data_2ES0
# 
_entry.id   2ES0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.289 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2ES0         
RCSB  RCSB035020   
WWPDB D_1000035020 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2ES0 
_pdbx_database_status.recvd_initial_deposition_date   2005-10-25 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Schoch, G.A.'                         1  
'Phillips, C.'                         2  
'Turnbull, A.'                         3  
'Niesen, F.'                           4  
'Johansson, C.'                        5  
'Elkins, J.M.'                         6  
'Longman, E.'                          7  
'Gilealdi, C.'                         8  
'Sobott, F.'                           9  
'Ball, L.'                             10 
'Sundstrom, M.'                        11 
'Edwards, A.'                          12 
'Arrowsmith, C.'                       13 
'von Delft, F.'                        14 
'Doyle, D.A.'                          15 
'Structural Genomics Consortium (SGC)' 16 
# 
_citation.id                        primary 
_citation.title                     
'Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.Usa 
_citation.journal_volume            105 
_citation.page_first                6457 
_citation.page_last                 6462 
_citation.year                      2008 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18434541 
_citation.pdbx_database_id_DOI      10.1073/pnas.0801508105 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Soundararajan, M.' 1  
primary 'Willard, F.S.'     2  
primary 'Kimple, A.J.'      3  
primary 'Turnbull, A.P.'    4  
primary 'Ball, L.J.'        5  
primary 'Schoch, G.A.'      6  
primary 'Gileadi, C.'       7  
primary 'Fedorov, O.Y.'     8  
primary 'Dowler, E.F.'      9  
primary 'Higman, V.A.'      10 
primary 'Hutsell, S.Q.'     11 
primary 'Sundstrom, M.'     12 
primary 'Doyle, D.A.'       13 
primary 'Siderovski, D.P.'  14 
# 
_cell.entry_id           2ES0 
_cell.length_a           77.567 
_cell.length_b           77.567 
_cell.length_c           73.020 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2ES0 
_symmetry.space_group_name_H-M             'P 32 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                154 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'regulator of G-protein signalling 6' 17236.523 1   ? ? ? ? 
2 water   nat water                                 18.015    134 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SMPSQQRVKRWGFSFDEILKDQVGRDQFLRFLESEFSSENLRFWLAVQDLKKQPLQDVAKRVEEIWQEFLAPGAPSAINL
DSHSYEITSQNVKDGGRYTFEDAQEHIYKLMKSDSYARFLRSNAYQDLLLAKKKGKSLAGKRLTGLMQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SMPSQQRVKRWGFSFDEILKDQVGRDQFLRFLESEFSSENLRFWLAVQDLKKQPLQDVAKRVEEIWQEFLAPGAPSAINL
DSHSYEITSQNVKDGGRYTFEDAQEHIYKLMKSDSYARFLRSNAYQDLLLAKKKGKSLAGKRLTGLMQ
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   PRO n 
1 4   SER n 
1 5   GLN n 
1 6   GLN n 
1 7   ARG n 
1 8   VAL n 
1 9   LYS n 
1 10  ARG n 
1 11  TRP n 
1 12  GLY n 
1 13  PHE n 
1 14  SER n 
1 15  PHE n 
1 16  ASP n 
1 17  GLU n 
1 18  ILE n 
1 19  LEU n 
1 20  LYS n 
1 21  ASP n 
1 22  GLN n 
1 23  VAL n 
1 24  GLY n 
1 25  ARG n 
1 26  ASP n 
1 27  GLN n 
1 28  PHE n 
1 29  LEU n 
1 30  ARG n 
1 31  PHE n 
1 32  LEU n 
1 33  GLU n 
1 34  SER n 
1 35  GLU n 
1 36  PHE n 
1 37  SER n 
1 38  SER n 
1 39  GLU n 
1 40  ASN n 
1 41  LEU n 
1 42  ARG n 
1 43  PHE n 
1 44  TRP n 
1 45  LEU n 
1 46  ALA n 
1 47  VAL n 
1 48  GLN n 
1 49  ASP n 
1 50  LEU n 
1 51  LYS n 
1 52  LYS n 
1 53  GLN n 
1 54  PRO n 
1 55  LEU n 
1 56  GLN n 
1 57  ASP n 
1 58  VAL n 
1 59  ALA n 
1 60  LYS n 
1 61  ARG n 
1 62  VAL n 
1 63  GLU n 
1 64  GLU n 
1 65  ILE n 
1 66  TRP n 
1 67  GLN n 
1 68  GLU n 
1 69  PHE n 
1 70  LEU n 
1 71  ALA n 
1 72  PRO n 
1 73  GLY n 
1 74  ALA n 
1 75  PRO n 
1 76  SER n 
1 77  ALA n 
1 78  ILE n 
1 79  ASN n 
1 80  LEU n 
1 81  ASP n 
1 82  SER n 
1 83  HIS n 
1 84  SER n 
1 85  TYR n 
1 86  GLU n 
1 87  ILE n 
1 88  THR n 
1 89  SER n 
1 90  GLN n 
1 91  ASN n 
1 92  VAL n 
1 93  LYS n 
1 94  ASP n 
1 95  GLY n 
1 96  GLY n 
1 97  ARG n 
1 98  TYR n 
1 99  THR n 
1 100 PHE n 
1 101 GLU n 
1 102 ASP n 
1 103 ALA n 
1 104 GLN n 
1 105 GLU n 
1 106 HIS n 
1 107 ILE n 
1 108 TYR n 
1 109 LYS n 
1 110 LEU n 
1 111 MET n 
1 112 LYS n 
1 113 SER n 
1 114 ASP n 
1 115 SER n 
1 116 TYR n 
1 117 ALA n 
1 118 ARG n 
1 119 PHE n 
1 120 LEU n 
1 121 ARG n 
1 122 SER n 
1 123 ASN n 
1 124 ALA n 
1 125 TYR n 
1 126 GLN n 
1 127 ASP n 
1 128 LEU n 
1 129 LEU n 
1 130 LEU n 
1 131 ALA n 
1 132 LYS n 
1 133 LYS n 
1 134 LYS n 
1 135 GLY n 
1 136 LYS n 
1 137 SER n 
1 138 LEU n 
1 139 ALA n 
1 140 GLY n 
1 141 LYS n 
1 142 ARG n 
1 143 LEU n 
1 144 THR n 
1 145 GLY n 
1 146 LEU n 
1 147 MET n 
1 148 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pLIC-SGC 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RGS6_HUMAN 
_struct_ref.pdbx_db_accession          P49758 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;PSQQRVKRWGFSFDEILKDQVGRDQFLRFLESEFSSENLRFWLAVQDLKKQPLQDVAKRVEEIWQEFLAPGAPSAINLDS
HSYEITSQNVKDGGRYTFEDAQEHIYKLMKSDSYARFLRSNAYQDLLLAKKKGKSLAGKRLTGLMQSS
;
_struct_ref.pdbx_align_begin           325 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2ES0 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 148 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P49758 
_struct_ref_seq.db_align_beg                  325 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  470 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       325 
_struct_ref_seq.pdbx_auth_seq_align_end       470 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2ES0 SER A 1 ? UNP P49758 ? ? 'CLONING ARTIFACT' 323 1 
1 2ES0 MET A 2 ? UNP P49758 ? ? 'CLONING ARTIFACT' 324 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2ES0 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.64 
_exptl_crystal.density_percent_sol   66.22 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_details    'PEG 10K;  (NH4)(ac); BIS-TRIS , pH pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2005-10-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.987 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.987 
# 
_reflns.entry_id                     2ES0 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             72.93 
_reflns.d_resolution_high            2.1 
_reflns.number_obs                   15210 
_reflns.number_all                   15210 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.083 
_reflns.pdbx_Rsym_value              0.089 
_reflns.pdbx_netI_over_sigmaI        15.4 
_reflns.B_iso_Wilson_estimate        43.143 
_reflns.pdbx_redundancy              7.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.1 
_reflns_shell.d_res_low              2.21 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.01088 
_reflns_shell.pdbx_Rsym_value        0.01204 
_reflns_shell.meanI_over_sigI_obs    1.7 
_reflns_shell.pdbx_redundancy        5.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2183 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2ES0 
_refine.ls_number_reflns_obs                     14413 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             67.12 
_refine.ls_d_res_high                            2.10 
_refine.ls_percent_reflns_obs                    99.86 
_refine.ls_R_factor_obs                          0.19636 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19474 
_refine.ls_R_factor_R_free                       0.22855 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  763 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.961 
_refine.correlation_coeff_Fo_to_Fc_free          0.946 
_refine.B_iso_mean                               43.143 
_refine.aniso_B[1][1]                            2.25 
_refine.aniso_B[2][2]                            2.25 
_refine.aniso_B[3][3]                            -3.38 
_refine.aniso_B[1][2]                            1.13 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      2A72.pdb 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.148 
_refine.pdbx_overall_ESU_R_Free                  0.142 
_refine.overall_SU_ML                            0.122 
_refine.overall_SU_B                             8.654 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1061 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             134 
_refine_hist.number_atoms_total               1195 
_refine_hist.d_res_high                       2.10 
_refine_hist.d_res_low                        67.12 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.008  0.022  ? 1101 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 965  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          0.979  1.942  ? 1487 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.744  3.000  ? 2247 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.484  5.000  ? 132  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       36.580 24.262 ? 61   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.691 15.000 ? 195  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       18.378 15.000 ? 8    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.053  0.200  ? 153  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.003  0.020  ? 1235 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 242  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.202  0.200  ? 267  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.165  0.200  ? 896  'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.185  0.200  ? 554  'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.082  0.200  ? 577  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.168  0.200  ? 78   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.168  0.200  ? 19   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.216  0.200  ? 70   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.124  0.200  ? 25   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.451  1.500  ? 673  'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.084  1.500  ? 263  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.750  2.000  ? 1043 'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.106  3.000  ? 498  'X-RAY DIFFRACTION' ? 
r_scangle_it                 1.800  4.500  ? 442  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.10 
_refine_ls_shell.d_res_low                        2.155 
_refine_ls_shell.number_reflns_R_work             1045 
_refine_ls_shell.R_factor_R_work                  0.32 
_refine_ls_shell.percent_reflns_obs               99.10 
_refine_ls_shell.R_factor_R_free                  0.41 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             51 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2ES0 
_struct.title                     'Structure of the regulator of G-protein signaling domain of RGS6' 
_struct.pdbx_descriptor           'regulator of G-protein signalling 6' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2ES0 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            
;HUMAN RGS6, REGULATOR OF G-PROTEIN SIGNALING 6, GTPASE-ACTIVATING PROTEINS (GAP), DOMAIN SWAP, STRUCTURAL GENOMICS, STRUCTURAL GENOMICS CONSORTIUM, SGC, SIGNALING PROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;Dimer, with domain swap 
Form a biological unit with symmetry related molecule (X, Y, -Z)
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 4   ? GLY A 12  ? SER A 326 GLY A 334 1 ? 9  
HELX_P HELX_P2  2  SER A 14  ? ASP A 21  ? SER A 336 ASP A 343 1 ? 8  
HELX_P HELX_P3  3  ASP A 21  ? GLU A 35  ? ASP A 343 GLU A 357 1 ? 15 
HELX_P HELX_P4  4  SER A 37  ? LYS A 52  ? SER A 359 LYS A 374 1 ? 16 
HELX_P HELX_P5  5  GLN A 53  ? GLN A 56  ? GLN A 375 GLN A 378 5 ? 4  
HELX_P HELX_P6  6  ASP A 57  ? LEU A 70  ? ASP A 379 LEU A 392 1 ? 14 
HELX_P HELX_P7  7  ASP A 81  ? GLY A 95  ? ASP A 403 GLY A 417 1 ? 15 
HELX_P HELX_P8  8  PHE A 100 ? SER A 115 ? PHE A 422 SER A 437 1 ? 16 
HELX_P HELX_P9  9  SER A 115 ? SER A 122 ? SER A 437 SER A 444 1 ? 8  
HELX_P HELX_P10 10 SER A 122 ? ASP A 127 ? SER A 444 ASP A 449 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          2ES0 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2ES0 
_atom_sites.fract_transf_matrix[1][1]   0.012892 
_atom_sites.fract_transf_matrix[1][2]   0.007443 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014886 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013695 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 2   ? -13.810 61.355 0.311   1.00 63.27 ? 324 MET A N   1 
ATOM   2    C CA  . MET A 1 2   ? -14.005 59.962 0.813   1.00 63.16 ? 324 MET A CA  1 
ATOM   3    C C   . MET A 1 2   ? -13.775 58.988 -0.350  1.00 63.01 ? 324 MET A C   1 
ATOM   4    O O   . MET A 1 2   ? -13.629 59.421 -1.502  1.00 62.95 ? 324 MET A O   1 
ATOM   5    C CB  . MET A 1 2   ? -15.431 59.806 1.371   1.00 63.24 ? 324 MET A CB  1 
ATOM   6    C CG  . MET A 1 2   ? -15.545 59.072 2.712   1.00 63.42 ? 324 MET A CG  1 
ATOM   7    N N   . PRO A 1 3   ? -13.721 57.672 -0.058  1.00 62.69 ? 325 PRO A N   1 
ATOM   8    C CA  . PRO A 1 3   ? -13.754 56.687 -1.137  1.00 62.28 ? 325 PRO A CA  1 
ATOM   9    C C   . PRO A 1 3   ? -15.197 56.297 -1.464  1.00 61.65 ? 325 PRO A C   1 
ATOM   10   O O   . PRO A 1 3   ? -16.078 56.402 -0.606  1.00 61.58 ? 325 PRO A O   1 
ATOM   11   C CB  . PRO A 1 3   ? -12.971 55.497 -0.558  1.00 62.26 ? 325 PRO A CB  1 
ATOM   12   C CG  . PRO A 1 3   ? -12.853 55.756 0.935   1.00 62.70 ? 325 PRO A CG  1 
ATOM   13   C CD  . PRO A 1 3   ? -13.615 57.011 1.253   1.00 62.70 ? 325 PRO A CD  1 
ATOM   14   N N   . SER A 1 4   ? -15.434 55.855 -2.695  1.00 61.00 ? 326 SER A N   1 
ATOM   15   C CA  . SER A 1 4   ? -16.788 55.528 -3.143  1.00 60.39 ? 326 SER A CA  1 
ATOM   16   C C   . SER A 1 4   ? -17.311 54.269 -2.468  1.00 59.91 ? 326 SER A C   1 
ATOM   17   O O   . SER A 1 4   ? -16.547 53.487 -1.902  1.00 59.58 ? 326 SER A O   1 
ATOM   18   C CB  . SER A 1 4   ? -16.817 55.317 -4.654  1.00 60.35 ? 326 SER A CB  1 
ATOM   19   O OG  . SER A 1 4   ? -16.139 54.119 -4.999  1.00 60.21 ? 326 SER A OG  1 
ATOM   20   N N   . GLN A 1 5   ? -18.621 54.072 -2.561  1.00 59.34 ? 327 GLN A N   1 
ATOM   21   C CA  . GLN A 1 5   ? -19.258 52.866 -2.049  1.00 58.86 ? 327 GLN A CA  1 
ATOM   22   C C   . GLN A 1 5   ? -18.812 51.638 -2.837  1.00 58.23 ? 327 GLN A C   1 
ATOM   23   O O   . GLN A 1 5   ? -18.706 50.545 -2.281  1.00 58.11 ? 327 GLN A O   1 
ATOM   24   C CB  . GLN A 1 5   ? -20.782 52.998 -2.109  1.00 59.00 ? 327 GLN A CB  1 
ATOM   25   C CG  . GLN A 1 5   ? -21.344 54.159 -1.298  1.00 59.41 ? 327 GLN A CG  1 
ATOM   26   C CD  . GLN A 1 5   ? -21.079 54.017 0.190   1.00 60.09 ? 327 GLN A CD  1 
ATOM   27   O OE1 . GLN A 1 5   ? -21.956 53.594 0.937   1.00 61.12 ? 327 GLN A OE1 1 
ATOM   28   N NE2 . GLN A 1 5   ? -19.871 54.369 0.626   1.00 58.84 ? 327 GLN A NE2 1 
ATOM   29   N N   . GLN A 1 6   ? -18.544 51.828 -4.127  1.00 57.39 ? 328 GLN A N   1 
ATOM   30   C CA  . GLN A 1 6   ? -18.136 50.733 -4.992  1.00 56.85 ? 328 GLN A CA  1 
ATOM   31   C C   . GLN A 1 6   ? -16.820 50.112 -4.517  1.00 56.35 ? 328 GLN A C   1 
ATOM   32   O O   . GLN A 1 6   ? -16.709 48.886 -4.460  1.00 56.23 ? 328 GLN A O   1 
ATOM   33   C CB  . GLN A 1 6   ? -18.010 51.213 -6.440  1.00 56.90 ? 328 GLN A CB  1 
ATOM   34   C CG  . GLN A 1 6   ? -17.716 50.105 -7.444  1.00 57.19 ? 328 GLN A CG  1 
ATOM   35   N N   . ARG A 1 7   ? -15.837 50.948 -4.172  1.00 55.62 ? 329 ARG A N   1 
ATOM   36   C CA  . ARG A 1 7   ? -14.536 50.439 -3.720  1.00 55.23 ? 329 ARG A CA  1 
ATOM   37   C C   . ARG A 1 7   ? -14.575 50.010 -2.250  1.00 54.71 ? 329 ARG A C   1 
ATOM   38   O O   . ARG A 1 7   ? -14.005 48.981 -1.898  1.00 54.43 ? 329 ARG A O   1 
ATOM   39   C CB  . ARG A 1 7   ? -13.386 51.427 -4.010  1.00 55.40 ? 329 ARG A CB  1 
ATOM   40   C CG  . ARG A 1 7   ? -13.228 52.606 -3.046  1.00 55.35 ? 329 ARG A CG  1 
ATOM   41   C CD  . ARG A 1 7   ? -12.243 53.673 -3.597  1.00 54.79 ? 329 ARG A CD  1 
ATOM   42   N NE  . ARG A 1 7   ? -10.845 53.482 -3.193  1.00 53.21 ? 329 ARG A NE  1 
ATOM   43   C CZ  . ARG A 1 7   ? -9.865  54.366 -3.412  1.00 52.46 ? 329 ARG A CZ  1 
ATOM   44   N NH1 . ARG A 1 7   ? -10.098 55.516 -4.035  1.00 52.07 ? 329 ARG A NH1 1 
ATOM   45   N NH2 . ARG A 1 7   ? -8.629  54.106 -2.999  1.00 52.76 ? 329 ARG A NH2 1 
ATOM   46   N N   . VAL A 1 8   ? -15.271 50.773 -1.409  1.00 54.33 ? 330 VAL A N   1 
ATOM   47   C CA  . VAL A 1 8   ? -15.511 50.365 -0.021  1.00 54.13 ? 330 VAL A CA  1 
ATOM   48   C C   . VAL A 1 8   ? -16.133 48.959 0.020   1.00 53.99 ? 330 VAL A C   1 
ATOM   49   O O   . VAL A 1 8   ? -15.744 48.122 0.838   1.00 53.98 ? 330 VAL A O   1 
ATOM   50   C CB  . VAL A 1 8   ? -16.386 51.392 0.752   1.00 54.07 ? 330 VAL A CB  1 
ATOM   51   C CG1 . VAL A 1 8   ? -16.824 50.836 2.105   1.00 54.21 ? 330 VAL A CG1 1 
ATOM   52   C CG2 . VAL A 1 8   ? -15.621 52.698 0.961   1.00 53.95 ? 330 VAL A CG2 1 
ATOM   53   N N   . LYS A 1 9   ? -17.071 48.702 -0.886  1.00 53.94 ? 331 LYS A N   1 
ATOM   54   C CA  . LYS A 1 9   ? -17.663 47.374 -1.045  1.00 53.91 ? 331 LYS A CA  1 
ATOM   55   C C   . LYS A 1 9   ? -16.648 46.336 -1.541  1.00 53.76 ? 331 LYS A C   1 
ATOM   56   O O   . LYS A 1 9   ? -16.701 45.181 -1.123  1.00 53.84 ? 331 LYS A O   1 
ATOM   57   C CB  . LYS A 1 9   ? -18.855 47.438 -2.006  1.00 53.99 ? 331 LYS A CB  1 
ATOM   58   C CG  . LYS A 1 9   ? -19.703 46.175 -2.052  1.00 54.56 ? 331 LYS A CG  1 
ATOM   59   N N   . ARG A 1 10  ? -15.731 46.744 -2.422  1.00 53.41 ? 332 ARG A N   1 
ATOM   60   C CA  . ARG A 1 10  ? -14.751 45.815 -3.001  1.00 53.52 ? 332 ARG A CA  1 
ATOM   61   C C   . ARG A 1 10  ? -13.774 45.288 -1.949  1.00 52.71 ? 332 ARG A C   1 
ATOM   62   O O   . ARG A 1 10  ? -13.295 44.158 -2.050  1.00 52.57 ? 332 ARG A O   1 
ATOM   63   C CB  . ARG A 1 10  ? -13.968 46.461 -4.158  1.00 53.54 ? 332 ARG A CB  1 
ATOM   64   C CG  . ARG A 1 10  ? -13.505 45.447 -5.216  1.00 54.28 ? 332 ARG A CG  1 
ATOM   65   C CD  . ARG A 1 10  ? -12.685 46.060 -6.369  1.00 55.46 ? 332 ARG A CD  1 
ATOM   66   N NE  . ARG A 1 10  ? -12.816 47.517 -6.497  1.00 57.04 ? 332 ARG A NE  1 
ATOM   67   C CZ  . ARG A 1 10  ? -13.784 48.160 -7.150  1.00 58.68 ? 332 ARG A CZ  1 
ATOM   68   N NH1 . ARG A 1 10  ? -14.767 47.502 -7.767  1.00 60.19 ? 332 ARG A NH1 1 
ATOM   69   N NH2 . ARG A 1 10  ? -13.778 49.492 -7.178  1.00 59.00 ? 332 ARG A NH2 1 
ATOM   70   N N   . TRP A 1 11  ? -13.481 46.109 -0.946  1.00 51.99 ? 333 TRP A N   1 
ATOM   71   C CA  . TRP A 1 11  ? -12.655 45.677 0.175   1.00 51.61 ? 333 TRP A CA  1 
ATOM   72   C C   . TRP A 1 11  ? -13.273 44.461 0.873   1.00 51.51 ? 333 TRP A C   1 
ATOM   73   O O   . TRP A 1 11  ? -12.557 43.588 1.357   1.00 51.55 ? 333 TRP A O   1 
ATOM   74   C CB  . TRP A 1 11  ? -12.470 46.802 1.195   1.00 51.48 ? 333 TRP A CB  1 
ATOM   75   C CG  . TRP A 1 11  ? -11.914 48.073 0.636   1.00 51.37 ? 333 TRP A CG  1 
ATOM   76   C CD1 . TRP A 1 11  ? -11.286 48.243 -0.568  1.00 50.93 ? 333 TRP A CD1 1 
ATOM   77   C CD2 . TRP A 1 11  ? -11.922 49.357 1.270   1.00 51.02 ? 333 TRP A CD2 1 
ATOM   78   N NE1 . TRP A 1 11  ? -10.922 49.554 -0.726  1.00 50.53 ? 333 TRP A NE1 1 
ATOM   79   C CE2 . TRP A 1 11  ? -11.297 50.262 0.384   1.00 50.90 ? 333 TRP A CE2 1 
ATOM   80   C CE3 . TRP A 1 11  ? -12.397 49.830 2.502   1.00 50.79 ? 333 TRP A CE3 1 
ATOM   81   C CZ2 . TRP A 1 11  ? -11.129 51.617 0.691   1.00 51.22 ? 333 TRP A CZ2 1 
ATOM   82   C CZ3 . TRP A 1 11  ? -12.235 51.175 2.809   1.00 51.00 ? 333 TRP A CZ3 1 
ATOM   83   C CH2 . TRP A 1 11  ? -11.608 52.056 1.903   1.00 51.40 ? 333 TRP A CH2 1 
ATOM   84   N N   . GLY A 1 12  ? -14.602 44.407 0.917   1.00 51.22 ? 334 GLY A N   1 
ATOM   85   C CA  . GLY A 1 12  ? -15.307 43.272 1.500   1.00 51.15 ? 334 GLY A CA  1 
ATOM   86   C C   . GLY A 1 12  ? -15.517 42.099 0.556   1.00 51.05 ? 334 GLY A C   1 
ATOM   87   O O   . GLY A 1 12  ? -16.291 41.182 0.867   1.00 51.34 ? 334 GLY A O   1 
ATOM   88   N N   . PHE A 1 13  ? -14.851 42.122 -0.596  1.00 50.65 ? 335 PHE A N   1 
ATOM   89   C CA  . PHE A 1 13  ? -14.993 41.059 -1.589  1.00 50.39 ? 335 PHE A CA  1 
ATOM   90   C C   . PHE A 1 13  ? -13.975 39.978 -1.290  1.00 49.85 ? 335 PHE A C   1 
ATOM   91   O O   . PHE A 1 13  ? -14.281 38.788 -1.328  1.00 49.56 ? 335 PHE A O   1 
ATOM   92   C CB  . PHE A 1 13  ? -14.784 41.602 -3.008  1.00 50.60 ? 335 PHE A CB  1 
ATOM   93   C CG  . PHE A 1 13  ? -15.130 40.619 -4.088  1.00 50.82 ? 335 PHE A CG  1 
ATOM   94   C CD1 . PHE A 1 13  ? -16.440 40.496 -4.537  1.00 51.04 ? 335 PHE A CD1 1 
ATOM   95   C CD2 . PHE A 1 13  ? -14.148 39.809 -4.651  1.00 51.29 ? 335 PHE A CD2 1 
ATOM   96   C CE1 . PHE A 1 13  ? -16.767 39.583 -5.536  1.00 51.19 ? 335 PHE A CE1 1 
ATOM   97   C CE2 . PHE A 1 13  ? -14.465 38.891 -5.648  1.00 51.12 ? 335 PHE A CE2 1 
ATOM   98   C CZ  . PHE A 1 13  ? -15.777 38.779 -6.092  1.00 51.22 ? 335 PHE A CZ  1 
ATOM   99   N N   . SER A 1 14  ? -12.752 40.409 -1.010  1.00 49.30 ? 336 SER A N   1 
ATOM   100  C CA  . SER A 1 14  ? -11.706 39.509 -0.578  1.00 49.06 ? 336 SER A CA  1 
ATOM   101  C C   . SER A 1 14  ? -10.628 40.303 0.153   1.00 48.99 ? 336 SER A C   1 
ATOM   102  O O   . SER A 1 14  ? -10.568 41.537 0.053   1.00 48.63 ? 336 SER A O   1 
ATOM   103  C CB  . SER A 1 14  ? -11.121 38.737 -1.769  1.00 49.06 ? 336 SER A CB  1 
ATOM   104  O OG  . SER A 1 14  ? -10.117 39.477 -2.445  1.00 48.60 ? 336 SER A OG  1 
ATOM   105  N N   . PHE A 1 15  ? -9.804  39.583 0.908   1.00 48.77 ? 337 PHE A N   1 
ATOM   106  C CA  . PHE A 1 15  ? -8.724  40.183 1.683   1.00 48.63 ? 337 PHE A CA  1 
ATOM   107  C C   . PHE A 1 15  ? -7.690  40.801 0.748   1.00 49.15 ? 337 PHE A C   1 
ATOM   108  O O   . PHE A 1 15  ? -7.114  41.858 1.041   1.00 49.24 ? 337 PHE A O   1 
ATOM   109  C CB  . PHE A 1 15  ? -8.069  39.113 2.580   1.00 48.08 ? 337 PHE A CB  1 
ATOM   110  C CG  . PHE A 1 15  ? -6.902  39.613 3.394   1.00 47.05 ? 337 PHE A CG  1 
ATOM   111  C CD1 . PHE A 1 15  ? -6.989  40.797 4.111   1.00 46.58 ? 337 PHE A CD1 1 
ATOM   112  C CD2 . PHE A 1 15  ? -5.728  38.880 3.464   1.00 46.62 ? 337 PHE A CD2 1 
ATOM   113  C CE1 . PHE A 1 15  ? -5.929  41.255 4.871   1.00 46.50 ? 337 PHE A CE1 1 
ATOM   114  C CE2 . PHE A 1 15  ? -4.656  39.328 4.232   1.00 47.45 ? 337 PHE A CE2 1 
ATOM   115  C CZ  . PHE A 1 15  ? -4.757  40.522 4.936   1.00 46.88 ? 337 PHE A CZ  1 
ATOM   116  N N   . ASP A 1 16  ? -7.444  40.120 -0.367  1.00 49.65 ? 338 ASP A N   1 
ATOM   117  C CA  . ASP A 1 16  ? -6.557  40.635 -1.412  1.00 50.13 ? 338 ASP A CA  1 
ATOM   118  C C   . ASP A 1 16  ? -6.988  42.006 -1.942  1.00 50.04 ? 338 ASP A C   1 
ATOM   119  O O   . ASP A 1 16  ? -6.137  42.822 -2.260  1.00 49.83 ? 338 ASP A O   1 
ATOM   120  C CB  . ASP A 1 16  ? -6.447  39.629 -2.559  1.00 50.34 ? 338 ASP A CB  1 
ATOM   121  C CG  . ASP A 1 16  ? -5.629  38.394 -2.177  1.00 51.43 ? 338 ASP A CG  1 
ATOM   122  O OD1 . ASP A 1 16  ? -5.172  38.307 -1.008  1.00 50.05 ? 338 ASP A OD1 1 
ATOM   123  O OD2 . ASP A 1 16  ? -5.446  37.514 -3.053  1.00 53.29 ? 338 ASP A OD2 1 
ATOM   124  N N   . GLU A 1 17  ? -8.294  42.267 -2.004  1.00 49.69 ? 339 GLU A N   1 
ATOM   125  C CA  . GLU A 1 17  ? -8.768  43.571 -2.450  1.00 50.03 ? 339 GLU A CA  1 
ATOM   126  C C   . GLU A 1 17  ? -8.385  44.680 -1.488  1.00 50.30 ? 339 GLU A C   1 
ATOM   127  O O   . GLU A 1 17  ? -8.073  45.783 -1.924  1.00 50.54 ? 339 GLU A O   1 
ATOM   128  C CB  . GLU A 1 17  ? -10.281 43.578 -2.688  1.00 50.11 ? 339 GLU A CB  1 
ATOM   129  C CG  . GLU A 1 17  ? -10.746 42.700 -3.847  1.00 50.63 ? 339 GLU A CG  1 
ATOM   130  C CD  . GLU A 1 17  ? -10.009 42.970 -5.163  1.00 51.68 ? 339 GLU A CD  1 
ATOM   131  O OE1 . GLU A 1 17  ? -9.519  44.104 -5.385  1.00 51.30 ? 339 GLU A OE1 1 
ATOM   132  O OE2 . GLU A 1 17  ? -9.920  42.031 -5.980  1.00 52.97 ? 339 GLU A OE2 1 
ATOM   133  N N   . ILE A 1 18  ? -8.394  44.398 -0.187  1.00 50.51 ? 340 ILE A N   1 
ATOM   134  C CA  . ILE A 1 18  ? -7.922  45.370 0.799   1.00 50.73 ? 340 ILE A CA  1 
ATOM   135  C C   . ILE A 1 18  ? -6.419  45.606 0.637   1.00 50.72 ? 340 ILE A C   1 
ATOM   136  O O   . ILE A 1 18  ? -5.955  46.745 0.677   1.00 51.19 ? 340 ILE A O   1 
ATOM   137  C CB  . ILE A 1 18  ? -8.229  44.922 2.264   1.00 50.93 ? 340 ILE A CB  1 
ATOM   138  C CG1 . ILE A 1 18  ? -9.690  45.171 2.603   1.00 50.86 ? 340 ILE A CG1 1 
ATOM   139  C CG2 . ILE A 1 18  ? -7.392  45.703 3.273   1.00 51.38 ? 340 ILE A CG2 1 
ATOM   140  N N   . LEU A 1 19  ? -5.663  44.529 0.465   1.00 50.40 ? 341 LEU A N   1 
ATOM   141  C CA  . LEU A 1 19  ? -4.214  44.637 0.374   1.00 50.35 ? 341 LEU A CA  1 
ATOM   142  C C   . LEU A 1 19  ? -3.787  45.412 -0.869  1.00 50.19 ? 341 LEU A C   1 
ATOM   143  O O   . LEU A 1 19  ? -2.766  46.088 -0.850  1.00 50.19 ? 341 LEU A O   1 
ATOM   144  C CB  . LEU A 1 19  ? -3.555  43.249 0.390   1.00 50.33 ? 341 LEU A CB  1 
ATOM   145  C CG  . LEU A 1 19  ? -3.580  42.468 1.712   1.00 50.13 ? 341 LEU A CG  1 
ATOM   146  C CD1 . LEU A 1 19  ? -2.978  41.090 1.521   1.00 49.65 ? 341 LEU A CD1 1 
ATOM   147  C CD2 . LEU A 1 19  ? -2.838  43.224 2.831   1.00 50.24 ? 341 LEU A CD2 1 
ATOM   148  N N   . LYS A 1 20  ? -4.567  45.312 -1.943  1.00 50.03 ? 342 LYS A N   1 
ATOM   149  C CA  . LYS A 1 20  ? -4.236  45.982 -3.210  1.00 49.81 ? 342 LYS A CA  1 
ATOM   150  C C   . LYS A 1 20  ? -4.521  47.484 -3.192  1.00 49.86 ? 342 LYS A C   1 
ATOM   151  O O   . LYS A 1 20  ? -3.836  48.261 -3.857  1.00 50.54 ? 342 LYS A O   1 
ATOM   152  C CB  . LYS A 1 20  ? -5.029  45.365 -4.360  1.00 49.78 ? 342 LYS A CB  1 
ATOM   153  C CG  . LYS A 1 20  ? -4.605  43.970 -4.723  1.00 49.78 ? 342 LYS A CG  1 
ATOM   154  C CD  . LYS A 1 20  ? -5.125  43.578 -6.084  1.00 50.97 ? 342 LYS A CD  1 
ATOM   155  C CE  . LYS A 1 20  ? -6.618  43.573 -6.160  1.00 50.96 ? 342 LYS A CE  1 
ATOM   156  N NZ  . LYS A 1 20  ? -7.046  42.957 -7.443  1.00 51.25 ? 342 LYS A NZ  1 
ATOM   157  N N   . ASP A 1 21  ? -5.550  47.884 -2.459  1.00 49.59 ? 343 ASP A N   1 
ATOM   158  C CA  . ASP A 1 21  ? -5.983  49.270 -2.440  1.00 49.54 ? 343 ASP A CA  1 
ATOM   159  C C   . ASP A 1 21  ? -5.404  49.965 -1.209  1.00 49.85 ? 343 ASP A C   1 
ATOM   160  O O   . ASP A 1 21  ? -5.727  49.600 -0.079  1.00 50.04 ? 343 ASP A O   1 
ATOM   161  C CB  . ASP A 1 21  ? -7.513  49.312 -2.464  1.00 49.27 ? 343 ASP A CB  1 
ATOM   162  C CG  . ASP A 1 21  ? -8.070  50.711 -2.408  1.00 48.29 ? 343 ASP A CG  1 
ATOM   163  O OD1 . ASP A 1 21  ? -7.387  51.642 -1.924  1.00 47.10 ? 343 ASP A OD1 1 
ATOM   164  O OD2 . ASP A 1 21  ? -9.226  50.869 -2.835  1.00 45.56 ? 343 ASP A OD2 1 
ATOM   165  N N   . GLN A 1 22  ? -4.560  50.972 -1.438  1.00 49.95 ? 344 GLN A N   1 
ATOM   166  C CA  . GLN A 1 22  ? -3.801  51.606 -0.359  1.00 50.12 ? 344 GLN A CA  1 
ATOM   167  C C   . GLN A 1 22  ? -4.690  52.358 0.636   1.00 49.99 ? 344 GLN A C   1 
ATOM   168  O O   . GLN A 1 22  ? -4.315  52.517 1.792   1.00 50.02 ? 344 GLN A O   1 
ATOM   169  C CB  . GLN A 1 22  ? -2.726  52.554 -0.918  1.00 50.08 ? 344 GLN A CB  1 
ATOM   170  C CG  . GLN A 1 22  ? -3.281  53.906 -1.368  1.00 50.80 ? 344 GLN A CG  1 
ATOM   171  C CD  . GLN A 1 22  ? -2.252  54.778 -2.049  1.00 50.31 ? 344 GLN A CD  1 
ATOM   172  O OE1 . GLN A 1 22  ? -1.059  54.667 -1.779  1.00 50.65 ? 344 GLN A OE1 1 
ATOM   173  N NE2 . GLN A 1 22  ? -2.711  55.654 -2.936  1.00 50.35 ? 344 GLN A NE2 1 
ATOM   174  N N   . VAL A 1 23  ? -5.853  52.829 0.193   1.00 50.09 ? 345 VAL A N   1 
ATOM   175  C CA  . VAL A 1 23  ? -6.783  53.501 1.098   1.00 50.31 ? 345 VAL A CA  1 
ATOM   176  C C   . VAL A 1 23  ? -7.530  52.483 1.979   1.00 49.94 ? 345 VAL A C   1 
ATOM   177  O O   . VAL A 1 23  ? -7.787  52.756 3.150   1.00 50.10 ? 345 VAL A O   1 
ATOM   178  C CB  . VAL A 1 23  ? -7.782  54.422 0.334   1.00 50.37 ? 345 VAL A CB  1 
ATOM   179  C CG1 . VAL A 1 23  ? -8.860  54.984 1.273   1.00 50.82 ? 345 VAL A CG1 1 
ATOM   180  C CG2 . VAL A 1 23  ? -7.029  55.562 -0.337  1.00 50.78 ? 345 VAL A CG2 1 
ATOM   181  N N   . GLY A 1 24  ? -7.878  51.330 1.409   1.00 49.62 ? 346 GLY A N   1 
ATOM   182  C CA  . GLY A 1 24  ? -8.516  50.253 2.162   1.00 49.53 ? 346 GLY A CA  1 
ATOM   183  C C   . GLY A 1 24  ? -7.535  49.658 3.144   1.00 49.60 ? 346 GLY A C   1 
ATOM   184  O O   . GLY A 1 24  ? -7.882  49.349 4.288   1.00 49.45 ? 346 GLY A O   1 
ATOM   185  N N   . ARG A 1 25  ? -6.293  49.516 2.685   1.00 49.65 ? 347 ARG A N   1 
ATOM   186  C CA  . ARG A 1 25  ? -5.205  48.999 3.500   1.00 49.46 ? 347 ARG A CA  1 
ATOM   187  C C   . ARG A 1 25  ? -4.921  49.908 4.696   1.00 49.41 ? 347 ARG A C   1 
ATOM   188  O O   . ARG A 1 25  ? -4.687  49.421 5.804   1.00 49.04 ? 347 ARG A O   1 
ATOM   189  C CB  . ARG A 1 25  ? -3.951  48.843 2.641   1.00 49.55 ? 347 ARG A CB  1 
ATOM   190  C CG  . ARG A 1 25  ? -2.977  47.806 3.150   1.00 50.06 ? 347 ARG A CG  1 
ATOM   191  C CD  . ARG A 1 25  ? -1.855  47.559 2.158   1.00 49.86 ? 347 ARG A CD  1 
ATOM   192  N NE  . ARG A 1 25  ? -1.117  48.784 1.848   1.00 49.95 ? 347 ARG A NE  1 
ATOM   193  C CZ  . ARG A 1 25  ? -0.905  49.280 0.629   1.00 49.83 ? 347 ARG A CZ  1 
ATOM   194  N NH1 . ARG A 1 25  ? -1.344  48.673 -0.469  1.00 49.40 ? 347 ARG A NH1 1 
ATOM   195  N NH2 . ARG A 1 25  ? -0.222  50.405 0.508   1.00 50.47 ? 347 ARG A NH2 1 
ATOM   196  N N   . ASP A 1 26  ? -4.929  51.221 4.478   1.00 49.57 ? 348 ASP A N   1 
ATOM   197  C CA  A ASP A 1 26  ? -4.734  52.170 5.570   0.50 49.85 ? 348 ASP A CA  1 
ATOM   198  C CA  B ASP A 1 26  ? -4.737  52.173 5.578   0.50 49.97 ? 348 ASP A CA  1 
ATOM   199  C C   . ASP A 1 26  ? -5.873  52.095 6.588   1.00 49.82 ? 348 ASP A C   1 
ATOM   200  O O   . ASP A 1 26  ? -5.655  52.301 7.778   1.00 49.91 ? 348 ASP A O   1 
ATOM   201  C CB  A ASP A 1 26  ? -4.611  53.597 5.029   0.50 49.94 ? 348 ASP A CB  1 
ATOM   202  C CB  B ASP A 1 26  ? -4.631  53.621 5.088   0.50 50.15 ? 348 ASP A CB  1 
ATOM   203  C CG  A ASP A 1 26  ? -3.314  53.832 4.274   0.50 50.23 ? 348 ASP A CG  1 
ATOM   204  C CG  B ASP A 1 26  ? -4.633  54.625 6.246   0.50 50.97 ? 348 ASP A CG  1 
ATOM   205  O OD1 A ASP A 1 26  ? -2.521  52.875 4.096   0.50 50.32 ? 348 ASP A OD1 1 
ATOM   206  O OD1 B ASP A 1 26  ? -5.614  55.399 6.377   0.50 51.72 ? 348 ASP A OD1 1 
ATOM   207  O OD2 A ASP A 1 26  ? -3.099  54.987 3.850   0.50 50.69 ? 348 ASP A OD2 1 
ATOM   208  O OD2 B ASP A 1 26  ? -3.673  54.603 7.052   0.50 51.94 ? 348 ASP A OD2 1 
ATOM   209  N N   . GLN A 1 27  ? -7.081  51.815 6.109   1.00 49.82 ? 349 GLN A N   1 
ATOM   210  C CA  . GLN A 1 27  ? -8.233  51.665 6.990   1.00 49.86 ? 349 GLN A CA  1 
ATOM   211  C C   . GLN A 1 27  ? -8.076  50.396 7.815   1.00 49.15 ? 349 GLN A C   1 
ATOM   212  O O   . GLN A 1 27  ? -8.305  50.403 9.025   1.00 48.31 ? 349 GLN A O   1 
ATOM   213  C CB  . GLN A 1 27  ? -9.546  51.605 6.204   1.00 50.26 ? 349 GLN A CB  1 
ATOM   214  C CG  . GLN A 1 27  ? -10.135 52.966 5.823   1.00 52.75 ? 349 GLN A CG  1 
ATOM   215  C CD  . GLN A 1 27  ? -10.405 53.849 7.029   1.00 54.92 ? 349 GLN A CD  1 
ATOM   216  O OE1 . GLN A 1 27  ? -11.212 53.511 7.898   1.00 56.76 ? 349 GLN A OE1 1 
ATOM   217  N NE2 . GLN A 1 27  ? -9.713  54.985 7.094   1.00 56.98 ? 349 GLN A NE2 1 
ATOM   218  N N   . PHE A 1 28  ? -7.688  49.318 7.134   1.00 48.61 ? 350 PHE A N   1 
ATOM   219  C CA  . PHE A 1 28  ? -7.412  48.036 7.771   1.00 48.31 ? 350 PHE A CA  1 
ATOM   220  C C   . PHE A 1 28  ? -6.335  48.196 8.836   1.00 48.00 ? 350 PHE A C   1 
ATOM   221  O O   . PHE A 1 28  ? -6.449  47.630 9.912   1.00 47.89 ? 350 PHE A O   1 
ATOM   222  C CB  . PHE A 1 28  ? -6.983  46.999 6.721   1.00 47.88 ? 350 PHE A CB  1 
ATOM   223  C CG  . PHE A 1 28  ? -6.850  45.590 7.256   1.00 47.86 ? 350 PHE A CG  1 
ATOM   224  C CD1 . PHE A 1 28  ? -7.896  44.985 7.947   1.00 47.89 ? 350 PHE A CD1 1 
ATOM   225  C CD2 . PHE A 1 28  ? -5.686  44.852 7.037   1.00 48.05 ? 350 PHE A CD2 1 
ATOM   226  C CE1 . PHE A 1 28  ? -7.783  43.684 8.429   1.00 47.15 ? 350 PHE A CE1 1 
ATOM   227  C CE2 . PHE A 1 28  ? -5.570  43.541 7.523   1.00 47.44 ? 350 PHE A CE2 1 
ATOM   228  C CZ  . PHE A 1 28  ? -6.615  42.965 8.217   1.00 46.92 ? 350 PHE A CZ  1 
ATOM   229  N N   . LEU A 1 29  ? -5.310  48.992 8.529   1.00 48.03 ? 351 LEU A N   1 
ATOM   230  C CA  . LEU A 1 29  ? -4.203  49.223 9.442   1.00 47.90 ? 351 LEU A CA  1 
ATOM   231  C C   . LEU A 1 29  ? -4.658  49.926 10.718  1.00 48.12 ? 351 LEU A C   1 
ATOM   232  O O   . LEU A 1 29  ? -4.214  49.575 11.809  1.00 47.99 ? 351 LEU A O   1 
ATOM   233  C CB  . LEU A 1 29  ? -3.104  50.043 8.759   1.00 47.51 ? 351 LEU A CB  1 
ATOM   234  C CG  . LEU A 1 29  ? -1.868  50.366 9.603   1.00 47.96 ? 351 LEU A CG  1 
ATOM   235  C CD1 . LEU A 1 29  ? -1.116  49.097 9.980   1.00 47.35 ? 351 LEU A CD1 1 
ATOM   236  C CD2 . LEU A 1 29  ? -0.943  51.342 8.888   1.00 48.22 ? 351 LEU A CD2 1 
ATOM   237  N N   . ARG A 1 30  ? -5.526  50.926 10.578  1.00 48.36 ? 352 ARG A N   1 
ATOM   238  C CA  . ARG A 1 30  ? -6.074  51.630 11.748  1.00 48.84 ? 352 ARG A CA  1 
ATOM   239  C C   . ARG A 1 30  ? -6.902  50.673 12.615  1.00 48.03 ? 352 ARG A C   1 
ATOM   240  O O   . ARG A 1 30  ? -6.882  50.764 13.840  1.00 47.80 ? 352 ARG A O   1 
ATOM   241  C CB  . ARG A 1 30  ? -6.898  52.851 11.314  1.00 48.98 ? 352 ARG A CB  1 
ATOM   242  C CG  . ARG A 1 30  ? -6.037  53.959 10.681  1.00 50.31 ? 352 ARG A CG  1 
ATOM   243  C CD  . ARG A 1 30  ? -6.878  55.071 10.059  1.00 50.64 ? 352 ARG A CD  1 
ATOM   244  N NE  . ARG A 1 30  ? -6.081  55.952 9.202   1.00 52.46 ? 352 ARG A NE  1 
ATOM   245  N N   . PHE A 1 31  ? -7.605  49.745 11.970  1.00 47.81 ? 353 PHE A N   1 
ATOM   246  C CA  . PHE A 1 31  ? -8.318  48.681 12.675  1.00 47.37 ? 353 PHE A CA  1 
ATOM   247  C C   . PHE A 1 31  ? -7.355  47.760 13.417  1.00 47.44 ? 353 PHE A C   1 
ATOM   248  O O   . PHE A 1 31  ? -7.576  47.437 14.583  1.00 47.70 ? 353 PHE A O   1 
ATOM   249  C CB  . PHE A 1 31  ? -9.166  47.858 11.706  1.00 47.29 ? 353 PHE A CB  1 
ATOM   250  C CG  . PHE A 1 31  ? -9.852  46.677 12.352  1.00 46.99 ? 353 PHE A CG  1 
ATOM   251  C CD1 . PHE A 1 31  ? -10.915 46.872 13.228  1.00 47.19 ? 353 PHE A CD1 1 
ATOM   252  C CD2 . PHE A 1 31  ? -9.436  45.380 12.080  1.00 46.68 ? 353 PHE A CD2 1 
ATOM   253  C CE1 . PHE A 1 31  ? -11.555 45.791 13.826  1.00 47.09 ? 353 PHE A CE1 1 
ATOM   254  C CE2 . PHE A 1 31  ? -10.061 44.294 12.675  1.00 46.52 ? 353 PHE A CE2 1 
ATOM   255  C CZ  . PHE A 1 31  ? -11.124 44.498 13.551  1.00 46.97 ? 353 PHE A CZ  1 
ATOM   256  N N   . LEU A 1 32  ? -6.293  47.322 12.746  1.00 47.28 ? 354 LEU A N   1 
ATOM   257  C CA  . LEU A 1 32  ? -5.312  46.463 13.399  1.00 47.07 ? 354 LEU A CA  1 
ATOM   258  C C   . LEU A 1 32  ? -4.664  47.187 14.579  1.00 47.07 ? 354 LEU A C   1 
ATOM   259  O O   . LEU A 1 32  ? -4.389  46.576 15.599  1.00 46.60 ? 354 LEU A O   1 
ATOM   260  C CB  . LEU A 1 32  ? -4.244  45.984 12.408  1.00 47.29 ? 354 LEU A CB  1 
ATOM   261  C CG  . LEU A 1 32  ? -4.699  45.127 11.220  1.00 46.93 ? 354 LEU A CG  1 
ATOM   262  C CD1 . LEU A 1 32  ? -3.491  44.551 10.484  1.00 46.03 ? 354 LEU A CD1 1 
ATOM   263  C CD2 . LEU A 1 32  ? -5.660  44.006 11.650  1.00 46.18 ? 354 LEU A CD2 1 
ATOM   264  N N   . GLU A 1 33  ? -4.440  48.491 14.451  1.00 47.42 ? 355 GLU A N   1 
ATOM   265  C CA  . GLU A 1 33  ? -3.895  49.264 15.565  1.00 48.09 ? 355 GLU A CA  1 
ATOM   266  C C   . GLU A 1 33  ? -4.800  49.235 16.802  1.00 48.13 ? 355 GLU A C   1 
ATOM   267  O O   . GLU A 1 33  ? -4.305  49.101 17.919  1.00 47.88 ? 355 GLU A O   1 
ATOM   268  C CB  . GLU A 1 33  ? -3.598  50.699 15.138  1.00 48.56 ? 355 GLU A CB  1 
ATOM   269  C CG  . GLU A 1 33  ? -2.348  50.799 14.285  1.00 50.10 ? 355 GLU A CG  1 
ATOM   270  C CD  . GLU A 1 33  ? -2.157  52.164 13.663  1.00 52.37 ? 355 GLU A CD  1 
ATOM   271  O OE1 . GLU A 1 33  ? -3.126  52.960 13.639  1.00 54.87 ? 355 GLU A OE1 1 
ATOM   272  O OE2 . GLU A 1 33  ? -1.028  52.443 13.196  1.00 54.39 ? 355 GLU A OE2 1 
ATOM   273  N N   . SER A 1 34  ? -6.115  49.326 16.599  1.00 48.21 ? 356 SER A N   1 
ATOM   274  C CA  . SER A 1 34  ? -7.076  49.203 17.702  1.00 48.43 ? 356 SER A CA  1 
ATOM   275  C C   . SER A 1 34  ? -7.155  47.771 18.238  1.00 48.56 ? 356 SER A C   1 
ATOM   276  O O   . SER A 1 34  ? -7.571  47.563 19.367  1.00 48.99 ? 356 SER A O   1 
ATOM   277  C CB  . SER A 1 34  ? -8.465  49.673 17.267  1.00 48.49 ? 356 SER A CB  1 
ATOM   278  O OG  . SER A 1 34  ? -9.050  48.782 16.331  1.00 48.66 ? 356 SER A OG  1 
ATOM   279  N N   . GLU A 1 35  ? -6.768  46.796 17.417  1.00 48.23 ? 357 GLU A N   1 
ATOM   280  C CA  . GLU A 1 35  ? -6.679  45.388 17.815  1.00 47.87 ? 357 GLU A CA  1 
ATOM   281  C C   . GLU A 1 35  ? -5.328  45.021 18.428  1.00 47.45 ? 357 GLU A C   1 
ATOM   282  O O   . GLU A 1 35  ? -5.145  43.892 18.874  1.00 46.94 ? 357 GLU A O   1 
ATOM   283  C CB  . GLU A 1 35  ? -6.863  44.496 16.585  1.00 48.20 ? 357 GLU A CB  1 
ATOM   284  C CG  . GLU A 1 35  ? -8.198  44.642 15.884  1.00 49.43 ? 357 GLU A CG  1 
ATOM   285  C CD  . GLU A 1 35  ? -9.193  43.604 16.327  1.00 49.97 ? 357 GLU A CD  1 
ATOM   286  O OE1 . GLU A 1 35  ? -9.001  42.418 15.973  1.00 49.94 ? 357 GLU A OE1 1 
ATOM   287  O OE2 . GLU A 1 35  ? -10.159 43.974 17.031  1.00 51.37 ? 357 GLU A OE2 1 
ATOM   288  N N   . PHE A 1 36  ? -4.379  45.956 18.425  1.00 46.96 ? 358 PHE A N   1 
ATOM   289  C CA  . PHE A 1 36  ? -2.974  45.662 18.733  1.00 46.65 ? 358 PHE A CA  1 
ATOM   290  C C   . PHE A 1 36  ? -2.419  44.456 17.964  1.00 46.19 ? 358 PHE A C   1 
ATOM   291  O O   . PHE A 1 36  ? -1.829  43.555 18.545  1.00 45.54 ? 358 PHE A O   1 
ATOM   292  C CB  . PHE A 1 36  ? -2.757  45.516 20.239  1.00 46.68 ? 358 PHE A CB  1 
ATOM   293  C CG  . PHE A 1 36  ? -2.957  46.797 20.991  1.00 46.91 ? 358 PHE A CG  1 
ATOM   294  C CD1 . PHE A 1 36  ? -1.869  47.592 21.337  1.00 46.69 ? 358 PHE A CD1 1 
ATOM   295  C CD2 . PHE A 1 36  ? -4.232  47.219 21.335  1.00 47.18 ? 358 PHE A CD2 1 
ATOM   296  C CE1 . PHE A 1 36  ? -2.049  48.782 22.018  1.00 46.83 ? 358 PHE A CE1 1 
ATOM   297  C CE2 . PHE A 1 36  ? -4.426  48.416 22.023  1.00 47.56 ? 358 PHE A CE2 1 
ATOM   298  C CZ  . PHE A 1 36  ? -3.331  49.200 22.359  1.00 46.82 ? 358 PHE A CZ  1 
ATOM   299  N N   . SER A 1 37  ? -2.619  44.466 16.647  1.00 46.08 ? 359 SER A N   1 
ATOM   300  C CA  . SER A 1 37  ? -2.046  43.449 15.753  1.00 45.89 ? 359 SER A CA  1 
ATOM   301  C C   . SER A 1 37  ? -1.477  44.047 14.465  1.00 45.43 ? 359 SER A C   1 
ATOM   302  O O   . SER A 1 37  ? -1.272  43.328 13.485  1.00 45.26 ? 359 SER A O   1 
ATOM   303  C CB  . SER A 1 37  ? -3.106  42.402 15.402  1.00 46.07 ? 359 SER A CB  1 
ATOM   304  O OG  . SER A 1 37  ? -4.085  42.973 14.540  1.00 47.24 ? 359 SER A OG  1 
ATOM   305  N N   . SER A 1 38  ? -1.175  45.348 14.481  1.00 44.80 ? 360 SER A N   1 
ATOM   306  C CA  . SER A 1 38  ? -0.690  46.051 13.303  1.00 44.39 ? 360 SER A CA  1 
ATOM   307  C C   . SER A 1 38  ? 0.699   45.597 12.851  1.00 44.53 ? 360 SER A C   1 
ATOM   308  O O   . SER A 1 38  ? 1.085   45.842 11.709  1.00 43.72 ? 360 SER A O   1 
ATOM   309  C CB  . SER A 1 38  ? -0.672  47.572 13.535  1.00 44.33 ? 360 SER A CB  1 
ATOM   310  O OG  . SER A 1 38  ? 0.188   47.939 14.606  1.00 44.05 ? 360 SER A OG  1 
ATOM   311  N N   . GLU A 1 39  ? 1.445   44.963 13.746  1.00 44.70 ? 361 GLU A N   1 
ATOM   312  C CA  . GLU A 1 39  ? 2.777   44.463 13.415  1.00 44.83 ? 361 GLU A CA  1 
ATOM   313  C C   . GLU A 1 39  ? 2.720   43.437 12.279  1.00 45.03 ? 361 GLU A C   1 
ATOM   314  O O   . GLU A 1 39  ? 3.661   43.328 11.501  1.00 44.91 ? 361 GLU A O   1 
ATOM   315  C CB  . GLU A 1 39  ? 3.458   43.872 14.655  1.00 44.68 ? 361 GLU A CB  1 
ATOM   316  C CG  . GLU A 1 39  ? 2.848   42.572 15.196  1.00 45.04 ? 361 GLU A CG  1 
ATOM   317  C CD  . GLU A 1 39  ? 1.679   42.759 16.157  1.00 45.37 ? 361 GLU A CD  1 
ATOM   318  O OE1 . GLU A 1 39  ? 1.189   43.893 16.349  1.00 43.66 ? 361 GLU A OE1 1 
ATOM   319  O OE2 . GLU A 1 39  ? 1.255   41.739 16.735  1.00 45.17 ? 361 GLU A OE2 1 
ATOM   320  N N   . ASN A 1 40  ? 1.607   42.696 12.192  1.00 45.44 ? 362 ASN A N   1 
ATOM   321  C CA  . ASN A 1 40  ? 1.395   41.710 11.132  1.00 45.02 ? 362 ASN A CA  1 
ATOM   322  C C   . ASN A 1 40  ? 1.363   42.365 9.762   1.00 45.14 ? 362 ASN A C   1 
ATOM   323  O O   . ASN A 1 40  ? 2.012   41.903 8.831   1.00 44.99 ? 362 ASN A O   1 
ATOM   324  C CB  . ASN A 1 40  ? 0.085   40.940 11.351  1.00 45.11 ? 362 ASN A CB  1 
ATOM   325  C CG  . ASN A 1 40  ? 0.122   40.047 12.565  1.00 44.45 ? 362 ASN A CG  1 
ATOM   326  O OD1 . ASN A 1 40  ? 1.181   39.572 12.968  1.00 44.79 ? 362 ASN A OD1 1 
ATOM   327  N ND2 . ASN A 1 40  ? -1.049  39.798 13.157  1.00 44.32 ? 362 ASN A ND2 1 
ATOM   328  N N   . LEU A 1 41  ? 0.608   43.451 9.632   1.00 45.35 ? 363 LEU A N   1 
ATOM   329  C CA  . LEU A 1 41  ? 0.533   44.138 8.356   1.00 45.52 ? 363 LEU A CA  1 
ATOM   330  C C   . LEU A 1 41  ? 1.828   44.861 8.027   1.00 45.24 ? 363 LEU A C   1 
ATOM   331  O O   . LEU A 1 41  ? 2.242   44.887 6.873   1.00 45.47 ? 363 LEU A O   1 
ATOM   332  C CB  . LEU A 1 41  ? -0.643  45.116 8.310   1.00 45.64 ? 363 LEU A CB  1 
ATOM   333  C CG  . LEU A 1 41  ? -0.919  45.784 6.962   1.00 46.14 ? 363 LEU A CG  1 
ATOM   334  C CD1 . LEU A 1 41  ? -0.986  44.752 5.838   1.00 47.16 ? 363 LEU A CD1 1 
ATOM   335  C CD2 . LEU A 1 41  ? -2.225  46.604 7.024   1.00 46.23 ? 363 LEU A CD2 1 
ATOM   336  N N   . ARG A 1 42  ? 2.456   45.474 9.026   1.00 45.13 ? 364 ARG A N   1 
ATOM   337  C CA  A ARG A 1 42  ? 3.696   46.206 8.787   0.50 45.15 ? 364 ARG A CA  1 
ATOM   338  C CA  B ARG A 1 42  ? 3.701   46.203 8.800   0.50 44.92 ? 364 ARG A CA  1 
ATOM   339  C C   . ARG A 1 42  ? 4.804   45.240 8.364   1.00 44.92 ? 364 ARG A C   1 
ATOM   340  O O   . ARG A 1 42  ? 5.640   45.569 7.516   1.00 44.91 ? 364 ARG A O   1 
ATOM   341  C CB  A ARG A 1 42  ? 4.083   47.040 10.011  0.50 45.32 ? 364 ARG A CB  1 
ATOM   342  C CB  B ARG A 1 42  ? 4.102   46.989 10.049  0.50 45.09 ? 364 ARG A CB  1 
ATOM   343  C CG  A ARG A 1 42  ? 3.120   48.211 10.246  0.50 45.42 ? 364 ARG A CG  1 
ATOM   344  C CG  B ARG A 1 42  ? 3.157   48.163 10.350  0.50 44.78 ? 364 ARG A CG  1 
ATOM   345  C CD  A ARG A 1 42  ? 3.577   49.161 11.342  0.50 45.60 ? 364 ARG A CD  1 
ATOM   346  C CD  B ARG A 1 42  ? 3.643   49.042 11.497  0.50 44.54 ? 364 ARG A CD  1 
ATOM   347  N NE  A ARG A 1 42  ? 3.225   48.674 12.675  0.50 46.41 ? 364 ARG A NE  1 
ATOM   348  N NE  B ARG A 1 42  ? 5.064   49.375 11.369  0.50 44.07 ? 364 ARG A NE  1 
ATOM   349  C CZ  A ARG A 1 42  ? 4.035   47.993 13.488  0.50 46.61 ? 364 ARG A CZ  1 
ATOM   350  C CZ  B ARG A 1 42  ? 6.015   49.079 12.254  0.50 43.82 ? 364 ARG A CZ  1 
ATOM   351  N NH1 A ARG A 1 42  ? 5.277   47.683 13.130  0.50 47.14 ? 364 ARG A NH1 1 
ATOM   352  N NH1 B ARG A 1 42  ? 7.269   49.434 12.004  0.50 44.30 ? 364 ARG A NH1 1 
ATOM   353  N NH2 A ARG A 1 42  ? 3.591   47.610 14.678  0.50 46.38 ? 364 ARG A NH2 1 
ATOM   354  N NH2 B ARG A 1 42  ? 5.734   48.447 13.391  0.50 44.14 ? 364 ARG A NH2 1 
ATOM   355  N N   . PHE A 1 43  ? 4.794   44.037 8.926   1.00 44.71 ? 365 PHE A N   1 
ATOM   356  C CA  . PHE A 1 43  ? 5.771   43.031 8.528   1.00 44.46 ? 365 PHE A CA  1 
ATOM   357  C C   . PHE A 1 43  ? 5.530   42.614 7.081   1.00 44.51 ? 365 PHE A C   1 
ATOM   358  O O   . PHE A 1 43  ? 6.431   42.618 6.266   1.00 44.39 ? 365 PHE A O   1 
ATOM   359  C CB  . PHE A 1 43  ? 5.703   41.819 9.446   1.00 44.34 ? 365 PHE A CB  1 
ATOM   360  C CG  . PHE A 1 43  ? 6.601   40.683 9.015   1.00 43.92 ? 365 PHE A CG  1 
ATOM   361  C CD1 . PHE A 1 43  ? 7.983   40.792 9.126   1.00 43.69 ? 365 PHE A CD1 1 
ATOM   362  C CD2 . PHE A 1 43  ? 6.063   39.509 8.504   1.00 43.00 ? 365 PHE A CD2 1 
ATOM   363  C CE1 . PHE A 1 43  ? 8.809   39.747 8.739   1.00 44.01 ? 365 PHE A CE1 1 
ATOM   364  C CE2 . PHE A 1 43  ? 6.885   38.466 8.113   1.00 43.49 ? 365 PHE A CE2 1 
ATOM   365  C CZ  . PHE A 1 43  ? 8.256   38.585 8.233   1.00 43.11 ? 365 PHE A CZ  1 
ATOM   366  N N   . TRP A 1 44  ? 4.293   42.263 6.773   1.00 45.24 ? 366 TRP A N   1 
ATOM   367  C CA  . TRP A 1 44  ? 3.906   41.881 5.422   1.00 45.32 ? 366 TRP A CA  1 
ATOM   368  C C   . TRP A 1 44  ? 4.323   42.976 4.413   1.00 45.39 ? 366 TRP A C   1 
ATOM   369  O O   . TRP A 1 44  ? 4.937   42.691 3.383   1.00 44.87 ? 366 TRP A O   1 
ATOM   370  C CB  . TRP A 1 44  ? 2.401   41.614 5.388   1.00 45.68 ? 366 TRP A CB  1 
ATOM   371  C CG  . TRP A 1 44  ? 1.931   41.006 4.116   1.00 46.12 ? 366 TRP A CG  1 
ATOM   372  C CD1 . TRP A 1 44  ? 1.833   39.683 3.838   1.00 45.78 ? 366 TRP A CD1 1 
ATOM   373  C CD2 . TRP A 1 44  ? 1.508   41.702 2.935   1.00 45.79 ? 366 TRP A CD2 1 
ATOM   374  N NE1 . TRP A 1 44  ? 1.385   39.502 2.555   1.00 46.25 ? 366 TRP A NE1 1 
ATOM   375  C CE2 . TRP A 1 44  ? 1.171   40.725 1.977   1.00 46.24 ? 366 TRP A CE2 1 
ATOM   376  C CE3 . TRP A 1 44  ? 1.404   43.054 2.587   1.00 46.07 ? 366 TRP A CE3 1 
ATOM   377  C CZ2 . TRP A 1 44  ? 0.719   41.053 0.697   1.00 45.63 ? 366 TRP A CZ2 1 
ATOM   378  C CZ3 . TRP A 1 44  ? 0.951   43.382 1.327   1.00 46.09 ? 366 TRP A CZ3 1 
ATOM   379  C CH2 . TRP A 1 44  ? 0.614   42.382 0.389   1.00 45.90 ? 366 TRP A CH2 1 
ATOM   380  N N   . LEU A 1 45  ? 4.008   44.228 4.735   1.00 44.77 ? 367 LEU A N   1 
ATOM   381  C CA  . LEU A 1 45  ? 4.370   45.344 3.885   1.00 44.66 ? 367 LEU A CA  1 
ATOM   382  C C   . LEU A 1 45  ? 5.875   45.493 3.748   1.00 44.03 ? 367 LEU A C   1 
ATOM   383  O O   . LEU A 1 45  ? 6.365   45.781 2.657   1.00 43.57 ? 367 LEU A O   1 
ATOM   384  C CB  . LEU A 1 45  ? 3.767   46.647 4.410   1.00 44.83 ? 367 LEU A CB  1 
ATOM   385  C CG  . LEU A 1 45  ? 2.251   46.770 4.209   1.00 45.90 ? 367 LEU A CG  1 
ATOM   386  C CD1 . LEU A 1 45  ? 1.736   47.964 4.978   1.00 46.43 ? 367 LEU A CD1 1 
ATOM   387  C CD2 . LEU A 1 45  ? 1.904   46.890 2.710   1.00 47.05 ? 367 LEU A CD2 1 
ATOM   388  N N   . ALA A 1 46  ? 6.600   45.304 4.851   1.00 43.97 ? 368 ALA A N   1 
ATOM   389  C CA  . ALA A 1 46  ? 8.071   45.415 4.838   1.00 43.86 ? 368 ALA A CA  1 
ATOM   390  C C   . ALA A 1 46  ? 8.695   44.365 3.931   1.00 43.89 ? 368 ALA A C   1 
ATOM   391  O O   . ALA A 1 46  ? 9.627   44.650 3.193   1.00 44.05 ? 368 ALA A O   1 
ATOM   392  C CB  . ALA A 1 46  ? 8.637   45.283 6.250   1.00 43.82 ? 368 ALA A CB  1 
ATOM   393  N N   . VAL A 1 47  ? 8.178   43.147 4.000   1.00 44.12 ? 369 VAL A N   1 
ATOM   394  C CA  . VAL A 1 47  ? 8.657   42.053 3.160   1.00 44.48 ? 369 VAL A CA  1 
ATOM   395  C C   . VAL A 1 47  ? 8.317   42.269 1.672   1.00 45.16 ? 369 VAL A C   1 
ATOM   396  O O   . VAL A 1 47  ? 9.148   41.972 0.821   1.00 44.94 ? 369 VAL A O   1 
ATOM   397  C CB  . VAL A 1 47  ? 8.126   40.692 3.645   1.00 44.29 ? 369 VAL A CB  1 
ATOM   398  C CG1 . VAL A 1 47  ? 8.561   39.580 2.700   1.00 44.83 ? 369 VAL A CG1 1 
ATOM   399  C CG2 . VAL A 1 47  ? 8.612   40.415 5.048   1.00 43.55 ? 369 VAL A CG2 1 
ATOM   400  N N   . GLN A 1 48  ? 7.121   42.787 1.359   1.00 45.29 ? 370 GLN A N   1 
ATOM   401  C CA  . GLN A 1 48  ? 6.796   43.174 -0.020  1.00 46.04 ? 370 GLN A CA  1 
ATOM   402  C C   . GLN A 1 48  ? 7.761   44.220 -0.563  1.00 46.63 ? 370 GLN A C   1 
ATOM   403  O O   . GLN A 1 48  ? 8.169   44.158 -1.727  1.00 46.89 ? 370 GLN A O   1 
ATOM   404  C CB  . GLN A 1 48  ? 5.380   43.743 -0.138  1.00 45.95 ? 370 GLN A CB  1 
ATOM   405  C CG  . GLN A 1 48  ? 4.290   42.717 -0.096  1.00 46.75 ? 370 GLN A CG  1 
ATOM   406  C CD  . GLN A 1 48  ? 4.414   41.659 -1.180  1.00 46.80 ? 370 GLN A CD  1 
ATOM   407  O OE1 . GLN A 1 48  ? 4.841   40.532 -0.909  1.00 45.27 ? 370 GLN A OE1 1 
ATOM   408  N NE2 . GLN A 1 48  ? 4.031   42.013 -2.411  1.00 47.44 ? 370 GLN A NE2 1 
ATOM   409  N N   . ASP A 1 49  ? 8.097   45.204 0.266   1.00 47.10 ? 371 ASP A N   1 
ATOM   410  C CA  . ASP A 1 49  ? 9.055   46.235 -0.128  1.00 47.46 ? 371 ASP A CA  1 
ATOM   411  C C   . ASP A 1 49  ? 10.453  45.639 -0.362  1.00 47.15 ? 371 ASP A C   1 
ATOM   412  O O   . ASP A 1 49  ? 11.159  46.042 -1.266  1.00 47.81 ? 371 ASP A O   1 
ATOM   413  C CB  . ASP A 1 49  ? 9.107   47.322 0.934   1.00 47.87 ? 371 ASP A CB  1 
ATOM   414  C CG  . ASP A 1 49  ? 10.004  48.455 0.545   1.00 50.30 ? 371 ASP A CG  1 
ATOM   415  O OD1 . ASP A 1 49  ? 9.586   49.270 -0.316  1.00 52.74 ? 371 ASP A OD1 1 
ATOM   416  O OD2 . ASP A 1 49  ? 11.143  48.511 1.087   1.00 55.34 ? 371 ASP A OD2 1 
ATOM   417  N N   . LEU A 1 50  ? 10.840  44.668 0.450   1.00 47.42 ? 372 LEU A N   1 
ATOM   418  C CA  . LEU A 1 50  ? 12.128  43.988 0.289   1.00 47.10 ? 372 LEU A CA  1 
ATOM   419  C C   . LEU A 1 50  ? 12.274  43.429 -1.124  1.00 47.00 ? 372 LEU A C   1 
ATOM   420  O O   . LEU A 1 50  ? 13.325  43.558 -1.741  1.00 46.70 ? 372 LEU A O   1 
ATOM   421  C CB  . LEU A 1 50  ? 12.275  42.867 1.329   1.00 47.24 ? 372 LEU A CB  1 
ATOM   422  C CG  . LEU A 1 50  ? 13.511  41.962 1.194   1.00 46.29 ? 372 LEU A CG  1 
ATOM   423  C CD1 . LEU A 1 50  ? 14.789  42.731 1.489   1.00 46.87 ? 372 LEU A CD1 1 
ATOM   424  C CD2 . LEU A 1 50  ? 13.375  40.773 2.102   1.00 46.72 ? 372 LEU A CD2 1 
ATOM   425  N N   . LYS A 1 51  ? 11.206  42.825 -1.634  1.00 47.19 ? 373 LYS A N   1 
ATOM   426  C CA  . LYS A 1 51  ? 11.214  42.208 -2.964  1.00 47.32 ? 373 LYS A CA  1 
ATOM   427  C C   . LYS A 1 51  ? 11.488  43.196 -4.088  1.00 47.66 ? 373 LYS A C   1 
ATOM   428  O O   . LYS A 1 51  ? 11.951  42.802 -5.150  1.00 47.40 ? 373 LYS A O   1 
ATOM   429  C CB  . LYS A 1 51  ? 9.895   41.479 -3.230  1.00 47.42 ? 373 LYS A CB  1 
ATOM   430  C CG  . LYS A 1 51  ? 9.626   40.300 -2.299  1.00 47.42 ? 373 LYS A CG  1 
ATOM   431  C CD  . LYS A 1 51  ? 8.189   39.844 -2.442  1.00 47.26 ? 373 LYS A CD  1 
ATOM   432  C CE  . LYS A 1 51  ? 7.808   38.879 -1.348  1.00 46.70 ? 373 LYS A CE  1 
ATOM   433  N NZ  . LYS A 1 51  ? 6.398   38.448 -1.495  1.00 46.64 ? 373 LYS A NZ  1 
ATOM   434  N N   . LYS A 1 52  ? 11.218  44.476 -3.843  1.00 48.22 ? 374 LYS A N   1 
ATOM   435  C CA  . LYS A 1 52  ? 11.427  45.525 -4.835  1.00 48.93 ? 374 LYS A CA  1 
ATOM   436  C C   . LYS A 1 52  ? 12.784  46.242 -4.709  1.00 49.61 ? 374 LYS A C   1 
ATOM   437  O O   . LYS A 1 52  ? 13.050  47.172 -5.465  1.00 50.11 ? 374 LYS A O   1 
ATOM   438  C CB  . LYS A 1 52  ? 10.286  46.549 -4.743  1.00 48.79 ? 374 LYS A CB  1 
ATOM   439  C CG  . LYS A 1 52  ? 8.902   45.922 -4.642  1.00 48.57 ? 374 LYS A CG  1 
ATOM   440  C CD  . LYS A 1 52  ? 7.792   46.952 -4.795  1.00 49.38 ? 374 LYS A CD  1 
ATOM   441  C CE  . LYS A 1 52  ? 6.422   46.421 -4.368  1.00 50.56 ? 374 LYS A CE  1 
ATOM   442  N NZ  . LYS A 1 52  ? 6.376   44.931 -4.121  1.00 54.26 ? 374 LYS A NZ  1 
ATOM   443  N N   . GLN A 1 53  ? 13.645  45.812 -3.781  1.00 50.34 ? 375 GLN A N   1 
ATOM   444  C CA  . GLN A 1 53  ? 14.899  46.536 -3.474  1.00 50.61 ? 375 GLN A CA  1 
ATOM   445  C C   . GLN A 1 53  ? 16.031  46.235 -4.437  1.00 50.73 ? 375 GLN A C   1 
ATOM   446  O O   . GLN A 1 53  ? 16.196  45.086 -4.831  1.00 50.65 ? 375 GLN A O   1 
ATOM   447  C CB  . GLN A 1 53  ? 15.407  46.169 -2.073  1.00 51.02 ? 375 GLN A CB  1 
ATOM   448  C CG  . GLN A 1 53  ? 14.563  46.692 -0.936  1.00 52.30 ? 375 GLN A CG  1 
ATOM   449  C CD  . GLN A 1 53  ? 14.436  48.182 -0.978  1.00 54.54 ? 375 GLN A CD  1 
ATOM   450  O OE1 . GLN A 1 53  ? 13.344  48.719 -1.205  1.00 57.75 ? 375 GLN A OE1 1 
ATOM   451  N NE2 . GLN A 1 53  ? 15.560  48.873 -0.811  1.00 56.77 ? 375 GLN A NE2 1 
ATOM   452  N N   . PRO A 1 54  ? 16.858  47.253 -4.768  1.00 50.74 ? 376 PRO A N   1 
ATOM   453  C CA  . PRO A 1 54  ? 18.072  46.983 -5.528  1.00 51.08 ? 376 PRO A CA  1 
ATOM   454  C C   . PRO A 1 54  ? 18.945  45.964 -4.795  1.00 51.43 ? 376 PRO A C   1 
ATOM   455  O O   . PRO A 1 54  ? 19.013  45.990 -3.571  1.00 51.26 ? 376 PRO A O   1 
ATOM   456  C CB  . PRO A 1 54  ? 18.773  48.344 -5.577  1.00 51.04 ? 376 PRO A CB  1 
ATOM   457  C CG  . PRO A 1 54  ? 17.710  49.346 -5.337  1.00 51.13 ? 376 PRO A CG  1 
ATOM   458  C CD  . PRO A 1 54  ? 16.723  48.682 -4.434  1.00 50.76 ? 376 PRO A CD  1 
ATOM   459  N N   . LEU A 1 55  ? 19.596  45.078 -5.539  1.00 52.09 ? 377 LEU A N   1 
ATOM   460  C CA  . LEU A 1 55  ? 20.414  44.004 -4.957  1.00 53.05 ? 377 LEU A CA  1 
ATOM   461  C C   . LEU A 1 55  ? 21.337  44.468 -3.824  1.00 53.36 ? 377 LEU A C   1 
ATOM   462  O O   . LEU A 1 55  ? 21.452  43.824 -2.790  1.00 53.58 ? 377 LEU A O   1 
ATOM   463  C CB  . LEU A 1 55  ? 21.283  43.358 -6.042  1.00 53.23 ? 377 LEU A CB  1 
ATOM   464  C CG  . LEU A 1 55  ? 21.552  41.845 -6.001  1.00 55.06 ? 377 LEU A CG  1 
ATOM   465  C CD1 . LEU A 1 55  ? 22.930  41.549 -6.616  1.00 55.66 ? 377 LEU A CD1 1 
ATOM   466  C CD2 . LEU A 1 55  ? 21.461  41.236 -4.612  1.00 56.09 ? 377 LEU A CD2 1 
ATOM   467  N N   . GLN A 1 56  ? 21.998  45.592 -4.032  1.00 53.97 ? 378 GLN A N   1 
ATOM   468  C CA  . GLN A 1 56  ? 22.990  46.078 -3.081  1.00 54.58 ? 378 GLN A CA  1 
ATOM   469  C C   . GLN A 1 56  ? 22.391  46.475 -1.727  1.00 54.25 ? 378 GLN A C   1 
ATOM   470  O O   . GLN A 1 56  ? 23.128  46.653 -0.760  1.00 54.61 ? 378 GLN A O   1 
ATOM   471  C CB  . GLN A 1 56  ? 23.750  47.272 -3.677  1.00 54.90 ? 378 GLN A CB  1 
ATOM   472  C CG  . GLN A 1 56  ? 22.890  48.526 -3.940  1.00 57.06 ? 378 GLN A CG  1 
ATOM   473  C CD  . GLN A 1 56  ? 22.456  48.707 -5.408  1.00 60.27 ? 378 GLN A CD  1 
ATOM   474  O OE1 . GLN A 1 56  ? 22.403  47.746 -6.196  1.00 61.26 ? 378 GLN A OE1 1 
ATOM   475  N NE2 . GLN A 1 56  ? 22.139  49.957 -5.774  1.00 59.90 ? 378 GLN A NE2 1 
ATOM   476  N N   . ASP A 1 57  ? 21.069  46.656 -1.678  1.00 53.58 ? 379 ASP A N   1 
ATOM   477  C CA  . ASP A 1 57  ? 20.367  47.076 -0.470  1.00 52.93 ? 379 ASP A CA  1 
ATOM   478  C C   . ASP A 1 57  ? 19.677  45.934 0.287   1.00 51.86 ? 379 ASP A C   1 
ATOM   479  O O   . ASP A 1 57  ? 19.154  46.139 1.372   1.00 51.52 ? 379 ASP A O   1 
ATOM   480  C CB  . ASP A 1 57  ? 19.313  48.118 -0.846  1.00 53.42 ? 379 ASP A CB  1 
ATOM   481  C CG  . ASP A 1 57  ? 19.921  49.403 -1.372  1.00 55.18 ? 379 ASP A CG  1 
ATOM   482  O OD1 . ASP A 1 57  ? 19.202  50.151 -2.073  1.00 58.60 ? 379 ASP A OD1 1 
ATOM   483  O OD2 . ASP A 1 57  ? 21.106  49.683 -1.081  1.00 57.15 ? 379 ASP A OD2 1 
ATOM   484  N N   . VAL A 1 58  ? 19.675  44.737 -0.278  1.00 50.86 ? 380 VAL A N   1 
ATOM   485  C CA  . VAL A 1 58  ? 18.894  43.639 0.274   1.00 50.36 ? 380 VAL A CA  1 
ATOM   486  C C   . VAL A 1 58  ? 19.401  43.188 1.642   1.00 50.06 ? 380 VAL A C   1 
ATOM   487  O O   . VAL A 1 58  ? 18.620  43.066 2.577   1.00 49.52 ? 380 VAL A O   1 
ATOM   488  C CB  . VAL A 1 58  ? 18.853  42.442 -0.704  1.00 50.21 ? 380 VAL A CB  1 
ATOM   489  C CG1 . VAL A 1 58  ? 18.305  41.194 -0.028  1.00 50.08 ? 380 VAL A CG1 1 
ATOM   490  C CG2 . VAL A 1 58  ? 18.016  42.806 -1.910  1.00 50.54 ? 380 VAL A CG2 1 
ATOM   491  N N   . ALA A 1 59  ? 20.706  42.955 1.750   1.00 50.08 ? 381 ALA A N   1 
ATOM   492  C CA  . ALA A 1 59  ? 21.310  42.399 2.966   1.00 49.85 ? 381 ALA A CA  1 
ATOM   493  C C   . ALA A 1 59  ? 21.006  43.261 4.175   1.00 49.75 ? 381 ALA A C   1 
ATOM   494  O O   . ALA A 1 59  ? 20.662  42.750 5.234   1.00 49.67 ? 381 ALA A O   1 
ATOM   495  C CB  . ALA A 1 59  ? 22.811  42.262 2.794   1.00 49.98 ? 381 ALA A CB  1 
ATOM   496  N N   . LYS A 1 60  ? 21.144  44.572 4.007   1.00 49.46 ? 382 LYS A N   1 
ATOM   497  C CA  . LYS A 1 60  ? 20.848  45.516 5.068   1.00 49.39 ? 382 LYS A CA  1 
ATOM   498  C C   . LYS A 1 60  ? 19.373  45.512 5.426   1.00 48.83 ? 382 LYS A C   1 
ATOM   499  O O   . LYS A 1 60  ? 19.012  45.578 6.598   1.00 48.35 ? 382 LYS A O   1 
ATOM   500  C CB  . LYS A 1 60  ? 21.241  46.929 4.646   1.00 49.83 ? 382 LYS A CB  1 
ATOM   501  C CG  . LYS A 1 60  ? 21.108  47.940 5.758   1.00 51.21 ? 382 LYS A CG  1 
ATOM   502  C CD  . LYS A 1 60  ? 21.531  49.319 5.322   1.00 53.39 ? 382 LYS A CD  1 
ATOM   503  C CE  . LYS A 1 60  ? 21.442  50.289 6.494   1.00 54.85 ? 382 LYS A CE  1 
ATOM   504  N NZ  . LYS A 1 60  ? 21.790  51.695 6.115   1.00 57.22 ? 382 LYS A NZ  1 
ATOM   505  N N   . ARG A 1 61  ? 18.522  45.460 4.410   1.00 48.06 ? 383 ARG A N   1 
ATOM   506  C CA  . ARG A 1 61  ? 17.097  45.519 4.639   1.00 47.98 ? 383 ARG A CA  1 
ATOM   507  C C   . ARG A 1 61  ? 16.608  44.260 5.346   1.00 47.28 ? 383 ARG A C   1 
ATOM   508  O O   . ARG A 1 61  ? 15.747  44.331 6.212   1.00 47.87 ? 383 ARG A O   1 
ATOM   509  C CB  . ARG A 1 61  ? 16.339  45.759 3.328   1.00 48.05 ? 383 ARG A CB  1 
ATOM   510  C CG  . ARG A 1 61  ? 14.865  46.107 3.518   1.00 49.05 ? 383 ARG A CG  1 
ATOM   511  C CD  . ARG A 1 61  ? 14.660  47.438 4.240   1.00 50.50 ? 383 ARG A CD  1 
ATOM   512  N NE  . ARG A 1 61  ? 13.363  47.487 4.923   1.00 53.00 ? 383 ARG A NE  1 
ATOM   513  N N   . VAL A 1 62  ? 17.153  43.115 4.971   1.00 46.91 ? 384 VAL A N   1 
ATOM   514  C CA  . VAL A 1 62  ? 16.856  41.860 5.658   1.00 46.91 ? 384 VAL A CA  1 
ATOM   515  C C   . VAL A 1 62  ? 17.189  41.948 7.155   1.00 47.11 ? 384 VAL A C   1 
ATOM   516  O O   . VAL A 1 62  ? 16.364  41.598 8.001   1.00 47.16 ? 384 VAL A O   1 
ATOM   517  C CB  . VAL A 1 62  ? 17.605  40.691 5.001   1.00 47.11 ? 384 VAL A CB  1 
ATOM   518  C CG1 . VAL A 1 62  ? 17.615  39.429 5.902   1.00 46.97 ? 384 VAL A CG1 1 
ATOM   519  C CG2 . VAL A 1 62  ? 16.987  40.389 3.652   1.00 46.94 ? 384 VAL A CG2 1 
ATOM   520  N N   . GLU A 1 63  ? 18.377  42.450 7.478   1.00 47.51 ? 385 GLU A N   1 
ATOM   521  C CA  . GLU A 1 63  ? 18.770  42.615 8.868   1.00 47.75 ? 385 GLU A CA  1 
ATOM   522  C C   . GLU A 1 63  ? 17.828  43.584 9.608   1.00 47.56 ? 385 GLU A C   1 
ATOM   523  O O   . GLU A 1 63  ? 17.480  43.353 10.766  1.00 47.50 ? 385 GLU A O   1 
ATOM   524  C CB  . GLU A 1 63  ? 20.229  43.082 8.952   1.00 48.19 ? 385 GLU A CB  1 
ATOM   525  C CG  . GLU A 1 63  ? 20.763  43.357 10.378  1.00 49.88 ? 385 GLU A CG  1 
ATOM   526  C CD  . GLU A 1 63  ? 20.765  42.131 11.296  1.00 51.43 ? 385 GLU A CD  1 
ATOM   527  O OE1 . GLU A 1 63  ? 20.631  40.983 10.811  1.00 52.05 ? 385 GLU A OE1 1 
ATOM   528  O OE2 . GLU A 1 63  ? 20.906  42.332 12.519  1.00 53.30 ? 385 GLU A OE2 1 
ATOM   529  N N   . GLU A 1 64  ? 17.416  44.661 8.943   1.00 47.23 ? 386 GLU A N   1 
ATOM   530  C CA  . GLU A 1 64  ? 16.467  45.615 9.538   1.00 47.00 ? 386 GLU A CA  1 
ATOM   531  C C   . GLU A 1 64  ? 15.092  44.989 9.810   1.00 46.24 ? 386 GLU A C   1 
ATOM   532  O O   . GLU A 1 64  ? 14.467  45.256 10.841  1.00 46.15 ? 386 GLU A O   1 
ATOM   533  C CB  . GLU A 1 64  ? 16.309  46.834 8.631   1.00 47.06 ? 386 GLU A CB  1 
ATOM   534  C CG  . GLU A 1 64  ? 17.560  47.718 8.573   1.00 47.76 ? 386 GLU A CG  1 
ATOM   535  C CD  . GLU A 1 64  ? 17.465  48.823 7.540   1.00 48.23 ? 386 GLU A CD  1 
ATOM   536  O OE1 . GLU A 1 64  ? 16.562  48.775 6.681   1.00 52.07 ? 386 GLU A OE1 1 
ATOM   537  O OE2 . GLU A 1 64  ? 18.299  49.749 7.586   1.00 51.60 ? 386 GLU A OE2 1 
ATOM   538  N N   . ILE A 1 65  ? 14.616  44.171 8.882   1.00 45.49 ? 387 ILE A N   1 
ATOM   539  C CA  . ILE A 1 65  ? 13.336  43.496 9.059   1.00 45.14 ? 387 ILE A CA  1 
ATOM   540  C C   . ILE A 1 65  ? 13.416  42.513 10.224  1.00 45.04 ? 387 ILE A C   1 
ATOM   541  O O   . ILE A 1 65  ? 12.543  42.494 11.090  1.00 44.55 ? 387 ILE A O   1 
ATOM   542  C CB  . ILE A 1 65  ? 12.880  42.801 7.758   1.00 45.23 ? 387 ILE A CB  1 
ATOM   543  C CG1 . ILE A 1 65  ? 12.531  43.867 6.703   1.00 45.40 ? 387 ILE A CG1 1 
ATOM   544  C CG2 . ILE A 1 65  ? 11.670  41.884 8.024   1.00 45.24 ? 387 ILE A CG2 1 
ATOM   545  C CD1 . ILE A 1 65  ? 12.360  43.333 5.302   1.00 44.39 ? 387 ILE A CD1 1 
ATOM   546  N N   . TRP A 1 66  ? 14.475  41.705 10.245  1.00 45.32 ? 388 TRP A N   1 
ATOM   547  C CA  . TRP A 1 66  ? 14.734  40.789 11.358  1.00 45.12 ? 388 TRP A CA  1 
ATOM   548  C C   . TRP A 1 66  ? 14.759  41.528 12.694  1.00 44.94 ? 388 TRP A C   1 
ATOM   549  O O   . TRP A 1 66  ? 14.060  41.149 13.617  1.00 44.12 ? 388 TRP A O   1 
ATOM   550  C CB  . TRP A 1 66  ? 16.062  40.055 11.155  1.00 45.29 ? 388 TRP A CB  1 
ATOM   551  C CG  . TRP A 1 66  ? 16.406  39.130 12.283  1.00 45.06 ? 388 TRP A CG  1 
ATOM   552  C CD1 . TRP A 1 66  ? 17.269  39.373 13.296  1.00 44.73 ? 388 TRP A CD1 1 
ATOM   553  C CD2 . TRP A 1 66  ? 15.872  37.820 12.511  1.00 44.38 ? 388 TRP A CD2 1 
ATOM   554  N NE1 . TRP A 1 66  ? 17.304  38.304 14.149  1.00 45.31 ? 388 TRP A NE1 1 
ATOM   555  C CE2 . TRP A 1 66  ? 16.463  37.330 13.681  1.00 44.94 ? 388 TRP A CE2 1 
ATOM   556  C CE3 . TRP A 1 66  ? 14.954  37.013 11.831  1.00 45.33 ? 388 TRP A CE3 1 
ATOM   557  C CZ2 . TRP A 1 66  ? 16.166  36.063 14.201  1.00 45.96 ? 388 TRP A CZ2 1 
ATOM   558  C CZ3 . TRP A 1 66  ? 14.660  35.744 12.348  1.00 45.09 ? 388 TRP A CZ3 1 
ATOM   559  C CH2 . TRP A 1 66  ? 15.260  35.289 13.514  1.00 45.04 ? 388 TRP A CH2 1 
ATOM   560  N N   . GLN A 1 67  ? 15.574  42.577 12.786  1.00 45.43 ? 389 GLN A N   1 
ATOM   561  C CA  . GLN A 1 67  ? 15.695  43.352 14.015  1.00 45.80 ? 389 GLN A CA  1 
ATOM   562  C C   . GLN A 1 67  ? 14.358  43.974 14.434  1.00 46.03 ? 389 GLN A C   1 
ATOM   563  O O   . GLN A 1 67  ? 14.035  43.979 15.614  1.00 46.26 ? 389 GLN A O   1 
ATOM   564  C CB  . GLN A 1 67  ? 16.761  44.445 13.883  1.00 46.09 ? 389 GLN A CB  1 
ATOM   565  C CG  . GLN A 1 67  ? 18.201  43.933 13.809  1.00 46.97 ? 389 GLN A CG  1 
ATOM   566  C CD  . GLN A 1 67  ? 18.621  43.160 15.047  1.00 47.60 ? 389 GLN A CD  1 
ATOM   567  O OE1 . GLN A 1 67  ? 18.195  43.470 16.157  1.00 48.65 ? 389 GLN A OE1 1 
ATOM   568  N NE2 . GLN A 1 67  ? 19.461  42.148 14.859  1.00 48.19 ? 389 GLN A NE2 1 
ATOM   569  N N   . GLU A 1 68  ? 13.579  44.475 13.475  1.00 46.04 ? 390 GLU A N   1 
ATOM   570  C CA  . GLU A 1 68  ? 12.293  45.127 13.785  1.00 45.91 ? 390 GLU A CA  1 
ATOM   571  C C   . GLU A 1 68  ? 11.207  44.153 14.245  1.00 45.83 ? 390 GLU A C   1 
ATOM   572  O O   . GLU A 1 68  ? 10.389  44.501 15.084  1.00 45.46 ? 390 GLU A O   1 
ATOM   573  C CB  . GLU A 1 68  ? 11.778  45.903 12.561  1.00 45.82 ? 390 GLU A CB  1 
ATOM   574  C CG  . GLU A 1 68  ? 10.401  46.577 12.730  1.00 46.18 ? 390 GLU A CG  1 
ATOM   575  C CD  . GLU A 1 68  ? 10.386  47.677 13.787  1.00 47.85 ? 390 GLU A CD  1 
ATOM   576  O OE1 . GLU A 1 68  ? 11.449  48.278 14.048  1.00 48.42 ? 390 GLU A OE1 1 
ATOM   577  O OE2 . GLU A 1 68  ? 9.305   47.963 14.350  1.00 49.47 ? 390 GLU A OE2 1 
ATOM   578  N N   . PHE A 1 69  ? 11.190  42.947 13.686  1.00 45.88 ? 391 PHE A N   1 
ATOM   579  C CA  . PHE A 1 69  ? 10.021  42.051 13.823  1.00 45.86 ? 391 PHE A CA  1 
ATOM   580  C C   . PHE A 1 69  ? 10.295  40.688 14.457  1.00 46.10 ? 391 PHE A C   1 
ATOM   581  O O   . PHE A 1 69  ? 9.359   40.021 14.889  1.00 46.06 ? 391 PHE A O   1 
ATOM   582  C CB  . PHE A 1 69  ? 9.371   41.824 12.448  1.00 45.53 ? 391 PHE A CB  1 
ATOM   583  C CG  . PHE A 1 69  ? 8.798   43.081 11.816  1.00 45.37 ? 391 PHE A CG  1 
ATOM   584  C CD1 . PHE A 1 69  ? 7.606   43.624 12.271  1.00 44.43 ? 391 PHE A CD1 1 
ATOM   585  C CD2 . PHE A 1 69  ? 9.448   43.711 10.766  1.00 45.17 ? 391 PHE A CD2 1 
ATOM   586  C CE1 . PHE A 1 69  ? 7.071   44.778 11.697  1.00 44.30 ? 391 PHE A CE1 1 
ATOM   587  C CE2 . PHE A 1 69  ? 8.916   44.875 10.187  1.00 45.92 ? 391 PHE A CE2 1 
ATOM   588  C CZ  . PHE A 1 69  ? 7.725   45.400 10.656  1.00 44.77 ? 391 PHE A CZ  1 
ATOM   589  N N   . LEU A 1 70  ? 11.557  40.265 14.515  1.00 46.67 ? 392 LEU A N   1 
ATOM   590  C CA  . LEU A 1 70  ? 11.871  38.864 14.851  1.00 46.95 ? 392 LEU A CA  1 
ATOM   591  C C   . LEU A 1 70  ? 13.018  38.638 15.825  1.00 47.24 ? 392 LEU A C   1 
ATOM   592  O O   . LEU A 1 70  ? 13.079  37.583 16.450  1.00 47.09 ? 392 LEU A O   1 
ATOM   593  C CB  . LEU A 1 70  ? 12.144  38.077 13.569  1.00 47.00 ? 392 LEU A CB  1 
ATOM   594  C CG  . LEU A 1 70  ? 10.891  37.785 12.729  1.00 47.51 ? 392 LEU A CG  1 
ATOM   595  C CD1 . LEU A 1 70  ? 11.239  37.508 11.291  1.00 48.62 ? 392 LEU A CD1 1 
ATOM   596  C CD2 . LEU A 1 70  ? 10.125  36.617 13.316  1.00 47.83 ? 392 LEU A CD2 1 
ATOM   597  N N   . ALA A 1 71  ? 13.928  39.596 15.952  1.00 47.85 ? 393 ALA A N   1 
ATOM   598  C CA  . ALA A 1 71  ? 15.077  39.421 16.826  1.00 48.32 ? 393 ALA A CA  1 
ATOM   599  C C   . ALA A 1 71  ? 14.639  39.425 18.284  1.00 49.20 ? 393 ALA A C   1 
ATOM   600  O O   . ALA A 1 71  ? 13.539  39.891 18.610  1.00 48.87 ? 393 ALA A O   1 
ATOM   601  C CB  . ALA A 1 71  ? 16.106  40.520 16.587  1.00 48.32 ? 393 ALA A CB  1 
ATOM   602  N N   . PRO A 1 72  ? 15.501  38.905 19.176  1.00 50.08 ? 394 PRO A N   1 
ATOM   603  C CA  . PRO A 1 72  ? 15.243  39.123 20.587  1.00 50.55 ? 394 PRO A CA  1 
ATOM   604  C C   . PRO A 1 72  ? 15.189  40.614 20.875  1.00 50.91 ? 394 PRO A C   1 
ATOM   605  O O   . PRO A 1 72  ? 16.063  41.361 20.424  1.00 51.50 ? 394 PRO A O   1 
ATOM   606  C CB  . PRO A 1 72  ? 16.460  38.482 21.272  1.00 50.62 ? 394 PRO A CB  1 
ATOM   607  C CG  . PRO A 1 72  ? 16.989  37.517 20.292  1.00 50.22 ? 394 PRO A CG  1 
ATOM   608  C CD  . PRO A 1 72  ? 16.728  38.118 18.958  1.00 50.22 ? 394 PRO A CD  1 
ATOM   609  N N   . GLY A 1 73  ? 14.165  41.043 21.600  1.00 51.12 ? 395 GLY A N   1 
ATOM   610  C CA  . GLY A 1 73  ? 14.006  42.453 21.933  1.00 51.27 ? 395 GLY A CA  1 
ATOM   611  C C   . GLY A 1 73  ? 13.520  43.306 20.773  1.00 51.20 ? 395 GLY A C   1 
ATOM   612  O O   . GLY A 1 73  ? 13.653  44.536 20.819  1.00 51.27 ? 395 GLY A O   1 
ATOM   613  N N   . ALA A 1 74  ? 12.953  42.656 19.747  1.00 50.98 ? 396 ALA A N   1 
ATOM   614  C CA  . ALA A 1 74  ? 12.341  43.336 18.602  1.00 50.46 ? 396 ALA A CA  1 
ATOM   615  C C   . ALA A 1 74  ? 11.163  44.213 19.030  1.00 50.08 ? 396 ALA A C   1 
ATOM   616  O O   . ALA A 1 74  ? 10.249  43.737 19.711  1.00 50.13 ? 396 ALA A O   1 
ATOM   617  C CB  . ALA A 1 74  ? 11.860  42.315 17.562  1.00 50.46 ? 396 ALA A CB  1 
ATOM   618  N N   . PRO A 1 75  ? 11.159  45.484 18.595  1.00 49.42 ? 397 PRO A N   1 
ATOM   619  C CA  . PRO A 1 75  ? 10.101  46.412 18.971  1.00 49.00 ? 397 PRO A CA  1 
ATOM   620  C C   . PRO A 1 75  ? 8.721   46.073 18.419  1.00 48.67 ? 397 PRO A C   1 
ATOM   621  O O   . PRO A 1 75  ? 7.735   46.562 18.962  1.00 48.64 ? 397 PRO A O   1 
ATOM   622  C CB  . PRO A 1 75  ? 10.579  47.735 18.376  1.00 49.22 ? 397 PRO A CB  1 
ATOM   623  C CG  . PRO A 1 75  ? 11.410  47.342 17.240  1.00 49.16 ? 397 PRO A CG  1 
ATOM   624  C CD  . PRO A 1 75  ? 12.141  46.131 17.710  1.00 49.40 ? 397 PRO A CD  1 
ATOM   625  N N   . SER A 1 76  ? 8.646   45.269 17.354  1.00 48.20 ? 398 SER A N   1 
ATOM   626  C CA  . SER A 1 76  ? 7.360   44.898 16.751  1.00 48.10 ? 398 SER A CA  1 
ATOM   627  C C   . SER A 1 76  ? 7.221   43.393 16.574  1.00 47.94 ? 398 SER A C   1 
ATOM   628  O O   . SER A 1 76  ? 6.861   42.919 15.498  1.00 48.59 ? 398 SER A O   1 
ATOM   629  C CB  . SER A 1 76  ? 7.174   45.598 15.399  1.00 48.10 ? 398 SER A CB  1 
ATOM   630  O OG  . SER A 1 76  ? 7.432   46.984 15.502  1.00 48.18 ? 398 SER A OG  1 
ATOM   631  N N   . ALA A 1 77  ? 7.469   42.647 17.644  1.00 47.95 ? 399 ALA A N   1 
ATOM   632  C CA  . ALA A 1 77  ? 7.492   41.189 17.592  1.00 48.04 ? 399 ALA A CA  1 
ATOM   633  C C   . ALA A 1 77  ? 6.257   40.565 16.942  1.00 48.43 ? 399 ALA A C   1 
ATOM   634  O O   . ALA A 1 77  ? 5.132   40.796 17.378  1.00 48.39 ? 399 ALA A O   1 
ATOM   635  C CB  . ALA A 1 77  ? 7.670   40.624 18.984  1.00 48.15 ? 399 ALA A CB  1 
ATOM   636  N N   . ILE A 1 78  ? 6.495   39.763 15.906  1.00 48.74 ? 400 ILE A N   1 
ATOM   637  C CA  . ILE A 1 78  ? 5.481   38.897 15.331  1.00 49.33 ? 400 ILE A CA  1 
ATOM   638  C C   . ILE A 1 78  ? 5.633   37.482 15.861  1.00 49.90 ? 400 ILE A C   1 
ATOM   639  O O   . ILE A 1 78  ? 6.692   37.099 16.357  1.00 49.57 ? 400 ILE A O   1 
ATOM   640  C CB  . ILE A 1 78  ? 5.546   38.863 13.779  1.00 49.61 ? 400 ILE A CB  1 
ATOM   641  C CG1 . ILE A 1 78  ? 6.890   38.314 13.285  1.00 49.55 ? 400 ILE A CG1 1 
ATOM   642  C CG2 . ILE A 1 78  ? 5.277   40.256 13.218  1.00 49.46 ? 400 ILE A CG2 1 
ATOM   643  C CD1 . ILE A 1 78  ? 6.870   37.912 11.852  1.00 50.46 ? 400 ILE A CD1 1 
ATOM   644  N N   . ASN A 1 79  ? 4.558   36.713 15.761  1.00 50.85 ? 401 ASN A N   1 
ATOM   645  C CA  . ASN A 1 79  ? 4.575   35.317 16.166  1.00 51.70 ? 401 ASN A CA  1 
ATOM   646  C C   . ASN A 1 79  ? 4.510   34.417 14.945  1.00 52.02 ? 401 ASN A C   1 
ATOM   647  O O   . ASN A 1 79  ? 3.594   34.535 14.131  1.00 52.57 ? 401 ASN A O   1 
ATOM   648  C CB  . ASN A 1 79  ? 3.415   35.012 17.111  1.00 52.10 ? 401 ASN A CB  1 
ATOM   649  C CG  . ASN A 1 79  ? 3.569   33.672 17.794  1.00 53.14 ? 401 ASN A CG  1 
ATOM   650  O OD1 . ASN A 1 79  ? 3.275   32.628 17.210  1.00 55.92 ? 401 ASN A OD1 1 
ATOM   651  N ND2 . ASN A 1 79  ? 4.052   33.689 19.025  1.00 53.67 ? 401 ASN A ND2 1 
ATOM   652  N N   . LEU A 1 80  ? 5.499   33.537 14.814  1.00 52.29 ? 402 LEU A N   1 
ATOM   653  C CA  . LEU A 1 80  ? 5.551   32.567 13.731  1.00 52.28 ? 402 LEU A CA  1 
ATOM   654  C C   . LEU A 1 80  ? 5.424   31.181 14.307  1.00 52.63 ? 402 LEU A C   1 
ATOM   655  O O   . LEU A 1 80  ? 5.782   30.957 15.463  1.00 52.65 ? 402 LEU A O   1 
ATOM   656  C CB  . LEU A 1 80  ? 6.889   32.658 12.992  1.00 52.17 ? 402 LEU A CB  1 
ATOM   657  C CG  . LEU A 1 80  ? 7.210   33.952 12.251  1.00 52.03 ? 402 LEU A CG  1 
ATOM   658  C CD1 . LEU A 1 80  ? 8.589   33.866 11.594  1.00 52.22 ? 402 LEU A CD1 1 
ATOM   659  C CD2 . LEU A 1 80  ? 6.142   34.274 11.219  1.00 52.42 ? 402 LEU A CD2 1 
ATOM   660  N N   . ASP A 1 81  ? 4.927   30.247 13.501  1.00 53.10 ? 403 ASP A N   1 
ATOM   661  C CA  . ASP A 1 81  ? 5.101   28.825 13.798  1.00 53.61 ? 403 ASP A CA  1 
ATOM   662  C C   . ASP A 1 81  ? 6.605   28.547 13.869  1.00 53.93 ? 403 ASP A C   1 
ATOM   663  O O   . ASP A 1 81  ? 7.396   29.219 13.204  1.00 53.90 ? 403 ASP A O   1 
ATOM   664  C CB  . ASP A 1 81  ? 4.445   27.941 12.728  1.00 53.64 ? 403 ASP A CB  1 
ATOM   665  C CG  . ASP A 1 81  ? 4.936   28.254 11.325  1.00 54.31 ? 403 ASP A CG  1 
ATOM   666  O OD1 . ASP A 1 81  ? 4.796   29.418 10.893  1.00 54.07 ? 403 ASP A OD1 1 
ATOM   667  O OD2 . ASP A 1 81  ? 5.457   27.338 10.651  1.00 55.56 ? 403 ASP A OD2 1 
ATOM   668  N N   . SER A 1 82  ? 6.996   27.570 14.677  1.00 54.25 ? 404 SER A N   1 
ATOM   669  C CA  . SER A 1 82  ? 8.411   27.286 14.900  1.00 54.93 ? 404 SER A CA  1 
ATOM   670  C C   . SER A 1 82  ? 9.140   26.989 13.592  1.00 55.25 ? 404 SER A C   1 
ATOM   671  O O   . SER A 1 82  ? 10.289  27.378 13.418  1.00 55.45 ? 404 SER A O   1 
ATOM   672  C CB  . SER A 1 82  ? 8.578   26.113 15.863  1.00 55.01 ? 404 SER A CB  1 
ATOM   673  O OG  . SER A 1 82  ? 7.974   24.949 15.335  1.00 56.06 ? 404 SER A OG  1 
ATOM   674  N N   . HIS A 1 83  ? 8.455   26.330 12.662  1.00 55.50 ? 405 HIS A N   1 
ATOM   675  C CA  . HIS A 1 83  ? 9.057   25.962 11.389  1.00 55.50 ? 405 HIS A CA  1 
ATOM   676  C C   . HIS A 1 83  ? 9.495   27.169 10.566  1.00 55.02 ? 405 HIS A C   1 
ATOM   677  O O   . HIS A 1 83  ? 10.635  27.229 10.102  1.00 54.75 ? 405 HIS A O   1 
ATOM   678  C CB  . HIS A 1 83  ? 8.102   25.097 10.559  1.00 55.95 ? 405 HIS A CB  1 
ATOM   679  C CG  . HIS A 1 83  ? 8.632   24.766 9.200   1.00 56.95 ? 405 HIS A CG  1 
ATOM   680  N ND1 . HIS A 1 83  ? 9.538   23.749 8.985   1.00 57.80 ? 405 HIS A ND1 1 
ATOM   681  C CD2 . HIS A 1 83  ? 8.414   25.340 7.993   1.00 58.32 ? 405 HIS A CD2 1 
ATOM   682  C CE1 . HIS A 1 83  ? 9.845   23.700 7.701   1.00 58.95 ? 405 HIS A CE1 1 
ATOM   683  N NE2 . HIS A 1 83  ? 9.177   24.656 7.077   1.00 59.51 ? 405 HIS A NE2 1 
ATOM   684  N N   . SER A 1 84  ? 8.594   28.124 10.363  1.00 54.49 ? 406 SER A N   1 
ATOM   685  C CA  . SER A 1 84  ? 8.949   29.281 9.554   1.00 54.05 ? 406 SER A CA  1 
ATOM   686  C C   . SER A 1 84  ? 9.926   30.181 10.304  1.00 53.29 ? 406 SER A C   1 
ATOM   687  O O   . SER A 1 84  ? 10.742  30.842 9.676   1.00 53.09 ? 406 SER A O   1 
ATOM   688  C CB  . SER A 1 84  ? 7.715   30.041 9.073   1.00 53.93 ? 406 SER A CB  1 
ATOM   689  O OG  . SER A 1 84  ? 6.953   30.474 10.161  1.00 55.06 ? 406 SER A OG  1 
ATOM   690  N N   . TYR A 1 85  ? 9.876   30.180 11.634  1.00 52.82 ? 407 TYR A N   1 
ATOM   691  C CA  . TYR A 1 85  ? 10.874  30.916 12.417  1.00 52.64 ? 407 TYR A CA  1 
ATOM   692  C C   . TYR A 1 85  ? 12.283  30.366 12.203  1.00 52.57 ? 407 TYR A C   1 
ATOM   693  O O   . TYR A 1 85  ? 13.226  31.129 11.986  1.00 52.02 ? 407 TYR A O   1 
ATOM   694  C CB  . TYR A 1 85  ? 10.567  30.912 13.920  1.00 52.37 ? 407 TYR A CB  1 
ATOM   695  C CG  . TYR A 1 85  ? 11.645  31.636 14.715  1.00 52.47 ? 407 TYR A CG  1 
ATOM   696  C CD1 . TYR A 1 85  ? 11.620  33.026 14.875  1.00 51.74 ? 407 TYR A CD1 1 
ATOM   697  C CD2 . TYR A 1 85  ? 12.710  30.938 15.268  1.00 52.30 ? 407 TYR A CD2 1 
ATOM   698  C CE1 . TYR A 1 85  ? 12.623  33.688 15.586  1.00 51.44 ? 407 TYR A CE1 1 
ATOM   699  C CE2 . TYR A 1 85  ? 13.711  31.590 15.973  1.00 52.45 ? 407 TYR A CE2 1 
ATOM   700  C CZ  . TYR A 1 85  ? 13.667  32.962 16.127  1.00 52.33 ? 407 TYR A CZ  1 
ATOM   701  O OH  . TYR A 1 85  ? 14.674  33.586 16.835  1.00 52.23 ? 407 TYR A OH  1 
ATOM   702  N N   . GLU A 1 86  ? 12.422  29.046 12.287  1.00 52.37 ? 408 GLU A N   1 
ATOM   703  C CA  . GLU A 1 86  ? 13.729  28.418 12.144  1.00 52.71 ? 408 GLU A CA  1 
ATOM   704  C C   . GLU A 1 86  ? 14.279  28.589 10.739  1.00 52.35 ? 408 GLU A C   1 
ATOM   705  O O   . GLU A 1 86  ? 15.474  28.828 10.574  1.00 51.95 ? 408 GLU A O   1 
ATOM   706  C CB  . GLU A 1 86  ? 13.678  26.933 12.518  1.00 52.87 ? 408 GLU A CB  1 
ATOM   707  C CG  . GLU A 1 86  ? 13.351  26.672 13.992  1.00 54.40 ? 408 GLU A CG  1 
ATOM   708  C CD  . GLU A 1 86  ? 14.371  27.271 14.968  1.00 57.40 ? 408 GLU A CD  1 
ATOM   709  O OE1 . GLU A 1 86  ? 15.545  27.485 14.572  1.00 58.59 ? 408 GLU A OE1 1 
ATOM   710  O OE2 . GLU A 1 86  ? 13.993  27.523 16.142  1.00 58.79 ? 408 GLU A OE2 1 
ATOM   711  N N   . ILE A 1 87  ? 13.410  28.465 9.736   1.00 52.07 ? 409 ILE A N   1 
ATOM   712  C CA  . ILE A 1 87  ? 13.794  28.707 8.349   1.00 52.47 ? 409 ILE A CA  1 
ATOM   713  C C   . ILE A 1 87  ? 14.215  30.156 8.136   1.00 51.48 ? 409 ILE A C   1 
ATOM   714  O O   . ILE A 1 87  ? 15.225  30.422 7.490   1.00 51.20 ? 409 ILE A O   1 
ATOM   715  C CB  . ILE A 1 87  ? 12.655  28.345 7.360   1.00 52.53 ? 409 ILE A CB  1 
ATOM   716  C CG1 . ILE A 1 87  ? 12.474  26.825 7.336   1.00 54.06 ? 409 ILE A CG1 1 
ATOM   717  C CG2 . ILE A 1 87  ? 12.979  28.842 5.964   1.00 53.56 ? 409 ILE A CG2 1 
ATOM   718  C CD1 . ILE A 1 87  ? 11.581  26.305 6.217   1.00 54.32 ? 409 ILE A CD1 1 
ATOM   719  N N   . THR A 1 88  ? 13.432  31.084 8.679   1.00 50.62 ? 410 THR A N   1 
ATOM   720  C CA  . THR A 1 88  ? 13.739  32.501 8.556   1.00 50.10 ? 410 THR A CA  1 
ATOM   721  C C   . THR A 1 88  ? 15.076  32.824 9.207   1.00 50.06 ? 410 THR A C   1 
ATOM   722  O O   . THR A 1 88  ? 15.888  33.534 8.633   1.00 49.72 ? 410 THR A O   1 
ATOM   723  C CB  . THR A 1 88  ? 12.657  33.374 9.203   1.00 49.80 ? 410 THR A CB  1 
ATOM   724  O OG1 . THR A 1 88  ? 11.374  33.034 8.661   1.00 49.08 ? 410 THR A OG1 1 
ATOM   725  C CG2 . THR A 1 88  ? 12.947  34.843 8.941   1.00 50.11 ? 410 THR A CG2 1 
ATOM   726  N N   . SER A 1 89  ? 15.289  32.294 10.403  1.00 50.01 ? 411 SER A N   1 
ATOM   727  C CA  . SER A 1 89  ? 16.505  32.542 11.154  1.00 50.63 ? 411 SER A CA  1 
ATOM   728  C C   . SER A 1 89  ? 17.748  32.004 10.421  1.00 50.89 ? 411 SER A C   1 
ATOM   729  O O   . SER A 1 89  ? 18.787  32.652 10.382  1.00 50.57 ? 411 SER A O   1 
ATOM   730  C CB  . SER A 1 89  ? 16.386  31.905 12.537  1.00 50.40 ? 411 SER A CB  1 
ATOM   731  O OG  . SER A 1 89  ? 17.482  32.271 13.348  1.00 51.95 ? 411 SER A OG  1 
ATOM   732  N N   . GLN A 1 90  ? 17.629  30.817 9.846   1.00 51.26 ? 412 GLN A N   1 
ATOM   733  C CA  . GLN A 1 90  ? 18.700  30.249 9.039   1.00 52.17 ? 412 GLN A CA  1 
ATOM   734  C C   . GLN A 1 90  ? 19.001  31.100 7.795   1.00 51.54 ? 412 GLN A C   1 
ATOM   735  O O   . GLN A 1 90  ? 20.160  31.351 7.482   1.00 50.95 ? 412 GLN A O   1 
ATOM   736  C CB  . GLN A 1 90  ? 18.333  28.825 8.611   1.00 52.47 ? 412 GLN A CB  1 
ATOM   737  C CG  . GLN A 1 90  ? 19.454  28.102 7.890   1.00 53.94 ? 412 GLN A CG  1 
ATOM   738  C CD  . GLN A 1 90  ? 19.079  26.696 7.487   1.00 53.82 ? 412 GLN A CD  1 
ATOM   739  O OE1 . GLN A 1 90  ? 18.259  26.498 6.589   1.00 56.63 ? 412 GLN A OE1 1 
ATOM   740  N NE2 . GLN A 1 90  ? 19.687  25.709 8.142   1.00 56.64 ? 412 GLN A NE2 1 
ATOM   741  N N   . ASN A 1 91  ? 17.952  31.532 7.094   1.00 51.55 ? 413 ASN A N   1 
ATOM   742  C CA  . ASN A 1 91  ? 18.101  32.369 5.902   1.00 51.59 ? 413 ASN A CA  1 
ATOM   743  C C   . ASN A 1 91  ? 18.842  33.660 6.222   1.00 51.62 ? 413 ASN A C   1 
ATOM   744  O O   . ASN A 1 91  ? 19.766  34.058 5.492   1.00 51.71 ? 413 ASN A O   1 
ATOM   745  C CB  . ASN A 1 91  ? 16.741  32.714 5.297   1.00 51.54 ? 413 ASN A CB  1 
ATOM   746  C CG  . ASN A 1 91  ? 16.094  31.547 4.599   1.00 51.84 ? 413 ASN A CG  1 
ATOM   747  O OD1 . ASN A 1 91  ? 16.725  30.509 4.379   1.00 52.07 ? 413 ASN A OD1 1 
ATOM   748  N ND2 . ASN A 1 91  ? 14.820  31.710 4.234   1.00 50.90 ? 413 ASN A ND2 1 
ATOM   749  N N   . VAL A 1 92  ? 18.441  34.297 7.323   1.00 51.23 ? 414 VAL A N   1 
ATOM   750  C CA  . VAL A 1 92  ? 19.055  35.538 7.759   1.00 51.12 ? 414 VAL A CA  1 
ATOM   751  C C   . VAL A 1 92  ? 20.507  35.295 8.153   1.00 51.49 ? 414 VAL A C   1 
ATOM   752  O O   . VAL A 1 92  ? 21.383  36.071 7.780   1.00 51.10 ? 414 VAL A O   1 
ATOM   753  C CB  . VAL A 1 92  ? 18.291  36.189 8.947   1.00 51.09 ? 414 VAL A CB  1 
ATOM   754  C CG1 . VAL A 1 92  ? 19.044  37.408 9.472   1.00 50.95 ? 414 VAL A CG1 1 
ATOM   755  C CG2 . VAL A 1 92  ? 16.884  36.585 8.543   1.00 50.28 ? 414 VAL A CG2 1 
ATOM   756  N N   . LYS A 1 93  ? 20.763  34.222 8.901   1.00 51.78 ? 415 LYS A N   1 
ATOM   757  C CA  . LYS A 1 93  ? 22.132  33.899 9.309   1.00 52.59 ? 415 LYS A CA  1 
ATOM   758  C C   . LYS A 1 93  ? 23.015  33.539 8.112   1.00 52.30 ? 415 LYS A C   1 
ATOM   759  O O   . LYS A 1 93  ? 24.115  34.065 7.992   1.00 52.07 ? 415 LYS A O   1 
ATOM   760  C CB  . LYS A 1 93  ? 22.168  32.768 10.346  1.00 52.95 ? 415 LYS A CB  1 
ATOM   761  C CG  . LYS A 1 93  ? 22.327  33.232 11.804  1.00 56.12 ? 415 LYS A CG  1 
ATOM   762  C CD  . LYS A 1 93  ? 21.003  33.462 12.562  1.00 58.27 ? 415 LYS A CD  1 
ATOM   763  C CE  . LYS A 1 93  ? 20.660  34.946 12.726  1.00 59.31 ? 415 LYS A CE  1 
ATOM   764  N NZ  . LYS A 1 93  ? 19.440  35.126 13.544  1.00 59.10 ? 415 LYS A NZ  1 
ATOM   765  N N   . ASP A 1 94  ? 22.527  32.639 7.253   1.00 52.34 ? 416 ASP A N   1 
ATOM   766  C CA  . ASP A 1 94  ? 23.201  32.238 6.004   1.00 52.36 ? 416 ASP A CA  1 
ATOM   767  C C   . ASP A 1 94  ? 23.616  33.441 5.155   1.00 52.23 ? 416 ASP A C   1 
ATOM   768  O O   . ASP A 1 94  ? 24.738  33.499 4.649   1.00 51.70 ? 416 ASP A O   1 
ATOM   769  C CB  . ASP A 1 94  ? 22.261  31.391 5.144   1.00 52.70 ? 416 ASP A CB  1 
ATOM   770  C CG  . ASP A 1 94  ? 22.141  29.938 5.615   1.00 53.83 ? 416 ASP A CG  1 
ATOM   771  O OD1 . ASP A 1 94  ? 22.611  29.612 6.720   1.00 51.72 ? 416 ASP A OD1 1 
ATOM   772  O OD2 . ASP A 1 94  ? 21.557  29.125 4.843   1.00 56.45 ? 416 ASP A OD2 1 
ATOM   773  N N   . GLY A 1 95  ? 22.675  34.363 4.953   1.00 51.76 ? 417 GLY A N   1 
ATOM   774  C CA  . GLY A 1 95  ? 22.946  35.629 4.283   1.00 51.60 ? 417 GLY A CA  1 
ATOM   775  C C   . GLY A 1 95  ? 23.393  35.513 2.840   1.00 51.32 ? 417 GLY A C   1 
ATOM   776  O O   . GLY A 1 95  ? 24.181  36.345 2.361   1.00 51.82 ? 417 GLY A O   1 
ATOM   777  N N   . GLY A 1 96  ? 22.886  34.496 2.152   1.00 50.66 ? 418 GLY A N   1 
ATOM   778  C CA  . GLY A 1 96  ? 23.221  34.244 0.752   1.00 50.57 ? 418 GLY A CA  1 
ATOM   779  C C   . GLY A 1 96  ? 24.422  33.342 0.512   1.00 49.78 ? 418 GLY A C   1 
ATOM   780  O O   . GLY A 1 96  ? 24.702  32.977 -0.621  1.00 49.96 ? 418 GLY A O   1 
ATOM   781  N N   . ARG A 1 97  ? 25.111  32.952 1.577   1.00 49.52 ? 419 ARG A N   1 
ATOM   782  C CA  . ARG A 1 97  ? 26.375  32.209 1.457   1.00 48.90 ? 419 ARG A CA  1 
ATOM   783  C C   . ARG A 1 97  ? 26.217  30.782 0.916   1.00 48.54 ? 419 ARG A C   1 
ATOM   784  O O   . ARG A 1 97  ? 27.204  30.158 0.524   1.00 47.98 ? 419 ARG A O   1 
ATOM   785  C CB  . ARG A 1 97  ? 27.090  32.173 2.798   1.00 49.14 ? 419 ARG A CB  1 
ATOM   786  C CG  . ARG A 1 97  ? 27.634  33.512 3.237   1.00 50.04 ? 419 ARG A CG  1 
ATOM   787  C CD  . ARG A 1 97  ? 28.259  33.390 4.602   1.00 52.23 ? 419 ARG A CD  1 
ATOM   788  N NE  . ARG A 1 97  ? 28.674  34.675 5.171   1.00 54.06 ? 419 ARG A NE  1 
ATOM   789  C CZ  . ARG A 1 97  ? 27.877  35.490 5.872   1.00 55.16 ? 419 ARG A CZ  1 
ATOM   790  N NH1 . ARG A 1 97  ? 28.348  36.635 6.360   1.00 54.87 ? 419 ARG A NH1 1 
ATOM   791  N NH2 . ARG A 1 97  ? 26.609  35.169 6.102   1.00 55.03 ? 419 ARG A NH2 1 
ATOM   792  N N   . TYR A 1 98  ? 24.981  30.282 0.877   1.00 48.06 ? 420 TYR A N   1 
ATOM   793  C CA  . TYR A 1 98  ? 24.704  28.910 0.435   1.00 48.06 ? 420 TYR A CA  1 
ATOM   794  C C   . TYR A 1 98  ? 23.880  28.883 -0.849  1.00 48.07 ? 420 TYR A C   1 
ATOM   795  O O   . TYR A 1 98  ? 23.201  27.909 -1.152  1.00 48.31 ? 420 TYR A O   1 
ATOM   796  C CB  . TYR A 1 98  ? 24.090  28.116 1.598   1.00 47.53 ? 420 TYR A CB  1 
ATOM   797  C CG  . TYR A 1 98  ? 25.101  28.019 2.714   1.00 47.03 ? 420 TYR A CG  1 
ATOM   798  C CD1 . TYR A 1 98  ? 25.951  26.925 2.809   1.00 46.92 ? 420 TYR A CD1 1 
ATOM   799  C CD2 . TYR A 1 98  ? 25.278  29.068 3.614   1.00 46.54 ? 420 TYR A CD2 1 
ATOM   800  C CE1 . TYR A 1 98  ? 26.919  26.855 3.788   1.00 46.55 ? 420 TYR A CE1 1 
ATOM   801  C CE2 . TYR A 1 98  ? 26.243  29.012 4.597   1.00 46.03 ? 420 TYR A CE2 1 
ATOM   802  C CZ  . TYR A 1 98  ? 27.062  27.900 4.683   1.00 46.73 ? 420 TYR A CZ  1 
ATOM   803  O OH  . TYR A 1 98  ? 28.027  27.827 5.653   1.00 46.19 ? 420 TYR A OH  1 
ATOM   804  N N   . THR A 1 99  ? 23.996  29.976 -1.608  1.00 48.50 ? 421 THR A N   1 
ATOM   805  C CA  . THR A 1 99  ? 23.416  30.139 -2.926  1.00 48.40 ? 421 THR A CA  1 
ATOM   806  C C   . THR A 1 99  ? 23.772  28.985 -3.883  1.00 48.65 ? 421 THR A C   1 
ATOM   807  O O   . THR A 1 99  ? 22.940  28.603 -4.713  1.00 48.22 ? 421 THR A O   1 
ATOM   808  C CB  . THR A 1 99  ? 23.891  31.495 -3.533  1.00 48.93 ? 421 THR A CB  1 
ATOM   809  O OG1 . THR A 1 99  ? 23.342  32.590 -2.781  1.00 48.62 ? 421 THR A OG1 1 
ATOM   810  C CG2 . THR A 1 99  ? 23.494  31.652 -4.985  1.00 48.78 ? 421 THR A CG2 1 
ATOM   811  N N   . PHE A 1 100 ? 24.989  28.437 -3.751  1.00 48.42 ? 422 PHE A N   1 
ATOM   812  C CA  . PHE A 1 100 ? 25.508  27.398 -4.668  1.00 48.55 ? 422 PHE A CA  1 
ATOM   813  C C   . PHE A 1 100 ? 25.566  25.991 -4.044  1.00 48.98 ? 422 PHE A C   1 
ATOM   814  O O   . PHE A 1 100 ? 26.383  25.168 -4.456  1.00 49.06 ? 422 PHE A O   1 
ATOM   815  C CB  . PHE A 1 100 ? 26.912  27.794 -5.156  1.00 47.87 ? 422 PHE A CB  1 
ATOM   816  C CG  . PHE A 1 100 ? 26.956  29.113 -5.881  1.00 47.20 ? 422 PHE A CG  1 
ATOM   817  C CD1 . PHE A 1 100 ? 26.531  29.207 -7.196  1.00 46.04 ? 422 PHE A CD1 1 
ATOM   818  C CD2 . PHE A 1 100 ? 27.417  30.252 -5.250  1.00 45.30 ? 422 PHE A CD2 1 
ATOM   819  C CE1 . PHE A 1 100 ? 26.563  30.429 -7.875  1.00 47.67 ? 422 PHE A CE1 1 
ATOM   820  C CE2 . PHE A 1 100 ? 27.455  31.481 -5.919  1.00 47.16 ? 422 PHE A CE2 1 
ATOM   821  C CZ  . PHE A 1 100 ? 27.035  31.566 -7.235  1.00 46.44 ? 422 PHE A CZ  1 
ATOM   822  N N   . GLU A 1 101 ? 24.705  25.720 -3.062  1.00 49.92 ? 423 GLU A N   1 
ATOM   823  C CA  . GLU A 1 101 ? 24.743  24.459 -2.292  1.00 50.81 ? 423 GLU A CA  1 
ATOM   824  C C   . GLU A 1 101 ? 24.585  23.204 -3.141  1.00 50.14 ? 423 GLU A C   1 
ATOM   825  O O   . GLU A 1 101 ? 25.375  22.260 -3.027  1.00 50.42 ? 423 GLU A O   1 
ATOM   826  C CB  . GLU A 1 101 ? 23.653  24.464 -1.209  1.00 50.98 ? 423 GLU A CB  1 
ATOM   827  C CG  . GLU A 1 101 ? 23.712  23.290 -0.225  1.00 52.18 ? 423 GLU A CG  1 
ATOM   828  C CD  . GLU A 1 101 ? 22.757  23.456 0.975   1.00 53.75 ? 423 GLU A CD  1 
ATOM   829  O OE1 . GLU A 1 101 ? 21.871  24.360 0.936   1.00 59.82 ? 423 GLU A OE1 1 
ATOM   830  N N   . ASP A 1 102 ? 23.541  23.172 -3.961  1.00 49.80 ? 424 ASP A N   1 
ATOM   831  C CA  . ASP A 1 102 ? 23.276  22.006 -4.818  1.00 49.54 ? 424 ASP A CA  1 
ATOM   832  C C   . ASP A 1 102 ? 24.342  21.887 -5.907  1.00 48.38 ? 424 ASP A C   1 
ATOM   833  O O   . ASP A 1 102 ? 24.874  20.814 -6.144  1.00 48.18 ? 424 ASP A O   1 
ATOM   834  C CB  . ASP A 1 102 ? 21.882  22.087 -5.443  1.00 49.89 ? 424 ASP A CB  1 
ATOM   835  C CG  . ASP A 1 102 ? 20.780  22.046 -4.401  1.00 51.80 ? 424 ASP A CG  1 
ATOM   836  O OD1 . ASP A 1 102 ? 20.626  20.995 -3.730  1.00 53.50 ? 424 ASP A OD1 1 
ATOM   837  O OD2 . ASP A 1 102 ? 20.089  23.073 -4.237  1.00 53.66 ? 424 ASP A OD2 1 
ATOM   838  N N   . ALA A 1 103 ? 24.659  23.010 -6.534  1.00 47.58 ? 425 ALA A N   1 
ATOM   839  C CA  . ALA A 1 103 ? 25.718  23.080 -7.534  1.00 46.65 ? 425 ALA A CA  1 
ATOM   840  C C   . ALA A 1 103 ? 27.048  22.565 -6.994  1.00 46.08 ? 425 ALA A C   1 
ATOM   841  O O   . ALA A 1 103 ? 27.692  21.737 -7.625  1.00 45.44 ? 425 ALA A O   1 
ATOM   842  C CB  . ALA A 1 103 ? 25.863  24.499 -8.037  1.00 46.69 ? 425 ALA A CB  1 
ATOM   843  N N   . GLN A 1 104 ? 27.458  23.050 -5.829  1.00 46.13 ? 426 GLN A N   1 
ATOM   844  C CA  . GLN A 1 104 ? 28.726  22.617 -5.248  1.00 45.81 ? 426 GLN A CA  1 
ATOM   845  C C   . GLN A 1 104 ? 28.741  21.116 -4.947  1.00 45.98 ? 426 GLN A C   1 
ATOM   846  O O   . GLN A 1 104 ? 29.766  20.459 -5.106  1.00 45.66 ? 426 GLN A O   1 
ATOM   847  C CB  . GLN A 1 104 ? 29.041  23.390 -3.973  1.00 45.71 ? 426 GLN A CB  1 
ATOM   848  C CG  . GLN A 1 104 ? 30.435  23.083 -3.403  1.00 45.46 ? 426 GLN A CG  1 
ATOM   849  C CD  . GLN A 1 104 ? 30.734  23.824 -2.121  1.00 45.42 ? 426 GLN A CD  1 
ATOM   850  O OE1 . GLN A 1 104 ? 29.819  24.176 -1.358  1.00 44.34 ? 426 GLN A OE1 1 
ATOM   851  N NE2 . GLN A 1 104 ? 32.027  24.055 -1.859  1.00 43.04 ? 426 GLN A NE2 1 
ATOM   852  N N   . GLU A 1 105 ? 27.611  20.593 -4.482  1.00 46.28 ? 427 GLU A N   1 
ATOM   853  C CA  . GLU A 1 105 ? 27.494  19.173 -4.151  1.00 46.66 ? 427 GLU A CA  1 
ATOM   854  C C   . GLU A 1 105 ? 27.606  18.310 -5.414  1.00 46.13 ? 427 GLU A C   1 
ATOM   855  O O   . GLU A 1 105 ? 28.256  17.265 -5.408  1.00 45.36 ? 427 GLU A O   1 
ATOM   856  C CB  . GLU A 1 105 ? 26.171  18.915 -3.409  1.00 47.19 ? 427 GLU A CB  1 
ATOM   857  C CG  . GLU A 1 105 ? 25.889  17.454 -3.039  1.00 49.96 ? 427 GLU A CG  1 
ATOM   858  C CD  . GLU A 1 105 ? 26.950  16.831 -2.127  1.00 53.88 ? 427 GLU A CD  1 
ATOM   859  O OE1 . GLU A 1 105 ? 27.681  17.590 -1.432  1.00 55.57 ? 427 GLU A OE1 1 
ATOM   860  O OE2 . GLU A 1 105 ? 27.041  15.570 -2.092  1.00 56.86 ? 427 GLU A OE2 1 
ATOM   861  N N   . HIS A 1 106 ? 26.971  18.756 -6.494  1.00 46.04 ? 428 HIS A N   1 
ATOM   862  C CA  . HIS A 1 106 ? 27.061  18.059 -7.777  1.00 46.02 ? 428 HIS A CA  1 
ATOM   863  C C   . HIS A 1 106 ? 28.521  18.001 -8.242  1.00 45.72 ? 428 HIS A C   1 
ATOM   864  O O   . HIS A 1 106 ? 29.022  16.940 -8.604  1.00 45.03 ? 428 HIS A O   1 
ATOM   865  C CB  . HIS A 1 106 ? 26.181  18.751 -8.822  1.00 46.62 ? 428 HIS A CB  1 
ATOM   866  C CG  . HIS A 1 106 ? 26.185  18.080 -10.161 1.00 47.22 ? 428 HIS A CG  1 
ATOM   867  N ND1 . HIS A 1 106 ? 26.980  18.511 -11.202 1.00 48.58 ? 428 HIS A ND1 1 
ATOM   868  C CD2 . HIS A 1 106 ? 25.504  17.005 -10.626 1.00 48.02 ? 428 HIS A CD2 1 
ATOM   869  C CE1 . HIS A 1 106 ? 26.786  17.734 -12.251 1.00 48.01 ? 428 HIS A CE1 1 
ATOM   870  N NE2 . HIS A 1 106 ? 25.893  16.813 -11.931 1.00 48.12 ? 428 HIS A NE2 1 
ATOM   871  N N   . ILE A 1 107 ? 29.209  19.141 -8.176  1.00 45.19 ? 429 ILE A N   1 
ATOM   872  C CA  . ILE A 1 107 ? 30.606  19.233 -8.606  1.00 44.99 ? 429 ILE A CA  1 
ATOM   873  C C   . ILE A 1 107 ? 31.554  18.469 -7.673  1.00 44.64 ? 429 ILE A C   1 
ATOM   874  O O   . ILE A 1 107 ? 32.513  17.839 -8.135  1.00 44.26 ? 429 ILE A O   1 
ATOM   875  C CB  . ILE A 1 107 ? 31.046  20.714 -8.729  1.00 45.09 ? 429 ILE A CB  1 
ATOM   876  C CG1 . ILE A 1 107 ? 30.212  21.441 -9.803  1.00 44.71 ? 429 ILE A CG1 1 
ATOM   877  C CG2 . ILE A 1 107 ? 32.536  20.833 -9.014  1.00 45.68 ? 429 ILE A CG2 1 
ATOM   878  C CD1 . ILE A 1 107 ? 30.311  20.867 -11.197 1.00 44.80 ? 429 ILE A CD1 1 
ATOM   879  N N   . TYR A 1 108 ? 31.295  18.523 -6.367  1.00 44.31 ? 430 TYR A N   1 
ATOM   880  C CA  . TYR A 1 108 ? 32.044  17.700 -5.412  1.00 44.13 ? 430 TYR A CA  1 
ATOM   881  C C   . TYR A 1 108 ? 31.946  16.213 -5.814  1.00 43.96 ? 430 TYR A C   1 
ATOM   882  O O   . TYR A 1 108 ? 32.953  15.507 -5.931  1.00 43.73 ? 430 TYR A O   1 
ATOM   883  C CB  . TYR A 1 108 ? 31.517  17.910 -3.978  1.00 44.07 ? 430 TYR A CB  1 
ATOM   884  C CG  . TYR A 1 108 ? 32.069  16.912 -2.981  1.00 43.60 ? 430 TYR A CG  1 
ATOM   885  C CD1 . TYR A 1 108 ? 33.355  17.054 -2.457  1.00 44.21 ? 430 TYR A CD1 1 
ATOM   886  C CD2 . TYR A 1 108 ? 31.318  15.816 -2.579  1.00 43.78 ? 430 TYR A CD2 1 
ATOM   887  C CE1 . TYR A 1 108 ? 33.878  16.123 -1.551  1.00 44.36 ? 430 TYR A CE1 1 
ATOM   888  C CE2 . TYR A 1 108 ? 31.826  14.885 -1.675  1.00 43.93 ? 430 TYR A CE2 1 
ATOM   889  C CZ  . TYR A 1 108 ? 33.105  15.038 -1.163  1.00 44.51 ? 430 TYR A CZ  1 
ATOM   890  O OH  . TYR A 1 108 ? 33.610  14.102 -0.267  1.00 44.43 ? 430 TYR A OH  1 
ATOM   891  N N   . LYS A 1 109 ? 30.725  15.744 -6.028  1.00 43.98 ? 431 LYS A N   1 
ATOM   892  C CA  . LYS A 1 109 ? 30.513  14.347 -6.401  1.00 44.83 ? 431 LYS A CA  1 
ATOM   893  C C   . LYS A 1 109 ? 31.158  14.000 -7.745  1.00 44.25 ? 431 LYS A C   1 
ATOM   894  O O   . LYS A 1 109 ? 31.685  12.907 -7.918  1.00 43.56 ? 431 LYS A O   1 
ATOM   895  C CB  . LYS A 1 109 ? 29.021  14.027 -6.413  1.00 44.68 ? 431 LYS A CB  1 
ATOM   896  C CG  . LYS A 1 109 ? 28.434  13.966 -5.014  1.00 45.96 ? 431 LYS A CG  1 
ATOM   897  C CD  . LYS A 1 109 ? 27.067  13.274 -4.968  1.00 47.05 ? 431 LYS A CD  1 
ATOM   898  C CE  . LYS A 1 109 ? 25.900  14.261 -4.964  1.00 49.92 ? 431 LYS A CE  1 
ATOM   899  N NZ  . LYS A 1 109 ? 24.742  13.767 -4.125  1.00 51.51 ? 431 LYS A NZ  1 
ATOM   900  N N   . LEU A 1 110 ? 31.122  14.946 -8.680  1.00 44.37 ? 432 LEU A N   1 
ATOM   901  C CA  . LEU A 1 110 ? 31.740  14.765 -9.996  1.00 44.48 ? 432 LEU A CA  1 
ATOM   902  C C   . LEU A 1 110 ? 33.244  14.570 -9.894  1.00 44.28 ? 432 LEU A C   1 
ATOM   903  O O   . LEU A 1 110 ? 33.786  13.638 -10.469 1.00 43.81 ? 432 LEU A O   1 
ATOM   904  C CB  . LEU A 1 110 ? 31.451  15.974 -10.893 1.00 44.61 ? 432 LEU A CB  1 
ATOM   905  C CG  . LEU A 1 110 ? 31.939  15.876 -12.338 1.00 44.71 ? 432 LEU A CG  1 
ATOM   906  C CD1 . LEU A 1 110 ? 31.396  14.621 -12.995 1.00 45.50 ? 432 LEU A CD1 1 
ATOM   907  C CD2 . LEU A 1 110 ? 31.503  17.107 -13.096 1.00 44.98 ? 432 LEU A CD2 1 
ATOM   908  N N   . MET A 1 111 ? 33.914  15.457 -9.161  1.00 44.44 ? 433 MET A N   1 
ATOM   909  C CA  . MET A 1 111 ? 35.363  15.324 -8.930  1.00 44.77 ? 433 MET A CA  1 
ATOM   910  C C   . MET A 1 111 ? 35.714  14.009 -8.226  1.00 45.01 ? 433 MET A C   1 
ATOM   911  O O   . MET A 1 111 ? 36.686  13.345 -8.589  1.00 44.54 ? 433 MET A O   1 
ATOM   912  C CB  . MET A 1 111 ? 35.880  16.496 -8.091  1.00 44.93 ? 433 MET A CB  1 
ATOM   913  C CG  . MET A 1 111 ? 35.875  17.830 -8.815  1.00 44.51 ? 433 MET A CG  1 
ATOM   914  S SD  . MET A 1 111 ? 36.737  19.079 -7.865  1.00 44.35 ? 433 MET A SD  1 
ATOM   915  C CE  . MET A 1 111 ? 35.559  19.364 -6.529  1.00 44.55 ? 433 MET A CE  1 
ATOM   916  N N   . LYS A 1 112 ? 34.919  13.650 -7.217  1.00 45.79 ? 434 LYS A N   1 
ATOM   917  C CA  . LYS A 1 112 ? 35.159  12.438 -6.437  1.00 46.69 ? 434 LYS A CA  1 
ATOM   918  C C   . LYS A 1 112 ? 35.033  11.187 -7.301  1.00 46.99 ? 434 LYS A C   1 
ATOM   919  O O   . LYS A 1 112 ? 35.908  10.315 -7.272  1.00 46.91 ? 434 LYS A O   1 
ATOM   920  C CB  . LYS A 1 112 ? 34.201  12.346 -5.239  1.00 46.71 ? 434 LYS A CB  1 
ATOM   921  C CG  . LYS A 1 112 ? 34.616  11.254 -4.241  1.00 47.73 ? 434 LYS A CG  1 
ATOM   922  C CD  . LYS A 1 112 ? 33.496  10.805 -3.304  1.00 47.94 ? 434 LYS A CD  1 
ATOM   923  C CE  . LYS A 1 112 ? 33.263  11.797 -2.182  1.00 49.84 ? 434 LYS A CE  1 
ATOM   924  N NZ  . LYS A 1 112 ? 32.480  11.214 -1.036  1.00 50.07 ? 434 LYS A NZ  1 
ATOM   925  N N   . SER A 1 113 ? 33.948  11.101 -8.072  1.00 47.43 ? 435 SER A N   1 
ATOM   926  C CA  . SER A 1 113 ? 33.707  9.930  -8.909  1.00 47.83 ? 435 SER A CA  1 
ATOM   927  C C   . SER A 1 113 ? 34.563  9.913  -10.181 1.00 48.36 ? 435 SER A C   1 
ATOM   928  O O   . SER A 1 113 ? 35.057  8.858  -10.564 1.00 48.20 ? 435 SER A O   1 
ATOM   929  C CB  . SER A 1 113 ? 32.222  9.816  -9.270  1.00 47.86 ? 435 SER A CB  1 
ATOM   930  O OG  . SER A 1 113 ? 31.780  10.948 -9.997  1.00 47.82 ? 435 SER A OG  1 
ATOM   931  N N   . ASP A 1 114 ? 34.750  11.065 -10.833 1.00 48.98 ? 436 ASP A N   1 
ATOM   932  C CA  . ASP A 1 114 ? 35.315  11.075 -12.199 1.00 49.64 ? 436 ASP A CA  1 
ATOM   933  C C   . ASP A 1 114 ? 36.777  11.499 -12.323 1.00 49.27 ? 436 ASP A C   1 
ATOM   934  O O   . ASP A 1 114 ? 37.411  11.185 -13.328 1.00 49.85 ? 436 ASP A O   1 
ATOM   935  C CB  . ASP A 1 114 ? 34.460  11.939 -13.138 1.00 50.23 ? 436 ASP A CB  1 
ATOM   936  C CG  . ASP A 1 114 ? 33.097  11.305 -13.465 1.00 52.74 ? 436 ASP A CG  1 
ATOM   937  O OD1 . ASP A 1 114 ? 32.698  10.302 -12.823 1.00 55.18 ? 436 ASP A OD1 1 
ATOM   938  O OD2 . ASP A 1 114 ? 32.419  11.824 -14.380 1.00 56.23 ? 436 ASP A OD2 1 
ATOM   939  N N   . SER A 1 115 ? 37.305  12.215 -11.334 1.00 48.74 ? 437 SER A N   1 
ATOM   940  C CA  . SER A 1 115 ? 38.681  12.734 -11.394 1.00 48.46 ? 437 SER A CA  1 
ATOM   941  C C   . SER A 1 115 ? 39.612  12.158 -10.327 1.00 47.67 ? 437 SER A C   1 
ATOM   942  O O   . SER A 1 115 ? 40.795  11.951 -10.582 1.00 47.25 ? 437 SER A O   1 
ATOM   943  C CB  . SER A 1 115 ? 38.673  14.255 -11.249 1.00 48.43 ? 437 SER A CB  1 
ATOM   944  O OG  . SER A 1 115 ? 37.905  14.863 -12.266 1.00 50.26 ? 437 SER A OG  1 
ATOM   945  N N   . TYR A 1 116 ? 39.079  11.926 -9.131  1.00 47.60 ? 438 TYR A N   1 
ATOM   946  C CA  . TYR A 1 116 ? 39.896  11.525 -7.983  1.00 47.58 ? 438 TYR A CA  1 
ATOM   947  C C   . TYR A 1 116 ? 40.647  10.212 -8.215  1.00 46.95 ? 438 TYR A C   1 
ATOM   948  O O   . TYR A 1 116 ? 41.871  10.189 -8.113  1.00 46.98 ? 438 TYR A O   1 
ATOM   949  C CB  . TYR A 1 116 ? 39.053  11.474 -6.698  1.00 47.85 ? 438 TYR A CB  1 
ATOM   950  C CG  . TYR A 1 116 ? 39.803  10.934 -5.492  1.00 48.48 ? 438 TYR A CG  1 
ATOM   951  C CD1 . TYR A 1 116 ? 41.014  11.496 -5.088  1.00 48.80 ? 438 TYR A CD1 1 
ATOM   952  C CD2 . TYR A 1 116 ? 39.301  9.859  -4.759  1.00 48.76 ? 438 TYR A CD2 1 
ATOM   953  C CE1 . TYR A 1 116 ? 41.704  10.999 -3.979  1.00 48.90 ? 438 TYR A CE1 1 
ATOM   954  C CE2 . TYR A 1 116 ? 39.983  9.357  -3.655  1.00 48.85 ? 438 TYR A CE2 1 
ATOM   955  C CZ  . TYR A 1 116 ? 41.180  9.929  -3.272  1.00 48.57 ? 438 TYR A CZ  1 
ATOM   956  O OH  . TYR A 1 116 ? 41.851  9.427  -2.182  1.00 48.77 ? 438 TYR A OH  1 
ATOM   957  N N   . ALA A 1 117 ? 39.936  9.132  -8.544  1.00 46.72 ? 439 ALA A N   1 
ATOM   958  C CA  . ALA A 1 117 ? 40.590  7.835  -8.809  1.00 46.24 ? 439 ALA A CA  1 
ATOM   959  C C   . ALA A 1 117 ? 41.610  7.904  -9.942  1.00 45.98 ? 439 ALA A C   1 
ATOM   960  O O   . ALA A 1 117 ? 42.648  7.244  -9.891  1.00 45.80 ? 439 ALA A O   1 
ATOM   961  C CB  . ALA A 1 117 ? 39.560  6.755  -9.103  1.00 46.50 ? 439 ALA A CB  1 
ATOM   962  N N   . ARG A 1 118 ? 41.314  8.704  -10.963 1.00 45.70 ? 440 ARG A N   1 
ATOM   963  C CA  . ARG A 1 118 ? 42.240  8.897  -12.078 1.00 45.60 ? 440 ARG A CA  1 
ATOM   964  C C   . ARG A 1 118 ? 43.543  9.556  -11.631 1.00 45.37 ? 440 ARG A C   1 
ATOM   965  O O   . ARG A 1 118 ? 44.627  9.152  -12.067 1.00 45.09 ? 440 ARG A O   1 
ATOM   966  C CB  . ARG A 1 118 ? 41.598  9.759  -13.166 1.00 45.73 ? 440 ARG A CB  1 
ATOM   967  C CG  . ARG A 1 118 ? 40.536  9.053  -13.991 1.00 46.12 ? 440 ARG A CG  1 
ATOM   968  C CD  . ARG A 1 118 ? 40.049  9.952  -15.124 1.00 46.13 ? 440 ARG A CD  1 
ATOM   969  N NE  . ARG A 1 118 ? 41.161  10.439 -15.937 1.00 45.25 ? 440 ARG A NE  1 
ATOM   970  C CZ  . ARG A 1 118 ? 41.844  9.699  -16.804 1.00 45.25 ? 440 ARG A CZ  1 
ATOM   971  N NH1 . ARG A 1 118 ? 41.540  8.424  -17.004 1.00 44.82 ? 440 ARG A NH1 1 
ATOM   972  N NH2 . ARG A 1 118 ? 42.840  10.244 -17.491 1.00 45.65 ? 440 ARG A NH2 1 
ATOM   973  N N   . PHE A 1 119 ? 43.430  10.583 -10.785 1.00 45.15 ? 441 PHE A N   1 
ATOM   974  C CA  . PHE A 1 119 ? 44.601  11.231 -10.187 1.00 45.15 ? 441 PHE A CA  1 
ATOM   975  C C   . PHE A 1 119 ? 45.525  10.199 -9.544  1.00 45.45 ? 441 PHE A C   1 
ATOM   976  O O   . PHE A 1 119 ? 46.725  10.177 -9.805  1.00 45.12 ? 441 PHE A O   1 
ATOM   977  C CB  . PHE A 1 119 ? 44.180  12.264 -9.136  1.00 44.95 ? 441 PHE A CB  1 
ATOM   978  C CG  . PHE A 1 119 ? 45.334  12.905 -8.415  1.00 44.63 ? 441 PHE A CG  1 
ATOM   979  C CD1 . PHE A 1 119 ? 45.422  12.855 -7.033  1.00 44.54 ? 441 PHE A CD1 1 
ATOM   980  C CD2 . PHE A 1 119 ? 46.339  13.553 -9.121  1.00 44.52 ? 441 PHE A CD2 1 
ATOM   981  C CE1 . PHE A 1 119 ? 46.491  13.449 -6.366  1.00 44.56 ? 441 PHE A CE1 1 
ATOM   982  C CE2 . PHE A 1 119 ? 47.412  14.143 -8.460  1.00 44.61 ? 441 PHE A CE2 1 
ATOM   983  C CZ  . PHE A 1 119 ? 47.484  14.091 -7.082  1.00 44.31 ? 441 PHE A CZ  1 
ATOM   984  N N   . LEU A 1 120 ? 44.945  9.337  -8.721  1.00 46.02 ? 442 LEU A N   1 
ATOM   985  C CA  . LEU A 1 120 ? 45.710  8.341  -7.994  1.00 46.96 ? 442 LEU A CA  1 
ATOM   986  C C   . LEU A 1 120 ? 46.469  7.404  -8.931  1.00 47.90 ? 442 LEU A C   1 
ATOM   987  O O   . LEU A 1 120 ? 47.579  6.972  -8.615  1.00 48.07 ? 442 LEU A O   1 
ATOM   988  C CB  . LEU A 1 120 ? 44.787  7.545  -7.076  1.00 46.88 ? 442 LEU A CB  1 
ATOM   989  C CG  . LEU A 1 120 ? 44.085  8.368  -6.001  1.00 46.43 ? 442 LEU A CG  1 
ATOM   990  C CD1 . LEU A 1 120 ? 43.240  7.454  -5.123  1.00 46.58 ? 442 LEU A CD1 1 
ATOM   991  C CD2 . LEU A 1 120 ? 45.094  9.170  -5.173  1.00 46.04 ? 442 LEU A CD2 1 
ATOM   992  N N   . ARG A 1 121 ? 45.884  7.116  -10.092 1.00 49.01 ? 443 ARG A N   1 
ATOM   993  C CA  . ARG A 1 121 ? 46.544  6.280  -11.093 1.00 50.14 ? 443 ARG A CA  1 
ATOM   994  C C   . ARG A 1 121 ? 47.559  7.071  -11.913 1.00 50.49 ? 443 ARG A C   1 
ATOM   995  O O   . ARG A 1 121 ? 48.312  6.492  -12.674 1.00 50.80 ? 443 ARG A O   1 
ATOM   996  C CB  . ARG A 1 121 ? 45.520  5.628  -12.032 1.00 50.06 ? 443 ARG A CB  1 
ATOM   997  C CG  . ARG A 1 121 ? 44.355  4.927  -11.320 1.00 50.96 ? 443 ARG A CG  1 
ATOM   998  C CD  . ARG A 1 121 ? 43.587  3.929  -12.221 1.00 51.88 ? 443 ARG A CD  1 
ATOM   999  N NE  . ARG A 1 121 ? 42.144  4.197  -12.216 1.00 53.78 ? 443 ARG A NE  1 
ATOM   1000 C CZ  . ARG A 1 121 ? 41.477  4.858  -13.169 1.00 54.45 ? 443 ARG A CZ  1 
ATOM   1001 N NH1 . ARG A 1 121 ? 42.096  5.306  -14.265 1.00 54.77 ? 443 ARG A NH1 1 
ATOM   1002 N NH2 . ARG A 1 121 ? 40.169  5.064  -13.032 1.00 54.09 ? 443 ARG A NH2 1 
ATOM   1003 N N   . SER A 1 122 ? 47.591  8.390  -11.767 1.00 51.29 ? 444 SER A N   1 
ATOM   1004 C CA  . SER A 1 122 ? 48.432  9.208  -12.640 1.00 51.86 ? 444 SER A CA  1 
ATOM   1005 C C   . SER A 1 122 ? 49.899  9.044  -12.293 1.00 52.44 ? 444 SER A C   1 
ATOM   1006 O O   . SER A 1 122 ? 50.257  8.782  -11.145 1.00 52.35 ? 444 SER A O   1 
ATOM   1007 C CB  . SER A 1 122 ? 48.044  10.693 -12.570 1.00 51.74 ? 444 SER A CB  1 
ATOM   1008 O OG  . SER A 1 122 ? 48.439  11.284 -11.347 1.00 51.30 ? 444 SER A OG  1 
ATOM   1009 N N   . ASN A 1 123 ? 50.747  9.201  -13.299 1.00 53.33 ? 445 ASN A N   1 
ATOM   1010 C CA  . ASN A 1 123 ? 52.181  9.284  -13.064 1.00 54.05 ? 445 ASN A CA  1 
ATOM   1011 C C   . ASN A 1 123 ? 52.508  10.507 -12.216 1.00 54.31 ? 445 ASN A C   1 
ATOM   1012 O O   . ASN A 1 123 ? 53.380  10.449 -11.359 1.00 54.52 ? 445 ASN A O   1 
ATOM   1013 C CB  . ASN A 1 123 ? 52.941  9.310  -14.387 1.00 54.27 ? 445 ASN A CB  1 
ATOM   1014 C CG  . ASN A 1 123 ? 52.832  7.997  -15.134 1.00 55.09 ? 445 ASN A CG  1 
ATOM   1015 O OD1 . ASN A 1 123 ? 53.112  6.934  -14.578 1.00 56.11 ? 445 ASN A OD1 1 
ATOM   1016 N ND2 . ASN A 1 123 ? 52.415  8.060  -16.392 1.00 56.12 ? 445 ASN A ND2 1 
ATOM   1017 N N   . ALA A 1 124 ? 51.785  11.602 -12.436 1.00 54.55 ? 446 ALA A N   1 
ATOM   1018 C CA  . ALA A 1 124 ? 51.912  12.783 -11.586 1.00 54.80 ? 446 ALA A CA  1 
ATOM   1019 C C   . ALA A 1 124 ? 51.927  12.381 -10.111 1.00 54.87 ? 446 ALA A C   1 
ATOM   1020 O O   . ALA A 1 124 ? 52.864  12.725 -9.386  1.00 54.96 ? 446 ALA A O   1 
ATOM   1021 C CB  . ALA A 1 124 ? 50.773  13.778 -11.861 1.00 54.94 ? 446 ALA A CB  1 
ATOM   1022 N N   . TYR A 1 125 ? 50.907  11.631 -9.690  1.00 54.88 ? 447 TYR A N   1 
ATOM   1023 C CA  . TYR A 1 125 ? 50.787  11.177 -8.300  1.00 54.97 ? 447 TYR A CA  1 
ATOM   1024 C C   . TYR A 1 125 ? 51.809  10.093 -7.949  1.00 55.47 ? 447 TYR A C   1 
ATOM   1025 O O   . TYR A 1 125 ? 52.584  10.250 -7.004  1.00 55.19 ? 447 TYR A O   1 
ATOM   1026 C CB  . TYR A 1 125 ? 49.375  10.648 -8.020  1.00 54.52 ? 447 TYR A CB  1 
ATOM   1027 C CG  . TYR A 1 125 ? 49.194  10.109 -6.616  1.00 53.89 ? 447 TYR A CG  1 
ATOM   1028 C CD1 . TYR A 1 125 ? 49.049  10.970 -5.533  1.00 53.53 ? 447 TYR A CD1 1 
ATOM   1029 C CD2 . TYR A 1 125 ? 49.178  8.739  -6.370  1.00 53.59 ? 447 TYR A CD2 1 
ATOM   1030 C CE1 . TYR A 1 125 ? 48.885  10.482 -4.242  1.00 53.47 ? 447 TYR A CE1 1 
ATOM   1031 C CE2 . TYR A 1 125 ? 49.014  8.238  -5.083  1.00 53.37 ? 447 TYR A CE2 1 
ATOM   1032 C CZ  . TYR A 1 125 ? 48.868  9.113  -4.023  1.00 53.66 ? 447 TYR A CZ  1 
ATOM   1033 O OH  . TYR A 1 125 ? 48.705  8.622  -2.748  1.00 53.28 ? 447 TYR A OH  1 
ATOM   1034 N N   . GLN A 1 126 ? 51.797  9.001  -8.710  1.00 56.25 ? 448 GLN A N   1 
ATOM   1035 C CA  . GLN A 1 126 ? 52.636  7.827  -8.419  1.00 56.98 ? 448 GLN A CA  1 
ATOM   1036 C C   . GLN A 1 126 ? 54.127  8.169  -8.345  1.00 57.68 ? 448 GLN A C   1 
ATOM   1037 O O   . GLN A 1 126 ? 54.854  7.589  -7.543  1.00 57.64 ? 448 GLN A O   1 
ATOM   1038 C CB  . GLN A 1 126 ? 52.402  6.720  -9.456  1.00 56.97 ? 448 GLN A CB  1 
ATOM   1039 C CG  . GLN A 1 126 ? 50.993  6.117  -9.438  1.00 57.19 ? 448 GLN A CG  1 
ATOM   1040 C CD  . GLN A 1 126 ? 50.706  5.279  -8.199  1.00 57.33 ? 448 GLN A CD  1 
ATOM   1041 O OE1 . GLN A 1 126 ? 51.563  4.531  -7.727  1.00 58.19 ? 448 GLN A OE1 1 
ATOM   1042 N NE2 . GLN A 1 126 ? 49.487  5.387  -7.679  1.00 56.93 ? 448 GLN A NE2 1 
ATOM   1043 N N   . ASP A 1 127 ? 54.571  9.117  -9.170  1.00 58.79 ? 449 ASP A N   1 
ATOM   1044 C CA  . ASP A 1 127 ? 55.959  9.601  -9.132  1.00 59.73 ? 449 ASP A CA  1 
ATOM   1045 C C   . ASP A 1 127 ? 56.329  10.227 -7.778  1.00 60.47 ? 449 ASP A C   1 
ATOM   1046 O O   . ASP A 1 127 ? 57.497  10.202 -7.384  1.00 60.53 ? 449 ASP A O   1 
ATOM   1047 C CB  . ASP A 1 127 ? 56.225  10.615 -10.259 1.00 59.77 ? 449 ASP A CB  1 
ATOM   1048 C CG  . ASP A 1 127 ? 56.177  9.985  -11.654 1.00 60.41 ? 449 ASP A CG  1 
ATOM   1049 O OD1 . ASP A 1 127 ? 56.573  8.806  -11.808 1.00 60.47 ? 449 ASP A OD1 1 
ATOM   1050 O OD2 . ASP A 1 127 ? 55.744  10.681 -12.604 1.00 61.08 ? 449 ASP A OD2 1 
ATOM   1051 N N   . LEU A 1 128 ? 55.341  10.783 -7.076  1.00 61.32 ? 450 LEU A N   1 
ATOM   1052 C CA  . LEU A 1 128 ? 55.555  11.317 -5.725  1.00 61.98 ? 450 LEU A CA  1 
ATOM   1053 C C   . LEU A 1 128 ? 55.771  10.199 -4.703  1.00 62.64 ? 450 LEU A C   1 
ATOM   1054 O O   . LEU A 1 128 ? 56.517  10.376 -3.737  1.00 62.68 ? 450 LEU A O   1 
ATOM   1055 C CB  . LEU A 1 128 ? 54.372  12.177 -5.271  1.00 61.98 ? 450 LEU A CB  1 
ATOM   1056 C CG  . LEU A 1 128 ? 53.874  13.275 -6.210  1.00 62.09 ? 450 LEU A CG  1 
ATOM   1057 C CD1 . LEU A 1 128 ? 52.691  13.998 -5.585  1.00 62.27 ? 450 LEU A CD1 1 
ATOM   1058 C CD2 . LEU A 1 128 ? 54.982  14.254 -6.556  1.00 62.26 ? 450 LEU A CD2 1 
ATOM   1059 N N   . LEU A 1 129 ? 55.123  9.053  -4.917  1.00 63.40 ? 451 LEU A N   1 
ATOM   1060 C CA  . LEU A 1 129 ? 55.148  7.955  -3.938  1.00 63.94 ? 451 LEU A CA  1 
ATOM   1061 C C   . LEU A 1 129 ? 56.505  7.259  -3.773  1.00 64.46 ? 451 LEU A C   1 
ATOM   1062 O O   . LEU A 1 129 ? 56.615  6.326  -2.980  1.00 64.83 ? 451 LEU A O   1 
ATOM   1063 C CB  . LEU A 1 129 ? 54.041  6.918  -4.217  1.00 63.97 ? 451 LEU A CB  1 
ATOM   1064 C CG  . LEU A 1 129 ? 52.725  7.103  -3.448  1.00 64.07 ? 451 LEU A CG  1 
ATOM   1065 C CD1 . LEU A 1 129 ? 51.794  5.931  -3.731  1.00 64.10 ? 451 LEU A CD1 1 
ATOM   1066 C CD2 . LEU A 1 129 ? 52.953  7.241  -1.941  1.00 63.99 ? 451 LEU A CD2 1 
ATOM   1067 N N   . LEU A 1 130 ? 57.519  7.693  -4.523  1.00 64.84 ? 452 LEU A N   1 
ATOM   1068 C CA  . LEU A 1 130 ? 58.919  7.485  -4.133  1.00 65.03 ? 452 LEU A CA  1 
ATOM   1069 C C   . LEU A 1 130 ? 59.825  8.502  -4.830  1.00 65.17 ? 452 LEU A C   1 
ATOM   1070 O O   . LEU A 1 130 ? 59.708  9.710  -4.606  1.00 65.15 ? 452 LEU A O   1 
ATOM   1071 C CB  . LEU A 1 130 ? 59.392  6.054  -4.433  1.00 65.16 ? 452 LEU A CB  1 
ATOM   1072 C CG  . LEU A 1 130 ? 59.133  4.951  -3.395  1.00 65.32 ? 452 LEU A CG  1 
ATOM   1073 C CD1 . LEU A 1 130 ? 59.711  3.634  -3.888  1.00 65.34 ? 452 LEU A CD1 1 
ATOM   1074 C CD2 . LEU A 1 130 ? 59.698  5.302  -2.014  1.00 65.46 ? 452 LEU A CD2 1 
HETATM 1075 O O   . HOH B 2 .   ? 10.707  32.837 6.207   1.00 37.76 ? 1   HOH A O   1 
HETATM 1076 O O   . HOH B 2 .   ? 17.426  28.252 12.623  1.00 54.80 ? 2   HOH A O   1 
HETATM 1077 O O   . HOH B 2 .   ? 8.117   33.164 16.853  1.00 51.73 ? 3   HOH A O   1 
HETATM 1078 O O   . HOH B 2 .   ? 22.238  31.093 1.263   1.00 39.20 ? 4   HOH A O   1 
HETATM 1079 O O   . HOH B 2 .   ? 5.920   24.689 12.932  1.00 66.50 ? 5   HOH A O   1 
HETATM 1080 O O   . HOH B 2 .   ? 29.651  25.846 5.891   1.00 40.16 ? 6   HOH A O   1 
HETATM 1081 O O   . HOH B 2 .   ? 20.000  30.313 3.104   1.00 52.13 ? 7   HOH A O   1 
HETATM 1082 O O   . HOH B 2 .   ? 16.853  33.512 1.097   1.00 48.31 ? 8   HOH A O   1 
HETATM 1083 O O   . HOH B 2 .   ? 20.724  26.801 -1.130  1.00 57.51 ? 9   HOH A O   1 
HETATM 1084 O O   . HOH B 2 .   ? 21.468  25.296 -4.017  1.00 46.15 ? 10  HOH A O   1 
HETATM 1085 O O   . HOH B 2 .   ? 27.115  21.591 -1.147  1.00 41.82 ? 11  HOH A O   1 
HETATM 1086 O O   . HOH B 2 .   ? 11.633  34.597 19.405  1.00 54.75 ? 12  HOH A O   1 
HETATM 1087 O O   . HOH B 2 .   ? 12.575  38.983 22.420  1.00 58.11 ? 13  HOH A O   1 
HETATM 1088 O O   . HOH B 2 .   ? -0.173  49.226 -5.178  1.00 40.02 ? 14  HOH A O   1 
HETATM 1089 O O   . HOH B 2 .   ? -5.827  40.315 -6.804  1.00 42.47 ? 15  HOH A O   1 
HETATM 1090 O O   . HOH B 2 .   ? -1.133  45.078 -5.927  1.00 39.07 ? 16  HOH A O   1 
HETATM 1091 O O   . HOH B 2 .   ? 1.819   47.202 -4.562  1.00 50.60 ? 17  HOH A O   1 
HETATM 1092 O O   . HOH B 2 .   ? -0.023  45.461 -3.299  1.00 45.99 ? 18  HOH A O   1 
HETATM 1093 O O   . HOH B 2 .   ? 1.809   45.689 -1.447  1.00 49.60 ? 19  HOH A O   1 
HETATM 1094 O O   . HOH B 2 .   ? -6.887  48.194 -6.286  1.00 43.48 ? 20  HOH A O   1 
HETATM 1095 O O   . HOH B 2 .   ? -4.681  47.609 -7.203  1.00 54.53 ? 21  HOH A O   1 
HETATM 1096 O O   . HOH B 2 .   ? 3.411   49.650 -7.340  1.00 44.13 ? 22  HOH A O   1 
HETATM 1097 O O   . HOH B 2 .   ? 7.111   48.739 -7.887  1.00 40.99 ? 23  HOH A O   1 
HETATM 1098 O O   . HOH B 2 .   ? 6.140   46.342 -8.426  1.00 41.48 ? 24  HOH A O   1 
HETATM 1099 O O   . HOH B 2 .   ? 9.545   49.197 -7.695  1.00 51.46 ? 25  HOH A O   1 
HETATM 1100 O O   . HOH B 2 .   ? 28.101  14.763 -10.051 1.00 50.69 ? 26  HOH A O   1 
HETATM 1101 O O   . HOH B 2 .   ? 29.246  12.391 -9.868  1.00 48.06 ? 27  HOH A O   1 
HETATM 1102 O O   . HOH B 2 .   ? 24.185  15.990 -7.714  1.00 67.05 ? 28  HOH A O   1 
HETATM 1103 O O   . HOH B 2 .   ? 1.614   37.169 0.850   1.00 36.94 ? 29  HOH A O   1 
HETATM 1104 O O   . HOH B 2 .   ? 17.053  24.431 14.667  1.00 58.29 ? 30  HOH A O   1 
HETATM 1105 O O   . HOH B 2 .   ? 4.748   26.395 16.186  1.00 57.87 ? 31  HOH A O   1 
HETATM 1106 O O   . HOH B 2 .   ? 17.243  32.454 16.199  1.00 58.98 ? 32  HOH A O   1 
HETATM 1107 O O   . HOH B 2 .   ? 14.151  47.778 14.628  1.00 45.26 ? 33  HOH A O   1 
HETATM 1108 O O   . HOH B 2 .   ? 6.220   48.075 7.077   1.00 39.22 ? 34  HOH A O   1 
HETATM 1109 O O   . HOH B 2 .   ? 2.055   37.848 14.897  1.00 38.52 ? 35  HOH A O   1 
HETATM 1110 O O   . HOH B 2 .   ? 26.617  23.897 1.086   1.00 54.73 ? 36  HOH A O   1 
HETATM 1111 O O   . HOH B 2 .   ? 3.399   44.566 -3.507  1.00 52.35 ? 37  HOH A O   1 
HETATM 1112 O O   . HOH B 2 .   ? 6.071   37.369 -4.132  1.00 44.02 ? 38  HOH A O   1 
HETATM 1113 O O   . HOH B 2 .   ? 22.886  45.814 1.822   1.00 44.94 ? 39  HOH A O   1 
HETATM 1114 O O   . HOH B 2 .   ? 11.412  46.582 3.458   1.00 48.78 ? 40  HOH A O   1 
HETATM 1115 O O   . HOH B 2 .   ? 11.102  39.053 19.069  1.00 49.25 ? 42  HOH A O   1 
HETATM 1116 O O   . HOH B 2 .   ? 20.445  33.135 3.042   1.00 41.89 ? 43  HOH A O   1 
HETATM 1117 O O   . HOH B 2 .   ? 15.123  47.700 12.232  1.00 50.38 ? 44  HOH A O   1 
HETATM 1118 O O   . HOH B 2 .   ? -17.568 46.820 -5.741  1.00 58.76 ? 45  HOH A O   1 
HETATM 1119 O O   . HOH B 2 .   ? -3.227  41.088 12.271  1.00 39.88 ? 46  HOH A O   1 
HETATM 1120 O O   . HOH B 2 .   ? 19.732  34.888 1.279   1.00 51.54 ? 47  HOH A O   1 
HETATM 1121 O O   . HOH B 2 .   ? -2.394  47.750 -5.957  1.00 52.66 ? 48  HOH A O   1 
HETATM 1122 O O   . HOH B 2 .   ? -10.588 36.515 1.455   1.00 55.54 ? 49  HOH A O   1 
HETATM 1123 O O   . HOH B 2 .   ? 5.094   47.323 0.967   1.00 44.04 ? 50  HOH A O   1 
HETATM 1124 O O   . HOH B 2 .   ? 1.264   51.879 -1.900  1.00 56.39 ? 51  HOH A O   1 
HETATM 1125 O O   . HOH B 2 .   ? 15.922  44.791 17.575  1.00 51.11 ? 52  HOH A O   1 
HETATM 1126 O O   . HOH B 2 .   ? 1.031   32.500 15.084  1.00 48.90 ? 53  HOH A O   1 
HETATM 1127 O O   . HOH B 2 .   ? 13.555  43.686 -7.406  1.00 50.93 ? 54  HOH A O   1 
HETATM 1128 O O   . HOH B 2 .   ? 11.525  47.541 -8.095  1.00 46.22 ? 55  HOH A O   1 
HETATM 1129 O O   . HOH B 2 .   ? -0.826  50.664 4.646   1.00 55.69 ? 56  HOH A O   1 
HETATM 1130 O O   . HOH B 2 .   ? 14.534  35.930 17.734  1.00 53.17 ? 57  HOH A O   1 
HETATM 1131 O O   . HOH B 2 .   ? 17.500  49.826 4.026   1.00 59.05 ? 58  HOH A O   1 
HETATM 1132 O O   . HOH B 2 .   ? -3.137  51.236 -4.025  1.00 44.26 ? 59  HOH A O   1 
HETATM 1133 O O   . HOH B 2 .   ? -6.632  44.213 -9.603  1.00 55.70 ? 60  HOH A O   1 
HETATM 1134 O O   . HOH B 2 .   ? 3.091   37.943 -1.157  1.00 49.14 ? 61  HOH A O   1 
HETATM 1135 O O   . HOH B 2 .   ? 21.180  40.383 6.128   1.00 45.12 ? 62  HOH A O   1 
HETATM 1136 O O   . HOH B 2 .   ? 4.059   45.821 -6.837  1.00 42.30 ? 63  HOH A O   1 
HETATM 1137 O O   . HOH B 2 .   ? 13.565  36.547 20.244  1.00 71.13 ? 64  HOH A O   1 
HETATM 1138 O O   . HOH B 2 .   ? 9.338   37.859 17.660  1.00 52.68 ? 65  HOH A O   1 
HETATM 1139 O O   . HOH B 2 .   ? -19.986 53.963 -5.759  1.00 60.23 ? 66  HOH A O   1 
HETATM 1140 O O   . HOH B 2 .   ? 18.942  48.657 2.523   1.00 61.92 ? 67  HOH A O   1 
HETATM 1141 O O   . HOH B 2 .   ? 5.699   40.041 -4.453  1.00 50.71 ? 68  HOH A O   1 
HETATM 1142 O O   . HOH B 2 .   ? -8.802  46.707 -4.489  1.00 50.22 ? 69  HOH A O   1 
HETATM 1143 O O   . HOH B 2 .   ? 18.523  35.629 17.312  1.00 60.44 ? 70  HOH A O   1 
HETATM 1144 O O   . HOH B 2 .   ? 5.787   31.510 19.164  1.00 72.12 ? 71  HOH A O   1 
HETATM 1145 O O   . HOH B 2 .   ? 12.648  50.270 -4.948  1.00 66.99 ? 72  HOH A O   1 
HETATM 1146 O O   . HOH B 2 .   ? 24.336  29.778 7.880   1.00 42.46 ? 73  HOH A O   1 
HETATM 1147 O O   . HOH B 2 .   ? 21.142  38.665 12.362  1.00 59.67 ? 74  HOH A O   1 
HETATM 1148 O O   . HOH B 2 .   ? 23.421  18.510 -6.054  1.00 52.62 ? 75  HOH A O   1 
HETATM 1149 O O   . HOH B 2 .   ? -0.635  50.328 -3.071  1.00 46.04 ? 76  HOH A O   1 
HETATM 1150 O O   . HOH B 2 .   ? 19.285  38.088 16.509  1.00 58.36 ? 77  HOH A O   1 
HETATM 1151 O O   . HOH B 2 .   ? -10.435 51.483 10.350  1.00 55.54 ? 78  HOH A O   1 
HETATM 1152 O O   . HOH B 2 .   ? 8.802   50.078 16.285  1.00 61.17 ? 80  HOH A O   1 
HETATM 1153 O O   . HOH B 2 .   ? -2.472  54.190 11.110  1.00 56.35 ? 81  HOH A O   1 
HETATM 1154 O O   . HOH B 2 .   ? -3.087  35.595 -2.549  1.00 69.42 ? 83  HOH A O   1 
HETATM 1155 O O   . HOH B 2 .   ? -5.916  42.715 -11.517 1.00 62.50 ? 84  HOH A O   1 
HETATM 1156 O O   . HOH B 2 .   ? 15.025  50.001 10.542  1.00 55.12 ? 85  HOH A O   1 
HETATM 1157 O O   . HOH B 2 .   ? 23.213  25.400 5.010   1.00 55.44 ? 86  HOH A O   1 
HETATM 1158 O O   . HOH B 2 .   ? 2.296   29.824 17.413  1.00 65.97 ? 87  HOH A O   1 
HETATM 1159 O O   . HOH B 2 .   ? 32.225  8.575  -5.798  1.00 49.88 ? 88  HOH A O   1 
HETATM 1160 O O   . HOH B 2 .   ? 20.812  37.751 5.702   1.00 47.91 ? 89  HOH A O   1 
HETATM 1161 O O   . HOH B 2 .   ? -2.310  56.334 1.904   1.00 62.85 ? 90  HOH A O   1 
HETATM 1162 O O   . HOH B 2 .   ? 14.834  51.891 5.131   1.00 62.61 ? 92  HOH A O   1 
HETATM 1163 O O   . HOH B 2 .   ? 27.100  28.483 -1.778  1.00 29.83 ? 94  HOH A O   1 
HETATM 1164 O O   . HOH B 2 .   ? 27.597  25.965 -0.990  1.00 36.28 ? 95  HOH A O   1 
HETATM 1165 O O   . HOH B 2 .   ? 8.294   49.073 4.466   1.00 50.56 ? 96  HOH A O   1 
HETATM 1166 O O   A HOH B 2 .   ? 7.552   48.789 12.429  0.50 45.67 ? 97  HOH A O   1 
HETATM 1167 O O   B HOH B 2 .   ? 2.641   48.191 14.851  0.50 39.21 ? 97  HOH A O   1 
HETATM 1168 O O   . HOH B 2 .   ? 44.997  8.624  -14.605 1.00 55.51 ? 98  HOH A O   1 
HETATM 1169 O O   . HOH B 2 .   ? 22.432  35.024 -3.331  1.00 42.49 ? 99  HOH A O   1 
HETATM 1170 O O   . HOH B 2 .   ? 33.210  13.660 -16.002 1.00 52.91 ? 100 HOH A O   1 
HETATM 1171 O O   . HOH B 2 .   ? -8.276  37.441 -0.517  1.00 63.88 ? 104 HOH A O   1 
HETATM 1172 O O   . HOH B 2 .   ? -10.590 48.718 -4.178  1.00 57.66 ? 106 HOH A O   1 
HETATM 1173 O O   . HOH B 2 .   ? 6.005   47.651 -1.468  1.00 41.28 ? 107 HOH A O   1 
HETATM 1174 O O   . HOH B 2 .   ? -0.673  47.448 17.049  1.00 34.34 ? 108 HOH A O   1 
HETATM 1175 O O   . HOH B 2 .   ? -1.628  49.554 18.375  1.00 40.44 ? 109 HOH A O   1 
HETATM 1176 O O   . HOH B 2 .   ? 25.133  43.527 -0.002  0.50 44.16 ? 110 HOH A O   1 
HETATM 1177 O O   . HOH B 2 .   ? 22.616  42.820 -0.514  1.00 44.45 ? 111 HOH A O   1 
HETATM 1178 O O   . HOH B 2 .   ? 29.080  20.023 -1.170  1.00 48.05 ? 112 HOH A O   1 
HETATM 1179 O O   . HOH B 2 .   ? 38.588  9.286  -11.251 1.00 56.90 ? 113 HOH A O   1 
HETATM 1180 O O   . HOH B 2 .   ? 37.195  8.556  -8.871  1.00 60.92 ? 114 HOH A O   1 
HETATM 1181 O O   . HOH B 2 .   ? 31.325  12.598 1.754   1.00 63.60 ? 116 HOH A O   1 
HETATM 1182 O O   . HOH B 2 .   ? 34.090  11.619 2.111   1.00 63.14 ? 118 HOH A O   1 
HETATM 1183 O O   . HOH B 2 .   ? 26.369  31.361 7.390   1.00 52.47 ? 119 HOH A O   1 
HETATM 1184 O O   . HOH B 2 .   ? 25.576  45.126 2.253   1.00 49.59 ? 120 HOH A O   1 
HETATM 1185 O O   . HOH B 2 .   ? 25.200  44.613 4.802   1.00 52.99 ? 121 HOH A O   1 
HETATM 1186 O O   . HOH B 2 .   ? 5.598   49.371 -5.664  1.00 49.30 ? 122 HOH A O   1 
HETATM 1187 O O   . HOH B 2 .   ? 15.212  46.593 -8.147  1.00 67.05 ? 123 HOH A O   1 
HETATM 1188 O O   . HOH B 2 .   ? -5.818  52.909 17.725  1.00 60.97 ? 124 HOH A O   1 
HETATM 1189 O O   . HOH B 2 .   ? 36.915  11.418 -15.934 1.00 66.12 ? 125 HOH A O   1 
HETATM 1190 O O   . HOH B 2 .   ? 23.349  37.062 -2.464  1.00 50.32 ? 126 HOH A O   1 
HETATM 1191 O O   . HOH B 2 .   ? 23.871  43.709 6.818   1.00 65.34 ? 127 HOH A O   1 
HETATM 1192 O O   . HOH B 2 .   ? 37.306  14.738 -17.091 1.00 54.15 ? 129 HOH A O   1 
HETATM 1193 O O   . HOH B 2 .   ? 31.011  10.888 -5.897  1.00 51.98 ? 130 HOH A O   1 
HETATM 1194 O O   . HOH B 2 .   ? 35.129  15.378 -15.258 1.00 52.96 ? 131 HOH A O   1 
HETATM 1195 O O   . HOH B 2 .   ? 4.202   50.058 7.010   1.00 58.93 ? 132 HOH A O   1 
HETATM 1196 O O   . HOH B 2 .   ? -5.099  51.438 19.752  1.00 61.75 ? 133 HOH A O   1 
HETATM 1197 O O   . HOH B 2 .   ? 13.597  49.305 1.970   1.00 66.29 ? 134 HOH A O   1 
HETATM 1198 O O   . HOH B 2 .   ? 22.867  51.513 -2.486  1.00 72.04 ? 135 HOH A O   1 
HETATM 1199 O O   . HOH B 2 .   ? -8.478  40.437 -8.274  1.00 63.63 ? 136 HOH A O   1 
HETATM 1200 O O   . HOH B 2 .   ? 22.475  18.669 -3.345  1.00 63.41 ? 137 HOH A O   1 
HETATM 1201 O O   . HOH B 2 .   ? 19.395  45.088 -8.354  1.00 51.90 ? 138 HOH A O   1 
HETATM 1202 O O   . HOH B 2 .   ? 11.333  30.841 19.283  1.00 51.14 ? 139 HOH A O   1 
HETATM 1203 O O   . HOH B 2 .   ? -9.836  54.941 11.410  1.00 75.10 ? 140 HOH A O   1 
HETATM 1204 O O   . HOH B 2 .   ? -5.292  56.725 3.854   1.00 69.30 ? 141 HOH A O   1 
HETATM 1205 O O   . HOH B 2 .   ? 9.944   50.392 -3.096  1.00 64.82 ? 142 HOH A O   1 
HETATM 1206 O O   . HOH B 2 .   ? 23.284  37.133 11.399  1.00 50.76 ? 143 HOH A O   1 
HETATM 1207 O O   . HOH B 2 .   ? 2.142   51.134 2.776   1.00 60.48 ? 144 HOH A O   1 
HETATM 1208 O O   . HOH B 2 .   ? 15.673  47.385 16.809  1.00 61.31 ? 145 HOH A O   1 
HETATM 1209 O O   . HOH B 2 .   ? 24.530  19.485 0.215   1.00 59.93 ? 146 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   323 ?   ?   ?   A . n 
A 1 2   MET 2   324 324 MET MET A . n 
A 1 3   PRO 3   325 325 PRO PRO A . n 
A 1 4   SER 4   326 326 SER SER A . n 
A 1 5   GLN 5   327 327 GLN GLN A . n 
A 1 6   GLN 6   328 328 GLN GLN A . n 
A 1 7   ARG 7   329 329 ARG ARG A . n 
A 1 8   VAL 8   330 330 VAL VAL A . n 
A 1 9   LYS 9   331 331 LYS LYS A . n 
A 1 10  ARG 10  332 332 ARG ARG A . n 
A 1 11  TRP 11  333 333 TRP TRP A . n 
A 1 12  GLY 12  334 334 GLY GLY A . n 
A 1 13  PHE 13  335 335 PHE PHE A . n 
A 1 14  SER 14  336 336 SER SER A . n 
A 1 15  PHE 15  337 337 PHE PHE A . n 
A 1 16  ASP 16  338 338 ASP ASP A . n 
A 1 17  GLU 17  339 339 GLU GLU A . n 
A 1 18  ILE 18  340 340 ILE ILE A . n 
A 1 19  LEU 19  341 341 LEU LEU A . n 
A 1 20  LYS 20  342 342 LYS LYS A . n 
A 1 21  ASP 21  343 343 ASP ASP A . n 
A 1 22  GLN 22  344 344 GLN GLN A . n 
A 1 23  VAL 23  345 345 VAL VAL A . n 
A 1 24  GLY 24  346 346 GLY GLY A . n 
A 1 25  ARG 25  347 347 ARG ARG A . n 
A 1 26  ASP 26  348 348 ASP ASP A . n 
A 1 27  GLN 27  349 349 GLN GLN A . n 
A 1 28  PHE 28  350 350 PHE PHE A . n 
A 1 29  LEU 29  351 351 LEU LEU A . n 
A 1 30  ARG 30  352 352 ARG ARG A . n 
A 1 31  PHE 31  353 353 PHE PHE A . n 
A 1 32  LEU 32  354 354 LEU LEU A . n 
A 1 33  GLU 33  355 355 GLU GLU A . n 
A 1 34  SER 34  356 356 SER SER A . n 
A 1 35  GLU 35  357 357 GLU GLU A . n 
A 1 36  PHE 36  358 358 PHE PHE A . n 
A 1 37  SER 37  359 359 SER SER A . n 
A 1 38  SER 38  360 360 SER SER A . n 
A 1 39  GLU 39  361 361 GLU GLU A . n 
A 1 40  ASN 40  362 362 ASN ASN A . n 
A 1 41  LEU 41  363 363 LEU LEU A . n 
A 1 42  ARG 42  364 364 ARG ARG A . n 
A 1 43  PHE 43  365 365 PHE PHE A . n 
A 1 44  TRP 44  366 366 TRP TRP A . n 
A 1 45  LEU 45  367 367 LEU LEU A . n 
A 1 46  ALA 46  368 368 ALA ALA A . n 
A 1 47  VAL 47  369 369 VAL VAL A . n 
A 1 48  GLN 48  370 370 GLN GLN A . n 
A 1 49  ASP 49  371 371 ASP ASP A . n 
A 1 50  LEU 50  372 372 LEU LEU A . n 
A 1 51  LYS 51  373 373 LYS LYS A . n 
A 1 52  LYS 52  374 374 LYS LYS A . n 
A 1 53  GLN 53  375 375 GLN GLN A . n 
A 1 54  PRO 54  376 376 PRO PRO A . n 
A 1 55  LEU 55  377 377 LEU LEU A . n 
A 1 56  GLN 56  378 378 GLN GLN A . n 
A 1 57  ASP 57  379 379 ASP ASP A . n 
A 1 58  VAL 58  380 380 VAL VAL A . n 
A 1 59  ALA 59  381 381 ALA ALA A . n 
A 1 60  LYS 60  382 382 LYS LYS A . n 
A 1 61  ARG 61  383 383 ARG ARG A . n 
A 1 62  VAL 62  384 384 VAL VAL A . n 
A 1 63  GLU 63  385 385 GLU GLU A . n 
A 1 64  GLU 64  386 386 GLU GLU A . n 
A 1 65  ILE 65  387 387 ILE ILE A . n 
A 1 66  TRP 66  388 388 TRP TRP A . n 
A 1 67  GLN 67  389 389 GLN GLN A . n 
A 1 68  GLU 68  390 390 GLU GLU A . n 
A 1 69  PHE 69  391 391 PHE PHE A . n 
A 1 70  LEU 70  392 392 LEU LEU A . n 
A 1 71  ALA 71  393 393 ALA ALA A . n 
A 1 72  PRO 72  394 394 PRO PRO A . n 
A 1 73  GLY 73  395 395 GLY GLY A . n 
A 1 74  ALA 74  396 396 ALA ALA A . n 
A 1 75  PRO 75  397 397 PRO PRO A . n 
A 1 76  SER 76  398 398 SER SER A . n 
A 1 77  ALA 77  399 399 ALA ALA A . n 
A 1 78  ILE 78  400 400 ILE ILE A . n 
A 1 79  ASN 79  401 401 ASN ASN A . n 
A 1 80  LEU 80  402 402 LEU LEU A . n 
A 1 81  ASP 81  403 403 ASP ASP A . n 
A 1 82  SER 82  404 404 SER SER A . n 
A 1 83  HIS 83  405 405 HIS HIS A . n 
A 1 84  SER 84  406 406 SER SER A . n 
A 1 85  TYR 85  407 407 TYR TYR A . n 
A 1 86  GLU 86  408 408 GLU GLU A . n 
A 1 87  ILE 87  409 409 ILE ILE A . n 
A 1 88  THR 88  410 410 THR THR A . n 
A 1 89  SER 89  411 411 SER SER A . n 
A 1 90  GLN 90  412 412 GLN GLN A . n 
A 1 91  ASN 91  413 413 ASN ASN A . n 
A 1 92  VAL 92  414 414 VAL VAL A . n 
A 1 93  LYS 93  415 415 LYS LYS A . n 
A 1 94  ASP 94  416 416 ASP ASP A . n 
A 1 95  GLY 95  417 417 GLY GLY A . n 
A 1 96  GLY 96  418 418 GLY GLY A . n 
A 1 97  ARG 97  419 419 ARG ARG A . n 
A 1 98  TYR 98  420 420 TYR TYR A . n 
A 1 99  THR 99  421 421 THR THR A . n 
A 1 100 PHE 100 422 422 PHE PHE A . n 
A 1 101 GLU 101 423 423 GLU GLU A . n 
A 1 102 ASP 102 424 424 ASP ASP A . n 
A 1 103 ALA 103 425 425 ALA ALA A . n 
A 1 104 GLN 104 426 426 GLN GLN A . n 
A 1 105 GLU 105 427 427 GLU GLU A . n 
A 1 106 HIS 106 428 428 HIS HIS A . n 
A 1 107 ILE 107 429 429 ILE ILE A . n 
A 1 108 TYR 108 430 430 TYR TYR A . n 
A 1 109 LYS 109 431 431 LYS LYS A . n 
A 1 110 LEU 110 432 432 LEU LEU A . n 
A 1 111 MET 111 433 433 MET MET A . n 
A 1 112 LYS 112 434 434 LYS LYS A . n 
A 1 113 SER 113 435 435 SER SER A . n 
A 1 114 ASP 114 436 436 ASP ASP A . n 
A 1 115 SER 115 437 437 SER SER A . n 
A 1 116 TYR 116 438 438 TYR TYR A . n 
A 1 117 ALA 117 439 439 ALA ALA A . n 
A 1 118 ARG 118 440 440 ARG ARG A . n 
A 1 119 PHE 119 441 441 PHE PHE A . n 
A 1 120 LEU 120 442 442 LEU LEU A . n 
A 1 121 ARG 121 443 443 ARG ARG A . n 
A 1 122 SER 122 444 444 SER SER A . n 
A 1 123 ASN 123 445 445 ASN ASN A . n 
A 1 124 ALA 124 446 446 ALA ALA A . n 
A 1 125 TYR 125 447 447 TYR TYR A . n 
A 1 126 GLN 126 448 448 GLN GLN A . n 
A 1 127 ASP 127 449 449 ASP ASP A . n 
A 1 128 LEU 128 450 450 LEU LEU A . n 
A 1 129 LEU 129 451 451 LEU LEU A . n 
A 1 130 LEU 130 452 452 LEU LEU A . n 
A 1 131 ALA 131 453 ?   ?   ?   A . n 
A 1 132 LYS 132 454 ?   ?   ?   A . n 
A 1 133 LYS 133 455 ?   ?   ?   A . n 
A 1 134 LYS 134 456 ?   ?   ?   A . n 
A 1 135 GLY 135 457 ?   ?   ?   A . n 
A 1 136 LYS 136 458 ?   ?   ?   A . n 
A 1 137 SER 137 459 ?   ?   ?   A . n 
A 1 138 LEU 138 460 ?   ?   ?   A . n 
A 1 139 ALA 139 461 ?   ?   ?   A . n 
A 1 140 GLY 140 462 ?   ?   ?   A . n 
A 1 141 LYS 141 463 ?   ?   ?   A . n 
A 1 142 ARG 142 464 ?   ?   ?   A . n 
A 1 143 LEU 143 465 ?   ?   ?   A . n 
A 1 144 THR 144 466 ?   ?   ?   A . n 
A 1 145 GLY 145 467 ?   ?   ?   A . n 
A 1 146 LEU 146 468 ?   ?   ?   A . n 
A 1 147 MET 147 469 ?   ?   ?   A . n 
A 1 148 GLN 148 470 ?   ?   ?   A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   1   1   HOH HOH A . 
B 2 HOH 2   2   2   HOH HOH A . 
B 2 HOH 3   3   3   HOH HOH A . 
B 2 HOH 4   4   4   HOH HOH A . 
B 2 HOH 5   5   5   HOH HOH A . 
B 2 HOH 6   6   6   HOH HOH A . 
B 2 HOH 7   7   7   HOH HOH A . 
B 2 HOH 8   8   8   HOH HOH A . 
B 2 HOH 9   9   9   HOH HOH A . 
B 2 HOH 10  10  10  HOH HOH A . 
B 2 HOH 11  11  11  HOH HOH A . 
B 2 HOH 12  12  12  HOH HOH A . 
B 2 HOH 13  13  13  HOH HOH A . 
B 2 HOH 14  14  14  HOH HOH A . 
B 2 HOH 15  15  15  HOH HOH A . 
B 2 HOH 16  16  16  HOH HOH A . 
B 2 HOH 17  17  17  HOH HOH A . 
B 2 HOH 18  18  18  HOH HOH A . 
B 2 HOH 19  19  19  HOH HOH A . 
B 2 HOH 20  20  20  HOH HOH A . 
B 2 HOH 21  21  21  HOH HOH A . 
B 2 HOH 22  22  22  HOH HOH A . 
B 2 HOH 23  23  23  HOH HOH A . 
B 2 HOH 24  24  24  HOH HOH A . 
B 2 HOH 25  25  25  HOH HOH A . 
B 2 HOH 26  26  26  HOH HOH A . 
B 2 HOH 27  27  27  HOH HOH A . 
B 2 HOH 28  28  28  HOH HOH A . 
B 2 HOH 29  29  29  HOH HOH A . 
B 2 HOH 30  30  30  HOH HOH A . 
B 2 HOH 31  31  31  HOH HOH A . 
B 2 HOH 32  32  32  HOH HOH A . 
B 2 HOH 33  33  33  HOH HOH A . 
B 2 HOH 34  34  34  HOH HOH A . 
B 2 HOH 35  35  35  HOH HOH A . 
B 2 HOH 36  36  36  HOH HOH A . 
B 2 HOH 37  37  37  HOH HOH A . 
B 2 HOH 38  38  38  HOH HOH A . 
B 2 HOH 39  39  39  HOH HOH A . 
B 2 HOH 40  40  40  HOH HOH A . 
B 2 HOH 41  42  42  HOH HOH A . 
B 2 HOH 42  43  43  HOH HOH A . 
B 2 HOH 43  44  44  HOH HOH A . 
B 2 HOH 44  45  45  HOH HOH A . 
B 2 HOH 45  46  46  HOH HOH A . 
B 2 HOH 46  47  47  HOH HOH A . 
B 2 HOH 47  48  48  HOH HOH A . 
B 2 HOH 48  49  49  HOH HOH A . 
B 2 HOH 49  50  50  HOH HOH A . 
B 2 HOH 50  51  51  HOH HOH A . 
B 2 HOH 51  52  52  HOH HOH A . 
B 2 HOH 52  53  53  HOH HOH A . 
B 2 HOH 53  54  54  HOH HOH A . 
B 2 HOH 54  55  55  HOH HOH A . 
B 2 HOH 55  56  56  HOH HOH A . 
B 2 HOH 56  57  57  HOH HOH A . 
B 2 HOH 57  58  58  HOH HOH A . 
B 2 HOH 58  59  59  HOH HOH A . 
B 2 HOH 59  60  60  HOH HOH A . 
B 2 HOH 60  61  61  HOH HOH A . 
B 2 HOH 61  62  62  HOH HOH A . 
B 2 HOH 62  63  63  HOH HOH A . 
B 2 HOH 63  64  64  HOH HOH A . 
B 2 HOH 64  65  65  HOH HOH A . 
B 2 HOH 65  66  66  HOH HOH A . 
B 2 HOH 66  67  67  HOH HOH A . 
B 2 HOH 67  68  68  HOH HOH A . 
B 2 HOH 68  69  69  HOH HOH A . 
B 2 HOH 69  70  70  HOH HOH A . 
B 2 HOH 70  71  71  HOH HOH A . 
B 2 HOH 71  72  72  HOH HOH A . 
B 2 HOH 72  73  73  HOH HOH A . 
B 2 HOH 73  74  74  HOH HOH A . 
B 2 HOH 74  75  75  HOH HOH A . 
B 2 HOH 75  76  76  HOH HOH A . 
B 2 HOH 76  77  77  HOH HOH A . 
B 2 HOH 77  78  78  HOH HOH A . 
B 2 HOH 78  80  80  HOH HOH A . 
B 2 HOH 79  81  81  HOH HOH A . 
B 2 HOH 80  83  83  HOH HOH A . 
B 2 HOH 81  84  84  HOH HOH A . 
B 2 HOH 82  85  85  HOH HOH A . 
B 2 HOH 83  86  86  HOH HOH A . 
B 2 HOH 84  87  87  HOH HOH A . 
B 2 HOH 85  88  88  HOH HOH A . 
B 2 HOH 86  89  89  HOH HOH A . 
B 2 HOH 87  90  90  HOH HOH A . 
B 2 HOH 88  92  92  HOH HOH A . 
B 2 HOH 89  94  94  HOH HOH A . 
B 2 HOH 90  95  95  HOH HOH A . 
B 2 HOH 91  96  96  HOH HOH A . 
B 2 HOH 92  97  97  HOH HOH A . 
B 2 HOH 93  98  98  HOH HOH A . 
B 2 HOH 94  99  99  HOH HOH A . 
B 2 HOH 95  100 100 HOH HOH A . 
B 2 HOH 96  104 104 HOH HOH A . 
B 2 HOH 97  106 106 HOH HOH A . 
B 2 HOH 98  107 107 HOH HOH A . 
B 2 HOH 99  108 108 HOH HOH A . 
B 2 HOH 100 109 109 HOH HOH A . 
B 2 HOH 101 110 110 HOH HOH A . 
B 2 HOH 102 111 111 HOH HOH A . 
B 2 HOH 103 112 112 HOH HOH A . 
B 2 HOH 104 113 113 HOH HOH A . 
B 2 HOH 105 114 114 HOH HOH A . 
B 2 HOH 106 116 116 HOH HOH A . 
B 2 HOH 107 118 118 HOH HOH A . 
B 2 HOH 108 119 119 HOH HOH A . 
B 2 HOH 109 120 120 HOH HOH A . 
B 2 HOH 110 121 121 HOH HOH A . 
B 2 HOH 111 122 122 HOH HOH A . 
B 2 HOH 112 123 123 HOH HOH A . 
B 2 HOH 113 124 124 HOH HOH A . 
B 2 HOH 114 125 125 HOH HOH A . 
B 2 HOH 115 126 126 HOH HOH A . 
B 2 HOH 116 127 127 HOH HOH A . 
B 2 HOH 117 129 129 HOH HOH A . 
B 2 HOH 118 130 130 HOH HOH A . 
B 2 HOH 119 131 131 HOH HOH A . 
B 2 HOH 120 132 132 HOH HOH A . 
B 2 HOH 121 133 133 HOH HOH A . 
B 2 HOH 122 134 134 HOH HOH A . 
B 2 HOH 123 135 135 HOH HOH A . 
B 2 HOH 124 136 136 HOH HOH A . 
B 2 HOH 125 137 137 HOH HOH A . 
B 2 HOH 126 138 138 HOH HOH A . 
B 2 HOH 127 139 139 HOH HOH A . 
B 2 HOH 128 140 140 HOH HOH A . 
B 2 HOH 129 141 141 HOH HOH A . 
B 2 HOH 130 142 142 HOH HOH A . 
B 2 HOH 131 143 143 HOH HOH A . 
B 2 HOH 132 144 144 HOH HOH A . 
B 2 HOH 133 145 145 HOH HOH A . 
B 2 HOH 134 146 146 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6320  ? 
1 MORE         -50   ? 
1 'SSA (A^2)'  14350 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z  1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 4_555 y,x,-z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     110 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   B 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-11-29 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-01-31 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Derived calculations'      
4 3 'Structure model' 'Version format compliance' 
5 4 'Structure model' 'Structure summary'         
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            audit_author 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_audit_author.name' 
# 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         13.3000 
_pdbx_refine_tls.origin_y         35.5591 
_pdbx_refine_tls.origin_z         2.5897 
_pdbx_refine_tls.T[1][1]          -0.1546 
_pdbx_refine_tls.T[2][2]          -0.1820 
_pdbx_refine_tls.T[3][3]          -0.1974 
_pdbx_refine_tls.T[1][2]          -0.0511 
_pdbx_refine_tls.T[1][3]          -0.0541 
_pdbx_refine_tls.T[2][3]          0.0497 
_pdbx_refine_tls.L[1][1]          5.1292 
_pdbx_refine_tls.L[2][2]          2.5416 
_pdbx_refine_tls.L[3][3]          2.1981 
_pdbx_refine_tls.L[1][2]          -2.9337 
_pdbx_refine_tls.L[1][3]          -2.6095 
_pdbx_refine_tls.L[2][3]          1.6100 
_pdbx_refine_tls.S[1][1]          -0.1103 
_pdbx_refine_tls.S[1][2]          -0.0351 
_pdbx_refine_tls.S[1][3]          0.0396 
_pdbx_refine_tls.S[2][1]          0.1714 
_pdbx_refine_tls.S[2][2]          0.2059 
_pdbx_refine_tls.S[2][3]          0.0118 
_pdbx_refine_tls.S[3][1]          0.2014 
_pdbx_refine_tls.S[3][2]          -0.0734 
_pdbx_refine_tls.S[3][3]          -0.0956 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
# 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    A 
_pdbx_refine_tls_group.beg_auth_seq_id     324 
_pdbx_refine_tls_group.beg_label_asym_id   A 
_pdbx_refine_tls_group.beg_label_seq_id    2 
_pdbx_refine_tls_group.end_auth_asym_id    A 
_pdbx_refine_tls_group.end_auth_seq_id     452 
_pdbx_refine_tls_group.end_label_asym_id   A 
_pdbx_refine_tls_group.end_label_seq_id    130 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.selection_details   ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.2.0005  ? 1 
MOSFLM 'data reduction' .         ? 2 
CCP4   'data scaling'   '(SCALA)' ? 3 
PHASER phasing          .         ? 4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OD1 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   ASP 
_pdbx_validate_close_contact.auth_seq_id_1    416 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    73 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.09 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A MET 324 ? SD  ? A MET 2   SD  
2  1 Y 1 A MET 324 ? CE  ? A MET 2   CE  
3  1 Y 1 A GLN 328 ? CD  ? A GLN 6   CD  
4  1 Y 1 A GLN 328 ? OE1 ? A GLN 6   OE1 
5  1 Y 1 A GLN 328 ? NE2 ? A GLN 6   NE2 
6  1 Y 1 A LYS 331 ? CD  ? A LYS 9   CD  
7  1 Y 1 A LYS 331 ? CE  ? A LYS 9   CE  
8  1 Y 1 A LYS 331 ? NZ  ? A LYS 9   NZ  
9  1 Y 1 A ILE 340 ? CD1 ? A ILE 18  CD1 
10 1 Y 1 A ARG 352 ? CZ  ? A ARG 30  CZ  
11 1 Y 1 A ARG 352 ? NH1 ? A ARG 30  NH1 
12 1 Y 1 A ARG 352 ? NH2 ? A ARG 30  NH2 
13 1 Y 1 A ARG 383 ? CZ  ? A ARG 61  CZ  
14 1 Y 1 A ARG 383 ? NH1 ? A ARG 61  NH1 
15 1 Y 1 A ARG 383 ? NH2 ? A ARG 61  NH2 
16 1 Y 1 A GLU 423 ? OE2 ? A GLU 101 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 323 ? A SER 1   
2  1 Y 1 A ALA 453 ? A ALA 131 
3  1 Y 1 A LYS 454 ? A LYS 132 
4  1 Y 1 A LYS 455 ? A LYS 133 
5  1 Y 1 A LYS 456 ? A LYS 134 
6  1 Y 1 A GLY 457 ? A GLY 135 
7  1 Y 1 A LYS 458 ? A LYS 136 
8  1 Y 1 A SER 459 ? A SER 137 
9  1 Y 1 A LEU 460 ? A LEU 138 
10 1 Y 1 A ALA 461 ? A ALA 139 
11 1 Y 1 A GLY 462 ? A GLY 140 
12 1 Y 1 A LYS 463 ? A LYS 141 
13 1 Y 1 A ARG 464 ? A ARG 142 
14 1 Y 1 A LEU 465 ? A LEU 143 
15 1 Y 1 A THR 466 ? A THR 144 
16 1 Y 1 A GLY 467 ? A GLY 145 
17 1 Y 1 A LEU 468 ? A LEU 146 
18 1 Y 1 A MET 469 ? A MET 147 
19 1 Y 1 A GLN 470 ? A GLN 148 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#