data_2F1X
# 
_entry.id   2F1X 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.284 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2F1X         
RCSB  RCSB035350   
WWPDB D_1000035350 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2F1W 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2F1X 
_pdbx_database_status.recvd_initial_deposition_date   2005-11-15 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hu, M.'        1 
'Gu, L.'        2 
'Jeffrey, P.D.' 3 
'Shi, Y.'       4 
# 
_citation.id                        primary 
_citation.title                     
'Structural Basis of Competitive Recognition of p53 and MDM2 by HAUSP/USP7: Implications for the Regulation of the p53-MDM2 Pathway.' 
_citation.journal_abbrev            'Plos Biol.' 
_citation.journal_volume            4 
_citation.page_first                e27 
_citation.page_last                 e27 
_citation.year                      2006 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1544-9173 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16402859 
_citation.pdbx_database_id_DOI      10.1371/journal.pbio.0040027 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hu, M.'        1 
primary 'Gu, L.'        2 
primary 'Li, M.'        3 
primary 'Jeffrey, P.D.' 4 
primary 'Gu, W.'        5 
primary 'Shi, Y.'       6 
# 
_cell.entry_id           2F1X 
_cell.length_a           87.756 
_cell.length_b           39.560 
_cell.length_c           101.885 
_cell.angle_alpha        90.00 
_cell.angle_beta         105.32 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2F1X 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man HAUSP/USP7 18706.686 2   ? ? 'p53 peptide fusion with HAUSP N terminal' ? 
2 water   nat water      18.015    107 ? ? ?                                          ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSHMNTAEEDMEDDTSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYPDRPHQKSVGFFLQCNAESDST
SWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIDDDKVTFEVFVQADAPGGSRAHSS
H
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSHMNTAEEDMEDDTSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYPDRPHQKSVGFFLQCNAESDST
SWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIDDDKVTFEVFVQADAPGGSRAHSS
H
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   ASN n 
1 6   THR n 
1 7   ALA n 
1 8   GLU n 
1 9   GLU n 
1 10  ASP n 
1 11  MET n 
1 12  GLU n 
1 13  ASP n 
1 14  ASP n 
1 15  THR n 
1 16  SER n 
1 17  TRP n 
1 18  ARG n 
1 19  SER n 
1 20  GLU n 
1 21  ALA n 
1 22  THR n 
1 23  PHE n 
1 24  GLN n 
1 25  PHE n 
1 26  THR n 
1 27  VAL n 
1 28  GLU n 
1 29  ARG n 
1 30  PHE n 
1 31  SER n 
1 32  ARG n 
1 33  LEU n 
1 34  SER n 
1 35  GLU n 
1 36  SER n 
1 37  VAL n 
1 38  LEU n 
1 39  SER n 
1 40  PRO n 
1 41  PRO n 
1 42  CYS n 
1 43  PHE n 
1 44  VAL n 
1 45  ARG n 
1 46  ASN n 
1 47  LEU n 
1 48  PRO n 
1 49  TRP n 
1 50  LYS n 
1 51  ILE n 
1 52  MET n 
1 53  VAL n 
1 54  MET n 
1 55  PRO n 
1 56  ARG n 
1 57  PHE n 
1 58  TYR n 
1 59  PRO n 
1 60  ASP n 
1 61  ARG n 
1 62  PRO n 
1 63  HIS n 
1 64  GLN n 
1 65  LYS n 
1 66  SER n 
1 67  VAL n 
1 68  GLY n 
1 69  PHE n 
1 70  PHE n 
1 71  LEU n 
1 72  GLN n 
1 73  CYS n 
1 74  ASN n 
1 75  ALA n 
1 76  GLU n 
1 77  SER n 
1 78  ASP n 
1 79  SER n 
1 80  THR n 
1 81  SER n 
1 82  TRP n 
1 83  SER n 
1 84  CYS n 
1 85  HIS n 
1 86  ALA n 
1 87  GLN n 
1 88  ALA n 
1 89  VAL n 
1 90  LEU n 
1 91  LYS n 
1 92  ILE n 
1 93  ILE n 
1 94  ASN n 
1 95  TYR n 
1 96  ARG n 
1 97  ASP n 
1 98  ASP n 
1 99  GLU n 
1 100 LYS n 
1 101 SER n 
1 102 PHE n 
1 103 SER n 
1 104 ARG n 
1 105 ARG n 
1 106 ILE n 
1 107 SER n 
1 108 HIS n 
1 109 LEU n 
1 110 PHE n 
1 111 PHE n 
1 112 HIS n 
1 113 LYS n 
1 114 GLU n 
1 115 ASN n 
1 116 ASP n 
1 117 TRP n 
1 118 GLY n 
1 119 PHE n 
1 120 SER n 
1 121 ASN n 
1 122 PHE n 
1 123 MET n 
1 124 ALA n 
1 125 TRP n 
1 126 SER n 
1 127 GLU n 
1 128 VAL n 
1 129 THR n 
1 130 ASP n 
1 131 PRO n 
1 132 GLU n 
1 133 LYS n 
1 134 GLY n 
1 135 PHE n 
1 136 ILE n 
1 137 ASP n 
1 138 ASP n 
1 139 ASP n 
1 140 LYS n 
1 141 VAL n 
1 142 THR n 
1 143 PHE n 
1 144 GLU n 
1 145 VAL n 
1 146 PHE n 
1 147 VAL n 
1 148 GLN n 
1 149 ALA n 
1 150 ASP n 
1 151 ALA n 
1 152 PRO n 
1 153 GLY n 
1 154 GLY n 
1 155 SER n 
1 156 ARG n 
1 157 ALA n 
1 158 HIS n 
1 159 SER n 
1 160 SER n 
1 161 HIS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? 5   152 human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 Escherichia 
? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pGEX-2T ? ? 
1 2 sample ? 153 161 human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 Escherichia 
? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pGEX-2T ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP UBP7_HUMAN Q93009 1 
;NTAEEDMEDDTSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYPDRPHQKSVGFFLQCNAESDSTSWSC
HAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIDDDKVTFEVFVQADAP
;
53  ? 
2 UNP P53_HUMAN  P04637 1 GGSRAHSSH 360 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2F1X A 5   ? 152 ? Q93009 53  ? 200 ? 53  200 
2 2 2F1X A 153 ? 161 ? P04637 360 ? 368 ? 201 209 
3 1 2F1X B 5   ? 152 ? Q93009 53  ? 200 ? 53  200 
4 2 2F1X B 153 ? 161 ? P04637 360 ? 368 ? 201 209 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2F1X GLY A 1 ? UNP Q93009 ? ? 'CLONING ARTIFACT' 49 1 
1 2F1X SER A 2 ? UNP Q93009 ? ? 'CLONING ARTIFACT' 50 2 
1 2F1X HIS A 3 ? UNP Q93009 ? ? 'CLONING ARTIFACT' 51 3 
1 2F1X MET A 4 ? UNP Q93009 ? ? 'CLONING ARTIFACT' 52 4 
3 2F1X GLY B 1 ? UNP Q93009 ? ? 'CLONING ARTIFACT' 49 5 
3 2F1X SER B 2 ? UNP Q93009 ? ? 'CLONING ARTIFACT' 50 6 
3 2F1X HIS B 3 ? UNP Q93009 ? ? 'CLONING ARTIFACT' 51 7 
3 2F1X MET B 4 ? UNP Q93009 ? ? 'CLONING ARTIFACT' 52 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2F1X 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.28 
_exptl_crystal.density_percent_sol   46.02 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'PEG2000 monomethylether, calcium chloride, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2004-09-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'focusing mirror' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.1 
# 
_reflns.entry_id                     2F1X 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             99 
_reflns.d_resolution_high            2.3 
_reflns.number_obs                   15182 
_reflns.number_all                   16466 
_reflns.percent_possible_obs         92.2 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.3 
_reflns_shell.d_res_low              2.4 
_reflns_shell.percent_possible_all   73.6 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2F1X 
_refine.ls_number_reflns_obs                     13952 
_refine.ls_number_reflns_all                     15279 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20 
_refine.ls_d_res_high                            2.3 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.23 
_refine.ls_R_factor_all                          0.23 
_refine.ls_R_factor_R_work                       0.227 
_refine.ls_R_factor_R_free                       0.263 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  696 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB Entry: 2F1W' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2299 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             107 
_refine_hist.number_atoms_total               2406 
_refine_hist.d_res_high                       2.3 
_refine_hist.d_res_low                        20 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_angle_deg 1.52  ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d    0.007 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  2F1X 
_struct.title                     'Crystal structure of the TRAF-like domain of HAUSP/USP7 bound to a p53 peptide' 
_struct.pdbx_descriptor           HAUSP/USP7 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2F1X 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
'TRAF-like domain, p53 recognition, peptide binding, HAUSP, USP7, UBP, substrate recognition, Hydrolase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ARG A 29  ? LEU A 33  ? ARG A 77  LEU A 81  5 ? 5 
HELX_P HELX_P2 2 ASP A 97  ? SER A 101 ? ASP A 145 SER A 149 5 ? 5 
HELX_P HELX_P3 3 TRP A 125 ? THR A 129 ? TRP A 173 THR A 177 1 ? 5 
HELX_P HELX_P4 4 ASP B 97  ? SER B 101 ? ASP B 145 SER B 149 5 ? 5 
HELX_P HELX_P5 5 ALA B 124 ? THR B 129 ? ALA B 172 THR B 177 1 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          TYR 
_struct_mon_prot_cis.label_seq_id           58 
_struct_mon_prot_cis.label_asym_id          B 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           TYR 
_struct_mon_prot_cis.auth_seq_id            106 
_struct_mon_prot_cis.auth_asym_id           B 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    59 
_struct_mon_prot_cis.pdbx_label_asym_id_2   B 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     107 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    B 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.36 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 3 ? 
C ? 4 ? 
D ? 4 ? 
E ? 3 ? 
F ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 20  ? VAL A 27  ? GLU A 68  VAL A 75  
A 2 VAL A 141 ? ALA A 149 ? VAL A 189 ALA A 197 
A 3 SER A 83  ? ILE A 92  ? SER A 131 ILE A 140 
A 4 PHE A 102 ? PHE A 111 ? PHE A 150 PHE A 159 
B 1 VAL A 37  ? LEU A 38  ? VAL A 85  LEU A 86  
B 2 LEU A 47  ? ARG A 56  ? LEU A 95  ARG A 104 
B 3 CYS A 42  ? VAL A 44  ? CYS A 90  VAL A 92  
C 1 VAL A 37  ? LEU A 38  ? VAL A 85  LEU A 86  
C 2 LEU A 47  ? ARG A 56  ? LEU A 95  ARG A 104 
C 3 SER A 66  ? CYS A 73  ? SER A 114 CYS A 121 
C 4 ASP A 116 ? ALA A 124 ? ASP A 164 ALA A 172 
D 1 GLU B 20  ? GLU B 28  ? GLU B 68  GLU B 76  
D 2 LYS B 140 ? ALA B 149 ? LYS B 188 ALA B 197 
D 3 SER B 83  ? ILE B 92  ? SER B 131 ILE B 140 
D 4 PHE B 102 ? PHE B 111 ? PHE B 150 PHE B 159 
E 1 VAL B 37  ? LEU B 38  ? VAL B 85  LEU B 86  
E 2 LEU B 47  ? ARG B 56  ? LEU B 95  ARG B 104 
E 3 CYS B 42  ? VAL B 44  ? CYS B 90  VAL B 92  
F 1 VAL B 37  ? LEU B 38  ? VAL B 85  LEU B 86  
F 2 LEU B 47  ? ARG B 56  ? LEU B 95  ARG B 104 
F 3 SER B 66  ? CYS B 73  ? SER B 114 CYS B 121 
F 4 ASP B 116 ? PHE B 119 ? ASP B 164 PHE B 167 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 27  ? N VAL A 75  O VAL A 141 ? O VAL A 189 
A 2 3 O GLU A 144 ? O GLU A 192 N LYS A 91  ? N LYS A 139 
A 3 4 N LEU A 90  ? N LEU A 138 O ARG A 104 ? O ARG A 152 
B 1 2 N VAL A 37  ? N VAL A 85  O VAL A 53  ? O VAL A 101 
B 2 3 O TRP A 49  ? O TRP A 97  N CYS A 42  ? N CYS A 90  
C 1 2 N VAL A 37  ? N VAL A 85  O VAL A 53  ? O VAL A 101 
C 2 3 N LYS A 50  ? N LYS A 98  O GLN A 72  ? O GLN A 120 
C 3 4 N LEU A 71  ? N LEU A 119 O TRP A 117 ? O TRP A 165 
D 1 2 N PHE B 25  ? N PHE B 73  O PHE B 143 ? O PHE B 191 
D 2 3 O GLU B 144 ? O GLU B 192 N LYS B 91  ? N LYS B 139 
D 3 4 N CYS B 84  ? N CYS B 132 O PHE B 110 ? O PHE B 158 
E 1 2 N VAL B 37  ? N VAL B 85  O VAL B 53  ? O VAL B 101 
E 2 3 O TRP B 49  ? O TRP B 97  N CYS B 42  ? N CYS B 90  
F 1 2 N VAL B 37  ? N VAL B 85  O VAL B 53  ? O VAL B 101 
F 2 3 N MET B 52  ? N MET B 100 O PHE B 70  ? O PHE B 118 
F 3 4 N LEU B 71  ? N LEU B 119 O TRP B 117 ? O TRP B 165 
# 
_database_PDB_matrix.entry_id          2F1X 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2F1X 
_atom_sites.fract_transf_matrix[1][1]   0.011395 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003122 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.025278 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010177 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . THR A 1 15  ? -20.855 16.916 10.603 1.00 65.56  ? 63  THR A N   1 
ATOM   2    C CA  . THR A 1 15  ? -19.579 16.165 10.786 1.00 64.33  ? 63  THR A CA  1 
ATOM   3    C C   . THR A 1 15  ? -18.405 17.099 11.084 1.00 63.47  ? 63  THR A C   1 
ATOM   4    O O   . THR A 1 15  ? -17.382 16.670 11.619 1.00 58.76  ? 63  THR A O   1 
ATOM   5    C CB  . THR A 1 15  ? -19.228 15.347 9.535  1.00 65.47  ? 63  THR A CB  1 
ATOM   6    O OG1 . THR A 1 15  ? -17.980 14.669 9.740  1.00 64.86  ? 63  THR A OG1 1 
ATOM   7    C CG2 . THR A 1 15  ? -19.117 16.262 8.323  1.00 63.53  ? 63  THR A CG2 1 
ATOM   8    N N   . SER A 1 16  ? -18.553 18.371 10.736 1.00 61.08  ? 64  SER A N   1 
ATOM   9    C CA  . SER A 1 16  ? -17.494 19.338 10.975 1.00 63.06  ? 64  SER A CA  1 
ATOM   10   C C   . SER A 1 16  ? -17.694 19.975 12.342 1.00 63.63  ? 64  SER A C   1 
ATOM   11   O O   . SER A 1 16  ? -16.984 20.910 12.710 1.00 62.83  ? 64  SER A O   1 
ATOM   12   C CB  . SER A 1 16  ? -17.508 20.427 9.897  1.00 62.58  ? 64  SER A CB  1 
ATOM   13   O OG  . SER A 1 16  ? -18.625 21.289 10.046 1.00 65.20  ? 64  SER A OG  1 
ATOM   14   N N   . TRP A 1 17  ? -18.662 19.459 13.091 1.00 64.20  ? 65  TRP A N   1 
ATOM   15   C CA  . TRP A 1 17  ? -18.971 19.986 14.414 1.00 67.34  ? 65  TRP A CA  1 
ATOM   16   C C   . TRP A 1 17  ? -18.304 19.180 15.519 1.00 63.88  ? 65  TRP A C   1 
ATOM   17   O O   . TRP A 1 17  ? -18.375 19.537 16.691 1.00 66.75  ? 65  TRP A O   1 
ATOM   18   C CB  . TRP A 1 17  ? -20.494 20.000 14.630 1.00 75.67  ? 65  TRP A CB  1 
ATOM   19   C CG  . TRP A 1 17  ? -21.201 18.636 14.800 1.00 85.12  ? 65  TRP A CG  1 
ATOM   20   C CD1 . TRP A 1 17  ? -22.459 18.445 15.299 1.00 87.06  ? 65  TRP A CD1 1 
ATOM   21   C CD2 . TRP A 1 17  ? -20.691 17.313 14.507 1.00 88.75  ? 65  TRP A CD2 1 
ATOM   22   N NE1 . TRP A 1 17  ? -22.762 17.104 15.345 1.00 89.27  ? 65  TRP A NE1 1 
ATOM   23   C CE2 . TRP A 1 17  ? -21.698 16.388 14.867 1.00 89.81  ? 65  TRP A CE2 1 
ATOM   24   C CE3 . TRP A 1 17  ? -19.488 16.822 13.982 1.00 91.02  ? 65  TRP A CE3 1 
ATOM   25   C CZ2 . TRP A 1 17  ? -21.535 15.002 14.719 1.00 91.18  ? 65  TRP A CZ2 1 
ATOM   26   C CZ3 . TRP A 1 17  ? -19.326 15.440 13.838 1.00 91.59  ? 65  TRP A CZ3 1 
ATOM   27   C CH2 . TRP A 1 17  ? -20.344 14.551 14.206 1.00 91.20  ? 65  TRP A CH2 1 
ATOM   28   N N   . ARG A 1 18  ? -17.649 18.095 15.123 1.00 58.72  ? 66  ARG A N   1 
ATOM   29   C CA  . ARG A 1 18  ? -16.983 17.189 16.046 1.00 54.52  ? 66  ARG A CA  1 
ATOM   30   C C   . ARG A 1 18  ? -15.911 17.884 16.872 1.00 50.35  ? 66  ARG A C   1 
ATOM   31   O O   . ARG A 1 18  ? -15.307 18.865 16.436 1.00 50.91  ? 66  ARG A O   1 
ATOM   32   C CB  . ARG A 1 18  ? -16.381 16.025 15.265 1.00 54.08  ? 66  ARG A CB  1 
ATOM   33   C CG  . ARG A 1 18  ? -15.477 16.472 14.147 1.00 52.04  ? 66  ARG A CG  1 
ATOM   34   C CD  . ARG A 1 18  ? -15.015 15.318 13.295 1.00 54.21  ? 66  ARG A CD  1 
ATOM   35   N NE  . ARG A 1 18  ? -14.156 15.804 12.223 1.00 58.90  ? 66  ARG A NE  1 
ATOM   36   C CZ  . ARG A 1 18  ? -13.565 15.030 11.322 1.00 61.19  ? 66  ARG A CZ  1 
ATOM   37   N NH1 . ARG A 1 18  ? -12.797 15.576 10.387 1.00 62.21  ? 66  ARG A NH1 1 
ATOM   38   N NH2 . ARG A 1 18  ? -13.741 13.713 11.356 1.00 60.84  ? 66  ARG A NH2 1 
ATOM   39   N N   . SER A 1 19  ? -15.678 17.355 18.065 1.00 47.01  ? 67  SER A N   1 
ATOM   40   C CA  . SER A 1 19  ? -14.710 17.918 18.998 1.00 43.36  ? 67  SER A CA  1 
ATOM   41   C C   . SER A 1 19  ? -13.295 17.397 18.793 1.00 39.85  ? 67  SER A C   1 
ATOM   42   O O   . SER A 1 19  ? -12.331 17.973 19.295 1.00 38.58  ? 67  SER A O   1 
ATOM   43   C CB  . SER A 1 19  ? -15.165 17.610 20.415 1.00 41.80  ? 67  SER A CB  1 
ATOM   44   O OG  . SER A 1 19  ? -15.605 16.265 20.480 1.00 41.92  ? 67  SER A OG  1 
ATOM   45   N N   . GLU A 1 20  ? -13.163 16.302 18.060 1.00 38.35  ? 68  GLU A N   1 
ATOM   46   C CA  . GLU A 1 20  ? -11.838 15.754 17.829 1.00 38.26  ? 68  GLU A CA  1 
ATOM   47   C C   . GLU A 1 20  ? -11.709 15.013 16.512 1.00 35.85  ? 68  GLU A C   1 
ATOM   48   O O   . GLU A 1 20  ? -12.698 14.638 15.889 1.00 39.26  ? 68  GLU A O   1 
ATOM   49   C CB  . GLU A 1 20  ? -11.445 14.831 18.980 1.00 33.12  ? 68  GLU A CB  1 
ATOM   50   C CG  . GLU A 1 20  ? -12.293 13.591 19.111 1.00 32.27  ? 68  GLU A CG  1 
ATOM   51   C CD  . GLU A 1 20  ? -11.943 12.811 20.363 1.00 43.29  ? 68  GLU A CD  1 
ATOM   52   O OE1 . GLU A 1 20  ? -12.067 13.393 21.465 1.00 46.58  ? 68  GLU A OE1 1 
ATOM   53   O OE2 . GLU A 1 20  ? -11.536 11.629 20.250 1.00 45.03  ? 68  GLU A OE2 1 
ATOM   54   N N   . ALA A 1 21  ? -10.473 14.813 16.088 1.00 32.41  ? 69  ALA A N   1 
ATOM   55   C CA  . ALA A 1 21  ? -10.222 14.104 14.853 1.00 32.66  ? 69  ALA A CA  1 
ATOM   56   C C   . ALA A 1 21  ? -8.745  13.822 14.681 1.00 30.71  ? 69  ALA A C   1 
ATOM   57   O O   . ALA A 1 21  ? -7.893  14.461 15.303 1.00 35.96  ? 69  ALA A O   1 
ATOM   58   C CB  . ALA A 1 21  ? -10.731 14.913 13.673 1.00 31.89  ? 69  ALA A CB  1 
ATOM   59   N N   . THR A 1 22  ? -8.461  12.844 13.832 1.00 35.41  ? 70  THR A N   1 
ATOM   60   C CA  . THR A 1 22  ? -7.103  12.454 13.490 1.00 35.34  ? 70  THR A CA  1 
ATOM   61   C C   . THR A 1 22  ? -7.028  12.493 11.972 1.00 35.90  ? 70  THR A C   1 
ATOM   62   O O   . THR A 1 22  ? -7.839  11.863 11.289 1.00 33.15  ? 70  THR A O   1 
ATOM   63   C CB  . THR A 1 22  ? -6.797  11.040 13.968 1.00 34.61  ? 70  THR A CB  1 
ATOM   64   O OG1 . THR A 1 22  ? -6.976  10.983 15.386 1.00 38.08  ? 70  THR A OG1 1 
ATOM   65   C CG2 . THR A 1 22  ? -5.355  10.660 13.628 1.00 34.96  ? 70  THR A CG2 1 
ATOM   66   N N   . PHE A 1 23  ? -6.078  13.249 11.439 1.00 33.58  ? 71  PHE A N   1 
ATOM   67   C CA  . PHE A 1 23  ? -5.941  13.343 9.993  1.00 33.06  ? 71  PHE A CA  1 
ATOM   68   C C   . PHE A 1 23  ? -4.473  13.342 9.602  1.00 32.34  ? 71  PHE A C   1 
ATOM   69   O O   . PHE A 1 23  ? -3.619  13.749 10.384 1.00 34.18  ? 71  PHE A O   1 
ATOM   70   C CB  . PHE A 1 23  ? -6.663  14.595 9.471  1.00 31.51  ? 71  PHE A CB  1 
ATOM   71   C CG  . PHE A 1 23  ? -6.134  15.896 10.022 1.00 30.20  ? 71  PHE A CG  1 
ATOM   72   C CD1 . PHE A 1 23  ? -5.383  16.755 9.217  1.00 29.20  ? 71  PHE A CD1 1 
ATOM   73   C CD2 . PHE A 1 23  ? -6.424  16.285 11.326 1.00 29.82  ? 71  PHE A CD2 1 
ATOM   74   C CE1 . PHE A 1 23  ? -4.930  17.987 9.703  1.00 30.71  ? 71  PHE A CE1 1 
ATOM   75   C CE2 . PHE A 1 23  ? -5.976  17.519 11.831 1.00 31.32  ? 71  PHE A CE2 1 
ATOM   76   C CZ  . PHE A 1 23  ? -5.229  18.370 11.015 1.00 32.79  ? 71  PHE A CZ  1 
ATOM   77   N N   . GLN A 1 24  ? -4.179  12.866 8.399  1.00 33.23  ? 72  GLN A N   1 
ATOM   78   C CA  . GLN A 1 24  ? -2.798  12.797 7.945  1.00 36.79  ? 72  GLN A CA  1 
ATOM   79   C C   . GLN A 1 24  ? -2.469  13.721 6.778  1.00 36.61  ? 72  GLN A C   1 
ATOM   80   O O   . GLN A 1 24  ? -3.355  14.324 6.159  1.00 35.74  ? 72  GLN A O   1 
ATOM   81   C CB  . GLN A 1 24  ? -2.444  11.361 7.553  1.00 38.01  ? 72  GLN A CB  1 
ATOM   82   C CG  . GLN A 1 24  ? -2.853  10.318 8.564  1.00 46.27  ? 72  GLN A CG  1 
ATOM   83   C CD  . GLN A 1 24  ? -2.253  8.961  8.269  1.00 48.77  ? 72  GLN A CD  1 
ATOM   84   O OE1 . GLN A 1 24  ? -2.174  8.546  7.113  1.00 53.69  ? 72  GLN A OE1 1 
ATOM   85   N NE2 . GLN A 1 24  ? -1.838  8.253  9.317  1.00 47.94  ? 72  GLN A NE2 1 
ATOM   86   N N   . PHE A 1 25  ? -1.176  13.802 6.483  1.00 33.66  ? 73  PHE A N   1 
ATOM   87   C CA  . PHE A 1 25  ? -0.667  14.631 5.403  1.00 32.32  ? 73  PHE A CA  1 
ATOM   88   C C   . PHE A 1 25  ? 0.689   14.090 4.976  1.00 34.97  ? 73  PHE A C   1 
ATOM   89   O O   . PHE A 1 25  ? 1.655   14.107 5.743  1.00 37.12  ? 73  PHE A O   1 
ATOM   90   C CB  . PHE A 1 25  ? -0.519  16.078 5.881  1.00 32.08  ? 73  PHE A CB  1 
ATOM   91   C CG  . PHE A 1 25  ? 0.075   17.005 4.858  1.00 29.95  ? 73  PHE A CG  1 
ATOM   92   C CD1 . PHE A 1 25  ? -0.376  16.997 3.537  1.00 24.91  ? 73  PHE A CD1 1 
ATOM   93   C CD2 . PHE A 1 25  ? 1.027   17.951 5.236  1.00 22.22  ? 73  PHE A CD2 1 
ATOM   94   C CE1 . PHE A 1 25  ? 0.114   17.934 2.607  1.00 23.71  ? 73  PHE A CE1 1 
ATOM   95   C CE2 . PHE A 1 25  ? 1.514   18.881 4.320  1.00 23.81  ? 73  PHE A CE2 1 
ATOM   96   C CZ  . PHE A 1 25  ? 1.058   18.876 3.005  1.00 20.19  ? 73  PHE A CZ  1 
ATOM   97   N N   . THR A 1 26  ? 0.759   13.604 3.746  1.00 34.14  ? 74  THR A N   1 
ATOM   98   C CA  . THR A 1 26  ? 1.997   13.069 3.230  1.00 32.89  ? 74  THR A CA  1 
ATOM   99   C C   . THR A 1 26  ? 2.715   14.119 2.393  1.00 32.59  ? 74  THR A C   1 
ATOM   100  O O   . THR A 1 26  ? 2.105   14.796 1.562  1.00 35.34  ? 74  THR A O   1 
ATOM   101  C CB  . THR A 1 26  ? 1.738   11.820 2.363  1.00 35.93  ? 74  THR A CB  1 
ATOM   102  O OG1 . THR A 1 26  ? 1.112   10.807 3.161  1.00 38.90  ? 74  THR A OG1 1 
ATOM   103  C CG2 . THR A 1 26  ? 3.058   11.274 1.814  1.00 39.91  ? 74  THR A CG2 1 
ATOM   104  N N   . VAL A 1 27  ? 4.012   14.264 2.632  1.00 30.97  ? 75  VAL A N   1 
ATOM   105  C CA  . VAL A 1 27  ? 4.812   15.208 1.872  1.00 32.11  ? 75  VAL A CA  1 
ATOM   106  C C   . VAL A 1 27  ? 5.755   14.373 1.003  1.00 35.56  ? 75  VAL A C   1 
ATOM   107  O O   . VAL A 1 27  ? 6.582   13.599 1.505  1.00 35.46  ? 75  VAL A O   1 
ATOM   108  C CB  . VAL A 1 27  ? 5.625   16.163 2.795  1.00 30.71  ? 75  VAL A CB  1 
ATOM   109  C CG1 . VAL A 1 27  ? 6.553   17.020 1.957  1.00 33.22  ? 75  VAL A CG1 1 
ATOM   110  C CG2 . VAL A 1 27  ? 4.679   17.077 3.589  1.00 24.16  ? 75  VAL A CG2 1 
ATOM   111  N N   . GLU A 1 28  ? 5.605   14.532 -0.307 1.00 32.23  ? 76  GLU A N   1 
ATOM   112  C CA  . GLU A 1 28  ? 6.392   13.802 -1.289 1.00 33.06  ? 76  GLU A CA  1 
ATOM   113  C C   . GLU A 1 28  ? 7.702   14.534 -1.555 1.00 31.57  ? 76  GLU A C   1 
ATOM   114  O O   . GLU A 1 28  ? 7.828   15.710 -1.225 1.00 28.73  ? 76  GLU A O   1 
ATOM   115  C CB  . GLU A 1 28  ? 5.587   13.670 -2.596 1.00 33.85  ? 76  GLU A CB  1 
ATOM   116  C CG  . GLU A 1 28  ? 4.115   13.199 -2.432 1.00 35.81  ? 76  GLU A CG  1 
ATOM   117  C CD  . GLU A 1 28  ? 3.128   14.328 -2.006 1.00 39.75  ? 76  GLU A CD  1 
ATOM   118  O OE1 . GLU A 1 28  ? 1.899   14.077 -1.948 1.00 37.94  ? 76  GLU A OE1 1 
ATOM   119  O OE2 . GLU A 1 28  ? 3.572   15.462 -1.727 1.00 36.45  ? 76  GLU A OE2 1 
ATOM   120  N N   . ARG A 1 29  ? 8.681   13.829 -2.123 1.00 31.14  ? 77  ARG A N   1 
ATOM   121  C CA  . ARG A 1 29  ? 9.974   14.433 -2.460 1.00 32.06  ? 77  ARG A CA  1 
ATOM   122  C C   . ARG A 1 29  ? 10.489  15.252 -1.285 1.00 36.01  ? 77  ARG A C   1 
ATOM   123  O O   . ARG A 1 29  ? 11.060  16.340 -1.441 1.00 34.61  ? 77  ARG A O   1 
ATOM   124  C CB  . ARG A 1 29  ? 9.806   15.317 -3.704 1.00 32.63  ? 77  ARG A CB  1 
ATOM   125  C CG  . ARG A 1 29  ? 9.575   14.524 -4.994 1.00 31.69  ? 77  ARG A CG  1 
ATOM   126  C CD  . ARG A 1 29  ? 9.003   15.379 -6.118 1.00 34.42  ? 77  ARG A CD  1 
ATOM   127  N NE  . ARG A 1 29  ? 7.542   15.392 -6.082 1.00 41.86  ? 77  ARG A NE  1 
ATOM   128  C CZ  . ARG A 1 29  ? 6.817   16.443 -5.722 1.00 43.59  ? 77  ARG A CZ  1 
ATOM   129  N NH1 . ARG A 1 29  ? 7.424   17.567 -5.371 1.00 50.01  ? 77  ARG A NH1 1 
ATOM   130  N NH2 . ARG A 1 29  ? 5.490   16.371 -5.711 1.00 48.94  ? 77  ARG A NH2 1 
ATOM   131  N N   . PHE A 1 30  ? 10.294  14.684 -0.102 1.00 36.84  ? 78  PHE A N   1 
ATOM   132  C CA  . PHE A 1 30  ? 10.657  15.316 1.148  1.00 37.06  ? 78  PHE A CA  1 
ATOM   133  C C   . PHE A 1 30  ? 12.091  15.779 1.305  1.00 36.41  ? 78  PHE A C   1 
ATOM   134  O O   . PHE A 1 30  ? 12.333  16.865 1.826  1.00 37.67  ? 78  PHE A O   1 
ATOM   135  C CB  . PHE A 1 30  ? 10.299  14.395 2.310  1.00 35.51  ? 78  PHE A CB  1 
ATOM   136  C CG  . PHE A 1 30  ? 10.350  15.076 3.632  1.00 39.08  ? 78  PHE A CG  1 
ATOM   137  C CD1 . PHE A 1 30  ? 9.318   15.927 4.024  1.00 37.95  ? 78  PHE A CD1 1 
ATOM   138  C CD2 . PHE A 1 30  ? 11.450  14.919 4.469  1.00 35.18  ? 78  PHE A CD2 1 
ATOM   139  C CE1 . PHE A 1 30  ? 9.382   16.611 5.229  1.00 38.80  ? 78  PHE A CE1 1 
ATOM   140  C CE2 . PHE A 1 30  ? 11.521  15.602 5.674  1.00 37.95  ? 78  PHE A CE2 1 
ATOM   141  C CZ  . PHE A 1 30  ? 10.484  16.449 6.056  1.00 35.36  ? 78  PHE A CZ  1 
ATOM   142  N N   . SER A 1 31  ? 13.043  14.956 0.885  1.00 40.77  ? 79  SER A N   1 
ATOM   143  C CA  . SER A 1 31  ? 14.453  15.311 1.012  1.00 45.64  ? 79  SER A CA  1 
ATOM   144  C C   . SER A 1 31  ? 14.773  16.593 0.253  1.00 48.50  ? 79  SER A C   1 
ATOM   145  O O   . SER A 1 31  ? 15.736  17.283 0.575  1.00 51.83  ? 79  SER A O   1 
ATOM   146  C CB  . SER A 1 31  ? 15.338  14.190 0.479  1.00 47.12  ? 79  SER A CB  1 
ATOM   147  O OG  . SER A 1 31  ? 15.294  14.156 -0.939 1.00 54.99  ? 79  SER A OG  1 
ATOM   148  N N   . ARG A 1 32  ? 13.970  16.911 -0.758 1.00 53.12  ? 80  ARG A N   1 
ATOM   149  C CA  . ARG A 1 32  ? 14.199  18.123 -1.540 1.00 58.20  ? 80  ARG A CA  1 
ATOM   150  C C   . ARG A 1 32  ? 13.438  19.334 -0.996 1.00 56.73  ? 80  ARG A C   1 
ATOM   151  O O   . ARG A 1 32  ? 13.652  20.457 -1.453 1.00 59.80  ? 80  ARG A O   1 
ATOM   152  C CB  . ARG A 1 32  ? 13.793  17.911 -3.002 1.00 63.25  ? 80  ARG A CB  1 
ATOM   153  C CG  . ARG A 1 32  ? 14.493  16.771 -3.732 1.00 68.30  ? 80  ARG A CG  1 
ATOM   154  C CD  . ARG A 1 32  ? 14.033  16.756 -5.183 1.00 72.01  ? 80  ARG A CD  1 
ATOM   155  N NE  . ARG A 1 32  ? 13.843  15.406 -5.708 1.00 77.20  ? 80  ARG A NE  1 
ATOM   156  C CZ  . ARG A 1 32  ? 13.209  15.133 -6.847 1.00 78.88  ? 80  ARG A CZ  1 
ATOM   157  N NH1 . ARG A 1 32  ? 12.705  16.120 -7.579 1.00 77.20  ? 80  ARG A NH1 1 
ATOM   158  N NH2 . ARG A 1 32  ? 13.074  13.876 -7.254 1.00 78.45  ? 80  ARG A NH2 1 
ATOM   159  N N   . LEU A 1 33  ? 12.545  19.110 -0.035 1.00 50.69  ? 81  LEU A N   1 
ATOM   160  C CA  . LEU A 1 33  ? 11.770  20.207 0.533  1.00 47.18  ? 81  LEU A CA  1 
ATOM   161  C C   . LEU A 1 33  ? 12.705  21.346 0.954  1.00 47.90  ? 81  LEU A C   1 
ATOM   162  O O   . LEU A 1 33  ? 13.632  21.157 1.746  1.00 47.38  ? 81  LEU A O   1 
ATOM   163  C CB  . LEU A 1 33  ? 10.952  19.717 1.730  1.00 39.79  ? 81  LEU A CB  1 
ATOM   164  C CG  . LEU A 1 33  ? 9.856   20.686 2.172  1.00 41.58  ? 81  LEU A CG  1 
ATOM   165  C CD1 . LEU A 1 33  ? 8.909   20.903 1.013  1.00 36.08  ? 81  LEU A CD1 1 
ATOM   166  C CD2 . LEU A 1 33  ? 9.110   20.149 3.395  1.00 32.37  ? 81  LEU A CD2 1 
ATOM   167  N N   . SER A 1 34  ? 12.459  22.527 0.403  1.00 46.34  ? 82  SER A N   1 
ATOM   168  C CA  . SER A 1 34  ? 13.281  23.691 0.691  1.00 49.44  ? 82  SER A CA  1 
ATOM   169  C C   . SER A 1 34  ? 12.376  24.848 1.038  1.00 48.52  ? 82  SER A C   1 
ATOM   170  O O   . SER A 1 34  ? 12.825  25.986 1.138  1.00 47.21  ? 82  SER A O   1 
ATOM   171  C CB  . SER A 1 34  ? 14.117  24.066 -0.537 1.00 53.95  ? 82  SER A CB  1 
ATOM   172  O OG  . SER A 1 34  ? 13.281  24.390 -1.644 1.00 58.61  ? 82  SER A OG  1 
ATOM   173  N N   . GLU A 1 35  ? 11.096  24.544 1.205  1.00 47.08  ? 83  GLU A N   1 
ATOM   174  C CA  . GLU A 1 35  ? 10.099  25.548 1.524  1.00 44.61  ? 83  GLU A CA  1 
ATOM   175  C C   . GLU A 1 35  ? 8.893   24.922 2.221  1.00 43.16  ? 83  GLU A C   1 
ATOM   176  O O   . GLU A 1 35  ? 8.762   23.702 2.304  1.00 39.85  ? 83  GLU A O   1 
ATOM   177  C CB  . GLU A 1 35  ? 9.644   26.248 0.249  1.00 45.21  ? 83  GLU A CB  1 
ATOM   178  C CG  . GLU A 1 35  ? 8.933   25.335 -0.730 1.00 48.00  ? 83  GLU A CG  1 
ATOM   179  C CD  . GLU A 1 35  ? 8.406   26.089 -1.931 1.00 49.12  ? 83  GLU A CD  1 
ATOM   180  O OE1 . GLU A 1 35  ? 9.182   26.333 -2.874 1.00 49.46  ? 83  GLU A OE1 1 
ATOM   181  O OE2 . GLU A 1 35  ? 7.211   26.456 -1.924 1.00 56.65  ? 83  GLU A OE2 1 
ATOM   182  N N   . SER A 1 36  ? 8.001   25.776 2.698  1.00 38.53  ? 84  SER A N   1 
ATOM   183  C CA  . SER A 1 36  ? 6.820   25.336 3.417  1.00 38.41  ? 84  SER A CA  1 
ATOM   184  C C   . SER A 1 36  ? 5.693   24.771 2.555  1.00 36.82  ? 84  SER A C   1 
ATOM   185  O O   . SER A 1 36  ? 5.424   25.282 1.467  1.00 41.37  ? 84  SER A O   1 
ATOM   186  C CB  . SER A 1 36  ? 6.287   26.503 4.227  1.00 35.42  ? 84  SER A CB  1 
ATOM   187  O OG  . SER A 1 36  ? 5.144   26.116 4.951  1.00 47.59  ? 84  SER A OG  1 
ATOM   188  N N   . VAL A 1 37  ? 5.041   23.713 3.037  1.00 31.32  ? 85  VAL A N   1 
ATOM   189  C CA  . VAL A 1 37  ? 3.914   23.116 2.319  1.00 29.90  ? 85  VAL A CA  1 
ATOM   190  C C   . VAL A 1 37  ? 2.789   23.049 3.312  1.00 29.96  ? 85  VAL A C   1 
ATOM   191  O O   . VAL A 1 37  ? 3.030   22.934 4.512  1.00 32.28  ? 85  VAL A O   1 
ATOM   192  C CB  . VAL A 1 37  ? 4.207   21.688 1.780  1.00 32.45  ? 85  VAL A CB  1 
ATOM   193  C CG1 . VAL A 1 37  ? 5.068   21.777 0.518  1.00 30.71  ? 85  VAL A CG1 1 
ATOM   194  C CG2 . VAL A 1 37  ? 4.903   20.853 2.848  1.00 28.06  ? 85  VAL A CG2 1 
ATOM   195  N N   . LEU A 1 38  ? 1.559   23.118 2.820  1.00 26.42  ? 86  LEU A N   1 
ATOM   196  C CA  . LEU A 1 38  ? 0.405   23.111 3.692  1.00 26.83  ? 86  LEU A CA  1 
ATOM   197  C C   . LEU A 1 38  ? -0.588  22.050 3.250  1.00 29.83  ? 86  LEU A C   1 
ATOM   198  O O   . LEU A 1 38  ? -0.787  21.845 2.064  1.00 36.57  ? 86  LEU A O   1 
ATOM   199  C CB  . LEU A 1 38  ? -0.238  24.493 3.655  1.00 29.79  ? 86  LEU A CB  1 
ATOM   200  C CG  . LEU A 1 38  ? -1.277  24.846 4.706  1.00 30.88  ? 86  LEU A CG  1 
ATOM   201  C CD1 . LEU A 1 38  ? -0.579  25.121 6.025  1.00 32.66  ? 86  LEU A CD1 1 
ATOM   202  C CD2 . LEU A 1 38  ? -2.040  26.084 4.253  1.00 33.10  ? 86  LEU A CD2 1 
ATOM   203  N N   . SER A 1 39  ? -1.220  21.384 4.206  1.00 28.09  ? 87  SER A N   1 
ATOM   204  C CA  . SER A 1 39  ? -2.177  20.331 3.891  1.00 31.39  ? 87  SER A CA  1 
ATOM   205  C C   . SER A 1 39  ? -3.598  20.830 3.677  1.00 33.13  ? 87  SER A C   1 
ATOM   206  O O   . SER A 1 39  ? -3.942  21.964 4.028  1.00 37.04  ? 87  SER A O   1 
ATOM   207  C CB  . SER A 1 39  ? -2.235  19.323 5.035  1.00 28.11  ? 87  SER A CB  1 
ATOM   208  O OG  . SER A 1 39  ? -3.087  19.814 6.058  1.00 26.76  ? 87  SER A OG  1 
ATOM   209  N N   . PRO A 1 40  ? -4.446  19.987 3.078  1.00 30.23  ? 88  PRO A N   1 
ATOM   210  C CA  . PRO A 1 40  ? -5.815  20.465 2.901  1.00 33.33  ? 88  PRO A CA  1 
ATOM   211  C C   . PRO A 1 40  ? -6.406  20.472 4.317  1.00 36.34  ? 88  PRO A C   1 
ATOM   212  O O   . PRO A 1 40  ? -5.887  19.801 5.208  1.00 38.26  ? 88  PRO A O   1 
ATOM   213  C CB  . PRO A 1 40  ? -6.440  19.415 1.974  1.00 28.79  ? 88  PRO A CB  1 
ATOM   214  C CG  . PRO A 1 40  ? -5.605  18.191 2.199  1.00 31.32  ? 88  PRO A CG  1 
ATOM   215  C CD  . PRO A 1 40  ? -4.206  18.755 2.314  1.00 30.45  ? 88  PRO A CD  1 
ATOM   216  N N   . PRO A 1 41  ? -7.487  21.230 4.545  1.00 36.67  ? 89  PRO A N   1 
ATOM   217  C CA  . PRO A 1 41  ? -8.097  21.297 5.872  1.00 34.88  ? 89  PRO A CA  1 
ATOM   218  C C   . PRO A 1 41  ? -8.850  20.064 6.338  1.00 35.50  ? 89  PRO A C   1 
ATOM   219  O O   . PRO A 1 41  ? -9.284  19.241 5.541  1.00 35.98  ? 89  PRO A O   1 
ATOM   220  C CB  . PRO A 1 41  ? -9.025  22.495 5.751  1.00 31.77  ? 89  PRO A CB  1 
ATOM   221  C CG  . PRO A 1 41  ? -9.524  22.348 4.361  1.00 36.18  ? 89  PRO A CG  1 
ATOM   222  C CD  . PRO A 1 41  ? -8.241  22.067 3.592  1.00 36.62  ? 89  PRO A CD  1 
ATOM   223  N N   . CYS A 1 42  ? -8.975  19.957 7.657  1.00 32.85  ? 90  CYS A N   1 
ATOM   224  C CA  . CYS A 1 42  ? -9.714  18.896 8.319  1.00 33.29  ? 90  CYS A CA  1 
ATOM   225  C C   . CYS A 1 42  ? -10.543 19.688 9.328  1.00 35.38  ? 90  CYS A C   1 
ATOM   226  O O   . CYS A 1 42  ? -9.996  20.447 10.123 1.00 38.06  ? 90  CYS A O   1 
ATOM   227  C CB  . CYS A 1 42  ? -8.781  17.924 9.046  1.00 32.17  ? 90  CYS A CB  1 
ATOM   228  S SG  . CYS A 1 42  ? -9.697  16.733 10.087 1.00 32.55  ? 90  CYS A SG  1 
ATOM   229  N N   . PHE A 1 43  ? -11.859 19.530 9.285  1.00 36.03  ? 91  PHE A N   1 
ATOM   230  C CA  . PHE A 1 43  ? -12.722 20.283 10.179 1.00 35.65  ? 91  PHE A CA  1 
ATOM   231  C C   . PHE A 1 43  ? -13.029 19.634 11.502 1.00 34.99  ? 91  PHE A C   1 
ATOM   232  O O   . PHE A 1 43  ? -13.339 18.448 11.577 1.00 37.62  ? 91  PHE A O   1 
ATOM   233  C CB  . PHE A 1 43  ? -14.030 20.647 9.479  1.00 31.23  ? 91  PHE A CB  1 
ATOM   234  C CG  . PHE A 1 43  ? -13.847 21.605 8.349  1.00 32.48  ? 91  PHE A CG  1 
ATOM   235  C CD1 . PHE A 1 43  ? -13.352 21.165 7.131  1.00 30.09  ? 91  PHE A CD1 1 
ATOM   236  C CD2 . PHE A 1 43  ? -14.134 22.959 8.515  1.00 33.65  ? 91  PHE A CD2 1 
ATOM   237  C CE1 . PHE A 1 43  ? -13.140 22.059 6.083  1.00 38.70  ? 91  PHE A CE1 1 
ATOM   238  C CE2 . PHE A 1 43  ? -13.929 23.866 7.479  1.00 35.54  ? 91  PHE A CE2 1 
ATOM   239  C CZ  . PHE A 1 43  ? -13.431 23.419 6.258  1.00 36.89  ? 91  PHE A CZ  1 
ATOM   240  N N   . VAL A 1 44  ? -12.931 20.462 12.537 1.00 33.35  ? 92  VAL A N   1 
ATOM   241  C CA  . VAL A 1 44  ? -13.185 20.105 13.927 1.00 31.08  ? 92  VAL A CA  1 
ATOM   242  C C   . VAL A 1 44  ? -13.782 21.376 14.544 1.00 31.69  ? 92  VAL A C   1 
ATOM   243  O O   . VAL A 1 44  ? -13.262 22.473 14.328 1.00 28.84  ? 92  VAL A O   1 
ATOM   244  C CB  . VAL A 1 44  ? -11.871 19.742 14.648 1.00 30.14  ? 92  VAL A CB  1 
ATOM   245  C CG1 . VAL A 1 44  ? -12.124 19.573 16.130 1.00 30.20  ? 92  VAL A CG1 1 
ATOM   246  C CG2 . VAL A 1 44  ? -11.295 18.451 14.059 1.00 24.76  ? 92  VAL A CG2 1 
ATOM   247  N N   . ARG A 1 45  ? -14.873 21.231 15.289 1.00 32.48  ? 93  ARG A N   1 
ATOM   248  C CA  . ARG A 1 45  ? -15.543 22.375 15.901 1.00 36.71  ? 93  ARG A CA  1 
ATOM   249  C C   . ARG A 1 45  ? -15.799 23.484 14.871 1.00 40.11  ? 93  ARG A C   1 
ATOM   250  O O   . ARG A 1 45  ? -15.647 24.676 15.163 1.00 41.17  ? 93  ARG A O   1 
ATOM   251  C CB  . ARG A 1 45  ? -14.712 22.925 17.060 1.00 35.43  ? 93  ARG A CB  1 
ATOM   252  C CG  . ARG A 1 45  ? -14.551 21.967 18.234 1.00 37.70  ? 93  ARG A CG  1 
ATOM   253  C CD  . ARG A 1 45  ? -15.891 21.579 18.851 1.00 39.80  ? 93  ARG A CD  1 
ATOM   254  N NE  . ARG A 1 45  ? -15.705 20.889 20.126 1.00 40.58  ? 93  ARG A NE  1 
ATOM   255  C CZ  . ARG A 1 45  ? -16.683 20.550 20.965 1.00 44.12  ? 93  ARG A CZ  1 
ATOM   256  N NH1 . ARG A 1 45  ? -17.951 20.828 20.675 1.00 40.88  ? 93  ARG A NH1 1 
ATOM   257  N NH2 . ARG A 1 45  ? -16.386 19.947 22.113 1.00 37.38  ? 93  ARG A NH2 1 
ATOM   258  N N   . ASN A 1 46  ? -16.172 23.071 13.663 1.00 42.02  ? 94  ASN A N   1 
ATOM   259  C CA  . ASN A 1 46  ? -16.475 23.983 12.561 1.00 43.80  ? 94  ASN A CA  1 
ATOM   260  C C   . ASN A 1 46  ? -15.372 24.940 12.188 1.00 42.12  ? 94  ASN A C   1 
ATOM   261  O O   . ASN A 1 46  ? -15.636 26.063 11.748 1.00 41.95  ? 94  ASN A O   1 
ATOM   262  C CB  . ASN A 1 46  ? -17.746 24.778 12.848 1.00 45.77  ? 94  ASN A CB  1 
ATOM   263  C CG  . ASN A 1 46  ? -18.995 23.997 12.516 1.00 54.13  ? 94  ASN A CG  1 
ATOM   264  O OD1 . ASN A 1 46  ? -19.383 23.079 13.243 1.00 57.67  ? 94  ASN A OD1 1 
ATOM   265  N ND2 . ASN A 1 46  ? -19.622 24.341 11.396 1.00 55.34  ? 94  ASN A ND2 1 
ATOM   266  N N   . LEU A 1 47  ? -14.137 24.485 12.349 1.00 38.09  ? 95  LEU A N   1 
ATOM   267  C CA  . LEU A 1 47  ? -12.978 25.292 12.013 1.00 35.08  ? 95  LEU A CA  1 
ATOM   268  C C   . LEU A 1 47  ? -12.087 24.451 11.125 1.00 33.23  ? 95  LEU A C   1 
ATOM   269  O O   . LEU A 1 47  ? -12.069 23.230 11.235 1.00 32.93  ? 95  LEU A O   1 
ATOM   270  C CB  . LEU A 1 47  ? -12.221 25.684 13.278 1.00 35.25  ? 95  LEU A CB  1 
ATOM   271  C CG  . LEU A 1 47  ? -12.993 26.567 14.247 1.00 37.24  ? 95  LEU A CG  1 
ATOM   272  C CD1 . LEU A 1 47  ? -12.168 26.775 15.504 1.00 35.46  ? 95  LEU A CD1 1 
ATOM   273  C CD2 . LEU A 1 47  ? -13.303 27.896 13.574 1.00 34.61  ? 95  LEU A CD2 1 
ATOM   274  N N   . PRO A 1 48  ? -11.362 25.089 10.204 1.00 32.54  ? 96  PRO A N   1 
ATOM   275  C CA  . PRO A 1 48  ? -10.480 24.326 9.322  1.00 32.44  ? 96  PRO A CA  1 
ATOM   276  C C   . PRO A 1 48  ? -9.076  24.197 9.928  1.00 34.62  ? 96  PRO A C   1 
ATOM   277  O O   . PRO A 1 48  ? -8.392  25.204 10.138 1.00 29.23  ? 96  PRO A O   1 
ATOM   278  C CB  . PRO A 1 48  ? -10.487 25.157 8.046  1.00 29.40  ? 96  PRO A CB  1 
ATOM   279  C CG  . PRO A 1 48  ? -10.521 26.560 8.576  1.00 31.04  ? 96  PRO A CG  1 
ATOM   280  C CD  . PRO A 1 48  ? -11.537 26.471 9.715  1.00 32.01  ? 96  PRO A CD  1 
ATOM   281  N N   . TRP A 1 49  ? -8.656  22.968 10.227 1.00 31.87  ? 97  TRP A N   1 
ATOM   282  C CA  . TRP A 1 49  ? -7.319  22.752 10.792 1.00 34.95  ? 97  TRP A CA  1 
ATOM   283  C C   . TRP A 1 49  ? -6.364  22.204 9.735  1.00 30.94  ? 97  TRP A C   1 
ATOM   284  O O   . TRP A 1 49  ? -6.756  21.386 8.904  1.00 31.48  ? 97  TRP A O   1 
ATOM   285  C CB  . TRP A 1 49  ? -7.370  21.771 11.963 1.00 35.24  ? 97  TRP A CB  1 
ATOM   286  C CG  . TRP A 1 49  ? -8.291  22.184 13.056 1.00 36.90  ? 97  TRP A CG  1 
ATOM   287  C CD1 . TRP A 1 49  ? -9.652  22.072 13.068 1.00 36.90  ? 97  TRP A CD1 1 
ATOM   288  C CD2 . TRP A 1 49  ? -7.923  22.768 14.311 1.00 37.09  ? 97  TRP A CD2 1 
ATOM   289  N NE1 . TRP A 1 49  ? -10.157 22.545 14.256 1.00 37.71  ? 97  TRP A NE1 1 
ATOM   290  C CE2 . TRP A 1 49  ? -9.116  22.981 15.038 1.00 38.05  ? 97  TRP A CE2 1 
ATOM   291  C CE3 . TRP A 1 49  ? -6.698  23.133 14.892 1.00 35.66  ? 97  TRP A CE3 1 
ATOM   292  C CZ2 . TRP A 1 49  ? -9.122  23.543 16.320 1.00 35.90  ? 97  TRP A CZ2 1 
ATOM   293  C CZ3 . TRP A 1 49  ? -6.705  23.693 16.170 1.00 38.01  ? 97  TRP A CZ3 1 
ATOM   294  C CH2 . TRP A 1 49  ? -7.911  23.891 16.867 1.00 34.11  ? 97  TRP A CH2 1 
ATOM   295  N N   . LYS A 1 50  ? -5.110  22.647 9.775  1.00 28.75  ? 98  LYS A N   1 
ATOM   296  C CA  . LYS A 1 50  ? -4.121  22.182 8.814  1.00 25.48  ? 98  LYS A CA  1 
ATOM   297  C C   . LYS A 1 50  ? -2.748  21.878 9.408  1.00 28.44  ? 98  LYS A C   1 
ATOM   298  O O   . LYS A 1 50  ? -2.365  22.394 10.460 1.00 24.83  ? 98  LYS A O   1 
ATOM   299  C CB  . LYS A 1 50  ? -3.941  23.214 7.700  1.00 24.23  ? 98  LYS A CB  1 
ATOM   300  C CG  . LYS A 1 50  ? -5.215  23.559 6.932  1.00 24.89  ? 98  LYS A CG  1 
ATOM   301  C CD  . LYS A 1 50  ? -4.943  24.531 5.797  1.00 23.31  ? 98  LYS A CD  1 
ATOM   302  C CE  . LYS A 1 50  ? -6.256  24.987 5.146  1.00 27.02  ? 98  LYS A CE  1 
ATOM   303  N NZ  . LYS A 1 50  ? -6.042  26.122 4.201  1.00 26.98  ? 98  LYS A NZ  1 
ATOM   304  N N   . ILE A 1 51  ? -2.012  21.031 8.701  1.00 26.54  ? 99  ILE A N   1 
ATOM   305  C CA  . ILE A 1 51  ? -0.666  20.675 9.083  1.00 26.58  ? 99  ILE A CA  1 
ATOM   306  C C   . ILE A 1 51  ? 0.270   21.506 8.203  1.00 27.59  ? 99  ILE A C   1 
ATOM   307  O O   . ILE A 1 51  ? 0.145   21.507 6.980  1.00 28.94  ? 99  ILE A O   1 
ATOM   308  C CB  . ILE A 1 51  ? -0.390  19.173 8.835  1.00 25.82  ? 99  ILE A CB  1 
ATOM   309  C CG1 . ILE A 1 51  ? -1.208  18.340 9.822  1.00 26.51  ? 99  ILE A CG1 1 
ATOM   310  C CG2 . ILE A 1 51  ? 1.113   18.889 8.940  1.00 22.38  ? 99  ILE A CG2 1 
ATOM   311  C CD1 . ILE A 1 51  ? -1.022  16.835 9.694  1.00 30.12  ? 99  ILE A CD1 1 
ATOM   312  N N   . MET A 1 52  ? 1.184   22.237 8.824  1.00 27.75  ? 100 MET A N   1 
ATOM   313  C CA  . MET A 1 52  ? 2.142   23.033 8.076  1.00 29.33  ? 100 MET A CA  1 
ATOM   314  C C   . MET A 1 52  ? 3.521   22.417 8.302  1.00 29.05  ? 100 MET A C   1 
ATOM   315  O O   . MET A 1 52  ? 3.924   22.191 9.441  1.00 33.51  ? 100 MET A O   1 
ATOM   316  C CB  . MET A 1 52  ? 2.134   24.473 8.567  1.00 30.95  ? 100 MET A CB  1 
ATOM   317  C CG  . MET A 1 52  ? 3.169   25.343 7.875  1.00 40.39  ? 100 MET A CG  1 
ATOM   318  S SD  . MET A 1 52  ? 3.222   27.057 8.487  1.00 48.08  ? 100 MET A SD  1 
ATOM   319  C CE  . MET A 1 52  ? 1.675   27.166 9.479  1.00 43.82  ? 100 MET A CE  1 
ATOM   320  N N   . VAL A 1 53  ? 4.242   22.150 7.224  1.00 31.30  ? 101 VAL A N   1 
ATOM   321  C CA  . VAL A 1 53  ? 5.566   21.546 7.325  1.00 30.13  ? 101 VAL A CA  1 
ATOM   322  C C   . VAL A 1 53  ? 6.627   22.360 6.592  1.00 34.49  ? 101 VAL A C   1 
ATOM   323  O O   . VAL A 1 53  ? 6.346   23.003 5.579  1.00 35.85  ? 101 VAL A O   1 
ATOM   324  C CB  . VAL A 1 53  ? 5.564   20.111 6.723  1.00 28.85  ? 101 VAL A CB  1 
ATOM   325  C CG1 . VAL A 1 53  ? 6.977   19.525 6.751  1.00 27.38  ? 101 VAL A CG1 1 
ATOM   326  C CG2 . VAL A 1 53  ? 4.588   19.215 7.483  1.00 20.37  ? 101 VAL A CG2 1 
ATOM   327  N N   . MET A 1 54  ? 7.848   22.339 7.111  1.00 35.01  ? 102 MET A N   1 
ATOM   328  C CA  . MET A 1 54  ? 8.936   23.039 6.456  1.00 36.03  ? 102 MET A CA  1 
ATOM   329  C C   . MET A 1 54  ? 10.251  22.839 7.172  1.00 36.57  ? 102 MET A C   1 
ATOM   330  O O   . MET A 1 54  ? 10.294  22.656 8.384  1.00 34.69  ? 102 MET A O   1 
ATOM   331  C CB  . MET A 1 54  ? 8.654   24.542 6.340  1.00 38.06  ? 102 MET A CB  1 
ATOM   332  C CG  . MET A 1 54  ? 9.337   25.404 7.395  1.00 44.90  ? 102 MET A CG  1 
ATOM   333  S SD  . MET A 1 54  ? 8.416   25.542 8.931  1.00 56.00  ? 102 MET A SD  1 
ATOM   334  C CE  . MET A 1 54  ? 7.414   26.969 8.546  1.00 42.46  ? 102 MET A CE  1 
ATOM   335  N N   . PRO A 1 55  ? 11.348  22.852 6.411  1.00 35.82  ? 103 PRO A N   1 
ATOM   336  C CA  . PRO A 1 55  ? 12.689  22.683 6.962  1.00 35.53  ? 103 PRO A CA  1 
ATOM   337  C C   . PRO A 1 55  ? 13.072  23.976 7.687  1.00 40.26  ? 103 PRO A C   1 
ATOM   338  O O   . PRO A 1 55  ? 12.676  25.059 7.264  1.00 38.44  ? 103 PRO A O   1 
ATOM   339  C CB  . PRO A 1 55  ? 13.536  22.435 5.719  1.00 34.65  ? 103 PRO A CB  1 
ATOM   340  C CG  . PRO A 1 55  ? 12.810  23.228 4.657  1.00 33.86  ? 103 PRO A CG  1 
ATOM   341  C CD  . PRO A 1 55  ? 11.374  22.902 4.936  1.00 33.25  ? 103 PRO A CD  1 
ATOM   342  N N   . ARG A 1 56  ? 13.813  23.856 8.788  1.00 44.17  ? 104 ARG A N   1 
ATOM   343  C CA  . ARG A 1 56  ? 14.263  25.016 9.564  1.00 49.70  ? 104 ARG A CA  1 
ATOM   344  C C   . ARG A 1 56  ? 15.781  24.977 9.725  1.00 55.08  ? 104 ARG A C   1 
ATOM   345  O O   . ARG A 1 56  ? 16.375  23.894 9.772  1.00 55.95  ? 104 ARG A O   1 
ATOM   346  C CB  . ARG A 1 56  ? 13.585  25.033 10.938 1.00 48.98  ? 104 ARG A CB  1 
ATOM   347  C CG  . ARG A 1 56  ? 12.068  24.973 10.881 1.00 53.02  ? 104 ARG A CG  1 
ATOM   348  C CD  . ARG A 1 56  ? 11.441  26.292 10.461 1.00 54.99  ? 104 ARG A CD  1 
ATOM   349  N NE  . ARG A 1 56  ? 11.482  27.276 11.539 1.00 59.43  ? 104 ARG A NE  1 
ATOM   350  C CZ  . ARG A 1 56  ? 10.590  28.250 11.702 1.00 58.01  ? 104 ARG A CZ  1 
ATOM   351  N NH1 . ARG A 1 56  ? 9.577   28.375 10.856 1.00 56.59  ? 104 ARG A NH1 1 
ATOM   352  N NH2 . ARG A 1 56  ? 10.706  29.096 12.719 1.00 58.82  ? 104 ARG A NH2 1 
ATOM   353  N N   . PHE A 1 57  ? 16.403  26.154 9.808  1.00 58.28  ? 105 PHE A N   1 
ATOM   354  C CA  . PHE A 1 57  ? 17.857  26.231 9.933  1.00 61.52  ? 105 PHE A CA  1 
ATOM   355  C C   . PHE A 1 57  ? 18.346  26.990 11.165 1.00 60.28  ? 105 PHE A C   1 
ATOM   356  O O   . PHE A 1 57  ? 17.571  27.708 11.806 1.00 61.59  ? 105 PHE A O   1 
ATOM   357  C CB  . PHE A 1 57  ? 18.446  26.867 8.675  1.00 61.96  ? 105 PHE A CB  1 
ATOM   358  C CG  . PHE A 1 57  ? 18.073  26.151 7.407  1.00 63.80  ? 105 PHE A CG  1 
ATOM   359  C CD1 . PHE A 1 57  ? 16.797  26.285 6.863  1.00 64.43  ? 105 PHE A CD1 1 
ATOM   360  C CD2 . PHE A 1 57  ? 18.993  25.332 6.761  1.00 63.19  ? 105 PHE A CD2 1 
ATOM   361  C CE1 . PHE A 1 57  ? 16.451  25.614 5.693  1.00 66.41  ? 105 PHE A CE1 1 
ATOM   362  C CE2 . PHE A 1 57  ? 18.657  24.662 5.597  1.00 63.83  ? 105 PHE A CE2 1 
ATOM   363  C CZ  . PHE A 1 57  ? 17.389  24.800 5.061  1.00 65.59  ? 105 PHE A CZ  1 
ATOM   364  N N   . HIS A 1 63  ? 24.359  24.608 10.804 1.00 87.84  ? 111 HIS A N   1 
ATOM   365  C CA  . HIS A 1 63  ? 24.330  23.580 9.767  1.00 86.80  ? 111 HIS A CA  1 
ATOM   366  C C   . HIS A 1 63  ? 23.303  22.512 10.129 1.00 84.08  ? 111 HIS A C   1 
ATOM   367  O O   . HIS A 1 63  ? 22.957  21.666 9.301  1.00 82.20  ? 111 HIS A O   1 
ATOM   368  C CB  . HIS A 1 63  ? 25.715  22.941 9.626  1.00 90.77  ? 111 HIS A CB  1 
ATOM   369  C CG  . HIS A 1 63  ? 26.074  22.573 8.226  1.00 95.10  ? 111 HIS A CG  1 
ATOM   370  N ND1 . HIS A 1 63  ? 25.360  21.648 7.497  1.00 96.66  ? 111 HIS A ND1 1 
ATOM   371  C CD2 . HIS A 1 63  ? 27.064  23.015 7.416  1.00 96.82  ? 111 HIS A CD2 1 
ATOM   372  C CE1 . HIS A 1 63  ? 25.896  21.538 6.295  1.00 97.71  ? 111 HIS A CE1 1 
ATOM   373  N NE2 . HIS A 1 63  ? 26.930  22.357 6.219  1.00 98.07  ? 111 HIS A NE2 1 
ATOM   374  N N   . GLN A 1 64  ? 22.823  22.571 11.371 1.00 79.79  ? 112 GLN A N   1 
ATOM   375  C CA  . GLN A 1 64  ? 21.818  21.641 11.880 1.00 74.28  ? 112 GLN A CA  1 
ATOM   376  C C   . GLN A 1 64  ? 20.437  21.991 11.333 1.00 70.51  ? 112 GLN A C   1 
ATOM   377  O O   . GLN A 1 64  ? 19.863  23.024 11.680 1.00 70.65  ? 112 GLN A O   1 
ATOM   378  C CB  . GLN A 1 64  ? 21.762  21.687 13.407 1.00 75.93  ? 112 GLN A CB  1 
ATOM   379  C CG  . GLN A 1 64  ? 23.030  21.249 14.102 1.00 77.89  ? 112 GLN A CG  1 
ATOM   380  C CD  . GLN A 1 64  ? 22.962  21.484 15.596 1.00 77.42  ? 112 GLN A CD  1 
ATOM   381  O OE1 . GLN A 1 64  ? 22.816  22.621 16.049 1.00 75.82  ? 112 GLN A OE1 1 
ATOM   382  N NE2 . GLN A 1 64  ? 23.067  20.411 16.372 1.00 79.23  ? 112 GLN A NE2 1 
ATOM   383  N N   . LYS A 1 65  ? 19.905  21.113 10.492 1.00 62.25  ? 113 LYS A N   1 
ATOM   384  C CA  . LYS A 1 65  ? 18.607  21.316 9.869  1.00 55.46  ? 113 LYS A CA  1 
ATOM   385  C C   . LYS A 1 65  ? 17.561  20.522 10.648 1.00 52.37  ? 113 LYS A C   1 
ATOM   386  O O   . LYS A 1 65  ? 17.814  19.389 11.057 1.00 51.00  ? 113 LYS A O   1 
ATOM   387  C CB  . LYS A 1 65  ? 18.691  20.831 8.421  1.00 52.58  ? 113 LYS A CB  1 
ATOM   388  C CG  . LYS A 1 65  ? 17.634  21.341 7.469  1.00 51.81  ? 113 LYS A CG  1 
ATOM   389  C CD  . LYS A 1 65  ? 17.988  20.877 6.059  1.00 47.96  ? 113 LYS A CD  1 
ATOM   390  C CE  . LYS A 1 65  ? 16.881  21.140 5.056  1.00 50.49  ? 113 LYS A CE  1 
ATOM   391  N NZ  . LYS A 1 65  ? 17.211  20.552 3.712  1.00 48.35  ? 113 LYS A NZ  1 
ATOM   392  N N   . SER A 1 66  ? 16.394  21.118 10.868 1.00 47.67  ? 114 SER A N   1 
ATOM   393  C CA  . SER A 1 66  ? 15.331  20.439 11.597 1.00 42.97  ? 114 SER A CA  1 
ATOM   394  C C   . SER A 1 66  ? 14.004  20.495 10.852 1.00 38.81  ? 114 SER A C   1 
ATOM   395  O O   . SER A 1 66  ? 13.826  21.281 9.922  1.00 39.53  ? 114 SER A O   1 
ATOM   396  C CB  . SER A 1 66  ? 15.148  21.071 12.970 1.00 44.10  ? 114 SER A CB  1 
ATOM   397  O OG  . SER A 1 66  ? 14.600  22.371 12.845 1.00 43.24  ? 114 SER A OG  1 
ATOM   398  N N   . VAL A 1 67  ? 13.073  19.650 11.272 1.00 37.85  ? 115 VAL A N   1 
ATOM   399  C CA  . VAL A 1 67  ? 11.743  19.610 10.678 1.00 34.62  ? 115 VAL A CA  1 
ATOM   400  C C   . VAL A 1 67  ? 10.810  20.521 11.476 1.00 35.64  ? 115 VAL A C   1 
ATOM   401  O O   . VAL A 1 67  ? 10.682  20.381 12.698 1.00 34.01  ? 115 VAL A O   1 
ATOM   402  C CB  . VAL A 1 67  ? 11.144  18.184 10.712 1.00 32.41  ? 115 VAL A CB  1 
ATOM   403  C CG1 . VAL A 1 67  ? 9.754   18.189 10.098 1.00 32.60  ? 115 VAL A CG1 1 
ATOM   404  C CG2 . VAL A 1 67  ? 12.047  17.215 9.968  1.00 36.40  ? 115 VAL A CG2 1 
ATOM   405  N N   . GLY A 1 68  ? 10.187  21.469 10.783 1.00 29.83  ? 116 GLY A N   1 
ATOM   406  C CA  . GLY A 1 68  ? 9.242   22.365 11.425 1.00 29.63  ? 116 GLY A CA  1 
ATOM   407  C C   . GLY A 1 68  ? 7.879   21.748 11.173 1.00 24.16  ? 116 GLY A C   1 
ATOM   408  O O   . GLY A 1 68  ? 7.496   21.526 10.032 1.00 27.41  ? 116 GLY A O   1 
ATOM   409  N N   . PHE A 1 69  ? 7.142   21.483 12.242 1.00 25.77  ? 117 PHE A N   1 
ATOM   410  C CA  . PHE A 1 69  ? 5.843   20.830 12.162 1.00 23.04  ? 117 PHE A CA  1 
ATOM   411  C C   . PHE A 1 69  ? 4.866   21.671 12.982 1.00 24.15  ? 117 PHE A C   1 
ATOM   412  O O   . PHE A 1 69  ? 5.031   21.818 14.188 1.00 26.93  ? 117 PHE A O   1 
ATOM   413  C CB  . PHE A 1 69  ? 6.013   19.415 12.744 1.00 22.63  ? 117 PHE A CB  1 
ATOM   414  C CG  . PHE A 1 69  ? 4.797   18.523 12.658 1.00 24.93  ? 117 PHE A CG  1 
ATOM   415  C CD1 . PHE A 1 69  ? 3.592   18.973 12.126 1.00 26.28  ? 117 PHE A CD1 1 
ATOM   416  C CD2 . PHE A 1 69  ? 4.867   17.216 13.156 1.00 22.07  ? 117 PHE A CD2 1 
ATOM   417  C CE1 . PHE A 1 69  ? 2.464   18.140 12.090 1.00 30.51  ? 117 PHE A CE1 1 
ATOM   418  C CE2 . PHE A 1 69  ? 3.754   16.374 13.131 1.00 30.53  ? 117 PHE A CE2 1 
ATOM   419  C CZ  . PHE A 1 69  ? 2.541   16.839 12.594 1.00 30.14  ? 117 PHE A CZ  1 
ATOM   420  N N   . PHE A 1 70  ? 3.862   22.248 12.333 1.00 23.37  ? 118 PHE A N   1 
ATOM   421  C CA  . PHE A 1 70  ? 2.898   23.057 13.074 1.00 23.30  ? 118 PHE A CA  1 
ATOM   422  C C   . PHE A 1 70  ? 1.457   22.723 12.723 1.00 24.44  ? 118 PHE A C   1 
ATOM   423  O O   . PHE A 1 70  ? 1.160   22.219 11.636 1.00 27.46  ? 118 PHE A O   1 
ATOM   424  C CB  . PHE A 1 70  ? 3.115   24.560 12.830 1.00 25.09  ? 118 PHE A CB  1 
ATOM   425  C CG  . PHE A 1 70  ? 4.512   25.048 13.143 1.00 24.92  ? 118 PHE A CG  1 
ATOM   426  C CD1 . PHE A 1 70  ? 5.543   24.892 12.224 1.00 22.60  ? 118 PHE A CD1 1 
ATOM   427  C CD2 . PHE A 1 70  ? 4.783   25.682 14.355 1.00 21.97  ? 118 PHE A CD2 1 
ATOM   428  C CE1 . PHE A 1 70  ? 6.829   25.363 12.508 1.00 29.29  ? 118 PHE A CE1 1 
ATOM   429  C CE2 . PHE A 1 70  ? 6.055   26.156 14.652 1.00 25.24  ? 118 PHE A CE2 1 
ATOM   430  C CZ  . PHE A 1 70  ? 7.087   25.999 13.728 1.00 23.84  ? 118 PHE A CZ  1 
ATOM   431  N N   . LEU A 1 71  ? 0.573   23.004 13.670 1.00 24.82  ? 119 LEU A N   1 
ATOM   432  C CA  . LEU A 1 71  ? -0.859  22.812 13.500 1.00 23.33  ? 119 LEU A CA  1 
ATOM   433  C C   . LEU A 1 71  ? -1.458  24.210 13.286 1.00 28.41  ? 119 LEU A C   1 
ATOM   434  O O   . LEU A 1 71  ? -1.265  25.109 14.112 1.00 26.79  ? 119 LEU A O   1 
ATOM   435  C CB  . LEU A 1 71  ? -1.456  22.181 14.751 1.00 21.60  ? 119 LEU A CB  1 
ATOM   436  C CG  . LEU A 1 71  ? -2.978  22.096 14.773 1.00 21.06  ? 119 LEU A CG  1 
ATOM   437  C CD1 . LEU A 1 71  ? -3.436  21.195 13.624 1.00 24.18  ? 119 LEU A CD1 1 
ATOM   438  C CD2 . LEU A 1 71  ? -3.454  21.569 16.112 1.00 20.40  ? 119 LEU A CD2 1 
ATOM   439  N N   . GLN A 1 72  ? -2.176  24.389 12.181 1.00 27.75  ? 120 GLN A N   1 
ATOM   440  C CA  . GLN A 1 72  ? -2.776  25.677 11.852 1.00 27.27  ? 120 GLN A CA  1 
ATOM   441  C C   . GLN A 1 72  ? -4.291  25.637 11.928 1.00 28.89  ? 120 GLN A C   1 
ATOM   442  O O   . GLN A 1 72  ? -4.936  24.719 11.416 1.00 30.51  ? 120 GLN A O   1 
ATOM   443  C CB  . GLN A 1 72  ? -2.368  26.118 10.440 1.00 26.59  ? 120 GLN A CB  1 
ATOM   444  C CG  . GLN A 1 72  ? -3.204  27.266 9.887  1.00 26.11  ? 120 GLN A CG  1 
ATOM   445  C CD  . GLN A 1 72  ? -2.921  27.567 8.418  1.00 28.18  ? 120 GLN A CD  1 
ATOM   446  O OE1 . GLN A 1 72  ? -1.957  28.264 8.078  1.00 27.30  ? 120 GLN A OE1 1 
ATOM   447  N NE2 . GLN A 1 72  ? -3.760  27.038 7.542  1.00 28.30  ? 120 GLN A NE2 1 
ATOM   448  N N   . CYS A 1 73  ? -4.867  26.650 12.556 1.00 28.11  ? 121 CYS A N   1 
ATOM   449  C CA  . CYS A 1 73  ? -6.305  26.699 12.664 1.00 32.08  ? 121 CYS A CA  1 
ATOM   450  C C   . CYS A 1 73  ? -6.930  27.975 12.111 1.00 30.57  ? 121 CYS A C   1 
ATOM   451  O O   . CYS A 1 73  ? -6.529  29.086 12.472 1.00 31.09  ? 121 CYS A O   1 
ATOM   452  C CB  . CYS A 1 73  ? -6.731  26.528 14.120 1.00 31.53  ? 121 CYS A CB  1 
ATOM   453  S SG  . CYS A 1 73  ? -8.515  26.712 14.333 1.00 34.23  ? 121 CYS A SG  1 
ATOM   454  N N   . ASN A 1 74  ? -7.889  27.792 11.207 1.00 35.06  ? 122 ASN A N   1 
ATOM   455  C CA  . ASN A 1 74  ? -8.674  28.887 10.633 1.00 37.02  ? 122 ASN A CA  1 
ATOM   456  C C   . ASN A 1 74  ? -7.889  30.151 10.288 1.00 38.03  ? 122 ASN A C   1 
ATOM   457  O O   . ASN A 1 74  ? -8.308  31.252 10.627 1.00 38.30  ? 122 ASN A O   1 
ATOM   458  C CB  . ASN A 1 74  ? -9.775  29.217 11.640 1.00 38.81  ? 122 ASN A CB  1 
ATOM   459  C CG  . ASN A 1 74  ? -10.870 30.064 11.066 1.00 45.58  ? 122 ASN A CG  1 
ATOM   460  O OD1 . ASN A 1 74  ? -11.448 29.741 10.027 1.00 47.27  ? 122 ASN A OD1 1 
ATOM   461  N ND2 . ASN A 1 74  ? -11.189 31.154 11.759 1.00 47.99  ? 122 ASN A ND2 1 
ATOM   462  N N   . ALA A 1 75  ? -6.763  29.991 9.601  1.00 37.71  ? 123 ALA A N   1 
ATOM   463  C CA  . ALA A 1 75  ? -5.916  31.125 9.250  1.00 44.09  ? 123 ALA A CA  1 
ATOM   464  C C   . ALA A 1 75  ? -6.456  32.062 8.164  1.00 49.10  ? 123 ALA A C   1 
ATOM   465  O O   . ALA A 1 75  ? -6.119  33.246 8.143  1.00 47.38  ? 123 ALA A O   1 
ATOM   466  C CB  . ALA A 1 75  ? -4.536  30.628 8.849  1.00 36.82  ? 123 ALA A CB  1 
ATOM   467  N N   . GLU A 1 76  ? -7.288  31.551 7.266  1.00 51.69  ? 124 GLU A N   1 
ATOM   468  C CA  . GLU A 1 76  ? -7.804  32.396 6.197  1.00 59.08  ? 124 GLU A CA  1 
ATOM   469  C C   . GLU A 1 76  ? -8.918  33.341 6.631  1.00 59.15  ? 124 GLU A C   1 
ATOM   470  O O   . GLU A 1 76  ? -9.135  34.377 6.007  1.00 59.96  ? 124 GLU A O   1 
ATOM   471  C CB  . GLU A 1 76  ? -8.271  31.534 5.021  1.00 60.88  ? 124 GLU A CB  1 
ATOM   472  C CG  . GLU A 1 76  ? -7.496  31.785 3.721  1.00 66.62  ? 124 GLU A CG  1 
ATOM   473  C CD  . GLU A 1 76  ? -6.009  31.449 3.817  1.00 67.17  ? 124 GLU A CD  1 
ATOM   474  O OE1 . GLU A 1 76  ? -5.540  30.600 3.027  1.00 69.91  ? 124 GLU A OE1 1 
ATOM   475  O OE2 . GLU A 1 76  ? -5.308  32.033 4.671  1.00 69.47  ? 124 GLU A OE2 1 
ATOM   476  N N   . SER A 1 77  ? -9.604  32.992 7.713  1.00 59.83  ? 125 SER A N   1 
ATOM   477  C CA  . SER A 1 77  ? -10.707 33.797 8.236  1.00 59.84  ? 125 SER A CA  1 
ATOM   478  C C   . SER A 1 77  ? -10.366 35.257 8.547  1.00 63.17  ? 125 SER A C   1 
ATOM   479  O O   . SER A 1 77  ? -9.341  35.553 9.170  1.00 65.13  ? 125 SER A O   1 
ATOM   480  C CB  . SER A 1 77  ? -11.266 33.134 9.494  1.00 58.40  ? 125 SER A CB  1 
ATOM   481  O OG  . SER A 1 77  ? -12.269 33.930 10.095 1.00 57.54  ? 125 SER A OG  1 
ATOM   482  N N   . ASP A 1 78  ? -11.243 36.164 8.121  1.00 65.72  ? 126 ASP A N   1 
ATOM   483  C CA  . ASP A 1 78  ? -11.059 37.597 8.357  1.00 66.97  ? 126 ASP A CA  1 
ATOM   484  C C   . ASP A 1 78  ? -11.369 37.887 9.826  1.00 64.75  ? 126 ASP A C   1 
ATOM   485  O O   . ASP A 1 78  ? -10.796 38.797 10.433 1.00 64.15  ? 126 ASP A O   1 
ATOM   486  C CB  . ASP A 1 78  ? -12.015 38.421 7.480  1.00 71.94  ? 126 ASP A CB  1 
ATOM   487  C CG  . ASP A 1 78  ? -12.037 37.961 6.026  1.00 76.68  ? 126 ASP A CG  1 
ATOM   488  O OD1 . ASP A 1 78  ? -10.968 37.934 5.373  1.00 78.37  ? 126 ASP A OD1 1 
ATOM   489  O OD2 . ASP A 1 78  ? -13.138 37.633 5.534  1.00 78.56  ? 126 ASP A OD2 1 
ATOM   490  N N   . SER A 1 79  ? -12.286 37.093 10.377 1.00 61.43  ? 127 SER A N   1 
ATOM   491  C CA  . SER A 1 79  ? -12.730 37.203 11.764 1.00 58.90  ? 127 SER A CA  1 
ATOM   492  C C   . SER A 1 79  ? -11.582 37.355 12.756 1.00 58.49  ? 127 SER A C   1 
ATOM   493  O O   . SER A 1 79  ? -10.488 36.830 12.542 1.00 58.59  ? 127 SER A O   1 
ATOM   494  C CB  . SER A 1 79  ? -13.565 35.974 12.133 1.00 58.02  ? 127 SER A CB  1 
ATOM   495  O OG  . SER A 1 79  ? -13.937 36.001 13.497 1.00 63.92  ? 127 SER A OG  1 
ATOM   496  N N   . THR A 1 80  ? -11.844 38.078 13.841 1.00 55.26  ? 128 THR A N   1 
ATOM   497  C CA  . THR A 1 80  ? -10.841 38.315 14.881 1.00 55.87  ? 128 THR A CA  1 
ATOM   498  C C   . THR A 1 80  ? -11.452 38.110 16.265 1.00 53.33  ? 128 THR A C   1 
ATOM   499  O O   . THR A 1 80  ? -10.962 38.647 17.259 1.00 55.37  ? 128 THR A O   1 
ATOM   500  C CB  . THR A 1 80  ? -10.280 39.755 14.811 1.00 57.12  ? 128 THR A CB  1 
ATOM   501  O OG1 . THR A 1 80  ? -11.368 40.682 14.726 1.00 61.46  ? 128 THR A OG1 1 
ATOM   502  C CG2 . THR A 1 80  ? -9.378  39.930 13.605 1.00 57.99  ? 128 THR A CG2 1 
ATOM   503  N N   . SER A 1 81  ? -12.516 37.318 16.321 1.00 50.28  ? 129 SER A N   1 
ATOM   504  C CA  . SER A 1 81  ? -13.208 37.056 17.571 1.00 47.07  ? 129 SER A CA  1 
ATOM   505  C C   . SER A 1 81  ? -13.389 35.558 17.788 1.00 46.20  ? 129 SER A C   1 
ATOM   506  O O   . SER A 1 81  ? -14.093 35.132 18.707 1.00 46.59  ? 129 SER A O   1 
ATOM   507  C CB  . SER A 1 81  ? -14.578 37.730 17.542 1.00 49.17  ? 129 SER A CB  1 
ATOM   508  O OG  . SER A 1 81  ? -15.370 37.158 16.515 1.00 49.85  ? 129 SER A OG  1 
ATOM   509  N N   . TRP A 1 82  ? -12.776 34.754 16.929 1.00 44.42  ? 130 TRP A N   1 
ATOM   510  C CA  . TRP A 1 82  ? -12.885 33.311 17.076 1.00 39.24  ? 130 TRP A CA  1 
ATOM   511  C C   . TRP A 1 82  ? -11.749 32.824 17.977 1.00 34.84  ? 130 TRP A C   1 
ATOM   512  O O   . TRP A 1 82  ? -10.729 33.506 18.141 1.00 33.49  ? 130 TRP A O   1 
ATOM   513  C CB  . TRP A 1 82  ? -12.803 32.615 15.705 1.00 39.40  ? 130 TRP A CB  1 
ATOM   514  C CG  . TRP A 1 82  ? -11.456 32.722 15.058 1.00 42.62  ? 130 TRP A CG  1 
ATOM   515  C CD1 . TRP A 1 82  ? -11.004 33.732 14.257 1.00 45.44  ? 130 TRP A CD1 1 
ATOM   516  C CD2 . TRP A 1 82  ? -10.356 31.818 15.226 1.00 39.99  ? 130 TRP A CD2 1 
ATOM   517  N NE1 . TRP A 1 82  ? -9.685  33.514 13.918 1.00 45.09  ? 130 TRP A NE1 1 
ATOM   518  C CE2 . TRP A 1 82  ? -9.265  32.347 14.501 1.00 41.64  ? 130 TRP A CE2 1 
ATOM   519  C CE3 . TRP A 1 82  ? -10.186 30.615 15.924 1.00 38.88  ? 130 TRP A CE3 1 
ATOM   520  C CZ2 . TRP A 1 82  ? -8.016  31.712 14.453 1.00 39.07  ? 130 TRP A CZ2 1 
ATOM   521  C CZ3 . TRP A 1 82  ? -8.942  29.982 15.876 1.00 36.26  ? 130 TRP A CZ3 1 
ATOM   522  C CH2 . TRP A 1 82  ? -7.876  30.534 15.145 1.00 35.80  ? 130 TRP A CH2 1 
ATOM   523  N N   . SER A 1 83  ? -11.946 31.659 18.581 1.00 30.93  ? 131 SER A N   1 
ATOM   524  C CA  . SER A 1 83  ? -10.921 31.064 19.431 1.00 35.06  ? 131 SER A CA  1 
ATOM   525  C C   . SER A 1 83  ? -11.225 29.590 19.656 1.00 32.97  ? 131 SER A C   1 
ATOM   526  O O   . SER A 1 83  ? -12.382 29.173 19.640 1.00 31.81  ? 131 SER A O   1 
ATOM   527  C CB  . SER A 1 83  ? -10.828 31.784 20.783 1.00 29.08  ? 131 SER A CB  1 
ATOM   528  O OG  . SER A 1 83  ? -11.989 31.557 21.551 1.00 34.73  ? 131 SER A OG  1 
ATOM   529  N N   . CYS A 1 84  ? -10.180 28.795 19.848 1.00 28.85  ? 132 CYS A N   1 
ATOM   530  C CA  . CYS A 1 84  ? -10.385 27.377 20.103 1.00 31.37  ? 132 CYS A CA  1 
ATOM   531  C C   . CYS A 1 84  ? -9.273  26.879 21.010 1.00 28.99  ? 132 CYS A C   1 
ATOM   532  O O   . CYS A 1 84  ? -8.089  26.939 20.657 1.00 25.94  ? 132 CYS A O   1 
ATOM   533  C CB  . CYS A 1 84  ? -10.403 26.584 18.783 1.00 26.65  ? 132 CYS A CB  1 
ATOM   534  N N   . HIS A 1 85  ? -9.652  26.418 22.195 1.00 28.89  ? 133 HIS A N   1 
ATOM   535  C CA  . HIS A 1 85  ? -8.664  25.891 23.125 1.00 31.48  ? 133 HIS A CA  1 
ATOM   536  C C   . HIS A 1 85  ? -8.493  24.435 22.708 1.00 31.17  ? 133 HIS A C   1 
ATOM   537  O O   . HIS A 1 85  ? -9.454  23.666 22.744 1.00 28.05  ? 133 HIS A O   1 
ATOM   538  C CB  . HIS A 1 85  ? -9.181  25.997 24.557 1.00 33.65  ? 133 HIS A CB  1 
ATOM   539  C CG  . HIS A 1 85  ? -8.157  25.665 25.597 1.00 35.52  ? 133 HIS A CG  1 
ATOM   540  N ND1 . HIS A 1 85  ? -6.812  25.561 25.313 1.00 35.94  ? 133 HIS A ND1 1 
ATOM   541  C CD2 . HIS A 1 85  ? -8.278  25.442 26.927 1.00 33.45  ? 133 HIS A CD2 1 
ATOM   542  C CE1 . HIS A 1 85  ? -6.148  25.292 26.422 1.00 28.73  ? 133 HIS A CE1 1 
ATOM   543  N NE2 . HIS A 1 85  ? -7.014  25.214 27.415 1.00 34.57  ? 133 HIS A NE2 1 
ATOM   544  N N   . ALA A 1 86  ? -7.279  24.067 22.300 1.00 25.14  ? 134 ALA A N   1 
ATOM   545  C CA  . ALA A 1 86  ? -7.024  22.706 21.849 1.00 27.69  ? 134 ALA A CA  1 
ATOM   546  C C   . ALA A 1 86  ? -5.708  22.075 22.285 1.00 27.32  ? 134 ALA A C   1 
ATOM   547  O O   . ALA A 1 86  ? -4.702  22.753 22.508 1.00 26.19  ? 134 ALA A O   1 
ATOM   548  C CB  . ALA A 1 86  ? -7.100  22.648 20.324 1.00 21.83  ? 134 ALA A CB  1 
ATOM   549  N N   . GLN A 1 87  ? -5.741  20.753 22.377 1.00 24.35  ? 135 GLN A N   1 
ATOM   550  C CA  . GLN A 1 87  ? -4.567  19.965 22.691 1.00 30.20  ? 135 GLN A CA  1 
ATOM   551  C C   . GLN A 1 87  ? -4.465  18.998 21.509 1.00 28.73  ? 135 GLN A C   1 
ATOM   552  O O   . GLN A 1 87  ? -5.486  18.584 20.944 1.00 24.56  ? 135 GLN A O   1 
ATOM   553  C CB  . GLN A 1 87  ? -4.740  19.194 24.002 1.00 27.86  ? 135 GLN A CB  1 
ATOM   554  C CG  . GLN A 1 87  ? -5.922  18.239 24.031 1.00 38.78  ? 135 GLN A CG  1 
ATOM   555  C CD  . GLN A 1 87  ? -5.948  17.405 25.300 1.00 43.48  ? 135 GLN A CD  1 
ATOM   556  O OE1 . GLN A 1 87  ? -6.840  16.578 25.504 1.00 48.03  ? 135 GLN A OE1 1 
ATOM   557  N NE2 . GLN A 1 87  ? -4.959  17.616 26.159 1.00 43.46  ? 135 GLN A NE2 1 
ATOM   558  N N   . ALA A 1 88  ? -3.244  18.649 21.123 1.00 26.73  ? 136 ALA A N   1 
ATOM   559  C CA  . ALA A 1 88  ? -3.070  17.748 20.001 1.00 27.09  ? 136 ALA A CA  1 
ATOM   560  C C   . ALA A 1 88  ? -1.776  16.961 20.087 1.00 27.81  ? 136 ALA A C   1 
ATOM   561  O O   . ALA A 1 88  ? -0.855  17.330 20.802 1.00 26.42  ? 136 ALA A O   1 
ATOM   562  C CB  . ALA A 1 88  ? -3.093  18.536 18.693 1.00 24.52  ? 136 ALA A CB  1 
ATOM   563  N N   . VAL A 1 89  ? -1.728  15.867 19.339 1.00 28.16  ? 137 VAL A N   1 
ATOM   564  C CA  . VAL A 1 89  ? -0.541  15.041 19.267 1.00 28.64  ? 137 VAL A CA  1 
ATOM   565  C C   . VAL A 1 89  ? -0.023  15.225 17.848 1.00 30.27  ? 137 VAL A C   1 
ATOM   566  O O   . VAL A 1 89  ? -0.713  14.889 16.894 1.00 29.17  ? 137 VAL A O   1 
ATOM   567  C CB  . VAL A 1 89  ? -0.882  13.550 19.496 1.00 30.99  ? 137 VAL A CB  1 
ATOM   568  C CG1 . VAL A 1 89  ? 0.387   12.719 19.380 1.00 25.43  ? 137 VAL A CG1 1 
ATOM   569  C CG2 . VAL A 1 89  ? -1.560  13.365 20.888 1.00 23.24  ? 137 VAL A CG2 1 
ATOM   570  N N   . LEU A 1 90  ? 1.167   15.802 17.709 1.00 32.30  ? 138 LEU A N   1 
ATOM   571  C CA  . LEU A 1 90  ? 1.755   16.001 16.397 1.00 31.09  ? 138 LEU A CA  1 
ATOM   572  C C   . LEU A 1 90  ? 2.688   14.824 16.231 1.00 36.58  ? 138 LEU A C   1 
ATOM   573  O O   . LEU A 1 90  ? 3.665   14.689 16.972 1.00 32.39  ? 138 LEU A O   1 
ATOM   574  C CB  . LEU A 1 90  ? 2.514   17.331 16.344 1.00 31.65  ? 138 LEU A CB  1 
ATOM   575  C CG  . LEU A 1 90  ? 1.641   18.536 15.960 1.00 29.26  ? 138 LEU A CG  1 
ATOM   576  C CD1 . LEU A 1 90  ? 0.402   18.570 16.830 1.00 20.52  ? 138 LEU A CD1 1 
ATOM   577  C CD2 . LEU A 1 90  ? 2.436   19.829 16.090 1.00 26.84  ? 138 LEU A CD2 1 
ATOM   578  N N   . LYS A 1 91  ? 2.378   13.973 15.254 1.00 38.11  ? 139 LYS A N   1 
ATOM   579  C CA  . LYS A 1 91  ? 3.149   12.763 15.035 1.00 37.41  ? 139 LYS A CA  1 
ATOM   580  C C   . LYS A 1 91  ? 3.622   12.441 13.615 1.00 38.59  ? 139 LYS A C   1 
ATOM   581  O O   . LYS A 1 91  ? 2.844   12.476 12.663 1.00 40.37  ? 139 LYS A O   1 
ATOM   582  C CB  . LYS A 1 91  ? 2.328   11.595 15.572 1.00 37.85  ? 139 LYS A CB  1 
ATOM   583  C CG  . LYS A 1 91  ? 2.604   10.254 14.941 1.00 42.72  ? 139 LYS A CG  1 
ATOM   584  C CD  . LYS A 1 91  ? 1.451   9.308  15.218 1.00 46.82  ? 139 LYS A CD  1 
ATOM   585  C CE  . LYS A 1 91  ? 1.664   7.960  14.552 1.00 55.09  ? 139 LYS A CE  1 
ATOM   586  N NZ  . LYS A 1 91  ? 0.520   7.027  14.799 1.00 58.46  ? 139 LYS A NZ  1 
ATOM   587  N N   . ILE A 1 92  ? 4.910   12.126 13.496 1.00 37.74  ? 140 ILE A N   1 
ATOM   588  C CA  . ILE A 1 92  ? 5.501   11.721 12.227 1.00 42.33  ? 140 ILE A CA  1 
ATOM   589  C C   . ILE A 1 92  ? 5.509   10.193 12.270 1.00 44.49  ? 140 ILE A C   1 
ATOM   590  O O   . ILE A 1 92  ? 6.242   9.586  13.046 1.00 45.23  ? 140 ILE A O   1 
ATOM   591  C CB  . ILE A 1 92  ? 6.943   12.224 12.064 1.00 37.35  ? 140 ILE A CB  1 
ATOM   592  C CG1 . ILE A 1 92  ? 6.934   13.739 11.842 1.00 37.34  ? 140 ILE A CG1 1 
ATOM   593  C CG2 . ILE A 1 92  ? 7.611   11.509 10.890 1.00 35.93  ? 140 ILE A CG2 1 
ATOM   594  C CD1 . ILE A 1 92  ? 8.306   14.370 11.652 1.00 31.52  ? 140 ILE A CD1 1 
ATOM   595  N N   . ILE A 1 93  ? 4.675   9.583  11.441 1.00 45.54  ? 141 ILE A N   1 
ATOM   596  C CA  . ILE A 1 93  ? 4.541   8.137  11.396 1.00 49.68  ? 141 ILE A CA  1 
ATOM   597  C C   . ILE A 1 93  ? 5.757   7.342  10.925 1.00 54.07  ? 141 ILE A C   1 
ATOM   598  O O   . ILE A 1 93  ? 6.461   7.747  9.998  1.00 54.14  ? 141 ILE A O   1 
ATOM   599  C CB  . ILE A 1 93  ? 3.344   7.765  10.527 1.00 48.12  ? 141 ILE A CB  1 
ATOM   600  C CG1 . ILE A 1 93  ? 2.063   8.276  11.187 1.00 46.23  ? 141 ILE A CG1 1 
ATOM   601  C CG2 . ILE A 1 93  ? 3.291   6.271  10.332 1.00 48.65  ? 141 ILE A CG2 1 
ATOM   602  C CD1 . ILE A 1 93  ? 0.845   8.114  10.332 1.00 47.99  ? 141 ILE A CD1 1 
ATOM   603  N N   . ASN A 1 94  ? 6.000   6.208  11.585 1.00 57.27  ? 142 ASN A N   1 
ATOM   604  C CA  . ASN A 1 94  ? 7.110   5.326  11.230 1.00 58.14  ? 142 ASN A CA  1 
ATOM   605  C C   . ASN A 1 94  ? 6.510   4.116  10.529 1.00 59.64  ? 142 ASN A C   1 
ATOM   606  O O   . ASN A 1 94  ? 5.820   3.305  11.144 1.00 59.94  ? 142 ASN A O   1 
ATOM   607  C CB  . ASN A 1 94  ? 7.892   4.888  12.474 1.00 56.77  ? 142 ASN A CB  1 
ATOM   608  C CG  . ASN A 1 94  ? 9.098   4.021  12.129 1.00 56.89  ? 142 ASN A CG  1 
ATOM   609  O OD1 . ASN A 1 94  ? 8.950   2.895  11.654 1.00 55.33  ? 142 ASN A OD1 1 
ATOM   610  N ND2 . ASN A 1 94  ? 10.297  4.548  12.359 1.00 52.33  ? 142 ASN A ND2 1 
ATOM   611  N N   . TYR A 1 95  ? 6.776   4.023  9.232  1.00 63.90  ? 143 TYR A N   1 
ATOM   612  C CA  . TYR A 1 95  ? 6.260   2.959  8.377  1.00 67.71  ? 143 TYR A CA  1 
ATOM   613  C C   . TYR A 1 95  ? 6.606   1.545  8.821  1.00 71.01  ? 143 TYR A C   1 
ATOM   614  O O   . TYR A 1 95  ? 5.836   0.613  8.592  1.00 70.97  ? 143 TYR A O   1 
ATOM   615  C CB  . TYR A 1 95  ? 6.760   3.175  6.950  1.00 71.24  ? 143 TYR A CB  1 
ATOM   616  C CG  . TYR A 1 95  ? 6.391   4.524  6.370  1.00 75.07  ? 143 TYR A CG  1 
ATOM   617  C CD1 . TYR A 1 95  ? 7.363   5.348  5.800  1.00 75.24  ? 143 TYR A CD1 1 
ATOM   618  C CD2 . TYR A 1 95  ? 5.066   4.964  6.359  1.00 75.47  ? 143 TYR A CD2 1 
ATOM   619  C CE1 . TYR A 1 95  ? 7.023   6.575  5.230  1.00 75.39  ? 143 TYR A CE1 1 
ATOM   620  C CE2 . TYR A 1 95  ? 4.716   6.189  5.790  1.00 75.12  ? 143 TYR A CE2 1 
ATOM   621  C CZ  . TYR A 1 95  ? 5.700   6.987  5.226  1.00 74.23  ? 143 TYR A CZ  1 
ATOM   622  O OH  . TYR A 1 95  ? 5.361   8.181  4.636  1.00 71.86  ? 143 TYR A OH  1 
ATOM   623  N N   . ARG A 1 96  ? 7.768   1.380  9.442  1.00 73.48  ? 144 ARG A N   1 
ATOM   624  C CA  . ARG A 1 96  ? 8.193   0.066  9.901  1.00 76.52  ? 144 ARG A CA  1 
ATOM   625  C C   . ARG A 1 96  ? 7.582   -0.265 11.258 1.00 78.71  ? 144 ARG A C   1 
ATOM   626  O O   . ARG A 1 96  ? 6.606   -1.014 11.347 1.00 78.47  ? 144 ARG A O   1 
ATOM   627  C CB  . ARG A 1 96  ? 9.724   0.004  9.986  1.00 76.08  ? 144 ARG A CB  1 
ATOM   628  C CG  . ARG A 1 96  ? 10.419  0.135  8.637  1.00 77.11  ? 144 ARG A CG  1 
ATOM   629  C CD  . ARG A 1 96  ? 11.913  0.390  8.781  1.00 77.97  ? 144 ARG A CD  1 
ATOM   630  N NE  . ARG A 1 96  ? 12.533  0.689  7.490  1.00 79.69  ? 144 ARG A NE  1 
ATOM   631  C CZ  . ARG A 1 96  ? 13.736  1.238  7.340  1.00 79.75  ? 144 ARG A CZ  1 
ATOM   632  N NH1 . ARG A 1 96  ? 14.463  1.556  8.403  1.00 80.54  ? 144 ARG A NH1 1 
ATOM   633  N NH2 . ARG A 1 96  ? 14.213  1.477  6.127  1.00 78.32  ? 144 ARG A NH2 1 
ATOM   634  N N   . ASP A 1 97  ? 8.153   0.317  12.308 1.00 80.48  ? 145 ASP A N   1 
ATOM   635  C CA  . ASP A 1 97  ? 7.700   0.072  13.672 1.00 82.35  ? 145 ASP A CA  1 
ATOM   636  C C   . ASP A 1 97  ? 6.911   1.250  14.253 1.00 82.32  ? 145 ASP A C   1 
ATOM   637  O O   . ASP A 1 97  ? 7.496   2.248  14.680 1.00 82.13  ? 145 ASP A O   1 
ATOM   638  C CB  . ASP A 1 97  ? 8.922   -0.236 14.550 1.00 82.00  ? 145 ASP A CB  1 
ATOM   639  C CG  . ASP A 1 97  ? 8.551   -0.875 15.872 1.00 81.05  ? 145 ASP A CG  1 
ATOM   640  O OD1 . ASP A 1 97  ? 7.823   -1.891 15.856 1.00 80.02  ? 145 ASP A OD1 1 
ATOM   641  O OD2 . ASP A 1 97  ? 8.997   -0.368 16.923 1.00 78.90  ? 145 ASP A OD2 1 
ATOM   642  N N   . ASP A 1 98  ? 5.585   1.124  14.271 1.00 83.03  ? 146 ASP A N   1 
ATOM   643  C CA  . ASP A 1 98  ? 4.722   2.175  14.801 1.00 82.93  ? 146 ASP A CA  1 
ATOM   644  C C   . ASP A 1 98  ? 5.154   2.587  16.203 1.00 82.83  ? 146 ASP A C   1 
ATOM   645  O O   . ASP A 1 98  ? 5.115   3.765  16.551 1.00 83.33  ? 146 ASP A O   1 
ATOM   646  C CB  . ASP A 1 98  ? 3.267   1.713  14.850 1.00 84.34  ? 146 ASP A CB  1 
ATOM   647  C CG  . ASP A 1 98  ? 2.321   2.819  15.289 1.00 87.54  ? 146 ASP A CG  1 
ATOM   648  O OD1 . ASP A 1 98  ? 1.133   2.524  15.542 1.00 88.65  ? 146 ASP A OD1 1 
ATOM   649  O OD2 . ASP A 1 98  ? 2.761   3.987  15.374 1.00 87.75  ? 146 ASP A OD2 1 
ATOM   650  N N   . GLU A 1 99  ? 5.553   1.612  17.012 1.00 82.15  ? 147 GLU A N   1 
ATOM   651  C CA  . GLU A 1 99  ? 6.005   1.897  18.366 1.00 80.26  ? 147 GLU A CA  1 
ATOM   652  C C   . GLU A 1 99  ? 7.027   3.017  18.290 1.00 76.37  ? 147 GLU A C   1 
ATOM   653  O O   . GLU A 1 99  ? 7.168   3.808  19.218 1.00 77.76  ? 147 GLU A O   1 
ATOM   654  C CB  . GLU A 1 99  ? 6.662   0.661  18.986 1.00 85.05  ? 147 GLU A CB  1 
ATOM   655  C CG  . GLU A 1 99  ? 5.697   -0.447 19.372 1.00 90.83  ? 147 GLU A CG  1 
ATOM   656  C CD  . GLU A 1 99  ? 4.849   -0.081 20.573 1.00 94.03  ? 147 GLU A CD  1 
ATOM   657  O OE1 . GLU A 1 99  ? 4.101   0.917  20.490 1.00 94.48  ? 147 GLU A OE1 1 
ATOM   658  O OE2 . GLU A 1 99  ? 4.936   -0.790 21.602 1.00 95.93  ? 147 GLU A OE2 1 
ATOM   659  N N   . LYS A 1 100 ? 7.730   3.082  17.166 1.00 72.10  ? 148 LYS A N   1 
ATOM   660  C CA  . LYS A 1 100 ? 8.758   4.089  16.970 1.00 67.15  ? 148 LYS A CA  1 
ATOM   661  C C   . LYS A 1 100 ? 8.292   5.359  16.267 1.00 62.08  ? 148 LYS A C   1 
ATOM   662  O O   . LYS A 1 100 ? 9.114   6.183  15.874 1.00 59.05  ? 148 LYS A O   1 
ATOM   663  C CB  . LYS A 1 100 ? 9.942   3.466  16.230 1.00 71.64  ? 148 LYS A CB  1 
ATOM   664  C CG  . LYS A 1 100 ? 10.599  2.342  17.030 1.00 76.84  ? 148 LYS A CG  1 
ATOM   665  C CD  . LYS A 1 100 ? 11.676  1.612  16.239 1.00 80.73  ? 148 LYS A CD  1 
ATOM   666  C CE  . LYS A 1 100 ? 12.185  0.402  17.014 1.00 81.64  ? 148 LYS A CE  1 
ATOM   667  N NZ  . LYS A 1 100 ? 13.099  -0.444 16.197 1.00 83.07  ? 148 LYS A NZ  1 
ATOM   668  N N   . SER A 1 101 ? 6.981   5.518  16.099 1.00 55.36  ? 149 SER A N   1 
ATOM   669  C CA  . SER A 1 101 ? 6.455   6.733  15.485 1.00 52.28  ? 149 SER A CA  1 
ATOM   670  C C   . SER A 1 101 ? 6.804   7.857  16.463 1.00 49.76  ? 149 SER A C   1 
ATOM   671  O O   . SER A 1 101 ? 6.529   7.758  17.657 1.00 53.65  ? 149 SER A O   1 
ATOM   672  C CB  . SER A 1 101 ? 4.933   6.649  15.293 1.00 51.23  ? 149 SER A CB  1 
ATOM   673  O OG  . SER A 1 101 ? 4.567   5.749  14.251 1.00 46.81  ? 149 SER A OG  1 
ATOM   674  N N   . PHE A 1 102 ? 7.420   8.911  15.946 1.00 46.47  ? 150 PHE A N   1 
ATOM   675  C CA  . PHE A 1 102 ? 7.863   10.067 16.729 1.00 45.10  ? 150 PHE A CA  1 
ATOM   676  C C   . PHE A 1 102 ? 6.728   11.071 16.977 1.00 46.18  ? 150 PHE A C   1 
ATOM   677  O O   . PHE A 1 102 ? 6.200   11.670 16.042 1.00 45.60  ? 150 PHE A O   1 
ATOM   678  C CB  . PHE A 1 102 ? 9.004   10.725 15.953 1.00 46.85  ? 150 PHE A CB  1 
ATOM   679  C CG  . PHE A 1 102 ? 9.713   11.826 16.679 1.00 48.06  ? 150 PHE A CG  1 
ATOM   680  C CD1 . PHE A 1 102 ? 11.095  11.753 16.868 1.00 45.98  ? 150 PHE A CD1 1 
ATOM   681  C CD2 . PHE A 1 102 ? 9.037   12.973 17.090 1.00 46.72  ? 150 PHE A CD2 1 
ATOM   682  C CE1 . PHE A 1 102 ? 11.802  12.808 17.450 1.00 48.85  ? 150 PHE A CE1 1 
ATOM   683  C CE2 . PHE A 1 102 ? 9.729   14.040 17.674 1.00 52.10  ? 150 PHE A CE2 1 
ATOM   684  C CZ  . PHE A 1 102 ? 11.119  13.957 17.854 1.00 51.93  ? 150 PHE A CZ  1 
ATOM   685  N N   . SER A 1 103 ? 6.346   11.263 18.233 1.00 46.58  ? 151 SER A N   1 
ATOM   686  C CA  . SER A 1 103 ? 5.273   12.213 18.518 1.00 43.02  ? 151 SER A CA  1 
ATOM   687  C C   . SER A 1 103 ? 5.552   13.138 19.703 1.00 42.04  ? 151 SER A C   1 
ATOM   688  O O   . SER A 1 103 ? 6.344   12.816 20.594 1.00 39.82  ? 151 SER A O   1 
ATOM   689  C CB  . SER A 1 103 ? 3.951   11.472 18.734 1.00 42.80  ? 151 SER A CB  1 
ATOM   690  O OG  . SER A 1 103 ? 3.972   10.717 19.926 1.00 47.06  ? 151 SER A OG  1 
ATOM   691  N N   . ARG A 1 104 ? 4.908   14.305 19.679 1.00 36.07  ? 152 ARG A N   1 
ATOM   692  C CA  . ARG A 1 104 ? 5.036   15.310 20.729 1.00 33.32  ? 152 ARG A CA  1 
ATOM   693  C C   . ARG A 1 104 ? 3.657   15.958 20.900 1.00 35.07  ? 152 ARG A C   1 
ATOM   694  O O   . ARG A 1 104 ? 2.882   16.023 19.947 1.00 36.89  ? 152 ARG A O   1 
ATOM   695  C CB  . ARG A 1 104 ? 6.092   16.356 20.342 1.00 30.37  ? 152 ARG A CB  1 
ATOM   696  C CG  . ARG A 1 104 ? 7.521   15.787 20.249 1.00 32.84  ? 152 ARG A CG  1 
ATOM   697  C CD  . ARG A 1 104 ? 8.574   16.825 19.852 1.00 28.78  ? 152 ARG A CD  1 
ATOM   698  N NE  . ARG A 1 104 ? 8.848   17.805 20.900 1.00 28.85  ? 152 ARG A NE  1 
ATOM   699  C CZ  . ARG A 1 104 ? 9.775   18.756 20.802 1.00 26.78  ? 152 ARG A CZ  1 
ATOM   700  N NH1 . ARG A 1 104 ? 10.509  18.856 19.708 1.00 28.50  ? 152 ARG A NH1 1 
ATOM   701  N NH2 . ARG A 1 104 ? 9.985   19.602 21.801 1.00 27.76  ? 152 ARG A NH2 1 
ATOM   702  N N   . ARG A 1 105 ? 3.340   16.421 22.108 1.00 32.93  ? 153 ARG A N   1 
ATOM   703  C CA  . ARG A 1 105 ? 2.037   17.029 22.361 1.00 33.27  ? 153 ARG A CA  1 
ATOM   704  C C   . ARG A 1 105 ? 2.066   18.540 22.570 1.00 31.83  ? 153 ARG A C   1 
ATOM   705  O O   . ARG A 1 105 ? 3.077   19.107 23.000 1.00 26.54  ? 153 ARG A O   1 
ATOM   706  C CB  . ARG A 1 105 ? 1.383   16.378 23.582 1.00 37.88  ? 153 ARG A CB  1 
ATOM   707  C CG  . ARG A 1 105 ? 1.294   14.855 23.519 1.00 46.62  ? 153 ARG A CG  1 
ATOM   708  C CD  . ARG A 1 105 ? 0.805   14.283 24.846 1.00 54.20  ? 153 ARG A CD  1 
ATOM   709  N NE  . ARG A 1 105 ? -0.653  14.226 24.950 1.00 60.82  ? 153 ARG A NE  1 
ATOM   710  C CZ  . ARG A 1 105 ? -1.382  13.168 24.599 1.00 65.82  ? 153 ARG A CZ  1 
ATOM   711  N NH1 . ARG A 1 105 ? -0.785  12.078 24.125 1.00 65.72  ? 153 ARG A NH1 1 
ATOM   712  N NH2 . ARG A 1 105 ? -2.707  13.195 24.718 1.00 66.32  ? 153 ARG A NH2 1 
ATOM   713  N N   . ILE A 1 106 ? 0.949   19.188 22.250 1.00 25.93  ? 154 ILE A N   1 
ATOM   714  C CA  . ILE A 1 106 ? 0.825   20.627 22.438 1.00 29.07  ? 154 ILE A CA  1 
ATOM   715  C C   . ILE A 1 106 ? -0.546  20.940 23.033 1.00 27.45  ? 154 ILE A C   1 
ATOM   716  O O   . ILE A 1 106 ? -1.447  20.103 23.038 1.00 29.89  ? 154 ILE A O   1 
ATOM   717  C CB  . ILE A 1 106 ? 1.008   21.430 21.099 1.00 31.04  ? 154 ILE A CB  1 
ATOM   718  C CG1 . ILE A 1 106 ? -0.051  21.023 20.066 1.00 29.93  ? 154 ILE A CG1 1 
ATOM   719  C CG2 . ILE A 1 106 ? 2.404   21.194 20.545 1.00 30.78  ? 154 ILE A CG2 1 
ATOM   720  C CD1 . ILE A 1 106 ? -0.015  21.841 18.768 1.00 28.37  ? 154 ILE A CD1 1 
ATOM   721  N N   . SER A 1 107 ? -0.680  22.147 23.558 1.00 27.75  ? 155 SER A N   1 
ATOM   722  C CA  . SER A 1 107 ? -1.924  22.618 24.150 1.00 29.95  ? 155 SER A CA  1 
ATOM   723  C C   . SER A 1 107 ? -1.815  24.104 23.883 1.00 30.48  ? 155 SER A C   1 
ATOM   724  O O   . SER A 1 107 ? -0.789  24.702 24.184 1.00 31.47  ? 155 SER A O   1 
ATOM   725  C CB  . SER A 1 107 ? -1.939  22.347 25.646 1.00 28.56  ? 155 SER A CB  1 
ATOM   726  O OG  . SER A 1 107 ? -3.224  22.596 26.176 1.00 39.44  ? 155 SER A OG  1 
ATOM   727  N N   . HIS A 1 108 ? -2.854  24.705 23.318 1.00 29.17  ? 156 HIS A N   1 
ATOM   728  C CA  . HIS A 1 108 ? -2.758  26.109 22.960 1.00 27.49  ? 156 HIS A CA  1 
ATOM   729  C C   . HIS A 1 108 ? -4.124  26.705 22.676 1.00 28.14  ? 156 HIS A C   1 
ATOM   730  O O   . HIS A 1 108 ? -5.059  26.002 22.285 1.00 27.09  ? 156 HIS A O   1 
ATOM   731  C CB  . HIS A 1 108 ? -1.870  26.213 21.714 1.00 26.72  ? 156 HIS A CB  1 
ATOM   732  C CG  . HIS A 1 108 ? -1.719  27.599 21.167 1.00 28.63  ? 156 HIS A CG  1 
ATOM   733  N ND1 . HIS A 1 108 ? -2.219  27.972 19.936 1.00 30.02  ? 156 HIS A ND1 1 
ATOM   734  C CD2 . HIS A 1 108 ? -1.048  28.676 21.640 1.00 26.99  ? 156 HIS A CD2 1 
ATOM   735  C CE1 . HIS A 1 108 ? -1.855  29.215 19.671 1.00 27.62  ? 156 HIS A CE1 1 
ATOM   736  N NE2 . HIS A 1 108 ? -1.144  29.665 20.689 1.00 27.82  ? 156 HIS A NE2 1 
ATOM   737  N N   . LEU A 1 109 ? -4.236  28.009 22.890 1.00 30.47  ? 157 LEU A N   1 
ATOM   738  C CA  . LEU A 1 109 ? -5.484  28.711 22.636 1.00 31.29  ? 157 LEU A CA  1 
ATOM   739  C C   . LEU A 1 109 ? -5.305  29.331 21.263 1.00 30.33  ? 157 LEU A C   1 
ATOM   740  O O   . LEU A 1 109 ? -4.567  30.310 21.085 1.00 25.50  ? 157 LEU A O   1 
ATOM   741  C CB  . LEU A 1 109 ? -5.715  29.790 23.698 1.00 33.08  ? 157 LEU A CB  1 
ATOM   742  C CG  . LEU A 1 109 ? -7.008  30.624 23.681 1.00 36.55  ? 157 LEU A CG  1 
ATOM   743  C CD1 . LEU A 1 109 ? -6.978  31.617 22.520 1.00 32.17  ? 157 LEU A CD1 1 
ATOM   744  C CD2 . LEU A 1 109 ? -8.213  29.702 23.614 1.00 26.58  ? 157 LEU A CD2 1 
ATOM   745  N N   . PHE A 1 110 ? -5.945  28.730 20.276 1.00 25.90  ? 158 PHE A N   1 
ATOM   746  C CA  . PHE A 1 110 ? -5.833  29.260 18.935 1.00 30.81  ? 158 PHE A CA  1 
ATOM   747  C C   . PHE A 1 110 ? -6.816  30.412 18.736 1.00 30.43  ? 158 PHE A C   1 
ATOM   748  O O   . PHE A 1 110 ? -7.967  30.339 19.180 1.00 30.61  ? 158 PHE A O   1 
ATOM   749  C CB  . PHE A 1 110 ? -6.119  28.169 17.898 1.00 29.72  ? 158 PHE A CB  1 
ATOM   750  C CG  . PHE A 1 110 ? -5.078  27.065 17.845 1.00 29.26  ? 158 PHE A CG  1 
ATOM   751  C CD1 . PHE A 1 110 ? -5.087  26.026 18.779 1.00 27.66  ? 158 PHE A CD1 1 
ATOM   752  C CD2 . PHE A 1 110 ? -4.136  27.031 16.816 1.00 28.02  ? 158 PHE A CD2 1 
ATOM   753  C CE1 . PHE A 1 110 ? -4.175  24.958 18.681 1.00 25.78  ? 158 PHE A CE1 1 
ATOM   754  C CE2 . PHE A 1 110 ? -3.219  25.976 16.705 1.00 28.22  ? 158 PHE A CE2 1 
ATOM   755  C CZ  . PHE A 1 110 ? -3.241  24.931 17.643 1.00 24.34  ? 158 PHE A CZ  1 
ATOM   756  N N   . PHE A 1 111 ? -6.346  31.474 18.090 1.00 30.22  ? 159 PHE A N   1 
ATOM   757  C CA  . PHE A 1 111 ? -7.171  32.629 17.764 1.00 34.42  ? 159 PHE A CA  1 
ATOM   758  C C   . PHE A 1 111 ? -6.438  33.429 16.687 1.00 39.14  ? 159 PHE A C   1 
ATOM   759  O O   . PHE A 1 111 ? -5.316  33.069 16.306 1.00 36.18  ? 159 PHE A O   1 
ATOM   760  C CB  . PHE A 1 111 ? -7.516  33.466 19.014 1.00 38.35  ? 159 PHE A CB  1 
ATOM   761  C CG  . PHE A 1 111 ? -6.372  34.255 19.584 1.00 40.87  ? 159 PHE A CG  1 
ATOM   762  C CD1 . PHE A 1 111 ? -6.378  35.647 19.513 1.00 42.06  ? 159 PHE A CD1 1 
ATOM   763  C CD2 . PHE A 1 111 ? -5.321  33.621 20.238 1.00 39.85  ? 159 PHE A CD2 1 
ATOM   764  C CE1 . PHE A 1 111 ? -5.354  36.402 20.090 1.00 42.83  ? 159 PHE A CE1 1 
ATOM   765  C CE2 . PHE A 1 111 ? -4.290  34.363 20.820 1.00 41.79  ? 159 PHE A CE2 1 
ATOM   766  C CZ  . PHE A 1 111 ? -4.307  35.759 20.747 1.00 43.82  ? 159 PHE A CZ  1 
ATOM   767  N N   . HIS A 1 112 ? -7.053  34.496 16.182 1.00 42.03  ? 160 HIS A N   1 
ATOM   768  C CA  . HIS A 1 112 ? -6.450  35.244 15.083 1.00 46.19  ? 160 HIS A CA  1 
ATOM   769  C C   . HIS A 1 112 ? -4.994  35.698 15.180 1.00 44.96  ? 160 HIS A C   1 
ATOM   770  O O   . HIS A 1 112 ? -4.314  35.748 14.159 1.00 44.99  ? 160 HIS A O   1 
ATOM   771  C CB  . HIS A 1 112 ? -7.349  36.426 14.664 1.00 50.51  ? 160 HIS A CB  1 
ATOM   772  C CG  . HIS A 1 112 ? -7.176  37.667 15.484 1.00 55.71  ? 160 HIS A CG  1 
ATOM   773  N ND1 . HIS A 1 112 ? -7.827  37.869 16.683 1.00 57.26  ? 160 HIS A ND1 1 
ATOM   774  C CD2 . HIS A 1 112 ? -6.452  38.789 15.256 1.00 57.25  ? 160 HIS A CD2 1 
ATOM   775  C CE1 . HIS A 1 112 ? -7.513  39.062 17.156 1.00 58.62  ? 160 HIS A CE1 1 
ATOM   776  N NE2 . HIS A 1 112 ? -6.681  39.642 16.309 1.00 57.97  ? 160 HIS A NE2 1 
ATOM   777  N N   . LYS A 1 113 ? -4.494  36.005 16.373 1.00 47.72  ? 161 LYS A N   1 
ATOM   778  C CA  . LYS A 1 113 ? -3.096  36.448 16.503 1.00 49.74  ? 161 LYS A CA  1 
ATOM   779  C C   . LYS A 1 113 ? -2.083  35.315 16.669 1.00 47.49  ? 161 LYS A C   1 
ATOM   780  O O   . LYS A 1 113 ? -0.877  35.539 16.581 1.00 44.74  ? 161 LYS A O   1 
ATOM   781  C CB  . LYS A 1 113 ? -2.938  37.420 17.676 1.00 56.14  ? 161 LYS A CB  1 
ATOM   782  C CG  . LYS A 1 113 ? -3.701  38.721 17.515 1.00 62.67  ? 161 LYS A CG  1 
ATOM   783  C CD  . LYS A 1 113 ? -3.505  39.605 18.734 1.00 68.05  ? 161 LYS A CD  1 
ATOM   784  C CE  . LYS A 1 113 ? -4.392  40.833 18.684 1.00 68.99  ? 161 LYS A CE  1 
ATOM   785  N NZ  . LYS A 1 113 ? -4.197  41.662 19.905 1.00 74.24  ? 161 LYS A NZ  1 
ATOM   786  N N   . GLU A 1 114 ? -2.574  34.106 16.925 1.00 45.30  ? 162 GLU A N   1 
ATOM   787  C CA  . GLU A 1 114 ? -1.711  32.935 17.079 1.00 38.17  ? 162 GLU A CA  1 
ATOM   788  C C   . GLU A 1 114 ? -2.494  31.745 16.522 1.00 36.81  ? 162 GLU A C   1 
ATOM   789  O O   . GLU A 1 114 ? -2.886  30.841 17.265 1.00 29.72  ? 162 GLU A O   1 
ATOM   790  C CB  . GLU A 1 114 ? -1.392  32.724 18.557 1.00 41.85  ? 162 GLU A CB  1 
ATOM   791  C CG  . GLU A 1 114 ? -0.920  33.986 19.255 1.00 44.78  ? 162 GLU A CG  1 
ATOM   792  C CD  . GLU A 1 114 ? -0.517  33.758 20.699 1.00 50.91  ? 162 GLU A CD  1 
ATOM   793  O OE1 . GLU A 1 114 ? -0.317  34.758 21.419 1.00 57.25  ? 162 GLU A OE1 1 
ATOM   794  O OE2 . GLU A 1 114 ? -0.393  32.589 21.118 1.00 53.15  ? 162 GLU A OE2 1 
ATOM   795  N N   . ASN A 1 115 ? -2.721  31.760 15.208 1.00 35.23  ? 163 ASN A N   1 
ATOM   796  C CA  . ASN A 1 115 ? -3.504  30.719 14.546 1.00 33.48  ? 163 ASN A CA  1 
ATOM   797  C C   . ASN A 1 115 ? -2.775  29.405 14.272 1.00 35.18  ? 163 ASN A C   1 
ATOM   798  O O   . ASN A 1 115 ? -3.353  28.472 13.696 1.00 28.99  ? 163 ASN A O   1 
ATOM   799  C CB  . ASN A 1 115 ? -4.133  31.273 13.247 1.00 30.09  ? 163 ASN A CB  1 
ATOM   800  C CG  . ASN A 1 115 ? -3.103  31.661 12.202 1.00 31.01  ? 163 ASN A CG  1 
ATOM   801  O OD1 . ASN A 1 115 ? -3.267  32.666 11.513 1.00 35.27  ? 163 ASN A OD1 1 
ATOM   802  N ND2 . ASN A 1 115 ? -2.050  30.856 12.059 1.00 23.33  ? 163 ASN A ND2 1 
ATOM   803  N N   . ASP A 1 116 ? -1.511  29.326 14.674 1.00 32.48  ? 164 ASP A N   1 
ATOM   804  C CA  . ASP A 1 116 ? -0.770  28.084 14.503 1.00 34.72  ? 164 ASP A CA  1 
ATOM   805  C C   . ASP A 1 116 ? 0.181   27.843 15.674 1.00 33.41  ? 164 ASP A C   1 
ATOM   806  O O   . ASP A 1 116 ? 0.602   28.782 16.354 1.00 33.47  ? 164 ASP A O   1 
ATOM   807  C CB  . ASP A 1 116 ? -0.048  28.052 13.149 1.00 29.92  ? 164 ASP A CB  1 
ATOM   808  C CG  . ASP A 1 116 ? 1.207   28.895 13.106 1.00 31.95  ? 164 ASP A CG  1 
ATOM   809  O OD1 . ASP A 1 116 ? 1.721   29.065 11.987 1.00 35.69  ? 164 ASP A OD1 1 
ATOM   810  O OD2 . ASP A 1 116 ? 1.704   29.372 14.150 1.00 35.03  ? 164 ASP A OD2 1 
ATOM   811  N N   . TRP A 1 117 ? 0.491   26.576 15.926 1.00 33.55  ? 165 TRP A N   1 
ATOM   812  C CA  . TRP A 1 117 ? 1.356   26.206 17.047 1.00 31.61  ? 165 TRP A CA  1 
ATOM   813  C C   . TRP A 1 117 ? 1.979   24.854 16.738 1.00 31.95  ? 165 TRP A C   1 
ATOM   814  O O   . TRP A 1 117 ? 1.342   23.996 16.124 1.00 29.25  ? 165 TRP A O   1 
ATOM   815  C CB  . TRP A 1 117 ? 0.504   26.120 18.314 1.00 31.51  ? 165 TRP A CB  1 
ATOM   816  C CG  . TRP A 1 117 ? 1.249   26.164 19.611 1.00 34.83  ? 165 TRP A CG  1 
ATOM   817  C CD1 . TRP A 1 117 ? 1.461   25.121 20.471 1.00 32.86  ? 165 TRP A CD1 1 
ATOM   818  C CD2 . TRP A 1 117 ? 1.797   27.326 20.250 1.00 33.57  ? 165 TRP A CD2 1 
ATOM   819  N NE1 . TRP A 1 117 ? 2.094   25.564 21.606 1.00 32.65  ? 165 TRP A NE1 1 
ATOM   820  C CE2 . TRP A 1 117 ? 2.314   26.911 21.500 1.00 31.74  ? 165 TRP A CE2 1 
ATOM   821  C CE3 . TRP A 1 117 ? 1.897   28.678 19.892 1.00 31.48  ? 165 TRP A CE3 1 
ATOM   822  C CZ2 . TRP A 1 117 ? 2.924   27.800 22.398 1.00 29.83  ? 165 TRP A CZ2 1 
ATOM   823  C CZ3 . TRP A 1 117 ? 2.502   29.565 20.786 1.00 32.95  ? 165 TRP A CZ3 1 
ATOM   824  C CH2 . TRP A 1 117 ? 3.008   29.117 22.026 1.00 30.45  ? 165 TRP A CH2 1 
ATOM   825  N N   . GLY A 1 118 ? 3.225   24.675 17.165 1.00 31.90  ? 166 GLY A N   1 
ATOM   826  C CA  . GLY A 1 118 ? 3.935   23.434 16.919 1.00 28.33  ? 166 GLY A CA  1 
ATOM   827  C C   . GLY A 1 118 ? 5.394   23.534 17.334 1.00 31.67  ? 166 GLY A C   1 
ATOM   828  O O   . GLY A 1 118 ? 5.724   24.189 18.329 1.00 33.37  ? 166 GLY A O   1 
ATOM   829  N N   . PHE A 1 119 ? 6.278   22.894 16.572 1.00 28.21  ? 167 PHE A N   1 
ATOM   830  C CA  . PHE A 1 119 ? 7.697   22.919 16.896 1.00 28.28  ? 167 PHE A CA  1 
ATOM   831  C C   . PHE A 1 119 ? 8.591   23.221 15.703 1.00 28.16  ? 167 PHE A C   1 
ATOM   832  O O   . PHE A 1 119 ? 8.611   22.468 14.733 1.00 30.17  ? 167 PHE A O   1 
ATOM   833  C CB  . PHE A 1 119 ? 8.143   21.568 17.479 1.00 29.26  ? 167 PHE A CB  1 
ATOM   834  C CG  . PHE A 1 119 ? 7.328   21.105 18.647 1.00 28.82  ? 167 PHE A CG  1 
ATOM   835  C CD1 . PHE A 1 119 ? 6.160   20.383 18.448 1.00 27.69  ? 167 PHE A CD1 1 
ATOM   836  C CD2 . PHE A 1 119 ? 7.733   21.388 19.949 1.00 29.42  ? 167 PHE A CD2 1 
ATOM   837  C CE1 . PHE A 1 119 ? 5.402   19.944 19.531 1.00 31.17  ? 167 PHE A CE1 1 
ATOM   838  C CE2 . PHE A 1 119 ? 6.985   20.956 21.043 1.00 28.96  ? 167 PHE A CE2 1 
ATOM   839  C CZ  . PHE A 1 119 ? 5.814   20.232 20.834 1.00 29.45  ? 167 PHE A CZ  1 
ATOM   840  N N   . SER A 1 120 ? 9.358   24.302 15.778 1.00 30.57  ? 168 SER A N   1 
ATOM   841  C CA  . SER A 1 120 ? 10.268  24.620 14.686 1.00 33.50  ? 168 SER A CA  1 
ATOM   842  C C   . SER A 1 120 ? 11.380  23.567 14.661 1.00 34.77  ? 168 SER A C   1 
ATOM   843  O O   . SER A 1 120 ? 11.967  23.279 13.612 1.00 35.93  ? 168 SER A O   1 
ATOM   844  C CB  . SER A 1 120 ? 10.855  26.016 14.869 1.00 32.28  ? 168 SER A CB  1 
ATOM   845  O OG  . SER A 1 120 ? 11.389  26.174 16.163 1.00 38.68  ? 168 SER A OG  1 
ATOM   846  N N   . ASN A 1 121 ? 11.657  22.979 15.822 1.00 36.21  ? 169 ASN A N   1 
ATOM   847  C CA  . ASN A 1 121 ? 12.680  21.943 15.927 1.00 34.69  ? 169 ASN A CA  1 
ATOM   848  C C   . ASN A 1 121 ? 11.990  20.668 16.393 1.00 33.93  ? 169 ASN A C   1 
ATOM   849  O O   . ASN A 1 121 ? 12.382  20.038 17.374 1.00 34.75  ? 169 ASN A O   1 
ATOM   850  C CB  . ASN A 1 121 ? 13.758  22.354 16.925 1.00 34.63  ? 169 ASN A CB  1 
ATOM   851  C CG  . ASN A 1 121 ? 14.998  21.466 16.847 1.00 39.28  ? 169 ASN A CG  1 
ATOM   852  O OD1 . ASN A 1 121 ? 14.951  20.355 16.309 1.00 34.01  ? 169 ASN A OD1 1 
ATOM   853  N ND2 . ASN A 1 121 ? 16.115  21.955 17.396 1.00 31.39  ? 169 ASN A ND2 1 
ATOM   854  N N   . PHE A 1 122 ? 10.929  20.307 15.690 1.00 33.73  ? 170 PHE A N   1 
ATOM   855  C CA  . PHE A 1 122 ? 10.179  19.108 16.031 1.00 33.07  ? 170 PHE A CA  1 
ATOM   856  C C   . PHE A 1 122 ? 11.114  17.919 16.120 1.00 34.88  ? 170 PHE A C   1 
ATOM   857  O O   . PHE A 1 122 ? 11.172  17.237 17.134 1.00 36.90  ? 170 PHE A O   1 
ATOM   858  C CB  . PHE A 1 122 ? 9.138   18.802 14.956 1.00 28.62  ? 170 PHE A CB  1 
ATOM   859  C CG  . PHE A 1 122 ? 8.304   17.586 15.252 1.00 26.58  ? 170 PHE A CG  1 
ATOM   860  C CD1 . PHE A 1 122 ? 7.297   17.633 16.206 1.00 23.58  ? 170 PHE A CD1 1 
ATOM   861  C CD2 . PHE A 1 122 ? 8.528   16.397 14.574 1.00 27.14  ? 170 PHE A CD2 1 
ATOM   862  C CE1 . PHE A 1 122 ? 6.518   16.509 16.482 1.00 27.49  ? 170 PHE A CE1 1 
ATOM   863  C CE2 . PHE A 1 122 ? 7.763   15.269 14.835 1.00 28.57  ? 170 PHE A CE2 1 
ATOM   864  C CZ  . PHE A 1 122 ? 6.748   15.322 15.795 1.00 25.83  ? 170 PHE A CZ  1 
ATOM   865  N N   . MET A 1 123 ? 11.851  17.701 15.036 1.00 35.57  ? 171 MET A N   1 
ATOM   866  C CA  . MET A 1 123 ? 12.749  16.570 14.905 1.00 38.02  ? 171 MET A CA  1 
ATOM   867  C C   . MET A 1 123 ? 13.927  16.999 14.038 1.00 39.71  ? 171 MET A C   1 
ATOM   868  O O   . MET A 1 123 ? 13.907  18.076 13.443 1.00 40.35  ? 171 MET A O   1 
ATOM   869  C CB  . MET A 1 123 ? 11.971  15.450 14.225 1.00 43.58  ? 171 MET A CB  1 
ATOM   870  C CG  . MET A 1 123 ? 12.567  14.085 14.256 1.00 45.77  ? 171 MET A CG  1 
ATOM   871  S SD  . MET A 1 123 ? 11.763  13.124 12.968 1.00 49.03  ? 171 MET A SD  1 
ATOM   872  C CE  . MET A 1 123 ? 10.269  12.676 13.705 1.00 47.66  ? 171 MET A CE  1 
ATOM   873  N N   . ALA A 1 124 ? 14.954  16.164 13.962 1.00 39.10  ? 172 ALA A N   1 
ATOM   874  C CA  . ALA A 1 124 ? 16.133  16.501 13.166 1.00 39.13  ? 172 ALA A CA  1 
ATOM   875  C C   . ALA A 1 124 ? 15.951  16.017 11.742 1.00 36.83  ? 172 ALA A C   1 
ATOM   876  O O   . ALA A 1 124 ? 15.500  14.894 11.508 1.00 35.36  ? 172 ALA A O   1 
ATOM   877  C CB  . ALA A 1 124 ? 17.399  15.878 13.781 1.00 41.28  ? 172 ALA A CB  1 
ATOM   878  N N   . TRP A 1 125 ? 16.302  16.877 10.795 1.00 36.92  ? 173 TRP A N   1 
ATOM   879  C CA  . TRP A 1 125 ? 16.173  16.556 9.386  1.00 40.60  ? 173 TRP A CA  1 
ATOM   880  C C   . TRP A 1 125 ? 16.952  15.290 9.047  1.00 43.65  ? 173 TRP A C   1 
ATOM   881  O O   . TRP A 1 125 ? 16.418  14.373 8.416  1.00 44.84  ? 173 TRP A O   1 
ATOM   882  C CB  . TRP A 1 125 ? 16.663  17.733 8.547  1.00 42.88  ? 173 TRP A CB  1 
ATOM   883  C CG  . TRP A 1 125 ? 16.177  17.692 7.143  1.00 47.91  ? 173 TRP A CG  1 
ATOM   884  C CD1 . TRP A 1 125 ? 16.830  17.175 6.059  1.00 48.52  ? 173 TRP A CD1 1 
ATOM   885  C CD2 . TRP A 1 125 ? 14.909  18.152 6.665  1.00 49.55  ? 173 TRP A CD2 1 
ATOM   886  N NE1 . TRP A 1 125 ? 16.047  17.288 4.936  1.00 52.59  ? 173 TRP A NE1 1 
ATOM   887  C CE2 . TRP A 1 125 ? 14.863  17.887 5.280  1.00 49.97  ? 173 TRP A CE2 1 
ATOM   888  C CE3 . TRP A 1 125 ? 13.806  18.767 7.273  1.00 49.80  ? 173 TRP A CE3 1 
ATOM   889  C CZ2 . TRP A 1 125 ? 13.757  18.212 4.492  1.00 51.07  ? 173 TRP A CZ2 1 
ATOM   890  C CZ3 . TRP A 1 125 ? 12.704  19.090 6.488  1.00 51.06  ? 173 TRP A CZ3 1 
ATOM   891  C CH2 . TRP A 1 125 ? 12.690  18.813 5.112  1.00 50.07  ? 173 TRP A CH2 1 
ATOM   892  N N   . SER A 1 126 ? 18.204  15.226 9.485  1.00 45.81  ? 174 SER A N   1 
ATOM   893  C CA  . SER A 1 126 ? 19.036  14.057 9.214  1.00 50.36  ? 174 SER A CA  1 
ATOM   894  C C   . SER A 1 126 ? 18.390  12.749 9.682  1.00 51.27  ? 174 SER A C   1 
ATOM   895  O O   . SER A 1 126 ? 18.532  11.707 9.031  1.00 52.40  ? 174 SER A O   1 
ATOM   896  C CB  . SER A 1 126 ? 20.401  14.219 9.885  1.00 50.95  ? 174 SER A CB  1 
ATOM   897  O OG  . SER A 1 126 ? 20.261  14.435 11.279 1.00 58.27  ? 174 SER A OG  1 
ATOM   898  N N   . GLU A 1 127 ? 17.671  12.807 10.801 1.00 48.83  ? 175 GLU A N   1 
ATOM   899  C CA  . GLU A 1 127 ? 17.034  11.619 11.349 1.00 47.31  ? 175 GLU A CA  1 
ATOM   900  C C   . GLU A 1 127 ? 15.767  11.188 10.614 1.00 48.86  ? 175 GLU A C   1 
ATOM   901  O O   . GLU A 1 127 ? 15.586  10.003 10.324 1.00 52.53  ? 175 GLU A O   1 
ATOM   902  C CB  . GLU A 1 127 ? 16.727  11.832 12.833 1.00 50.97  ? 175 GLU A CB  1 
ATOM   903  C CG  . GLU A 1 127 ? 16.135  10.608 13.527 1.00 54.11  ? 175 GLU A CG  1 
ATOM   904  C CD  . GLU A 1 127 ? 15.884  10.841 15.005 1.00 59.35  ? 175 GLU A CD  1 
ATOM   905  O OE1 . GLU A 1 127 ? 15.322  9.940  15.670 1.00 58.94  ? 175 GLU A OE1 1 
ATOM   906  O OE2 . GLU A 1 127 ? 16.249  11.931 15.500 1.00 64.43  ? 175 GLU A OE2 1 
ATOM   907  N N   . VAL A 1 128 ? 14.884  12.135 10.315 1.00 45.00  ? 176 VAL A N   1 
ATOM   908  C CA  . VAL A 1 128 ? 13.652  11.802 9.611  1.00 39.18  ? 176 VAL A CA  1 
ATOM   909  C C   . VAL A 1 128 ? 13.931  11.388 8.163  1.00 41.79  ? 176 VAL A C   1 
ATOM   910  O O   . VAL A 1 128 ? 13.212  10.549 7.596  1.00 36.42  ? 176 VAL A O   1 
ATOM   911  C CB  . VAL A 1 128 ? 12.676  12.995 9.595  1.00 37.80  ? 176 VAL A CB  1 
ATOM   912  C CG1 . VAL A 1 128 ? 13.167  14.066 8.602  1.00 29.78  ? 176 VAL A CG1 1 
ATOM   913  C CG2 . VAL A 1 128 ? 11.286  12.507 9.242  1.00 32.13  ? 176 VAL A CG2 1 
ATOM   914  N N   . THR A 1 129 ? 14.969  11.982 7.568  1.00 39.92  ? 177 THR A N   1 
ATOM   915  C CA  . THR A 1 129 ? 15.340  11.672 6.186  1.00 45.26  ? 177 THR A CA  1 
ATOM   916  C C   . THR A 1 129 ? 16.375  10.551 6.093  1.00 48.40  ? 177 THR A C   1 
ATOM   917  O O   . THR A 1 129 ? 17.003  10.370 5.051  1.00 49.94  ? 177 THR A O   1 
ATOM   918  C CB  . THR A 1 129 ? 15.929  12.901 5.450  1.00 43.48  ? 177 THR A CB  1 
ATOM   919  O OG1 . THR A 1 129 ? 17.170  13.274 6.057  1.00 46.29  ? 177 THR A OG1 1 
ATOM   920  C CG2 . THR A 1 129 ? 14.971  14.071 5.504  1.00 41.94  ? 177 THR A CG2 1 
ATOM   921  N N   . ASP A 1 130 ? 16.566  9.807  7.179  1.00 52.36  ? 178 ASP A N   1 
ATOM   922  C CA  . ASP A 1 130 ? 17.521  8.707  7.179  1.00 54.76  ? 178 ASP A CA  1 
ATOM   923  C C   . ASP A 1 130 ? 16.772  7.468  6.696  1.00 56.08  ? 178 ASP A C   1 
ATOM   924  O O   . ASP A 1 130 ? 15.930  6.931  7.409  1.00 54.86  ? 178 ASP A O   1 
ATOM   925  C CB  . ASP A 1 130 ? 18.061  8.477  8.592  1.00 60.64  ? 178 ASP A CB  1 
ATOM   926  C CG  . ASP A 1 130 ? 19.234  7.515  8.621  1.00 63.26  ? 178 ASP A CG  1 
ATOM   927  O OD1 . ASP A 1 130 ? 19.157  6.451  7.971  1.00 66.54  ? 178 ASP A OD1 1 
ATOM   928  O OD2 . ASP A 1 130 ? 20.235  7.821  9.300  1.00 66.48  ? 178 ASP A OD2 1 
ATOM   929  N N   . PRO A 1 131 ? 17.078  6.987  5.482  1.00 58.60  ? 179 PRO A N   1 
ATOM   930  C CA  . PRO A 1 131 ? 16.389  5.805  4.954  1.00 60.74  ? 179 PRO A CA  1 
ATOM   931  C C   . PRO A 1 131 ? 16.443  4.576  5.856  1.00 62.66  ? 179 PRO A C   1 
ATOM   932  O O   . PRO A 1 131 ? 15.750  3.590  5.613  1.00 63.50  ? 179 PRO A O   1 
ATOM   933  C CB  . PRO A 1 131 ? 17.079  5.580  3.613  1.00 59.96  ? 179 PRO A CB  1 
ATOM   934  C CG  . PRO A 1 131 ? 18.465  6.064  3.873  1.00 59.56  ? 179 PRO A CG  1 
ATOM   935  C CD  . PRO A 1 131 ? 18.227  7.344  4.630  1.00 59.03  ? 179 PRO A CD  1 
ATOM   936  N N   . GLU A 1 132 ? 17.254  4.643  6.907  1.00 65.63  ? 180 GLU A N   1 
ATOM   937  C CA  . GLU A 1 132 ? 17.394  3.520  7.825  1.00 66.92  ? 180 GLU A CA  1 
ATOM   938  C C   . GLU A 1 132 ? 16.586  3.673  9.114  1.00 67.50  ? 180 GLU A C   1 
ATOM   939  O O   . GLU A 1 132 ? 16.467  2.722  9.887  1.00 69.05  ? 180 GLU A O   1 
ATOM   940  C CB  . GLU A 1 132 ? 18.877  3.308  8.164  1.00 70.46  ? 180 GLU A CB  1 
ATOM   941  C CG  . GLU A 1 132 ? 19.778  3.087  6.941  1.00 76.06  ? 180 GLU A CG  1 
ATOM   942  C CD  . GLU A 1 132 ? 19.413  1.833  6.146  1.00 77.85  ? 180 GLU A CD  1 
ATOM   943  O OE1 . GLU A 1 132 ? 19.857  1.709  4.981  1.00 75.68  ? 180 GLU A OE1 1 
ATOM   944  O OE2 . GLU A 1 132 ? 18.689  0.970  6.689  1.00 79.55  ? 180 GLU A OE2 1 
ATOM   945  N N   . LYS A 1 133 ? 16.023  4.859  9.340  1.00 65.28  ? 181 LYS A N   1 
ATOM   946  C CA  . LYS A 1 133 ? 15.241  5.117  10.550 1.00 61.17  ? 181 LYS A CA  1 
ATOM   947  C C   . LYS A 1 133 ? 13.757  4.747  10.453 1.00 57.96  ? 181 LYS A C   1 
ATOM   948  O O   . LYS A 1 133 ? 13.070  4.677  11.469 1.00 56.28  ? 181 LYS A O   1 
ATOM   949  C CB  . LYS A 1 133 ? 15.394  6.587  10.964 1.00 63.98  ? 181 LYS A CB  1 
ATOM   950  C CG  . LYS A 1 133 ? 16.648  6.888  11.801 1.00 62.44  ? 181 LYS A CG  1 
ATOM   951  C CD  . LYS A 1 133 ? 16.427  6.563  13.281 1.00 66.07  ? 181 LYS A CD  1 
ATOM   952  C CE  . LYS A 1 133 ? 17.731  6.588  14.090 1.00 67.51  ? 181 LYS A CE  1 
ATOM   953  N NZ  . LYS A 1 133 ? 18.369  7.932  14.219 1.00 69.75  ? 181 LYS A NZ  1 
ATOM   954  N N   . GLY A 1 134 ? 13.265  4.516  9.239  1.00 57.61  ? 182 GLY A N   1 
ATOM   955  C CA  . GLY A 1 134 ? 11.869  4.136  9.055  1.00 56.66  ? 182 GLY A CA  1 
ATOM   956  C C   . GLY A 1 134 ? 10.824  5.236  8.889  1.00 55.11  ? 182 GLY A C   1 
ATOM   957  O O   . GLY A 1 134 ? 9.631   4.944  8.786  1.00 56.23  ? 182 GLY A O   1 
ATOM   958  N N   . PHE A 1 135 ? 11.253  6.494  8.846  1.00 54.05  ? 183 PHE A N   1 
ATOM   959  C CA  . PHE A 1 135 ? 10.322  7.614  8.706  1.00 52.78  ? 183 PHE A CA  1 
ATOM   960  C C   . PHE A 1 135 ? 10.126  8.066  7.269  1.00 53.08  ? 183 PHE A C   1 
ATOM   961  O O   . PHE A 1 135 ? 9.155   8.757  6.958  1.00 52.37  ? 183 PHE A O   1 
ATOM   962  C CB  . PHE A 1 135 ? 10.810  8.821  9.505  1.00 48.41  ? 183 PHE A CB  1 
ATOM   963  C CG  . PHE A 1 135 ? 10.865  8.593  10.978 1.00 48.00  ? 183 PHE A CG  1 
ATOM   964  C CD1 . PHE A 1 135 ? 12.088  8.576  11.646 1.00 47.91  ? 183 PHE A CD1 1 
ATOM   965  C CD2 . PHE A 1 135 ? 9.693   8.430  11.712 1.00 46.26  ? 183 PHE A CD2 1 
ATOM   966  C CE1 . PHE A 1 135 ? 12.143  8.404  13.026 1.00 47.89  ? 183 PHE A CE1 1 
ATOM   967  C CE2 . PHE A 1 135 ? 9.736   8.255  13.089 1.00 45.05  ? 183 PHE A CE2 1 
ATOM   968  C CZ  . PHE A 1 135 ? 10.963  8.244  13.751 1.00 44.06  ? 183 PHE A CZ  1 
ATOM   969  N N   . ILE A 1 136 ? 11.047  7.686  6.393  1.00 51.09  ? 184 ILE A N   1 
ATOM   970  C CA  . ILE A 1 136 ? 10.960  8.112  5.005  1.00 51.06  ? 184 ILE A CA  1 
ATOM   971  C C   . ILE A 1 136 ? 10.913  6.929  4.046  1.00 51.92  ? 184 ILE A C   1 
ATOM   972  O O   . ILE A 1 136 ? 11.797  6.079  4.057  1.00 53.06  ? 184 ILE A O   1 
ATOM   973  C CB  . ILE A 1 136 ? 12.155  9.038  4.680  1.00 50.16  ? 184 ILE A CB  1 
ATOM   974  C CG1 . ILE A 1 136 ? 11.921  9.762  3.356  1.00 48.26  ? 184 ILE A CG1 1 
ATOM   975  C CG2 . ILE A 1 136 ? 13.457  8.232  4.669  1.00 52.80  ? 184 ILE A CG2 1 
ATOM   976  C CD1 . ILE A 1 136 ? 12.909  10.885 3.117  1.00 39.44  ? 184 ILE A CD1 1 
ATOM   977  N N   . ASP A 1 137 ? 9.869   6.880  3.223  1.00 52.29  ? 185 ASP A N   1 
ATOM   978  C CA  . ASP A 1 137 ? 9.688   5.792  2.264  1.00 53.79  ? 185 ASP A CA  1 
ATOM   979  C C   . ASP A 1 137 ? 9.432   6.309  0.854  1.00 53.21  ? 185 ASP A C   1 
ATOM   980  O O   . ASP A 1 137 ? 8.403   6.926  0.597  1.00 55.15  ? 185 ASP A O   1 
ATOM   981  C CB  . ASP A 1 137 ? 8.523   4.904  2.714  1.00 56.82  ? 185 ASP A CB  1 
ATOM   982  C CG  . ASP A 1 137 ? 7.960   4.051  1.591  1.00 63.87  ? 185 ASP A CG  1 
ATOM   983  O OD1 . ASP A 1 137 ? 7.081   4.545  0.846  1.00 66.71  ? 185 ASP A OD1 1 
ATOM   984  O OD2 . ASP A 1 137 ? 8.400   2.889  1.446  1.00 66.47  ? 185 ASP A OD2 1 
ATOM   985  N N   . ASP A 1 138 ? 10.368  6.058  -0.058 1.00 52.45  ? 186 ASP A N   1 
ATOM   986  C CA  . ASP A 1 138 ? 10.210  6.505  -1.435 1.00 49.22  ? 186 ASP A CA  1 
ATOM   987  C C   . ASP A 1 138 ? 10.153  8.031  -1.388 1.00 46.63  ? 186 ASP A C   1 
ATOM   988  O O   . ASP A 1 138 ? 9.382   8.677  -2.104 1.00 44.54  ? 186 ASP A O   1 
ATOM   989  C CB  . ASP A 1 138 ? 8.910   5.933  -2.006 1.00 56.13  ? 186 ASP A CB  1 
ATOM   990  C CG  . ASP A 1 138 ? 8.896   5.901  -3.514 1.00 60.39  ? 186 ASP A CG  1 
ATOM   991  O OD1 . ASP A 1 138 ? 9.532   6.780  -4.132 1.00 65.90  ? 186 ASP A OD1 1 
ATOM   992  O OD2 . ASP A 1 138 ? 8.237   5.006  -4.082 1.00 65.44  ? 186 ASP A OD2 1 
ATOM   993  N N   . ASP A 1 139 ? 10.979  8.581  -0.506 1.00 42.11  ? 187 ASP A N   1 
ATOM   994  C CA  . ASP A 1 139 ? 11.096  10.014 -0.265 1.00 38.09  ? 187 ASP A CA  1 
ATOM   995  C C   . ASP A 1 139 ? 9.814   10.671 0.249  1.00 38.88  ? 187 ASP A C   1 
ATOM   996  O O   . ASP A 1 139 ? 9.660   11.887 0.175  1.00 38.34  ? 187 ASP A O   1 
ATOM   997  C CB  . ASP A 1 139 ? 11.591  10.735 -1.518 1.00 33.39  ? 187 ASP A CB  1 
ATOM   998  C CG  . ASP A 1 139 ? 12.516  11.892 -1.185 1.00 37.22  ? 187 ASP A CG  1 
ATOM   999  O OD1 . ASP A 1 139 ? 12.919  12.630 -2.104 1.00 35.92  ? 187 ASP A OD1 1 
ATOM   1000 O OD2 . ASP A 1 139 ? 12.845  12.063 0.009  1.00 41.52  ? 187 ASP A OD2 1 
ATOM   1001 N N   . LYS A 1 140 ? 8.904   9.861  0.780  1.00 37.72  ? 188 LYS A N   1 
ATOM   1002 C CA  . LYS A 1 140 ? 7.649   10.360 1.327  1.00 39.30  ? 188 LYS A CA  1 
ATOM   1003 C C   . LYS A 1 140 ? 7.650   10.222 2.838  1.00 41.06  ? 188 LYS A C   1 
ATOM   1004 O O   . LYS A 1 140 ? 8.060   9.189  3.375  1.00 41.87  ? 188 LYS A O   1 
ATOM   1005 C CB  . LYS A 1 140 ? 6.457   9.579  0.778  1.00 41.98  ? 188 LYS A CB  1 
ATOM   1006 C CG  . LYS A 1 140 ? 6.147   9.847  -0.674 1.00 49.72  ? 188 LYS A CG  1 
ATOM   1007 C CD  . LYS A 1 140 ? 5.040   8.926  -1.171 1.00 52.24  ? 188 LYS A CD  1 
ATOM   1008 C CE  . LYS A 1 140 ? 5.521   7.476  -1.231 1.00 56.76  ? 188 LYS A CE  1 
ATOM   1009 N NZ  . LYS A 1 140 ? 4.423   6.533  -1.603 1.00 57.75  ? 188 LYS A NZ  1 
ATOM   1010 N N   . VAL A 1 141 ? 7.192   11.274 3.512  1.00 39.82  ? 189 VAL A N   1 
ATOM   1011 C CA  . VAL A 1 141 ? 7.100   11.305 4.965  1.00 35.85  ? 189 VAL A CA  1 
ATOM   1012 C C   . VAL A 1 141 ? 5.651   11.645 5.300  1.00 38.81  ? 189 VAL A C   1 
ATOM   1013 O O   . VAL A 1 141 ? 5.041   12.525 4.676  1.00 38.66  ? 189 VAL A O   1 
ATOM   1014 C CB  . VAL A 1 141 ? 8.036   12.367 5.564  1.00 37.28  ? 189 VAL A CB  1 
ATOM   1015 C CG1 . VAL A 1 141 ? 7.901   12.378 7.078  1.00 35.48  ? 189 VAL A CG1 1 
ATOM   1016 C CG2 . VAL A 1 141 ? 9.474   12.080 5.162  1.00 36.53  ? 189 VAL A CG2 1 
ATOM   1017 N N   . THR A 1 142 ? 5.091   10.934 6.271  1.00 35.98  ? 190 THR A N   1 
ATOM   1018 C CA  . THR A 1 142 ? 3.707   11.153 6.639  1.00 32.96  ? 190 THR A CA  1 
ATOM   1019 C C   . THR A 1 142 ? 3.565   11.797 8.001  1.00 35.00  ? 190 THR A C   1 
ATOM   1020 O O   . THR A 1 142 ? 4.162   11.362 8.991  1.00 37.91  ? 190 THR A O   1 
ATOM   1021 C CB  . THR A 1 142 ? 2.897   9.829  6.637  1.00 35.72  ? 190 THR A CB  1 
ATOM   1022 O OG1 . THR A 1 142 ? 2.957   9.225  5.339  1.00 34.24  ? 190 THR A OG1 1 
ATOM   1023 C CG2 . THR A 1 142 ? 1.435   10.100 6.981  1.00 33.47  ? 190 THR A CG2 1 
ATOM   1024 N N   . PHE A 1 143 ? 2.764   12.847 8.045  1.00 28.98  ? 191 PHE A N   1 
ATOM   1025 C CA  . PHE A 1 143 ? 2.533   13.531 9.286  1.00 26.65  ? 191 PHE A CA  1 
ATOM   1026 C C   . PHE A 1 143 ? 1.125   13.218 9.716  1.00 28.34  ? 191 PHE A C   1 
ATOM   1027 O O   . PHE A 1 143 ? 0.246   12.973 8.882  1.00 28.06  ? 191 PHE A O   1 
ATOM   1028 C CB  . PHE A 1 143 ? 2.716   15.031 9.111  1.00 24.58  ? 191 PHE A CB  1 
ATOM   1029 C CG  . PHE A 1 143 ? 4.094   15.421 8.671  1.00 23.27  ? 191 PHE A CG  1 
ATOM   1030 C CD1 . PHE A 1 143 ? 4.522   15.160 7.374  1.00 24.93  ? 191 PHE A CD1 1 
ATOM   1031 C CD2 . PHE A 1 143 ? 4.969   16.045 9.553  1.00 21.69  ? 191 PHE A CD2 1 
ATOM   1032 C CE1 . PHE A 1 143 ? 5.801   15.517 6.960  1.00 24.27  ? 191 PHE A CE1 1 
ATOM   1033 C CE2 . PHE A 1 143 ? 6.248   16.406 9.149  1.00 19.77  ? 191 PHE A CE2 1 
ATOM   1034 C CZ  . PHE A 1 143 ? 6.664   16.143 7.855  1.00 22.68  ? 191 PHE A CZ  1 
ATOM   1035 N N   . GLU A 1 144 ? 0.916   13.214 11.026 1.00 30.66  ? 192 GLU A N   1 
ATOM   1036 C CA  . GLU A 1 144 ? -0.395  12.932 11.581 1.00 31.53  ? 192 GLU A CA  1 
ATOM   1037 C C   . GLU A 1 144 ? -0.633  13.833 12.770 1.00 31.15  ? 192 GLU A C   1 
ATOM   1038 O O   . GLU A 1 144 ? 0.280   14.118 13.553 1.00 29.49  ? 192 GLU A O   1 
ATOM   1039 C CB  . GLU A 1 144 ? -0.477  11.483 12.034 1.00 37.42  ? 192 GLU A CB  1 
ATOM   1040 C CG  . GLU A 1 144 ? -1.859  11.063 12.502 1.00 42.60  ? 192 GLU A CG  1 
ATOM   1041 C CD  . GLU A 1 144 ? -1.853  9.679  13.109 1.00 44.19  ? 192 GLU A CD  1 
ATOM   1042 O OE1 . GLU A 1 144 ? -1.602  9.576  14.326 1.00 48.53  ? 192 GLU A OE1 1 
ATOM   1043 O OE2 . GLU A 1 144 ? -2.077  8.697  12.367 1.00 47.00  ? 192 GLU A OE2 1 
ATOM   1044 N N   . VAL A 1 145 ? -1.869  14.285 12.892 1.00 28.61  ? 193 VAL A N   1 
ATOM   1045 C CA  . VAL A 1 145 ? -2.255  15.149 13.978 1.00 30.60  ? 193 VAL A CA  1 
ATOM   1046 C C   . VAL A 1 145 ? -3.562  14.655 14.585 1.00 32.74  ? 193 VAL A C   1 
ATOM   1047 O O   . VAL A 1 145 ? -4.515  14.379 13.866 1.00 34.81  ? 193 VAL A O   1 
ATOM   1048 C CB  . VAL A 1 145 ? -2.467  16.606 13.485 1.00 31.50  ? 193 VAL A CB  1 
ATOM   1049 C CG1 . VAL A 1 145 ? -3.385  17.371 14.458 1.00 23.47  ? 193 VAL A CG1 1 
ATOM   1050 C CG2 . VAL A 1 145 ? -1.138  17.313 13.377 1.00 24.88  ? 193 VAL A CG2 1 
ATOM   1051 N N   . PHE A 1 146 ? -3.586  14.521 15.904 1.00 29.04  ? 194 PHE A N   1 
ATOM   1052 C CA  . PHE A 1 146 ? -4.793  14.129 16.615 1.00 31.05  ? 194 PHE A CA  1 
ATOM   1053 C C   . PHE A 1 146 ? -5.098  15.397 17.400 1.00 33.19  ? 194 PHE A C   1 
ATOM   1054 O O   . PHE A 1 146 ? -4.343  15.768 18.302 1.00 35.04  ? 194 PHE A O   1 
ATOM   1055 C CB  . PHE A 1 146 ? -4.526  12.976 17.581 1.00 28.23  ? 194 PHE A CB  1 
ATOM   1056 C CG  . PHE A 1 146 ? -5.680  12.682 18.492 1.00 29.36  ? 194 PHE A CG  1 
ATOM   1057 C CD1 . PHE A 1 146 ? -6.944  12.424 17.969 1.00 28.25  ? 194 PHE A CD1 1 
ATOM   1058 C CD2 . PHE A 1 146 ? -5.510  12.660 19.873 1.00 29.01  ? 194 PHE A CD2 1 
ATOM   1059 C CE1 . PHE A 1 146 ? -8.023  12.149 18.805 1.00 25.33  ? 194 PHE A CE1 1 
ATOM   1060 C CE2 . PHE A 1 146 ? -6.589  12.385 20.724 1.00 29.79  ? 194 PHE A CE2 1 
ATOM   1061 C CZ  . PHE A 1 146 ? -7.842  12.130 20.189 1.00 28.65  ? 194 PHE A CZ  1 
ATOM   1062 N N   . VAL A 1 147 ? -6.184  16.073 17.045 1.00 30.64  ? 195 VAL A N   1 
ATOM   1063 C CA  . VAL A 1 147 ? -6.529  17.326 17.698 1.00 28.62  ? 195 VAL A CA  1 
ATOM   1064 C C   . VAL A 1 147 ? -7.879  17.278 18.394 1.00 33.76  ? 195 VAL A C   1 
ATOM   1065 O O   . VAL A 1 147 ? -8.855  16.728 17.861 1.00 35.00  ? 195 VAL A O   1 
ATOM   1066 C CB  . VAL A 1 147 ? -6.530  18.491 16.673 1.00 28.38  ? 195 VAL A CB  1 
ATOM   1067 C CG1 . VAL A 1 147 ? -7.495  18.176 15.539 1.00 27.20  ? 195 VAL A CG1 1 
ATOM   1068 C CG2 . VAL A 1 147 ? -6.908  19.799 17.351 1.00 25.38  ? 195 VAL A CG2 1 
ATOM   1069 N N   . GLN A 1 148 ? -7.916  17.838 19.599 1.00 29.32  ? 196 GLN A N   1 
ATOM   1070 C CA  . GLN A 1 148 ? -9.139  17.893 20.387 1.00 32.41  ? 196 GLN A CA  1 
ATOM   1071 C C   . GLN A 1 148 ? -9.347  19.354 20.755 1.00 31.35  ? 196 GLN A C   1 
ATOM   1072 O O   . GLN A 1 148 ? -8.500  19.968 21.408 1.00 31.83  ? 196 GLN A O   1 
ATOM   1073 C CB  . GLN A 1 148 ? -9.006  17.038 21.649 1.00 32.82  ? 196 GLN A CB  1 
ATOM   1074 C CG  . GLN A 1 148 ? -8.691  15.573 21.371 1.00 35.90  ? 196 GLN A CG  1 
ATOM   1075 C CD  . GLN A 1 148 ? -8.589  14.748 22.642 1.00 40.77  ? 196 GLN A CD  1 
ATOM   1076 O OE1 . GLN A 1 148 ? -7.628  14.869 23.401 1.00 43.12  ? 196 GLN A OE1 1 
ATOM   1077 N NE2 . GLN A 1 148 ? -9.592  13.911 22.886 1.00 44.97  ? 196 GLN A NE2 1 
ATOM   1078 N N   . ALA A 1 149 ? -10.472 19.910 20.324 1.00 31.42  ? 197 ALA A N   1 
ATOM   1079 C CA  . ALA A 1 149 ? -10.768 21.312 20.579 1.00 29.56  ? 197 ALA A CA  1 
ATOM   1080 C C   . ALA A 1 149 ? -12.039 21.507 21.385 1.00 31.63  ? 197 ALA A C   1 
ATOM   1081 O O   . ALA A 1 149 ? -12.981 20.716 21.280 1.00 28.76  ? 197 ALA A O   1 
ATOM   1082 C CB  . ALA A 1 149 ? -10.868 22.047 19.264 1.00 24.63  ? 197 ALA A CB  1 
ATOM   1083 N N   . ASP A 1 150 ? -12.056 22.563 22.197 1.00 32.14  ? 198 ASP A N   1 
ATOM   1084 C CA  . ASP A 1 150 ? -13.219 22.884 23.025 1.00 33.39  ? 198 ASP A CA  1 
ATOM   1085 C C   . ASP A 1 150 ? -14.191 23.737 22.220 1.00 34.19  ? 198 ASP A C   1 
ATOM   1086 O O   . ASP A 1 150 ? -13.998 23.964 21.030 1.00 34.11  ? 198 ASP A O   1 
ATOM   1087 C CB  . ASP A 1 150 ? -12.796 23.656 24.280 1.00 26.55  ? 198 ASP A CB  1 
ATOM   1088 C CG  . ASP A 1 150 ? -12.575 25.141 24.015 1.00 31.58  ? 198 ASP A CG  1 
ATOM   1089 O OD1 . ASP A 1 150 ? -12.219 25.508 22.873 1.00 28.50  ? 198 ASP A OD1 1 
ATOM   1090 O OD2 . ASP A 1 150 ? -12.736 25.943 24.963 1.00 33.90  ? 198 ASP A OD2 1 
ATOM   1091 N N   . ALA A 1 151 ? -15.230 24.225 22.886 1.00 40.96  ? 199 ALA A N   1 
ATOM   1092 C CA  . ALA A 1 151 ? -16.227 25.057 22.228 1.00 38.97  ? 199 ALA A CA  1 
ATOM   1093 C C   . ALA A 1 151 ? -17.145 25.679 23.273 1.00 37.73  ? 199 ALA A C   1 
ATOM   1094 O O   . ALA A 1 151 ? -17.292 25.140 24.376 1.00 35.04  ? 199 ALA A O   1 
ATOM   1095 C CB  . ALA A 1 151 ? -17.050 24.206 21.259 1.00 40.28  ? 199 ALA A CB  1 
ATOM   1096 N N   . PRO A 1 152 ? -17.775 26.822 22.943 1.00 33.82  ? 200 PRO A N   1 
ATOM   1097 C CA  . PRO A 1 152 ? -18.676 27.460 23.907 1.00 29.31  ? 200 PRO A CA  1 
ATOM   1098 C C   . PRO A 1 152 ? -19.910 26.588 24.070 1.00 29.17  ? 200 PRO A C   1 
ATOM   1099 O O   . PRO A 1 152 ? -20.212 25.771 23.212 1.00 32.73  ? 200 PRO A O   1 
ATOM   1100 C CB  . PRO A 1 152 ? -18.991 28.805 23.258 1.00 29.34  ? 200 PRO A CB  1 
ATOM   1101 C CG  . PRO A 1 152 ? -18.937 28.476 21.778 1.00 31.54  ? 200 PRO A CG  1 
ATOM   1102 C CD  . PRO A 1 152 ? -17.720 27.579 21.677 1.00 33.72  ? 200 PRO A CD  1 
ATOM   1103 N N   . GLY A 1 153 ? -20.601 26.749 25.186 1.00 27.22  ? 201 GLY A N   1 
ATOM   1104 C CA  . GLY A 1 153 ? -21.792 25.974 25.443 1.00 27.03  ? 201 GLY A CA  1 
ATOM   1105 C C   . GLY A 1 153 ? -22.314 26.361 26.809 1.00 29.04  ? 201 GLY A C   1 
ATOM   1106 O O   . GLY A 1 153 ? -21.761 27.256 27.458 1.00 25.95  ? 201 GLY A O   1 
ATOM   1107 N N   . GLY A 1 154 ? -23.377 25.700 27.251 1.00 28.97  ? 202 GLY A N   1 
ATOM   1108 C CA  . GLY A 1 154 ? -23.922 26.007 28.557 1.00 34.18  ? 202 GLY A CA  1 
ATOM   1109 C C   . GLY A 1 154 ? -23.114 25.317 29.639 1.00 38.07  ? 202 GLY A C   1 
ATOM   1110 O O   . GLY A 1 154 ? -22.301 24.433 29.353 1.00 35.79  ? 202 GLY A O   1 
ATOM   1111 N N   . SER A 1 155 ? -23.344 25.713 30.887 1.00 40.90  ? 203 SER A N   1 
ATOM   1112 C CA  . SER A 1 155 ? -22.641 25.124 32.020 1.00 47.29  ? 203 SER A CA  1 
ATOM   1113 C C   . SER A 1 155 ? -23.106 23.686 32.201 1.00 50.78  ? 203 SER A C   1 
ATOM   1114 O O   . SER A 1 155 ? -22.392 22.866 32.768 1.00 52.05  ? 203 SER A O   1 
ATOM   1115 C CB  . SER A 1 155 ? -22.927 25.926 33.295 1.00 45.40  ? 203 SER A CB  1 
ATOM   1116 O OG  . SER A 1 155 ? -24.293 25.827 33.668 1.00 45.72  ? 203 SER A OG  1 
ATOM   1117 N N   . ARG A 1 156 ? -24.306 23.405 31.698 1.00 58.16  ? 204 ARG A N   1 
ATOM   1118 C CA  . ARG A 1 156 ? -24.953 22.093 31.766 1.00 64.92  ? 204 ARG A CA  1 
ATOM   1119 C C   . ARG A 1 156 ? -25.648 21.872 33.102 1.00 67.98  ? 204 ARG A C   1 
ATOM   1120 O O   . ARG A 1 156 ? -25.843 20.693 33.462 1.00 73.78  ? 204 ARG A O   1 
ATOM   1121 C CB  . ARG A 1 156 ? -23.942 20.967 31.524 1.00 66.70  ? 204 ARG A CB  1 
ATOM   1122 C CG  . ARG A 1 156 ? -23.486 20.830 30.086 1.00 72.74  ? 204 ARG A CG  1 
ATOM   1123 C CD  . ARG A 1 156 ? -22.288 19.907 29.981 1.00 79.35  ? 204 ARG A CD  1 
ATOM   1124 N NE  . ARG A 1 156 ? -21.881 19.703 28.594 1.00 85.78  ? 204 ARG A NE  1 
ATOM   1125 C CZ  . ARG A 1 156 ? -20.828 18.983 28.218 1.00 89.20  ? 204 ARG A CZ  1 
ATOM   1126 N NH1 . ARG A 1 156 ? -20.059 18.392 29.126 1.00 89.10  ? 204 ARG A NH1 1 
ATOM   1127 N NH2 . ARG A 1 156 ? -20.551 18.842 26.928 1.00 92.09  ? 204 ARG A NH2 1 
ATOM   1128 N N   . THR B 1 15  ? -30.896 52.890 35.490 1.00 91.66  ? 63  THR B N   1 
ATOM   1129 C CA  . THR B 1 15  ? -29.630 52.716 34.717 1.00 90.58  ? 63  THR B CA  1 
ATOM   1130 C C   . THR B 1 15  ? -29.495 51.258 34.287 1.00 89.90  ? 63  THR B C   1 
ATOM   1131 O O   . THR B 1 15  ? -28.525 50.879 33.631 1.00 89.65  ? 63  THR B O   1 
ATOM   1132 C CB  . THR B 1 15  ? -28.392 53.105 35.570 1.00 91.12  ? 63  THR B CB  1 
ATOM   1133 O OG1 . THR B 1 15  ? -27.253 53.264 34.714 1.00 93.33  ? 63  THR B OG1 1 
ATOM   1134 C CG2 . THR B 1 15  ? -28.087 52.022 36.609 1.00 90.43  ? 63  THR B CG2 1 
ATOM   1135 N N   . SER B 1 16  ? -30.480 50.446 34.662 1.00 88.13  ? 64  SER B N   1 
ATOM   1136 C CA  . SER B 1 16  ? -30.475 49.027 34.335 1.00 87.14  ? 64  SER B CA  1 
ATOM   1137 C C   . SER B 1 16  ? -30.980 48.774 32.925 1.00 86.34  ? 64  SER B C   1 
ATOM   1138 O O   . SER B 1 16  ? -30.955 47.645 32.446 1.00 85.52  ? 64  SER B O   1 
ATOM   1139 C CB  . SER B 1 16  ? -31.351 48.255 35.325 1.00 88.09  ? 64  SER B CB  1 
ATOM   1140 O OG  . SER B 1 16  ? -32.721 48.583 35.166 1.00 86.85  ? 64  SER B OG  1 
ATOM   1141 N N   . TRP B 1 17  ? -31.436 49.831 32.267 1.00 85.82  ? 65  TRP B N   1 
ATOM   1142 C CA  . TRP B 1 17  ? -31.968 49.722 30.919 1.00 86.58  ? 65  TRP B CA  1 
ATOM   1143 C C   . TRP B 1 17  ? -30.866 49.915 29.874 1.00 82.65  ? 65  TRP B C   1 
ATOM   1144 O O   . TRP B 1 17  ? -31.135 49.940 28.675 1.00 84.29  ? 65  TRP B O   1 
ATOM   1145 C CB  . TRP B 1 17  ? -33.076 50.767 30.730 1.00 93.16  ? 65  TRP B CB  1 
ATOM   1146 C CG  . TRP B 1 17  ? -34.297 50.304 29.957 1.00 100.32 ? 65  TRP B CG  1 
ATOM   1147 C CD1 . TRP B 1 17  ? -35.553 50.849 30.021 1.00 102.13 ? 65  TRP B CD1 1 
ATOM   1148 C CD2 . TRP B 1 17  ? -34.373 49.244 28.986 1.00 102.93 ? 65  TRP B CD2 1 
ATOM   1149 N NE1 . TRP B 1 17  ? -36.401 50.199 29.154 1.00 104.95 ? 65  TRP B NE1 1 
ATOM   1150 C CE2 . TRP B 1 17  ? -35.705 49.212 28.507 1.00 105.10 ? 65  TRP B CE2 1 
ATOM   1151 C CE3 . TRP B 1 17  ? -33.449 48.322 28.473 1.00 103.24 ? 65  TRP B CE3 1 
ATOM   1152 C CZ2 . TRP B 1 17  ? -36.133 48.291 27.540 1.00 105.22 ? 65  TRP B CZ2 1 
ATOM   1153 C CZ3 . TRP B 1 17  ? -33.878 47.408 27.512 1.00 104.00 ? 65  TRP B CZ3 1 
ATOM   1154 C CH2 . TRP B 1 17  ? -35.207 47.401 27.057 1.00 104.55 ? 65  TRP B CH2 1 
ATOM   1155 N N   . ARG B 1 18  ? -29.626 50.054 30.328 1.00 77.33  ? 66  ARG B N   1 
ATOM   1156 C CA  . ARG B 1 18  ? -28.508 50.238 29.407 1.00 72.46  ? 66  ARG B CA  1 
ATOM   1157 C C   . ARG B 1 18  ? -28.317 48.986 28.556 1.00 69.30  ? 66  ARG B C   1 
ATOM   1158 O O   . ARG B 1 18  ? -28.661 47.875 28.972 1.00 65.20  ? 66  ARG B O   1 
ATOM   1159 C CB  . ARG B 1 18  ? -27.226 50.549 30.182 1.00 73.49  ? 66  ARG B CB  1 
ATOM   1160 C CG  . ARG B 1 18  ? -26.919 49.539 31.262 1.00 72.80  ? 66  ARG B CG  1 
ATOM   1161 C CD  . ARG B 1 18  ? -25.699 49.927 32.067 1.00 72.45  ? 66  ARG B CD  1 
ATOM   1162 N NE  . ARG B 1 18  ? -25.563 49.055 33.228 1.00 71.43  ? 66  ARG B NE  1 
ATOM   1163 C CZ  . ARG B 1 18  ? -24.580 49.139 34.114 1.00 71.32  ? 66  ARG B CZ  1 
ATOM   1164 N NH1 . ARG B 1 18  ? -24.543 48.298 35.138 1.00 70.79  ? 66  ARG B NH1 1 
ATOM   1165 N NH2 . ARG B 1 18  ? -23.636 50.061 33.974 1.00 71.79  ? 66  ARG B NH2 1 
ATOM   1166 N N   . SER B 1 19  ? -27.752 49.176 27.369 1.00 64.90  ? 67  SER B N   1 
ATOM   1167 C CA  . SER B 1 19  ? -27.540 48.084 26.428 1.00 64.02  ? 67  SER B CA  1 
ATOM   1168 C C   . SER B 1 19  ? -26.268 47.259 26.635 1.00 63.20  ? 67  SER B C   1 
ATOM   1169 O O   . SER B 1 19  ? -26.216 46.092 26.240 1.00 61.62  ? 67  SER B O   1 
ATOM   1170 C CB  . SER B 1 19  ? -27.557 48.637 25.002 1.00 63.68  ? 67  SER B CB  1 
ATOM   1171 O OG  . SER B 1 19  ? -26.531 49.597 24.820 1.00 61.21  ? 67  SER B OG  1 
ATOM   1172 N N   . GLU B 1 20  ? -25.244 47.865 27.233 1.00 60.53  ? 68  GLU B N   1 
ATOM   1173 C CA  . GLU B 1 20  ? -23.976 47.176 27.468 1.00 57.11  ? 68  GLU B CA  1 
ATOM   1174 C C   . GLU B 1 20  ? -23.373 47.583 28.802 1.00 58.18  ? 68  GLU B C   1 
ATOM   1175 O O   . GLU B 1 20  ? -23.656 48.664 29.317 1.00 58.50  ? 68  GLU B O   1 
ATOM   1176 C CB  . GLU B 1 20  ? -22.979 47.498 26.353 1.00 53.94  ? 68  GLU B CB  1 
ATOM   1177 C CG  . GLU B 1 20  ? -22.592 48.959 26.291 1.00 49.51  ? 68  GLU B CG  1 
ATOM   1178 C CD  . GLU B 1 20  ? -21.536 49.236 25.250 1.00 51.03  ? 68  GLU B CD  1 
ATOM   1179 O OE1 . GLU B 1 20  ? -21.737 48.835 24.085 1.00 56.78  ? 68  GLU B OE1 1 
ATOM   1180 O OE2 . GLU B 1 20  ? -20.508 49.863 25.588 1.00 50.13  ? 68  GLU B OE2 1 
ATOM   1181 N N   . ALA B 1 21  ? -22.532 46.716 29.356 1.00 58.10  ? 69  ALA B N   1 
ATOM   1182 C CA  . ALA B 1 21  ? -21.896 46.992 30.635 1.00 54.97  ? 69  ALA B CA  1 
ATOM   1183 C C   . ALA B 1 21  ? -20.752 46.036 30.922 1.00 56.40  ? 69  ALA B C   1 
ATOM   1184 O O   . ALA B 1 21  ? -20.740 44.897 30.452 1.00 57.62  ? 69  ALA B O   1 
ATOM   1185 C CB  . ALA B 1 21  ? -22.917 46.909 31.750 1.00 55.87  ? 69  ALA B CB  1 
ATOM   1186 N N   . THR B 1 22  ? -19.791 46.515 31.703 1.00 54.51  ? 70  THR B N   1 
ATOM   1187 C CA  . THR B 1 22  ? -18.636 45.725 32.089 1.00 50.88  ? 70  THR B CA  1 
ATOM   1188 C C   . THR B 1 22  ? -18.640 45.558 33.598 1.00 51.07  ? 70  THR B C   1 
ATOM   1189 O O   . THR B 1 22  ? -18.786 46.532 34.325 1.00 54.07  ? 70  THR B O   1 
ATOM   1190 C CB  . THR B 1 22  ? -17.324 46.423 31.721 1.00 48.38  ? 70  THR B CB  1 
ATOM   1191 O OG1 . THR B 1 22  ? -17.242 46.591 30.303 1.00 41.50  ? 70  THR B OG1 1 
ATOM   1192 C CG2 . THR B 1 22  ? -16.143 45.604 32.209 1.00 48.26  ? 70  THR B CG2 1 
ATOM   1193 N N   . PHE B 1 23  ? -18.495 44.331 34.080 1.00 48.97  ? 71  PHE B N   1 
ATOM   1194 C CA  . PHE B 1 23  ? -18.450 44.132 35.517 1.00 48.71  ? 71  PHE B CA  1 
ATOM   1195 C C   . PHE B 1 23  ? -17.429 43.078 35.906 1.00 49.25  ? 71  PHE B C   1 
ATOM   1196 O O   . PHE B 1 23  ? -17.137 42.166 35.137 1.00 47.91  ? 71  PHE B O   1 
ATOM   1197 C CB  . PHE B 1 23  ? -19.841 43.800 36.076 1.00 46.57  ? 71  PHE B CB  1 
ATOM   1198 C CG  . PHE B 1 23  ? -20.414 42.500 35.598 1.00 46.75  ? 71  PHE B CG  1 
ATOM   1199 C CD1 . PHE B 1 23  ? -20.378 41.372 36.411 1.00 45.00  ? 71  PHE B CD1 1 
ATOM   1200 C CD2 . PHE B 1 23  ? -21.051 42.416 34.361 1.00 42.22  ? 71  PHE B CD2 1 
ATOM   1201 C CE1 . PHE B 1 23  ? -20.976 40.179 36.008 1.00 42.61  ? 71  PHE B CE1 1 
ATOM   1202 C CE2 . PHE B 1 23  ? -21.650 41.230 33.948 1.00 40.40  ? 71  PHE B CE2 1 
ATOM   1203 C CZ  . PHE B 1 23  ? -21.613 40.109 34.778 1.00 44.22  ? 71  PHE B CZ  1 
ATOM   1204 N N   . GLN B 1 24  ? -16.875 43.233 37.105 1.00 51.10  ? 72  GLN B N   1 
ATOM   1205 C CA  . GLN B 1 24  ? -15.864 42.321 37.616 1.00 49.21  ? 72  GLN B CA  1 
ATOM   1206 C C   . GLN B 1 24  ? -16.352 41.456 38.762 1.00 48.52  ? 72  GLN B C   1 
ATOM   1207 O O   . GLN B 1 24  ? -17.381 41.729 39.386 1.00 50.69  ? 72  GLN B O   1 
ATOM   1208 C CB  . GLN B 1 24  ? -14.646 43.100 38.099 1.00 50.58  ? 72  GLN B CB  1 
ATOM   1209 C CG  . GLN B 1 24  ? -14.108 44.116 37.122 1.00 53.72  ? 72  GLN B CG  1 
ATOM   1210 C CD  . GLN B 1 24  ? -12.680 44.478 37.438 1.00 56.04  ? 72  GLN B CD  1 
ATOM   1211 O OE1 . GLN B 1 24  ? -12.317 44.664 38.600 1.00 56.59  ? 72  GLN B OE1 1 
ATOM   1212 N NE2 . GLN B 1 24  ? -11.856 44.581 36.406 1.00 58.75  ? 72  GLN B NE2 1 
ATOM   1213 N N   . PHE B 1 25  ? -15.593 40.406 39.036 1.00 44.86  ? 73  PHE B N   1 
ATOM   1214 C CA  . PHE B 1 25  ? -15.910 39.502 40.123 1.00 44.77  ? 73  PHE B CA  1 
ATOM   1215 C C   . PHE B 1 25  ? -14.636 38.798 40.570 1.00 47.40  ? 73  PHE B C   1 
ATOM   1216 O O   . PHE B 1 25  ? -14.056 38.004 39.822 1.00 48.13  ? 73  PHE B O   1 
ATOM   1217 C CB  . PHE B 1 25  ? -16.940 38.470 39.688 1.00 39.26  ? 73  PHE B CB  1 
ATOM   1218 C CG  . PHE B 1 25  ? -17.254 37.464 40.746 1.00 42.74  ? 73  PHE B CG  1 
ATOM   1219 C CD1 . PHE B 1 25  ? -17.681 37.875 42.006 1.00 44.03  ? 73  PHE B CD1 1 
ATOM   1220 C CD2 . PHE B 1 25  ? -17.102 36.108 40.499 1.00 40.96  ? 73  PHE B CD2 1 
ATOM   1221 C CE1 . PHE B 1 25  ? -17.949 36.947 43.005 1.00 44.05  ? 73  PHE B CE1 1 
ATOM   1222 C CE2 . PHE B 1 25  ? -17.367 35.171 41.491 1.00 45.51  ? 73  PHE B CE2 1 
ATOM   1223 C CZ  . PHE B 1 25  ? -17.790 35.591 42.746 1.00 43.64  ? 73  PHE B CZ  1 
ATOM   1224 N N   . THR B 1 26  ? -14.194 39.099 41.787 1.00 47.25  ? 74  THR B N   1 
ATOM   1225 C CA  . THR B 1 26  ? -12.983 38.483 42.307 1.00 44.50  ? 74  THR B CA  1 
ATOM   1226 C C   . THR B 1 26  ? -13.308 37.278 43.171 1.00 45.85  ? 74  THR B C   1 
ATOM   1227 O O   . THR B 1 26  ? -14.104 37.358 44.109 1.00 42.87  ? 74  THR B O   1 
ATOM   1228 C CB  . THR B 1 26  ? -12.154 39.482 43.117 1.00 43.57  ? 74  THR B CB  1 
ATOM   1229 O OG1 . THR B 1 26  ? -11.795 40.590 42.279 1.00 44.05  ? 74  THR B OG1 1 
ATOM   1230 C CG2 . THR B 1 26  ? -10.880 38.819 43.626 1.00 45.81  ? 74  THR B CG2 1 
ATOM   1231 N N   . VAL B 1 27  ? -12.701 36.150 42.825 1.00 46.73  ? 75  VAL B N   1 
ATOM   1232 C CA  . VAL B 1 27  ? -12.911 34.921 43.566 1.00 50.88  ? 75  VAL B CA  1 
ATOM   1233 C C   . VAL B 1 27  ? -11.714 34.663 44.475 1.00 52.53  ? 75  VAL B C   1 
ATOM   1234 O O   . VAL B 1 27  ? -10.588 34.484 44.002 1.00 48.54  ? 75  VAL B O   1 
ATOM   1235 C CB  . VAL B 1 27  ? -13.089 33.719 42.615 1.00 51.61  ? 75  VAL B CB  1 
ATOM   1236 C CG1 . VAL B 1 27  ? -13.284 32.445 43.419 1.00 50.14  ? 75  VAL B CG1 1 
ATOM   1237 C CG2 . VAL B 1 27  ? -14.285 33.952 41.702 1.00 53.66  ? 75  VAL B CG2 1 
ATOM   1238 N N   . GLU B 1 28  ? -11.966 34.657 45.781 1.00 57.13  ? 76  GLU B N   1 
ATOM   1239 C CA  . GLU B 1 28  ? -10.915 34.418 46.765 1.00 60.31  ? 76  GLU B CA  1 
ATOM   1240 C C   . GLU B 1 28  ? -10.711 32.925 46.973 1.00 58.66  ? 76  GLU B C   1 
ATOM   1241 O O   . GLU B 1 28  ? -11.603 32.121 46.697 1.00 55.61  ? 76  GLU B O   1 
ATOM   1242 C CB  . GLU B 1 28  ? -11.272 35.082 48.096 1.00 64.95  ? 76  GLU B CB  1 
ATOM   1243 C CG  . GLU B 1 28  ? -11.434 36.592 48.005 1.00 70.78  ? 76  GLU B CG  1 
ATOM   1244 C CD  . GLU B 1 28  ? -11.554 37.245 49.367 1.00 72.13  ? 76  GLU B CD  1 
ATOM   1245 O OE1 . GLU B 1 28  ? -12.399 36.792 50.171 1.00 74.17  ? 76  GLU B OE1 1 
ATOM   1246 O OE2 . GLU B 1 28  ? -10.808 38.212 49.633 1.00 71.86  ? 76  GLU B OE2 1 
ATOM   1247 N N   . ARG B 1 29  ? -9.535  32.565 47.475 1.00 59.11  ? 77  ARG B N   1 
ATOM   1248 C CA  . ARG B 1 29  ? -9.196  31.165 47.701 1.00 58.85  ? 77  ARG B CA  1 
ATOM   1249 C C   . ARG B 1 29  ? -9.531  30.416 46.427 1.00 55.85  ? 77  ARG B C   1 
ATOM   1250 O O   . ARG B 1 29  ? -10.226 29.399 46.449 1.00 56.64  ? 77  ARG B O   1 
ATOM   1251 C CB  . ARG B 1 29  ? -10.001 30.571 48.861 1.00 59.76  ? 77  ARG B CB  1 
ATOM   1252 C CG  . ARG B 1 29  ? -9.701  31.155 50.224 1.00 59.56  ? 77  ARG B CG  1 
ATOM   1253 C CD  . ARG B 1 29  ? -9.947  30.109 51.302 1.00 59.09  ? 77  ARG B CD  1 
ATOM   1254 N NE  . ARG B 1 29  ? -11.245 29.450 51.167 1.00 57.44  ? 77  ARG B NE  1 
ATOM   1255 C CZ  . ARG B 1 29  ? -12.413 30.071 51.289 1.00 55.96  ? 77  ARG B CZ  1 
ATOM   1256 N NH1 . ARG B 1 29  ? -12.448 31.373 51.549 1.00 54.53  ? 77  ARG B NH1 1 
ATOM   1257 N NH2 . ARG B 1 29  ? -13.543 29.389 51.163 1.00 55.49  ? 77  ARG B NH2 1 
ATOM   1258 N N   . PHE B 1 30  ? -9.039  30.935 45.312 1.00 55.00  ? 78  PHE B N   1 
ATOM   1259 C CA  . PHE B 1 30  ? -9.300  30.322 44.023 1.00 54.85  ? 78  PHE B CA  1 
ATOM   1260 C C   . PHE B 1 30  ? -8.792  28.888 43.969 1.00 53.93  ? 78  PHE B C   1 
ATOM   1261 O O   . PHE B 1 30  ? -9.561  27.959 43.726 1.00 53.41  ? 78  PHE B O   1 
ATOM   1262 C CB  . PHE B 1 30  ? -8.646  31.124 42.898 1.00 51.17  ? 78  PHE B CB  1 
ATOM   1263 C CG  . PHE B 1 30  ? -9.043  30.659 41.535 1.00 49.83  ? 78  PHE B CG  1 
ATOM   1264 C CD1 . PHE B 1 30  ? -10.322 30.924 41.044 1.00 49.10  ? 78  PHE B CD1 1 
ATOM   1265 C CD2 . PHE B 1 30  ? -8.165  29.912 40.756 1.00 48.55  ? 78  PHE B CD2 1 
ATOM   1266 C CE1 . PHE B 1 30  ? -10.723 30.450 39.795 1.00 44.87  ? 78  PHE B CE1 1 
ATOM   1267 C CE2 . PHE B 1 30  ? -8.558  29.432 39.505 1.00 49.07  ? 78  PHE B CE2 1 
ATOM   1268 C CZ  . PHE B 1 30  ? -9.840  29.702 39.025 1.00 41.46  ? 78  PHE B CZ  1 
ATOM   1269 N N   . SER B 1 31  ? -7.493  28.724 44.194 1.00 52.55  ? 79  SER B N   1 
ATOM   1270 C CA  . SER B 1 31  ? -6.850  27.416 44.159 1.00 53.38  ? 79  SER B CA  1 
ATOM   1271 C C   . SER B 1 31  ? -7.687  26.300 44.773 1.00 53.94  ? 79  SER B C   1 
ATOM   1272 O O   . SER B 1 31  ? -7.653  25.160 44.313 1.00 53.60  ? 79  SER B O   1 
ATOM   1273 C CB  . SER B 1 31  ? -5.497  27.490 44.870 1.00 55.22  ? 79  SER B CB  1 
ATOM   1274 O OG  . SER B 1 31  ? -5.645  28.033 46.172 1.00 54.80  ? 79  SER B OG  1 
ATOM   1275 N N   . ARG B 1 32  ? -8.455  26.641 45.800 1.00 56.25  ? 80  ARG B N   1 
ATOM   1276 C CA  . ARG B 1 32  ? -9.284  25.672 46.502 1.00 56.70  ? 80  ARG B CA  1 
ATOM   1277 C C   . ARG B 1 32  ? -10.710 25.555 45.960 1.00 58.00  ? 80  ARG B C   1 
ATOM   1278 O O   . ARG B 1 32  ? -11.465 24.671 46.380 1.00 58.99  ? 80  ARG B O   1 
ATOM   1279 C CB  . ARG B 1 32  ? -9.329  26.040 47.985 1.00 59.05  ? 80  ARG B CB  1 
ATOM   1280 C CG  . ARG B 1 32  ? -8.011  26.587 48.500 1.00 64.47  ? 80  ARG B CG  1 
ATOM   1281 C CD  . ARG B 1 32  ? -8.076  26.937 49.970 1.00 70.52  ? 80  ARG B CD  1 
ATOM   1282 N NE  . ARG B 1 32  ? -6.901  27.695 50.392 1.00 77.00  ? 80  ARG B NE  1 
ATOM   1283 C CZ  . ARG B 1 32  ? -6.644  28.031 51.652 1.00 78.11  ? 80  ARG B CZ  1 
ATOM   1284 N NH1 . ARG B 1 32  ? -7.482  27.671 52.615 1.00 78.26  ? 80  ARG B NH1 1 
ATOM   1285 N NH2 . ARG B 1 32  ? -5.554  28.730 51.949 1.00 77.64  ? 80  ARG B NH2 1 
ATOM   1286 N N   . LEU B 1 33  ? -11.089 26.436 45.037 1.00 55.05  ? 81  LEU B N   1 
ATOM   1287 C CA  . LEU B 1 33  ? -12.441 26.381 44.489 1.00 52.69  ? 81  LEU B CA  1 
ATOM   1288 C C   . LEU B 1 33  ? -12.749 24.965 44.032 1.00 50.30  ? 81  LEU B C   1 
ATOM   1289 O O   . LEU B 1 33  ? -12.051 24.411 43.186 1.00 48.55  ? 81  LEU B O   1 
ATOM   1290 C CB  . LEU B 1 33  ? -12.603 27.348 43.311 1.00 51.39  ? 81  LEU B CB  1 
ATOM   1291 C CG  . LEU B 1 33  ? -14.053 27.435 42.813 1.00 51.44  ? 81  LEU B CG  1 
ATOM   1292 C CD1 . LEU B 1 33  ? -14.943 27.822 43.976 1.00 47.58  ? 81  LEU B CD1 1 
ATOM   1293 C CD2 . LEU B 1 33  ? -14.190 28.449 41.679 1.00 49.65  ? 81  LEU B CD2 1 
ATOM   1294 N N   . SER B 1 34  ? -13.786 24.374 44.608 1.00 50.62  ? 82  SER B N   1 
ATOM   1295 C CA  . SER B 1 34  ? -14.167 23.015 44.255 1.00 55.99  ? 82  SER B CA  1 
ATOM   1296 C C   . SER B 1 34  ? -15.601 22.942 43.763 1.00 56.54  ? 82  SER B C   1 
ATOM   1297 O O   . SER B 1 34  ? -16.097 21.869 43.410 1.00 59.06  ? 82  SER B O   1 
ATOM   1298 C CB  . SER B 1 34  ? -13.977 22.090 45.458 1.00 57.80  ? 82  SER B CB  1 
ATOM   1299 O OG  . SER B 1 34  ? -14.525 22.673 46.626 1.00 63.42  ? 82  SER B OG  1 
ATOM   1300 N N   . GLU B 1 35  ? -16.270 24.087 43.743 1.00 57.84  ? 83  GLU B N   1 
ATOM   1301 C CA  . GLU B 1 35  ? -17.645 24.135 43.267 1.00 59.09  ? 83  GLU B CA  1 
ATOM   1302 C C   . GLU B 1 35  ? -17.973 25.416 42.520 1.00 55.41  ? 83  GLU B C   1 
ATOM   1303 O O   . GLU B 1 35  ? -17.330 26.454 42.697 1.00 50.25  ? 83  GLU B O   1 
ATOM   1304 C CB  . GLU B 1 35  ? -18.640 23.965 44.424 1.00 63.98  ? 83  GLU B CB  1 
ATOM   1305 C CG  . GLU B 1 35  ? -19.261 22.576 44.512 1.00 68.92  ? 83  GLU B CG  1 
ATOM   1306 C CD  . GLU B 1 35  ? -18.579 21.697 45.542 1.00 75.76  ? 83  GLU B CD  1 
ATOM   1307 O OE1 . GLU B 1 35  ? -18.738 21.969 46.753 1.00 78.30  ? 83  GLU B OE1 1 
ATOM   1308 O OE2 . GLU B 1 35  ? -17.882 20.739 45.145 1.00 79.51  ? 83  GLU B OE2 1 
ATOM   1309 N N   . SER B 1 36  ? -18.988 25.316 41.674 1.00 52.21  ? 84  SER B N   1 
ATOM   1310 C CA  . SER B 1 36  ? -19.468 26.441 40.893 1.00 51.34  ? 84  SER B CA  1 
ATOM   1311 C C   . SER B 1 36  ? -19.731 27.624 41.823 1.00 50.60  ? 84  SER B C   1 
ATOM   1312 O O   . SER B 1 36  ? -20.219 27.441 42.936 1.00 51.29  ? 84  SER B O   1 
ATOM   1313 C CB  . SER B 1 36  ? -20.762 26.036 40.188 1.00 49.34  ? 84  SER B CB  1 
ATOM   1314 O OG  . SER B 1 36  ? -21.394 27.147 39.591 1.00 56.27  ? 84  SER B OG  1 
ATOM   1315 N N   . VAL B 1 37  ? -19.389 28.830 41.379 1.00 48.42  ? 85  VAL B N   1 
ATOM   1316 C CA  . VAL B 1 37  ? -19.640 30.024 42.179 1.00 47.94  ? 85  VAL B CA  1 
ATOM   1317 C C   . VAL B 1 37  ? -20.238 31.129 41.316 1.00 46.14  ? 85  VAL B C   1 
ATOM   1318 O O   . VAL B 1 37  ? -19.842 31.305 40.164 1.00 50.08  ? 85  VAL B O   1 
ATOM   1319 C CB  . VAL B 1 37  ? -18.356 30.546 42.851 1.00 47.56  ? 85  VAL B CB  1 
ATOM   1320 C CG1 . VAL B 1 37  ? -17.850 29.526 43.829 1.00 50.54  ? 85  VAL B CG1 1 
ATOM   1321 C CG2 . VAL B 1 37  ? -17.301 30.844 41.813 1.00 45.90  ? 85  VAL B CG2 1 
ATOM   1322 N N   . LEU B 1 38  ? -21.193 31.863 41.879 1.00 44.09  ? 86  LEU B N   1 
ATOM   1323 C CA  . LEU B 1 38  ? -21.869 32.943 41.171 1.00 45.47  ? 86  LEU B CA  1 
ATOM   1324 C C   . LEU B 1 38  ? -21.541 34.318 41.731 1.00 47.45  ? 86  LEU B C   1 
ATOM   1325 O O   . LEU B 1 38  ? -21.367 34.482 42.937 1.00 51.10  ? 86  LEU B O   1 
ATOM   1326 C CB  . LEU B 1 38  ? -23.381 32.725 41.226 1.00 45.78  ? 86  LEU B CB  1 
ATOM   1327 C CG  . LEU B 1 38  ? -23.900 31.577 40.362 1.00 48.28  ? 86  LEU B CG  1 
ATOM   1328 C CD1 . LEU B 1 38  ? -25.325 31.219 40.770 1.00 47.36  ? 86  LEU B CD1 1 
ATOM   1329 C CD2 . LEU B 1 38  ? -23.823 31.984 38.886 1.00 47.53  ? 86  LEU B CD2 1 
ATOM   1330 N N   . SER B 1 39  ? -21.478 35.310 40.851 1.00 48.28  ? 87  SER B N   1 
ATOM   1331 C CA  . SER B 1 39  ? -21.172 36.677 41.259 1.00 50.58  ? 87  SER B CA  1 
ATOM   1332 C C   . SER B 1 39  ? -22.447 37.464 41.556 1.00 54.79  ? 87  SER B C   1 
ATOM   1333 O O   . SER B 1 39  ? -23.563 36.950 41.424 1.00 53.74  ? 87  SER B O   1 
ATOM   1334 C CB  . SER B 1 39  ? -20.420 37.403 40.146 1.00 49.83  ? 87  SER B CB  1 
ATOM   1335 O OG  . SER B 1 39  ? -21.337 37.935 39.200 1.00 51.30  ? 87  SER B OG  1 
ATOM   1336 N N   . PRO B 1 40  ? -22.291 38.727 41.983 1.00 57.52  ? 88  PRO B N   1 
ATOM   1337 C CA  . PRO B 1 40  ? -23.466 39.550 42.274 1.00 58.65  ? 88  PRO B CA  1 
ATOM   1338 C C   . PRO B 1 40  ? -24.011 40.019 40.921 1.00 56.23  ? 88  PRO B C   1 
ATOM   1339 O O   . PRO B 1 40  ? -23.240 40.303 40.000 1.00 52.70  ? 88  PRO B O   1 
ATOM   1340 C CB  . PRO B 1 40  ? -22.884 40.693 43.094 1.00 56.90  ? 88  PRO B CB  1 
ATOM   1341 C CG  . PRO B 1 40  ? -21.544 40.881 42.445 1.00 59.87  ? 88  PRO B CG  1 
ATOM   1342 C CD  . PRO B 1 40  ? -21.052 39.453 42.319 1.00 55.80  ? 88  PRO B CD  1 
ATOM   1343 N N   . PRO B 1 41  ? -25.342 40.113 40.791 1.00 55.28  ? 89  PRO B N   1 
ATOM   1344 C CA  . PRO B 1 41  ? -25.980 40.541 39.544 1.00 55.68  ? 89  PRO B CA  1 
ATOM   1345 C C   . PRO B 1 41  ? -25.617 41.927 39.029 1.00 55.26  ? 89  PRO B C   1 
ATOM   1346 O O   . PRO B 1 41  ? -25.561 42.892 39.787 1.00 57.23  ? 89  PRO B O   1 
ATOM   1347 C CB  . PRO B 1 41  ? -27.466 40.430 39.867 1.00 56.66  ? 89  PRO B CB  1 
ATOM   1348 C CG  . PRO B 1 41  ? -27.504 40.769 41.332 1.00 54.21  ? 89  PRO B CG  1 
ATOM   1349 C CD  . PRO B 1 41  ? -26.346 39.960 41.861 1.00 55.03  ? 89  PRO B CD  1 
ATOM   1350 N N   . CYS B 1 42  ? -25.349 42.003 37.730 1.00 53.50  ? 90  CYS B N   1 
ATOM   1351 C CA  . CYS B 1 42  ? -25.059 43.269 37.075 1.00 52.82  ? 90  CYS B CA  1 
ATOM   1352 C C   . CYS B 1 42  ? -26.220 43.409 36.105 1.00 53.87  ? 90  CYS B C   1 
ATOM   1353 O O   . CYS B 1 42  ? -26.524 42.476 35.359 1.00 53.25  ? 90  CYS B O   1 
ATOM   1354 C CB  . CYS B 1 42  ? -23.746 43.222 36.299 1.00 54.22  ? 90  CYS B CB  1 
ATOM   1355 S SG  . CYS B 1 42  ? -23.394 44.775 35.425 1.00 54.13  ? 90  CYS B SG  1 
ATOM   1356 N N   . PHE B 1 43  ? -26.880 44.559 36.121 1.00 52.49  ? 91  PHE B N   1 
ATOM   1357 C CA  . PHE B 1 43  ? -28.021 44.753 35.247 1.00 48.05  ? 91  PHE B CA  1 
ATOM   1358 C C   . PHE B 1 43  ? -27.718 45.440 33.927 1.00 47.96  ? 91  PHE B C   1 
ATOM   1359 O O   . PHE B 1 43  ? -27.012 46.452 33.877 1.00 49.54  ? 91  PHE B O   1 
ATOM   1360 C CB  . PHE B 1 43  ? -29.135 45.507 35.987 1.00 46.68  ? 91  PHE B CB  1 
ATOM   1361 C CG  . PHE B 1 43  ? -29.816 44.687 37.055 1.00 42.46  ? 91  PHE B CG  1 
ATOM   1362 C CD1 . PHE B 1 43  ? -29.238 44.529 38.310 1.00 46.42  ? 91  PHE B CD1 1 
ATOM   1363 C CD2 . PHE B 1 43  ? -31.011 44.035 36.786 1.00 41.04  ? 91  PHE B CD2 1 
ATOM   1364 C CE1 . PHE B 1 43  ? -29.843 43.726 39.283 1.00 41.44  ? 91  PHE B CE1 1 
ATOM   1365 C CE2 . PHE B 1 43  ? -31.630 43.230 37.745 1.00 39.83  ? 91  PHE B CE2 1 
ATOM   1366 C CZ  . PHE B 1 43  ? -31.043 43.074 38.998 1.00 45.57  ? 91  PHE B CZ  1 
ATOM   1367 N N   . VAL B 1 44  ? -28.260 44.848 32.863 1.00 44.53  ? 92  VAL B N   1 
ATOM   1368 C CA  . VAL B 1 44  ? -28.147 45.327 31.485 1.00 43.04  ? 92  VAL B CA  1 
ATOM   1369 C C   . VAL B 1 44  ? -29.488 44.924 30.844 1.00 42.47  ? 92  VAL B C   1 
ATOM   1370 O O   . VAL B 1 44  ? -29.968 43.802 31.043 1.00 37.47  ? 92  VAL B O   1 
ATOM   1371 C CB  . VAL B 1 44  ? -26.972 44.643 30.737 1.00 45.66  ? 92  VAL B CB  1 
ATOM   1372 C CG1 . VAL B 1 44  ? -26.760 45.289 29.373 1.00 45.38  ? 92  VAL B CG1 1 
ATOM   1373 C CG2 . VAL B 1 44  ? -25.704 44.750 31.558 1.00 44.84  ? 92  VAL B CG2 1 
ATOM   1374 N N   . ARG B 1 45  ? -30.094 45.846 30.096 1.00 40.02  ? 93  ARG B N   1 
ATOM   1375 C CA  . ARG B 1 45  ? -31.396 45.609 29.467 1.00 41.77  ? 93  ARG B CA  1 
ATOM   1376 C C   . ARG B 1 45  ? -32.409 45.069 30.478 1.00 43.54  ? 93  ARG B C   1 
ATOM   1377 O O   . ARG B 1 45  ? -33.178 44.151 30.180 1.00 43.02  ? 93  ARG B O   1 
ATOM   1378 C CB  . ARG B 1 45  ? -31.275 44.636 28.293 1.00 39.27  ? 93  ARG B CB  1 
ATOM   1379 C CG  . ARG B 1 45  ? -30.458 45.158 27.120 1.00 44.20  ? 93  ARG B CG  1 
ATOM   1380 C CD  . ARG B 1 45  ? -31.044 46.422 26.504 1.00 38.86  ? 93  ARG B CD  1 
ATOM   1381 N NE  . ARG B 1 45  ? -30.452 46.689 25.197 1.00 46.25  ? 93  ARG B NE  1 
ATOM   1382 C CZ  . ARG B 1 45  ? -30.747 47.737 24.429 1.00 46.66  ? 93  ARG B CZ  1 
ATOM   1383 N NH1 . ARG B 1 45  ? -31.633 48.634 24.838 1.00 47.45  ? 93  ARG B NH1 1 
ATOM   1384 N NH2 . ARG B 1 45  ? -30.159 47.890 23.246 1.00 43.34  ? 93  ARG B NH2 1 
ATOM   1385 N N   . ASN B 1 46  ? -32.392 45.644 31.678 1.00 45.96  ? 94  ASN B N   1 
ATOM   1386 C CA  . ASN B 1 46  ? -33.303 45.259 32.751 1.00 48.03  ? 94  ASN B CA  1 
ATOM   1387 C C   . ASN B 1 46  ? -33.258 43.793 33.132 1.00 49.21  ? 94  ASN B C   1 
ATOM   1388 O O   . ASN B 1 46  ? -34.209 43.255 33.704 1.00 51.50  ? 94  ASN B O   1 
ATOM   1389 C CB  . ASN B 1 46  ? -34.731 45.642 32.387 1.00 52.15  ? 94  ASN B CB  1 
ATOM   1390 C CG  . ASN B 1 46  ? -35.031 47.084 32.694 1.00 58.69  ? 94  ASN B CG  1 
ATOM   1391 O OD1 . ASN B 1 46  ? -34.370 47.999 32.183 1.00 57.32  ? 94  ASN B OD1 1 
ATOM   1392 N ND2 . ASN B 1 46  ? -36.030 47.305 33.545 1.00 60.86  ? 94  ASN B ND2 1 
ATOM   1393 N N   . LEU B 1 47  ? -32.146 43.147 32.816 1.00 48.24  ? 95  LEU B N   1 
ATOM   1394 C CA  . LEU B 1 47  ? -31.972 41.748 33.147 1.00 44.39  ? 95  LEU B CA  1 
ATOM   1395 C C   . LEU B 1 47  ? -30.728 41.620 34.033 1.00 41.71  ? 95  LEU B C   1 
ATOM   1396 O O   . LEU B 1 47  ? -29.769 42.392 33.900 1.00 39.20  ? 95  LEU B O   1 
ATOM   1397 C CB  . LEU B 1 47  ? -31.825 40.922 31.861 1.00 44.11  ? 95  LEU B CB  1 
ATOM   1398 C CG  . LEU B 1 47  ? -33.101 40.745 31.017 1.00 44.55  ? 95  LEU B CG  1 
ATOM   1399 C CD1 . LEU B 1 47  ? -32.753 40.028 29.713 1.00 40.70  ? 95  LEU B CD1 1 
ATOM   1400 C CD2 . LEU B 1 47  ? -34.156 39.961 31.802 1.00 34.77  ? 95  LEU B CD2 1 
ATOM   1401 N N   . PRO B 1 48  ? -30.746 40.668 34.975 1.00 37.36  ? 96  PRO B N   1 
ATOM   1402 C CA  . PRO B 1 48  ? -29.603 40.468 35.866 1.00 39.35  ? 96  PRO B CA  1 
ATOM   1403 C C   . PRO B 1 48  ? -28.584 39.495 35.253 1.00 41.51  ? 96  PRO B C   1 
ATOM   1404 O O   . PRO B 1 48  ? -28.910 38.335 34.971 1.00 45.12  ? 96  PRO B O   1 
ATOM   1405 C CB  . PRO B 1 48  ? -30.256 39.909 37.118 1.00 35.07  ? 96  PRO B CB  1 
ATOM   1406 C CG  . PRO B 1 48  ? -31.312 39.019 36.549 1.00 36.10  ? 96  PRO B CG  1 
ATOM   1407 C CD  . PRO B 1 48  ? -31.896 39.851 35.409 1.00 38.07  ? 96  PRO B CD  1 
ATOM   1408 N N   . TRP B 1 49  ? -27.365 39.978 35.032 1.00 41.57  ? 97  TRP B N   1 
ATOM   1409 C CA  . TRP B 1 49  ? -26.300 39.152 34.463 1.00 44.81  ? 97  TRP B CA  1 
ATOM   1410 C C   . TRP B 1 49  ? -25.241 38.801 35.512 1.00 46.04  ? 97  TRP B C   1 
ATOM   1411 O O   . TRP B 1 49  ? -24.815 39.658 36.290 1.00 44.38  ? 97  TRP B O   1 
ATOM   1412 C CB  . TRP B 1 49  ? -25.622 39.871 33.292 1.00 43.50  ? 97  TRP B CB  1 
ATOM   1413 C CG  . TRP B 1 49  ? -26.560 40.269 32.181 1.00 46.86  ? 97  TRP B CG  1 
ATOM   1414 C CD1 . TRP B 1 49  ? -27.430 41.327 32.177 1.00 41.83  ? 97  TRP B CD1 1 
ATOM   1415 C CD2 . TRP B 1 49  ? -26.714 39.617 30.912 1.00 44.88  ? 97  TRP B CD2 1 
ATOM   1416 N NE1 . TRP B 1 49  ? -28.110 41.374 30.984 1.00 44.61  ? 97  TRP B NE1 1 
ATOM   1417 C CE2 . TRP B 1 49  ? -27.692 40.338 30.188 1.00 45.31  ? 97  TRP B CE2 1 
ATOM   1418 C CE3 . TRP B 1 49  ? -26.121 38.494 30.315 1.00 44.22  ? 97  TRP B CE3 1 
ATOM   1419 C CZ2 . TRP B 1 49  ? -28.091 39.972 28.893 1.00 41.06  ? 97  TRP B CZ2 1 
ATOM   1420 C CZ3 . TRP B 1 49  ? -26.519 38.129 29.024 1.00 42.67  ? 97  TRP B CZ3 1 
ATOM   1421 C CH2 . TRP B 1 49  ? -27.494 38.869 28.331 1.00 40.18  ? 97  TRP B CH2 1 
ATOM   1422 N N   . LYS B 1 50  ? -24.811 37.543 35.519 1.00 44.28  ? 98  LYS B N   1 
ATOM   1423 C CA  . LYS B 1 50  ? -23.808 37.098 36.475 1.00 42.46  ? 98  LYS B CA  1 
ATOM   1424 C C   . LYS B 1 50  ? -22.677 36.297 35.843 1.00 42.25  ? 98  LYS B C   1 
ATOM   1425 O O   . LYS B 1 50  ? -22.829 35.685 34.777 1.00 39.84  ? 98  LYS B O   1 
ATOM   1426 C CB  . LYS B 1 50  ? -24.452 36.228 37.558 1.00 45.13  ? 98  LYS B CB  1 
ATOM   1427 C CG  . LYS B 1 50  ? -25.622 36.860 38.299 1.00 44.14  ? 98  LYS B CG  1 
ATOM   1428 C CD  . LYS B 1 50  ? -26.243 35.847 39.258 1.00 41.73  ? 98  LYS B CD  1 
ATOM   1429 C CE  . LYS B 1 50  ? -27.379 36.460 40.082 1.00 47.23  ? 98  LYS B CE  1 
ATOM   1430 N NZ  . LYS B 1 50  ? -27.931 35.522 41.106 1.00 39.56  ? 98  LYS B NZ  1 
ATOM   1431 N N   . ILE B 1 51  ? -21.539 36.303 36.527 1.00 39.00  ? 99  ILE B N   1 
ATOM   1432 C CA  . ILE B 1 51  ? -20.377 35.556 36.093 1.00 36.07  ? 99  ILE B CA  1 
ATOM   1433 C C   . ILE B 1 51  ? -20.394 34.236 36.856 1.00 36.30  ? 99  ILE B C   1 
ATOM   1434 O O   . ILE B 1 51  ? -20.568 34.217 38.075 1.00 38.45  ? 99  ILE B O   1 
ATOM   1435 C CB  . ILE B 1 51  ? -19.089 36.313 36.408 1.00 36.52  ? 99  ILE B CB  1 
ATOM   1436 C CG1 . ILE B 1 51  ? -18.952 37.486 35.446 1.00 34.97  ? 99  ILE B CG1 1 
ATOM   1437 C CG2 . ILE B 1 51  ? -17.888 35.374 36.321 1.00 36.98  ? 99  ILE B CG2 1 
ATOM   1438 C CD1 . ILE B 1 51  ? -17.687 38.294 35.649 1.00 33.51  ? 99  ILE B CD1 1 
ATOM   1439 N N   . MET B 1 52  ? -20.255 33.129 36.141 1.00 34.47  ? 100 MET B N   1 
ATOM   1440 C CA  . MET B 1 52  ? -20.249 31.832 36.792 1.00 36.97  ? 100 MET B CA  1 
ATOM   1441 C C   . MET B 1 52  ? -18.868 31.223 36.622 1.00 37.62  ? 100 MET B C   1 
ATOM   1442 O O   . MET B 1 52  ? -18.313 31.212 35.520 1.00 36.05  ? 100 MET B O   1 
ATOM   1443 C CB  . MET B 1 52  ? -21.299 30.911 36.181 1.00 37.48  ? 100 MET B CB  1 
ATOM   1444 C CG  . MET B 1 52  ? -21.454 29.619 36.940 1.00 43.77  ? 100 MET B CG  1 
ATOM   1445 S SD  . MET B 1 52  ? -22.450 28.418 36.074 1.00 55.76  ? 100 MET B SD  1 
ATOM   1446 C CE  . MET B 1 52  ? -24.114 29.102 36.297 1.00 56.50  ? 100 MET B CE  1 
ATOM   1447 N N   . VAL B 1 53  ? -18.310 30.733 37.721 1.00 39.83  ? 101 VAL B N   1 
ATOM   1448 C CA  . VAL B 1 53  ? -16.980 30.134 37.704 1.00 39.35  ? 101 VAL B CA  1 
ATOM   1449 C C   . VAL B 1 53  ? -16.978 28.827 38.476 1.00 43.93  ? 101 VAL B C   1 
ATOM   1450 O O   . VAL B 1 53  ? -17.603 28.717 39.537 1.00 46.06  ? 101 VAL B O   1 
ATOM   1451 C CB  . VAL B 1 53  ? -15.935 31.078 38.342 1.00 36.10  ? 101 VAL B CB  1 
ATOM   1452 C CG1 . VAL B 1 53  ? -14.563 30.415 38.331 1.00 34.81  ? 101 VAL B CG1 1 
ATOM   1453 C CG2 . VAL B 1 53  ? -15.892 32.405 37.585 1.00 30.75  ? 101 VAL B CG2 1 
ATOM   1454 N N   . MET B 1 54  ? -16.284 27.832 37.935 1.00 44.50  ? 102 MET B N   1 
ATOM   1455 C CA  . MET B 1 54  ? -16.197 26.533 38.585 1.00 46.03  ? 102 MET B CA  1 
ATOM   1456 C C   . MET B 1 54  ? -15.089 25.739 37.931 1.00 44.07  ? 102 MET B C   1 
ATOM   1457 O O   . MET B 1 54  ? -14.740 25.989 36.782 1.00 43.27  ? 102 MET B O   1 
ATOM   1458 C CB  . MET B 1 54  ? -17.496 25.749 38.426 1.00 49.85  ? 102 MET B CB  1 
ATOM   1459 C CG  . MET B 1 54  ? -17.626 25.069 37.070 1.00 55.21  ? 102 MET B CG  1 
ATOM   1460 S SD  . MET B 1 54  ? -18.879 25.805 36.027 1.00 63.70  ? 102 MET B SD  1 
ATOM   1461 C CE  . MET B 1 54  ? -20.238 24.683 36.345 1.00 55.67  ? 102 MET B CE  1 
ATOM   1462 N N   . PRO B 1 55  ? -14.508 24.785 38.666 1.00 43.96  ? 103 PRO B N   1 
ATOM   1463 C CA  . PRO B 1 55  ? -13.434 23.946 38.140 1.00 43.87  ? 103 PRO B CA  1 
ATOM   1464 C C   . PRO B 1 55  ? -14.083 22.813 37.368 1.00 46.58  ? 103 PRO B C   1 
ATOM   1465 O O   . PRO B 1 55  ? -15.209 22.412 37.671 1.00 47.21  ? 103 PRO B O   1 
ATOM   1466 C CB  . PRO B 1 55  ? -12.734 23.462 39.400 1.00 43.48  ? 103 PRO B CB  1 
ATOM   1467 C CG  . PRO B 1 55  ? -13.879 23.314 40.354 1.00 42.06  ? 103 PRO B CG  1 
ATOM   1468 C CD  . PRO B 1 55  ? -14.662 24.586 40.120 1.00 44.84  ? 103 PRO B CD  1 
ATOM   1469 N N   . ARG B 1 56  ? -13.382 22.299 36.369 1.00 49.57  ? 104 ARG B N   1 
ATOM   1470 C CA  . ARG B 1 56  ? -13.917 21.213 35.563 1.00 56.70  ? 104 ARG B CA  1 
ATOM   1471 C C   . ARG B 1 56  ? -12.875 20.114 35.442 1.00 62.12  ? 104 ARG B C   1 
ATOM   1472 O O   . ARG B 1 56  ? -11.813 20.334 34.860 1.00 61.76  ? 104 ARG B O   1 
ATOM   1473 C CB  . ARG B 1 56  ? -14.266 21.726 34.164 1.00 53.42  ? 104 ARG B CB  1 
ATOM   1474 C CG  . ARG B 1 56  ? -14.963 23.080 34.152 1.00 55.33  ? 104 ARG B CG  1 
ATOM   1475 C CD  . ARG B 1 56  ? -16.427 22.969 34.525 1.00 53.82  ? 104 ARG B CD  1 
ATOM   1476 N NE  . ARG B 1 56  ? -17.163 22.239 33.500 1.00 59.63  ? 104 ARG B NE  1 
ATOM   1477 C CZ  . ARG B 1 56  ? -18.485 22.252 33.377 1.00 59.65  ? 104 ARG B CZ  1 
ATOM   1478 N NH1 . ARG B 1 56  ? -19.223 22.961 34.222 1.00 63.18  ? 104 ARG B NH1 1 
ATOM   1479 N NH2 . ARG B 1 56  ? -19.068 21.571 32.402 1.00 57.68  ? 104 ARG B NH2 1 
ATOM   1480 N N   . PHE B 1 57  ? -13.162 18.946 36.012 1.00 69.84  ? 105 PHE B N   1 
ATOM   1481 C CA  . PHE B 1 57  ? -12.238 17.821 35.909 1.00 79.49  ? 105 PHE B CA  1 
ATOM   1482 C C   . PHE B 1 57  ? -12.845 16.897 34.858 1.00 85.34  ? 105 PHE B C   1 
ATOM   1483 O O   . PHE B 1 57  ? -13.446 15.873 35.184 1.00 87.34  ? 105 PHE B O   1 
ATOM   1484 C CB  . PHE B 1 57  ? -12.104 17.064 37.235 1.00 79.09  ? 105 PHE B CB  1 
ATOM   1485 C CG  . PHE B 1 57  ? -12.286 17.919 38.452 1.00 81.88  ? 105 PHE B CG  1 
ATOM   1486 C CD1 . PHE B 1 57  ? -13.551 18.108 38.995 1.00 84.45  ? 105 PHE B CD1 1 
ATOM   1487 C CD2 . PHE B 1 57  ? -11.195 18.524 39.069 1.00 83.56  ? 105 PHE B CD2 1 
ATOM   1488 C CE1 . PHE B 1 57  ? -13.733 18.886 40.141 1.00 86.66  ? 105 PHE B CE1 1 
ATOM   1489 C CE2 . PHE B 1 57  ? -11.362 19.306 40.215 1.00 85.20  ? 105 PHE B CE2 1 
ATOM   1490 C CZ  . PHE B 1 57  ? -12.635 19.486 40.753 1.00 85.82  ? 105 PHE B CZ  1 
ATOM   1491 N N   . TYR B 1 58  ? -12.686 17.282 33.596 1.00 92.32  ? 106 TYR B N   1 
ATOM   1492 C CA  . TYR B 1 58  ? -13.220 16.542 32.453 1.00 98.96  ? 106 TYR B CA  1 
ATOM   1493 C C   . TYR B 1 58  ? -12.114 15.851 31.635 1.00 102.60 ? 106 TYR B C   1 
ATOM   1494 O O   . TYR B 1 58  ? -11.537 16.442 30.719 1.00 104.03 ? 106 TYR B O   1 
ATOM   1495 C CB  . TYR B 1 58  ? -14.010 17.514 31.558 1.00 100.73 ? 106 TYR B CB  1 
ATOM   1496 C CG  . TYR B 1 58  ? -13.223 18.750 31.141 1.00 101.95 ? 106 TYR B CG  1 
ATOM   1497 C CD1 . TYR B 1 58  ? -13.794 19.733 30.333 1.00 102.65 ? 106 TYR B CD1 1 
ATOM   1498 C CD2 . TYR B 1 58  ? -11.894 18.916 31.535 1.00 102.01 ? 106 TYR B CD2 1 
ATOM   1499 C CE1 . TYR B 1 58  ? -13.055 20.839 29.934 1.00 103.23 ? 106 TYR B CE1 1 
ATOM   1500 C CE2 . TYR B 1 58  ? -11.159 20.000 31.145 1.00 102.62 ? 106 TYR B CE2 1 
ATOM   1501 C CZ  . TYR B 1 58  ? -11.737 20.954 30.349 1.00 103.55 ? 106 TYR B CZ  1 
ATOM   1502 O OH  . TYR B 1 58  ? -10.972 22.019 29.981 1.00 106.56 ? 106 TYR B OH  1 
ATOM   1503 N N   . PRO B 1 59  ? -11.829 14.571 31.928 1.00 105.78 ? 107 PRO B N   1 
ATOM   1504 C CA  . PRO B 1 59  ? -12.440 13.704 32.940 1.00 106.94 ? 107 PRO B CA  1 
ATOM   1505 C C   . PRO B 1 59  ? -11.925 13.826 34.378 1.00 107.87 ? 107 PRO B C   1 
ATOM   1506 O O   . PRO B 1 59  ? -11.044 14.630 34.691 1.00 108.63 ? 107 PRO B O   1 
ATOM   1507 C CB  . PRO B 1 59  ? -12.207 12.313 32.366 1.00 107.41 ? 107 PRO B CB  1 
ATOM   1508 C CG  . PRO B 1 59  ? -10.843 12.455 31.788 1.00 107.22 ? 107 PRO B CG  1 
ATOM   1509 C CD  . PRO B 1 59  ? -10.921 13.790 31.066 1.00 106.81 ? 107 PRO B CD  1 
ATOM   1510 N N   . ASP B 1 60  ? -12.500 12.980 35.225 1.00 108.38 ? 108 ASP B N   1 
ATOM   1511 C CA  . ASP B 1 60  ? -12.239 12.889 36.657 1.00 108.43 ? 108 ASP B CA  1 
ATOM   1512 C C   . ASP B 1 60  ? -10.820 12.784 37.201 1.00 108.15 ? 108 ASP B C   1 
ATOM   1513 O O   . ASP B 1 60  ? -10.627 12.953 38.404 1.00 108.68 ? 108 ASP B O   1 
ATOM   1514 C CB  . ASP B 1 60  ? -13.026 11.707 37.213 1.00 108.46 ? 108 ASP B CB  1 
ATOM   1515 C CG  . ASP B 1 60  ? -12.433 10.372 36.791 1.00 109.34 ? 108 ASP B CG  1 
ATOM   1516 O OD1 . ASP B 1 60  ? -11.997 10.256 35.623 1.00 108.08 ? 108 ASP B OD1 1 
ATOM   1517 O OD2 . ASP B 1 60  ? -12.400 9.447  37.628 1.00 110.20 ? 108 ASP B OD2 1 
ATOM   1518 N N   . ARG B 1 61  ? -9.820  12.496 36.376 1.00 107.41 ? 109 ARG B N   1 
ATOM   1519 C CA  . ARG B 1 61  ? -8.494  12.362 36.972 1.00 106.94 ? 109 ARG B CA  1 
ATOM   1520 C C   . ARG B 1 61  ? -7.184  12.748 36.287 1.00 105.97 ? 109 ARG B C   1 
ATOM   1521 O O   . ARG B 1 61  ? -6.317  13.355 36.926 1.00 106.79 ? 109 ARG B O   1 
ATOM   1522 C CB  . ARG B 1 61  ? -8.309  10.932 37.481 1.00 107.73 ? 109 ARG B CB  1 
ATOM   1523 C CG  . ARG B 1 61  ? -6.917  10.710 38.042 1.00 109.16 ? 109 ARG B CG  1 
ATOM   1524 C CD  . ARG B 1 61  ? -6.389  9.319  37.747 1.00 110.45 ? 109 ARG B CD  1 
ATOM   1525 N NE  . ARG B 1 61  ? -4.938  9.334  37.557 1.00 111.90 ? 109 ARG B NE  1 
ATOM   1526 C CZ  . ARG B 1 61  ? -4.130  8.318  37.844 1.00 113.85 ? 109 ARG B CZ  1 
ATOM   1527 N NH1 . ARG B 1 61  ? -4.624  7.191  38.345 1.00 115.43 ? 109 ARG B NH1 1 
ATOM   1528 N NH2 . ARG B 1 61  ? -2.825  8.426  37.632 1.00 114.31 ? 109 ARG B NH2 1 
ATOM   1529 N N   . PRO B 1 62  ? -6.995  12.379 35.005 1.00 104.34 ? 110 PRO B N   1 
ATOM   1530 C CA  . PRO B 1 62  ? -5.729  12.731 34.337 1.00 101.91 ? 110 PRO B CA  1 
ATOM   1531 C C   . PRO B 1 62  ? -5.482  14.243 34.378 1.00 100.79 ? 110 PRO B C   1 
ATOM   1532 O O   . PRO B 1 62  ? -4.729  14.797 33.563 1.00 100.40 ? 110 PRO B O   1 
ATOM   1533 C CB  . PRO B 1 62  ? -5.947  12.201 32.921 1.00 101.68 ? 110 PRO B CB  1 
ATOM   1534 C CG  . PRO B 1 62  ? -7.406  12.399 32.733 1.00 102.11 ? 110 PRO B CG  1 
ATOM   1535 C CD  . PRO B 1 62  ? -7.971  11.869 34.021 1.00 103.63 ? 110 PRO B CD  1 
ATOM   1536 N N   . HIS B 1 63  ? -6.105  14.846 35.399 1.00 98.67  ? 111 HIS B N   1 
ATOM   1537 C CA  . HIS B 1 63  ? -6.185  16.273 35.683 1.00 96.11  ? 111 HIS B CA  1 
ATOM   1538 C C   . HIS B 1 63  ? -5.504  17.231 34.763 1.00 91.64  ? 111 HIS B C   1 
ATOM   1539 O O   . HIS B 1 63  ? -4.315  17.562 34.824 1.00 91.33  ? 111 HIS B O   1 
ATOM   1540 C CB  . HIS B 1 63  ? -5.932  16.655 37.172 1.00 101.17 ? 111 HIS B CB  1 
ATOM   1541 C CG  . HIS B 1 63  ? -4.500  16.582 37.629 1.00 107.01 ? 111 HIS B CG  1 
ATOM   1542 N ND1 . HIS B 1 63  ? -4.011  15.531 38.378 1.00 108.80 ? 111 HIS B ND1 1 
ATOM   1543 C CD2 . HIS B 1 63  ? -3.478  17.468 37.519 1.00 108.80 ? 111 HIS B CD2 1 
ATOM   1544 C CE1 . HIS B 1 63  ? -2.754  15.771 38.710 1.00 110.44 ? 111 HIS B CE1 1 
ATOM   1545 N NE2 . HIS B 1 63  ? -2.405  16.940 38.202 1.00 110.58 ? 111 HIS B NE2 1 
ATOM   1546 N N   . GLN B 1 64  ? -6.387  17.638 33.872 1.00 85.05  ? 112 GLN B N   1 
ATOM   1547 C CA  . GLN B 1 64  ? -6.231  18.613 32.825 1.00 78.66  ? 112 GLN B CA  1 
ATOM   1548 C C   . GLN B 1 64  ? -7.415  19.416 33.331 1.00 72.90  ? 112 GLN B C   1 
ATOM   1549 O O   . GLN B 1 64  ? -8.467  19.510 32.689 1.00 73.91  ? 112 GLN B O   1 
ATOM   1550 C CB  . GLN B 1 64  ? -6.571  18.007 31.465 1.00 80.03  ? 112 GLN B CB  1 
ATOM   1551 C CG  . GLN B 1 64  ? -5.446  17.207 30.837 1.00 80.51  ? 112 GLN B CG  1 
ATOM   1552 C CD  . GLN B 1 64  ? -5.793  16.804 29.419 1.00 81.93  ? 112 GLN B CD  1 
ATOM   1553 O OE1 . GLN B 1 64  ? -5.968  15.618 29.104 1.00 79.86  ? 112 GLN B OE1 1 
ATOM   1554 N NE2 . GLN B 1 64  ? -5.926  17.803 28.551 1.00 83.20  ? 112 GLN B NE2 1 
ATOM   1555 N N   . LYS B 1 65  ? -7.242  19.895 34.556 1.00 63.86  ? 113 LYS B N   1 
ATOM   1556 C CA  . LYS B 1 65  ? -8.242  20.665 35.257 1.00 56.15  ? 113 LYS B CA  1 
ATOM   1557 C C   . LYS B 1 65  ? -8.367  22.000 34.552 1.00 50.68  ? 113 LYS B C   1 
ATOM   1558 O O   . LYS B 1 65  ? -7.379  22.678 34.280 1.00 44.95  ? 113 LYS B O   1 
ATOM   1559 C CB  . LYS B 1 65  ? -7.806  20.857 36.709 1.00 56.99  ? 113 LYS B CB  1 
ATOM   1560 C CG  . LYS B 1 65  ? -8.869  21.393 37.651 1.00 56.12  ? 113 LYS B CG  1 
ATOM   1561 C CD  . LYS B 1 65  ? -8.341  21.391 39.087 1.00 56.13  ? 113 LYS B CD  1 
ATOM   1562 C CE  . LYS B 1 65  ? -9.328  21.974 40.086 1.00 57.95  ? 113 LYS B CE  1 
ATOM   1563 N NZ  . LYS B 1 65  ? -8.715  22.023 41.445 1.00 57.69  ? 113 LYS B NZ  1 
ATOM   1564 N N   . SER B 1 66  ? -9.594  22.379 34.250 1.00 45.14  ? 114 SER B N   1 
ATOM   1565 C CA  . SER B 1 66  ? -9.809  23.625 33.549 1.00 42.46  ? 114 SER B CA  1 
ATOM   1566 C C   . SER B 1 66  ? -10.688 24.567 34.330 1.00 39.74  ? 114 SER B C   1 
ATOM   1567 O O   . SER B 1 66  ? -11.417 24.155 35.233 1.00 38.81  ? 114 SER B O   1 
ATOM   1568 C CB  . SER B 1 66  ? -10.476 23.346 32.213 1.00 39.25  ? 114 SER B CB  1 
ATOM   1569 O OG  . SER B 1 66  ? -11.788 22.846 32.420 1.00 34.19  ? 114 SER B OG  1 
ATOM   1570 N N   . VAL B 1 67  ? -10.610 25.836 33.961 1.00 37.59  ? 115 VAL B N   1 
ATOM   1571 C CA  . VAL B 1 67  ? -11.428 26.871 34.570 1.00 36.52  ? 115 VAL B CA  1 
ATOM   1572 C C   . VAL B 1 67  ? -12.743 26.948 33.776 1.00 36.58  ? 115 VAL B C   1 
ATOM   1573 O O   . VAL B 1 67  ? -12.730 27.031 32.545 1.00 38.27  ? 115 VAL B O   1 
ATOM   1574 C CB  . VAL B 1 67  ? -10.739 28.249 34.487 1.00 32.84  ? 115 VAL B CB  1 
ATOM   1575 C CG1 . VAL B 1 67  ? -11.565 29.281 35.202 1.00 35.20  ? 115 VAL B CG1 1 
ATOM   1576 C CG2 . VAL B 1 67  ? -9.354  28.178 35.088 1.00 37.73  ? 115 VAL B CG2 1 
ATOM   1577 N N   . GLY B 1 68  ? -13.870 26.887 34.474 1.00 33.05  ? 116 GLY B N   1 
ATOM   1578 C CA  . GLY B 1 68  ? -15.152 27.004 33.807 1.00 33.24  ? 116 GLY B CA  1 
ATOM   1579 C C   . GLY B 1 68  ? -15.602 28.446 33.995 1.00 34.07  ? 116 GLY B C   1 
ATOM   1580 O O   . GLY B 1 68  ? -15.844 28.872 35.128 1.00 32.89  ? 116 GLY B O   1 
ATOM   1581 N N   . PHE B 1 69  ? -15.707 29.193 32.894 1.00 30.60  ? 117 PHE B N   1 
ATOM   1582 C CA  . PHE B 1 69  ? -16.100 30.601 32.920 1.00 28.91  ? 117 PHE B CA  1 
ATOM   1583 C C   . PHE B 1 69  ? -17.336 30.838 32.029 1.00 32.81  ? 117 PHE B C   1 
ATOM   1584 O O   . PHE B 1 69  ? -17.227 30.832 30.802 1.00 29.45  ? 117 PHE B O   1 
ATOM   1585 C CB  . PHE B 1 69  ? -14.910 31.432 32.434 1.00 25.67  ? 117 PHE B CB  1 
ATOM   1586 C CG  . PHE B 1 69  ? -15.068 32.915 32.605 1.00 25.34  ? 117 PHE B CG  1 
ATOM   1587 C CD1 . PHE B 1 69  ? -16.198 33.464 33.206 1.00 27.33  ? 117 PHE B CD1 1 
ATOM   1588 C CD2 . PHE B 1 69  ? -14.071 33.772 32.148 1.00 26.81  ? 117 PHE B CD2 1 
ATOM   1589 C CE1 . PHE B 1 69  ? -16.334 34.850 33.344 1.00 22.86  ? 117 PHE B CE1 1 
ATOM   1590 C CE2 . PHE B 1 69  ? -14.194 35.157 32.281 1.00 28.32  ? 117 PHE B CE2 1 
ATOM   1591 C CZ  . PHE B 1 69  ? -15.333 35.695 32.881 1.00 27.30  ? 117 PHE B CZ  1 
ATOM   1592 N N   . PHE B 1 70  ? -18.497 31.055 32.655 1.00 32.22  ? 118 PHE B N   1 
ATOM   1593 C CA  . PHE B 1 70  ? -19.762 31.277 31.946 1.00 31.24  ? 118 PHE B CA  1 
ATOM   1594 C C   . PHE B 1 70  ? -20.503 32.564 32.324 1.00 35.58  ? 118 PHE B C   1 
ATOM   1595 O O   . PHE B 1 70  ? -20.417 33.053 33.452 1.00 34.87  ? 118 PHE B O   1 
ATOM   1596 C CB  . PHE B 1 70  ? -20.744 30.123 32.201 1.00 30.99  ? 118 PHE B CB  1 
ATOM   1597 C CG  . PHE B 1 70  ? -20.187 28.772 31.900 1.00 31.99  ? 118 PHE B CG  1 
ATOM   1598 C CD1 . PHE B 1 70  ? -19.380 28.115 32.828 1.00 31.62  ? 118 PHE B CD1 1 
ATOM   1599 C CD2 . PHE B 1 70  ? -20.449 28.152 30.681 1.00 29.93  ? 118 PHE B CD2 1 
ATOM   1600 C CE1 . PHE B 1 70  ? -18.847 26.864 32.541 1.00 29.28  ? 118 PHE B CE1 1 
ATOM   1601 C CE2 . PHE B 1 70  ? -19.918 26.898 30.387 1.00 28.42  ? 118 PHE B CE2 1 
ATOM   1602 C CZ  . PHE B 1 70  ? -19.117 26.256 31.317 1.00 27.37  ? 118 PHE B CZ  1 
ATOM   1603 N N   . LEU B 1 71  ? -21.256 33.093 31.363 1.00 35.93  ? 119 LEU B N   1 
ATOM   1604 C CA  . LEU B 1 71  ? -22.066 34.281 31.586 1.00 33.77  ? 119 LEU B CA  1 
ATOM   1605 C C   . LEU B 1 71  ? -23.495 33.773 31.770 1.00 34.54  ? 119 LEU B C   1 
ATOM   1606 O O   . LEU B 1 71  ? -23.984 32.986 30.960 1.00 37.02  ? 119 LEU B O   1 
ATOM   1607 C CB  . LEU B 1 71  ? -21.979 35.226 30.382 1.00 30.45  ? 119 LEU B CB  1 
ATOM   1608 C CG  . LEU B 1 71  ? -22.890 36.458 30.459 1.00 32.16  ? 119 LEU B CG  1 
ATOM   1609 C CD1 . LEU B 1 71  ? -22.564 37.285 31.703 1.00 27.69  ? 119 LEU B CD1 1 
ATOM   1610 C CD2 . LEU B 1 71  ? -22.725 37.293 29.209 1.00 30.85  ? 119 LEU B CD2 1 
ATOM   1611 N N   . GLN B 1 72  ? -24.155 34.194 32.847 1.00 36.71  ? 120 GLN B N   1 
ATOM   1612 C CA  . GLN B 1 72  ? -25.521 33.750 33.124 1.00 37.33  ? 120 GLN B CA  1 
ATOM   1613 C C   . GLN B 1 72  ? -26.519 34.904 33.079 1.00 38.67  ? 120 GLN B C   1 
ATOM   1614 O O   . GLN B 1 72  ? -26.207 36.042 33.448 1.00 40.49  ? 120 GLN B O   1 
ATOM   1615 C CB  . GLN B 1 72  ? -25.581 33.063 34.491 1.00 36.31  ? 120 GLN B CB  1 
ATOM   1616 C CG  . GLN B 1 72  ? -26.985 32.685 34.962 1.00 32.46  ? 120 GLN B CG  1 
ATOM   1617 C CD  . GLN B 1 72  ? -26.994 32.148 36.399 1.00 38.93  ? 120 GLN B CD  1 
ATOM   1618 O OE1 . GLN B 1 72  ? -26.955 30.932 36.637 1.00 32.81  ? 120 GLN B OE1 1 
ATOM   1619 N NE2 . GLN B 1 72  ? -27.028 33.059 37.360 1.00 27.60  ? 120 GLN B NE2 1 
ATOM   1620 N N   . CYS B 1 73  ? -27.735 34.610 32.645 1.00 39.86  ? 121 CYS B N   1 
ATOM   1621 C CA  . CYS B 1 73  ? -28.739 35.656 32.544 1.00 39.12  ? 121 CYS B CA  1 
ATOM   1622 C C   . CYS B 1 73  ? -30.118 35.273 33.051 1.00 40.39  ? 121 CYS B C   1 
ATOM   1623 O O   . CYS B 1 73  ? -30.699 34.282 32.606 1.00 42.46  ? 121 CYS B O   1 
ATOM   1624 C CB  . CYS B 1 73  ? -28.853 36.118 31.085 1.00 39.42  ? 121 CYS B CB  1 
ATOM   1625 S SG  . CYS B 1 73  ? -30.068 37.446 30.777 1.00 39.87  ? 121 CYS B SG  1 
ATOM   1626 N N   . ASN B 1 74  ? -30.620 36.052 34.009 1.00 42.27  ? 122 ASN B N   1 
ATOM   1627 C CA  . ASN B 1 74  ? -31.969 35.872 34.536 1.00 39.02  ? 122 ASN B CA  1 
ATOM   1628 C C   . ASN B 1 74  ? -32.374 34.436 34.880 1.00 40.32  ? 122 ASN B C   1 
ATOM   1629 O O   . ASN B 1 74  ? -33.519 34.048 34.639 1.00 37.73  ? 122 ASN B O   1 
ATOM   1630 C CB  . ASN B 1 74  ? -32.935 36.440 33.494 1.00 44.91  ? 122 ASN B CB  1 
ATOM   1631 C CG  . ASN B 1 74  ? -34.268 36.825 34.077 1.00 49.22  ? 122 ASN B CG  1 
ATOM   1632 O OD1 . ASN B 1 74  ? -34.335 37.559 35.066 1.00 50.95  ? 122 ASN B OD1 1 
ATOM   1633 N ND2 . ASN B 1 74  ? -35.342 36.349 33.457 1.00 46.64  ? 122 ASN B ND2 1 
ATOM   1634 N N   . ALA B 1 75  ? -31.455 33.665 35.467 1.00 40.04  ? 123 ALA B N   1 
ATOM   1635 C CA  . ALA B 1 75  ? -31.710 32.260 35.816 1.00 41.48  ? 123 ALA B CA  1 
ATOM   1636 C C   . ALA B 1 75  ? -32.699 31.990 36.961 1.00 46.05  ? 123 ALA B C   1 
ATOM   1637 O O   . ALA B 1 75  ? -33.182 30.863 37.108 1.00 42.28  ? 123 ALA B O   1 
ATOM   1638 C CB  . ALA B 1 75  ? -30.389 31.555 36.122 1.00 39.42  ? 123 ALA B CB  1 
ATOM   1639 N N   . GLU B 1 76  ? -32.995 32.997 37.775 1.00 49.66  ? 124 GLU B N   1 
ATOM   1640 C CA  . GLU B 1 76  ? -33.920 32.799 38.891 1.00 58.84  ? 124 GLU B CA  1 
ATOM   1641 C C   . GLU B 1 76  ? -35.385 33.052 38.546 1.00 61.54  ? 124 GLU B C   1 
ATOM   1642 O O   . GLU B 1 76  ? -36.282 32.480 39.169 1.00 62.35  ? 124 GLU B O   1 
ATOM   1643 C CB  . GLU B 1 76  ? -33.507 33.674 40.076 1.00 59.60  ? 124 GLU B CB  1 
ATOM   1644 C CG  . GLU B 1 76  ? -32.507 33.003 40.999 1.00 63.96  ? 124 GLU B CG  1 
ATOM   1645 C CD  . GLU B 1 76  ? -31.776 33.991 41.879 1.00 68.30  ? 124 GLU B CD  1 
ATOM   1646 O OE1 . GLU B 1 76  ? -31.213 33.567 42.912 1.00 71.28  ? 124 GLU B OE1 1 
ATOM   1647 O OE2 . GLU B 1 76  ? -31.751 35.191 41.532 1.00 70.68  ? 124 GLU B OE2 1 
ATOM   1648 N N   . SER B 1 77  ? -35.621 33.900 37.551 1.00 62.81  ? 125 SER B N   1 
ATOM   1649 C CA  . SER B 1 77  ? -36.975 34.231 37.133 1.00 62.07  ? 125 SER B CA  1 
ATOM   1650 C C   . SER B 1 77  ? -37.751 33.011 36.649 1.00 63.12  ? 125 SER B C   1 
ATOM   1651 O O   . SER B 1 77  ? -37.175 32.068 36.105 1.00 61.22  ? 125 SER B O   1 
ATOM   1652 C CB  . SER B 1 77  ? -36.931 35.284 36.029 1.00 62.64  ? 125 SER B CB  1 
ATOM   1653 O OG  . SER B 1 77  ? -38.239 35.629 35.611 1.00 67.74  ? 125 SER B OG  1 
ATOM   1654 N N   . ASP B 1 78  ? -39.064 33.034 36.868 1.00 66.17  ? 126 ASP B N   1 
ATOM   1655 C CA  . ASP B 1 78  ? -39.941 31.948 36.440 1.00 68.09  ? 126 ASP B CA  1 
ATOM   1656 C C   . ASP B 1 78  ? -40.481 32.270 35.055 1.00 65.62  ? 126 ASP B C   1 
ATOM   1657 O O   . ASP B 1 78  ? -41.004 31.396 34.367 1.00 64.06  ? 126 ASP B O   1 
ATOM   1658 C CB  . ASP B 1 78  ? -41.118 31.781 37.404 1.00 75.01  ? 126 ASP B CB  1 
ATOM   1659 C CG  . ASP B 1 78  ? -40.702 31.196 38.738 1.00 81.10  ? 126 ASP B CG  1 
ATOM   1660 O OD1 . ASP B 1 78  ? -40.144 30.076 38.748 1.00 83.25  ? 126 ASP B OD1 1 
ATOM   1661 O OD2 . ASP B 1 78  ? -40.937 31.855 39.776 1.00 83.80  ? 126 ASP B OD2 1 
ATOM   1662 N N   . SER B 1 79  ? -40.359 33.535 34.663 1.00 62.71  ? 127 SER B N   1 
ATOM   1663 C CA  . SER B 1 79  ? -40.826 33.984 33.357 1.00 60.52  ? 127 SER B CA  1 
ATOM   1664 C C   . SER B 1 79  ? -40.184 33.179 32.243 1.00 59.04  ? 127 SER B C   1 
ATOM   1665 O O   . SER B 1 79  ? -38.977 32.941 32.251 1.00 56.72  ? 127 SER B O   1 
ATOM   1666 C CB  . SER B 1 79  ? -40.499 35.463 33.150 1.00 60.52  ? 127 SER B CB  1 
ATOM   1667 O OG  . SER B 1 79  ? -40.627 35.812 31.784 1.00 59.60  ? 127 SER B OG  1 
ATOM   1668 N N   . THR B 1 80  ? -41.002 32.766 31.284 1.00 57.66  ? 128 THR B N   1 
ATOM   1669 C CA  . THR B 1 80  ? -40.521 31.991 30.153 1.00 57.57  ? 128 THR B CA  1 
ATOM   1670 C C   . THR B 1 80  ? -40.756 32.766 28.861 1.00 54.57  ? 128 THR B C   1 
ATOM   1671 O O   . THR B 1 80  ? -40.836 32.183 27.782 1.00 52.39  ? 128 THR B O   1 
ATOM   1672 C CB  . THR B 1 80  ? -41.254 30.641 30.058 1.00 59.23  ? 128 THR B CB  1 
ATOM   1673 O OG1 . THR B 1 80  ? -42.670 30.871 30.024 1.00 60.94  ? 128 THR B OG1 1 
ATOM   1674 C CG2 . THR B 1 80  ? -40.900 29.755 31.244 1.00 55.35  ? 128 THR B CG2 1 
ATOM   1675 N N   . SER B 1 81  ? -40.869 34.085 28.976 1.00 54.05  ? 129 SER B N   1 
ATOM   1676 C CA  . SER B 1 81  ? -41.108 34.920 27.806 1.00 53.33  ? 129 SER B CA  1 
ATOM   1677 C C   . SER B 1 81  ? -40.054 36.005 27.661 1.00 51.73  ? 129 SER B C   1 
ATOM   1678 O O   . SER B 1 81  ? -40.263 37.009 26.974 1.00 54.88  ? 129 SER B O   1 
ATOM   1679 C CB  . SER B 1 81  ? -42.496 35.560 27.888 1.00 54.06  ? 129 SER B CB  1 
ATOM   1680 O OG  . SER B 1 81  ? -42.586 36.436 28.993 1.00 56.82  ? 129 SER B OG  1 
ATOM   1681 N N   . TRP B 1 82  ? -38.924 35.816 28.327 1.00 44.73  ? 130 TRP B N   1 
ATOM   1682 C CA  . TRP B 1 82  ? -37.854 36.786 28.221 1.00 39.82  ? 130 TRP B CA  1 
ATOM   1683 C C   . TRP B 1 82  ? -36.823 36.243 27.228 1.00 38.15  ? 130 TRP B C   1 
ATOM   1684 O O   . TRP B 1 82  ? -36.776 35.042 26.930 1.00 30.07  ? 130 TRP B O   1 
ATOM   1685 C CB  . TRP B 1 82  ? -37.189 37.025 29.587 1.00 43.17  ? 130 TRP B CB  1 
ATOM   1686 C CG  . TRP B 1 82  ? -36.452 35.820 30.129 1.00 45.50  ? 130 TRP B CG  1 
ATOM   1687 C CD1 . TRP B 1 82  ? -36.988 34.759 30.811 1.00 48.85  ? 130 TRP B CD1 1 
ATOM   1688 C CD2 . TRP B 1 82  ? -35.054 35.545 29.994 1.00 42.06  ? 130 TRP B CD2 1 
ATOM   1689 N NE1 . TRP B 1 82  ? -36.005 33.842 31.108 1.00 48.83  ? 130 TRP B NE1 1 
ATOM   1690 C CE2 . TRP B 1 82  ? -34.810 34.300 30.619 1.00 46.36  ? 130 TRP B CE2 1 
ATOM   1691 C CE3 . TRP B 1 82  ? -33.983 36.228 29.407 1.00 43.47  ? 130 TRP B CE3 1 
ATOM   1692 C CZ2 . TRP B 1 82  ? -33.534 33.725 30.672 1.00 46.31  ? 130 TRP B CZ2 1 
ATOM   1693 C CZ3 . TRP B 1 82  ? -32.710 35.654 29.459 1.00 43.83  ? 130 TRP B CZ3 1 
ATOM   1694 C CH2 . TRP B 1 82  ? -32.500 34.416 30.088 1.00 44.17  ? 130 TRP B CH2 1 
ATOM   1695 N N   . SER B 1 83  ? -36.004 37.139 26.702 1.00 32.48  ? 131 SER B N   1 
ATOM   1696 C CA  . SER B 1 83  ? -34.981 36.732 25.772 1.00 34.84  ? 131 SER B CA  1 
ATOM   1697 C C   . SER B 1 83  ? -33.997 37.859 25.646 1.00 33.22  ? 131 SER B C   1 
ATOM   1698 O O   . SER B 1 83  ? -34.354 39.029 25.765 1.00 35.79  ? 131 SER B O   1 
ATOM   1699 C CB  . SER B 1 83  ? -35.572 36.408 24.401 1.00 35.74  ? 131 SER B CB  1 
ATOM   1700 O OG  . SER B 1 83  ? -35.923 37.592 23.709 1.00 40.90  ? 131 SER B OG  1 
ATOM   1701 N N   . CYS B 1 84  ? -32.743 37.496 25.434 1.00 31.21  ? 132 CYS B N   1 
ATOM   1702 C CA  . CYS B 1 84  ? -31.704 38.483 25.273 1.00 32.67  ? 132 CYS B CA  1 
ATOM   1703 C C   . CYS B 1 84  ? -30.683 37.907 24.315 1.00 33.87  ? 132 CYS B C   1 
ATOM   1704 O O   . CYS B 1 84  ? -30.122 36.829 24.549 1.00 33.88  ? 132 CYS B O   1 
ATOM   1705 C CB  . CYS B 1 84  ? -31.056 38.804 26.619 1.00 31.41  ? 132 CYS B CB  1 
ATOM   1706 N N   . HIS B 1 85  ? -30.478 38.605 23.208 1.00 31.78  ? 133 HIS B N   1 
ATOM   1707 C CA  . HIS B 1 85  ? -29.500 38.170 22.238 1.00 33.99  ? 133 HIS B CA  1 
ATOM   1708 C C   . HIS B 1 85  ? -28.290 39.010 22.587 1.00 34.67  ? 133 HIS B C   1 
ATOM   1709 O O   . HIS B 1 85  ? -28.301 40.224 22.396 1.00 36.15  ? 133 HIS B O   1 
ATOM   1710 C CB  . HIS B 1 85  ? -29.980 38.455 20.814 1.00 32.27  ? 133 HIS B CB  1 
ATOM   1711 C CG  . HIS B 1 85  ? -29.051 37.941 19.760 1.00 39.73  ? 133 HIS B CG  1 
ATOM   1712 N ND1 . HIS B 1 85  ? -28.396 36.733 19.875 1.00 36.80  ? 133 HIS B ND1 1 
ATOM   1713 C CD2 . HIS B 1 85  ? -28.675 38.461 18.569 1.00 38.70  ? 133 HIS B CD2 1 
ATOM   1714 C CE1 . HIS B 1 85  ? -27.656 36.532 18.801 1.00 37.22  ? 133 HIS B CE1 1 
ATOM   1715 N NE2 . HIS B 1 85  ? -27.807 37.565 17.993 1.00 38.67  ? 133 HIS B NE2 1 
ATOM   1716 N N   . ALA B 1 86  ? -27.252 38.374 23.121 1.00 32.09  ? 134 ALA B N   1 
ATOM   1717 C CA  . ALA B 1 86  ? -26.077 39.130 23.512 1.00 34.60  ? 134 ALA B CA  1 
ATOM   1718 C C   . ALA B 1 86  ? -24.741 38.613 23.023 1.00 36.67  ? 134 ALA B C   1 
ATOM   1719 O O   . ALA B 1 86  ? -24.554 37.435 22.718 1.00 37.73  ? 134 ALA B O   1 
ATOM   1720 C CB  . ALA B 1 86  ? -26.037 39.287 25.028 1.00 30.42  ? 134 ALA B CB  1 
ATOM   1721 N N   . GLN B 1 87  ? -23.810 39.549 22.974 1.00 38.47  ? 135 GLN B N   1 
ATOM   1722 C CA  . GLN B 1 87  ? -22.448 39.322 22.546 1.00 39.64  ? 135 GLN B CA  1 
ATOM   1723 C C   . GLN B 1 87  ? -21.627 39.724 23.774 1.00 40.88  ? 135 GLN B C   1 
ATOM   1724 O O   . GLN B 1 87  ? -21.966 40.696 24.463 1.00 39.04  ? 135 GLN B O   1 
ATOM   1725 C CB  . GLN B 1 87  ? -22.171 40.255 21.383 1.00 40.28  ? 135 GLN B CB  1 
ATOM   1726 C CG  . GLN B 1 87  ? -20.902 40.036 20.648 1.00 49.90  ? 135 GLN B CG  1 
ATOM   1727 C CD  . GLN B 1 87  ? -20.656 41.151 19.660 1.00 51.77  ? 135 GLN B CD  1 
ATOM   1728 O OE1 . GLN B 1 87  ? -19.812 41.038 18.773 1.00 58.39  ? 135 GLN B OE1 1 
ATOM   1729 N NE2 . GLN B 1 87  ? -21.392 42.250 19.817 1.00 56.59  ? 135 GLN B NE2 1 
ATOM   1730 N N   . ALA B 1 88  ? -20.567 38.987 24.076 1.00 39.51  ? 136 ALA B N   1 
ATOM   1731 C CA  . ALA B 1 88  ? -19.778 39.339 25.251 1.00 39.27  ? 136 ALA B CA  1 
ATOM   1732 C C   . ALA B 1 88  ? -18.334 38.896 25.191 1.00 37.48  ? 136 ALA B C   1 
ATOM   1733 O O   . ALA B 1 88  ? -17.985 37.949 24.482 1.00 38.55  ? 136 ALA B O   1 
ATOM   1734 C CB  . ALA B 1 88  ? -20.434 38.770 26.502 1.00 38.40  ? 136 ALA B CB  1 
ATOM   1735 N N   . VAL B 1 89  ? -17.502 39.607 25.943 1.00 37.42  ? 137 VAL B N   1 
ATOM   1736 C CA  . VAL B 1 89  ? -16.086 39.300 26.047 1.00 33.71  ? 137 VAL B CA  1 
ATOM   1737 C C   . VAL B 1 89  ? -15.841 38.783 27.461 1.00 33.92  ? 137 VAL B C   1 
ATOM   1738 O O   . VAL B 1 89  ? -16.109 39.482 28.432 1.00 31.04  ? 137 VAL B O   1 
ATOM   1739 C CB  . VAL B 1 89  ? -15.212 40.551 25.839 1.00 36.87  ? 137 VAL B CB  1 
ATOM   1740 C CG1 . VAL B 1 89  ? -13.735 40.146 25.779 1.00 37.39  ? 137 VAL B CG1 1 
ATOM   1741 C CG2 . VAL B 1 89  ? -15.626 41.276 24.561 1.00 37.99  ? 137 VAL B CG2 1 
ATOM   1742 N N   . LEU B 1 90  ? -15.370 37.545 27.576 1.00 35.39  ? 138 LEU B N   1 
ATOM   1743 C CA  . LEU B 1 90  ? -15.057 36.958 28.875 1.00 34.94  ? 138 LEU B CA  1 
ATOM   1744 C C   . LEU B 1 90  ? -13.540 36.996 29.050 1.00 39.22  ? 138 LEU B C   1 
ATOM   1745 O O   . LEU B 1 90  ? -12.801 36.424 28.248 1.00 39.51  ? 138 LEU B O   1 
ATOM   1746 C CB  . LEU B 1 90  ? -15.545 35.509 28.955 1.00 27.20  ? 138 LEU B CB  1 
ATOM   1747 C CG  . LEU B 1 90  ? -17.026 35.268 29.252 1.00 31.17  ? 138 LEU B CG  1 
ATOM   1748 C CD1 . LEU B 1 90  ? -17.915 36.003 28.233 1.00 28.59  ? 138 LEU B CD1 1 
ATOM   1749 C CD2 . LEU B 1 90  ? -17.292 33.764 29.221 1.00 29.20  ? 138 LEU B CD2 1 
ATOM   1750 N N   . LYS B 1 91  ? -13.070 37.681 30.087 1.00 45.06  ? 139 LYS B N   1 
ATOM   1751 C CA  . LYS B 1 91  ? -11.634 37.762 30.318 1.00 48.27  ? 139 LYS B CA  1 
ATOM   1752 C C   . LYS B 1 91  ? -11.240 37.565 31.772 1.00 45.64  ? 139 LYS B C   1 
ATOM   1753 O O   . LYS B 1 91  ? -11.978 37.925 32.684 1.00 46.36  ? 139 LYS B O   1 
ATOM   1754 C CB  . LYS B 1 91  ? -11.084 39.108 29.856 1.00 51.72  ? 139 LYS B CB  1 
ATOM   1755 C CG  . LYS B 1 91  ? -11.474 40.259 30.757 1.00 54.97  ? 139 LYS B CG  1 
ATOM   1756 C CD  . LYS B 1 91  ? -10.357 41.285 30.854 1.00 58.82  ? 139 LYS B CD  1 
ATOM   1757 C CE  . LYS B 1 91  ? -9.995  41.859 29.501 1.00 60.34  ? 139 LYS B CE  1 
ATOM   1758 N NZ  . LYS B 1 91  ? -8.956  42.922 29.628 1.00 65.76  ? 139 LYS B NZ  1 
ATOM   1759 N N   . ILE B 1 92  ? -10.073 36.963 31.967 1.00 45.56  ? 140 ILE B N   1 
ATOM   1760 C CA  . ILE B 1 92  ? -9.513  36.743 33.290 1.00 45.33  ? 140 ILE B CA  1 
ATOM   1761 C C   . ILE B 1 92  ? -8.330  37.703 33.291 1.00 46.07  ? 140 ILE B C   1 
ATOM   1762 O O   . ILE B 1 92  ? -7.401  37.570 32.499 1.00 45.15  ? 140 ILE B O   1 
ATOM   1763 C CB  . ILE B 1 92  ? -9.061  35.280 33.473 1.00 45.83  ? 140 ILE B CB  1 
ATOM   1764 C CG1 . ILE B 1 92  ? -10.297 34.392 33.653 1.00 44.39  ? 140 ILE B CG1 1 
ATOM   1765 C CG2 . ILE B 1 92  ? -8.137  35.151 34.669 1.00 42.71  ? 140 ILE B CG2 1 
ATOM   1766 C CD1 . ILE B 1 92  ? -9.994  32.920 33.846 1.00 43.61  ? 140 ILE B CD1 1 
ATOM   1767 N N   . ILE B 1 93  ? -8.408  38.698 34.160 1.00 49.76  ? 141 ILE B N   1 
ATOM   1768 C CA  . ILE B 1 93  ? -7.402  39.744 34.251 1.00 52.91  ? 141 ILE B CA  1 
ATOM   1769 C C   . ILE B 1 93  ? -5.999  39.320 34.661 1.00 56.86  ? 141 ILE B C   1 
ATOM   1770 O O   . ILE B 1 93  ? -5.820  38.525 35.585 1.00 56.76  ? 141 ILE B O   1 
ATOM   1771 C CB  . ILE B 1 93  ? -7.890  40.841 35.216 1.00 54.73  ? 141 ILE B CB  1 
ATOM   1772 C CG1 . ILE B 1 93  ? -9.205  41.425 34.692 1.00 53.56  ? 141 ILE B CG1 1 
ATOM   1773 C CG2 . ILE B 1 93  ? -6.829  41.923 35.369 1.00 53.12  ? 141 ILE B CG2 1 
ATOM   1774 C CD1 . ILE B 1 93  ? -9.886  42.375 35.650 1.00 53.72  ? 141 ILE B CD1 1 
ATOM   1775 N N   . ASN B 1 94  ? -5.007  39.852 33.951 1.00 60.95  ? 142 ASN B N   1 
ATOM   1776 C CA  . ASN B 1 94  ? -3.610  39.576 34.262 1.00 64.62  ? 142 ASN B CA  1 
ATOM   1777 C C   . ASN B 1 94  ? -3.096  40.844 34.922 1.00 66.54  ? 142 ASN B C   1 
ATOM   1778 O O   . ASN B 1 94  ? -2.901  41.863 34.259 1.00 63.88  ? 142 ASN B O   1 
ATOM   1779 C CB  . ASN B 1 94  ? -2.795  39.289 33.002 1.00 65.57  ? 142 ASN B CB  1 
ATOM   1780 C CG  . ASN B 1 94  ? -1.372  38.862 33.323 1.00 66.45  ? 142 ASN B CG  1 
ATOM   1781 O OD1 . ASN B 1 94  ? -0.636  39.579 34.004 1.00 66.99  ? 142 ASN B OD1 1 
ATOM   1782 N ND2 . ASN B 1 94  ? -0.980  37.688 32.840 1.00 64.79  ? 142 ASN B ND2 1 
ATOM   1783 N N   . TYR B 1 95  ? -2.890  40.773 36.231 1.00 70.94  ? 143 TYR B N   1 
ATOM   1784 C CA  . TYR B 1 95  ? -2.439  41.916 37.013 1.00 77.03  ? 143 TYR B CA  1 
ATOM   1785 C C   . TYR B 1 95  ? -1.115  42.536 36.567 1.00 81.19  ? 143 TYR B C   1 
ATOM   1786 O O   . TYR B 1 95  ? -0.917  43.745 36.696 1.00 82.71  ? 143 TYR B O   1 
ATOM   1787 C CB  . TYR B 1 95  ? -2.325  41.527 38.490 1.00 75.00  ? 143 TYR B CB  1 
ATOM   1788 C CG  . TYR B 1 95  ? -3.554  40.862 39.076 1.00 75.42  ? 143 TYR B CG  1 
ATOM   1789 C CD1 . TYR B 1 95  ? -3.583  39.485 39.309 1.00 75.21  ? 143 TYR B CD1 1 
ATOM   1790 C CD2 . TYR B 1 95  ? -4.674  41.613 39.437 1.00 74.25  ? 143 TYR B CD2 1 
ATOM   1791 C CE1 . TYR B 1 95  ? -4.696  38.872 39.895 1.00 75.67  ? 143 TYR B CE1 1 
ATOM   1792 C CE2 . TYR B 1 95  ? -5.793  41.009 40.023 1.00 74.78  ? 143 TYR B CE2 1 
ATOM   1793 C CZ  . TYR B 1 95  ? -5.796  39.641 40.251 1.00 75.07  ? 143 TYR B CZ  1 
ATOM   1794 O OH  . TYR B 1 95  ? -6.890  39.043 40.842 1.00 73.49  ? 143 TYR B OH  1 
ATOM   1795 N N   . ARG B 1 96  ? -0.217  41.717 36.032 1.00 84.85  ? 144 ARG B N   1 
ATOM   1796 C CA  . ARG B 1 96  ? 1.096   42.201 35.622 1.00 88.49  ? 144 ARG B CA  1 
ATOM   1797 C C   . ARG B 1 96  ? 1.182   42.893 34.263 1.00 89.34  ? 144 ARG B C   1 
ATOM   1798 O O   . ARG B 1 96  ? 1.986   43.809 34.080 1.00 89.50  ? 144 ARG B O   1 
ATOM   1799 C CB  . ARG B 1 96  ? 2.094   41.044 35.691 1.00 91.03  ? 144 ARG B CB  1 
ATOM   1800 C CG  . ARG B 1 96  ? 2.124   40.402 37.069 1.00 94.89  ? 144 ARG B CG  1 
ATOM   1801 C CD  . ARG B 1 96  ? 3.018   39.177 37.139 1.00 97.30  ? 144 ARG B CD  1 
ATOM   1802 N NE  . ARG B 1 96  ? 2.884   38.521 38.438 1.00 99.80  ? 144 ARG B NE  1 
ATOM   1803 C CZ  . ARG B 1 96  ? 3.497   37.393 38.780 1.00 100.27 ? 144 ARG B CZ  1 
ATOM   1804 N NH1 . ARG B 1 96  ? 4.299   36.782 37.919 1.00 100.03 ? 144 ARG B NH1 1 
ATOM   1805 N NH2 . ARG B 1 96  ? 3.299   36.871 39.984 1.00 100.04 ? 144 ARG B NH2 1 
ATOM   1806 N N   . ASP B 1 97  ? 0.364   42.462 33.312 1.00 89.55  ? 145 ASP B N   1 
ATOM   1807 C CA  . ASP B 1 97  ? 0.375   43.065 31.985 1.00 90.97  ? 145 ASP B CA  1 
ATOM   1808 C C   . ASP B 1 97  ? -0.957  42.814 31.293 1.00 90.71  ? 145 ASP B C   1 
ATOM   1809 O O   . ASP B 1 97  ? -1.226  41.711 30.815 1.00 89.55  ? 145 ASP B O   1 
ATOM   1810 C CB  . ASP B 1 97  ? 1.530   42.492 31.156 1.00 92.77  ? 145 ASP B CB  1 
ATOM   1811 C CG  . ASP B 1 97  ? 1.635   43.129 29.782 1.00 96.15  ? 145 ASP B CG  1 
ATOM   1812 O OD1 . ASP B 1 97  ? 1.393   44.350 29.668 1.00 96.72  ? 145 ASP B OD1 1 
ATOM   1813 O OD2 . ASP B 1 97  ? 1.975   42.411 28.817 1.00 98.63  ? 145 ASP B OD2 1 
ATOM   1814 N N   . ASP B 1 98  ? -1.787  43.851 31.247 1.00 90.42  ? 146 ASP B N   1 
ATOM   1815 C CA  . ASP B 1 98  ? -3.106  43.750 30.643 1.00 89.37  ? 146 ASP B CA  1 
ATOM   1816 C C   . ASP B 1 98  ? -3.083  43.093 29.269 1.00 88.13  ? 146 ASP B C   1 
ATOM   1817 O O   . ASP B 1 98  ? -3.962  42.293 28.952 1.00 89.97  ? 146 ASP B O   1 
ATOM   1818 C CB  . ASP B 1 98  ? -3.755  45.129 30.546 1.00 89.78  ? 146 ASP B CB  1 
ATOM   1819 C CG  . ASP B 1 98  ? -5.254  45.049 30.326 1.00 90.14  ? 146 ASP B CG  1 
ATOM   1820 O OD1 . ASP B 1 98  ? -5.892  46.112 30.183 1.00 90.77  ? 146 ASP B OD1 1 
ATOM   1821 O OD2 . ASP B 1 98  ? -5.795  43.922 30.300 1.00 88.86  ? 146 ASP B OD2 1 
ATOM   1822 N N   . GLU B 1 99  ? -2.085  43.422 28.453 1.00 85.60  ? 147 GLU B N   1 
ATOM   1823 C CA  . GLU B 1 99  ? -1.986  42.826 27.125 1.00 83.42  ? 147 GLU B CA  1 
ATOM   1824 C C   . GLU B 1 99  ? -1.764  41.320 27.210 1.00 79.65  ? 147 GLU B C   1 
ATOM   1825 O O   . GLU B 1 99  ? -1.540  40.659 26.200 1.00 78.35  ? 147 GLU B O   1 
ATOM   1826 C CB  . GLU B 1 99  ? -0.850  43.459 26.320 1.00 86.25  ? 147 GLU B CB  1 
ATOM   1827 C CG  . GLU B 1 99  ? -1.231  44.743 25.601 1.00 90.92  ? 147 GLU B CG  1 
ATOM   1828 C CD  . GLU B 1 99  ? -0.182  45.170 24.589 1.00 95.11  ? 147 GLU B CD  1 
ATOM   1829 O OE1 . GLU B 1 99  ? 0.139   44.360 23.692 1.00 97.20  ? 147 GLU B OE1 1 
ATOM   1830 O OE2 . GLU B 1 99  ? 0.321   46.311 24.686 1.00 98.18  ? 147 GLU B OE2 1 
ATOM   1831 N N   . LYS B 1 100 ? -1.818  40.782 28.422 1.00 76.61  ? 148 LYS B N   1 
ATOM   1832 C CA  . LYS B 1 100 ? -1.642  39.352 28.631 1.00 73.00  ? 148 LYS B CA  1 
ATOM   1833 C C   . LYS B 1 100 ? -2.888  38.775 29.281 1.00 68.48  ? 148 LYS B C   1 
ATOM   1834 O O   . LYS B 1 100 ? -2.895  37.624 29.715 1.00 68.09  ? 148 LYS B O   1 
ATOM   1835 C CB  . LYS B 1 100 ? -0.423  39.079 29.514 1.00 76.11  ? 148 LYS B CB  1 
ATOM   1836 C CG  . LYS B 1 100 ? 0.899   39.448 28.863 1.00 81.49  ? 148 LYS B CG  1 
ATOM   1837 C CD  . LYS B 1 100 ? 2.085   39.064 29.739 1.00 84.61  ? 148 LYS B CD  1 
ATOM   1838 C CE  . LYS B 1 100 ? 3.406   39.480 29.099 1.00 85.41  ? 148 LYS B CE  1 
ATOM   1839 N NZ  . LYS B 1 100 ? 4.566   39.168 29.979 1.00 84.77  ? 148 LYS B NZ  1 
ATOM   1840 N N   . SER B 1 101 ? -3.937  39.588 29.360 1.00 63.96  ? 149 SER B N   1 
ATOM   1841 C CA  . SER B 1 101 ? -5.197  39.142 29.938 1.00 60.19  ? 149 SER B CA  1 
ATOM   1842 C C   . SER B 1 101 ? -5.804  38.135 28.971 1.00 57.24  ? 149 SER B C   1 
ATOM   1843 O O   . SER B 1 101 ? -5.805  38.350 27.759 1.00 58.71  ? 149 SER B O   1 
ATOM   1844 C CB  . SER B 1 101 ? -6.144  40.324 30.138 1.00 60.37  ? 149 SER B CB  1 
ATOM   1845 O OG  . SER B 1 101 ? -5.597  41.254 31.057 1.00 60.58  ? 149 SER B OG  1 
ATOM   1846 N N   . PHE B 1 102 ? -6.313  37.034 29.511 1.00 52.62  ? 150 PHE B N   1 
ATOM   1847 C CA  . PHE B 1 102 ? -6.897  35.974 28.701 1.00 47.61  ? 150 PHE B CA  1 
ATOM   1848 C C   . PHE B 1 102 ? -8.371  36.232 28.392 1.00 45.02  ? 150 PHE B C   1 
ATOM   1849 O O   . PHE B 1 102 ? -9.226  36.085 29.261 1.00 42.82  ? 150 PHE B O   1 
ATOM   1850 C CB  . PHE B 1 102 ? -6.754  34.653 29.440 1.00 49.63  ? 150 PHE B CB  1 
ATOM   1851 C CG  . PHE B 1 102 ? -6.857  33.453 28.563 1.00 53.36  ? 150 PHE B CG  1 
ATOM   1852 C CD1 . PHE B 1 102 ? -5.710  32.783 28.148 1.00 54.71  ? 150 PHE B CD1 1 
ATOM   1853 C CD2 . PHE B 1 102 ? -8.101  32.970 28.170 1.00 53.01  ? 150 PHE B CD2 1 
ATOM   1854 C CE1 . PHE B 1 102 ? -5.800  31.639 27.353 1.00 57.30  ? 150 PHE B CE1 1 
ATOM   1855 C CE2 . PHE B 1 102 ? -8.203  31.832 27.377 1.00 55.14  ? 150 PHE B CE2 1 
ATOM   1856 C CZ  . PHE B 1 102 ? -7.051  31.163 26.968 1.00 54.55  ? 150 PHE B CZ  1 
ATOM   1857 N N   . SER B 1 103 ? -8.679  36.611 27.156 1.00 41.00  ? 151 SER B N   1 
ATOM   1858 C CA  . SER B 1 103 ? -10.073 36.870 26.824 1.00 43.06  ? 151 SER B CA  1 
ATOM   1859 C C   . SER B 1 103 ? -10.569 36.069 25.636 1.00 36.23  ? 151 SER B C   1 
ATOM   1860 O O   . SER B 1 103 ? -9.807  35.730 24.738 1.00 37.59  ? 151 SER B O   1 
ATOM   1861 C CB  . SER B 1 103 ? -10.305 38.367 26.568 1.00 40.40  ? 151 SER B CB  1 
ATOM   1862 O OG  . SER B 1 103 ? -9.763  38.779 25.325 1.00 46.27  ? 151 SER B OG  1 
ATOM   1863 N N   . ARG B 1 104 ? -11.856 35.756 25.658 1.00 32.59  ? 152 ARG B N   1 
ATOM   1864 C CA  . ARG B 1 104 ? -12.501 35.016 24.577 1.00 33.88  ? 152 ARG B CA  1 
ATOM   1865 C C   . ARG B 1 104 ? -13.897 35.614 24.388 1.00 33.01  ? 152 ARG B C   1 
ATOM   1866 O O   . ARG B 1 104 ? -14.495 36.131 25.334 1.00 34.19  ? 152 ARG B O   1 
ATOM   1867 C CB  . ARG B 1 104 ? -12.575 33.530 24.927 1.00 31.68  ? 152 ARG B CB  1 
ATOM   1868 C CG  . ARG B 1 104 ? -11.204 32.934 25.266 1.00 34.91  ? 152 ARG B CG  1 
ATOM   1869 C CD  . ARG B 1 104 ? -11.258 31.438 25.560 1.00 32.57  ? 152 ARG B CD  1 
ATOM   1870 N NE  . ARG B 1 104 ? -11.688 30.667 24.399 1.00 32.72  ? 152 ARG B NE  1 
ATOM   1871 C CZ  . ARG B 1 104 ? -11.893 29.357 24.409 1.00 34.84  ? 152 ARG B CZ  1 
ATOM   1872 N NH1 . ARG B 1 104 ? -11.707 28.658 25.523 1.00 33.88  ? 152 ARG B NH1 1 
ATOM   1873 N NH2 . ARG B 1 104 ? -12.295 28.747 23.306 1.00 29.54  ? 152 ARG B NH2 1 
ATOM   1874 N N   . ARG B 1 105 ? -14.417 35.562 23.169 1.00 32.49  ? 153 ARG B N   1 
ATOM   1875 C CA  . ARG B 1 105 ? -15.721 36.148 22.906 1.00 32.24  ? 153 ARG B CA  1 
ATOM   1876 C C   . ARG B 1 105 ? -16.836 35.144 22.668 1.00 33.97  ? 153 ARG B C   1 
ATOM   1877 O O   . ARG B 1 105 ? -16.598 34.059 22.136 1.00 31.77  ? 153 ARG B O   1 
ATOM   1878 C CB  . ARG B 1 105 ? -15.636 37.088 21.704 1.00 36.53  ? 153 ARG B CB  1 
ATOM   1879 C CG  . ARG B 1 105 ? -14.441 38.032 21.723 1.00 42.92  ? 153 ARG B CG  1 
ATOM   1880 C CD  . ARG B 1 105 ? -14.772 39.345 21.023 1.00 58.15  ? 153 ARG B CD  1 
ATOM   1881 N NE  . ARG B 1 105 ? -13.595 40.034 20.488 1.00 66.94  ? 153 ARG B NE  1 
ATOM   1882 C CZ  . ARG B 1 105 ? -12.497 40.335 21.181 1.00 72.35  ? 153 ARG B CZ  1 
ATOM   1883 N NH1 . ARG B 1 105 ? -12.391 40.011 22.466 1.00 74.08  ? 153 ARG B NH1 1 
ATOM   1884 N NH2 . ARG B 1 105 ? -11.500 40.977 20.584 1.00 74.26  ? 153 ARG B NH2 1 
ATOM   1885 N N   . ILE B 1 106 ? -18.049 35.511 23.084 1.00 30.97  ? 154 ILE B N   1 
ATOM   1886 C CA  . ILE B 1 106 ? -19.231 34.678 22.877 1.00 27.48  ? 154 ILE B CA  1 
ATOM   1887 C C   . ILE B 1 106 ? -20.367 35.493 22.248 1.00 27.55  ? 154 ILE B C   1 
ATOM   1888 O O   . ILE B 1 106 ? -20.342 36.718 22.214 1.00 29.91  ? 154 ILE B O   1 
ATOM   1889 C CB  . ILE B 1 106 ? -19.785 34.050 24.187 1.00 25.74  ? 154 ILE B CB  1 
ATOM   1890 C CG1 . ILE B 1 106 ? -20.072 35.144 25.226 1.00 24.53  ? 154 ILE B CG1 1 
ATOM   1891 C CG2 . ILE B 1 106 ? -18.841 32.966 24.679 1.00 25.40  ? 154 ILE B CG2 1 
ATOM   1892 C CD1 . ILE B 1 106 ? -20.983 34.686 26.396 1.00 15.54  ? 154 ILE B CD1 1 
ATOM   1893 N N   . SER B 1 107 ? -21.362 34.775 21.755 1.00 26.79  ? 155 SER B N   1 
ATOM   1894 C CA  . SER B 1 107 ? -22.535 35.342 21.116 1.00 28.50  ? 155 SER B CA  1 
ATOM   1895 C C   . SER B 1 107 ? -23.601 34.292 21.389 1.00 28.12  ? 155 SER B C   1 
ATOM   1896 O O   . SER B 1 107 ? -23.425 33.122 21.038 1.00 30.28  ? 155 SER B O   1 
ATOM   1897 C CB  . SER B 1 107 ? -22.282 35.464 19.617 1.00 25.43  ? 155 SER B CB  1 
ATOM   1898 O OG  . SER B 1 107 ? -23.327 36.169 18.997 1.00 44.24  ? 155 SER B OG  1 
ATOM   1899 N N   . HIS B 1 108 ? -24.709 34.680 22.005 1.00 27.85  ? 156 HIS B N   1 
ATOM   1900 C CA  . HIS B 1 108 ? -25.724 33.687 22.330 1.00 25.12  ? 156 HIS B CA  1 
ATOM   1901 C C   . HIS B 1 108 ? -27.069 34.327 22.595 1.00 24.08  ? 156 HIS B C   1 
ATOM   1902 O O   . HIS B 1 108 ? -27.147 35.486 23.007 1.00 24.27  ? 156 HIS B O   1 
ATOM   1903 C CB  . HIS B 1 108 ? -25.233 32.880 23.560 1.00 22.99  ? 156 HIS B CB  1 
ATOM   1904 C CG  . HIS B 1 108 ? -26.225 31.903 24.109 1.00 23.63  ? 156 HIS B CG  1 
ATOM   1905 N ND1 . HIS B 1 108 ? -26.909 32.120 25.291 1.00 27.19  ? 156 HIS B ND1 1 
ATOM   1906 C CD2 . HIS B 1 108 ? -26.637 30.693 23.653 1.00 25.44  ? 156 HIS B CD2 1 
ATOM   1907 C CE1 . HIS B 1 108 ? -27.698 31.085 25.537 1.00 26.99  ? 156 HIS B CE1 1 
ATOM   1908 N NE2 . HIS B 1 108 ? -27.552 30.206 24.559 1.00 25.36  ? 156 HIS B NE2 1 
ATOM   1909 N N   . LEU B 1 109 ? -28.133 33.577 22.330 1.00 24.04  ? 157 LEU B N   1 
ATOM   1910 C CA  . LEU B 1 109 ? -29.482 34.069 22.588 1.00 29.77  ? 157 LEU B CA  1 
ATOM   1911 C C   . LEU B 1 109 ? -29.849 33.453 23.925 1.00 31.12  ? 157 LEU B C   1 
ATOM   1912 O O   . LEU B 1 109 ? -30.147 32.259 24.006 1.00 29.84  ? 157 LEU B O   1 
ATOM   1913 C CB  . LEU B 1 109 ? -30.479 33.601 21.500 1.00 29.78  ? 157 LEU B CB  1 
ATOM   1914 C CG  . LEU B 1 109 ? -31.965 34.020 21.539 1.00 30.85  ? 157 LEU B CG  1 
ATOM   1915 C CD1 . LEU B 1 109 ? -32.652 33.352 22.702 1.00 34.43  ? 157 LEU B CD1 1 
ATOM   1916 C CD2 . LEU B 1 109 ? -32.106 35.540 21.634 1.00 28.50  ? 157 LEU B CD2 1 
ATOM   1917 N N   . PHE B 1 110 ? -29.795 34.257 24.980 1.00 31.98  ? 158 PHE B N   1 
ATOM   1918 C CA  . PHE B 1 110 ? -30.139 33.767 26.301 1.00 29.74  ? 158 PHE B CA  1 
ATOM   1919 C C   . PHE B 1 110 ? -31.645 33.797 26.474 1.00 35.44  ? 158 PHE B C   1 
ATOM   1920 O O   . PHE B 1 110 ? -32.314 34.769 26.091 1.00 33.23  ? 158 PHE B O   1 
ATOM   1921 C CB  . PHE B 1 110 ? -29.510 34.636 27.400 1.00 29.51  ? 158 PHE B CB  1 
ATOM   1922 C CG  . PHE B 1 110 ? -28.005 34.727 27.337 1.00 26.50  ? 158 PHE B CG  1 
ATOM   1923 C CD1 . PHE B 1 110 ? -27.371 35.491 26.354 1.00 22.31  ? 158 PHE B CD1 1 
ATOM   1924 C CD2 . PHE B 1 110 ? -27.221 34.064 28.284 1.00 26.40  ? 158 PHE B CD2 1 
ATOM   1925 C CE1 . PHE B 1 110 ? -25.970 35.601 26.313 1.00 23.58  ? 158 PHE B CE1 1 
ATOM   1926 C CE2 . PHE B 1 110 ? -25.822 34.162 28.260 1.00 22.94  ? 158 PHE B CE2 1 
ATOM   1927 C CZ  . PHE B 1 110 ? -25.195 34.934 27.271 1.00 22.72  ? 158 PHE B CZ  1 
ATOM   1928 N N   . PHE B 1 111 ? -32.177 32.720 27.035 1.00 36.47  ? 159 PHE B N   1 
ATOM   1929 C CA  . PHE B 1 111 ? -33.592 32.629 27.323 1.00 37.30  ? 159 PHE B CA  1 
ATOM   1930 C C   . PHE B 1 111 ? -33.763 31.533 28.356 1.00 42.86  ? 159 PHE B C   1 
ATOM   1931 O O   . PHE B 1 111 ? -32.803 30.847 28.703 1.00 38.71  ? 159 PHE B O   1 
ATOM   1932 C CB  . PHE B 1 111 ? -34.417 32.348 26.055 1.00 41.98  ? 159 PHE B CB  1 
ATOM   1933 C CG  . PHE B 1 111 ? -34.203 30.983 25.457 1.00 41.36  ? 159 PHE B CG  1 
ATOM   1934 C CD1 . PHE B 1 111 ? -35.180 29.997 25.577 1.00 42.29  ? 159 PHE B CD1 1 
ATOM   1935 C CD2 . PHE B 1 111 ? -33.048 30.695 24.737 1.00 43.57  ? 159 PHE B CD2 1 
ATOM   1936 C CE1 . PHE B 1 111 ? -35.013 28.742 24.985 1.00 41.04  ? 159 PHE B CE1 1 
ATOM   1937 C CE2 . PHE B 1 111 ? -32.871 29.445 24.141 1.00 42.96  ? 159 PHE B CE2 1 
ATOM   1938 C CZ  . PHE B 1 111 ? -33.859 28.468 24.267 1.00 43.50  ? 159 PHE B CZ  1 
ATOM   1939 N N   . HIS B 1 112 ? -34.988 31.383 28.844 1.00 45.26  ? 160 HIS B N   1 
ATOM   1940 C CA  . HIS B 1 112 ? -35.313 30.412 29.879 1.00 52.53  ? 160 HIS B CA  1 
ATOM   1941 C C   . HIS B 1 112 ? -34.593 29.058 29.858 1.00 51.16  ? 160 HIS B C   1 
ATOM   1942 O O   . HIS B 1 112 ? -34.057 28.634 30.884 1.00 49.60  ? 160 HIS B O   1 
ATOM   1943 C CB  . HIS B 1 112 ? -36.829 30.180 29.905 1.00 59.80  ? 160 HIS B CB  1 
ATOM   1944 C CG  . HIS B 1 112 ? -37.298 29.446 31.119 1.00 68.55  ? 160 HIS B CG  1 
ATOM   1945 N ND1 . HIS B 1 112 ? -37.244 28.073 31.225 1.00 73.08  ? 160 HIS B ND1 1 
ATOM   1946 C CD2 . HIS B 1 112 ? -37.760 29.899 32.311 1.00 72.95  ? 160 HIS B CD2 1 
ATOM   1947 C CE1 . HIS B 1 112 ? -37.650 27.711 32.431 1.00 77.70  ? 160 HIS B CE1 1 
ATOM   1948 N NE2 . HIS B 1 112 ? -37.968 28.800 33.109 1.00 76.86  ? 160 HIS B NE2 1 
ATOM   1949 N N   . LYS B 1 113 ? -34.568 28.387 28.706 1.00 47.03  ? 161 LYS B N   1 
ATOM   1950 C CA  . LYS B 1 113 ? -33.948 27.066 28.608 1.00 43.78  ? 161 LYS B CA  1 
ATOM   1951 C C   . LYS B 1 113 ? -32.432 27.018 28.419 1.00 43.11  ? 161 LYS B C   1 
ATOM   1952 O O   . LYS B 1 113 ? -31.824 25.946 28.517 1.00 41.23  ? 161 LYS B O   1 
ATOM   1953 C CB  . LYS B 1 113 ? -34.614 26.273 27.486 1.00 46.52  ? 161 LYS B CB  1 
ATOM   1954 C CG  . LYS B 1 113 ? -36.092 25.996 27.714 1.00 49.52  ? 161 LYS B CG  1 
ATOM   1955 C CD  . LYS B 1 113 ? -36.600 24.963 26.720 1.00 53.76  ? 161 LYS B CD  1 
ATOM   1956 C CE  . LYS B 1 113 ? -37.939 24.388 27.157 1.00 59.89  ? 161 LYS B CE  1 
ATOM   1957 N NZ  . LYS B 1 113 ? -38.380 23.255 26.288 1.00 63.33  ? 161 LYS B NZ  1 
ATOM   1958 N N   . GLU B 1 114 ? -31.831 28.172 28.144 1.00 38.73  ? 162 GLU B N   1 
ATOM   1959 C CA  . GLU B 1 114 ? -30.389 28.280 27.932 1.00 34.50  ? 162 GLU B CA  1 
ATOM   1960 C C   . GLU B 1 114 ? -29.973 29.642 28.489 1.00 33.76  ? 162 GLU B C   1 
ATOM   1961 O O   . GLU B 1 114 ? -29.629 30.554 27.730 1.00 30.34  ? 162 GLU B O   1 
ATOM   1962 C CB  . GLU B 1 114 ? -30.079 28.203 26.428 1.00 36.55  ? 162 GLU B CB  1 
ATOM   1963 C CG  . GLU B 1 114 ? -30.680 26.981 25.721 1.00 43.16  ? 162 GLU B CG  1 
ATOM   1964 C CD  . GLU B 1 114 ? -30.237 26.837 24.262 1.00 51.62  ? 162 GLU B CD  1 
ATOM   1965 O OE1 . GLU B 1 114 ? -30.627 25.834 23.623 1.00 52.69  ? 162 GLU B OE1 1 
ATOM   1966 O OE2 . GLU B 1 114 ? -29.500 27.715 23.748 1.00 53.61  ? 162 GLU B OE2 1 
ATOM   1967 N N   . ASN B 1 115 ? -29.999 29.769 29.818 1.00 33.42  ? 163 ASN B N   1 
ATOM   1968 C CA  . ASN B 1 115 ? -29.695 31.040 30.474 1.00 33.02  ? 163 ASN B CA  1 
ATOM   1969 C C   . ASN B 1 115 ? -28.243 31.361 30.788 1.00 34.14  ? 163 ASN B C   1 
ATOM   1970 O O   . ASN B 1 115 ? -27.969 32.367 31.458 1.00 28.52  ? 163 ASN B O   1 
ATOM   1971 C CB  . ASN B 1 115 ? -30.543 31.191 31.745 1.00 34.77  ? 163 ASN B CB  1 
ATOM   1972 C CG  . ASN B 1 115 ? -30.293 30.093 32.758 1.00 38.93  ? 163 ASN B CG  1 
ATOM   1973 O OD1 . ASN B 1 115 ? -31.236 29.544 33.331 1.00 41.35  ? 163 ASN B OD1 1 
ATOM   1974 N ND2 . ASN B 1 115 ? -29.020 29.780 33.004 1.00 30.76  ? 163 ASN B ND2 1 
ATOM   1975 N N   . ASP B 1 116 ? -27.321 30.514 30.322 1.00 32.41  ? 164 ASP B N   1 
ATOM   1976 C CA  . ASP B 1 116 ? -25.894 30.757 30.515 1.00 30.97  ? 164 ASP B CA  1 
ATOM   1977 C C   . ASP B 1 116 ? -25.118 30.199 29.329 1.00 32.40  ? 164 ASP B C   1 
ATOM   1978 O O   . ASP B 1 116 ? -25.583 29.286 28.647 1.00 31.73  ? 164 ASP B O   1 
ATOM   1979 C CB  . ASP B 1 116 ? -25.396 30.180 31.864 1.00 34.79  ? 164 ASP B CB  1 
ATOM   1980 C CG  . ASP B 1 116 ? -25.150 28.671 31.845 1.00 29.39  ? 164 ASP B CG  1 
ATOM   1981 O OD1 . ASP B 1 116 ? -25.292 28.051 32.917 1.00 40.05  ? 164 ASP B OD1 1 
ATOM   1982 O OD2 . ASP B 1 116 ? -24.793 28.097 30.805 1.00 37.59  ? 164 ASP B OD2 1 
ATOM   1983 N N   . TRP B 1 117 ? -23.947 30.768 29.073 1.00 30.33  ? 165 TRP B N   1 
ATOM   1984 C CA  . TRP B 1 117 ? -23.131 30.347 27.956 1.00 27.01  ? 165 TRP B CA  1 
ATOM   1985 C C   . TRP B 1 117 ? -21.703 30.766 28.268 1.00 29.95  ? 165 TRP B C   1 
ATOM   1986 O O   . TRP B 1 117 ? -21.479 31.756 28.972 1.00 25.03  ? 165 TRP B O   1 
ATOM   1987 C CB  . TRP B 1 117 ? -23.624 31.046 26.689 1.00 28.73  ? 165 TRP B CB  1 
ATOM   1988 C CG  . TRP B 1 117 ? -23.156 30.442 25.394 1.00 30.63  ? 165 TRP B CG  1 
ATOM   1989 C CD1 . TRP B 1 117 ? -22.220 30.949 24.546 1.00 29.25  ? 165 TRP B CD1 1 
ATOM   1990 C CD2 . TRP B 1 117 ? -23.676 29.265 24.762 1.00 28.00  ? 165 TRP B CD2 1 
ATOM   1991 N NE1 . TRP B 1 117 ? -22.129 30.167 23.414 1.00 31.34  ? 165 TRP B NE1 1 
ATOM   1992 C CE2 . TRP B 1 117 ? -23.013 29.127 23.523 1.00 28.99  ? 165 TRP B CE2 1 
ATOM   1993 C CE3 . TRP B 1 117 ? -24.641 28.315 25.121 1.00 27.20  ? 165 TRP B CE3 1 
ATOM   1994 C CZ2 . TRP B 1 117 ? -23.287 28.073 22.634 1.00 26.28  ? 165 TRP B CZ2 1 
ATOM   1995 C CZ3 . TRP B 1 117 ? -24.912 27.266 24.234 1.00 27.53  ? 165 TRP B CZ3 1 
ATOM   1996 C CH2 . TRP B 1 117 ? -24.236 27.160 23.010 1.00 17.94  ? 165 TRP B CH2 1 
ATOM   1997 N N   . GLY B 1 118 ? -20.736 30.021 27.744 1.00 26.37  ? 166 GLY B N   1 
ATOM   1998 C CA  . GLY B 1 118 ? -19.350 30.356 28.009 1.00 30.78  ? 166 GLY B CA  1 
ATOM   1999 C C   . GLY B 1 118 ? -18.447 29.185 27.692 1.00 34.30  ? 166 GLY B C   1 
ATOM   2000 O O   . GLY B 1 118 ? -18.789 28.350 26.848 1.00 36.12  ? 166 GLY B O   1 
ATOM   2001 N N   . PHE B 1 119 ? -17.310 29.096 28.377 1.00 32.71  ? 167 PHE B N   1 
ATOM   2002 C CA  . PHE B 1 119 ? -16.374 28.006 28.118 1.00 32.14  ? 167 PHE B CA  1 
ATOM   2003 C C   . PHE B 1 119 ? -16.050 27.117 29.327 1.00 32.88  ? 167 PHE B C   1 
ATOM   2004 O O   . PHE B 1 119 ? -15.457 27.578 30.306 1.00 35.58  ? 167 PHE B O   1 
ATOM   2005 C CB  . PHE B 1 119 ? -15.070 28.573 27.559 1.00 30.80  ? 167 PHE B CB  1 
ATOM   2006 C CG  . PHE B 1 119 ? -15.261 29.544 26.424 1.00 34.91  ? 167 PHE B CG  1 
ATOM   2007 C CD1 . PHE B 1 119 ? -15.606 30.875 26.673 1.00 34.26  ? 167 PHE B CD1 1 
ATOM   2008 C CD2 . PHE B 1 119 ? -15.087 29.133 25.104 1.00 33.02  ? 167 PHE B CD2 1 
ATOM   2009 C CE1 . PHE B 1 119 ? -15.771 31.779 25.629 1.00 28.76  ? 167 PHE B CE1 1 
ATOM   2010 C CE2 . PHE B 1 119 ? -15.254 30.029 24.050 1.00 32.48  ? 167 PHE B CE2 1 
ATOM   2011 C CZ  . PHE B 1 119 ? -15.596 31.355 24.314 1.00 34.30  ? 167 PHE B CZ  1 
ATOM   2012 N N   . SER B 1 120 ? -16.424 25.843 29.254 1.00 28.93  ? 168 SER B N   1 
ATOM   2013 C CA  . SER B 1 120 ? -16.140 24.911 30.341 1.00 28.54  ? 168 SER B CA  1 
ATOM   2014 C C   . SER B 1 120 ? -14.633 24.645 30.364 1.00 30.04  ? 168 SER B C   1 
ATOM   2015 O O   . SER B 1 120 ? -14.089 24.173 31.356 1.00 30.21  ? 168 SER B O   1 
ATOM   2016 C CB  . SER B 1 120 ? -16.908 23.600 30.148 1.00 26.73  ? 168 SER B CB  1 
ATOM   2017 O OG  . SER B 1 120 ? -16.397 22.873 29.039 1.00 35.54  ? 168 SER B OG  1 
ATOM   2018 N N   . ASN B 1 121 ? -13.966 24.938 29.252 1.00 28.85  ? 169 ASN B N   1 
ATOM   2019 C CA  . ASN B 1 121 ? -12.523 24.781 29.170 1.00 29.65  ? 169 ASN B CA  1 
ATOM   2020 C C   . ASN B 1 121 ? -11.957 26.138 28.799 1.00 28.65  ? 169 ASN B C   1 
ATOM   2021 O O   . ASN B 1 121 ? -11.190 26.264 27.846 1.00 28.90  ? 169 ASN B O   1 
ATOM   2022 C CB  . ASN B 1 121 ? -12.118 23.775 28.097 1.00 30.80  ? 169 ASN B CB  1 
ATOM   2023 C CG  . ASN B 1 121 ? -10.626 23.429 28.167 1.00 37.53  ? 169 ASN B CG  1 
ATOM   2024 O OD1 . ASN B 1 121 ? -9.858  24.116 28.846 1.00 34.66  ? 169 ASN B OD1 1 
ATOM   2025 N ND2 . ASN B 1 121 ? -10.217 22.360 27.479 1.00 33.29  ? 169 ASN B ND2 1 
ATOM   2026 N N   . PHE B 1 122 ? -12.343 27.162 29.548 1.00 28.98  ? 170 PHE B N   1 
ATOM   2027 C CA  . PHE B 1 122 ? -11.880 28.508 29.251 1.00 30.47  ? 170 PHE B CA  1 
ATOM   2028 C C   . PHE B 1 122 ? -10.370 28.644 29.220 1.00 34.14  ? 170 PHE B C   1 
ATOM   2029 O O   . PHE B 1 122 ? -9.812  29.274 28.324 1.00 37.38  ? 170 PHE B O   1 
ATOM   2030 C CB  . PHE B 1 122 ? -12.435 29.502 30.273 1.00 25.39  ? 170 PHE B CB  1 
ATOM   2031 C CG  . PHE B 1 122 ? -12.047 30.930 29.999 1.00 27.46  ? 170 PHE B CG  1 
ATOM   2032 C CD1 . PHE B 1 122 ? -12.729 31.680 29.049 1.00 25.07  ? 170 PHE B CD1 1 
ATOM   2033 C CD2 . PHE B 1 122 ? -10.985 31.524 30.687 1.00 31.25  ? 170 PHE B CD2 1 
ATOM   2034 C CE1 . PHE B 1 122 ? -12.365 33.002 28.785 1.00 28.11  ? 170 PHE B CE1 1 
ATOM   2035 C CE2 . PHE B 1 122 ? -10.610 32.852 30.433 1.00 31.23  ? 170 PHE B CE2 1 
ATOM   2036 C CZ  . PHE B 1 122 ? -11.303 33.590 29.480 1.00 28.86  ? 170 PHE B CZ  1 
ATOM   2037 N N   . MET B 1 123 ? -9.711  28.043 30.201 1.00 38.22  ? 171 MET B N   1 
ATOM   2038 C CA  . MET B 1 123 ? -8.264  28.155 30.321 1.00 41.41  ? 171 MET B CA  1 
ATOM   2039 C C   . MET B 1 123 ? -7.752  27.042 31.242 1.00 39.53  ? 171 MET B C   1 
ATOM   2040 O O   . MET B 1 123 ? -8.494  26.519 32.076 1.00 32.49  ? 171 MET B O   1 
ATOM   2041 C CB  . MET B 1 123 ? -7.944  29.520 30.937 1.00 42.81  ? 171 MET B CB  1 
ATOM   2042 C CG  . MET B 1 123 ? -6.553  30.039 30.740 1.00 49.35  ? 171 MET B CG  1 
ATOM   2043 S SD  . MET B 1 123 ? -6.237  31.416 31.884 1.00 50.86  ? 171 MET B SD  1 
ATOM   2044 C CE  . MET B 1 123 ? -7.646  32.404 31.684 1.00 53.03  ? 171 MET B CE  1 
ATOM   2045 N N   . ALA B 1 124 ? -6.482  26.689 31.092 1.00 39.30  ? 172 ALA B N   1 
ATOM   2046 C CA  . ALA B 1 124 ? -5.883  25.651 31.919 1.00 41.67  ? 172 ALA B CA  1 
ATOM   2047 C C   . ALA B 1 124 ? -5.864  26.092 33.383 1.00 40.06  ? 172 ALA B C   1 
ATOM   2048 O O   . ALA B 1 124 ? -5.446  27.201 33.703 1.00 39.31  ? 172 ALA B O   1 
ATOM   2049 C CB  . ALA B 1 124 ? -4.474  25.366 31.441 1.00 37.85  ? 172 ALA B CB  1 
ATOM   2050 N N   . TRP B 1 125 ? -6.343  25.228 34.268 1.00 44.04  ? 173 TRP B N   1 
ATOM   2051 C CA  . TRP B 1 125 ? -6.357  25.531 35.696 1.00 50.04  ? 173 TRP B CA  1 
ATOM   2052 C C   . TRP B 1 125 ? -4.910  25.776 36.137 1.00 52.92  ? 173 TRP B C   1 
ATOM   2053 O O   . TRP B 1 125 ? -4.602  26.768 36.802 1.00 49.66  ? 173 TRP B O   1 
ATOM   2054 C CB  . TRP B 1 125 ? -6.963  24.346 36.462 1.00 50.59  ? 173 TRP B CB  1 
ATOM   2055 C CG  . TRP B 1 125 ? -7.250  24.603 37.906 1.00 56.99  ? 173 TRP B CG  1 
ATOM   2056 C CD1 . TRP B 1 125 ? -6.475  24.251 38.975 1.00 56.30  ? 173 TRP B CD1 1 
ATOM   2057 C CD2 . TRP B 1 125 ? -8.398  25.266 38.445 1.00 57.92  ? 173 TRP B CD2 1 
ATOM   2058 N NE1 . TRP B 1 125 ? -7.073  24.651 40.146 1.00 55.27  ? 173 TRP B NE1 1 
ATOM   2059 C CE2 . TRP B 1 125 ? -8.252  25.279 39.850 1.00 55.67  ? 173 TRP B CE2 1 
ATOM   2060 C CE3 . TRP B 1 125 ? -9.536  25.854 37.877 1.00 57.96  ? 173 TRP B CE3 1 
ATOM   2061 C CZ2 . TRP B 1 125 ? -9.203  25.855 40.697 1.00 59.35  ? 173 TRP B CZ2 1 
ATOM   2062 C CZ3 . TRP B 1 125 ? -10.483 26.428 38.719 1.00 59.18  ? 173 TRP B CZ3 1 
ATOM   2063 C CH2 . TRP B 1 125 ? -10.309 26.424 40.115 1.00 59.33  ? 173 TRP B CH2 1 
ATOM   2064 N N   . SER B 1 126 ? -4.027  24.870 35.727 1.00 55.15  ? 174 SER B N   1 
ATOM   2065 C CA  . SER B 1 126 ? -2.612  24.948 36.065 1.00 57.85  ? 174 SER B CA  1 
ATOM   2066 C C   . SER B 1 126 ? -1.941  26.237 35.604 1.00 57.17  ? 174 SER B C   1 
ATOM   2067 O O   . SER B 1 126 ? -0.991  26.697 36.227 1.00 57.43  ? 174 SER B O   1 
ATOM   2068 C CB  . SER B 1 126 ? -1.871  23.749 35.471 1.00 56.81  ? 174 SER B CB  1 
ATOM   2069 O OG  . SER B 1 126 ? -2.071  23.671 34.071 1.00 59.59  ? 174 SER B OG  1 
ATOM   2070 N N   . GLU B 1 127 ? -2.422  26.819 34.512 1.00 56.65  ? 175 GLU B N   1 
ATOM   2071 C CA  . GLU B 1 127 ? -1.821  28.051 34.013 1.00 56.25  ? 175 GLU B CA  1 
ATOM   2072 C C   . GLU B 1 127 ? -2.347  29.292 34.716 1.00 54.39  ? 175 GLU B C   1 
ATOM   2073 O O   . GLU B 1 127 ? -1.660  30.305 34.789 1.00 55.37  ? 175 GLU B O   1 
ATOM   2074 C CB  . GLU B 1 127 ? -2.049  28.198 32.510 1.00 57.93  ? 175 GLU B CB  1 
ATOM   2075 C CG  . GLU B 1 127 ? -1.549  29.526 31.965 1.00 63.65  ? 175 GLU B CG  1 
ATOM   2076 C CD  . GLU B 1 127 ? -1.736  29.661 30.468 1.00 68.81  ? 175 GLU B CD  1 
ATOM   2077 O OE1 . GLU B 1 127 ? -1.387  30.734 29.924 1.00 70.54  ? 175 GLU B OE1 1 
ATOM   2078 O OE2 . GLU B 1 127 ? -2.231  28.698 29.838 1.00 70.58  ? 175 GLU B OE2 1 
ATOM   2079 N N   . VAL B 1 128 ? -3.565  29.220 35.235 1.00 51.42  ? 176 VAL B N   1 
ATOM   2080 C CA  . VAL B 1 128 ? -4.138  30.374 35.913 1.00 52.15  ? 176 VAL B CA  1 
ATOM   2081 C C   . VAL B 1 128 ? -3.733  30.417 37.386 1.00 53.72  ? 176 VAL B C   1 
ATOM   2082 O O   . VAL B 1 128 ? -3.665  31.491 37.986 1.00 52.03  ? 176 VAL B O   1 
ATOM   2083 C CB  . VAL B 1 128 ? -5.685  30.378 35.806 1.00 50.10  ? 176 VAL B CB  1 
ATOM   2084 C CG1 . VAL B 1 128 ? -6.283  29.270 36.670 1.00 47.71  ? 176 VAL B CG1 1 
ATOM   2085 C CG2 . VAL B 1 128 ? -6.226  31.738 36.209 1.00 45.67  ? 176 VAL B CG2 1 
ATOM   2086 N N   . THR B 1 129 ? -3.467  29.246 37.960 1.00 56.74  ? 177 THR B N   1 
ATOM   2087 C CA  . THR B 1 129 ? -3.070  29.147 39.362 1.00 56.90  ? 177 THR B CA  1 
ATOM   2088 C C   . THR B 1 129 ? -1.557  29.235 39.509 1.00 58.81  ? 177 THR B C   1 
ATOM   2089 O O   . THR B 1 129 ? -1.039  29.235 40.625 1.00 62.29  ? 177 THR B O   1 
ATOM   2090 C CB  . THR B 1 129 ? -3.551  27.828 39.993 1.00 55.53  ? 177 THR B CB  1 
ATOM   2091 O OG1 . THR B 1 129 ? -2.940  26.721 39.317 1.00 53.16  ? 177 THR B OG1 1 
ATOM   2092 C CG2 . THR B 1 129 ? -5.063  27.720 39.895 1.00 55.38  ? 177 THR B CG2 1 
ATOM   2093 N N   . ASP B 1 130 ? -0.857  29.303 38.380 1.00 60.40  ? 178 ASP B N   1 
ATOM   2094 C CA  . ASP B 1 130 ? 0.595   29.419 38.369 1.00 63.75  ? 178 ASP B CA  1 
ATOM   2095 C C   . ASP B 1 130 ? 0.924   30.833 38.846 1.00 66.24  ? 178 ASP B C   1 
ATOM   2096 O O   . ASP B 1 130 ? 0.783   31.791 38.093 1.00 63.83  ? 178 ASP B O   1 
ATOM   2097 C CB  . ASP B 1 130 ? 1.125   29.216 36.950 1.00 66.02  ? 178 ASP B CB  1 
ATOM   2098 C CG  . ASP B 1 130 ? 2.637   29.326 36.867 1.00 70.26  ? 178 ASP B CG  1 
ATOM   2099 O OD1 . ASP B 1 130 ? 3.183   30.339 37.357 1.00 72.47  ? 178 ASP B OD1 1 
ATOM   2100 O OD2 . ASP B 1 130 ? 3.277   28.406 36.306 1.00 67.58  ? 178 ASP B OD2 1 
ATOM   2101 N N   . PRO B 1 131 ? 1.382   30.976 40.101 1.00 71.05  ? 179 PRO B N   1 
ATOM   2102 C CA  . PRO B 1 131 ? 1.720   32.291 40.661 1.00 72.94  ? 179 PRO B CA  1 
ATOM   2103 C C   . PRO B 1 131 ? 2.842   33.063 39.972 1.00 73.75  ? 179 PRO B C   1 
ATOM   2104 O O   . PRO B 1 131 ? 3.503   33.881 40.604 1.00 75.90  ? 179 PRO B O   1 
ATOM   2105 C CB  . PRO B 1 131 ? 2.046   31.968 42.117 1.00 72.23  ? 179 PRO B CB  1 
ATOM   2106 C CG  . PRO B 1 131 ? 2.644   30.592 42.018 1.00 73.92  ? 179 PRO B CG  1 
ATOM   2107 C CD  . PRO B 1 131 ? 1.703   29.900 41.059 1.00 71.29  ? 179 PRO B CD  1 
ATOM   2108 N N   . GLU B 1 132 ? 3.050   32.817 38.683 1.00 74.46  ? 180 GLU B N   1 
ATOM   2109 C CA  . GLU B 1 132 ? 4.097   33.513 37.947 1.00 76.72  ? 180 GLU B CA  1 
ATOM   2110 C C   . GLU B 1 132 ? 3.593   34.011 36.594 1.00 76.94  ? 180 GLU B C   1 
ATOM   2111 O O   . GLU B 1 132 ? 4.242   34.831 35.939 1.00 76.45  ? 180 GLU B O   1 
ATOM   2112 C CB  . GLU B 1 132 ? 5.300   32.588 37.744 1.00 80.14  ? 180 GLU B CB  1 
ATOM   2113 C CG  . GLU B 1 132 ? 6.509   33.261 37.103 1.00 84.15  ? 180 GLU B CG  1 
ATOM   2114 C CD  . GLU B 1 132 ? 7.716   32.340 37.028 1.00 88.57  ? 180 GLU B CD  1 
ATOM   2115 O OE1 . GLU B 1 132 ? 8.770   32.778 36.512 1.00 88.62  ? 180 GLU B OE1 1 
ATOM   2116 O OE2 . GLU B 1 132 ? 7.610   31.179 37.486 1.00 90.19  ? 180 GLU B OE2 1 
ATOM   2117 N N   . LYS B 1 133 ? 2.431   33.512 36.183 1.00 75.08  ? 181 LYS B N   1 
ATOM   2118 C CA  . LYS B 1 133 ? 1.835   33.901 34.910 1.00 71.76  ? 181 LYS B CA  1 
ATOM   2119 C C   . LYS B 1 133 ? 1.206   35.286 34.973 1.00 69.23  ? 181 LYS B C   1 
ATOM   2120 O O   . LYS B 1 133 ? 1.105   35.971 33.958 1.00 68.31  ? 181 LYS B O   1 
ATOM   2121 C CB  . LYS B 1 133 ? 0.789   32.871 34.486 1.00 74.36  ? 181 LYS B CB  1 
ATOM   2122 C CG  . LYS B 1 133 ? 1.372   31.626 33.837 1.00 74.60  ? 181 LYS B CG  1 
ATOM   2123 C CD  . LYS B 1 133 ? 2.008   31.968 32.498 1.00 76.42  ? 181 LYS B CD  1 
ATOM   2124 C CE  . LYS B 1 133 ? 2.547   30.726 31.808 1.00 79.22  ? 181 LYS B CE  1 
ATOM   2125 N NZ  . LYS B 1 133 ? 3.106   31.043 30.464 1.00 80.50  ? 181 LYS B NZ  1 
ATOM   2126 N N   . GLY B 1 134 ? 0.773   35.689 36.165 1.00 66.46  ? 182 GLY B N   1 
ATOM   2127 C CA  . GLY B 1 134 ? 0.187   37.008 36.331 1.00 65.54  ? 182 GLY B CA  1 
ATOM   2128 C C   . GLY B 1 134 ? -1.322  37.109 36.518 1.00 63.63  ? 182 GLY B C   1 
ATOM   2129 O O   . GLY B 1 134 ? -1.858  38.218 36.610 1.00 60.95  ? 182 GLY B O   1 
ATOM   2130 N N   . PHE B 1 135 ? -2.012  35.973 36.584 1.00 61.56  ? 183 PHE B N   1 
ATOM   2131 C CA  . PHE B 1 135 ? -3.465  35.989 36.746 1.00 60.59  ? 183 PHE B CA  1 
ATOM   2132 C C   . PHE B 1 135 ? -3.890  35.773 38.189 1.00 61.75  ? 183 PHE B C   1 
ATOM   2133 O O   . PHE B 1 135 ? -5.005  36.131 38.577 1.00 61.29  ? 183 PHE B O   1 
ATOM   2134 C CB  . PHE B 1 135 ? -4.116  34.907 35.884 1.00 56.00  ? 183 PHE B CB  1 
ATOM   2135 C CG  . PHE B 1 135 ? -3.737  34.969 34.436 1.00 54.70  ? 183 PHE B CG  1 
ATOM   2136 C CD1 . PHE B 1 135 ? -2.807  34.077 33.910 1.00 52.62  ? 183 PHE B CD1 1 
ATOM   2137 C CD2 . PHE B 1 135 ? -4.319  35.909 33.590 1.00 51.67  ? 183 PHE B CD2 1 
ATOM   2138 C CE1 . PHE B 1 135 ? -2.465  34.118 32.560 1.00 53.30  ? 183 PHE B CE1 1 
ATOM   2139 C CE2 . PHE B 1 135 ? -3.982  35.958 32.238 1.00 51.97  ? 183 PHE B CE2 1 
ATOM   2140 C CZ  . PHE B 1 135 ? -3.055  35.062 31.721 1.00 50.76  ? 183 PHE B CZ  1 
ATOM   2141 N N   . ILE B 1 136 ? -3.002  35.184 38.983 1.00 61.40  ? 184 ILE B N   1 
ATOM   2142 C CA  . ILE B 1 136 ? -3.316  34.898 40.376 1.00 60.17  ? 184 ILE B CA  1 
ATOM   2143 C C   . ILE B 1 136 ? -2.406  35.666 41.329 1.00 63.03  ? 184 ILE B C   1 
ATOM   2144 O O   . ILE B 1 136 ? -1.189  35.723 41.137 1.00 63.28  ? 184 ILE B O   1 
ATOM   2145 C CB  . ILE B 1 136 ? -3.223  33.374 40.636 1.00 55.19  ? 184 ILE B CB  1 
ATOM   2146 C CG1 . ILE B 1 136 ? -3.857  33.022 41.977 1.00 52.07  ? 184 ILE B CG1 1 
ATOM   2147 C CG2 . ILE B 1 136 ? -1.779  32.917 40.562 1.00 54.01  ? 184 ILE B CG2 1 
ATOM   2148 C CD1 . ILE B 1 136 ? -4.208  31.548 42.092 1.00 45.64  ? 184 ILE B CD1 1 
ATOM   2149 N N   . ASP B 1 137 ? -3.015  36.258 42.351 1.00 64.33  ? 185 ASP B N   1 
ATOM   2150 C CA  . ASP B 1 137 ? -2.300  37.050 43.346 1.00 66.32  ? 185 ASP B CA  1 
ATOM   2151 C C   . ASP B 1 137 ? -3.021  36.961 44.689 1.00 67.43  ? 185 ASP B C   1 
ATOM   2152 O O   . ASP B 1 137 ? -4.178  37.364 44.805 1.00 68.07  ? 185 ASP B O   1 
ATOM   2153 C CB  . ASP B 1 137 ? -2.224  38.506 42.867 1.00 68.18  ? 185 ASP B CB  1 
ATOM   2154 C CG  . ASP B 1 137 ? -2.019  39.495 44.000 1.00 70.13  ? 185 ASP B CG  1 
ATOM   2155 O OD1 . ASP B 1 137 ? -2.933  39.641 44.839 1.00 69.27  ? 185 ASP B OD1 1 
ATOM   2156 O OD2 . ASP B 1 137 ? -0.947  40.137 44.043 1.00 72.69  ? 185 ASP B OD2 1 
ATOM   2157 N N   . ASP B 1 138 ? -2.338  36.428 45.699 1.00 67.16  ? 186 ASP B N   1 
ATOM   2158 C CA  . ASP B 1 138 ? -2.930  36.288 47.028 1.00 66.68  ? 186 ASP B CA  1 
ATOM   2159 C C   . ASP B 1 138 ? -4.042  35.255 46.904 1.00 66.08  ? 186 ASP B C   1 
ATOM   2160 O O   . ASP B 1 138 ? -4.977  35.220 47.705 1.00 65.39  ? 186 ASP B O   1 
ATOM   2161 C CB  . ASP B 1 138 ? -3.514  37.631 47.490 1.00 70.34  ? 186 ASP B CB  1 
ATOM   2162 C CG  . ASP B 1 138 ? -3.730  37.699 48.996 1.00 72.98  ? 186 ASP B CG  1 
ATOM   2163 O OD1 . ASP B 1 138 ? -4.439  36.837 49.553 1.00 76.17  ? 186 ASP B OD1 1 
ATOM   2164 O OD2 . ASP B 1 138 ? -3.193  38.633 49.626 1.00 76.91  ? 186 ASP B OD2 1 
ATOM   2165 N N   . ASP B 1 139 ? -3.938  34.415 45.881 1.00 63.91  ? 187 ASP B N   1 
ATOM   2166 C CA  . ASP B 1 139 ? -4.939  33.387 45.642 1.00 61.32  ? 187 ASP B CA  1 
ATOM   2167 C C   . ASP B 1 139 ? -6.266  34.042 45.231 1.00 59.97  ? 187 ASP B C   1 
ATOM   2168 O O   . ASP B 1 139 ? -7.346  33.549 45.568 1.00 57.04  ? 187 ASP B O   1 
ATOM   2169 C CB  . ASP B 1 139 ? -5.140  32.545 46.907 1.00 58.80  ? 187 ASP B CB  1 
ATOM   2170 C CG  . ASP B 1 139 ? -5.521  31.109 46.599 1.00 61.51  ? 187 ASP B CG  1 
ATOM   2171 O OD1 . ASP B 1 139 ? -6.039  30.423 47.507 1.00 59.30  ? 187 ASP B OD1 1 
ATOM   2172 O OD2 . ASP B 1 139 ? -5.290  30.661 45.454 1.00 63.08  ? 187 ASP B OD2 1 
ATOM   2173 N N   . LYS B 1 140 ? -6.179  35.166 44.524 1.00 58.82  ? 188 LYS B N   1 
ATOM   2174 C CA  . LYS B 1 140 ? -7.372  35.869 44.051 1.00 59.89  ? 188 LYS B CA  1 
ATOM   2175 C C   . LYS B 1 140 ? -7.305  36.022 42.540 1.00 57.94  ? 188 LYS B C   1 
ATOM   2176 O O   . LYS B 1 140 ? -6.358  36.615 42.021 1.00 59.87  ? 188 LYS B O   1 
ATOM   2177 C CB  . LYS B 1 140 ? -7.482  37.274 44.650 1.00 61.28  ? 188 LYS B CB  1 
ATOM   2178 C CG  . LYS B 1 140 ? -7.561  37.362 46.159 1.00 68.31  ? 188 LYS B CG  1 
ATOM   2179 C CD  . LYS B 1 140 ? -7.824  38.809 46.581 1.00 69.97  ? 188 LYS B CD  1 
ATOM   2180 C CE  . LYS B 1 140 ? -7.581  39.027 48.070 1.00 73.17  ? 188 LYS B CE  1 
ATOM   2181 N NZ  . LYS B 1 140 ? -8.375  38.092 48.913 1.00 76.21  ? 188 LYS B NZ  1 
ATOM   2182 N N   . VAL B 1 141 ? -8.301  35.492 41.836 1.00 53.94  ? 189 VAL B N   1 
ATOM   2183 C CA  . VAL B 1 141 ? -8.340  35.619 40.384 1.00 48.65  ? 189 VAL B CA  1 
ATOM   2184 C C   . VAL B 1 141 ? -9.564  36.457 40.060 1.00 47.65  ? 189 VAL B C   1 
ATOM   2185 O O   . VAL B 1 141 ? -10.645 36.198 40.587 1.00 47.57  ? 189 VAL B O   1 
ATOM   2186 C CB  . VAL B 1 141 ? -8.451  34.246 39.690 1.00 49.83  ? 189 VAL B CB  1 
ATOM   2187 C CG1 . VAL B 1 141 ? -8.282  34.415 38.189 1.00 45.16  ? 189 VAL B CG1 1 
ATOM   2188 C CG2 . VAL B 1 141 ? -7.386  33.295 40.225 1.00 47.73  ? 189 VAL B CG2 1 
ATOM   2189 N N   . THR B 1 142 ? -9.391  37.476 39.226 1.00 45.23  ? 190 THR B N   1 
ATOM   2190 C CA  . THR B 1 142 ? -10.501 38.354 38.865 1.00 51.57  ? 190 THR B CA  1 
ATOM   2191 C C   . THR B 1 142 ? -11.028 38.150 37.447 1.00 48.67  ? 190 THR B C   1 
ATOM   2192 O O   . THR B 1 142 ? -10.281 38.216 36.468 1.00 47.48  ? 190 THR B O   1 
ATOM   2193 C CB  . THR B 1 142 ? -10.125 39.840 39.040 1.00 54.73  ? 190 THR B CB  1 
ATOM   2194 O OG1 . THR B 1 142 ? -10.060 40.151 40.437 1.00 61.94  ? 190 THR B OG1 1 
ATOM   2195 C CG2 . THR B 1 142 ? -11.170 40.738 38.386 1.00 57.54  ? 190 THR B CG2 1 
ATOM   2196 N N   . PHE B 1 143 ? -12.333 37.917 37.359 1.00 48.34  ? 191 PHE B N   1 
ATOM   2197 C CA  . PHE B 1 143 ? -13.004 37.689 36.085 1.00 46.24  ? 191 PHE B CA  1 
ATOM   2198 C C   . PHE B 1 143 ? -13.762 38.921 35.635 1.00 45.35  ? 191 PHE B C   1 
ATOM   2199 O O   . PHE B 1 143 ? -14.402 39.597 36.449 1.00 45.83  ? 191 PHE B O   1 
ATOM   2200 C CB  . PHE B 1 143 ? -13.977 36.525 36.211 1.00 45.16  ? 191 PHE B CB  1 
ATOM   2201 C CG  . PHE B 1 143 ? -13.333 35.251 36.646 1.00 46.36  ? 191 PHE B CG  1 
ATOM   2202 C CD1 . PHE B 1 143 ? -12.952 35.066 37.971 1.00 42.30  ? 191 PHE B CD1 1 
ATOM   2203 C CD2 . PHE B 1 143 ? -13.090 34.234 35.726 1.00 45.94  ? 191 PHE B CD2 1 
ATOM   2204 C CE1 . PHE B 1 143 ? -12.339 33.884 38.374 1.00 45.07  ? 191 PHE B CE1 1 
ATOM   2205 C CE2 . PHE B 1 143 ? -12.475 33.045 36.124 1.00 46.36  ? 191 PHE B CE2 1 
ATOM   2206 C CZ  . PHE B 1 143 ? -12.100 32.871 37.448 1.00 44.07  ? 191 PHE B CZ  1 
ATOM   2207 N N   . GLU B 1 144 ? -13.701 39.207 34.340 1.00 42.33  ? 192 GLU B N   1 
ATOM   2208 C CA  . GLU B 1 144 ? -14.391 40.372 33.799 1.00 43.67  ? 192 GLU B CA  1 
ATOM   2209 C C   . GLU B 1 144 ? -15.287 40.021 32.620 1.00 42.44  ? 192 GLU B C   1 
ATOM   2210 O O   . GLU B 1 144 ? -14.984 39.115 31.838 1.00 39.50  ? 192 GLU B O   1 
ATOM   2211 C CB  . GLU B 1 144 ? -13.388 41.437 33.348 1.00 41.37  ? 192 GLU B CB  1 
ATOM   2212 C CG  . GLU B 1 144 ? -14.053 42.732 32.917 1.00 42.75  ? 192 GLU B CG  1 
ATOM   2213 C CD  . GLU B 1 144 ? -13.101 43.678 32.214 1.00 50.55  ? 192 GLU B CD  1 
ATOM   2214 O OE1 . GLU B 1 144 ? -12.732 43.397 31.049 1.00 49.89  ? 192 GLU B OE1 1 
ATOM   2215 O OE2 . GLU B 1 144 ? -12.716 44.702 32.828 1.00 53.55  ? 192 GLU B OE2 1 
ATOM   2216 N N   . VAL B 1 145 ? -16.388 40.758 32.497 1.00 43.61  ? 193 VAL B N   1 
ATOM   2217 C CA  . VAL B 1 145 ? -17.334 40.553 31.407 1.00 40.66  ? 193 VAL B CA  1 
ATOM   2218 C C   . VAL B 1 145 ? -17.847 41.848 30.797 1.00 42.81  ? 193 VAL B C   1 
ATOM   2219 O O   . VAL B 1 145 ? -18.342 42.733 31.497 1.00 43.28  ? 193 VAL B O   1 
ATOM   2220 C CB  . VAL B 1 145 ? -18.585 39.755 31.859 1.00 37.44  ? 193 VAL B CB  1 
ATOM   2221 C CG1 . VAL B 1 145 ? -19.670 39.866 30.791 1.00 32.77  ? 193 VAL B CG1 1 
ATOM   2222 C CG2 . VAL B 1 145 ? -18.235 38.289 32.095 1.00 31.97  ? 193 VAL B CG2 1 
ATOM   2223 N N   . PHE B 1 146 ? -17.708 41.962 29.485 1.00 43.07  ? 194 PHE B N   1 
ATOM   2224 C CA  . PHE B 1 146 ? -18.254 43.104 28.772 1.00 41.78  ? 194 PHE B CA  1 
ATOM   2225 C C   . PHE B 1 146 ? -19.364 42.453 27.963 1.00 41.89  ? 194 PHE B C   1 
ATOM   2226 O O   . PHE B 1 146 ? -19.099 41.630 27.085 1.00 41.84  ? 194 PHE B O   1 
ATOM   2227 C CB  . PHE B 1 146 ? -17.227 43.741 27.836 1.00 42.58  ? 194 PHE B CB  1 
ATOM   2228 C CG  . PHE B 1 146 ? -17.819 44.755 26.889 1.00 47.26  ? 194 PHE B CG  1 
ATOM   2229 C CD1 . PHE B 1 146 ? -18.703 45.734 27.355 1.00 44.09  ? 194 PHE B CD1 1 
ATOM   2230 C CD2 . PHE B 1 146 ? -17.493 44.736 25.527 1.00 44.01  ? 194 PHE B CD2 1 
ATOM   2231 C CE1 . PHE B 1 146 ? -19.256 46.680 26.481 1.00 45.01  ? 194 PHE B CE1 1 
ATOM   2232 C CE2 . PHE B 1 146 ? -18.041 45.679 24.642 1.00 44.82  ? 194 PHE B CE2 1 
ATOM   2233 C CZ  . PHE B 1 146 ? -18.923 46.652 25.118 1.00 43.42  ? 194 PHE B CZ  1 
ATOM   2234 N N   . VAL B 1 147 ? -20.609 42.777 28.294 1.00 42.10  ? 195 VAL B N   1 
ATOM   2235 C CA  . VAL B 1 147 ? -21.749 42.204 27.588 1.00 39.52  ? 195 VAL B CA  1 
ATOM   2236 C C   . VAL B 1 147 ? -22.663 43.255 26.981 1.00 40.00  ? 195 VAL B C   1 
ATOM   2237 O O   . VAL B 1 147 ? -23.032 44.241 27.631 1.00 41.95  ? 195 VAL B O   1 
ATOM   2238 C CB  . VAL B 1 147 ? -22.590 41.299 28.513 1.00 38.40  ? 195 VAL B CB  1 
ATOM   2239 C CG1 . VAL B 1 147 ? -22.912 42.025 29.811 1.00 34.35  ? 195 VAL B CG1 1 
ATOM   2240 C CG2 . VAL B 1 147 ? -23.870 40.881 27.799 1.00 34.46  ? 195 VAL B CG2 1 
ATOM   2241 N N   . GLN B 1 148 ? -23.022 43.026 25.724 1.00 40.04  ? 196 GLN B N   1 
ATOM   2242 C CA  . GLN B 1 148 ? -23.908 43.911 24.977 1.00 36.71  ? 196 GLN B CA  1 
ATOM   2243 C C   . GLN B 1 148 ? -25.135 43.106 24.600 1.00 36.69  ? 196 GLN B C   1 
ATOM   2244 O O   . GLN B 1 148 ? -25.028 42.122 23.865 1.00 40.44  ? 196 GLN B O   1 
ATOM   2245 C CB  . GLN B 1 148 ? -23.225 44.394 23.701 1.00 34.58  ? 196 GLN B CB  1 
ATOM   2246 C CG  . GLN B 1 148 ? -22.026 45.286 23.916 1.00 36.81  ? 196 GLN B CG  1 
ATOM   2247 C CD  . GLN B 1 148 ? -21.223 45.478 22.646 1.00 42.96  ? 196 GLN B CD  1 
ATOM   2248 O OE1 . GLN B 1 148 ? -20.687 44.518 22.084 1.00 46.71  ? 196 GLN B OE1 1 
ATOM   2249 N NE2 . GLN B 1 148 ? -21.134 46.722 22.182 1.00 45.37  ? 196 GLN B NE2 1 
ATOM   2250 N N   . ALA B 1 149 ? -26.292 43.513 25.108 1.00 33.42  ? 197 ALA B N   1 
ATOM   2251 C CA  . ALA B 1 149 ? -27.545 42.827 24.807 1.00 35.91  ? 197 ALA B CA  1 
ATOM   2252 C C   . ALA B 1 149 ? -28.501 43.676 23.945 1.00 38.35  ? 197 ALA B C   1 
ATOM   2253 O O   . ALA B 1 149 ? -28.566 44.904 24.088 1.00 37.26  ? 197 ALA B O   1 
ATOM   2254 C CB  . ALA B 1 149 ? -28.231 42.421 26.107 1.00 31.62  ? 197 ALA B CB  1 
ATOM   2255 N N   . ASP B 1 150 ? -29.240 43.007 23.055 1.00 37.39  ? 198 ASP B N   1 
ATOM   2256 C CA  . ASP B 1 150 ? -30.194 43.669 22.169 1.00 33.09  ? 198 ASP B CA  1 
ATOM   2257 C C   . ASP B 1 150 ? -31.476 43.944 22.948 1.00 36.59  ? 198 ASP B C   1 
ATOM   2258 O O   . ASP B 1 150 ? -31.527 43.756 24.167 1.00 36.99  ? 198 ASP B O   1 
ATOM   2259 C CB  . ASP B 1 150 ? -30.495 42.784 20.946 1.00 31.01  ? 198 ASP B CB  1 
ATOM   2260 C CG  . ASP B 1 150 ? -31.475 41.655 21.253 1.00 32.42  ? 198 ASP B CG  1 
ATOM   2261 O OD1 . ASP B 1 150 ? -31.630 41.292 22.440 1.00 31.55  ? 198 ASP B OD1 1 
ATOM   2262 O OD2 . ASP B 1 150 ? -32.088 41.115 20.304 1.00 29.99  ? 198 ASP B OD2 1 
ATOM   2263 N N   . ALA B 1 151 ? -32.511 44.383 22.243 1.00 36.13  ? 199 ALA B N   1 
ATOM   2264 C CA  . ALA B 1 151 ? -33.786 44.683 22.879 1.00 36.39  ? 199 ALA B CA  1 
ATOM   2265 C C   . ALA B 1 151 ? -34.866 44.806 21.820 1.00 34.53  ? 199 ALA B C   1 
ATOM   2266 O O   . ALA B 1 151 ? -34.584 45.141 20.682 1.00 31.93  ? 199 ALA B O   1 
ATOM   2267 C CB  . ALA B 1 151 ? -33.680 45.984 23.664 1.00 34.38  ? 199 ALA B CB  1 
ATOM   2268 N N   . PRO B 1 152 ? -36.120 44.507 22.177 1.00 37.44  ? 200 PRO B N   1 
ATOM   2269 C CA  . PRO B 1 152 ? -37.194 44.618 21.191 1.00 35.14  ? 200 PRO B CA  1 
ATOM   2270 C C   . PRO B 1 152 ? -37.453 46.095 20.934 1.00 36.78  ? 200 PRO B C   1 
ATOM   2271 O O   . PRO B 1 152 ? -37.086 46.936 21.749 1.00 37.11  ? 200 PRO B O   1 
ATOM   2272 C CB  . PRO B 1 152 ? -38.361 43.932 21.883 1.00 35.00  ? 200 PRO B CB  1 
ATOM   2273 C CG  . PRO B 1 152 ? -38.127 44.249 23.313 1.00 36.54  ? 200 PRO B CG  1 
ATOM   2274 C CD  . PRO B 1 152 ? -36.638 44.039 23.475 1.00 36.20  ? 200 PRO B CD  1 
ATOM   2275 N N   . GLY B 1 153 ? -38.058 46.412 19.795 1.00 37.43  ? 201 GLY B N   1 
ATOM   2276 C CA  . GLY B 1 153 ? -38.350 47.800 19.482 1.00 35.04  ? 201 GLY B CA  1 
ATOM   2277 C C   . GLY B 1 153 ? -38.969 47.941 18.110 1.00 37.23  ? 201 GLY B C   1 
ATOM   2278 O O   . GLY B 1 153 ? -39.321 46.941 17.471 1.00 34.97  ? 201 GLY B O   1 
ATOM   2279 N N   . GLY B 1 154 ? -39.116 49.183 17.659 1.00 38.04  ? 202 GLY B N   1 
ATOM   2280 C CA  . GLY B 1 154 ? -39.681 49.434 16.344 1.00 38.40  ? 202 GLY B CA  1 
ATOM   2281 C C   . GLY B 1 154 ? -38.630 49.266 15.260 1.00 37.34  ? 202 GLY B C   1 
ATOM   2282 O O   . GLY B 1 154 ? -37.446 49.161 15.552 1.00 37.52  ? 202 GLY B O   1 
ATOM   2283 N N   . SER B 1 155 ? -39.052 49.244 14.001 1.00 40.64  ? 203 SER B N   1 
ATOM   2284 C CA  . SER B 1 155 ? -38.104 49.077 12.907 1.00 41.11  ? 203 SER B CA  1 
ATOM   2285 C C   . SER B 1 155 ? -37.422 50.388 12.506 1.00 44.39  ? 203 SER B C   1 
ATOM   2286 O O   . SER B 1 155 ? -36.503 50.383 11.691 1.00 46.99  ? 203 SER B O   1 
ATOM   2287 C CB  . SER B 1 155 ? -38.811 48.458 11.694 1.00 43.52  ? 203 SER B CB  1 
ATOM   2288 O OG  . SER B 1 155 ? -39.872 49.274 11.220 1.00 38.31  ? 203 SER B OG  1 
ATOM   2289 N N   . ARG B 1 156 ? -37.856 51.493 13.109 1.00 49.05  ? 204 ARG B N   1 
ATOM   2290 C CA  . ARG B 1 156 ? -37.339 52.836 12.822 1.00 56.07  ? 204 ARG B CA  1 
ATOM   2291 C C   . ARG B 1 156 ? -37.939 53.327 11.501 1.00 59.74  ? 204 ARG B C   1 
ATOM   2292 O O   . ARG B 1 156 ? -38.828 54.210 11.538 1.00 61.66  ? 204 ARG B O   1 
ATOM   2293 C CB  . ARG B 1 156 ? -35.806 52.853 12.706 1.00 60.30  ? 204 ARG B CB  1 
ATOM   2294 C CG  . ARG B 1 156 ? -35.015 52.582 13.986 1.00 65.07  ? 204 ARG B CG  1 
ATOM   2295 C CD  . ARG B 1 156 ? -33.540 52.950 13.760 1.00 70.87  ? 204 ARG B CD  1 
ATOM   2296 N NE  . ARG B 1 156 ? -32.602 51.884 14.115 1.00 73.08  ? 204 ARG B NE  1 
ATOM   2297 C CZ  . ARG B 1 156 ? -31.294 51.931 13.873 1.00 75.63  ? 204 ARG B CZ  1 
ATOM   2298 N NH1 . ARG B 1 156 ? -30.766 52.992 13.275 1.00 76.75  ? 204 ARG B NH1 1 
ATOM   2299 N NH2 . ARG B 1 156 ? -30.512 50.918 14.225 1.00 75.17  ? 204 ARG B NH2 1 
HETATM 2300 O O   . HOH C 2 .   ? 18.632  20.179 18.677 1.00 49.85  ? 210 HOH A O   1 
HETATM 2301 O O   . HOH C 2 .   ? -17.986 24.980 26.973 1.00 35.38  ? 211 HOH A O   1 
HETATM 2302 O O   . HOH C 2 .   ? 13.558  7.779  8.273  1.00 37.39  ? 212 HOH A O   1 
HETATM 2303 O O   . HOH C 2 .   ? -16.178 22.448 25.378 1.00 50.52  ? 213 HOH A O   1 
HETATM 2304 O O   . HOH C 2 .   ? -2.660  28.994 24.949 1.00 40.48  ? 214 HOH A O   1 
HETATM 2305 O O   . HOH C 2 .   ? -6.269  27.207 8.943  1.00 49.03  ? 215 HOH A O   1 
HETATM 2306 O O   . HOH C 2 .   ? -2.815  31.697 22.512 1.00 49.09  ? 216 HOH A O   1 
HETATM 2307 O O   . HOH C 2 .   ? -5.124  23.735 2.185  1.00 49.08  ? 217 HOH A O   1 
HETATM 2308 O O   . HOH C 2 .   ? -14.844 25.435 26.678 1.00 49.21  ? 218 HOH A O   1 
HETATM 2309 O O   . HOH C 2 .   ? -8.445  33.865 11.426 1.00 38.94  ? 219 HOH A O   1 
HETATM 2310 O O   . HOH C 2 .   ? -2.843  15.914 24.363 1.00 55.88  ? 220 HOH A O   1 
HETATM 2311 O O   . HOH C 2 .   ? 1.448   24.027 -0.056 1.00 38.95  ? 221 HOH A O   1 
HETATM 2312 O O   . HOH C 2 .   ? -0.124  30.164 10.288 1.00 39.88  ? 222 HOH A O   1 
HETATM 2313 O O   . HOH C 2 .   ? 16.045  25.059 18.672 1.00 55.42  ? 223 HOH A O   1 
HETATM 2314 O O   . HOH C 2 .   ? 6.584   9.095  7.570  1.00 40.79  ? 224 HOH A O   1 
HETATM 2315 O O   . HOH C 2 .   ? -14.343 32.900 20.646 1.00 36.62  ? 225 HOH A O   1 
HETATM 2316 O O   . HOH C 2 .   ? 1.710   11.160 22.937 1.00 60.98  ? 226 HOH A O   1 
HETATM 2317 O O   . HOH C 2 .   ? -12.353 18.364 22.705 1.00 41.18  ? 227 HOH A O   1 
HETATM 2318 O O   . HOH C 2 .   ? 17.918  19.790 15.356 1.00 59.28  ? 228 HOH A O   1 
HETATM 2319 O O   . HOH C 2 .   ? -26.635 23.870 29.888 1.00 58.89  ? 229 HOH A O   1 
HETATM 2320 O O   . HOH C 2 .   ? -7.676  37.828 11.887 1.00 72.52  ? 230 HOH A O   1 
HETATM 2321 O O   . HOH C 2 .   ? 0.204   12.769 27.482 1.00 52.23  ? 231 HOH A O   1 
HETATM 2322 O O   . HOH C 2 .   ? 21.103  11.818 11.883 1.00 51.95  ? 232 HOH A O   1 
HETATM 2323 O O   . HOH C 2 .   ? -7.309  8.875  10.511 1.00 59.81  ? 233 HOH A O   1 
HETATM 2324 O O   . HOH C 2 .   ? -5.882  34.516 11.936 1.00 52.84  ? 234 HOH A O   1 
HETATM 2325 O O   . HOH C 2 .   ? 8.661   10.651 20.878 1.00 56.22  ? 235 HOH A O   1 
HETATM 2326 O O   . HOH C 2 .   ? 2.061   23.703 23.730 1.00 43.24  ? 236 HOH A O   1 
HETATM 2327 O O   . HOH C 2 .   ? 2.595   17.207 0.175  1.00 54.85  ? 237 HOH A O   1 
HETATM 2328 O O   . HOH C 2 .   ? 5.263   15.684 24.276 1.00 47.26  ? 238 HOH A O   1 
HETATM 2329 O O   . HOH C 2 .   ? 8.648   11.178 -3.060 1.00 43.72  ? 239 HOH A O   1 
HETATM 2330 O O   . HOH C 2 .   ? 17.911  12.567 17.976 1.00 55.05  ? 240 HOH A O   1 
HETATM 2331 O O   . HOH C 2 .   ? 19.864  23.582 16.774 1.00 55.47  ? 241 HOH A O   1 
HETATM 2332 O O   . HOH C 2 .   ? -9.748  9.687  15.929 1.00 51.17  ? 242 HOH A O   1 
HETATM 2333 O O   . HOH C 2 .   ? -7.630  28.882 6.704  1.00 56.13  ? 243 HOH A O   1 
HETATM 2334 O O   . HOH C 2 .   ? -14.043 29.312 9.211  1.00 48.79  ? 244 HOH A O   1 
HETATM 2335 O O   . HOH C 2 .   ? -0.312  37.565 20.693 1.00 50.81  ? 245 HOH A O   1 
HETATM 2336 O O   . HOH C 2 .   ? -0.759  30.102 5.944  1.00 49.12  ? 246 HOH A O   1 
HETATM 2337 O O   . HOH C 2 .   ? -13.593 11.593 14.977 1.00 62.41  ? 247 HOH A O   1 
HETATM 2338 O O   . HOH C 2 .   ? 15.748  14.541 15.975 1.00 65.98  ? 248 HOH A O   1 
HETATM 2339 O O   . HOH C 2 .   ? -9.469  35.556 16.875 1.00 47.91  ? 249 HOH A O   1 
HETATM 2340 O O   . HOH C 2 .   ? -3.644  25.193 0.555  1.00 52.37  ? 250 HOH A O   1 
HETATM 2341 O O   . HOH C 2 .   ? 10.317  10.952 -5.245 1.00 42.03  ? 251 HOH A O   1 
HETATM 2342 O O   . HOH C 2 .   ? 2.848   25.757 25.283 1.00 63.68  ? 252 HOH A O   1 
HETATM 2343 O O   . HOH C 2 .   ? -15.269 30.334 20.393 1.00 53.96  ? 253 HOH A O   1 
HETATM 2344 O O   . HOH C 2 .   ? 4.214   21.758 23.823 1.00 41.33  ? 254 HOH A O   1 
HETATM 2345 O O   . HOH C 2 .   ? -3.052  25.811 27.294 1.00 53.27  ? 255 HOH A O   1 
HETATM 2346 O O   . HOH C 2 .   ? 6.477   9.418  22.049 1.00 70.37  ? 256 HOH A O   1 
HETATM 2347 O O   . HOH C 2 .   ? 13.221  7.175  0.459  1.00 56.66  ? 257 HOH A O   1 
HETATM 2348 O O   . HOH C 2 .   ? -20.788 23.179 23.841 1.00 59.57  ? 258 HOH A O   1 
HETATM 2349 O O   . HOH C 2 .   ? -6.822  11.824 7.069  1.00 53.51  ? 259 HOH A O   1 
HETATM 2350 O O   . HOH C 2 .   ? 24.573  26.197 13.215 1.00 66.71  ? 260 HOH A O   1 
HETATM 2351 O O   . HOH C 2 .   ? 3.629   -0.613 10.039 1.00 49.06  ? 261 HOH A O   1 
HETATM 2352 O O   . HOH C 2 .   ? -9.969  19.267 2.883  1.00 58.11  ? 262 HOH A O   1 
HETATM 2353 O O   . HOH C 2 .   ? -8.630  7.136  16.745 1.00 65.90  ? 263 HOH A O   1 
HETATM 2354 O O   . HOH C 2 .   ? -13.728 34.811 6.684  1.00 59.17  ? 264 HOH A O   1 
HETATM 2355 O O   . HOH C 2 .   ? 2.005   28.888 4.830  1.00 58.66  ? 265 HOH A O   1 
HETATM 2356 O O   . HOH D 2 .   ? -6.950  21.706 27.355 1.00 43.70  ? 210 HOH B O   1 
HETATM 2357 O O   . HOH D 2 .   ? -20.602 31.739 21.318 1.00 33.91  ? 211 HOH B O   1 
HETATM 2358 O O   . HOH D 2 .   ? -34.872 46.133 18.128 1.00 33.11  ? 212 HOH B O   1 
HETATM 2359 O O   . HOH D 2 .   ? -9.803  20.566 24.996 1.00 53.45  ? 213 HOH B O   1 
HETATM 2360 O O   . HOH D 2 .   ? -18.698 38.147 19.594 1.00 53.58  ? 214 HOH B O   1 
HETATM 2361 O O   . HOH D 2 .   ? -32.807 43.390 18.707 1.00 32.56  ? 215 HOH B O   1 
HETATM 2362 O O   . HOH D 2 .   ? -10.976 37.658 21.871 1.00 53.61  ? 216 HOH B O   1 
HETATM 2363 O O   . HOH D 2 .   ? -33.354 41.925 25.041 1.00 55.25  ? 217 HOH B O   1 
HETATM 2364 O O   . HOH D 2 .   ? -25.550 35.633 43.251 1.00 57.05  ? 218 HOH B O   1 
HETATM 2365 O O   . HOH D 2 .   ? -37.551 32.831 28.249 1.00 39.87  ? 219 HOH B O   1 
HETATM 2366 O O   . HOH D 2 .   ? -38.232 38.794 24.408 1.00 53.63  ? 220 HOH B O   1 
HETATM 2367 O O   . HOH D 2 .   ? -4.648  27.542 29.000 1.00 47.16  ? 221 HOH B O   1 
HETATM 2368 O O   . HOH D 2 .   ? -43.992 34.224 31.322 1.00 53.53  ? 222 HOH B O   1 
HETATM 2369 O O   . HOH D 2 .   ? -12.776 20.558 26.415 1.00 69.19  ? 223 HOH B O   1 
HETATM 2370 O O   . HOH D 2 .   ? -28.700 35.196 36.560 1.00 40.16  ? 224 HOH B O   1 
HETATM 2371 O O   . HOH D 2 .   ? -38.237 38.104 33.500 1.00 44.76  ? 225 HOH B O   1 
HETATM 2372 O O   . HOH D 2 .   ? -39.243 50.492 8.894  1.00 58.29  ? 226 HOH B O   1 
HETATM 2373 O O   . HOH D 2 .   ? -17.593 31.518 21.086 1.00 48.38  ? 227 HOH B O   1 
HETATM 2374 O O   . HOH D 2 .   ? -16.049 41.369 43.503 1.00 47.43  ? 228 HOH B O   1 
HETATM 2375 O O   . HOH D 2 .   ? -23.459 30.711 19.886 1.00 50.75  ? 229 HOH B O   1 
HETATM 2376 O O   . HOH D 2 .   ? -25.913 29.647 20.721 1.00 58.43  ? 230 HOH B O   1 
HETATM 2377 O O   . HOH D 2 .   ? -37.782 47.580 24.666 1.00 51.32  ? 231 HOH B O   1 
HETATM 2378 O O   . HOH D 2 .   ? -38.072 22.931 22.944 1.00 60.71  ? 232 HOH B O   1 
HETATM 2379 O O   . HOH D 2 .   ? -5.959  40.265 50.398 1.00 75.72  ? 233 HOH B O   1 
HETATM 2380 O O   . HOH D 2 .   ? -33.968 29.958 33.498 1.00 54.25  ? 234 HOH B O   1 
HETATM 2381 O O   . HOH D 2 .   ? -40.443 52.017 14.095 1.00 54.62  ? 235 HOH B O   1 
HETATM 2382 O O   . HOH D 2 .   ? -41.475 28.716 34.348 1.00 59.63  ? 236 HOH B O   1 
HETATM 2383 O O   . HOH D 2 .   ? -5.477  21.535 41.619 1.00 56.05  ? 237 HOH B O   1 
HETATM 2384 O O   . HOH D 2 .   ? -40.572 21.172 25.327 1.00 60.28  ? 238 HOH B O   1 
HETATM 2385 O O   . HOH D 2 .   ? -16.952 40.689 17.742 1.00 60.59  ? 239 HOH B O   1 
HETATM 2386 O O   . HOH D 2 .   ? -8.814  18.538 28.601 1.00 50.51  ? 240 HOH B O   1 
HETATM 2387 O O   . HOH D 2 .   ? -28.333 31.327 20.345 1.00 58.46  ? 241 HOH B O   1 
HETATM 2388 O O   . HOH D 2 .   ? -2.250  29.324 43.819 1.00 46.32  ? 242 HOH B O   1 
HETATM 2389 O O   . HOH D 2 .   ? -7.318  44.768 28.002 1.00 72.59  ? 243 HOH B O   1 
HETATM 2390 O O   . HOH D 2 .   ? -6.392  35.703 24.108 1.00 61.63  ? 244 HOH B O   1 
HETATM 2391 O O   . HOH D 2 .   ? -31.478 46.010 19.571 1.00 51.63  ? 245 HOH B O   1 
HETATM 2392 O O   . HOH D 2 .   ? -6.992  37.863 37.973 1.00 71.46  ? 246 HOH B O   1 
HETATM 2393 O O   . HOH D 2 .   ? -10.654 16.727 26.691 1.00 59.42  ? 247 HOH B O   1 
HETATM 2394 O O   . HOH D 2 .   ? -40.452 38.442 31.146 1.00 57.16  ? 248 HOH B O   1 
HETATM 2395 O O   . HOH D 2 .   ? -16.791 19.882 40.830 1.00 73.61  ? 249 HOH B O   1 
HETATM 2396 O O   . HOH D 2 .   ? -23.506 34.034 15.800 1.00 51.63  ? 250 HOH B O   1 
HETATM 2397 O O   . HOH D 2 .   ? -29.230 48.643 12.922 1.00 58.76  ? 251 HOH B O   1 
HETATM 2398 O O   . HOH D 2 .   ? -25.296 28.232 18.087 1.00 70.07  ? 252 HOH B O   1 
HETATM 2399 O O   . HOH D 2 .   ? -6.497  9.402  40.876 1.00 65.56  ? 253 HOH B O   1 
HETATM 2400 O O   . HOH D 2 .   ? -27.617 52.584 24.103 1.00 68.54  ? 254 HOH B O   1 
HETATM 2401 O O   . HOH D 2 .   ? -39.208 53.250 16.184 1.00 67.19  ? 255 HOH B O   1 
HETATM 2402 O O   . HOH D 2 .   ? -1.478  42.617 42.011 1.00 62.48  ? 256 HOH B O   1 
HETATM 2403 O O   . HOH D 2 .   ? -24.578 26.669 39.262 1.00 58.58  ? 257 HOH B O   1 
HETATM 2404 O O   . HOH D 2 .   ? -7.836  19.397 43.174 1.00 54.97  ? 258 HOH B O   1 
HETATM 2405 O O   . HOH D 2 .   ? -17.631 46.084 38.252 1.00 65.20  ? 259 HOH B O   1 
HETATM 2406 O O   . HOH D 2 .   ? 10.355  29.900 39.081 1.00 70.60  ? 260 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   49  ?   ?   ?   A . n 
A 1 2   SER 2   50  ?   ?   ?   A . n 
A 1 3   HIS 3   51  ?   ?   ?   A . n 
A 1 4   MET 4   52  ?   ?   ?   A . n 
A 1 5   ASN 5   53  ?   ?   ?   A . n 
A 1 6   THR 6   54  ?   ?   ?   A . n 
A 1 7   ALA 7   55  ?   ?   ?   A . n 
A 1 8   GLU 8   56  ?   ?   ?   A . n 
A 1 9   GLU 9   57  ?   ?   ?   A . n 
A 1 10  ASP 10  58  ?   ?   ?   A . n 
A 1 11  MET 11  59  ?   ?   ?   A . n 
A 1 12  GLU 12  60  ?   ?   ?   A . n 
A 1 13  ASP 13  61  ?   ?   ?   A . n 
A 1 14  ASP 14  62  ?   ?   ?   A . n 
A 1 15  THR 15  63  63  THR THR A . n 
A 1 16  SER 16  64  64  SER SER A . n 
A 1 17  TRP 17  65  65  TRP TRP A . n 
A 1 18  ARG 18  66  66  ARG ARG A . n 
A 1 19  SER 19  67  67  SER SER A . n 
A 1 20  GLU 20  68  68  GLU GLU A . n 
A 1 21  ALA 21  69  69  ALA ALA A . n 
A 1 22  THR 22  70  70  THR THR A . n 
A 1 23  PHE 23  71  71  PHE PHE A . n 
A 1 24  GLN 24  72  72  GLN GLN A . n 
A 1 25  PHE 25  73  73  PHE PHE A . n 
A 1 26  THR 26  74  74  THR THR A . n 
A 1 27  VAL 27  75  75  VAL VAL A . n 
A 1 28  GLU 28  76  76  GLU GLU A . n 
A 1 29  ARG 29  77  77  ARG ARG A . n 
A 1 30  PHE 30  78  78  PHE PHE A . n 
A 1 31  SER 31  79  79  SER SER A . n 
A 1 32  ARG 32  80  80  ARG ARG A . n 
A 1 33  LEU 33  81  81  LEU LEU A . n 
A 1 34  SER 34  82  82  SER SER A . n 
A 1 35  GLU 35  83  83  GLU GLU A . n 
A 1 36  SER 36  84  84  SER SER A . n 
A 1 37  VAL 37  85  85  VAL VAL A . n 
A 1 38  LEU 38  86  86  LEU LEU A . n 
A 1 39  SER 39  87  87  SER SER A . n 
A 1 40  PRO 40  88  88  PRO PRO A . n 
A 1 41  PRO 41  89  89  PRO PRO A . n 
A 1 42  CYS 42  90  90  CYS CYS A . n 
A 1 43  PHE 43  91  91  PHE PHE A . n 
A 1 44  VAL 44  92  92  VAL VAL A . n 
A 1 45  ARG 45  93  93  ARG ARG A . n 
A 1 46  ASN 46  94  94  ASN ASN A . n 
A 1 47  LEU 47  95  95  LEU LEU A . n 
A 1 48  PRO 48  96  96  PRO PRO A . n 
A 1 49  TRP 49  97  97  TRP TRP A . n 
A 1 50  LYS 50  98  98  LYS LYS A . n 
A 1 51  ILE 51  99  99  ILE ILE A . n 
A 1 52  MET 52  100 100 MET MET A . n 
A 1 53  VAL 53  101 101 VAL VAL A . n 
A 1 54  MET 54  102 102 MET MET A . n 
A 1 55  PRO 55  103 103 PRO PRO A . n 
A 1 56  ARG 56  104 104 ARG ARG A . n 
A 1 57  PHE 57  105 105 PHE PHE A . n 
A 1 58  TYR 58  106 ?   ?   ?   A . n 
A 1 59  PRO 59  107 ?   ?   ?   A . n 
A 1 60  ASP 60  108 ?   ?   ?   A . n 
A 1 61  ARG 61  109 ?   ?   ?   A . n 
A 1 62  PRO 62  110 ?   ?   ?   A . n 
A 1 63  HIS 63  111 111 HIS HIS A . n 
A 1 64  GLN 64  112 112 GLN GLN A . n 
A 1 65  LYS 65  113 113 LYS LYS A . n 
A 1 66  SER 66  114 114 SER SER A . n 
A 1 67  VAL 67  115 115 VAL VAL A . n 
A 1 68  GLY 68  116 116 GLY GLY A . n 
A 1 69  PHE 69  117 117 PHE PHE A . n 
A 1 70  PHE 70  118 118 PHE PHE A . n 
A 1 71  LEU 71  119 119 LEU LEU A . n 
A 1 72  GLN 72  120 120 GLN GLN A . n 
A 1 73  CYS 73  121 121 CYS CYS A . n 
A 1 74  ASN 74  122 122 ASN ASN A . n 
A 1 75  ALA 75  123 123 ALA ALA A . n 
A 1 76  GLU 76  124 124 GLU GLU A . n 
A 1 77  SER 77  125 125 SER SER A . n 
A 1 78  ASP 78  126 126 ASP ASP A . n 
A 1 79  SER 79  127 127 SER SER A . n 
A 1 80  THR 80  128 128 THR THR A . n 
A 1 81  SER 81  129 129 SER SER A . n 
A 1 82  TRP 82  130 130 TRP TRP A . n 
A 1 83  SER 83  131 131 SER SER A . n 
A 1 84  CYS 84  132 132 CYS ALA A . n 
A 1 85  HIS 85  133 133 HIS HIS A . n 
A 1 86  ALA 86  134 134 ALA ALA A . n 
A 1 87  GLN 87  135 135 GLN GLN A . n 
A 1 88  ALA 88  136 136 ALA ALA A . n 
A 1 89  VAL 89  137 137 VAL VAL A . n 
A 1 90  LEU 90  138 138 LEU LEU A . n 
A 1 91  LYS 91  139 139 LYS LYS A . n 
A 1 92  ILE 92  140 140 ILE ILE A . n 
A 1 93  ILE 93  141 141 ILE ILE A . n 
A 1 94  ASN 94  142 142 ASN ASN A . n 
A 1 95  TYR 95  143 143 TYR TYR A . n 
A 1 96  ARG 96  144 144 ARG ARG A . n 
A 1 97  ASP 97  145 145 ASP ASP A . n 
A 1 98  ASP 98  146 146 ASP ASP A . n 
A 1 99  GLU 99  147 147 GLU GLU A . n 
A 1 100 LYS 100 148 148 LYS LYS A . n 
A 1 101 SER 101 149 149 SER SER A . n 
A 1 102 PHE 102 150 150 PHE PHE A . n 
A 1 103 SER 103 151 151 SER SER A . n 
A 1 104 ARG 104 152 152 ARG ARG A . n 
A 1 105 ARG 105 153 153 ARG ARG A . n 
A 1 106 ILE 106 154 154 ILE ILE A . n 
A 1 107 SER 107 155 155 SER SER A . n 
A 1 108 HIS 108 156 156 HIS HIS A . n 
A 1 109 LEU 109 157 157 LEU LEU A . n 
A 1 110 PHE 110 158 158 PHE PHE A . n 
A 1 111 PHE 111 159 159 PHE PHE A . n 
A 1 112 HIS 112 160 160 HIS HIS A . n 
A 1 113 LYS 113 161 161 LYS LYS A . n 
A 1 114 GLU 114 162 162 GLU GLU A . n 
A 1 115 ASN 115 163 163 ASN ASN A . n 
A 1 116 ASP 116 164 164 ASP ASP A . n 
A 1 117 TRP 117 165 165 TRP TRP A . n 
A 1 118 GLY 118 166 166 GLY GLY A . n 
A 1 119 PHE 119 167 167 PHE PHE A . n 
A 1 120 SER 120 168 168 SER SER A . n 
A 1 121 ASN 121 169 169 ASN ASN A . n 
A 1 122 PHE 122 170 170 PHE PHE A . n 
A 1 123 MET 123 171 171 MET MET A . n 
A 1 124 ALA 124 172 172 ALA ALA A . n 
A 1 125 TRP 125 173 173 TRP TRP A . n 
A 1 126 SER 126 174 174 SER SER A . n 
A 1 127 GLU 127 175 175 GLU GLU A . n 
A 1 128 VAL 128 176 176 VAL VAL A . n 
A 1 129 THR 129 177 177 THR THR A . n 
A 1 130 ASP 130 178 178 ASP ASP A . n 
A 1 131 PRO 131 179 179 PRO PRO A . n 
A 1 132 GLU 132 180 180 GLU GLU A . n 
A 1 133 LYS 133 181 181 LYS LYS A . n 
A 1 134 GLY 134 182 182 GLY GLY A . n 
A 1 135 PHE 135 183 183 PHE PHE A . n 
A 1 136 ILE 136 184 184 ILE ILE A . n 
A 1 137 ASP 137 185 185 ASP ASP A . n 
A 1 138 ASP 138 186 186 ASP ASP A . n 
A 1 139 ASP 139 187 187 ASP ASP A . n 
A 1 140 LYS 140 188 188 LYS LYS A . n 
A 1 141 VAL 141 189 189 VAL VAL A . n 
A 1 142 THR 142 190 190 THR THR A . n 
A 1 143 PHE 143 191 191 PHE PHE A . n 
A 1 144 GLU 144 192 192 GLU GLU A . n 
A 1 145 VAL 145 193 193 VAL VAL A . n 
A 1 146 PHE 146 194 194 PHE PHE A . n 
A 1 147 VAL 147 195 195 VAL VAL A . n 
A 1 148 GLN 148 196 196 GLN GLN A . n 
A 1 149 ALA 149 197 197 ALA ALA A . n 
A 1 150 ASP 150 198 198 ASP ASP A . n 
A 1 151 ALA 151 199 199 ALA ALA A . n 
A 1 152 PRO 152 200 200 PRO PRO A . n 
A 1 153 GLY 153 201 201 GLY GLY A . n 
A 1 154 GLY 154 202 202 GLY GLY A . n 
A 1 155 SER 155 203 203 SER SER A . n 
A 1 156 ARG 156 204 204 ARG ARG A . n 
A 1 157 ALA 157 205 ?   ?   ?   A . n 
A 1 158 HIS 158 206 ?   ?   ?   A . n 
A 1 159 SER 159 207 ?   ?   ?   A . n 
A 1 160 SER 160 208 ?   ?   ?   A . n 
A 1 161 HIS 161 209 ?   ?   ?   A . n 
B 1 1   GLY 1   49  ?   ?   ?   B . n 
B 1 2   SER 2   50  ?   ?   ?   B . n 
B 1 3   HIS 3   51  ?   ?   ?   B . n 
B 1 4   MET 4   52  ?   ?   ?   B . n 
B 1 5   ASN 5   53  ?   ?   ?   B . n 
B 1 6   THR 6   54  ?   ?   ?   B . n 
B 1 7   ALA 7   55  ?   ?   ?   B . n 
B 1 8   GLU 8   56  ?   ?   ?   B . n 
B 1 9   GLU 9   57  ?   ?   ?   B . n 
B 1 10  ASP 10  58  ?   ?   ?   B . n 
B 1 11  MET 11  59  ?   ?   ?   B . n 
B 1 12  GLU 12  60  ?   ?   ?   B . n 
B 1 13  ASP 13  61  ?   ?   ?   B . n 
B 1 14  ASP 14  62  ?   ?   ?   B . n 
B 1 15  THR 15  63  63  THR THR B . n 
B 1 16  SER 16  64  64  SER SER B . n 
B 1 17  TRP 17  65  65  TRP TRP B . n 
B 1 18  ARG 18  66  66  ARG ARG B . n 
B 1 19  SER 19  67  67  SER SER B . n 
B 1 20  GLU 20  68  68  GLU GLU B . n 
B 1 21  ALA 21  69  69  ALA ALA B . n 
B 1 22  THR 22  70  70  THR THR B . n 
B 1 23  PHE 23  71  71  PHE PHE B . n 
B 1 24  GLN 24  72  72  GLN GLN B . n 
B 1 25  PHE 25  73  73  PHE PHE B . n 
B 1 26  THR 26  74  74  THR THR B . n 
B 1 27  VAL 27  75  75  VAL VAL B . n 
B 1 28  GLU 28  76  76  GLU GLU B . n 
B 1 29  ARG 29  77  77  ARG ARG B . n 
B 1 30  PHE 30  78  78  PHE PHE B . n 
B 1 31  SER 31  79  79  SER SER B . n 
B 1 32  ARG 32  80  80  ARG ARG B . n 
B 1 33  LEU 33  81  81  LEU LEU B . n 
B 1 34  SER 34  82  82  SER SER B . n 
B 1 35  GLU 35  83  83  GLU GLU B . n 
B 1 36  SER 36  84  84  SER SER B . n 
B 1 37  VAL 37  85  85  VAL VAL B . n 
B 1 38  LEU 38  86  86  LEU LEU B . n 
B 1 39  SER 39  87  87  SER SER B . n 
B 1 40  PRO 40  88  88  PRO PRO B . n 
B 1 41  PRO 41  89  89  PRO PRO B . n 
B 1 42  CYS 42  90  90  CYS CYS B . n 
B 1 43  PHE 43  91  91  PHE PHE B . n 
B 1 44  VAL 44  92  92  VAL VAL B . n 
B 1 45  ARG 45  93  93  ARG ARG B . n 
B 1 46  ASN 46  94  94  ASN ASN B . n 
B 1 47  LEU 47  95  95  LEU LEU B . n 
B 1 48  PRO 48  96  96  PRO PRO B . n 
B 1 49  TRP 49  97  97  TRP TRP B . n 
B 1 50  LYS 50  98  98  LYS LYS B . n 
B 1 51  ILE 51  99  99  ILE ILE B . n 
B 1 52  MET 52  100 100 MET MET B . n 
B 1 53  VAL 53  101 101 VAL VAL B . n 
B 1 54  MET 54  102 102 MET MET B . n 
B 1 55  PRO 55  103 103 PRO PRO B . n 
B 1 56  ARG 56  104 104 ARG ARG B . n 
B 1 57  PHE 57  105 105 PHE PHE B . n 
B 1 58  TYR 58  106 106 TYR TYR B . n 
B 1 59  PRO 59  107 107 PRO PRO B . n 
B 1 60  ASP 60  108 108 ASP ASP B . n 
B 1 61  ARG 61  109 109 ARG ARG B . n 
B 1 62  PRO 62  110 110 PRO PRO B . n 
B 1 63  HIS 63  111 111 HIS HIS B . n 
B 1 64  GLN 64  112 112 GLN GLN B . n 
B 1 65  LYS 65  113 113 LYS LYS B . n 
B 1 66  SER 66  114 114 SER SER B . n 
B 1 67  VAL 67  115 115 VAL VAL B . n 
B 1 68  GLY 68  116 116 GLY GLY B . n 
B 1 69  PHE 69  117 117 PHE PHE B . n 
B 1 70  PHE 70  118 118 PHE PHE B . n 
B 1 71  LEU 71  119 119 LEU LEU B . n 
B 1 72  GLN 72  120 120 GLN GLN B . n 
B 1 73  CYS 73  121 121 CYS CYS B . n 
B 1 74  ASN 74  122 122 ASN ASN B . n 
B 1 75  ALA 75  123 123 ALA ALA B . n 
B 1 76  GLU 76  124 124 GLU GLU B . n 
B 1 77  SER 77  125 125 SER SER B . n 
B 1 78  ASP 78  126 126 ASP ASP B . n 
B 1 79  SER 79  127 127 SER SER B . n 
B 1 80  THR 80  128 128 THR THR B . n 
B 1 81  SER 81  129 129 SER SER B . n 
B 1 82  TRP 82  130 130 TRP TRP B . n 
B 1 83  SER 83  131 131 SER SER B . n 
B 1 84  CYS 84  132 132 CYS ALA B . n 
B 1 85  HIS 85  133 133 HIS HIS B . n 
B 1 86  ALA 86  134 134 ALA ALA B . n 
B 1 87  GLN 87  135 135 GLN GLN B . n 
B 1 88  ALA 88  136 136 ALA ALA B . n 
B 1 89  VAL 89  137 137 VAL VAL B . n 
B 1 90  LEU 90  138 138 LEU LEU B . n 
B 1 91  LYS 91  139 139 LYS LYS B . n 
B 1 92  ILE 92  140 140 ILE ILE B . n 
B 1 93  ILE 93  141 141 ILE ILE B . n 
B 1 94  ASN 94  142 142 ASN ASN B . n 
B 1 95  TYR 95  143 143 TYR TYR B . n 
B 1 96  ARG 96  144 144 ARG ARG B . n 
B 1 97  ASP 97  145 145 ASP ASP B . n 
B 1 98  ASP 98  146 146 ASP ASP B . n 
B 1 99  GLU 99  147 147 GLU GLU B . n 
B 1 100 LYS 100 148 148 LYS LYS B . n 
B 1 101 SER 101 149 149 SER SER B . n 
B 1 102 PHE 102 150 150 PHE PHE B . n 
B 1 103 SER 103 151 151 SER SER B . n 
B 1 104 ARG 104 152 152 ARG ARG B . n 
B 1 105 ARG 105 153 153 ARG ARG B . n 
B 1 106 ILE 106 154 154 ILE ILE B . n 
B 1 107 SER 107 155 155 SER SER B . n 
B 1 108 HIS 108 156 156 HIS HIS B . n 
B 1 109 LEU 109 157 157 LEU LEU B . n 
B 1 110 PHE 110 158 158 PHE PHE B . n 
B 1 111 PHE 111 159 159 PHE PHE B . n 
B 1 112 HIS 112 160 160 HIS HIS B . n 
B 1 113 LYS 113 161 161 LYS LYS B . n 
B 1 114 GLU 114 162 162 GLU GLU B . n 
B 1 115 ASN 115 163 163 ASN ASN B . n 
B 1 116 ASP 116 164 164 ASP ASP B . n 
B 1 117 TRP 117 165 165 TRP TRP B . n 
B 1 118 GLY 118 166 166 GLY GLY B . n 
B 1 119 PHE 119 167 167 PHE PHE B . n 
B 1 120 SER 120 168 168 SER SER B . n 
B 1 121 ASN 121 169 169 ASN ASN B . n 
B 1 122 PHE 122 170 170 PHE PHE B . n 
B 1 123 MET 123 171 171 MET MET B . n 
B 1 124 ALA 124 172 172 ALA ALA B . n 
B 1 125 TRP 125 173 173 TRP TRP B . n 
B 1 126 SER 126 174 174 SER SER B . n 
B 1 127 GLU 127 175 175 GLU GLU B . n 
B 1 128 VAL 128 176 176 VAL VAL B . n 
B 1 129 THR 129 177 177 THR THR B . n 
B 1 130 ASP 130 178 178 ASP ASP B . n 
B 1 131 PRO 131 179 179 PRO PRO B . n 
B 1 132 GLU 132 180 180 GLU GLU B . n 
B 1 133 LYS 133 181 181 LYS LYS B . n 
B 1 134 GLY 134 182 182 GLY GLY B . n 
B 1 135 PHE 135 183 183 PHE PHE B . n 
B 1 136 ILE 136 184 184 ILE ILE B . n 
B 1 137 ASP 137 185 185 ASP ASP B . n 
B 1 138 ASP 138 186 186 ASP ASP B . n 
B 1 139 ASP 139 187 187 ASP ASP B . n 
B 1 140 LYS 140 188 188 LYS LYS B . n 
B 1 141 VAL 141 189 189 VAL VAL B . n 
B 1 142 THR 142 190 190 THR THR B . n 
B 1 143 PHE 143 191 191 PHE PHE B . n 
B 1 144 GLU 144 192 192 GLU GLU B . n 
B 1 145 VAL 145 193 193 VAL VAL B . n 
B 1 146 PHE 146 194 194 PHE PHE B . n 
B 1 147 VAL 147 195 195 VAL VAL B . n 
B 1 148 GLN 148 196 196 GLN GLN B . n 
B 1 149 ALA 149 197 197 ALA ALA B . n 
B 1 150 ASP 150 198 198 ASP ASP B . n 
B 1 151 ALA 151 199 199 ALA ALA B . n 
B 1 152 PRO 152 200 200 PRO PRO B . n 
B 1 153 GLY 153 201 201 GLY GLY B . n 
B 1 154 GLY 154 202 202 GLY GLY B . n 
B 1 155 SER 155 203 203 SER SER B . n 
B 1 156 ARG 156 204 204 ARG ARG B . n 
B 1 157 ALA 157 205 ?   ?   ?   B . n 
B 1 158 HIS 158 206 ?   ?   ?   B . n 
B 1 159 SER 159 207 ?   ?   ?   B . n 
B 1 160 SER 160 208 ?   ?   ?   B . n 
B 1 161 HIS 161 209 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1  210 2   HOH TIP A . 
C 2 HOH 2  211 5   HOH TIP A . 
C 2 HOH 3  212 7   HOH TIP A . 
C 2 HOH 4  213 10  HOH TIP A . 
C 2 HOH 5  214 11  HOH TIP A . 
C 2 HOH 6  215 13  HOH TIP A . 
C 2 HOH 7  216 14  HOH TIP A . 
C 2 HOH 8  217 16  HOH TIP A . 
C 2 HOH 9  218 18  HOH TIP A . 
C 2 HOH 10 219 20  HOH TIP A . 
C 2 HOH 11 220 21  HOH TIP A . 
C 2 HOH 12 221 22  HOH TIP A . 
C 2 HOH 13 222 25  HOH TIP A . 
C 2 HOH 14 223 26  HOH TIP A . 
C 2 HOH 15 224 27  HOH TIP A . 
C 2 HOH 16 225 28  HOH TIP A . 
C 2 HOH 17 226 30  HOH TIP A . 
C 2 HOH 18 227 31  HOH TIP A . 
C 2 HOH 19 228 34  HOH TIP A . 
C 2 HOH 20 229 35  HOH TIP A . 
C 2 HOH 21 230 37  HOH TIP A . 
C 2 HOH 22 231 38  HOH TIP A . 
C 2 HOH 23 232 39  HOH TIP A . 
C 2 HOH 24 233 41  HOH TIP A . 
C 2 HOH 25 234 42  HOH TIP A . 
C 2 HOH 26 235 43  HOH TIP A . 
C 2 HOH 27 236 46  HOH TIP A . 
C 2 HOH 28 237 50  HOH TIP A . 
C 2 HOH 29 238 51  HOH TIP A . 
C 2 HOH 30 239 52  HOH TIP A . 
C 2 HOH 31 240 53  HOH TIP A . 
C 2 HOH 32 241 54  HOH TIP A . 
C 2 HOH 33 242 56  HOH TIP A . 
C 2 HOH 34 243 57  HOH TIP A . 
C 2 HOH 35 244 60  HOH TIP A . 
C 2 HOH 36 245 65  HOH TIP A . 
C 2 HOH 37 246 68  HOH TIP A . 
C 2 HOH 38 247 71  HOH TIP A . 
C 2 HOH 39 248 72  HOH TIP A . 
C 2 HOH 40 249 74  HOH TIP A . 
C 2 HOH 41 250 75  HOH TIP A . 
C 2 HOH 42 251 77  HOH TIP A . 
C 2 HOH 43 252 79  HOH TIP A . 
C 2 HOH 44 253 80  HOH TIP A . 
C 2 HOH 45 254 83  HOH TIP A . 
C 2 HOH 46 255 84  HOH TIP A . 
C 2 HOH 47 256 85  HOH TIP A . 
C 2 HOH 48 257 87  HOH TIP A . 
C 2 HOH 49 258 91  HOH TIP A . 
C 2 HOH 50 259 92  HOH TIP A . 
C 2 HOH 51 260 93  HOH TIP A . 
C 2 HOH 52 261 96  HOH TIP A . 
C 2 HOH 53 262 99  HOH TIP A . 
C 2 HOH 54 263 100 HOH TIP A . 
C 2 HOH 55 264 104 HOH TIP A . 
C 2 HOH 56 265 105 HOH TIP A . 
D 2 HOH 1  210 1   HOH TIP B . 
D 2 HOH 2  211 3   HOH TIP B . 
D 2 HOH 3  212 4   HOH TIP B . 
D 2 HOH 4  213 6   HOH TIP B . 
D 2 HOH 5  214 8   HOH TIP B . 
D 2 HOH 6  215 9   HOH TIP B . 
D 2 HOH 7  216 12  HOH TIP B . 
D 2 HOH 8  217 15  HOH TIP B . 
D 2 HOH 9  218 17  HOH TIP B . 
D 2 HOH 10 219 19  HOH TIP B . 
D 2 HOH 11 220 23  HOH TIP B . 
D 2 HOH 12 221 24  HOH TIP B . 
D 2 HOH 13 222 29  HOH TIP B . 
D 2 HOH 14 223 32  HOH TIP B . 
D 2 HOH 15 224 33  HOH TIP B . 
D 2 HOH 16 225 36  HOH TIP B . 
D 2 HOH 17 226 40  HOH TIP B . 
D 2 HOH 18 227 44  HOH TIP B . 
D 2 HOH 19 228 45  HOH TIP B . 
D 2 HOH 20 229 47  HOH TIP B . 
D 2 HOH 21 230 48  HOH TIP B . 
D 2 HOH 22 231 49  HOH TIP B . 
D 2 HOH 23 232 55  HOH TIP B . 
D 2 HOH 24 233 58  HOH TIP B . 
D 2 HOH 25 234 59  HOH TIP B . 
D 2 HOH 26 235 61  HOH TIP B . 
D 2 HOH 27 236 62  HOH TIP B . 
D 2 HOH 28 237 63  HOH TIP B . 
D 2 HOH 29 238 64  HOH TIP B . 
D 2 HOH 30 239 66  HOH TIP B . 
D 2 HOH 31 240 67  HOH TIP B . 
D 2 HOH 32 241 69  HOH TIP B . 
D 2 HOH 33 242 70  HOH TIP B . 
D 2 HOH 34 243 73  HOH TIP B . 
D 2 HOH 35 244 76  HOH TIP B . 
D 2 HOH 36 245 78  HOH TIP B . 
D 2 HOH 37 246 81  HOH TIP B . 
D 2 HOH 38 247 82  HOH TIP B . 
D 2 HOH 39 248 86  HOH TIP B . 
D 2 HOH 40 249 88  HOH TIP B . 
D 2 HOH 41 250 89  HOH TIP B . 
D 2 HOH 42 251 90  HOH TIP B . 
D 2 HOH 43 252 94  HOH TIP B . 
D 2 HOH 44 253 95  HOH TIP B . 
D 2 HOH 45 254 97  HOH TIP B . 
D 2 HOH 46 255 98  HOH TIP B . 
D 2 HOH 47 256 101 HOH TIP B . 
D 2 HOH 48 257 102 HOH TIP B . 
D 2 HOH 49 258 103 HOH TIP B . 
D 2 HOH 50 259 106 HOH TIP B . 
D 2 HOH 51 260 107 HOH TIP B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C 
2 1 B,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-02-07 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-08-16 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
4 4 'Structure model' 'Source and taxonomy'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' entity_src_gen 
2 4 'Structure model' software       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
AMoRE     phasing          . ? 3 
CNS       refinement       . ? 4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   B 
_pdbx_validate_close_contact.auth_comp_id_1   ARG 
_pdbx_validate_close_contact.auth_seq_id_1    109 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   N 
_pdbx_validate_close_contact.auth_asym_id_2   B 
_pdbx_validate_close_contact.auth_comp_id_2   HIS 
_pdbx_validate_close_contact.auth_seq_id_2    111 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.14 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             N 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             GLN 
_pdbx_validate_rmsd_angle.auth_seq_id_1              112 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             GLN 
_pdbx_validate_rmsd_angle.auth_seq_id_2              112 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             C 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             GLN 
_pdbx_validate_rmsd_angle.auth_seq_id_3              112 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                91.80 
_pdbx_validate_rmsd_angle.angle_target_value         111.00 
_pdbx_validate_rmsd_angle.angle_deviation            -19.20 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.70 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 MET A 102 ? ? -177.43 149.01 
2  1 ARG A 144 ? ? -83.33  -77.80 
3  1 ASN A 169 ? ? -118.37 51.65  
4  1 PRO A 179 ? ? -54.74  -9.40  
5  1 SER B 79  ? ? -39.32  -33.61 
6  1 PHE B 105 ? ? -103.09 77.11  
7  1 ARG B 109 ? ? -146.66 -45.00 
8  1 PRO B 110 ? ? -56.55  24.97  
9  1 HIS B 111 ? ? -0.31   93.99  
10 1 GLU B 147 ? ? -63.87  5.91   
11 1 PRO B 179 ? ? -61.99  27.07  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A CYS 132 ? SG ? A CYS 84 SG 
2 1 Y 1 B CYS 132 ? SG ? B CYS 84 SG 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 49  ? A GLY 1   
2  1 Y 1 A SER 50  ? A SER 2   
3  1 Y 1 A HIS 51  ? A HIS 3   
4  1 Y 1 A MET 52  ? A MET 4   
5  1 Y 1 A ASN 53  ? A ASN 5   
6  1 Y 1 A THR 54  ? A THR 6   
7  1 Y 1 A ALA 55  ? A ALA 7   
8  1 Y 1 A GLU 56  ? A GLU 8   
9  1 Y 1 A GLU 57  ? A GLU 9   
10 1 Y 1 A ASP 58  ? A ASP 10  
11 1 Y 1 A MET 59  ? A MET 11  
12 1 Y 1 A GLU 60  ? A GLU 12  
13 1 Y 1 A ASP 61  ? A ASP 13  
14 1 Y 1 A ASP 62  ? A ASP 14  
15 1 Y 1 A TYR 106 ? A TYR 58  
16 1 Y 1 A PRO 107 ? A PRO 59  
17 1 Y 1 A ASP 108 ? A ASP 60  
18 1 Y 1 A ARG 109 ? A ARG 61  
19 1 Y 1 A PRO 110 ? A PRO 62  
20 1 Y 1 A ALA 205 ? A ALA 157 
21 1 Y 1 A HIS 206 ? A HIS 158 
22 1 Y 1 A SER 207 ? A SER 159 
23 1 Y 1 A SER 208 ? A SER 160 
24 1 Y 1 A HIS 209 ? A HIS 161 
25 1 Y 1 B GLY 49  ? B GLY 1   
26 1 Y 1 B SER 50  ? B SER 2   
27 1 Y 1 B HIS 51  ? B HIS 3   
28 1 Y 1 B MET 52  ? B MET 4   
29 1 Y 1 B ASN 53  ? B ASN 5   
30 1 Y 1 B THR 54  ? B THR 6   
31 1 Y 1 B ALA 55  ? B ALA 7   
32 1 Y 1 B GLU 56  ? B GLU 8   
33 1 Y 1 B GLU 57  ? B GLU 9   
34 1 Y 1 B ASP 58  ? B ASP 10  
35 1 Y 1 B MET 59  ? B MET 11  
36 1 Y 1 B GLU 60  ? B GLU 12  
37 1 Y 1 B ASP 61  ? B ASP 13  
38 1 Y 1 B ASP 62  ? B ASP 14  
39 1 Y 1 B ALA 205 ? B ALA 157 
40 1 Y 1 B HIS 206 ? B HIS 158 
41 1 Y 1 B SER 207 ? B SER 159 
42 1 Y 1 B SER 208 ? B SER 160 
43 1 Y 1 B HIS 209 ? B HIS 161 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#