"  . U   A 1 1   ? -0.923  -10.408 9.274   1.00 0.00  ? 197 U   B "O2'"  7  
ATOM 9825  C "C1'"  . U   A 1 1   ? -0.059  -11.391 7.287   1.00 0.00  ? 197 U   B "C1'"  7  
ATOM 9826  N N1     . U   A 1 1   ? -0.143  -11.311 5.800   1.00 0.00  ? 197 U   B N1     7  
ATOM 9827  C C2     . U   A 1 1   ? 0.515   -10.232 5.192   1.00 0.00  ? 197 U   B C2     7  
ATOM 9828  O O2     . U   A 1 1   ? 0.814   -9.195  5.781   1.00 0.00  ? 197 U   B O2     7  
ATOM 9829  N N3     . U   A 1 1   ? 0.859   -10.375 3.870   1.00 0.00  ? 197 U   B N3     7  
ATOM 9830  C C4     . U   A 1 1   ? 0.520   -11.430 3.065   1.00 0.00  ? 197 U   B C4     7  
ATOM 9831  O O4     . U   A 1 1   ? 0.889   -11.445 1.894   1.00 0.00  ? 197 U   B O4     7  
ATOM 9832  C C5     . U   A 1 1   ? -0.300  -12.432 3.706   1.00 0.00  ? 197 U   B C5     7  
ATOM 9833  C C6     . U   A 1 1   ? -0.603  -12.362 5.032   1.00 0.00  ? 197 U   B C6     7  
ATOM 9834  H "H5'"  . U   A 1 1   ? -1.907  -15.022 8.811   1.00 0.00  ? 197 U   B "H5'"  7  
ATOM 9835  H "H5''" . U   A 1 1   ? -1.172  -14.882 7.212   1.00 0.00  ? 197 U   B "H5''" 7  
ATOM 9836  H "H4'"  . U   A 1 1   ? -0.425  -13.100 9.573   1.00 0.00  ? 197 U   B "H4'"  7  
ATOM 9837  H "H3'"  . U   A 1 1   ? -2.459  -12.724 7.368   1.00 0.00  ? 197 U   B "H3'"  7  
ATOM 9838  H "H2'"  . U   A 1 1   ? -1.994  -10.361 7.473   1.00 0.00  ? 197 U   B "H2'"  7  
ATOM 9839  H "HO2'" . U   A 1 1   ? -1.704  -10.347 9.857   1.00 0.00  ? 197 U   B "HO2'" 7  
ATOM 9840  H "H1'"  . U   A 1 1   ? 0.735   -10.711 7.603   1.00 0.00  ? 197 U   B "H1'"  7  
ATOM 9841  H H3     . U   A 1 1   ? 1.435   -9.664  3.461   1.00 0.00  ? 197 U   B H3     7  
ATOM 9842  H H5     . U   A 1 1   ? -0.642  -13.251 3.095   1.00 0.00  ? 197 U   B H5     7  
ATOM 9843  H H6     . U   A 1 1   ? -1.171  -13.157 5.499   1.00 0.00  ? 197 U   B H6     7  
ATOM 9844  H "HO5'" . U   A 1 1   ? 0.147   -15.529 9.686   1.00 0.00  ? 197 U   B "HO5'" 7  
ATOM 9845  P P      . G   A 1 2   ? -4.438  -12.604 9.258   1.00 0.00  ? 198 G   B P      7  
ATOM 9846  O OP1    . G   A 1 2   ? -4.868  -13.489 10.366  1.00 0.00  ? 198 G   B OP1    7  
ATOM 9847  O OP2    . G   A 1 2   ? -4.775  -12.998 7.869   1.00 0.00  ? 198 G   B OP2    7  
ATOM 9848  O "O5'"  . G   A 1 2   ? -5.060  -11.152 9.541   1.00 0.00  ? 198 G   B "O5'"  7  
ATOM 9849  C "C5'"  . G   A 1 2   ? -5.010  -10.099 8.586   1.00 0.00  ? 198 G   B "C5'"  7  
ATOM 9850  C "C4'"  . G   A 1 2   ? -6.219  -9.143  8.712   1.00 0.00  ? 198 G   B "C4'"  7  
ATOM 9851  O "O4'"  . G   A 1 2   ? -6.528  -8.606  7.424   1.00 0.00  ? 198 G   B "O4'"  7  
ATOM 9852  C "C3'"  . G   A 1 2   ? -7.528  -9.828  9.140   1.00 0.00  ? 198 G   B "C3'"  7  
ATOM 9853  O "O3'"  . G   A 1 2   ? -8.501  -8.872  9.554   1.00 0.00  ? 198 G   B "O3'"  7  
ATOM 9854  C "C2'"  . G   A 1 2   ? -7.930  -10.479 7.817   1.00 0.00  ? 198 G   B "C2'"  7  
ATOM 9855  O "O2'"  . G   A 1 2   ? -9.307  -10.831 7.756   1.00 0.00  ? 198 G   B "O2'"  7  
ATOM 9856  C "C1'"  . G   A 1 2   ? -7.536  -9.403  6.795   1.00 0.00  ? 198 G   B "C1'"  7  
ATOM 9857  N N9     . G   A 1 2   ? -7.105  -9.950  5.476   1.00 0.00  ? 198 G   B N9     7  
ATOM 9858  C C8     . G   A 1 2   ? -6.946  -11.261 5.078   1.00 0.00  ? 198 G   B C8     7  
ATOM 9859  N N7     . G   A 1 2   ? -6.544  -11.410 3.842   1.00 0.00  ? 198 G   B N7     7  
ATOM 9860  C C5     . G   A 1 2   ? -6.458  -10.097 3.359   1.00 0.00  ? 198 G   B C5     7  
ATOM 9861  C C6     . G   A 1 2   ? -6.062  -9.573  2.074   1.00 0.00  ? 198 G   B C6     7  
ATOM 9862  O O6     . G   A 1 2   ? -5.656  -10.158 1.070   1.00 0.00  ? 198 G   B O6     7  
ATOM 9863  N N1     . G   A 1 2   ? -6.172  -8.203  1.992   1.00 0.00  ? 198 G   B N1     7  
ATOM 9864  C C2     . G   A 1 2   ? -6.584  -7.415  3.008   1.00 0.00  ? 198 G   B C2     7  
ATOM 9865  N N2     . G   A 1 2   ? -6.638  -6.135  2.755   1.00 0.00  ? 198 G   B N2     7  
ATOM 9866  N N3     . G   A 1 2   ? -6.951  -7.844  4.208   1.00 0.00  ? 198 G   B N3     7  
ATOM 9867  C C4     . G   A 1 2   ? -6.851  -9.204  4.340   1.00 0.00  ? 198 G   B C4     7  
ATOM 9868  H "H5'"  . G   A 1 2   ? -5.012  -10.525 7.582   1.00 0.00  ? 198 G   B "H5'"  7  
ATOM 9869  H "H5''" . G   A 1 2   ? -4.090  -9.530  8.707   1.00 0.00  ? 198 G   B "H5''" 7  
ATOM 9870  H "H4'"  . G   A 1 2   ? -5.959  -8.350  9.415   1.00 0.00  ? 198 G   B "H4'"  7  
ATOM 9871  H "H3'"  . G   A 1 2   ? -7.372  -10.589 9.907   1.00 0.00  ? 198 G   B "H3'"  7  
ATOM 9872  H "H2'"  . G   A 1 2   ? -7.311  -11.368 7.697   1.00 0.00  ? 198 G   B "H2'"  7  
ATOM 9873  H "HO2'" . G   A 1 2   ? -9.810  -10.146 8.241   1.00 0.00  ? 198 G   B "HO2'" 7  
ATOM 9874  H "H1'"  . G   A 1 2   ? -8.411  -8.770  6.623   1.00 0.00  ? 198 G   B "H1'"  7  
ATOM 9875  H H8     . G   A 1 2   ? -7.114  -12.103 5.734   1.00 0.00  ? 198 G   B H8     7  
ATOM 9876  H H1     . G   A 1 2   ? -5.917  -7.748  1.132   1.00 0.00  ? 198 G   B H1     7  
ATOM 9877  H H21    . G   A 1 2   ? -6.292  -5.797  1.868   1.00 0.00  ? 198 G   B H21    7  
ATOM 9878  H H22    . G   A 1 2   ? -6.921  -5.497  3.489   1.00 0.00  ? 198 G   B H22    7  
ATOM 9879  P P      . C   A 1 3   ? -8.673  -8.480  11.102  1.00 0.00  ? 199 C   B P      7  
ATOM 9880  O OP1    . C   A 1 3   ? -8.713  -9.731  11.897  1.00 0.00  ? 199 C   B OP1    7  
ATOM 9881  O OP2    . C   A 1 3   ? -9.823  -7.549  11.199  1.00 0.00  ? 199 C   B OP2    7  
ATOM 9882  O "O5'"  . C   A 1 3   ? -7.328  -7.687  11.501  1.00 0.00  ? 199 C   B "O5'"  7  
ATOM 9883  C "C5'"  . C   A 1 3   ? -7.050  -6.399  10.975  1.00 0.00  ? 199 C   B "C5'"  7  
ATOM 9884  C "C4'"  . C   A 1 3   ? -5.770  -5.822  11.588  1.00 0.00  ? 199 C   B "C4'"  7  
ATOM 9885  O "O4'"  . C   A 1 3   ? -4.622  -6.558  11.167  1.00 0.00  ? 199 C   B "O4'"  7  
ATOM 9886  C "C3'"  . C   A 1 3   ? -5.547  -4.353  11.164  1.00 0.00  ? 199 C   B "C3'"  7  
ATOM 9887  O "O3'"  . C   A 1 3   ? -5.321  -3.509  12.289  1.00 0.00  ? 199 C   B "O3'"  7  
ATOM 9888  C "C2'"  . C   A 1 3   ? -4.280  -4.444  10.300  1.00 0.00  ? 199 C   B "C2'"  7  
ATOM 9889  O "O2'"  . C   A 1 3   ? -3.497  -3.258  10.300  1.00 0.00  ? 199 C   B "O2'"  7  
ATOM 9890  C "C1'"  . C   A 1 3   ? -3.578  -5.624  10.959  1.00 0.00  ? 199 C   B "C1'"  7  
ATOM 9891  N N1     . C   A 1 3   ? -2.471  -6.191  10.143  1.00 0.00  ? 199 C   B N1     7  
ATOM 9892  C C2     . C   A 1 3   ? -1.167  -6.159  10.662  1.00 0.00  ? 199 C   B C2     7  
ATOM 9893  O O2     . C   A 1 3   ? -0.922  -5.730  11.790  1.00 0.00  ? 199 C   B O2     7  
ATOM 9894  N N3     . C   A 1 3   ? -0.124  -6.609  9.922   1.00 0.00  ? 199 C   B N3     7  
ATOM 9895  C C4     . C   A 1 3   ? -0.361  -7.078  8.717   1.00 0.00  ? 199 C   B C4     7  
ATOM 9896  N N4     . C   A 1 3   ? 0.689   -7.458  8.054   1.00 0.00  ? 199 C   B N4     7  
ATOM 9897  C C5     . C   A 1 3   ? -1.655  -7.135  8.134   1.00 0.00  ? 199 C   B C5     7  
ATOM 9898  C C6     . C   A 1 3   ? -2.693  -6.672  8.875   1.00 0.00  ? 199 C   B C6     7  
ATOM 9899  H "H5'"  . C   A 1 3   ? -7.878  -5.729  11.216  1.00 0.00  ? 199 C   B "H5'"  7  
ATOM 9900  H "H5''" . C   A 1 3   ? -6.951  -6.446  9.893   1.00 0.00  ? 199 C   B "H5''" 7  
ATOM 9901  H "H4'"  . C   A 1 3   ? -5.851  -5.864  12.674  1.00 0.00  ? 199 C   B "H4'"  7  
ATOM 9902  H "H3'"  . C   A 1 3   ? -6.362  -3.984  10.557  1.00 0.00  ? 199 C   B "H3'"  7  
ATOM 9903  H "H2'"  . C   A 1 3   ? -4.572  -4.704  9.280   1.00 0.00  ? 199 C   B "H2'"  7  
ATOM 9904  H "HO2'" . C   A 1 3   ? -3.601  -2.835  11.172  1.00 0.00  ? 199 C   B "HO2'" 7  
ATOM 9905  H "H1'"  . C   A 1 3   ? -3.203  -5.289  11.928  1.00 0.00  ? 199 C   B "H1'"  7  
ATOM 9906  H H41    . C   A 1 3   ? 1.578   -7.374  8.507   1.00 0.00  ? 199 C   B H41    7  
ATOM 9907  H H42    . C   A 1 3   ? 0.608   -7.841  7.124   1.00 0.00  ? 199 C   B H42    7  
ATOM 9908  H H5     . C   A 1 3   ? -1.804  -7.521  7.142   1.00 0.00  ? 199 C   B H5     7  
ATOM 9909  H H6     . C   A 1 3   ? -3.700  -6.684  8.474   1.00 0.00  ? 199 C   B H6     7  
ATOM 9910  P P      . A   A 1 4   ? -6.558  -2.857  13.084  1.00 0.00  ? 200 A   B P      7  
ATOM 9911  O OP1    . A   A 1 4   ? -6.023  -2.164  14.280  1.00 0.00  ? 200 A   B OP1    7  
ATOM 9912  O OP2    . A   A 1 4   ? -7.599  -3.892  13.265  1.00 0.00  ? 200 A   B OP2    7  
ATOM 9913  O "O5'"  . A   A 1 4   ? -7.148  -1.759  12.066  1.00 0.00  ? 200 A   B "O5'"  7  
ATOM 9914  C "C5'"  . A   A 1 4   ? -6.481  -0.519  11.846  1.00 0.00  ? 200 A   B "C5'"  7  
ATOM 9915  C "C4'"  . A   A 1 4   ? -7.242  0.425   10.895  1.00 0.00  ? 200 A   B "C4'"  7  
ATOM 9916  O "O4'"  . A   A 1 4   ? -7.135  -0.035  9.552   1.00 0.00  ? 200 A   B "O4'"  7  
ATOM 9917  C "C3'"  . A   A 1 4   ? -8.733  0.569   11.238  1.00 0.00  ? 200 A   B "C3'"  7  
ATOM 9918  O "O3'"  . A   A 1 4   ? -9.234  1.914   11.251  1.00 0.00  ? 200 A   B "O3'"  7  
ATOM 9919  C "C2'"  . A   A 1 4   ? -9.399  -0.429  10.278  1.00 0.00  ? 200 A   B "C2'"  7  
ATOM 9920  O "O2'"  . A   A 1 4   ? -10.668 -0.044  9.770   1.00 0.00  ? 200 A   B "O2'"  7  
ATOM 9921  C "C1'"  . A   A 1 4   ? -8.367  -0.621  9.146   1.00 0.00  ? 200 A   B "C1'"  7  
ATOM 9922  N N9     . A   A 1 4   ? -8.211  -2.049  8.752   1.00 0.00  ? 200 A   B N9     7  
ATOM 9923  C C8     . A   A 1 4   ? -8.480  -3.186  9.482   1.00 0.00  ? 200 A   B C8     7  
ATOM 9924  N N7     . A   A 1 4   ? -8.289  -4.306  8.841   1.00 0.00  ? 200 A   B N7     7  
ATOM 9925  C C5     . A   A 1 4   ? -7.890  -3.875  7.570   1.00 0.00  ? 200 A   B C5     7  
ATOM 9926  C C6     . A   A 1 4   ? -7.538  -4.541  6.375   1.00 0.00  ? 200 A   B C6     7  
ATOM 9927  N N6     . A   A 1 4   ? -7.479  -5.855  6.280   1.00 0.00  ? 200 A   B N6     7  
ATOM 9928  N N1     . A   A 1 4   ? -7.255  -3.863  5.258   1.00 0.00  ? 200 A   B N1     7  
ATOM 9929  C C2     . A   A 1 4   ? -7.278  -2.534  5.331   1.00 0.00  ? 200 A   B C2     7  
ATOM 9930  N N3     . A   A 1 4   ? -7.554  -1.768  6.387   1.00 0.00  ? 200 A   B N3     7  
ATOM 9931  C C4     . A   A 1 4   ? -7.861  -2.507  7.495   1.00 0.00  ? 200 A   B C4     7  
ATOM 9932  H "H5'"  . A   A 1 4   ? -5.483  -0.703  11.443  1.00 0.00  ? 200 A   B "H5'"  7  
ATOM 9933  H "H5''" . A   A 1 4   ? -6.372  -0.007  12.801  1.00 0.00  ? 200 A   B "H5''" 7  
ATOM 9934  H "H4'"  . A   A 1 4   ? -6.770  1.401   10.975  1.00 0.00  ? 200 A   B "H4'"  7  
ATOM 9935  H "H3'"  . A   A 1 4   ? -8.881  0.185   12.251  1.00 0.00  ? 200 A   B "H3'"  7  
ATOM 9936  H "H2'"  . A   A 1 4   ? -9.530  -1.342  10.849  1.00 0.00  ? 200 A   B "H2'"  7  
ATOM 9937  H "HO2'" . A   A 1 4   ? -10.514 0.806   9.299   1.00 0.00  ? 200 A   B "HO2'" 7  
ATOM 9938  H "H1'"  . A   A 1 4   ? -8.698  -0.063  8.265   1.00 0.00  ? 200 A   B "H1'"  7  
ATOM 9939  H H8     . A   A 1 4   ? -8.791  -3.170  10.520  1.00 0.00  ? 200 A   B H8     7  
ATOM 9940  H H61    . A   A 1 4   ? -7.207  -6.309  5.420   1.00 0.00  ? 200 A   B H61    7  
ATOM 9941  H H62    . A   A 1 4   ? -7.634  -6.400  7.114   1.00 0.00  ? 200 A   B H62    7  
ATOM 9942  H H2     . A   A 1 4   ? -7.036  -1.997  4.422   1.00 0.00  ? 200 A   B H2     7  
ATOM 9943  P P      . U   A 1 5   ? -9.385  2.922   10.001  1.00 0.00  ? 201 U   B P      7  
ATOM 9944  O OP1    . U   A 1 5   ? -10.374 3.939   10.422  1.00 0.00  ? 201 U   B OP1    7  
ATOM 9945  O OP2    . U   A 1 5   ? -9.659  2.170   8.756   1.00 0.00  ? 201 U   B OP2    7  
ATOM 9946  O "O5'"  . U   A 1 5   ? -7.994  3.713   9.851   1.00 0.00  ? 201 U   B "O5'"  7  
ATOM 9947  C "C5'"  . U   A 1 5   ? -6.997  3.403   8.887   1.00 0.00  ? 201 U   B "C5'"  7  
ATOM 9948  C "C4'"  . U   A 1 5   ? -6.151  4.642   8.507   1.00 0.00  ? 201 U   B "C4'"  7  
ATOM 9949  O "O4'"  . U   A 1 5   ? -6.511  5.133   7.214   1.00 0.00  ? 201 U   B "O4'"  7  
ATOM 9950  C "C3'"  . U   A 1 5   ? -6.268  5.846   9.467   1.00 0.00  ? 201 U   B "C3'"  7  
ATOM 9951  O "O3'"  . U   A 1 5   ? -5.114  6.693   9.457   1.00 0.00  ? 201 U   B "O3'"  7  
ATOM 9952  C "C2'"  . U   A 1 5   ? -7.483  6.550   8.853   1.00 0.00  ? 201 U   B "C2'"  7  
ATOM 9953  O "O2'"  . U   A 1 5   ? -7.598  7.900   9.266   1.00 0.00  ? 201 U   B "O2'"  7  
ATOM 9954  C "C1'"  . U   A 1 5   ? -7.276  6.329   7.343   1.00 0.00  ? 201 U   B "C1'"  7  
ATOM 9955  N N1     . U   A 1 5   ? -8.562  6.193   6.603   1.00 0.00  ? 201 U   B N1     7  
ATOM 9956  C C2     . U   A 1 5   ? -8.849  7.076   5.553   1.00 0.00  ? 201 U   B C2     7  
ATOM 9957  O O2     . U   A 1 5   ? -8.121  8.014   5.230   1.00 0.00  ? 201 U   B O2     7  
ATOM 9958  N N3     . U   A 1 5   ? -10.030 6.882   4.865   1.00 0.00  ? 201 U   B N3     7  
ATOM 9959  C C4     . U   A 1 5   ? -11.001 5.962   5.202   1.00 0.00  ? 201 U   B C4     7  
ATOM 9960  O O4     . U   A 1 5   ? -12.069 5.919   4.603   1.00 0.00  ? 201 U   B O4     7  
ATOM 9961  C C5     . U   A 1 5   ? -10.651 5.094   6.300   1.00 0.00  ? 201 U   B C5     7  
ATOM 9962  C C6     . U   A 1 5   ? -9.469  5.214   6.950   1.00 0.00  ? 201 U   B C6     7  
ATOM 9963  H "H5'"  . U   A 1 5   ? -7.443  2.997   7.978   1.00 0.00  ? 201 U   B "H5'"  7  
ATOM 9964  H "H5''" . U   A 1 5   ? -6.327  2.645   9.293   1.00 0.00  ? 201 U   B "H5''" 7  
ATOM 9965  H "H4'"  . U   A 1 5   ? -5.127  4.299   8.471   1.00 0.00  ? 201 U   B "H4'"  7  
ATOM 9966  H "H3'"  . U   A 1 5   ? -6.496  5.538   10.489  1.00 0.00  ? 201 U   B "H3'"  7  
ATOM 9967  H "H2'"  . U   A 1 5   ? -8.377  6.022   9.178   1.00 0.00  ? 201 U   B "H2'"  7  
ATOM 9968  H "HO2'" . U   A 1 5   ? -6.799  8.142   9.774   1.00 0.00  ? 201 U   B "HO2'" 7  
ATOM 9969  H "H1'"  . U   A 1 5   ? -6.689  7.156   6.928   1.00 0.00  ? 201 U   B "H1'"  7  
ATOM 9970  H H3     . U   A 1 5   ? -10.173 7.431   4.030   1.00 0.00  ? 201 U   B H3     7  
ATOM 9971  H H5     . U   A 1 5   ? -11.352 4.325   6.590   1.00 0.00  ? 201 U   B H5     7  
ATOM 9972  H H6     . U   A 1 5   ? -9.228  4.530   7.746   1.00 0.00  ? 201 U   B H6     7  
ATOM 9973  P P      . G   A 1 6   ? -3.811  6.298   10.309  1.00 0.00  ? 202 G   B P      7  
ATOM 9974  O OP1    . G   A 1 6   ? -4.016  4.982   10.957  1.00 0.00  ? 202 G   B OP1    7  
ATOM 9975  O OP2    . G   A 1 6   ? -3.399  7.445   11.150  1.00 0.00  ? 202 G   B OP2    7  
ATOM 9976  O "O5'"  . G   A 1 6   ? -2.662  6.140   9.211   1.00 0.00  ? 202 G   B "O5'"  7  
ATOM 9977  C "C5'"  . G   A 1 6   ? -2.674  5.049   8.317   1.00 0.00  ? 202 G   B "C5'"  7  
ATOM 9978  C "C4'"  . G   A 1 6   ? -1.470  4.926   7.384   1.00 0.00  ? 202 G   B "C4'"  7  
ATOM 9979  O "O4'"  . G   A 1 6   ? -1.734  5.605   6.161   1.00 0.00  ? 202 G   B "O4'"  7  
ATOM 9980  C "C3'"  . G   A 1 6   ? -0.170  5.434   8.002   1.00 0.00  ? 202 G   B "C3'"  7  
ATOM 9981  O "O3'"  . G   A 1 6   ? 0.849   4.513   7.662   1.00 0.00  ? 202 G   B "O3'"  7  
ATOM 9982  C "C2'"  . G   A 1 6   ? -0.176  6.808   7.329   1.00 0.00  ? 202 G   B "C2'"  7  
ATOM 9983  O "O2'"  . G   A 1 6   ? 1.036   7.559   7.389   1.00 0.00  ? 202 G   B "O2'"  7  
ATOM 9984  C "C1'"  . G   A 1 6   ? -0.656  6.486   5.932   1.00 0.00  ? 202 G   B "C1'"  7  
ATOM 9985  N N9     . G   A 1 6   ? -1.063  7.720   5.237   1.00 0.00  ? 202 G   B N9     7  
ATOM 9986  C C8     . G   A 1 6   ? -0.349  8.415   4.298   1.00 0.00  ? 202 G   B C8     7  
ATOM 9987  N N7     . G   A 1 6   ? -0.897  9.545   3.926   1.00 0.00  ? 202 G   B N7     7  
ATOM 9988  C C5     . G   A 1 6   ? -2.073  9.600   4.688   1.00 0.00  ? 202 G   B C5     7  
ATOM 9989  C C6     . G   A 1 6   ? -3.108  10.599  4.786   1.00 0.00  ? 202 G   B C6     7  
ATOM 9990  O O6     . G   A 1 6   ? -3.195  11.692  4.227   1.00 0.00  ? 202 G   B O6     7  
ATOM 9991  N N1     . G   A 1 6   ? -4.127  10.262  5.653   1.00 0.00  ? 202 G   B N1     7  
ATOM 9992  C C2     . G   A 1 6   ? -4.110  9.147   6.430   1.00 0.00  ? 202 G   B C2     7  
ATOM 9993  N N2     . G   A 1 6   ? -5.071  8.953   7.286   1.00 0.00  ? 202 G   B N2     7  
ATOM 9994  N N3     . G   A 1 6   ? -3.137  8.248   6.439   1.00 0.00  ? 202 G   B N3     7  
ATOM 9995  C C4     . G   A 1 6   ? -2.161  8.503   5.518   1.00 0.00  ? 202 G   B C4     7  
ATOM 9996  H "H5'"  . G   A 1 6   ? -3.546  5.154   7.677   1.00 0.00  ? 202 G   B "H5'"  7  
ATOM 9997  H "H5''" . G   A 1 6   ? -2.743  4.128   8.896   1.00 0.00  ? 202 G   B "H5''" 7  
ATOM 9998  H "H4'"  . G   A 1 6   ? -1.306  3.887   7.131   1.00 0.00  ? 202 G   B "H4'"  7  
ATOM 9999  H "H3'"  . G   A 1 6   ? -0.224  5.522   9.080   1.00 0.00  ? 202 G   B "H3'"  7  
ATOM 10000 H "H2'"  . G   A 1 6   ? -0.998  7.362   7.784   1.00 0.00  ? 202 G   B "H2'"  7  
ATOM 10001 H "HO2'" . G   A 1 6   ? 0.944   8.375   6.864   1.00 0.00  ? 202 G   B "HO2'" 7  
ATOM 10002 H "H1'"  . G   A 1 6   ? 0.125   5.966   5.392   1.00 0.00  ? 202 G   B "H1'"  7  
ATOM 10003 H H8     . G   A 1 6   ? 0.594   8.023   3.946   1.00 0.00  ? 202 G   B H8     7  
ATOM 10004 H H1     . G   A 1 6   ? -4.918  10.890  5.646   1.00 0.00  ? 202 G   B H1     7  
ATOM 10005 H H21    . G   A 1 6   ? -5.920  9.508   7.299   1.00 0.00  ? 202 G   B H21    7  
ATOM 10006 H H22    . G   A 1 6   ? -4.959  8.157   7.899   1.00 0.00  ? 202 G   B H22    7  
ATOM 10007 P P      . U   A 1 7   ? 1.776   3.914   8.815   1.00 0.00  ? 203 U   B P      7  
ATOM 10008 O OP1    . U   A 1 7   ? 2.631   2.834   8.267   1.00 0.00  ? 203 U   B OP1    7  
ATOM 10009 O OP2    . U   A 1 7   ? 0.953   3.619   10.009  1.00 0.00  ? 203 U   B OP2    7  
ATOM 10010 O "O5'"  . U   A 1 7   ? 2.664   5.205   9.087   1.00 0.00  ? 203 U   B "O5'"  7  
ATOM 10011 C "C5'"  . U   A 1 7   ? 3.847   5.459   8.354   1.00 0.00  ? 203 U   B "C5'"  7  
ATOM 10012 C "C4'"  . U   A 1 7   ? 3.757   5.647   6.815   1.00 0.00  ? 203 U   B "C4'"  7  
ATOM 10013 O "O4'"  . U   A 1 7   ? 5.095   5.918   6.398   1.00 0.00  ? 203 U   B "O4'"  7  
ATOM 10014 C "C3'"  . U   A 1 7   ? 3.316   4.571   5.795   1.00 0.00  ? 203 U   B "C3'"  7  
ATOM 10015 O "O3'"  . U   A 1 7   ? 2.869   5.231   4.615   1.00 0.00  ? 203 U   B "O3'"  7  
ATOM 10016 C "C2'"  . U   A 1 7   ? 4.576   3.748   5.492   1.00 0.00  ? 203 U   B "C2'"  7  
ATOM 10017 O "O2'"  . U   A 1 7   ? 4.755   3.416   4.114   1.00 0.00  ? 203 U   B "O2'"  7  
ATOM 10018 C "C1'"  . U   A 1 7   ? 5.699   4.694   5.953   1.00 0.00  ? 203 U   B "C1'"  7  
ATOM 10019 N N1     . U   A 1 7   ? 6.626   4.080   6.959   1.00 0.00  ? 203 U   B N1     7  
ATOM 10020 C C2     . U   A 1 7   ? 7.983   4.427   6.881   1.00 0.00  ? 203 U   B C2     7  
ATOM 10021 O O2     . U   A 1 7   ? 8.428   5.277   6.105   1.00 0.00  ? 203 U   B O2     7  
ATOM 10022 N N3     . U   A 1 7   ? 8.856   3.760   7.718   1.00 0.00  ? 203 U   B N3     7  
ATOM 10023 C C4     . U   A 1 7   ? 8.516   2.769   8.609   1.00 0.00  ? 203 U   B C4     7  
ATOM 10024 O O4     . U   A 1 7   ? 9.383   2.231   9.296   1.00 0.00  ? 203 U   B O4     7  
ATOM 10025 C C5     . U   A 1 7   ? 7.103   2.463   8.645   1.00 0.00  ? 203 U   B C5     7  
ATOM 10026 C C6     . U   A 1 7   ? 6.211   3.108   7.854   1.00 0.00  ? 203 U   B C6     7  
ATOM 10027 H "H5'"  . U   A 1 7   ? 4.558   4.689   8.601   1.00 0.00  ? 203 U   B "H5'"  7  
ATOM 10028 H "H5''" . U   A 1 7   ? 4.261   6.384   8.751   1.00 0.00  ? 203 U   B "H5''" 7  
ATOM 10029 H "H4'"  . U   A 1 7   ? 3.088   6.491   6.662   1.00 0.00  ? 203 U   B "H4'"  7  
ATOM 10030 H "H3'"  . U   A 1 7   ? 2.527   3.922   6.149   1.00 0.00  ? 203 U   B "H3'"  7  
ATOM 10031 H "HO3'" . U   A 1 7   ? 3.539   5.034   3.934   1.00 0.00  ? 203 U   B "HO3'" 7  
ATOM 10032 H "H2'"  . U   A 1 7   ? 4.539   2.827   6.080   1.00 0.00  ? 203 U   B "H2'"  7  
ATOM 10033 H "HO2'" . U   A 1 7   ? 3.968   2.951   3.767   1.00 0.00  ? 203 U   B "HO2'" 7  
ATOM 10034 H "H1'"  . U   A 1 7   ? 6.291   4.931   5.064   1.00 0.00  ? 203 U   B "H1'"  7  
ATOM 10035 H H3     . U   A 1 7   ? 9.827   4.011   7.669   1.00 0.00  ? 203 U   B H3     7  
ATOM 10036 H H5     . U   A 1 7   ? 6.740   1.700   9.316   1.00 0.00  ? 203 U   B H5     7  
ATOM 10037 H H6     . U   A 1 7   ? 5.156   2.853   7.965   1.00 0.00  ? 203 U   B H6     7  
ATOM 10038 N N      . ASN B 2 22  ? -2.393  33.352  -4.973  1.00 0.00  ? 109 ASN A N      7  
ATOM 10039 C CA     . ASN B 2 22  ? -2.813  32.167  -5.772  1.00 0.00  ? 109 ASN A CA     7  
ATOM 10040 C C      . ASN B 2 22  ? -1.607  31.260  -6.045  1.00 0.00  ? 109 ASN A C      7  
ATOM 10041 O O      . ASN B 2 22  ? -0.485  31.751  -6.187  1.00 0.00  ? 109 ASN A O      7  
ATOM 10042 C CB     . ASN B 2 22  ? -3.508  32.571  -7.096  1.00 0.00  ? 109 ASN A CB     7  
ATOM 10043 C CG     . ASN B 2 22  ? -4.831  33.309  -6.867  1.00 0.00  ? 109 ASN A CG     7  
ATOM 10044 O OD1    . ASN B 2 22  ? -4.915  34.243  -6.080  1.00 0.00  ? 109 ASN A OD1    7  
ATOM 10045 N ND2    . ASN B 2 22  ? -5.906  32.928  -7.530  1.00 0.00  ? 109 ASN A ND2    7  
ATOM 10046 H H      . ASN B 2 22  ? -2.016  33.063  -4.084  1.00 0.00  ? 109 ASN A H      7  
ATOM 10047 H HA     . ASN B 2 22  ? -3.523  31.589  -5.179  1.00 0.00  ? 109 ASN A HA     7  
ATOM 10048 H HB2    . ASN B 2 22  ? -2.849  33.208  -7.686  1.00 0.00  ? 109 ASN A HB2    7  
ATOM 10049 H HB3    . ASN B 2 22  ? -3.707  31.668  -7.679  1.00 0.00  ? 109 ASN A HB3    7  
ATOM 10050 H HD21   . ASN B 2 22  ? -5.878  32.174  -8.203  1.00 0.00  ? 109 ASN A HD21   7  
ATOM 10051 H HD22   . ASN B 2 22  ? -6.762  33.439  -7.362  1.00 0.00  ? 109 ASN A HD22   7  
ATOM 10052 N N      . THR B 2 23  ? -1.814  29.939  -6.105  1.00 0.00  ? 110 THR A N      7  
ATOM 10053 C CA     . THR B 2 23  ? -0.760  28.932  -6.370  1.00 0.00  ? 110 THR A CA     7  
ATOM 10054 C C      . THR B 2 23  ? -1.305  27.708  -7.131  1.00 0.00  ? 110 THR A C      7  
ATOM 10055 O O      . THR B 2 23  ? -2.504  27.609  -7.395  1.00 0.00  ? 110 THR A O      7  
ATOM 10056 C CB     . THR B 2 23  ? -0.047  28.557  -5.050  1.00 0.00  ? 110 THR A CB     7  
ATOM 10057 O OG1    . THR B 2 23  ? 1.118   27.805  -5.315  1.00 0.00  ? 110 THR A OG1    7  
ATOM 10058 C CG2    . THR B 2 23  ? -0.912  27.753  -4.077  1.00 0.00  ? 110 THR A CG2    7  
ATOM 10059 H H      . THR B 2 23  ? -2.757  29.586  -6.027  1.00 0.00  ? 110 THR A H      7  
ATOM 10060 H HA     . THR B 2 23  ? -0.010  29.384  -7.015  1.00 0.00  ? 110 THR A HA     7  
ATOM 10061 H HB     . THR B 2 23  ? 0.256   29.480  -4.555  1.00 0.00  ? 110 THR A HB     7  
ATOM 10062 H HG1    . THR B 2 23  ? 1.612   27.736  -4.478  1.00 0.00  ? 110 THR A HG1    7  
ATOM 10063 H HG21   . THR B 2 23  ? -1.833  28.294  -3.861  1.00 0.00  ? 110 THR A HG21   7  
ATOM 10064 H HG22   . THR B 2 23  ? -1.148  26.777  -4.496  1.00 0.00  ? 110 THR A HG22   7  
ATOM 10065 H HG23   . THR B 2 23  ? -0.371  27.610  -3.143  1.00 0.00  ? 110 THR A HG23   7  
ATOM 10066 N N      . GLU B 2 24  ? -0.437  26.758  -7.492  1.00 0.00  ? 111 GLU A N      7  
ATOM 10067 C CA     . GLU B 2 24  ? -0.720  25.574  -8.329  1.00 0.00  ? 111 GLU A CA     7  
ATOM 10068 C C      . GLU B 2 24  ? -1.772  24.607  -7.739  1.00 0.00  ? 111 GLU A C      7  
ATOM 10069 O O      . GLU B 2 24  ? -2.369  23.807  -8.462  1.00 0.00  ? 111 GLU A O      7  
ATOM 10070 C CB     . GLU B 2 24  ? 0.617   24.871  -8.624  1.00 0.00  ? 111 GLU A CB     7  
ATOM 10071 C CG     . GLU B 2 24  ? 0.550   23.876  -9.789  1.00 0.00  ? 111 GLU A CG     7  
ATOM 10072 C CD     . GLU B 2 24  ? 1.965   23.468  -10.237 1.00 0.00  ? 111 GLU A CD     7  
ATOM 10073 O OE1    . GLU B 2 24  ? 2.522   22.476  -9.705  1.00 0.00  ? 111 GLU A OE1    7  
ATOM 10074 O OE2    . GLU B 2 24  ? 2.539   24.135  -11.135 1.00 0.00  ? 111 GLU A OE2    7  
ATOM 10075 H H      . GLU B 2 24  ? 0.513   26.904  -7.168  1.00 0.00  ? 111 GLU A H      7  
ATOM 10076 H HA     . GLU B 2 24  ? -1.126  25.931  -9.278  1.00 0.00  ? 111 GLU A HA     7  
ATOM 10077 H HB2    . GLU B 2 24  ? 1.351   25.636  -8.885  1.00 0.00  ? 111 GLU A HB2    7  
ATOM 10078 H HB3    . GLU B 2 24  ? 0.968   24.358  -7.728  1.00 0.00  ? 111 GLU A HB3    7  
ATOM 10079 H HG2    . GLU B 2 24  ? -0.017  22.996  -9.485  1.00 0.00  ? 111 GLU A HG2    7  
ATOM 10080 H HG3    . GLU B 2 24  ? 0.022   24.341  -10.627 1.00 0.00  ? 111 GLU A HG3    7  
ATOM 10081 N N      . ASN B 2 25  ? -2.103  24.758  -6.452  1.00 0.00  ? 112 ASN A N      7  
ATOM 10082 C CA     . ASN B 2 25  ? -3.271  24.159  -5.790  1.00 0.00  ? 112 ASN A CA     7  
ATOM 10083 C C      . ASN B 2 25  ? -4.609  24.424  -6.529  1.00 0.00  ? 112 ASN A C      7  
ATOM 10084 O O      . ASN B 2 25  ? -5.559  23.653  -6.377  1.00 0.00  ? 112 ASN A O      7  
ATOM 10085 C CB     . ASN B 2 25  ? -3.305  24.689  -4.346  1.00 0.00  ? 112 ASN A CB     7  
ATOM 10086 C CG     . ASN B 2 25  ? -4.405  24.045  -3.516  1.00 0.00  ? 112 ASN A CG     7  
ATOM 10087 O OD1    . ASN B 2 25  ? -4.488  22.832  -3.394  1.00 0.00  ? 112 ASN A OD1    7  
ATOM 10088 N ND2    . ASN B 2 25  ? -5.284  24.820  -2.923  1.00 0.00  ? 112 ASN A ND2    7  
ATOM 10089 H H      . ASN B 2 25  ? -1.547  25.423  -5.937  1.00 0.00  ? 112 ASN A H      7  
ATOM 10090 H HA     . ASN B 2 25  ? -3.133  23.078  -5.756  1.00 0.00  ? 112 ASN A HA     7  
ATOM 10091 H HB2    . ASN B 2 25  ? -2.358  24.461  -3.857  1.00 0.00  ? 112 ASN A HB2    7  
ATOM 10092 H HB3    . ASN B 2 25  ? -3.442  25.772  -4.355  1.00 0.00  ? 112 ASN A HB3    7  
ATOM 10093 H HD21   . ASN B 2 25  ? -5.231  25.824  -2.990  1.00 0.00  ? 112 ASN A HD21   7  
ATOM 10094 H HD22   . ASN B 2 25  ? -5.995  24.371  -2.366  1.00 0.00  ? 112 ASN A HD22   7  
ATOM 10095 N N      . LYS B 2 26  ? -4.657  25.455  -7.389  1.00 0.00  ? 113 LYS A N      7  
ATOM 10096 C CA     . LYS B 2 26  ? -5.728  25.763  -8.355  1.00 0.00  ? 113 LYS A CA     7  
ATOM 10097 C C      . LYS B 2 26  ? -6.120  24.575  -9.257  1.00 0.00  ? 113 LYS A C      7  
ATOM 10098 O O      . LYS B 2 26  ? -7.278  24.496  -9.674  1.00 0.00  ? 113 LYS A O      7  
ATOM 10099 C CB     . LYS B 2 26  ? -5.264  26.983  -9.184  1.00 0.00  ? 113 LYS A CB     7  
ATOM 10100 C CG     . LYS B 2 26  ? -6.259  27.527  -10.220 1.00 0.00  ? 113 LYS A CG     7  
ATOM 10101 C CD     . LYS B 2 26  ? -7.564  28.049  -9.597  1.00 0.00  ? 113 LYS A CD     7  
ATOM 10102 C CE     . LYS B 2 26  ? -8.462  28.756  -10.622 1.00 0.00  ? 113 LYS A CE     7  
ATOM 10103 N NZ     . LYS B 2 26  ? -9.016  27.818  -11.638 1.00 0.00  ? 113 LYS A NZ     7  
ATOM 10104 H H      . LYS B 2 26  ? -3.833  26.049  -7.401  1.00 0.00  ? 113 LYS A H      7  
ATOM 10105 H HA     . LYS B 2 26  ? -6.624  26.041  -7.797  1.00 0.00  ? 113 LYS A HA     7  
ATOM 10106 H HB2    . LYS B 2 26  ? -5.021  27.798  -8.499  1.00 0.00  ? 113 LYS A HB2    7  
ATOM 10107 H HB3    . LYS B 2 26  ? -4.346  26.713  -9.709  1.00 0.00  ? 113 LYS A HB3    7  
ATOM 10108 H HG2    . LYS B 2 26  ? -5.777  28.351  -10.746 1.00 0.00  ? 113 LYS A HG2    7  
ATOM 10109 H HG3    . LYS B 2 26  ? -6.480  26.747  -10.951 1.00 0.00  ? 113 LYS A HG3    7  
ATOM 10110 H HD2    . LYS B 2 26  ? -8.119  27.223  -9.147  1.00 0.00  ? 113 LYS A HD2    7  
ATOM 10111 H HD3    . LYS B 2 26  ? -7.317  28.762  -8.808  1.00 0.00  ? 113 LYS A HD3    7  
ATOM 10112 H HE2    . LYS B 2 26  ? -9.284  29.233  -10.082 1.00 0.00  ? 113 LYS A HE2    7  
ATOM 10113 H HE3    . LYS B 2 26  ? -7.884  29.545  -11.113 1.00 0.00  ? 113 LYS A HE3    7  
ATOM 10114 H HZ1    . LYS B 2 26  ? -8.285  27.397  -12.197 1.00 0.00  ? 113 LYS A HZ1    7  
ATOM 10115 H HZ2    . LYS B 2 26  ? -9.543  27.073  -11.204 1.00 0.00  ? 113 LYS A HZ2    7  
ATOM 10116 H HZ3    . LYS B 2 26  ? -9.639  28.298  -12.274 1.00 0.00  ? 113 LYS A HZ3    7  
ATOM 10117 N N      . SER B 2 27  ? -5.196  23.646  -9.534  1.00 0.00  ? 114 SER A N      7  
ATOM 10118 C CA     . SER B 2 27  ? -5.433  22.439  -10.351 1.00 0.00  ? 114 SER A CA     7  
ATOM 10119 C C      . SER B 2 27  ? -4.809  21.142  -9.806  1.00 0.00  ? 114 SER A C      7  
ATOM 10120 O O      . SER B 2 27  ? -5.255  20.057  -10.188 1.00 0.00  ? 114 SER A O      7  
ATOM 10121 C CB     . SER B 2 27  ? -4.951  22.685  -11.786 1.00 0.00  ? 114 SER A CB     7  
ATOM 10122 O OG     . SER B 2 27  ? -3.561  22.974  -11.812 1.00 0.00  ? 114 SER A OG     7  
ATOM 10123 H H      . SER B 2 27  ? -4.255  23.837  -9.214  1.00 0.00  ? 114 SER A H      7  
ATOM 10124 H HA     . SER B 2 27  ? -6.508  22.255  -10.404 1.00 0.00  ? 114 SER A HA     7  
ATOM 10125 H HB2    . SER B 2 27  ? -5.147  21.796  -12.391 1.00 0.00  ? 114 SER A HB2    7  
ATOM 10126 H HB3    . SER B 2 27  ? -5.508  23.524  -12.210 1.00 0.00  ? 114 SER A HB3    7  
ATOM 10127 H HG     . SER B 2 27  ? -3.303  23.145  -12.737 1.00 0.00  ? 114 SER A HG     7  
ATOM 10128 N N      . GLN B 2 28  ? -3.815  21.210  -8.913  1.00 0.00  ? 115 GLN A N      7  
ATOM 10129 C CA     . GLN B 2 28  ? -3.094  20.045  -8.375  1.00 0.00  ? 115 GLN A CA     7  
ATOM 10130 C C      . GLN B 2 28  ? -4.007  19.061  -7.586  1.00 0.00  ? 115 GLN A C      7  
ATOM 10131 O O      . GLN B 2 28  ? -4.706  19.498  -6.664  1.00 0.00  ? 115 GLN A O      7  
ATOM 10132 C CB     . GLN B 2 28  ? -1.933  20.551  -7.500  1.00 0.00  ? 115 GLN A CB     7  
ATOM 10133 C CG     . GLN B 2 28  ? -0.969  19.426  -7.085  1.00 0.00  ? 115 GLN A CG     7  
ATOM 10134 C CD     . GLN B 2 28  ? 0.265   19.949  -6.348  1.00 0.00  ? 115 GLN A CD     7  
ATOM 10135 O OE1    . GLN B 2 28  ? 0.220   20.895  -5.574  1.00 0.00  ? 115 GLN A OE1    7  
ATOM 10136 N NE2    . GLN B 2 28  ? 1.418   19.347  -6.548  1.00 0.00  ? 115 GLN A NE2    7  
ATOM 10137 H H      . GLN B 2 28  ? -3.452  22.129  -8.691  1.00 0.00  ? 115 GLN A H      7  
ATOM 10138 H HA     . GLN B 2 28  ? -2.648  19.535  -9.226  1.00 0.00  ? 115 GLN A HA     7  
ATOM 10139 H HB2    . GLN B 2 28  ? -1.359  21.282  -8.072  1.00 0.00  ? 115 GLN A HB2    7  
ATOM 10140 H HB3    . GLN B 2 28  ? -2.331  21.041  -6.612  1.00 0.00  ? 115 GLN A HB3    7  
ATOM 10141 H HG2    . GLN B 2 28  ? -1.483  18.725  -6.432  1.00 0.00  ? 115 GLN A HG2    7  
ATOM 10142 H HG3    . GLN B 2 28  ? -0.648  18.891  -7.983  1.00 0.00  ? 115 GLN A HG3    7  
ATOM 10143 H HE21   . GLN B 2 28  ? 1.500   18.562  -7.176  1.00 0.00  ? 115 GLN A HE21   7  
ATOM 10144 H HE22   . GLN B 2 28  ? 2.219   19.704  -6.048  1.00 0.00  ? 115 GLN A HE22   7  
ATOM 10145 N N      . PRO B 2 29  ? -4.010  17.744  -7.903  1.00 0.00  ? 116 PRO A N      7  
ATOM 10146 C CA     . PRO B 2 29  ? -4.641  16.668  -7.117  1.00 0.00  ? 116 PRO A CA     7  
ATOM 10147 C C      . PRO B 2 29  ? -4.204  16.550  -5.643  1.00 0.00  ? 116 PRO A C      7  
ATOM 10148 O O      . PRO B 2 29  ? -3.301  17.247  -5.180  1.00 0.00  ? 116 PRO A O      7  
ATOM 10149 C CB     . PRO B 2 29  ? -4.318  15.371  -7.879  1.00 0.00  ? 116 PRO A CB     7  
ATOM 10150 C CG     . PRO B 2 29  ? -4.220  15.847  -9.323  1.00 0.00  ? 116 PRO A CG     7  
ATOM 10151 C CD     . PRO B 2 29  ? -3.515  17.191  -9.157  1.00 0.00  ? 116 PRO A CD     7  
ATOM 10152 H HA     . PRO B 2 29  ? -5.722  16.823  -7.133  1.00 0.00  ? 116 PRO A HA     7  
ATOM 10153 H HB2    . PRO B 2 29  ? -3.355  14.976  -7.556  1.00 0.00  ? 116 PRO A HB2    7  
ATOM 10154 H HB3    . PRO B 2 29  ? -5.097  14.622  -7.761  1.00 0.00  ? 116 PRO A HB3    7  
ATOM 10155 H HG2    . PRO B 2 29  ? -3.656  15.159  -9.948  1.00 0.00  ? 116 PRO A HG2    7  
ATOM 10156 H HG3    . PRO B 2 29  ? -5.221  16.002  -9.730  1.00 0.00  ? 116 PRO A HG3    7  
ATOM 10157 H HD2    . PRO B 2 29  ? -2.437  17.046  -9.083  1.00 0.00  ? 116 PRO A HD2    7  
ATOM 10158 H HD3    . PRO B 2 29  ? -3.752  17.830  -10.009 1.00 0.00  ? 116 PRO A HD3    7  
ATOM 10159 N N      . LYS B 2 30  ? -4.862  15.643  -4.903  1.00 0.00  ? 117 LYS A N      7  
ATOM 10160 C CA     . LYS B 2 30  ? -4.655  15.281  -3.495  1.00 0.00  ? 117 LYS A CA     7  
ATOM 10161 C C      . LYS B 2 30  ? -5.418  13.980  -3.210  1.00 0.00  ? 117 LYS A C      7  
ATOM 10162 O O      . LYS B 2 30  ? -5.891  13.343  -4.155  1.00 0.00  ? 117 LYS A O      7  
ATOM 10163 C CB     . LYS B 2 30  ? -4.945  16.437  -2.520  1.00 0.00  ? 117 LYS A CB     7  
ATOM 10164 C CG     . LYS B 2 30  ? -6.338  17.094  -2.563  1.00 0.00  ? 117 LYS A CG     7  
ATOM 10165 C CD     . LYS B 2 30  ? -6.518  18.240  -3.573  1.00 0.00  ? 117 LYS A CD     7  
ATOM 10166 C CE     . LYS B 2 30  ? -5.577  19.419  -3.309  1.00 0.00  ? 117 LYS A CE     7  
ATOM 10167 N NZ     . LYS B 2 30  ? -5.809  20.515  -4.282  1.00 0.00  ? 117 LYS A NZ     7  
ATOM 10168 H H      . LYS B 2 30  ? -5.444  14.944  -5.354  1.00 0.00  ? 117 LYS A H      7  
ATOM 10169 H HA     . LYS B 2 30  ? -3.602  15.041  -3.372  1.00 0.00  ? 117 LYS A HA     7  
ATOM 10170 H HB2    . LYS B 2 30  ? -4.799  16.050  -1.514  1.00 0.00  ? 117 LYS A HB2    7  
ATOM 10171 H HB3    . LYS B 2 30  ? -4.163  17.179  -2.655  1.00 0.00  ? 117 LYS A HB3    7  
ATOM 10172 H HG2    . LYS B 2 30  ? -7.085  16.326  -2.761  1.00 0.00  ? 117 LYS A HG2    7  
ATOM 10173 H HG3    . LYS B 2 30  ? -6.544  17.501  -1.572  1.00 0.00  ? 117 LYS A HG3    7  
ATOM 10174 H HD2    . LYS B 2 30  ? -6.379  17.873  -4.588  1.00 0.00  ? 117 LYS A HD2    7  
ATOM 10175 H HD3    . LYS B 2 30  ? -7.538  18.608  -3.481  1.00 0.00  ? 117 LYS A HD3    7  
ATOM 10176 H HE2    . LYS B 2 30  ? -5.746  19.784  -2.293  1.00 0.00  ? 117 LYS A HE2    7  
ATOM 10177 H HE3    . LYS B 2 30  ? -4.540  19.079  -3.377  1.00 0.00  ? 117 LYS A HE3    7  
ATOM 10178 H HZ1    . LYS B 2 30  ? -5.533  20.227  -5.217  1.00 0.00  ? 117 LYS A HZ1    7  
ATOM 10179 H HZ2    . LYS B 2 30  ? -6.777  20.799  -4.295  1.00 0.00  ? 117 LYS A HZ2    7  
ATOM 10180 H HZ3    . LYS B 2 30  ? -5.251  21.331  -4.040  1.00 0.00  ? 117 LYS A HZ3    7  
ATOM 10181 N N      . ARG B 2 31  ? -5.367  13.473  -1.981  1.00 0.00  ? 118 ARG A N      7  
ATOM 10182 C CA     . ARG B 2 31  ? -5.094  12.038  -1.805  1.00 0.00  ? 118 ARG A CA     7  
ATOM 10183 C C      . ARG B 2 31  ? -6.184  11.199  -1.130  1.00 0.00  ? 118 ARG A C      7  
ATOM 10184 O O      . ARG B 2 31  ? -7.172  11.704  -0.604  1.00 0.00  ? 118 ARG A O      7  
ATOM 10185 C CB     . ARG B 2 31  ? -3.666  11.898  -1.262  1.00 0.00  ? 118 ARG A CB     7  
ATOM 10186 C CG     . ARG B 2 31  ? -3.469  12.304  0.201   1.00 0.00  ? 118 ARG A CG     7  
ATOM 10187 C CD     . ARG B 2 31  ? -1.970  12.248  0.530   1.00 0.00  ? 118 ARG A CD     7  
ATOM 10188 N NE     . ARG B 2 31  ? -1.737  12.513  1.956   1.00 0.00  ? 118 ARG A NE     7  
ATOM 10189 C CZ     . ARG B 2 31  ? -0.660  12.986  2.550   1.00 0.00  ? 118 ARG A CZ     7  
ATOM 10190 N NH1    . ARG B 2 31  ? 0.412   13.336  1.896   1.00 0.00  ? 118 ARG A NH1    7  
ATOM 10191 N NH2    . ARG B 2 31  ? -0.660  13.126  3.843   1.00 0.00  ? 118 ARG A NH2    7  
ATOM 10192 H H      . ARG B 2 31  ? -5.076  14.102  -1.247  1.00 0.00  ? 118 ARG A H      7  
ATOM 10193 H HA     . ARG B 2 31  ? -5.064  11.593  -2.800  1.00 0.00  ? 118 ARG A HA     7  
ATOM 10194 H HB2    . ARG B 2 31  ? -3.322  10.872  -1.368  1.00 0.00  ? 118 ARG A HB2    7  
ATOM 10195 H HB3    . ARG B 2 31  ? -3.046  12.529  -1.904  1.00 0.00  ? 118 ARG A HB3    7  
ATOM 10196 H HG2    . ARG B 2 31  ? -3.835  13.317  0.365   1.00 0.00  ? 118 ARG A HG2    7  
ATOM 10197 H HG3    . ARG B 2 31  ? -4.012  11.616  0.848   1.00 0.00  ? 118 ARG A HG3    7  
ATOM 10198 H HD2    . ARG B 2 31  ? -1.585  11.254  0.287   1.00 0.00  ? 118 ARG A HD2    7  
ATOM 10199 H HD3    . ARG B 2 31  ? -1.449  12.986  -0.085  1.00 0.00  ? 118 ARG A HD3    7  
ATOM 10200 H HE     . ARG B 2 31  ? -2.475  12.254  2.604   1.00 0.00  ? 118 ARG A HE     7  
ATOM 10201 H HH11   . ARG B 2 31  ? 0.435   13.218  0.898   1.00 0.00  ? 118 ARG A HH11   7  
ATOM 10202 H HH12   . ARG B 2 31  ? 1.213   13.695  2.389   1.00 0.00  ? 118 ARG A HH12   7  
ATOM 10203 H HH21   . ARG B 2 31  ? -1.483  12.812  4.337   1.00 0.00  ? 118 ARG A HH21   7  
ATOM 10204 H HH22   . ARG B 2 31  ? 0.149   13.466  4.335   1.00 0.00  ? 118 ARG A HH22   7  
ATOM 10205 N N      . LEU B 2 32  ? -6.013  9.889   -1.289  1.00 0.00  ? 119 LEU A N      7  
ATOM 10206 C CA     . LEU B 2 32  ? -7.059  8.898   -1.539  1.00 0.00  ? 119 LEU A CA     7  
ATOM 10207 C C      . LEU B 2 32  ? -6.686  7.580   -0.840  1.00 0.00  ? 119 LEU A C      7  
ATOM 10208 O O      . LEU B 2 32  ? -5.612  7.046   -1.114  1.00 0.00  ? 119 LEU A O      7  
ATOM 10209 C CB     . LEU B 2 32  ? -7.134  8.761   -3.085  1.00 0.00  ? 119 LEU A CB     7  
ATOM 10210 C CG     . LEU B 2 32  ? -8.094  7.714   -3.659  1.00 0.00  ? 119 LEU A CG     7  
ATOM 10211 C CD1    . LEU B 2 32  ? -9.517  7.981   -3.198  1.00 0.00  ? 119 LEU A CD1    7  
ATOM 10212 C CD2    . LEU B 2 32  ? -8.116  7.766   -5.185  1.00 0.00  ? 119 LEU A CD2    7  
ATOM 10213 H H      . LEU B 2 32  ? -5.122  9.646   -1.707  1.00 0.00  ? 119 LEU A H      7  
ATOM 10214 H HA     . LEU B 2 32  ? -8.012  9.258   -1.145  1.00 0.00  ? 119 LEU A HA     7  
ATOM 10215 H HB2    . LEU B 2 32  ? -7.375  9.737   -3.509  1.00 0.00  ? 119 LEU A HB2    7  
ATOM 10216 H HB3    . LEU B 2 32  ? -6.151  8.476   -3.452  1.00 0.00  ? 119 LEU A HB3    7  
ATOM 10217 H HG     . LEU B 2 32  ? -7.749  6.722   -3.365  1.00 0.00  ? 119 LEU A HG     7  
ATOM 10218 H HD11   . LEU B 2 32  ? -9.563  7.991   -2.117  1.00 0.00  ? 119 LEU A HD11   7  
ATOM 10219 H HD12   . LEU B 2 32  ? -9.862  8.949   -3.568  1.00 0.00  ? 119 LEU A HD12   7  
ATOM 10220 H HD13   . LEU B 2 32  ? -10.171 7.195   -3.551  1.00 0.00  ? 119 LEU A HD13   7  
ATOM 10221 H HD21   . LEU B 2 32  ? -8.459  8.746   -5.517  1.00 0.00  ? 119 LEU A HD21   7  
ATOM 10222 H HD22   . LEU B 2 32  ? -7.120  7.580   -5.582  1.00 0.00  ? 119 LEU A HD22   7  
ATOM 10223 H HD23   . LEU B 2 32  ? -8.784  7.001   -5.572  1.00 0.00  ? 119 LEU A HD23   7  
ATOM 10224 N N      . HIS B 2 33  ? -7.517  7.079   0.081   1.00 0.00  ? 120 HIS A N      7  
ATOM 10225 C CA     . HIS B 2 33  ? -7.300  5.829   0.835   1.00 0.00  ? 120 HIS A CA     7  
ATOM 10226 C C      . HIS B 2 33  ? -7.857  4.636   0.041   1.00 0.00  ? 120 HIS A C      7  
ATOM 10227 O O      . HIS B 2 33  ? -8.949  4.690   -0.525  1.00 0.00  ? 120 HIS A O      7  
ATOM 10228 C CB     . HIS B 2 33  ? -8.005  5.950   2.203   1.00 0.00  ? 120 HIS A CB     7  
ATOM 10229 C CG     . HIS B 2 33  ? -8.153  4.670   2.991   1.00 0.00  ? 120 HIS A CG     7  
ATOM 10230 N ND1    . HIS B 2 33  ? -9.317  3.910   3.104   1.00 0.00  ? 120 HIS A ND1    7  
ATOM 10231 C CD2    . HIS B 2 33  ? -7.207  4.149   3.821   1.00 0.00  ? 120 HIS A CD2    7  
ATOM 10232 C CE1    . HIS B 2 33  ? -9.047  2.950   4.006   1.00 0.00  ? 120 HIS A CE1    7  
ATOM 10233 N NE2    . HIS B 2 33  ? -7.779  3.061   4.441   1.00 0.00  ? 120 HIS A NE2    7  
ATOM 10234 H H      . HIS B 2 33  ? -8.446  7.485   0.140   1.00 0.00  ? 120 HIS A H      7  
ATOM 10235 H HA     . HIS B 2 33  ? -6.218  5.662   0.981   1.00 0.00  ? 120 HIS A HA     7  
ATOM 10236 H HB2    . HIS B 2 33  ? -7.446  6.635   2.843   1.00 0.00  ? 120 HIS A HB2    7  
ATOM 10237 H HB3    . HIS B 2 33  ? -9.004  6.362   2.056   1.00 0.00  ? 120 HIS A HB3    7  
ATOM 10238 H HD2    . HIS B 2 33  ? -6.218  4.542   3.976   1.00 0.00  ? 120 HIS A HD2    7  
ATOM 10239 H HE1    . HIS B 2 33  ? -9.745  2.188   4.340   1.00 0.00  ? 120 HIS A HE1    7  
ATOM 10240 H HE2    . HIS B 2 33  ? -7.338  2.448   5.116   1.00 0.00  ? 120 HIS A HE2    7  
ATOM 10241 N N      . VAL B 2 34  ? -7.080  3.560   -0.032  1.00 0.00  ? 121 VAL A N      7  
ATOM 10242 C CA     . VAL B 2 34  ? -7.238  2.469   -1.004  1.00 0.00  ? 121 VAL A CA     7  
ATOM 10243 C C      . VAL B 2 34  ? -7.136  1.137   -0.269  1.00 0.00  ? 121 VAL A C      7  
ATOM 10244 O O      . VAL B 2 34  ? -6.047  0.594   -0.085  1.00 0.00  ? 121 VAL A O      7  
ATOM 10245 C CB     . VAL B 2 34  ? -6.190  2.632   -2.118  1.00 0.00  ? 121 VAL A CB     7  
ATOM 10246 C CG1    . VAL B 2 34  ? -6.232  1.549   -3.185  1.00 0.00  ? 121 VAL A CG1    7  
ATOM 10247 C CG2    . VAL B 2 34  ? -6.388  3.955   -2.865  1.00 0.00  ? 121 VAL A CG2    7  
ATOM 10248 H H      . VAL B 2 34  ? -6.188  3.592   0.452   1.00 0.00  ? 121 VAL A H      7  
ATOM 10249 H HA     . VAL B 2 34  ? -8.226  2.507   -1.462  1.00 0.00  ? 121 VAL A HA     7  
ATOM 10250 H HB     . VAL B 2 34  ? -5.191  2.629   -1.687  1.00 0.00  ? 121 VAL A HB     7  
ATOM 10251 H HG11   . VAL B 2 34  ? -6.092  0.565   -2.740  1.00 0.00  ? 121 VAL A HG11   7  
ATOM 10252 H HG12   . VAL B 2 34  ? -7.172  1.587   -3.726  1.00 0.00  ? 121 VAL A HG12   7  
ATOM 10253 H HG13   . VAL B 2 34  ? -5.407  1.748   -3.864  1.00 0.00  ? 121 VAL A HG13   7  
ATOM 10254 H HG21   . VAL B 2 34  ? -7.416  4.039   -3.223  1.00 0.00  ? 121 VAL A HG21   7  
ATOM 10255 H HG22   . VAL B 2 34  ? -6.167  4.796   -2.214  1.00 0.00  ? 121 VAL A HG22   7  
ATOM 10256 H HG23   . VAL B 2 34  ? -5.711  4.000   -3.715  1.00 0.00  ? 121 VAL A HG23   7  
ATOM 10257 N N      . SER B 2 35  ? -8.280  0.661   0.224   1.00 0.00  ? 122 SER A N      7  
ATOM 10258 C CA     . SER B 2 35  ? -8.406  -0.430  1.191   1.00 0.00  ? 122 SER A CA     7  
ATOM 10259 C C      . SER B 2 35  ? -8.766  -1.775  0.576   1.00 0.00  ? 122 SER A C      7  
ATOM 10260 O O      . SER B 2 35  ? -9.191  -1.859  -0.577  1.00 0.00  ? 122 SER A O      7  
ATOM 10261 C CB     . SER B 2 35  ? -9.473  -0.080  2.231   1.00 0.00  ? 122 SER A CB     7  
ATOM 10262 O OG     . SER B 2 35  ? -9.090  -0.605  3.491   1.00 0.00  ? 122 SER A OG     7  
ATOM 10263 H H      . SER B 2 35  ? -9.130  1.154   -0.031  1.00 0.00  ? 122 SER A H      7  
ATOM 10264 H HA     . SER B 2 35  ? -7.454  -0.548  1.695   1.00 0.00  ? 122 SER A HA     7  
ATOM 10265 H HB2    . SER B 2 35  ? -9.593  0.998   2.292   1.00 0.00  ? 122 SER A HB2    7  
ATOM 10266 H HB3    . SER B 2 35  ? -10.433 -0.505  1.938   1.00 0.00  ? 122 SER A HB3    7  
ATOM 10267 H HG     . SER B 2 35  ? -9.815  -0.465  4.126   1.00 0.00  ? 122 SER A HG     7  
ATOM 10268 N N      . ASN B 2 36  ? -8.664  -2.832  1.386   1.00 0.00  ? 123 ASN A N      7  
ATOM 10269 C CA     . ASN B 2 36  ? -9.020  -4.216  1.060   1.00 0.00  ? 123 ASN A CA     7  
ATOM 10270 C C      . ASN B 2 36  ? -8.348  -4.703  -0.236  1.00 0.00  ? 123 ASN A C      7  
ATOM 10271 O O      . ASN B 2 36  ? -8.931  -5.432  -1.036  1.00 0.00  ? 123 ASN A O      7  
ATOM 10272 C CB     . ASN B 2 36  ? -10.552 -4.374  1.090   1.00 0.00  ? 123 ASN A CB     7  
ATOM 10273 C CG     . ASN B 2 36  ? -10.982 -5.834  1.070   1.00 0.00  ? 123 ASN A CG     7  
ATOM 10274 O OD1    . ASN B 2 36  ? -10.544 -6.650  1.872   1.00 0.00  ? 123 ASN A OD1    7  
ATOM 10275 N ND2    . ASN B 2 36  ? -11.844 -6.222  0.159   1.00 0.00  ? 123 ASN A ND2    7  
ATOM 10276 H H      . ASN B 2 36  ? -8.201  -2.649  2.267   1.00 0.00  ? 123 ASN A H      7  
ATOM 10277 H HA     . ASN B 2 36  ? -8.621  -4.853  1.852   1.00 0.00  ? 123 ASN A HA     7  
ATOM 10278 H HB2    . ASN B 2 36  ? -10.939 -3.932  2.006   1.00 0.00  ? 123 ASN A HB2    7  
ATOM 10279 H HB3    . ASN B 2 36  ? -10.987 -3.853  0.241   1.00 0.00  ? 123 ASN A HB3    7  
ATOM 10280 H HD21   . ASN B 2 36  ? -12.111 -5.566  -0.571  1.00 0.00  ? 123 ASN A HD21   7  
ATOM 10281 H HD22   . ASN B 2 36  ? -12.192 -7.164  0.190   1.00 0.00  ? 123 ASN A HD22   7  
ATOM 10282 N N      . ILE B 2 37  ? -7.103  -4.276  -0.452  1.00 0.00  ? 124 ILE A N      7  
ATOM 10283 C CA     . ILE B 2 37  ? -6.265  -4.721  -1.569  1.00 0.00  ? 124 ILE A CA     7  
ATOM 10284 C C      . ILE B 2 37  ? -5.686  -6.116  -1.252  1.00 0.00  ? 124 ILE A C      7  
ATOM 10285 O O      . ILE B 2 37  ? -5.536  -6.435  -0.066  1.00 0.00  ? 124 ILE A O      7  
ATOM 10286 C CB     . ILE B 2 37  ? -5.167  -3.663  -1.846  1.00 0.00  ? 124 ILE A CB     7  
ATOM 10287 C CG1    . ILE B 2 37  ? -4.011  -3.740  -0.824  1.00 0.00  ? 124 ILE A CG1    7  
ATOM 10288 C CG2    . ILE B 2 37  ? -5.786  -2.252  -1.860  1.00 0.00  ? 124 ILE A CG2    7  
ATOM 10289 C CD1    . ILE B 2 37  ? -3.071  -2.538  -0.892  1.00 0.00  ? 124 ILE A CD1    7  
ATOM 10290 H H      . ILE B 2 37  ? -6.695  -3.670  0.250   1.00 0.00  ? 124 ILE A H      7  
ATOM 10291 H HA     . ILE B 2 37  ? -6.892  -4.789  -2.457  1.00 0.00  ? 124 ILE A HA     7  
ATOM 10292 H HB     . ILE B 2 37  ? -4.753  -3.862  -2.836  1.00 0.00  ? 124 ILE A HB     7  
ATOM 10293 H HG12   . ILE B 2 37  ? -4.410  -3.801  0.184   1.00 0.00  ? 124 ILE A HG12   7  
ATOM 10294 H HG13   . ILE B 2 37  ? -3.427  -4.640  -1.010  1.00 0.00  ? 124 ILE A HG13   7  
ATOM 10295 H HG21   . ILE B 2 37  ? -6.735  -2.253  -2.396  1.00 0.00  ? 124 ILE A HG21   7  
ATOM 10296 H HG22   . ILE B 2 37  ? -5.939  -1.905  -0.834  1.00 0.00  ? 124 ILE A HG22   7  
ATOM 10297 H HG23   . ILE B 2 37  ? -5.113  -1.551  -2.358  1.00 0.00  ? 124 ILE A HG23   7  
ATOM 10298 H HD11   . ILE B 2 37  ? -2.768  -2.370  -1.928  1.00 0.00  ? 124 ILE A HD11   7  
ATOM 10299 H HD12   . ILE B 2 37  ? -3.588  -1.658  -0.521  1.00 0.00  ? 124 ILE A HD12   7  
ATOM 10300 H HD13   . ILE B 2 37  ? -2.199  -2.730  -0.271  1.00 0.00  ? 124 ILE A HD13   7  
ATOM 10301 N N      . PRO B 2 38  ? -5.331  -6.952  -2.247  1.00 0.00  ? 125 PRO A N      7  
ATOM 10302 C CA     . PRO B 2 38  ? -4.601  -8.199  -2.004  1.00 0.00  ? 125 PRO A CA     7  
ATOM 10303 C C      . PRO B 2 38  ? -3.279  -7.912  -1.288  1.00 0.00  ? 125 PRO A C      7  
ATOM 10304 O O      . PRO B 2 38  ? -2.524  -7.049  -1.728  1.00 0.00  ? 125 PRO A O      7  
ATOM 10305 C CB     . PRO B 2 38  ? -4.341  -8.820  -3.383  1.00 0.00  ? 125 PRO A CB     7  
ATOM 10306 C CG     . PRO B 2 38  ? -5.339  -8.117  -4.294  1.00 0.00  ? 125 PRO A CG     7  
ATOM 10307 C CD     . PRO B 2 38  ? -5.541  -6.740  -3.669  1.00 0.00  ? 125 PRO A CD     7  
ATOM 10308 H HA     . PRO B 2 38  ? -5.221  -8.875  -1.409  1.00 0.00  ? 125 PRO A HA     7  
ATOM 10309 H HB2    . PRO B 2 38  ? -3.331  -8.601  -3.734  1.00 0.00  ? 125 PRO A HB2    7  
ATOM 10310 H HB3    . PRO B 2 38  ? -4.501  -9.896  -3.375  1.00 0.00  ? 125 PRO A HB3    7  
ATOM 10311 H HG2    . PRO B 2 38  ? -4.975  -8.055  -5.309  1.00 0.00  ? 125 PRO A HG2    7  
ATOM 10312 H HG3    . PRO B 2 38  ? -6.270  -8.665  -4.297  1.00 0.00  ? 125 PRO A HG3    7  
ATOM 10313 H HD2    . PRO B 2 38  ? -4.794  -6.044  -4.044  1.00 0.00  ? 125 PRO A HD2    7  
ATOM 10314 H HD3    . PRO B 2 38  ? -6.544  -6.373  -3.888  1.00 0.00  ? 125 PRO A HD3    7  
ATOM 10315 N N      . PHE B 2 39  ? -2.950  -8.629  -0.211  1.00 0.00  ? 126 PHE A N      7  
ATOM 10316 C CA     . PHE B 2 39  ? -1.768  -8.325  0.613   1.00 0.00  ? 126 PHE A CA     7  
ATOM 10317 C C      . PHE B 2 39  ? -0.414  -8.297  -0.129  1.00 0.00  ? 126 PHE A C      7  
ATOM 10318 O O      . PHE B 2 39  ? 0.521   -7.644  0.341   1.00 0.00  ? 126 PHE A O      7  
ATOM 10319 C CB     . PHE B 2 39  ? -1.661  -9.341  1.747   1.00 0.00  ? 126 PHE A CB     7  
ATOM 10320 C CG     . PHE B 2 39  ? -2.472  -9.102  2.999   1.00 0.00  ? 126 PHE A CG     7  
ATOM 10321 C CD1    . PHE B 2 39  ? -2.547  -7.820  3.581   1.00 0.00  ? 126 PHE A CD1    7  
ATOM 10322 C CD2    . PHE B 2 39  ? -3.018  -10.212 3.672   1.00 0.00  ? 126 PHE A CD2    7  
ATOM 10323 C CE1    . PHE B 2 39  ? -3.214  -7.657  4.805   1.00 0.00  ? 126 PHE A CE1    7  
ATOM 10324 C CE2    . PHE B 2 39  ? -3.636  -10.049 4.921   1.00 0.00  ? 126 PHE A CE2    7  
ATOM 10325 C CZ     . PHE B 2 39  ? -3.748  -8.765  5.475   1.00 0.00  ? 126 PHE A CZ     7  
ATOM 10326 H H      . PHE B 2 39  ? -3.612  -9.316  0.130   1.00 0.00  ? 126 PHE A H      7  
ATOM 10327 H HA     . PHE B 2 39  ? -1.902  -7.330  1.030   1.00 0.00  ? 126 PHE A HA     7  
ATOM 10328 H HB2    . PHE B 2 39  ? -1.864  -10.337 1.351   1.00 0.00  ? 126 PHE A HB2    7  
ATOM 10329 H HB3    . PHE B 2 39  ? -0.632  -9.337  2.080   1.00 0.00  ? 126 PHE A HB3    7  
ATOM 10330 H HD1    . PHE B 2 39  ? -2.051  -6.961  3.139   1.00 0.00  ? 126 PHE A HD1    7  
ATOM 10331 H HD2    . PHE B 2 39  ? -2.933  -11.201 3.244   1.00 0.00  ? 126 PHE A HD2    7  
ATOM 10332 H HE1    . PHE B 2 39  ? -3.285  -6.689  5.269   1.00 0.00  ? 126 PHE A HE1    7  
ATOM 10333 H HE2    . PHE B 2 39  ? -4.038  -10.908 5.441   1.00 0.00  ? 126 PHE A HE2    7  
ATOM 10334 H HZ     . PHE B 2 39  ? -4.230  -8.614  6.428   1.00 0.00  ? 126 PHE A HZ     7  
ATOM 10335 N N      . ARG B 2 40  ? -0.301  -8.988  -1.273  1.00 0.00  ? 127 ARG A N      7  
ATOM 10336 C CA     . ARG B 2 40  ? 0.879   -8.994  -2.158  1.00 0.00  ? 127 ARG A CA     7  
ATOM 10337 C C      . ARG B 2 40  ? 1.128   -7.654  -2.882  1.00 0.00  ? 127 ARG A C      7  
ATOM 10338 O O      . ARG B 2 40  ? 2.190   -7.499  -3.490  1.00 0.00  ? 127 ARG A O      7  
ATOM 10339 C CB     . ARG B 2 40  ? 0.752   -10.145 -3.176  1.00 0.00  ? 127 ARG A CB     7  
ATOM 10340 C CG     . ARG B 2 40  ? 1.074   -11.545 -2.623  1.00 0.00  ? 127 ARG A CG     7  
ATOM 10341 C CD     . ARG B 2 40  ? 0.063   -12.111 -1.616  1.00 0.00  ? 127 ARG A CD     7  
ATOM 10342 N NE     . ARG B 2 40  ? 0.245   -13.569 -1.459  1.00 0.00  ? 127 ARG A NE     7  
ATOM 10343 C CZ     . ARG B 2 40  ? 1.039   -14.219 -0.626  1.00 0.00  ? 127 ARG A CZ     7  
ATOM 10344 N NH1    . ARG B 2 40  ? 1.691   -13.631 0.333   1.00 0.00  ? 127 ARG A NH1    7  
ATOM 10345 N NH2    . ARG B 2 40  ? 1.193   -15.508 -0.744  1.00 0.00  ? 127 ARG A NH2    7  
ATOM 10346 H H      . ARG B 2 40  ? -1.128  -9.488  -1.562  1.00 0.00  ? 127 ARG A H      7  
ATOM 10347 H HA     . ARG B 2 40  ? 1.779   -9.166  -1.562  1.00 0.00  ? 127 ARG A HA     7  
ATOM 10348 H HB2    . ARG B 2 40  ? -0.248  -10.145 -3.617  1.00 0.00  ? 127 ARG A HB2    7  
ATOM 10349 H HB3    . ARG B 2 40  ? 1.453   -9.967  -3.993  1.00 0.00  ? 127 ARG A HB3    7  
ATOM 10350 H HG2    . ARG B 2 40  ? 1.112   -12.224 -3.477  1.00 0.00  ? 127 ARG A HG2    7  
ATOM 10351 H HG3    . ARG B 2 40  ? 2.066   -11.537 -2.165  1.00 0.00  ? 127 ARG A HG3    7  
ATOM 10352 H HD2    . ARG B 2 40  ? 0.172   -11.598 -0.662  1.00 0.00  ? 127 ARG A HD2    7  
ATOM 10353 H HD3    . ARG B 2 40  ? -0.949  -11.926 -1.991  1.00 0.00  ? 127 ARG A HD3    7  
ATOM 10354 H HE     . ARG B 2 40  ? -0.243  -14.154 -2.119  1.00 0.00  ? 127 ARG A HE     7  
ATOM 10355 H HH11   . ARG B 2 40  ? 1.464   -12.670 0.562   1.00 0.00  ? 127 ARG A HH11   7  
ATOM 10356 H HH12   . ARG B 2 40  ? 2.283   -14.157 0.947   1.00 0.00  ? 127 ARG A HH12   7  
ATOM 10357 H HH21   . ARG B 2 40  ? 0.706   -16.011 -1.469  1.00 0.00  ? 127 ARG A HH21   7  
ATOM 10358 H HH22   . ARG B 2 40  ? 1.799   -16.008 -0.117  1.00 0.00  ? 127 ARG A HH22   7  
ATOM 10359 N N      . PHE B 2 41  ? 0.187   -6.704  -2.830  1.00 0.00  ? 128 PHE A N      7  
ATOM 10360 C CA     . PHE B 2 41  ? 0.280   -5.397  -3.496  1.00 0.00  ? 128 PHE A CA     7  
ATOM 10361 C C      . PHE B 2 41  ? 1.530   -4.570  -3.152  1.00 0.00  ? 128 PHE A C      7  
ATOM 10362 O O      . PHE B 2 41  ? 2.154   -4.714  -2.098  1.00 0.00  ? 128 PHE A O      7  
ATOM 10363 C CB     . PHE B 2 41  ? -0.986  -4.564  -3.225  1.00 0.00  ? 128 PHE A CB     7  
ATOM 10364 C CG     . PHE B 2 41  ? -1.976  -4.532  -4.376  1.00 0.00  ? 128 PHE A CG     7  
ATOM 10365 C CD1    . PHE B 2 41  ? -2.290  -5.700  -5.100  1.00 0.00  ? 128 PHE A CD1    7  
ATOM 10366 C CD2    . PHE B 2 41  ? -2.546  -3.302  -4.757  1.00 0.00  ? 128 PHE A CD2    7  
ATOM 10367 C CE1    . PHE B 2 41  ? -3.137  -5.629  -6.221  1.00 0.00  ? 128 PHE A CE1    7  
ATOM 10368 C CE2    . PHE B 2 41  ? -3.406  -3.235  -5.860  1.00 0.00  ? 128 PHE A CE2    7  
ATOM 10369 C CZ     . PHE B 2 41  ? -3.688  -4.392  -6.601  1.00 0.00  ? 128 PHE A CZ     7  
ATOM 10370 H H      . PHE B 2 41  ? -0.683  -6.925  -2.362  1.00 0.00  ? 128 PHE A H      7  
ATOM 10371 H HA     . PHE B 2 41  ? 0.336   -5.588  -4.569  1.00 0.00  ? 128 PHE A HA     7  
ATOM 10372 H HB2    . PHE B 2 41  ? -1.485  -4.902  -2.318  1.00 0.00  ? 128 PHE A HB2    7  
ATOM 10373 H HB3    . PHE B 2 41  ? -0.684  -3.537  -3.022  1.00 0.00  ? 128 PHE A HB3    7  
ATOM 10374 H HD1    . PHE B 2 41  ? -1.867  -6.654  -4.811  1.00 0.00  ? 128 PHE A HD1    7  
ATOM 10375 H HD2    . PHE B 2 41  ? -2.319  -2.405  -4.204  1.00 0.00  ? 128 PHE A HD2    7  
ATOM 10376 H HE1    . PHE B 2 41  ? -3.364  -6.524  -6.787  1.00 0.00  ? 128 PHE A HE1    7  
ATOM 10377 H HE2    . PHE B 2 41  ? -3.850  -2.295  -6.148  1.00 0.00  ? 128 PHE A HE2    7  
ATOM 10378 H HZ     . PHE B 2 41  ? -4.328  -4.324  -7.469  1.00 0.00  ? 128 PHE A HZ     7  
ATOM 10379 N N      . ARG B 2 42  ? 1.849   -3.653  -4.072  1.00 0.00  ? 129 ARG A N      7  
ATOM 10380 C CA     . ARG B 2 42  ? 3.022   -2.771  -4.098  1.00 0.00  ? 129 ARG A CA     7  
ATOM 10381 C C      . ARG B 2 42  ? 2.653   -1.331  -4.465  1.00 0.00  ? 129 ARG A C      7  
ATOM 10382 O O      . ARG B 2 42  ? 1.613   -1.052  -5.064  1.00 0.00  ? 129 ARG A O      7  
ATOM 10383 C CB     . ARG B 2 42  ? 4.071   -3.368  -5.046  1.00 0.00  ? 129 ARG A CB     7  
ATOM 10384 C CG     . ARG B 2 42  ? 4.510   -4.760  -4.568  1.00 0.00  ? 129 ARG A CG     7  
ATOM 10385 C CD     . ARG B 2 42  ? 5.878   -5.137  -5.123  1.00 0.00  ? 129 ARG A CD     7  
ATOM 10386 N NE     . ARG B 2 42  ? 5.822   -5.530  -6.547  1.00 0.00  ? 129 ARG A NE     7  
ATOM 10387 C CZ     . ARG B 2 42  ? 5.565   -6.729  -7.043  1.00 0.00  ? 129 ARG A CZ     7  
ATOM 10388 N NH1    . ARG B 2 42  ? 5.315   -7.761  -6.284  1.00 0.00  ? 129 ARG A NH1    7  
ATOM 10389 N NH2    . ARG B 2 42  ? 5.565   -6.921  -8.331  1.00 0.00  ? 129 ARG A NH2    7  
ATOM 10390 H H      . ARG B 2 42  ? 1.234   -3.623  -4.878  1.00 0.00  ? 129 ARG A H      7  
ATOM 10391 H HA     . ARG B 2 42  ? 3.524   -2.743  -3.133  1.00 0.00  ? 129 ARG A HA     7  
ATOM 10392 H HB2    . ARG B 2 42  ? 3.699   -3.417  -6.069  1.00 0.00  ? 129 ARG A HB2    7  
ATOM 10393 H HB3    . ARG B 2 42  ? 4.946   -2.730  -5.010  1.00 0.00  ? 129 ARG A HB3    7  
ATOM 10394 H HG2    . ARG B 2 42  ? 4.598   -4.753  -3.480  1.00 0.00  ? 129 ARG A HG2    7  
ATOM 10395 H HG3    . ARG B 2 42  ? 3.771   -5.512  -4.846  1.00 0.00  ? 129 ARG A HG3    7  
ATOM 10396 H HD2    . ARG B 2 42  ? 6.570   -4.303  -5.002  1.00 0.00  ? 129 ARG A HD2    7  
ATOM 10397 H HD3    . ARG B 2 42  ? 6.244   -5.945  -4.500  1.00 0.00  ? 129 ARG A HD3    7  
ATOM 10398 H HE     . ARG B 2 42  ? 6.010   -4.814  -7.230  1.00 0.00  ? 129 ARG A HE     7  
ATOM 10399 H HH11   . ARG B 2 42  ? 5.287   -7.637  -5.287  1.00 0.00  ? 129 ARG A HH11   7  
ATOM 10400 H HH12   . ARG B 2 42  ? 5.119   -8.663  -6.683  1.00 0.00  ? 129 ARG A HH12   7  
ATOM 10401 H HH21   . ARG B 2 42  ? 5.730   -6.152  -8.962  1.00 0.00  ? 129 ARG A HH21   7  
ATOM 10402 H HH22   . ARG B 2 42  ? 5.362   -7.832  -8.703  1.00 0.00  ? 129 ARG A HH22   7  
ATOM 10403 N N      . ASP B 2 43  ? 3.561   -0.419  -4.150  1.00 0.00  ? 130 ASP A N      7  
ATOM 10404 C CA     . ASP B 2 43  ? 3.584   0.960   -4.636  1.00 0.00  ? 130 ASP A CA     7  
ATOM 10405 C C      . ASP B 2 43  ? 3.531   0.996   -6.192  1.00 0.00  ? 130 ASP A C      7  
ATOM 10406 O O      . ASP B 2 43  ? 2.571   1.554   -6.743  1.00 0.00  ? 130 ASP A O      7  
ATOM 10407 C CB     . ASP B 2 43  ? 4.808   1.620   -3.961  1.00 0.00  ? 130 ASP A CB     7  
ATOM 10408 C CG     . ASP B 2 43  ? 5.262   2.986   -4.504  1.00 0.00  ? 130 ASP A CG     7  
ATOM 10409 O OD1    . ASP B 2 43  ? 5.407   3.148   -5.738  1.00 0.00  ? 130 ASP A OD1    7  
ATOM 10410 O OD2    . ASP B 2 43  ? 5.557   3.874   -3.672  1.00 0.00  ? 130 ASP A OD2    7  
ATOM 10411 H H      . ASP B 2 43  ? 4.365   -0.744  -3.634  1.00 0.00  ? 130 ASP A H      7  
ATOM 10412 H HA     . ASP B 2 43  ? 2.674   1.444   -4.262  1.00 0.00  ? 130 ASP A HA     7  
ATOM 10413 H HB2    . ASP B 2 43  ? 4.572   1.703   -2.904  1.00 0.00  ? 130 ASP A HB2    7  
ATOM 10414 H HB3    . ASP B 2 43  ? 5.661   0.943   -3.997  1.00 0.00  ? 130 ASP A HB3    7  
ATOM 10415 N N      . PRO B 2 44  ? 4.449   0.303   -6.911  1.00 0.00  ? 131 PRO A N      7  
ATOM 10416 C CA     . PRO B 2 44  ? 4.332   -0.002  -8.342  1.00 0.00  ? 131 PRO A CA     7  
ATOM 10417 C C      . PRO B 2 44  ? 2.947   -0.477  -8.798  1.00 0.00  ? 131 PRO A C      7  
ATOM 10418 O O      . PRO B 2 44  ? 2.443   -0.010  -9.823  1.00 0.00  ? 131 PRO A O      7  
ATOM 10419 C CB     . PRO B 2 44  ? 5.396   -1.071  -8.621  1.00 0.00  ? 131 PRO A CB     7  
ATOM 10420 C CG     . PRO B 2 44  ? 6.498   -0.737  -7.621  1.00 0.00  ? 131 PRO A CG     7  
ATOM 10421 C CD     . PRO B 2 44  ? 5.727   -0.199  -6.417  1.00 0.00  ? 131 PRO A CD     7  
ATOM 10422 H HA     . PRO B 2 44  ? 4.597   0.893   -8.897  1.00 0.00  ? 131 PRO A HA     7  
ATOM 10423 H HB2    . PRO B 2 44  ? 5.004   -2.066  -8.401  1.00 0.00  ? 131 PRO A HB2    7  
ATOM 10424 H HB3    . PRO B 2 44  ? 5.757   -1.021  -9.649  1.00 0.00  ? 131 PRO A HB3    7  
ATOM 10425 H HG2    . PRO B 2 44  ? 7.085   -1.616  -7.361  1.00 0.00  ? 131 PRO A HG2    7  
ATOM 10426 H HG3    . PRO B 2 44  ? 7.134   0.049   -8.031  1.00 0.00  ? 131 PRO A HG3    7  
ATOM 10427 H HD2    . PRO B 2 44  ? 5.567   -0.975  -5.686  1.00 0.00  ? 131 PRO A HD2    7  
ATOM 10428 H HD3    . PRO B 2 44  ? 6.296   0.577   -5.930  1.00 0.00  ? 131 PRO A HD3    7  
ATOM 10429 N N      . ASP B 2 45  ? 2.312   -1.388  -8.053  1.00 0.00  ? 132 ASP A N      7  
ATOM 10430 C CA     . ASP B 2 45  ? 1.007   -1.923  -8.401  1.00 0.00  ? 132 ASP A CA     7  
ATOM 10431 C C      . ASP B 2 45  ? -0.066  -0.830  -8.369  1.00 0.00  ? 132 ASP A C      7  
ATOM 10432 O O      . ASP B 2 45  ? -0.726  -0.647  -9.390  1.00 0.00  ? 132 ASP A O      7  
ATOM 10433 C CB     . ASP B 2 45  ? 0.639   -3.113  -7.511  1.00 0.00  ? 132 ASP A CB     7  
ATOM 10434 C CG     . ASP B 2 45  ? 1.510   -4.370  -7.703  1.00 0.00  ? 132 ASP A CG     7  
ATOM 10435 O OD1    . ASP B 2 45  ? 2.290   -4.466  -8.683  1.00 0.00  ? 132 ASP A OD1    7  
ATOM 10436 O OD2    . ASP B 2 45  ? 1.394   -5.284  -6.856  1.00 0.00  ? 132 ASP A OD2    7  
ATOM 10437 H H      . ASP B 2 45  ? 2.704   -1.742  -7.199  1.00 0.00  ? 132 ASP A H      7  
ATOM 10438 H HA     . ASP B 2 45  ? 1.052   -2.288  -9.427  1.00 0.00  ? 132 ASP A HA     7  
ATOM 10439 H HB2    . ASP B 2 45  ? 0.643   -2.818  -6.464  1.00 0.00  ? 132 ASP A HB2    7  
ATOM 10440 H HB3    . ASP B 2 45  ? -0.380  -3.377  -7.749  1.00 0.00  ? 132 ASP A HB3    7  
ATOM 10441 N N      . LEU B 2 46  ? -0.243  -0.056  -7.283  1.00 0.00  ? 133 LEU A N      7  
ATOM 10442 C CA     . LEU B 2 46  ? -1.254  0.998   -7.292  1.00 0.00  ? 133 LEU A CA     7  
ATOM 10443 C C      . LEU B 2 46  ? -0.980  2.096   -8.311  1.00 0.00  ? 133 LEU A C      7  
ATOM 10444 O O      . LEU B 2 46  ? -1.930  2.525   -8.963  1.00 0.00  ? 133 LEU A O      7  
ATOM 10445 C CB     . LEU B 2 46  ? -1.494  1.587   -5.894  1.00 0.00  ? 133 LEU A CB     7  
ATOM 10446 C CG     . LEU B 2 46  ? -2.254  0.634   -4.960  1.00 0.00  ? 133 LEU A CG     7  
ATOM 10447 C CD1    . LEU B 2 46  ? -2.322  1.188   -3.538  1.00 0.00  ? 133 LEU A CD1    7  
ATOM 10448 C CD2    . LEU B 2 46  ? -3.679  0.418   -5.457  1.00 0.00  ? 133 LEU A CD2    7  
ATOM 10449 H H      . LEU B 2 46  ? 0.300   -0.142  -6.434  1.00 0.00  ? 133 LEU A H      7  
ATOM 10450 H HA     . LEU B 2 46  ? -2.180  0.546   -7.634  1.00 0.00  ? 133 LEU A HA     7  
ATOM 10451 H HB2    . LEU B 2 46  ? -0.576  1.942   -5.438  1.00 0.00  ? 133 LEU A HB2    7  
ATOM 10452 H HB3    . LEU B 2 46  ? -2.088  2.467   -6.026  1.00 0.00  ? 133 LEU A HB3    7  
ATOM 10453 H HG     . LEU B 2 46  ? -1.759  -0.334  -4.948  1.00 0.00  ? 133 LEU A HG     7  
ATOM 10454 H HD11   . LEU B 2 46  ? -1.312  1.332   -3.152  1.00 0.00  ? 133 LEU A HD11   7  
ATOM 10455 H HD12   . LEU B 2 46  ? -2.850  2.144   -3.532  1.00 0.00  ? 133 LEU A HD12   7  
ATOM 10456 H HD13   . LEU B 2 46  ? -2.845  0.482   -2.895  1.00 0.00  ? 133 LEU A HD13   7  
ATOM 10457 H HD21   . LEU B 2 46  ? -4.155  1.377   -5.656  1.00 0.00  ? 133 LEU A HD21   7  
ATOM 10458 H HD22   . LEU B 2 46  ? -3.648  -0.145  -6.381  1.00 0.00  ? 133 LEU A HD22   7  
ATOM 10459 H HD23   . LEU B 2 46  ? -4.260  -0.149  -4.729  1.00 0.00  ? 133 LEU A HD23   7  
ATOM 10460 N N      . ARG B 2 47  ? 0.274   2.531   -8.509  1.00 0.00  ? 134 ARG A N      7  
ATOM 10461 C CA     . ARG B 2 47  ? 0.543   3.580   -9.509  1.00 0.00  ? 134 ARG A CA     7  
ATOM 10462 C C      . ARG B 2 47  ? 0.248   3.106   -10.931 1.00 0.00  ? 134 ARG A C      7  
ATOM 10463 O O      . ARG B 2 47  ? -0.268  3.880   -11.726 1.00 0.00  ? 134 ARG A O      7  
ATOM 10464 C CB     . ARG B 2 47  ? 1.934   4.215   -9.334  1.00 0.00  ? 134 ARG A CB     7  
ATOM 10465 C CG     . ARG B 2 47  ? 3.109   3.324   -9.748  1.00 0.00  ? 134 ARG A CG     7  
ATOM 10466 C CD     . ARG B 2 47  ? 4.435   3.917   -9.254  1.00 0.00  ? 134 ARG A CD     7  
ATOM 10467 N NE     . ARG B 2 47  ? 5.594   3.242   -9.866  1.00 0.00  ? 134 ARG A NE     7  
ATOM 10468 C CZ     . ARG B 2 47  ? 6.735   2.892   -9.295  1.00 0.00  ? 134 ARG A CZ     7  
ATOM 10469 N NH1    . ARG B 2 47  ? 6.959   2.965   -8.012  1.00 0.00  ? 134 ARG A NH1    7  
ATOM 10470 N NH2    . ARG B 2 47  ? 7.713   2.443   -10.028 1.00 0.00  ? 134 ARG A NH2    7  
ATOM 10471 H H      . ARG B 2 47  ? 1.028   2.088   -7.988  1.00 0.00  ? 134 ARG A H      7  
ATOM 10472 H HA     . ARG B 2 47  ? -0.176  4.381   -9.331  1.00 0.00  ? 134 ARG A HA     7  
ATOM 10473 H HB2    . ARG B 2 47  ? 1.975   5.132   -9.922  1.00 0.00  ? 134 ARG A HB2    7  
ATOM 10474 H HB3    . ARG B 2 47  ? 2.049   4.498   -8.291  1.00 0.00  ? 134 ARG A HB3    7  
ATOM 10475 H HG2    . ARG B 2 47  ? 2.984   2.350   -9.293  1.00 0.00  ? 134 ARG A HG2    7  
ATOM 10476 H HG3    . ARG B 2 47  ? 3.119   3.209   -10.836 1.00 0.00  ? 134 ARG A HG3    7  
ATOM 10477 H HD2    . ARG B 2 47  ? 4.471   4.974   -9.523  1.00 0.00  ? 134 ARG A HD2    7  
ATOM 10478 H HD3    . ARG B 2 47  ? 4.465   3.838   -8.165  1.00 0.00  ? 134 ARG A HD3    7  
ATOM 10479 H HE     . ARG B 2 47  ? 5.562   3.100   -10.866 1.00 0.00  ? 134 ARG A HE     7  
ATOM 10480 H HH11   . ARG B 2 47  ? 6.213   3.200   -7.355  1.00 0.00  ? 134 ARG A HH11   7  
ATOM 10481 H HH12   . ARG B 2 47  ? 7.858   2.726   -7.636  1.00 0.00  ? 134 ARG A HH12   7  
ATOM 10482 H HH21   . ARG B 2 47  ? 7.612   2.375   -11.028 1.00 0.00  ? 134 ARG A HH21   7  
ATOM 10483 H HH22   . ARG B 2 47  ? 8.592   2.196   -9.607  1.00 0.00  ? 134 ARG A HH22   7  
ATOM 10484 N N      . GLN B 2 48  ? 0.472   1.826   -11.239 1.00 0.00  ? 135 GLN A N      7  
ATOM 10485 C CA     . GLN B 2 48  ? 0.093   1.213   -12.520 1.00 0.00  ? 135 GLN A CA     7  
ATOM 10486 C C      . GLN B 2 48  ? -1.430  0.956   -12.663 1.00 0.00  ? 135 GLN A C      7  
ATOM 10487 O O      . GLN B 2 48  ? -2.020  1.156   -13.732 1.00 0.00  ? 135 GLN A O      7  
ATOM 10488 C CB     . GLN B 2 48  ? 0.905   -0.077  -12.654 1.00 0.00  ? 135 GLN A CB     7  
ATOM 10489 C CG     . GLN B 2 48  ? 0.858   -0.655  -14.068 1.00 0.00  ? 135 GLN A CG     7  
ATOM 10490 C CD     . GLN B 2 48  ? 1.696   -1.928  -14.191 1.00 0.00  ? 135 GLN A CD     7  
ATOM 10491 O OE1    . GLN B 2 48  ? 2.845   -1.914  -14.617 1.00 0.00  ? 135 GLN A OE1    7  
ATOM 10492 N NE2    . GLN B 2 48  ? 1.165   -3.080  -13.833 1.00 0.00  ? 135 GLN A NE2    7  
ATOM 10493 H H      . GLN B 2 48  ? 0.918   1.242   -10.539 1.00 0.00  ? 135 GLN A H      7  
ATOM 10494 H HA     . GLN B 2 48  ? 0.395   1.877   -13.326 1.00 0.00  ? 135 GLN A HA     7  
ATOM 10495 H HB2    . GLN B 2 48  ? 1.951   0.144   -12.431 1.00 0.00  ? 135 GLN A HB2    7  
ATOM 10496 H HB3    . GLN B 2 48  ? 0.537   -0.798  -11.925 1.00 0.00  ? 135 GLN A HB3    7  
ATOM 10497 H HG2    . GLN B 2 48  ? -0.171  -0.881  -14.350 1.00 0.00  ? 135 GLN A HG2    7  
ATOM 10498 H HG3    . GLN B 2 48  ? 1.256   0.096   -14.750 1.00 0.00  ? 135 GLN A HG3    7  
ATOM 10499 H HE21   . GLN B 2 48  ? 0.223   -3.131  -13.476 1.00 0.00  ? 135 GLN A HE21   7  
ATOM 10500 H HE22   . GLN B 2 48  ? 1.745   -3.903  -13.918 1.00 0.00  ? 135 GLN A HE22   7  
ATOM 10501 N N      . MET B 2 49  ? -2.092  0.549   -11.581 1.00 0.00  ? 136 MET A N      7  
ATOM 10502 C CA     . MET B 2 49  ? -3.483  0.099   -11.565 1.00 0.00  ? 136 MET A CA     7  
ATOM 10503 C C      . MET B 2 49  ? -4.451  1.274   -11.562 1.00 0.00  ? 136 MET A C      7  
ATOM 10504 O O      . MET B 2 49  ? -5.339  1.318   -12.412 1.00 0.00  ? 136 MET A O      7  
ATOM 10505 C CB     . MET B 2 49  ? -3.619  -0.802  -10.346 1.00 0.00  ? 136 MET A CB     7  
ATOM 10506 C CG     . MET B 2 49  ? -4.933  -1.577  -10.204 1.00 0.00  ? 136 MET A CG     7  
ATOM 10507 S SD     . MET B 2 49  ? -6.372  -0.604  -9.684  1.00 0.00  ? 136 MET A SD     7  
ATOM 10508 C CE     . MET B 2 49  ? -5.706  0.164   -8.180  1.00 0.00  ? 136 MET A CE     7  
ATOM 10509 H H      . MET B 2 49  ? -1.600  0.416   -10.701 1.00 0.00  ? 136 MET A H      7  
ATOM 10510 H HA     . MET B 2 49  ? -3.678  -0.496  -12.461 1.00 0.00  ? 136 MET A HA     7  
ATOM 10511 H HB2    . MET B 2 49  ? -2.815  -1.508  -10.454 1.00 0.00  ? 136 MET A HB2    7  
ATOM 10512 H HB3    . MET B 2 49  ? -3.399  -0.247  -9.435  1.00 0.00  ? 136 MET A HB3    7  
ATOM 10513 H HG2    . MET B 2 49  ? -5.162  -2.068  -11.150 1.00 0.00  ? 136 MET A HG2    7  
ATOM 10514 H HG3    . MET B 2 49  ? -4.777  -2.358  -9.456  1.00 0.00  ? 136 MET A HG3    7  
ATOM 10515 H HE1    . MET B 2 49  ? -5.377  -0.619  -7.499  1.00 0.00  ? 136 MET A HE1    7  
ATOM 10516 H HE2    . MET B 2 49  ? -4.850  0.798   -8.426  1.00 0.00  ? 136 MET A HE2    7  
ATOM 10517 H HE3    . MET B 2 49  ? -6.474  0.767   -7.701  1.00 0.00  ? 136 MET A HE3    7  
ATOM 10518 N N      . PHE B 2 50  ? -4.214  2.280   -10.718 1.00 0.00  ? 137 PHE A N      7  
ATOM 10519 C CA     . PHE B 2 50  ? -4.731  3.627   -10.979 1.00 0.00  ? 137 PHE A CA     7  
ATOM 10520 C C      . PHE B 2 50  ? -4.155  4.199   -12.284 1.00 0.00  ? 137 PHE A C      7  
ATOM 10521 O O      . PHE B 2 50  ? -4.828  4.971   -12.967 1.00 0.00  ? 137 PHE A O      7  
ATOM 10522 C CB     . PHE B 2 50  ? -4.474  4.580   -9.804  1.00 0.00  ? 137 PHE A CB     7  
ATOM 10523 C CG     . PHE B 2 50  ? -5.469  4.445   -8.668  1.00 0.00  ? 137 PHE A CG     7  
ATOM 10524 C CD1    . PHE B 2 50  ? -6.667  5.182   -8.712  1.00 0.00  ? 137 PHE A CD1    7  
ATOM 10525 C CD2    . PHE B 2 50  ? -5.219  3.585   -7.589  1.00 0.00  ? 137 PHE A CD2    7  
ATOM 10526 C CE1    . PHE B 2 50  ? -7.614  5.073   -7.681  1.00 0.00  ? 137 PHE A CE1    7  
ATOM 10527 C CE2    . PHE B 2 50  ? -6.169  3.470   -6.559  1.00 0.00  ? 137 PHE A CE2    7  
ATOM 10528 C CZ     . PHE B 2 50  ? -7.353  4.230   -6.590  1.00 0.00  ? 137 PHE A CZ     7  
ATOM 10529 H H      . PHE B 2 50  ? -3.457  2.145   -10.056 1.00 0.00  ? 137 PHE A H      7  
ATOM 10530 H HA     . PHE B 2 50  ? -5.808  3.562   -11.103 1.00 0.00  ? 137 PHE A HA     7  
ATOM 10531 H HB2    . PHE B 2 50  ? -3.460  4.460   -9.432  1.00 0.00  ? 137 PHE A HB2    7  
ATOM 10532 H HB3    . PHE B 2 50  ? -4.554  5.604   -10.168 1.00 0.00  ? 137 PHE A HB3    7  
ATOM 10533 H HD1    . PHE B 2 50  ? -6.880  5.805   -9.563  1.00 0.00  ? 137 PHE A HD1    7  
ATOM 10534 H HD2    . PHE B 2 50  ? -4.304  3.010   -7.560  1.00 0.00  ? 137 PHE A HD2    7  
ATOM 10535 H HE1    . PHE B 2 50  ? -8.554  5.608   -7.753  1.00 0.00  ? 137 PHE A HE1    7  
ATOM 10536 H HE2    . PHE B 2 50  ? -5.993  2.796   -5.737  1.00 0.00  ? 137 PHE A HE2    7  
ATOM 10537 H HZ     . PHE B 2 50  ? -8.062  4.152   -5.784  1.00 0.00  ? 137 PHE A HZ     7  
ATOM 10538 N N      . GLY B 2 51  ? -2.933  3.804   -12.673 1.00 0.00  ? 138 GLY A N      7  
ATOM 10539 C CA     . GLY B 2 51  ? -2.274  4.191   -13.931 1.00 0.00  ? 138 GLY A CA     7  
ATOM 10540 C C      . GLY B 2 51  ? -3.058  3.883   -15.210 1.00 0.00  ? 138 GLY A C      7  
ATOM 10541 O O      . GLY B 2 51  ? -2.882  4.597   -16.199 1.00 0.00  ? 138 GLY A O      7  
ATOM 10542 H H      . GLY B 2 51  ? -2.371  3.261   -12.018 1.00 0.00  ? 138 GLY A H      7  
ATOM 10543 H HA2    . GLY B 2 51  ? -2.073  5.262   -13.907 1.00 0.00  ? 138 GLY A HA2    7  
ATOM 10544 H HA3    . GLY B 2 51  ? -1.317  3.682   -14.015 1.00 0.00  ? 138 GLY A HA3    7  
ATOM 10545 N N      . GLN B 2 52  ? -3.985  2.914   -15.187 1.00 0.00  ? 139 GLN A N      7  
ATOM 10546 C CA     . GLN B 2 52  ? -5.017  2.780   -16.242 1.00 0.00  ? 139 GLN A CA     7  
ATOM 10547 C C      . GLN B 2 52  ? -5.755  4.096   -16.566 1.00 0.00  ? 139 GLN A C      7  
ATOM 10548 O O      . GLN B 2 52  ? -6.085  4.352   -17.727 1.00 0.00  ? 139 GLN A O      7  
ATOM 10549 C CB     . GLN B 2 52  ? -6.040  1.671   -15.924 1.00 0.00  ? 139 GLN A CB     7  
ATOM 10550 C CG     . GLN B 2 52  ? -7.183  2.042   -14.957 1.00 0.00  ? 139 GLN A CG     7  
ATOM 10551 C CD     . GLN B 2 52  ? -8.010  0.823   -14.546 1.00 0.00  ? 139 GLN A CD     7  
ATOM 10552 O OE1    . GLN B 2 52  ? -9.123  0.590   -15.007 1.00 0.00  ? 139 GLN A OE1    7  
ATOM 10553 N NE2    . GLN B 2 52  ? -7.511  0.009   -13.647 1.00 0.00  ? 139 GLN A NE2    7  
ATOM 10554 H H      . GLN B 2 52  ? -3.863  2.224   -14.447 1.00 0.00  ? 139 GLN A H      7  
ATOM 10555 H HA     . GLN B 2 52  ? -4.494  2.481   -17.151 1.00 0.00  ? 139 GLN A HA     7  
ATOM 10556 H HB2    . GLN B 2 52  ? -6.512  1.417   -16.870 1.00 0.00  ? 139 GLN A HB2    7  
ATOM 10557 H HB3    . GLN B 2 52  ? -5.507  0.795   -15.553 1.00 0.00  ? 139 GLN A HB3    7  
ATOM 10558 H HG2    . GLN B 2 52  ? -6.776  2.521   -14.067 1.00 0.00  ? 139 GLN A HG2    7  
ATOM 10559 H HG3    . GLN B 2 52  ? -7.849  2.751   -15.450 1.00 0.00  ? 139 GLN A HG3    7  
ATOM 10560 H HE21   . GLN B 2 52  ? -6.648  0.278   -13.183 1.00 0.00  ? 139 GLN A HE21   7  
ATOM 10561 H HE22   . GLN B 2 52  ? -8.049  -0.786  -13.351 1.00 0.00  ? 139 GLN A HE22   7  
ATOM 10562 N N      . PHE B 2 53  ? -5.998  4.930   -15.548 1.00 0.00  ? 140 PHE A N      7  
ATOM 10563 C CA     . PHE B 2 53  ? -6.622  6.248   -15.660 1.00 0.00  ? 140 PHE A CA     7  
ATOM 10564 C C      . PHE B 2 53  ? -5.611  7.413   -15.668 1.00 0.00  ? 140 PHE A C      7  
ATOM 10565 O O      . PHE B 2 53  ? -5.899  8.469   -16.234 1.00 0.00  ? 140 PHE A O      7  
ATOM 10566 C CB     . PHE B 2 53  ? -7.639  6.421   -14.516 1.00 0.00  ? 140 PHE A CB     7  
ATOM 10567 C CG     . PHE B 2 53  ? -8.961  5.728   -14.779 1.00 0.00  ? 140 PHE A CG     7  
ATOM 10568 C CD1    . PHE B 2 53  ? -9.776  6.188   -15.832 1.00 0.00  ? 140 PHE A CD1    7  
ATOM 10569 C CD2    . PHE B 2 53  ? -9.407  4.666   -13.966 1.00 0.00  ? 140 PHE A CD2    7  
ATOM 10570 C CE1    . PHE B 2 53  ? -11.024 5.590   -16.076 1.00 0.00  ? 140 PHE A CE1    7  
ATOM 10571 C CE2    . PHE B 2 53  ? -10.646 4.061   -14.221 1.00 0.00  ? 140 PHE A CE2    7  
ATOM 10572 C CZ     . PHE B 2 53  ? -11.456 4.524   -15.273 1.00 0.00  ? 140 PHE A CZ     7  
ATOM 10573 H H      . PHE B 2 53  ? -5.698  4.632   -14.628 1.00 0.00  ? 140 PHE A H      7  
ATOM 10574 H HA     . PHE B 2 53  ? -7.156  6.270   -16.612 1.00 0.00  ? 140 PHE A HA     7  
ATOM 10575 H HB2    . PHE B 2 53  ? -7.214  6.064   -13.579 1.00 0.00  ? 140 PHE A HB2    7  
ATOM 10576 H HB3    . PHE B 2 53  ? -7.850  7.481   -14.382 1.00 0.00  ? 140 PHE A HB3    7  
ATOM 10577 H HD1    . PHE B 2 53  ? -9.460  7.014   -16.450 1.00 0.00  ? 140 PHE A HD1    7  
ATOM 10578 H HD2    . PHE B 2 53  ? -8.839  4.327   -13.111 1.00 0.00  ? 140 PHE A HD2    7  
ATOM 10579 H HE1    . PHE B 2 53  ? -11.656 5.954   -16.876 1.00 0.00  ? 140 PHE A HE1    7  
ATOM 10580 H HE2    . PHE B 2 53  ? -10.973 3.257   -13.579 1.00 0.00  ? 140 PHE A HE2    7  
ATOM 10581 H HZ     . PHE B 2 53  ? -12.424 4.082   -15.464 1.00 0.00  ? 140 PHE A HZ     7  
ATOM 10582 N N      . GLY B 2 54  ? -4.427  7.215   -15.075 1.00 0.00  ? 141 GLY A N      7  
ATOM 10583 C CA     . GLY B 2 54  ? -3.211  8.017   -15.270 1.00 0.00  ? 141 GLY A CA     7  
ATOM 10584 C C      . GLY B 2 54  ? -3.268  9.476   -14.820 1.00 0.00  ? 141 GLY A C      7  
ATOM 10585 O O      . GLY B 2 54  ? -2.914  10.383  -15.572 1.00 0.00  ? 141 GLY A O      7  
ATOM 10586 H H      . GLY B 2 54  ? -4.336  6.330   -14.590 1.00 0.00  ? 141 GLY A H      7  
ATOM 10587 H HA2    . GLY B 2 54  ? -2.422  7.571   -14.674 1.00 0.00  ? 141 GLY A HA2    7  
ATOM 10588 H HA3    . GLY B 2 54  ? -2.917  7.982   -16.320 1.00 0.00  ? 141 GLY A HA3    7  
ATOM 10589 N N      . LYS B 2 55  ? -3.664  9.676   -13.560 1.00 0.00  ? 142 LYS A N      7  
ATOM 10590 C CA     . LYS B 2 55  ? -3.808  10.979  -12.874 1.00 0.00  ? 142 LYS A CA     7  
ATOM 10591 C C      . LYS B 2 55  ? -2.983  11.101  -11.584 1.00 0.00  ? 142 LYS A C      7  
ATOM 10592 O O      . LYS B 2 55  ? -3.096  12.075  -10.841 1.00 0.00  ? 142 LYS A O      7  
ATOM 10593 C CB     . LYS B 2 55  ? -5.300  11.199  -12.593 1.00 0.00  ? 142 LYS A CB     7  
ATOM 10594 C CG     . LYS B 2 55  ? -6.099  11.201  -13.894 1.00 0.00  ? 142 LYS A CG     7  
ATOM 10595 C CD     . LYS B 2 55  ? -7.534  11.685  -13.664 1.00 0.00  ? 142 LYS A CD     7  
ATOM 10596 C CE     . LYS B 2 55  ? -8.356  11.689  -14.955 1.00 0.00  ? 142 LYS A CE     7  
ATOM 10597 N NZ     . LYS B 2 55  ? -8.546  10.330  -15.525 1.00 0.00  ? 142 LYS A NZ     7  
ATOM 10598 H H      . LYS B 2 55  ? -4.003  8.845   -13.093 1.00 0.00  ? 142 LYS A H      7  
ATOM 10599 H HA     . LYS B 2 55  ? -3.463  11.781  -13.530 1.00 0.00  ? 142 LYS A HA     7  
ATOM 10600 H HB2    . LYS B 2 55  ? -5.658  10.390  -11.962 1.00 0.00  ? 142 LYS A HB2    7  
ATOM 10601 H HB3    . LYS B 2 55  ? -5.435  12.153  -12.080 1.00 0.00  ? 142 LYS A HB3    7  
ATOM 10602 H HG2    . LYS B 2 55  ? -5.584  11.843  -14.605 1.00 0.00  ? 142 LYS A HG2    7  
ATOM 10603 H HG3    . LYS B 2 55  ? -6.138  10.186  -14.289 1.00 0.00  ? 142 LYS A HG3    7  
ATOM 10604 H HD2    . LYS B 2 55  ? -8.015  11.036  -12.928 1.00 0.00  ? 142 LYS A HD2    7  
ATOM 10605 H HD3    . LYS B 2 55  ? -7.509  12.701  -13.268 1.00 0.00  ? 142 LYS A HD3    7  
ATOM 10606 H HE2    . LYS B 2 55  ? -9.331  12.126  -14.726 1.00 0.00  ? 142 LYS A HE2    7  
ATOM 10607 H HE3    . LYS B 2 55  ? -7.870  12.338  -15.691 1.00 0.00  ? 142 LYS A HE3    7  
ATOM 10608 H HZ1    . LYS B 2 55  ? -7.691  9.962   -15.922 1.00 0.00  ? 142 LYS A HZ1    7  
ATOM 10609 H HZ2    . LYS B 2 55  ? -8.897  9.689   -14.828 1.00 0.00  ? 142 LYS A HZ2    7  
ATOM 10610 H HZ3    . LYS B 2 55  ? -9.258  10.369  -16.258 1.00 0.00  ? 142 LYS A HZ3    7  
ATOM 10611 N N      . ILE B 2 56  ? -2.177  10.079  -11.314 1.00 0.00  ? 143 ILE A N      7  
ATOM 10612 C CA     . ILE B 2 56  ? -1.420  9.862   -10.076 1.00 0.00  ? 143 ILE A CA     7  
ATOM 10613 C C      . ILE B 2 56  ? -0.208  10.795  -9.986  1.00 0.00  ? 143 ILE A C      7  
ATOM 10614 O O      . ILE B 2 56  ? 0.650   10.796  -10.872 1.00 0.00  ? 143 ILE A O      7  
ATOM 10615 C CB     . ILE B 2 56  ? -0.965  8.387   -9.908  1.00 0.00  ? 143 ILE A CB     7  
ATOM 10616 C CG1    . ILE B 2 56  ? -2.073  7.348   -10.137 1.00 0.00  ? 143 ILE A CG1    7  
ATOM 10617 C CG2    . ILE B 2 56  ? -0.497  8.228   -8.459  1.00 0.00  ? 143 ILE A CG2    7  
ATOM 10618 C CD1    . ILE B 2 56  ? -2.191  6.942   -11.606 1.00 0.00  ? 143 ILE A CD1    7  
ATOM 10619 H H      . ILE B 2 56  ? -2.133  9.420   -12.071 1.00 0.00  ? 143 ILE A H      7  
ATOM 10620 H HA     . ILE B 2 56  ? -2.092  10.104  -9.252  1.00 0.00  ? 143 ILE A HA     7  
ATOM 10621 H HB     . ILE B 2 56  ? -0.134  8.144   -10.575 1.00 0.00  ? 143 ILE A HB     7  
ATOM 10622 H HG12   . ILE B 2 56  ? -1.876  6.442   -9.565  1.00 0.00  ? 143 ILE A HG12   7  
ATOM 10623 H HG13   . ILE B 2 56  ? -3.010  7.740   -9.761  1.00 0.00  ? 143 ILE A HG13   7  
ATOM 10624 H HG21   . ILE B 2 56  ? 0.433   8.769   -8.296  1.00 0.00  ? 143 ILE A HG21   7  
ATOM 10625 H HG22   . ILE B 2 56  ? -1.274  8.598   -7.780  1.00 0.00  ? 143 ILE A HG22   7  
ATOM 10626 H HG23   . ILE B 2 56  ? -0.314  7.176   -8.248  1.00 0.00  ? 143 ILE A HG23   7  
ATOM 10627 H HD11   . ILE B 2 56  ? -1.972  7.762   -12.282 1.00 0.00  ? 143 ILE A HD11   7  
ATOM 10628 H HD12   . ILE B 2 56  ? -1.472  6.151   -11.809 1.00 0.00  ? 143 ILE A HD12   7  
ATOM 10629 H HD13   . ILE B 2 56  ? -3.197  6.595   -11.808 1.00 0.00  ? 143 ILE A HD13   7  
ATOM 10630 N N      . LEU B 2 57  ? -0.115  11.548  -8.889  1.00 0.00  ? 144 LEU A N      7  
ATOM 10631 C CA     . LEU B 2 57  ? 1.071   12.318  -8.496  1.00 0.00  ? 144 LEU A CA     7  
ATOM 10632 C C      . LEU B 2 57  ? 2.026   11.456  -7.647  1.00 0.00  ? 144 LEU A C      7  
ATOM 10633 O O      . LEU B 2 57  ? 3.232   11.448  -7.893  1.00 0.00  ? 144 LEU A O      7  
ATOM 10634 C CB     . LEU B 2 57  ? 0.637   13.581  -7.720  1.00 0.00  ? 144 LEU A CB     7  
ATOM 10635 C CG     . LEU B 2 57  ? 0.228   14.805  -8.564  1.00 0.00  ? 144 LEU A CG     7  
ATOM 10636 C CD1    . LEU B 2 57  ? 1.423   15.431  -9.281  1.00 0.00  ? 144 LEU A CD1    7  
ATOM 10637 C CD2    . LEU B 2 57  ? -0.859  14.508  -9.593  1.00 0.00  ? 144 LEU A CD2    7  
ATOM 10638 H H      . LEU B 2 57  ? -0.898  11.511  -8.249  1.00 0.00  ? 144 LEU A H      7  
ATOM 10639 H HA     . LEU B 2 57  ? 1.625   12.623  -9.385  1.00 0.00  ? 144 LEU A HA     7  
ATOM 10640 H HB2    . LEU B 2 57  ? -0.197  13.327  -7.066  1.00 0.00  ? 144 LEU A HB2    7  
ATOM 10641 H HB3    . LEU B 2 57  ? 1.461   13.893  -7.075  1.00 0.00  ? 144 LEU A HB3    7  
ATOM 10642 H HG     . LEU B 2 57  ? -0.167  15.551  -7.876  1.00 0.00  ? 144 LEU A HG     7  
ATOM 10643 H HD11   . LEU B 2 57  ? 2.203   15.667  -8.560  1.00 0.00  ? 144 LEU A HD11   7  
ATOM 10644 H HD12   . LEU B 2 57  ? 1.824   14.750  -10.031 1.00 0.00  ? 144 LEU A HD12   7  
ATOM 10645 H HD13   . LEU B 2 57  ? 1.112   16.351  -9.777  1.00 0.00  ? 144 LEU A HD13   7  
ATOM 10646 H HD21   . LEU B 2 57  ? -0.484  13.837  -10.363 1.00 0.00  ? 144 LEU A HD21   7  
ATOM 10647 H HD22   . LEU B 2 57  ? -1.712  14.041  -9.099  1.00 0.00  ? 144 LEU A HD22   7  
ATOM 10648 H HD23   . LEU B 2 57  ? -1.181  15.436  -10.068 1.00 0.00  ? 144 LEU A HD23   7  
ATOM 10649 N N      . ASP B 2 58  ? 1.493   10.725  -6.662  1.00 0.00  ? 145 ASP A N      7  
ATOM 10650 C CA     . ASP B 2 58  ? 2.235   9.855   -5.734  1.00 0.00  ? 145 ASP A CA     7  
ATOM 10651 C C      . ASP B 2 58  ? 1.388   8.665   -5.239  1.00 0.00  ? 145 ASP A C      7  
ATOM 10652 O O      . ASP B 2 58  ? 0.162   8.702   -5.319  1.00 0.00  ? 145 ASP A O      7  
ATOM 10653 C CB     . ASP B 2 58  ? 2.692   10.683  -4.517  1.00 0.00  ? 145 ASP A CB     7  
ATOM 10654 C CG     . ASP B 2 58  ? 3.969   11.492  -4.789  1.00 0.00  ? 145 ASP A CG     7  
ATOM 10655 O OD1    . ASP B 2 58  ? 5.052   10.873  -4.933  1.00 0.00  ? 145 ASP A OD1    7  
ATOM 10656 O OD2    . ASP B 2 58  ? 3.908   12.747  -4.800  1.00 0.00  ? 145 ASP A OD2    7  
ATOM 10657 H H      . ASP B 2 58  ? 0.488   10.734  -6.575  1.00 0.00  ? 145 ASP A H      7  
ATOM 10658 H HA     . ASP B 2 58  ? 3.105   9.446   -6.248  1.00 0.00  ? 145 ASP A HA     7  
ATOM 10659 H HB2    . ASP B 2 58  ? 1.883   11.344  -4.203  1.00 0.00  ? 145 ASP A HB2    7  
ATOM 10660 H HB3    . ASP B 2 58  ? 2.895   10.014  -3.680  1.00 0.00  ? 145 ASP A HB3    7  
ATOM 10661 N N      . VAL B 2 59  ? 2.042   7.637   -4.680  1.00 0.00  ? 146 VAL A N      7  
ATOM 10662 C CA     . VAL B 2 59  ? 1.452   6.468   -3.988  1.00 0.00  ? 146 VAL A CA     7  
ATOM 10663 C C      . VAL B 2 59  ? 2.229   6.097   -2.720  1.00 0.00  ? 146 VAL A C      7  
ATOM 10664 O O      . VAL B 2 59  ? 3.353   6.554   -2.500  1.00 0.00  ? 146 VAL A O      7  
ATOM 10665 C CB     . VAL B 2 59  ? 1.368   5.213   -4.877  1.00 0.00  ? 146 VAL A CB     7  
ATOM 10666 C CG1    . VAL B 2 59  ? 0.291   5.304   -5.923  1.00 0.00  ? 146 VAL A CG1    7  
ATOM 10667 C CG2    . VAL B 2 59  ? 2.692   4.940   -5.587  1.00 0.00  ? 146 VAL A CG2    7  
ATOM 10668 H H      . VAL B 2 59  ? 3.047   7.708   -4.636  1.00 0.00  ? 146 VAL A H      7  
ATOM 10669 H HA     . VAL B 2 59  ? 0.445   6.722   -3.675  1.00 0.00  ? 146 VAL A HA     7  
ATOM 10670 H HB     . VAL B 2 59  ? 1.052   4.365   -4.267  1.00 0.00  ? 146 VAL A HB     7  
ATOM 10671 H HG11   . VAL B 2 59  ? -0.643  5.365   -5.383  1.00 0.00  ? 146 VAL A HG11   7  
ATOM 10672 H HG12   . VAL B 2 59  ? 0.454   6.186   -6.529  1.00 0.00  ? 146 VAL A HG12   7  
ATOM 10673 H HG13   . VAL B 2 59  ? 0.281   4.404   -6.533  1.00 0.00  ? 146 VAL A HG13   7  
ATOM 10674 H HG21   . VAL B 2 59  ? 2.876   5.693   -6.351  1.00 0.00  ? 146 VAL A HG21   7  
ATOM 10675 H HG22   . VAL B 2 59  ? 3.503   4.973   -4.868  1.00 0.00  ? 146 VAL A HG22   7  
ATOM 10676 H HG23   . VAL B 2 59  ? 2.662   3.962   -6.056  1.00 0.00  ? 146 VAL A HG23   7  
ATOM 10677 N N      . GLU B 2 60  ? 1.607   5.276   -1.869  1.00 0.00  ? 147 GLU A N      7  
ATOM 10678 C CA     . GLU B 2 60  ? 1.976   5.117   -0.461  1.00 0.00  ? 147 GLU A CA     7  
ATOM 10679 C C      . GLU B 2 60  ? 1.317   3.866   0.169   1.00 0.00  ? 147 GLU A C      7  
ATOM 10680 O O      . GLU B 2 60  ? 0.258   3.952   0.792   1.00 0.00  ? 147 GLU A O      7  
ATOM 10681 C CB     . GLU B 2 60  ? 1.526   6.423   0.223   1.00 0.00  ? 147 GLU A CB     7  
ATOM 10682 C CG     . GLU B 2 60  ? 1.915   6.561   1.695   1.00 0.00  ? 147 GLU A CG     7  
ATOM 10683 C CD     . GLU B 2 60  ? 3.415   6.886   1.850   1.00 0.00  ? 147 GLU A CD     7  
ATOM 10684 O OE1    . GLU B 2 60  ? 4.255   5.963   1.741   1.00 0.00  ? 147 GLU A OE1    7  
ATOM 10685 O OE2    . GLU B 2 60  ? 3.760   8.075   2.060   1.00 0.00  ? 147 GLU A OE2    7  
ATOM 10686 H H      . GLU B 2 60  ? 0.647   5.038   -2.103  1.00 0.00  ? 147 GLU A H      7  
ATOM 10687 H HA     . GLU B 2 60  ? 3.062   5.020   -0.375  1.00 0.00  ? 147 GLU A HA     7  
ATOM 10688 H HB2    . GLU B 2 60  ? 1.964   7.280   -0.294  1.00 0.00  ? 147 GLU A HB2    7  
ATOM 10689 H HB3    . GLU B 2 60  ? 0.446   6.515   0.089   1.00 0.00  ? 147 GLU A HB3    7  
ATOM 10690 H HG2    . GLU B 2 60  ? 1.330   7.384   2.105   1.00 0.00  ? 147 GLU A HG2    7  
ATOM 10691 H HG3    . GLU B 2 60  ? 1.645   5.661   2.246   1.00 0.00  ? 147 GLU A HG3    7  
ATOM 10692 N N      . ILE B 2 61  ? 1.887   2.669   -0.011  1.00 0.00  ? 148 ILE A N      7  
ATOM 10693 C CA     . ILE B 2 61  ? 1.407   1.437   0.662   1.00 0.00  ? 148 ILE A CA     7  
ATOM 10694 C C      . ILE B 2 61  ? 1.746   1.459   2.157   1.00 0.00  ? 148 ILE A C      7  
ATOM 10695 O O      . ILE B 2 61  ? 2.790   1.976   2.558   1.00 0.00  ? 148 ILE A O      7  
ATOM 10696 C CB     . ILE B 2 61  ? 1.977   0.187   -0.043  1.00 0.00  ? 148 ILE A CB     7  
ATOM 10697 C CG1    . ILE B 2 61  ? 1.183   -0.038  -1.346  1.00 0.00  ? 148 ILE A CG1    7  
ATOM 10698 C CG2    . ILE B 2 61  ? 1.982   -1.091  0.824   1.00 0.00  ? 148 ILE A CG2    7  
ATOM 10699 C CD1    . ILE B 2 61  ? -0.114  -0.832  -1.196  1.00 0.00  ? 148 ILE A CD1    7  
ATOM 10700 H H      . ILE B 2 61  ? 2.753   2.638   -0.532  1.00 0.00  ? 148 ILE A H      7  
ATOM 10701 H HA     . ILE B 2 61  ? 0.323   1.398   0.588   1.00 0.00  ? 148 ILE A HA     7  
ATOM 10702 H HB     . ILE B 2 61  ? 3.014   0.395   -0.310  1.00 0.00  ? 148 ILE A HB     7  
ATOM 10703 H HG12   . ILE B 2 61  ? 0.965   0.916   -1.830  1.00 0.00  ? 148 ILE A HG12   7  
ATOM 10704 H HG13   . ILE B 2 61  ? 1.800   -0.602  -2.022  1.00 0.00  ? 148 ILE A HG13   7  
ATOM 10705 H HG21   . ILE B 2 61  ? 2.683   -0.977  1.648   1.00 0.00  ? 148 ILE A HG21   7  
ATOM 10706 H HG22   . ILE B 2 61  ? 0.994   -1.291  1.239   1.00 0.00  ? 148 ILE A HG22   7  
ATOM 10707 H HG23   . ILE B 2 61  ? 2.294   -1.947  0.224   1.00 0.00  ? 148 ILE A HG23   7  
ATOM 10708 H HD11   . ILE B 2 61  ? 0.117   -1.846  -0.855  1.00 0.00  ? 148 ILE A HD11   7  
ATOM 10709 H HD12   . ILE B 2 61  ? -0.766  -0.354  -0.465  1.00 0.00  ? 148 ILE A HD12   7  
ATOM 10710 H HD13   . ILE B 2 61  ? -0.600  -0.878  -2.168  1.00 0.00  ? 148 ILE A HD13   7  
ATOM 10711 N N      . ILE B 2 62  ? 0.896   0.859   3.002   1.00 0.00  ? 149 ILE A N      7  
ATOM 10712 C CA     . ILE B 2 62  ? 1.058   0.884   4.445   1.00 0.00  ? 149 ILE A CA     7  
ATOM 10713 C C      . ILE B 2 62  ? 1.754   -0.445  4.764   1.00 0.00  ? 149 ILE A C      7  
ATOM 10714 O O      . ILE B 2 62  ? 1.122   -1.421  5.147   1.00 0.00  ? 149 ILE A O      7  
ATOM 10715 C CB     . ILE B 2 62  ? -0.347  1.158   5.031   1.00 0.00  ? 149 ILE A CB     7  
ATOM 10716 C CG1    . ILE B 2 62  ? -0.974  2.426   4.394   1.00 0.00  ? 149 ILE A CG1    7  
ATOM 10717 C CG2    . ILE B 2 62  ? -0.336  1.320   6.548   1.00 0.00  ? 149 ILE A CG2    7  
ATOM 10718 C CD1    . ILE B 2 62  ? -0.092  3.669   4.274   1.00 0.00  ? 149 ILE A CD1    7  
ATOM 10719 H H      . ILE B 2 62  ? 0.074   0.319   2.749   1.00 0.00  ? 149 ILE A H      7  
ATOM 10720 H HA     . ILE B 2 62  ? 1.703   1.707   4.771   1.00 0.00  ? 149 ILE A HA     7  
ATOM 10721 H HB     . ILE B 2 62  ? -1.003  0.318   4.793   1.00 0.00  ? 149 ILE A HB     7  
ATOM 10722 H HG12   . ILE B 2 62  ? -1.352  2.177   3.406   1.00 0.00  ? 149 ILE A HG12   7  
ATOM 10723 H HG13   . ILE B 2 62  ? -1.831  2.716   4.977   1.00 0.00  ? 149 ILE A HG13   7  
ATOM 10724 H HG21   . ILE B 2 62  ? -0.327  0.336   6.997   1.00 0.00  ? 149 ILE A HG21   7  
ATOM 10725 H HG22   . ILE B 2 62  ? 0.514   1.923   6.865   1.00 0.00  ? 149 ILE A HG22   7  
ATOM 10726 H HG23   . ILE B 2 62  ? -1.260  1.776   6.893   1.00 0.00  ? 149 ILE A HG23   7  
ATOM 10727 H HD11   . ILE B 2 62  ? 0.335   3.904   5.243   1.00 0.00  ? 149 ILE A HD11   7  
ATOM 10728 H HD12   . ILE B 2 62  ? 0.713   3.521   3.559   1.00 0.00  ? 149 ILE A HD12   7  
ATOM 10729 H HD13   . ILE B 2 62  ? -0.698  4.507   3.927   1.00 0.00  ? 149 ILE A HD13   7  
ATOM 10730 N N      . PHE B 2 63  ? 3.043   -0.544  4.427   1.00 0.00  ? 150 PHE A N      7  
ATOM 10731 C CA     . PHE B 2 63  ? 3.771   -1.822  4.397   1.00 0.00  ? 150 PHE A CA     7  
ATOM 10732 C C      . PHE B 2 63  ? 4.063   -2.372  5.811   1.00 0.00  ? 150 PHE A C      7  
ATOM 10733 O O      . PHE B 2 63  ? 4.151   -1.618  6.782   1.00 0.00  ? 150 PHE A O      7  
ATOM 10734 C CB     . PHE B 2 63  ? 5.096   -1.659  3.621   1.00 0.00  ? 150 PHE A CB     7  
ATOM 10735 C CG     . PHE B 2 63  ? 5.061   -2.225  2.214   1.00 0.00  ? 150 PHE A CG     7  
ATOM 10736 C CD1    . PHE B 2 63  ? 4.769   -3.589  2.025   1.00 0.00  ? 150 PHE A CD1    7  
ATOM 10737 C CD2    . PHE B 2 63  ? 5.305   -1.400  1.100   1.00 0.00  ? 150 PHE A CD2    7  
ATOM 10738 C CE1    . PHE B 2 63  ? 4.661   -4.115  0.727   1.00 0.00  ? 150 PHE A CE1    7  
ATOM 10739 C CE2    . PHE B 2 63  ? 5.212   -1.930  -0.200  1.00 0.00  ? 150 PHE A CE2    7  
ATOM 10740 C CZ     . PHE B 2 63  ? 4.874   -3.282  -0.385  1.00 0.00  ? 150 PHE A CZ     7  
ATOM 10741 H H      . PHE B 2 63  ? 3.486   0.281   4.051   1.00 0.00  ? 150 PHE A H      7  
ATOM 10742 H HA     . PHE B 2 63  ? 3.130   -2.526  3.849   1.00 0.00  ? 150 PHE A HA     7  
ATOM 10743 H HB2    . PHE B 2 63  ? 5.380   -0.606  3.588   1.00 0.00  ? 150 PHE A HB2    7  
ATOM 10744 H HB3    . PHE B 2 63  ? 5.896   -2.178  4.153   1.00 0.00  ? 150 PHE A HB3    7  
ATOM 10745 H HD1    . PHE B 2 63  ? 4.615   -4.236  2.874   1.00 0.00  ? 150 PHE A HD1    7  
ATOM 10746 H HD2    . PHE B 2 63  ? 5.541   -0.353  1.242   1.00 0.00  ? 150 PHE A HD2    7  
ATOM 10747 H HE1    . PHE B 2 63  ? 4.410   -5.158  0.582   1.00 0.00  ? 150 PHE A HE1    7  
ATOM 10748 H HE2    . PHE B 2 63  ? 5.390   -1.291  -1.054  1.00 0.00  ? 150 PHE A HE2    7  
ATOM 10749 H HZ     . PHE B 2 63  ? 4.768   -3.692  -1.377  1.00 0.00  ? 150 PHE A HZ     7  
ATOM 10750 N N      . ASN B 2 64  ? 4.286   -3.685  5.925   1.00 0.00  ? 151 ASN A N      7  
ATOM 10751 C CA     . ASN B 2 64  ? 4.627   -4.420  7.147   1.00 0.00  ? 151 ASN A CA     7  
ATOM 10752 C C      . ASN B 2 64  ? 5.648   -5.532  6.817   1.00 0.00  ? 151 ASN A C      7  
ATOM 10753 O O      . ASN B 2 64  ? 5.867   -5.861  5.649   1.00 0.00  ? 151 ASN A O      7  
ATOM 10754 C CB     . ASN B 2 64  ? 3.279   -4.922  7.717   1.00 0.00  ? 151 ASN A CB     7  
ATOM 10755 C CG     . ASN B 2 64  ? 3.345   -5.995  8.784   1.00 0.00  ? 151 ASN A CG     7  
ATOM 10756 O OD1    . ASN B 2 64  ? 3.595   -7.157  8.514   1.00 0.00  ? 151 ASN A OD1    7  
ATOM 10757 N ND2    . ASN B 2 64  ? 3.013   -5.693  10.009  1.00 0.00  ? 151 ASN A ND2    7  
ATOM 10758 H H      . ASN B 2 64  ? 4.178   -4.298  5.116   1.00 0.00  ? 151 ASN A H      7  
ATOM 10759 H HA     . ASN B 2 64  ? 5.097   -3.754  7.868   1.00 0.00  ? 151 ASN A HA     7  
ATOM 10760 H HB2    . ASN B 2 64  ? 2.750   -4.068  8.127   1.00 0.00  ? 151 ASN A HB2    7  
ATOM 10761 H HB3    . ASN B 2 64  ? 2.677   -5.327  6.905   1.00 0.00  ? 151 ASN A HB3    7  
ATOM 10762 H HD21   . ASN B 2 64  ? 2.672   -4.778  10.252  1.00 0.00  ? 151 ASN A HD21   7  
ATOM 10763 H HD22   . ASN B 2 64  ? 2.874   -6.480  10.620  1.00 0.00  ? 151 ASN A HD22   7  
ATOM 10764 N N      . GLU B 2 65  ? 6.272   -6.135  7.832   1.00 0.00  ? 152 GLU A N      7  
ATOM 10765 C CA     . GLU B 2 65  ? 7.251   -7.234  7.704   1.00 0.00  ? 152 GLU A CA     7  
ATOM 10766 C C      . GLU B 2 65  ? 6.744   -8.430  6.869   1.00 0.00  ? 152 GLU A C      7  
ATOM 10767 O O      . GLU B 2 65  ? 7.538   -9.141  6.245   1.00 0.00  ? 152 GLU A O      7  
ATOM 10768 C CB     . GLU B 2 65  ? 7.635   -7.747  9.101   1.00 0.00  ? 152 GLU A CB     7  
ATOM 10769 C CG     . GLU B 2 65  ? 8.275   -6.683  9.998   1.00 0.00  ? 152 GLU A CG     7  
ATOM 10770 C CD     . GLU B 2 65  ? 8.651   -7.281  11.369  1.00 0.00  ? 152 GLU A CD     7  
ATOM 10771 O OE1    . GLU B 2 65  ? 7.769   -7.377  12.257  1.00 0.00  ? 152 GLU A OE1    7  
ATOM 10772 O OE2    . GLU B 2 65  ? 9.832   -7.651  11.575  1.00 0.00  ? 152 GLU A OE2    7  
ATOM 10773 H H      . GLU B 2 65  ? 6.059   -5.820  8.768   1.00 0.00  ? 152 GLU A H      7  
ATOM 10774 H HA     . GLU B 2 65  ? 8.149   -6.852  7.220   1.00 0.00  ? 152 GLU A HA     7  
ATOM 10775 H HB2    . GLU B 2 65  ? 6.743   -8.135  9.591   1.00 0.00  ? 152 GLU A HB2    7  
ATOM 10776 H HB3    . GLU B 2 65  ? 8.345   -8.567  8.986   1.00 0.00  ? 152 GLU A HB3    7  
ATOM 10777 H HG2    . GLU B 2 65  ? 9.169   -6.291  9.501   1.00 0.00  ? 152 GLU A HG2    7  
ATOM 10778 H HG3    . GLU B 2 65  ? 7.584   -5.853  10.146  1.00 0.00  ? 152 GLU A HG3    7  
ATOM 10779 N N      . ARG B 2 66  ? 5.420   -8.645  6.848   1.00 0.00  ? 153 ARG A N      7  
ATOM 10780 C CA     . ARG B 2 66  ? 4.724   -9.748  6.172   1.00 0.00  ? 153 ARG A CA     7  
ATOM 10781 C C      . ARG B 2 66  ? 4.195   -9.401  4.768   1.00 0.00  ? 153 ARG A C      7  
ATOM 10782 O O      . ARG B 2 66  ? 3.848   -10.320 4.024   1.00 0.00  ? 153 ARG A O      7  
ATOM 10783 C CB     . ARG B 2 66  ? 3.571   -10.221 7.077   1.00 0.00  ? 153 ARG A CB     7  
ATOM 10784 C CG     . ARG B 2 66  ? 4.026   -10.709 8.463   1.00 0.00  ? 153 ARG A CG     7  
ATOM 10785 C CD     . ARG B 2 66  ? 2.785   -11.078 9.273   1.00 0.00  ? 153 ARG A CD     7  
ATOM 10786 N NE     . ARG B 2 66  ? 3.083   -11.427 10.671  1.00 0.00  ? 153 ARG A NE     7  
ATOM 10787 C CZ     . ARG B 2 66  ? 2.201   -11.576 11.641  1.00 0.00  ? 153 ARG A CZ     7  
ATOM 10788 N NH1    . ARG B 2 66  ? 0.925   -11.350 11.468  1.00 0.00  ? 153 ARG A NH1    7  
ATOM 10789 N NH2    . ARG B 2 66  ? 2.589   -11.958 12.823  1.00 0.00  ? 153 ARG A NH2    7  
ATOM 10790 H H      . ARG B 2 66  ? 4.865   -8.015  7.423   1.00 0.00  ? 153 ARG A H      7  
ATOM 10791 H HA     . ARG B 2 66  ? 5.407   -10.589 6.044   1.00 0.00  ? 153 ARG A HA     7  
ATOM 10792 H HB2    . ARG B 2 66  ? 2.871   -9.397  7.214   1.00 0.00  ? 153 ARG A HB2    7  
ATOM 10793 H HB3    . ARG B 2 66  ? 3.029   -11.034 6.590   1.00 0.00  ? 153 ARG A HB3    7  
ATOM 10794 H HG2    . ARG B 2 66  ? 4.670   -11.585 8.350   1.00 0.00  ? 153 ARG A HG2    7  
ATOM 10795 H HG3    . ARG B 2 66  ? 4.568   -9.919  8.982   1.00 0.00  ? 153 ARG A HG3    7  
ATOM 10796 H HD2    . ARG B 2 66  ? 2.109   -10.223 9.248   1.00 0.00  ? 153 ARG A HD2    7  
ATOM 10797 H HD3    . ARG B 2 66  ? 2.304   -11.934 8.801   1.00 0.00  ? 153 ARG A HD3    7  
ATOM 10798 H HE     . ARG B 2 66  ? 4.044   -11.609 10.915  1.00 0.00  ? 153 ARG A HE     7  
ATOM 10799 H HH11   . ARG B 2 66  ? 0.583   -11.018 10.576  1.00 0.00  ? 153 ARG A HH11   7  
ATOM 10800 H HH12   . ARG B 2 66  ? 0.280   -11.457 12.230  1.00 0.00  ? 153 ARG A HH12   7  
ATOM 10801 H HH21   . ARG B 2 66  ? 3.563   -12.141 13.004  1.00 0.00  ? 153 ARG A HH21   7  
ATOM 10802 H HH22   . ARG B 2 66  ? 1.920   -12.076 13.565  1.00 0.00  ? 153 ARG A HH22   7  
ATOM 10803 N N      . GLY B 2 67  ? 4.123   -8.120  4.377   1.00 0.00  ? 154 GLY A N      7  
ATOM 10804 C CA     . GLY B 2 67  ? 3.460   -7.650  3.149   1.00 0.00  ? 154 GLY A CA     7  
ATOM 10805 C C      . GLY B 2 67  ? 2.693   -6.355  3.404   1.00 0.00  ? 154 GLY A C      7  
ATOM 10806 O O      . GLY B 2 67  ? 3.041   -5.613  4.321   1.00 0.00  ? 154 GLY A O      7  
ATOM 10807 H H      . GLY B 2 67  ? 4.447   -7.390  5.005   1.00 0.00  ? 154 GLY A H      7  
ATOM 10808 H HA2    . GLY B 2 67  ? 4.211   -7.463  2.380   1.00 0.00  ? 154 GLY A HA2    7  
ATOM 10809 H HA3    . GLY B 2 67  ? 2.763   -8.400  2.775   1.00 0.00  ? 154 GLY A HA3    7  
ATOM 10810 N N      . SER B 2 68  ? 1.667   -6.034  2.611   1.00 0.00  ? 155 SER A N      7  
ATOM 10811 C CA     . SER B 2 68  ? 0.773   -4.912  2.942   1.00 0.00  ? 155 SER A CA     7  
ATOM 10812 C C      . SER B 2 68  ? 0.088   -5.100  4.312   1.00 0.00  ? 155 SER A C      7  
ATOM 10813 O O      . SER B 2 68  ? -0.201  -6.228  4.717   1.00 0.00  ? 155 SER A O      7  
ATOM 10814 C CB     . SER B 2 68  ? -0.267  -4.709  1.835   1.00 0.00  ? 155 SER A CB     7  
ATOM 10815 O OG     . SER B 2 68  ? -1.070  -3.579  2.124   1.00 0.00  ? 155 SER A OG     7  
ATOM 10816 H H      . SER B 2 68  ? 1.420   -6.651  1.841   1.00 0.00  ? 155 SER A H      7  
ATOM 10817 H HA     . SER B 2 68  ? 1.360   -4.005  2.984   1.00 0.00  ? 155 SER A HA     7  
ATOM 10818 H HB2    . SER B 2 68  ? 0.238   -4.563  0.875   1.00 0.00  ? 155 SER A HB2    7  
ATOM 10819 H HB3    . SER B 2 68  ? -0.899  -5.589  1.770   1.00 0.00  ? 155 SER A HB3    7  
ATOM 10820 H HG     . SER B 2 68  ? -0.601  -2.775  1.840   1.00 0.00  ? 155 SER A HG     7  
ATOM 10821 N N      . LYS B 2 69  ? -0.246  -4.006  5.011   1.00 0.00  ? 156 LYS A N      7  
ATOM 10822 C CA     . LYS B 2 69  ? -1.236  -3.987  6.112   1.00 0.00  ? 156 LYS A CA     7  
ATOM 10823 C C      . LYS B 2 69  ? -2.691  -4.146  5.634   1.00 0.00  ? 156 LYS A C      7  
ATOM 10824 O O      . LYS B 2 69  ? -3.598  -4.299  6.452   1.00 0.00  ? 156 LYS A O      7  
ATOM 10825 C CB     . LYS B 2 69  ? -1.067  -2.690  6.925   1.00 0.00  ? 156 LYS A CB     7  
ATOM 10826 C CG     . LYS B 2 69  ? 0.149   -2.861  7.853   1.00 0.00  ? 156 LYS A CG     7  
ATOM 10827 C CD     . LYS B 2 69  ? 0.417   -1.686  8.804   1.00 0.00  ? 156 LYS A CD     7  
ATOM 10828 C CE     . LYS B 2 69  ? 1.562   -0.798  8.296   1.00 0.00  ? 156 LYS A CE     7  
ATOM 10829 N NZ     . LYS B 2 69  ? 1.754   0.386   9.174   1.00 0.00  ? 156 LYS A NZ     7  
ATOM 10830 H H      . LYS B 2 69  ? 0.118   -3.113  4.696   1.00 0.00  ? 156 LYS A H      7  
ATOM 10831 H HA     . LYS B 2 69  ? -1.048  -4.839  6.770   1.00 0.00  ? 156 LYS A HA     7  
ATOM 10832 H HB2    . LYS B 2 69  ? -0.962  -1.833  6.243   1.00 0.00  ? 156 LYS A HB2    7  
ATOM 10833 H HB3    . LYS B 2 69  ? -1.946  -2.524  7.548   1.00 0.00  ? 156 LYS A HB3    7  
ATOM 10834 H HG2    . LYS B 2 69  ? -0.023  -3.744  8.470   1.00 0.00  ? 156 LYS A HG2    7  
ATOM 10835 H HG3    . LYS B 2 69  ? 1.035   -3.055  7.249   1.00 0.00  ? 156 LYS A HG3    7  
ATOM 10836 H HD2    . LYS B 2 69  ? -0.496  -1.106  8.939   1.00 0.00  ? 156 LYS A HD2    7  
ATOM 10837 H HD3    . LYS B 2 69  ? 0.701   -2.091  9.777   1.00 0.00  ? 156 LYS A HD3    7  
ATOM 10838 H HE2    . LYS B 2 69  ? 2.480   -1.387  8.261   1.00 0.00  ? 156 LYS A HE2    7  
ATOM 10839 H HE3    . LYS B 2 69  ? 1.351   -0.486  7.264   1.00 0.00  ? 156 LYS A HE3    7  
ATOM 10840 H HZ1    . LYS B 2 69  ? 0.881   0.858   9.369   1.00 0.00  ? 156 LYS A HZ1    7  
ATOM 10841 H HZ2    . LYS B 2 69  ? 2.171   0.131   10.057  1.00 0.00  ? 156 LYS A HZ2    7  
ATOM 10842 H HZ3    . LYS B 2 69  ? 2.353   1.090   8.734   1.00 0.00  ? 156 LYS A HZ3    7  
ATOM 10843 N N      . GLY B 2 70  ? -2.902  -4.147  4.315   1.00 0.00  ? 157 GLY A N      7  
ATOM 10844 C CA     . GLY B 2 70  ? -4.178  -4.371  3.630   1.00 0.00  ? 157 GLY A CA     7  
ATOM 10845 C C      . GLY B 2 70  ? -4.725  -3.141  2.899   1.00 0.00  ? 157 GLY A C      7  
ATOM 10846 O O      . GLY B 2 70  ? -5.799  -3.205  2.293   1.00 0.00  ? 157 GLY A O      7  
ATOM 10847 H H      . GLY B 2 70  ? -2.089  -4.011  3.728   1.00 0.00  ? 157 GLY A H      7  
ATOM 10848 H HA2    . GLY B 2 70  ? -4.047  -5.161  2.891   1.00 0.00  ? 157 GLY A HA2    7  
ATOM 10849 H HA3    . GLY B 2 70  ? -4.926  -4.709  4.346   1.00 0.00  ? 157 GLY A HA3    7  
ATOM 10850 N N      . PHE B 2 71  ? -3.996  -2.025  2.936   1.00 0.00  ? 158 PHE A N      7  
ATOM 10851 C CA     . PHE B 2 71  ? -4.306  -0.788  2.233   1.00 0.00  ? 158 PHE A CA     7  
ATOM 10852 C C      . PHE B 2 71  ? -3.047  -0.014  1.807   1.00 0.00  ? 158 PHE A C      7  
ATOM 10853 O O      . PHE B 2 71  ? -1.923  -0.215  2.296   1.00 0.00  ? 158 PHE A O      7  
ATOM 10854 C CB     . PHE B 2 71  ? -5.277  0.078   3.066   1.00 0.00  ? 158 PHE A CB     7  
ATOM 10855 C CG     . PHE B 2 71  ? -4.723  0.908   4.206   1.00 0.00  ? 158 PHE A CG     7  
ATOM 10856 C CD1    . PHE B 2 71  ? -4.441  0.295   5.439   1.00 0.00  ? 158 PHE A CD1    7  
ATOM 10857 C CD2    . PHE B 2 71  ? -4.618  2.309   4.072   1.00 0.00  ? 158 PHE A CD2    7  
ATOM 10858 C CE1    . PHE B 2 71  ? -4.057  1.081   6.534   1.00 0.00  ? 158 PHE A CE1    7  
ATOM 10859 C CE2    . PHE B 2 71  ? -4.269  3.108   5.177   1.00 0.00  ? 158 PHE A CE2    7  
ATOM 10860 C CZ     . PHE B 2 71  ? -3.974  2.477   6.396   1.00 0.00  ? 158 PHE A CZ     7  
ATOM 10861 H H      . PHE B 2 71  ? -3.065  -2.089  3.308   1.00 0.00  ? 158 PHE A H      7  
ATOM 10862 H HA     . PHE B 2 71  ? -4.829  -1.069  1.318   1.00 0.00  ? 158 PHE A HA     7  
ATOM 10863 H HB2    . PHE B 2 71  ? -5.812  0.747   2.410