data_2FL0
# 
_entry.id   2FL0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2FL0         
RCSB  RCSB036003   
WWPDB D_1000036003 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2FKZ 
_pdbx_database_related.details        
'Crystal structure of Reduced (All Ferrous) form of the Azotobacter vinelandii bacterioferritin' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2FL0 
_pdbx_database_status.recvd_initial_deposition_date   2006-01-05 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Swartz, L.'       1 
'Kunchinskas, K.'  2 
'Li, H.'           3 
'Poulos, T.L.'     4 
'Lanzilotta, W.N.' 5 
# 
_citation.id                        primary 
_citation.title                     
;Redox-Dependent Structural Changes in the Azotobacter vinelandii Bacterioferritin: New Insights into the Ferroxidase and Iron Transport Mechanism(,).
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            45 
_citation.page_first                4421 
_citation.page_last                 4428 
_citation.year                      2006 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16584178 
_citation.pdbx_database_id_DOI      10.1021/bi060146w 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Swartz, L.'       1 
primary 'Kuchinskas, M.'   2 
primary 'Li, H.'           3 
primary 'Poulos, T.L.'     4 
primary 'Lanzilotta, W.N.' 5 
# 
_cell.entry_id           2FL0 
_cell.length_a           124.480 
_cell.length_b           124.480 
_cell.length_c           285.112 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              72 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2FL0 
_symmetry.space_group_name_H-M             'H 3' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                146 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat Bacterioferritin                  17998.574 8   ? ? ? ? 
2 non-polymer syn 'FE (II) ION'                     55.845    18  ? ? ? ? 
3 non-polymer syn 'MAGNESIUM ION'                   24.305    13  ? ? ? ? 
4 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487   4   ? ? ? ? 
5 water       nat water                             18.015    387 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'BFR, Cytochrome b-557.5' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MKGDKIVIQHLNKILGNELIAINQYFLHARMYEDWGLEKLGKHEYHESIDEMKHADKLIKRILFLEGLPNLQELGKLLIG
EHTKEMLECDLKLEQAGLPDLKAAIAYCESVGDYASRELLEDILESEEDHIDWLETQLDLIDKIGLENYLQSQMD
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MKGDKIVIQHLNKILGNELIAINQYFLHARMYEDWGLEKLGKHEYHESIDEMKHADKLIKRILFLEGLPNLQELGKLLIG
EHTKEMLECDLKLEQAGLPDLKAAIAYCESVGDYASRELLEDILESEEDHIDWLETQLDLIDKIGLENYLQSQMD
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   GLY n 
1 4   ASP n 
1 5   LYS n 
1 6   ILE n 
1 7   VAL n 
1 8   ILE n 
1 9   GLN n 
1 10  HIS n 
1 11  LEU n 
1 12  ASN n 
1 13  LYS n 
1 14  ILE n 
1 15  LEU n 
1 16  GLY n 
1 17  ASN n 
1 18  GLU n 
1 19  LEU n 
1 20  ILE n 
1 21  ALA n 
1 22  ILE n 
1 23  ASN n 
1 24  GLN n 
1 25  TYR n 
1 26  PHE n 
1 27  LEU n 
1 28  HIS n 
1 29  ALA n 
1 30  ARG n 
1 31  MET n 
1 32  TYR n 
1 33  GLU n 
1 34  ASP n 
1 35  TRP n 
1 36  GLY n 
1 37  LEU n 
1 38  GLU n 
1 39  LYS n 
1 40  LEU n 
1 41  GLY n 
1 42  LYS n 
1 43  HIS n 
1 44  GLU n 
1 45  TYR n 
1 46  HIS n 
1 47  GLU n 
1 48  SER n 
1 49  ILE n 
1 50  ASP n 
1 51  GLU n 
1 52  MET n 
1 53  LYS n 
1 54  HIS n 
1 55  ALA n 
1 56  ASP n 
1 57  LYS n 
1 58  LEU n 
1 59  ILE n 
1 60  LYS n 
1 61  ARG n 
1 62  ILE n 
1 63  LEU n 
1 64  PHE n 
1 65  LEU n 
1 66  GLU n 
1 67  GLY n 
1 68  LEU n 
1 69  PRO n 
1 70  ASN n 
1 71  LEU n 
1 72  GLN n 
1 73  GLU n 
1 74  LEU n 
1 75  GLY n 
1 76  LYS n 
1 77  LEU n 
1 78  LEU n 
1 79  ILE n 
1 80  GLY n 
1 81  GLU n 
1 82  HIS n 
1 83  THR n 
1 84  LYS n 
1 85  GLU n 
1 86  MET n 
1 87  LEU n 
1 88  GLU n 
1 89  CYS n 
1 90  ASP n 
1 91  LEU n 
1 92  LYS n 
1 93  LEU n 
1 94  GLU n 
1 95  GLN n 
1 96  ALA n 
1 97  GLY n 
1 98  LEU n 
1 99  PRO n 
1 100 ASP n 
1 101 LEU n 
1 102 LYS n 
1 103 ALA n 
1 104 ALA n 
1 105 ILE n 
1 106 ALA n 
1 107 TYR n 
1 108 CYS n 
1 109 GLU n 
1 110 SER n 
1 111 VAL n 
1 112 GLY n 
1 113 ASP n 
1 114 TYR n 
1 115 ALA n 
1 116 SER n 
1 117 ARG n 
1 118 GLU n 
1 119 LEU n 
1 120 LEU n 
1 121 GLU n 
1 122 ASP n 
1 123 ILE n 
1 124 LEU n 
1 125 GLU n 
1 126 SER n 
1 127 GLU n 
1 128 GLU n 
1 129 ASP n 
1 130 HIS n 
1 131 ILE n 
1 132 ASP n 
1 133 TRP n 
1 134 LEU n 
1 135 GLU n 
1 136 THR n 
1 137 GLN n 
1 138 LEU n 
1 139 ASP n 
1 140 LEU n 
1 141 ILE n 
1 142 ASP n 
1 143 LYS n 
1 144 ILE n 
1 145 GLY n 
1 146 LEU n 
1 147 GLU n 
1 148 ASN n 
1 149 TYR n 
1 150 LEU n 
1 151 GLN n 
1 152 SER n 
1 153 GLN n 
1 154 MET n 
1 155 ASP n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Azotobacter vinelandii' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      354 
_entity_src_nat.genus                      Azotobacter 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    BFR_AZOVI 
_struct_ref.pdbx_db_accession          P22759 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MKGDKIVIQHLNKILGNELIAINQYFLHARMYEDWGLEKLGKHEYHESIDEMKHADKLIKRILFLEGLPNLQELGKLLIG
EHTKEMLECDLKLEQAGLPDLKAAIAYCESVGDYASRELLEDILESEEDHIDWLETQLDLIDKIGLENYLQSQMD
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2FL0 A 1 ? 155 ? P22759 1 ? 155 ? 1 155 
2 1 2FL0 B 1 ? 155 ? P22759 1 ? 155 ? 1 155 
3 1 2FL0 C 1 ? 155 ? P22759 1 ? 155 ? 1 155 
4 1 2FL0 D 1 ? 155 ? P22759 1 ? 155 ? 1 155 
5 1 2FL0 E 1 ? 155 ? P22759 1 ? 155 ? 1 155 
6 1 2FL0 F 1 ? 155 ? P22759 1 ? 155 ? 1 155 
7 1 2FL0 G 1 ? 155 ? P22759 1 ? 155 ? 1 155 
8 1 2FL0 H 1 ? 155 ? P22759 1 ? 155 ? 1 155 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                           ?    'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                          ?    'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ?    'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ?    'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                          ?    'C3 H7 N O2 S'     121.158 
FE2 non-polymer         . 'FE (II) ION'                     ?    'Fe 2'             55.845  
GLN 'L-peptide linking' y GLUTAMINE                         ?    'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ?    'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                           ?    'C2 H5 N O2'       75.067  
HEM non-polymer         . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 
HIS 'L-peptide linking' y HISTIDINE                         ?    'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                             ?    'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                        ?    'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                           ?    'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                            ?    'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                        ?    'C5 H11 N O2 S'    149.211 
MG  non-polymer         . 'MAGNESIUM ION'                   ?    'Mg 2'             24.305  
PHE 'L-peptide linking' y PHENYLALANINE                     ?    'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                           ?    'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                            ?    'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                         ?    'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ?    'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                          ?    'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                            ?    'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          2FL0 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.95 
_exptl_crystal.density_percent_sol   58.33 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    
'25% ethanol, 100 mM imidazole, 200 mM Magnesium chloride, Capillary batch method, pH 8.0, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           90 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2005-07-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Inverse bean method' 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.65 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.65 
# 
_reflns.entry_id                     2FL0 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   2 
_reflns.d_resolution_low             30.0 
_reflns.d_resolution_high            2.7 
_reflns.number_obs                   89043 
_reflns.number_all                   90412 
_reflns.percent_possible_obs         98.5 
_reflns.pdbx_Rmerge_I_obs            0.095 
_reflns.pdbx_Rsym_value              0.088 
_reflns.pdbx_netI_over_sigmaI        27.8 
_reflns.B_iso_Wilson_estimate        48.0 
_reflns.pdbx_redundancy              6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.70 
_reflns_shell.d_res_low              2.80 
_reflns_shell.percent_possible_all   98.8 
_reflns_shell.Rmerge_I_obs           0.289 
_reflns_shell.pdbx_Rsym_value        0.279 
_reflns_shell.meanI_over_sigI_obs    6.8 
_reflns_shell.pdbx_redundancy        4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      4444 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2FL0 
_refine.ls_number_reflns_obs                     89043 
_refine.ls_number_reflns_all                     90412 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               566218.42 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             27.57 
_refine.ls_d_res_high                            2.70 
_refine.ls_percent_reflns_obs                    98.6 
_refine.ls_R_factor_obs                          0.203 
_refine.ls_R_factor_all                          0.203 
_refine.ls_R_factor_R_work                       0.203 
_refine.ls_R_factor_R_free                       0.256 
_refine.ls_R_factor_R_free_error                 0.004 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  4405 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               36.5 
_refine.aniso_B[1][1]                            6.91 
_refine.aniso_B[2][2]                            6.91 
_refine.aniso_B[3][3]                            -13.82 
_refine.aniso_B[1][2]                            7.41 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.36552 
_refine.solvent_model_param_bsol                 36.9365 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
'Friedel pairs have been used in refinement. MG 1703 lies on a special position and has occupancy less than 1.0' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2FL0 
_refine_analyze.Luzzati_coordinate_error_obs    0.30 
_refine_analyze.Luzzati_sigma_a_obs             0.35 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.40 
_refine_analyze.Luzzati_sigma_a_free            0.44 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        10096 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         203 
_refine_hist.number_atoms_solvent             387 
_refine_hist.number_atoms_total               10686 
_refine_hist.d_res_high                       2.70 
_refine_hist.d_res_low                        27.57 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.008 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.1   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 17.8  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.84  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.70 
_refine_ls_shell.d_res_low                        2.87 
_refine_ls_shell.number_reflns_R_work             13265 
_refine_ls_shell.R_factor_R_work                  0.272 
_refine_ls_shell.percent_reflns_obs               93.0 
_refine_ls_shell.R_factor_R_free                  0.321 
_refine_ls_shell.R_factor_R_free_error            0.012 
_refine_ls_shell.percent_reflns_R_free            5.2 
_refine_ls_shell.number_reflns_R_free             4405 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param ? 'X-RAY DIFFRACTION' 
2 ion.param         ? 'X-RAY DIFFRACTION' 
3 water_rep.param   ? 'X-RAY DIFFRACTION' 
4 param.cns.heme    ? 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2FL0 
_struct.title                     'Oxidized (All ferric) form of the Azotobacter vinelandii bacterioferritin' 
_struct.pdbx_descriptor           Bacterioferritin 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2FL0 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
_struct_keywords.text            'Bacterioferritin, Ferritin, Diiron site, Iron transport, METAL BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 2 ? 
J  N N 2 ? 
K  N N 2 ? 
L  N N 3 ? 
M  N N 3 ? 
N  N N 3 ? 
O  N N 4 ? 
P  N N 2 ? 
Q  N N 2 ? 
R  N N 2 ? 
S  N N 3 ? 
T  N N 3 ? 
U  N N 2 ? 
V  N N 2 ? 
W  N N 3 ? 
X  N N 4 ? 
Y  N N 2 ? 
Z  N N 2 ? 
AA N N 3 ? 
BA N N 3 ? 
CA N N 3 ? 
DA N N 2 ? 
EA N N 2 ? 
FA N N 4 ? 
GA N N 2 ? 
HA N N 2 ? 
IA N N 3 ? 
JA N N 2 ? 
KA N N 2 ? 
LA N N 3 ? 
MA N N 3 ? 
NA N N 4 ? 
OA N N 2 ? 
PA N N 2 ? 
QA N N 3 ? 
RA N N 5 ? 
SA N N 5 ? 
TA N N 5 ? 
UA N N 5 ? 
VA N N 5 ? 
WA N N 5 ? 
XA N N 5 ? 
YA N N 5 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;The asymmetric unit represents 1/3 of the 24-mer protein sphere.  Each 24-mer is composed of 12 dimers that each contain a single b-type heme.
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 4   ? GLY A 36  ? ASP A 4   GLY A 36  1 ? 33 
HELX_P HELX_P2  2  LEU A 37  ? LEU A 65  ? LEU A 37  LEU A 65  1 ? 29 
HELX_P HELX_P3  3  HIS A 82  ? GLY A 97  ? HIS A 82  GLY A 97  1 ? 16 
HELX_P HELX_P4  4  GLY A 97  ? VAL A 111 ? GLY A 97  VAL A 111 1 ? 15 
HELX_P HELX_P5  5  ASP A 113 ? GLY A 145 ? ASP A 113 GLY A 145 1 ? 33 
HELX_P HELX_P6  6  GLY A 145 ? MET A 154 ? GLY A 145 MET A 154 1 ? 10 
HELX_P HELX_P7  7  ASP B 4   ? TRP B 35  ? ASP B 4   TRP B 35  1 ? 32 
HELX_P HELX_P8  8  LEU B 37  ? LEU B 65  ? LEU B 37  LEU B 65  1 ? 29 
HELX_P HELX_P9  9  HIS B 82  ? VAL B 111 ? HIS B 82  VAL B 111 1 ? 30 
HELX_P HELX_P10 10 ASP B 113 ? GLY B 145 ? ASP B 113 GLY B 145 1 ? 33 
HELX_P HELX_P11 11 GLY B 145 ? MET B 154 ? GLY B 145 MET B 154 1 ? 10 
HELX_P HELX_P12 12 ASP C 4   ? GLY C 36  ? ASP C 4   GLY C 36  1 ? 33 
HELX_P HELX_P13 13 LEU C 37  ? LEU C 65  ? LEU C 37  LEU C 65  1 ? 29 
HELX_P HELX_P14 14 HIS C 82  ? GLY C 112 ? HIS C 82  GLY C 112 1 ? 31 
HELX_P HELX_P15 15 ASP C 113 ? GLY C 145 ? ASP C 113 GLY C 145 1 ? 33 
HELX_P HELX_P16 16 GLY C 145 ? GLN C 153 ? GLY C 145 GLN C 153 1 ? 9  
HELX_P HELX_P17 17 ASP D 4   ? TRP D 35  ? ASP D 4   TRP D 35  1 ? 32 
HELX_P HELX_P18 18 LEU D 37  ? LEU D 65  ? LEU D 37  LEU D 65  1 ? 29 
HELX_P HELX_P19 19 HIS D 82  ? VAL D 111 ? HIS D 82  VAL D 111 1 ? 30 
HELX_P HELX_P20 20 ASP D 113 ? GLY D 145 ? ASP D 113 GLY D 145 1 ? 33 
HELX_P HELX_P21 21 GLY D 145 ? GLN D 153 ? GLY D 145 GLN D 153 1 ? 9  
HELX_P HELX_P22 22 ASP E 4   ? TRP E 35  ? ASP E 4   TRP E 35  1 ? 32 
HELX_P HELX_P23 23 LEU E 37  ? LEU E 65  ? LEU E 37  LEU E 65  1 ? 29 
HELX_P HELX_P24 24 HIS E 82  ? ALA E 96  ? HIS E 82  ALA E 96  1 ? 15 
HELX_P HELX_P25 25 GLY E 97  ? VAL E 111 ? GLY E 97  VAL E 111 1 ? 15 
HELX_P HELX_P26 26 ASP E 113 ? GLY E 145 ? ASP E 113 GLY E 145 1 ? 33 
HELX_P HELX_P27 27 GLY E 145 ? ASP E 155 ? GLY E 145 ASP E 155 1 ? 11 
HELX_P HELX_P28 28 ASP F 4   ? GLY F 36  ? ASP F 4   GLY F 36  1 ? 33 
HELX_P HELX_P29 29 LEU F 37  ? LEU F 65  ? LEU F 37  LEU F 65  1 ? 29 
HELX_P HELX_P30 30 HIS F 82  ? VAL F 111 ? HIS F 82  VAL F 111 1 ? 30 
HELX_P HELX_P31 31 ASP F 113 ? GLY F 145 ? ASP F 113 GLY F 145 1 ? 33 
HELX_P HELX_P32 32 GLY F 145 ? SER F 152 ? GLY F 145 SER F 152 1 ? 8  
HELX_P HELX_P33 33 ASP G 4   ? GLY G 36  ? ASP G 4   GLY G 36  1 ? 33 
HELX_P HELX_P34 34 LEU G 37  ? LEU G 65  ? LEU G 37  LEU G 65  1 ? 29 
HELX_P HELX_P35 35 HIS G 82  ? GLY G 112 ? HIS G 82  GLY G 112 1 ? 31 
HELX_P HELX_P36 36 ASP G 113 ? GLY G 145 ? ASP G 113 GLY G 145 1 ? 33 
HELX_P HELX_P37 37 GLY G 145 ? GLN G 153 ? GLY G 145 GLN G 153 1 ? 9  
HELX_P HELX_P38 38 ASP H 4   ? TRP H 35  ? ASP H 4   TRP H 35  1 ? 32 
HELX_P HELX_P39 39 LEU H 37  ? LEU H 65  ? LEU H 37  LEU H 65  1 ? 29 
HELX_P HELX_P40 40 HIS H 82  ? VAL H 111 ? HIS H 82  VAL H 111 1 ? 30 
HELX_P HELX_P41 41 ASP H 113 ? GLY H 145 ? ASP H 113 GLY H 145 1 ? 33 
HELX_P HELX_P42 42 GLY H 145 ? GLN H 153 ? GLY H 145 GLN H 153 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? I  FE2 . FE ? ? ? 1_555 A  GLU 18  OE1 ? ? A FE2 1601 A GLU 18   1_555 ? ? ? ? ? ? ? 2.195 ? 
metalc2   metalc ? ? I  FE2 . FE ? ? ? 1_555 A  GLU 51  OE1 ? ? A FE2 1601 A GLU 51   1_555 ? ? ? ? ? ? ? 1.988 ? 
metalc3   metalc ? ? I  FE2 . FE ? ? ? 1_555 A  HIS 54  ND1 ? ? A FE2 1601 A HIS 54   1_555 ? ? ? ? ? ? ? 2.008 ? 
metalc4   metalc ? ? I  FE2 . FE ? ? ? 1_555 A  GLU 127 OE2 ? ? A FE2 1601 A GLU 127  1_555 ? ? ? ? ? ? ? 1.781 ? 
metalc5   metalc ? ? J  FE2 . FE ? ? ? 1_555 A  GLU 51  OE2 ? ? A FE2 1602 A GLU 51   1_555 ? ? ? ? ? ? ? 1.843 ? 
metalc6   metalc ? ? J  FE2 . FE ? ? ? 1_555 A  GLU 127 OE1 ? ? A FE2 1602 A GLU 127  1_555 ? ? ? ? ? ? ? 1.906 ? 
metalc7   metalc ? ? J  FE2 . FE ? ? ? 1_555 A  GLU 94  OE2 ? ? A FE2 1602 A GLU 94   1_555 ? ? ? ? ? ? ? 1.977 ? 
metalc8   metalc ? ? P  FE2 . FE ? ? ? 1_555 B  GLU 51  OE1 ? ? B FE2 1605 B GLU 51   1_555 ? ? ? ? ? ? ? 1.788 ? 
metalc9   metalc ? ? P  FE2 . FE ? ? ? 1_555 B  GLU 94  OE2 ? ? B FE2 1605 B GLU 94   1_555 ? ? ? ? ? ? ? 1.897 ? 
metalc10  metalc ? ? P  FE2 . FE ? ? ? 1_555 B  GLU 127 OE1 ? ? B FE2 1605 B GLU 127  1_555 ? ? ? ? ? ? ? 1.976 ? 
metalc11  metalc ? ? P  FE2 . FE ? ? ? 1_555 B  HIS 130 ND1 ? ? B FE2 1605 B HIS 130  1_555 ? ? ? ? ? ? ? 2.075 ? 
metalc12  metalc ? ? Q  FE2 . FE ? ? ? 1_555 B  GLU 127 OE2 ? ? B FE2 1606 B GLU 127  1_555 ? ? ? ? ? ? ? 1.861 ? 
metalc13  metalc ? ? Q  FE2 . FE ? ? ? 1_555 B  GLU 18  OE1 ? ? B FE2 1606 B GLU 18   1_555 ? ? ? ? ? ? ? 2.171 ? 
metalc14  metalc ? ? Q  FE2 . FE ? ? ? 1_555 B  HIS 54  ND1 ? ? B FE2 1606 B HIS 54   1_555 ? ? ? ? ? ? ? 2.165 ? 
metalc15  metalc ? ? Q  FE2 . FE ? ? ? 1_555 B  GLU 51  OE2 ? ? B FE2 1606 B GLU 51   1_555 ? ? ? ? ? ? ? 2.002 ? 
metalc16  metalc ? ? U  FE2 . FE ? ? ? 1_555 C  GLU 18  OE1 ? ? C FE2 1608 C GLU 18   1_555 ? ? ? ? ? ? ? 2.175 ? 
metalc17  metalc ? ? U  FE2 . FE ? ? ? 1_555 C  GLU 51  OE1 ? ? C FE2 1608 C GLU 51   1_555 ? ? ? ? ? ? ? 2.032 ? 
metalc18  metalc ? ? U  FE2 . FE ? ? ? 1_555 C  GLU 127 OE2 ? ? C FE2 1608 C GLU 127  1_555 ? ? ? ? ? ? ? 1.903 ? 
metalc19  metalc ? ? V  FE2 . FE ? ? ? 1_555 C  GLU 94  OE1 ? ? C FE2 1610 C GLU 94   1_555 ? ? ? ? ? ? ? 2.177 ? 
metalc20  metalc ? ? V  FE2 . FE ? ? ? 1_555 C  GLU 51  OE2 ? ? C FE2 1610 C GLU 51   1_555 ? ? ? ? ? ? ? 1.968 ? 
metalc21  metalc ? ? V  FE2 . FE ? ? ? 1_555 C  GLU 127 OE1 ? ? C FE2 1610 C GLU 127  1_555 ? ? ? ? ? ? ? 1.945 ? 
metalc22  metalc ? ? Y  FE2 . FE ? ? ? 1_555 D  GLU 51  OE1 ? ? D FE2 1611 D GLU 51   1_555 ? ? ? ? ? ? ? 2.041 ? 
metalc23  metalc ? ? Y  FE2 . FE ? ? ? 1_555 D  HIS 54  ND1 ? ? D FE2 1611 D HIS 54   1_555 ? ? ? ? ? ? ? 2.145 ? 
metalc24  metalc ? ? Y  FE2 . FE ? ? ? 1_555 D  GLU 127 OE1 ? ? D FE2 1611 D GLU 127  1_555 ? ? ? ? ? ? ? 1.640 ? 
metalc25  metalc ? ? Z  FE2 . FE ? ? ? 1_555 D  GLU 51  OE2 ? ? D FE2 1612 D GLU 51   1_555 ? ? ? ? ? ? ? 2.046 ? 
metalc26  metalc ? ? Z  FE2 . FE ? ? ? 1_555 D  GLU 94  OE1 ? ? D FE2 1612 D GLU 94   1_555 ? ? ? ? ? ? ? 1.992 ? 
metalc27  metalc ? ? Z  FE2 . FE ? ? ? 1_555 D  GLU 127 OE2 ? ? D FE2 1612 D GLU 127  1_555 ? ? ? ? ? ? ? 1.967 ? 
metalc28  metalc ? ? DA FE2 . FE ? ? ? 1_555 E  GLU 51  OE1 ? ? E FE2 1613 E GLU 51   1_555 ? ? ? ? ? ? ? 2.042 ? 
metalc29  metalc ? ? DA FE2 . FE ? ? ? 1_555 E  GLU 18  OE2 ? ? E FE2 1613 E GLU 18   1_555 ? ? ? ? ? ? ? 2.087 ? 
metalc30  metalc ? ? DA FE2 . FE ? ? ? 1_555 E  GLU 127 OE2 ? ? E FE2 1613 E GLU 127  1_555 ? ? ? ? ? ? ? 1.864 ? 
metalc31  metalc ? ? DA FE2 . FE ? ? ? 1_555 E  HIS 54  ND1 ? ? E FE2 1613 E HIS 54   1_555 ? ? ? ? ? ? ? 2.121 ? 
metalc32  metalc ? ? EA FE2 . FE ? ? ? 1_555 E  GLU 51  OE2 ? ? E FE2 1614 E GLU 51   1_555 ? ? ? ? ? ? ? 1.894 ? 
metalc33  metalc ? ? EA FE2 . FE ? ? ? 1_555 E  GLU 94  OE1 ? ? E FE2 1614 E GLU 94   1_555 ? ? ? ? ? ? ? 1.804 ? 
metalc34  metalc ? ? EA FE2 . FE ? ? ? 1_555 E  GLU 127 OE1 ? ? E FE2 1614 E GLU 127  1_555 ? ? ? ? ? ? ? 2.092 ? 
metalc35  metalc ? ? GA FE2 . FE ? ? ? 1_555 F  GLU 18  OE2 ? ? F FE2 1616 F GLU 18   1_555 ? ? ? ? ? ? ? 2.111 ? 
metalc36  metalc ? ? GA FE2 . FE ? ? ? 1_555 F  GLU 51  OE1 ? ? F FE2 1616 F GLU 51   1_555 ? ? ? ? ? ? ? 2.087 ? 
metalc37  metalc ? ? GA FE2 . FE ? ? ? 1_555 F  HIS 54  ND1 ? ? F FE2 1616 F HIS 54   1_555 ? ? ? ? ? ? ? 2.040 ? 
metalc38  metalc ? ? GA FE2 . FE ? ? ? 1_555 F  GLU 127 OE2 ? ? F FE2 1616 F GLU 127  1_555 ? ? ? ? ? ? ? 2.047 ? 
metalc39  metalc ? ? HA FE2 . FE ? ? ? 1_555 F  GLU 51  OE2 ? ? F FE2 1617 F GLU 51   1_555 ? ? ? ? ? ? ? 1.936 ? 
metalc40  metalc ? ? HA FE2 . FE ? ? ? 1_555 F  GLU 94  OE2 ? ? F FE2 1617 F GLU 94   1_555 ? ? ? ? ? ? ? 2.004 ? 
metalc41  metalc ? ? HA FE2 . FE ? ? ? 1_555 F  GLU 127 OE1 ? ? F FE2 1617 F GLU 127  1_555 ? ? ? ? ? ? ? 2.170 ? 
metalc42  metalc ? ? JA FE2 . FE ? ? ? 1_555 G  GLU 51  OE1 ? ? G FE2 1618 G GLU 51   1_555 ? ? ? ? ? ? ? 1.981 ? 
metalc43  metalc ? ? JA FE2 . FE ? ? ? 1_555 G  HIS 54  ND1 ? ? G FE2 1618 G HIS 54   1_555 ? ? ? ? ? ? ? 2.197 ? 
metalc44  metalc ? ? JA FE2 . FE ? ? ? 1_555 G  GLU 127 OE2 ? ? G FE2 1618 G GLU 127  1_555 ? ? ? ? ? ? ? 1.809 ? 
metalc45  metalc ? ? KA FE2 . FE ? ? ? 1_555 G  GLU 51  OE2 ? ? G FE2 1619 G GLU 51   1_555 ? ? ? ? ? ? ? 1.887 ? 
metalc46  metalc ? ? KA FE2 . FE ? ? ? 1_555 G  GLU 94  OE1 ? ? G FE2 1619 G GLU 94   1_555 ? ? ? ? ? ? ? 2.165 ? 
metalc47  metalc ? ? KA FE2 . FE ? ? ? 1_555 G  GLU 127 OE1 ? ? G FE2 1619 G GLU 127  1_555 ? ? ? ? ? ? ? 1.994 ? 
metalc48  metalc ? ? OA FE2 . FE ? ? ? 1_555 H  GLU 51  OE1 ? ? H FE2 1621 H GLU 51   1_555 ? ? ? ? ? ? ? 1.929 ? 
metalc49  metalc ? ? OA FE2 . FE ? ? ? 1_555 H  GLU 18  OE1 ? ? H FE2 1621 H GLU 18   1_555 ? ? ? ? ? ? ? 2.124 ? 
metalc50  metalc ? ? OA FE2 . FE ? ? ? 1_555 H  GLU 127 OE1 ? ? H FE2 1621 H GLU 127  1_555 ? ? ? ? ? ? ? 1.662 ? 
metalc51  metalc ? ? PA FE2 . FE ? ? ? 1_555 H  GLU 51  OE2 ? ? H FE2 1622 H GLU 51   1_555 ? ? ? ? ? ? ? 2.011 ? 
metalc52  metalc ? ? PA FE2 . FE ? ? ? 1_555 H  GLU 94  OE2 ? ? H FE2 1622 H GLU 94   1_555 ? ? ? ? ? ? ? 2.050 ? 
metalc53  metalc ? ? PA FE2 . FE ? ? ? 1_555 H  GLU 127 OE2 ? ? H FE2 1622 H GLU 127  1_555 ? ? ? ? ? ? ? 1.912 ? 
metalc54  metalc ? ? O  HEM . FE ? ? ? 1_555 A  MET 52  SD  ? ? A HEM 3001 A MET 52   1_555 ? ? ? ? ? ? ? 2.123 ? 
metalc55  metalc ? ? O  HEM . FE ? ? ? 1_555 B  MET 52  SD  ? ? A HEM 3001 B MET 52   1_555 ? ? ? ? ? ? ? 2.147 ? 
metalc56  metalc ? ? X  HEM . FE ? ? ? 1_555 C  MET 52  SD  ? ? C HEM 3002 C MET 52   1_555 ? ? ? ? ? ? ? 2.137 ? 
metalc57  metalc ? ? X  HEM . FE ? ? ? 1_555 D  MET 52  SD  ? ? C HEM 3002 D MET 52   1_555 ? ? ? ? ? ? ? 2.122 ? 
metalc58  metalc ? ? FA HEM . FE ? ? ? 1_555 E  MET 52  SD  ? ? E HEM 3003 E MET 52   1_555 ? ? ? ? ? ? ? 2.131 ? 
metalc59  metalc ? ? FA HEM . FE ? ? ? 1_555 F  MET 52  SD  ? ? E HEM 3003 F MET 52   1_555 ? ? ? ? ? ? ? 2.141 ? 
metalc60  metalc ? ? NA HEM . FE ? ? ? 1_555 G  MET 52  SD  ? ? G HEM 3004 G MET 52   1_555 ? ? ? ? ? ? ? 2.136 ? 
metalc61  metalc ? ? NA HEM . FE ? ? ? 1_555 H  MET 52  SD  ? ? G HEM 3004 H MET 52   1_555 ? ? ? ? ? ? ? 2.103 ? 
metalc62  metalc ? ? I  FE2 . FE ? ? ? 1_555 A  GLU 18  OE2 ? ? A FE2 1601 A GLU 18   1_555 ? ? ? ? ? ? ? 2.654 ? 
metalc63  metalc ? ? J  FE2 . FE ? ? ? 1_555 A  GLU 94  OE1 ? ? A FE2 1602 A GLU 94   1_555 ? ? ? ? ? ? ? 2.536 ? 
metalc64  metalc ? ? J  FE2 . FE ? ? ? 1_555 A  HIS 130 ND1 ? ? A FE2 1602 A HIS 130  1_555 ? ? ? ? ? ? ? 2.348 ? 
metalc65  metalc ? ? K  FE2 . FE ? ? ? 1_555 A  ASN 148 OD1 ? ? A FE2 1603 A ASN 148  1_555 ? ? ? ? ? ? ? 2.701 ? 
metalc66  metalc ? ? K  FE2 . FE ? ? ? 1_555 G  ASN 148 OD1 ? ? A FE2 1603 G ASN 148  1_555 ? ? ? ? ? ? ? 2.569 ? 
metalc67  metalc ? ? K  FE2 . FE ? ? ? 1_555 XA HOH .   O   ? ? A FE2 1603 G HOH 3007 1_555 ? ? ? ? ? ? ? 2.762 ? 
metalc68  metalc ? ? L  MG  . MG ? ? ? 1_555 SA HOH .   O   ? ? A MG  1701 B HOH 1719 1_555 ? ? ? ? ? ? ? 2.731 ? 
metalc69  metalc ? ? N  MG  . MG ? ? ? 1_555 A  GLU 118 OE2 ? ? A MG  1710 A GLU 118  1_555 ? ? ? ? ? ? ? 2.770 ? 
metalc70  metalc ? ? N  MG  . MG ? ? ? 1_555 RA HOH .   O   ? ? A MG  1710 A HOH 3031 1_555 ? ? ? ? ? ? ? 2.594 ? 
metalc71  metalc ? ? P  FE2 . FE ? ? ? 1_555 B  GLU 94  OE1 ? ? B FE2 1605 B GLU 94   1_555 ? ? ? ? ? ? ? 2.717 ? 
metalc72  metalc ? ? Q  FE2 . FE ? ? ? 1_555 B  GLU 18  OE2 ? ? B FE2 1606 B GLU 18   1_555 ? ? ? ? ? ? ? 2.694 ? 
metalc73  metalc ? ? R  FE2 . FE ? ? ? 1_555 UA HOH .   O   ? ? B FE2 1607 D HOH 1742 1_555 ? ? ? ? ? ? ? 2.699 ? 
metalc74  metalc ? ? S  MG  . MG ? ? ? 1_555 RA HOH .   O   ? ? B MG  1702 A HOH 3013 1_555 ? ? ? ? ? ? ? 2.951 ? 
metalc75  metalc ? ? U  FE2 . FE ? ? ? 1_555 C  HIS 54  ND1 ? ? C FE2 1608 C HIS 54   1_555 ? ? ? ? ? ? ? 2.282 ? 
metalc76  metalc ? ? U  FE2 . FE ? ? ? 1_555 C  GLU 18  OE2 ? ? C FE2 1608 C GLU 18   1_555 ? ? ? ? ? ? ? 2.729 ? 
metalc77  metalc ? ? V  FE2 . FE ? ? ? 1_555 C  GLU 94  OE2 ? ? C FE2 1610 C GLU 94   1_555 ? ? ? ? ? ? ? 2.664 ? 
metalc78  metalc ? ? V  FE2 . FE ? ? ? 1_555 C  HIS 130 ND1 ? ? C FE2 1610 C HIS 130  1_555 ? ? ? ? ? ? ? 2.554 ? 
metalc79  metalc ? ? W  MG  . MG ? ? ? 1_555 VA HOH .   O   ? ? C MG  1706 E HOH 3022 1_555 ? ? ? ? ? ? ? 2.764 ? 
metalc80  metalc ? ? Y  FE2 . FE ? ? ? 1_555 D  GLU 18  OE1 ? ? D FE2 1611 D GLU 18   1_555 ? ? ? ? ? ? ? 2.347 ? 
metalc81  metalc ? ? Y  FE2 . FE ? ? ? 1_555 D  GLU 18  OE2 ? ? D FE2 1611 D GLU 18   1_555 ? ? ? ? ? ? ? 2.732 ? 
metalc82  metalc ? ? Z  FE2 . FE ? ? ? 1_555 D  HIS 130 ND1 ? ? D FE2 1612 D HIS 130  1_555 ? ? ? ? ? ? ? 2.247 ? 
metalc83  metalc ? ? AA MG  . MG ? ? ? 1_555 UA HOH .   O   ? ? D MG  1705 D HOH 1713 1_555 ? ? ? ? ? ? ? 2.969 ? 
metalc84  metalc ? ? AA MG  . MG ? ? ? 1_555 UA HOH .   O   ? ? D MG  1705 D HOH 1752 1_555 ? ? ? ? ? ? ? 3.125 ? 
metalc85  metalc ? ? AA MG  . MG ? ? ? 1_555 D  GLU 85  OE2 ? ? D MG  1705 D GLU 85   1_555 ? ? ? ? ? ? ? 2.608 ? 
metalc86  metalc ? ? BA MG  . MG ? ? ? 1_555 UA HOH .   O   ? ? D MG  1707 D HOH 1761 1_555 ? ? ? ? ? ? ? 2.688 ? 
metalc87  metalc ? ? CA MG  . MG ? ? ? 1_555 D  GLU 121 OE2 ? ? D MG  1712 D GLU 121  1_555 ? ? ? ? ? ? ? 2.183 ? 
metalc88  metalc ? ? CA MG  . MG ? ? ? 1_555 D  GLU 118 OE1 ? ? D MG  1712 D GLU 118  1_555 ? ? ? ? ? ? ? 2.732 ? 
metalc89  metalc ? ? CA MG  . MG ? ? ? 1_555 UA HOH .   O   ? ? D MG  1712 D HOH 1759 1_555 ? ? ? ? ? ? ? 2.613 ? 
metalc90  metalc ? ? DA FE2 . FE ? ? ? 1_555 E  GLU 18  OE1 ? ? E FE2 1613 E GLU 18   1_555 ? ? ? ? ? ? ? 2.711 ? 
metalc91  metalc ? ? EA FE2 . FE ? ? ? 1_555 E  HIS 130 ND1 ? ? E FE2 1614 E HIS 130  1_555 ? ? ? ? ? ? ? 2.276 ? 
metalc92  metalc ? ? GA FE2 . FE ? ? ? 1_555 F  GLU 18  OE1 ? ? F FE2 1616 F GLU 18   1_555 ? ? ? ? ? ? ? 2.677 ? 
metalc93  metalc ? ? HA FE2 . FE ? ? ? 1_555 F  HIS 130 ND1 ? ? F FE2 1617 F HIS 130  1_555 ? ? ? ? ? ? ? 2.249 ? 
metalc94  metalc ? ? HA FE2 . FE ? ? ? 1_555 F  GLU 94  OE1 ? ? F FE2 1617 F GLU 94   1_555 ? ? ? ? ? ? ? 2.569 ? 
metalc95  metalc ? ? IA MG  . MG ? ? ? 1_555 TA HOH .   O   ? ? F MG  1711 C HOH 3042 1_555 ? ? ? ? ? ? ? 2.355 ? 
metalc96  metalc ? ? IA MG  . MG ? ? ? 1_555 F  GLU 118 OE2 ? ? F MG  1711 F GLU 118  1_555 ? ? ? ? ? ? ? 2.410 ? 
metalc97  metalc ? ? IA MG  . MG ? ? ? 1_555 F  GLU 121 OE1 ? ? F MG  1711 F GLU 121  1_555 ? ? ? ? ? ? ? 3.127 ? 
metalc98  metalc ? ? IA MG  . MG ? ? ? 1_555 WA HOH .   O   ? ? F MG  1711 F HOH 1735 1_555 ? ? ? ? ? ? ? 2.241 ? 
metalc99  metalc ? ? IA MG  . MG ? ? ? 1_555 B  GLU 118 OE1 ? ? F MG  1711 B GLU 118  1_555 ? ? ? ? ? ? ? 2.748 ? 
metalc100 metalc ? ? IA MG  . MG ? ? ? 1_555 C  GLU 118 OE2 ? ? F MG  1711 C GLU 118  1_555 ? ? ? ? ? ? ? 2.478 ? 
metalc101 metalc ? ? IA MG  . MG ? ? ? 1_555 C  GLU 121 OE1 ? ? F MG  1711 C GLU 121  1_555 ? ? ? ? ? ? ? 3.133 ? 
metalc102 metalc ? ? IA MG  . MG ? ? ? 1_555 B  GLU 118 OE2 ? ? F MG  1711 B GLU 118  1_555 ? ? ? ? ? ? ? 2.582 ? 
metalc103 metalc ? ? JA FE2 . FE ? ? ? 1_555 G  GLU 18  OE2 ? ? G FE2 1618 G GLU 18   1_555 ? ? ? ? ? ? ? 2.300 ? 
metalc104 metalc ? ? JA FE2 . FE ? ? ? 1_555 G  GLU 18  OE1 ? ? G FE2 1618 G GLU 18   1_555 ? ? ? ? ? ? ? 2.601 ? 
metalc105 metalc ? ? KA FE2 . FE ? ? ? 1_555 G  GLU 94  OE2 ? ? G FE2 1619 G GLU 94   1_555 ? ? ? ? ? ? ? 2.551 ? 
metalc106 metalc ? ? KA FE2 . FE ? ? ? 1_555 G  HIS 130 ND1 ? ? G FE2 1619 G HIS 130  1_555 ? ? ? ? ? ? ? 2.494 ? 
metalc107 metalc ? ? LA MG  . MG ? ? ? 1_555 VA HOH .   O   ? ? G MG  1708 E HOH 3052 1_555 ? ? ? ? ? ? ? 2.842 ? 
metalc108 metalc ? ? LA MG  . MG ? ? ? 1_555 VA HOH .   O   ? ? G MG  1708 E HOH 3051 1_555 ? ? ? ? ? ? ? 2.683 ? 
metalc109 metalc ? ? MA MG  . MG ? ? ? 1_555 YA HOH .   O   ? ? G MG  1709 H HOH 1742 1_555 ? ? ? ? ? ? ? 1.955 ? 
metalc110 metalc ? ? OA FE2 . FE ? ? ? 1_555 H  GLU 18  OE2 ? ? H FE2 1621 H GLU 18   1_555 ? ? ? ? ? ? ? 2.528 ? 
metalc111 metalc ? ? OA FE2 . FE ? ? ? 1_555 H  HIS 54  ND1 ? ? H FE2 1621 H HIS 54   1_555 ? ? ? ? ? ? ? 2.252 ? 
metalc112 metalc ? ? PA FE2 . FE ? ? ? 1_555 H  GLU 94  OE1 ? ? H FE2 1622 H GLU 94   1_555 ? ? ? ? ? ? ? 2.726 ? 
metalc113 metalc ? ? PA FE2 . FE ? ? ? 1_555 H  HIS 130 ND1 ? ? H FE2 1622 H HIS 130  1_555 ? ? ? ? ? ? ? 2.209 ? 
metalc114 metalc ? ? QA MG  . MG ? ? ? 1_555 YA HOH .   O   ? ? H MG  1713 H HOH 1766 1_555 ? ? ? ? ? ? ? 2.205 ? 
metalc115 metalc ? ? QA MG  . MG ? ? ? 1_555 YA HOH .   O   ? ? H MG  1713 H HOH 1765 1_555 ? ? ? ? ? ? ? 1.974 ? 
metalc116 metalc ? ? K  FE2 . FE ? ? ? 1_555 H  ASN 148 OD1 ? ? A FE2 1603 H ASN 148  2_655 ? ? ? ? ? ? ? 2.662 ? 
metalc117 metalc ? ? N  MG  . MG ? ? ? 1_555 VA HOH .   O   ? ? A MG  1710 E HOH 3047 2_655 ? ? ? ? ? ? ? 1.856 ? 
metalc118 metalc ? ? N  MG  . MG ? ? ? 1_555 G  GLU 118 OE2 ? ? A MG  1710 G GLU 118  2_655 ? ? ? ? ? ? ? 2.337 ? 
metalc119 metalc ? ? N  MG  . MG ? ? ? 1_555 G  GLU 121 OE1 ? ? A MG  1710 G GLU 121  2_655 ? ? ? ? ? ? ? 2.704 ? 
metalc120 metalc ? ? N  MG  . MG ? ? ? 1_555 E  GLU 118 OE1 ? ? A MG  1710 E GLU 118  2_655 ? ? ? ? ? ? ? 2.610 ? 
metalc121 metalc ? ? R  FE2 . FE ? ? ? 1_555 C  ASN 148 OD1 ? ? B FE2 1607 C ASN 148  2_655 ? ? ? ? ? ? ? 2.565 ? 
metalc122 metalc ? ? AA MG  . MG ? ? ? 1_555 YA HOH .   O   ? ? D MG  1705 H HOH 1757 7_444 ? ? ? ? ? ? ? 1.815 ? 
metalc123 metalc ? ? AA MG  . MG ? ? ? 1_555 H  GLU 85  OE2 ? ? D MG  1705 H GLU 85   7_444 ? ? ? ? ? ? ? 2.749 ? 
metalc124 metalc ? ? AA MG  . MG ? ? ? 1_555 YA HOH .   O   ? ? D MG  1705 H HOH 1756 7_444 ? ? ? ? ? ? ? 2.943 ? 
metalc125 metalc ? ? AA MG  . MG ? ? ? 1_555 H  GLU 85  OE1 ? ? D MG  1705 H GLU 85   7_444 ? ? ? ? ? ? ? 2.656 ? 
metalc126 metalc ? ? BA MG  . MG ? ? ? 1_555 TA HOH .   O   ? ? D MG  1707 C HOH 3058 2_655 ? ? ? ? ? ? ? 2.040 ? 
metalc127 metalc ? ? BA MG  . MG ? ? ? 1_555 TA HOH .   O   ? ? D MG  1707 C HOH 3057 2_655 ? ? ? ? ? ? ? 1.899 ? 
metalc128 metalc ? ? BA MG  . MG ? ? ? 1_555 UA HOH .   O   ? ? D MG  1707 D HOH 1762 2_655 ? ? ? ? ? ? ? 2.358 ? 
metalc129 metalc ? ? CA MG  . MG ? ? ? 1_555 UA HOH .   O   ? ? D MG  1712 D HOH 1741 3_665 ? ? ? ? ? ? ? 3.033 ? 
metalc130 metalc ? ? CA MG  . MG ? ? ? 1_555 D  GLU 118 OE1 ? ? D MG  1712 D GLU 118  2_655 ? ? ? ? ? ? ? 2.960 ? 
metalc131 metalc ? ? CA MG  . MG ? ? ? 1_555 UA HOH .   O   ? ? D MG  1712 D HOH 1741 2_655 ? ? ? ? ? ? ? 2.185 ? 
metalc132 metalc ? ? CA MG  . MG ? ? ? 1_555 UA HOH .   O   ? ? D MG  1712 D HOH 1759 2_655 ? ? ? ? ? ? ? 2.668 ? 
metalc133 metalc ? ? CA MG  . MG ? ? ? 1_555 UA HOH .   O   ? ? D MG  1712 D HOH 1759 3_665 ? ? ? ? ? ? ? 2.495 ? 
metalc134 metalc ? ? MA MG  . MG ? ? ? 1_555 YA HOH .   O   ? ? G MG  1709 H HOH 1770 2_655 ? ? ? ? ? ? ? 2.098 ? 
metalc135 metalc ? ? MA MG  . MG ? ? ? 1_555 YA HOH .   O   ? ? G MG  1709 H HOH 1728 2_655 ? ? ? ? ? ? ? 3.059 ? 
metalc136 metalc ? ? QA MG  . MG ? ? ? 1_555 YA HOH .   O   ? ? H MG  1713 H HOH 1766 3_665 ? ? ? ? ? ? ? 2.072 ? 
metalc137 metalc ? ? QA MG  . MG ? ? ? 1_555 YA HOH .   O   ? ? H MG  1713 H HOH 1766 2_655 ? ? ? ? ? ? ? 2.105 ? 
metalc138 metalc ? ? QA MG  . MG ? ? ? 1_555 YA HOH .   O   ? ? H MG  1713 H HOH 1765 3_665 ? ? ? ? ? ? ? 1.863 ? 
metalc139 metalc ? ? QA MG  . MG ? ? ? 1_555 YA HOH .   O   ? ? H MG  1713 H HOH 1765 2_655 ? ? ? ? ? ? ? 2.085 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FE2 A 1601' 
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FE2 A 1602' 
AC3 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE FE2 A 1603' 
AC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FE2 B 1605' 
AC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FE2 B 1606' 
AC6 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE FE2 B 1607' 
AC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FE2 C 1608' 
AC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FE2 C 1610' 
AC9 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FE2 D 1611' 
BC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FE2 D 1612' 
BC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FE2 E 1613' 
BC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FE2 E 1614' 
BC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FE2 F 1616' 
BC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FE2 F 1617' 
BC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FE2 G 1618' 
BC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FE2 G 1619' 
BC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FE2 H 1621' 
BC9 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FE2 H 1622' 
CC1 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG A 1701'  
CC2 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG B 1702'  
CC3 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG A 1703'  
CC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG D 1705'  
CC5 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG C 1706'  
CC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG D 1707'  
CC7 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG G 1708'  
CC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG G 1709'  
CC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 1710'  
DC1 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG F 1711'  
DC2 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE MG D 1712'  
DC3 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE MG H 1713'  
DC4 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE HEM A 3001' 
DC5 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE HEM C 3002' 
DC6 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE HEM E 3003' 
DC7 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE HEM G 3004' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 5  GLU A  18  ? GLU A 18   . ? 1_555 ? 
2   AC1 5  GLU A  51  ? GLU A 51   . ? 1_555 ? 
3   AC1 5  HIS A  54  ? HIS A 54   . ? 1_555 ? 
4   AC1 5  GLU A  127 ? GLU A 127  . ? 1_555 ? 
5   AC1 5  FE2 J  .   ? FE2 A 1602 . ? 1_555 ? 
6   AC2 5  GLU A  51  ? GLU A 51   . ? 1_555 ? 
7   AC2 5  GLU A  94  ? GLU A 94   . ? 1_555 ? 
8   AC2 5  GLU A  127 ? GLU A 127  . ? 1_555 ? 
9   AC2 5  HIS A  130 ? HIS A 130  . ? 1_555 ? 
10  AC2 5  FE2 I  .   ? FE2 A 1601 . ? 1_555 ? 
11  AC3 9  ASN A  148 ? ASN A 148  . ? 1_555 ? 
12  AC3 9  GLN A  151 ? GLN A 151  . ? 1_555 ? 
13  AC3 9  ASN F  148 ? ASN F 148  . ? 1_555 ? 
14  AC3 9  GLN F  151 ? GLN F 151  . ? 1_555 ? 
15  AC3 9  ASN G  148 ? ASN G 148  . ? 1_555 ? 
16  AC3 9  GLN G  151 ? GLN G 151  . ? 1_555 ? 
17  AC3 9  HOH XA .   ? HOH G 3007 . ? 1_555 ? 
18  AC3 9  ASN H  148 ? ASN H 148  . ? 2_655 ? 
19  AC3 9  GLN H  151 ? GLN H 151  . ? 2_655 ? 
20  AC4 5  GLU B  51  ? GLU B 51   . ? 1_555 ? 
21  AC4 5  GLU B  94  ? GLU B 94   . ? 1_555 ? 
22  AC4 5  GLU B  127 ? GLU B 127  . ? 1_555 ? 
23  AC4 5  HIS B  130 ? HIS B 130  . ? 1_555 ? 
24  AC4 5  FE2 Q  .   ? FE2 B 1606 . ? 1_555 ? 
25  AC5 5  GLU B  18  ? GLU B 18   . ? 1_555 ? 
26  AC5 5  GLU B  51  ? GLU B 51   . ? 1_555 ? 
27  AC5 5  HIS B  54  ? HIS B 54   . ? 1_555 ? 
28  AC5 5  GLU B  127 ? GLU B 127  . ? 1_555 ? 
29  AC5 5  FE2 P  .   ? FE2 B 1605 . ? 1_555 ? 
30  AC6 9  ASN B  148 ? ASN B 148  . ? 1_555 ? 
31  AC6 9  GLN B  151 ? GLN B 151  . ? 1_555 ? 
32  AC6 9  ASN C  148 ? ASN C 148  . ? 2_655 ? 
33  AC6 9  GLN C  151 ? GLN C 151  . ? 2_655 ? 
34  AC6 9  ASN D  148 ? ASN D 148  . ? 1_555 ? 
35  AC6 9  GLN D  151 ? GLN D 151  . ? 1_555 ? 
36  AC6 9  HOH UA .   ? HOH D 1742 . ? 1_555 ? 
37  AC6 9  ASN E  148 ? ASN E 148  . ? 2_655 ? 
38  AC6 9  GLN E  151 ? GLN E 151  . ? 2_655 ? 
39  AC7 5  GLU C  18  ? GLU C 18   . ? 1_555 ? 
40  AC7 5  GLU C  51  ? GLU C 51   . ? 1_555 ? 
41  AC7 5  HIS C  54  ? HIS C 54   . ? 1_555 ? 
42  AC7 5  GLU C  127 ? GLU C 127  . ? 1_555 ? 
43  AC7 5  FE2 V  .   ? FE2 C 1610 . ? 1_555 ? 
44  AC8 5  GLU C  51  ? GLU C 51   . ? 1_555 ? 
45  AC8 5  GLU C  94  ? GLU C 94   . ? 1_555 ? 
46  AC8 5  GLU C  127 ? GLU C 127  . ? 1_555 ? 
47  AC8 5  HIS C  130 ? HIS C 130  . ? 1_555 ? 
48  AC8 5  FE2 U  .   ? FE2 C 1608 . ? 1_555 ? 
49  AC9 5  GLU D  18  ? GLU D 18   . ? 1_555 ? 
50  AC9 5  GLU D  51  ? GLU D 51   . ? 1_555 ? 
51  AC9 5  HIS D  54  ? HIS D 54   . ? 1_555 ? 
52  AC9 5  GLU D  127 ? GLU D 127  . ? 1_555 ? 
53  AC9 5  FE2 Z  .   ? FE2 D 1612 . ? 1_555 ? 
54  BC1 5  GLU D  51  ? GLU D 51   . ? 1_555 ? 
55  BC1 5  GLU D  94  ? GLU D 94   . ? 1_555 ? 
56  BC1 5  GLU D  127 ? GLU D 127  . ? 1_555 ? 
57  BC1 5  HIS D  130 ? HIS D 130  . ? 1_555 ? 
58  BC1 5  FE2 Y  .   ? FE2 D 1611 . ? 1_555 ? 
59  BC2 5  GLU E  18  ? GLU E 18   . ? 1_555 ? 
60  BC2 5  GLU E  51  ? GLU E 51   . ? 1_555 ? 
61  BC2 5  HIS E  54  ? HIS E 54   . ? 1_555 ? 
62  BC2 5  GLU E  127 ? GLU E 127  . ? 1_555 ? 
63  BC2 5  FE2 EA .   ? FE2 E 1614 . ? 1_555 ? 
64  BC3 5  GLU E  51  ? GLU E 51   . ? 1_555 ? 
65  BC3 5  GLU E  94  ? GLU E 94   . ? 1_555 ? 
66  BC3 5  GLU E  127 ? GLU E 127  . ? 1_555 ? 
67  BC3 5  HIS E  130 ? HIS E 130  . ? 1_555 ? 
68  BC3 5  FE2 DA .   ? FE2 E 1613 . ? 1_555 ? 
69  BC4 5  GLU F  18  ? GLU F 18   . ? 1_555 ? 
70  BC4 5  GLU F  51  ? GLU F 51   . ? 1_555 ? 
71  BC4 5  HIS F  54  ? HIS F 54   . ? 1_555 ? 
72  BC4 5  GLU F  127 ? GLU F 127  . ? 1_555 ? 
73  BC4 5  FE2 HA .   ? FE2 F 1617 . ? 1_555 ? 
74  BC5 5  GLU F  51  ? GLU F 51   . ? 1_555 ? 
75  BC5 5  GLU F  94  ? GLU F 94   . ? 1_555 ? 
76  BC5 5  GLU F  127 ? GLU F 127  . ? 1_555 ? 
77  BC5 5  HIS F  130 ? HIS F 130  . ? 1_555 ? 
78  BC5 5  FE2 GA .   ? FE2 F 1616 . ? 1_555 ? 
79  BC6 5  GLU G  18  ? GLU G 18   . ? 1_555 ? 
80  BC6 5  GLU G  51  ? GLU G 51   . ? 1_555 ? 
81  BC6 5  HIS G  54  ? HIS G 54   . ? 1_555 ? 
82  BC6 5  GLU G  127 ? GLU G 127  . ? 1_555 ? 
83  BC6 5  FE2 KA .   ? FE2 G 1619 . ? 1_555 ? 
84  BC7 5  GLU G  51  ? GLU G 51   . ? 1_555 ? 
85  BC7 5  GLU G  94  ? GLU G 94   . ? 1_555 ? 
86  BC7 5  GLU G  127 ? GLU G 127  . ? 1_555 ? 
87  BC7 5  HIS G  130 ? HIS G 130  . ? 1_555 ? 
88  BC7 5  FE2 JA .   ? FE2 G 1618 . ? 1_555 ? 
89  BC8 5  GLU H  18  ? GLU H 18   . ? 1_555 ? 
90  BC8 5  GLU H  51  ? GLU H 51   . ? 1_555 ? 
91  BC8 5  HIS H  54  ? HIS H 54   . ? 1_555 ? 
92  BC8 5  GLU H  127 ? GLU H 127  . ? 1_555 ? 
93  BC8 5  FE2 PA .   ? FE2 H 1622 . ? 1_555 ? 
94  BC9 5  GLU H  51  ? GLU H 51   . ? 1_555 ? 
95  BC9 5  GLU H  94  ? GLU H 94   . ? 1_555 ? 
96  BC9 5  GLU H  127 ? GLU H 127  . ? 1_555 ? 
97  BC9 5  HIS H  130 ? HIS H 130  . ? 1_555 ? 
98  BC9 5  FE2 OA .   ? FE2 H 1621 . ? 1_555 ? 
99  CC1 1  HOH SA .   ? HOH B 1719 . ? 1_555 ? 
100 CC2 1  HOH RA .   ? HOH A 3013 . ? 1_555 ? 
101 CC3 1  GLU A  135 ? GLU A 135  . ? 1_555 ? 
102 CC4 6  GLU D  85  ? GLU D 85   . ? 1_555 ? 
103 CC4 6  HOH UA .   ? HOH D 1713 . ? 1_555 ? 
104 CC4 6  GLU H  81  ? GLU H 81   . ? 7_444 ? 
105 CC4 6  GLU H  85  ? GLU H 85   . ? 7_444 ? 
106 CC4 6  HOH YA .   ? HOH H 1756 . ? 7_444 ? 
107 CC4 6  HOH YA .   ? HOH H 1757 . ? 7_444 ? 
108 CC5 1  HOH VA .   ? HOH E 3022 . ? 1_555 ? 
109 CC6 6  ASP C  34  ? ASP C 34   . ? 2_655 ? 
110 CC6 6  HOH TA .   ? HOH C 3057 . ? 2_655 ? 
111 CC6 6  HOH TA .   ? HOH C 3058 . ? 2_655 ? 
112 CC6 6  ASP D  132 ? ASP D 132  . ? 1_555 ? 
113 CC6 6  HOH UA .   ? HOH D 1761 . ? 1_555 ? 
114 CC6 6  HOH UA .   ? HOH D 1762 . ? 2_655 ? 
115 CC7 2  HOH VA .   ? HOH E 3051 . ? 1_555 ? 
116 CC7 2  HOH VA .   ? HOH E 3052 . ? 1_555 ? 
117 CC8 3  HOH YA .   ? HOH H 1728 . ? 2_655 ? 
118 CC8 3  HOH YA .   ? HOH H 1742 . ? 1_555 ? 
119 CC8 3  HOH YA .   ? HOH H 1770 . ? 2_655 ? 
120 CC9 6  GLU A  118 ? GLU A 118  . ? 1_555 ? 
121 CC9 6  HOH RA .   ? HOH A 3031 . ? 1_555 ? 
122 CC9 6  GLU E  118 ? GLU E 118  . ? 2_655 ? 
123 CC9 6  HOH VA .   ? HOH E 3047 . ? 2_655 ? 
124 CC9 6  GLU G  118 ? GLU G 118  . ? 2_655 ? 
125 CC9 6  GLU G  121 ? GLU G 121  . ? 2_655 ? 
126 DC1 7  GLU B  118 ? GLU B 118  . ? 1_555 ? 
127 DC1 7  GLU C  118 ? GLU C 118  . ? 1_555 ? 
128 DC1 7  GLU C  121 ? GLU C 121  . ? 1_555 ? 
129 DC1 7  HOH TA .   ? HOH C 3042 . ? 1_555 ? 
130 DC1 7  GLU F  118 ? GLU F 118  . ? 1_555 ? 
131 DC1 7  GLU F  121 ? GLU F 121  . ? 1_555 ? 
132 DC1 7  HOH WA .   ? HOH F 1735 . ? 1_555 ? 
133 DC2 8  GLU D  118 ? GLU D 118  . ? 2_655 ? 
134 DC2 8  GLU D  118 ? GLU D 118  . ? 1_555 ? 
135 DC2 8  GLU D  121 ? GLU D 121  . ? 1_555 ? 
136 DC2 8  HOH UA .   ? HOH D 1741 . ? 2_655 ? 
137 DC2 8  HOH UA .   ? HOH D 1741 . ? 3_665 ? 
138 DC2 8  HOH UA .   ? HOH D 1759 . ? 3_665 ? 
139 DC2 8  HOH UA .   ? HOH D 1759 . ? 2_655 ? 
140 DC2 8  HOH UA .   ? HOH D 1759 . ? 1_555 ? 
141 DC3 12 GLU H  118 ? GLU H 118  . ? 2_655 ? 
142 DC3 12 GLU H  118 ? GLU H 118  . ? 1_555 ? 
143 DC3 12 GLU H  118 ? GLU H 118  . ? 3_665 ? 
144 DC3 12 GLU H  121 ? GLU H 121  . ? 2_655 ? 
145 DC3 12 GLU H  121 ? GLU H 121  . ? 3_665 ? 
146 DC3 12 GLU H  121 ? GLU H 121  . ? 1_555 ? 
147 DC3 12 HOH YA .   ? HOH H 1765 . ? 2_655 ? 
148 DC3 12 HOH YA .   ? HOH H 1765 . ? 3_665 ? 
149 DC3 12 HOH YA .   ? HOH H 1765 . ? 1_555 ? 
150 DC3 12 HOH YA .   ? HOH H 1766 . ? 2_655 ? 
151 DC3 12 HOH YA .   ? HOH H 1766 . ? 3_665 ? 
152 DC3 12 HOH YA .   ? HOH H 1766 . ? 1_555 ? 
153 DC4 15 LEU A  19  ? LEU A 19   . ? 1_555 ? 
154 DC4 15 ILE A  22  ? ILE A 22   . ? 1_555 ? 
155 DC4 15 ASN A  23  ? ASN A 23   . ? 1_555 ? 
156 DC4 15 PHE A  26  ? PHE A 26   . ? 1_555 ? 
157 DC4 15 TYR A  45  ? TYR A 45   . ? 1_555 ? 
158 DC4 15 ILE A  49  ? ILE A 49   . ? 1_555 ? 
159 DC4 15 MET A  52  ? MET A 52   . ? 1_555 ? 
160 DC4 15 LEU B  19  ? LEU B 19   . ? 1_555 ? 
161 DC4 15 ILE B  22  ? ILE B 22   . ? 1_555 ? 
162 DC4 15 ASN B  23  ? ASN B 23   . ? 1_555 ? 
163 DC4 15 PHE B  26  ? PHE B 26   . ? 1_555 ? 
164 DC4 15 TYR B  45  ? TYR B 45   . ? 1_555 ? 
165 DC4 15 ILE B  49  ? ILE B 49   . ? 1_555 ? 
166 DC4 15 MET B  52  ? MET B 52   . ? 1_555 ? 
167 DC4 15 LYS B  53  ? LYS B 53   . ? 1_555 ? 
168 DC5 14 ASN C  23  ? ASN C 23   . ? 1_555 ? 
169 DC5 14 PHE C  26  ? PHE C 26   . ? 1_555 ? 
170 DC5 14 TYR C  45  ? TYR C 45   . ? 1_555 ? 
171 DC5 14 MET C  52  ? MET C 52   . ? 1_555 ? 
172 DC5 14 LYS C  53  ? LYS C 53   . ? 1_555 ? 
173 DC5 14 ILE C  59  ? ILE C 59   . ? 1_555 ? 
174 DC5 14 HOH TA .   ? HOH C 3055 . ? 1_555 ? 
175 DC5 14 ILE D  22  ? ILE D 22   . ? 1_555 ? 
176 DC5 14 ASN D  23  ? ASN D 23   . ? 1_555 ? 
177 DC5 14 PHE D  26  ? PHE D 26   . ? 1_555 ? 
178 DC5 14 TYR D  45  ? TYR D 45   . ? 1_555 ? 
179 DC5 14 ILE D  49  ? ILE D 49   . ? 1_555 ? 
180 DC5 14 MET D  52  ? MET D 52   . ? 1_555 ? 
181 DC5 14 LYS D  53  ? LYS D 53   . ? 1_555 ? 
182 DC6 14 LEU E  19  ? LEU E 19   . ? 1_555 ? 
183 DC6 14 ILE E  22  ? ILE E 22   . ? 1_555 ? 
184 DC6 14 PHE E  26  ? PHE E 26   . ? 1_555 ? 
185 DC6 14 TYR E  45  ? TYR E 45   . ? 1_555 ? 
186 DC6 14 MET E  52  ? MET E 52   . ? 1_555 ? 
187 DC6 14 LYS E  53  ? LYS E 53   . ? 1_555 ? 
188 DC6 14 LEU E  71  ? LEU E 71   . ? 1_555 ? 
189 DC6 14 LEU F  19  ? LEU F 19   . ? 1_555 ? 
190 DC6 14 ILE F  22  ? ILE F 22   . ? 1_555 ? 
191 DC6 14 PHE F  26  ? PHE F 26   . ? 1_555 ? 
192 DC6 14 TYR F  45  ? TYR F 45   . ? 1_555 ? 
193 DC6 14 ILE F  49  ? ILE F 49   . ? 1_555 ? 
194 DC6 14 MET F  52  ? MET F 52   . ? 1_555 ? 
195 DC6 14 LYS F  53  ? LYS F 53   . ? 1_555 ? 
196 DC7 12 LEU G  19  ? LEU G 19   . ? 1_555 ? 
197 DC7 12 ASN G  23  ? ASN G 23   . ? 1_555 ? 
198 DC7 12 PHE G  26  ? PHE G 26   . ? 1_555 ? 
199 DC7 12 TYR G  45  ? TYR G 45   . ? 1_555 ? 
200 DC7 12 ILE G  49  ? ILE G 49   . ? 1_555 ? 
201 DC7 12 MET G  52  ? MET G 52   . ? 1_555 ? 
202 DC7 12 HOH XA .   ? HOH G 3069 . ? 1_555 ? 
203 DC7 12 ASN H  23  ? ASN H 23   . ? 1_555 ? 
204 DC7 12 PHE H  26  ? PHE H 26   . ? 1_555 ? 
205 DC7 12 TYR H  45  ? TYR H 45   . ? 1_555 ? 
206 DC7 12 MET H  52  ? MET H 52   . ? 1_555 ? 
207 DC7 12 LYS H  53  ? LYS H 53   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2FL0 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2FL0 
_atom_sites.fract_transf_matrix[1][1]   0.008033 
_atom_sites.fract_transf_matrix[1][2]   0.004638 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009276 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003507 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
MG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . MET A  1 1   ? 15.104 9.967  91.053  1.00 47.71 ? 1    MET A N   1 
ATOM   2     C  CA  . MET A  1 1   ? 14.627 8.887  91.964  1.00 47.77 ? 1    MET A CA  1 
ATOM   3     C  C   . MET A  1 1   ? 13.299 9.303  92.607  1.00 48.87 ? 1    MET A C   1 
ATOM   4     O  O   . MET A  1 1   ? 13.250 10.245 93.399  1.00 52.86 ? 1    MET A O   1 
ATOM   5     C  CB  . MET A  1 1   ? 15.684 8.628  93.041  1.00 48.03 ? 1    MET A CB  1 
ATOM   6     C  CG  . MET A  1 1   ? 15.434 7.394  93.893  1.00 48.60 ? 1    MET A CG  1 
ATOM   7     S  SD  . MET A  1 1   ? 16.681 7.182  95.198  1.00 49.83 ? 1    MET A SD  1 
ATOM   8     C  CE  . MET A  1 1   ? 16.011 8.278  96.510  1.00 46.14 ? 1    MET A CE  1 
ATOM   9     N  N   . LYS A  1 2   ? 12.223 8.609  92.255  1.00 47.20 ? 2    LYS A N   1 
ATOM   10    C  CA  . LYS A  1 2   ? 10.899 8.908  92.796  1.00 48.08 ? 2    LYS A CA  1 
ATOM   11    C  C   . LYS A  1 2   ? 10.873 8.893  94.333  1.00 47.21 ? 2    LYS A C   1 
ATOM   12    O  O   . LYS A  1 2   ? 11.225 7.888  94.952  1.00 46.69 ? 2    LYS A O   1 
ATOM   13    C  CB  . LYS A  1 2   ? 9.893  7.890  92.256  1.00 51.09 ? 2    LYS A CB  1 
ATOM   14    C  CG  . LYS A  1 2   ? 8.509  7.979  92.879  1.00 58.23 ? 2    LYS A CG  1 
ATOM   15    C  CD  . LYS A  1 2   ? 7.742  6.672  92.692  1.00 62.06 ? 2    LYS A CD  1 
ATOM   16    C  CE  . LYS A  1 2   ? 6.467  6.639  93.530  1.00 63.78 ? 2    LYS A CE  1 
ATOM   17    N  NZ  . LYS A  1 2   ? 5.860  5.275  93.559  1.00 66.69 ? 2    LYS A NZ  1 
ATOM   18    N  N   . GLY A  1 3   ? 10.450 9.999  94.944  1.00 44.70 ? 3    GLY A N   1 
ATOM   19    C  CA  . GLY A  1 3   ? 10.390 10.062 96.398  1.00 43.36 ? 3    GLY A CA  1 
ATOM   20    C  C   . GLY A  1 3   ? 8.965  10.070 96.925  1.00 42.96 ? 3    GLY A C   1 
ATOM   21    O  O   . GLY A  1 3   ? 8.020  10.059 96.138  1.00 42.46 ? 3    GLY A O   1 
ATOM   22    N  N   . ASP A  1 4   ? 8.789  10.080 98.244  1.00 42.02 ? 4    ASP A N   1 
ATOM   23    C  CA  . ASP A  1 4   ? 7.438  10.095 98.800  1.00 45.16 ? 4    ASP A CA  1 
ATOM   24    C  C   . ASP A  1 4   ? 6.719  11.402 98.494  1.00 44.99 ? 4    ASP A C   1 
ATOM   25    O  O   . ASP A  1 4   ? 7.265  12.494 98.677  1.00 44.53 ? 4    ASP A O   1 
ATOM   26    C  CB  . ASP A  1 4   ? 7.442  9.889  100.318 1.00 50.00 ? 4    ASP A CB  1 
ATOM   27    C  CG  . ASP A  1 4   ? 7.725  8.452  100.715 1.00 57.46 ? 4    ASP A CG  1 
ATOM   28    O  OD1 . ASP A  1 4   ? 8.909  8.045  100.689 1.00 62.55 ? 4    ASP A OD1 1 
ATOM   29    O  OD2 . ASP A  1 4   ? 6.760  7.727  101.051 1.00 58.61 ? 4    ASP A OD2 1 
ATOM   30    N  N   . LYS A  1 5   ? 5.485  11.275 98.028  1.00 42.52 ? 5    LYS A N   1 
ATOM   31    C  CA  . LYS A  1 5   ? 4.658  12.422 97.698  1.00 40.87 ? 5    LYS A CA  1 
ATOM   32    C  C   . LYS A  1 5   ? 4.546  13.380 98.886  1.00 39.87 ? 5    LYS A C   1 
ATOM   33    O  O   . LYS A  1 5   ? 4.674  14.596 98.731  1.00 39.12 ? 5    LYS A O   1 
ATOM   34    C  CB  . LYS A  1 5   ? 3.271  11.925 97.285  1.00 46.00 ? 5    LYS A CB  1 
ATOM   35    C  CG  . LYS A  1 5   ? 2.161  12.969 97.306  1.00 53.43 ? 5    LYS A CG  1 
ATOM   36    C  CD  . LYS A  1 5   ? 0.815  12.327 96.983  1.00 57.56 ? 5    LYS A CD  1 
ATOM   37    C  CE  . LYS A  1 5   ? -0.301 13.361 96.942  1.00 61.61 ? 5    LYS A CE  1 
ATOM   38    N  NZ  . LYS A  1 5   ? -1.589 12.779 96.456  1.00 61.93 ? 5    LYS A NZ  1 
ATOM   39    N  N   . ILE A  1 6   ? 4.311  12.833 100.074 1.00 37.36 ? 6    ILE A N   1 
ATOM   40    C  CA  . ILE A  1 6   ? 4.164  13.661 101.260 1.00 36.28 ? 6    ILE A CA  1 
ATOM   41    C  C   . ILE A  1 6   ? 5.463  14.354 101.676 1.00 33.54 ? 6    ILE A C   1 
ATOM   42    O  O   . ILE A  1 6   ? 5.430  15.492 102.156 1.00 30.52 ? 6    ILE A O   1 
ATOM   43    C  CB  . ILE A  1 6   ? 3.620  12.843 102.454 1.00 39.01 ? 6    ILE A CB  1 
ATOM   44    C  CG1 . ILE A  1 6   ? 2.258  12.244 102.097 1.00 39.71 ? 6    ILE A CG1 1 
ATOM   45    C  CG2 . ILE A  1 6   ? 3.459  13.745 103.675 1.00 38.32 ? 6    ILE A CG2 1 
ATOM   46    C  CD1 . ILE A  1 6   ? 1.605  11.490 103.256 1.00 42.39 ? 6    ILE A CD1 1 
ATOM   47    N  N   . VAL A  1 7   ? 6.597  13.676 101.504 1.00 30.05 ? 7    VAL A N   1 
ATOM   48    C  CA  . VAL A  1 7   ? 7.874  14.283 101.857 1.00 28.45 ? 7    VAL A CA  1 
ATOM   49    C  C   . VAL A  1 7   ? 8.123  15.473 100.933 1.00 30.01 ? 7    VAL A C   1 
ATOM   50    O  O   . VAL A  1 7   ? 8.546  16.550 101.380 1.00 30.70 ? 7    VAL A O   1 
ATOM   51    C  CB  . VAL A  1 7   ? 9.052  13.292 101.722 1.00 29.41 ? 7    VAL A CB  1 
ATOM   52    C  CG1 . VAL A  1 7   ? 10.372 14.060 101.703 1.00 26.03 ? 7    VAL A CG1 1 
ATOM   53    C  CG2 . VAL A  1 7   ? 9.047  12.299 102.895 1.00 24.67 ? 7    VAL A CG2 1 
ATOM   54    N  N   . ILE A  1 8   ? 7.860  15.286 99.643  1.00 27.30 ? 8    ILE A N   1 
ATOM   55    C  CA  . ILE A  1 8   ? 8.053  16.376 98.696  1.00 27.68 ? 8    ILE A CA  1 
ATOM   56    C  C   . ILE A  1 8   ? 7.079  17.502 99.018  1.00 27.39 ? 8    ILE A C   1 
ATOM   57    O  O   . ILE A  1 8   ? 7.367  18.670 98.776  1.00 28.82 ? 8    ILE A O   1 
ATOM   58    C  CB  . ILE A  1 8   ? 7.836  15.922 97.231  1.00 26.12 ? 8    ILE A CB  1 
ATOM   59    C  CG1 . ILE A  1 8   ? 8.928  14.936 96.818  1.00 22.91 ? 8    ILE A CG1 1 
ATOM   60    C  CG2 . ILE A  1 8   ? 7.892  17.124 96.308  1.00 23.32 ? 8    ILE A CG2 1 
ATOM   61    C  CD1 . ILE A  1 8   ? 8.681  14.299 95.475  1.00 26.11 ? 8    ILE A CD1 1 
ATOM   62    N  N   . GLN A  1 9   ? 5.923  17.156 99.568  1.00 29.87 ? 9    GLN A N   1 
ATOM   63    C  CA  . GLN A  1 9   ? 4.952  18.183 99.918  1.00 34.19 ? 9    GLN A CA  1 
ATOM   64    C  C   . GLN A  1 9   ? 5.496  19.060 101.044 1.00 34.78 ? 9    GLN A C   1 
ATOM   65    O  O   . GLN A  1 9   ? 5.328  20.286 101.012 1.00 36.04 ? 9    GLN A O   1 
ATOM   66    C  CB  . GLN A  1 9   ? 3.613  17.557 100.317 1.00 36.55 ? 9    GLN A CB  1 
ATOM   67    C  CG  . GLN A  1 9   ? 2.799  17.031 99.131  1.00 40.82 ? 9    GLN A CG  1 
ATOM   68    C  CD  . GLN A  1 9   ? 1.398  16.589 99.536  1.00 46.51 ? 9    GLN A CD  1 
ATOM   69    O  OE1 . GLN A  1 9   ? 1.213  15.555 100.194 1.00 49.00 ? 9    GLN A OE1 1 
ATOM   70    N  NE2 . GLN A  1 9   ? 0.401  17.379 99.151  1.00 48.30 ? 9    GLN A NE2 1 
ATOM   71    N  N   . HIS A  1 10  ? 6.151  18.438 102.029 1.00 33.36 ? 10   HIS A N   1 
ATOM   72    C  CA  . HIS A  1 10  ? 6.745  19.178 103.143 1.00 31.64 ? 10   HIS A CA  1 
ATOM   73    C  C   . HIS A  1 10  ? 7.841  20.069 102.587 1.00 30.76 ? 10   HIS A C   1 
ATOM   74    O  O   . HIS A  1 10  ? 7.851  21.282 102.827 1.00 30.09 ? 10   HIS A O   1 
ATOM   75    C  CB  . HIS A  1 10  ? 7.356  18.228 104.169 1.00 37.35 ? 10   HIS A CB  1 
ATOM   76    C  CG  . HIS A  1 10  ? 6.392  17.765 105.213 1.00 42.62 ? 10   HIS A CG  1 
ATOM   77    N  ND1 . HIS A  1 10  ? 5.816  18.625 106.125 1.00 44.04 ? 10   HIS A ND1 1 
ATOM   78    C  CD2 . HIS A  1 10  ? 5.911  16.531 105.500 1.00 43.07 ? 10   HIS A CD2 1 
ATOM   79    C  CE1 . HIS A  1 10  ? 5.024  17.938 106.930 1.00 46.74 ? 10   HIS A CE1 1 
ATOM   80    N  NE2 . HIS A  1 10  ? 5.064  16.665 106.573 1.00 43.87 ? 10   HIS A NE2 1 
ATOM   81    N  N   . LEU A  1 11  ? 8.768  19.454 101.851 1.00 27.89 ? 11   LEU A N   1 
ATOM   82    C  CA  . LEU A  1 11  ? 9.866  20.176 101.220 1.00 25.61 ? 11   LEU A CA  1 
ATOM   83    C  C   . LEU A  1 11  ? 9.320  21.417 100.516 1.00 27.57 ? 11   LEU A C   1 
ATOM   84    O  O   . LEU A  1 11  ? 9.810  22.533 100.711 1.00 26.19 ? 11   LEU A O   1 
ATOM   85    C  CB  . LEU A  1 11  ? 10.562 19.265 100.218 1.00 21.39 ? 11   LEU A CB  1 
ATOM   86    C  CG  . LEU A  1 11  ? 11.770 18.527 100.783 1.00 19.56 ? 11   LEU A CG  1 
ATOM   87    C  CD1 . LEU A  1 11  ? 11.460 18.037 102.170 1.00 23.61 ? 11   LEU A CD1 1 
ATOM   88    C  CD2 . LEU A  1 11  ? 12.150 17.374 99.856  1.00 19.63 ? 11   LEU A CD2 1 
ATOM   89    N  N   . ASN A  1 12  ? 8.295  21.215 99.699  1.00 29.62 ? 12   ASN A N   1 
ATOM   90    C  CA  . ASN A  1 12  ? 7.665  22.319 98.993  1.00 34.29 ? 12   ASN A CA  1 
ATOM   91    C  C   . ASN A  1 12  ? 7.191  23.385 99.984  1.00 35.44 ? 12   ASN A C   1 
ATOM   92    O  O   . ASN A  1 12  ? 7.373  24.586 99.757  1.00 34.69 ? 12   ASN A O   1 
ATOM   93    C  CB  . ASN A  1 12  ? 6.489  21.794 98.180  1.00 35.70 ? 12   ASN A CB  1 
ATOM   94    C  CG  . ASN A  1 12  ? 6.743  21.868 96.700  1.00 37.35 ? 12   ASN A CG  1 
ATOM   95    O  OD1 . ASN A  1 12  ? 6.286  21.017 95.935  1.00 34.64 ? 12   ASN A OD1 1 
ATOM   96    N  ND2 . ASN A  1 12  ? 7.470  22.901 96.279  1.00 41.59 ? 12   ASN A ND2 1 
ATOM   97    N  N   . LYS A  1 13  ? 6.589  22.940 101.083 1.00 36.75 ? 13   LYS A N   1 
ATOM   98    C  CA  . LYS A  1 13  ? 6.107  23.853 102.108 1.00 38.92 ? 13   LYS A CA  1 
ATOM   99    C  C   . LYS A  1 13  ? 7.267  24.629 102.716 1.00 38.73 ? 13   LYS A C   1 
ATOM   100   O  O   . LYS A  1 13  ? 7.230  25.855 102.798 1.00 39.19 ? 13   LYS A O   1 
ATOM   101   C  CB  . LYS A  1 13  ? 5.373  23.087 103.208 1.00 42.10 ? 13   LYS A CB  1 
ATOM   102   C  CG  . LYS A  1 13  ? 4.935  23.982 104.352 1.00 49.55 ? 13   LYS A CG  1 
ATOM   103   C  CD  . LYS A  1 13  ? 3.989  23.284 105.315 1.00 54.84 ? 13   LYS A CD  1 
ATOM   104   C  CE  . LYS A  1 13  ? 3.374  24.290 106.281 1.00 55.62 ? 13   LYS A CE  1 
ATOM   105   N  NZ  . LYS A  1 13  ? 2.335  23.670 107.146 1.00 59.53 ? 13   LYS A NZ  1 
ATOM   106   N  N   . ILE A  1 14  ? 8.297  23.911 103.149 1.00 37.05 ? 14   ILE A N   1 
ATOM   107   C  CA  . ILE A  1 14  ? 9.462  24.551 103.741 1.00 35.74 ? 14   ILE A CA  1 
ATOM   108   C  C   . ILE A  1 14  ? 10.011 25.592 102.767 1.00 35.97 ? 14   ILE A C   1 
ATOM   109   O  O   . ILE A  1 14  ? 10.344 26.706 103.164 1.00 36.68 ? 14   ILE A O   1 
ATOM   110   C  CB  . ILE A  1 14  ? 10.578 23.506 104.064 1.00 36.27 ? 14   ILE A CB  1 
ATOM   111   C  CG1 . ILE A  1 14  ? 10.117 22.556 105.174 1.00 31.87 ? 14   ILE A CG1 1 
ATOM   112   C  CG2 . ILE A  1 14  ? 11.845 24.212 104.517 1.00 39.86 ? 14   ILE A CG2 1 
ATOM   113   C  CD1 . ILE A  1 14  ? 9.771  23.260 106.472 1.00 24.43 ? 14   ILE A CD1 1 
ATOM   114   N  N   . LEU A  1 15  ? 10.088 25.225 101.490 1.00 36.82 ? 15   LEU A N   1 
ATOM   115   C  CA  . LEU A  1 15  ? 10.604 26.112 100.443 1.00 36.94 ? 15   LEU A CA  1 
ATOM   116   C  C   . LEU A  1 15  ? 9.892  27.460 100.354 1.00 37.19 ? 15   LEU A C   1 
ATOM   117   O  O   . LEU A  1 15  ? 10.520 28.488 100.091 1.00 36.82 ? 15   LEU A O   1 
ATOM   118   C  CB  . LEU A  1 15  ? 10.534 25.414 99.078  1.00 36.54 ? 15   LEU A CB  1 
ATOM   119   C  CG  . LEU A  1 15  ? 10.872 26.268 97.849  1.00 35.21 ? 15   LEU A CG  1 
ATOM   120   C  CD1 . LEU A  1 15  ? 12.236 26.924 98.028  1.00 34.84 ? 15   LEU A CD1 1 
ATOM   121   C  CD2 . LEU A  1 15  ? 10.852 25.402 96.602  1.00 30.12 ? 15   LEU A CD2 1 
ATOM   122   N  N   . GLY A  1 16  ? 8.578  27.456 100.545 1.00 37.25 ? 16   GLY A N   1 
ATOM   123   C  CA  . GLY A  1 16  ? 7.844  28.704 100.490 1.00 38.39 ? 16   GLY A CA  1 
ATOM   124   C  C   . GLY A  1 16  ? 8.313  29.643 101.589 1.00 40.92 ? 16   GLY A C   1 
ATOM   125   O  O   . GLY A  1 16  ? 8.493  30.842 101.360 1.00 43.52 ? 16   GLY A O   1 
ATOM   126   N  N   . ASN A  1 17  ? 8.518  29.094 102.784 1.00 39.79 ? 17   ASN A N   1 
ATOM   127   C  CA  . ASN A  1 17  ? 8.969  29.873 103.940 1.00 40.72 ? 17   ASN A CA  1 
ATOM   128   C  C   . ASN A  1 17  ? 10.298 30.575 103.676 1.00 38.42 ? 17   ASN A C   1 
ATOM   129   O  O   . ASN A  1 17  ? 10.467 31.747 104.022 1.00 37.07 ? 17   ASN A O   1 
ATOM   130   C  CB  . ASN A  1 17  ? 9.121  28.966 105.182 1.00 42.79 ? 17   ASN A CB  1 
ATOM   131   C  CG  . ASN A  1 17  ? 7.777  28.554 105.796 1.00 43.70 ? 17   ASN A CG  1 
ATOM   132   O  OD1 . ASN A  1 17  ? 7.717  27.643 106.622 1.00 41.04 ? 17   ASN A OD1 1 
ATOM   133   N  ND2 . ASN A  1 17  ? 6.701  29.234 105.399 1.00 46.42 ? 17   ASN A ND2 1 
ATOM   134   N  N   . GLU A  1 18  ? 11.238 29.858 103.069 1.00 36.76 ? 18   GLU A N   1 
ATOM   135   C  CA  . GLU A  1 18  ? 12.547 30.427 102.792 1.00 39.11 ? 18   GLU A CA  1 
ATOM   136   C  C   . GLU A  1 18  ? 12.406 31.622 101.854 1.00 39.79 ? 18   GLU A C   1 
ATOM   137   O  O   . GLU A  1 18  ? 12.966 32.689 102.112 1.00 41.53 ? 18   GLU A O   1 
ATOM   138   C  CB  . GLU A  1 18  ? 13.471 29.383 102.160 1.00 38.46 ? 18   GLU A CB  1 
ATOM   139   C  CG  . GLU A  1 18  ? 13.789 28.182 103.042 1.00 38.57 ? 18   GLU A CG  1 
ATOM   140   C  CD  . GLU A  1 18  ? 14.393 28.565 104.388 1.00 41.07 ? 18   GLU A CD  1 
ATOM   141   O  OE1 . GLU A  1 18  ? 15.037 29.635 104.482 1.00 44.97 ? 18   GLU A OE1 1 
ATOM   142   O  OE2 . GLU A  1 18  ? 14.233 27.781 105.350 1.00 41.16 ? 18   GLU A OE2 1 
ATOM   143   N  N   . LEU A  1 19  ? 11.668 31.427 100.763 1.00 40.80 ? 19   LEU A N   1 
ATOM   144   C  CA  . LEU A  1 19  ? 11.453 32.483 99.775  1.00 39.69 ? 19   LEU A CA  1 
ATOM   145   C  C   . LEU A  1 19  ? 10.926 33.739 100.457 1.00 39.43 ? 19   LEU A C   1 
ATOM   146   O  O   . LEU A  1 19  ? 11.224 34.853 100.027 1.00 42.19 ? 19   LEU A O   1 
ATOM   147   C  CB  . LEU A  1 19  ? 10.478 32.010 98.691  1.00 35.94 ? 19   LEU A CB  1 
ATOM   148   C  CG  . LEU A  1 19  ? 10.939 30.781 97.889  1.00 34.37 ? 19   LEU A CG  1 
ATOM   149   C  CD1 . LEU A  1 19  ? 9.834  30.336 96.951  1.00 29.20 ? 19   LEU A CD1 1 
ATOM   150   C  CD2 . LEU A  1 19  ? 12.219 31.104 97.112  1.00 27.49 ? 19   LEU A CD2 1 
ATOM   151   N  N   . ILE A  1 20  ? 10.153 33.558 101.524 1.00 37.95 ? 20   ILE A N   1 
ATOM   152   C  CA  . ILE A  1 20  ? 9.618  34.688 102.275 1.00 38.58 ? 20   ILE A CA  1 
ATOM   153   C  C   . ILE A  1 20  ? 10.774 35.317 103.064 1.00 36.49 ? 20   ILE A C   1 
ATOM   154   O  O   . ILE A  1 20  ? 10.973 36.534 103.052 1.00 35.07 ? 20   ILE A O   1 
ATOM   155   C  CB  . ILE A  1 20  ? 8.509  34.232 103.273 1.00 42.07 ? 20   ILE A CB  1 
ATOM   156   C  CG1 . ILE A  1 20  ? 7.335  33.619 102.505 1.00 46.81 ? 20   ILE A CG1 1 
ATOM   157   C  CG2 . ILE A  1 20  ? 8.013  35.418 104.108 1.00 41.23 ? 20   ILE A CG2 1 
ATOM   158   C  CD1 . ILE A  1 20  ? 6.209  33.103 103.399 1.00 46.68 ? 20   ILE A CD1 1 
ATOM   159   N  N   . ALA A  1 21  ? 11.539 34.477 103.751 1.00 33.87 ? 21   ALA A N   1 
ATOM   160   C  CA  . ALA A  1 21  ? 12.657 34.964 104.534 1.00 30.42 ? 21   ALA A CA  1 
ATOM   161   C  C   . ALA A  1 21  ? 13.542 35.819 103.635 1.00 30.20 ? 21   ALA A C   1 
ATOM   162   O  O   . ALA A  1 21  ? 13.835 36.974 103.948 1.00 30.22 ? 21   ALA A O   1 
ATOM   163   C  CB  . ALA A  1 21  ? 13.439 33.793 105.102 1.00 26.28 ? 21   ALA A CB  1 
ATOM   164   N  N   . ILE A  1 22  ? 13.943 35.247 102.503 1.00 31.81 ? 22   ILE A N   1 
ATOM   165   C  CA  . ILE A  1 22  ? 14.799 35.924 101.535 1.00 29.75 ? 22   ILE A CA  1 
ATOM   166   C  C   . ILE A  1 22  ? 14.369 37.364 101.277 1.00 28.24 ? 22   ILE A C   1 
ATOM   167   O  O   . ILE A  1 22  ? 15.172 38.289 101.391 1.00 26.64 ? 22   ILE A O   1 
ATOM   168   C  CB  . ILE A  1 22  ? 14.781 35.192 100.188 1.00 34.40 ? 22   ILE A CB  1 
ATOM   169   C  CG1 . ILE A  1 22  ? 15.118 33.720 100.394 1.00 35.58 ? 22   ILE A CG1 1 
ATOM   170   C  CG2 . ILE A  1 22  ? 15.782 35.836 99.221  1.00 35.34 ? 22   ILE A CG2 1 
ATOM   171   C  CD1 . ILE A  1 22  ? 14.987 32.909 99.130  1.00 38.74 ? 22   ILE A CD1 1 
ATOM   172   N  N   . ASN A  1 23  ? 13.100 37.539 100.926 1.00 25.69 ? 23   ASN A N   1 
ATOM   173   C  CA  . ASN A  1 23  ? 12.556 38.857 100.616 1.00 30.17 ? 23   ASN A CA  1 
ATOM   174   C  C   . ASN A  1 23  ? 12.416 39.794 101.804 1.00 29.87 ? 23   ASN A C   1 
ATOM   175   O  O   . ASN A  1 23  ? 12.652 41.004 101.686 1.00 28.88 ? 23   ASN A O   1 
ATOM   176   C  CB  . ASN A  1 23  ? 11.194 38.713 99.931  1.00 32.82 ? 23   ASN A CB  1 
ATOM   177   C  CG  . ASN A  1 23  ? 11.306 38.165 98.520  1.00 34.50 ? 23   ASN A CG  1 
ATOM   178   O  OD1 . ASN A  1 23  ? 12.312 37.542 98.156  1.00 34.35 ? 23   ASN A OD1 1 
ATOM   179   N  ND2 . ASN A  1 23  ? 10.266 38.383 97.718  1.00 31.58 ? 23   ASN A ND2 1 
ATOM   180   N  N   . GLN A  1 24  ? 12.013 39.252 102.945 1.00 30.57 ? 24   GLN A N   1 
ATOM   181   C  CA  . GLN A  1 24  ? 11.850 40.087 104.121 1.00 30.79 ? 24   GLN A CA  1 
ATOM   182   C  C   . GLN A  1 24  ? 13.208 40.566 104.614 1.00 31.69 ? 24   GLN A C   1 
ATOM   183   O  O   . GLN A  1 24  ? 13.385 41.737 104.953 1.00 30.72 ? 24   GLN A O   1 
ATOM   184   C  CB  . GLN A  1 24  ? 11.131 39.315 105.215 1.00 30.31 ? 24   GLN A CB  1 
ATOM   185   C  CG  . GLN A  1 24  ? 11.067 40.051 106.530 1.00 30.00 ? 24   GLN A CG  1 
ATOM   186   C  CD  . GLN A  1 24  ? 10.117 39.398 107.492 1.00 28.09 ? 24   GLN A CD  1 
ATOM   187   O  OE1 . GLN A  1 24  ? 10.279 39.501 108.701 1.00 31.30 ? 24   GLN A OE1 1 
ATOM   188   N  NE2 . GLN A  1 24  ? 9.106  38.725 106.960 1.00 26.53 ? 24   GLN A NE2 1 
ATOM   189   N  N   . TYR A  1 25  ? 14.178 39.663 104.636 1.00 33.15 ? 25   TYR A N   1 
ATOM   190   C  CA  . TYR A  1 25  ? 15.509 40.032 105.094 1.00 35.06 ? 25   TYR A CA  1 
ATOM   191   C  C   . TYR A  1 25  ? 16.172 40.989 104.103 1.00 34.41 ? 25   TYR A C   1 
ATOM   192   O  O   . TYR A  1 25  ? 16.897 41.903 104.497 1.00 33.36 ? 25   TYR A O   1 
ATOM   193   C  CB  . TYR A  1 25  ? 16.368 38.771 105.295 1.00 33.78 ? 25   TYR A CB  1 
ATOM   194   C  CG  . TYR A  1 25  ? 15.842 37.842 106.379 1.00 35.77 ? 25   TYR A CG  1 
ATOM   195   C  CD1 . TYR A  1 25  ? 14.557 38.011 106.903 1.00 38.24 ? 25   TYR A CD1 1 
ATOM   196   C  CD2 . TYR A  1 25  ? 16.603 36.764 106.840 1.00 35.71 ? 25   TYR A CD2 1 
ATOM   197   C  CE1 . TYR A  1 25  ? 14.040 37.139 107.844 1.00 38.77 ? 25   TYR A CE1 1 
ATOM   198   C  CE2 . TYR A  1 25  ? 16.095 35.881 107.788 1.00 37.13 ? 25   TYR A CE2 1 
ATOM   199   C  CZ  . TYR A  1 25  ? 14.807 36.076 108.283 1.00 40.53 ? 25   TYR A CZ  1 
ATOM   200   O  OH  . TYR A  1 25  ? 14.264 35.211 109.209 1.00 41.44 ? 25   TYR A OH  1 
ATOM   201   N  N   . PHE A  1 26  ? 15.909 40.799 102.818 1.00 34.39 ? 26   PHE A N   1 
ATOM   202   C  CA  . PHE A  1 26  ? 16.524 41.674 101.842 1.00 35.89 ? 26   PHE A CA  1 
ATOM   203   C  C   . PHE A  1 26  ? 15.992 43.078 101.976 1.00 34.25 ? 26   PHE A C   1 
ATOM   204   O  O   . PHE A  1 26  ? 16.742 44.044 101.845 1.00 35.23 ? 26   PHE A O   1 
ATOM   205   C  CB  . PHE A  1 26  ? 16.287 41.194 100.416 1.00 39.68 ? 26   PHE A CB  1 
ATOM   206   C  CG  . PHE A  1 26  ? 17.405 41.553 99.495  1.00 46.18 ? 26   PHE A CG  1 
ATOM   207   C  CD1 . PHE A  1 26  ? 18.544 40.747 99.425  1.00 48.74 ? 26   PHE A CD1 1 
ATOM   208   C  CD2 . PHE A  1 26  ? 17.375 42.746 98.777  1.00 48.61 ? 26   PHE A CD2 1 
ATOM   209   C  CE1 . PHE A  1 26  ? 19.647 41.131 98.654  1.00 54.98 ? 26   PHE A CE1 1 
ATOM   210   C  CE2 . PHE A  1 26  ? 18.471 43.145 98.000  1.00 52.91 ? 26   PHE A CE2 1 
ATOM   211   C  CZ  . PHE A  1 26  ? 19.612 42.339 97.937  1.00 54.04 ? 26   PHE A CZ  1 
ATOM   212   N  N   . LEU A  1 27  ? 14.694 43.193 102.239 1.00 34.04 ? 27   LEU A N   1 
ATOM   213   C  CA  . LEU A  1 27  ? 14.074 44.504 102.386 1.00 32.56 ? 27   LEU A CA  1 
ATOM   214   C  C   . LEU A  1 27  ? 14.582 45.201 103.636 1.00 30.85 ? 27   LEU A C   1 
ATOM   215   O  O   . LEU A  1 27  ? 14.927 46.384 103.593 1.00 31.51 ? 27   LEU A O   1 
ATOM   216   C  CB  . LEU A  1 27  ? 12.547 44.391 102.444 1.00 30.77 ? 27   LEU A CB  1 
ATOM   217   C  CG  . LEU A  1 27  ? 11.871 45.758 102.631 1.00 29.67 ? 27   LEU A CG  1 
ATOM   218   C  CD1 . LEU A  1 27  ? 12.227 46.669 101.452 1.00 23.43 ? 27   LEU A CD1 1 
ATOM   219   C  CD2 . LEU A  1 27  ? 10.362 45.587 102.741 1.00 27.50 ? 27   LEU A CD2 1 
ATOM   220   N  N   . HIS A  1 28  ? 14.625 44.471 104.748 1.00 29.16 ? 28   HIS A N   1 
ATOM   221   C  CA  . HIS A  1 28  ? 15.112 45.042 106.000 1.00 30.69 ? 28   HIS A CA  1 
ATOM   222   C  C   . HIS A  1 28  ? 16.562 45.510 105.829 1.00 30.67 ? 28   HIS A C   1 
ATOM   223   O  O   . HIS A  1 28  ? 16.928 46.616 106.244 1.00 30.49 ? 28   HIS A O   1 
ATOM   224   C  CB  . HIS A  1 28  ? 15.011 44.009 107.132 1.00 29.49 ? 28   HIS A CB  1 
ATOM   225   C  CG  . HIS A  1 28  ? 13.606 43.749 107.590 1.00 27.12 ? 28   HIS A CG  1 
ATOM   226   N  ND1 . HIS A  1 28  ? 13.276 42.704 108.429 1.00 25.76 ? 28   HIS A ND1 1 
ATOM   227   C  CD2 . HIS A  1 28  ? 12.448 44.400 107.329 1.00 26.00 ? 28   HIS A CD2 1 
ATOM   228   C  CE1 . HIS A  1 28  ? 11.976 42.721 108.662 1.00 25.04 ? 28   HIS A CE1 1 
ATOM   229   N  NE2 . HIS A  1 28  ? 11.450 43.742 108.007 1.00 28.18 ? 28   HIS A NE2 1 
ATOM   230   N  N   . ALA A  1 29  ? 17.377 44.667 105.205 1.00 29.64 ? 29   ALA A N   1 
ATOM   231   C  CA  . ALA A  1 29  ? 18.776 44.986 104.963 1.00 29.72 ? 29   ALA A CA  1 
ATOM   232   C  C   . ALA A  1 29  ? 18.944 46.314 104.240 1.00 29.47 ? 29   ALA A C   1 
ATOM   233   O  O   . ALA A  1 29  ? 19.791 47.119 104.621 1.00 30.22 ? 29   ALA A O   1 
ATOM   234   C  CB  . ALA A  1 29  ? 19.431 43.881 104.155 1.00 31.18 ? 29   ALA A CB  1 
ATOM   235   N  N   . ARG A  1 30  ? 18.153 46.546 103.195 1.00 30.34 ? 30   ARG A N   1 
ATOM   236   C  CA  . ARG A  1 30  ? 18.254 47.802 102.442 1.00 31.41 ? 30   ARG A CA  1 
ATOM   237   C  C   . ARG A  1 30  ? 17.744 48.974 103.243 1.00 29.03 ? 30   ARG A C   1 
ATOM   238   O  O   . ARG A  1 30  ? 18.243 50.089 103.106 1.00 29.21 ? 30   ARG A O   1 
ATOM   239   C  CB  . ARG A  1 30  ? 17.479 47.724 101.131 1.00 34.01 ? 30   ARG A CB  1 
ATOM   240   C  CG  . ARG A  1 30  ? 18.037 46.689 100.204 1.00 40.56 ? 30   ARG A CG  1 
ATOM   241   C  CD  . ARG A  1 30  ? 19.503 46.945 99.963  1.00 42.23 ? 30   ARG A CD  1 
ATOM   242   N  NE  . ARG A  1 30  ? 20.190 45.705 99.641  1.00 48.89 ? 30   ARG A NE  1 
ATOM   243   C  CZ  . ARG A  1 30  ? 21.491 45.619 99.397  1.00 51.87 ? 30   ARG A CZ  1 
ATOM   244   N  NH1 . ARG A  1 30  ? 22.245 46.712 99.436  1.00 51.50 ? 30   ARG A NH1 1 
ATOM   245   N  NH2 . ARG A  1 30  ? 22.034 44.438 99.125  1.00 51.67 ? 30   ARG A NH2 1 
ATOM   246   N  N   . MET A  1 31  ? 16.740 48.721 104.074 1.00 28.17 ? 31   MET A N   1 
ATOM   247   C  CA  . MET A  1 31  ? 16.180 49.763 104.916 1.00 25.47 ? 31   MET A CA  1 
ATOM   248   C  C   . MET A  1 31  ? 17.235 50.201 105.931 1.00 25.49 ? 31   MET A C   1 
ATOM   249   O  O   . MET A  1 31  ? 17.474 51.401 106.114 1.00 22.76 ? 31   MET A O   1 
ATOM   250   C  CB  . MET A  1 31  ? 14.933 49.236 105.620 1.00 26.40 ? 31   MET A CB  1 
ATOM   251   C  CG  . MET A  1 31  ? 13.749 49.007 104.692 1.00 22.52 ? 31   MET A CG  1 
ATOM   252   S  SD  . MET A  1 31  ? 12.310 48.349 105.577 1.00 27.95 ? 31   MET A SD  1 
ATOM   253   C  CE  . MET A  1 31  ? 11.969 49.718 106.709 1.00 20.68 ? 31   MET A CE  1 
ATOM   254   N  N   . TYR A  1 32  ? 17.866 49.223 106.583 1.00 25.95 ? 32   TYR A N   1 
ATOM   255   C  CA  . TYR A  1 32  ? 18.910 49.500 107.567 1.00 28.28 ? 32   TYR A CA  1 
ATOM   256   C  C   . TYR A  1 32  ? 19.999 50.342 106.931 1.00 30.69 ? 32   TYR A C   1 
ATOM   257   O  O   . TYR A  1 32  ? 20.380 51.402 107.455 1.00 31.49 ? 32   TYR A O   1 
ATOM   258   C  CB  . TYR A  1 32  ? 19.534 48.204 108.072 1.00 27.54 ? 32   TYR A CB  1 
ATOM   259   C  CG  . TYR A  1 32  ? 18.679 47.447 109.059 1.00 29.52 ? 32   TYR A CG  1 
ATOM   260   C  CD1 . TYR A  1 32  ? 18.605 46.051 109.011 1.00 26.59 ? 32   TYR A CD1 1 
ATOM   261   C  CD2 . TYR A  1 32  ? 17.945 48.116 110.047 1.00 25.64 ? 32   TYR A CD2 1 
ATOM   262   C  CE1 . TYR A  1 32  ? 17.821 45.338 109.914 1.00 24.02 ? 32   TYR A CE1 1 
ATOM   263   C  CE2 . TYR A  1 32  ? 17.153 47.401 110.963 1.00 25.48 ? 32   TYR A CE2 1 
ATOM   264   C  CZ  . TYR A  1 32  ? 17.100 46.013 110.884 1.00 25.11 ? 32   TYR A CZ  1 
ATOM   265   O  OH  . TYR A  1 32  ? 16.329 45.281 111.765 1.00 29.02 ? 32   TYR A OH  1 
ATOM   266   N  N   . GLU A  1 33  ? 20.501 49.859 105.799 1.00 31.43 ? 33   GLU A N   1 
ATOM   267   C  CA  . GLU A  1 33  ? 21.550 50.557 105.072 1.00 32.17 ? 33   GLU A CA  1 
ATOM   268   C  C   . GLU A  1 33  ? 21.051 51.929 104.615 1.00 31.97 ? 33   GLU A C   1 
ATOM   269   O  O   . GLU A  1 33  ? 21.816 52.883 104.533 1.00 32.70 ? 33   GLU A O   1 
ATOM   270   C  CB  . GLU A  1 33  ? 22.034 49.666 103.913 1.00 34.23 ? 33   GLU A CB  1 
ATOM   271   C  CG  . GLU A  1 33  ? 22.645 48.334 104.473 1.00 43.81 ? 33   GLU A CG  1 
ATOM   272   C  CD  . GLU A  1 33  ? 23.125 47.319 103.428 1.00 42.27 ? 33   GLU A CD  1 
ATOM   273   O  OE1 . GLU A  1 33  ? 22.325 46.922 102.554 1.00 47.39 ? 33   GLU A OE1 1 
ATOM   274   O  OE2 . GLU A  1 33  ? 24.300 46.898 103.500 1.00 37.47 ? 33   GLU A OE2 1 
ATOM   275   N  N   . ASP A  1 34  ? 19.750 52.041 104.374 1.00 33.83 ? 34   ASP A N   1 
ATOM   276   C  CA  . ASP A  1 34  ? 19.163 53.308 103.953 1.00 32.42 ? 34   ASP A CA  1 
ATOM   277   C  C   . ASP A  1 34  ? 19.152 54.310 105.099 1.00 33.35 ? 34   ASP A C   1 
ATOM   278   O  O   . ASP A  1 34  ? 19.201 55.521 104.876 1.00 34.34 ? 34   ASP A O   1 
ATOM   279   C  CB  . ASP A  1 34  ? 17.730 53.099 103.456 1.00 33.31 ? 34   ASP A CB  1 
ATOM   280   C  CG  . ASP A  1 34  ? 17.046 54.404 103.105 1.00 35.56 ? 34   ASP A CG  1 
ATOM   281   O  OD1 . ASP A  1 34  ? 17.564 55.118 102.219 1.00 38.26 ? 34   ASP A OD1 1 
ATOM   282   O  OD2 . ASP A  1 34  ? 15.999 54.721 103.715 1.00 36.69 ? 34   ASP A OD2 1 
ATOM   283   N  N   . TRP A  1 35  ? 19.071 53.804 106.326 1.00 33.35 ? 35   TRP A N   1 
ATOM   284   C  CA  . TRP A  1 35  ? 19.051 54.671 107.499 1.00 31.62 ? 35   TRP A CA  1 
ATOM   285   C  C   . TRP A  1 35  ? 20.453 54.974 107.994 1.00 32.22 ? 35   TRP A C   1 
ATOM   286   O  O   . TRP A  1 35  ? 20.655 55.874 108.809 1.00 34.71 ? 35   TRP A O   1 
ATOM   287   C  CB  . TRP A  1 35  ? 18.250 54.032 108.634 1.00 30.70 ? 35   TRP A CB  1 
ATOM   288   C  CG  . TRP A  1 35  ? 16.785 53.932 108.371 1.00 28.48 ? 35   TRP A CG  1 
ATOM   289   C  CD1 . TRP A  1 35  ? 16.008 54.848 107.731 1.00 25.82 ? 35   TRP A CD1 1 
ATOM   290   C  CD2 . TRP A  1 35  ? 15.897 52.905 108.835 1.00 26.92 ? 35   TRP A CD2 1 
ATOM   291   N  NE1 . TRP A  1 35  ? 14.689 54.462 107.774 1.00 25.78 ? 35   TRP A NE1 1 
ATOM   292   C  CE2 . TRP A  1 35  ? 14.593 53.273 108.446 1.00 26.45 ? 35   TRP A CE2 1 
ATOM   293   C  CE3 . TRP A  1 35  ? 16.077 51.714 109.546 1.00 27.03 ? 35   TRP A CE3 1 
ATOM   294   C  CZ2 . TRP A  1 35  ? 13.469 52.491 108.747 1.00 26.31 ? 35   TRP A CZ2 1 
ATOM   295   C  CZ3 . TRP A  1 35  ? 14.959 50.938 109.846 1.00 26.52 ? 35   TRP A CZ3 1 
ATOM   296   C  CH2 . TRP A  1 35  ? 13.672 51.333 109.445 1.00 24.30 ? 35   TRP A CH2 1 
ATOM   297   N  N   . GLY A  1 36  ? 21.423 54.208 107.517 1.00 33.05 ? 36   GLY A N   1 
ATOM   298   C  CA  . GLY A  1 36  ? 22.790 54.438 107.935 1.00 31.87 ? 36   GLY A CA  1 
ATOM   299   C  C   . GLY A  1 36  ? 23.299 53.436 108.944 1.00 32.84 ? 36   GLY A C   1 
ATOM   300   O  O   . GLY A  1 36  ? 24.330 53.659 109.574 1.00 35.52 ? 36   GLY A O   1 
ATOM   301   N  N   . LEU A  1 37  ? 22.598 52.319 109.094 1.00 32.83 ? 37   LEU A N   1 
ATOM   302   C  CA  . LEU A  1 37  ? 23.021 51.306 110.052 1.00 32.50 ? 37   LEU A CA  1 
ATOM   303   C  C   . LEU A  1 37  ? 23.790 50.166 109.364 1.00 32.60 ? 37   LEU A C   1 
ATOM   304   O  O   . LEU A  1 37  ? 23.319 49.024 109.299 1.00 28.66 ? 37   LEU A O   1 
ATOM   305   C  CB  . LEU A  1 37  ? 21.789 50.785 110.802 1.00 32.10 ? 37   LEU A CB  1 
ATOM   306   C  CG  . LEU A  1 37  ? 20.910 51.909 111.374 1.00 31.27 ? 37   LEU A CG  1 
ATOM   307   C  CD1 . LEU A  1 37  ? 19.662 51.326 112.001 1.00 34.33 ? 37   LEU A CD1 1 
ATOM   308   C  CD2 . LEU A  1 37  ? 21.689 52.714 112.402 1.00 31.65 ? 37   LEU A CD2 1 
ATOM   309   N  N   . GLU A  1 38  ? 24.983 50.497 108.863 1.00 35.23 ? 38   GLU A N   1 
ATOM   310   C  CA  . GLU A  1 38  ? 25.848 49.546 108.157 1.00 38.37 ? 38   GLU A CA  1 
ATOM   311   C  C   . GLU A  1 38  ? 25.910 48.152 108.773 1.00 37.09 ? 38   GLU A C   1 
ATOM   312   O  O   . GLU A  1 38  ? 25.601 47.167 108.106 1.00 36.89 ? 38   GLU A O   1 
ATOM   313   C  CB  . GLU A  1 38  ? 27.273 50.103 108.035 1.00 42.63 ? 38   GLU A CB  1 
ATOM   314   C  CG  . GLU A  1 38  ? 27.456 51.146 106.927 1.00 55.46 ? 38   GLU A CG  1 
ATOM   315   C  CD  . GLU A  1 38  ? 28.795 51.890 107.003 1.00 60.80 ? 38   GLU A CD  1 
ATOM   316   O  OE1 . GLU A  1 38  ? 29.851 51.231 107.142 1.00 64.26 ? 38   GLU A OE1 1 
ATOM   317   O  OE2 . GLU A  1 38  ? 28.790 53.138 106.914 1.00 61.49 ? 38   GLU A OE2 1 
ATOM   318   N  N   . LYS A  1 39  ? 26.313 48.061 110.036 1.00 37.15 ? 39   LYS A N   1 
ATOM   319   C  CA  . LYS A  1 39  ? 26.407 46.759 110.691 1.00 35.98 ? 39   LYS A CA  1 
ATOM   320   C  C   . LYS A  1 39  ? 25.126 45.951 110.532 1.00 33.01 ? 39   LYS A C   1 
ATOM   321   O  O   . LYS A  1 39  ? 25.168 44.818 110.056 1.00 31.11 ? 39   LYS A O   1 
ATOM   322   C  CB  . LYS A  1 39  ? 26.751 46.921 112.175 1.00 38.50 ? 39   LYS A CB  1 
ATOM   323   C  CG  . LYS A  1 39  ? 28.210 47.279 112.427 1.00 43.99 ? 39   LYS A CG  1 
ATOM   324   C  CD  . LYS A  1 39  ? 28.548 47.227 113.907 1.00 51.80 ? 39   LYS A CD  1 
ATOM   325   C  CE  . LYS A  1 39  ? 28.261 45.850 114.509 1.00 55.02 ? 39   LYS A CE  1 
ATOM   326   N  NZ  . LYS A  1 39  ? 28.342 45.858 116.008 1.00 58.72 ? 39   LYS A NZ  1 
ATOM   327   N  N   . LEU A  1 40  ? 23.989 46.529 110.914 1.00 29.76 ? 40   LEU A N   1 
ATOM   328   C  CA  . LEU A  1 40  ? 22.713 45.831 110.781 1.00 29.37 ? 40   LEU A CA  1 
ATOM   329   C  C   . LEU A  1 40  ? 22.438 45.435 109.336 1.00 30.87 ? 40   LEU A C   1 
ATOM   330   O  O   . LEU A  1 40  ? 22.051 44.304 109.053 1.00 31.60 ? 40   LEU A O   1 
ATOM   331   C  CB  . LEU A  1 40  ? 21.577 46.706 111.296 1.00 27.12 ? 40   LEU A CB  1 
ATOM   332   C  CG  . LEU A  1 40  ? 21.384 46.642 112.805 1.00 23.48 ? 40   LEU A CG  1 
ATOM   333   C  CD1 . LEU A  1 40  ? 20.389 47.689 113.248 1.00 18.77 ? 40   LEU A CD1 1 
ATOM   334   C  CD2 . LEU A  1 40  ? 20.910 45.241 113.175 1.00 26.69 ? 40   LEU A CD2 1 
ATOM   335   N  N   . GLY A  1 41  ? 22.639 46.372 108.420 1.00 32.87 ? 41   GLY A N   1 
ATOM   336   C  CA  . GLY A  1 41  ? 22.417 46.076 107.019 1.00 34.80 ? 41   GLY A CA  1 
ATOM   337   C  C   . GLY A  1 41  ? 23.238 44.890 106.551 1.00 34.58 ? 41   GLY A C   1 
ATOM   338   O  O   . GLY A  1 41  ? 22.710 43.948 105.969 1.00 36.09 ? 41   GLY A O   1 
ATOM   339   N  N   . LYS A  1 42  ? 24.537 44.931 106.812 1.00 35.86 ? 42   LYS A N   1 
ATOM   340   C  CA  . LYS A  1 42  ? 25.429 43.857 106.407 1.00 37.38 ? 42   LYS A CA  1 
ATOM   341   C  C   . LYS A  1 42  ? 24.979 42.493 106.941 1.00 39.43 ? 42   LYS A C   1 
ATOM   342   O  O   . LYS A  1 42  ? 25.035 41.489 106.223 1.00 38.19 ? 42   LYS A O   1 
ATOM   343   C  CB  . LYS A  1 42  ? 26.846 44.166 106.881 1.00 39.83 ? 42   LYS A CB  1 
ATOM   344   C  CG  . LYS A  1 42  ? 27.898 43.180 106.412 1.00 47.41 ? 42   LYS A CG  1 
ATOM   345   C  CD  . LYS A  1 42  ? 29.252 43.490 107.056 1.00 54.56 ? 42   LYS A CD  1 
ATOM   346   C  CE  . LYS A  1 42  ? 30.313 42.455 106.690 1.00 57.21 ? 42   LYS A CE  1 
ATOM   347   N  NZ  . LYS A  1 42  ? 31.626 42.758 107.331 1.00 59.33 ? 42   LYS A NZ  1 
ATOM   348   N  N   . HIS A  1 43  ? 24.519 42.445 108.189 1.00 39.79 ? 43   HIS A N   1 
ATOM   349   C  CA  . HIS A  1 43  ? 24.088 41.171 108.747 1.00 40.52 ? 43   HIS A CA  1 
ATOM   350   C  C   . HIS A  1 43  ? 22.789 40.669 108.124 1.00 40.15 ? 43   HIS A C   1 
ATOM   351   O  O   . HIS A  1 43  ? 22.655 39.477 107.845 1.00 40.01 ? 43   HIS A O   1 
ATOM   352   C  CB  . HIS A  1 43  ? 23.923 41.250 110.261 1.00 43.47 ? 43   HIS A CB  1 
ATOM   353   C  CG  . HIS A  1 43  ? 23.932 39.908 110.927 1.00 51.66 ? 43   HIS A CG  1 
ATOM   354   N  ND1 . HIS A  1 43  ? 25.092 39.195 111.150 1.00 54.20 ? 43   HIS A ND1 1 
ATOM   355   C  CD2 . HIS A  1 43  ? 22.919 39.123 111.368 1.00 53.94 ? 43   HIS A CD2 1 
ATOM   356   C  CE1 . HIS A  1 43  ? 24.794 38.030 111.699 1.00 55.29 ? 43   HIS A CE1 1 
ATOM   357   N  NE2 . HIS A  1 43  ? 23.482 37.961 111.843 1.00 54.87 ? 43   HIS A NE2 1 
ATOM   358   N  N   . GLU A  1 44  ? 21.830 41.568 107.917 1.00 38.40 ? 44   GLU A N   1 
ATOM   359   C  CA  . GLU A  1 44  ? 20.560 41.177 107.305 1.00 37.25 ? 44   GLU A CA  1 
ATOM   360   C  C   . GLU A  1 44  ? 20.830 40.704 105.899 1.00 35.60 ? 44   GLU A C   1 
ATOM   361   O  O   . GLU A  1 44  ? 20.190 39.777 105.415 1.00 31.59 ? 44   GLU A O   1 
ATOM   362   C  CB  . GLU A  1 44  ? 19.594 42.352 107.262 1.00 38.60 ? 44   GLU A CB  1 
ATOM   363   C  CG  . GLU A  1 44  ? 18.958 42.608 108.587 1.00 41.87 ? 44   GLU A CG  1 
ATOM   364   C  CD  . GLU A  1 44  ? 18.051 41.483 108.971 1.00 43.61 ? 44   GLU A CD  1 
ATOM   365   O  OE1 . GLU A  1 44  ? 16.867 41.533 108.573 1.00 44.36 ? 44   GLU A OE1 1 
ATOM   366   O  OE2 . GLU A  1 44  ? 18.531 40.544 109.646 1.00 45.41 ? 44   GLU A OE2 1 
ATOM   367   N  N   . TYR A  1 45  ? 21.790 41.356 105.252 1.00 37.61 ? 45   TYR A N   1 
ATOM   368   C  CA  . TYR A  1 45  ? 22.173 41.003 103.898 1.00 41.16 ? 45   TYR A CA  1 
ATOM   369   C  C   . TYR A  1 45  ? 22.712 39.575 103.881 1.00 41.95 ? 45   TYR A C   1 
ATOM   370   O  O   . TYR A  1 45  ? 22.380 38.791 102.991 1.00 44.37 ? 45   TYR A O   1 
ATOM   371   C  CB  . TYR A  1 45  ? 23.246 41.958 103.368 1.00 41.16 ? 45   TYR A CB  1 
ATOM   372   C  CG  . TYR A  1 45  ? 23.616 41.675 101.934 1.00 42.37 ? 45   TYR A CG  1 
ATOM   373   C  CD1 . TYR A  1 45  ? 22.741 41.989 100.897 1.00 44.25 ? 45   TYR A CD1 1 
ATOM   374   C  CD2 . TYR A  1 45  ? 24.804 41.019 101.617 1.00 44.29 ? 45   TYR A CD2 1 
ATOM   375   C  CE1 . TYR A  1 45  ? 23.038 41.650 99.571  1.00 48.23 ? 45   TYR A CE1 1 
ATOM   376   C  CE2 . TYR A  1 45  ? 25.111 40.673 100.297 1.00 48.39 ? 45   TYR A CE2 1 
ATOM   377   C  CZ  . TYR A  1 45  ? 24.221 40.989 99.278  1.00 47.21 ? 45   TYR A CZ  1 
ATOM   378   O  OH  . TYR A  1 45  ? 24.493 40.617 97.981  1.00 44.48 ? 45   TYR A OH  1 
ATOM   379   N  N   . HIS A  1 46  ? 23.546 39.238 104.860 1.00 42.82 ? 46   HIS A N   1 
ATOM   380   C  CA  . HIS A  1 46  ? 24.094 37.893 104.923 1.00 44.32 ? 46   HIS A CA  1 
ATOM   381   C  C   . HIS A  1 46  ? 22.981 36.890 105.230 1.00 43.58 ? 46   HIS A C   1 
ATOM   382   O  O   . HIS A  1 46  ? 22.883 35.848 104.582 1.00 43.60 ? 46   HIS A O   1 
ATOM   383   C  CB  . HIS A  1 46  ? 25.190 37.804 105.981 1.00 48.10 ? 46   HIS A CB  1 
ATOM   384   C  CG  . HIS A  1 46  ? 25.752 36.424 106.150 1.00 55.70 ? 46   HIS A CG  1 
ATOM   385   N  ND1 . HIS A  1 46  ? 26.304 35.711 105.107 1.00 58.68 ? 46   HIS A ND1 1 
ATOM   386   C  CD2 . HIS A  1 46  ? 25.853 35.629 107.243 1.00 57.43 ? 46   HIS A CD2 1 
ATOM   387   C  CE1 . HIS A  1 46  ? 26.723 34.538 105.549 1.00 57.49 ? 46   HIS A CE1 1 
ATOM   388   N  NE2 . HIS A  1 46  ? 26.462 34.463 106.843 1.00 58.38 ? 46   HIS A NE2 1 
ATOM   389   N  N   . GLU A  1 47  ? 22.137 37.204 106.209 1.00 41.56 ? 47   GLU A N   1 
ATOM   390   C  CA  . GLU A  1 47  ? 21.039 36.313 106.552 1.00 41.42 ? 47   GLU A CA  1 
ATOM   391   C  C   . GLU A  1 47  ? 20.121 36.125 105.349 1.00 39.72 ? 47   GLU A C   1 
ATOM   392   O  O   . GLU A  1 47  ? 19.472 35.091 105.207 1.00 38.43 ? 47   GLU A O   1 
ATOM   393   C  CB  . GLU A  1 47  ? 20.235 36.866 107.727 1.00 45.00 ? 47   GLU A CB  1 
ATOM   394   C  CG  . GLU A  1 47  ? 20.685 36.363 109.095 1.00 56.39 ? 47   GLU A CG  1 
ATOM   395   C  CD  . GLU A  1 47  ? 19.691 36.732 110.206 1.00 63.86 ? 47   GLU A CD  1 
ATOM   396   O  OE1 . GLU A  1 47  ? 19.394 37.940 110.366 1.00 66.80 ? 47   GLU A OE1 1 
ATOM   397   O  OE2 . GLU A  1 47  ? 19.208 35.816 110.915 1.00 65.11 ? 47   GLU A OE2 1 
ATOM   398   N  N   . SER A  1 48  ? 20.063 37.137 104.488 1.00 38.94 ? 48   SER A N   1 
ATOM   399   C  CA  . SER A  1 48  ? 19.237 37.076 103.289 1.00 33.71 ? 48   SER A CA  1 
ATOM   400   C  C   . SER A  1 48  ? 19.843 36.030 102.364 1.00 32.59 ? 48   SER A C   1 
ATOM   401   O  O   . SER A  1 48  ? 19.144 35.170 101.818 1.00 27.64 ? 48   SER A O   1 
ATOM   402   C  CB  . SER A  1 48  ? 19.221 38.437 102.598 1.00 35.54 ? 48   SER A CB  1 
ATOM   403   O  OG  . SER A  1 48  ? 18.651 38.351 101.305 1.00 43.57 ? 48   SER A OG  1 
ATOM   404   N  N   . ILE A  1 49  ? 21.158 36.100 102.203 1.00 31.32 ? 49   ILE A N   1 
ATOM   405   C  CA  . ILE A  1 49  ? 21.851 35.157 101.349 1.00 34.58 ? 49   ILE A CA  1 
ATOM   406   C  C   . ILE A  1 49  ? 21.708 33.740 101.880 1.00 37.41 ? 49   ILE A C   1 
ATOM   407   O  O   . ILE A  1 49  ? 21.415 32.808 101.129 1.00 40.33 ? 49   ILE A O   1 
ATOM   408   C  CB  . ILE A  1 49  ? 23.320 35.511 101.250 1.00 33.42 ? 49   ILE A CB  1 
ATOM   409   C  CG1 . ILE A  1 49  ? 23.449 36.920 100.671 1.00 38.01 ? 49   ILE A CG1 1 
ATOM   410   C  CG2 . ILE A  1 49  ? 24.041 34.494 100.390 1.00 29.62 ? 49   ILE A CG2 1 
ATOM   411   C  CD1 . ILE A  1 49  ? 22.748 37.099 99.313  1.00 41.87 ? 49   ILE A CD1 1 
ATOM   412   N  N   . ASP A  1 50  ? 21.918 33.585 103.179 1.00 38.13 ? 50   ASP A N   1 
ATOM   413   C  CA  . ASP A  1 50  ? 21.799 32.288 103.828 1.00 40.27 ? 50   ASP A CA  1 
ATOM   414   C  C   . ASP A  1 50  ? 20.480 31.637 103.444 1.00 39.84 ? 50   ASP A C   1 
ATOM   415   O  O   . ASP A  1 50  ? 20.430 30.463 103.068 1.00 37.78 ? 50   ASP A O   1 
ATOM   416   C  CB  . ASP A  1 50  ? 21.832 32.466 105.346 1.00 45.29 ? 50   ASP A CB  1 
ATOM   417   C  CG  . ASP A  1 50  ? 22.990 31.752 105.989 1.00 51.84 ? 50   ASP A CG  1 
ATOM   418   O  OD1 . ASP A  1 50  ? 24.138 31.975 105.543 1.00 54.57 ? 50   ASP A OD1 1 
ATOM   419   O  OD2 . ASP A  1 50  ? 22.750 30.972 106.942 1.00 56.77 ? 50   ASP A OD2 1 
ATOM   420   N  N   . GLU A  1 51  ? 19.409 32.420 103.527 1.00 39.20 ? 51   GLU A N   1 
ATOM   421   C  CA  . GLU A  1 51  ? 18.085 31.900 103.231 1.00 39.07 ? 51   GLU A CA  1 
ATOM   422   C  C   . GLU A  1 51  ? 17.992 31.457 101.779 1.00 38.65 ? 51   GLU A C   1 
ATOM   423   O  O   . GLU A  1 51  ? 17.266 30.519 101.453 1.00 38.78 ? 51   GLU A O   1 
ATOM   424   C  CB  . GLU A  1 51  ? 17.026 32.956 103.549 1.00 39.43 ? 51   GLU A CB  1 
ATOM   425   C  CG  . GLU A  1 51  ? 16.924 33.307 105.038 1.00 46.52 ? 51   GLU A CG  1 
ATOM   426   C  CD  . GLU A  1 51  ? 16.580 32.118 105.920 1.00 47.43 ? 51   GLU A CD  1 
ATOM   427   O  OE1 . GLU A  1 51  ? 16.313 31.027 105.380 1.00 51.53 ? 51   GLU A OE1 1 
ATOM   428   O  OE2 . GLU A  1 51  ? 16.593 32.272 107.160 1.00 49.95 ? 51   GLU A OE2 1 
ATOM   429   N  N   . MET A  1 52  ? 18.728 32.146 100.907 1.00 37.21 ? 52   MET A N   1 
ATOM   430   C  CA  . MET A  1 52  ? 18.749 31.827 99.486  1.00 32.80 ? 52   MET A CA  1 
ATOM   431   C  C   . MET A  1 52  ? 19.419 30.469 99.289  1.00 30.46 ? 52   MET A C   1 
ATOM   432   O  O   . MET A  1 52  ? 18.987 29.662 98.468  1.00 26.75 ? 52   MET A O   1 
ATOM   433   C  CB  . MET A  1 52  ? 19.489 32.925 98.711  1.00 33.65 ? 52   MET A CB  1 
ATOM   434   C  CG  . MET A  1 52  ? 18.692 34.223 98.591  1.00 42.89 ? 52   MET A CG  1 
ATOM   435   S  SD  . MET A  1 52  ? 19.496 35.593 97.670  1.00 53.09 ? 52   MET A SD  1 
ATOM   436   C  CE  . MET A  1 52  ? 19.331 36.998 98.855  1.00 50.54 ? 52   MET A CE  1 
ATOM   437   N  N   . LYS A  1 53  ? 20.468 30.206 100.059 1.00 30.07 ? 53   LYS A N   1 
ATOM   438   C  CA  . LYS A  1 53  ? 21.149 28.923 99.963  1.00 30.15 ? 53   LYS A CA  1 
ATOM   439   C  C   . LYS A  1 53  ? 20.231 27.811 100.485 1.00 31.45 ? 53   LYS A C   1 
ATOM   440   O  O   . LYS A  1 53  ? 20.264 26.684 99.980  1.00 31.03 ? 53   LYS A O   1 
ATOM   441   C  CB  . LYS A  1 53  ? 22.443 28.952 100.766 1.00 32.80 ? 53   LYS A CB  1 
ATOM   442   C  CG  . LYS A  1 53  ? 23.460 29.979 100.278 1.00 34.92 ? 53   LYS A CG  1 
ATOM   443   C  CD  . LYS A  1 53  ? 24.607 30.082 101.273 1.00 36.94 ? 53   LYS A CD  1 
ATOM   444   C  CE  . LYS A  1 53  ? 25.507 31.262 100.979 1.00 39.32 ? 53   LYS A CE  1 
ATOM   445   N  NZ  . LYS A  1 53  ? 26.268 31.675 102.195 1.00 42.46 ? 53   LYS A NZ  1 
ATOM   446   N  N   . HIS A  1 54  ? 19.424 28.122 101.502 1.00 29.72 ? 54   HIS A N   1 
ATOM   447   C  CA  . HIS A  1 54  ? 18.480 27.149 102.051 1.00 29.52 ? 54   HIS A CA  1 
ATOM   448   C  C   . HIS A  1 54  ? 17.494 26.710 100.976 1.00 29.92 ? 54   HIS A C   1 
ATOM   449   O  O   . HIS A  1 54  ? 17.331 25.510 100.727 1.00 30.08 ? 54   HIS A O   1 
ATOM   450   C  CB  . HIS A  1 54  ? 17.655 27.757 103.180 1.00 30.62 ? 54   HIS A CB  1 
ATOM   451   C  CG  . HIS A  1 54  ? 18.432 27.793 104.509 1.00 33.67 ? 54   HIS A CG  1 
ATOM   452   N  ND1 . HIS A  1 54  ? 17.877 28.290 105.671 1.00 30.97 ? 54   HIS A ND1 1 
ATOM   453   C  CD2 . HIS A  1 54  ? 19.681 27.383 104.834 1.00 32.37 ? 54   HIS A CD2 1 
ATOM   454   C  CE1 . HIS A  1 54  ? 18.755 28.189 106.654 1.00 33.73 ? 54   HIS A CE1 1 
ATOM   455   N  NE2 . HIS A  1 54  ? 19.857 27.640 106.172 1.00 31.93 ? 54   HIS A NE2 1 
ATOM   456   N  N   . ALA A  1 55  ? 16.841 27.697 100.369 1.00 29.57 ? 55   ALA A N   1 
ATOM   457   C  CA  . ALA A  1 55  ? 15.855 27.472 99.325  1.00 30.24 ? 55   ALA A CA  1 
ATOM   458   C  C   . ALA A  1 55  ? 16.448 26.693 98.157  1.00 34.19 ? 55   ALA A C   1 
ATOM   459   O  O   . ALA A  1 55  ? 15.790 25.818 97.578  1.00 34.75 ? 55   ALA A O   1 
ATOM   460   C  CB  . ALA A  1 55  ? 15.317 28.800 98.845  1.00 27.19 ? 55   ALA A CB  1 
ATOM   461   N  N   . ASP A  1 56  ? 17.694 27.014 97.813  1.00 36.01 ? 56   ASP A N   1 
ATOM   462   C  CA  . ASP A  1 56  ? 18.385 26.343 96.721  1.00 34.59 ? 56   ASP A CA  1 
ATOM   463   C  C   . ASP A  1 56  ? 18.557 24.861 97.061  1.00 34.96 ? 56   ASP A C   1 
ATOM   464   O  O   . ASP A  1 56  ? 18.347 24.000 96.213  1.00 39.96 ? 56   ASP A O   1 
ATOM   465   C  CB  . ASP A  1 56  ? 19.740 27.017 96.477  1.00 34.56 ? 56   ASP A CB  1 
ATOM   466   C  CG  . ASP A  1 56  ? 20.421 26.534 95.209  1.00 37.09 ? 56   ASP A CG  1 
ATOM   467   O  OD1 . ASP A  1 56  ? 19.714 26.166 94.248  1.00 40.07 ? 56   ASP A OD1 1 
ATOM   468   O  OD2 . ASP A  1 56  ? 21.669 26.542 95.161  1.00 37.90 ? 56   ASP A OD2 1 
ATOM   469   N  N   . LYS A  1 57  ? 18.909 24.556 98.303  1.00 33.69 ? 57   LYS A N   1 
ATOM   470   C  CA  . LYS A  1 57  ? 19.080 23.160 98.716  1.00 34.93 ? 57   LYS A CA  1 
ATOM   471   C  C   . LYS A  1 57  ? 17.776 22.377 98.534  1.00 32.96 ? 57   LYS A C   1 
ATOM   472   O  O   . LYS A  1 57  ? 17.765 21.256 98.009  1.00 31.89 ? 57   LYS A O   1 
ATOM   473   C  CB  . LYS A  1 57  ? 19.502 23.079 100.188 1.00 38.44 ? 57   LYS A CB  1 
ATOM   474   C  CG  . LYS A  1 57  ? 20.806 23.782 100.535 1.00 45.37 ? 57   LYS A CG  1 
ATOM   475   C  CD  . LYS A  1 57  ? 20.984 23.819 102.048 1.00 51.69 ? 57   LYS A CD  1 
ATOM   476   C  CE  . LYS A  1 57  ? 22.284 24.489 102.471 1.00 54.32 ? 57   LYS A CE  1 
ATOM   477   N  NZ  . LYS A  1 57  ? 22.439 24.465 103.964 1.00 55.72 ? 57   LYS A NZ  1 
ATOM   478   N  N   . LEU A  1 58  ? 16.677 22.967 98.987  1.00 29.46 ? 58   LEU A N   1 
ATOM   479   C  CA  . LEU A  1 58  ? 15.380 22.326 98.868  1.00 28.50 ? 58   LEU A CA  1 
ATOM   480   C  C   . LEU A  1 58  ? 15.031 22.073 97.398  1.00 29.25 ? 58   LEU A C   1 
ATOM   481   O  O   . LEU A  1 58  ? 14.711 20.948 97.016  1.00 28.11 ? 58   LEU A O   1 
ATOM   482   C  CB  . LEU A  1 58  ? 14.318 23.202 99.530  1.00 28.27 ? 58   LEU A CB  1 
ATOM   483   C  CG  . LEU A  1 58  ? 14.477 23.346 101.044 1.00 27.09 ? 58   LEU A CG  1 
ATOM   484   C  CD1 . LEU A  1 58  ? 13.537 24.418 101.570 1.00 27.21 ? 58   LEU A CD1 1 
ATOM   485   C  CD2 . LEU A  1 58  ? 14.188 22.009 101.702 1.00 23.75 ? 58   LEU A CD2 1 
ATOM   486   N  N   . ILE A  1 59  ? 15.109 23.121 96.579  1.00 31.39 ? 59   ILE A N   1 
ATOM   487   C  CA  . ILE A  1 59  ? 14.812 23.015 95.147  1.00 33.08 ? 59   ILE A CA  1 
ATOM   488   C  C   . ILE A  1 59  ? 15.500 21.802 94.522  1.00 33.51 ? 59   ILE A C   1 
ATOM   489   O  O   . ILE A  1 59  ? 14.875 21.014 93.798  1.00 32.52 ? 59   ILE A O   1 
ATOM   490   C  CB  . ILE A  1 59  ? 15.289 24.268 94.375  1.00 32.41 ? 59   ILE A CB  1 
ATOM   491   C  CG1 . ILE A  1 59  ? 14.580 25.510 94.895  1.00 34.18 ? 59   ILE A CG1 1 
ATOM   492   C  CG2 . ILE A  1 59  ? 14.990 24.117 92.904  1.00 30.83 ? 59   ILE A CG2 1 
ATOM   493   C  CD1 . ILE A  1 59  ? 14.964 26.756 94.152  1.00 37.43 ? 59   ILE A CD1 1 
ATOM   494   N  N   . LYS A  1 60  ? 16.792 21.660 94.796  1.00 31.55 ? 60   LYS A N   1 
ATOM   495   C  CA  . LYS A  1 60  ? 17.537 20.547 94.244  1.00 31.44 ? 60   LYS A CA  1 
ATOM   496   C  C   . LYS A  1 60  ? 16.987 19.231 94.759  1.00 30.40 ? 60   LYS A C   1 
ATOM   497   O  O   . LYS A  1 60  ? 16.777 18.305 93.981  1.00 33.20 ? 60   LYS A O   1 
ATOM   498   C  CB  . LYS A  1 60  ? 19.020 20.685 94.580  1.00 33.01 ? 60   LYS A CB  1 
ATOM   499   C  CG  . LYS A  1 60  ? 19.683 21.856 93.859  1.00 37.44 ? 60   LYS A CG  1 
ATOM   500   C  CD  . LYS A  1 60  ? 21.159 22.003 94.228  1.00 42.86 ? 60   LYS A CD  1 
ATOM   501   C  CE  . LYS A  1 60  ? 21.821 23.131 93.432  1.00 47.19 ? 60   LYS A CE  1 
ATOM   502   N  NZ  . LYS A  1 60  ? 23.242 23.351 93.841  1.00 49.79 ? 60   LYS A NZ  1 
ATOM   503   N  N   . ARG A  1 61  ? 16.733 19.148 96.061  1.00 28.94 ? 61   ARG A N   1 
ATOM   504   C  CA  . ARG A  1 61  ? 16.203 17.917 96.645  1.00 26.09 ? 61   ARG A CA  1 
ATOM   505   C  C   . ARG A  1 61  ? 14.875 17.576 95.984  1.00 25.70 ? 61   ARG A C   1 
ATOM   506   O  O   . ARG A  1 61  ? 14.646 16.442 95.557  1.00 24.64 ? 61   ARG A O   1 
ATOM   507   C  CB  . ARG A  1 61  ? 16.003 18.080 98.156  1.00 25.81 ? 61   ARG A CB  1 
ATOM   508   C  CG  . ARG A  1 61  ? 15.576 16.805 98.863  1.00 23.00 ? 61   ARG A CG  1 
ATOM   509   C  CD  . ARG A  1 61  ? 16.677 15.770 98.827  1.00 25.38 ? 61   ARG A CD  1 
ATOM   510   N  NE  . ARG A  1 61  ? 16.206 14.430 99.184  1.00 28.62 ? 61   ARG A NE  1 
ATOM   511   C  CZ  . ARG A  1 61  ? 16.962 13.335 99.112  1.00 28.19 ? 61   ARG A CZ  1 
ATOM   512   N  NH1 . ARG A  1 61  ? 18.222 13.427 98.701  1.00 28.24 ? 61   ARG A NH1 1 
ATOM   513   N  NH2 . ARG A  1 61  ? 16.463 12.149 99.440  1.00 27.49 ? 61   ARG A NH2 1 
ATOM   514   N  N   . ILE A  1 62  ? 14.000 18.569 95.897  1.00 24.59 ? 62   ILE A N   1 
ATOM   515   C  CA  . ILE A  1 62  ? 12.699 18.375 95.276  1.00 25.24 ? 62   ILE A CA  1 
ATOM   516   C  C   . ILE A  1 62  ? 12.839 17.885 93.827  1.00 26.06 ? 62   ILE A C   1 
ATOM   517   O  O   . ILE A  1 62  ? 12.184 16.922 93.424  1.00 26.51 ? 62   ILE A O   1 
ATOM   518   C  CB  . ILE A  1 62  ? 11.885 19.683 95.291  1.00 25.21 ? 62   ILE A CB  1 
ATOM   519   C  CG1 . ILE A  1 62  ? 11.670 20.135 96.741  1.00 25.42 ? 62   ILE A CG1 1 
ATOM   520   C  CG2 . ILE A  1 62  ? 10.554 19.483 94.566  1.00 21.56 ? 62   ILE A CG2 1 
ATOM   521   C  CD1 . ILE A  1 62  ? 10.858 21.407 96.873  1.00 24.92 ? 62   ILE A CD1 1 
ATOM   522   N  N   . LEU A  1 63  ? 13.688 18.538 93.039  1.00 24.43 ? 63   LEU A N   1 
ATOM   523   C  CA  . LEU A  1 63  ? 13.860 18.116 91.652  1.00 24.19 ? 63   LEU A CA  1 
ATOM   524   C  C   . LEU A  1 63  ? 14.408 16.695 91.576  1.00 24.00 ? 63   LEU A C   1 
ATOM   525   O  O   . LEU A  1 63  ? 13.924 15.871 90.794  1.00 24.61 ? 63   LEU A O   1 
ATOM   526   C  CB  . LEU A  1 63  ? 14.775 19.089 90.894  1.00 18.51 ? 63   LEU A CB  1 
ATOM   527   C  CG  . LEU A  1 63  ? 14.151 20.453 90.585  1.00 14.97 ? 63   LEU A CG  1 
ATOM   528   C  CD1 . LEU A  1 63  ? 15.183 21.367 89.963  1.00 16.09 ? 63   LEU A CD1 1 
ATOM   529   C  CD2 . LEU A  1 63  ? 12.980 20.273 89.638  1.00 14.29 ? 63   LEU A CD2 1 
ATOM   530   N  N   . PHE A  1 64  ? 15.409 16.403 92.395  1.00 25.39 ? 64   PHE A N   1 
ATOM   531   C  CA  . PHE A  1 64  ? 15.998 15.070 92.406  1.00 29.53 ? 64   PHE A CA  1 
ATOM   532   C  C   . PHE A  1 64  ? 14.937 14.051 92.802  1.00 31.12 ? 64   PHE A C   1 
ATOM   533   O  O   . PHE A  1 64  ? 14.901 12.942 92.269  1.00 33.27 ? 64   PHE A O   1 
ATOM   534   C  CB  . PHE A  1 64  ? 17.166 15.007 93.396  1.00 30.75 ? 64   PHE A CB  1 
ATOM   535   C  CG  . PHE A  1 64  ? 17.619 13.613 93.703  1.00 31.67 ? 64   PHE A CG  1 
ATOM   536   C  CD1 . PHE A  1 64  ? 18.163 12.808 92.706  1.00 34.78 ? 64   PHE A CD1 1 
ATOM   537   C  CD2 . PHE A  1 64  ? 17.485 13.094 94.986  1.00 31.98 ? 64   PHE A CD2 1 
ATOM   538   C  CE1 . PHE A  1 64  ? 18.568 11.503 92.984  1.00 35.47 ? 64   PHE A CE1 1 
ATOM   539   C  CE2 . PHE A  1 64  ? 17.887 11.793 95.274  1.00 33.18 ? 64   PHE A CE2 1 
ATOM   540   C  CZ  . PHE A  1 64  ? 18.429 10.996 94.274  1.00 34.88 ? 64   PHE A CZ  1 
ATOM   541   N  N   . LEU A  1 65  ? 14.077 14.435 93.742  1.00 32.00 ? 65   LEU A N   1 
ATOM   542   C  CA  . LEU A  1 65  ? 13.011 13.556 94.213  1.00 33.98 ? 65   LEU A CA  1 
ATOM   543   C  C   . LEU A  1 65  ? 11.854 13.545 93.215  1.00 36.52 ? 65   LEU A C   1 
ATOM   544   O  O   . LEU A  1 65  ? 10.761 13.055 93.511  1.00 36.56 ? 65   LEU A O   1 
ATOM   545   C  CB  . LEU A  1 65  ? 12.526 14.025 95.587  1.00 35.46 ? 65   LEU A CB  1 
ATOM   546   C  CG  . LEU A  1 65  ? 12.738 13.095 96.788  1.00 34.94 ? 65   LEU A CG  1 
ATOM   547   C  CD1 . LEU A  1 65  ? 14.059 12.349 96.680  1.00 31.37 ? 65   LEU A CD1 1 
ATOM   548   C  CD2 . LEU A  1 65  ? 12.685 13.934 98.064  1.00 37.74 ? 65   LEU A CD2 1 
ATOM   549   N  N   . GLU A  1 66  ? 12.111 14.109 92.036  1.00 38.11 ? 66   GLU A N   1 
ATOM   550   C  CA  . GLU A  1 66  ? 11.141 14.165 90.951  1.00 38.12 ? 66   GLU A CA  1 
ATOM   551   C  C   . GLU A  1 66  ? 9.826  14.887 91.240  1.00 38.64 ? 66   GLU A C   1 
ATOM   552   O  O   . GLU A  1 66  ? 8.779  14.520 90.692  1.00 38.60 ? 66   GLU A O   1 
ATOM   553   C  CB  . GLU A  1 66  ? 10.858 12.747 90.461  1.00 39.47 ? 66   GLU A CB  1 
ATOM   554   C  CG  . GLU A  1 66  ? 12.034 12.130 89.730  1.00 45.61 ? 66   GLU A CG  1 
ATOM   555   C  CD  . GLU A  1 66  ? 11.823 10.668 89.385  1.00 48.72 ? 66   GLU A CD  1 
ATOM   556   O  OE1 . GLU A  1 66  ? 10.691 10.298 88.995  1.00 48.73 ? 66   GLU A OE1 1 
ATOM   557   O  OE2 . GLU A  1 66  ? 12.799 9.894  89.490  1.00 51.15 ? 66   GLU A OE2 1 
ATOM   558   N  N   . GLY A  1 67  ? 9.878  15.914 92.087  1.00 36.36 ? 67   GLY A N   1 
ATOM   559   C  CA  . GLY A  1 67  ? 8.680  16.675 92.404  1.00 34.79 ? 67   GLY A CA  1 
ATOM   560   C  C   . GLY A  1 67  ? 8.717  17.998 91.660  1.00 37.05 ? 67   GLY A C   1 
ATOM   561   O  O   . GLY A  1 67  ? 9.630  18.231 90.870  1.00 39.44 ? 67   GLY A O   1 
ATOM   562   N  N   . LEU A  1 68  ? 7.738  18.866 91.885  1.00 36.39 ? 68   LEU A N   1 
ATOM   563   C  CA  . LEU A  1 68  ? 7.740  20.158 91.209  1.00 36.23 ? 68   LEU A CA  1 
ATOM   564   C  C   . LEU A  1 68  ? 7.884  21.287 92.207  1.00 36.68 ? 68   LEU A C   1 
ATOM   565   O  O   . LEU A  1 68  ? 6.978  21.553 92.991  1.00 35.90 ? 68   LEU A O   1 
ATOM   566   C  CB  . LEU A  1 68  ? 6.460  20.358 90.407  1.00 35.67 ? 68   LEU A CB  1 
ATOM   567   C  CG  . LEU A  1 68  ? 6.324  19.454 89.187  1.00 37.06 ? 68   LEU A CG  1 
ATOM   568   C  CD1 . LEU A  1 68  ? 4.963  19.661 88.554  1.00 38.47 ? 68   LEU A CD1 1 
ATOM   569   C  CD2 . LEU A  1 68  ? 7.429  19.772 88.194  1.00 39.99 ? 68   LEU A CD2 1 
ATOM   570   N  N   . PRO A  1 69  ? 9.039  21.962 92.198  1.00 36.93 ? 69   PRO A N   1 
ATOM   571   C  CA  . PRO A  1 69  ? 9.271  23.070 93.123  1.00 35.99 ? 69   PRO A CA  1 
ATOM   572   C  C   . PRO A  1 69  ? 8.227  24.137 92.882  1.00 38.29 ? 69   PRO A C   1 
ATOM   573   O  O   . PRO A  1 69  ? 7.852  24.398 91.739  1.00 38.45 ? 69   PRO A O   1 
ATOM   574   C  CB  . PRO A  1 69  ? 10.666 23.551 92.744  1.00 36.06 ? 69   PRO A CB  1 
ATOM   575   C  CG  . PRO A  1 69  ? 11.326 22.303 92.207  1.00 37.43 ? 69   PRO A CG  1 
ATOM   576   C  CD  . PRO A  1 69  ? 10.231 21.698 91.374  1.00 37.82 ? 69   PRO A CD  1 
ATOM   577   N  N   . ASN A  1 70  ? 7.741  24.744 93.954  1.00 41.17 ? 70   ASN A N   1 
ATOM   578   C  CA  . ASN A  1 70  ? 6.750  25.799 93.809  1.00 44.24 ? 70   ASN A CA  1 
ATOM   579   C  C   . ASN A  1 70  ? 7.397  27.110 94.240  1.00 44.01 ? 70   ASN A C   1 
ATOM   580   O  O   . ASN A  1 70  ? 7.452  27.423 95.430  1.00 42.27 ? 70   ASN A O   1 
ATOM   581   C  CB  . ASN A  1 70  ? 5.522  25.514 94.678  1.00 46.79 ? 70   ASN A CB  1 
ATOM   582   C  CG  . ASN A  1 70  ? 4.395  26.513 94.447  1.00 49.32 ? 70   ASN A CG  1 
ATOM   583   O  OD1 . ASN A  1 70  ? 4.610  27.729 94.420  1.00 49.29 ? 70   ASN A OD1 1 
ATOM   584   N  ND2 . ASN A  1 70  ? 3.182  26.001 94.289  1.00 54.26 ? 70   ASN A ND2 1 
ATOM   585   N  N   . LEU A  1 71  ? 7.919  27.857 93.272  1.00 44.28 ? 71   LEU A N   1 
ATOM   586   C  CA  . LEU A  1 71  ? 8.554  29.135 93.564  1.00 45.21 ? 71   LEU A CA  1 
ATOM   587   C  C   . LEU A  1 71  ? 7.445  30.158 93.442  1.00 48.92 ? 71   LEU A C   1 
ATOM   588   O  O   . LEU A  1 71  ? 7.600  31.316 93.832  1.00 49.31 ? 71   LEU A O   1 
ATOM   589   C  CB  . LEU A  1 71  ? 9.656  29.444 92.540  1.00 39.10 ? 71   LEU A CB  1 
ATOM   590   C  CG  . LEU A  1 71  ? 11.029 28.742 92.559  1.00 34.45 ? 71   LEU A CG  1 
ATOM   591   C  CD1 . LEU A  1 71  ? 11.933 29.359 93.598  1.00 32.32 ? 71   LEU A CD1 1 
ATOM   592   C  CD2 . LEU A  1 71  ? 10.857 27.268 92.794  1.00 32.12 ? 71   LEU A CD2 1 
ATOM   593   N  N   . GLN A  1 72  ? 6.317  29.694 92.906  1.00 53.39 ? 72   GLN A N   1 
ATOM   594   C  CA  . GLN A  1 72  ? 5.144  30.529 92.673  1.00 57.69 ? 72   GLN A CA  1 
ATOM   595   C  C   . GLN A  1 72  ? 4.589  31.210 93.920  1.00 59.04 ? 72   GLN A C   1 
ATOM   596   O  O   . GLN A  1 72  ? 4.807  32.406 94.124  1.00 60.85 ? 72   GLN A O   1 
ATOM   597   C  CB  . GLN A  1 72  ? 4.037  29.708 91.998  1.00 58.62 ? 72   GLN A CB  1 
ATOM   598   C  CG  . GLN A  1 72  ? 2.818  30.532 91.590  1.00 58.17 ? 72   GLN A CG  1 
ATOM   599   C  CD  . GLN A  1 72  ? 3.151  31.579 90.547  1.00 58.26 ? 72   GLN A CD  1 
ATOM   600   O  OE1 . GLN A  1 72  ? 3.513  31.248 89.419  1.00 60.61 ? 72   GLN A OE1 1 
ATOM   601   N  NE2 . GLN A  1 72  ? 3.038  32.850 90.919  1.00 56.02 ? 72   GLN A NE2 1 
ATOM   602   N  N   . GLU A  1 73  ? 3.867  30.464 94.748  1.00 60.56 ? 73   GLU A N   1 
ATOM   603   C  CA  . GLU A  1 73  ? 3.295  31.059 95.946  1.00 63.87 ? 73   GLU A CA  1 
ATOM   604   C  C   . GLU A  1 73  ? 4.347  31.635 96.895  1.00 64.44 ? 73   GLU A C   1 
ATOM   605   O  O   . GLU A  1 73  ? 5.414  31.043 97.126  1.00 64.01 ? 73   GLU A O   1 
ATOM   606   C  CB  . GLU A  1 73  ? 2.411  30.052 96.685  1.00 66.38 ? 73   GLU A CB  1 
ATOM   607   C  CG  . GLU A  1 73  ? 1.151  29.659 95.920  1.00 68.02 ? 73   GLU A CG  1 
ATOM   608   C  CD  . GLU A  1 73  ? 0.059  29.142 96.841  1.00 70.72 ? 73   GLU A CD  1 
ATOM   609   O  OE1 . GLU A  1 73  ? -0.426 29.933 97.683  1.00 72.22 ? 73   GLU A OE1 1 
ATOM   610   O  OE2 . GLU A  1 73  ? -0.313 27.951 96.729  1.00 70.71 ? 73   GLU A OE2 1 
ATOM   611   N  N   . LEU A  1 74  ? 4.024  32.811 97.426  1.00 62.96 ? 74   LEU A N   1 
ATOM   612   C  CA  . LEU A  1 74  ? 4.886  33.543 98.346  1.00 60.55 ? 74   LEU A CA  1 
ATOM   613   C  C   . LEU A  1 74  ? 3.988  33.973 99.504  1.00 59.32 ? 74   LEU A C   1 
ATOM   614   O  O   . LEU A  1 74  ? 3.010  34.702 99.302  1.00 58.83 ? 74   LEU A O   1 
ATOM   615   C  CB  . LEU A  1 74  ? 5.465  34.768 97.630  1.00 60.39 ? 74   LEU A CB  1 
ATOM   616   C  CG  . LEU A  1 74  ? 6.782  35.364 98.133  1.00 60.41 ? 74   LEU A CG  1 
ATOM   617   C  CD1 . LEU A  1 74  ? 6.570  36.102 99.439  1.00 60.42 ? 74   LEU A CD1 1 
ATOM   618   C  CD2 . LEU A  1 74  ? 7.801  34.248 98.282  1.00 58.50 ? 74   LEU A CD2 1 
ATOM   619   N  N   . GLY A  1 75  ? 4.310  33.514 100.710 1.00 55.30 ? 75   GLY A N   1 
ATOM   620   C  CA  . GLY A  1 75  ? 3.488  33.853 101.858 1.00 51.27 ? 75   GLY A CA  1 
ATOM   621   C  C   . GLY A  1 75  ? 3.543  35.315 102.227 1.00 48.95 ? 75   GLY A C   1 
ATOM   622   O  O   . GLY A  1 75  ? 4.333  36.069 101.670 1.00 47.63 ? 75   GLY A O   1 
ATOM   623   N  N   . LYS A  1 76  ? 2.707  35.724 103.174 1.00 48.97 ? 76   LYS A N   1 
ATOM   624   C  CA  . LYS A  1 76  ? 2.702  37.116 103.599 1.00 53.00 ? 76   LYS A CA  1 
ATOM   625   C  C   . LYS A  1 76  ? 4.128  37.524 103.969 1.00 51.81 ? 76   LYS A C   1 
ATOM   626   O  O   . LYS A  1 76  ? 5.032  36.690 104.038 1.00 53.49 ? 76   LYS A O   1 
ATOM   627   C  CB  . LYS A  1 76  ? 1.761  37.325 104.795 1.00 56.38 ? 76   LYS A CB  1 
ATOM   628   C  CG  . LYS A  1 76  ? 1.220  38.754 104.910 1.00 59.00 ? 76   LYS A CG  1 
ATOM   629   C  CD  . LYS A  1 76  ? 0.215  38.892 106.043 1.00 61.70 ? 76   LYS A CD  1 
ATOM   630   C  CE  . LYS A  1 76  ? -0.329 40.317 106.129 1.00 64.90 ? 76   LYS A CE  1 
ATOM   631   N  NZ  . LYS A  1 76  ? -1.248 40.514 107.298 1.00 66.20 ? 76   LYS A NZ  1 
ATOM   632   N  N   . LEU A  1 77  ? 4.328  38.808 104.216 1.00 49.65 ? 77   LEU A N   1 
ATOM   633   C  CA  . LEU A  1 77  ? 5.655  39.295 104.527 1.00 47.15 ? 77   LEU A CA  1 
ATOM   634   C  C   . LEU A  1 77  ? 5.574  40.236 105.708 1.00 45.78 ? 77   LEU A C   1 
ATOM   635   O  O   . LEU A  1 77  ? 4.962  41.294 105.615 1.00 46.22 ? 77   LEU A O   1 
ATOM   636   C  CB  . LEU A  1 77  ? 6.206  40.032 103.307 1.00 48.20 ? 77   LEU A CB  1 
ATOM   637   C  CG  . LEU A  1 77  ? 7.699  40.000 103.007 1.00 47.70 ? 77   LEU A CG  1 
ATOM   638   C  CD1 . LEU A  1 77  ? 8.135  38.563 102.750 1.00 45.73 ? 77   LEU A CD1 1 
ATOM   639   C  CD2 . LEU A  1 77  ? 7.980  40.883 101.797 1.00 45.20 ? 77   LEU A CD2 1 
ATOM   640   N  N   . LEU A  1 78  ? 6.185  39.848 106.821 1.00 45.26 ? 78   LEU A N   1 
ATOM   641   C  CA  . LEU A  1 78  ? 6.174  40.684 108.011 1.00 42.38 ? 78   LEU A CA  1 
ATOM   642   C  C   . LEU A  1 78  ? 7.180  41.812 107.865 1.00 42.09 ? 78   LEU A C   1 
ATOM   643   O  O   . LEU A  1 78  ? 8.343  41.673 108.239 1.00 42.81 ? 78   LEU A O   1 
ATOM   644   C  CB  . LEU A  1 78  ? 6.520  39.866 109.252 1.00 41.87 ? 78   LEU A CB  1 
ATOM   645   C  CG  . LEU A  1 78  ? 5.646  38.659 109.581 1.00 42.95 ? 78   LEU A CG  1 
ATOM   646   C  CD1 . LEU A  1 78  ? 5.954  38.193 111.010 1.00 41.02 ? 78   LEU A CD1 1 
ATOM   647   C  CD2 . LEU A  1 78  ? 4.174  39.030 109.436 1.00 43.03 ? 78   LEU A CD2 1 
ATOM   648   N  N   . ILE A  1 79  ? 6.735  42.928 107.310 1.00 41.53 ? 79   ILE A N   1 
ATOM   649   C  CA  . ILE A  1 79  ? 7.610  44.075 107.143 1.00 42.66 ? 79   ILE A CA  1 
ATOM   650   C  C   . ILE A  1 79  ? 7.527  44.940 108.392 1.00 40.76 ? 79   ILE A C   1 
ATOM   651   O  O   . ILE A  1 79  ? 6.443  45.148 108.928 1.00 42.96 ? 79   ILE A O   1 
ATOM   652   C  CB  . ILE A  1 79  ? 7.187  44.912 105.923 1.00 43.44 ? 79   ILE A CB  1 
ATOM   653   C  CG1 . ILE A  1 79  ? 7.225  44.040 104.679 1.00 40.06 ? 79   ILE A CG1 1 
ATOM   654   C  CG2 . ILE A  1 79  ? 8.120  46.111 105.752 1.00 44.54 ? 79   ILE A CG2 1 
ATOM   655   C  CD1 . ILE A  1 79  ? 8.586  43.419 104.441 1.00 45.94 ? 79   ILE A CD1 1 
ATOM   656   N  N   . GLY A  1 80  ? 8.670  45.432 108.856 1.00 40.33 ? 80   GLY A N   1 
ATOM   657   C  CA  . GLY A  1 80  ? 8.683  46.277 110.039 1.00 40.35 ? 80   GLY A CA  1 
ATOM   658   C  C   . GLY A  1 80  ? 8.901  47.733 109.674 1.00 40.91 ? 80   GLY A C   1 
ATOM   659   O  O   . GLY A  1 80  ? 9.333  48.040 108.561 1.00 43.16 ? 80   GLY A O   1 
ATOM   660   N  N   . GLU A  1 81  ? 8.606  48.641 110.597 1.00 40.17 ? 81   GLU A N   1 
ATOM   661   C  CA  . GLU A  1 81  ? 8.794  50.059 110.321 1.00 39.57 ? 81   GLU A CA  1 
ATOM   662   C  C   . GLU A  1 81  ? 10.032 50.653 110.993 1.00 38.18 ? 81   GLU A C   1 
ATOM   663   O  O   . GLU A  1 81  ? 10.570 51.666 110.536 1.00 35.54 ? 81   GLU A O   1 
ATOM   664   C  CB  . GLU A  1 81  ? 7.547  50.844 110.726 1.00 41.50 ? 81   GLU A CB  1 
ATOM   665   C  CG  . GLU A  1 81  ? 6.428  50.798 109.691 1.00 44.13 ? 81   GLU A CG  1 
ATOM   666   C  CD  . GLU A  1 81  ? 5.205  51.602 110.112 1.00 48.77 ? 81   GLU A CD  1 
ATOM   667   O  OE1 . GLU A  1 81  ? 5.357  52.798 110.459 1.00 50.07 ? 81   GLU A OE1 1 
ATOM   668   O  OE2 . GLU A  1 81  ? 4.092  51.035 110.092 1.00 49.03 ? 81   GLU A OE2 1 
ATOM   669   N  N   . HIS A  1 82  ? 10.482 50.016 112.069 1.00 38.68 ? 82   HIS A N   1 
ATOM   670   C  CA  . HIS A  1 82  ? 11.664 50.470 112.803 1.00 41.43 ? 82   HIS A CA  1 
ATOM   671   C  C   . HIS A  1 82  ? 12.494 49.278 113.281 1.00 39.04 ? 82   HIS A C   1 
ATOM   672   O  O   . HIS A  1 82  ? 11.966 48.179 113.445 1.00 39.78 ? 82   HIS A O   1 
ATOM   673   C  CB  . HIS A  1 82  ? 11.248 51.325 113.999 1.00 46.30 ? 82   HIS A CB  1 
ATOM   674   C  CG  . HIS A  1 82  ? 10.107 50.754 114.779 1.00 52.69 ? 82   HIS A CG  1 
ATOM   675   N  ND1 . HIS A  1 82  ? 8.800  50.848 114.354 1.00 58.08 ? 82   HIS A ND1 1 
ATOM   676   C  CD2 . HIS A  1 82  ? 10.076 50.063 115.943 1.00 55.58 ? 82   HIS A CD2 1 
ATOM   677   C  CE1 . HIS A  1 82  ? 8.012  50.240 115.224 1.00 60.84 ? 82   HIS A CE1 1 
ATOM   678   N  NE2 . HIS A  1 82  ? 8.762  49.755 116.198 1.00 60.88 ? 82   HIS A NE2 1 
ATOM   679   N  N   . THR A  1 83  ? 13.787 49.503 113.503 1.00 35.68 ? 83   THR A N   1 
ATOM   680   C  CA  . THR A  1 83  ? 14.701 48.445 113.942 1.00 33.87 ? 83   THR A CA  1 
ATOM   681   C  C   . THR A  1 83  ? 14.069 47.457 114.901 1.00 32.74 ? 83   THR A C   1 
ATOM   682   O  O   . THR A  1 83  ? 13.947 46.270 114.616 1.00 30.98 ? 83   THR A O   1 
ATOM   683   C  CB  . THR A  1 83  ? 15.934 49.019 114.650 1.00 32.77 ? 83   THR A CB  1 
ATOM   684   O  OG1 . THR A  1 83  ? 16.624 49.917 113.770 1.00 36.68 ? 83   THR A OG1 1 
ATOM   685   C  CG2 . THR A  1 83  ? 16.869 47.890 115.062 1.00 29.21 ? 83   THR A CG2 1 
ATOM   686   N  N   . LYS A  1 84  ? 13.693 47.977 116.056 1.00 34.25 ? 84   LYS A N   1 
ATOM   687   C  CA  . LYS A  1 84  ? 13.076 47.212 117.120 1.00 34.80 ? 84   LYS A CA  1 
ATOM   688   C  C   . LYS A  1 84  ? 12.025 46.250 116.573 1.00 35.26 ? 84   LYS A C   1 
ATOM   689   O  O   . LYS A  1 84  ? 12.053 45.054 116.865 1.00 35.75 ? 84   LYS A O   1 
ATOM   690   C  CB  . LYS A  1 84  ? 12.453 48.185 118.121 1.00 38.08 ? 84   LYS A CB  1 
ATOM   691   C  CG  . LYS A  1 84  ? 13.118 49.590 118.135 1.00 45.92 ? 84   LYS A CG  1 
ATOM   692   C  CD  . LYS A  1 84  ? 12.920 50.328 116.795 1.00 49.70 ? 84   LYS A CD  1 
ATOM   693   C  CE  . LYS A  1 84  ? 13.244 51.821 116.837 1.00 53.20 ? 84   LYS A CE  1 
ATOM   694   N  NZ  . LYS A  1 84  ? 14.653 52.145 116.466 1.00 59.60 ? 84   LYS A NZ  1 
ATOM   695   N  N   . GLU A  1 85  ? 11.102 46.767 115.769 1.00 36.24 ? 85   GLU A N   1 
ATOM   696   C  CA  . GLU A  1 85  ? 10.047 45.937 115.191 1.00 35.90 ? 85   GLU A CA  1 
ATOM   697   C  C   . GLU A  1 85  ? 10.566 45.011 114.083 1.00 35.47 ? 85   GLU A C   1 
ATOM   698   O  O   . GLU A  1 85  ? 10.147 43.857 113.968 1.00 33.93 ? 85   GLU A O   1 
ATOM   699   C  CB  . GLU A  1 85  ? 8.930  46.829 114.653 1.00 37.09 ? 85   GLU A CB  1 
ATOM   700   C  CG  . GLU A  1 85  ? 7.896  46.084 113.844 1.00 45.74 ? 85   GLU A CG  1 
ATOM   701   C  CD  . GLU A  1 85  ? 6.726  46.960 113.426 1.00 50.51 ? 85   GLU A CD  1 
ATOM   702   O  OE1 . GLU A  1 85  ? 6.949  48.143 113.078 1.00 50.83 ? 85   GLU A OE1 1 
ATOM   703   O  OE2 . GLU A  1 85  ? 5.581  46.451 113.433 1.00 54.79 ? 85   GLU A OE2 1 
ATOM   704   N  N   . MET A  1 86  ? 11.486 45.521 113.271 1.00 35.70 ? 86   MET A N   1 
ATOM   705   C  CA  . MET A  1 86  ? 12.062 44.736 112.186 1.00 35.60 ? 86   MET A CA  1 
ATOM   706   C  C   . MET A  1 86  ? 12.780 43.525 112.758 1.00 34.65 ? 86   MET A C   1 
ATOM   707   O  O   . MET A  1 86  ? 12.731 42.435 112.192 1.00 35.79 ? 86   MET A O   1 
ATOM   708   C  CB  . MET A  1 86  ? 13.032 45.597 111.377 1.00 33.32 ? 86   MET A CB  1 
ATOM   709   C  CG  . MET A  1 86  ? 12.357 46.788 110.712 1.00 35.69 ? 86   MET A CG  1 
ATOM   710   S  SD  . MET A  1 86  ? 13.517 48.009 110.079 1.00 35.70 ? 86   MET A SD  1 
ATOM   711   C  CE  . MET A  1 86  ? 14.402 47.004 108.841 1.00 36.14 ? 86   MET A CE  1 
ATOM   712   N  N   . LEU A  1 87  ? 13.446 43.723 113.887 1.00 35.47 ? 87   LEU A N   1 
ATOM   713   C  CA  . LEU A  1 87  ? 14.165 42.645 114.554 1.00 35.52 ? 87   LEU A CA  1 
ATOM   714   C  C   . LEU A  1 87  ? 13.149 41.623 115.075 1.00 37.69 ? 87   LEU A C   1 
ATOM   715   O  O   . LEU A  1 87  ? 13.380 40.414 115.013 1.00 38.74 ? 87   LEU A O   1 
ATOM   716   C  CB  . LEU A  1 87  ? 14.998 43.222 115.706 1.00 32.31 ? 87   LEU A CB  1 
ATOM   717   C  CG  . LEU A  1 87  ? 16.532 43.330 115.608 1.00 32.70 ? 87   LEU A CG  1 
ATOM   718   C  CD1 . LEU A  1 87  ? 17.024 43.517 114.178 1.00 32.90 ? 87   LEU A CD1 1 
ATOM   719   C  CD2 . LEU A  1 87  ? 16.970 44.492 116.477 1.00 31.11 ? 87   LEU A CD2 1 
ATOM   720   N  N   . GLU A  1 88  ? 12.016 42.113 115.569 1.00 38.19 ? 88   GLU A N   1 
ATOM   721   C  CA  . GLU A  1 88  ? 10.980 41.232 116.088 1.00 39.96 ? 88   GLU A CA  1 
ATOM   722   C  C   . GLU A  1 88  ? 10.274 40.441 114.985 1.00 41.15 ? 88   GLU A C   1 
ATOM   723   O  O   . GLU A  1 88  ? 10.030 39.234 115.131 1.00 41.14 ? 88   GLU A O   1 
ATOM   724   C  CB  . GLU A  1 88  ? 9.968  42.040 116.895 1.00 40.08 ? 88   GLU A CB  1 
ATOM   725   C  CG  . GLU A  1 88  ? 10.335 42.174 118.362 1.00 45.04 ? 88   GLU A CG  1 
ATOM   726   C  CD  . GLU A  1 88  ? 9.569  43.284 119.074 1.00 50.26 ? 88   GLU A CD  1 
ATOM   727   O  OE1 . GLU A  1 88  ? 9.547  43.275 120.323 1.00 55.31 ? 88   GLU A OE1 1 
ATOM   728   O  OE2 . GLU A  1 88  ? 9.003  44.174 118.398 1.00 51.34 ? 88   GLU A OE2 1 
ATOM   729   N  N   . CYS A  1 89  ? 9.946  41.111 113.883 1.00 39.82 ? 89   CYS A N   1 
ATOM   730   C  CA  . CYS A  1 89  ? 9.290  40.429 112.775 1.00 37.68 ? 89   CYS A CA  1 
ATOM   731   C  C   . CYS A  1 89  ? 10.181 39.314 112.224 1.00 37.32 ? 89   CYS A C   1 
ATOM   732   O  O   . CYS A  1 89  ? 9.680  38.266 111.811 1.00 39.71 ? 89   CYS A O   1 
ATOM   733   C  CB  . CYS A  1 89  ? 8.952  41.414 111.656 1.00 37.19 ? 89   CYS A CB  1 
ATOM   734   S  SG  . CYS A  1 89  ? 7.669  42.618 112.073 1.00 40.93 ? 89   CYS A SG  1 
ATOM   735   N  N   . ASP A  1 90  ? 11.496 39.532 112.213 1.00 33.96 ? 90   ASP A N   1 
ATOM   736   C  CA  . ASP A  1 90  ? 12.406 38.515 111.704 1.00 34.31 ? 90   ASP A CA  1 
ATOM   737   C  C   . ASP A  1 90  ? 12.502 37.349 112.674 1.00 34.86 ? 90   ASP A C   1 
ATOM   738   O  O   . ASP A  1 90  ? 12.672 36.205 112.251 1.00 35.81 ? 90   ASP A O   1 
ATOM   739   C  CB  . ASP A  1 90  ? 13.815 39.078 111.458 1.00 37.22 ? 90   ASP A CB  1 
ATOM   740   C  CG  . ASP A  1 90  ? 13.871 40.078 110.299 1.00 37.50 ? 90   ASP A CG  1 
ATOM   741   O  OD1 . ASP A  1 90  ? 12.986 40.050 109.414 1.00 39.56 ? 90   ASP A OD1 1 
ATOM   742   O  OD2 . ASP A  1 90  ? 14.826 40.885 110.270 1.00 35.92 ? 90   ASP A OD2 1 
ATOM   743   N  N   . LEU A  1 91  ? 12.403 37.635 113.972 1.00 34.95 ? 91   LEU A N   1 
ATOM   744   C  CA  . LEU A  1 91  ? 12.472 36.581 114.981 1.00 33.55 ? 91   LEU A CA  1 
ATOM   745   C  C   . LEU A  1 91  ? 11.191 35.760 114.939 1.00 34.37 ? 91   LEU A C   1 
ATOM   746   O  O   . LEU A  1 91  ? 11.219 34.536 115.097 1.00 31.94 ? 91   LEU A O   1 
ATOM   747   C  CB  . LEU A  1 91  ? 12.668 37.169 116.384 1.00 33.82 ? 91   LEU A CB  1 
ATOM   748   C  CG  . LEU A  1 91  ? 12.695 36.180 117.567 1.00 31.05 ? 91   LEU A CG  1 
ATOM   749   C  CD1 . LEU A  1 91  ? 13.699 35.059 117.331 1.00 24.61 ? 91   LEU A CD1 1 
ATOM   750   C  CD2 . LEU A  1 91  ? 13.046 36.935 118.827 1.00 29.89 ? 91   LEU A CD2 1 
ATOM   751   N  N   . LYS A  1 92  ? 10.066 36.430 114.720 1.00 35.45 ? 92   LYS A N   1 
ATOM   752   C  CA  . LYS A  1 92  ? 8.801  35.720 114.645 1.00 40.64 ? 92   LYS A CA  1 
ATOM   753   C  C   . LYS A  1 92  ? 8.841  34.718 113.483 1.00 41.83 ? 92   LYS A C   1 
ATOM   754   O  O   . LYS A  1 92  ? 8.501  33.544 113.653 1.00 41.24 ? 92   LYS A O   1 
ATOM   755   C  CB  . LYS A  1 92  ? 7.641  36.701 114.456 1.00 44.25 ? 92   LYS A CB  1 
ATOM   756   C  CG  . LYS A  1 92  ? 6.268  36.030 114.477 1.00 52.92 ? 92   LYS A CG  1 
ATOM   757   C  CD  . LYS A  1 92  ? 5.118  37.021 114.280 1.00 58.12 ? 92   LYS A CD  1 
ATOM   758   C  CE  . LYS A  1 92  ? 3.764  36.298 114.276 1.00 61.45 ? 92   LYS A CE  1 
ATOM   759   N  NZ  . LYS A  1 92  ? 2.618  37.217 113.999 1.00 63.51 ? 92   LYS A NZ  1 
ATOM   760   N  N   . LEU A  1 93  ? 9.273  35.189 112.312 1.00 43.10 ? 93   LEU A N   1 
ATOM   761   C  CA  . LEU A  1 93  ? 9.365  34.358 111.108 1.00 42.76 ? 93   LEU A CA  1 
ATOM   762   C  C   . LEU A  1 93  ? 10.257 33.147 111.370 1.00 42.16 ? 93   LEU A C   1 
ATOM   763   O  O   . LEU A  1 93  ? 9.871  32.010 111.100 1.00 40.80 ? 93   LEU A O   1 
ATOM   764   C  CB  . LEU A  1 93  ? 9.925  35.181 109.938 1.00 43.42 ? 93   LEU A CB  1 
ATOM   765   C  CG  . LEU A  1 93  ? 9.610  34.716 108.510 1.00 44.48 ? 93   LEU A CG  1 
ATOM   766   C  CD1 . LEU A  1 93  ? 10.089 35.752 107.496 1.00 45.06 ? 93   LEU A CD1 1 
ATOM   767   C  CD2 . LEU A  1 93  ? 10.274 33.379 108.247 1.00 50.11 ? 93   LEU A CD2 1 
ATOM   768   N  N   . GLU A  1 94  ? 11.451 33.390 111.897 1.00 43.83 ? 94   GLU A N   1 
ATOM   769   C  CA  . GLU A  1 94  ? 12.371 32.293 112.204 1.00 45.43 ? 94   GLU A CA  1 
ATOM   770   C  C   . GLU A  1 94  ? 11.757 31.283 113.181 1.00 46.30 ? 94   GLU A C   1 
ATOM   771   O  O   . GLU A  1 94  ? 12.179 30.134 113.239 1.00 45.07 ? 94   GLU A O   1 
ATOM   772   C  CB  . GLU A  1 94  ? 13.679 32.832 112.765 1.00 43.80 ? 94   GLU A CB  1 
ATOM   773   C  CG  . GLU A  1 94  ? 14.557 33.602 111.798 1.00 49.07 ? 94   GLU A CG  1 
ATOM   774   C  CD  . GLU A  1 94  ? 15.384 32.708 110.883 1.00 49.57 ? 94   GLU A CD  1 
ATOM   775   O  OE1 . GLU A  1 94  ? 15.768 31.590 111.294 1.00 51.87 ? 94   GLU A OE1 1 
ATOM   776   O  OE2 . GLU A  1 94  ? 15.641 33.127 109.734 1.00 49.56 ? 94   GLU A OE2 1 
ATOM   777   N  N   . GLN A  1 95  ? 10.777 31.716 113.966 1.00 49.82 ? 95   GLN A N   1 
ATOM   778   C  CA  . GLN A  1 95  ? 10.148 30.818 114.929 1.00 52.63 ? 95   GLN A CA  1 
ATOM   779   C  C   . GLN A  1 95  ? 8.872  30.186 114.392 1.00 54.82 ? 95   GLN A C   1 
ATOM   780   O  O   . GLN A  1 95  ? 8.513  29.082 114.793 1.00 56.29 ? 95   GLN A O   1 
ATOM   781   C  CB  . GLN A  1 95  ? 9.847  31.552 116.245 1.00 50.68 ? 95   GLN A CB  1 
ATOM   782   C  CG  . GLN A  1 95  ? 11.094 31.974 117.014 1.00 50.27 ? 95   GLN A CG  1 
ATOM   783   C  CD  . GLN A  1 95  ? 10.784 32.568 118.378 1.00 49.51 ? 95   GLN A CD  1 
ATOM   784   O  OE1 . GLN A  1 95  ? 9.881  33.398 118.522 1.00 46.79 ? 95   GLN A OE1 1 
ATOM   785   N  NE2 . GLN A  1 95  ? 11.548 32.157 119.387 1.00 47.75 ? 95   GLN A NE2 1 
ATOM   786   N  N   . ALA A  1 96  ? 8.185  30.884 113.493 1.00 56.46 ? 96   ALA A N   1 
ATOM   787   C  CA  . ALA A  1 96  ? 6.952  30.361 112.914 1.00 56.60 ? 96   ALA A CA  1 
ATOM   788   C  C   . ALA A  1 96  ? 7.278  29.327 111.844 1.00 57.30 ? 96   ALA A C   1 
ATOM   789   O  O   . ALA A  1 96  ? 6.380  28.756 111.223 1.00 58.50 ? 96   ALA A O   1 
ATOM   790   C  CB  . ALA A  1 96  ? 6.128  31.492 112.316 1.00 56.20 ? 96   ALA A CB  1 
ATOM   791   N  N   . GLY A  1 97  ? 8.570  29.091 111.637 1.00 56.16 ? 97   GLY A N   1 
ATOM   792   C  CA  . GLY A  1 97  ? 8.993  28.127 110.645 1.00 56.92 ? 97   GLY A CA  1 
ATOM   793   C  C   . GLY A  1 97  ? 9.790  26.995 111.255 1.00 59.38 ? 97   GLY A C   1 
ATOM   794   O  O   . GLY A  1 97  ? 9.966  25.946 110.631 1.00 62.26 ? 97   GLY A O   1 
ATOM   795   N  N   . LEU A  1 98  ? 10.281 27.209 112.474 1.00 58.77 ? 98   LEU A N   1 
ATOM   796   C  CA  . LEU A  1 98  ? 11.064 26.199 113.176 1.00 55.82 ? 98   LEU A CA  1 
ATOM   797   C  C   . LEU A  1 98  ? 10.233 24.921 113.292 1.00 54.68 ? 98   LEU A C   1 
ATOM   798   O  O   . LEU A  1 98  ? 10.714 23.830 112.994 1.00 54.30 ? 98   LEU A O   1 
ATOM   799   C  CB  . LEU A  1 98  ? 11.458 26.710 114.565 1.00 56.61 ? 98   LEU A CB  1 
ATOM   800   C  CG  . LEU A  1 98  ? 12.630 26.017 115.272 1.00 58.12 ? 98   LEU A CG  1 
ATOM   801   C  CD1 . LEU A  1 98  ? 13.908 26.234 114.481 1.00 56.83 ? 98   LEU A CD1 1 
ATOM   802   C  CD2 . LEU A  1 98  ? 12.789 26.578 116.677 1.00 58.27 ? 98   LEU A CD2 1 
ATOM   803   N  N   . PRO A  1 99  ? 8.972  25.039 113.731 1.00 53.90 ? 99   PRO A N   1 
ATOM   804   C  CA  . PRO A  1 99  ? 8.127  23.851 113.854 1.00 54.49 ? 99   PRO A CA  1 
ATOM   805   C  C   . PRO A  1 99  ? 8.036  23.056 112.555 1.00 54.48 ? 99   PRO A C   1 
ATOM   806   O  O   . PRO A  1 99  ? 8.151  21.830 112.570 1.00 55.19 ? 99   PRO A O   1 
ATOM   807   C  CB  . PRO A  1 99  ? 6.783  24.433 114.281 1.00 53.68 ? 99   PRO A CB  1 
ATOM   808   C  CG  . PRO A  1 99  ? 7.209  25.548 115.178 1.00 55.12 ? 99   PRO A CG  1 
ATOM   809   C  CD  . PRO A  1 99  ? 8.323  26.197 114.371 1.00 56.56 ? 99   PRO A CD  1 
ATOM   810   N  N   . ASP A  1 100 ? 7.829  23.751 111.436 1.00 54.85 ? 100  ASP A N   1 
ATOM   811   C  CA  . ASP A  1 100 ? 7.729  23.083 110.139 1.00 54.10 ? 100  ASP A CA  1 
ATOM   812   C  C   . ASP A  1 100 ? 8.932  22.176 109.905 1.00 51.49 ? 100  ASP A C   1 
ATOM   813   O  O   . ASP A  1 100 ? 8.771  21.003 109.565 1.00 52.07 ? 100  ASP A O   1 
ATOM   814   C  CB  . ASP A  1 100 ? 7.615  24.108 109.007 1.00 59.64 ? 100  ASP A CB  1 
ATOM   815   C  CG  . ASP A  1 100 ? 6.212  24.700 108.890 1.00 64.98 ? 100  ASP A CG  1 
ATOM   816   O  OD1 . ASP A  1 100 ? 5.964  25.468 107.933 1.00 68.01 ? 100  ASP A OD1 1 
ATOM   817   O  OD2 . ASP A  1 100 ? 5.356  24.400 109.753 1.00 67.62 ? 100  ASP A OD2 1 
ATOM   818   N  N   . LEU A  1 101 ? 10.131 22.719 110.095 1.00 45.99 ? 101  LEU A N   1 
ATOM   819   C  CA  . LEU A  1 101 ? 11.358 21.948 109.932 1.00 43.65 ? 101  LEU A CA  1 
ATOM   820   C  C   . LEU A  1 101 ? 11.349 20.727 110.857 1.00 42.20 ? 101  LEU A C   1 
ATOM   821   O  O   . LEU A  1 101 ? 11.799 19.641 110.486 1.00 40.97 ? 101  LEU A O   1 
ATOM   822   C  CB  . LEU A  1 101 ? 12.570 22.824 110.253 1.00 43.39 ? 101  LEU A CB  1 
ATOM   823   C  CG  . LEU A  1 101 ? 13.118 23.670 109.106 1.00 42.94 ? 101  LEU A CG  1 
ATOM   824   C  CD1 . LEU A  1 101 ? 14.080 24.719 109.638 1.00 40.50 ? 101  LEU A CD1 1 
ATOM   825   C  CD2 . LEU A  1 101 ? 13.808 22.755 108.103 1.00 41.09 ? 101  LEU A CD2 1 
ATOM   826   N  N   . LYS A  1 102 ? 10.844 20.924 112.071 1.00 40.48 ? 102  LYS A N   1 
ATOM   827   C  CA  . LYS A  1 102 ? 10.759 19.857 113.056 1.00 36.23 ? 102  LYS A CA  1 
ATOM   828   C  C   . LYS A  1 102 ? 9.709  18.848 112.598 1.00 34.39 ? 102  LYS A C   1 
ATOM   829   O  O   . LYS A  1 102 ? 9.925  17.635 112.676 1.00 33.12 ? 102  LYS A O   1 
ATOM   830   C  CB  . LYS A  1 102 ? 10.377 20.434 114.429 1.00 33.44 ? 102  LYS A CB  1 
ATOM   831   C  CG  . LYS A  1 102 ? 11.535 21.066 115.202 1.00 34.27 ? 102  LYS A CG  1 
ATOM   832   C  CD  . LYS A  1 102 ? 11.057 21.753 116.493 1.00 34.49 ? 102  LYS A CD  1 
ATOM   833   C  CE  . LYS A  1 102 ? 12.201 22.019 117.480 1.00 31.60 ? 102  LYS A CE  1 
ATOM   834   N  NZ  . LYS A  1 102 ? 13.226 22.981 116.998 1.00 31.93 ? 102  LYS A NZ  1 
ATOM   835   N  N   . ALA A  1 103 ? 8.581  19.360 112.107 1.00 31.16 ? 103  ALA A N   1 
ATOM   836   C  CA  . ALA A  1 103 ? 7.489  18.516 111.637 1.00 30.80 ? 103  ALA A CA  1 
ATOM   837   C  C   . ALA A  1 103 ? 7.902  17.742 110.397 1.00 32.44 ? 103  ALA A C   1 
ATOM   838   O  O   . ALA A  1 103 ? 7.449  16.615 110.179 1.00 36.66 ? 103  ALA A O   1 
ATOM   839   C  CB  . ALA A  1 103 ? 6.270  19.365 111.330 1.00 29.32 ? 103  ALA A CB  1 
ATOM   840   N  N   . ALA A  1 104 ? 8.764  18.350 109.586 1.00 31.55 ? 104  ALA A N   1 
ATOM   841   C  CA  . ALA A  1 104 ? 9.236  17.714 108.362 1.00 26.94 ? 104  ALA A CA  1 
ATOM   842   C  C   . ALA A  1 104 ? 10.267 16.636 108.670 1.00 26.08 ? 104  ALA A C   1 
ATOM   843   O  O   . ALA A  1 104 ? 10.228 15.552 108.086 1.00 25.28 ? 104  ALA A O   1 
ATOM   844   C  CB  . ALA A  1 104 ? 9.817  18.750 107.440 1.00 25.29 ? 104  ALA A CB  1 
ATOM   845   N  N   . ILE A  1 105 ? 11.187 16.921 109.588 1.00 27.02 ? 105  ILE A N   1 
ATOM   846   C  CA  . ILE A  1 105 ? 12.204 15.936 109.961 1.00 27.30 ? 105  ILE A CA  1 
ATOM   847   C  C   . ILE A  1 105 ? 11.530 14.707 110.580 1.00 30.00 ? 105  ILE A C   1 
ATOM   848   O  O   . ILE A  1 105 ? 11.970 13.567 110.370 1.00 29.93 ? 105  ILE A O   1 
ATOM   849   C  CB  . ILE A  1 105 ? 13.206 16.507 110.977 1.00 26.73 ? 105  ILE A CB  1 
ATOM   850   C  CG1 . ILE A  1 105 ? 14.024 17.629 110.343 1.00 27.52 ? 105  ILE A CG1 1 
ATOM   851   C  CG2 . ILE A  1 105 ? 14.145 15.418 111.445 1.00 28.33 ? 105  ILE A CG2 1 
ATOM   852   C  CD1 . ILE A  1 105 ? 14.887 18.366 111.342 1.00 29.63 ? 105  ILE A CD1 1 
ATOM   853   N  N   . ALA A  1 106 ? 10.465 14.934 111.346 1.00 28.43 ? 106  ALA A N   1 
ATOM   854   C  CA  . ALA A  1 106 ? 9.755  13.816 111.955 1.00 29.04 ? 106  ALA A CA  1 
ATOM   855   C  C   . ALA A  1 106 ? 9.109  12.987 110.845 1.00 29.08 ? 106  ALA A C   1 
ATOM   856   O  O   . ALA A  1 106 ? 9.107  11.759 110.901 1.00 30.21 ? 106  ALA A O   1 
ATOM   857   C  CB  . ALA A  1 106 ? 8.689  14.319 112.940 1.00 24.93 ? 106  ALA A CB  1 
ATOM   858   N  N   . TYR A  1 107 ? 8.579  13.651 109.822 1.00 30.45 ? 107  TYR A N   1 
ATOM   859   C  CA  . TYR A  1 107 ? 7.939  12.914 108.739 1.00 32.38 ? 107  TYR A CA  1 
ATOM   860   C  C   . TYR A  1 107 ? 8.946  12.086 107.956 1.00 32.29 ? 107  TYR A C   1 
ATOM   861   O  O   . TYR A  1 107 ? 8.731  10.902 107.690 1.00 31.56 ? 107  TYR A O   1 
ATOM   862   C  CB  . TYR A  1 107 ? 7.221  13.845 107.759 1.00 35.86 ? 107  TYR A CB  1 
ATOM   863   C  CG  . TYR A  1 107 ? 6.307  13.058 106.855 1.00 40.81 ? 107  TYR A CG  1 
ATOM   864   C  CD1 . TYR A  1 107 ? 5.003  12.765 107.245 1.00 43.34 ? 107  TYR A CD1 1 
ATOM   865   C  CD2 . TYR A  1 107 ? 6.789  12.471 105.682 1.00 46.69 ? 107  TYR A CD2 1 
ATOM   866   C  CE1 . TYR A  1 107 ? 4.201  11.897 106.503 1.00 48.65 ? 107  TYR A CE1 1 
ATOM   867   C  CE2 . TYR A  1 107 ? 5.996  11.595 104.928 1.00 49.66 ? 107  TYR A CE2 1 
ATOM   868   C  CZ  . TYR A  1 107 ? 4.703  11.312 105.349 1.00 50.48 ? 107  TYR A CZ  1 
ATOM   869   O  OH  . TYR A  1 107 ? 3.910  10.444 104.631 1.00 52.20 ? 107  TYR A OH  1 
ATOM   870   N  N   . CYS A  1 108 ? 10.045 12.720 107.577 1.00 31.61 ? 108  CYS A N   1 
ATOM   871   C  CA  . CYS A  1 108 ? 11.064 12.032 106.811 1.00 32.65 ? 108  CYS A CA  1 
ATOM   872   C  C   . CYS A  1 108 ? 11.513 10.784 107.533 1.00 32.60 ? 108  CYS A C   1 
ATOM   873   O  O   . CYS A  1 108 ? 11.722 9.739  106.910 1.00 33.67 ? 108  CYS A O   1 
ATOM   874   C  CB  . CYS A  1 108 ? 12.251 12.963 106.562 1.00 33.55 ? 108  CYS A CB  1 
ATOM   875   S  SG  . CYS A  1 108 ? 11.823 14.364 105.502 1.00 33.92 ? 108  CYS A SG  1 
ATOM   876   N  N   . GLU A  1 109 ? 11.648 10.894 108.850 1.00 33.50 ? 109  GLU A N   1 
ATOM   877   C  CA  . GLU A  1 109 ? 12.077 9.768  109.675 1.00 33.17 ? 109  GLU A CA  1 
ATOM   878   C  C   . GLU A  1 109 ? 11.050 8.642  109.678 1.00 33.32 ? 109  GLU A C   1 
ATOM   879   O  O   . GLU A  1 109 ? 11.404 7.472  109.568 1.00 34.17 ? 109  GLU A O   1 
ATOM   880   C  CB  . GLU A  1 109 ? 12.318 10.224 111.117 1.00 33.26 ? 109  GLU A CB  1 
ATOM   881   C  CG  . GLU A  1 109 ? 12.775 9.109  112.044 1.00 35.18 ? 109  GLU A CG  1 
ATOM   882   C  CD  . GLU A  1 109 ? 14.230 8.709  111.840 1.00 36.92 ? 109  GLU A CD  1 
ATOM   883   O  OE1 . GLU A  1 109 ? 14.618 7.617  112.314 1.00 39.58 ? 109  GLU A OE1 1 
ATOM   884   O  OE2 . GLU A  1 109 ? 14.990 9.483  111.221 1.00 36.21 ? 109  GLU A OE2 1 
ATOM   885   N  N   . SER A  1 110 ? 9.776  8.986  109.799 1.00 32.91 ? 110  SER A N   1 
ATOM   886   C  CA  . SER A  1 110 ? 8.756  7.953  109.833 1.00 36.11 ? 110  SER A CA  1 
ATOM   887   C  C   . SER A  1 110 ? 8.594  7.219  108.505 1.00 35.90 ? 110  SER A C   1 
ATOM   888   O  O   . SER A  1 110 ? 8.139  6.075  108.485 1.00 38.15 ? 110  SER A O   1 
ATOM   889   C  CB  . SER A  1 110 ? 7.418  8.540  110.289 1.00 38.23 ? 110  SER A CB  1 
ATOM   890   O  OG  . SER A  1 110 ? 6.981  9.555  109.406 1.00 49.14 ? 110  SER A OG  1 
ATOM   891   N  N   . VAL A  1 111 ? 8.963  7.849  107.393 1.00 35.03 ? 111  VAL A N   1 
ATOM   892   C  CA  . VAL A  1 111 ? 8.831  7.169  106.105 1.00 32.79 ? 111  VAL A CA  1 
ATOM   893   C  C   . VAL A  1 111 ? 10.180 6.774  105.523 1.00 30.84 ? 111  VAL A C   1 
ATOM   894   O  O   . VAL A  1 111 ? 10.268 6.412  104.356 1.00 33.08 ? 111  VAL A O   1 
ATOM   895   C  CB  . VAL A  1 111 ? 8.083  8.022  105.051 1.00 30.38 ? 111  VAL A CB  1 
ATOM   896   C  CG1 . VAL A  1 111 ? 6.793  8.548  105.628 1.00 32.70 ? 111  VAL A CG1 1 
ATOM   897   C  CG2 . VAL A  1 111 ? 8.964  9.144  104.570 1.00 35.77 ? 111  VAL A CG2 1 
ATOM   898   N  N   . GLY A  1 112 ? 11.232 6.863  106.328 1.00 29.78 ? 112  GLY A N   1 
ATOM   899   C  CA  . GLY A  1 112 ? 12.550 6.473  105.860 1.00 30.85 ? 112  GLY A CA  1 
ATOM   900   C  C   . GLY A  1 112 ? 13.350 7.367  104.916 1.00 32.67 ? 112  GLY A C   1 
ATOM   901   O  O   . GLY A  1 112 ? 14.348 6.899  104.341 1.00 32.32 ? 112  GLY A O   1 
ATOM   902   N  N   . ASP A  1 113 ? 12.949 8.626  104.721 1.00 31.82 ? 113  ASP A N   1 
ATOM   903   C  CA  . ASP A  1 113 ? 13.738 9.496  103.843 1.00 29.15 ? 113  ASP A CA  1 
ATOM   904   C  C   . ASP A  1 113 ? 14.847 10.127 104.690 1.00 27.56 ? 113  ASP A C   1 
ATOM   905   O  O   . ASP A  1 113 ? 14.848 11.333 104.964 1.00 26.32 ? 113  ASP A O   1 
ATOM   906   C  CB  . ASP A  1 113 ? 12.891 10.601 103.207 1.00 28.06 ? 113  ASP A CB  1 
ATOM   907   C  CG  . ASP A  1 113 ? 13.638 11.326 102.082 1.00 31.61 ? 113  ASP A CG  1 
ATOM   908   O  OD1 . ASP A  1 113 ? 14.888 11.278 102.063 1.00 36.94 ? 113  ASP A OD1 1 
ATOM   909   O  OD2 . ASP A  1 113 ? 12.990 11.951 101.219 1.00 32.15 ? 113  ASP A OD2 1 
ATOM   910   N  N   . TYR A  1 114 ? 15.789 9.294  105.107 1.00 24.63 ? 114  TYR A N   1 
ATOM   911   C  CA  . TYR A  1 114 ? 16.883 9.748  105.939 1.00 25.26 ? 114  TYR A CA  1 
ATOM   912   C  C   . TYR A  1 114 ? 17.710 10.858 105.296 1.00 24.59 ? 114  TYR A C   1 
ATOM   913   O  O   . TYR A  1 114 ? 18.149 11.786 105.980 1.00 22.66 ? 114  TYR A O   1 
ATOM   914   C  CB  . TYR A  1 114 ? 17.755 8.552  106.308 1.00 27.38 ? 114  TYR A CB  1 
ATOM   915   C  CG  . TYR A  1 114 ? 16.973 7.448  107.003 1.00 31.49 ? 114  TYR A CG  1 
ATOM   916   C  CD1 . TYR A  1 114 ? 16.338 7.680  108.232 1.00 31.39 ? 114  TYR A CD1 1 
ATOM   917   C  CD2 . TYR A  1 114 ? 16.866 6.174  106.434 1.00 30.76 ? 114  TYR A CD2 1 
ATOM   918   C  CE1 . TYR A  1 114 ? 15.617 6.668  108.878 1.00 32.96 ? 114  TYR A CE1 1 
ATOM   919   C  CE2 . TYR A  1 114 ? 16.149 5.154  107.068 1.00 31.82 ? 114  TYR A CE2 1 
ATOM   920   C  CZ  . TYR A  1 114 ? 15.528 5.407  108.290 1.00 34.09 ? 114  TYR A CZ  1 
ATOM   921   O  OH  . TYR A  1 114 ? 14.840 4.396  108.925 1.00 30.04 ? 114  TYR A OH  1 
ATOM   922   N  N   . ALA A  1 115 ? 17.912 10.779 103.984 1.00 24.42 ? 115  ALA A N   1 
ATOM   923   C  CA  . ALA A  1 115 ? 18.688 11.800 103.291 1.00 23.86 ? 115  ALA A CA  1 
ATOM   924   C  C   . ALA A  1 115 ? 18.019 13.164 103.431 1.00 24.14 ? 115  ALA A C   1 
ATOM   925   O  O   . ALA A  1 115 ? 18.661 14.130 103.839 1.00 24.74 ? 115  ALA A O   1 
ATOM   926   C  CB  . ALA A  1 115 ? 18.845 11.438 101.826 1.00 24.97 ? 115  ALA A CB  1 
ATOM   927   N  N   . SER A  1 116 ? 16.731 13.252 103.106 1.00 24.03 ? 116  SER A N   1 
ATOM   928   C  CA  . SER A  1 116 ? 16.028 14.525 103.221 1.00 25.27 ? 116  SER A CA  1 
ATOM   929   C  C   . SER A  1 116 ? 16.098 15.021 104.657 1.00 27.16 ? 116  SER A C   1 
ATOM   930   O  O   . SER A  1 116 ? 16.218 16.225 104.906 1.00 28.03 ? 116  SER A O   1 
ATOM   931   C  CB  . SER A  1 116 ? 14.564 14.390 102.792 1.00 25.62 ? 116  SER A CB  1 
ATOM   932   O  OG  . SER A  1 116 ? 14.466 14.101 101.406 1.00 29.67 ? 116  SER A OG  1 
ATOM   933   N  N   . ARG A  1 117 ? 16.027 14.094 105.606 1.00 27.04 ? 117  ARG A N   1 
ATOM   934   C  CA  . ARG A  1 117 ? 16.104 14.471 107.008 1.00 26.89 ? 117  ARG A CA  1 
ATOM   935   C  C   . ARG A  1 117 ? 17.396 15.244 107.320 1.00 28.54 ? 117  ARG A C   1 
ATOM   936   O  O   . ARG A  1 117 ? 17.350 16.357 107.838 1.00 26.45 ? 117  ARG A O   1 
ATOM   937   C  CB  . ARG A  1 117 ? 16.037 13.238 107.906 1.00 28.30 ? 117  ARG A CB  1 
ATOM   938   C  CG  . ARG A  1 117 ? 16.141 13.619 109.365 1.00 25.95 ? 117  ARG A CG  1 
ATOM   939   C  CD  . ARG A  1 117 ? 16.348 12.457 110.299 1.00 25.12 ? 117  ARG A CD  1 
ATOM   940   N  NE  . ARG A  1 117 ? 16.749 13.006 111.589 1.00 31.16 ? 117  ARG A NE  1 
ATOM   941   C  CZ  . ARG A  1 117 ? 16.203 12.690 112.757 1.00 30.30 ? 117  ARG A CZ  1 
ATOM   942   N  NH1 . ARG A  1 117 ? 15.216 11.803 112.820 1.00 28.84 ? 117  ARG A NH1 1 
ATOM   943   N  NH2 . ARG A  1 117 ? 16.634 13.292 113.860 1.00 31.06 ? 117  ARG A NH2 1 
ATOM   944   N  N   . GLU A  1 118 ? 18.547 14.652 107.012 1.00 30.39 ? 118  GLU A N   1 
ATOM   945   C  CA  . GLU A  1 118 ? 19.813 15.316 107.287 1.00 34.46 ? 118  GLU A CA  1 
ATOM   946   C  C   . GLU A  1 118 ? 19.902 16.652 106.566 1.00 33.84 ? 118  GLU A C   1 
ATOM   947   O  O   . GLU A  1 118 ? 20.627 17.551 106.985 1.00 35.58 ? 118  GLU A O   1 
ATOM   948   C  CB  . GLU A  1 118 ? 21.009 14.433 106.895 1.00 38.13 ? 118  GLU A CB  1 
ATOM   949   C  CG  . GLU A  1 118 ? 21.301 13.261 107.852 1.00 47.21 ? 118  GLU A CG  1 
ATOM   950   C  CD  . GLU A  1 118 ? 21.447 13.671 109.335 1.00 54.65 ? 118  GLU A CD  1 
ATOM   951   O  OE1 . GLU A  1 118 ? 20.461 13.549 110.105 1.00 56.10 ? 118  GLU A OE1 1 
ATOM   952   O  OE2 . GLU A  1 118 ? 22.549 14.115 109.737 1.00 57.12 ? 118  GLU A OE2 1 
ATOM   953   N  N   . LEU A  1 119 ? 19.167 16.799 105.477 1.00 33.17 ? 119  LEU A N   1 
ATOM   954   C  CA  . LEU A  1 119 ? 19.203 18.067 104.766 1.00 31.69 ? 119  LEU A CA  1 
ATOM   955   C  C   . LEU A  1 119 ? 18.409 19.100 105.577 1.00 29.27 ? 119  LEU A C   1 
ATOM   956   O  O   . LEU A  1 119 ? 18.859 20.225 105.784 1.00 26.02 ? 119  LEU A O   1 
ATOM   957   C  CB  . LEU A  1 119 ? 18.626 17.885 103.362 1.00 32.42 ? 119  LEU A CB  1 
ATOM   958   C  CG  . LEU A  1 119 ? 18.542 19.082 102.419 1.00 31.88 ? 119  LEU A CG  1 
ATOM   959   C  CD1 . LEU A  1 119 ? 18.368 18.561 101.003 1.00 36.93 ? 119  LEU A CD1 1 
ATOM   960   C  CD2 . LEU A  1 119 ? 17.386 19.981 102.803 1.00 30.49 ? 119  LEU A CD2 1 
ATOM   961   N  N   . LEU A  1 120 ? 17.230 18.709 106.049 1.00 28.69 ? 120  LEU A N   1 
ATOM   962   C  CA  . LEU A  1 120 ? 16.416 19.617 106.845 1.00 30.30 ? 120  LEU A CA  1 
ATOM   963   C  C   . LEU A  1 120 ? 17.148 19.883 108.154 1.00 34.14 ? 120  LEU A C   1 
ATOM   964   O  O   . LEU A  1 120 ? 17.164 21.007 108.659 1.00 34.97 ? 120  LEU A O   1 
ATOM   965   C  CB  . LEU A  1 120 ? 15.056 18.991 107.142 1.00 26.31 ? 120  LEU A CB  1 
ATOM   966   C  CG  . LEU A  1 120 ? 14.166 18.683 105.943 1.00 23.69 ? 120  LEU A CG  1 
ATOM   967   C  CD1 . LEU A  1 120 ? 12.962 17.914 106.423 1.00 18.96 ? 120  LEU A CD1 1 
ATOM   968   C  CD2 . LEU A  1 120 ? 13.754 19.967 105.236 1.00 18.38 ? 120  LEU A CD2 1 
ATOM   969   N  N   . GLU A  1 121 ? 17.757 18.827 108.687 1.00 36.43 ? 121  GLU A N   1 
ATOM   970   C  CA  . GLU A  1 121 ? 18.500 18.888 109.932 1.00 37.50 ? 121  GLU A CA  1 
ATOM   971   C  C   . GLU A  1 121 ? 19.458 20.079 109.924 1.00 37.28 ? 121  GLU A C   1 
ATOM   972   O  O   . GLU A  1 121 ? 19.510 20.856 110.879 1.00 35.68 ? 121  GLU A O   1 
ATOM   973   C  CB  . GLU A  1 121 ? 19.276 17.586 110.113 1.00 42.75 ? 121  GLU A CB  1 
ATOM   974   C  CG  . GLU A  1 121 ? 19.875 17.389 111.486 1.00 52.34 ? 121  GLU A CG  1 
ATOM   975   C  CD  . GLU A  1 121 ? 19.229 16.236 112.244 1.00 60.44 ? 121  GLU A CD  1 
ATOM   976   O  OE1 . GLU A  1 121 ? 19.405 15.062 111.837 1.00 61.73 ? 121  GLU A OE1 1 
ATOM   977   O  OE2 . GLU A  1 121 ? 18.541 16.507 113.252 1.00 65.46 ? 121  GLU A OE2 1 
ATOM   978   N  N   . ASP A  1 122 ? 20.211 20.257 108.833 1.00 37.11 ? 122  ASP A N   1 
ATOM   979   C  CA  . ASP A  1 122 ? 21.160 21.316 108.707 1.00 38.00 ? 122  ASP A CA  1 
ATOM   980   C  C   . ASP A  1 122 ? 20.485 22.672 108.686 1.00 36.33 ? 122  ASP A C   1 
ATOM   981   O  O   . ASP A  1 122 ? 20.876 23.584 109.439 1.00 36.25 ? 122  ASP A O   1 
ATOM   982   C  CB  . ASP A  1 122 ? 21.958 21.044 107.440 1.00 38.60 ? 122  ASP A CB  1 
ATOM   983   C  CG  . ASP A  1 122 ? 22.684 19.711 107.544 1.00 20.00 ? 122  ASP A CG  1 
ATOM   984   O  OD1 . ASP A  1 122 ? 22.878 19.233 108.685 1.00 20.00 ? 122  ASP A OD1 1 
ATOM   985   O  OD2 . ASP A  1 122 ? 23.049 19.138 106.497 1.00 20.00 ? 122  ASP A OD2 1 
ATOM   986   N  N   . ILE A  1 123 ? 19.489 22.858 107.826 1.00 34.97 ? 123  ILE A N   1 
ATOM   987   C  CA  . ILE A  1 123 ? 18.788 24.138 107.753 1.00 32.88 ? 123  ILE A CA  1 
ATOM   988   C  C   . ILE A  1 123 ? 18.305 24.462 109.157 1.00 29.45 ? 123  ILE A C   1 
ATOM   989   O  O   . ILE A  1 123 ? 18.369 25.598 109.594 1.00 28.03 ? 123  ILE A O   1 
ATOM   990   C  CB  . ILE A  1 123 ? 17.581 24.081 106.759 1.00 34.06 ? 123  ILE A CB  1 
ATOM   991   C  CG1 . ILE A  1 123 ? 18.099 23.874 105.329 1.00 28.53 ? 123  ILE A CG1 1 
ATOM   992   C  CG2 . ILE A  1 123 ? 16.755 25.376 106.833 1.00 31.98 ? 123  ILE A CG2 1 
ATOM   993   C  CD1 . ILE A  1 123 ? 17.022 23.818 104.302 1.00 26.35 ? 123  ILE A CD1 1 
ATOM   994   N  N   . LEU A  1 124 ? 17.858 23.438 109.870 1.00 31.77 ? 124  LEU A N   1 
ATOM   995   C  CA  . LEU A  1 124 ? 17.371 23.594 111.239 1.00 35.02 ? 124  LEU A CA  1 
ATOM   996   C  C   . LEU A  1 124 ? 18.424 24.151 112.197 1.00 37.04 ? 124  LEU A C   1 
ATOM   997   O  O   . LEU A  1 124 ? 18.165 25.111 112.928 1.00 38.11 ? 124  LEU A O   1 
ATOM   998   C  CB  . LEU A  1 124 ? 16.873 22.250 111.771 1.00 35.41 ? 124  LEU A CB  1 
ATOM   999   C  CG  . LEU A  1 124 ? 16.514 22.181 113.254 1.00 35.62 ? 124  LEU A CG  1 
ATOM   1000  C  CD1 . LEU A  1 124 ? 15.661 23.369 113.644 1.00 38.02 ? 124  LEU A CD1 1 
ATOM   1001  C  CD2 . LEU A  1 124 ? 15.774 20.881 113.526 1.00 36.13 ? 124  LEU A CD2 1 
ATOM   1002  N  N   . GLU A  1 125 ? 19.606 23.546 112.206 1.00 37.94 ? 125  GLU A N   1 
ATOM   1003  C  CA  . GLU A  1 125 ? 20.656 24.015 113.094 1.00 39.92 ? 125  GLU A CA  1 
ATOM   1004  C  C   . GLU A  1 125 ? 20.937 25.467 112.759 1.00 39.96 ? 125  GLU A C   1 
ATOM   1005  O  O   . GLU A  1 125 ? 21.048 26.315 113.645 1.00 41.46 ? 125  GLU A O   1 
ATOM   1006  C  CB  . GLU A  1 125 ? 21.920 23.165 112.929 1.00 43.02 ? 125  GLU A CB  1 
ATOM   1007  C  CG  . GLU A  1 125 ? 21.686 21.680 113.204 1.00 51.09 ? 125  GLU A CG  1 
ATOM   1008  C  CD  . GLU A  1 125 ? 22.968 20.862 113.243 1.00 56.46 ? 125  GLU A CD  1 
ATOM   1009  O  OE1 . GLU A  1 125 ? 23.800 21.115 114.142 1.00 60.42 ? 125  GLU A OE1 1 
ATOM   1010  O  OE2 . GLU A  1 125 ? 23.144 19.967 112.381 1.00 58.14 ? 125  GLU A OE2 1 
ATOM   1011  N  N   . SER A  1 126 ? 21.017 25.756 111.469 1.00 39.01 ? 126  SER A N   1 
ATOM   1012  C  CA  . SER A  1 126 ? 21.286 27.109 111.014 1.00 39.58 ? 126  SER A CA  1 
ATOM   1013  C  C   . SER A  1 126 ? 20.232 28.105 111.495 1.00 39.46 ? 126  SER A C   1 
ATOM   1014  O  O   . SER A  1 126 ? 20.559 29.206 111.947 1.00 38.54 ? 126  SER A O   1 
ATOM   1015  C  CB  . SER A  1 126 ? 21.368 27.133 109.483 1.00 39.93 ? 126  SER A CB  1 
ATOM   1016  O  OG  . SER A  1 126 ? 21.565 28.450 108.996 1.00 45.12 ? 126  SER A OG  1 
ATOM   1017  N  N   . GLU A  1 127 ? 18.968 27.714 111.411 1.00 40.64 ? 127  GLU A N   1 
ATOM   1018  C  CA  . GLU A  1 127 ? 17.873 28.588 111.813 1.00 42.91 ? 127  GLU A CA  1 
ATOM   1019  C  C   . GLU A  1 127 ? 17.921 28.875 113.310 1.00 42.57 ? 127  GLU A C   1 
ATOM   1020  O  O   . GLU A  1 127 ? 17.526 29.971 113.726 1.00 39.78 ? 127  GLU A O   1 
ATOM   1021  C  CB  . GLU A  1 127 ? 16.527 27.971 111.430 1.00 45.22 ? 127  GLU A CB  1 
ATOM   1022  C  CG  . GLU A  1 127 ? 16.447 27.504 109.986 1.00 57.66 ? 127  GLU A CG  1 
ATOM   1023  C  CD  . GLU A  1 127 ? 16.654 28.633 108.995 1.00 65.55 ? 127  GLU A CD  1 
ATOM   1024  O  OE1 . GLU A  1 127 ? 16.845 29.785 109.439 1.00 70.63 ? 127  GLU A OE1 1 
ATOM   1025  O  OE2 . GLU A  1 127 ? 16.624 28.366 107.776 1.00 69.41 ? 127  GLU A OE2 1 
ATOM   1026  N  N   . GLU A  1 128 ? 18.404 27.928 114.113 1.00 43.39 ? 128  GLU A N   1 
ATOM   1027  C  CA  . GLU A  1 128 ? 18.504 28.180 115.546 1.00 44.24 ? 128  GLU A CA  1 
ATOM   1028  C  C   . GLU A  1 128 ? 19.587 29.236 115.757 1.00 45.15 ? 128  GLU A C   1 
ATOM   1029  O  O   . GLU A  1 128 ? 19.575 29.952 116.749 1.00 43.59 ? 128  GLU A O   1 
ATOM   1030  C  CB  . GLU A  1 128 ? 18.805 26.887 116.317 1.00 42.83 ? 128  GLU A CB  1 
ATOM   1031  C  CG  . GLU A  1 128 ? 17.526 26.159 116.765 1.00 44.50 ? 128  GLU A CG  1 
ATOM   1032  C  CD  . GLU A  1 128 ? 17.784 24.862 117.529 1.00 47.69 ? 128  GLU A CD  1 
ATOM   1033  O  OE1 . GLU A  1 128 ? 18.786 24.785 118.269 1.00 52.19 ? 128  GLU A OE1 1 
ATOM   1034  O  OE2 . GLU A  1 128 ? 16.973 23.918 117.411 1.00 46.70 ? 128  GLU A OE2 1 
ATOM   1035  N  N   . ASP A  1 129 ? 20.505 29.343 114.793 1.00 49.64 ? 129  ASP A N   1 
ATOM   1036  C  CA  . ASP A  1 129 ? 21.576 30.345 114.832 1.00 49.82 ? 129  ASP A CA  1 
ATOM   1037  C  C   . ASP A  1 129 ? 21.051 31.693 114.365 1.00 47.90 ? 129  ASP A C   1 
ATOM   1038  O  O   . ASP A  1 129 ? 21.492 32.740 114.842 1.00 46.95 ? 129  ASP A O   1 
ATOM   1039  C  CB  . ASP A  1 129 ? 22.755 29.918 113.973 1.00 52.60 ? 129  ASP A CB  1 
ATOM   1040  C  CG  . ASP A  1 129 ? 23.677 28.984 114.710 1.00 60.77 ? 129  ASP A CG  1 
ATOM   1041  O  OD1 . ASP A  1 129 ? 24.656 28.509 114.091 1.00 66.68 ? 129  ASP A OD1 1 
ATOM   1042  O  OD2 . ASP A  1 129 ? 23.420 28.729 115.916 1.00 62.29 ? 129  ASP A OD2 1 
ATOM   1043  N  N   . HIS A  1 130 ? 20.137 31.686 113.404 1.00 46.85 ? 130  HIS A N   1 
ATOM   1044  C  CA  . HIS A  1 130 ? 19.545 32.968 113.023 1.00 44.42 ? 130  HIS A CA  1 
ATOM   1045  C  C   . HIS A  1 130 ? 18.756 33.485 114.176 1.00 44.10 ? 130  HIS A C   1 
ATOM   1046  O  O   . HIS A  1 130 ? 18.740 34.682 114.454 1.00 45.77 ? 130  HIS A O   1 
ATOM   1047  C  CB  . HIS A  1 130 ? 18.618 32.814 111.814 1.00 45.76 ? 130  HIS A CB  1 
ATOM   1048  C  CG  . HIS A  1 130 ? 19.354 32.483 110.504 1.00 50.40 ? 130  HIS A CG  1 
ATOM   1049  N  ND1 . HIS A  1 130 ? 18.702 31.929 109.422 1.00 49.55 ? 130  HIS A ND1 1 
ATOM   1050  C  CD2 . HIS A  1 130 ? 20.645 32.639 110.126 1.00 50.73 ? 130  HIS A CD2 1 
ATOM   1051  C  CE1 . HIS A  1 130 ? 19.560 31.760 108.432 1.00 50.07 ? 130  HIS A CE1 1 
ATOM   1052  N  NE2 . HIS A  1 130 ? 20.746 32.183 108.833 1.00 51.31 ? 130  HIS A NE2 1 
ATOM   1053  N  N   . ILE A  1 131 ? 18.068 32.586 114.878 1.00 41.91 ? 131  ILE A N   1 
ATOM   1054  C  CA  . ILE A  1 131 ? 17.254 32.997 116.021 1.00 41.31 ? 131  ILE A CA  1 
ATOM   1055  C  C   . ILE A  1 131 ? 18.074 33.474 117.217 1.00 39.20 ? 131  ILE A C   1 
ATOM   1056  O  O   . ILE A  1 131 ? 17.683 34.418 117.901 1.00 37.81 ? 131  ILE A O   1 
ATOM   1057  C  CB  . ILE A  1 131 ? 16.318 31.859 116.504 1.00 42.94 ? 131  ILE A CB  1 
ATOM   1058  C  CG1 . ILE A  1 131 ? 15.211 31.616 115.472 1.00 43.38 ? 131  ILE A CG1 1 
ATOM   1059  C  CG2 . ILE A  1 131 ? 15.711 32.223 117.865 1.00 42.79 ? 131  ILE A CG2 1 
ATOM   1060  C  CD1 . ILE A  1 131 ? 14.171 30.568 115.883 1.00 42.14 ? 131  ILE A CD1 1 
ATOM   1061  N  N   . ASP A  1 132 ? 19.203 32.822 117.471 1.00 37.48 ? 132  ASP A N   1 
ATOM   1062  C  CA  . ASP A  1 132 ? 20.051 33.197 118.595 1.00 38.26 ? 132  ASP A CA  1 
ATOM   1063  C  C   . ASP A  1 132 ? 20.524 34.640 118.422 1.00 37.83 ? 132  ASP A C   1 
ATOM   1064  O  O   . ASP A  1 132 ? 20.496 35.438 119.365 1.00 36.39 ? 132  ASP A O   1 
ATOM   1065  C  CB  . ASP A  1 132 ? 21.248 32.240 118.686 1.00 39.97 ? 132  ASP A CB  1 
ATOM   1066  C  CG  . ASP A  1 132 ? 22.000 32.350 120.011 1.00 44.97 ? 132  ASP A CG  1 
ATOM   1067  O  OD1 . ASP A  1 132 ? 21.402 32.795 121.019 1.00 45.28 ? 132  ASP A OD1 1 
ATOM   1068  O  OD2 . ASP A  1 132 ? 23.194 31.967 120.047 1.00 47.58 ? 132  ASP A OD2 1 
ATOM   1069  N  N   . TRP A  1 133 ? 20.934 34.978 117.204 1.00 36.10 ? 133  TRP A N   1 
ATOM   1070  C  CA  . TRP A  1 133 ? 21.414 36.322 116.919 1.00 35.66 ? 133  TRP A CA  1 
ATOM   1071  C  C   . TRP A  1 133 ? 20.301 37.351 117.088 1.00 37.60 ? 133  TRP A C   1 
ATOM   1072  O  O   . TRP A  1 133 ? 20.523 38.442 117.627 1.00 39.45 ? 133  TRP A O   1 
ATOM   1073  C  CB  . TRP A  1 133 ? 21.968 36.399 115.495 1.00 33.50 ? 133  TRP A CB  1 
ATOM   1074  C  CG  . TRP A  1 133 ? 22.504 37.750 115.152 1.00 29.75 ? 133  TRP A CG  1 
ATOM   1075  C  CD1 . TRP A  1 133 ? 23.760 38.228 115.405 1.00 29.14 ? 133  TRP A CD1 1 
ATOM   1076  C  CD2 . TRP A  1 133 ? 21.778 38.828 114.548 1.00 28.29 ? 133  TRP A CD2 1 
ATOM   1077  N  NE1 . TRP A  1 133 ? 23.860 39.540 114.997 1.00 26.18 ? 133  TRP A NE1 1 
ATOM   1078  C  CE2 . TRP A  1 133 ? 22.658 39.933 114.468 1.00 26.34 ? 133  TRP A CE2 1 
ATOM   1079  C  CE3 . TRP A  1 133 ? 20.471 38.968 114.065 1.00 27.02 ? 133  TRP A CE3 1 
ATOM   1080  C  CZ2 . TRP A  1 133 ? 22.271 41.161 113.925 1.00 25.68 ? 133  TRP A CZ2 1 
ATOM   1081  C  CZ3 . TRP A  1 133 ? 20.086 40.197 113.522 1.00 27.53 ? 133  TRP A CZ3 1 
ATOM   1082  C  CH2 . TRP A  1 133 ? 20.986 41.273 113.459 1.00 25.74 ? 133  TRP A CH2 1 
ATOM   1083  N  N   . LEU A  1 134 ? 19.103 37.011 116.622 1.00 36.48 ? 134  LEU A N   1 
ATOM   1084  C  CA  . LEU A  1 134 ? 17.980 37.926 116.741 1.00 35.82 ? 134  LEU A CA  1 
ATOM   1085  C  C   . LEU A  1 134 ? 17.625 38.156 118.204 1.00 37.42 ? 134  LEU A C   1 
ATOM   1086  O  O   . LEU A  1 134 ? 17.485 39.296 118.640 1.00 36.56 ? 134  LEU A O   1 
ATOM   1087  C  CB  . LEU A  1 134 ? 16.768 37.383 115.985 1.00 35.42 ? 134  LEU A CB  1 
ATOM   1088  C  CG  . LEU A  1 134 ? 16.823 37.458 114.456 1.00 35.06 ? 134  LEU A CG  1 
ATOM   1089  C  CD1 . LEU A  1 134 ? 15.675 36.654 113.868 1.00 35.59 ? 134  LEU A CD1 1 
ATOM   1090  C  CD2 . LEU A  1 134 ? 16.753 38.911 114.001 1.00 34.27 ? 134  LEU A CD2 1 
ATOM   1091  N  N   . GLU A  1 135 ? 17.484 37.076 118.967 1.00 40.45 ? 135  GLU A N   1 
ATOM   1092  C  CA  . GLU A  1 135 ? 17.142 37.200 120.384 1.00 43.28 ? 135  GLU A CA  1 
ATOM   1093  C  C   . GLU A  1 135 ? 18.198 38.057 121.084 1.00 43.16 ? 135  GLU A C   1 
ATOM   1094  O  O   . GLU A  1 135 ? 17.873 38.903 121.926 1.00 42.76 ? 135  GLU A O   1 
ATOM   1095  C  CB  . GLU A  1 135 ? 17.075 35.821 121.056 1.00 43.72 ? 135  GLU A CB  1 
ATOM   1096  C  CG  . GLU A  1 135 ? 16.143 34.831 120.378 1.00 46.72 ? 135  GLU A CG  1 
ATOM   1097  C  CD  . GLU A  1 135 ? 16.064 33.488 121.097 1.00 47.80 ? 135  GLU A CD  1 
ATOM   1098  O  OE1 . GLU A  1 135 ? 17.122 32.947 121.508 1.00 45.34 ? 135  GLU A OE1 1 
ATOM   1099  O  OE2 . GLU A  1 135 ? 14.934 32.971 121.231 1.00 47.83 ? 135  GLU A OE2 1 
ATOM   1100  N  N   . THR A  1 136 ? 19.462 37.838 120.728 1.00 39.36 ? 136  THR A N   1 
ATOM   1101  C  CA  . THR A  1 136 ? 20.547 38.598 121.329 1.00 38.70 ? 136  THR A CA  1 
ATOM   1102  C  C   . THR A  1 136 ? 20.408 40.091 121.046 1.00 37.61 ? 136  THR A C   1 
ATOM   1103  O  O   . THR A  1 136 ? 20.536 40.912 121.953 1.00 35.96 ? 136  THR A O   1 
ATOM   1104  C  CB  . THR A  1 136 ? 21.917 38.113 120.823 1.00 38.64 ? 136  THR A CB  1 
ATOM   1105  O  OG1 . THR A  1 136 ? 22.117 36.753 121.226 1.00 43.51 ? 136  THR A OG1 1 
ATOM   1106  C  CG2 . THR A  1 136 ? 23.029 38.958 121.403 1.00 36.41 ? 136  THR A CG2 1 
ATOM   1107  N  N   . GLN A  1 137 ? 20.142 40.450 119.795 1.00 36.56 ? 137  GLN A N   1 
ATOM   1108  C  CA  . GLN A  1 137 ? 19.994 41.860 119.470 1.00 34.50 ? 137  GLN A CA  1 
ATOM   1109  C  C   . GLN A  1 137 ? 18.895 42.487 120.319 1.00 33.24 ? 137  GLN A C   1 
ATOM   1110  O  O   . GLN A  1 137 ? 19.072 43.575 120.878 1.00 34.16 ? 137  GLN A O   1 
ATOM   1111  C  CB  . GLN A  1 137 ? 19.679 42.046 117.989 1.00 31.64 ? 137  GLN A CB  1 
ATOM   1112  C  CG  . GLN A  1 137 ? 20.681 41.380 117.079 1.00 33.55 ? 137  GLN A CG  1 
ATOM   1113  C  CD  . GLN A  1 137 ? 22.115 41.575 117.542 1.00 35.40 ? 137  GLN A CD  1 
ATOM   1114  O  OE1 . GLN A  1 137 ? 22.603 42.703 117.665 1.00 33.27 ? 137  GLN A OE1 1 
ATOM   1115  N  NE2 . GLN A  1 137 ? 22.800 40.467 117.800 1.00 36.45 ? 137  GLN A NE2 1 
ATOM   1116  N  N   . LEU A  1 138 ? 17.764 41.803 120.433 1.00 31.69 ? 138  LEU A N   1 
ATOM   1117  C  CA  . LEU A  1 138 ? 16.666 42.341 121.227 1.00 33.41 ? 138  LEU A CA  1 
ATOM   1118  C  C   . LEU A  1 138 ? 17.049 42.544 122.693 1.00 35.16 ? 138  LEU A C   1 
ATOM   1119  O  O   . LEU A  1 138 ? 16.736 43.581 123.273 1.00 36.26 ? 138  LEU A O   1 
ATOM   1120  C  CB  . LEU A  1 138 ? 15.437 41.439 121.114 1.00 28.93 ? 138  LEU A CB  1 
ATOM   1121  C  CG  . LEU A  1 138 ? 14.700 41.564 119.778 1.00 27.93 ? 138  LEU A CG  1 
ATOM   1122  C  CD1 . LEU A  1 138 ? 13.641 40.483 119.668 1.00 25.00 ? 138  LEU A CD1 1 
ATOM   1123  C  CD2 . LEU A  1 138 ? 14.074 42.954 119.668 1.00 23.48 ? 138  LEU A CD2 1 
ATOM   1124  N  N   . ASP A  1 139 ? 17.737 41.567 123.284 1.00 36.04 ? 139  ASP A N   1 
ATOM   1125  C  CA  . ASP A  1 139 ? 18.155 41.668 124.680 1.00 36.64 ? 139  ASP A CA  1 
ATOM   1126  C  C   . ASP A  1 139 ? 19.169 42.785 124.868 1.00 35.03 ? 139  ASP A C   1 
ATOM   1127  O  O   . ASP A  1 139 ? 19.163 43.474 125.883 1.00 37.15 ? 139  ASP A O   1 
ATOM   1128  C  CB  . ASP A  1 139 ? 18.755 40.340 125.156 1.00 45.98 ? 139  ASP A CB  1 
ATOM   1129  C  CG  . ASP A  1 139 ? 17.792 39.535 126.042 1.00 52.66 ? 139  ASP A CG  1 
ATOM   1130  O  OD1 . ASP A  1 139 ? 17.519 39.974 127.185 1.00 56.86 ? 139  ASP A OD1 1 
ATOM   1131  O  OD2 . ASP A  1 139 ? 17.311 38.465 125.597 1.00 53.11 ? 139  ASP A OD2 1 
ATOM   1132  N  N   . LEU A  1 140 ? 20.037 42.962 123.880 1.00 34.50 ? 140  LEU A N   1 
ATOM   1133  C  CA  . LEU A  1 140 ? 21.061 44.003 123.910 1.00 30.97 ? 140  LEU A CA  1 
ATOM   1134  C  C   . LEU A  1 140 ? 20.396 45.377 123.914 1.00 31.70 ? 140  LEU A C   1 
ATOM   1135  O  O   . LEU A  1 140 ? 20.864 46.311 124.571 1.00 31.46 ? 140  LEU A O   1 
ATOM   1136  C  CB  . LEU A  1 140 ? 21.969 43.865 122.686 1.00 30.38 ? 140  LEU A CB  1 
ATOM   1137  C  CG  . LEU A  1 140 ? 23.438 43.489 122.885 1.00 33.02 ? 140  LEU A CG  1 
ATOM   1138  C  CD1 . LEU A  1 140 ? 23.565 42.438 123.950 1.00 30.81 ? 140  LEU A CD1 1 
ATOM   1139  C  CD2 . LEU A  1 140 ? 24.018 42.991 121.567 1.00 30.52 ? 140  LEU A CD2 1 
ATOM   1140  N  N   . ILE A  1 141 ? 19.304 45.509 123.172 1.00 31.00 ? 141  ILE A N   1 
ATOM   1141  C  CA  . ILE A  1 141 ? 18.598 46.779 123.134 1.00 32.64 ? 141  ILE A CA  1 
ATOM   1142  C  C   . ILE A  1 141 ? 18.166 47.151 124.552 1.00 34.78 ? 141  ILE A C   1 
ATOM   1143  O  O   . ILE A  1 141 ? 18.220 48.315 124.943 1.00 36.44 ? 141  ILE A O   1 
ATOM   1144  C  CB  . ILE A  1 141 ? 17.366 46.704 122.207 1.00 30.56 ? 141  ILE A CB  1 
ATOM   1145  C  CG1 . ILE A  1 141 ? 17.818 46.772 120.747 1.00 28.43 ? 141  ILE A CG1 1 
ATOM   1146  C  CG2 . ILE A  1 141 ? 16.400 47.821 122.533 1.00 27.88 ? 141  ILE A CG2 1 
ATOM   1147  C  CD1 . ILE A  1 141 ? 16.680 46.690 119.735 1.00 27.26 ? 141  ILE A CD1 1 
ATOM   1148  N  N   . ASP A  1 142 ? 17.750 46.152 125.323 1.00 39.05 ? 142  ASP A N   1 
ATOM   1149  C  CA  . ASP A  1 142 ? 17.324 46.372 126.704 1.00 43.53 ? 142  ASP A CA  1 
ATOM   1150  C  C   . ASP A  1 142 ? 18.473 46.814 127.600 1.00 43.18 ? 142  ASP A C   1 
ATOM   1151  O  O   . ASP A  1 142 ? 18.406 47.853 128.253 1.00 46.34 ? 142  ASP A O   1 
ATOM   1152  C  CB  . ASP A  1 142 ? 16.729 45.090 127.291 1.00 48.21 ? 142  ASP A CB  1 
ATOM   1153  C  CG  . ASP A  1 142 ? 15.398 44.726 126.672 1.00 52.56 ? 142  ASP A CG  1 
ATOM   1154  O  OD1 . ASP A  1 142 ? 14.482 45.579 126.683 1.00 54.09 ? 142  ASP A OD1 1 
ATOM   1155  O  OD2 . ASP A  1 142 ? 15.268 43.583 126.184 1.00 56.36 ? 142  ASP A OD2 1 
ATOM   1156  N  N   . LYS A  1 143 ? 19.527 46.006 127.620 1.00 41.23 ? 143  LYS A N   1 
ATOM   1157  C  CA  . LYS A  1 143 ? 20.701 46.258 128.445 1.00 40.05 ? 143  LYS A CA  1 
ATOM   1158  C  C   . LYS A  1 143 ? 21.488 47.551 128.180 1.00 39.04 ? 143  LYS A C   1 
ATOM   1159  O  O   . LYS A  1 143 ? 22.164 48.051 129.080 1.00 40.90 ? 143  LYS A O   1 
ATOM   1160  C  CB  . LYS A  1 143 ? 21.651 45.054 128.345 1.00 40.07 ? 143  LYS A CB  1 
ATOM   1161  C  CG  . LYS A  1 143 ? 21.047 43.733 128.818 1.00 38.30 ? 143  LYS A CG  1 
ATOM   1162  C  CD  . LYS A  1 143 ? 22.025 42.576 128.642 1.00 38.50 ? 143  LYS A CD  1 
ATOM   1163  C  CE  . LYS A  1 143 ? 21.495 41.263 129.240 1.00 37.54 ? 143  LYS A CE  1 
ATOM   1164  N  NZ  . LYS A  1 143 ? 20.430 40.606 128.423 1.00 33.53 ? 143  LYS A NZ  1 
ATOM   1165  N  N   . ILE A  1 144 ? 21.417 48.097 126.969 1.00 38.55 ? 144  ILE A N   1 
ATOM   1166  C  CA  . ILE A  1 144 ? 22.181 49.313 126.667 1.00 36.10 ? 144  ILE A CA  1 
ATOM   1167  C  C   . ILE A  1 144 ? 21.348 50.474 126.143 1.00 35.70 ? 144  ILE A C   1 
ATOM   1168  O  O   . ILE A  1 144 ? 21.845 51.599 126.049 1.00 34.77 ? 144  ILE A O   1 
ATOM   1169  C  CB  . ILE A  1 144 ? 23.303 49.041 125.635 1.00 35.63 ? 144  ILE A CB  1 
ATOM   1170  C  CG1 . ILE A  1 144 ? 22.690 48.663 124.276 1.00 35.47 ? 144  ILE A CG1 1 
ATOM   1171  C  CG2 . ILE A  1 144 ? 24.210 47.917 126.139 1.00 35.59 ? 144  ILE A CG2 1 
ATOM   1172  C  CD1 . ILE A  1 144 ? 23.701 48.596 123.118 1.00 31.23 ? 144  ILE A CD1 1 
ATOM   1173  N  N   . GLY A  1 145 ? 20.088 50.208 125.800 1.00 33.51 ? 145  GLY A N   1 
ATOM   1174  C  CA  . GLY A  1 145 ? 19.235 51.265 125.283 1.00 31.52 ? 145  GLY A CA  1 
ATOM   1175  C  C   . GLY A  1 145 ? 19.283 51.409 123.769 1.00 30.01 ? 145  GLY A C   1 
ATOM   1176  O  O   . GLY A  1 145 ? 20.356 51.331 123.151 1.00 25.51 ? 145  GLY A O   1 
ATOM   1177  N  N   . LEU A  1 146 ? 18.114 51.637 123.170 1.00 31.10 ? 146  LEU A N   1 
ATOM   1178  C  CA  . LEU A  1 146 ? 18.004 51.775 121.720 1.00 31.57 ? 146  LEU A CA  1 
ATOM   1179  C  C   . LEU A  1 146 ? 19.038 52.704 121.098 1.00 33.40 ? 146  LEU A C   1 
ATOM   1180  O  O   . LEU A  1 146 ? 19.740 52.300 120.169 1.00 35.13 ? 146  LEU A O   1 
ATOM   1181  C  CB  . LEU A  1 146 ? 16.612 52.252 121.326 1.00 29.21 ? 146  LEU A CB  1 
ATOM   1182  C  CG  . LEU A  1 146 ? 16.352 52.170 119.816 1.00 31.44 ? 146  LEU A CG  1 
ATOM   1183  C  CD1 . LEU A  1 146 ? 16.464 50.721 119.327 1.00 24.97 ? 146  LEU A CD1 1 
ATOM   1184  C  CD2 . LEU A  1 146 ? 14.972 52.735 119.518 1.00 26.19 ? 146  LEU A CD2 1 
ATOM   1185  N  N   . GLU A  1 147 ? 19.142 53.936 121.599 1.00 32.96 ? 147  GLU A N   1 
ATOM   1186  C  CA  . GLU A  1 147 ? 20.110 54.886 121.045 1.00 32.31 ? 147  GLU A CA  1 
ATOM   1187  C  C   . GLU A  1 147 ? 21.537 54.346 120.994 1.00 31.99 ? 147  GLU A C   1 
ATOM   1188  O  O   . GLU A  1 147 ? 22.245 54.555 119.998 1.00 31.58 ? 147  GLU A O   1 
ATOM   1189  C  CB  . GLU A  1 147 ? 20.086 56.198 121.820 1.00 33.64 ? 147  GLU A CB  1 
ATOM   1190  C  CG  . GLU A  1 147 ? 18.810 56.976 121.638 1.00 41.26 ? 147  GLU A CG  1 
ATOM   1191  C  CD  . GLU A  1 147 ? 18.717 58.148 122.588 1.00 50.85 ? 147  GLU A CD  1 
ATOM   1192  O  OE1 . GLU A  1 147 ? 18.828 57.915 123.814 1.00 56.32 ? 147  GLU A OE1 1 
ATOM   1193  O  OE2 . GLU A  1 147 ? 18.530 59.295 122.118 1.00 53.98 ? 147  GLU A OE2 1 
ATOM   1194  N  N   . ASN A  1 148 ? 21.971 53.657 122.049 1.00 31.72 ? 148  ASN A N   1 
ATOM   1195  C  CA  . ASN A  1 148 ? 23.321 53.098 122.044 1.00 31.06 ? 148  ASN A CA  1 
ATOM   1196  C  C   . ASN A  1 148 ? 23.405 51.944 121.058 1.00 29.28 ? 148  ASN A C   1 
ATOM   1197  O  O   . ASN A  1 148 ? 24.381 51.821 120.313 1.00 27.07 ? 148  ASN A O   1 
ATOM   1198  C  CB  . ASN A  1 148 ? 23.740 52.599 123.430 1.00 31.94 ? 148  ASN A CB  1 
ATOM   1199  C  CG  . ASN A  1 148 ? 24.311 53.702 124.305 1.00 34.37 ? 148  ASN A CG  1 
ATOM   1200  O  OD1 . ASN A  1 148 ? 25.084 54.549 123.847 1.00 34.26 ? 148  ASN A OD1 1 
ATOM   1201  N  ND2 . ASN A  1 148 ? 23.948 53.684 125.578 1.00 36.35 ? 148  ASN A ND2 1 
ATOM   1202  N  N   . TYR A  1 149 ? 22.378 51.102 121.039 1.00 29.15 ? 149  TYR A N   1 
ATOM   1203  C  CA  . TYR A  1 149 ? 22.391 49.964 120.131 1.00 30.57 ? 149  TYR A CA  1 
ATOM   1204  C  C   . TYR A  1 149 ? 22.501 50.417 118.681 1.00 31.20 ? 149  TYR A C   1 
ATOM   1205  O  O   . TYR A  1 149 ? 23.258 49.840 117.906 1.00 33.31 ? 149  TYR A O   1 
ATOM   1206  C  CB  . TYR A  1 149 ? 21.141 49.107 120.305 1.00 29.42 ? 149  TYR A CB  1 
ATOM   1207  C  CG  . TYR A  1 149 ? 21.117 47.936 119.355 1.00 28.02 ? 149  TYR A CG  1 
ATOM   1208  C  CD1 . TYR A  1 149 ? 21.947 46.833 119.552 1.00 25.95 ? 149  TYR A CD1 1 
ATOM   1209  C  CD2 . TYR A  1 149 ? 20.293 47.953 118.229 1.00 28.14 ? 149  TYR A CD2 1 
ATOM   1210  C  CE1 . TYR A  1 149 ? 21.957 45.774 118.646 1.00 27.71 ? 149  TYR A CE1 1 
ATOM   1211  C  CE2 . TYR A  1 149 ? 20.293 46.904 117.320 1.00 27.28 ? 149  TYR A CE2 1 
ATOM   1212  C  CZ  . TYR A  1 149 ? 21.124 45.820 117.531 1.00 28.46 ? 149  TYR A CZ  1 
ATOM   1213  O  OH  . TYR A  1 149 ? 21.106 44.786 116.623 1.00 28.93 ? 149  TYR A OH  1 
ATOM   1214  N  N   . LEU A  1 150 ? 21.741 51.449 118.321 1.00 31.95 ? 150  LEU A N   1 
ATOM   1215  C  CA  . LEU A  1 150 ? 21.764 51.994 116.969 1.00 31.41 ? 150  LEU A CA  1 
ATOM   1216  C  C   . LEU A  1 150 ? 23.121 52.625 116.668 1.00 31.53 ? 150  LEU A C   1 
ATOM   1217  O  O   . LEU A  1 150 ? 23.680 52.444 115.584 1.00 30.19 ? 150  LEU A O   1 
ATOM   1218  C  CB  . LEU A  1 150 ? 20.673 53.054 116.811 1.00 32.64 ? 150  LEU A CB  1 
ATOM   1219  C  CG  . LEU A  1 150 ? 19.234 52.554 116.798 1.00 33.69 ? 150  LEU A CG  1 
ATOM   1220  C  CD1 . LEU A  1 150 ? 18.291 53.742 116.822 1.00 36.90 ? 150  LEU A CD1 1 
ATOM   1221  C  CD2 . LEU A  1 150 ? 19.000 51.699 115.565 1.00 33.81 ? 150  LEU A CD2 1 
ATOM   1222  N  N   . GLN A  1 151 ? 23.641 53.380 117.629 1.00 31.97 ? 151  GLN A N   1 
ATOM   1223  C  CA  . GLN A  1 151 ? 24.936 54.025 117.453 1.00 33.82 ? 151  GLN A CA  1 
ATOM   1224  C  C   . GLN A  1 151 ? 26.019 52.998 117.166 1.00 34.58 ? 151  GLN A C   1 
ATOM   1225  O  O   . GLN A  1 151 ? 26.984 53.283 116.463 1.00 36.39 ? 151  GLN A O   1 
ATOM   1226  C  CB  . GLN A  1 151 ? 25.333 54.811 118.707 1.00 32.09 ? 151  GLN A CB  1 
ATOM   1227  C  CG  . GLN A  1 151 ? 26.820 55.151 118.742 1.00 28.73 ? 151  GLN A CG  1 
ATOM   1228  C  CD  . GLN A  1 151 ? 27.226 55.924 119.973 1.00 29.64 ? 151  GLN A CD  1 
ATOM   1229  O  OE1 . GLN A  1 151 ? 26.881 55.555 121.093 1.00 34.96 ? 151  GLN A OE1 1 
ATOM   1230  N  NE2 . GLN A  1 151 ? 27.975 56.998 119.774 1.00 29.95 ? 151  GLN A NE2 1 
ATOM   1231  N  N   . SER A  1 152 ? 25.861 51.804 117.719 1.00 34.42 ? 152  SER A N   1 
ATOM   1232  C  CA  . SER A  1 152 ? 26.855 50.770 117.527 1.00 35.79 ? 152  SER A CA  1 
ATOM   1233  C  C   . SER A  1 152 ? 26.673 50.045 116.204 1.00 37.94 ? 152  SER A C   1 
ATOM   1234  O  O   . SER A  1 152 ? 27.571 49.338 115.750 1.00 37.94 ? 152  SER A O   1 
ATOM   1235  C  CB  . SER A  1 152 ? 26.799 49.782 118.690 1.00 35.26 ? 152  SER A CB  1 
ATOM   1236  O  OG  . SER A  1 152 ? 25.518 49.189 118.783 1.00 38.55 ? 152  SER A OG  1 
ATOM   1237  N  N   . GLN A  1 153 ? 25.517 50.229 115.577 1.00 39.07 ? 153  GLN A N   1 
ATOM   1238  C  CA  . GLN A  1 153 ? 25.246 49.570 114.306 1.00 42.36 ? 153  GLN A CA  1 
ATOM   1239  C  C   . GLN A  1 153 ? 25.560 50.460 113.111 1.00 46.47 ? 153  GLN A C   1 
ATOM   1240  O  O   . GLN A  1 153 ? 25.405 50.047 111.961 1.00 47.76 ? 153  GLN A O   1 
ATOM   1241  C  CB  . GLN A  1 153 ? 23.787 49.128 114.249 1.00 41.38 ? 153  GLN A CB  1 
ATOM   1242  C  CG  . GLN A  1 153 ? 23.394 48.199 115.386 1.00 38.21 ? 153  GLN A CG  1 
ATOM   1243  C  CD  . GLN A  1 153 ? 24.360 47.045 115.540 1.00 34.84 ? 153  GLN A CD  1 
ATOM   1244  O  OE1 . GLN A  1 153 ? 24.663 46.345 114.576 1.00 33.89 ? 153  GLN A OE1 1 
ATOM   1245  N  NE2 . GLN A  1 153 ? 24.845 46.835 116.759 1.00 31.12 ? 153  GLN A NE2 1 
ATOM   1246  N  N   . MET A  1 154 ? 26.004 51.681 113.383 1.00 49.86 ? 154  MET A N   1 
ATOM   1247  C  CA  . MET A  1 154 ? 26.343 52.620 112.322 1.00 53.37 ? 154  MET A CA  1 
ATOM   1248  C  C   . MET A  1 154 ? 27.529 52.168 111.481 1.00 59.51 ? 154  MET A C   1 
ATOM   1249  O  O   . MET A  1 154 ? 27.359 51.776 110.327 1.00 61.54 ? 154  MET A O   1 
ATOM   1250  C  CB  . MET A  1 154 ? 26.634 53.998 112.908 1.00 47.86 ? 154  MET A CB  1 
ATOM   1251  C  CG  . MET A  1 154 ? 25.400 54.844 113.081 1.00 44.84 ? 154  MET A CG  1 
ATOM   1252  S  SD  . MET A  1 154 ? 25.786 56.383 113.880 1.00 38.84 ? 154  MET A SD  1 
ATOM   1253  C  CE  . MET A  1 154 ? 26.994 57.047 112.754 1.00 44.19 ? 154  MET A CE  1 
ATOM   1254  N  N   . ASP A  1 155 ? 28.727 52.227 112.054 1.00 65.80 ? 155  ASP A N   1 
ATOM   1255  C  CA  . ASP A  1 155 ? 29.933 51.823 111.334 1.00 72.53 ? 155  ASP A CA  1 
ATOM   1256  C  C   . ASP A  1 155 ? 30.424 50.436 111.741 1.00 75.90 ? 155  ASP A C   1 
ATOM   1257  O  O   . ASP A  1 155 ? 30.576 49.585 110.829 1.00 77.15 ? 155  ASP A O   1 
ATOM   1258  C  CB  . ASP A  1 155 ? 31.043 52.856 111.550 1.00 74.00 ? 155  ASP A CB  1 
ATOM   1259  C  CG  . ASP A  1 155 ? 30.715 54.198 110.920 1.00 78.30 ? 155  ASP A CG  1 
ATOM   1260  O  OD1 . ASP A  1 155 ? 30.650 54.264 109.671 1.00 79.81 ? 155  ASP A OD1 1 
ATOM   1261  O  OD2 . ASP A  1 155 ? 30.512 55.182 111.671 1.00 79.21 ? 155  ASP A OD2 1 
ATOM   1262  O  OXT . ASP A  1 155 ? 30.654 50.218 112.956 1.00 77.78 ? 155  ASP A OXT 1 
ATOM   1263  N  N   . MET B  1 1   ? 15.040 62.151 100.179 1.00 56.24 ? 1    MET B N   1 
ATOM   1264  C  CA  . MET B  1 1   ? 14.527 63.112 99.160  1.00 55.09 ? 1    MET B CA  1 
ATOM   1265  C  C   . MET B  1 1   ? 13.227 62.554 98.578  1.00 54.88 ? 1    MET B C   1 
ATOM   1266  O  O   . MET B  1 1   ? 13.223 61.481 97.971  1.00 57.96 ? 1    MET B O   1 
ATOM   1267  C  CB  . MET B  1 1   ? 15.571 63.290 98.053  1.00 54.66 ? 1    MET B CB  1 
ATOM   1268  C  CG  . MET B  1 1   ? 15.342 64.497 97.157  1.00 54.00 ? 1    MET B CG  1 
ATOM   1269  S  SD  . MET B  1 1   ? 16.614 64.647 95.878  1.00 53.91 ? 1    MET B SD  1 
ATOM   1270  C  CE  . MET B  1 1   ? 15.764 63.882 94.441  1.00 51.52 ? 1    MET B CE  1 
ATOM   1271  N  N   . LYS B  1 2   ? 12.123 63.267 98.768  1.00 51.59 ? 2    LYS B N   1 
ATOM   1272  C  CA  . LYS B  1 2   ? 10.853 62.784 98.249  1.00 50.74 ? 2    LYS B CA  1 
ATOM   1273  C  C   . LYS B  1 2   ? 10.819 62.868 96.723  1.00 48.39 ? 2    LYS B C   1 
ATOM   1274  O  O   . LYS B  1 2   ? 11.143 63.906 96.142  1.00 46.78 ? 2    LYS B O   1 
ATOM   1275  C  CB  . LYS B  1 2   ? 9.683  63.581 98.844  1.00 53.73 ? 2    LYS B CB  1 
ATOM   1276  C  CG  . LYS B  1 2   ? 8.526  62.693 99.327  1.00 57.72 ? 2    LYS B CG  1 
ATOM   1277  C  CD  . LYS B  1 2   ? 8.091  61.693 98.248  1.00 59.68 ? 2    LYS B CD  1 
ATOM   1278  C  CE  . LYS B  1 2   ? 7.085  60.675 98.777  1.00 61.23 ? 2    LYS B CE  1 
ATOM   1279  N  NZ  . LYS B  1 2   ? 6.668  59.697 97.721  1.00 63.05 ? 2    LYS B NZ  1 
ATOM   1280  N  N   . GLY B  1 3   ? 10.431 61.768 96.082  1.00 44.53 ? 3    GLY B N   1 
ATOM   1281  C  CA  . GLY B  1 3   ? 10.362 61.745 94.632  1.00 43.10 ? 3    GLY B CA  1 
ATOM   1282  C  C   . GLY B  1 3   ? 8.930  61.750 94.146  1.00 42.02 ? 3    GLY B C   1 
ATOM   1283  O  O   . GLY B  1 3   ? 8.006  61.805 94.956  1.00 42.77 ? 3    GLY B O   1 
ATOM   1284  N  N   . ASP B  1 4   ? 8.729  61.697 92.834  1.00 41.11 ? 4    ASP B N   1 
ATOM   1285  C  CA  . ASP B  1 4   ? 7.371  61.693 92.305  1.00 42.71 ? 4    ASP B CA  1 
ATOM   1286  C  C   . ASP B  1 4   ? 6.664  60.384 92.631  1.00 42.16 ? 4    ASP B C   1 
ATOM   1287  O  O   . ASP B  1 4   ? 7.207  59.292 92.431  1.00 39.66 ? 4    ASP B O   1 
ATOM   1288  C  CB  . ASP B  1 4   ? 7.357  61.912 90.789  1.00 45.81 ? 4    ASP B CB  1 
ATOM   1289  C  CG  . ASP B  1 4   ? 7.785  63.317 90.395  1.00 52.74 ? 4    ASP B CG  1 
ATOM   1290  O  OD1 . ASP B  1 4   ? 9.004  63.605 90.401  1.00 56.70 ? 4    ASP B OD1 1 
ATOM   1291  O  OD2 . ASP B  1 4   ? 6.900  64.142 90.084  1.00 55.39 ? 4    ASP B OD2 1 
ATOM   1292  N  N   . LYS B  1 5   ? 5.447  60.513 93.146  1.00 40.50 ? 5    LYS B N   1 
ATOM   1293  C  CA  . LYS B  1 5   ? 4.629  59.367 93.502  1.00 40.58 ? 5    LYS B CA  1 
ATOM   1294  C  C   . LYS B  1 5   ? 4.501  58.404 92.319  1.00 39.18 ? 5    LYS B C   1 
ATOM   1295  O  O   . LYS B  1 5   ? 4.605  57.184 92.476  1.00 38.36 ? 5    LYS B O   1 
ATOM   1296  C  CB  . LYS B  1 5   ? 3.241  59.854 93.937  1.00 46.01 ? 5    LYS B CB  1 
ATOM   1297  C  CG  . LYS B  1 5   ? 2.186  58.760 94.090  1.00 54.65 ? 5    LYS B CG  1 
ATOM   1298  C  CD  . LYS B  1 5   ? 0.819  59.345 94.463  1.00 59.52 ? 5    LYS B CD  1 
ATOM   1299  C  CE  . LYS B  1 5   ? -0.216 58.242 94.690  1.00 61.24 ? 5    LYS B CE  1 
ATOM   1300  N  NZ  . LYS B  1 5   ? -1.551 58.773 95.099  1.00 62.10 ? 5    LYS B NZ  1 
ATOM   1301  N  N   . ILE B  1 6   ? 4.283  58.958 91.132  1.00 36.52 ? 6    ILE B N   1 
ATOM   1302  C  CA  . ILE B  1 6   ? 4.125  58.138 89.946  1.00 36.42 ? 6    ILE B CA  1 
ATOM   1303  C  C   . ILE B  1 6   ? 5.437  57.498 89.498  1.00 35.64 ? 6    ILE B C   1 
ATOM   1304  O  O   . ILE B  1 6   ? 5.437  56.370 88.986  1.00 33.54 ? 6    ILE B O   1 
ATOM   1305  C  CB  . ILE B  1 6   ? 3.518  58.959 88.792  1.00 38.20 ? 6    ILE B CB  1 
ATOM   1306  C  CG1 . ILE B  1 6   ? 2.161  59.515 89.224  1.00 37.89 ? 6    ILE B CG1 1 
ATOM   1307  C  CG2 . ILE B  1 6   ? 3.336  58.079 87.560  1.00 36.08 ? 6    ILE B CG2 1 
ATOM   1308  C  CD1 . ILE B  1 6   ? 1.479  60.345 88.156  1.00 43.08 ? 6    ILE B CD1 1 
ATOM   1309  N  N   . VAL B  1 7   ? 6.552  58.206 89.681  1.00 34.14 ? 7    VAL B N   1 
ATOM   1310  C  CA  . VAL B  1 7   ? 7.849  57.644 89.305  1.00 32.63 ? 7    VAL B CA  1 
ATOM   1311  C  C   . VAL B  1 7   ? 8.092  56.419 90.188  1.00 33.15 ? 7    VAL B C   1 
ATOM   1312  O  O   . VAL B  1 7   ? 8.519  55.362 89.710  1.00 34.48 ? 7    VAL B O   1 
ATOM   1313  C  CB  . VAL B  1 7   ? 9.011  58.649 89.514  1.00 31.45 ? 7    VAL B CB  1 
ATOM   1314  C  CG1 . VAL B  1 7   ? 10.341 57.916 89.435  1.00 28.14 ? 7    VAL B CG1 1 
ATOM   1315  C  CG2 . VAL B  1 7   ? 8.962  59.746 88.454  1.00 26.24 ? 7    VAL B CG2 1 
ATOM   1316  N  N   . ILE B  1 8   ? 7.813  56.563 91.481  1.00 30.23 ? 8    ILE B N   1 
ATOM   1317  C  CA  . ILE B  1 8   ? 7.987  55.450 92.406  1.00 30.09 ? 8    ILE B CA  1 
ATOM   1318  C  C   . ILE B  1 8   ? 7.022  54.322 92.045  1.00 28.77 ? 8    ILE B C   1 
ATOM   1319  O  O   . ILE B  1 8   ? 7.339  53.146 92.200  1.00 27.70 ? 8    ILE B O   1 
ATOM   1320  C  CB  . ILE B  1 8   ? 7.726  55.876 93.866  1.00 29.59 ? 8    ILE B CB  1 
ATOM   1321  C  CG1 . ILE B  1 8   ? 8.762  56.912 94.305  1.00 25.15 ? 8    ILE B CG1 1 
ATOM   1322  C  CG2 . ILE B  1 8   ? 7.784  54.657 94.771  1.00 25.63 ? 8    ILE B CG2 1 
ATOM   1323  C  CD1 . ILE B  1 8   ? 8.512  57.455 95.689  1.00 27.49 ? 8    ILE B CD1 1 
ATOM   1324  N  N   . GLN B  1 9   ? 5.838  54.679 91.568  1.00 31.27 ? 9    GLN B N   1 
ATOM   1325  C  CA  . GLN B  1 9   ? 4.878  53.658 91.181  1.00 35.05 ? 9    GLN B CA  1 
ATOM   1326  C  C   . GLN B  1 9   ? 5.461  52.808 90.056  1.00 34.45 ? 9    GLN B C   1 
ATOM   1327  O  O   . GLN B  1 9   ? 5.320  51.583 90.074  1.00 35.65 ? 9    GLN B O   1 
ATOM   1328  C  CB  . GLN B  1 9   ? 3.556  54.290 90.751  1.00 37.75 ? 9    GLN B CB  1 
ATOM   1329  C  CG  . GLN B  1 9   ? 2.745  54.849 91.910  1.00 44.16 ? 9    GLN B CG  1 
ATOM   1330  C  CD  . GLN B  1 9   ? 1.373  55.340 91.475  1.00 50.01 ? 9    GLN B CD  1 
ATOM   1331  O  OE1 . GLN B  1 9   ? 1.245  56.358 90.780  1.00 53.23 ? 9    GLN B OE1 1 
ATOM   1332  N  NE2 . GLN B  1 9   ? 0.337  54.610 91.875  1.00 51.31 ? 9    GLN B NE2 1 
ATOM   1333  N  N   . HIS B  1 10  ? 6.119  53.448 89.087  1.00 32.05 ? 10   HIS B N   1 
ATOM   1334  C  CA  . HIS B  1 10  ? 6.737  52.711 87.984  1.00 30.62 ? 10   HIS B CA  1 
ATOM   1335  C  C   . HIS B  1 10  ? 7.849  51.847 88.551  1.00 28.34 ? 10   HIS B C   1 
ATOM   1336  O  O   . HIS B  1 10  ? 7.895  50.639 88.304  1.00 27.19 ? 10   HIS B O   1 
ATOM   1337  C  CB  . HIS B  1 10  ? 7.324  53.660 86.939  1.00 34.60 ? 10   HIS B CB  1 
ATOM   1338  C  CG  . HIS B  1 10  ? 6.315  54.186 85.968  1.00 39.96 ? 10   HIS B CG  1 
ATOM   1339  N  ND1 . HIS B  1 10  ? 5.626  53.369 85.097  1.00 41.31 ? 10   HIS B ND1 1 
ATOM   1340  C  CD2 . HIS B  1 10  ? 5.879  55.447 85.729  1.00 40.49 ? 10   HIS B CD2 1 
ATOM   1341  C  CE1 . HIS B  1 10  ? 4.809  54.104 84.363  1.00 43.31 ? 10   HIS B CE1 1 
ATOM   1342  N  NE2 . HIS B  1 10  ? 4.942  55.368 84.727  1.00 42.45 ? 10   HIS B NE2 1 
ATOM   1343  N  N   . LEU B  1 11  ? 8.746  52.478 89.309  1.00 25.37 ? 11   LEU B N   1 
ATOM   1344  C  CA  . LEU B  1 11  ? 9.856  51.774 89.944  1.00 23.20 ? 11   LEU B CA  1 
ATOM   1345  C  C   . LEU B  1 11  ? 9.345  50.505 90.623  1.00 24.88 ? 11   LEU B C   1 
ATOM   1346  O  O   . LEU B  1 11  ? 9.892  49.412 90.435  1.00 23.24 ? 11   LEU B O   1 
ATOM   1347  C  CB  . LEU B  1 11  ? 10.517 52.690 90.963  1.00 19.40 ? 11   LEU B CB  1 
ATOM   1348  C  CG  . LEU B  1 11  ? 11.792 53.384 90.497  1.00 22.08 ? 11   LEU B CG  1 
ATOM   1349  C  CD1 . LEU B  1 11  ? 11.755 53.613 89.002  1.00 23.77 ? 11   LEU B CD1 1 
ATOM   1350  C  CD2 . LEU B  1 11  ? 11.959 54.698 91.268  1.00 24.19 ? 11   LEU B CD2 1 
ATOM   1351  N  N   . ASN B  1 12  ? 8.283  50.652 91.408  1.00 27.60 ? 12   ASN B N   1 
ATOM   1352  C  CA  . ASN B  1 12  ? 7.688  49.508 92.082  1.00 31.89 ? 12   ASN B CA  1 
ATOM   1353  C  C   . ASN B  1 12  ? 7.274  48.442 91.070  1.00 32.28 ? 12   ASN B C   1 
ATOM   1354  O  O   . ASN B  1 12  ? 7.554  47.259 91.252  1.00 33.25 ? 12   ASN B O   1 
ATOM   1355  C  CB  . ASN B  1 12  ? 6.471  49.947 92.889  1.00 33.33 ? 12   ASN B CB  1 
ATOM   1356  C  CG  . ASN B  1 12  ? 6.758  50.014 94.360  1.00 34.16 ? 12   ASN B CG  1 
ATOM   1357  O  OD1 . ASN B  1 12  ? 7.315  49.073 94.927  1.00 39.80 ? 12   ASN B OD1 1 
ATOM   1358  N  ND2 . ASN B  1 12  ? 6.379  51.118 94.996  1.00 32.38 ? 12   ASN B ND2 1 
ATOM   1359  N  N   . LYS B  1 13  ? 6.610  48.874 90.003  1.00 33.55 ? 13   LYS B N   1 
ATOM   1360  C  CA  . LYS B  1 13  ? 6.161  47.965 88.959  1.00 36.48 ? 13   LYS B CA  1 
ATOM   1361  C  C   . LYS B  1 13  ? 7.346  47.230 88.341  1.00 37.28 ? 13   LYS B C   1 
ATOM   1362  O  O   . LYS B  1 13  ? 7.351  46.000 88.248  1.00 38.21 ? 13   LYS B O   1 
ATOM   1363  C  CB  . LYS B  1 13  ? 5.408  48.742 87.877  1.00 39.66 ? 13   LYS B CB  1 
ATOM   1364  C  CG  . LYS B  1 13  ? 4.926  47.875 86.730  1.00 45.21 ? 13   LYS B CG  1 
ATOM   1365  C  CD  . LYS B  1 13  ? 3.876  48.589 85.903  1.00 50.11 ? 13   LYS B CD  1 
ATOM   1366  C  CE  . LYS B  1 13  ? 3.039  47.595 85.116  1.00 49.91 ? 13   LYS B CE  1 
ATOM   1367  N  NZ  . LYS B  1 13  ? 1.779  48.226 84.651  1.00 53.17 ? 13   LYS B NZ  1 
ATOM   1368  N  N   . ILE B  1 14  ? 8.348  47.988 87.912  1.00 35.69 ? 14   ILE B N   1 
ATOM   1369  C  CA  . ILE B  1 14  ? 9.530  47.391 87.318  1.00 34.77 ? 14   ILE B CA  1 
ATOM   1370  C  C   . ILE B  1 14  ? 10.047 46.319 88.264  1.00 34.96 ? 14   ILE B C   1 
ATOM   1371  O  O   . ILE B  1 14  ? 10.375 45.213 87.841  1.00 35.35 ? 14   ILE B O   1 
ATOM   1372  C  CB  . ILE B  1 14  ? 10.635 48.452 87.091  1.00 36.08 ? 14   ILE B CB  1 
ATOM   1373  C  CG1 . ILE B  1 14  ? 10.195 49.435 86.010  1.00 34.38 ? 14   ILE B CG1 1 
ATOM   1374  C  CG2 . ILE B  1 14  ? 11.928 47.787 86.653  1.00 39.65 ? 14   ILE B CG2 1 
ATOM   1375  C  CD1 . ILE B  1 14  ? 9.887  48.762 84.688  1.00 30.54 ? 14   ILE B CD1 1 
ATOM   1376  N  N   . LEU B  1 15  ? 10.092 46.652 89.551  1.00 36.11 ? 15   LEU B N   1 
ATOM   1377  C  CA  . LEU B  1 15  ? 10.580 45.741 90.587  1.00 37.30 ? 15   LEU B CA  1 
ATOM   1378  C  C   . LEU B  1 15  ? 9.844  44.398 90.669  1.00 37.65 ? 15   LEU B C   1 
ATOM   1379  O  O   . LEU B  1 15  ? 10.471 43.346 90.830  1.00 37.62 ? 15   LEU B O   1 
ATOM   1380  C  CB  . LEU B  1 15  ? 10.536 46.441 91.954  1.00 36.73 ? 15   LEU B CB  1 
ATOM   1381  C  CG  . LEU B  1 15  ? 10.894 45.601 93.186  1.00 36.07 ? 15   LEU B CG  1 
ATOM   1382  C  CD1 . LEU B  1 15  ? 12.249 44.932 92.982  1.00 36.24 ? 15   LEU B CD1 1 
ATOM   1383  C  CD2 . LEU B  1 15  ? 10.901 46.483 94.429  1.00 30.44 ? 15   LEU B CD2 1 
ATOM   1384  N  N   . GLY B  1 16  ? 8.519  44.426 90.583  1.00 36.28 ? 16   GLY B N   1 
ATOM   1385  C  CA  . GLY B  1 16  ? 7.780  43.181 90.640  1.00 37.40 ? 16   GLY B CA  1 
ATOM   1386  C  C   . GLY B  1 16  ? 8.273  42.224 89.565  1.00 40.42 ? 16   GLY B C   1 
ATOM   1387  O  O   . GLY B  1 16  ? 8.471  41.035 89.825  1.00 41.26 ? 16   GLY B O   1 
ATOM   1388  N  N   . ASN B  1 17  ? 8.483  42.754 88.358  1.00 40.78 ? 17   ASN B N   1 
ATOM   1389  C  CA  . ASN B  1 17  ? 8.952  41.972 87.207  1.00 41.05 ? 17   ASN B CA  1 
ATOM   1390  C  C   . ASN B  1 17  ? 10.290 41.288 87.472  1.00 38.57 ? 17   ASN B C   1 
ATOM   1391  O  O   . ASN B  1 17  ? 10.478 40.120 87.123  1.00 37.87 ? 17   ASN B O   1 
ATOM   1392  C  CB  . ASN B  1 17  ? 9.081  42.872 85.959  1.00 43.69 ? 17   ASN B CB  1 
ATOM   1393  C  CG  . ASN B  1 17  ? 7.724  43.279 85.366  1.00 45.49 ? 17   ASN B CG  1 
ATOM   1394  O  OD1 . ASN B  1 17  ? 7.650  44.171 84.519  1.00 40.78 ? 17   ASN B OD1 1 
ATOM   1395  N  ND2 . ASN B  1 17  ? 6.651  42.616 85.804  1.00 47.89 ? 17   ASN B ND2 1 
ATOM   1396  N  N   . GLU B  1 18  ? 11.218 42.025 88.075  1.00 36.73 ? 18   GLU B N   1 
ATOM   1397  C  CA  . GLU B  1 18  ? 12.535 41.489 88.391  1.00 38.71 ? 18   GLU B CA  1 
ATOM   1398  C  C   . GLU B  1 18  ? 12.397 40.285 89.320  1.00 38.69 ? 18   GLU B C   1 
ATOM   1399  O  O   . GLU B  1 18  ? 12.954 39.220 89.051  1.00 39.28 ? 18   GLU B O   1 
ATOM   1400  C  CB  . GLU B  1 18  ? 13.412 42.550 89.060  1.00 39.42 ? 18   GLU B CB  1 
ATOM   1401  C  CG  . GLU B  1 18  ? 13.663 43.786 88.217  1.00 40.60 ? 18   GLU B CG  1 
ATOM   1402  C  CD  . GLU B  1 18  ? 14.403 43.479 86.929  1.00 43.63 ? 18   GLU B CD  1 
ATOM   1403  O  OE1 . GLU B  1 18  ? 15.268 42.576 86.930  1.00 49.62 ? 18   GLU B OE1 1 
ATOM   1404  O  OE2 . GLU B  1 18  ? 14.129 44.153 85.915  1.00 42.90 ? 18   GLU B OE2 1 
ATOM   1405  N  N   . LEU B  1 19  ? 11.642 40.460 90.400  1.00 39.79 ? 19   LEU B N   1 
ATOM   1406  C  CA  . LEU B  1 19  ? 11.418 39.392 91.371  1.00 37.84 ? 19   LEU B CA  1 
ATOM   1407  C  C   . LEU B  1 19  ? 10.880 38.139 90.676  1.00 37.61 ? 19   LEU B C   1 
ATOM   1408  O  O   . LEU B  1 19  ? 11.179 37.016 91.093  1.00 39.94 ? 19   LEU B O   1 
ATOM   1409  C  CB  . LEU B  1 19  ? 10.441 39.868 92.446  1.00 33.46 ? 19   LEU B CB  1 
ATOM   1410  C  CG  . LEU B  1 19  ? 10.903 41.115 93.211  1.00 32.91 ? 19   LEU B CG  1 
ATOM   1411  C  CD1 . LEU B  1 19  ? 9.744  41.670 94.021  1.00 30.86 ? 19   LEU B CD1 1 
ATOM   1412  C  CD2 . LEU B  1 19  ? 12.096 40.778 94.108  1.00 26.32 ? 19   LEU B CD2 1 
ATOM   1413  N  N   . ILE B  1 20  ? 10.097 38.333 89.616  1.00 36.06 ? 20   ILE B N   1 
ATOM   1414  C  CA  . ILE B  1 20  ? 9.545  37.213 88.854  1.00 36.18 ? 20   ILE B CA  1 
ATOM   1415  C  C   . ILE B  1 20  ? 10.693 36.575 88.077  1.00 35.47 ? 20   ILE B C   1 
ATOM   1416  O  O   . ILE B  1 20  ? 10.878 35.354 88.084  1.00 34.72 ? 20   ILE B O   1 
ATOM   1417  C  CB  . ILE B  1 20  ? 8.481  37.682 87.819  1.00 38.18 ? 20   ILE B CB  1 
ATOM   1418  C  CG1 . ILE B  1 20  ? 7.339  38.414 88.524  1.00 41.97 ? 20   ILE B CG1 1 
ATOM   1419  C  CG2 . ILE B  1 20  ? 7.923  36.482 87.048  1.00 36.86 ? 20   ILE B CG2 1 
ATOM   1420  C  CD1 . ILE B  1 20  ? 6.259  38.937 87.576  1.00 41.63 ? 20   ILE B CD1 1 
ATOM   1421  N  N   . ALA B  1 21  ? 11.462 37.416 87.396  1.00 32.59 ? 21   ALA B N   1 
ATOM   1422  C  CA  . ALA B  1 21  ? 12.577 36.928 86.613  1.00 30.51 ? 21   ALA B CA  1 
ATOM   1423  C  C   . ALA B  1 21  ? 13.483 36.090 87.501  1.00 30.96 ? 21   ALA B C   1 
ATOM   1424  O  O   . ALA B  1 21  ? 13.857 34.977 87.136  1.00 32.02 ? 21   ALA B O   1 
ATOM   1425  C  CB  . ALA B  1 21  ? 13.346 38.094 86.015  1.00 26.07 ? 21   ALA B CB  1 
ATOM   1426  N  N   . ILE B  1 22  ? 13.817 36.626 88.674  1.00 32.64 ? 22   ILE B N   1 
ATOM   1427  C  CA  . ILE B  1 22  ? 14.694 35.949 89.626  1.00 30.62 ? 22   ILE B CA  1 
ATOM   1428  C  C   . ILE B  1 22  ? 14.275 34.512 89.888  1.00 29.58 ? 22   ILE B C   1 
ATOM   1429  O  O   . ILE B  1 22  ? 15.058 33.579 89.690  1.00 26.85 ? 22   ILE B O   1 
ATOM   1430  C  CB  . ILE B  1 22  ? 14.722 36.679 90.980  1.00 34.19 ? 22   ILE B CB  1 
ATOM   1431  C  CG1 . ILE B  1 22  ? 15.161 38.126 90.785  1.00 34.73 ? 22   ILE B CG1 1 
ATOM   1432  C  CG2 . ILE B  1 22  ? 15.693 35.975 91.940  1.00 34.27 ? 22   ILE B CG2 1 
ATOM   1433  C  CD1 . ILE B  1 22  ? 15.159 38.916 92.068  1.00 37.45 ? 22   ILE B CD1 1 
ATOM   1434  N  N   . ASN B  1 23  ? 13.037 34.335 90.332  1.00 27.88 ? 23   ASN B N   1 
ATOM   1435  C  CA  . ASN B  1 23  ? 12.542 33.001 90.633  1.00 32.10 ? 23   ASN B CA  1 
ATOM   1436  C  C   . ASN B  1 23  ? 12.464 32.104 89.406  1.00 32.01 ? 23   ASN B C   1 
ATOM   1437  O  O   . ASN B  1 23  ? 12.858 30.936 89.458  1.00 33.10 ? 23   ASN B O   1 
ATOM   1438  C  CB  . ASN B  1 23  ? 11.169 33.082 91.307  1.00 34.43 ? 23   ASN B CB  1 
ATOM   1439  C  CG  . ASN B  1 23  ? 11.221 33.797 92.653  1.00 38.55 ? 23   ASN B CG  1 
ATOM   1440  O  OD1 . ASN B  1 23  ? 12.262 34.335 93.047  1.00 37.14 ? 23   ASN B OD1 1 
ATOM   1441  N  ND2 . ASN B  1 23  ? 10.093 33.811 93.362  1.00 37.56 ? 23   ASN B ND2 1 
ATOM   1442  N  N   . GLN B  1 24  ? 11.967 32.641 88.297  1.00 31.94 ? 24   GLN B N   1 
ATOM   1443  C  CA  . GLN B  1 24  ? 11.842 31.834 87.098  1.00 30.75 ? 24   GLN B CA  1 
ATOM   1444  C  C   . GLN B  1 24  ? 13.182 31.315 86.607  1.00 31.28 ? 24   GLN B C   1 
ATOM   1445  O  O   . GLN B  1 24  ? 13.331 30.126 86.322  1.00 30.43 ? 24   GLN B O   1 
ATOM   1446  C  CB  . GLN B  1 24  ? 11.154 32.623 85.994  1.00 31.42 ? 24   GLN B CB  1 
ATOM   1447  C  CG  . GLN B  1 24  ? 11.202 31.927 84.645  1.00 29.73 ? 24   GLN B CG  1 
ATOM   1448  C  CD  . GLN B  1 24  ? 10.196 32.482 83.671  1.00 27.12 ? 24   GLN B CD  1 
ATOM   1449  O  OE1 . GLN B  1 24  ? 10.400 32.427 82.466  1.00 30.02 ? 24   GLN B OE1 1 
ATOM   1450  N  NE2 . GLN B  1 24  ? 9.094  33.009 84.186  1.00 26.42 ? 24   GLN B NE2 1 
ATOM   1451  N  N   . TYR B  1 25  ? 14.166 32.198 86.518  1.00 32.70 ? 25   TYR B N   1 
ATOM   1452  C  CA  . TYR B  1 25  ? 15.478 31.782 86.042  1.00 33.76 ? 25   TYR B CA  1 
ATOM   1453  C  C   . TYR B  1 25  ? 16.152 30.866 87.051  1.00 33.18 ? 25   TYR B C   1 
ATOM   1454  O  O   . TYR B  1 25  ? 16.912 29.972 86.682  1.00 31.76 ? 25   TYR B O   1 
ATOM   1455  C  CB  . TYR B  1 25  ? 16.361 33.007 85.754  1.00 33.27 ? 25   TYR B CB  1 
ATOM   1456  C  CG  . TYR B  1 25  ? 15.779 33.947 84.708  1.00 35.51 ? 25   TYR B CG  1 
ATOM   1457  C  CD1 . TYR B  1 25  ? 14.560 33.658 84.085  1.00 35.73 ? 25   TYR B CD1 1 
ATOM   1458  C  CD2 . TYR B  1 25  ? 16.423 35.143 84.373  1.00 34.98 ? 25   TYR B CD2 1 
ATOM   1459  C  CE1 . TYR B  1 25  ? 13.994 34.527 83.170  1.00 37.88 ? 25   TYR B CE1 1 
ATOM   1460  C  CE2 . TYR B  1 25  ? 15.866 36.025 83.450  1.00 36.21 ? 25   TYR B CE2 1 
ATOM   1461  C  CZ  . TYR B  1 25  ? 14.647 35.710 82.853  1.00 39.44 ? 25   TYR B CZ  1 
ATOM   1462  O  OH  . TYR B  1 25  ? 14.065 36.568 81.944  1.00 39.06 ? 25   TYR B OH  1 
ATOM   1463  N  N   . PHE B  1 26  ? 15.870 31.072 88.329  1.00 34.20 ? 26   PHE B N   1 
ATOM   1464  C  CA  . PHE B  1 26  ? 16.490 30.224 89.327  1.00 35.55 ? 26   PHE B CA  1 
ATOM   1465  C  C   . PHE B  1 26  ? 15.982 28.809 89.178  1.00 33.75 ? 26   PHE B C   1 
ATOM   1466  O  O   . PHE B  1 26  ? 16.743 27.848 89.294  1.00 35.27 ? 26   PHE B O   1 
ATOM   1467  C  CB  . PHE B  1 26  ? 16.194 30.706 90.740  1.00 39.87 ? 26   PHE B CB  1 
ATOM   1468  C  CG  . PHE B  1 26  ? 17.161 30.181 91.736  1.00 45.49 ? 26   PHE B CG  1 
ATOM   1469  C  CD1 . PHE B  1 26  ? 18.425 30.746 91.844  1.00 49.35 ? 26   PHE B CD1 1 
ATOM   1470  C  CD2 . PHE B  1 26  ? 16.861 29.056 92.487  1.00 49.89 ? 26   PHE B CD2 1 
ATOM   1471  C  CE1 . PHE B  1 26  ? 19.391 30.190 92.685  1.00 55.26 ? 26   PHE B CE1 1 
ATOM   1472  C  CE2 . PHE B  1 26  ? 17.817 28.489 93.333  1.00 55.33 ? 26   PHE B CE2 1 
ATOM   1473  C  CZ  . PHE B  1 26  ? 19.087 29.056 93.432  1.00 55.15 ? 26   PHE B CZ  1 
ATOM   1474  N  N   . LEU B  1 27  ? 14.687 28.685 88.917  1.00 32.29 ? 27   LEU B N   1 
ATOM   1475  C  CA  . LEU B  1 27  ? 14.074 27.377 88.745  1.00 31.26 ? 27   LEU B CA  1 
ATOM   1476  C  C   . LEU B  1 27  ? 14.563 26.707 87.461  1.00 30.79 ? 27   LEU B C   1 
ATOM   1477  O  O   . LEU B  1 27  ? 14.816 25.498 87.456  1.00 31.84 ? 27   LEU B O   1 
ATOM   1478  C  CB  . LEU B  1 27  ? 12.547 27.506 88.734  1.00 30.10 ? 27   LEU B CB  1 
ATOM   1479  C  CG  . LEU B  1 27  ? 11.764 26.203 88.548  1.00 28.34 ? 27   LEU B CG  1 
ATOM   1480  C  CD1 . LEU B  1 27  ? 12.132 25.212 89.648  1.00 25.31 ? 27   LEU B CD1 1 
ATOM   1481  C  CD2 . LEU B  1 27  ? 10.271 26.514 88.572  1.00 26.55 ? 27   LEU B CD2 1 
ATOM   1482  N  N   . HIS B  1 28  ? 14.700 27.474 86.377  1.00 27.57 ? 28   HIS B N   1 
ATOM   1483  C  CA  . HIS B  1 28  ? 15.187 26.891 85.128  1.00 28.67 ? 28   HIS B CA  1 
ATOM   1484  C  C   . HIS B  1 28  ? 16.641 26.450 85.311  1.00 28.08 ? 28   HIS B C   1 
ATOM   1485  O  O   . HIS B  1 28  ? 17.061 25.408 84.796  1.00 29.43 ? 28   HIS B O   1 
ATOM   1486  C  CB  . HIS B  1 28  ? 15.109 27.885 83.953  1.00 28.25 ? 28   HIS B CB  1 
ATOM   1487  C  CG  . HIS B  1 28  ? 13.716 28.176 83.479  1.00 25.41 ? 28   HIS B CG  1 
ATOM   1488  N  ND1 . HIS B  1 28  ? 12.642 27.357 83.755  1.00 25.94 ? 28   HIS B ND1 1 
ATOM   1489  C  CD2 . HIS B  1 28  ? 13.229 29.190 82.723  1.00 21.68 ? 28   HIS B CD2 1 
ATOM   1490  C  CE1 . HIS B  1 28  ? 11.554 27.855 83.192  1.00 24.04 ? 28   HIS B CE1 1 
ATOM   1491  N  NE2 . HIS B  1 28  ? 11.885 28.968 82.560  1.00 22.05 ? 28   HIS B NE2 1 
ATOM   1492  N  N   . ALA B  1 29  ? 17.410 27.245 86.044  1.00 27.34 ? 29   ALA B N   1 
ATOM   1493  C  CA  . ALA B  1 29  ? 18.810 26.918 86.290  1.00 27.10 ? 29   ALA B CA  1 
ATOM   1494  C  C   . ALA B  1 29  ? 18.949 25.571 86.985  1.00 26.93 ? 29   ALA B C   1 
ATOM   1495  O  O   . ALA B  1 29  ? 19.748 24.736 86.570  1.00 27.03 ? 29   ALA B O   1 
ATOM   1496  C  CB  . ALA B  1 29  ? 19.463 27.998 87.133  1.00 29.55 ? 29   ALA B CB  1 
ATOM   1497  N  N   . ARG B  1 30  ? 18.177 25.350 88.044  1.00 28.29 ? 30   ARG B N   1 
ATOM   1498  C  CA  . ARG B  1 30  ? 18.271 24.079 88.756  1.00 30.13 ? 30   ARG B CA  1 
ATOM   1499  C  C   . ARG B  1 30  ? 17.748 22.940 87.914  1.00 27.98 ? 30   ARG B C   1 
ATOM   1500  O  O   . ARG B  1 30  ? 18.274 21.832 87.969  1.00 28.55 ? 30   ARG B O   1 
ATOM   1501  C  CB  . ARG B  1 30  ? 17.514 24.136 90.080  1.00 32.45 ? 30   ARG B CB  1 
ATOM   1502  C  CG  . ARG B  1 30  ? 18.004 25.247 90.972  1.00 40.42 ? 30   ARG B CG  1 
ATOM   1503  C  CD  . ARG B  1 30  ? 19.521 25.248 91.051  1.00 42.11 ? 30   ARG B CD  1 
ATOM   1504  N  NE  . ARG B  1 30  ? 20.017 26.491 91.627  1.00 50.43 ? 30   ARG B NE  1 
ATOM   1505  C  CZ  . ARG B  1 30  ? 21.292 26.868 91.603  1.00 54.46 ? 30   ARG B CZ  1 
ATOM   1506  N  NH1 . ARG B  1 30  ? 22.206 26.093 91.029  1.00 54.08 ? 30   ARG B NH1 1 
ATOM   1507  N  NH2 . ARG B  1 30  ? 21.655 28.021 92.152  1.00 54.11 ? 30   ARG B NH2 1 
ATOM   1508  N  N   . MET B  1 31  ? 16.711 23.213 87.131  1.00 28.30 ? 31   MET B N   1 
ATOM   1509  C  CA  . MET B  1 31  ? 16.143 22.185 86.266  1.00 26.02 ? 31   MET B CA  1 
ATOM   1510  C  C   . MET B  1 31  ? 17.208 21.738 85.266  1.00 25.84 ? 31   MET B C   1 
ATOM   1511  O  O   . MET B  1 31  ? 17.464 20.539 85.121  1.00 25.22 ? 31   MET B O   1 
ATOM   1512  C  CB  . MET B  1 31  ? 14.908 22.733 85.549  1.00 25.13 ? 31   MET B CB  1 
ATOM   1513  C  CG  . MET B  1 31  ? 13.708 22.944 86.465  1.00 18.90 ? 31   MET B CG  1 
ATOM   1514  S  SD  . MET B  1 31  ? 12.255 23.581 85.578  1.00 27.08 ? 31   MET B SD  1 
ATOM   1515  C  CE  . MET B  1 31  ? 11.904 22.173 84.497  1.00 17.10 ? 31   MET B CE  1 
ATOM   1516  N  N   . TYR B  1 32  ? 17.827 22.709 84.590  1.00 25.21 ? 32   TYR B N   1 
ATOM   1517  C  CA  . TYR B  1 32  ? 18.891 22.441 83.626  1.00 27.23 ? 32   TYR B CA  1 
ATOM   1518  C  C   . TYR B  1 32  ? 19.974 21.572 84.247  1.00 30.25 ? 32   TYR B C   1 
ATOM   1519  O  O   . TYR B  1 32  ? 20.341 20.521 83.708  1.00 31.75 ? 32   TYR B O   1 
ATOM   1520  C  CB  . TYR B  1 32  ? 19.532 23.747 83.162  1.00 29.17 ? 32   TYR B CB  1 
ATOM   1521  C  CG  . TYR B  1 32  ? 18.719 24.504 82.138  1.00 29.70 ? 32   TYR B CG  1 
ATOM   1522  C  CD1 . TYR B  1 32  ? 18.529 25.883 82.253  1.00 25.91 ? 32   TYR B CD1 1 
ATOM   1523  C  CD2 . TYR B  1 32  ? 18.128 23.843 81.058  1.00 25.24 ? 32   TYR B CD2 1 
ATOM   1524  C  CE1 . TYR B  1 32  ? 17.765 26.582 81.321  1.00 22.91 ? 32   TYR B CE1 1 
ATOM   1525  C  CE2 . TYR B  1 32  ? 17.361 24.537 80.122  1.00 23.97 ? 32   TYR B CE2 1 
ATOM   1526  C  CZ  . TYR B  1 32  ? 17.185 25.904 80.262  1.00 24.18 ? 32   TYR B CZ  1 
ATOM   1527  O  OH  . TYR B  1 32  ? 16.421 26.603 79.349  1.00 27.54 ? 32   TYR B OH  1 
ATOM   1528  N  N   . GLU B  1 33  ? 20.491 22.021 85.386  1.00 32.73 ? 33   GLU B N   1 
ATOM   1529  C  CA  . GLU B  1 33  ? 21.542 21.294 86.088  1.00 33.68 ? 33   GLU B CA  1 
ATOM   1530  C  C   . GLU B  1 33  ? 21.053 19.912 86.537  1.00 33.39 ? 33   GLU B C   1 
ATOM   1531  O  O   . GLU B  1 33  ? 21.826 18.963 86.595  1.00 35.27 ? 33   GLU B O   1 
ATOM   1532  C  CB  . GLU B  1 33  ? 22.053 22.164 87.252  1.00 34.52 ? 33   GLU B CB  1 
ATOM   1533  C  CG  . GLU B  1 33  ? 22.497 23.567 86.718  1.00 42.97 ? 33   GLU B CG  1 
ATOM   1534  C  CD  . GLU B  1 33  ? 23.082 24.530 87.757  1.00 42.24 ? 33   GLU B CD  1 
ATOM   1535  O  OE1 . GLU B  1 33  ? 22.396 24.836 88.755  1.00 45.47 ? 33   GLU B OE1 1 
ATOM   1536  O  OE2 . GLU B  1 33  ? 24.225 25.001 87.560  1.00 37.12 ? 33   GLU B OE2 1 
ATOM   1537  N  N   . ASP B  1 34  ? 19.757 19.788 86.804  1.00 35.21 ? 34   ASP B N   1 
ATOM   1538  C  CA  . ASP B  1 34  ? 19.179 18.512 87.225  1.00 33.72 ? 34   ASP B CA  1 
ATOM   1539  C  C   . ASP B  1 34  ? 19.114 17.536 86.068  1.00 33.99 ? 34   ASP B C   1 
ATOM   1540  O  O   . ASP B  1 34  ? 19.034 16.323 86.267  1.00 34.64 ? 34   ASP B O   1 
ATOM   1541  C  CB  . ASP B  1 34  ? 17.762 18.704 87.765  1.00 33.84 ? 34   ASP B CB  1 
ATOM   1542  C  CG  . ASP B  1 34  ? 17.067 17.383 88.043  1.00 34.73 ? 34   ASP B CG  1 
ATOM   1543  O  OD1 . ASP B  1 34  ? 17.525 16.649 88.944  1.00 37.95 ? 34   ASP B OD1 1 
ATOM   1544  O  OD2 . ASP B  1 34  ? 16.070 17.071 87.357  1.00 36.47 ? 34   ASP B OD2 1 
ATOM   1545  N  N   . TRP B  1 35  ? 19.113 18.072 84.855  1.00 33.65 ? 35   TRP B N   1 
ATOM   1546  C  CA  . TRP B  1 35  ? 19.055 17.242 83.667  1.00 33.13 ? 35   TRP B CA  1 
ATOM   1547  C  C   . TRP B  1 35  ? 20.460 16.949 83.165  1.00 34.01 ? 35   TRP B C   1 
ATOM   1548  O  O   . TRP B  1 35  ? 20.657 16.128 82.263  1.00 35.70 ? 35   TRP B O   1 
ATOM   1549  C  CB  . TRP B  1 35  ? 18.258 17.944 82.570  1.00 31.59 ? 35   TRP B CB  1 
ATOM   1550  C  CG  . TRP B  1 35  ? 16.793 18.026 82.835  1.00 28.44 ? 35   TRP B CG  1 
ATOM   1551  C  CD1 . TRP B  1 35  ? 16.024 17.099 83.478  1.00 27.07 ? 35   TRP B CD1 1 
ATOM   1552  C  CD2 . TRP B  1 35  ? 15.891 19.024 82.342  1.00 27.85 ? 35   TRP B CD2 1 
ATOM   1553  N  NE1 . TRP B  1 35  ? 14.696 17.454 83.407  1.00 27.01 ? 35   TRP B NE1 1 
ATOM   1554  C  CE2 . TRP B  1 35  ? 14.587 18.631 82.714  1.00 27.50 ? 35   TRP B CE2 1 
ATOM   1555  C  CE3 . TRP B  1 35  ? 16.058 20.209 81.614  1.00 27.03 ? 35   TRP B CE3 1 
ATOM   1556  C  CZ2 . TRP B  1 35  ? 13.451 19.382 82.381  1.00 26.14 ? 35   TRP B CZ2 1 
ATOM   1557  C  CZ3 . TRP B  1 35  ? 14.930 20.955 81.281  1.00 26.51 ? 35   TRP B CZ3 1 
ATOM   1558  C  CH2 . TRP B  1 35  ? 13.641 20.535 81.665  1.00 25.59 ? 35   TRP B CH2 1 
ATOM   1559  N  N   . GLY B  1 36  ? 21.434 17.639 83.746  1.00 34.52 ? 36   GLY B N   1 
ATOM   1560  C  CA  . GLY B  1 36  ? 22.812 17.441 83.349  1.00 33.36 ? 36   GLY B CA  1 
ATOM   1561  C  C   . GLY B  1 36  ? 23.295 18.438 82.319  1.00 34.08 ? 36   GLY B C   1 
ATOM   1562  O  O   . GLY B  1 36  ? 24.277 18.185 81.622  1.00 36.29 ? 36   GLY B O   1 
ATOM   1563  N  N   . LEU B  1 37  ? 22.618 19.576 82.218  1.00 34.30 ? 37   LEU B N   1 
ATOM   1564  C  CA  . LEU B  1 37  ? 23.016 20.597 81.254  1.00 33.75 ? 37   LEU B CA  1 
ATOM   1565  C  C   . LEU B  1 37  ? 23.800 21.746 81.905  1.00 34.35 ? 37   LEU B C   1 
ATOM   1566  O  O   . LEU B  1 37  ? 23.332 22.891 81.956  1.00 31.29 ? 37   LEU B O   1 
ATOM   1567  C  CB  . LEU B  1 37  ? 21.779 21.124 80.520  1.00 31.87 ? 37   LEU B CB  1 
ATOM   1568  C  CG  . LEU B  1 37  ? 21.222 20.196 79.434  1.00 30.33 ? 37   LEU B CG  1 
ATOM   1569  C  CD1 . LEU B  1 37  ? 21.103 18.781 79.950  1.00 34.37 ? 37   LEU B CD1 1 
ATOM   1570  C  CD2 . LEU B  1 37  ? 19.872 20.698 78.980  1.00 34.85 ? 37   LEU B CD2 1 
ATOM   1571  N  N   . GLU B  1 38  ? 25.000 21.415 82.387  1.00 35.55 ? 38   GLU B N   1 
ATOM   1572  C  CA  . GLU B  1 38  ? 25.897 22.370 83.041  1.00 38.36 ? 38   GLU B CA  1 
ATOM   1573  C  C   . GLU B  1 38  ? 25.975 23.742 82.358  1.00 37.30 ? 38   GLU B C   1 
ATOM   1574  O  O   . GLU B  1 38  ? 25.745 24.766 82.998  1.00 36.75 ? 38   GLU B O   1 
ATOM   1575  C  CB  . GLU B  1 38  ? 27.306 21.766 83.162  1.00 41.48 ? 38   GLU B CB  1 
ATOM   1576  C  CG  . GLU B  1 38  ? 27.491 20.828 84.368  1.00 52.30 ? 38   GLU B CG  1 
ATOM   1577  C  CD  . GLU B  1 38  ? 28.639 19.816 84.201  1.00 57.47 ? 38   GLU B CD  1 
ATOM   1578  O  OE1 . GLU B  1 38  ? 29.738 20.205 83.736  1.00 60.58 ? 38   GLU B OE1 1 
ATOM   1579  O  OE2 . GLU B  1 38  ? 28.439 18.627 84.551  1.00 57.21 ? 38   GLU B OE2 1 
ATOM   1580  N  N   . LYS B  1 39  ? 26.301 23.772 81.069  1.00 36.74 ? 39   LYS B N   1 
ATOM   1581  C  CA  . LYS B  1 39  ? 26.390 25.046 80.357  1.00 36.58 ? 39   LYS B CA  1 
ATOM   1582  C  C   . LYS B  1 39  ? 25.123 25.877 80.565  1.00 35.34 ? 39   LYS B C   1 
ATOM   1583  O  O   . LYS B  1 39  ? 25.193 26.998 81.067  1.00 34.81 ? 39   LYS B O   1 
ATOM   1584  C  CB  . LYS B  1 39  ? 26.619 24.810 78.864  1.00 38.86 ? 39   LYS B CB  1 
ATOM   1585  C  CG  . LYS B  1 39  ? 27.996 24.271 78.513  1.00 42.12 ? 39   LYS B CG  1 
ATOM   1586  C  CD  . LYS B  1 39  ? 28.903 25.376 77.990  1.00 46.58 ? 39   LYS B CD  1 
ATOM   1587  C  CE  . LYS B  1 39  ? 30.170 24.804 77.351  1.00 49.03 ? 39   LYS B CE  1 
ATOM   1588  N  NZ  . LYS B  1 39  ? 31.018 25.859 76.708  1.00 49.44 ? 39   LYS B NZ  1 
ATOM   1589  N  N   . LEU B  1 40  ? 23.969 25.327 80.190  1.00 32.82 ? 40   LEU B N   1 
ATOM   1590  C  CA  . LEU B  1 40  ? 22.696 26.033 80.357  1.00 31.73 ? 40   LEU B CA  1 
ATOM   1591  C  C   . LEU B  1 40  ? 22.471 26.418 81.814  1.00 31.76 ? 40   LEU B C   1 
ATOM   1592  O  O   . LEU B  1 40  ? 22.002 27.508 82.118  1.00 31.31 ? 40   LEU B O   1 
ATOM   1593  C  CB  . LEU B  1 40  ? 21.543 25.150 79.884  1.00 29.84 ? 40   LEU B CB  1 
ATOM   1594  C  CG  . LEU B  1 40  ? 20.858 25.458 78.552  1.00 25.81 ? 40   LEU B CG  1 
ATOM   1595  C  CD1 . LEU B  1 40  ? 21.718 26.367 77.708  1.00 26.89 ? 40   LEU B CD1 1 
ATOM   1596  C  CD2 . LEU B  1 40  ? 20.565 24.142 77.838  1.00 22.52 ? 40   LEU B CD2 1 
ATOM   1597  N  N   . GLY B  1 41  ? 22.810 25.504 82.711  1.00 35.21 ? 41   GLY B N   1 
ATOM   1598  C  CA  . GLY B  1 41  ? 22.647 25.764 84.127  1.00 36.85 ? 41   GLY B CA  1 
ATOM   1599  C  C   . GLY B  1 41  ? 23.351 27.024 84.583  1.00 37.29 ? 41   GLY B C   1 
ATOM   1600  O  O   . GLY B  1 41  ? 22.709 27.952 85.066  1.00 39.83 ? 41   GLY B O   1 
ATOM   1601  N  N   . LYS B  1 42  ? 24.667 27.070 84.422  1.00 38.41 ? 42   LYS B N   1 
ATOM   1602  C  CA  . LYS B  1 42  ? 25.439 28.227 84.849  1.00 39.56 ? 42   LYS B CA  1 
ATOM   1603  C  C   . LYS B  1 42  ? 24.945 29.543 84.276  1.00 40.66 ? 42   LYS B C   1 
ATOM   1604  O  O   . LYS B  1 42  ? 24.890 30.549 84.986  1.00 40.39 ? 42   LYS B O   1 
ATOM   1605  C  CB  . LYS B  1 42  ? 26.914 28.040 84.503  1.00 41.64 ? 42   LYS B CB  1 
ATOM   1606  C  CG  . LYS B  1 42  ? 27.579 26.967 85.336  1.00 51.01 ? 42   LYS B CG  1 
ATOM   1607  C  CD  . LYS B  1 42  ? 29.067 26.840 85.038  1.00 58.91 ? 42   LYS B CD  1 
ATOM   1608  C  CE  . LYS B  1 42  ? 29.697 25.738 85.897  1.00 60.68 ? 42   LYS B CE  1 
ATOM   1609  N  NZ  . LYS B  1 42  ? 31.135 25.510 85.585  1.00 60.77 ? 42   LYS B NZ  1 
ATOM   1610  N  N   . HIS B  1 43  ? 24.574 29.552 83.002  1.00 40.37 ? 43   HIS B N   1 
ATOM   1611  C  CA  . HIS B  1 43  ? 24.116 30.797 82.423  1.00 41.40 ? 43   HIS B CA  1 
ATOM   1612  C  C   . HIS B  1 43  ? 22.828 31.253 83.080  1.00 41.68 ? 43   HIS B C   1 
ATOM   1613  O  O   . HIS B  1 43  ? 22.713 32.417 83.475  1.00 42.38 ? 43   HIS B O   1 
ATOM   1614  C  CB  . HIS B  1 43  ? 23.910 30.686 80.916  1.00 44.16 ? 43   HIS B CB  1 
ATOM   1615  C  CG  . HIS B  1 43  ? 23.939 32.012 80.221  1.00 51.40 ? 43   HIS B CG  1 
ATOM   1616  N  ND1 . HIS B  1 43  ? 25.113 32.693 79.969  1.00 53.60 ? 43   HIS B ND1 1 
ATOM   1617  C  CD2 . HIS B  1 43  ? 22.938 32.821 79.798  1.00 53.76 ? 43   HIS B CD2 1 
ATOM   1618  C  CE1 . HIS B  1 43  ? 24.833 33.864 79.423  1.00 55.29 ? 43   HIS B CE1 1 
ATOM   1619  N  NE2 . HIS B  1 43  ? 23.521 33.967 79.308  1.00 54.01 ? 43   HIS B NE2 1 
ATOM   1620  N  N   . GLU B  1 44  ? 21.858 30.349 83.200  1.00 40.24 ? 44   GLU B N   1 
ATOM   1621  C  CA  . GLU B  1 44  ? 20.587 30.708 83.828  1.00 39.70 ? 44   GLU B CA  1 
ATOM   1622  C  C   . GLU B  1 44  ? 20.850 31.134 85.251  1.00 37.76 ? 44   GLU B C   1 
ATOM   1623  O  O   . GLU B  1 44  ? 20.197 32.036 85.765  1.00 34.41 ? 44   GLU B O   1 
ATOM   1624  C  CB  . GLU B  1 44  ? 19.618 29.534 83.809  1.00 41.62 ? 44   GLU B CB  1 
ATOM   1625  C  CG  . GLU B  1 44  ? 19.019 29.329 82.453  1.00 45.84 ? 44   GLU B CG  1 
ATOM   1626  C  CD  . GLU B  1 44  ? 18.196 30.513 82.037  1.00 48.11 ? 44   GLU B CD  1 
ATOM   1627  O  OE1 . GLU B  1 44  ? 17.038 30.604 82.498  1.00 50.63 ? 44   GLU B OE1 1 
ATOM   1628  O  OE2 . GLU B  1 44  ? 18.713 31.357 81.270  1.00 50.01 ? 44   GLU B OE2 1 
ATOM   1629  N  N   . TYR B  1 45  ? 21.823 30.482 85.879  1.00 38.35 ? 45   TYR B N   1 
ATOM   1630  C  CA  . TYR B  1 45  ? 22.190 30.819 87.237  1.00 40.31 ? 45   TYR B CA  1 
ATOM   1631  C  C   . TYR B  1 45  ? 22.673 32.262 87.294  1.00 40.77 ? 45   TYR B C   1 
ATOM   1632  O  O   . TYR B  1 45  ? 22.211 33.038 88.131  1.00 45.47 ? 45   TYR B O   1 
ATOM   1633  C  CB  . TYR B  1 45  ? 23.296 29.903 87.758  1.00 40.27 ? 45   TYR B CB  1 
ATOM   1634  C  CG  . TYR B  1 45  ? 23.676 30.229 89.181  1.00 42.86 ? 45   TYR B CG  1 
ATOM   1635  C  CD1 . TYR B  1 45  ? 22.754 30.082 90.217  1.00 44.81 ? 45   TYR B CD1 1 
ATOM   1636  C  CD2 . TYR B  1 45  ? 24.936 30.735 89.488  1.00 45.65 ? 45   TYR B CD2 1 
ATOM   1637  C  CE1 . TYR B  1 45  ? 23.077 30.435 91.530  1.00 48.77 ? 45   TYR B CE1 1 
ATOM   1638  C  CE2 . TYR B  1 45  ? 25.272 31.094 90.799  1.00 49.75 ? 45   TYR B CE2 1 
ATOM   1639  C  CZ  . TYR B  1 45  ? 24.336 30.942 91.815  1.00 49.60 ? 45   TYR B CZ  1 
ATOM   1640  O  OH  . TYR B  1 45  ? 24.649 31.309 93.105  1.00 48.75 ? 45   TYR B OH  1 
ATOM   1641  N  N   . HIS B  1 46  ? 23.597 32.630 86.413  1.00 39.77 ? 46   HIS B N   1 
ATOM   1642  C  CA  . HIS B  1 46  ? 24.099 34.000 86.415  1.00 42.26 ? 46   HIS B CA  1 
ATOM   1643  C  C   . HIS B  1 46  ? 23.017 34.999 86.030  1.00 40.18 ? 46   HIS B C   1 
ATOM   1644  O  O   . HIS B  1 46  ? 22.945 36.086 86.596  1.00 40.16 ? 46   HIS B O   1 
ATOM   1645  C  CB  . HIS B  1 46  ? 25.304 34.141 85.490  1.00 46.47 ? 46   HIS B CB  1 
ATOM   1646  C  CG  . HIS B  1 46  ? 26.494 33.351 85.938  1.00 54.33 ? 46   HIS B CG  1 
ATOM   1647  N  ND1 . HIS B  1 46  ? 27.760 33.557 85.432  1.00 57.89 ? 46   HIS B ND1 1 
ATOM   1648  C  CD2 . HIS B  1 46  ? 26.606 32.342 86.836  1.00 57.43 ? 46   HIS B CD2 1 
ATOM   1649  C  CE1 . HIS B  1 46  ? 28.601 32.709 86.000  1.00 60.83 ? 46   HIS B CE1 1 
ATOM   1650  N  NE2 . HIS B  1 46  ? 27.926 31.960 86.855  1.00 59.06 ? 46   HIS B NE2 1 
ATOM   1651  N  N   . GLU B  1 47  ? 22.167 34.632 85.080  1.00 37.00 ? 47   GLU B N   1 
ATOM   1652  C  CA  . GLU B  1 47  ? 21.092 35.519 84.680  1.00 37.73 ? 47   GLU B CA  1 
ATOM   1653  C  C   . GLU B  1 47  ? 20.198 35.761 85.888  1.00 38.02 ? 47   GLU B C   1 
ATOM   1654  O  O   . GLU B  1 47  ? 19.681 36.861 86.095  1.00 36.54 ? 47   GLU B O   1 
ATOM   1655  C  CB  . GLU B  1 47  ? 20.289 34.892 83.548  1.00 40.02 ? 47   GLU B CB  1 
ATOM   1656  C  CG  . GLU B  1 47  ? 21.091 34.778 82.283  1.00 49.69 ? 47   GLU B CG  1 
ATOM   1657  C  CD  . GLU B  1 47  ? 21.831 36.069 81.979  1.00 53.58 ? 47   GLU B CD  1 
ATOM   1658  O  OE1 . GLU B  1 47  ? 21.168 37.127 82.003  1.00 55.44 ? 47   GLU B OE1 1 
ATOM   1659  O  OE2 . GLU B  1 47  ? 23.059 36.030 81.725  1.00 53.87 ? 47   GLU B OE2 1 
ATOM   1660  N  N   . SER B  1 48  ? 20.026 34.717 86.689  1.00 37.50 ? 48   SER B N   1 
ATOM   1661  C  CA  . SER B  1 48  ? 19.209 34.809 87.880  1.00 35.19 ? 48   SER B CA  1 
ATOM   1662  C  C   . SER B  1 48  ? 19.842 35.841 88.798  1.00 33.91 ? 48   SER B C   1 
ATOM   1663  O  O   . SER B  1 48  ? 19.161 36.714 89.341  1.00 31.96 ? 48   SER B O   1 
ATOM   1664  C  CB  . SER B  1 48  ? 19.147 33.452 88.579  1.00 36.61 ? 48   SER B CB  1 
ATOM   1665  O  OG  . SER B  1 48  ? 18.339 33.520 89.741  1.00 42.62 ? 48   SER B OG  1 
ATOM   1666  N  N   . ILE B  1 49  ? 21.155 35.749 88.958  1.00 32.71 ? 49   ILE B N   1 
ATOM   1667  C  CA  . ILE B  1 49  ? 21.860 36.683 89.819  1.00 35.85 ? 49   ILE B CA  1 
ATOM   1668  C  C   . ILE B  1 49  ? 21.765 38.102 89.289  1.00 37.40 ? 49   ILE B C   1 
ATOM   1669  O  O   . ILE B  1 49  ? 21.622 39.057 90.053  1.00 39.64 ? 49   ILE B O   1 
ATOM   1670  C  CB  . ILE B  1 49  ? 23.323 36.300 89.953  1.00 34.50 ? 49   ILE B CB  1 
ATOM   1671  C  CG1 . ILE B  1 49  ? 23.419 34.879 90.514  1.00 38.58 ? 49   ILE B CG1 1 
ATOM   1672  C  CG2 . ILE B  1 49  ? 24.030 37.290 90.848  1.00 31.66 ? 49   ILE B CG2 1 
ATOM   1673  C  CD1 . ILE B  1 49  ? 22.632 34.670 91.812  1.00 42.79 ? 49   ILE B CD1 1 
ATOM   1674  N  N   . ASP B  1 50  ? 21.842 38.232 87.974  1.00 38.53 ? 50   ASP B N   1 
ATOM   1675  C  CA  . ASP B  1 50  ? 21.751 39.528 87.322  1.00 40.55 ? 50   ASP B CA  1 
ATOM   1676  C  C   . ASP B  1 50  ? 20.444 40.211 87.715  1.00 39.65 ? 50   ASP B C   1 
ATOM   1677  O  O   . ASP B  1 50  ? 20.431 41.376 88.124  1.00 37.14 ? 50   ASP B O   1 
ATOM   1678  C  CB  . ASP B  1 50  ? 21.789 39.334 85.809  1.00 45.46 ? 50   ASP B CB  1 
ATOM   1679  C  CG  . ASP B  1 50  ? 22.825 40.194 85.144  1.00 50.89 ? 50   ASP B CG  1 
ATOM   1680  O  OD1 . ASP B  1 50  ? 24.002 40.110 85.555  1.00 51.15 ? 50   ASP B OD1 1 
ATOM   1681  O  OD2 . ASP B  1 50  ? 22.464 40.949 84.213  1.00 55.87 ? 50   ASP B OD2 1 
ATOM   1682  N  N   . GLU B  1 51  ? 19.345 39.469 87.595  1.00 39.31 ? 51   GLU B N   1 
ATOM   1683  C  CA  . GLU B  1 51  ? 18.028 39.991 87.916  1.00 38.77 ? 51   GLU B CA  1 
ATOM   1684  C  C   . GLU B  1 51  ? 17.949 40.387 89.388  1.00 37.79 ? 51   GLU B C   1 
ATOM   1685  O  O   . GLU B  1 51  ? 17.151 41.248 89.767  1.00 36.23 ? 51   GLU B O   1 
ATOM   1686  C  CB  . GLU B  1 51  ? 16.956 38.959 87.553  1.00 39.52 ? 51   GLU B CB  1 
ATOM   1687  C  CG  . GLU B  1 51  ? 17.005 38.550 86.078  1.00 46.60 ? 51   GLU B CG  1 
ATOM   1688  C  CD  . GLU B  1 51  ? 16.917 39.744 85.129  1.00 49.99 ? 51   GLU B CD  1 
ATOM   1689  O  OE1 . GLU B  1 51  ? 17.038 39.526 83.898  1.00 55.88 ? 51   GLU B OE1 1 
ATOM   1690  O  OE2 . GLU B  1 51  ? 16.715 40.875 85.613  1.00 52.98 ? 51   GLU B OE2 1 
ATOM   1691  N  N   . MET B  1 52  ? 18.771 39.750 90.218  1.00 35.96 ? 52   MET B N   1 
ATOM   1692  C  CA  . MET B  1 52  ? 18.806 40.059 91.640  1.00 31.86 ? 52   MET B CA  1 
ATOM   1693  C  C   . MET B  1 52  ? 19.473 41.420 91.855  1.00 28.44 ? 52   MET B C   1 
ATOM   1694  O  O   . MET B  1 52  ? 19.028 42.220 92.674  1.00 24.40 ? 52   MET B O   1 
ATOM   1695  C  CB  . MET B  1 52  ? 19.539 38.946 92.399  1.00 33.84 ? 52   MET B CB  1 
ATOM   1696  C  CG  . MET B  1 52  ? 18.691 37.691 92.548  1.00 41.90 ? 52   MET B CG  1 
ATOM   1697  S  SD  . MET B  1 52  ? 19.431 36.299 93.460  1.00 53.92 ? 52   MET B SD  1 
ATOM   1698  C  CE  . MET B  1 52  ? 19.077 34.918 92.319  1.00 49.97 ? 52   MET B CE  1 
ATOM   1699  N  N   . LYS B  1 53  ? 20.530 41.695 91.101  1.00 28.21 ? 53   LYS B N   1 
ATOM   1700  C  CA  . LYS B  1 53  ? 21.207 42.981 91.213  1.00 29.22 ? 53   LYS B CA  1 
ATOM   1701  C  C   . LYS B  1 53  ? 20.279 44.086 90.687  1.00 30.92 ? 53   LYS B C   1 
ATOM   1702  O  O   . LYS B  1 53  ? 20.310 45.224 91.168  1.00 30.97 ? 53   LYS B O   1 
ATOM   1703  C  CB  . LYS B  1 53  ? 22.509 42.963 90.413  1.00 30.44 ? 53   LYS B CB  1 
ATOM   1704  C  CG  . LYS B  1 53  ? 23.510 41.898 90.872  1.00 33.36 ? 53   LYS B CG  1 
ATOM   1705  C  CD  . LYS B  1 53  ? 24.651 41.760 89.872  1.00 34.74 ? 53   LYS B CD  1 
ATOM   1706  C  CE  . LYS B  1 53  ? 25.469 40.505 90.133  1.00 37.93 ? 53   LYS B CE  1 
ATOM   1707  N  NZ  . LYS B  1 53  ? 26.294 40.101 88.942  1.00 40.86 ? 53   LYS B NZ  1 
ATOM   1708  N  N   . HIS B  1 54  ? 19.454 43.749 89.695  1.00 29.98 ? 54   HIS B N   1 
ATOM   1709  C  CA  . HIS B  1 54  ? 18.506 44.711 89.130  1.00 27.97 ? 54   HIS B CA  1 
ATOM   1710  C  C   . HIS B  1 54  ? 17.472 45.123 90.169  1.00 26.46 ? 54   HIS B C   1 
ATOM   1711  O  O   . HIS B  1 54  ? 17.211 46.318 90.372  1.00 26.14 ? 54   HIS B O   1 
ATOM   1712  C  CB  . HIS B  1 54  ? 17.738 44.110 87.961  1.00 28.52 ? 54   HIS B CB  1 
ATOM   1713  C  CG  . HIS B  1 54  ? 18.598 44.029 86.687  1.00 31.18 ? 54   HIS B CG  1 
ATOM   1714  N  ND1 . HIS B  1 54  ? 18.104 43.547 85.492  1.00 24.65 ? 54   HIS B ND1 1 
ATOM   1715  C  CD2 . HIS B  1 54  ? 19.886 44.375 86.450  1.00 31.77 ? 54   HIS B CD2 1 
ATOM   1716  C  CE1 . HIS B  1 54  ? 19.055 43.597 84.577  1.00 28.53 ? 54   HIS B CE1 1 
ATOM   1717  N  NE2 . HIS B  1 54  ? 20.146 44.094 85.131  1.00 29.90 ? 54   HIS B NE2 1 
ATOM   1718  N  N   . ALA B  1 55  ? 16.895 44.126 90.834  1.00 24.73 ? 55   ALA B N   1 
ATOM   1719  C  CA  . ALA B  1 55  ? 15.883 44.365 91.852  1.00 25.13 ? 55   ALA B CA  1 
ATOM   1720  C  C   . ALA B  1 55  ? 16.483 45.194 92.978  1.00 29.00 ? 55   ALA B C   1 
ATOM   1721  O  O   . ALA B  1 55  ? 15.845 46.108 93.518  1.00 28.72 ? 55   ALA B O   1 
ATOM   1722  C  CB  . ALA B  1 55  ? 15.380 43.052 92.381  1.00 25.01 ? 55   ALA B CB  1 
ATOM   1723  N  N   . ASP B  1 56  ? 17.725 44.866 93.318  1.00 30.98 ? 56   ASP B N   1 
ATOM   1724  C  CA  . ASP B  1 56  ? 18.461 45.558 94.362  1.00 31.15 ? 56   ASP B CA  1 
ATOM   1725  C  C   . ASP B  1 56  ? 18.605 47.040 93.995  1.00 31.53 ? 56   ASP B C   1 
ATOM   1726  O  O   . ASP B  1 56  ? 18.391 47.913 94.831  1.00 36.45 ? 56   ASP B O   1 
ATOM   1727  C  CB  . ASP B  1 56  ? 19.831 44.896 94.523  1.00 32.81 ? 56   ASP B CB  1 
ATOM   1728  C  CG  . ASP B  1 56  ? 20.530 45.289 95.806  1.00 37.41 ? 56   ASP B CG  1 
ATOM   1729  O  OD1 . ASP B  1 56  ? 19.865 45.841 96.709  1.00 41.46 ? 56   ASP B OD1 1 
ATOM   1730  O  OD2 . ASP B  1 56  ? 21.748 45.027 95.918  1.00 38.84 ? 56   ASP B OD2 1 
ATOM   1731  N  N   . LYS B  1 57  ? 18.953 47.329 92.746  1.00 31.07 ? 57   LYS B N   1 
ATOM   1732  C  CA  . LYS B  1 57  ? 19.098 48.717 92.299  1.00 32.48 ? 57   LYS B CA  1 
ATOM   1733  C  C   . LYS B  1 57  ? 17.795 49.496 92.488  1.00 31.69 ? 57   LYS B C   1 
ATOM   1734  O  O   . LYS B  1 57  ? 17.804 50.647 92.936  1.00 31.73 ? 57   LYS B O   1 
ATOM   1735  C  CB  . LYS B  1 57  ? 19.506 48.769 90.820  1.00 37.90 ? 57   LYS B CB  1 
ATOM   1736  C  CG  . LYS B  1 57  ? 20.941 48.331 90.518  1.00 43.81 ? 57   LYS B CG  1 
ATOM   1737  C  CD  . LYS B  1 57  ? 21.957 49.376 90.985  1.00 50.80 ? 57   LYS B CD  1 
ATOM   1738  C  CE  . LYS B  1 57  ? 23.394 48.958 90.658  1.00 54.53 ? 57   LYS B CE  1 
ATOM   1739  N  NZ  . LYS B  1 57  ? 24.410 49.944 91.152  1.00 55.52 ? 57   LYS B NZ  1 
ATOM   1740  N  N   . LEU B  1 58  ? 16.675 48.868 92.143  1.00 28.86 ? 58   LEU B N   1 
ATOM   1741  C  CA  . LEU B  1 58  ? 15.371 49.511 92.284  1.00 27.00 ? 58   LEU B CA  1 
ATOM   1742  C  C   . LEU B  1 58  ? 15.005 49.760 93.751  1.00 27.28 ? 58   LEU B C   1 
ATOM   1743  O  O   . LEU B  1 58  ? 14.623 50.874 94.121  1.00 26.57 ? 58   LEU B O   1 
ATOM   1744  C  CB  . LEU B  1 58  ? 14.294 48.656 91.612  1.00 24.98 ? 58   LEU B CB  1 
ATOM   1745  C  CG  . LEU B  1 58  ? 14.458 48.516 90.097  1.00 23.78 ? 58   LEU B CG  1 
ATOM   1746  C  CD1 . LEU B  1 58  ? 13.515 47.456 89.559  1.00 20.63 ? 58   LEU B CD1 1 
ATOM   1747  C  CD2 . LEU B  1 58  ? 14.194 49.860 89.440  1.00 16.85 ? 58   LEU B CD2 1 
ATOM   1748  N  N   . ILE B  1 59  ? 15.127 48.726 94.582  1.00 28.91 ? 59   ILE B N   1 
ATOM   1749  C  CA  . ILE B  1 59  ? 14.809 48.847 96.005  1.00 29.60 ? 59   ILE B CA  1 
ATOM   1750  C  C   . ILE B  1 59  ? 15.500 50.065 96.619  1.00 30.01 ? 59   ILE B C   1 
ATOM   1751  O  O   . ILE B  1 59  ? 14.894 50.825 97.385  1.00 29.42 ? 59   ILE B O   1 
ATOM   1752  C  CB  . ILE B  1 59  ? 15.259 47.598 96.798  1.00 29.95 ? 59   ILE B CB  1 
ATOM   1753  C  CG1 . ILE B  1 59  ? 14.600 46.347 96.232  1.00 30.71 ? 59   ILE B CG1 1 
ATOM   1754  C  CG2 . ILE B  1 59  ? 14.874 47.739 98.258  1.00 27.40 ? 59   ILE B CG2 1 
ATOM   1755  C  CD1 . ILE B  1 59  ? 14.915 45.106 97.026  1.00 31.94 ? 59   ILE B CD1 1 
ATOM   1756  N  N   . LYS B  1 60  ? 16.774 50.247 96.284  1.00 28.75 ? 60   LYS B N   1 
ATOM   1757  C  CA  . LYS B  1 60  ? 17.527 51.365 96.822  1.00 29.27 ? 60   LYS B CA  1 
ATOM   1758  C  C   . LYS B  1 60  ? 16.990 52.685 96.306  1.00 28.38 ? 60   LYS B C   1 
ATOM   1759  O  O   . LYS B  1 60  ? 16.753 53.605 97.082  1.00 28.83 ? 60   LYS B O   1 
ATOM   1760  C  CB  . LYS B  1 60  ? 19.008 51.222 96.474  1.00 30.94 ? 60   LYS B CB  1 
ATOM   1761  C  CG  . LYS B  1 60  ? 19.672 50.052 97.177  1.00 36.95 ? 60   LYS B CG  1 
ATOM   1762  C  CD  . LYS B  1 60  ? 21.148 49.930 96.819  1.00 44.55 ? 60   LYS B CD  1 
ATOM   1763  C  CE  . LYS B  1 60  ? 21.753 48.654 97.403  1.00 49.68 ? 60   LYS B CE  1 
ATOM   1764  N  NZ  . LYS B  1 60  ? 23.179 48.447 96.998  1.00 51.81 ? 60   LYS B NZ  1 
ATOM   1765  N  N   . ARG B  1 61  ? 16.788 52.777 94.997  1.00 28.57 ? 61   ARG B N   1 
ATOM   1766  C  CA  . ARG B  1 61  ? 16.277 54.009 94.412  1.00 27.22 ? 61   ARG B CA  1 
ATOM   1767  C  C   . ARG B  1 61  ? 14.932 54.350 95.039  1.00 28.37 ? 61   ARG B C   1 
ATOM   1768  O  O   . ARG B  1 61  ? 14.653 55.510 95.372  1.00 27.93 ? 61   ARG B O   1 
ATOM   1769  C  CB  . ARG B  1 61  ? 16.120 53.860 92.901  1.00 25.33 ? 61   ARG B CB  1 
ATOM   1770  C  CG  . ARG B  1 61  ? 15.681 55.135 92.219  1.00 22.48 ? 61   ARG B CG  1 
ATOM   1771  C  CD  . ARG B  1 61  ? 16.707 56.214 92.414  1.00 23.12 ? 61   ARG B CD  1 
ATOM   1772  N  NE  . ARG B  1 61  ? 16.248 57.513 91.929  1.00 28.25 ? 61   ARG B NE  1 
ATOM   1773  C  CZ  . ARG B  1 61  ? 16.995 58.614 91.936  1.00 26.30 ? 61   ARG B CZ  1 
ATOM   1774  N  NH1 . ARG B  1 61  ? 18.234 58.566 92.402  1.00 26.05 ? 61   ARG B NH1 1 
ATOM   1775  N  NH2 . ARG B  1 61  ? 16.508 59.759 91.477  1.00 30.03 ? 61   ARG B NH2 1 
ATOM   1776  N  N   . ILE B  1 62  ? 14.097 53.331 95.203  1.00 26.51 ? 62   ILE B N   1 
ATOM   1777  C  CA  . ILE B  1 62  ? 12.785 53.531 95.798  1.00 27.95 ? 62   ILE B CA  1 
ATOM   1778  C  C   . ILE B  1 62  ? 12.900 53.994 97.254  1.00 27.12 ? 62   ILE B C   1 
ATOM   1779  O  O   . ILE B  1 62  ? 12.271 54.969 97.662  1.00 27.59 ? 62   ILE B O   1 
ATOM   1780  C  CB  . ILE B  1 62  ? 11.960 52.237 95.725  1.00 29.52 ? 62   ILE B CB  1 
ATOM   1781  C  CG1 . ILE B  1 62  ? 11.749 51.858 94.250  1.00 28.82 ? 62   ILE B CG1 1 
ATOM   1782  C  CG2 . ILE B  1 62  ? 10.638 52.421 96.464  1.00 26.31 ? 62   ILE B CG2 1 
ATOM   1783  C  CD1 . ILE B  1 62  ? 10.996 50.568 94.039  1.00 26.56 ? 62   ILE B CD1 1 
ATOM   1784  N  N   . LEU B  1 63  ? 13.708 53.292 98.037  1.00 27.09 ? 63   LEU B N   1 
ATOM   1785  C  CA  . LEU B  1 63  ? 13.899 53.659 99.435  1.00 26.97 ? 63   LEU B CA  1 
ATOM   1786  C  C   . LEU B  1 63  ? 14.378 55.107 99.543  1.00 27.37 ? 63   LEU B C   1 
ATOM   1787  O  O   . LEU B  1 63  ? 13.881 55.884 100.365 1.00 28.85 ? 63   LEU B O   1 
ATOM   1788  C  CB  . LEU B  1 63  ? 14.912 52.711 100.075 1.00 22.82 ? 63   LEU B CB  1 
ATOM   1789  C  CG  . LEU B  1 63  ? 14.384 51.696 101.089 1.00 20.17 ? 63   LEU B CG  1 
ATOM   1790  C  CD1 . LEU B  1 63  ? 12.889 51.539 100.994 1.00 18.04 ? 63   LEU B CD1 1 
ATOM   1791  C  CD2 . LEU B  1 63  ? 15.087 50.378 100.868 1.00 21.91 ? 63   LEU B CD2 1 
ATOM   1792  N  N   . PHE B  1 64  ? 15.335 55.462 98.695  1.00 27.53 ? 64   PHE B N   1 
ATOM   1793  C  CA  . PHE B  1 64  ? 15.890 56.806 98.675  1.00 31.57 ? 64   PHE B CA  1 
ATOM   1794  C  C   . PHE B  1 64  ? 14.815 57.832 98.326  1.00 33.35 ? 64   PHE B C   1 
ATOM   1795  O  O   . PHE B  1 64  ? 14.732 58.892 98.951  1.00 35.48 ? 64   PHE B O   1 
ATOM   1796  C  CB  . PHE B  1 64  ? 17.034 56.885 97.653  1.00 33.41 ? 64   PHE B CB  1 
ATOM   1797  C  CG  . PHE B  1 64  ? 17.552 58.274 97.433  1.00 35.56 ? 64   PHE B CG  1 
ATOM   1798  C  CD1 . PHE B  1 64  ? 18.167 58.974 98.469  1.00 37.58 ? 64   PHE B CD1 1 
ATOM   1799  C  CD2 . PHE B  1 64  ? 17.399 58.898 96.199  1.00 36.30 ? 64   PHE B CD2 1 
ATOM   1800  C  CE1 . PHE B  1 64  ? 18.620 60.277 98.280  1.00 37.46 ? 64   PHE B CE1 1 
ATOM   1801  C  CE2 . PHE B  1 64  ? 17.850 60.201 96.000  1.00 35.66 ? 64   PHE B CE2 1 
ATOM   1802  C  CZ  . PHE B  1 64  ? 18.460 60.891 97.041  1.00 37.56 ? 64   PHE B CZ  1 
ATOM   1803  N  N   . LEU B  1 65  ? 14.000 57.518 97.322  1.00 33.66 ? 65   LEU B N   1 
ATOM   1804  C  CA  . LEU B  1 65  ? 12.933 58.414 96.891  1.00 35.15 ? 65   LEU B CA  1 
ATOM   1805  C  C   . LEU B  1 65  ? 11.809 58.440 97.917  1.00 38.25 ? 65   LEU B C   1 
ATOM   1806  O  O   . LEU B  1 65  ? 10.758 59.048 97.693  1.00 40.50 ? 65   LEU B O   1 
ATOM   1807  C  CB  . LEU B  1 65  ? 12.399 57.968 95.527  1.00 36.46 ? 65   LEU B CB  1 
ATOM   1808  C  CG  . LEU B  1 65  ? 12.857 58.740 94.280  1.00 35.08 ? 65   LEU B CG  1 
ATOM   1809  C  CD1 . LEU B  1 65  ? 14.197 59.420 94.515  1.00 32.41 ? 65   LEU B CD1 1 
ATOM   1810  C  CD2 . LEU B  1 65  ? 12.924 57.768 93.101  1.00 36.68 ? 65   LEU B CD2 1 
ATOM   1811  N  N   . GLU B  1 66  ? 12.041 57.763 99.040  1.00 39.25 ? 66   GLU B N   1 
ATOM   1812  C  CA  . GLU B  1 66  ? 11.090 57.705 100.142 1.00 39.06 ? 66   GLU B CA  1 
ATOM   1813  C  C   . GLU B  1 66  ? 9.770  56.989 99.853  1.00 38.79 ? 66   GLU B C   1 
ATOM   1814  O  O   . GLU B  1 66  ? 8.709  57.425 100.314 1.00 39.82 ? 66   GLU B O   1 
ATOM   1815  C  CB  . GLU B  1 66  ? 10.814 59.125 100.648 1.00 40.06 ? 66   GLU B CB  1 
ATOM   1816  C  CG  . GLU B  1 66  ? 11.980 59.722 101.422 1.00 45.97 ? 66   GLU B CG  1 
ATOM   1817  C  CD  . GLU B  1 66  ? 11.764 61.177 101.822 1.00 47.96 ? 66   GLU B CD  1 
ATOM   1818  O  OE1 . GLU B  1 66  ? 10.616 61.554 102.154 1.00 48.23 ? 66   GLU B OE1 1 
ATOM   1819  O  OE2 . GLU B  1 66  ? 12.755 61.937 101.822 1.00 48.76 ? 66   GLU B OE2 1 
ATOM   1820  N  N   . GLY B  1 67  ? 9.839  55.889 99.105  1.00 35.76 ? 67   GLY B N   1 
ATOM   1821  C  CA  . GLY B  1 67  ? 8.641  55.125 98.791  1.00 32.49 ? 67   GLY B CA  1 
ATOM   1822  C  C   . GLY B  1 67  ? 8.670  53.803 99.534  1.00 34.59 ? 67   GLY B C   1 
ATOM   1823  O  O   . GLY B  1 67  ? 9.569  53.565 100.342 1.00 36.07 ? 67   GLY B O   1 
ATOM   1824  N  N   . LEU B  1 68  ? 7.700  52.936 99.282  1.00 33.90 ? 68   LEU B N   1 
ATOM   1825  C  CA  . LEU B  1 68  ? 7.684  51.645 99.956  1.00 35.12 ? 68   LEU B CA  1 
ATOM   1826  C  C   . LEU B  1 68  ? 7.825  50.509 98.961  1.00 36.41 ? 68   LEU B C   1 
ATOM   1827  O  O   . LEU B  1 68  ? 6.899  50.207 98.219  1.00 37.52 ? 68   LEU B O   1 
ATOM   1828  C  CB  . LEU B  1 68  ? 6.396  51.476 100.748 1.00 35.25 ? 68   LEU B CB  1 
ATOM   1829  C  CG  . LEU B  1 68  ? 6.286  52.405 101.955 1.00 36.61 ? 68   LEU B CG  1 
ATOM   1830  C  CD1 . LEU B  1 68  ? 4.877  52.356 102.506 1.00 38.51 ? 68   LEU B CD1 1 
ATOM   1831  C  CD2 . LEU B  1 68  ? 7.290  51.990 103.013 1.00 36.72 ? 68   LEU B CD2 1 
ATOM   1832  N  N   . PRO B  1 69  ? 9.002  49.870 98.926  1.00 36.81 ? 69   PRO B N   1 
ATOM   1833  C  CA  . PRO B  1 69  ? 9.245  48.760 98.004  1.00 37.16 ? 69   PRO B CA  1 
ATOM   1834  C  C   . PRO B  1 69  ? 8.194  47.691 98.210  1.00 40.35 ? 69   PRO B C   1 
ATOM   1835  O  O   . PRO B  1 69  ? 7.803  47.406 99.342  1.00 43.60 ? 69   PRO B O   1 
ATOM   1836  C  CB  . PRO B  1 69  ? 10.632 48.271 98.405  1.00 36.63 ? 69   PRO B CB  1 
ATOM   1837  C  CG  . PRO B  1 69  ? 11.296 49.521 98.922  1.00 37.09 ? 69   PRO B CG  1 
ATOM   1838  C  CD  . PRO B  1 69  ? 10.197 50.152 99.740  1.00 37.51 ? 69   PRO B CD  1 
ATOM   1839  N  N   . ASN B  1 70  ? 7.719  47.105 97.122  1.00 41.23 ? 70   ASN B N   1 
ATOM   1840  C  CA  . ASN B  1 70  ? 6.726  46.055 97.244  1.00 42.34 ? 70   ASN B CA  1 
ATOM   1841  C  C   . ASN B  1 70  ? 7.401  44.763 96.822  1.00 43.24 ? 70   ASN B C   1 
ATOM   1842  O  O   . ASN B  1 70  ? 7.491  44.457 95.631  1.00 42.50 ? 70   ASN B O   1 
ATOM   1843  C  CB  . ASN B  1 70  ? 5.524  46.338 96.340  1.00 42.55 ? 70   ASN B CB  1 
ATOM   1844  C  CG  . ASN B  1 70  ? 4.373  45.368 96.571  1.00 42.06 ? 70   ASN B CG  1 
ATOM   1845  O  OD1 . ASN B  1 70  ? 4.579  44.175 96.814  1.00 42.68 ? 70   ASN B OD1 1 
ATOM   1846  N  ND2 . ASN B  1 70  ? 3.153  45.876 96.473  1.00 42.80 ? 70   ASN B ND2 1 
ATOM   1847  N  N   . LEU B  1 71  ? 7.909  44.025 97.805  1.00 44.35 ? 71   LEU B N   1 
ATOM   1848  C  CA  . LEU B  1 71  ? 8.572  42.755 97.540  1.00 45.13 ? 71   LEU B CA  1 
ATOM   1849  C  C   . LEU B  1 71  ? 7.490  41.700 97.686  1.00 48.19 ? 71   LEU B C   1 
ATOM   1850  O  O   . LEU B  1 71  ? 7.672  40.545 97.306  1.00 47.52 ? 71   LEU B O   1 
ATOM   1851  C  CB  . LEU B  1 71  ? 9.682  42.497 98.570  1.00 39.72 ? 71   LEU B CB  1 
ATOM   1852  C  CG  . LEU B  1 71  ? 10.992 43.308 98.617  1.00 35.43 ? 71   LEU B CG  1 
ATOM   1853  C  CD1 . LEU B  1 71  ? 11.969 42.847 97.563  1.00 31.46 ? 71   LEU B CD1 1 
ATOM   1854  C  CD2 . LEU B  1 71  ? 10.689 44.773 98.474  1.00 34.55 ? 71   LEU B CD2 1 
ATOM   1855  N  N   . GLN B  1 72  ? 6.353  42.136 98.229  1.00 53.36 ? 72   GLN B N   1 
ATOM   1856  C  CA  . GLN B  1 72  ? 5.201  41.273 98.494  1.00 57.94 ? 72   GLN B CA  1 
ATOM   1857  C  C   . GLN B  1 72  ? 4.626  40.505 97.301  1.00 58.82 ? 72   GLN B C   1 
ATOM   1858  O  O   . GLN B  1 72  ? 4.740  39.277 97.226  1.00 59.96 ? 72   GLN B O   1 
ATOM   1859  C  CB  . GLN B  1 72  ? 4.082  42.090 99.163  1.00 57.87 ? 72   GLN B CB  1 
ATOM   1860  C  CG  . GLN B  1 72  ? 2.823  41.286 99.497  1.00 56.01 ? 72   GLN B CG  1 
ATOM   1861  C  CD  . GLN B  1 72  ? 3.072  40.213 100.542 1.00 55.05 ? 72   GLN B CD  1 
ATOM   1862  O  OE1 . GLN B  1 72  ? 3.308  40.515 101.710 1.00 54.56 ? 72   GLN B OE1 1 
ATOM   1863  N  NE2 . GLN B  1 72  ? 3.029  38.952 100.121 1.00 51.76 ? 72   GLN B NE2 1 
ATOM   1864  N  N   . GLU B  1 73  ? 4.005  41.218 96.373  1.00 60.00 ? 73   GLU B N   1 
ATOM   1865  C  CA  . GLU B  1 73  ? 3.402  40.555 95.228  1.00 62.88 ? 73   GLU B CA  1 
ATOM   1866  C  C   . GLU B  1 73  ? 4.365  40.041 94.166  1.00 62.74 ? 73   GLU B C   1 
ATOM   1867  O  O   . GLU B  1 73  ? 5.343  40.703 93.785  1.00 62.27 ? 73   GLU B O   1 
ATOM   1868  C  CB  . GLU B  1 73  ? 2.336  41.462 94.613  1.00 65.56 ? 73   GLU B CB  1 
ATOM   1869  C  CG  . GLU B  1 73  ? 1.094  41.543 95.492  1.00 67.23 ? 73   GLU B CG  1 
ATOM   1870  C  CD  . GLU B  1 73  ? 0.435  42.899 95.455  1.00 69.82 ? 73   GLU B CD  1 
ATOM   1871  O  OE1 . GLU B  1 73  ? -0.092 43.280 94.385  1.00 69.74 ? 73   GLU B OE1 1 
ATOM   1872  O  OE2 . GLU B  1 73  ? 0.453  43.583 96.505  1.00 71.90 ? 73   GLU B OE2 1 
ATOM   1873  N  N   . LEU B  1 74  ? 4.064  38.827 93.716  1.00 60.95 ? 74   LEU B N   1 
ATOM   1874  C  CA  . LEU B  1 74  ? 4.838  38.112 92.715  1.00 58.00 ? 74   LEU B CA  1 
ATOM   1875  C  C   . LEU B  1 74  ? 3.839  37.724 91.621  1.00 56.74 ? 74   LEU B C   1 
ATOM   1876  O  O   . LEU B  1 74  ? 2.823  37.082 91.903  1.00 55.56 ? 74   LEU B O   1 
ATOM   1877  C  CB  . LEU B  1 74  ? 5.458  36.871 93.369  1.00 58.09 ? 74   LEU B CB  1 
ATOM   1878  C  CG  . LEU B  1 74  ? 6.689  36.183 92.770  1.00 58.29 ? 74   LEU B CG  1 
ATOM   1879  C  CD1 . LEU B  1 74  ? 6.272  35.078 91.809  1.00 57.90 ? 74   LEU B CD1 1 
ATOM   1880  C  CD2 . LEU B  1 74  ? 7.571  37.233 92.110  1.00 55.09 ? 74   LEU B CD2 1 
ATOM   1881  N  N   . GLY B  1 75  ? 4.120  38.123 90.381  1.00 52.87 ? 75   GLY B N   1 
ATOM   1882  C  CA  . GLY B  1 75  ? 3.210  37.830 89.287  1.00 49.28 ? 75   GLY B CA  1 
ATOM   1883  C  C   . GLY B  1 75  ? 3.318  36.435 88.716  1.00 47.37 ? 75   GLY B C   1 
ATOM   1884  O  O   . GLY B  1 75  ? 4.001  35.578 89.267  1.00 44.95 ? 75   GLY B O   1 
ATOM   1885  N  N   . LYS B  1 76  ? 2.635  36.204 87.602  1.00 49.45 ? 76   LYS B N   1 
ATOM   1886  C  CA  . LYS B  1 76  ? 2.675  34.900 86.951  1.00 53.98 ? 76   LYS B CA  1 
ATOM   1887  C  C   . LYS B  1 76  ? 4.133  34.458 86.828  1.00 53.09 ? 76   LYS B C   1 
ATOM   1888  O  O   . LYS B  1 76  ? 5.056  35.274 86.890  1.00 54.16 ? 76   LYS B O   1 
ATOM   1889  C  CB  . LYS B  1 76  ? 2.038  34.971 85.557  1.00 58.27 ? 76   LYS B CB  1 
ATOM   1890  C  CG  . LYS B  1 76  ? 1.701  33.611 84.940  1.00 63.31 ? 76   LYS B CG  1 
ATOM   1891  C  CD  . LYS B  1 76  ? 1.247  33.764 83.489  1.00 66.44 ? 76   LYS B CD  1 
ATOM   1892  C  CE  . LYS B  1 76  ? 0.684  32.458 82.925  1.00 70.09 ? 76   LYS B CE  1 
ATOM   1893  N  NZ  . LYS B  1 76  ? -0.594 32.023 83.577  1.00 69.59 ? 76   LYS B NZ  1 
ATOM   1894  N  N   . LEU B  1 77  ? 4.339  33.163 86.645  1.00 50.66 ? 77   LEU B N   1 
ATOM   1895  C  CA  . LEU B  1 77  ? 5.685  32.641 86.543  1.00 48.19 ? 77   LEU B CA  1 
ATOM   1896  C  C   . LEU B  1 77  ? 5.689  31.605 85.438  1.00 46.33 ? 77   LEU B C   1 
ATOM   1897  O  O   . LEU B  1 77  ? 5.303  30.462 85.654  1.00 47.15 ? 77   LEU B O   1 
ATOM   1898  C  CB  . LEU B  1 77  ? 6.070  32.007 87.877  1.00 49.58 ? 77   LEU B CB  1 
ATOM   1899  C  CG  . LEU B  1 77  ? 7.537  31.798 88.221  1.00 49.13 ? 77   LEU B CG  1 
ATOM   1900  C  CD1 . LEU B  1 77  ? 8.230  33.152 88.314  1.00 49.50 ? 77   LEU B CD1 1 
ATOM   1901  C  CD2 . LEU B  1 77  ? 7.637  31.042 89.536  1.00 47.01 ? 77   LEU B CD2 1 
ATOM   1902  N  N   . LEU B  1 78  ? 6.115  32.013 84.249  1.00 45.02 ? 78   LEU B N   1 
ATOM   1903  C  CA  . LEU B  1 78  ? 6.155  31.119 83.101  1.00 41.61 ? 78   LEU B CA  1 
ATOM   1904  C  C   . LEU B  1 78  ? 7.205  30.030 83.259  1.00 41.11 ? 78   LEU B C   1 
ATOM   1905  O  O   . LEU B  1 78  ? 8.359  30.205 82.874  1.00 42.32 ? 78   LEU B O   1 
ATOM   1906  C  CB  . LEU B  1 78  ? 6.450  31.903 81.825  1.00 41.69 ? 78   LEU B CB  1 
ATOM   1907  C  CG  . LEU B  1 78  ? 5.646  33.171 81.525  1.00 43.27 ? 78   LEU B CG  1 
ATOM   1908  C  CD1 . LEU B  1 78  ? 5.986  33.643 80.102  1.00 40.44 ? 78   LEU B CD1 1 
ATOM   1909  C  CD2 . LEU B  1 78  ? 4.148  32.906 81.679  1.00 42.35 ? 78   LEU B CD2 1 
ATOM   1910  N  N   . ILE B  1 79  ? 6.806  28.902 83.825  1.00 40.09 ? 79   ILE B N   1 
ATOM   1911  C  CA  . ILE B  1 79  ? 7.723  27.789 84.001  1.00 41.66 ? 79   ILE B CA  1 
ATOM   1912  C  C   . ILE B  1 79  ? 7.567  26.903 82.773  1.00 39.26 ? 79   ILE B C   1 
ATOM   1913  O  O   . ILE B  1 79  ? 6.451  26.662 82.333  1.00 40.26 ? 79   ILE B O   1 
ATOM   1914  C  CB  . ILE B  1 79  ? 7.364  26.977 85.265  1.00 43.00 ? 79   ILE B CB  1 
ATOM   1915  C  CG1 . ILE B  1 79  ? 7.175  27.928 86.438  1.00 40.00 ? 79   ILE B CG1 1 
ATOM   1916  C  CG2 . ILE B  1 79  ? 8.471  25.975 85.588  1.00 44.26 ? 79   ILE B CG2 1 
ATOM   1917  C  CD1 . ILE B  1 79  ? 8.392  28.791 86.708  1.00 46.79 ? 79   ILE B CD1 1 
ATOM   1918  N  N   . GLY B  1 80  ? 8.677  26.431 82.217  1.00 40.27 ? 80   GLY B N   1 
ATOM   1919  C  CA  . GLY B  1 80  ? 8.601  25.579 81.039  1.00 40.99 ? 80   GLY B CA  1 
ATOM   1920  C  C   . GLY B  1 80  ? 8.833  24.122 81.385  1.00 42.31 ? 80   GLY B C   1 
ATOM   1921  O  O   . GLY B  1 80  ? 9.224  23.807 82.511  1.00 44.50 ? 80   GLY B O   1 
ATOM   1922  N  N   . GLU B  1 81  ? 8.604  23.222 80.433  1.00 42.42 ? 81   GLU B N   1 
ATOM   1923  C  CA  . GLU B  1 81  ? 8.807  21.803 80.706  1.00 42.10 ? 81   GLU B CA  1 
ATOM   1924  C  C   . GLU B  1 81  ? 10.025 21.216 80.001  1.00 40.57 ? 81   GLU B C   1 
ATOM   1925  O  O   . GLU B  1 81  ? 10.572 20.197 80.438  1.00 39.34 ? 81   GLU B O   1 
ATOM   1926  C  CB  . GLU B  1 81  ? 7.555  21.005 80.342  1.00 44.34 ? 81   GLU B CB  1 
ATOM   1927  C  CG  . GLU B  1 81  ? 6.288  21.512 81.018  1.00 48.26 ? 81   GLU B CG  1 
ATOM   1928  C  CD  . GLU B  1 81  ? 5.167  20.482 81.032  1.00 50.01 ? 81   GLU B CD  1 
ATOM   1929  O  OE1 . GLU B  1 81  ? 4.860  19.883 79.973  1.00 49.92 ? 81   GLU B OE1 1 
ATOM   1930  O  OE2 . GLU B  1 81  ? 4.586  20.278 82.115  1.00 51.92 ? 81   GLU B OE2 1 
ATOM   1931  N  N   . HIS B  1 82  ? 10.447 21.853 78.911  1.00 39.80 ? 82   HIS B N   1 
ATOM   1932  C  CA  . HIS B  1 82  ? 11.619 21.397 78.167  1.00 41.51 ? 82   HIS B CA  1 
ATOM   1933  C  C   . HIS B  1 82  ? 12.478 22.586 77.755  1.00 38.99 ? 82   HIS B C   1 
ATOM   1934  O  O   . HIS B  1 82  ? 11.982 23.706 77.693  1.00 41.50 ? 82   HIS B O   1 
ATOM   1935  C  CB  . HIS B  1 82  ? 11.209 20.578 76.936  1.00 46.65 ? 82   HIS B CB  1 
ATOM   1936  C  CG  . HIS B  1 82  ? 10.121 21.197 76.117  1.00 51.63 ? 82   HIS B CG  1 
ATOM   1937  N  ND1 . HIS B  1 82  ? 8.799  21.177 76.503  1.00 56.80 ? 82   HIS B ND1 1 
ATOM   1938  C  CD2 . HIS B  1 82  ? 10.154 21.828 74.919  1.00 55.35 ? 82   HIS B CD2 1 
ATOM   1939  C  CE1 . HIS B  1 82  ? 8.063  21.767 75.576  1.00 60.80 ? 82   HIS B CE1 1 
ATOM   1940  N  NE2 . HIS B  1 82  ? 8.862  22.170 74.604  1.00 60.59 ? 82   HIS B NE2 1 
ATOM   1941  N  N   . THR B  1 83  ? 13.761 22.346 77.485  1.00 34.94 ? 83   THR B N   1 
ATOM   1942  C  CA  . THR B  1 83  ? 14.678 23.424 77.113  1.00 32.25 ? 83   THR B CA  1 
ATOM   1943  C  C   . THR B  1 83  ? 14.040 24.446 76.194  1.00 32.51 ? 83   THR B C   1 
ATOM   1944  O  O   . THR B  1 83  ? 13.933 25.628 76.516  1.00 31.42 ? 83   THR B O   1 
ATOM   1945  C  CB  . THR B  1 83  ? 15.922 22.894 76.396  1.00 30.85 ? 83   THR B CB  1 
ATOM   1946  O  OG1 . THR B  1 83  ? 16.664 22.040 77.276  1.00 35.64 ? 83   THR B OG1 1 
ATOM   1947  C  CG2 . THR B  1 83  ? 16.802 24.048 75.964  1.00 27.99 ? 83   THR B CG2 1 
ATOM   1948  N  N   . LYS B  1 84  ? 13.626 23.960 75.036  1.00 32.80 ? 84   LYS B N   1 
ATOM   1949  C  CA  . LYS B  1 84  ? 13.007 24.762 74.004  1.00 32.24 ? 84   LYS B CA  1 
ATOM   1950  C  C   . LYS B  1 84  ? 11.962 25.701 74.591  1.00 32.76 ? 84   LYS B C   1 
ATOM   1951  O  O   . LYS B  1 84  ? 11.982 26.903 74.329  1.00 32.52 ? 84   LYS B O   1 
ATOM   1952  C  CB  . LYS B  1 84  ? 12.380 23.826 72.976  1.00 35.17 ? 84   LYS B CB  1 
ATOM   1953  C  CG  . LYS B  1 84  ? 13.104 22.458 72.864  1.00 42.96 ? 84   LYS B CG  1 
ATOM   1954  C  CD  . LYS B  1 84  ? 13.038 21.647 74.182  1.00 43.31 ? 84   LYS B CD  1 
ATOM   1955  C  CE  . LYS B  1 84  ? 13.789 20.316 74.128  1.00 47.46 ? 84   LYS B CE  1 
ATOM   1956  N  NZ  . LYS B  1 84  ? 13.830 19.579 75.443  1.00 44.85 ? 84   LYS B NZ  1 
ATOM   1957  N  N   . GLU B  1 85  ? 11.057 25.154 75.398  1.00 33.92 ? 85   GLU B N   1 
ATOM   1958  C  CA  . GLU B  1 85  ? 9.999  25.952 76.017  1.00 33.04 ? 85   GLU B CA  1 
ATOM   1959  C  C   . GLU B  1 85  ? 10.531 26.886 77.111  1.00 33.05 ? 85   GLU B C   1 
ATOM   1960  O  O   . GLU B  1 85  ? 10.105 28.038 77.231  1.00 32.26 ? 85   GLU B O   1 
ATOM   1961  C  CB  . GLU B  1 85  ? 8.926  25.020 76.586  1.00 35.48 ? 85   GLU B CB  1 
ATOM   1962  C  CG  . GLU B  1 85  ? 7.878  25.725 77.426  1.00 45.97 ? 85   GLU B CG  1 
ATOM   1963  C  CD  . GLU B  1 85  ? 6.752  24.803 77.869  1.00 50.45 ? 85   GLU B CD  1 
ATOM   1964  O  OE1 . GLU B  1 85  ? 7.034  23.737 78.466  1.00 51.65 ? 85   GLU B OE1 1 
ATOM   1965  O  OE2 . GLU B  1 85  ? 5.578  25.156 77.622  1.00 54.60 ? 85   GLU B OE2 1 
ATOM   1966  N  N   . MET B  1 86  ? 11.470 26.387 77.907  1.00 32.89 ? 86   MET B N   1 
ATOM   1967  C  CA  . MET B  1 86  ? 12.058 27.184 78.976  1.00 32.55 ? 86   MET B CA  1 
ATOM   1968  C  C   . MET B  1 86  ? 12.754 28.396 78.377  1.00 31.06 ? 86   MET B C   1 
ATOM   1969  O  O   . MET B  1 86  ? 12.677 29.498 78.915  1.00 31.88 ? 86   MET B O   1 
ATOM   1970  C  CB  . MET B  1 86  ? 13.047 26.337 79.776  1.00 30.82 ? 86   MET B CB  1 
ATOM   1971  C  CG  . MET B  1 86  ? 12.386 25.154 80.473  1.00 31.86 ? 86   MET B CG  1 
ATOM   1972  S  SD  . MET B  1 86  ? 13.551 23.883 80.983  1.00 34.16 ? 86   MET B SD  1 
ATOM   1973  C  CE  . MET B  1 86  ? 14.322 24.692 82.410  1.00 32.71 ? 86   MET B CE  1 
ATOM   1974  N  N   . LEU B  1 87  ? 13.431 28.185 77.257  1.00 32.18 ? 87   LEU B N   1 
ATOM   1975  C  CA  . LEU B  1 87  ? 14.126 29.268 76.573  1.00 32.84 ? 87   LEU B CA  1 
ATOM   1976  C  C   . LEU B  1 87  ? 13.091 30.278 76.059  1.00 35.84 ? 87   LEU B C   1 
ATOM   1977  O  O   . LEU B  1 87  ? 13.288 31.492 76.172  1.00 36.92 ? 87   LEU B O   1 
ATOM   1978  C  CB  . LEU B  1 87  ? 14.957 28.699 75.415  1.00 28.12 ? 87   LEU B CB  1 
ATOM   1979  C  CG  . LEU B  1 87  ? 16.496 28.615 75.481  1.00 28.39 ? 87   LEU B CG  1 
ATOM   1980  C  CD1 . LEU B  1 87  ? 17.036 28.560 76.899  1.00 26.91 ? 87   LEU B CD1 1 
ATOM   1981  C  CD2 . LEU B  1 87  ? 16.924 27.380 74.711  1.00 26.01 ? 87   LEU B CD2 1 
ATOM   1982  N  N   . GLU B  1 88  ? 11.976 29.785 75.521  1.00 35.37 ? 88   GLU B N   1 
ATOM   1983  C  CA  . GLU B  1 88  ? 10.949 30.686 75.009  1.00 38.13 ? 88   GLU B CA  1 
ATOM   1984  C  C   . GLU B  1 88  ? 10.266 31.480 76.128  1.00 40.05 ? 88   GLU B C   1 
ATOM   1985  O  O   . GLU B  1 88  ? 10.052 32.695 76.000  1.00 40.27 ? 88   GLU B O   1 
ATOM   1986  C  CB  . GLU B  1 88  ? 9.915  29.905 74.201  1.00 37.54 ? 88   GLU B CB  1 
ATOM   1987  C  CG  . GLU B  1 88  ? 10.462 29.345 72.897  1.00 43.62 ? 88   GLU B CG  1 
ATOM   1988  C  CD  . GLU B  1 88  ? 9.483  28.423 72.175  1.00 48.16 ? 88   GLU B CD  1 
ATOM   1989  O  OE1 . GLU B  1 88  ? 9.200  27.306 72.673  1.00 47.25 ? 88   GLU B OE1 1 
ATOM   1990  O  OE2 . GLU B  1 88  ? 8.996  28.820 71.097  1.00 52.82 ? 88   GLU B OE2 1 
ATOM   1991  N  N   . CYS B  1 89  ? 9.929  30.804 77.224  1.00 40.07 ? 89   CYS B N   1 
ATOM   1992  C  CA  . CYS B  1 89  ? 9.287  31.480 78.348  1.00 39.82 ? 89   CYS B CA  1 
ATOM   1993  C  C   . CYS B  1 89  ? 10.201 32.572 78.912  1.00 39.82 ? 89   CYS B C   1 
ATOM   1994  O  O   . CYS B  1 89  ? 9.729  33.636 79.319  1.00 41.00 ? 89   CYS B O   1 
ATOM   1995  C  CB  . CYS B  1 89  ? 8.936  30.478 79.448  1.00 38.71 ? 89   CYS B CB  1 
ATOM   1996  S  SG  . CYS B  1 89  ? 7.692  29.257 78.959  1.00 42.48 ? 89   CYS B SG  1 
ATOM   1997  N  N   . ASP B  1 90  ? 11.506 32.312 78.935  1.00 37.97 ? 90   ASP B N   1 
ATOM   1998  C  CA  . ASP B  1 90  ? 12.446 33.301 79.438  1.00 37.32 ? 90   ASP B CA  1 
ATOM   1999  C  C   . ASP B  1 90  ? 12.514 34.475 78.474  1.00 36.81 ? 90   ASP B C   1 
ATOM   2000  O  O   . ASP B  1 90  ? 12.810 35.594 78.885  1.00 37.59 ? 90   ASP B O   1 
ATOM   2001  C  CB  . ASP B  1 90  ? 13.858 32.712 79.610  1.00 39.74 ? 90   ASP B CB  1 
ATOM   2002  C  CG  . ASP B  1 90  ? 13.953 31.703 80.756  1.00 39.36 ? 90   ASP B CG  1 
ATOM   2003  O  OD1 . ASP B  1 90  ? 13.122 31.761 81.687  1.00 41.62 ? 90   ASP B OD1 1 
ATOM   2004  O  OD2 . ASP B  1 90  ? 14.878 30.863 80.732  1.00 37.75 ? 90   ASP B OD2 1 
ATOM   2005  N  N   . LEU B  1 91  ? 12.245 34.222 77.193  1.00 36.80 ? 91   LEU B N   1 
ATOM   2006  C  CA  . LEU B  1 91  ? 12.284 35.289 76.194  1.00 34.97 ? 91   LEU B CA  1 
ATOM   2007  C  C   . LEU B  1 91  ? 10.986 36.090 76.216  1.00 35.98 ? 91   LEU B C   1 
ATOM   2008  O  O   . LEU B  1 91  ? 11.003 37.303 76.006  1.00 34.04 ? 91   LEU B O   1 
ATOM   2009  C  CB  . LEU B  1 91  ? 12.537 34.725 74.789  1.00 34.67 ? 91   LEU B CB  1 
ATOM   2010  C  CG  . LEU B  1 91  ? 12.635 35.717 73.609  1.00 30.82 ? 91   LEU B CG  1 
ATOM   2011  C  CD1 . LEU B  1 91  ? 13.720 36.758 73.843  1.00 27.40 ? 91   LEU B CD1 1 
ATOM   2012  C  CD2 . LEU B  1 91  ? 12.936 34.943 72.348  1.00 27.82 ? 91   LEU B CD2 1 
ATOM   2013  N  N   . LYS B  1 92  ? 9.860  35.427 76.468  1.00 35.90 ? 92   LYS B N   1 
ATOM   2014  C  CA  . LYS B  1 92  ? 8.601  36.159 76.535  1.00 39.76 ? 92   LYS B CA  1 
ATOM   2015  C  C   . LYS B  1 92  ? 8.742  37.211 77.634  1.00 40.35 ? 92   LYS B C   1 
ATOM   2016  O  O   . LYS B  1 92  ? 8.600  38.412 77.392  1.00 38.17 ? 92   LYS B O   1 
ATOM   2017  C  CB  . LYS B  1 92  ? 7.428  35.242 76.896  1.00 44.02 ? 92   LYS B CB  1 
ATOM   2018  C  CG  . LYS B  1 92  ? 7.144  34.104 75.927  1.00 52.32 ? 92   LYS B CG  1 
ATOM   2019  C  CD  . LYS B  1 92  ? 5.823  33.403 76.293  1.00 55.45 ? 92   LYS B CD  1 
ATOM   2020  C  CE  . LYS B  1 92  ? 5.716  32.022 75.647  1.00 57.11 ? 92   LYS B CE  1 
ATOM   2021  N  NZ  . LYS B  1 92  ? 5.934  32.068 74.170  1.00 58.15 ? 92   LYS B NZ  1 
ATOM   2022  N  N   . LEU B  1 93  ? 9.031  36.728 78.843  1.00 42.73 ? 93   LEU B N   1 
ATOM   2023  C  CA  . LEU B  1 93  ? 9.199  37.559 80.034  1.00 42.36 ? 93   LEU B CA  1 
ATOM   2024  C  C   . LEU B  1 93  ? 10.196 38.683 79.779  1.00 41.55 ? 93   LEU B C   1 
ATOM   2025  O  O   . LEU B  1 93  ? 9.893  39.862 79.967  1.00 39.44 ? 93   LEU B O   1 
ATOM   2026  C  CB  . LEU B  1 93  ? 9.669  36.678 81.206  1.00 42.37 ? 93   LEU B CB  1 
ATOM   2027  C  CG  . LEU B  1 93  ? 9.840  37.257 82.617  1.00 43.85 ? 93   LEU B CG  1 
ATOM   2028  C  CD1 . LEU B  1 93  ? 9.873  36.133 83.647  1.00 45.05 ? 93   LEU B CD1 1 
ATOM   2029  C  CD2 . LEU B  1 93  ? 11.120 38.067 82.693  1.00 47.74 ? 93   LEU B CD2 1 
ATOM   2030  N  N   . GLU B  1 94  ? 11.387 38.313 79.335  1.00 42.72 ? 94   GLU B N   1 
ATOM   2031  C  CA  . GLU B  1 94  ? 12.425 39.299 79.059  1.00 44.96 ? 94   GLU B CA  1 
ATOM   2032  C  C   . GLU B  1 94  ? 11.953 40.375 78.065  1.00 46.75 ? 94   GLU B C   1 
ATOM   2033  O  O   . GLU B  1 94  ? 12.529 41.454 77.995  1.00 47.40 ? 94   GLU B O   1 
ATOM   2034  C  CB  . GLU B  1 94  ? 13.674 38.591 78.527  1.00 43.02 ? 94   GLU B CB  1 
ATOM   2035  C  CG  . GLU B  1 94  ? 14.983 39.317 78.805  1.00 46.83 ? 94   GLU B CG  1 
ATOM   2036  C  CD  . GLU B  1 94  ? 15.357 39.343 80.280  1.00 46.71 ? 94   GLU B CD  1 
ATOM   2037  O  OE1 . GLU B  1 94  ? 15.559 38.264 80.874  1.00 48.47 ? 94   GLU B OE1 1 
ATOM   2038  O  OE2 . GLU B  1 94  ? 15.455 40.448 80.845  1.00 48.27 ? 94   GLU B OE2 1 
ATOM   2039  N  N   . GLN B  1 95  ? 10.908 40.081 77.302  1.00 49.65 ? 95   GLN B N   1 
ATOM   2040  C  CA  . GLN B  1 95  ? 10.391 41.051 76.347  1.00 52.28 ? 95   GLN B CA  1 
ATOM   2041  C  C   . GLN B  1 95  ? 9.204  41.796 76.935  1.00 54.81 ? 95   GLN B C   1 
ATOM   2042  O  O   . GLN B  1 95  ? 9.119  43.015 76.807  1.00 57.57 ? 95   GLN B O   1 
ATOM   2043  C  CB  . GLN B  1 95  ? 9.983  40.368 75.031  1.00 51.63 ? 95   GLN B CB  1 
ATOM   2044  C  CG  . GLN B  1 95  ? 11.171 39.911 74.189  1.00 52.90 ? 95   GLN B CG  1 
ATOM   2045  C  CD  . GLN B  1 95  ? 10.766 39.277 72.869  1.00 52.79 ? 95   GLN B CD  1 
ATOM   2046  O  OE1 . GLN B  1 95  ? 9.794  38.520 72.798  1.00 50.46 ? 95   GLN B OE1 1 
ATOM   2047  N  NE2 . GLN B  1 95  ? 11.530 39.566 71.819  1.00 51.05 ? 95   GLN B NE2 1 
ATOM   2048  N  N   . ALA B  1 96  ? 8.296  41.066 77.582  1.00 56.41 ? 96   ALA B N   1 
ATOM   2049  C  CA  . ALA B  1 96  ? 7.109  41.665 78.195  1.00 55.85 ? 96   ALA B CA  1 
ATOM   2050  C  C   . ALA B  1 96  ? 7.494  42.780 79.164  1.00 56.54 ? 96   ALA B C   1 
ATOM   2051  O  O   . ALA B  1 96  ? 6.654  43.579 79.578  1.00 57.67 ? 96   ALA B O   1 
ATOM   2052  C  CB  . ALA B  1 96  ? 6.304  40.601 78.919  1.00 54.12 ? 96   ALA B CB  1 
ATOM   2053  N  N   . GLY B  1 97  ? 8.772  42.825 79.520  1.00 56.19 ? 97   GLY B N   1 
ATOM   2054  C  CA  . GLY B  1 97  ? 9.250  43.849 80.423  1.00 57.26 ? 97   GLY B CA  1 
ATOM   2055  C  C   . GLY B  1 97  ? 9.671  45.101 79.678  1.00 58.78 ? 97   GLY B C   1 
ATOM   2056  O  O   . GLY B  1 97  ? 9.310  46.209 80.078  1.00 62.38 ? 97   GLY B O   1 
ATOM   2057  N  N   . LEU B  1 98  ? 10.433 44.928 78.597  1.00 57.11 ? 98   LEU B N   1 
ATOM   2058  C  CA  . LEU B  1 98  ? 10.910 46.053 77.797  1.00 54.40 ? 98   LEU B CA  1 
ATOM   2059  C  C   . LEU B  1 98  ? 9.954  47.231 77.810  1.00 52.56 ? 98   LEU B C   1 
ATOM   2060  O  O   . LEU B  1 98  ? 10.322 48.325 78.228  1.00 51.33 ? 98   LEU B O   1 
ATOM   2061  C  CB  . LEU B  1 98  ? 11.173 45.627 76.352  1.00 55.65 ? 98   LEU B CB  1 
ATOM   2062  C  CG  . LEU B  1 98  ? 12.447 44.822 76.079  1.00 58.40 ? 98   LEU B CG  1 
ATOM   2063  C  CD1 . LEU B  1 98  ? 12.553 44.561 74.582  1.00 58.24 ? 98   LEU B CD1 1 
ATOM   2064  C  CD2 . LEU B  1 98  ? 13.673 45.582 76.578  1.00 54.36 ? 98   LEU B CD2 1 
ATOM   2065  N  N   . PRO B  1 99  ? 8.712  47.028 77.349  1.00 53.06 ? 99   PRO B N   1 
ATOM   2066  C  CA  . PRO B  1 99  ? 7.763  48.140 77.352  1.00 53.49 ? 99   PRO B CA  1 
ATOM   2067  C  C   . PRO B  1 99  ? 7.782  48.895 78.676  1.00 53.30 ? 99   PRO B C   1 
ATOM   2068  O  O   . PRO B  1 99  ? 8.036  50.104 78.701  1.00 54.72 ? 99   PRO B O   1 
ATOM   2069  C  CB  . PRO B  1 99  ? 6.430  47.447 77.090  1.00 52.91 ? 99   PRO B CB  1 
ATOM   2070  C  CG  . PRO B  1 99  ? 6.829  46.370 76.132  1.00 53.59 ? 99   PRO B CG  1 
ATOM   2071  C  CD  . PRO B  1 99  ? 8.095  45.820 76.770  1.00 54.96 ? 99   PRO B CD  1 
ATOM   2072  N  N   . ASP B  1 100 ? 7.531  48.183 79.774  1.00 51.20 ? 100  ASP B N   1 
ATOM   2073  C  CA  . ASP B  1 100 ? 7.520  48.815 81.088  1.00 49.00 ? 100  ASP B CA  1 
ATOM   2074  C  C   . ASP B  1 100 ? 8.731  49.706 81.306  1.00 45.94 ? 100  ASP B C   1 
ATOM   2075  O  O   . ASP B  1 100 ? 8.578  50.873 81.665  1.00 45.92 ? 100  ASP B O   1 
ATOM   2076  C  CB  . ASP B  1 100 ? 7.428  47.767 82.197  1.00 52.22 ? 100  ASP B CB  1 
ATOM   2077  C  CG  . ASP B  1 100 ? 6.036  47.166 82.309  1.00 56.74 ? 100  ASP B CG  1 
ATOM   2078  O  OD1 . ASP B  1 100 ? 5.705  46.614 83.383  1.00 58.09 ? 100  ASP B OD1 1 
ATOM   2079  O  OD2 . ASP B  1 100 ? 5.272  47.244 81.318  1.00 60.44 ? 100  ASP B OD2 1 
ATOM   2080  N  N   . LEU B  1 101 ? 9.928  49.167 81.083  1.00 40.34 ? 101  LEU B N   1 
ATOM   2081  C  CA  . LEU B  1 101 ? 11.144 49.956 81.248  1.00 37.54 ? 101  LEU B CA  1 
ATOM   2082  C  C   . LEU B  1 101 ? 11.120 51.168 80.312  1.00 36.47 ? 101  LEU B C   1 
ATOM   2083  O  O   . LEU B  1 101 ? 11.346 52.306 80.732  1.00 34.39 ? 101  LEU B O   1 
ATOM   2084  C  CB  . LEU B  1 101 ? 12.375 49.095 80.957  1.00 36.84 ? 101  LEU B CB  1 
ATOM   2085  C  CG  . LEU B  1 101 ? 12.981 48.358 82.155  1.00 36.29 ? 101  LEU B CG  1 
ATOM   2086  C  CD1 . LEU B  1 101 ? 13.955 47.291 81.689  1.00 33.11 ? 101  LEU B CD1 1 
ATOM   2087  C  CD2 . LEU B  1 101 ? 13.674 49.364 83.058  1.00 35.37 ? 101  LEU B CD2 1 
ATOM   2088  N  N   . LYS B  1 102 ? 10.853 50.912 79.035  1.00 36.08 ? 102  LYS B N   1 
ATOM   2089  C  CA  . LYS B  1 102 ? 10.782 51.973 78.040  1.00 33.27 ? 102  LYS B CA  1 
ATOM   2090  C  C   . LYS B  1 102 ? 9.753  53.004 78.492  1.00 33.30 ? 102  LYS B C   1 
ATOM   2091  O  O   . LYS B  1 102 ? 9.998  54.212 78.426  1.00 32.35 ? 102  LYS B O   1 
ATOM   2092  C  CB  . LYS B  1 102 ? 10.382 51.388 76.680  1.00 31.13 ? 102  LYS B CB  1 
ATOM   2093  C  CG  . LYS B  1 102 ? 11.559 50.957 75.805  1.00 30.52 ? 102  LYS B CG  1 
ATOM   2094  C  CD  . LYS B  1 102 ? 11.141 49.925 74.748  1.00 29.90 ? 102  LYS B CD  1 
ATOM   2095  C  CE  . LYS B  1 102 ? 12.139 49.846 73.597  1.00 26.44 ? 102  LYS B CE  1 
ATOM   2096  N  NZ  . LYS B  1 102 ? 13.552 49.753 74.051  1.00 25.78 ? 102  LYS B NZ  1 
ATOM   2097  N  N   . ALA B  1 103 ? 8.610  52.511 78.969  1.00 31.90 ? 103  ALA B N   1 
ATOM   2098  C  CA  . ALA B  1 103 ? 7.524  53.372 79.425  1.00 31.31 ? 103  ALA B CA  1 
ATOM   2099  C  C   . ALA B  1 103 ? 7.912  54.165 80.658  1.00 32.23 ? 103  ALA B C   1 
ATOM   2100  O  O   . ALA B  1 103 ? 7.456  55.295 80.836  1.00 35.97 ? 103  ALA B O   1 
ATOM   2101  C  CB  . ALA B  1 103 ? 6.286  52.540 79.718  1.00 27.92 ? 103  ALA B CB  1 
ATOM   2102  N  N   . ALA B  1 104 ? 8.756  53.565 81.500  1.00 30.42 ? 104  ALA B N   1 
ATOM   2103  C  CA  . ALA B  1 104 ? 9.218  54.187 82.741  1.00 26.34 ? 104  ALA B CA  1 
ATOM   2104  C  C   . ALA B  1 104 ? 10.278 55.248 82.467  1.00 26.33 ? 104  ALA B C   1 
ATOM   2105  O  O   . ALA B  1 104 ? 10.315 56.290 83.125  1.00 24.98 ? 104  ALA B O   1 
ATOM   2106  C  CB  . ALA B  1 104 ? 9.763  53.123 83.673  1.00 23.55 ? 104  ALA B CB  1 
ATOM   2107  N  N   . ILE B  1 105 ? 11.142 54.985 81.492  1.00 27.86 ? 105  ILE B N   1 
ATOM   2108  C  CA  . ILE B  1 105 ? 12.172 55.949 81.121  1.00 27.84 ? 105  ILE B CA  1 
ATOM   2109  C  C   . ILE B  1 105 ? 11.496 57.192 80.535  1.00 30.78 ? 105  ILE B C   1 
ATOM   2110  O  O   . ILE B  1 105 ? 11.881 58.324 80.845  1.00 33.15 ? 105  ILE B O   1 
ATOM   2111  C  CB  . ILE B  1 105 ? 13.151 55.355 80.086  1.00 27.54 ? 105  ILE B CB  1 
ATOM   2112  C  CG1 . ILE B  1 105 ? 14.022 54.297 80.761  1.00 28.78 ? 105  ILE B CG1 1 
ATOM   2113  C  CG2 . ILE B  1 105 ? 14.013 56.450 79.482  1.00 27.55 ? 105  ILE B CG2 1 
ATOM   2114  C  CD1 . ILE B  1 105 ? 15.218 53.872 79.949  1.00 33.09 ? 105  ILE B CD1 1 
ATOM   2115  N  N   . ALA B  1 106 ? 10.486 56.991 79.690  1.00 29.21 ? 106  ALA B N   1 
ATOM   2116  C  CA  . ALA B  1 106 ? 9.785  58.135 79.114  1.00 28.98 ? 106  ALA B CA  1 
ATOM   2117  C  C   . ALA B  1 106 ? 9.142  58.951 80.235  1.00 28.17 ? 106  ALA B C   1 
ATOM   2118  O  O   . ALA B  1 106 ? 9.168  60.178 80.212  1.00 27.42 ? 106  ALA B O   1 
ATOM   2119  C  CB  . ALA B  1 106 ? 8.716  57.672 78.121  1.00 23.74 ? 106  ALA B CB  1 
ATOM   2120  N  N   . TYR B  1 107 ? 8.579  58.267 81.228  1.00 30.87 ? 107  TYR B N   1 
ATOM   2121  C  CA  . TYR B  1 107 ? 7.927  58.962 82.330  1.00 32.05 ? 107  TYR B CA  1 
ATOM   2122  C  C   . TYR B  1 107 ? 8.915  59.777 83.154  1.00 32.94 ? 107  TYR B C   1 
ATOM   2123  O  O   . TYR B  1 107 ? 8.649  60.931 83.506  1.00 32.11 ? 107  TYR B O   1 
ATOM   2124  C  CB  . TYR B  1 107 ? 7.207  57.982 83.256  1.00 36.09 ? 107  TYR B CB  1 
ATOM   2125  C  CG  . TYR B  1 107 ? 6.326  58.719 84.227  1.00 41.30 ? 107  TYR B CG  1 
ATOM   2126  C  CD1 . TYR B  1 107 ? 5.084  59.200 83.829  1.00 43.06 ? 107  TYR B CD1 1 
ATOM   2127  C  CD2 . TYR B  1 107 ? 6.789  59.064 85.497  1.00 46.02 ? 107  TYR B CD2 1 
ATOM   2128  C  CE1 . TYR B  1 107 ? 4.324  60.016 84.660  1.00 48.01 ? 107  TYR B CE1 1 
ATOM   2129  C  CE2 . TYR B  1 107 ? 6.039  59.886 86.342  1.00 50.21 ? 107  TYR B CE2 1 
ATOM   2130  C  CZ  . TYR B  1 107 ? 4.804  60.360 85.912  1.00 51.48 ? 107  TYR B CZ  1 
ATOM   2131  O  OH  . TYR B  1 107 ? 4.046  61.174 86.728  1.00 55.12 ? 107  TYR B OH  1 
ATOM   2132  N  N   . CYS B  1 108 ? 10.056 59.177 83.469  1.00 32.01 ? 108  CYS B N   1 
ATOM   2133  C  CA  . CYS B  1 108 ? 11.058 59.878 84.253  1.00 32.59 ? 108  CYS B CA  1 
ATOM   2134  C  C   . CYS B  1 108 ? 11.469 61.151 83.531  1.00 32.74 ? 108  CYS B C   1 
ATOM   2135  O  O   . CYS B  1 108 ? 11.637 62.199 84.157  1.00 33.37 ? 108  CYS B O   1 
ATOM   2136  C  CB  . CYS B  1 108 ? 12.264 58.969 84.498  1.00 34.17 ? 108  CYS B CB  1 
ATOM   2137  S  SG  . CYS B  1 108 ? 11.858 57.528 85.536  1.00 37.00 ? 108  CYS B SG  1 
ATOM   2138  N  N   . GLU B  1 109 ? 11.618 61.059 82.212  1.00 33.59 ? 109  GLU B N   1 
ATOM   2139  C  CA  . GLU B  1 109 ? 11.986 62.214 81.391  1.00 33.65 ? 109  GLU B CA  1 
ATOM   2140  C  C   . GLU B  1 109 ? 10.949 63.317 81.517  1.00 33.88 ? 109  GLU B C   1 
ATOM   2141  O  O   . GLU B  1 109 ? 11.290 64.481 81.718  1.00 35.00 ? 109  GLU B O   1 
ATOM   2142  C  CB  . GLU B  1 109 ? 12.063 61.833 79.913  1.00 33.85 ? 109  GLU B CB  1 
ATOM   2143  C  CG  . GLU B  1 109 ? 13.458 61.655 79.356  1.00 37.55 ? 109  GLU B CG  1 
ATOM   2144  C  CD  . GLU B  1 109 ? 14.275 62.936 79.338  1.00 37.63 ? 109  GLU B CD  1 
ATOM   2145  O  OE1 . GLU B  1 109 ? 13.759 63.985 78.889  1.00 38.76 ? 109  GLU B OE1 1 
ATOM   2146  O  OE2 . GLU B  1 109 ? 15.448 62.883 79.757  1.00 37.32 ? 109  GLU B OE2 1 
ATOM   2147  N  N   . SER B  1 110 ? 9.679  62.948 81.396  1.00 31.42 ? 110  SER B N   1 
ATOM   2148  C  CA  . SER B  1 110 ? 8.619  63.938 81.458  1.00 33.70 ? 110  SER B CA  1 
ATOM   2149  C  C   . SER B  1 110 ? 8.518  64.665 82.788  1.00 31.36 ? 110  SER B C   1 
ATOM   2150  O  O   . SER B  1 110 ? 8.063  65.806 82.825  1.00 31.36 ? 110  SER B O   1 
ATOM   2151  C  CB  . SER B  1 110 ? 7.270  63.302 81.108  1.00 35.96 ? 110  SER B CB  1 
ATOM   2152  O  OG  . SER B  1 110 ? 6.892  62.339 82.074  1.00 45.05 ? 110  SER B OG  1 
ATOM   2153  N  N   . VAL B  1 111 ? 8.941  64.031 83.878  1.00 32.22 ? 111  VAL B N   1 
ATOM   2154  C  CA  . VAL B  1 111 ? 8.857  64.691 85.185  1.00 31.69 ? 111  VAL B CA  1 
ATOM   2155  C  C   . VAL B  1 111 ? 10.205 65.093 85.767  1.00 31.41 ? 111  VAL B C   1 
ATOM   2156  O  O   . VAL B  1 111 ? 10.292 65.420 86.948  1.00 36.11 ? 111  VAL B O   1 
ATOM   2157  C  CB  . VAL B  1 111 ? 8.136  63.823 86.239  1.00 29.02 ? 111  VAL B CB  1 
ATOM   2158  C  CG1 . VAL B  1 111 ? 6.878  63.211 85.649  1.00 31.96 ? 111  VAL B CG1 1 
ATOM   2159  C  CG2 . VAL B  1 111 ? 9.072  62.757 86.753  1.00 33.78 ? 111  VAL B CG2 1 
ATOM   2160  N  N   . GLY B  1 112 ? 11.255 65.052 84.957  1.00 31.72 ? 112  GLY B N   1 
ATOM   2161  C  CA  . GLY B  1 112 ? 12.568 65.454 85.438  1.00 33.01 ? 112  GLY B CA  1 
ATOM   2162  C  C   . GLY B  1 112 ? 13.397 64.526 86.323  1.00 34.19 ? 112  GLY B C   1 
ATOM   2163  O  O   . GLY B  1 112 ? 14.431 64.962 86.850  1.00 31.82 ? 112  GLY B O   1 
ATOM   2164  N  N   . ASP B  1 113 ? 12.976 63.270 86.508  1.00 34.11 ? 113  ASP B N   1 
ATOM   2165  C  CA  . ASP B  1 113 ? 13.763 62.350 87.337  1.00 32.34 ? 113  ASP B CA  1 
ATOM   2166  C  C   . ASP B  1 113 ? 14.858 61.709 86.486  1.00 31.14 ? 113  ASP B C   1 
ATOM   2167  O  O   . ASP B  1 113 ? 14.847 60.505 86.214  1.00 31.07 ? 113  ASP B O   1 
ATOM   2168  C  CB  . ASP B  1 113 ? 12.896 61.251 87.950  1.00 31.18 ? 113  ASP B CB  1 
ATOM   2169  C  CG  . ASP B  1 113 ? 13.582 60.577 89.134  1.00 34.53 ? 113  ASP B CG  1 
ATOM   2170  O  OD1 . ASP B  1 113 ? 14.809 60.351 89.065  1.00 38.08 ? 113  ASP B OD1 1 
ATOM   2171  O  OD2 . ASP B  1 113 ? 12.909 60.276 90.138  1.00 38.73 ? 113  ASP B OD2 1 
ATOM   2172  N  N   . TYR B  1 114 ? 15.807 62.532 86.067  1.00 28.93 ? 114  TYR B N   1 
ATOM   2173  C  CA  . TYR B  1 114 ? 16.894 62.074 85.229  1.00 28.96 ? 114  TYR B CA  1 
ATOM   2174  C  C   . TYR B  1 114 ? 17.716 60.946 85.842  1.00 27.57 ? 114  TYR B C   1 
ATOM   2175  O  O   . TYR B  1 114 ? 18.112 60.018 85.136  1.00 28.49 ? 114  TYR B O   1 
ATOM   2176  C  CB  . TYR B  1 114 ? 17.783 63.271 84.866  1.00 30.47 ? 114  TYR B CB  1 
ATOM   2177  C  CG  . TYR B  1 114 ? 17.010 64.381 84.176  1.00 32.41 ? 114  TYR B CG  1 
ATOM   2178  C  CD1 . TYR B  1 114 ? 16.372 64.155 82.950  1.00 32.01 ? 114  TYR B CD1 1 
ATOM   2179  C  CD2 . TYR B  1 114 ? 16.886 65.647 84.760  1.00 31.17 ? 114  TYR B CD2 1 
ATOM   2180  C  CE1 . TYR B  1 114 ? 15.626 65.162 82.320  1.00 31.47 ? 114  TYR B CE1 1 
ATOM   2181  C  CE2 . TYR B  1 114 ? 16.144 66.661 84.140  1.00 30.33 ? 114  TYR B CE2 1 
ATOM   2182  C  CZ  . TYR B  1 114 ? 15.518 66.410 82.917  1.00 31.26 ? 114  TYR B CZ  1 
ATOM   2183  O  OH  . TYR B  1 114 ? 14.820 67.408 82.276  1.00 26.48 ? 114  TYR B OH  1 
ATOM   2184  N  N   . ALA B  1 115 ? 17.973 61.013 87.145  1.00 25.99 ? 115  ALA B N   1 
ATOM   2185  C  CA  . ALA B  1 115 ? 18.755 59.966 87.800  1.00 26.18 ? 115  ALA B CA  1 
ATOM   2186  C  C   . ALA B  1 115 ? 18.033 58.622 87.720  1.00 26.50 ? 115  ALA B C   1 
ATOM   2187  O  O   . ALA B  1 115 ? 18.646 57.603 87.419  1.00 27.74 ? 115  ALA B O   1 
ATOM   2188  C  CB  . ALA B  1 115 ? 19.028 60.333 89.254  1.00 25.84 ? 115  ALA B CB  1 
ATOM   2189  N  N   . SER B  1 116 ? 16.733 58.608 87.989  1.00 25.80 ? 116  SER B N   1 
ATOM   2190  C  CA  . SER B  1 116 ? 15.991 57.361 87.907  1.00 25.68 ? 116  SER B CA  1 
ATOM   2191  C  C   . SER B  1 116 ? 16.049 56.874 86.469  1.00 27.10 ? 116  SER B C   1 
ATOM   2192  O  O   . SER B  1 116 ? 16.133 55.667 86.211  1.00 27.03 ? 116  SER B O   1 
ATOM   2193  C  CB  . SER B  1 116 ? 14.535 57.557 88.334  1.00 26.04 ? 116  SER B CB  1 
ATOM   2194  O  OG  . SER B  1 116 ? 14.448 57.866 89.718  1.00 28.72 ? 116  SER B OG  1 
ATOM   2195  N  N   . ARG B  1 117 ? 16.016 57.812 85.526  1.00 27.42 ? 117  ARG B N   1 
ATOM   2196  C  CA  . ARG B  1 117 ? 16.081 57.438 84.121  1.00 28.79 ? 117  ARG B CA  1 
ATOM   2197  C  C   . ARG B  1 117 ? 17.356 56.669 83.790  1.00 28.80 ? 117  ARG B C   1 
ATOM   2198  O  O   . ARG B  1 117 ? 17.299 55.573 83.243  1.00 27.54 ? 117  ARG B O   1 
ATOM   2199  C  CB  . ARG B  1 117 ? 16.004 58.661 83.196  1.00 31.43 ? 117  ARG B CB  1 
ATOM   2200  C  CG  . ARG B  1 117 ? 16.213 58.237 81.749  1.00 29.83 ? 117  ARG B CG  1 
ATOM   2201  C  CD  . ARG B  1 117 ? 16.177 59.329 80.710  1.00 29.68 ? 117  ARG B CD  1 
ATOM   2202  N  NE  . ARG B  1 117 ? 16.617 58.732 79.451  1.00 34.47 ? 117  ARG B NE  1 
ATOM   2203  C  CZ  . ARG B  1 117 ? 16.248 59.125 78.236  1.00 33.07 ? 117  ARG B CZ  1 
ATOM   2204  N  NH1 . ARG B  1 117 ? 15.414 60.143 78.081  1.00 32.15 ? 117  ARG B NH1 1 
ATOM   2205  N  NH2 . ARG B  1 117 ? 16.708 58.479 77.171  1.00 33.76 ? 117  ARG B NH2 1 
ATOM   2206  N  N   . GLU B  1 118 ? 18.507 57.253 84.110  1.00 32.15 ? 118  GLU B N   1 
ATOM   2207  C  CA  . GLU B  1 118 ? 19.778 56.602 83.821  1.00 36.31 ? 118  GLU B CA  1 
ATOM   2208  C  C   . GLU B  1 118 ? 19.870 55.251 84.508  1.00 35.55 ? 118  GLU B C   1 
ATOM   2209  O  O   . GLU B  1 118 ? 20.473 54.314 83.990  1.00 37.03 ? 118  GLU B O   1 
ATOM   2210  C  CB  . GLU B  1 118 ? 20.961 57.493 84.233  1.00 40.55 ? 118  GLU B CB  1 
ATOM   2211  C  CG  . GLU B  1 118 ? 21.234 58.640 83.255  1.00 52.81 ? 118  GLU B CG  1 
ATOM   2212  C  CD  . GLU B  1 118 ? 21.415 58.166 81.804  1.00 61.25 ? 118  GLU B CD  1 
ATOM   2213  O  OE1 . GLU B  1 118 ? 22.360 57.385 81.541  1.00 67.19 ? 118  GLU B OE1 1 
ATOM   2214  O  OE2 . GLU B  1 118 ? 20.614 58.570 80.924  1.00 62.85 ? 118  GLU B OE2 1 
ATOM   2215  N  N   . LEU B  1 119 ? 19.264 55.137 85.677  1.00 34.73 ? 119  LEU B N   1 
ATOM   2216  C  CA  . LEU B  1 119 ? 19.301 53.868 86.376  1.00 33.95 ? 119  LEU B CA  1 
ATOM   2217  C  C   . LEU B  1 119 ? 18.500 52.845 85.565  1.00 32.78 ? 119  LEU B C   1 
ATOM   2218  O  O   . LEU B  1 119 ? 18.940 51.715 85.358  1.00 29.88 ? 119  LEU B O   1 
ATOM   2219  C  CB  . LEU B  1 119 ? 18.725 54.042 87.778  1.00 33.39 ? 119  LEU B CB  1 
ATOM   2220  C  CG  . LEU B  1 119 ? 18.638 52.814 88.678  1.00 33.30 ? 119  LEU B CG  1 
ATOM   2221  C  CD1 . LEU B  1 119 ? 18.371 53.293 90.094  1.00 37.37 ? 119  LEU B CD1 1 
ATOM   2222  C  CD2 . LEU B  1 119 ? 17.541 51.878 88.208  1.00 28.25 ? 119  LEU B CD2 1 
ATOM   2223  N  N   . LEU B  1 120 ? 17.323 53.246 85.100  1.00 32.60 ? 120  LEU B N   1 
ATOM   2224  C  CA  . LEU B  1 120 ? 16.502 52.346 84.312  1.00 33.36 ? 120  LEU B CA  1 
ATOM   2225  C  C   . LEU B  1 120 ? 17.219 52.050 83.015  1.00 36.72 ? 120  LEU B C   1 
ATOM   2226  O  O   . LEU B  1 120 ? 17.258 50.903 82.566  1.00 38.43 ? 120  LEU B O   1 
ATOM   2227  C  CB  . LEU B  1 120 ? 15.152 52.977 83.994  1.00 31.57 ? 120  LEU B CB  1 
ATOM   2228  C  CG  . LEU B  1 120 ? 14.201 53.233 85.157  1.00 30.30 ? 120  LEU B CG  1 
ATOM   2229  C  CD1 . LEU B  1 120 ? 12.984 53.941 84.617  1.00 28.76 ? 120  LEU B CD1 1 
ATOM   2230  C  CD2 . LEU B  1 120 ? 13.820 51.924 85.845  1.00 26.07 ? 120  LEU B CD2 1 
ATOM   2231  N  N   . GLU B  1 121 ? 17.787 53.095 82.417  1.00 38.42 ? 121  GLU B N   1 
ATOM   2232  C  CA  . GLU B  1 121 ? 18.497 52.962 81.157  1.00 39.27 ? 121  GLU B CA  1 
ATOM   2233  C  C   . GLU B  1 121 ? 19.463 51.779 81.241  1.00 38.40 ? 121  GLU B C   1 
ATOM   2234  O  O   . GLU B  1 121 ? 19.521 50.945 80.334  1.00 33.20 ? 121  GLU B O   1 
ATOM   2235  C  CB  . GLU B  1 121 ? 19.266 54.249 80.846  1.00 44.72 ? 121  GLU B CB  1 
ATOM   2236  C  CG  . GLU B  1 121 ? 19.370 54.590 79.357  1.00 55.60 ? 121  GLU B CG  1 
ATOM   2237  C  CD  . GLU B  1 121 ? 19.521 53.355 78.465  1.00 63.45 ? 121  GLU B CD  1 
ATOM   2238  O  OE1 . GLU B  1 121 ? 18.525 52.616 78.299  1.00 69.12 ? 121  GLU B OE1 1 
ATOM   2239  O  OE2 . GLU B  1 121 ? 20.627 53.110 77.932  1.00 64.41 ? 121  GLU B OE2 1 
ATOM   2240  N  N   . ASP B  1 122 ? 20.204 51.698 82.342  1.00 40.17 ? 122  ASP B N   1 
ATOM   2241  C  CA  . ASP B  1 122 ? 21.164 50.612 82.530  1.00 42.67 ? 122  ASP B CA  1 
ATOM   2242  C  C   . ASP B  1 122 ? 20.496 49.244 82.555  1.00 39.10 ? 122  ASP B C   1 
ATOM   2243  O  O   . ASP B  1 122 ? 20.902 48.344 81.824  1.00 38.69 ? 122  ASP B O   1 
ATOM   2244  C  CB  . ASP B  1 122 ? 21.976 50.816 83.814  1.00 48.69 ? 122  ASP B CB  1 
ATOM   2245  C  CG  . ASP B  1 122 ? 22.862 52.057 83.756  1.00 58.16 ? 122  ASP B CG  1 
ATOM   2246  O  OD1 . ASP B  1 122 ? 23.472 52.315 82.689  1.00 62.86 ? 122  ASP B OD1 1 
ATOM   2247  O  OD2 . ASP B  1 122 ? 22.959 52.770 84.784  1.00 64.18 ? 122  ASP B OD2 1 
ATOM   2248  N  N   . ILE B  1 123 ? 19.475 49.076 83.386  1.00 35.54 ? 123  ILE B N   1 
ATOM   2249  C  CA  . ILE B  1 123 ? 18.787 47.792 83.430  1.00 33.50 ? 123  ILE B CA  1 
ATOM   2250  C  C   . ILE B  1 123 ? 18.300 47.468 82.019  1.00 30.42 ? 123  ILE B C   1 
ATOM   2251  O  O   . ILE B  1 123 ? 18.328 46.323 81.597  1.00 28.14 ? 123  ILE B O   1 
ATOM   2252  C  CB  . ILE B  1 123 ? 17.586 47.824 84.411  1.00 34.39 ? 123  ILE B CB  1 
ATOM   2253  C  CG1 . ILE B  1 123 ? 18.097 47.995 85.846  1.00 29.50 ? 123  ILE B CG1 1 
ATOM   2254  C  CG2 . ILE B  1 123 ? 16.766 46.534 84.291  1.00 35.07 ? 123  ILE B CG2 1 
ATOM   2255  C  CD1 . ILE B  1 123 ? 17.012 47.988 86.875  1.00 25.44 ? 123  ILE B CD1 1 
ATOM   2256  N  N   . LEU B  1 124 ? 17.886 48.498 81.290  1.00 32.29 ? 124  LEU B N   1 
ATOM   2257  C  CA  . LEU B  1 124 ? 17.398 48.349 79.919  1.00 33.90 ? 124  LEU B CA  1 
ATOM   2258  C  C   . LEU B  1 124 ? 18.431 47.777 78.949  1.00 35.65 ? 124  LEU B C   1 
ATOM   2259  O  O   . LEU B  1 124 ? 18.116 46.907 78.133  1.00 36.38 ? 124  LEU B O   1 
ATOM   2260  C  CB  . LEU B  1 124 ? 16.913 49.697 79.381  1.00 33.55 ? 124  LEU B CB  1 
ATOM   2261  C  CG  . LEU B  1 124 ? 16.508 49.700 77.905  1.00 34.12 ? 124  LEU B CG  1 
ATOM   2262  C  CD1 . LEU B  1 124 ? 15.522 48.578 77.648  1.00 35.58 ? 124  LEU B CD1 1 
ATOM   2263  C  CD2 . LEU B  1 124 ? 15.897 51.037 77.540  1.00 34.57 ? 124  LEU B CD2 1 
ATOM   2264  N  N   . GLU B  1 125 ? 19.659 48.271 79.018  1.00 36.60 ? 125  GLU B N   1 
ATOM   2265  C  CA  . GLU B  1 125 ? 20.687 47.770 78.123  1.00 40.55 ? 125  GLU B CA  1 
ATOM   2266  C  C   . GLU B  1 125 ? 20.955 46.317 78.473  1.00 40.70 ? 125  GLU B C   1 
ATOM   2267  O  O   . GLU B  1 125 ? 21.085 45.466 77.597  1.00 43.10 ? 125  GLU B O   1 
ATOM   2268  C  CB  . GLU B  1 125 ? 21.957 48.611 78.251  1.00 44.42 ? 125  GLU B CB  1 
ATOM   2269  C  CG  . GLU B  1 125 ? 21.698 50.099 78.005  1.00 54.85 ? 125  GLU B CG  1 
ATOM   2270  C  CD  . GLU B  1 125 ? 22.968 50.928 77.919  1.00 60.79 ? 125  GLU B CD  1 
ATOM   2271  O  OE1 . GLU B  1 125 ? 23.722 50.752 76.935  1.00 64.20 ? 125  GLU B OE1 1 
ATOM   2272  O  OE2 . GLU B  1 125 ? 23.210 51.753 78.834  1.00 64.85 ? 125  GLU B OE2 1 
ATOM   2273  N  N   . SER B  1 126 ? 21.002 46.029 79.765  1.00 40.72 ? 126  SER B N   1 
ATOM   2274  C  CA  . SER B  1 126 ? 21.249 44.676 80.228  1.00 39.90 ? 126  SER B CA  1 
ATOM   2275  C  C   . SER B  1 126 ? 20.167 43.727 79.713  1.00 40.56 ? 126  SER B C   1 
ATOM   2276  O  O   . SER B  1 126 ? 20.463 42.640 79.211  1.00 39.81 ? 126  SER B O   1 
ATOM   2277  C  CB  . SER B  1 126 ? 21.295 44.658 81.760  1.00 39.48 ? 126  SER B CB  1 
ATOM   2278  O  OG  . SER B  1 126 ? 21.578 43.361 82.256  1.00 43.99 ? 126  SER B OG  1 
ATOM   2279  N  N   . GLU B  1 127 ? 18.911 44.145 79.827  1.00 42.04 ? 127  GLU B N   1 
ATOM   2280  C  CA  . GLU B  1 127 ? 17.790 43.321 79.380  1.00 44.35 ? 127  GLU B CA  1 
ATOM   2281  C  C   . GLU B  1 127 ? 17.899 42.991 77.897  1.00 43.98 ? 127  GLU B C   1 
ATOM   2282  O  O   . GLU B  1 127 ? 17.511 41.901 77.480  1.00 43.38 ? 127  GLU B O   1 
ATOM   2283  C  CB  . GLU B  1 127 ? 16.460 44.023 79.660  1.00 45.96 ? 127  GLU B CB  1 
ATOM   2284  C  CG  . GLU B  1 127 ? 16.298 44.453 81.109  1.00 57.65 ? 127  GLU B CG  1 
ATOM   2285  C  CD  . GLU B  1 127 ? 16.397 43.290 82.084  1.00 65.59 ? 127  GLU B CD  1 
ATOM   2286  O  OE1 . GLU B  1 127 ? 16.546 42.136 81.628  1.00 71.12 ? 127  GLU B OE1 1 
ATOM   2287  O  OE2 . GLU B  1 127 ? 16.336 43.526 83.308  1.00 68.95 ? 127  GLU B OE2 1 
ATOM   2288  N  N   . GLU B  1 128 ? 18.407 43.921 77.090  1.00 44.04 ? 128  GLU B N   1 
ATOM   2289  C  CA  . GLU B  1 128 ? 18.544 43.647 75.663  1.00 43.48 ? 128  GLU B CA  1 
ATOM   2290  C  C   . GLU B  1 128 ? 19.627 42.597 75.420  1.00 44.46 ? 128  GLU B C   1 
ATOM   2291  O  O   . GLU B  1 128 ? 19.673 41.990 74.358  1.00 43.09 ? 128  GLU B O   1 
ATOM   2292  C  CB  . GLU B  1 128 ? 18.828 44.937 74.879  1.00 42.59 ? 128  GLU B CB  1 
ATOM   2293  C  CG  . GLU B  1 128 ? 17.549 45.617 74.347  1.00 43.31 ? 128  GLU B CG  1 
ATOM   2294  C  CD  . GLU B  1 128 ? 17.802 46.954 73.643  1.00 44.13 ? 128  GLU B CD  1 
ATOM   2295  O  OE1 . GLU B  1 128 ? 18.843 47.093 72.971  1.00 47.25 ? 128  GLU B OE1 1 
ATOM   2296  O  OE2 . GLU B  1 128 ? 16.952 47.867 73.743  1.00 41.57 ? 128  GLU B OE2 1 
ATOM   2297  N  N   . ASP B  1 129 ? 20.483 42.369 76.419  1.00 47.69 ? 129  ASP B N   1 
ATOM   2298  C  CA  . ASP B  1 129 ? 21.535 41.349 76.324  1.00 47.66 ? 129  ASP B CA  1 
ATOM   2299  C  C   . ASP B  1 129 ? 21.047 39.999 76.855  1.00 44.77 ? 129  ASP B C   1 
ATOM   2300  O  O   . ASP B  1 129 ? 21.596 38.953 76.519  1.00 42.16 ? 129  ASP B O   1 
ATOM   2301  C  CB  . ASP B  1 129 ? 22.796 41.804 77.047  1.00 52.46 ? 129  ASP B CB  1 
ATOM   2302  C  CG  . ASP B  1 129 ? 23.629 42.745 76.197  1.00 60.00 ? 129  ASP B CG  1 
ATOM   2303  O  OD1 . ASP B  1 129 ? 24.663 43.238 76.697  1.00 66.58 ? 129  ASP B OD1 1 
ATOM   2304  O  OD2 . ASP B  1 129 ? 23.249 42.990 75.023  1.00 61.36 ? 129  ASP B OD2 1 
ATOM   2305  N  N   . HIS B  1 130 ? 20.035 40.026 77.714  1.00 43.84 ? 130  HIS B N   1 
ATOM   2306  C  CA  . HIS B  1 130 ? 19.419 38.777 78.169  1.00 42.47 ? 130  HIS B CA  1 
ATOM   2307  C  C   . HIS B  1 130 ? 18.640 38.259 76.978  1.00 42.53 ? 130  HIS B C   1 
ATOM   2308  O  O   . HIS B  1 130 ? 18.551 37.055 76.750  1.00 43.94 ? 130  HIS B O   1 
ATOM   2309  C  CB  . HIS B  1 130 ? 18.492 39.004 79.332  1.00 44.77 ? 130  HIS B CB  1 
ATOM   2310  C  CG  . HIS B  1 130 ? 19.227 39.436 80.612  1.00 49.16 ? 130  HIS B CG  1 
ATOM   2311  N  ND1 . HIS B  1 130 ? 18.551 39.890 81.725  1.00 50.29 ? 130  HIS B ND1 1 
ATOM   2312  C  CD2 . HIS B  1 130 ? 20.543 39.473 80.930  1.00 49.63 ? 130  HIS B CD2 1 
ATOM   2313  C  CE1 . HIS B  1 130 ? 19.419 40.184 82.676  1.00 50.15 ? 130  HIS B CE1 1 
ATOM   2314  N  NE2 . HIS B  1 130 ? 20.635 39.941 82.220  1.00 51.18 ? 130  HIS B NE2 1 
ATOM   2315  N  N   . ILE B  1 131 ? 18.054 39.179 76.216  1.00 39.81 ? 131  ILE B N   1 
ATOM   2316  C  CA  . ILE B  1 131 ? 17.265 38.788 75.056  1.00 42.01 ? 131  ILE B CA  1 
ATOM   2317  C  C   . ILE B  1 131 ? 18.110 38.318 73.871  1.00 40.49 ? 131  ILE B C   1 
ATOM   2318  O  O   . ILE B  1 131 ? 17.763 37.340 73.204  1.00 39.36 ? 131  ILE B O   1 
ATOM   2319  C  CB  . ILE B  1 131 ? 16.339 39.940 74.595  1.00 44.70 ? 131  ILE B CB  1 
ATOM   2320  C  CG1 . ILE B  1 131 ? 15.277 40.206 75.671  1.00 45.04 ? 131  ILE B CG1 1 
ATOM   2321  C  CG2 . ILE B  1 131 ? 15.676 39.581 73.260  1.00 45.38 ? 131  ILE B CG2 1 
ATOM   2322  C  CD1 . ILE B  1 131 ? 14.250 41.281 75.312  1.00 45.50 ? 131  ILE B CD1 1 
ATOM   2323  N  N   . ASP B  1 132 ? 19.217 39.007 73.610  1.00 38.76 ? 132  ASP B N   1 
ATOM   2324  C  CA  . ASP B  1 132 ? 20.082 38.629 72.503  1.00 38.63 ? 132  ASP B CA  1 
ATOM   2325  C  C   . ASP B  1 132 ? 20.534 37.183 72.695  1.00 37.21 ? 132  ASP B C   1 
ATOM   2326  O  O   . ASP B  1 132 ? 20.473 36.371 71.768  1.00 35.37 ? 132  ASP B O   1 
ATOM   2327  C  CB  . ASP B  1 132 ? 21.289 39.569 72.437  1.00 40.25 ? 132  ASP B CB  1 
ATOM   2328  C  CG  . ASP B  1 132 ? 22.106 39.395 71.164  1.00 44.50 ? 132  ASP B CG  1 
ATOM   2329  O  OD1 . ASP B  1 132 ? 21.526 39.047 70.110  1.00 44.42 ? 132  ASP B OD1 1 
ATOM   2330  O  OD2 . ASP B  1 132 ? 23.335 39.630 71.213  1.00 49.86 ? 132  ASP B OD2 1 
ATOM   2331  N  N   . TRP B  1 133 ? 20.966 36.862 73.910  1.00 35.12 ? 133  TRP B N   1 
ATOM   2332  C  CA  . TRP B  1 133 ? 21.421 35.514 74.221  1.00 34.78 ? 133  TRP B CA  1 
ATOM   2333  C  C   . TRP B  1 133 ? 20.288 34.512 74.022  1.00 36.71 ? 133  TRP B C   1 
ATOM   2334  O  O   . TRP B  1 133 ? 20.483 33.448 73.424  1.00 40.51 ? 133  TRP B O   1 
ATOM   2335  C  CB  . TRP B  1 133 ? 21.911 35.432 75.668  1.00 31.81 ? 133  TRP B CB  1 
ATOM   2336  C  CG  . TRP B  1 133 ? 22.482 34.093 76.018  1.00 27.17 ? 133  TRP B CG  1 
ATOM   2337  C  CD1 . TRP B  1 133 ? 23.749 33.651 75.768  1.00 24.75 ? 133  TRP B CD1 1 
ATOM   2338  C  CD2 . TRP B  1 133 ? 21.787 32.997 76.622  1.00 25.90 ? 133  TRP B CD2 1 
ATOM   2339  N  NE1 . TRP B  1 133 ? 23.885 32.342 76.175  1.00 23.59 ? 133  TRP B NE1 1 
ATOM   2340  C  CE2 . TRP B  1 133 ? 22.694 31.918 76.703  1.00 23.76 ? 133  TRP B CE2 1 
ATOM   2341  C  CE3 . TRP B  1 133 ? 20.484 32.821 77.103  1.00 28.12 ? 133  TRP B CE3 1 
ATOM   2342  C  CZ2 . TRP B  1 133 ? 22.340 30.681 77.244  1.00 25.03 ? 133  TRP B CZ2 1 
ATOM   2343  C  CZ3 . TRP B  1 133 ? 20.130 31.584 77.645  1.00 28.51 ? 133  TRP B CZ3 1 
ATOM   2344  C  CH2 . TRP B  1 133 ? 21.057 30.533 77.710  1.00 26.53 ? 133  TRP B CH2 1 
ATOM   2345  N  N   . LEU B  1 134 ? 19.104 34.847 74.523  1.00 34.29 ? 134  LEU B N   1 
ATOM   2346  C  CA  . LEU B  1 134 ? 17.972 33.950 74.387  1.00 34.00 ? 134  LEU B CA  1 
ATOM   2347  C  C   . LEU B  1 134 ? 17.589 33.726 72.932  1.00 35.25 ? 134  LEU B C   1 
ATOM   2348  O  O   . LEU B  1 134 ? 17.435 32.582 72.502  1.00 34.82 ? 134  LEU B O   1 
ATOM   2349  C  CB  . LEU B  1 134 ? 16.780 34.480 75.180  1.00 34.28 ? 134  LEU B CB  1 
ATOM   2350  C  CG  . LEU B  1 134 ? 16.981 34.410 76.698  1.00 33.19 ? 134  LEU B CG  1 
ATOM   2351  C  CD1 . LEU B  1 134 ? 15.919 35.237 77.399  1.00 33.10 ? 134  LEU B CD1 1 
ATOM   2352  C  CD2 . LEU B  1 134 ? 16.937 32.959 77.153  1.00 30.72 ? 134  LEU B CD2 1 
ATOM   2353  N  N   . GLU B  1 135 ? 17.442 34.801 72.163  1.00 36.93 ? 135  GLU B N   1 
ATOM   2354  C  CA  . GLU B  1 135 ? 17.079 34.647 70.752  1.00 39.61 ? 135  GLU B CA  1 
ATOM   2355  C  C   . GLU B  1 135 ? 18.151 33.826 70.025  1.00 40.51 ? 135  GLU B C   1 
ATOM   2356  O  O   . GLU B  1 135 ? 17.840 33.022 69.137  1.00 39.66 ? 135  GLU B O   1 
ATOM   2357  C  CB  . GLU B  1 135 ? 16.937 36.011 70.072  1.00 38.14 ? 135  GLU B CB  1 
ATOM   2358  C  CG  . GLU B  1 135 ? 15.950 36.930 70.747  1.00 41.40 ? 135  GLU B CG  1 
ATOM   2359  C  CD  . GLU B  1 135 ? 15.846 38.289 70.074  1.00 41.59 ? 135  GLU B CD  1 
ATOM   2360  O  OE1 . GLU B  1 135 ? 16.900 38.864 69.707  1.00 40.23 ? 135  GLU B OE1 1 
ATOM   2361  O  OE2 . GLU B  1 135 ? 14.704 38.784 69.934  1.00 41.05 ? 135  GLU B OE2 1 
ATOM   2362  N  N   . THR B  1 136 ? 19.410 34.029 70.409  1.00 38.29 ? 136  THR B N   1 
ATOM   2363  C  CA  . THR B  1 136 ? 20.509 33.303 69.792  1.00 37.47 ? 136  THR B CA  1 
ATOM   2364  C  C   . THR B  1 136 ? 20.397 31.814 70.073  1.00 36.65 ? 136  THR B C   1 
ATOM   2365  O  O   . THR B  1 136 ? 20.552 31.000 69.168  1.00 35.14 ? 136  THR B O   1 
ATOM   2366  C  CB  . THR B  1 136 ? 21.872 33.819 70.288  1.00 38.74 ? 136  THR B CB  1 
ATOM   2367  O  OG1 . THR B  1 136 ? 22.102 35.132 69.761  1.00 43.59 ? 136  THR B OG1 1 
ATOM   2368  C  CG2 . THR B  1 136 ? 22.991 32.903 69.833  1.00 35.73 ? 136  THR B CG2 1 
ATOM   2369  N  N   . GLN B  1 137 ? 20.121 31.452 71.320  1.00 35.58 ? 137  GLN B N   1 
ATOM   2370  C  CA  . GLN B  1 137 ? 19.988 30.041 71.652  1.00 34.40 ? 137  GLN B CA  1 
ATOM   2371  C  C   . GLN B  1 137 ? 18.902 29.381 70.800  1.00 33.98 ? 137  GLN B C   1 
ATOM   2372  O  O   . GLN B  1 137 ? 19.113 28.305 70.230  1.00 34.94 ? 137  GLN B O   1 
ATOM   2373  C  CB  . GLN B  1 137 ? 19.664 29.872 73.134  1.00 33.59 ? 137  GLN B CB  1 
ATOM   2374  C  CG  . GLN B  1 137 ? 20.710 30.473 74.047  1.00 37.96 ? 137  GLN B CG  1 
ATOM   2375  C  CD  . GLN B  1 137 ? 22.122 30.098 73.630  1.00 39.47 ? 137  GLN B CD  1 
ATOM   2376  O  OE1 . GLN B  1 137 ? 22.464 28.923 73.545  1.00 40.33 ? 137  GLN B OE1 1 
ATOM   2377  N  NE2 . GLN B  1 137 ? 22.949 31.101 73.368  1.00 41.45 ? 137  GLN B NE2 1 
ATOM   2378  N  N   . LEU B  1 138 ? 17.741 30.024 70.704  1.00 32.70 ? 138  LEU B N   1 
ATOM   2379  C  CA  . LEU B  1 138 ? 16.650 29.466 69.915  1.00 32.40 ? 138  LEU B CA  1 
ATOM   2380  C  C   . LEU B  1 138 ? 17.062 29.268 68.461  1.00 35.80 ? 138  LEU B C   1 
ATOM   2381  O  O   . LEU B  1 138 ? 16.789 28.215 67.883  1.00 36.75 ? 138  LEU B O   1 
ATOM   2382  C  CB  . LEU B  1 138 ? 15.414 30.359 70.008  1.00 27.39 ? 138  LEU B CB  1 
ATOM   2383  C  CG  . LEU B  1 138 ? 14.686 30.277 71.357  1.00 26.54 ? 138  LEU B CG  1 
ATOM   2384  C  CD1 . LEU B  1 138 ? 13.634 31.371 71.467  1.00 21.61 ? 138  LEU B CD1 1 
ATOM   2385  C  CD2 . LEU B  1 138 ? 14.050 28.896 71.500  1.00 21.04 ? 138  LEU B CD2 1 
ATOM   2386  N  N   . ASP B  1 139 ? 17.729 30.265 67.874  1.00 35.62 ? 139  ASP B N   1 
ATOM   2387  C  CA  . ASP B  1 139 ? 18.182 30.160 66.489  1.00 35.28 ? 139  ASP B CA  1 
ATOM   2388  C  C   . ASP B  1 139 ? 19.161 29.010 66.323  1.00 33.86 ? 139  ASP B C   1 
ATOM   2389  O  O   . ASP B  1 139 ? 19.091 28.260 65.351  1.00 36.80 ? 139  ASP B O   1 
ATOM   2390  C  CB  . ASP B  1 139 ? 18.858 31.456 66.035  1.00 44.23 ? 139  ASP B CB  1 
ATOM   2391  C  CG  . ASP B  1 139 ? 17.955 32.316 65.146  1.00 50.82 ? 139  ASP B CG  1 
ATOM   2392  O  OD1 . ASP B  1 139 ? 16.925 32.832 65.647  1.00 48.89 ? 139  ASP B OD1 1 
ATOM   2393  O  OD2 . ASP B  1 139 ? 18.283 32.471 63.942  1.00 53.61 ? 139  ASP B OD2 1 
ATOM   2394  N  N   . LEU B  1 140 ? 20.076 28.882 67.277  1.00 31.62 ? 140  LEU B N   1 
ATOM   2395  C  CA  . LEU B  1 140 ? 21.085 27.830 67.272  1.00 28.98 ? 140  LEU B CA  1 
ATOM   2396  C  C   . LEU B  1 140 ? 20.423 26.452 67.252  1.00 30.92 ? 140  LEU B C   1 
ATOM   2397  O  O   . LEU B  1 140 ? 20.919 25.512 66.623  1.00 29.58 ? 140  LEU B O   1 
ATOM   2398  C  CB  . LEU B  1 140 ? 21.966 27.963 68.513  1.00 27.54 ? 140  LEU B CB  1 
ATOM   2399  C  CG  . LEU B  1 140 ? 23.458 28.266 68.350  1.00 30.82 ? 140  LEU B CG  1 
ATOM   2400  C  CD1 . LEU B  1 140 ? 23.680 29.246 67.216  1.00 28.81 ? 140  LEU B CD1 1 
ATOM   2401  C  CD2 . LEU B  1 140 ? 24.000 28.828 69.671  1.00 27.57 ? 140  LEU B CD2 1 
ATOM   2402  N  N   . ILE B  1 141 ? 19.306 26.323 67.954  1.00 31.06 ? 141  ILE B N   1 
ATOM   2403  C  CA  . ILE B  1 141 ? 18.609 25.052 67.970  1.00 33.54 ? 141  ILE B CA  1 
ATOM   2404  C  C   . ILE B  1 141 ? 18.198 24.700 66.542  1.00 35.54 ? 141  ILE B C   1 
ATOM   2405  O  O   . ILE B  1 141 ? 18.257 23.539 66.136  1.00 38.36 ? 141  ILE B O   1 
ATOM   2406  C  CB  . ILE B  1 141 ? 17.373 25.115 68.883  1.00 32.98 ? 141  ILE B CB  1 
ATOM   2407  C  CG1 . ILE B  1 141 ? 17.824 25.078 70.346  1.00 32.04 ? 141  ILE B CG1 1 
ATOM   2408  C  CG2 . ILE B  1 141 ? 16.417 23.982 68.547  1.00 32.01 ? 141  ILE B CG2 1 
ATOM   2409  C  CD1 . ILE B  1 141 ? 16.693 25.195 71.359  1.00 30.15 ? 141  ILE B CD1 1 
ATOM   2410  N  N   . ASP B  1 142 ? 17.797 25.708 65.777  1.00 38.03 ? 142  ASP B N   1 
ATOM   2411  C  CA  . ASP B  1 142 ? 17.394 25.495 64.391  1.00 41.71 ? 142  ASP B CA  1 
ATOM   2412  C  C   . ASP B  1 142 ? 18.570 25.090 63.522  1.00 41.26 ? 142  ASP B C   1 
ATOM   2413  O  O   . ASP B  1 142 ? 18.531 24.069 62.841  1.00 44.87 ? 142  ASP B O   1 
ATOM   2414  C  CB  . ASP B  1 142 ? 16.786 26.766 63.799  1.00 45.21 ? 142  ASP B CB  1 
ATOM   2415  C  CG  . ASP B  1 142 ? 15.458 27.126 64.427  1.00 50.21 ? 142  ASP B CG  1 
ATOM   2416  O  OD1 . ASP B  1 142 ? 14.580 26.237 64.530  1.00 50.50 ? 142  ASP B OD1 1 
ATOM   2417  O  OD2 . ASP B  1 142 ? 15.289 28.305 64.804  1.00 54.25 ? 142  ASP B OD2 1 
ATOM   2418  N  N   . LYS B  1 143 ? 19.617 25.902 63.559  1.00 39.58 ? 143  LYS B N   1 
ATOM   2419  C  CA  . LYS B  1 143 ? 20.809 25.673 62.756  1.00 36.64 ? 143  LYS B CA  1 
ATOM   2420  C  C   . LYS B  1 143 ? 21.588 24.378 63.003  1.00 35.55 ? 143  LYS B C   1 
ATOM   2421  O  O   . LYS B  1 143 ? 22.330 23.941 62.129  1.00 37.93 ? 143  LYS B O   1 
ATOM   2422  C  CB  . LYS B  1 143 ? 21.749 26.880 62.895  1.00 36.43 ? 143  LYS B CB  1 
ATOM   2423  C  CG  . LYS B  1 143 ? 21.151 28.191 62.372  1.00 35.04 ? 143  LYS B CG  1 
ATOM   2424  C  CD  . LYS B  1 143 ? 22.117 29.360 62.543  1.00 34.57 ? 143  LYS B CD  1 
ATOM   2425  C  CE  . LYS B  1 143 ? 21.562 30.666 61.955  1.00 32.74 ? 143  LYS B CE  1 
ATOM   2426  N  NZ  . LYS B  1 143 ? 20.484 31.300 62.769  1.00 28.72 ? 143  LYS B NZ  1 
ATOM   2427  N  N   . ILE B  1 144 ? 21.439 23.751 64.164  1.00 34.74 ? 144  ILE B N   1 
ATOM   2428  C  CA  . ILE B  1 144 ? 22.194 22.520 64.411  1.00 33.10 ? 144  ILE B CA  1 
ATOM   2429  C  C   . ILE B  1 144 ? 21.368 21.374 64.973  1.00 33.23 ? 144  ILE B C   1 
ATOM   2430  O  O   . ILE B  1 144 ? 21.888 20.270 65.155  1.00 32.26 ? 144  ILE B O   1 
ATOM   2431  C  CB  . ILE B  1 144 ? 23.380 22.750 65.375  1.00 33.06 ? 144  ILE B CB  1 
ATOM   2432  C  CG1 . ILE B  1 144 ? 22.864 23.032 66.793  1.00 33.82 ? 144  ILE B CG1 1 
ATOM   2433  C  CG2 . ILE B  1 144 ? 24.230 23.914 64.879  1.00 34.73 ? 144  ILE B CG2 1 
ATOM   2434  C  CD1 . ILE B  1 144 ? 23.963 23.125 67.857  1.00 29.40 ? 144  ILE B CD1 1 
ATOM   2435  N  N   . GLY B  1 145 ? 20.089 21.626 65.247  1.00 31.24 ? 145  GLY B N   1 
ATOM   2436  C  CA  . GLY B  1 145 ? 19.246 20.574 65.790  1.00 30.21 ? 145  GLY B CA  1 
ATOM   2437  C  C   . GLY B  1 145 ? 19.281 20.452 67.309  1.00 29.42 ? 145  GLY B C   1 
ATOM   2438  O  O   . GLY B  1 145 ? 20.348 20.538 67.939  1.00 25.46 ? 145  GLY B O   1 
ATOM   2439  N  N   . LEU B  1 146 ? 18.105 20.231 67.894  1.00 29.52 ? 146  LEU B N   1 
ATOM   2440  C  CA  . LEU B  1 146 ? 17.965 20.114 69.342  1.00 29.88 ? 146  LEU B CA  1 
ATOM   2441  C  C   . LEU B  1 146 ? 18.973 19.196 70.021  1.00 32.11 ? 146  LEU B C   1 
ATOM   2442  O  O   . LEU B  1 146 ? 19.747 19.653 70.868  1.00 32.05 ? 146  LEU B O   1 
ATOM   2443  C  CB  . LEU B  1 146 ? 16.565 19.648 69.702  1.00 26.42 ? 146  LEU B CB  1 
ATOM   2444  C  CG  . LEU B  1 146 ? 16.291 19.690 71.208  1.00 28.52 ? 146  LEU B CG  1 
ATOM   2445  C  CD1 . LEU B  1 146 ? 16.329 21.133 71.721  1.00 20.88 ? 146  LEU B CD1 1 
ATOM   2446  C  CD2 . LEU B  1 146 ? 14.940 19.050 71.474  1.00 24.93 ? 146  LEU B CD2 1 
ATOM   2447  N  N   . GLU B  1 147 ? 18.968 17.911 69.661  1.00 33.68 ? 147  GLU B N   1 
ATOM   2448  C  CA  . GLU B  1 147 ? 19.892 16.960 70.279  1.00 36.67 ? 147  GLU B CA  1 
ATOM   2449  C  C   . GLU B  1 147 ? 21.342 17.439 70.213  1.00 34.31 ? 147  GLU B C   1 
ATOM   2450  O  O   . GLU B  1 147 ? 22.146 17.143 71.101  1.00 33.62 ? 147  GLU B O   1 
ATOM   2451  C  CB  . GLU B  1 147 ? 19.755 15.557 69.660  1.00 41.58 ? 147  GLU B CB  1 
ATOM   2452  C  CG  . GLU B  1 147 ? 20.055 15.464 68.172  1.00 58.53 ? 147  GLU B CG  1 
ATOM   2453  C  CD  . GLU B  1 147 ? 18.819 15.649 67.286  1.00 64.98 ? 147  GLU B CD  1 
ATOM   2454  O  OE1 . GLU B  1 147 ? 18.209 16.749 67.294  1.00 66.11 ? 147  GLU B OE1 1 
ATOM   2455  O  OE2 . GLU B  1 147 ? 18.465 14.681 66.573  1.00 66.93 ? 147  GLU B OE2 1 
ATOM   2456  N  N   . ASN B  1 148 ? 21.678 18.197 69.175  1.00 34.46 ? 148  ASN B N   1 
ATOM   2457  C  CA  . ASN B  1 148 ? 23.037 18.718 69.052  1.00 31.96 ? 148  ASN B CA  1 
ATOM   2458  C  C   . ASN B  1 148 ? 23.251 19.884 70.005  1.00 30.19 ? 148  ASN B C   1 
ATOM   2459  O  O   . ASN B  1 148 ? 24.289 19.979 70.666  1.00 27.38 ? 148  ASN B O   1 
ATOM   2460  C  CB  . ASN B  1 148 ? 23.325 19.185 67.630  1.00 32.14 ? 148  ASN B CB  1 
ATOM   2461  C  CG  . ASN B  1 148 ? 24.359 18.332 66.952  1.00 32.47 ? 148  ASN B CG  1 
ATOM   2462  O  OD1 . ASN B  1 148 ? 25.311 17.877 67.585  1.00 36.20 ? 148  ASN B OD1 1 
ATOM   2463  N  ND2 . ASN B  1 148 ? 24.194 18.120 65.657  1.00 33.59 ? 148  ASN B ND2 1 
ATOM   2464  N  N   . TYR B  1 149 ? 22.265 20.773 70.073  1.00 28.30 ? 149  TYR B N   1 
ATOM   2465  C  CA  . TYR B  1 149 ? 22.367 21.924 70.954  1.00 28.87 ? 149  TYR B CA  1 
ATOM   2466  C  C   . TYR B  1 149 ? 22.593 21.449 72.384  1.00 29.63 ? 149  TYR B C   1 
ATOM   2467  O  O   . TYR B  1 149 ? 23.519 21.905 73.061  1.00 31.03 ? 149  TYR B O   1 
ATOM   2468  C  CB  . TYR B  1 149 ? 21.095 22.762 70.874  1.00 28.07 ? 149  TYR B CB  1 
ATOM   2469  C  CG  . TYR B  1 149 ? 21.084 23.926 71.833  1.00 26.95 ? 149  TYR B CG  1 
ATOM   2470  C  CD1 . TYR B  1 149 ? 21.886 25.048 71.615  1.00 25.55 ? 149  TYR B CD1 1 
ATOM   2471  C  CD2 . TYR B  1 149 ? 20.290 23.890 72.981  1.00 27.15 ? 149  TYR B CD2 1 
ATOM   2472  C  CE1 . TYR B  1 149 ? 21.898 26.107 72.521  1.00 27.25 ? 149  TYR B CE1 1 
ATOM   2473  C  CE2 . TYR B  1 149 ? 20.293 24.938 73.893  1.00 27.78 ? 149  TYR B CE2 1 
ATOM   2474  C  CZ  . TYR B  1 149 ? 21.097 26.042 73.663  1.00 28.95 ? 149  TYR B CZ  1 
ATOM   2475  O  OH  . TYR B  1 149 ? 21.097 27.066 74.588  1.00 26.15 ? 149  TYR B OH  1 
ATOM   2476  N  N   . LEU B  1 150 ? 21.745 20.524 72.829  1.00 29.48 ? 150  LEU B N   1 
ATOM   2477  C  CA  . LEU B  1 150 ? 21.833 19.956 74.169  1.00 29.00 ? 150  LEU B CA  1 
ATOM   2478  C  C   . LEU B  1 150 ? 23.215 19.350 74.430  1.00 29.23 ? 150  LEU B C   1 
ATOM   2479  O  O   . LEU B  1 150 ? 23.844 19.632 75.451  1.00 29.64 ? 150  LEU B O   1 
ATOM   2480  C  CB  . LEU B  1 150 ? 20.756 18.879 74.350  1.00 30.33 ? 150  LEU B CB  1 
ATOM   2481  C  CG  . LEU B  1 150 ? 19.295 19.332 74.332  1.00 28.90 ? 150  LEU B CG  1 
ATOM   2482  C  CD1 . LEU B  1 150 ? 18.384 18.127 74.220  1.00 30.61 ? 150  LEU B CD1 1 
ATOM   2483  C  CD2 . LEU B  1 150 ? 18.985 20.116 75.594  1.00 30.57 ? 150  LEU B CD2 1 
ATOM   2484  N  N   . GLN B  1 151 ? 23.685 18.511 73.513  1.00 30.37 ? 151  GLN B N   1 
ATOM   2485  C  CA  . GLN B  1 151 ? 25.002 17.893 73.670  1.00 30.98 ? 151  GLN B CA  1 
ATOM   2486  C  C   . GLN B  1 151 ? 26.054 18.952 73.994  1.00 31.10 ? 151  GLN B C   1 
ATOM   2487  O  O   . GLN B  1 151 ? 27.024 18.680 74.695  1.00 30.82 ? 151  GLN B O   1 
ATOM   2488  C  CB  . GLN B  1 151 ? 25.411 17.152 72.389  1.00 27.82 ? 151  GLN B CB  1 
ATOM   2489  C  CG  . GLN B  1 151 ? 26.884 16.749 72.349  1.00 23.69 ? 151  GLN B CG  1 
ATOM   2490  C  CD  . GLN B  1 151 ? 27.232 15.922 71.123  1.00 26.93 ? 151  GLN B CD  1 
ATOM   2491  O  OE1 . GLN B  1 151 ? 26.839 16.255 70.003  1.00 32.64 ? 151  GLN B OE1 1 
ATOM   2492  N  NE2 . GLN B  1 151 ? 27.980 14.843 71.327  1.00 23.16 ? 151  GLN B NE2 1 
ATOM   2493  N  N   . SER B  1 152 ? 25.851 20.159 73.480  1.00 30.13 ? 152  SER B N   1 
ATOM   2494  C  CA  . SER B  1 152 ? 26.786 21.241 73.706  1.00 34.27 ? 152  SER B CA  1 
ATOM   2495  C  C   . SER B  1 152 ? 26.648 21.839 75.095  1.00 37.50 ? 152  SER B C   1 
ATOM   2496  O  O   . SER B  1 152 ? 27.618 22.323 75.675  1.00 38.12 ? 152  SER B O   1 
ATOM   2497  C  CB  . SER B  1 152 ? 26.564 22.326 72.662  1.00 35.10 ? 152  SER B CB  1 
ATOM   2498  O  OG  . SER B  1 152 ? 26.720 21.783 71.368  1.00 42.83 ? 152  SER B OG  1 
ATOM   2499  N  N   . GLN B  1 153 ? 25.437 21.798 75.630  1.00 39.64 ? 153  GLN B N   1 
ATOM   2500  C  CA  . GLN B  1 153 ? 25.179 22.366 76.935  1.00 41.70 ? 153  GLN B CA  1 
ATOM   2501  C  C   . GLN B  1 153 ? 25.476 21.409 78.078  1.00 45.90 ? 153  GLN B C   1 
ATOM   2502  O  O   . GLN B  1 153 ? 25.274 21.749 79.243  1.00 47.33 ? 153  GLN B O   1 
ATOM   2503  C  CB  . GLN B  1 153 ? 23.731 22.828 77.002  1.00 40.24 ? 153  GLN B CB  1 
ATOM   2504  C  CG  . GLN B  1 153 ? 23.330 23.691 75.818  1.00 38.29 ? 153  GLN B CG  1 
ATOM   2505  C  CD  . GLN B  1 153 ? 24.278 24.849 75.606  1.00 36.14 ? 153  GLN B CD  1 
ATOM   2506  O  OE1 . GLN B  1 153 ? 24.615 25.568 76.547  1.00 34.64 ? 153  GLN B OE1 1 
ATOM   2507  N  NE2 . GLN B  1 153 ? 24.709 25.042 74.365  1.00 34.19 ? 153  GLN B NE2 1 
ATOM   2508  N  N   . MET B  1 154 ? 25.963 20.216 77.756  1.00 49.22 ? 154  MET B N   1 
ATOM   2509  C  CA  . MET B  1 154 ? 26.276 19.243 78.797  1.00 53.64 ? 154  MET B CA  1 
ATOM   2510  C  C   . MET B  1 154 ? 27.428 19.686 79.681  1.00 59.97 ? 154  MET B C   1 
ATOM   2511  O  O   . MET B  1 154 ? 27.221 20.040 80.842  1.00 62.69 ? 154  MET B O   1 
ATOM   2512  C  CB  . MET B  1 154 ? 26.597 17.880 78.189  1.00 48.25 ? 154  MET B CB  1 
ATOM   2513  C  CG  . MET B  1 154 ? 25.385 16.983 78.074  1.00 45.27 ? 154  MET B CG  1 
ATOM   2514  S  SD  . MET B  1 154 ? 25.771 15.467 77.231  1.00 38.05 ? 154  MET B SD  1 
ATOM   2515  C  CE  . MET B  1 154 ? 26.876 14.717 78.400  1.00 44.60 ? 154  MET B CE  1 
ATOM   2516  N  N   . ASP B  1 155 ? 28.638 19.667 79.134  1.00 66.14 ? 155  ASP B N   1 
ATOM   2517  C  CA  . ASP B  1 155 ? 29.821 20.066 79.892  1.00 72.27 ? 155  ASP B CA  1 
ATOM   2518  C  C   . ASP B  1 155 ? 30.230 21.512 79.612  1.00 75.26 ? 155  ASP B C   1 
ATOM   2519  O  O   . ASP B  1 155 ? 30.457 22.259 80.596  1.00 76.70 ? 155  ASP B O   1 
ATOM   2520  C  CB  . ASP B  1 155 ? 30.980 19.115 79.583  1.00 74.10 ? 155  ASP B CB  1 
ATOM   2521  C  CG  . ASP B  1 155 ? 30.702 17.695 80.050  1.00 78.31 ? 155  ASP B CG  1 
ATOM   2522  O  OD1 . ASP B  1 155 ? 30.608 17.485 81.280  1.00 79.70 ? 155  ASP B OD1 1 
ATOM   2523  O  OD2 . ASP B  1 155 ? 30.567 16.792 79.191  1.00 79.06 ? 155  ASP B OD2 1 
ATOM   2524  O  OXT . ASP B  1 155 ? 30.321 21.879 78.416  1.00 78.03 ? 155  ASP B OXT 1 
ATOM   2525  N  N   . MET C  1 1   ? 16.357 40.991 67.871  1.00 49.27 ? 1    MET C N   1 
ATOM   2526  C  CA  . MET C  1 1   ? 15.195 41.832 68.272  1.00 50.00 ? 1    MET C CA  1 
ATOM   2527  C  C   . MET C  1 1   ? 14.885 42.832 67.158  1.00 49.79 ? 1    MET C C   1 
ATOM   2528  O  O   . MET C  1 1   ? 15.753 43.603 66.749  1.00 50.09 ? 1    MET C O   1 
ATOM   2529  C  CB  . MET C  1 1   ? 15.519 42.568 69.574  1.00 50.63 ? 1    MET C CB  1 
ATOM   2530  C  CG  . MET C  1 1   ? 14.292 43.093 70.305  1.00 53.37 ? 1    MET C CG  1 
ATOM   2531  S  SD  . MET C  1 1   ? 14.666 43.675 71.975  1.00 53.50 ? 1    MET C SD  1 
ATOM   2532  C  CE  . MET C  1 1   ? 14.841 45.470 71.701  1.00 51.92 ? 1    MET C CE  1 
ATOM   2533  N  N   . LYS C  1 2   ? 13.651 42.814 66.663  1.00 48.94 ? 2    LYS C N   1 
ATOM   2534  C  CA  . LYS C  1 2   ? 13.264 43.712 65.583  1.00 49.85 ? 2    LYS C CA  1 
ATOM   2535  C  C   . LYS C  1 2   ? 13.291 45.171 65.993  1.00 48.03 ? 2    LYS C C   1 
ATOM   2536  O  O   . LYS C  1 2   ? 12.562 45.591 66.886  1.00 47.08 ? 2    LYS C O   1 
ATOM   2537  C  CB  . LYS C  1 2   ? 11.879 43.347 65.054  1.00 53.88 ? 2    LYS C CB  1 
ATOM   2538  C  CG  . LYS C  1 2   ? 11.857 42.029 64.292  1.00 62.14 ? 2    LYS C CG  1 
ATOM   2539  C  CD  . LYS C  1 2   ? 10.446 41.640 63.876  1.00 68.61 ? 2    LYS C CD  1 
ATOM   2540  C  CE  . LYS C  1 2   ? 10.415 40.244 63.257  1.00 72.04 ? 2    LYS C CE  1 
ATOM   2541  N  NZ  . LYS C  1 2   ? 9.019  39.793 62.975  1.00 72.49 ? 2    LYS C NZ  1 
ATOM   2542  N  N   . GLY C  1 3   ? 14.144 45.940 65.325  1.00 46.22 ? 3    GLY C N   1 
ATOM   2543  C  CA  . GLY C  1 3   ? 14.265 47.350 65.629  1.00 43.10 ? 3    GLY C CA  1 
ATOM   2544  C  C   . GLY C  1 3   ? 13.388 48.210 64.747  1.00 41.93 ? 3    GLY C C   1 
ATOM   2545  O  O   . GLY C  1 3   ? 12.612 47.710 63.940  1.00 41.38 ? 3    GLY C O   1 
ATOM   2546  N  N   . ASP C  1 4   ? 13.515 49.518 64.908  1.00 42.44 ? 4    ASP C N   1 
ATOM   2547  C  CA  . ASP C  1 4   ? 12.736 50.460 64.131  1.00 42.95 ? 4    ASP C CA  1 
ATOM   2548  C  C   . ASP C  1 4   ? 13.426 50.693 62.794  1.00 43.95 ? 4    ASP C C   1 
ATOM   2549  O  O   . ASP C  1 4   ? 14.613 51.036 62.744  1.00 43.71 ? 4    ASP C O   1 
ATOM   2550  C  CB  . ASP C  1 4   ? 12.624 51.777 64.878  1.00 44.96 ? 4    ASP C CB  1 
ATOM   2551  C  CG  . ASP C  1 4   ? 11.711 52.748 64.190  1.00 49.84 ? 4    ASP C CG  1 
ATOM   2552  O  OD1 . ASP C  1 4   ? 10.500 52.735 64.508  1.00 51.29 ? 4    ASP C OD1 1 
ATOM   2553  O  OD2 . ASP C  1 4   ? 12.204 53.511 63.323  1.00 52.13 ? 4    ASP C OD2 1 
ATOM   2554  N  N   . LYS C  1 5   ? 12.670 50.506 61.715  1.00 42.53 ? 5    LYS C N   1 
ATOM   2555  C  CA  . LYS C  1 5   ? 13.184 50.679 60.366  1.00 39.86 ? 5    LYS C CA  1 
ATOM   2556  C  C   . LYS C  1 5   ? 13.902 52.018 60.199  1.00 37.25 ? 5    LYS C C   1 
ATOM   2557  O  O   . LYS C  1 5   ? 15.022 52.066 59.684  1.00 33.60 ? 5    LYS C O   1 
ATOM   2558  C  CB  . LYS C  1 5   ? 12.039 50.573 59.350  1.00 43.63 ? 5    LYS C CB  1 
ATOM   2559  C  CG  . LYS C  1 5   ? 12.491 50.696 57.898  1.00 47.24 ? 5    LYS C CG  1 
ATOM   2560  C  CD  . LYS C  1 5   ? 11.327 50.802 56.922  1.00 50.13 ? 5    LYS C CD  1 
ATOM   2561  C  CE  . LYS C  1 5   ? 11.851 50.883 55.487  1.00 53.50 ? 5    LYS C CE  1 
ATOM   2562  N  NZ  . LYS C  1 5   ? 10.786 51.153 54.480  1.00 54.51 ? 5    LYS C NZ  1 
ATOM   2563  N  N   . ILE C  1 6   ? 13.262 53.105 60.627  1.00 34.65 ? 6    ILE C N   1 
ATOM   2564  C  CA  . ILE C  1 6   ? 13.878 54.419 60.498  1.00 33.77 ? 6    ILE C CA  1 
ATOM   2565  C  C   . ILE C  1 6   ? 15.112 54.523 61.396  1.00 33.27 ? 6    ILE C C   1 
ATOM   2566  O  O   . ILE C  1 6   ? 16.084 55.198 61.043  1.00 33.94 ? 6    ILE C O   1 
ATOM   2567  C  CB  . ILE C  1 6   ? 12.880 55.565 60.830  1.00 33.45 ? 6    ILE C CB  1 
ATOM   2568  C  CG1 . ILE C  1 6   ? 11.903 55.775 59.673  1.00 28.95 ? 6    ILE C CG1 1 
ATOM   2569  C  CG2 . ILE C  1 6   ? 13.627 56.868 61.021  1.00 34.22 ? 6    ILE C CG2 1 
ATOM   2570  C  CD1 . ILE C  1 6   ? 11.098 54.566 59.324  1.00 33.26 ? 6    ILE C CD1 1 
ATOM   2571  N  N   . VAL C  1 7   ? 15.085 53.855 62.548  1.00 31.11 ? 7    VAL C N   1 
ATOM   2572  C  CA  . VAL C  1 7   ? 16.241 53.887 63.436  1.00 30.10 ? 7    VAL C CA  1 
ATOM   2573  C  C   . VAL C  1 7   ? 17.424 53.175 62.779  1.00 30.44 ? 7    VAL C C   1 
ATOM   2574  O  O   . VAL C  1 7   ? 18.573 53.620 62.906  1.00 31.69 ? 7    VAL C O   1 
ATOM   2575  C  CB  . VAL C  1 7   ? 15.958 53.207 64.778  1.00 31.78 ? 7    VAL C CB  1 
ATOM   2576  C  CG1 . VAL C  1 7   ? 17.284 52.885 65.479  1.00 29.92 ? 7    VAL C CG1 1 
ATOM   2577  C  CG2 . VAL C  1 7   ? 15.115 54.129 65.657  1.00 30.98 ? 7    VAL C CG2 1 
ATOM   2578  N  N   . ILE C  1 8   ? 17.142 52.071 62.090  1.00 25.32 ? 8    ILE C N   1 
ATOM   2579  C  CA  . ILE C  1 8   ? 18.180 51.315 61.402  1.00 23.63 ? 8    ILE C CA  1 
ATOM   2580  C  C   . ILE C  1 8   ? 18.829 52.159 60.303  1.00 26.09 ? 8    ILE C C   1 
ATOM   2581  O  O   . ILE C  1 8   ? 20.026 52.029 60.029  1.00 24.68 ? 8    ILE C O   1 
ATOM   2582  C  CB  . ILE C  1 8   ? 17.618 50.064 60.709  1.00 26.03 ? 8    ILE C CB  1 
ATOM   2583  C  CG1 . ILE C  1 8   ? 16.828 49.196 61.702  1.00 23.66 ? 8    ILE C CG1 1 
ATOM   2584  C  CG2 . ILE C  1 8   ? 18.767 49.301 60.041  1.00 25.68 ? 8    ILE C CG2 1 
ATOM   2585  C  CD1 . ILE C  1 8   ? 17.662 48.447 62.706  1.00 20.13 ? 8    ILE C CD1 1 
ATOM   2586  N  N   . GLN C  1 9   ? 18.039 53.013 59.658  1.00 27.87 ? 9    GLN C N   1 
ATOM   2587  C  CA  . GLN C  1 9   ? 18.574 53.848 58.585  1.00 28.99 ? 9    GLN C CA  1 
ATOM   2588  C  C   . GLN C  1 9   ? 19.496 54.907 59.159  1.00 30.34 ? 9    GLN C C   1 
ATOM   2589  O  O   . GLN C  1 9   ? 20.576 55.156 58.612  1.00 33.47 ? 9    GLN C O   1 
ATOM   2590  C  CB  . GLN C  1 9   ? 17.448 54.511 57.793  1.00 27.80 ? 9    GLN C CB  1 
ATOM   2591  C  CG  . GLN C  1 9   ? 16.341 53.554 57.429  1.00 29.30 ? 9    GLN C CG  1 
ATOM   2592  C  CD  . GLN C  1 9   ? 15.478 54.055 56.294  1.00 33.77 ? 9    GLN C CD  1 
ATOM   2593  O  OE1 . GLN C  1 9   ? 15.199 55.252 56.177  1.00 31.39 ? 9    GLN C OE1 1 
ATOM   2594  N  NE2 . GLN C  1 9   ? 15.031 53.128 55.451  1.00 39.92 ? 9    GLN C NE2 1 
ATOM   2595  N  N   . HIS C  1 10  ? 19.076 55.537 60.254  1.00 30.34 ? 10   HIS C N   1 
ATOM   2596  C  CA  . HIS C  1 10  ? 19.920 56.548 60.883  1.00 29.33 ? 10   HIS C CA  1 
ATOM   2597  C  C   . HIS C  1 10  ? 21.244 55.876 61.213  1.00 27.07 ? 10   HIS C C   1 
ATOM   2598  O  O   . HIS C  1 10  ? 22.306 56.401 60.886  1.00 26.73 ? 10   HIS C O   1 
ATOM   2599  C  CB  . HIS C  1 10  ? 19.278 57.076 62.163  1.00 32.82 ? 10   HIS C CB  1 
ATOM   2600  C  CG  . HIS C  1 10  ? 18.267 58.155 61.935  1.00 35.62 ? 10   HIS C CG  1 
ATOM   2601  N  ND1 . HIS C  1 10  ? 18.592 59.369 61.368  1.00 38.69 ? 10   HIS C ND1 1 
ATOM   2602  C  CD2 . HIS C  1 10  ? 16.947 58.217 62.228  1.00 34.48 ? 10   HIS C CD2 1 
ATOM   2603  C  CE1 . HIS C  1 10  ? 17.516 60.134 61.325  1.00 36.71 ? 10   HIS C CE1 1 
ATOM   2604  N  NE2 . HIS C  1 10  ? 16.505 59.460 61.842  1.00 36.91 ? 10   HIS C NE2 1 
ATOM   2605  N  N   . LEU C  1 11  ? 21.166 54.705 61.851  1.00 23.84 ? 11   LEU C N   1 
ATOM   2606  C  CA  . LEU C  1 11  ? 22.351 53.938 62.216  1.00 22.02 ? 11   LEU C CA  1 
ATOM   2607  C  C   . LEU C  1 11  ? 23.204 53.643 60.971  1.00 25.31 ? 11   LEU C C   1 
ATOM   2608  O  O   . LEU C  1 11  ? 24.427 53.821 60.997  1.00 23.41 ? 11   LEU C O   1 
ATOM   2609  C  CB  . LEU C  1 11  ? 21.930 52.641 62.895  1.00 19.65 ? 11   LEU C CB  1 
ATOM   2610  C  CG  . LEU C  1 11  ? 21.961 52.537 64.424  1.00 25.69 ? 11   LEU C CG  1 
ATOM   2611  C  CD1 . LEU C  1 11  ? 21.666 53.866 65.086  1.00 23.88 ? 11   LEU C CD1 1 
ATOM   2612  C  CD2 . LEU C  1 11  ? 20.955 51.467 64.862  1.00 25.77 ? 11   LEU C CD2 1 
ATOM   2613  N  N   . ASN C  1 12  ? 22.566 53.198 59.884  1.00 27.15 ? 12   ASN C N   1 
ATOM   2614  C  CA  . ASN C  1 12  ? 23.296 52.917 58.638  1.00 28.33 ? 12   ASN C CA  1 
ATOM   2615  C  C   . ASN C  1 12  ? 23.936 54.181 58.082  1.00 28.81 ? 12   ASN C C   1 
ATOM   2616  O  O   . ASN C  1 12  ? 25.035 54.130 57.518  1.00 28.48 ? 12   ASN C O   1 
ATOM   2617  C  CB  . ASN C  1 12  ? 22.384 52.326 57.561  1.00 25.21 ? 12   ASN C CB  1 
ATOM   2618  C  CG  . ASN C  1 12  ? 22.500 50.816 57.464  1.00 26.82 ? 12   ASN C CG  1 
ATOM   2619  O  OD1 . ASN C  1 12  ? 23.599 50.262 57.505  1.00 27.86 ? 12   ASN C OD1 1 
ATOM   2620  N  ND2 . ASN C  1 12  ? 21.367 50.143 57.318  1.00 24.26 ? 12   ASN C ND2 1 
ATOM   2621  N  N   . LYS C  1 13  ? 23.253 55.314 58.230  1.00 27.46 ? 13   LYS C N   1 
ATOM   2622  C  CA  . LYS C  1 13  ? 23.821 56.555 57.736  1.00 30.17 ? 13   LYS C CA  1 
ATOM   2623  C  C   . LYS C  1 13  ? 25.052 56.930 58.554  1.00 29.52 ? 13   LYS C C   1 
ATOM   2624  O  O   . LYS C  1 13  ? 26.084 57.311 57.994  1.00 31.41 ? 13   LYS C O   1 
ATOM   2625  C  CB  . LYS C  1 13  ? 22.815 57.710 57.779  1.00 33.06 ? 13   LYS C CB  1 
ATOM   2626  C  CG  . LYS C  1 13  ? 23.463 59.005 57.291  1.00 39.01 ? 13   LYS C CG  1 
ATOM   2627  C  CD  . LYS C  1 13  ? 22.490 60.106 56.943  1.00 43.71 ? 13   LYS C CD  1 
ATOM   2628  C  CE  . LYS C  1 13  ? 23.234 61.208 56.189  1.00 49.40 ? 13   LYS C CE  1 
ATOM   2629  N  NZ  . LYS C  1 13  ? 22.380 62.396 55.879  1.00 55.54 ? 13   LYS C NZ  1 
ATOM   2630  N  N   . ILE C  1 14  ? 24.944 56.833 59.876  1.00 27.04 ? 14   ILE C N   1 
ATOM   2631  C  CA  . ILE C  1 14  ? 26.076 57.157 60.741  1.00 24.71 ? 14   ILE C CA  1 
ATOM   2632  C  C   . ILE C  1 14  ? 27.236 56.242 60.362  1.00 24.41 ? 14   ILE C C   1 
ATOM   2633  O  O   . ILE C  1 14  ? 28.378 56.693 60.222  1.00 23.57 ? 14   ILE C O   1 
ATOM   2634  C  CB  . ILE C  1 14  ? 25.736 56.948 62.233  1.00 22.30 ? 14   ILE C CB  1 
ATOM   2635  C  CG1 . ILE C  1 14  ? 24.499 57.770 62.604  1.00 18.19 ? 14   ILE C CG1 1 
ATOM   2636  C  CG2 . ILE C  1 14  ? 26.923 57.381 63.107  1.00 22.97 ? 14   ILE C CG2 1 
ATOM   2637  C  CD1 . ILE C  1 14  ? 24.693 59.269 62.466  1.00 14.13 ? 14   ILE C CD1 1 
ATOM   2638  N  N   . LEU C  1 15  ? 26.931 54.960 60.181  1.00 22.99 ? 15   LEU C N   1 
ATOM   2639  C  CA  . LEU C  1 15  ? 27.945 53.980 59.803  1.00 23.72 ? 15   LEU C CA  1 
ATOM   2640  C  C   . LEU C  1 15  ? 28.624 54.400 58.507  1.00 24.52 ? 15   LEU C C   1 
ATOM   2641  O  O   . LEU C  1 15  ? 29.828 54.213 58.338  1.00 24.39 ? 15   LEU C O   1 
ATOM   2642  C  CB  . LEU C  1 15  ? 27.317 52.594 59.618  1.00 21.66 ? 15   LEU C CB  1 
ATOM   2643  C  CG  . LEU C  1 15  ? 28.251 51.532 59.032  1.00 19.26 ? 15   LEU C CG  1 
ATOM   2644  C  CD1 . LEU C  1 15  ? 29.521 51.461 59.857  1.00 18.22 ? 15   LEU C CD1 1 
ATOM   2645  C  CD2 . LEU C  1 15  ? 27.554 50.180 59.001  1.00 16.48 ? 15   LEU C CD2 1 
ATOM   2646  N  N   . GLY C  1 16  ? 27.839 54.959 57.590  1.00 25.91 ? 16   GLY C N   1 
ATOM   2647  C  CA  . GLY C  1 16  ? 28.386 55.404 56.320  1.00 24.39 ? 16   GLY C CA  1 
ATOM   2648  C  C   . GLY C  1 16  ? 29.402 56.504 56.537  1.00 26.36 ? 16   GLY C C   1 
ATOM   2649  O  O   . GLY C  1 16  ? 30.431 56.549 55.865  1.00 27.19 ? 16   GLY C O   1 
ATOM   2650  N  N   . ASN C  1 17  ? 29.118 57.397 57.482  1.00 27.22 ? 17   ASN C N   1 
ATOM   2651  C  CA  . ASN C  1 17  ? 30.035 58.492 57.787  1.00 28.19 ? 17   ASN C CA  1 
ATOM   2652  C  C   . ASN C  1 17  ? 31.323 57.951 58.395  1.00 28.57 ? 17   ASN C C   1 
ATOM   2653  O  O   . ASN C  1 17  ? 32.411 58.448 58.098  1.00 30.26 ? 17   ASN C O   1 
ATOM   2654  C  CB  . ASN C  1 17  ? 29.392 59.482 58.764  1.00 27.54 ? 17   ASN C CB  1 
ATOM   2655  C  CG  . ASN C  1 17  ? 28.208 60.221 58.163  1.00 29.63 ? 17   ASN C CG  1 
ATOM   2656  O  OD1 . ASN C  1 17  ? 27.527 60.979 58.852  1.00 30.87 ? 17   ASN C OD1 1 
ATOM   2657  N  ND2 . ASN C  1 17  ? 27.957 60.005 56.872  1.00 34.85 ? 17   ASN C ND2 1 
ATOM   2658  N  N   . GLU C  1 18  ? 31.196 56.929 59.242  1.00 29.40 ? 18   GLU C N   1 
ATOM   2659  C  CA  . GLU C  1 18  ? 32.354 56.323 59.905  1.00 29.09 ? 18   GLU C CA  1 
ATOM   2660  C  C   . GLU C  1 18  ? 33.330 55.674 58.933  1.00 26.02 ? 18   GLU C C   1 
ATOM   2661  O  O   . GLU C  1 18  ? 34.534 55.918 59.014  1.00 23.77 ? 18   GLU C O   1 
ATOM   2662  C  CB  . GLU C  1 18  ? 31.916 55.284 60.948  1.00 29.81 ? 18   GLU C CB  1 
ATOM   2663  C  CG  . GLU C  1 18  ? 31.048 55.832 62.086  1.00 34.37 ? 18   GLU C CG  1 
ATOM   2664  C  CD  . GLU C  1 18  ? 31.743 56.913 62.904  1.00 38.10 ? 18   GLU C CD  1 
ATOM   2665  O  OE1 . GLU C  1 18  ? 32.978 56.836 63.085  1.00 41.61 ? 18   GLU C OE1 1 
ATOM   2666  O  OE2 . GLU C  1 18  ? 31.048 57.837 63.374  1.00 41.58 ? 18   GLU C OE2 1 
ATOM   2667  N  N   . LEU C  1 19  ? 32.815 54.859 58.017  1.00 25.63 ? 19   LEU C N   1 
ATOM   2668  C  CA  . LEU C  1 19  ? 33.670 54.181 57.045  1.00 25.75 ? 19   LEU C CA  1 
ATOM   2669  C  C   . LEU C  1 19  ? 34.532 55.194 56.291  1.00 27.30 ? 19   LEU C C   1 
ATOM   2670  O  O   . LEU C  1 19  ? 35.708 54.924 56.011  1.00 27.40 ? 19   LEU C O   1 
ATOM   2671  C  CB  . LEU C  1 19  ? 32.816 53.355 56.080  1.00 21.72 ? 19   LEU C CB  1 
ATOM   2672  C  CG  . LEU C  1 19  ? 32.015 52.251 56.786  1.00 19.39 ? 19   LEU C CG  1 
ATOM   2673  C  CD1 . LEU C  1 19  ? 30.963 51.698 55.860  1.00 19.85 ? 19   LEU C CD1 1 
ATOM   2674  C  CD2 . LEU C  1 19  ? 32.945 51.151 57.250  1.00 18.47 ? 19   LEU C CD2 1 
ATOM   2675  N  N   . ILE C  1 20  ? 33.950 56.359 55.986  1.00 26.92 ? 20   ILE C N   1 
ATOM   2676  C  CA  . ILE C  1 20  ? 34.659 57.442 55.297  1.00 26.45 ? 20   ILE C CA  1 
ATOM   2677  C  C   . ILE C  1 20  ? 35.789 57.953 56.198  1.00 28.03 ? 20   ILE C C   1 
ATOM   2678  O  O   . ILE C  1 20  ? 36.940 58.073 55.765  1.00 30.40 ? 20   ILE C O   1 
ATOM   2679  C  CB  . ILE C  1 20  ? 33.725 58.649 54.988  1.00 26.19 ? 20   ILE C CB  1 
ATOM   2680  C  CG1 . ILE C  1 20  ? 32.625 58.242 54.006  1.00 27.14 ? 20   ILE C CG1 1 
ATOM   2681  C  CG2 . ILE C  1 20  ? 34.526 59.802 54.396  1.00 20.93 ? 20   ILE C CG2 1 
ATOM   2682  C  CD1 . ILE C  1 20  ? 31.643 59.362 53.716  1.00 25.68 ? 20   ILE C CD1 1 
ATOM   2683  N  N   . ALA C  1 21  ? 35.457 58.258 57.451  1.00 27.43 ? 21   ALA C N   1 
ATOM   2684  C  CA  . ALA C  1 21  ? 36.453 58.753 58.399  1.00 25.80 ? 21   ALA C CA  1 
ATOM   2685  C  C   . ALA C  1 21  ? 37.628 57.779 58.516  1.00 24.83 ? 21   ALA C C   1 
ATOM   2686  O  O   . ALA C  1 21  ? 38.781 58.198 58.595  1.00 24.68 ? 21   ALA C O   1 
ATOM   2687  C  CB  . ALA C  1 21  ? 35.809 58.968 59.762  1.00 25.77 ? 21   ALA C CB  1 
ATOM   2688  N  N   . ILE C  1 22  ? 37.334 56.481 58.514  1.00 25.22 ? 22   ILE C N   1 
ATOM   2689  C  CA  . ILE C  1 22  ? 38.369 55.456 58.622  1.00 25.09 ? 22   ILE C CA  1 
ATOM   2690  C  C   . ILE C  1 22  ? 39.416 55.555 57.520  1.00 25.97 ? 22   ILE C C   1 
ATOM   2691  O  O   . ILE C  1 22  ? 40.615 55.667 57.793  1.00 27.89 ? 22   ILE C O   1 
ATOM   2692  C  CB  . ILE C  1 22  ? 37.773 54.029 58.557  1.00 26.66 ? 22   ILE C CB  1 
ATOM   2693  C  CG1 . ILE C  1 22  ? 36.822 53.788 59.729  1.00 24.19 ? 22   ILE C CG1 1 
ATOM   2694  C  CG2 . ILE C  1 22  ? 38.895 52.989 58.599  1.00 26.12 ? 22   ILE C CG2 1 
ATOM   2695  C  CD1 . ILE C  1 22  ? 36.085 52.471 59.608  1.00 24.75 ? 22   ILE C CD1 1 
ATOM   2696  N  N   . ASN C  1 23  ? 38.963 55.500 56.271  1.00 26.80 ? 23   ASN C N   1 
ATOM   2697  C  CA  . ASN C  1 23  ? 39.878 55.556 55.135  1.00 26.48 ? 23   ASN C CA  1 
ATOM   2698  C  C   . ASN C  1 23  ? 40.615 56.885 55.079  1.00 26.57 ? 23   ASN C C   1 
ATOM   2699  O  O   . ASN C  1 23  ? 41.826 56.935 54.831  1.00 25.18 ? 23   ASN C O   1 
ATOM   2700  C  CB  . ASN C  1 23  ? 39.109 55.340 53.833  1.00 30.27 ? 23   ASN C CB  1 
ATOM   2701  C  CG  . ASN C  1 23  ? 38.537 53.934 53.716  1.00 31.49 ? 23   ASN C CG  1 
ATOM   2702  O  OD1 . ASN C  1 23  ? 38.402 53.222 54.712  1.00 32.13 ? 23   ASN C OD1 1 
ATOM   2703  N  ND2 . ASN C  1 23  ? 38.180 53.536 52.496  1.00 28.07 ? 23   ASN C ND2 1 
ATOM   2704  N  N   . GLN C  1 24  ? 39.889 57.970 55.319  1.00 25.58 ? 24   GLN C N   1 
ATOM   2705  C  CA  . GLN C  1 24  ? 40.512 59.276 55.271  1.00 25.47 ? 24   GLN C CA  1 
ATOM   2706  C  C   . GLN C  1 24  ? 41.594 59.436 56.343  1.00 25.85 ? 24   GLN C C   1 
ATOM   2707  O  O   . GLN C  1 24  ? 42.713 59.865 56.044  1.00 23.51 ? 24   GLN C O   1 
ATOM   2708  C  CB  . GLN C  1 24  ? 39.456 60.372 55.401  1.00 24.69 ? 24   GLN C CB  1 
ATOM   2709  C  CG  . GLN C  1 24  ? 40.037 61.781 55.341  1.00 27.96 ? 24   GLN C CG  1 
ATOM   2710  C  CD  . GLN C  1 24  ? 38.969 62.863 55.345  1.00 29.18 ? 24   GLN C CD  1 
ATOM   2711  O  OE1 . GLN C  1 24  ? 39.198 63.967 55.831  1.00 30.11 ? 24   GLN C OE1 1 
ATOM   2712  N  NE2 . GLN C  1 24  ? 37.801 62.553 54.792  1.00 29.64 ? 24   GLN C NE2 1 
ATOM   2713  N  N   . TYR C  1 25  ? 41.290 59.076 57.586  1.00 26.72 ? 25   TYR C N   1 
ATOM   2714  C  CA  . TYR C  1 25  ? 42.294 59.233 58.630  1.00 28.42 ? 25   TYR C CA  1 
ATOM   2715  C  C   . TYR C  1 25  ? 43.460 58.258 58.453  1.00 28.94 ? 25   TYR C C   1 
ATOM   2716  O  O   . TYR C  1 25  ? 44.613 58.603 58.741  1.00 30.29 ? 25   TYR C O   1 
ATOM   2717  C  CB  . TYR C  1 25  ? 41.670 59.079 60.024  1.00 26.90 ? 25   TYR C CB  1 
ATOM   2718  C  CG  . TYR C  1 25  ? 40.566 60.080 60.324  1.00 30.78 ? 25   TYR C CG  1 
ATOM   2719  C  CD1 . TYR C  1 25  ? 40.355 61.191 59.502  1.00 32.69 ? 25   TYR C CD1 1 
ATOM   2720  C  CD2 . TYR C  1 25  ? 39.700 59.891 61.405  1.00 32.23 ? 25   TYR C CD2 1 
ATOM   2721  C  CE1 . TYR C  1 25  ? 39.306 62.081 59.740  1.00 32.41 ? 25   TYR C CE1 1 
ATOM   2722  C  CE2 . TYR C  1 25  ? 38.648 60.774 61.654  1.00 32.69 ? 25   TYR C CE2 1 
ATOM   2723  C  CZ  . TYR C  1 25  ? 38.456 61.863 60.814  1.00 34.58 ? 25   TYR C CZ  1 
ATOM   2724  O  OH  . TYR C  1 25  ? 37.398 62.717 61.028  1.00 35.07 ? 25   TYR C OH  1 
ATOM   2725  N  N   . PHE C  1 26  ? 43.183 57.050 57.970  1.00 26.23 ? 26   PHE C N   1 
ATOM   2726  C  CA  . PHE C  1 26  ? 44.266 56.102 57.795  1.00 24.02 ? 26   PHE C CA  1 
ATOM   2727  C  C   . PHE C  1 26  ? 45.239 56.611 56.745  1.00 24.14 ? 26   PHE C C   1 
ATOM   2728  O  O   . PHE C  1 26  ? 46.454 56.566 56.938  1.00 24.87 ? 26   PHE C O   1 
ATOM   2729  C  CB  . PHE C  1 26  ? 43.749 54.738 57.378  1.00 23.05 ? 26   PHE C CB  1 
ATOM   2730  C  CG  . PHE C  1 26  ? 44.733 53.642 57.633  1.00 27.84 ? 26   PHE C CG  1 
ATOM   2731  C  CD1 . PHE C  1 26  ? 44.836 53.068 58.903  1.00 29.19 ? 26   PHE C CD1 1 
ATOM   2732  C  CD2 . PHE C  1 26  ? 45.609 53.226 56.633  1.00 29.26 ? 26   PHE C CD2 1 
ATOM   2733  C  CE1 . PHE C  1 26  ? 45.803 52.094 59.174  1.00 32.41 ? 26   PHE C CE1 1 
ATOM   2734  C  CE2 . PHE C  1 26  ? 46.582 52.253 56.890  1.00 33.48 ? 26   PHE C CE2 1 
ATOM   2735  C  CZ  . PHE C  1 26  ? 46.680 51.684 58.165  1.00 31.82 ? 26   PHE C CZ  1 
ATOM   2736  N  N   . LEU C  1 27  ? 44.703 57.090 55.626  1.00 25.47 ? 27   LEU C N   1 
ATOM   2737  C  CA  . LEU C  1 27  ? 45.542 57.630 54.563  1.00 23.98 ? 27   LEU C CA  1 
ATOM   2738  C  C   . LEU C  1 27  ? 46.354 58.779 55.150  1.00 23.84 ? 27   LEU C C   1 
ATOM   2739  O  O   . LEU C  1 27  ? 47.584 58.772 55.067  1.00 25.22 ? 27   LEU C O   1 
ATOM   2740  C  CB  . LEU C  1 27  ? 44.687 58.147 53.393  1.00 24.07 ? 27   LEU C CB  1 
ATOM   2741  C  CG  . LEU C  1 27  ? 45.453 58.705 52.181  1.00 19.88 ? 27   LEU C CG  1 
ATOM   2742  C  CD1 . LEU C  1 27  ? 46.317 57.623 51.562  1.00 16.75 ? 27   LEU C CD1 1 
ATOM   2743  C  CD2 . LEU C  1 27  ? 44.473 59.207 51.157  1.00 19.91 ? 27   LEU C CD2 1 
ATOM   2744  N  N   . HIS C  1 28  ? 45.671 59.759 55.747  1.00 20.88 ? 28   HIS C N   1 
ATOM   2745  C  CA  . HIS C  1 28  ? 46.367 60.894 56.347  1.00 22.53 ? 28   HIS C CA  1 
ATOM   2746  C  C   . HIS C  1 28  ? 47.458 60.404 57.303  1.00 24.69 ? 28   HIS C C   1 
ATOM   2747  O  O   . HIS C  1 28  ? 48.588 60.896 57.281  1.00 25.11 ? 28   HIS C O   1 
ATOM   2748  C  CB  . HIS C  1 28  ? 45.404 61.796 57.126  1.00 22.68 ? 28   HIS C CB  1 
ATOM   2749  C  CG  . HIS C  1 28  ? 44.510 62.639 56.266  1.00 22.31 ? 28   HIS C CG  1 
ATOM   2750  N  ND1 . HIS C  1 28  ? 44.872 63.073 55.009  1.00 20.19 ? 28   HIS C ND1 1 
ATOM   2751  C  CD2 . HIS C  1 28  ? 43.287 63.171 56.510  1.00 20.79 ? 28   HIS C CD2 1 
ATOM   2752  C  CE1 . HIS C  1 28  ? 43.910 63.834 54.515  1.00 20.38 ? 28   HIS C CE1 1 
ATOM   2753  N  NE2 . HIS C  1 28  ? 42.938 63.909 55.407  1.00 20.36 ? 28   HIS C NE2 1 
ATOM   2754  N  N   . ALA C  1 29  ? 47.114 59.430 58.142  1.00 27.39 ? 29   ALA C N   1 
ATOM   2755  C  CA  . ALA C  1 29  ? 48.061 58.881 59.108  1.00 26.51 ? 29   ALA C CA  1 
ATOM   2756  C  C   . ALA C  1 29  ? 49.343 58.375 58.455  1.00 25.45 ? 29   ALA C C   1 
ATOM   2757  O  O   . ALA C  1 29  ? 50.438 58.729 58.891  1.00 25.44 ? 29   ALA C O   1 
ATOM   2758  C  CB  . ALA C  1 29  ? 47.406 57.767 59.905  1.00 26.99 ? 29   ALA C CB  1 
ATOM   2759  N  N   . ARG C  1 30  ? 49.222 57.556 57.412  1.00 24.08 ? 30   ARG C N   1 
ATOM   2760  C  CA  . ARG C  1 30  ? 50.417 57.040 56.748  1.00 24.70 ? 30   ARG C CA  1 
ATOM   2761  C  C   . ARG C  1 30  ? 51.184 58.115 55.992  1.00 25.14 ? 30   ARG C C   1 
ATOM   2762  O  O   . ARG C  1 30  ? 52.393 57.985 55.774  1.00 23.21 ? 30   ARG C O   1 
ATOM   2763  C  CB  . ARG C  1 30  ? 50.064 55.898 55.797  1.00 24.67 ? 30   ARG C CB  1 
ATOM   2764  C  CG  . ARG C  1 30  ? 49.556 54.662 56.504  1.00 29.30 ? 30   ARG C CG  1 
ATOM   2765  C  CD  . ARG C  1 30  ? 50.429 54.309 57.693  1.00 31.35 ? 30   ARG C CD  1 
ATOM   2766  N  NE  . ARG C  1 30  ? 49.920 53.139 58.405  1.00 38.09 ? 30   ARG C NE  1 
ATOM   2767  C  CZ  . ARG C  1 30  ? 50.243 52.824 59.657  1.00 36.86 ? 30   ARG C CZ  1 
ATOM   2768  N  NH1 . ARG C  1 30  ? 51.074 53.599 60.339  1.00 40.12 ? 30   ARG C NH1 1 
ATOM   2769  N  NH2 . ARG C  1 30  ? 49.744 51.732 60.223  1.00 34.52 ? 30   ARG C NH2 1 
ATOM   2770  N  N   . MET C  1 31  ? 50.483 59.172 55.585  1.00 25.67 ? 31   MET C N   1 
ATOM   2771  C  CA  . MET C  1 31  ? 51.127 60.271 54.874  1.00 24.89 ? 31   MET C CA  1 
ATOM   2772  C  C   . MET C  1 31  ? 52.030 61.006 55.860  1.00 27.19 ? 31   MET C C   1 
ATOM   2773  O  O   . MET C  1 31  ? 53.207 61.260 55.559  1.00 30.51 ? 31   MET C O   1 
ATOM   2774  C  CB  . MET C  1 31  ? 50.081 61.221 54.283  1.00 23.65 ? 31   MET C CB  1 
ATOM   2775  C  CG  . MET C  1 31  ? 49.325 60.632 53.091  1.00 21.26 ? 31   MET C CG  1 
ATOM   2776  S  SD  . MET C  1 31  ? 48.041 61.726 52.428  1.00 26.78 ? 31   MET C SD  1 
ATOM   2777  C  CE  . MET C  1 31  ? 48.976 63.216 52.133  1.00 20.93 ? 31   MET C CE  1 
ATOM   2778  N  N   . TYR C  1 32  ? 51.487 61.336 57.035  1.00 23.78 ? 32   TYR C N   1 
ATOM   2779  C  CA  . TYR C  1 32  ? 52.264 62.010 58.070  1.00 23.22 ? 32   TYR C CA  1 
ATOM   2780  C  C   . TYR C  1 32  ? 53.477 61.133 58.354  1.00 26.52 ? 32   TYR C C   1 
ATOM   2781  O  O   . TYR C  1 32  ? 54.617 61.611 58.407  1.00 25.89 ? 32   TYR C O   1 
ATOM   2782  C  CB  . TYR C  1 32  ? 51.448 62.154 59.350  1.00 21.40 ? 32   TYR C CB  1 
ATOM   2783  C  CG  . TYR C  1 32  ? 50.380 63.221 59.304  1.00 22.24 ? 32   TYR C CG  1 
ATOM   2784  C  CD1 . TYR C  1 32  ? 49.117 62.989 59.852  1.00 21.55 ? 32   TYR C CD1 1 
ATOM   2785  C  CD2 . TYR C  1 32  ? 50.635 64.473 58.749  1.00 24.00 ? 32   TYR C CD2 1 
ATOM   2786  C  CE1 . TYR C  1 32  ? 48.138 63.974 59.851  1.00 20.92 ? 32   TYR C CE1 1 
ATOM   2787  C  CE2 . TYR C  1 32  ? 49.655 65.469 58.743  1.00 23.06 ? 32   TYR C CE2 1 
ATOM   2788  C  CZ  . TYR C  1 32  ? 48.417 65.206 59.298  1.00 20.39 ? 32   TYR C CZ  1 
ATOM   2789  O  OH  . TYR C  1 32  ? 47.457 66.177 59.319  1.00 26.77 ? 32   TYR C OH  1 
ATOM   2790  N  N   . GLU C  1 33  ? 53.215 59.841 58.540  1.00 28.08 ? 33   GLU C N   1 
ATOM   2791  C  CA  . GLU C  1 33  ? 54.266 58.872 58.805  1.00 30.19 ? 33   GLU C CA  1 
ATOM   2792  C  C   . GLU C  1 33  ? 55.316 59.003 57.697  1.00 29.10 ? 33   GLU C C   1 
ATOM   2793  O  O   . GLU C  1 33  ? 56.498 59.194 57.969  1.00 24.82 ? 33   GLU C O   1 
ATOM   2794  C  CB  . GLU C  1 33  ? 53.683 57.457 58.793  1.00 39.60 ? 33   GLU C CB  1 
ATOM   2795  C  CG  . GLU C  1 33  ? 53.988 56.598 60.018  1.00 45.76 ? 33   GLU C CG  1 
ATOM   2796  C  CD  . GLU C  1 33  ? 53.198 57.017 61.258  1.00 52.50 ? 33   GLU C CD  1 
ATOM   2797  O  OE1 . GLU C  1 33  ? 53.510 58.087 61.836  1.00 53.95 ? 33   GLU C OE1 1 
ATOM   2798  O  OE2 . GLU C  1 33  ? 52.264 56.274 61.652  1.00 49.90 ? 33   GLU C OE2 1 
ATOM   2799  N  N   . ASP C  1 34  ? 54.874 58.922 56.444  1.00 30.94 ? 34   ASP C N   1 
ATOM   2800  C  CA  . ASP C  1 34  ? 55.788 59.021 55.302  1.00 31.79 ? 34   ASP C CA  1 
ATOM   2801  C  C   . ASP C  1 34  ? 56.589 60.326 55.251  1.00 31.19 ? 34   ASP C C   1 
ATOM   2802  O  O   . ASP C  1 34  ? 57.684 60.355 54.685  1.00 29.64 ? 34   ASP C O   1 
ATOM   2803  C  CB  . ASP C  1 34  ? 55.024 58.831 53.987  1.00 32.83 ? 34   ASP C CB  1 
ATOM   2804  C  CG  . ASP C  1 34  ? 55.893 59.083 52.762  1.00 38.04 ? 34   ASP C CG  1 
ATOM   2805  O  OD1 . ASP C  1 34  ? 56.965 58.449 52.634  1.00 39.98 ? 34   ASP C OD1 1 
ATOM   2806  O  OD2 . ASP C  1 34  ? 55.498 59.920 51.919  1.00 43.37 ? 34   ASP C OD2 1 
ATOM   2807  N  N   . TRP C  1 35  ? 56.053 61.400 55.832  1.00 29.26 ? 35   TRP C N   1 
ATOM   2808  C  CA  . TRP C  1 35  ? 56.766 62.674 55.844  1.00 26.85 ? 35   TRP C CA  1 
ATOM   2809  C  C   . TRP C  1 35  ? 57.699 62.790 57.033  1.00 27.98 ? 35   TRP C C   1 
ATOM   2810  O  O   . TRP C  1 35  ? 58.419 63.780 57.159  1.00 31.35 ? 35   TRP C O   1 
ATOM   2811  C  CB  . TRP C  1 35  ? 55.802 63.859 55.884  1.00 26.54 ? 35   TRP C CB  1 
ATOM   2812  C  CG  . TRP C  1 35  ? 55.115 64.110 54.599  1.00 26.43 ? 35   TRP C CG  1 
ATOM   2813  C  CD1 . TRP C  1 35  ? 55.635 63.944 53.350  1.00 25.77 ? 35   TRP C CD1 1 
ATOM   2814  C  CD2 . TRP C  1 35  ? 53.781 64.601 54.421  1.00 24.37 ? 35   TRP C CD2 1 
ATOM   2815  N  NE1 . TRP C  1 35  ? 54.705 64.300 52.400  1.00 25.95 ? 35   TRP C NE1 1 
ATOM   2816  C  CE2 . TRP C  1 35  ? 53.559 64.708 53.030  1.00 22.29 ? 35   TRP C CE2 1 
ATOM   2817  C  CE3 . TRP C  1 35  ? 52.753 64.961 55.301  1.00 22.95 ? 35   TRP C CE3 1 
ATOM   2818  C  CZ2 . TRP C  1 35  ? 52.351 65.159 52.496  1.00 16.50 ? 35   TRP C CZ2 1 
ATOM   2819  C  CZ3 . TRP C  1 35  ? 51.547 65.411 54.767  1.00 21.48 ? 35   TRP C CZ3 1 
ATOM   2820  C  CH2 . TRP C  1 35  ? 51.359 65.504 53.378  1.00 18.09 ? 35   TRP C CH2 1 
ATOM   2821  N  N   . GLY C  1 36  ? 57.677 61.795 57.915  1.00 26.75 ? 36   GLY C N   1 
ATOM   2822  C  CA  . GLY C  1 36  ? 58.546 61.837 59.076  1.00 26.46 ? 36   GLY C CA  1 
ATOM   2823  C  C   . GLY C  1 36  ? 57.932 62.630 60.215  1.00 29.42 ? 36   GLY C C   1 
ATOM   2824  O  O   . GLY C  1 36  ? 58.628 63.068 61.138  1.00 29.44 ? 36   GLY C O   1 
ATOM   2825  N  N   . LEU C  1 37  ? 56.619 62.822 60.145  1.00 29.98 ? 37   LEU C N   1 
ATOM   2826  C  CA  . LEU C  1 37  ? 55.895 63.546 61.180  1.00 30.21 ? 37   LEU C CA  1 
ATOM   2827  C  C   . LEU C  1 37  ? 55.229 62.499 62.081  1.00 30.62 ? 37   LEU C C   1 
ATOM   2828  O  O   . LEU C  1 37  ? 54.002 62.410 62.152  1.00 30.49 ? 37   LEU C O   1 
ATOM   2829  C  CB  . LEU C  1 37  ? 54.858 64.477 60.530  1.00 28.47 ? 37   LEU C CB  1 
ATOM   2830  C  CG  . LEU C  1 37  ? 55.441 65.474 59.507  1.00 26.37 ? 37   LEU C CG  1 
ATOM   2831  C  CD1 . LEU C  1 37  ? 54.363 66.387 58.991  1.00 21.91 ? 37   LEU C CD1 1 
ATOM   2832  C  CD2 . LEU C  1 37  ? 56.534 66.302 60.161  1.00 27.25 ? 37   LEU C CD2 1 
ATOM   2833  N  N   . GLU C  1 38  ? 56.071 61.721 62.767  1.00 32.33 ? 38   GLU C N   1 
ATOM   2834  C  CA  . GLU C  1 38  ? 55.664 60.626 63.664  1.00 35.77 ? 38   GLU C CA  1 
ATOM   2835  C  C   . GLU C  1 38  ? 54.582 60.935 64.695  1.00 33.83 ? 38   GLU C C   1 
ATOM   2836  O  O   . GLU C  1 38  ? 53.577 60.233 64.776  1.00 33.99 ? 38   GLU C O   1 
ATOM   2837  C  CB  . GLU C  1 38  ? 56.890 60.079 64.406  1.00 41.59 ? 38   GLU C CB  1 
ATOM   2838  C  CG  . GLU C  1 38  ? 58.153 60.002 63.551  1.00 53.48 ? 38   GLU C CG  1 
ATOM   2839  C  CD  . GLU C  1 38  ? 57.955 59.227 62.252  1.00 61.34 ? 38   GLU C CD  1 
ATOM   2840  O  OE1 . GLU C  1 38  ? 58.804 59.377 61.341  1.00 66.07 ? 38   GLU C OE1 1 
ATOM   2841  O  OE2 . GLU C  1 38  ? 56.961 58.467 62.142  1.00 62.67 ? 38   GLU C OE2 1 
ATOM   2842  N  N   . LYS C  1 39  ? 54.803 61.962 65.503  1.00 32.78 ? 39   LYS C N   1 
ATOM   2843  C  CA  . LYS C  1 39  ? 53.838 62.346 66.524  1.00 32.18 ? 39   LYS C CA  1 
ATOM   2844  C  C   . LYS C  1 39  ? 52.470 62.557 65.873  1.00 28.32 ? 39   LYS C C   1 
ATOM   2845  O  O   . LYS C  1 39  ? 51.466 61.966 66.276  1.00 25.35 ? 39   LYS C O   1 
ATOM   2846  C  CB  . LYS C  1 39  ? 54.315 63.630 67.213  1.00 36.36 ? 39   LYS C CB  1 
ATOM   2847  C  CG  . LYS C  1 39  ? 53.477 64.078 68.400  1.00 45.44 ? 39   LYS C CG  1 
ATOM   2848  C  CD  . LYS C  1 39  ? 54.114 65.287 69.090  1.00 51.43 ? 39   LYS C CD  1 
ATOM   2849  C  CE  . LYS C  1 39  ? 53.226 65.854 70.197  1.00 55.06 ? 39   LYS C CE  1 
ATOM   2850  N  NZ  . LYS C  1 39  ? 53.755 67.152 70.742  1.00 59.04 ? 39   LYS C NZ  1 
ATOM   2851  N  N   . LEU C  1 40  ? 52.454 63.382 64.837  1.00 24.80 ? 40   LEU C N   1 
ATOM   2852  C  CA  . LEU C  1 40  ? 51.236 63.696 64.109  1.00 22.67 ? 40   LEU C CA  1 
ATOM   2853  C  C   . LEU C  1 40  ? 50.647 62.449 63.457  1.00 23.12 ? 40   LEU C C   1 
ATOM   2854  O  O   . LEU C  1 40  ? 49.424 62.267 63.405  1.00 24.14 ? 40   LEU C O   1 
ATOM   2855  C  CB  . LEU C  1 40  ? 51.562 64.745 63.057  1.00 24.10 ? 40   LEU C CB  1 
ATOM   2856  C  CG  . LEU C  1 40  ? 50.455 65.585 62.452  1.00 24.43 ? 40   LEU C CG  1 
ATOM   2857  C  CD1 . LEU C  1 40  ? 49.450 66.000 63.511  1.00 27.75 ? 40   LEU C CD1 1 
ATOM   2858  C  CD2 . LEU C  1 40  ? 51.103 66.795 61.813  1.00 24.92 ? 40   LEU C CD2 1 
ATOM   2859  N  N   . GLY C  1 41  ? 51.522 61.587 62.958  1.00 22.48 ? 41   GLY C N   1 
ATOM   2860  C  CA  . GLY C  1 41  ? 51.062 60.366 62.329  1.00 24.57 ? 41   GLY C CA  1 
ATOM   2861  C  C   . GLY C  1 41  ? 50.436 59.398 63.314  1.00 27.61 ? 41   GLY C C   1 
ATOM   2862  O  O   . GLY C  1 41  ? 49.367 58.842 63.059  1.00 28.26 ? 41   GLY C O   1 
ATOM   2863  N  N   . LYS C  1 42  ? 51.098 59.184 64.444  1.00 31.24 ? 42   LYS C N   1 
ATOM   2864  C  CA  . LYS C  1 42  ? 50.586 58.264 65.451  1.00 32.85 ? 42   LYS C CA  1 
ATOM   2865  C  C   . LYS C  1 42  ? 49.215 58.728 65.941  1.00 31.75 ? 42   LYS C C   1 
ATOM   2866  O  O   . LYS C  1 42  ? 48.294 57.930 66.086  1.00 32.01 ? 42   LYS C O   1 
ATOM   2867  C  CB  . LYS C  1 42  ? 51.572 58.161 66.622  1.00 37.10 ? 42   LYS C CB  1 
ATOM   2868  C  CG  . LYS C  1 42  ? 51.126 57.242 67.757  1.00 43.64 ? 42   LYS C CG  1 
ATOM   2869  C  CD  . LYS C  1 42  ? 52.039 57.393 68.978  1.00 49.50 ? 42   LYS C CD  1 
ATOM   2870  C  CE  . LYS C  1 42  ? 51.458 56.714 70.228  1.00 53.70 ? 42   LYS C CE  1 
ATOM   2871  N  NZ  . LYS C  1 42  ? 51.337 55.223 70.106  1.00 53.05 ? 42   LYS C NZ  1 
ATOM   2872  N  N   . HIS C  1 43  ? 49.069 60.020 66.190  1.00 31.58 ? 43   HIS C N   1 
ATOM   2873  C  CA  . HIS C  1 43  ? 47.785 60.524 66.650  1.00 33.17 ? 43   HIS C CA  1 
ATOM   2874  C  C   . HIS C  1 43  ? 46.717 60.272 65.578  1.00 33.50 ? 43   HIS C C   1 
ATOM   2875  O  O   . HIS C  1 43  ? 45.642 59.744 65.871  1.00 34.62 ? 43   HIS C O   1 
ATOM   2876  C  CB  . HIS C  1 43  ? 47.880 62.021 66.965  1.00 35.24 ? 43   HIS C CB  1 
ATOM   2877  C  CG  . HIS C  1 43  ? 46.748 62.529 67.803  1.00 42.71 ? 43   HIS C CG  1 
ATOM   2878  N  ND1 . HIS C  1 43  ? 45.446 62.577 67.347  1.00 46.11 ? 43   HIS C ND1 1 
ATOM   2879  C  CD2 . HIS C  1 43  ? 46.712 62.956 69.088  1.00 44.06 ? 43   HIS C CD2 1 
ATOM   2880  C  CE1 . HIS C  1 43  ? 44.658 63.007 68.316  1.00 47.15 ? 43   HIS C CE1 1 
ATOM   2881  N  NE2 . HIS C  1 43  ? 45.401 63.243 69.384  1.00 47.93 ? 43   HIS C NE2 1 
ATOM   2882  N  N   . GLU C  1 44  ? 47.021 60.637 64.335  1.00 33.23 ? 44   GLU C N   1 
ATOM   2883  C  CA  . GLU C  1 44  ? 46.088 60.446 63.224  1.00 33.37 ? 44   GLU C CA  1 
ATOM   2884  C  C   . GLU C  1 44  ? 45.744 58.965 63.055  1.00 31.29 ? 44   GLU C C   1 
ATOM   2885  O  O   . GLU C  1 44  ? 44.643 58.607 62.644  1.00 28.99 ? 44   GLU C O   1 
ATOM   2886  C  CB  . GLU C  1 44  ? 46.709 60.979 61.933  1.00 36.23 ? 44   GLU C CB  1 
ATOM   2887  C  CG  . GLU C  1 44  ? 45.748 61.075 60.764  1.00 42.34 ? 44   GLU C CG  1 
ATOM   2888  C  CD  . GLU C  1 44  ? 44.632 62.073 61.016  1.00 46.32 ? 44   GLU C CD  1 
ATOM   2889  O  OE1 . GLU C  1 44  ? 44.883 63.070 61.728  1.00 45.91 ? 44   GLU C OE1 1 
ATOM   2890  O  OE2 . GLU C  1 44  ? 43.512 61.867 60.494  1.00 49.15 ? 44   GLU C OE2 1 
ATOM   2891  N  N   . TYR C  1 45  ? 46.705 58.108 63.374  1.00 32.29 ? 45   TYR C N   1 
ATOM   2892  C  CA  . TYR C  1 45  ? 46.520 56.670 63.271  1.00 32.98 ? 45   TYR C CA  1 
ATOM   2893  C  C   . TYR C  1 45  ? 45.453 56.218 64.255  1.00 32.89 ? 45   TYR C C   1 
ATOM   2894  O  O   . TYR C  1 45  ? 44.473 55.580 63.869  1.00 33.18 ? 45   TYR C O   1 
ATOM   2895  C  CB  . TYR C  1 45  ? 47.834 55.955 63.578  1.00 35.32 ? 45   TYR C CB  1 
ATOM   2896  C  CG  . TYR C  1 45  ? 47.718 54.452 63.667  1.00 37.09 ? 45   TYR C CG  1 
ATOM   2897  C  CD1 . TYR C  1 45  ? 47.690 53.662 62.519  1.00 39.20 ? 45   TYR C CD1 1 
ATOM   2898  C  CD2 . TYR C  1 45  ? 47.614 53.821 64.903  1.00 39.24 ? 45   TYR C CD2 1 
ATOM   2899  C  CE1 . TYR C  1 45  ? 47.561 52.271 62.605  1.00 41.43 ? 45   TYR C CE1 1 
ATOM   2900  C  CE2 . TYR C  1 45  ? 47.482 52.443 65.001  1.00 40.48 ? 45   TYR C CE2 1 
ATOM   2901  C  CZ  . TYR C  1 45  ? 47.456 51.671 63.853  1.00 41.79 ? 45   TYR C CZ  1 
ATOM   2902  O  OH  . TYR C  1 45  ? 47.318 50.305 63.963  1.00 43.55 ? 45   TYR C OH  1 
ATOM   2903  N  N   . HIS C  1 46  ? 45.653 56.548 65.528  1.00 33.46 ? 46   HIS C N   1 
ATOM   2904  C  CA  . HIS C  1 46  ? 44.707 56.181 66.576  1.00 34.22 ? 46   HIS C CA  1 
ATOM   2905  C  C   . HIS C  1 46  ? 43.326 56.694 66.260  1.00 32.12 ? 46   HIS C C   1 
ATOM   2906  O  O   . HIS C  1 46  ? 42.332 56.000 66.461  1.00 30.02 ? 46   HIS C O   1 
ATOM   2907  C  CB  . HIS C  1 46  ? 45.154 56.744 67.918  1.00 40.51 ? 46   HIS C CB  1 
ATOM   2908  C  CG  . HIS C  1 46  ? 46.343 56.044 68.484  1.00 49.66 ? 46   HIS C CG  1 
ATOM   2909  N  ND1 . HIS C  1 46  ? 46.324 54.705 68.812  1.00 52.69 ? 46   HIS C ND1 1 
ATOM   2910  C  CD2 . HIS C  1 46  ? 47.600 56.478 68.736  1.00 53.90 ? 46   HIS C CD2 1 
ATOM   2911  C  CE1 . HIS C  1 46  ? 47.520 54.345 69.240  1.00 57.79 ? 46   HIS C CE1 1 
ATOM   2912  N  NE2 . HIS C  1 46  ? 48.313 55.402 69.203  1.00 59.04 ? 46   HIS C NE2 1 
ATOM   2913  N  N   . GLU C  1 47  ? 43.266 57.917 65.762  1.00 30.67 ? 47   GLU C N   1 
ATOM   2914  C  CA  . GLU C  1 47  ? 41.993 58.494 65.416  1.00 33.39 ? 47   GLU C CA  1 
ATOM   2915  C  C   . GLU C  1 47  ? 41.242 57.599 64.436  1.00 32.15 ? 47   GLU C C   1 
ATOM   2916  O  O   . GLU C  1 47  ? 40.024 57.482 64.512  1.00 35.64 ? 47   GLU C O   1 
ATOM   2917  C  CB  . GLU C  1 47  ? 42.192 59.881 64.823  1.00 40.94 ? 47   GLU C CB  1 
ATOM   2918  C  CG  . GLU C  1 47  ? 40.888 60.595 64.560  1.00 53.92 ? 47   GLU C CG  1 
ATOM   2919  C  CD  . GLU C  1 47  ? 41.074 62.081 64.367  1.00 60.78 ? 47   GLU C CD  1 
ATOM   2920  O  OE1 . GLU C  1 47  ? 41.425 62.763 65.363  1.00 61.62 ? 47   GLU C OE1 1 
ATOM   2921  O  OE2 . GLU C  1 47  ? 40.870 62.561 63.222  1.00 63.62 ? 47   GLU C OE2 1 
ATOM   2922  N  N   . SER C  1 48  ? 41.948 56.953 63.515  1.00 31.52 ? 48   SER C N   1 
ATOM   2923  C  CA  . SER C  1 48  ? 41.250 56.083 62.574  1.00 30.45 ? 48   SER C CA  1 
ATOM   2924  C  C   . SER C  1 48  ? 40.839 54.789 63.272  1.00 27.12 ? 48   SER C C   1 
ATOM   2925  O  O   . SER C  1 48  ? 39.779 54.237 62.975  1.00 26.90 ? 48   SER C O   1 
ATOM   2926  C  CB  . SER C  1 48  ? 42.116 55.764 61.348  1.00 29.05 ? 48   SER C CB  1 
ATOM   2927  O  OG  . SER C  1 48  ? 42.999 54.701 61.629  1.00 33.71 ? 48   SER C OG  1 
ATOM   2928  N  N   . ILE C  1 49  ? 41.662 54.302 64.198  1.00 24.55 ? 49   ILE C N   1 
ATOM   2929  C  CA  . ILE C  1 49  ? 41.310 53.076 64.912  1.00 23.57 ? 49   ILE C CA  1 
ATOM   2930  C  C   . ILE C  1 49  ? 40.033 53.301 65.727  1.00 26.81 ? 49   ILE C C   1 
ATOM   2931  O  O   . ILE C  1 49  ? 39.219 52.383 65.873  1.00 27.56 ? 49   ILE C O   1 
ATOM   2932  C  CB  . ILE C  1 49  ? 42.426 52.609 65.863  1.00 20.95 ? 49   ILE C CB  1 
ATOM   2933  C  CG1 . ILE C  1 49  ? 43.710 52.324 65.079  1.00 26.31 ? 49   ILE C CG1 1 
ATOM   2934  C  CG2 . ILE C  1 49  ? 42.005 51.328 66.550  1.00 21.03 ? 49   ILE C CG2 1 
ATOM   2935  C  CD1 . ILE C  1 49  ? 43.624 51.110 64.137  1.00 28.23 ? 49   ILE C CD1 1 
ATOM   2936  N  N   . ASP C  1 50  ? 39.854 54.512 66.260  1.00 26.64 ? 50   ASP C N   1 
ATOM   2937  C  CA  . ASP C  1 50  ? 38.640 54.820 67.016  1.00 28.67 ? 50   ASP C CA  1 
ATOM   2938  C  C   . ASP C  1 50  ? 37.444 54.709 66.070  1.00 29.66 ? 50   ASP C C   1 
ATOM   2939  O  O   . ASP C  1 50  ? 36.423 54.090 66.402  1.00 28.17 ? 50   ASP C O   1 
ATOM   2940  C  CB  . ASP C  1 50  ? 38.665 56.247 67.580  1.00 32.90 ? 50   ASP C CB  1 
ATOM   2941  C  CG  . ASP C  1 50  ? 39.695 56.435 68.676  1.00 36.21 ? 50   ASP C CG  1 
ATOM   2942  O  OD1 . ASP C  1 50  ? 39.967 55.467 69.421  1.00 38.38 ? 50   ASP C OD1 1 
ATOM   2943  O  OD2 . ASP C  1 50  ? 40.219 57.564 68.802  1.00 38.82 ? 50   ASP C OD2 1 
ATOM   2944  N  N   . GLU C  1 51  ? 37.580 55.331 64.899  1.00 28.46 ? 51   GLU C N   1 
ATOM   2945  C  CA  . GLU C  1 51  ? 36.530 55.318 63.883  1.00 30.14 ? 51   GLU C CA  1 
ATOM   2946  C  C   . GLU C  1 51  ? 36.178 53.877 63.521  1.00 29.62 ? 51   GLU C C   1 
ATOM   2947  O  O   . GLU C  1 51  ? 35.018 53.550 63.238  1.00 28.68 ? 51   GLU C O   1 
ATOM   2948  C  CB  . GLU C  1 51  ? 36.963 56.112 62.631  1.00 37.57 ? 51   GLU C CB  1 
ATOM   2949  C  CG  . GLU C  1 51  ? 37.411 57.536 62.920  1.00 42.50 ? 51   GLU C CG  1 
ATOM   2950  C  CD  . GLU C  1 51  ? 36.308 58.367 63.539  1.00 47.16 ? 51   GLU C CD  1 
ATOM   2951  O  OE1 . GLU C  1 51  ? 35.230 57.815 63.812  1.00 51.68 ? 51   GLU C OE1 1 
ATOM   2952  O  OE2 . GLU C  1 51  ? 36.521 59.577 63.756  1.00 52.35 ? 51   GLU C OE2 1 
ATOM   2953  N  N   . MET C  1 52  ? 37.188 53.014 63.534  1.00 28.44 ? 52   MET C N   1 
ATOM   2954  C  CA  . MET C  1 52  ? 36.983 51.608 63.229  1.00 26.06 ? 52   MET C CA  1 
ATOM   2955  C  C   . MET C  1 52  ? 36.139 50.985 64.336  1.00 26.78 ? 52   MET C C   1 
ATOM   2956  O  O   . MET C  1 52  ? 35.325 50.102 64.086  1.00 28.01 ? 52   MET C O   1 
ATOM   2957  C  CB  . MET C  1 52  ? 38.333 50.890 63.105  1.00 25.11 ? 52   MET C CB  1 
ATOM   2958  C  CG  . MET C  1 52  ? 39.038 51.122 61.762  1.00 26.55 ? 52   MET C CG  1 
ATOM   2959  S  SD  . MET C  1 52  ? 40.626 50.244 61.552  1.00 31.15 ? 52   MET C SD  1 
ATOM   2960  C  CE  . MET C  1 52  ? 41.653 51.567 60.922  1.00 28.37 ? 52   MET C CE  1 
ATOM   2961  N  N   . LYS C  1 53  ? 36.320 51.464 65.562  1.00 27.84 ? 53   LYS C N   1 
ATOM   2962  C  CA  . LYS C  1 53  ? 35.565 50.942 66.694  1.00 26.06 ? 53   LYS C CA  1 
ATOM   2963  C  C   . LYS C  1 53  ? 34.141 51.467 66.671  1.00 26.46 ? 53   LYS C C   1 
ATOM   2964  O  O   . LYS C  1 53  ? 33.202 50.767 67.064  1.00 25.60 ? 53   LYS C O   1 
ATOM   2965  C  CB  . LYS C  1 53  ? 36.250 51.319 67.997  1.00 28.68 ? 53   LYS C CB  1 
ATOM   2966  C  CG  . LYS C  1 53  ? 37.650 50.733 68.139  1.00 30.31 ? 53   LYS C CG  1 
ATOM   2967  C  CD  . LYS C  1 53  ? 38.187 50.994 69.530  1.00 34.17 ? 53   LYS C CD  1 
ATOM   2968  C  CE  . LYS C  1 53  ? 39.583 50.452 69.694  1.00 35.44 ? 53   LYS C CE  1 
ATOM   2969  N  NZ  . LYS C  1 53  ? 39.987 50.503 71.129  1.00 40.88 ? 53   LYS C NZ  1 
ATOM   2970  N  N   . HIS C  1 54  ? 33.979 52.709 66.226  1.00 26.45 ? 54   HIS C N   1 
ATOM   2971  C  CA  . HIS C  1 54  ? 32.646 53.289 66.107  1.00 27.34 ? 54   HIS C CA  1 
ATOM   2972  C  C   . HIS C  1 54  ? 31.888 52.473 65.094  1.00 27.43 ? 54   HIS C C   1 
ATOM   2973  O  O   . HIS C  1 54  ? 30.718 52.140 65.285  1.00 28.90 ? 54   HIS C O   1 
ATOM   2974  C  CB  . HIS C  1 54  ? 32.721 54.748 65.666  1.00 30.78 ? 54   HIS C CB  1 
ATOM   2975  C  CG  . HIS C  1 54  ? 33.318 55.661 66.722  1.00 35.04 ? 54   HIS C CG  1 
ATOM   2976  N  ND1 . HIS C  1 54  ? 33.615 56.982 66.457  1.00 33.91 ? 54   HIS C ND1 1 
ATOM   2977  C  CD2 . HIS C  1 54  ? 33.656 55.452 68.017  1.00 34.22 ? 54   HIS C CD2 1 
ATOM   2978  C  CE1 . HIS C  1 54  ? 34.108 57.545 67.545  1.00 33.89 ? 54   HIS C CE1 1 
ATOM   2979  N  NE2 . HIS C  1 54  ? 34.143 56.639 68.506  1.00 32.21 ? 54   HIS C NE2 1 
ATOM   2980  N  N   . ALA C  1 55  ? 32.563 52.151 63.992  1.00 25.99 ? 55   ALA C N   1 
ATOM   2981  C  CA  . ALA C  1 55  ? 31.975 51.349 62.920  1.00 22.94 ? 55   ALA C CA  1 
ATOM   2982  C  C   . ALA C  1 55  ? 31.538 50.007 63.466  1.00 22.25 ? 55   ALA C C   1 
ATOM   2983  O  O   . ALA C  1 55  ? 30.434 49.545 63.183  1.00 23.49 ? 55   ALA C O   1 
ATOM   2984  C  CB  . ALA C  1 55  ? 32.984 51.138 61.805  1.00 21.47 ? 55   ALA C CB  1 
ATOM   2985  N  N   . ASP C  1 56  ? 32.409 49.387 64.255  1.00 23.65 ? 56   ASP C N   1 
ATOM   2986  C  CA  . ASP C  1 56  ? 32.128 48.079 64.840  1.00 25.92 ? 56   ASP C CA  1 
ATOM   2987  C  C   . ASP C  1 56  ? 30.848 48.107 65.675  1.00 27.41 ? 56   ASP C C   1 
ATOM   2988  O  O   . ASP C  1 56  ? 29.946 47.286 65.461  1.00 27.46 ? 56   ASP C O   1 
ATOM   2989  C  CB  . ASP C  1 56  ? 33.315 47.616 65.698  1.00 25.41 ? 56   ASP C CB  1 
ATOM   2990  C  CG  . ASP C  1 56  ? 33.262 46.126 66.018  1.00 31.38 ? 56   ASP C CG  1 
ATOM   2991  O  OD1 . ASP C  1 56  ? 32.562 45.381 65.296  1.00 33.75 ? 56   ASP C OD1 1 
ATOM   2992  O  OD2 . ASP C  1 56  ? 33.933 45.688 66.980  1.00 32.25 ? 56   ASP C OD2 1 
ATOM   2993  N  N   . LYS C  1 57  ? 30.764 49.055 66.611  1.00 26.33 ? 57   LYS C N   1 
ATOM   2994  C  CA  . LYS C  1 57  ? 29.588 49.178 67.467  1.00 27.15 ? 57   LYS C CA  1 
ATOM   2995  C  C   . LYS C  1 57  ? 28.315 49.310 66.642  1.00 28.74 ? 57   LYS C C   1 
ATOM   2996  O  O   . LYS C  1 57  ? 27.316 48.628 66.903  1.00 30.40 ? 57   LYS C O   1 
ATOM   2997  C  CB  . LYS C  1 57  ? 29.702 50.393 68.388  1.00 30.21 ? 57   LYS C CB  1 
ATOM   2998  C  CG  . LYS C  1 57  ? 30.699 50.258 69.524  1.00 35.30 ? 57   LYS C CG  1 
ATOM   2999  C  CD  . LYS C  1 57  ? 30.526 51.423 70.496  1.00 43.50 ? 57   LYS C CD  1 
ATOM   3000  C  CE  . LYS C  1 57  ? 31.613 51.443 71.570  1.00 49.43 ? 57   LYS C CE  1 
ATOM   3001  N  NZ  . LYS C  1 57  ? 32.983 51.677 71.002  1.00 50.16 ? 57   LYS C NZ  1 
ATOM   3002  N  N   . LEU C  1 58  ? 28.348 50.197 65.652  1.00 27.73 ? 58   LEU C N   1 
ATOM   3003  C  CA  . LEU C  1 58  ? 27.193 50.416 64.790  1.00 24.90 ? 58   LEU C CA  1 
ATOM   3004  C  C   . LEU C  1 58  ? 26.769 49.118 64.117  1.00 23.27 ? 58   LEU C C   1 
ATOM   3005  O  O   . LEU C  1 58  ? 25.607 48.726 64.188  1.00 22.77 ? 58   LEU C O   1 
ATOM   3006  C  CB  . LEU C  1 58  ? 27.518 51.481 63.738  1.00 23.61 ? 58   LEU C CB  1 
ATOM   3007  C  CG  . LEU C  1 58  ? 27.699 52.878 64.339  1.00 25.44 ? 58   LEU C CG  1 
ATOM   3008  C  CD1 . LEU C  1 58  ? 28.260 53.831 63.296  1.00 24.63 ? 58   LEU C CD1 1 
ATOM   3009  C  CD2 . LEU C  1 58  ? 26.356 53.382 64.889  1.00 20.32 ? 58   LEU C CD2 1 
ATOM   3010  N  N   . ILE C  1 59  ? 27.723 48.446 63.484  1.00 22.62 ? 59   ILE C N   1 
ATOM   3011  C  CA  . ILE C  1 59  ? 27.444 47.191 62.799  1.00 26.64 ? 59   ILE C CA  1 
ATOM   3012  C  C   . ILE C  1 59  ? 26.754 46.183 63.720  1.00 27.31 ? 59   ILE C C   1 
ATOM   3013  O  O   . ILE C  1 59  ? 25.744 45.582 63.338  1.00 27.60 ? 59   ILE C O   1 
ATOM   3014  C  CB  . ILE C  1 59  ? 28.753 46.567 62.226  1.00 28.31 ? 59   ILE C CB  1 
ATOM   3015  C  CG1 . ILE C  1 59  ? 29.361 47.503 61.175  1.00 27.10 ? 59   ILE C CG1 1 
ATOM   3016  C  CG2 . ILE C  1 59  ? 28.466 45.218 61.586  1.00 23.12 ? 59   ILE C CG2 1 
ATOM   3017  C  CD1 . ILE C  1 59  ? 30.754 47.090 60.735  1.00 30.43 ? 59   ILE C CD1 1 
ATOM   3018  N  N   . LYS C  1 60  ? 27.298 45.999 64.925  1.00 28.42 ? 60   LYS C N   1 
ATOM   3019  C  CA  . LYS C  1 60  ? 26.728 45.064 65.902  1.00 29.12 ? 60   LYS C CA  1 
ATOM   3020  C  C   . LYS C  1 60  ? 25.320 45.482 66.286  1.00 28.49 ? 60   LYS C C   1 
ATOM   3021  O  O   . LYS C  1 60  ? 24.409 44.653 66.351  1.00 28.89 ? 60   LYS C O   1 
ATOM   3022  C  CB  . LYS C  1 60  ? 27.572 45.018 67.177  1.00 33.26 ? 60   LYS C CB  1 
ATOM   3023  C  CG  . LYS C  1 60  ? 28.971 44.453 67.006  1.00 38.67 ? 60   LYS C CG  1 
ATOM   3024  C  CD  . LYS C  1 60  ? 29.748 44.536 68.306  1.00 41.53 ? 60   LYS C CD  1 
ATOM   3025  C  CE  . LYS C  1 60  ? 31.185 44.083 68.114  1.00 47.49 ? 60   LYS C CE  1 
ATOM   3026  N  NZ  . LYS C  1 60  ? 32.004 44.351 69.333  1.00 50.48 ? 60   LYS C NZ  1 
ATOM   3027  N  N   . ARG C  1 61  ? 25.144 46.771 66.560  1.00 25.32 ? 61   ARG C N   1 
ATOM   3028  C  CA  . ARG C  1 61  ? 23.833 47.271 66.934  1.00 24.80 ? 61   ARG C CA  1 
ATOM   3029  C  C   . ARG C  1 61  ? 22.844 46.963 65.813  1.00 25.30 ? 61   ARG C C   1 
ATOM   3030  O  O   . ARG C  1 61  ? 21.803 46.351 66.044  1.00 28.16 ? 61   ARG C O   1 
ATOM   3031  C  CB  . ARG C  1 61  ? 23.887 48.778 67.195  1.00 24.10 ? 61   ARG C CB  1 
ATOM   3032  C  CG  . ARG C  1 61  ? 22.557 49.381 67.642  1.00 21.12 ? 61   ARG C CG  1 
ATOM   3033  C  CD  . ARG C  1 61  ? 22.056 48.705 68.904  1.00 18.95 ? 61   ARG C CD  1 
ATOM   3034  N  NE  . ARG C  1 61  ? 20.814 49.297 69.390  1.00 20.23 ? 61   ARG C NE  1 
ATOM   3035  C  CZ  . ARG C  1 61  ? 20.111 48.820 70.414  1.00 19.05 ? 61   ARG C CZ  1 
ATOM   3036  N  NH1 . ARG C  1 61  ? 20.533 47.743 71.059  1.00 19.15 ? 61   ARG C NH1 1 
ATOM   3037  N  NH2 . ARG C  1 61  ? 18.983 49.413 70.793  1.00 18.32 ? 61   ARG C NH2 1 
ATOM   3038  N  N   . ILE C  1 62  ? 23.178 47.370 64.596  1.00 23.91 ? 62   ILE C N   1 
ATOM   3039  C  CA  . ILE C  1 62  ? 22.301 47.121 63.456  1.00 25.92 ? 62   ILE C CA  1 
ATOM   3040  C  C   . ILE C  1 62  ? 21.924 45.651 63.297  1.00 26.15 ? 62   ILE C C   1 
ATOM   3041  O  O   . ILE C  1 62  ? 20.771 45.333 62.996  1.00 24.76 ? 62   ILE C O   1 
ATOM   3042  C  CB  . ILE C  1 62  ? 22.934 47.615 62.147  1.00 25.47 ? 62   ILE C CB  1 
ATOM   3043  C  CG1 . ILE C  1 62  ? 23.108 49.138 62.214  1.00 26.96 ? 62   ILE C CG1 1 
ATOM   3044  C  CG2 . ILE C  1 62  ? 22.068 47.194 60.968  1.00 23.09 ? 62   ILE C CG2 1 
ATOM   3045  C  CD1 . ILE C  1 62  ? 23.721 49.741 60.984  1.00 32.40 ? 62   ILE C CD1 1 
ATOM   3046  N  N   . LEU C  1 63  ? 22.890 44.758 63.491  1.00 26.45 ? 63   LEU C N   1 
ATOM   3047  C  CA  . LEU C  1 63  ? 22.619 43.325 63.380  1.00 26.52 ? 63   LEU C CA  1 
ATOM   3048  C  C   . LEU C  1 63  ? 21.704 42.871 64.511  1.00 27.80 ? 63   LEU C C   1 
ATOM   3049  O  O   . LEU C  1 63  ? 20.840 42.012 64.314  1.00 29.49 ? 63   LEU C O   1 
ATOM   3050  C  CB  . LEU C  1 63  ? 23.918 42.518 63.433  1.00 19.73 ? 63   LEU C CB  1 
ATOM   3051  C  CG  . LEU C  1 63  ? 24.761 42.571 62.164  1.00 21.12 ? 63   LEU C CG  1 
ATOM   3052  C  CD1 . LEU C  1 63  ? 26.110 41.940 62.447  1.00 18.67 ? 63   LEU C CD1 1 
ATOM   3053  C  CD2 . LEU C  1 63  ? 24.026 41.850 61.003  1.00 13.90 ? 63   LEU C CD2 1 
ATOM   3054  N  N   . PHE C  1 64  ? 21.896 43.443 65.698  1.00 28.66 ? 64   PHE C N   1 
ATOM   3055  C  CA  . PHE C  1 64  ? 21.064 43.069 66.828  1.00 29.93 ? 64   PHE C CA  1 
ATOM   3056  C  C   . PHE C  1 64  ? 19.620 43.487 66.575  1.00 29.70 ? 64   PHE C C   1 
ATOM   3057  O  O   . PHE C  1 64  ? 18.693 42.750 66.918  1.00 29.87 ? 64   PHE C O   1 
ATOM   3058  C  CB  . PHE C  1 64  ? 21.559 43.702 68.134  1.00 28.48 ? 64   PHE C CB  1 
ATOM   3059  C  CG  . PHE C  1 64  ? 20.592 43.534 69.274  1.00 28.25 ? 64   PHE C CG  1 
ATOM   3060  C  CD1 . PHE C  1 64  ? 20.153 42.262 69.645  1.00 28.55 ? 64   PHE C CD1 1 
ATOM   3061  C  CD2 . PHE C  1 64  ? 20.061 44.644 69.931  1.00 26.91 ? 64   PHE C CD2 1 
ATOM   3062  C  CE1 . PHE C  1 64  ? 19.188 42.095 70.653  1.00 29.17 ? 64   PHE C CE1 1 
ATOM   3063  C  CE2 . PHE C  1 64  ? 19.098 44.490 70.938  1.00 26.21 ? 64   PHE C CE2 1 
ATOM   3064  C  CZ  . PHE C  1 64  ? 18.660 43.213 71.299  1.00 27.40 ? 64   PHE C CZ  1 
ATOM   3065  N  N   . LEU C  1 65  ? 19.433 44.671 65.991  1.00 28.59 ? 65   LEU C N   1 
ATOM   3066  C  CA  . LEU C  1 65  ? 18.093 45.157 65.686  1.00 29.59 ? 65   LEU C CA  1 
ATOM   3067  C  C   . LEU C  1 65  ? 17.510 44.442 64.465  1.00 31.81 ? 65   LEU C C   1 
ATOM   3068  O  O   . LEU C  1 65  ? 16.422 44.787 63.998  1.00 32.94 ? 65   LEU C O   1 
ATOM   3069  C  CB  . LEU C  1 65  ? 18.111 46.660 65.420  1.00 29.89 ? 65   LEU C CB  1 
ATOM   3070  C  CG  . LEU C  1 65  ? 18.152 47.664 66.573  1.00 30.47 ? 65   LEU C CG  1 
ATOM   3071  C  CD1 . LEU C  1 65  ? 17.852 46.977 67.901  1.00 28.72 ? 65   LEU C CD1 1 
ATOM   3072  C  CD2 . LEU C  1 65  ? 19.515 48.333 66.587  1.00 34.35 ? 65   LEU C CD2 1 
ATOM   3073  N  N   . GLU C  1 66  ? 18.250 43.454 63.954  1.00 33.42 ? 66   GLU C N   1 
ATOM   3074  C  CA  . GLU C  1 66  ? 17.849 42.659 62.794  1.00 31.26 ? 66   GLU C CA  1 
ATOM   3075  C  C   . GLU C  1 66  ? 17.798 43.442 61.486  1.00 31.08 ? 66   GLU C C   1 
ATOM   3076  O  O   . GLU C  1 66  ? 16.858 43.302 60.704  1.00 31.77 ? 66   GLU C O   1 
ATOM   3077  C  CB  . GLU C  1 66  ? 16.495 42.003 63.048  1.00 33.66 ? 66   GLU C CB  1 
ATOM   3078  C  CG  . GLU C  1 66  ? 16.544 40.866 64.042  1.00 41.37 ? 66   GLU C CG  1 
ATOM   3079  C  CD  . GLU C  1 66  ? 15.166 40.342 64.393  1.00 45.80 ? 66   GLU C CD  1 
ATOM   3080  O  OE1 . GLU C  1 66  ? 14.298 40.296 63.489  1.00 50.22 ? 66   GLU C OE1 1 
ATOM   3081  O  OE2 . GLU C  1 66  ? 14.957 39.964 65.568  1.00 47.81 ? 66   GLU C OE2 1 
ATOM   3082  N  N   . GLY C  1 67  ? 18.817 44.258 61.249  1.00 28.99 ? 67   GLY C N   1 
ATOM   3083  C  CA  . GLY C  1 67  ? 18.874 45.036 60.027  1.00 28.31 ? 67   GLY C CA  1 
ATOM   3084  C  C   . GLY C  1 67  ? 20.068 44.633 59.182  1.00 29.29 ? 67   GLY C C   1 
ATOM   3085  O  O   . GLY C  1 67  ? 20.815 43.719 59.533  1.00 30.11 ? 67   GLY C O   1 
ATOM   3086  N  N   . LEU C  1 68  ? 20.271 45.318 58.067  1.00 29.23 ? 68   LEU C N   1 
ATOM   3087  C  CA  . LEU C  1 68  ? 21.391 44.972 57.210  1.00 28.34 ? 68   LEU C CA  1 
ATOM   3088  C  C   . LEU C  1 68  ? 22.440 46.066 57.157  1.00 26.81 ? 68   LEU C C   1 
ATOM   3089  O  O   . LEU C  1 68  ? 22.217 47.122 56.579  1.00 28.68 ? 68   LEU C O   1 
ATOM   3090  C  CB  . LEU C  1 68  ? 20.887 44.664 55.806  1.00 28.22 ? 68   LEU C CB  1 
ATOM   3091  C  CG  . LEU C  1 68  ? 19.849 43.542 55.768  1.00 28.43 ? 68   LEU C CG  1 
ATOM   3092  C  CD1 . LEU C  1 68  ? 19.284 43.426 54.368  1.00 28.48 ? 68   LEU C CD1 1 
ATOM   3093  C  CD2 . LEU C  1 68  ? 20.482 42.237 56.208  1.00 24.38 ? 68   LEU C CD2 1 
ATOM   3094  N  N   . PRO C  1 69  ? 23.599 45.833 57.783  1.00 25.80 ? 69   PRO C N   1 
ATOM   3095  C  CA  . PRO C  1 69  ? 24.659 46.844 57.768  1.00 24.84 ? 69   PRO C CA  1 
ATOM   3096  C  C   . PRO C  1 69  ? 25.026 47.087 56.311  1.00 25.38 ? 69   PRO C C   1 
ATOM   3097  O  O   . PRO C  1 69  ? 24.933 46.174 55.499  1.00 26.48 ? 69   PRO C O   1 
ATOM   3098  C  CB  . PRO C  1 69  ? 25.793 46.174 58.538  1.00 25.02 ? 69   PRO C CB  1 
ATOM   3099  C  CG  . PRO C  1 69  ? 25.082 45.184 59.430  1.00 23.24 ? 69   PRO C CG  1 
ATOM   3100  C  CD  . PRO C  1 69  ? 23.998 44.639 58.550  1.00 23.80 ? 69   PRO C CD  1 
ATOM   3101  N  N   . ASN C  1 70  ? 25.434 48.309 55.987  1.00 28.87 ? 70   ASN C N   1 
ATOM   3102  C  CA  . ASN C  1 70  ? 25.796 48.675 54.616  1.00 30.01 ? 70   ASN C CA  1 
ATOM   3103  C  C   . ASN C  1 70  ? 27.226 49.206 54.554  1.00 30.29 ? 70   ASN C C   1 
ATOM   3104  O  O   . ASN C  1 70  ? 27.472 50.390 54.780  1.00 30.65 ? 70   ASN C O   1 
ATOM   3105  C  CB  . ASN C  1 70  ? 24.842 49.753 54.101  1.00 31.27 ? 70   ASN C CB  1 
ATOM   3106  C  CG  . ASN C  1 70  ? 25.127 50.154 52.665  1.00 33.13 ? 70   ASN C CG  1 
ATOM   3107  O  OD1 . ASN C  1 70  ? 26.268 50.088 52.191  1.00 35.01 ? 70   ASN C OD1 1 
ATOM   3108  N  ND2 . ASN C  1 70  ? 24.089 50.595 51.967  1.00 34.01 ? 70   ASN C ND2 1 
ATOM   3109  N  N   . LEU C  1 71  ? 28.166 48.326 54.247  1.00 31.08 ? 71   LEU C N   1 
ATOM   3110  C  CA  . LEU C  1 71  ? 29.568 48.711 54.156  1.00 30.36 ? 71   LEU C CA  1 
ATOM   3111  C  C   . LEU C  1 71  ? 29.919 48.935 52.695  1.00 30.95 ? 71   LEU C C   1 
ATOM   3112  O  O   . LEU C  1 71  ? 31.087 49.113 52.347  1.00 29.46 ? 71   LEU C O   1 
ATOM   3113  C  CB  . LEU C  1 71  ? 30.461 47.603 54.740  1.00 29.00 ? 71   LEU C CB  1 
ATOM   3114  C  CG  . LEU C  1 71  ? 30.418 47.405 56.262  1.00 28.00 ? 71   LEU C CG  1 
ATOM   3115  C  CD1 . LEU C  1 71  ? 29.194 46.609 56.665  1.00 25.98 ? 71   LEU C CD1 1 
ATOM   3116  C  CD2 . LEU C  1 71  ? 31.677 46.687 56.709  1.00 30.34 ? 71   LEU C CD2 1 
ATOM   3117  N  N   . GLN C  1 72  ? 28.889 48.935 51.850  1.00 31.86 ? 72   GLN C N   1 
ATOM   3118  C  CA  . GLN C  1 72  ? 29.059 49.094 50.413  1.00 33.88 ? 72   GLN C CA  1 
ATOM   3119  C  C   . GLN C  1 72  ? 29.132 50.536 49.900  1.00 35.93 ? 72   GLN C C   1 
ATOM   3120  O  O   . GLN C  1 72  ? 29.749 50.793 48.865  1.00 36.19 ? 72   GLN C O   1 
ATOM   3121  C  CB  . GLN C  1 72  ? 27.939 48.336 49.679  1.00 31.66 ? 72   GLN C CB  1 
ATOM   3122  C  CG  . GLN C  1 72  ? 28.039 48.374 48.146  1.00 31.87 ? 72   GLN C CG  1 
ATOM   3123  C  CD  . GLN C  1 72  ? 29.280 47.662 47.602  1.00 32.61 ? 72   GLN C CD  1 
ATOM   3124  O  OE1 . GLN C  1 72  ? 29.310 46.435 47.496  1.00 32.60 ? 72   GLN C OE1 1 
ATOM   3125  N  NE2 . GLN C  1 72  ? 30.314 48.437 47.266  1.00 29.66 ? 72   GLN C NE2 1 
ATOM   3126  N  N   . GLU C  1 73  ? 28.516 51.479 50.606  1.00 39.19 ? 73   GLU C N   1 
ATOM   3127  C  CA  . GLU C  1 73  ? 28.541 52.869 50.144  1.00 44.29 ? 73   GLU C CA  1 
ATOM   3128  C  C   . GLU C  1 73  ? 29.649 53.678 50.807  1.00 44.18 ? 73   GLU C C   1 
ATOM   3129  O  O   . GLU C  1 73  ? 29.628 53.932 52.018  1.00 44.77 ? 73   GLU C O   1 
ATOM   3130  C  CB  . GLU C  1 73  ? 27.189 53.540 50.399  1.00 49.09 ? 73   GLU C CB  1 
ATOM   3131  C  CG  . GLU C  1 73  ? 26.004 52.605 50.203  1.00 59.93 ? 73   GLU C CG  1 
ATOM   3132  C  CD  . GLU C  1 73  ? 25.825 52.129 48.765  1.00 63.99 ? 73   GLU C CD  1 
ATOM   3133  O  OE1 . GLU C  1 73  ? 26.830 51.802 48.089  1.00 65.65 ? 73   GLU C OE1 1 
ATOM   3134  O  OE2 . GLU C  1 73  ? 24.659 52.066 48.321  1.00 66.63 ? 73   GLU C OE2 1 
ATOM   3135  N  N   . LEU C  1 74  ? 30.626 54.074 50.001  1.00 42.26 ? 74   LEU C N   1 
ATOM   3136  C  CA  . LEU C  1 74  ? 31.741 54.853 50.499  1.00 39.98 ? 74   LEU C CA  1 
ATOM   3137  C  C   . LEU C  1 74  ? 31.553 56.272 49.985  1.00 40.60 ? 74   LEU C C   1 
ATOM   3138  O  O   . LEU C  1 74  ? 31.664 56.522 48.781  1.00 42.29 ? 74   LEU C O   1 
ATOM   3139  C  CB  . LEU C  1 74  ? 33.060 54.285 49.976  1.00 39.26 ? 74   LEU C CB  1 
ATOM   3140  C  CG  . LEU C  1 74  ? 34.303 54.492 50.847  1.00 37.77 ? 74   LEU C CG  1 
ATOM   3141  C  CD1 . LEU C  1 74  ? 35.539 54.288 49.984  1.00 37.17 ? 74   LEU C CD1 1 
ATOM   3142  C  CD2 . LEU C  1 74  ? 34.313 55.877 51.457  1.00 36.83 ? 74   LEU C CD2 1 
ATOM   3143  N  N   . GLY C  1 75  ? 31.261 57.196 50.896  1.00 38.60 ? 75   GLY C N   1 
ATOM   3144  C  CA  . GLY C  1 75  ? 31.061 58.577 50.504  1.00 33.07 ? 75   GLY C CA  1 
ATOM   3145  C  C   . GLY C  1 75  ? 32.363 59.178 50.035  1.00 32.43 ? 75   GLY C C   1 
ATOM   3146  O  O   . GLY C  1 75  ? 33.361 58.481 49.891  1.00 31.99 ? 75   GLY C O   1 
ATOM   3147  N  N   . LYS C  1 76  ? 32.372 60.479 49.807  1.00 33.38 ? 76   LYS C N   1 
ATOM   3148  C  CA  . LYS C  1 76  ? 33.588 61.113 49.341  1.00 37.00 ? 76   LYS C CA  1 
ATOM   3149  C  C   . LYS C  1 76  ? 34.612 61.414 50.442  1.00 37.36 ? 76   LYS C C   1 
ATOM   3150  O  O   . LYS C  1 76  ? 34.291 62.006 51.478  1.00 37.46 ? 76   LYS C O   1 
ATOM   3151  C  CB  . LYS C  1 76  ? 33.255 62.401 48.579  1.00 37.35 ? 76   LYS C CB  1 
ATOM   3152  C  CG  . LYS C  1 76  ? 34.488 63.045 47.986  1.00 40.75 ? 76   LYS C CG  1 
ATOM   3153  C  CD  . LYS C  1 76  ? 34.172 64.208 47.080  1.00 43.39 ? 76   LYS C CD  1 
ATOM   3154  C  CE  . LYS C  1 76  ? 35.439 64.615 46.350  1.00 46.49 ? 76   LYS C CE  1 
ATOM   3155  N  NZ  . LYS C  1 76  ? 36.123 63.411 45.774  1.00 44.19 ? 76   LYS C NZ  1 
ATOM   3156  N  N   . LEU C  1 77  ? 35.849 60.994 50.202  1.00 35.06 ? 77   LEU C N   1 
ATOM   3157  C  CA  . LEU C  1 77  ? 36.935 61.240 51.134  1.00 33.49 ? 77   LEU C CA  1 
ATOM   3158  C  C   . LEU C  1 77  ? 37.447 62.647 50.857  1.00 34.03 ? 77   LEU C C   1 
ATOM   3159  O  O   . LEU C  1 77  ? 37.441 63.100 49.710  1.00 34.41 ? 77   LEU C O   1 
ATOM   3160  C  CB  . LEU C  1 77  ? 38.082 60.251 50.907  1.00 32.64 ? 77   LEU C CB  1 
ATOM   3161  C  CG  . LEU C  1 77  ? 37.974 58.797 51.361  1.00 32.47 ? 77   LEU C CG  1 
ATOM   3162  C  CD1 . LEU C  1 77  ? 36.713 58.164 50.852  1.00 33.37 ? 77   LEU C CD1 1 
ATOM   3163  C  CD2 . LEU C  1 77  ? 39.183 58.044 50.846  1.00 33.27 ? 77   LEU C CD2 1 
ATOM   3164  N  N   . LEU C  1 78  ? 37.889 63.334 51.906  1.00 32.40 ? 78   LEU C N   1 
ATOM   3165  C  CA  . LEU C  1 78  ? 38.428 64.675 51.760  1.00 30.00 ? 78   LEU C CA  1 
ATOM   3166  C  C   . LEU C  1 78  ? 39.918 64.557 52.024  1.00 29.77 ? 78   LEU C C   1 
ATOM   3167  O  O   . LEU C  1 78  ? 40.375 64.737 53.153  1.00 32.68 ? 78   LEU C O   1 
ATOM   3168  C  CB  . LEU C  1 78  ? 37.802 65.629 52.780  1.00 29.54 ? 78   LEU C CB  1 
ATOM   3169  C  CG  . LEU C  1 78  ? 36.275 65.706 52.879  1.00 31.27 ? 78   LEU C CG  1 
ATOM   3170  C  CD1 . LEU C  1 78  ? 35.909 66.693 53.985  1.00 29.38 ? 78   LEU C CD1 1 
ATOM   3171  C  CD2 . LEU C  1 78  ? 35.665 66.129 51.540  1.00 28.59 ? 78   LEU C CD2 1 
ATOM   3172  N  N   . ILE C  1 79  ? 40.680 64.246 50.987  1.00 29.40 ? 79   ILE C N   1 
ATOM   3173  C  CA  . ILE C  1 79  ? 42.121 64.097 51.141  1.00 29.59 ? 79   ILE C CA  1 
ATOM   3174  C  C   . ILE C  1 79  ? 42.871 65.409 50.983  1.00 28.97 ? 79   ILE C C   1 
ATOM   3175  O  O   . ILE C  1 79  ? 42.577 66.200 50.092  1.00 30.68 ? 79   ILE C O   1 
ATOM   3176  C  CB  . ILE C  1 79  ? 42.680 63.086 50.125  1.00 29.20 ? 79   ILE C CB  1 
ATOM   3177  C  CG1 . ILE C  1 79  ? 41.934 61.761 50.278  1.00 26.05 ? 79   ILE C CG1 1 
ATOM   3178  C  CG2 . ILE C  1 79  ? 44.186 62.897 50.339  1.00 27.66 ? 79   ILE C CG2 1 
ATOM   3179  C  CD1 . ILE C  1 79  ? 41.969 61.214 51.692  1.00 21.65 ? 79   ILE C CD1 1 
ATOM   3180  N  N   . GLY C  1 80  ? 43.844 65.634 51.856  1.00 29.10 ? 80   GLY C N   1 
ATOM   3181  C  CA  . GLY C  1 80  ? 44.625 66.851 51.776  1.00 28.94 ? 80   GLY C CA  1 
ATOM   3182  C  C   . GLY C  1 80  ? 45.973 66.567 51.152  1.00 29.27 ? 80   GLY C C   1 
ATOM   3183  O  O   . GLY C  1 80  ? 46.311 65.409 50.896  1.00 29.07 ? 80   GLY C O   1 
ATOM   3184  N  N   . GLU C  1 81  ? 46.746 67.618 50.906  1.00 30.68 ? 81   GLU C N   1 
ATOM   3185  C  CA  . GLU C  1 81  ? 48.069 67.461 50.310  1.00 32.79 ? 81   GLU C CA  1 
ATOM   3186  C  C   . GLU C  1 81  ? 49.165 67.926 51.274  1.00 30.74 ? 81   GLU C C   1 
ATOM   3187  O  O   . GLU C  1 81  ? 50.345 67.665 51.061  1.00 27.09 ? 81   GLU C O   1 
ATOM   3188  C  CB  . GLU C  1 81  ? 48.155 68.253 49.005  1.00 34.04 ? 81   GLU C CB  1 
ATOM   3189  C  CG  . GLU C  1 81  ? 47.061 67.925 48.003  1.00 37.95 ? 81   GLU C CG  1 
ATOM   3190  C  CD  . GLU C  1 81  ? 47.147 68.785 46.754  1.00 39.52 ? 81   GLU C CD  1 
ATOM   3191  O  OE1 . GLU C  1 81  ? 47.276 70.020 46.893  1.00 39.58 ? 81   GLU C OE1 1 
ATOM   3192  O  OE2 . GLU C  1 81  ? 47.082 68.230 45.636  1.00 39.54 ? 81   GLU C OE2 1 
ATOM   3193  N  N   . HIS C  1 82  ? 48.769 68.623 52.332  1.00 32.30 ? 82   HIS C N   1 
ATOM   3194  C  CA  . HIS C  1 82  ? 49.729 69.101 53.316  1.00 32.94 ? 82   HIS C CA  1 
ATOM   3195  C  C   . HIS C  1 82  ? 49.079 69.245 54.693  1.00 31.73 ? 82   HIS C C   1 
ATOM   3196  O  O   . HIS C  1 82  ? 47.869 69.449 54.801  1.00 32.44 ? 82   HIS C O   1 
ATOM   3197  C  CB  . HIS C  1 82  ? 50.364 70.417 52.845  1.00 34.23 ? 82   HIS C CB  1 
ATOM   3198  C  CG  . HIS C  1 82  ? 49.393 71.537 52.663  1.00 38.77 ? 82   HIS C CG  1 
ATOM   3199  N  ND1 . HIS C  1 82  ? 48.863 72.243 53.721  1.00 44.19 ? 82   HIS C ND1 1 
ATOM   3200  C  CD2 . HIS C  1 82  ? 48.879 72.097 51.543  1.00 42.11 ? 82   HIS C CD2 1 
ATOM   3201  C  CE1 . HIS C  1 82  ? 48.066 73.192 53.261  1.00 44.98 ? 82   HIS C CE1 1 
ATOM   3202  N  NE2 . HIS C  1 82  ? 48.058 73.125 51.942  1.00 43.52 ? 82   HIS C NE2 1 
ATOM   3203  N  N   . THR C  1 83  ? 49.901 69.118 55.732  1.00 29.52 ? 83   THR C N   1 
ATOM   3204  C  CA  . THR C  1 83  ? 49.469 69.175 57.125  1.00 27.25 ? 83   THR C CA  1 
ATOM   3205  C  C   . THR C  1 83  ? 48.279 70.064 57.457  1.00 26.27 ? 83   THR C C   1 
ATOM   3206  O  O   . THR C  1 83  ? 47.241 69.581 57.918  1.00 21.42 ? 83   THR C O   1 
ATOM   3207  C  CB  . THR C  1 83  ? 50.638 69.583 58.041  1.00 30.90 ? 83   THR C CB  1 
ATOM   3208  O  OG1 . THR C  1 83  ? 51.699 68.625 57.921  1.00 30.11 ? 83   THR C OG1 1 
ATOM   3209  C  CG2 . THR C  1 83  ? 50.175 69.652 59.498  1.00 30.78 ? 83   THR C CG2 1 
ATOM   3210  N  N   . LYS C  1 84  ? 48.429 71.363 57.233  1.00 28.05 ? 84   LYS C N   1 
ATOM   3211  C  CA  . LYS C  1 84  ? 47.363 72.302 57.547  1.00 30.20 ? 84   LYS C CA  1 
ATOM   3212  C  C   . LYS C  1 84  ? 46.048 71.957 56.861  1.00 30.43 ? 84   LYS C C   1 
ATOM   3213  O  O   . LYS C  1 84  ? 44.977 72.069 57.466  1.00 31.12 ? 84   LYS C O   1 
ATOM   3214  C  CB  . LYS C  1 84  ? 47.784 73.728 57.184  1.00 30.23 ? 84   LYS C CB  1 
ATOM   3215  C  CG  . LYS C  1 84  ? 46.828 74.799 57.703  1.00 30.30 ? 84   LYS C CG  1 
ATOM   3216  C  CD  . LYS C  1 84  ? 47.365 76.198 57.427  1.00 34.68 ? 84   LYS C CD  1 
ATOM   3217  C  CE  . LYS C  1 84  ? 46.560 77.254 58.154  1.00 35.01 ? 84   LYS C CE  1 
ATOM   3218  N  NZ  . LYS C  1 84  ? 45.120 77.037 57.912  1.00 36.84 ? 84   LYS C NZ  1 
ATOM   3219  N  N   . GLU C  1 85  ? 46.129 71.533 55.603  1.00 29.37 ? 85   GLU C N   1 
ATOM   3220  C  CA  . GLU C  1 85  ? 44.933 71.175 54.843  1.00 28.87 ? 85   GLU C CA  1 
ATOM   3221  C  C   . GLU C  1 85  ? 44.301 69.877 55.372  1.00 27.28 ? 85   GLU C C   1 
ATOM   3222  O  O   . GLU C  1 85  ? 43.083 69.781 55.528  1.00 27.69 ? 85   GLU C O   1 
ATOM   3223  C  CB  . GLU C  1 85  ? 45.292 71.020 53.368  1.00 28.45 ? 85   GLU C CB  1 
ATOM   3224  C  CG  . GLU C  1 85  ? 44.097 70.886 52.461  1.00 33.42 ? 85   GLU C CG  1 
ATOM   3225  C  CD  . GLU C  1 85  ? 44.497 70.725 51.009  1.00 38.87 ? 85   GLU C CD  1 
ATOM   3226  O  OE1 . GLU C  1 85  ? 45.151 69.711 50.668  1.00 39.09 ? 85   GLU C OE1 1 
ATOM   3227  O  OE2 . GLU C  1 85  ? 44.161 71.618 50.204  1.00 44.55 ? 85   GLU C OE2 1 
ATOM   3228  N  N   . MET C  1 86  ? 45.140 68.884 55.646  1.00 24.17 ? 86   MET C N   1 
ATOM   3229  C  CA  . MET C  1 86  ? 44.682 67.607 56.161  1.00 22.72 ? 86   MET C CA  1 
ATOM   3230  C  C   . MET C  1 86  ? 43.927 67.787 57.483  1.00 25.02 ? 86   MET C C   1 
ATOM   3231  O  O   . MET C  1 86  ? 42.891 67.167 57.693  1.00 24.95 ? 86   MET C O   1 
ATOM   3232  C  CB  . MET C  1 86  ? 45.881 66.677 56.321  1.00 18.39 ? 86   MET C CB  1 
ATOM   3233  C  CG  . MET C  1 86  ? 46.444 66.236 54.985  1.00 17.71 ? 86   MET C CG  1 
ATOM   3234  S  SD  . MET C  1 86  ? 48.146 65.616 55.007  1.00 26.71 ? 86   MET C SD  1 
ATOM   3235  C  CE  . MET C  1 86  ? 47.906 63.984 55.812  1.00 19.63 ? 86   MET C CE  1 
ATOM   3236  N  N   . LEU C  1 87  ? 44.440 68.636 58.372  1.00 27.44 ? 87   LEU C N   1 
ATOM   3237  C  CA  . LEU C  1 87  ? 43.757 68.906 59.639  1.00 25.39 ? 87   LEU C CA  1 
ATOM   3238  C  C   . LEU C  1 87  ? 42.374 69.515 59.336  1.00 26.87 ? 87   LEU C C   1 
ATOM   3239  O  O   . LEU C  1 87  ? 41.366 69.160 59.973  1.00 25.31 ? 87   LEU C O   1 
ATOM   3240  C  CB  . LEU C  1 87  ? 44.577 69.882 60.502  1.00 23.52 ? 87   LEU C CB  1 
ATOM   3241  C  CG  . LEU C  1 87  ? 45.596 69.399 61.558  1.00 25.77 ? 87   LEU C CG  1 
ATOM   3242  C  CD1 . LEU C  1 87  ? 45.627 67.885 61.677  1.00 21.84 ? 87   LEU C CD1 1 
ATOM   3243  C  CD2 . LEU C  1 87  ? 46.970 69.928 61.202  1.00 24.45 ? 87   LEU C CD2 1 
ATOM   3244  N  N   . GLU C  1 88  ? 42.329 70.421 58.355  1.00 27.06 ? 88   GLU C N   1 
ATOM   3245  C  CA  . GLU C  1 88  ? 41.082 71.077 57.965  1.00 28.37 ? 88   GLU C CA  1 
ATOM   3246  C  C   . GLU C  1 88  ? 40.083 70.105 57.352  1.00 31.48 ? 88   GLU C C   1 
ATOM   3247  O  O   . GLU C  1 88  ? 38.874 70.256 57.541  1.00 33.85 ? 88   GLU C O   1 
ATOM   3248  C  CB  . GLU C  1 88  ? 41.355 72.210 56.979  1.00 30.77 ? 88   GLU C CB  1 
ATOM   3249  C  CG  . GLU C  1 88  ? 42.041 73.434 57.585  1.00 35.10 ? 88   GLU C CG  1 
ATOM   3250  C  CD  . GLU C  1 88  ? 42.522 74.433 56.530  1.00 40.71 ? 88   GLU C CD  1 
ATOM   3251  O  OE1 . GLU C  1 88  ? 43.107 75.466 56.912  1.00 40.59 ? 88   GLU C OE1 1 
ATOM   3252  O  OE2 . GLU C  1 88  ? 42.321 74.189 55.316  1.00 45.38 ? 88   GLU C OE2 1 
ATOM   3253  N  N   . CYS C  1 89  ? 40.579 69.108 56.620  1.00 32.33 ? 89   CYS C N   1 
ATOM   3254  C  CA  . CYS C  1 89  ? 39.702 68.114 56.006  1.00 32.03 ? 89   CYS C CA  1 
ATOM   3255  C  C   . CYS C  1 89  ? 39.073 67.229 57.060  1.00 33.17 ? 89   CYS C C   1 
ATOM   3256  O  O   . CYS C  1 89  ? 37.881 66.925 57.002  1.00 34.40 ? 89   CYS C O   1 
ATOM   3257  C  CB  . CYS C  1 89  ? 40.473 67.237 55.036  1.00 31.82 ? 89   CYS C CB  1 
ATOM   3258  S  SG  . CYS C  1 89  ? 40.871 68.068 53.526  1.00 36.60 ? 89   CYS C SG  1 
ATOM   3259  N  N   . ASP C  1 90  ? 39.884 66.792 58.015  1.00 32.92 ? 90   ASP C N   1 
ATOM   3260  C  CA  . ASP C  1 90  ? 39.367 65.951 59.080  1.00 33.20 ? 90   ASP C CA  1 
ATOM   3261  C  C   . ASP C  1 90  ? 38.344 66.765 59.857  1.00 30.94 ? 90   ASP C C   1 
ATOM   3262  O  O   . ASP C  1 90  ? 37.280 66.264 60.205  1.00 30.29 ? 90   ASP C O   1 
ATOM   3263  C  CB  . ASP C  1 90  ? 40.501 65.479 59.998  1.00 34.84 ? 90   ASP C CB  1 
ATOM   3264  C  CG  . ASP C  1 90  ? 41.461 64.501 59.304  1.00 36.85 ? 90   ASP C CG  1 
ATOM   3265  O  OD1 . ASP C  1 90  ? 41.161 64.035 58.175  1.00 32.67 ? 90   ASP C OD1 1 
ATOM   3266  O  OD2 . ASP C  1 90  ? 42.518 64.192 59.901  1.00 38.50 ? 90   ASP C OD2 1 
ATOM   3267  N  N   . LEU C  1 91  ? 38.656 68.035 60.100  1.00 31.40 ? 91   LEU C N   1 
ATOM   3268  C  CA  . LEU C  1 91  ? 37.740 68.911 60.830  1.00 30.97 ? 91   LEU C CA  1 
ATOM   3269  C  C   . LEU C  1 91  ? 36.416 69.033 60.071  1.00 32.24 ? 91   LEU C C   1 
ATOM   3270  O  O   . LEU C  1 91  ? 35.347 68.848 60.655  1.00 32.37 ? 91   LEU C O   1 
ATOM   3271  C  CB  . LEU C  1 91  ? 38.378 70.288 61.035  1.00 29.01 ? 91   LEU C CB  1 
ATOM   3272  C  CG  . LEU C  1 91  ? 37.611 71.301 61.887  1.00 28.11 ? 91   LEU C CG  1 
ATOM   3273  C  CD1 . LEU C  1 91  ? 37.147 70.655 63.181  1.00 29.78 ? 91   LEU C CD1 1 
ATOM   3274  C  CD2 . LEU C  1 91  ? 38.507 72.497 62.179  1.00 22.67 ? 91   LEU C CD2 1 
ATOM   3275  N  N   . LYS C  1 92  ? 36.485 69.326 58.771  1.00 32.28 ? 92   LYS C N   1 
ATOM   3276  C  CA  . LYS C  1 92  ? 35.272 69.433 57.954  1.00 34.61 ? 92   LYS C CA  1 
ATOM   3277  C  C   . LYS C  1 92  ? 34.418 68.160 58.090  1.00 33.86 ? 92   LYS C C   1 
ATOM   3278  O  O   . LYS C  1 92  ? 33.193 68.235 58.244  1.00 33.46 ? 92   LYS C O   1 
ATOM   3279  C  CB  . LYS C  1 92  ? 35.624 69.643 56.473  1.00 38.94 ? 92   LYS C CB  1 
ATOM   3280  C  CG  . LYS C  1 92  ? 36.450 70.898 56.160  1.00 47.87 ? 92   LYS C CG  1 
ATOM   3281  C  CD  . LYS C  1 92  ? 36.838 70.953 54.670  1.00 51.66 ? 92   LYS C CD  1 
ATOM   3282  C  CE  . LYS C  1 92  ? 37.873 72.039 54.358  1.00 51.95 ? 92   LYS C CE  1 
ATOM   3283  N  NZ  . LYS C  1 92  ? 37.391 73.423 54.651  1.00 51.50 ? 92   LYS C NZ  1 
ATOM   3284  N  N   . LEU C  1 93  ? 35.069 66.998 58.035  1.00 32.42 ? 93   LEU C N   1 
ATOM   3285  C  CA  . LEU C  1 93  ? 34.381 65.711 58.157  1.00 31.46 ? 93   LEU C CA  1 
ATOM   3286  C  C   . LEU C  1 93  ? 33.695 65.606 59.505  1.00 31.84 ? 93   LEU C C   1 
ATOM   3287  O  O   . LEU C  1 93  ? 32.474 65.449 59.604  1.00 30.29 ? 93   LEU C O   1 
ATOM   3288  C  CB  . LEU C  1 93  ? 35.372 64.554 58.054  1.00 29.41 ? 93   LEU C CB  1 
ATOM   3289  C  CG  . LEU C  1 93  ? 35.120 63.511 56.968  1.00 28.79 ? 93   LEU C CG  1 
ATOM   3290  C  CD1 . LEU C  1 93  ? 35.862 62.214 57.327  1.00 21.16 ? 93   LEU C CD1 1 
ATOM   3291  C  CD2 . LEU C  1 93  ? 33.622 63.271 56.835  1.00 27.43 ? 93   LEU C CD2 1 
ATOM   3292  N  N   . GLU C  1 94  ? 34.509 65.686 60.545  1.00 31.27 ? 94   GLU C N   1 
ATOM   3293  C  CA  . GLU C  1 94  ? 34.025 65.586 61.903  1.00 37.30 ? 94   GLU C CA  1 
ATOM   3294  C  C   . GLU C  1 94  ? 32.816 66.518 62.121  1.00 39.49 ? 94   GLU C C   1 
ATOM   3295  O  O   . GLU C  1 94  ? 31.864 66.146 62.804  1.00 38.82 ? 94   GLU C O   1 
ATOM   3296  C  CB  . GLU C  1 94  ? 35.174 65.923 62.864  1.00 39.51 ? 94   GLU C CB  1 
ATOM   3297  C  CG  . GLU C  1 94  ? 36.281 64.876 62.948  1.00 44.60 ? 94   GLU C CG  1 
ATOM   3298  C  CD  . GLU C  1 94  ? 35.853 63.583 63.626  1.00 48.29 ? 94   GLU C CD  1 
ATOM   3299  O  OE1 . GLU C  1 94  ? 36.724 62.731 63.906  1.00 50.82 ? 94   GLU C OE1 1 
ATOM   3300  O  OE2 . GLU C  1 94  ? 34.637 63.415 63.872  1.00 49.80 ? 94   GLU C OE2 1 
ATOM   3301  N  N   . GLN C  1 95  ? 32.855 67.710 61.534  1.00 40.91 ? 95   GLN C N   1 
ATOM   3302  C  CA  . GLN C  1 95  ? 31.756 68.655 61.698  1.00 42.38 ? 95   GLN C CA  1 
ATOM   3303  C  C   . GLN C  1 95  ? 30.524 68.302 60.872  1.00 43.56 ? 95   GLN C C   1 
ATOM   3304  O  O   . GLN C  1 95  ? 29.394 68.460 61.339  1.00 45.92 ? 95   GLN C O   1 
ATOM   3305  C  CB  . GLN C  1 95  ? 32.216 70.071 61.351  1.00 40.52 ? 95   GLN C CB  1 
ATOM   3306  C  CG  . GLN C  1 95  ? 33.318 70.586 62.254  1.00 43.58 ? 95   GLN C CG  1 
ATOM   3307  C  CD  . GLN C  1 95  ? 33.681 72.030 61.969  1.00 45.57 ? 95   GLN C CD  1 
ATOM   3308  O  OE1 . GLN C  1 95  ? 33.929 72.409 60.819  1.00 43.82 ? 95   GLN C OE1 1 
ATOM   3309  N  NE2 . GLN C  1 95  ? 33.725 72.845 63.021  1.00 45.96 ? 95   GLN C NE2 1 
ATOM   3310  N  N   . ALA C  1 96  ? 30.732 67.830 59.646  1.00 43.16 ? 96   ALA C N   1 
ATOM   3311  C  CA  . ALA C  1 96  ? 29.609 67.468 58.789  1.00 42.43 ? 96   ALA C CA  1 
ATOM   3312  C  C   . ALA C  1 96  ? 28.880 66.245 59.330  1.00 43.49 ? 96   ALA C C   1 
ATOM   3313  O  O   . ALA C  1 96  ? 27.791 65.918 58.869  1.00 43.88 ? 96   ALA C O   1 
ATOM   3314  C  CB  . ALA C  1 96  ? 30.092 67.196 57.390  1.00 41.05 ? 96   ALA C CB  1 
ATOM   3315  N  N   . GLY C  1 97  ? 29.483 65.576 60.311  1.00 43.94 ? 97   GLY C N   1 
ATOM   3316  C  CA  . GLY C  1 97  ? 28.877 64.387 60.884  1.00 43.44 ? 97   GLY C CA  1 
ATOM   3317  C  C   . GLY C  1 97  ? 28.019 64.628 62.114  1.00 44.77 ? 97   GLY C C   1 
ATOM   3318  O  O   . GLY C  1 97  ? 27.168 63.797 62.451  1.00 45.84 ? 97   GLY C O   1 
ATOM   3319  N  N   . LEU C  1 98  ? 28.230 65.756 62.789  1.00 43.71 ? 98   LEU C N   1 
ATOM   3320  C  CA  . LEU C  1 98  ? 27.453 66.075 63.983  1.00 41.90 ? 98   LEU C CA  1 
ATOM   3321  C  C   . LEU C  1 98  ? 25.949 66.186 63.742  1.00 41.11 ? 98   LEU C C   1 
ATOM   3322  O  O   . LEU C  1 98  ? 25.155 65.647 64.511  1.00 42.11 ? 98   LEU C O   1 
ATOM   3323  C  CB  . LEU C  1 98  ? 27.963 67.362 64.626  1.00 40.95 ? 98   LEU C CB  1 
ATOM   3324  C  CG  . LEU C  1 98  ? 29.210 67.221 65.503  1.00 42.70 ? 98   LEU C CG  1 
ATOM   3325  C  CD1 . LEU C  1 98  ? 29.541 68.568 66.149  1.00 41.80 ? 98   LEU C CD1 1 
ATOM   3326  C  CD2 . LEU C  1 98  ? 28.963 66.167 66.577  1.00 37.87 ? 98   LEU C CD2 1 
ATOM   3327  N  N   . PRO C  1 99  ? 25.533 66.887 62.678  1.00 40.17 ? 99   PRO C N   1 
ATOM   3328  C  CA  . PRO C  1 99  ? 24.097 67.013 62.417  1.00 41.28 ? 99   PRO C CA  1 
ATOM   3329  C  C   . PRO C  1 99  ? 23.400 65.659 62.284  1.00 42.10 ? 99   PRO C C   1 
ATOM   3330  O  O   . PRO C  1 99  ? 22.253 65.493 62.714  1.00 42.04 ? 99   PRO C O   1 
ATOM   3331  C  CB  . PRO C  1 99  ? 24.055 67.817 61.121  1.00 40.44 ? 99   PRO C CB  1 
ATOM   3332  C  CG  . PRO C  1 99  ? 25.257 68.680 61.240  1.00 40.77 ? 99   PRO C CG  1 
ATOM   3333  C  CD  . PRO C  1 99  ? 26.301 67.697 61.721  1.00 40.33 ? 99   PRO C CD  1 
ATOM   3334  N  N   . ASP C  1 100 ? 24.091 64.690 61.690  1.00 41.29 ? 100  ASP C N   1 
ATOM   3335  C  CA  . ASP C  1 100 ? 23.512 63.362 61.522  1.00 41.27 ? 100  ASP C CA  1 
ATOM   3336  C  C   . ASP C  1 100 ? 23.384 62.600 62.843  1.00 40.33 ? 100  ASP C C   1 
ATOM   3337  O  O   . ASP C  1 100 ? 22.380 61.923 63.067  1.00 40.94 ? 100  ASP C O   1 
ATOM   3338  C  CB  . ASP C  1 100 ? 24.339 62.538 60.535  1.00 42.72 ? 100  ASP C CB  1 
ATOM   3339  C  CG  . ASP C  1 100 ? 24.340 63.132 59.144  1.00 43.68 ? 100  ASP C CG  1 
ATOM   3340  O  OD1 . ASP C  1 100 ? 23.284 63.665 58.735  1.00 43.71 ? 100  ASP C OD1 1 
ATOM   3341  O  OD2 . ASP C  1 100 ? 25.388 63.055 58.460  1.00 44.06 ? 100  ASP C OD2 1 
ATOM   3342  N  N   . LEU C  1 101 ? 24.396 62.704 63.707  1.00 36.22 ? 101  LEU C N   1 
ATOM   3343  C  CA  . LEU C  1 101 ? 24.373 62.026 65.003  1.00 33.25 ? 101  LEU C CA  1 
ATOM   3344  C  C   . LEU C  1 101 ? 23.299 62.590 65.926  1.00 32.85 ? 101  LEU C C   1 
ATOM   3345  O  O   . LEU C  1 101 ? 22.588 61.844 66.601  1.00 31.70 ? 101  LEU C O   1 
ATOM   3346  C  CB  . LEU C  1 101 ? 25.731 62.148 65.695  1.00 33.63 ? 101  LEU C CB  1 
ATOM   3347  C  CG  . LEU C  1 101 ? 26.784 61.070 65.438  1.00 32.17 ? 101  LEU C CG  1 
ATOM   3348  C  CD1 . LEU C  1 101 ? 28.136 61.554 65.935  1.00 30.95 ? 101  LEU C CD1 1 
ATOM   3349  C  CD2 . LEU C  1 101 ? 26.384 59.778 66.128  1.00 27.80 ? 101  LEU C CD2 1 
ATOM   3350  N  N   . LYS C  1 102 ? 23.192 63.914 65.965  1.00 33.02 ? 102  LYS C N   1 
ATOM   3351  C  CA  . LYS C  1 102 ? 22.201 64.564 66.814  1.00 33.43 ? 102  LYS C CA  1 
ATOM   3352  C  C   . LYS C  1 102 ? 20.797 64.312 66.290  1.00 33.54 ? 102  LYS C C   1 
ATOM   3353  O  O   . LYS C  1 102 ? 19.845 64.204 67.072  1.00 33.03 ? 102  LYS C O   1 
ATOM   3354  C  CB  . LYS C  1 102 ? 22.492 66.062 66.907  1.00 33.16 ? 102  LYS C CB  1 
ATOM   3355  C  CG  . LYS C  1 102 ? 23.892 66.319 67.440  1.00 32.66 ? 102  LYS C CG  1 
ATOM   3356  C  CD  . LYS C  1 102 ? 24.067 67.680 68.070  1.00 34.24 ? 102  LYS C CD  1 
ATOM   3357  C  CE  . LYS C  1 102 ? 25.457 67.759 68.688  1.00 39.76 ? 102  LYS C CE  1 
ATOM   3358  N  NZ  . LYS C  1 102 ? 25.687 69.019 69.437  1.00 47.94 ? 102  LYS C NZ  1 
ATOM   3359  N  N   . ALA C  1 103 ? 20.675 64.204 64.968  1.00 31.89 ? 103  ALA C N   1 
ATOM   3360  C  CA  . ALA C  1 103 ? 19.385 63.928 64.348  1.00 29.81 ? 103  ALA C CA  1 
ATOM   3361  C  C   . ALA C  1 103 ? 19.019 62.470 64.632  1.00 30.25 ? 103  ALA C C   1 
ATOM   3362  O  O   . ALA C  1 103 ? 17.839 62.129 64.785  1.00 32.54 ? 103  ALA C O   1 
ATOM   3363  C  CB  . ALA C  1 103 ? 19.457 64.160 62.862  1.00 23.88 ? 103  ALA C CB  1 
ATOM   3364  N  N   . ALA C  1 104 ? 20.035 61.616 64.702  1.00 25.33 ? 104  ALA C N   1 
ATOM   3365  C  CA  . ALA C  1 104 ? 19.812 60.207 64.974  1.00 25.99 ? 104  ALA C CA  1 
ATOM   3366  C  C   . ALA C  1 104 ? 19.426 60.038 66.441  1.00 27.48 ? 104  ALA C C   1 
ATOM   3367  O  O   . ALA C  1 104 ? 18.490 59.296 66.763  1.00 27.40 ? 104  ALA C O   1 
ATOM   3368  C  CB  . ALA C  1 104 ? 21.067 59.411 64.670  1.00 27.34 ? 104  ALA C CB  1 
ATOM   3369  N  N   . ILE C  1 105 ? 20.142 60.730 67.326  1.00 26.07 ? 105  ILE C N   1 
ATOM   3370  C  CA  . ILE C  1 105 ? 19.863 60.650 68.756  1.00 27.85 ? 105  ILE C CA  1 
ATOM   3371  C  C   . ILE C  1 105 ? 18.430 61.105 69.043  1.00 30.62 ? 105  ILE C C   1 
ATOM   3372  O  O   . ILE C  1 105 ? 17.679 60.436 69.760  1.00 32.06 ? 105  ILE C O   1 
ATOM   3373  C  CB  . ILE C  1 105 ? 20.861 61.521 69.574  1.00 28.72 ? 105  ILE C CB  1 
ATOM   3374  C  CG1 . ILE C  1 105 ? 22.252 60.859 69.580  1.00 29.10 ? 105  ILE C CG1 1 
ATOM   3375  C  CG2 . ILE C  1 105 ? 20.344 61.725 70.996  1.00 19.43 ? 105  ILE C CG2 1 
ATOM   3376  C  CD1 . ILE C  1 105 ? 23.400 61.760 70.107  1.00 25.02 ? 105  ILE C CD1 1 
ATOM   3377  N  N   . ALA C  1 106 ? 18.049 62.243 68.473  1.00 31.23 ? 106  ALA C N   1 
ATOM   3378  C  CA  . ALA C  1 106 ? 16.706 62.771 68.672  1.00 29.16 ? 106  ALA C CA  1 
ATOM   3379  C  C   . ALA C  1 106 ? 15.657 61.786 68.171  1.00 28.44 ? 106  ALA C C   1 
ATOM   3380  O  O   . ALA C  1 106 ? 14.570 61.688 68.742  1.00 31.46 ? 106  ALA C O   1 
ATOM   3381  C  CB  . ALA C  1 106 ? 16.556 64.106 67.958  1.00 27.08 ? 106  ALA C CB  1 
ATOM   3382  N  N   . TYR C  1 107 ? 15.976 61.048 67.112  1.00 28.42 ? 107  TYR C N   1 
ATOM   3383  C  CA  . TYR C  1 107 ? 15.015 60.090 66.576  1.00 30.52 ? 107  TYR C CA  1 
ATOM   3384  C  C   . TYR C  1 107 ? 14.846 58.887 67.497  1.00 32.07 ? 107  TYR C C   1 
ATOM   3385  O  O   . TYR C  1 107 ? 13.735 58.390 67.701  1.00 31.67 ? 107  TYR C O   1 
ATOM   3386  C  CB  . TYR C  1 107 ? 15.426 59.589 65.194  1.00 30.33 ? 107  TYR C CB  1 
ATOM   3387  C  CG  . TYR C  1 107 ? 14.312 58.798 64.575  1.00 33.38 ? 107  TYR C CG  1 
ATOM   3388  C  CD1 . TYR C  1 107 ? 13.229 59.441 63.973  1.00 34.83 ? 107  TYR C CD1 1 
ATOM   3389  C  CD2 . TYR C  1 107 ? 14.263 57.412 64.710  1.00 38.19 ? 107  TYR C CD2 1 
ATOM   3390  C  CE1 . TYR C  1 107 ? 12.121 58.723 63.528  1.00 36.20 ? 107  TYR C CE1 1 
ATOM   3391  C  CE2 . TYR C  1 107 ? 13.158 56.682 64.276  1.00 38.92 ? 107  TYR C CE2 1 
ATOM   3392  C  CZ  . TYR C  1 107 ? 12.092 57.343 63.685  1.00 40.96 ? 107  TYR C CZ  1 
ATOM   3393  O  OH  . TYR C  1 107 ? 11.003 56.614 63.247  1.00 49.39 ? 107  TYR C OH  1 
ATOM   3394  N  N   . CYS C  1 108 ? 15.953 58.407 68.046  1.00 32.54 ? 108  CYS C N   1 
ATOM   3395  C  CA  . CYS C  1 108 ? 15.881 57.272 68.942  1.00 32.74 ? 108  CYS C CA  1 
ATOM   3396  C  C   . CYS C  1 108 ? 15.055 57.642 70.169  1.00 32.12 ? 108  CYS C C   1 
ATOM   3397  O  O   . CYS C  1 108 ? 14.306 56.812 70.688  1.00 30.33 ? 108  CYS C O   1 
ATOM   3398  C  CB  . CYS C  1 108 ? 17.292 56.814 69.313  1.00 34.22 ? 108  CYS C CB  1 
ATOM   3399  S  SG  . CYS C  1 108 ? 18.162 56.031 67.901  1.00 35.76 ? 108  CYS C SG  1 
ATOM   3400  N  N   . GLU C  1 109 ? 15.174 58.890 70.618  1.00 31.52 ? 109  GLU C N   1 
ATOM   3401  C  CA  . GLU C  1 109 ? 14.395 59.355 71.765  1.00 34.24 ? 109  GLU C CA  1 
ATOM   3402  C  C   . GLU C  1 109 ? 12.925 59.228 71.437  1.00 35.34 ? 109  GLU C C   1 
ATOM   3403  O  O   . GLU C  1 109 ? 12.170 58.593 72.166  1.00 37.96 ? 109  GLU C O   1 
ATOM   3404  C  CB  . GLU C  1 109 ? 14.656 60.830 72.063  1.00 36.55 ? 109  GLU C CB  1 
ATOM   3405  C  CG  . GLU C  1 109 ? 15.552 61.118 73.247  1.00 41.42 ? 109  GLU C CG  1 
ATOM   3406  C  CD  . GLU C  1 109 ? 15.020 60.577 74.559  1.00 41.84 ? 109  GLU C CD  1 
ATOM   3407  O  OE1 . GLU C  1 109 ? 13.828 60.803 74.865  1.00 43.27 ? 109  GLU C OE1 1 
ATOM   3408  O  OE2 . GLU C  1 109 ? 15.806 59.937 75.289  1.00 40.87 ? 109  GLU C OE2 1 
ATOM   3409  N  N   . SER C  1 110 ? 12.527 59.841 70.325  1.00 35.07 ? 110  SER C N   1 
ATOM   3410  C  CA  . SER C  1 110 ? 11.133 59.832 69.914  1.00 36.58 ? 110  SER C CA  1 
ATOM   3411  C  C   . SER C  1 110 ? 10.502 58.450 69.837  1.00 37.98 ? 110  SER C C   1 
ATOM   3412  O  O   . SER C  1 110 ? 9.338  58.290 70.201  1.00 42.52 ? 110  SER C O   1 
ATOM   3413  C  CB  . SER C  1 110 ? 10.962 60.543 68.570  1.00 37.59 ? 110  SER C CB  1 
ATOM   3414  O  OG  . SER C  1 110 ? 11.422 59.747 67.492  1.00 42.90 ? 110  SER C OG  1 
ATOM   3415  N  N   . VAL C  1 111 ? 11.248 57.447 69.383  1.00 36.48 ? 111  VAL C N   1 
ATOM   3416  C  CA  . VAL C  1 111 ? 10.670 56.111 69.267  1.00 35.76 ? 111  VAL C CA  1 
ATOM   3417  C  C   . VAL C  1 111 ? 10.946 55.175 70.442  1.00 35.99 ? 111  VAL C C   1 
ATOM   3418  O  O   . VAL C  1 111 ? 10.550 54.006 70.417  1.00 34.73 ? 111  VAL C O   1 
ATOM   3419  C  CB  . VAL C  1 111 ? 11.127 55.425 67.975  1.00 36.06 ? 111  VAL C CB  1 
ATOM   3420  C  CG1 . VAL C  1 111 ? 10.628 56.210 66.775  1.00 34.30 ? 111  VAL C CG1 1 
ATOM   3421  C  CG2 . VAL C  1 111 ? 12.639 55.312 67.959  1.00 37.34 ? 111  VAL C CG2 1 
ATOM   3422  N  N   . GLY C  1 112 ? 11.623 55.681 71.467  1.00 35.43 ? 112  GLY C N   1 
ATOM   3423  C  CA  . GLY C  1 112 ? 11.909 54.854 72.627  1.00 34.38 ? 112  GLY C CA  1 
ATOM   3424  C  C   . GLY C  1 112 ? 13.071 53.881 72.503  1.00 34.79 ? 112  GLY C C   1 
ATOM   3425  O  O   . GLY C  1 112 ? 13.200 52.969 73.331  1.00 36.88 ? 112  GLY C O   1 
ATOM   3426  N  N   . ASP C  1 113 ? 13.907 54.045 71.478  1.00 33.20 ? 113  ASP C N   1 
ATOM   3427  C  CA  . ASP C  1 113 ? 15.061 53.166 71.311  1.00 31.80 ? 113  ASP C CA  1 
ATOM   3428  C  C   . ASP C  1 113 ? 16.199 53.815 72.089  1.00 31.35 ? 113  ASP C C   1 
ATOM   3429  O  O   . ASP C  1 113 ? 17.187 54.296 71.531  1.00 32.06 ? 113  ASP C O   1 
ATOM   3430  C  CB  . ASP C  1 113 ? 15.444 53.010 69.838  1.00 29.87 ? 113  ASP C CB  1 
ATOM   3431  C  CG  . ASP C  1 113 ? 16.579 52.009 69.638  1.00 32.26 ? 113  ASP C CG  1 
ATOM   3432  O  OD1 . ASP C  1 113 ? 17.024 51.398 70.633  1.00 35.22 ? 113  ASP C OD1 1 
ATOM   3433  O  OD2 . ASP C  1 113 ? 17.034 51.825 68.491  1.00 33.57 ? 113  ASP C OD2 1 
ATOM   3434  N  N   . TYR C  1 114 ? 16.029 53.823 73.401  1.00 30.76 ? 114  TYR C N   1 
ATOM   3435  C  CA  . TYR C  1 114 ? 16.984 54.416 74.308  1.00 29.46 ? 114  TYR C CA  1 
ATOM   3436  C  C   . TYR C  1 114 ? 18.373 53.806 74.223  1.00 27.79 ? 114  TYR C C   1 
ATOM   3437  O  O   . TYR C  1 114 ? 19.358 54.542 74.169  1.00 26.37 ? 114  TYR C O   1 
ATOM   3438  C  CB  . TYR C  1 114 ? 16.419 54.336 75.720  1.00 27.61 ? 114  TYR C CB  1 
ATOM   3439  C  CG  . TYR C  1 114 ? 15.069 55.016 75.814  1.00 30.43 ? 114  TYR C CG  1 
ATOM   3440  C  CD1 . TYR C  1 114 ? 14.927 56.370 75.489  1.00 33.19 ? 114  TYR C CD1 1 
ATOM   3441  C  CD2 . TYR C  1 114 ? 13.938 54.318 76.232  1.00 30.18 ? 114  TYR C CD2 1 
ATOM   3442  C  CE1 . TYR C  1 114 ? 13.690 57.015 75.586  1.00 33.41 ? 114  TYR C CE1 1 
ATOM   3443  C  CE2 . TYR C  1 114 ? 12.693 54.950 76.333  1.00 31.45 ? 114  TYR C CE2 1 
ATOM   3444  C  CZ  . TYR C  1 114 ? 12.575 56.301 76.016  1.00 34.56 ? 114  TYR C CZ  1 
ATOM   3445  O  OH  . TYR C  1 114 ? 11.363 56.950 76.179  1.00 33.16 ? 114  TYR C OH  1 
ATOM   3446  N  N   . ALA C  1 115 ? 18.459 52.476 74.195  1.00 26.95 ? 115  ALA C N   1 
ATOM   3447  C  CA  . ALA C  1 115 ? 19.762 51.811 74.103  1.00 25.59 ? 115  ALA C CA  1 
ATOM   3448  C  C   . ALA C  1 115 ? 20.554 52.325 72.887  1.00 27.35 ? 115  ALA C C   1 
ATOM   3449  O  O   . ALA C  1 115 ? 21.749 52.622 73.002  1.00 27.13 ? 115  ALA C O   1 
ATOM   3450  C  CB  . ALA C  1 115 ? 19.583 50.297 74.029  1.00 19.65 ? 115  ALA C CB  1 
ATOM   3451  N  N   . SER C  1 116 ? 19.900 52.447 71.729  1.00 28.98 ? 116  SER C N   1 
ATOM   3452  C  CA  . SER C  1 116 ? 20.586 52.958 70.538  1.00 29.64 ? 116  SER C CA  1 
ATOM   3453  C  C   . SER C  1 116 ? 21.042 54.390 70.786  1.00 29.46 ? 116  SER C C   1 
ATOM   3454  O  O   . SER C  1 116 ? 22.146 54.779 70.372  1.00 31.67 ? 116  SER C O   1 
ATOM   3455  C  CB  . SER C  1 116 ? 19.678 52.925 69.308  1.00 30.46 ? 116  SER C CB  1 
ATOM   3456  O  OG  . SER C  1 116 ? 19.490 51.600 68.847  1.00 32.70 ? 116  SER C OG  1 
ATOM   3457  N  N   . ARG C  1 117 ? 20.202 55.175 71.459  1.00 25.63 ? 117  ARG C N   1 
ATOM   3458  C  CA  . ARG C  1 117 ? 20.567 56.552 71.762  1.00 27.37 ? 117  ARG C CA  1 
ATOM   3459  C  C   . ARG C  1 117 ? 21.862 56.612 72.596  1.00 30.28 ? 117  ARG C C   1 
ATOM   3460  O  O   . ARG C  1 117 ? 22.740 57.449 72.346  1.00 27.79 ? 117  ARG C O   1 
ATOM   3461  C  CB  . ARG C  1 117 ? 19.435 57.269 72.513  1.00 28.41 ? 117  ARG C CB  1 
ATOM   3462  C  CG  . ARG C  1 117 ? 19.936 58.493 73.288  1.00 28.30 ? 117  ARG C CG  1 
ATOM   3463  C  CD  . ARG C  1 117 ? 18.867 59.492 73.694  1.00 24.07 ? 117  ARG C CD  1 
ATOM   3464  N  NE  . ARG C  1 117 ? 19.496 60.523 74.514  1.00 24.48 ? 117  ARG C NE  1 
ATOM   3465  C  CZ  . ARG C  1 117 ? 19.024 61.753 74.694  1.00 24.42 ? 117  ARG C CZ  1 
ATOM   3466  N  NH1 . ARG C  1 117 ? 17.898 62.141 74.116  1.00 19.89 ? 117  ARG C NH1 1 
ATOM   3467  N  NH2 . ARG C  1 117 ? 19.697 62.610 75.449  1.00 27.97 ? 117  ARG C NH2 1 
ATOM   3468  N  N   . GLU C  1 118 ? 21.969 55.727 73.585  1.00 31.53 ? 118  GLU C N   1 
ATOM   3469  C  CA  . GLU C  1 118 ? 23.146 55.669 74.442  1.00 33.89 ? 118  GLU C CA  1 
ATOM   3470  C  C   . GLU C  1 118 ? 24.387 55.461 73.607  1.00 33.87 ? 118  GLU C C   1 
ATOM   3471  O  O   . GLU C  1 118 ? 25.392 56.154 73.778  1.00 32.71 ? 118  GLU C O   1 
ATOM   3472  C  CB  . GLU C  1 118 ? 23.022 54.521 75.437  1.00 40.32 ? 118  GLU C CB  1 
ATOM   3473  C  CG  . GLU C  1 118 ? 22.319 54.912 76.707  1.00 51.19 ? 118  GLU C CG  1 
ATOM   3474  C  CD  . GLU C  1 118 ? 23.058 56.005 77.451  1.00 57.61 ? 118  GLU C CD  1 
ATOM   3475  O  OE1 . GLU C  1 118 ? 24.224 55.759 77.847  1.00 59.96 ? 118  GLU C OE1 1 
ATOM   3476  O  OE2 . GLU C  1 118 ? 22.474 57.103 77.630  1.00 60.76 ? 118  GLU C OE2 1 
ATOM   3477  N  N   . LEU C  1 119 ? 24.304 54.486 72.709  1.00 33.82 ? 119  LEU C N   1 
ATOM   3478  C  CA  . LEU C  1 119 ? 25.399 54.161 71.815  1.00 30.61 ? 119  LEU C CA  1 
ATOM   3479  C  C   . LEU C  1 119 ? 25.817 55.408 71.046  1.00 29.91 ? 119  LEU C C   1 
ATOM   3480  O  O   . LEU C  1 119 ? 26.979 55.819 71.104  1.00 28.53 ? 119  LEU C O   1 
ATOM   3481  C  CB  . LEU C  1 119 ? 24.955 53.084 70.832  1.00 31.96 ? 119  LEU C CB  1 
ATOM   3482  C  CG  . LEU C  1 119 ? 25.999 52.391 69.954  1.00 32.03 ? 119  LEU C CG  1 
ATOM   3483  C  CD1 . LEU C  1 119 ? 25.470 52.373 68.529  1.00 32.15 ? 119  LEU C CD1 1 
ATOM   3484  C  CD2 . LEU C  1 119 ? 27.354 53.098 70.017  1.00 35.42 ? 119  LEU C CD2 1 
ATOM   3485  N  N   . LEU C  1 120 ? 24.873 56.014 70.331  1.00 28.98 ? 120  LEU C N   1 
ATOM   3486  C  CA  . LEU C  1 120 ? 25.194 57.208 69.550  1.00 30.16 ? 120  LEU C CA  1 
ATOM   3487  C  C   . LEU C  1 120 ? 25.757 58.309 70.437  1.00 33.29 ? 120  LEU C C   1 
ATOM   3488  O  O   . LEU C  1 120 ? 26.632 59.062 70.006  1.00 34.58 ? 120  LEU C O   1 
ATOM   3489  C  CB  . LEU C  1 120 ? 23.962 57.724 68.801  1.00 27.30 ? 120  LEU C CB  1 
ATOM   3490  C  CG  . LEU C  1 120 ? 23.240 56.736 67.874  1.00 27.51 ? 120  LEU C CG  1 
ATOM   3491  C  CD1 . LEU C  1 120 ? 21.981 57.387 67.316  1.00 24.28 ? 120  LEU C CD1 1 
ATOM   3492  C  CD2 . LEU C  1 120 ? 24.168 56.291 66.751  1.00 25.23 ? 120  LEU C CD2 1 
ATOM   3493  N  N   . GLU C  1 121 ? 25.262 58.407 71.674  1.00 36.99 ? 121  GLU C N   1 
ATOM   3494  C  CA  . GLU C  1 121 ? 25.751 59.427 72.605  1.00 36.95 ? 121  GLU C CA  1 
ATOM   3495  C  C   . GLU C  1 121 ? 27.240 59.229 72.866  1.00 35.96 ? 121  GLU C C   1 
ATOM   3496  O  O   . GLU C  1 121 ? 27.980 60.202 72.967  1.00 33.24 ? 121  GLU C O   1 
ATOM   3497  C  CB  . GLU C  1 121 ? 25.014 59.374 73.951  1.00 40.33 ? 121  GLU C CB  1 
ATOM   3498  C  CG  . GLU C  1 121 ? 23.567 59.831 73.928  1.00 46.41 ? 121  GLU C CG  1 
ATOM   3499  C  CD  . GLU C  1 121 ? 23.023 60.126 75.329  1.00 49.47 ? 121  GLU C CD  1 
ATOM   3500  O  OE1 . GLU C  1 121 ? 23.080 59.234 76.209  1.00 49.70 ? 121  GLU C OE1 1 
ATOM   3501  O  OE2 . GLU C  1 121 ? 22.536 61.257 75.548  1.00 50.65 ? 121  GLU C OE2 1 
ATOM   3502  N  N   . ASP C  1 122 ? 27.676 57.975 72.985  1.00 34.59 ? 122  ASP C N   1 
ATOM   3503  C  CA  . ASP C  1 122 ? 29.090 57.700 73.238  1.00 36.50 ? 122  ASP C CA  1 
ATOM   3504  C  C   . ASP C  1 122 ? 29.915 58.162 72.048  1.00 33.12 ? 122  ASP C C   1 
ATOM   3505  O  O   . ASP C  1 122 ? 30.826 58.975 72.178  1.00 33.97 ? 122  ASP C O   1 
ATOM   3506  C  CB  . ASP C  1 122 ? 29.333 56.203 73.482  1.00 41.90 ? 122  ASP C CB  1 
ATOM   3507  C  CG  . ASP C  1 122 ? 28.594 55.674 74.712  1.00 50.55 ? 122  ASP C CG  1 
ATOM   3508  O  OD1 . ASP C  1 122 ? 28.630 56.339 75.774  1.00 52.39 ? 122  ASP C OD1 1 
ATOM   3509  O  OD2 . ASP C  1 122 ? 27.982 54.582 74.619  1.00 54.78 ? 122  ASP C OD2 1 
ATOM   3510  N  N   . ILE C  1 123 ? 29.583 57.644 70.878  1.00 31.23 ? 123  ILE C N   1 
ATOM   3511  C  CA  . ILE C  1 123 ? 30.294 58.022 69.675  1.00 31.04 ? 123  ILE C CA  1 
ATOM   3512  C  C   . ILE C  1 123 ? 30.362 59.547 69.594  1.00 30.01 ? 123  ILE C C   1 
ATOM   3513  O  O   . ILE C  1 123 ? 31.413 60.112 69.315  1.00 29.25 ? 123  ILE C O   1 
ATOM   3514  C  CB  . ILE C  1 123 ? 29.594 57.411 68.436  1.00 31.53 ? 123  ILE C CB  1 
ATOM   3515  C  CG1 . ILE C  1 123 ? 29.697 55.882 68.525  1.00 30.41 ? 123  ILE C CG1 1 
ATOM   3516  C  CG2 . ILE C  1 123 ? 30.210 57.948 67.150  1.00 30.96 ? 123  ILE C CG2 1 
ATOM   3517  C  CD1 . ILE C  1 123 ? 29.209 55.137 67.316  1.00 34.01 ? 123  ILE C CD1 1 
ATOM   3518  N  N   . LEU C  1 124 ? 29.244 60.209 69.872  1.00 30.55 ? 124  LEU C N   1 
ATOM   3519  C  CA  . LEU C  1 124 ? 29.174 61.673 69.849  1.00 32.04 ? 124  LEU C CA  1 
ATOM   3520  C  C   . LEU C  1 124 ? 30.244 62.349 70.713  1.00 32.82 ? 124  LEU C C   1 
ATOM   3521  O  O   . LEU C  1 124 ? 30.922 63.277 70.271  1.00 33.32 ? 124  LEU C O   1 
ATOM   3522  C  CB  . LEU C  1 124 ? 27.798 62.140 70.329  1.00 30.36 ? 124  LEU C CB  1 
ATOM   3523  C  CG  . LEU C  1 124 ? 27.655 63.652 70.506  1.00 29.80 ? 124  LEU C CG  1 
ATOM   3524  C  CD1 . LEU C  1 124 ? 27.975 64.347 69.196  1.00 32.52 ? 124  LEU C CD1 1 
ATOM   3525  C  CD2 . LEU C  1 124 ? 26.247 63.990 70.946  1.00 32.44 ? 124  LEU C CD2 1 
ATOM   3526  N  N   . GLU C  1 125 ? 30.372 61.894 71.954  1.00 32.92 ? 125  GLU C N   1 
ATOM   3527  C  CA  . GLU C  1 125 ? 31.344 62.459 72.867  1.00 35.67 ? 125  GLU C CA  1 
ATOM   3528  C  C   . GLU C  1 125 ? 32.728 62.271 72.280  1.00 34.36 ? 125  GLU C C   1 
ATOM   3529  O  O   . GLU C  1 125 ? 33.590 63.148 72.371  1.00 34.80 ? 125  GLU C O   1 
ATOM   3530  C  CB  . GLU C  1 125 ? 31.230 61.778 74.231  1.00 40.72 ? 125  GLU C CB  1 
ATOM   3531  C  CG  . GLU C  1 125 ? 29.923 62.103 74.949  1.00 49.80 ? 125  GLU C CG  1 
ATOM   3532  C  CD  . GLU C  1 125 ? 29.723 61.287 76.212  1.00 56.88 ? 125  GLU C CD  1 
ATOM   3533  O  OE1 . GLU C  1 125 ? 30.671 61.212 77.024  1.00 62.02 ? 125  GLU C OE1 1 
ATOM   3534  O  OE2 . GLU C  1 125 ? 28.617 60.727 76.400  1.00 61.23 ? 125  GLU C OE2 1 
ATOM   3535  N  N   . SER C  1 126 ? 32.941 61.126 71.654  1.00 30.60 ? 126  SER C N   1 
ATOM   3536  C  CA  . SER C  1 126 ? 34.230 60.876 71.047  1.00 30.82 ? 126  SER C CA  1 
ATOM   3537  C  C   . SER C  1 126 ? 34.468 61.836 69.871  1.00 30.19 ? 126  SER C C   1 
ATOM   3538  O  O   . SER C  1 126 ? 35.582 62.329 69.678  1.00 28.12 ? 126  SER C O   1 
ATOM   3539  C  CB  . SER C  1 126 ? 34.318 59.417 70.583  1.00 30.74 ? 126  SER C CB  1 
ATOM   3540  O  OG  . SER C  1 126 ? 35.472 59.206 69.780  1.00 32.93 ? 126  SER C OG  1 
ATOM   3541  N  N   . GLU C  1 127 ? 33.426 62.112 69.090  1.00 31.30 ? 127  GLU C N   1 
ATOM   3542  C  CA  . GLU C  1 127 ? 33.584 63.007 67.944  1.00 33.30 ? 127  GLU C CA  1 
ATOM   3543  C  C   . GLU C  1 127 ? 33.936 64.417 68.414  1.00 33.85 ? 127  GLU C C   1 
ATOM   3544  O  O   . GLU C  1 127 ? 34.775 65.085 67.807  1.00 33.93 ? 127  GLU C O   1 
ATOM   3545  C  CB  . GLU C  1 127 ? 32.305 63.040 67.092  1.00 31.35 ? 127  GLU C CB  1 
ATOM   3546  C  CG  . GLU C  1 127 ? 31.789 61.657 66.700  1.00 39.89 ? 127  GLU C CG  1 
ATOM   3547  C  CD  . GLU C  1 127 ? 32.780 60.850 65.856  1.00 44.30 ? 127  GLU C CD  1 
ATOM   3548  O  OE1 . GLU C  1 127 ? 33.841 61.389 65.482  1.00 48.90 ? 127  GLU C OE1 1 
ATOM   3549  O  OE2 . GLU C  1 127 ? 32.499 59.662 65.582  1.00 48.64 ? 127  GLU C OE2 1 
ATOM   3550  N  N   . GLU C  1 128 ? 33.310 64.875 69.496  1.00 35.48 ? 128  GLU C N   1 
ATOM   3551  C  CA  . GLU C  1 128 ? 33.600 66.216 69.990  1.00 36.34 ? 128  GLU C CA  1 
ATOM   3552  C  C   . GLU C  1 128 ? 35.055 66.322 70.418  1.00 38.22 ? 128  GLU C C   1 
ATOM   3553  O  O   . GLU C  1 128 ? 35.665 67.380 70.275  1.00 39.68 ? 128  GLU C O   1 
ATOM   3554  C  CB  . GLU C  1 128 ? 32.662 66.592 71.138  1.00 34.86 ? 128  GLU C CB  1 
ATOM   3555  C  CG  . GLU C  1 128 ? 31.187 66.543 70.737  1.00 37.75 ? 128  GLU C CG  1 
ATOM   3556  C  CD  . GLU C  1 128 ? 30.320 67.513 71.522  1.00 40.37 ? 128  GLU C CD  1 
ATOM   3557  O  OE1 . GLU C  1 128 ? 30.590 67.725 72.724  1.00 43.88 ? 128  GLU C OE1 1 
ATOM   3558  O  OE2 . GLU C  1 128 ? 29.355 68.057 70.942  1.00 42.48 ? 128  GLU C OE2 1 
ATOM   3559  N  N   . ASP C  1 129 ? 35.618 65.224 70.924  1.00 41.12 ? 129  ASP C N   1 
ATOM   3560  C  CA  . ASP C  1 129 ? 37.029 65.208 71.327  1.00 42.41 ? 129  ASP C CA  1 
ATOM   3561  C  C   . ASP C  1 129 ? 37.929 65.407 70.109  1.00 40.36 ? 129  ASP C C   1 
ATOM   3562  O  O   . ASP C  1 129 ? 38.842 66.233 70.127  1.00 40.86 ? 129  ASP C O   1 
ATOM   3563  C  CB  . ASP C  1 129 ? 37.406 63.883 71.997  1.00 45.13 ? 129  ASP C CB  1 
ATOM   3564  C  CG  . ASP C  1 129 ? 36.988 63.819 73.446  1.00 48.95 ? 129  ASP C CG  1 
ATOM   3565  O  OD1 . ASP C  1 129 ? 36.951 64.880 74.111  1.00 53.31 ? 129  ASP C OD1 1 
ATOM   3566  O  OD2 . ASP C  1 129 ? 36.714 62.699 73.928  1.00 54.16 ? 129  ASP C OD2 1 
ATOM   3567  N  N   . HIS C  1 130 ? 37.673 64.632 69.060  1.00 39.44 ? 130  HIS C N   1 
ATOM   3568  C  CA  . HIS C  1 130 ? 38.443 64.734 67.828  1.00 39.15 ? 130  HIS C CA  1 
ATOM   3569  C  C   . HIS C  1 130 ? 38.389 66.152 67.339  1.00 36.85 ? 130  HIS C C   1 
ATOM   3570  O  O   . HIS C  1 130 ? 39.406 66.768 67.070  1.00 35.39 ? 130  HIS C O   1 
ATOM   3571  C  CB  . HIS C  1 130 ? 37.871 63.790 66.764  1.00 41.09 ? 130  HIS C CB  1 
ATOM   3572  C  CG  . HIS C  1 130 ? 38.095 62.302 67.067  1.00 46.97 ? 130  HIS C CG  1 
ATOM   3573  N  ND1 . HIS C  1 130 ? 37.452 61.305 66.361  1.00 47.68 ? 130  HIS C ND1 1 
ATOM   3574  C  CD2 . HIS C  1 130 ? 38.879 61.671 67.974  1.00 49.86 ? 130  HIS C CD2 1 
ATOM   3575  C  CE1 . HIS C  1 130 ? 37.831 60.126 66.821  1.00 48.72 ? 130  HIS C CE1 1 
ATOM   3576  N  NE2 . HIS C  1 130 ? 38.697 60.320 67.799  1.00 50.02 ? 130  HIS C NE2 1 
ATOM   3577  N  N   . ILE C  1 131 ? 37.178 66.689 67.245  1.00 34.39 ? 131  ILE C N   1 
ATOM   3578  C  CA  . ILE C  1 131 ? 37.014 68.060 66.801  1.00 33.65 ? 131  ILE C CA  1 
ATOM   3579  C  C   . ILE C  1 131 ? 37.850 68.994 67.674  1.00 33.93 ? 131  ILE C C   1 
ATOM   3580  O  O   . ILE C  1 131 ? 38.456 69.940 67.174  1.00 34.13 ? 131  ILE C O   1 
ATOM   3581  C  CB  . ILE C  1 131 ? 35.523 68.501 66.845  1.00 33.03 ? 131  ILE C CB  1 
ATOM   3582  C  CG1 . ILE C  1 131 ? 34.749 67.819 65.707  1.00 32.34 ? 131  ILE C CG1 1 
ATOM   3583  C  CG2 . ILE C  1 131 ? 35.413 70.023 66.725  1.00 30.10 ? 131  ILE C CG2 1 
ATOM   3584  C  CD1 . ILE C  1 131 ? 33.276 68.187 65.626  1.00 26.30 ? 131  ILE C CD1 1 
ATOM   3585  N  N   . ASP C  1 132 ? 37.902 68.722 68.975  1.00 34.36 ? 132  ASP C N   1 
ATOM   3586  C  CA  . ASP C  1 132 ? 38.662 69.583 69.866  1.00 33.52 ? 132  ASP C CA  1 
ATOM   3587  C  C   . ASP C  1 132 ? 40.146 69.520 69.561  1.00 31.06 ? 132  ASP C C   1 
ATOM   3588  O  O   . ASP C  1 132 ? 40.801 70.562 69.409  1.00 29.90 ? 132  ASP C O   1 
ATOM   3589  C  CB  . ASP C  1 132 ? 38.411 69.217 71.332  1.00 38.03 ? 132  ASP C CB  1 
ATOM   3590  C  CG  . ASP C  1 132 ? 38.922 70.293 72.301  1.00 41.73 ? 132  ASP C CG  1 
ATOM   3591  O  OD1 . ASP C  1 132 ? 38.882 71.495 71.944  1.00 45.46 ? 132  ASP C OD1 1 
ATOM   3592  O  OD2 . ASP C  1 132 ? 39.350 69.943 73.424  1.00 43.52 ? 132  ASP C OD2 1 
ATOM   3593  N  N   . TRP C  1 133 ? 40.678 68.306 69.463  1.00 27.30 ? 133  TRP C N   1 
ATOM   3594  C  CA  . TRP C  1 133 ? 42.096 68.149 69.170  1.00 27.21 ? 133  TRP C CA  1 
ATOM   3595  C  C   . TRP C  1 133 ? 42.410 68.838 67.850  1.00 28.62 ? 133  TRP C C   1 
ATOM   3596  O  O   . TRP C  1 133 ? 43.399 69.563 67.732  1.00 30.93 ? 133  TRP C O   1 
ATOM   3597  C  CB  . TRP C  1 133 ? 42.472 66.677 69.072  1.00 25.05 ? 133  TRP C CB  1 
ATOM   3598  C  CG  . TRP C  1 133 ? 43.921 66.479 68.797  1.00 29.24 ? 133  TRP C CG  1 
ATOM   3599  C  CD1 . TRP C  1 133 ? 44.944 66.555 69.698  1.00 32.92 ? 133  TRP C CD1 1 
ATOM   3600  C  CD2 . TRP C  1 133 ? 44.526 66.206 67.524  1.00 30.08 ? 133  TRP C CD2 1 
ATOM   3601  N  NE1 . TRP C  1 133 ? 46.152 66.343 69.067  1.00 33.08 ? 133  TRP C NE1 1 
ATOM   3602  C  CE2 . TRP C  1 133 ? 45.923 66.129 67.733  1.00 29.64 ? 133  TRP C CE2 1 
ATOM   3603  C  CE3 . TRP C  1 133 ? 44.024 66.019 66.229  1.00 29.36 ? 133  TRP C CE3 1 
ATOM   3604  C  CZ2 . TRP C  1 133 ? 46.822 65.876 66.698  1.00 27.99 ? 133  TRP C CZ2 1 
ATOM   3605  C  CZ3 . TRP C  1 133 ? 44.918 65.766 65.199  1.00 29.05 ? 133  TRP C CZ3 1 
ATOM   3606  C  CH2 . TRP C  1 133 ? 46.303 65.698 65.441  1.00 29.42 ? 133  TRP C CH2 1 
ATOM   3607  N  N   . LEU C  1 134 ? 41.559 68.616 66.853  1.00 28.14 ? 134  LEU C N   1 
ATOM   3608  C  CA  . LEU C  1 134 ? 41.769 69.230 65.554  1.00 26.85 ? 134  LEU C CA  1 
ATOM   3609  C  C   . LEU C  1 134 ? 41.829 70.752 65.654  1.00 28.19 ? 134  LEU C C   1 
ATOM   3610  O  O   . LEU C  1 134 ? 42.794 71.363 65.200  1.00 27.29 ? 134  LEU C O   1 
ATOM   3611  C  CB  . LEU C  1 134 ? 40.671 68.796 64.580  1.00 24.26 ? 134  LEU C CB  1 
ATOM   3612  C  CG  . LEU C  1 134 ? 40.805 67.340 64.119  1.00 23.07 ? 134  LEU C CG  1 
ATOM   3613  C  CD1 . LEU C  1 134 ? 39.598 66.925 63.323  1.00 22.03 ? 134  LEU C CD1 1 
ATOM   3614  C  CD2 . LEU C  1 134 ? 42.056 67.193 63.271  1.00 25.46 ? 134  LEU C CD2 1 
ATOM   3615  N  N   . GLU C  1 135 ? 40.819 71.368 66.259  1.00 30.85 ? 135  GLU C N   1 
ATOM   3616  C  CA  . GLU C  1 135 ? 40.804 72.825 66.375  1.00 33.89 ? 135  GLU C CA  1 
ATOM   3617  C  C   . GLU C  1 135 ? 42.030 73.324 67.126  1.00 34.08 ? 135  GLU C C   1 
ATOM   3618  O  O   . GLU C  1 135 ? 42.588 74.372 66.803  1.00 33.24 ? 135  GLU C O   1 
ATOM   3619  C  CB  . GLU C  1 135 ? 39.544 73.302 67.096  1.00 36.19 ? 135  GLU C CB  1 
ATOM   3620  C  CG  . GLU C  1 135 ? 38.258 72.823 66.471  1.00 42.74 ? 135  GLU C CG  1 
ATOM   3621  C  CD  . GLU C  1 135 ? 37.027 73.268 67.242  1.00 46.64 ? 135  GLU C CD  1 
ATOM   3622  O  OE1 . GLU C  1 135 ? 37.038 73.191 68.492  1.00 49.88 ? 135  GLU C OE1 1 
ATOM   3623  O  OE2 . GLU C  1 135 ? 36.041 73.679 66.592  1.00 51.86 ? 135  GLU C OE2 1 
ATOM   3624  N  N   . THR C  1 136 ? 42.455 72.564 68.126  1.00 33.59 ? 136  THR C N   1 
ATOM   3625  C  CA  . THR C  1 136 ? 43.618 72.949 68.910  1.00 32.17 ? 136  THR C CA  1 
ATOM   3626  C  C   . THR C  1 136 ? 44.897 72.974 68.058  1.00 30.05 ? 136  THR C C   1 
ATOM   3627  O  O   . THR C  1 136 ? 45.756 73.840 68.241  1.00 28.52 ? 136  THR C O   1 
ATOM   3628  C  CB  . THR C  1 136 ? 43.783 71.991 70.095  1.00 31.90 ? 136  THR C CB  1 
ATOM   3629  O  OG1 . THR C  1 136 ? 42.591 72.033 70.887  1.00 35.09 ? 136  THR C OG1 1 
ATOM   3630  C  CG2 . THR C  1 136 ? 44.968 72.383 70.953  1.00 30.01 ? 136  THR C CG2 1 
ATOM   3631  N  N   . GLN C  1 137 ? 45.014 72.029 67.129  1.00 28.77 ? 137  GLN C N   1 
ATOM   3632  C  CA  . GLN C  1 137 ? 46.178 71.950 66.248  1.00 29.21 ? 137  GLN C CA  1 
ATOM   3633  C  C   . GLN C  1 137 ? 46.203 73.121 65.274  1.00 29.36 ? 137  GLN C C   1 
ATOM   3634  O  O   . GLN C  1 137 ? 47.264 73.673 64.985  1.00 29.23 ? 137  GLN C O   1 
ATOM   3635  C  CB  . GLN C  1 137 ? 46.168 70.641 65.453  1.00 28.52 ? 137  GLN C CB  1 
ATOM   3636  C  CG  . GLN C  1 137 ? 46.086 69.425 66.320  1.00 29.77 ? 137  GLN C CG  1 
ATOM   3637  C  CD  . GLN C  1 137 ? 47.102 69.470 67.433  1.00 34.44 ? 137  GLN C CD  1 
ATOM   3638  O  OE1 . GLN C  1 137 ? 48.314 69.507 67.187  1.00 32.32 ? 137  GLN C OE1 1 
ATOM   3639  N  NE2 . GLN C  1 137 ? 46.617 69.478 68.675  1.00 35.02 ? 137  GLN C NE2 1 
ATOM   3640  N  N   . LEU C  1 138 ? 45.033 73.493 64.761  1.00 28.28 ? 138  LEU C N   1 
ATOM   3641  C  CA  . LEU C  1 138 ? 44.948 74.604 63.831  1.00 29.20 ? 138  LEU C CA  1 
ATOM   3642  C  C   . LEU C  1 138 ? 45.305 75.932 64.508  1.00 32.54 ? 138  LEU C C   1 
ATOM   3643  O  O   . LEU C  1 138 ? 45.870 76.823 63.870  1.00 33.66 ? 138  LEU C O   1 
ATOM   3644  C  CB  . LEU C  1 138 ? 43.551 74.654 63.218  1.00 27.54 ? 138  LEU C CB  1 
ATOM   3645  C  CG  . LEU C  1 138 ? 43.304 73.517 62.211  1.00 29.87 ? 138  LEU C CG  1 
ATOM   3646  C  CD1 . LEU C  1 138 ? 41.824 73.414 61.883  1.00 24.87 ? 138  LEU C CD1 1 
ATOM   3647  C  CD2 . LEU C  1 138 ? 44.130 73.765 60.938  1.00 26.88 ? 138  LEU C CD2 1 
ATOM   3648  N  N   . ASP C  1 139 ? 44.992 76.060 65.798  1.00 34.19 ? 139  ASP C N   1 
ATOM   3649  C  CA  . ASP C  1 139 ? 45.311 77.280 66.540  1.00 35.98 ? 139  ASP C CA  1 
ATOM   3650  C  C   . ASP C  1 139 ? 46.786 77.316 66.909  1.00 36.03 ? 139  ASP C C   1 
ATOM   3651  O  O   . ASP C  1 139 ? 47.430 78.371 66.859  1.00 33.62 ? 139  ASP C O   1 
ATOM   3652  C  CB  . ASP C  1 139 ? 44.490 77.382 67.827  1.00 40.96 ? 139  ASP C CB  1 
ATOM   3653  C  CG  . ASP C  1 139 ? 43.025 77.649 67.568  1.00 45.66 ? 139  ASP C CG  1 
ATOM   3654  O  OD1 . ASP C  1 139 ? 42.711 78.453 66.658  1.00 47.46 ? 139  ASP C OD1 1 
ATOM   3655  O  OD2 . ASP C  1 139 ? 42.187 77.064 68.291  1.00 50.02 ? 139  ASP C OD2 1 
ATOM   3656  N  N   . LEU C  1 140 ? 47.306 76.158 67.306  1.00 36.22 ? 140  LEU C N   1 
ATOM   3657  C  CA  . LEU C  1 140 ? 48.706 76.034 67.674  1.00 34.99 ? 140  LEU C CA  1 
ATOM   3658  C  C   . LEU C  1 140 ? 49.524 76.508 66.483  1.00 34.15 ? 140  LEU C C   1 
ATOM   3659  O  O   . LEU C  1 140 ? 50.446 77.309 66.633  1.00 36.50 ? 140  LEU C O   1 
ATOM   3660  C  CB  . LEU C  1 140 ? 49.032 74.574 68.014  1.00 33.50 ? 140  LEU C CB  1 
ATOM   3661  C  CG  . LEU C  1 140 ? 49.312 74.199 69.480  1.00 38.55 ? 140  LEU C CG  1 
ATOM   3662  C  CD1 . LEU C  1 140 ? 48.725 75.221 70.431  1.00 39.19 ? 140  LEU C CD1 1 
ATOM   3663  C  CD2 . LEU C  1 140 ? 48.739 72.814 69.765  1.00 35.86 ? 140  LEU C CD2 1 
ATOM   3664  N  N   . ILE C  1 141 ? 49.168 76.027 65.296  1.00 32.51 ? 141  ILE C N   1 
ATOM   3665  C  CA  . ILE C  1 141 ? 49.871 76.419 64.078  1.00 33.20 ? 141  ILE C CA  1 
ATOM   3666  C  C   . ILE C  1 141 ? 49.902 77.937 63.975  1.00 34.28 ? 141  ILE C C   1 
ATOM   3667  O  O   . ILE C  1 141 ? 50.955 78.544 63.787  1.00 33.28 ? 141  ILE C O   1 
ATOM   3668  C  CB  . ILE C  1 141 ? 49.173 75.867 62.805  1.00 30.64 ? 141  ILE C CB  1 
ATOM   3669  C  CG1 . ILE C  1 141 ? 49.400 74.354 62.689  1.00 25.92 ? 141  ILE C CG1 1 
ATOM   3670  C  CG2 . ILE C  1 141 ? 49.685 76.608 61.566  1.00 28.28 ? 141  ILE C CG2 1 
ATOM   3671  C  CD1 . ILE C  1 141 ? 48.754 73.712 61.452  1.00 21.98 ? 141  ILE C CD1 1 
ATOM   3672  N  N   . ASP C  1 142 ? 48.734 78.543 64.112  1.00 36.17 ? 142  ASP C N   1 
ATOM   3673  C  CA  . ASP C  1 142 ? 48.622 79.984 64.019  1.00 40.57 ? 142  ASP C CA  1 
ATOM   3674  C  C   . ASP C  1 142 ? 49.328 80.720 65.163  1.00 39.16 ? 142  ASP C C   1 
ATOM   3675  O  O   . ASP C  1 142 ? 49.534 81.928 65.089  1.00 38.62 ? 142  ASP C O   1 
ATOM   3676  C  CB  . ASP C  1 142 ? 47.144 80.379 63.974  1.00 45.69 ? 142  ASP C CB  1 
ATOM   3677  C  CG  . ASP C  1 142 ? 46.934 81.760 63.387  1.00 54.76 ? 142  ASP C CG  1 
ATOM   3678  O  OD1 . ASP C  1 142 ? 47.278 81.960 62.198  1.00 58.62 ? 142  ASP C OD1 1 
ATOM   3679  O  OD2 . ASP C  1 142 ? 46.430 82.648 64.111  1.00 59.77 ? 142  ASP C OD2 1 
ATOM   3680  N  N   . LYS C  1 143 ? 49.710 79.997 66.211  1.00 39.62 ? 143  LYS C N   1 
ATOM   3681  C  CA  . LYS C  1 143 ? 50.373 80.617 67.358  1.00 38.80 ? 143  LYS C CA  1 
ATOM   3682  C  C   . LYS C  1 143 ? 51.891 80.473 67.399  1.00 37.36 ? 143  LYS C C   1 
ATOM   3683  O  O   . LYS C  1 143 ? 52.594 81.419 67.750  1.00 37.30 ? 143  LYS C O   1 
ATOM   3684  C  CB  . LYS C  1 143 ? 49.780 80.077 68.673  1.00 40.61 ? 143  LYS C CB  1 
ATOM   3685  C  CG  . LYS C  1 143 ? 48.400 80.641 69.007  1.00 40.41 ? 143  LYS C CG  1 
ATOM   3686  C  CD  . LYS C  1 143 ? 47.731 79.941 70.195  1.00 38.12 ? 143  LYS C CD  1 
ATOM   3687  C  CE  . LYS C  1 143 ? 46.287 80.433 70.347  1.00 37.08 ? 143  LYS C CE  1 
ATOM   3688  N  NZ  . LYS C  1 143 ? 45.484 79.671 71.339  1.00 34.51 ? 143  LYS C NZ  1 
ATOM   3689  N  N   . ILE C  1 144 ? 52.404 79.297 67.056  1.00 35.09 ? 144  ILE C N   1 
ATOM   3690  C  CA  . ILE C  1 144 ? 53.842 79.101 67.096  1.00 31.65 ? 144  ILE C CA  1 
ATOM   3691  C  C   . ILE C  1 144 ? 54.470 79.093 65.707  1.00 32.48 ? 144  ILE C C   1 
ATOM   3692  O  O   . ILE C  1 144 ? 55.694 79.162 65.580  1.00 33.85 ? 144  ILE C O   1 
ATOM   3693  C  CB  . ILE C  1 144 ? 54.204 77.789 67.850  1.00 29.70 ? 144  ILE C CB  1 
ATOM   3694  C  CG1 . ILE C  1 144 ? 54.127 76.579 66.919  1.00 26.75 ? 144  ILE C CG1 1 
ATOM   3695  C  CG2 . ILE C  1 144 ? 53.233 77.581 69.000  1.00 23.32 ? 144  ILE C CG2 1 
ATOM   3696  C  CD1 . ILE C  1 144 ? 54.538 75.258 67.586  1.00 22.69 ? 144  ILE C CD1 1 
ATOM   3697  N  N   . GLY C  1 145 ? 53.631 79.019 64.673  1.00 31.77 ? 145  GLY C N   1 
ATOM   3698  C  CA  . GLY C  1 145 ? 54.122 79.002 63.300  1.00 28.70 ? 145  GLY C CA  1 
ATOM   3699  C  C   . GLY C  1 145 ? 54.191 77.601 62.712  1.00 29.49 ? 145  GLY C C   1 
ATOM   3700  O  O   . GLY C  1 145 ? 54.570 76.656 63.412  1.00 32.23 ? 145  GLY C O   1 
ATOM   3701  N  N   . LEU C  1 146 ? 53.848 77.453 61.432  1.00 26.61 ? 146  LEU C N   1 
ATOM   3702  C  CA  . LEU C  1 146 ? 53.870 76.138 60.790  1.00 25.39 ? 146  LEU C CA  1 
ATOM   3703  C  C   . LEU C  1 146 ? 55.185 75.369 60.929  1.00 28.14 ? 146  LEU C C   1 
ATOM   3704  O  O   . LEU C  1 146 ? 55.177 74.142 61.082  1.00 29.39 ? 146  LEU C O   1 
ATOM   3705  C  CB  . LEU C  1 146 ? 53.531 76.246 59.306  1.00 21.26 ? 146  LEU C CB  1 
ATOM   3706  C  CG  . LEU C  1 146 ? 53.319 74.868 58.658  1.00 23.12 ? 146  LEU C CG  1 
ATOM   3707  C  CD1 . LEU C  1 146 ? 52.121 74.173 59.328  1.00 17.08 ? 146  LEU C CD1 1 
ATOM   3708  C  CD2 . LEU C  1 146 ? 53.085 75.012 57.157  1.00 19.25 ? 146  LEU C CD2 1 
ATOM   3709  N  N   . GLU C  1 147 ? 56.310 76.077 60.872  1.00 30.85 ? 147  GLU C N   1 
ATOM   3710  C  CA  . GLU C  1 147 ? 57.608 75.425 60.989  1.00 32.27 ? 147  GLU C CA  1 
ATOM   3711  C  C   . GLU C  1 147 ? 57.801 74.834 62.381  1.00 31.36 ? 147  GLU C C   1 
ATOM   3712  O  O   . GLU C  1 147 ? 58.092 73.642 62.508  1.00 31.74 ? 147  GLU C O   1 
ATOM   3713  C  CB  . GLU C  1 147 ? 58.733 76.405 60.660  1.00 35.83 ? 147  GLU C CB  1 
ATOM   3714  C  CG  . GLU C  1 147 ? 58.563 77.080 59.312  1.00 44.56 ? 147  GLU C CG  1 
ATOM   3715  C  CD  . GLU C  1 147 ? 59.869 77.625 58.764  1.00 54.58 ? 147  GLU C CD  1 
ATOM   3716  O  OE1 . GLU C  1 147 ? 60.565 78.372 59.492  1.00 59.56 ? 147  GLU C OE1 1 
ATOM   3717  O  OE2 . GLU C  1 147 ? 60.201 77.309 57.597  1.00 59.30 ? 147  GLU C OE2 1 
ATOM   3718  N  N   . ASN C  1 148 ? 57.635 75.646 63.424  1.00 30.17 ? 148  ASN C N   1 
ATOM   3719  C  CA  . ASN C  1 148 ? 57.777 75.130 64.786  1.00 29.37 ? 148  ASN C CA  1 
ATOM   3720  C  C   . ASN C  1 148 ? 56.759 74.017 65.022  1.00 27.77 ? 148  ASN C C   1 
ATOM   3721  O  O   . ASN C  1 148 ? 57.095 72.976 65.586  1.00 27.66 ? 148  ASN C O   1 
ATOM   3722  C  CB  . ASN C  1 148 ? 57.564 76.225 65.841  1.00 32.00 ? 148  ASN C CB  1 
ATOM   3723  C  CG  . ASN C  1 148 ? 58.767 77.145 65.991  1.00 34.93 ? 148  ASN C CG  1 
ATOM   3724  O  OD1 . ASN C  1 148 ? 59.902 76.692 66.170  1.00 35.22 ? 148  ASN C OD1 1 
ATOM   3725  N  ND2 . ASN C  1 148 ? 58.518 78.448 65.932  1.00 36.08 ? 148  ASN C ND2 1 
ATOM   3726  N  N   . TYR C  1 149 ? 55.519 74.220 64.584  1.00 24.53 ? 149  TYR C N   1 
ATOM   3727  C  CA  . TYR C  1 149 ? 54.514 73.194 64.791  1.00 24.92 ? 149  TYR C CA  1 
ATOM   3728  C  C   . TYR C  1 149 ? 54.919 71.885 64.138  1.00 26.58 ? 149  TYR C C   1 
ATOM   3729  O  O   . TYR C  1 149 ? 54.733 70.821 64.718  1.00 28.62 ? 149  TYR C O   1 
ATOM   3730  C  CB  . TYR C  1 149 ? 53.152 73.600 64.235  1.00 23.51 ? 149  TYR C CB  1 
ATOM   3731  C  CG  . TYR C  1 149 ? 52.129 72.490 64.398  1.00 22.48 ? 149  TYR C CG  1 
ATOM   3732  C  CD1 . TYR C  1 149 ? 51.464 72.301 65.609  1.00 21.80 ? 149  TYR C CD1 1 
ATOM   3733  C  CD2 . TYR C  1 149 ? 51.863 71.596 63.355  1.00 23.28 ? 149  TYR C CD2 1 
ATOM   3734  C  CE1 . TYR C  1 149 ? 50.557 71.247 65.779  1.00 25.23 ? 149  TYR C CE1 1 
ATOM   3735  C  CE2 . TYR C  1 149 ? 50.960 70.538 63.512  1.00 20.92 ? 149  TYR C CE2 1 
ATOM   3736  C  CZ  . TYR C  1 149 ? 50.311 70.371 64.725  1.00 25.45 ? 149  TYR C CZ  1 
ATOM   3737  O  OH  . TYR C  1 149 ? 49.415 69.336 64.891  1.00 27.43 ? 149  TYR C OH  1 
ATOM   3738  N  N   . LEU C  1 150 ? 55.456 71.952 62.926  1.00 27.24 ? 150  LEU C N   1 
ATOM   3739  C  CA  . LEU C  1 150 ? 55.858 70.727 62.250  1.00 29.34 ? 150  LEU C CA  1 
ATOM   3740  C  C   . LEU C  1 150 ? 57.097 70.114 62.893  1.00 28.98 ? 150  LEU C C   1 
ATOM   3741  O  O   . LEU C  1 150 ? 57.252 68.892 62.911  1.00 29.74 ? 150  LEU C O   1 
ATOM   3742  C  CB  . LEU C  1 150 ? 56.097 70.980 60.756  1.00 29.80 ? 150  LEU C CB  1 
ATOM   3743  C  CG  . LEU C  1 150 ? 54.836 71.270 59.939  1.00 29.92 ? 150  LEU C CG  1 
ATOM   3744  C  CD1 . LEU C  1 150 ? 55.209 71.440 58.480  1.00 27.67 ? 150  LEU C CD1 1 
ATOM   3745  C  CD2 . LEU C  1 150 ? 53.826 70.124 60.101  1.00 29.75 ? 150  LEU C CD2 1 
ATOM   3746  N  N   . GLN C  1 151 ? 57.983 70.952 63.421  1.00 27.69 ? 151  GLN C N   1 
ATOM   3747  C  CA  . GLN C  1 151 ? 59.172 70.426 64.082  1.00 28.57 ? 151  GLN C CA  1 
ATOM   3748  C  C   . GLN C  1 151 ? 58.728 69.600 65.288  1.00 31.31 ? 151  GLN C C   1 
ATOM   3749  O  O   . GLN C  1 151 ? 59.268 68.526 65.546  1.00 31.51 ? 151  GLN C O   1 
ATOM   3750  C  CB  . GLN C  1 151 ? 60.076 71.559 64.554  1.00 25.33 ? 151  GLN C CB  1 
ATOM   3751  C  CG  . GLN C  1 151 ? 61.129 71.114 65.539  1.00 27.98 ? 151  GLN C CG  1 
ATOM   3752  C  CD  . GLN C  1 151 ? 62.127 72.210 65.870  1.00 30.19 ? 151  GLN C CD  1 
ATOM   3753  O  OE1 . GLN C  1 151 ? 61.743 73.323 66.220  1.00 34.40 ? 151  GLN C OE1 1 
ATOM   3754  N  NE2 . GLN C  1 151 ? 63.418 71.893 65.770  1.00 30.63 ? 151  GLN C NE2 1 
ATOM   3755  N  N   . SER C  1 152 ? 57.731 70.114 66.009  1.00 31.12 ? 152  SER C N   1 
ATOM   3756  C  CA  . SER C  1 152 ? 57.189 69.461 67.195  1.00 31.99 ? 152  SER C CA  1 
ATOM   3757  C  C   . SER C  1 152 ? 56.520 68.132 66.908  1.00 34.91 ? 152  SER C C   1 
ATOM   3758  O  O   . SER C  1 152 ? 56.337 67.315 67.815  1.00 35.21 ? 152  SER C O   1 
ATOM   3759  C  CB  . SER C  1 152 ? 56.169 70.370 67.884  1.00 30.37 ? 152  SER C CB  1 
ATOM   3760  O  OG  . SER C  1 152 ? 56.818 71.404 68.596  1.00 34.75 ? 152  SER C OG  1 
ATOM   3761  N  N   . GLN C  1 153 ? 56.145 67.910 65.656  1.00 36.28 ? 153  GLN C N   1 
ATOM   3762  C  CA  . GLN C  1 153 ? 55.471 66.672 65.311  1.00 40.01 ? 153  GLN C CA  1 
ATOM   3763  C  C   . GLN C  1 153 ? 56.416 65.661 64.690  1.00 43.19 ? 153  GLN C C   1 
ATOM   3764  O  O   . GLN C  1 153 ? 55.992 64.587 64.273  1.00 45.06 ? 153  GLN C O   1 
ATOM   3765  C  CB  . GLN C  1 153 ? 54.316 66.950 64.347  1.00 39.62 ? 153  GLN C CB  1 
ATOM   3766  C  CG  . GLN C  1 153 ? 53.321 68.011 64.817  1.00 40.65 ? 153  GLN C CG  1 
ATOM   3767  C  CD  . GLN C  1 153 ? 52.761 67.740 66.201  1.00 40.37 ? 153  GLN C CD  1 
ATOM   3768  O  OE1 . GLN C  1 153 ? 52.380 66.612 66.523  1.00 41.70 ? 153  GLN C OE1 1 
ATOM   3769  N  NE2 . GLN C  1 153 ? 52.694 68.781 67.023  1.00 39.34 ? 153  GLN C NE2 1 
ATOM   3770  N  N   . MET C  1 154 ? 57.700 65.989 64.634  1.00 47.18 ? 154  MET C N   1 
ATOM   3771  C  CA  . MET C  1 154 ? 58.657 65.077 64.033  1.00 51.64 ? 154  MET C CA  1 
ATOM   3772  C  C   . MET C  1 154 ? 58.759 63.725 64.713  1.00 57.18 ? 154  MET C C   1 
ATOM   3773  O  O   . MET C  1 154 ? 58.790 62.696 64.039  1.00 60.36 ? 154  MET C O   1 
ATOM   3774  C  CB  . MET C  1 154 ? 60.035 65.714 63.963  1.00 48.70 ? 154  MET C CB  1 
ATOM   3775  C  CG  . MET C  1 154 ? 60.148 66.775 62.896  1.00 45.76 ? 154  MET C CG  1 
ATOM   3776  S  SD  . MET C  1 154 ? 61.845 66.884 62.327  1.00 43.60 ? 154  MET C SD  1 
ATOM   3777  C  CE  . MET C  1 154 ? 62.611 67.648 63.741  1.00 45.28 ? 154  MET C CE  1 
ATOM   3778  N  N   . ASP C  1 155 ? 58.818 63.710 66.038  1.00 63.90 ? 155  ASP C N   1 
ATOM   3779  C  CA  . ASP C  1 155 ? 58.908 62.437 66.757  1.00 70.06 ? 155  ASP C CA  1 
ATOM   3780  C  C   . ASP C  1 155 ? 58.314 62.496 68.163  1.00 71.17 ? 155  ASP C C   1 
ATOM   3781  O  O   . ASP C  1 155 ? 57.496 61.605 68.494  1.00 71.67 ? 155  ASP C O   1 
ATOM   3782  C  CB  . ASP C  1 155 ? 60.366 61.959 66.817  1.00 72.60 ? 155  ASP C CB  1 
ATOM   3783  C  CG  . ASP C  1 155 ? 61.323 63.046 67.273  1.00 75.26 ? 155  ASP C CG  1 
ATOM   3784  O  OD1 . ASP C  1 155 ? 61.463 64.064 66.555  1.00 76.80 ? 155  ASP C OD1 1 
ATOM   3785  O  OD2 . ASP C  1 155 ? 61.934 62.880 68.350  1.00 75.91 ? 155  ASP C OD2 1 
ATOM   3786  O  OXT . ASP C  1 155 ? 58.674 63.428 68.915  1.00 73.17 ? 155  ASP C OXT 1 
ATOM   3787  N  N   . MET D  1 1   ? 61.312 58.267 46.662  1.00 59.80 ? 1    MET D N   1 
ATOM   3788  C  CA  . MET D  1 1   ? 61.860 57.644 45.423  1.00 58.02 ? 1    MET D CA  1 
ATOM   3789  C  C   . MET D  1 1   ? 60.716 57.463 44.425  1.00 56.13 ? 1    MET D C   1 
ATOM   3790  O  O   . MET D  1 1   ? 59.692 56.857 44.751  1.00 57.89 ? 1    MET D O   1 
ATOM   3791  C  CB  . MET D  1 1   ? 62.484 56.292 45.775  1.00 61.80 ? 1    MET D CB  1 
ATOM   3792  C  CG  . MET D  1 1   ? 63.359 55.701 44.690  1.00 64.52 ? 1    MET D CG  1 
ATOM   3793  S  SD  . MET D  1 1   ? 64.071 54.109 45.172  1.00 69.89 ? 1    MET D SD  1 
ATOM   3794  C  CE  . MET D  1 1   ? 62.841 52.965 44.450  1.00 67.90 ? 1    MET D CE  1 
ATOM   3795  N  N   . LYS D  1 2   ? 60.878 57.996 43.217  1.00 51.71 ? 2    LYS D N   1 
ATOM   3796  C  CA  . LYS D  1 2   ? 59.832 57.887 42.207  1.00 48.05 ? 2    LYS D CA  1 
ATOM   3797  C  C   . LYS D  1 2   ? 59.790 56.478 41.633  1.00 44.94 ? 2    LYS D C   1 
ATOM   3798  O  O   . LYS D  1 2   ? 60.798 55.976 41.134  1.00 43.39 ? 2    LYS D O   1 
ATOM   3799  C  CB  . LYS D  1 2   ? 60.066 58.906 41.086  1.00 53.42 ? 2    LYS D CB  1 
ATOM   3800  C  CG  . LYS D  1 2   ? 58.902 59.038 40.100  1.00 58.96 ? 2    LYS D CG  1 
ATOM   3801  C  CD  . LYS D  1 2   ? 57.628 59.509 40.803  1.00 64.98 ? 2    LYS D CD  1 
ATOM   3802  C  CE  . LYS D  1 2   ? 56.404 59.444 39.882  1.00 67.92 ? 2    LYS D CE  1 
ATOM   3803  N  NZ  . LYS D  1 2   ? 55.143 59.882 40.566  1.00 66.88 ? 2    LYS D NZ  1 
ATOM   3804  N  N   . GLY D  1 3   ? 58.620 55.844 41.712  1.00 40.50 ? 3    GLY D N   1 
ATOM   3805  C  CA  . GLY D  1 3   ? 58.468 54.492 41.206  1.00 37.92 ? 3    GLY D CA  1 
ATOM   3806  C  C   . GLY D  1 3   ? 57.869 54.422 39.811  1.00 39.24 ? 3    GLY D C   1 
ATOM   3807  O  O   . GLY D  1 3   ? 57.546 55.450 39.208  1.00 40.02 ? 3    GLY D O   1 
ATOM   3808  N  N   . ASP D  1 4   ? 57.713 53.202 39.302  1.00 37.47 ? 4    ASP D N   1 
ATOM   3809  C  CA  . ASP D  1 4   ? 57.164 52.984 37.971  1.00 37.53 ? 4    ASP D CA  1 
ATOM   3810  C  C   . ASP D  1 4   ? 55.655 53.158 37.921  1.00 36.56 ? 4    ASP D C   1 
ATOM   3811  O  O   . ASP D  1 4   ? 54.915 52.401 38.548  1.00 38.61 ? 4    ASP D O   1 
ATOM   3812  C  CB  . ASP D  1 4   ? 57.509 51.581 37.480  1.00 42.44 ? 4    ASP D CB  1 
ATOM   3813  C  CG  . ASP D  1 4   ? 57.074 51.345 36.050  1.00 46.71 ? 4    ASP D CG  1 
ATOM   3814  O  OD1 . ASP D  1 4   ? 57.856 51.682 35.135  1.00 49.22 ? 4    ASP D OD1 1 
ATOM   3815  O  OD2 . ASP D  1 4   ? 55.946 50.838 35.843  1.00 47.71 ? 4    ASP D OD2 1 
ATOM   3816  N  N   . LYS D  1 5   ? 55.211 54.149 37.151  1.00 35.60 ? 5    LYS D N   1 
ATOM   3817  C  CA  . LYS D  1 5   ? 53.794 54.463 36.980  1.00 33.85 ? 5    LYS D CA  1 
ATOM   3818  C  C   . LYS D  1 5   ? 52.886 53.236 36.904  1.00 33.20 ? 5    LYS D C   1 
ATOM   3819  O  O   . LYS D  1 5   ? 51.840 53.187 37.555  1.00 31.63 ? 5    LYS D O   1 
ATOM   3820  C  CB  . LYS D  1 5   ? 53.605 55.299 35.717  1.00 36.73 ? 5    LYS D CB  1 
ATOM   3821  C  CG  . LYS D  1 5   ? 52.160 55.669 35.422  1.00 41.23 ? 5    LYS D CG  1 
ATOM   3822  C  CD  . LYS D  1 5   ? 52.076 56.584 34.220  1.00 43.17 ? 5    LYS D CD  1 
ATOM   3823  C  CE  . LYS D  1 5   ? 50.661 57.060 33.982  1.00 44.65 ? 5    LYS D CE  1 
ATOM   3824  N  NZ  . LYS D  1 5   ? 50.623 57.965 32.797  1.00 49.12 ? 5    LYS D NZ  1 
ATOM   3825  N  N   . ILE D  1 6   ? 53.276 52.247 36.106  1.00 31.72 ? 6    ILE D N   1 
ATOM   3826  C  CA  . ILE D  1 6   ? 52.458 51.048 35.974  1.00 29.41 ? 6    ILE D CA  1 
ATOM   3827  C  C   . ILE D  1 6   ? 52.546 50.171 37.220  1.00 26.63 ? 6    ILE D C   1 
ATOM   3828  O  O   . ILE D  1 6   ? 51.569 49.509 37.580  1.00 23.27 ? 6    ILE D O   1 
ATOM   3829  C  CB  . ILE D  1 6   ? 52.861 50.224 34.724  1.00 30.99 ? 6    ILE D CB  1 
ATOM   3830  C  CG1 . ILE D  1 6   ? 52.827 51.120 33.478  1.00 31.51 ? 6    ILE D CG1 1 
ATOM   3831  C  CG2 . ILE D  1 6   ? 51.908 49.049 34.541  1.00 29.38 ? 6    ILE D CG2 1 
ATOM   3832  C  CD1 . ILE D  1 6   ? 51.521 51.887 33.301  1.00 33.43 ? 6    ILE D CD1 1 
ATOM   3833  N  N   . VAL D  1 7   ? 53.709 50.161 37.874  1.00 24.89 ? 7    VAL D N   1 
ATOM   3834  C  CA  . VAL D  1 7   ? 53.872 49.369 39.091  1.00 24.25 ? 7    VAL D CA  1 
ATOM   3835  C  C   . VAL D  1 7   ? 52.881 49.896 40.132  1.00 25.89 ? 7    VAL D C   1 
ATOM   3836  O  O   . VAL D  1 7   ? 52.185 49.121 40.811  1.00 26.03 ? 7    VAL D O   1 
ATOM   3837  C  CB  . VAL D  1 7   ? 55.306 49.469 39.662  1.00 24.69 ? 7    VAL D CB  1 
ATOM   3838  C  CG1 . VAL D  1 7   ? 55.329 48.946 41.096  1.00 23.78 ? 7    VAL D CG1 1 
ATOM   3839  C  CG2 . VAL D  1 7   ? 56.275 48.636 38.810  1.00 22.08 ? 7    VAL D CG2 1 
ATOM   3840  N  N   . ILE D  1 8   ? 52.808 51.219 40.243  1.00 20.66 ? 8    ILE D N   1 
ATOM   3841  C  CA  . ILE D  1 8   ? 51.896 51.843 41.182  1.00 21.37 ? 8    ILE D CA  1 
ATOM   3842  C  C   . ILE D  1 8   ? 50.434 51.505 40.851  1.00 24.68 ? 8    ILE D C   1 
ATOM   3843  O  O   . ILE D  1 8   ? 49.630 51.258 41.757  1.00 23.27 ? 8    ILE D O   1 
ATOM   3844  C  CB  . ILE D  1 8   ? 52.089 53.357 41.175  1.00 22.86 ? 8    ILE D CB  1 
ATOM   3845  C  CG1 . ILE D  1 8   ? 53.507 53.686 41.643  1.00 21.63 ? 8    ILE D CG1 1 
ATOM   3846  C  CG2 . ILE D  1 8   ? 51.044 54.025 42.064  1.00 25.21 ? 8    ILE D CG2 1 
ATOM   3847  C  CD1 . ILE D  1 8   ? 53.867 55.127 41.479  1.00 20.85 ? 8    ILE D CD1 1 
ATOM   3848  N  N   . GLN D  1 9   ? 50.095 51.505 39.560  1.00 27.02 ? 9    GLN D N   1 
ATOM   3849  C  CA  . GLN D  1 9   ? 48.740 51.177 39.108  1.00 29.55 ? 9    GLN D CA  1 
ATOM   3850  C  C   . GLN D  1 9   ? 48.395 49.779 39.590  1.00 31.12 ? 9    GLN D C   1 
ATOM   3851  O  O   . GLN D  1 9   ? 47.262 49.512 40.009  1.00 32.27 ? 9    GLN D O   1 
ATOM   3852  C  CB  . GLN D  1 9   ? 48.649 51.201 37.580  1.00 33.16 ? 9    GLN D CB  1 
ATOM   3853  C  CG  . GLN D  1 9   ? 48.447 52.576 36.964  1.00 39.19 ? 9    GLN D CG  1 
ATOM   3854  C  CD  . GLN D  1 9   ? 48.596 52.552 35.448  1.00 42.52 ? 9    GLN D CD  1 
ATOM   3855  O  OE1 . GLN D  1 9   ? 48.263 51.557 34.797  1.00 45.47 ? 9    GLN D OE1 1 
ATOM   3856  N  NE2 . GLN D  1 9   ? 49.087 53.651 34.880  1.00 41.96 ? 9    GLN D NE2 1 
ATOM   3857  N  N   . HIS D  1 10  ? 49.375 48.881 39.510  1.00 29.67 ? 10   HIS D N   1 
ATOM   3858  C  CA  . HIS D  1 10  ? 49.177 47.510 39.958  1.00 29.58 ? 10   HIS D CA  1 
ATOM   3859  C  C   . HIS D  1 10  ? 48.936 47.518 41.467  1.00 28.88 ? 10   HIS D C   1 
ATOM   3860  O  O   . HIS D  1 10  ? 47.911 47.014 41.937  1.00 27.38 ? 10   HIS D O   1 
ATOM   3861  C  CB  . HIS D  1 10  ? 50.400 46.646 39.610  1.00 32.29 ? 10   HIS D CB  1 
ATOM   3862  C  CG  . HIS D  1 10  ? 50.333 46.027 38.247  1.00 34.80 ? 10   HIS D CG  1 
ATOM   3863  N  ND1 . HIS D  1 10  ? 49.448 45.018 37.930  1.00 36.62 ? 10   HIS D ND1 1 
ATOM   3864  C  CD2 . HIS D  1 10  ? 51.017 46.296 37.108  1.00 35.22 ? 10   HIS D CD2 1 
ATOM   3865  C  CE1 . HIS D  1 10  ? 49.586 44.693 36.657  1.00 34.09 ? 10   HIS D CE1 1 
ATOM   3866  N  NE2 . HIS D  1 10  ? 50.531 45.453 36.135  1.00 36.76 ? 10   HIS D NE2 1 
ATOM   3867  N  N   . LEU D  1 11  ? 49.873 48.102 42.217  1.00 25.07 ? 11   LEU D N   1 
ATOM   3868  C  CA  . LEU D  1 11  ? 49.745 48.192 43.664  1.00 22.91 ? 11   LEU D CA  1 
ATOM   3869  C  C   . LEU D  1 11  ? 48.379 48.757 44.039  1.00 23.57 ? 11   LEU D C   1 
ATOM   3870  O  O   . LEU D  1 11  ? 47.683 48.205 44.894  1.00 25.16 ? 11   LEU D O   1 
ATOM   3871  C  CB  . LEU D  1 11  ? 50.840 49.085 44.233  1.00 19.56 ? 11   LEU D CB  1 
ATOM   3872  C  CG  . LEU D  1 11  ? 52.249 48.585 43.926  1.00 19.49 ? 11   LEU D CG  1 
ATOM   3873  C  CD1 . LEU D  1 11  ? 53.269 49.563 44.494  1.00 19.23 ? 11   LEU D CD1 1 
ATOM   3874  C  CD2 . LEU D  1 11  ? 52.440 47.191 44.519  1.00 17.26 ? 11   LEU D CD2 1 
ATOM   3875  N  N   . ASN D  1 12  ? 47.997 49.859 43.401  1.00 24.68 ? 12   ASN D N   1 
ATOM   3876  C  CA  . ASN D  1 12  ? 46.702 50.476 43.668  1.00 27.12 ? 12   ASN D CA  1 
ATOM   3877  C  C   . ASN D  1 12  ? 45.579 49.469 43.439  1.00 30.51 ? 12   ASN D C   1 
ATOM   3878  O  O   . ASN D  1 12  ? 44.579 49.458 44.155  1.00 31.71 ? 12   ASN D O   1 
ATOM   3879  C  CB  . ASN D  1 12  ? 46.480 51.686 42.758  1.00 27.44 ? 12   ASN D CB  1 
ATOM   3880  C  CG  . ASN D  1 12  ? 46.695 53.016 43.476  1.00 29.68 ? 12   ASN D CG  1 
ATOM   3881  O  OD1 . ASN D  1 12  ? 46.450 53.135 44.676  1.00 34.12 ? 12   ASN D OD1 1 
ATOM   3882  N  ND2 . ASN D  1 12  ? 47.125 54.030 42.732  1.00 30.80 ? 12   ASN D ND2 1 
ATOM   3883  N  N   . LYS D  1 13  ? 45.744 48.614 42.436  1.00 33.71 ? 13   LYS D N   1 
ATOM   3884  C  CA  . LYS D  1 13  ? 44.724 47.627 42.145  1.00 33.66 ? 13   LYS D CA  1 
ATOM   3885  C  C   . LYS D  1 13  ? 44.620 46.584 43.249  1.00 32.14 ? 13   LYS D C   1 
ATOM   3886  O  O   . LYS D  1 13  ? 43.520 46.269 43.707  1.00 33.54 ? 13   LYS D O   1 
ATOM   3887  C  CB  . LYS D  1 13  ? 44.997 46.939 40.803  1.00 37.78 ? 13   LYS D CB  1 
ATOM   3888  C  CG  . LYS D  1 13  ? 43.858 46.017 40.376  1.00 41.98 ? 13   LYS D CG  1 
ATOM   3889  C  CD  . LYS D  1 13  ? 43.974 45.543 38.939  1.00 46.00 ? 13   LYS D CD  1 
ATOM   3890  C  CE  . LYS D  1 13  ? 42.680 44.845 38.516  1.00 48.62 ? 13   LYS D CE  1 
ATOM   3891  N  NZ  . LYS D  1 13  ? 42.711 44.316 37.119  1.00 49.31 ? 13   LYS D NZ  1 
ATOM   3892  N  N   . ILE D  1 14  ? 45.752 46.037 43.678  1.00 29.98 ? 14   ILE D N   1 
ATOM   3893  C  CA  . ILE D  1 14  ? 45.711 45.026 44.729  1.00 29.98 ? 14   ILE D CA  1 
ATOM   3894  C  C   . ILE D  1 14  ? 45.042 45.651 45.946  1.00 29.83 ? 14   ILE D C   1 
ATOM   3895  O  O   . ILE D  1 14  ? 44.241 45.003 46.629  1.00 28.01 ? 14   ILE D O   1 
ATOM   3896  C  CB  . ILE D  1 14  ? 47.122 44.537 45.133  1.00 30.58 ? 14   ILE D CB  1 
ATOM   3897  C  CG1 . ILE D  1 14  ? 47.931 44.162 43.885  1.00 28.92 ? 14   ILE D CG1 1 
ATOM   3898  C  CG2 . ILE D  1 14  ? 47.000 43.325 46.071  1.00 30.68 ? 14   ILE D CG2 1 
ATOM   3899  C  CD1 . ILE D  1 14  ? 47.280 43.111 43.018  1.00 26.71 ? 14   ILE D CD1 1 
ATOM   3900  N  N   . LEU D  1 15  ? 45.366 46.919 46.195  1.00 26.21 ? 15   LEU D N   1 
ATOM   3901  C  CA  . LEU D  1 15  ? 44.798 47.660 47.314  1.00 25.01 ? 15   LEU D CA  1 
ATOM   3902  C  C   . LEU D  1 15  ? 43.278 47.651 47.228  1.00 27.04 ? 15   LEU D C   1 
ATOM   3903  O  O   . LEU D  1 15  ? 42.588 47.353 48.211  1.00 27.85 ? 15   LEU D O   1 
ATOM   3904  C  CB  . LEU D  1 15  ? 45.309 49.105 47.304  1.00 26.07 ? 15   LEU D CB  1 
ATOM   3905  C  CG  . LEU D  1 15  ? 44.749 50.064 48.365  1.00 26.39 ? 15   LEU D CG  1 
ATOM   3906  C  CD1 . LEU D  1 15  ? 44.909 49.459 49.749  1.00 27.62 ? 15   LEU D CD1 1 
ATOM   3907  C  CD2 . LEU D  1 15  ? 45.473 51.393 48.281  1.00 22.05 ? 15   LEU D CD2 1 
ATOM   3908  N  N   . GLY D  1 16  ? 42.761 47.986 46.049  1.00 27.82 ? 16   GLY D N   1 
ATOM   3909  C  CA  . GLY D  1 16  ? 41.325 47.998 45.848  1.00 28.16 ? 16   GLY D CA  1 
ATOM   3910  C  C   . GLY D  1 16  ? 40.707 46.661 46.220  1.00 30.33 ? 16   GLY D C   1 
ATOM   3911  O  O   . GLY D  1 16  ? 39.606 46.614 46.779  1.00 30.97 ? 16   GLY D O   1 
ATOM   3912  N  N   . ASN D  1 17  ? 41.410 45.573 45.908  1.00 29.48 ? 17   ASN D N   1 
ATOM   3913  C  CA  . ASN D  1 17  ? 40.923 44.233 46.233  1.00 31.05 ? 17   ASN D CA  1 
ATOM   3914  C  C   . ASN D  1 17  ? 40.988 44.041 47.742  1.00 29.78 ? 17   ASN D C   1 
ATOM   3915  O  O   . ASN D  1 17  ? 40.045 43.530 48.350  1.00 30.98 ? 17   ASN D O   1 
ATOM   3916  C  CB  . ASN D  1 17  ? 41.776 43.148 45.551  1.00 31.87 ? 17   ASN D CB  1 
ATOM   3917  C  CG  . ASN D  1 17  ? 41.572 43.091 44.039  1.00 30.90 ? 17   ASN D CG  1 
ATOM   3918  O  OD1 . ASN D  1 17  ? 42.355 42.464 43.324  1.00 30.61 ? 17   ASN D OD1 1 
ATOM   3919  N  ND2 . ASN D  1 17  ? 40.517 43.737 43.551  1.00 28.87 ? 17   ASN D ND2 1 
ATOM   3920  N  N   . GLU D  1 18  ? 42.099 44.457 48.343  1.00 27.21 ? 18   GLU D N   1 
ATOM   3921  C  CA  . GLU D  1 18  ? 42.264 44.321 49.783  1.00 29.12 ? 18   GLU D CA  1 
ATOM   3922  C  C   . GLU D  1 18  ? 41.144 45.058 50.508  1.00 29.36 ? 18   GLU D C   1 
ATOM   3923  O  O   . GLU D  1 18  ? 40.546 44.533 51.452  1.00 27.34 ? 18   GLU D O   1 
ATOM   3924  C  CB  . GLU D  1 18  ? 43.614 44.882 50.234  1.00 28.56 ? 18   GLU D CB  1 
ATOM   3925  C  CG  . GLU D  1 18  ? 44.830 44.130 49.709  1.00 30.41 ? 18   GLU D CG  1 
ATOM   3926  C  CD  . GLU D  1 18  ? 44.844 42.661 50.105  1.00 32.75 ? 18   GLU D CD  1 
ATOM   3927  O  OE1 . GLU D  1 18  ? 44.125 42.288 51.056  1.00 35.62 ? 18   GLU D OE1 1 
ATOM   3928  O  OE2 . GLU D  1 18  ? 45.591 41.882 49.472  1.00 34.82 ? 18   GLU D OE2 1 
ATOM   3929  N  N   . LEU D  1 19  ? 40.852 46.275 50.057  1.00 30.82 ? 19   LEU D N   1 
ATOM   3930  C  CA  . LEU D  1 19  ? 39.801 47.077 50.683  1.00 31.88 ? 19   LEU D CA  1 
ATOM   3931  C  C   . LEU D  1 19  ? 38.435 46.389 50.666  1.00 32.44 ? 19   LEU D C   1 
ATOM   3932  O  O   . LEU D  1 19  ? 37.639 46.561 51.589  1.00 35.64 ? 19   LEU D O   1 
ATOM   3933  C  CB  . LEU D  1 19  ? 39.710 48.451 50.016  1.00 28.10 ? 19   LEU D CB  1 
ATOM   3934  C  CG  . LEU D  1 19  ? 40.942 49.342 50.209  1.00 29.06 ? 19   LEU D CG  1 
ATOM   3935  C  CD1 . LEU D  1 19  ? 40.631 50.719 49.679  1.00 28.16 ? 19   LEU D CD1 1 
ATOM   3936  C  CD2 . LEU D  1 19  ? 41.324 49.426 51.686  1.00 23.66 ? 19   LEU D CD2 1 
ATOM   3937  N  N   . ILE D  1 20  ? 38.166 45.612 49.622  1.00 31.35 ? 20   ILE D N   1 
ATOM   3938  C  CA  . ILE D  1 20  ? 36.898 44.897 49.527  1.00 31.42 ? 20   ILE D CA  1 
ATOM   3939  C  C   . ILE D  1 20  ? 36.900 43.810 50.607  1.00 30.20 ? 20   ILE D C   1 
ATOM   3940  O  O   . ILE D  1 20  ? 36.016 43.755 51.464  1.00 28.35 ? 20   ILE D O   1 
ATOM   3941  C  CB  . ILE D  1 20  ? 36.730 44.244 48.124  1.00 33.70 ? 20   ILE D CB  1 
ATOM   3942  C  CG1 . ILE D  1 20  ? 36.757 45.326 47.036  1.00 34.33 ? 20   ILE D CG1 1 
ATOM   3943  C  CG2 . ILE D  1 20  ? 35.418 43.468 48.053  1.00 32.83 ? 20   ILE D CG2 1 
ATOM   3944  C  CD1 . ILE D  1 20  ? 36.694 44.784 45.610  1.00 29.52 ? 20   ILE D CD1 1 
ATOM   3945  N  N   . ALA D  1 21  ? 37.916 42.955 50.563  1.00 30.05 ? 21   ALA D N   1 
ATOM   3946  C  CA  . ALA D  1 21  ? 38.060 41.876 51.524  1.00 28.43 ? 21   ALA D CA  1 
ATOM   3947  C  C   . ALA D  1 21  ? 37.845 42.375 52.956  1.00 30.00 ? 21   ALA D C   1 
ATOM   3948  O  O   . ALA D  1 21  ? 37.106 41.751 53.721  1.00 32.63 ? 21   ALA D O   1 
ATOM   3949  C  CB  . ALA D  1 21  ? 39.442 41.246 51.390  1.00 25.20 ? 21   ALA D CB  1 
ATOM   3950  N  N   . ILE D  1 22  ? 38.479 43.494 53.315  1.00 27.46 ? 22   ILE D N   1 
ATOM   3951  C  CA  . ILE D  1 22  ? 38.347 44.047 54.665  1.00 24.09 ? 22   ILE D CA  1 
ATOM   3952  C  C   . ILE D  1 22  ? 36.895 44.155 55.114  1.00 25.99 ? 22   ILE D C   1 
ATOM   3953  O  O   . ILE D  1 22  ? 36.520 43.622 56.163  1.00 28.42 ? 22   ILE D O   1 
ATOM   3954  C  CB  . ILE D  1 22  ? 38.926 45.463 54.777  1.00 20.84 ? 22   ILE D CB  1 
ATOM   3955  C  CG1 . ILE D  1 22  ? 40.421 45.465 54.517  1.00 23.01 ? 22   ILE D CG1 1 
ATOM   3956  C  CG2 . ILE D  1 22  ? 38.670 46.014 56.163  1.00 17.18 ? 22   ILE D CG2 1 
ATOM   3957  C  CD1 . ILE D  1 22  ? 40.991 46.877 54.466  1.00 23.88 ? 22   ILE D CD1 1 
ATOM   3958  N  N   . ASN D  1 23  ? 36.088 44.861 54.324  1.00 24.49 ? 23   ASN D N   1 
ATOM   3959  C  CA  . ASN D  1 23  ? 34.684 45.059 54.655  1.00 26.33 ? 23   ASN D CA  1 
ATOM   3960  C  C   . ASN D  1 23  ? 33.888 43.765 54.634  1.00 28.74 ? 23   ASN D C   1 
ATOM   3961  O  O   . ASN D  1 23  ? 33.057 43.528 55.512  1.00 28.96 ? 23   ASN D O   1 
ATOM   3962  C  CB  . ASN D  1 23  ? 34.045 46.047 53.685  1.00 27.36 ? 23   ASN D CB  1 
ATOM   3963  C  CG  . ASN D  1 23  ? 34.562 47.458 53.859  1.00 29.23 ? 23   ASN D CG  1 
ATOM   3964  O  OD1 . ASN D  1 23  ? 35.728 47.673 54.209  1.00 28.02 ? 23   ASN D OD1 1 
ATOM   3965  N  ND2 . ASN D  1 23  ? 33.701 48.436 53.590  1.00 27.28 ? 23   ASN D ND2 1 
ATOM   3966  N  N   . GLN D  1 24  ? 34.131 42.926 53.633  1.00 30.45 ? 24   GLN D N   1 
ATOM   3967  C  CA  . GLN D  1 24  ? 33.393 41.676 53.535  1.00 30.86 ? 24   GLN D CA  1 
ATOM   3968  C  C   . GLN D  1 24  ? 33.648 40.798 54.754  1.00 31.32 ? 24   GLN D C   1 
ATOM   3969  O  O   . GLN D  1 24  ? 32.709 40.312 55.388  1.00 31.85 ? 24   GLN D O   1 
ATOM   3970  C  CB  . GLN D  1 24  ? 33.783 40.919 52.267  1.00 32.41 ? 24   GLN D CB  1 
ATOM   3971  C  CG  . GLN D  1 24  ? 32.696 39.976 51.753  1.00 34.87 ? 24   GLN D CG  1 
ATOM   3972  C  CD  . GLN D  1 24  ? 33.155 39.157 50.564  1.00 33.94 ? 24   GLN D CD  1 
ATOM   3973  O  OE1 . GLN D  1 24  ? 33.724 38.081 50.719  1.00 36.99 ? 24   GLN D OE1 1 
ATOM   3974  N  NE2 . GLN D  1 24  ? 32.924 39.674 49.368  1.00 35.54 ? 24   GLN D NE2 1 
ATOM   3975  N  N   . TYR D  1 25  ? 34.916 40.605 55.095  1.00 31.75 ? 25   TYR D N   1 
ATOM   3976  C  CA  . TYR D  1 25  ? 35.250 39.762 56.238  1.00 32.85 ? 25   TYR D CA  1 
ATOM   3977  C  C   . TYR D  1 25  ? 34.827 40.373 57.574  1.00 31.98 ? 25   TYR D C   1 
ATOM   3978  O  O   . TYR D  1 25  ? 34.488 39.645 58.507  1.00 30.77 ? 25   TYR D O   1 
ATOM   3979  C  CB  . TYR D  1 25  ? 36.752 39.433 56.247  1.00 31.09 ? 25   TYR D CB  1 
ATOM   3980  C  CG  . TYR D  1 25  ? 37.228 38.761 54.974  1.00 32.83 ? 25   TYR D CG  1 
ATOM   3981  C  CD1 . TYR D  1 25  ? 36.314 38.358 53.997  1.00 35.47 ? 25   TYR D CD1 1 
ATOM   3982  C  CD2 . TYR D  1 25  ? 38.591 38.559 54.725  1.00 32.16 ? 25   TYR D CD2 1 
ATOM   3983  C  CE1 . TYR D  1 25  ? 36.735 37.779 52.801  1.00 35.32 ? 25   TYR D CE1 1 
ATOM   3984  C  CE2 . TYR D  1 25  ? 39.026 37.977 53.528  1.00 33.52 ? 25   TYR D CE2 1 
ATOM   3985  C  CZ  . TYR D  1 25  ? 38.085 37.592 52.571  1.00 34.73 ? 25   TYR D CZ  1 
ATOM   3986  O  OH  . TYR D  1 25  ? 38.470 37.024 51.382  1.00 31.71 ? 25   TYR D OH  1 
ATOM   3987  N  N   . PHE D  1 26  ? 34.827 41.697 57.682  1.00 30.13 ? 26   PHE D N   1 
ATOM   3988  C  CA  . PHE D  1 26  ? 34.415 42.273 58.945  1.00 30.01 ? 26   PHE D CA  1 
ATOM   3989  C  C   . PHE D  1 26  ? 32.910 42.111 59.131  1.00 30.04 ? 26   PHE D C   1 
ATOM   3990  O  O   . PHE D  1 26  ? 32.441 41.810 60.228  1.00 33.07 ? 26   PHE D O   1 
ATOM   3991  C  CB  . PHE D  1 26  ? 34.779 43.746 59.048  1.00 31.17 ? 26   PHE D CB  1 
ATOM   3992  C  CG  . PHE D  1 26  ? 34.795 44.240 60.460  1.00 32.48 ? 26   PHE D CG  1 
ATOM   3993  C  CD1 . PHE D  1 26  ? 35.934 44.083 61.250  1.00 35.02 ? 26   PHE D CD1 1 
ATOM   3994  C  CD2 . PHE D  1 26  ? 33.643 44.765 61.040  1.00 31.00 ? 26   PHE D CD2 1 
ATOM   3995  C  CE1 . PHE D  1 26  ? 35.921 44.440 62.610  1.00 38.05 ? 26   PHE D CE1 1 
ATOM   3996  C  CE2 . PHE D  1 26  ? 33.617 45.124 62.392  1.00 35.25 ? 26   PHE D CE2 1 
ATOM   3997  C  CZ  . PHE D  1 26  ? 34.758 44.961 63.182  1.00 33.94 ? 26   PHE D CZ  1 
ATOM   3998  N  N   . LEU D  1 27  ? 32.148 42.311 58.065  1.00 27.90 ? 27   LEU D N   1 
ATOM   3999  C  CA  . LEU D  1 27  ? 30.703 42.153 58.152  1.00 28.25 ? 27   LEU D CA  1 
ATOM   4000  C  C   . LEU D  1 27  ? 30.380 40.686 58.426  1.00 28.43 ? 27   LEU D C   1 
ATOM   4001  O  O   . LEU D  1 27  ? 29.563 40.365 59.294  1.00 26.96 ? 27   LEU D O   1 
ATOM   4002  C  CB  . LEU D  1 27  ? 30.024 42.598 56.850  1.00 28.07 ? 27   LEU D CB  1 
ATOM   4003  C  CG  . LEU D  1 27  ? 28.505 42.385 56.786  1.00 24.32 ? 27   LEU D CG  1 
ATOM   4004  C  CD1 . LEU D  1 27  ? 27.859 43.014 58.005  1.00 23.36 ? 27   LEU D CD1 1 
ATOM   4005  C  CD2 . LEU D  1 27  ? 27.948 42.997 55.510  1.00 22.16 ? 27   LEU D CD2 1 
ATOM   4006  N  N   . HIS D  1 28  ? 31.024 39.793 57.680  1.00 28.32 ? 28   HIS D N   1 
ATOM   4007  C  CA  . HIS D  1 28  ? 30.803 38.364 57.872  1.00 29.09 ? 28   HIS D CA  1 
ATOM   4008  C  C   . HIS D  1 28  ? 31.147 37.953 59.308  1.00 29.43 ? 28   HIS D C   1 
ATOM   4009  O  O   . HIS D  1 28  ? 30.413 37.190 59.940  1.00 31.46 ? 28   HIS D O   1 
ATOM   4010  C  CB  . HIS D  1 28  ? 31.656 37.550 56.891  1.00 29.04 ? 28   HIS D CB  1 
ATOM   4011  C  CG  . HIS D  1 28  ? 31.041 37.395 55.536  1.00 27.86 ? 28   HIS D CG  1 
ATOM   4012  N  ND1 . HIS D  1 28  ? 29.756 37.805 55.250  1.00 28.41 ? 28   HIS D ND1 1 
ATOM   4013  C  CD2 . HIS D  1 28  ? 31.525 36.848 54.395  1.00 27.36 ? 28   HIS D CD2 1 
ATOM   4014  C  CE1 . HIS D  1 28  ? 29.473 37.519 53.991  1.00 28.34 ? 28   HIS D CE1 1 
ATOM   4015  N  NE2 . HIS D  1 28  ? 30.530 36.938 53.450  1.00 32.57 ? 28   HIS D NE2 1 
ATOM   4016  N  N   . ALA D  1 29  ? 32.268 38.463 59.810  1.00 27.97 ? 29   ALA D N   1 
ATOM   4017  C  CA  . ALA D  1 29  ? 32.722 38.158 61.157  1.00 27.29 ? 29   ALA D CA  1 
ATOM   4018  C  C   . ALA D  1 29  ? 31.678 38.535 62.202  1.00 28.46 ? 29   ALA D C   1 
ATOM   4019  O  O   . ALA D  1 29  ? 31.311 37.721 63.048  1.00 29.45 ? 29   ALA D O   1 
ATOM   4020  C  CB  . ALA D  1 29  ? 34.029 38.885 61.440  1.00 26.28 ? 29   ALA D CB  1 
ATOM   4021  N  N   . ARG D  1 30  ? 31.191 39.767 62.153  1.00 29.01 ? 30   ARG D N   1 
ATOM   4022  C  CA  . ARG D  1 30  ? 30.194 40.178 63.128  1.00 29.69 ? 30   ARG D CA  1 
ATOM   4023  C  C   . ARG D  1 30  ? 28.884 39.411 62.961  1.00 27.81 ? 30   ARG D C   1 
ATOM   4024  O  O   . ARG D  1 30  ? 28.114 39.285 63.908  1.00 30.41 ? 30   ARG D O   1 
ATOM   4025  C  CB  . ARG D  1 30  ? 29.947 41.692 63.042  1.00 30.48 ? 30   ARG D CB  1 
ATOM   4026  C  CG  . ARG D  1 30  ? 31.167 42.535 63.397  1.00 33.45 ? 30   ARG D CG  1 
ATOM   4027  C  CD  . ARG D  1 30  ? 31.846 42.013 64.653  1.00 34.33 ? 30   ARG D CD  1 
ATOM   4028  N  NE  . ARG D  1 30  ? 33.044 42.776 65.003  1.00 43.51 ? 30   ARG D NE  1 
ATOM   4029  C  CZ  . ARG D  1 30  ? 34.077 42.273 65.681  1.00 44.48 ? 30   ARG D CZ  1 
ATOM   4030  N  NH1 . ARG D  1 30  ? 34.055 41.005 66.075  1.00 41.62 ? 30   ARG D NH1 1 
ATOM   4031  N  NH2 . ARG D  1 30  ? 35.129 43.031 65.967  1.00 40.46 ? 30   ARG D NH2 1 
ATOM   4032  N  N   . MET D  1 31  ? 28.629 38.898 61.762  1.00 26.71 ? 31   MET D N   1 
ATOM   4033  C  CA  . MET D  1 31  ? 27.405 38.139 61.520  1.00 26.56 ? 31   MET D CA  1 
ATOM   4034  C  C   . MET D  1 31  ? 27.469 36.788 62.215  1.00 28.23 ? 31   MET D C   1 
ATOM   4035  O  O   . MET D  1 31  ? 26.482 36.340 62.805  1.00 27.24 ? 31   MET D O   1 
ATOM   4036  C  CB  . MET D  1 31  ? 27.174 37.954 60.026  1.00 23.98 ? 31   MET D CB  1 
ATOM   4037  C  CG  . MET D  1 31  ? 26.609 39.189 59.363  1.00 20.77 ? 31   MET D CG  1 
ATOM   4038  S  SD  . MET D  1 31  ? 26.578 39.029 57.577  1.00 30.80 ? 31   MET D SD  1 
ATOM   4039  C  CE  . MET D  1 31  ? 25.248 37.788 57.342  1.00 25.12 ? 31   MET D CE  1 
ATOM   4040  N  N   . TYR D  1 32  ? 28.630 36.138 62.139  1.00 29.18 ? 32   TYR D N   1 
ATOM   4041  C  CA  . TYR D  1 32  ? 28.823 34.857 62.809  1.00 29.87 ? 32   TYR D CA  1 
ATOM   4042  C  C   . TYR D  1 32  ? 28.619 35.095 64.306  1.00 31.32 ? 32   TYR D C   1 
ATOM   4043  O  O   . TYR D  1 32  ? 27.854 34.382 64.959  1.00 31.11 ? 32   TYR D O   1 
ATOM   4044  C  CB  . TYR D  1 32  ? 30.238 34.322 62.570  1.00 29.06 ? 32   TYR D CB  1 
ATOM   4045  C  CG  . TYR D  1 32  ? 30.487 33.785 61.180  1.00 30.65 ? 32   TYR D CG  1 
ATOM   4046  C  CD1 . TYR D  1 32  ? 31.487 34.329 60.372  1.00 31.65 ? 32   TYR D CD1 1 
ATOM   4047  C  CD2 . TYR D  1 32  ? 29.746 32.714 60.678  1.00 31.43 ? 32   TYR D CD2 1 
ATOM   4048  C  CE1 . TYR D  1 32  ? 31.746 33.819 59.098  1.00 29.42 ? 32   TYR D CE1 1 
ATOM   4049  C  CE2 . TYR D  1 32  ? 29.999 32.194 59.402  1.00 31.09 ? 32   TYR D CE2 1 
ATOM   4050  C  CZ  . TYR D  1 32  ? 31.002 32.752 58.620  1.00 29.50 ? 32   TYR D CZ  1 
ATOM   4051  O  OH  . TYR D  1 32  ? 31.273 32.238 57.372  1.00 24.95 ? 32   TYR D OH  1 
ATOM   4052  N  N   . GLU D  1 33  ? 29.306 36.106 64.839  1.00 31.28 ? 33   GLU D N   1 
ATOM   4053  C  CA  . GLU D  1 33  ? 29.204 36.457 66.252  1.00 32.75 ? 33   GLU D CA  1 
ATOM   4054  C  C   . GLU D  1 33  ? 27.742 36.621 66.650  1.00 31.84 ? 33   GLU D C   1 
ATOM   4055  O  O   . GLU D  1 33  ? 27.302 36.110 67.672  1.00 34.10 ? 33   GLU D O   1 
ATOM   4056  C  CB  . GLU D  1 33  ? 29.943 37.764 66.528  1.00 37.45 ? 33   GLU D CB  1 
ATOM   4057  C  CG  . GLU D  1 33  ? 31.144 37.644 67.461  1.00 44.89 ? 33   GLU D CG  1 
ATOM   4058  C  CD  . GLU D  1 33  ? 32.480 37.750 66.731  1.00 48.78 ? 33   GLU D CD  1 
ATOM   4059  O  OE1 . GLU D  1 33  ? 32.854 36.801 66.013  1.00 53.60 ? 33   GLU D OE1 1 
ATOM   4060  O  OE2 . GLU D  1 33  ? 33.159 38.791 66.873  1.00 52.31 ? 33   GLU D OE2 1 
ATOM   4061  N  N   . ASP D  1 34  ? 26.987 37.329 65.824  1.00 31.42 ? 34   ASP D N   1 
ATOM   4062  C  CA  . ASP D  1 34  ? 25.576 37.573 66.084  1.00 30.37 ? 34   ASP D CA  1 
ATOM   4063  C  C   . ASP D  1 34  ? 24.756 36.289 66.138  1.00 31.05 ? 34   ASP D C   1 
ATOM   4064  O  O   . ASP D  1 34  ? 23.690 36.253 66.759  1.00 31.82 ? 34   ASP D O   1 
ATOM   4065  C  CB  . ASP D  1 34  ? 25.016 38.495 65.002  1.00 34.02 ? 34   ASP D CB  1 
ATOM   4066  C  CG  . ASP D  1 34  ? 23.536 38.749 65.162  1.00 39.96 ? 34   ASP D CG  1 
ATOM   4067  O  OD1 . ASP D  1 34  ? 23.133 39.203 66.258  1.00 44.53 ? 34   ASP D OD1 1 
ATOM   4068  O  OD2 . ASP D  1 34  ? 22.776 38.500 64.194  1.00 40.90 ? 34   ASP D OD2 1 
ATOM   4069  N  N   . TRP D  1 35  ? 25.247 35.237 65.483  1.00 30.17 ? 35   TRP D N   1 
ATOM   4070  C  CA  . TRP D  1 35  ? 24.540 33.966 65.458  1.00 27.06 ? 35   TRP D CA  1 
ATOM   4071  C  C   . TRP D  1 35  ? 25.001 33.016 66.542  1.00 26.48 ? 35   TRP D C   1 
ATOM   4072  O  O   . TRP D  1 35  ? 24.409 31.950 66.724  1.00 27.30 ? 35   TRP D O   1 
ATOM   4073  C  CB  . TRP D  1 35  ? 24.696 33.270 64.105  1.00 28.24 ? 35   TRP D CB  1 
ATOM   4074  C  CG  . TRP D  1 35  ? 23.937 33.912 62.984  1.00 27.88 ? 35   TRP D CG  1 
ATOM   4075  C  CD1 . TRP D  1 35  ? 22.719 34.517 63.062  1.00 25.44 ? 35   TRP D CD1 1 
ATOM   4076  C  CD2 . TRP D  1 35  ? 24.334 33.978 61.605  1.00 25.28 ? 35   TRP D CD2 1 
ATOM   4077  N  NE1 . TRP D  1 35  ? 22.331 34.961 61.818  1.00 25.75 ? 35   TRP D NE1 1 
ATOM   4078  C  CE2 . TRP D  1 35  ? 23.304 34.645 60.906  1.00 24.72 ? 35   TRP D CE2 1 
ATOM   4079  C  CE3 . TRP D  1 35  ? 25.462 33.540 60.895  1.00 25.39 ? 35   TRP D CE3 1 
ATOM   4080  C  CZ2 . TRP D  1 35  ? 23.365 34.888 59.524  1.00 22.46 ? 35   TRP D CZ2 1 
ATOM   4081  C  CZ3 . TRP D  1 35  ? 25.523 33.780 59.514  1.00 26.64 ? 35   TRP D CZ3 1 
ATOM   4082  C  CH2 . TRP D  1 35  ? 24.477 34.449 58.849  1.00 25.08 ? 35   TRP D CH2 1 
ATOM   4083  N  N   . GLY D  1 36  ? 26.062 33.384 67.249  1.00 26.03 ? 36   GLY D N   1 
ATOM   4084  C  CA  . GLY D  1 36  ? 26.555 32.525 68.314  1.00 28.77 ? 36   GLY D CA  1 
ATOM   4085  C  C   . GLY D  1 36  ? 27.704 31.620 67.927  1.00 29.79 ? 36   GLY D C   1 
ATOM   4086  O  O   . GLY D  1 36  ? 28.201 30.839 68.744  1.00 31.47 ? 36   GLY D O   1 
ATOM   4087  N  N   . LEU D  1 37  ? 28.129 31.725 66.676  1.00 32.25 ? 37   LEU D N   1 
ATOM   4088  C  CA  . LEU D  1 37  ? 29.231 30.927 66.168  1.00 34.37 ? 37   LEU D CA  1 
ATOM   4089  C  C   . LEU D  1 37  ? 30.531 31.688 66.448  1.00 35.91 ? 37   LEU D C   1 
ATOM   4090  O  O   . LEU D  1 37  ? 31.123 32.288 65.552  1.00 37.01 ? 37   LEU D O   1 
ATOM   4091  C  CB  . LEU D  1 37  ? 29.025 30.694 64.668  1.00 33.32 ? 37   LEU D CB  1 
ATOM   4092  C  CG  . LEU D  1 37  ? 27.662 30.055 64.350  1.00 33.69 ? 37   LEU D CG  1 
ATOM   4093  C  CD1 . LEU D  1 37  ? 27.435 30.022 62.858  1.00 34.45 ? 37   LEU D CD1 1 
ATOM   4094  C  CD2 . LEU D  1 37  ? 27.602 28.644 64.921  1.00 32.74 ? 37   LEU D CD2 1 
ATOM   4095  N  N   . GLU D  1 38  ? 30.966 31.648 67.706  1.00 36.64 ? 38   GLU D N   1 
ATOM   4096  C  CA  . GLU D  1 38  ? 32.169 32.356 68.136  1.00 39.07 ? 38   GLU D CA  1 
ATOM   4097  C  C   . GLU D  1 38  ? 33.465 31.904 67.473  1.00 36.55 ? 38   GLU D C   1 
ATOM   4098  O  O   . GLU D  1 38  ? 34.301 32.733 67.112  1.00 35.80 ? 38   GLU D O   1 
ATOM   4099  C  CB  . GLU D  1 38  ? 32.308 32.274 69.664  1.00 45.71 ? 38   GLU D CB  1 
ATOM   4100  C  CG  . GLU D  1 38  ? 31.079 32.818 70.413  1.00 59.05 ? 38   GLU D CG  1 
ATOM   4101  C  CD  . GLU D  1 38  ? 31.297 32.996 71.919  1.00 65.81 ? 38   GLU D CD  1 
ATOM   4102  O  OE1 . GLU D  1 38  ? 31.789 32.049 72.578  1.00 68.81 ? 38   GLU D OE1 1 
ATOM   4103  O  OE2 . GLU D  1 38  ? 30.960 34.087 72.443  1.00 69.22 ? 38   GLU D OE2 1 
ATOM   4104  N  N   . LYS D  1 39  ? 33.639 30.598 67.320  1.00 34.95 ? 39   LYS D N   1 
ATOM   4105  C  CA  . LYS D  1 39  ? 34.845 30.050 66.695  1.00 34.54 ? 39   LYS D CA  1 
ATOM   4106  C  C   . LYS D  1 39  ? 35.016 30.696 65.312  1.00 32.97 ? 39   LYS D C   1 
ATOM   4107  O  O   . LYS D  1 39  ? 36.023 31.339 65.004  1.00 32.18 ? 39   LYS D O   1 
ATOM   4108  C  CB  . LYS D  1 39  ? 34.684 28.536 66.547  1.00 37.44 ? 39   LYS D CB  1 
ATOM   4109  C  CG  . LYS D  1 39  ? 35.941 27.716 66.736  1.00 41.06 ? 39   LYS D CG  1 
ATOM   4110  C  CD  . LYS D  1 39  ? 36.419 27.781 68.170  1.00 47.21 ? 39   LYS D CD  1 
ATOM   4111  C  CE  . LYS D  1 39  ? 37.399 26.660 68.465  1.00 50.47 ? 39   LYS D CE  1 
ATOM   4112  N  NZ  . LYS D  1 39  ? 36.733 25.327 68.376  1.00 53.45 ? 39   LYS D NZ  1 
ATOM   4113  N  N   . LEU D  1 40  ? 33.988 30.525 64.496  1.00 32.47 ? 40   LEU D N   1 
ATOM   4114  C  CA  . LEU D  1 40  ? 33.938 31.049 63.142  1.00 29.86 ? 40   LEU D CA  1 
ATOM   4115  C  C   . LEU D  1 40  ? 34.105 32.562 63.084  1.00 28.10 ? 40   LEU D C   1 
ATOM   4116  O  O   . LEU D  1 40  ? 34.858 33.075 62.260  1.00 28.98 ? 40   LEU D O   1 
ATOM   4117  C  CB  . LEU D  1 40  ? 32.599 30.663 62.534  1.00 29.64 ? 40   LEU D CB  1 
ATOM   4118  C  CG  . LEU D  1 40  ? 32.550 30.242 61.081  1.00 24.84 ? 40   LEU D CG  1 
ATOM   4119  C  CD1 . LEU D  1 40  ? 33.664 29.271 60.780  1.00 22.41 ? 40   LEU D CD1 1 
ATOM   4120  C  CD2 . LEU D  1 40  ? 31.195 29.621 60.836  1.00 25.48 ? 40   LEU D CD2 1 
ATOM   4121  N  N   . GLY D  1 41  ? 33.388 33.275 63.948  1.00 26.27 ? 41   GLY D N   1 
ATOM   4122  C  CA  . GLY D  1 41  ? 33.479 34.725 63.963  1.00 23.79 ? 41   GLY D CA  1 
ATOM   4123  C  C   . GLY D  1 41  ? 34.868 35.251 64.284  1.00 27.11 ? 41   GLY D C   1 
ATOM   4124  O  O   . GLY D  1 41  ? 35.318 36.250 63.719  1.00 28.54 ? 41   GLY D O   1 
ATOM   4125  N  N   . LYS D  1 42  ? 35.559 34.578 65.193  1.00 28.42 ? 42   LYS D N   1 
ATOM   4126  C  CA  . LYS D  1 42  ? 36.895 34.990 65.600  1.00 28.80 ? 42   LYS D CA  1 
ATOM   4127  C  C   . LYS D  1 42  ? 37.895 34.823 64.459  1.00 28.23 ? 42   LYS D C   1 
ATOM   4128  O  O   . LYS D  1 42  ? 38.757 35.672 64.233  1.00 25.73 ? 42   LYS D O   1 
ATOM   4129  C  CB  . LYS D  1 42  ? 37.325 34.163 66.813  1.00 31.86 ? 42   LYS D CB  1 
ATOM   4130  C  CG  . LYS D  1 42  ? 38.534 34.697 67.545  1.00 38.46 ? 42   LYS D CG  1 
ATOM   4131  C  CD  . LYS D  1 42  ? 38.597 34.114 68.948  1.00 47.86 ? 42   LYS D CD  1 
ATOM   4132  C  CE  . LYS D  1 42  ? 37.332 34.467 69.748  1.00 52.28 ? 42   LYS D CE  1 
ATOM   4133  N  NZ  . LYS D  1 42  ? 37.332 33.861 71.117  1.00 55.54 ? 42   LYS D NZ  1 
ATOM   4134  N  N   . HIS D  1 43  ? 37.782 33.715 63.743  1.00 30.70 ? 43   HIS D N   1 
ATOM   4135  C  CA  . HIS D  1 43  ? 38.671 33.454 62.623  1.00 33.06 ? 43   HIS D CA  1 
ATOM   4136  C  C   . HIS D  1 43  ? 38.423 34.492 61.528  1.00 34.36 ? 43   HIS D C   1 
ATOM   4137  O  O   . HIS D  1 43  ? 39.347 35.188 61.093  1.00 35.75 ? 43   HIS D O   1 
ATOM   4138  C  CB  . HIS D  1 43  ? 38.424 32.051 62.067  1.00 36.03 ? 43   HIS D CB  1 
ATOM   4139  C  CG  . HIS D  1 43  ? 39.543 31.547 61.218  1.00 41.83 ? 43   HIS D CG  1 
ATOM   4140  N  ND1 . HIS D  1 43  ? 39.884 32.131 60.017  1.00 45.47 ? 43   HIS D ND1 1 
ATOM   4141  C  CD2 . HIS D  1 43  ? 40.452 30.566 61.434  1.00 42.73 ? 43   HIS D CD2 1 
ATOM   4142  C  CE1 . HIS D  1 43  ? 40.959 31.535 59.532  1.00 46.43 ? 43   HIS D CE1 1 
ATOM   4143  N  NE2 . HIS D  1 43  ? 41.323 30.583 60.373  1.00 46.15 ? 43   HIS D NE2 1 
ATOM   4144  N  N   . GLU D  1 44  ? 37.172 34.595 61.087  1.00 31.75 ? 44   GLU D N   1 
ATOM   4145  C  CA  . GLU D  1 44  ? 36.804 35.556 60.053  1.00 33.00 ? 44   GLU D CA  1 
ATOM   4146  C  C   . GLU D  1 44  ? 37.266 36.957 60.467  1.00 31.82 ? 44   GLU D C   1 
ATOM   4147  O  O   . GLU D  1 44  ? 37.659 37.764 59.630  1.00 29.68 ? 44   GLU D O   1 
ATOM   4148  C  CB  . GLU D  1 44  ? 35.292 35.547 59.857  1.00 34.84 ? 44   GLU D CB  1 
ATOM   4149  C  CG  . GLU D  1 44  ? 34.804 36.294 58.629  1.00 41.20 ? 44   GLU D CG  1 
ATOM   4150  C  CD  . GLU D  1 44  ? 35.191 35.601 57.331  1.00 46.11 ? 44   GLU D CD  1 
ATOM   4151  O  OE1 . GLU D  1 44  ? 35.415 34.370 57.357  1.00 47.16 ? 44   GLU D OE1 1 
ATOM   4152  O  OE2 . GLU D  1 44  ? 35.257 36.283 56.281  1.00 50.19 ? 44   GLU D OE2 1 
ATOM   4153  N  N   . TYR D  1 45  ? 37.217 37.237 61.766  1.00 32.72 ? 45   TYR D N   1 
ATOM   4154  C  CA  . TYR D  1 45  ? 37.639 38.530 62.290  1.00 32.12 ? 45   TYR D CA  1 
ATOM   4155  C  C   . TYR D  1 45  ? 39.131 38.748 62.052  1.00 33.07 ? 45   TYR D C   1 
ATOM   4156  O  O   . TYR D  1 45  ? 39.544 39.813 61.589  1.00 35.18 ? 45   TYR D O   1 
ATOM   4157  C  CB  . TYR D  1 45  ? 37.345 38.628 63.788  1.00 31.78 ? 45   TYR D CB  1 
ATOM   4158  C  CG  . TYR D  1 45  ? 37.865 39.901 64.419  1.00 30.96 ? 45   TYR D CG  1 
ATOM   4159  C  CD1 . TYR D  1 45  ? 37.207 41.118 64.230  1.00 31.38 ? 45   TYR D CD1 1 
ATOM   4160  C  CD2 . TYR D  1 45  ? 39.047 39.898 65.159  1.00 32.01 ? 45   TYR D CD2 1 
ATOM   4161  C  CE1 . TYR D  1 45  ? 37.716 42.300 64.763  1.00 31.47 ? 45   TYR D CE1 1 
ATOM   4162  C  CE2 . TYR D  1 45  ? 39.567 41.070 65.692  1.00 31.93 ? 45   TYR D CE2 1 
ATOM   4163  C  CZ  . TYR D  1 45  ? 38.895 42.270 65.491  1.00 35.14 ? 45   TYR D CZ  1 
ATOM   4164  O  OH  . TYR D  1 45  ? 39.408 43.435 66.022  1.00 37.27 ? 45   TYR D OH  1 
ATOM   4165  N  N   . HIS D  1 46  ? 39.944 37.749 62.368  1.00 33.38 ? 46   HIS D N   1 
ATOM   4166  C  CA  . HIS D  1 46  ? 41.379 37.887 62.157  1.00 36.87 ? 46   HIS D CA  1 
ATOM   4167  C  C   . HIS D  1 46  ? 41.714 38.010 60.673  1.00 36.62 ? 46   HIS D C   1 
ATOM   4168  O  O   . HIS D  1 46  ? 42.643 38.722 60.304  1.00 35.93 ? 46   HIS D O   1 
ATOM   4169  C  CB  . HIS D  1 46  ? 42.135 36.703 62.766  1.00 40.24 ? 46   HIS D CB  1 
ATOM   4170  C  CG  . HIS D  1 46  ? 41.989 36.599 64.253  1.00 48.15 ? 46   HIS D CG  1 
ATOM   4171  N  ND1 . HIS D  1 46  ? 42.689 35.681 65.009  1.00 51.26 ? 46   HIS D ND1 1 
ATOM   4172  C  CD2 . HIS D  1 46  ? 41.211 37.286 65.123  1.00 50.27 ? 46   HIS D CD2 1 
ATOM   4173  C  CE1 . HIS D  1 46  ? 42.347 35.808 66.280  1.00 50.75 ? 46   HIS D CE1 1 
ATOM   4174  N  NE2 . HIS D  1 46  ? 41.451 36.774 66.376  1.00 52.19 ? 46   HIS D NE2 1 
ATOM   4175  N  N   . GLU D  1 47  ? 40.959 37.327 59.819  1.00 38.26 ? 47   GLU D N   1 
ATOM   4176  C  CA  . GLU D  1 47  ? 41.217 37.407 58.386  1.00 39.92 ? 47   GLU D CA  1 
ATOM   4177  C  C   . GLU D  1 47  ? 41.055 38.829 57.854  1.00 39.09 ? 47   GLU D C   1 
ATOM   4178  O  O   . GLU D  1 47  ? 41.861 39.281 57.037  1.00 40.80 ? 47   GLU D O   1 
ATOM   4179  C  CB  . GLU D  1 47  ? 40.302 36.461 57.599  1.00 43.29 ? 47   GLU D CB  1 
ATOM   4180  C  CG  . GLU D  1 47  ? 40.575 34.974 57.806  1.00 52.09 ? 47   GLU D CG  1 
ATOM   4181  C  CD  . GLU D  1 47  ? 42.037 34.572 57.587  1.00 56.24 ? 47   GLU D CD  1 
ATOM   4182  O  OE1 . GLU D  1 47  ? 42.294 33.369 57.343  1.00 58.75 ? 47   GLU D OE1 1 
ATOM   4183  O  OE2 . GLU D  1 47  ? 42.930 35.444 57.676  1.00 58.42 ? 47   GLU D OE2 1 
ATOM   4184  N  N   . SER D  1 48  ? 40.024 39.542 58.299  1.00 35.78 ? 48   SER D N   1 
ATOM   4185  C  CA  . SER D  1 48  ? 39.858 40.903 57.817  1.00 34.57 ? 48   SER D CA  1 
ATOM   4186  C  C   . SER D  1 48  ? 40.978 41.730 58.421  1.00 32.88 ? 48   SER D C   1 
ATOM   4187  O  O   . SER D  1 48  ? 41.501 42.635 57.779  1.00 33.65 ? 48   SER D O   1 
ATOM   4188  C  CB  . SER D  1 48  ? 38.503 41.487 58.216  1.00 33.74 ? 48   SER D CB  1 
ATOM   4189  O  OG  . SER D  1 48  ? 38.470 41.778 59.592  1.00 37.42 ? 48   SER D OG  1 
ATOM   4190  N  N   . ILE D  1 49  ? 41.365 41.420 59.655  1.00 32.17 ? 49   ILE D N   1 
ATOM   4191  C  CA  . ILE D  1 49  ? 42.449 42.176 60.268  1.00 31.59 ? 49   ILE D CA  1 
ATOM   4192  C  C   . ILE D  1 49  ? 43.691 42.007 59.403  1.00 32.97 ? 49   ILE D C   1 
ATOM   4193  O  O   . ILE D  1 49  ? 44.497 42.936 59.285  1.00 34.41 ? 49   ILE D O   1 
ATOM   4194  C  CB  . ILE D  1 49  ? 42.781 41.690 61.690  1.00 32.10 ? 49   ILE D CB  1 
ATOM   4195  C  CG1 . ILE D  1 49  ? 41.612 41.984 62.637  1.00 34.61 ? 49   ILE D CG1 1 
ATOM   4196  C  CG2 . ILE D  1 49  ? 44.043 42.393 62.194  1.00 30.98 ? 49   ILE D CG2 1 
ATOM   4197  C  CD1 . ILE D  1 49  ? 41.393 43.462 62.924  1.00 33.65 ? 49   ILE D CD1 1 
ATOM   4198  N  N   . ASP D  1 50  ? 43.851 40.830 58.797  1.00 28.87 ? 50   ASP D N   1 
ATOM   4199  C  CA  . ASP D  1 50  ? 45.007 40.602 57.946  1.00 28.97 ? 50   ASP D CA  1 
ATOM   4200  C  C   . ASP D  1 50  ? 44.923 41.483 56.710  1.00 28.20 ? 50   ASP D C   1 
ATOM   4201  O  O   . ASP D  1 50  ? 45.928 42.083 56.300  1.00 27.06 ? 50   ASP D O   1 
ATOM   4202  C  CB  . ASP D  1 50  ? 45.116 39.137 57.516  1.00 36.46 ? 50   ASP D CB  1 
ATOM   4203  C  CG  . ASP D  1 50  ? 45.678 38.240 58.609  1.00 40.94 ? 50   ASP D CG  1 
ATOM   4204  O  OD1 . ASP D  1 50  ? 46.595 38.676 59.341  1.00 43.15 ? 50   ASP D OD1 1 
ATOM   4205  O  OD2 . ASP D  1 50  ? 45.210 37.086 58.723  1.00 46.37 ? 50   ASP D OD2 1 
ATOM   4206  N  N   . GLU D  1 51  ? 43.731 41.567 56.120  1.00 24.88 ? 51   GLU D N   1 
ATOM   4207  C  CA  . GLU D  1 51  ? 43.539 42.391 54.927  1.00 24.28 ? 51   GLU D CA  1 
ATOM   4208  C  C   . GLU D  1 51  ? 43.880 43.826 55.279  1.00 22.68 ? 51   GLU D C   1 
ATOM   4209  O  O   . GLU D  1 51  ? 44.474 44.553 54.493  1.00 22.28 ? 51   GLU D O   1 
ATOM   4210  C  CB  . GLU D  1 51  ? 42.088 42.298 54.413  1.00 26.11 ? 51   GLU D CB  1 
ATOM   4211  C  CG  . GLU D  1 51  ? 41.605 40.861 54.234  1.00 29.13 ? 51   GLU D CG  1 
ATOM   4212  C  CD  . GLU D  1 51  ? 42.509 40.027 53.357  1.00 27.90 ? 51   GLU D CD  1 
ATOM   4213  O  OE1 . GLU D  1 51  ? 43.471 40.575 52.804  1.00 33.23 ? 51   GLU D OE1 1 
ATOM   4214  O  OE2 . GLU D  1 51  ? 42.253 38.810 53.231  1.00 31.42 ? 51   GLU D OE2 1 
ATOM   4215  N  N   . MET D  1 52  ? 43.528 44.226 56.490  1.00 22.34 ? 52   MET D N   1 
ATOM   4216  C  CA  . MET D  1 52  ? 43.827 45.572 56.929  1.00 22.42 ? 52   MET D CA  1 
ATOM   4217  C  C   . MET D  1 52  ? 45.332 45.818 56.886  1.00 21.45 ? 52   MET D C   1 
ATOM   4218  O  O   . MET D  1 52  ? 45.786 46.884 56.482  1.00 19.89 ? 52   MET D O   1 
ATOM   4219  C  CB  . MET D  1 52  ? 43.284 45.776 58.337  1.00 23.70 ? 52   MET D CB  1 
ATOM   4220  C  CG  . MET D  1 52  ? 41.771 45.866 58.368  1.00 25.55 ? 52   MET D CG  1 
ATOM   4221  S  SD  . MET D  1 52  ? 41.123 46.317 59.981  1.00 28.80 ? 52   MET D SD  1 
ATOM   4222  C  CE  . MET D  1 52  ? 39.892 45.046 60.210  1.00 28.12 ? 52   MET D CE  1 
ATOM   4223  N  N   . LYS D  1 53  ? 46.101 44.811 57.284  1.00 23.64 ? 53   LYS D N   1 
ATOM   4224  C  CA  . LYS D  1 53  ? 47.553 44.912 57.300  1.00 23.70 ? 53   LYS D CA  1 
ATOM   4225  C  C   . LYS D  1 53  ? 48.101 44.914 55.887  1.00 24.72 ? 53   LYS D C   1 
ATOM   4226  O  O   . LYS D  1 53  ? 49.044 45.645 55.576  1.00 26.13 ? 53   LYS D O   1 
ATOM   4227  C  CB  . LYS D  1 53  ? 48.138 43.750 58.093  1.00 26.31 ? 53   LYS D CB  1 
ATOM   4228  C  CG  . LYS D  1 53  ? 47.794 43.788 59.575  1.00 27.36 ? 53   LYS D CG  1 
ATOM   4229  C  CD  . LYS D  1 53  ? 48.356 42.577 60.274  1.00 30.75 ? 53   LYS D CD  1 
ATOM   4230  C  CE  . LYS D  1 53  ? 48.015 42.587 61.744  1.00 36.65 ? 53   LYS D CE  1 
ATOM   4231  N  NZ  . LYS D  1 53  ? 48.430 41.297 62.371  1.00 43.81 ? 53   LYS D NZ  1 
ATOM   4232  N  N   . HIS D  1 54  ? 47.515 44.082 55.033  1.00 24.40 ? 54   HIS D N   1 
ATOM   4233  C  CA  . HIS D  1 54  ? 47.917 44.021 53.631  1.00 23.87 ? 54   HIS D CA  1 
ATOM   4234  C  C   . HIS D  1 54  ? 47.757 45.409 53.013  1.00 23.44 ? 54   HIS D C   1 
ATOM   4235  O  O   . HIS D  1 54  ? 48.687 45.934 52.393  1.00 24.61 ? 54   HIS D O   1 
ATOM   4236  C  CB  . HIS D  1 54  ? 47.050 43.047 52.847  1.00 24.19 ? 54   HIS D CB  1 
ATOM   4237  C  CG  . HIS D  1 54  ? 47.282 41.598 53.295  1.00 25.77 ? 54   HIS D CG  1 
ATOM   4238  N  ND1 . HIS D  1 54  ? 46.524 40.548 52.820  1.00 21.70 ? 54   HIS D ND1 1 
ATOM   4239  C  CD2 . HIS D  1 54  ? 48.190 41.057 54.146  1.00 24.61 ? 54   HIS D CD2 1 
ATOM   4240  C  CE1 . HIS D  1 54  ? 46.951 39.419 53.365  1.00 25.73 ? 54   HIS D CE1 1 
ATOM   4241  N  NE2 . HIS D  1 54  ? 47.961 39.700 54.172  1.00 24.35 ? 54   HIS D NE2 1 
ATOM   4242  N  N   . ALA D  1 55  ? 46.576 45.994 53.204  1.00 22.53 ? 55   ALA D N   1 
ATOM   4243  C  CA  . ALA D  1 55  ? 46.284 47.331 52.700  1.00 26.29 ? 55   ALA D CA  1 
ATOM   4244  C  C   . ALA D  1 55  ? 47.327 48.315 53.227  1.00 27.60 ? 55   ALA D C   1 
ATOM   4245  O  O   . ALA D  1 55  ? 47.847 49.145 52.479  1.00 30.54 ? 55   ALA D O   1 
ATOM   4246  C  CB  . ALA D  1 55  ? 44.886 47.767 53.135  1.00 25.56 ? 55   ALA D CB  1 
ATOM   4247  N  N   . ASP D  1 56  ? 47.634 48.214 54.515  1.00 28.31 ? 56   ASP D N   1 
ATOM   4248  C  CA  . ASP D  1 56  ? 48.619 49.090 55.130  1.00 28.92 ? 56   ASP D CA  1 
ATOM   4249  C  C   . ASP D  1 56  ? 49.962 48.948 54.413  1.00 29.58 ? 56   ASP D C   1 
ATOM   4250  O  O   . ASP D  1 56  ? 50.613 49.943 54.093  1.00 32.59 ? 56   ASP D O   1 
ATOM   4251  C  CB  . ASP D  1 56  ? 48.769 48.751 56.623  1.00 30.53 ? 56   ASP D CB  1 
ATOM   4252  C  CG  . ASP D  1 56  ? 49.454 49.864 57.414  1.00 33.54 ? 56   ASP D CG  1 
ATOM   4253  O  OD1 . ASP D  1 56  ? 49.364 51.037 56.986  1.00 36.05 ? 56   ASP D OD1 1 
ATOM   4254  O  OD2 . ASP D  1 56  ? 50.066 49.576 58.470  1.00 31.15 ? 56   ASP D OD2 1 
ATOM   4255  N  N   . LYS D  1 57  ? 50.373 47.714 54.144  1.00 29.37 ? 57   LYS D N   1 
ATOM   4256  C  CA  . LYS D  1 57  ? 51.646 47.478 53.465  1.00 30.80 ? 57   LYS D CA  1 
ATOM   4257  C  C   . LYS D  1 57  ? 51.699 48.145 52.096  1.00 29.48 ? 57   LYS D C   1 
ATOM   4258  O  O   . LYS D  1 57  ? 52.714 48.731 51.715  1.00 28.48 ? 57   LYS D O   1 
ATOM   4259  C  CB  . LYS D  1 57  ? 51.893 45.977 53.279  1.00 36.00 ? 57   LYS D CB  1 
ATOM   4260  C  CG  . LYS D  1 57  ? 52.075 45.187 54.559  1.00 42.76 ? 57   LYS D CG  1 
ATOM   4261  C  CD  . LYS D  1 57  ? 52.315 43.716 54.236  1.00 49.02 ? 57   LYS D CD  1 
ATOM   4262  C  CE  . LYS D  1 57  ? 52.329 42.854 55.497  1.00 53.20 ? 57   LYS D CE  1 
ATOM   4263  N  NZ  . LYS D  1 57  ? 52.291 41.392 55.169  1.00 57.30 ? 57   LYS D NZ  1 
ATOM   4264  N  N   . LEU D  1 58  ? 50.602 48.036 51.352  1.00 28.58 ? 58   LEU D N   1 
ATOM   4265  C  CA  . LEU D  1 58  ? 50.517 48.607 50.011  1.00 27.43 ? 58   LEU D CA  1 
ATOM   4266  C  C   . LEU D  1 58  ? 50.536 50.129 50.044  1.00 27.18 ? 58   LEU D C   1 
ATOM   4267  O  O   . LEU D  1 58  ? 51.287 50.767 49.297  1.00 26.66 ? 58   LEU D O   1 
ATOM   4268  C  CB  . LEU D  1 58  ? 49.250 48.104 49.316  1.00 23.57 ? 58   LEU D CB  1 
ATOM   4269  C  CG  . LEU D  1 58  ? 49.280 46.595 49.062  1.00 23.17 ? 58   LEU D CG  1 
ATOM   4270  C  CD1 . LEU D  1 58  ? 47.880 46.072 48.736  1.00 15.37 ? 58   LEU D CD1 1 
ATOM   4271  C  CD2 . LEU D  1 58  ? 50.279 46.304 47.939  1.00 17.38 ? 58   LEU D CD2 1 
ATOM   4272  N  N   . ILE D  1 59  ? 49.711 50.704 50.912  1.00 25.16 ? 59   ILE D N   1 
ATOM   4273  C  CA  . ILE D  1 59  ? 49.641 52.147 51.048  1.00 27.17 ? 59   ILE D CA  1 
ATOM   4274  C  C   . ILE D  1 59  ? 51.028 52.731 51.300  1.00 28.17 ? 59   ILE D C   1 
ATOM   4275  O  O   . ILE D  1 59  ? 51.414 53.717 50.671  1.00 30.53 ? 59   ILE D O   1 
ATOM   4276  C  CB  . ILE D  1 59  ? 48.683 52.532 52.193  1.00 28.39 ? 59   ILE D CB  1 
ATOM   4277  C  CG1 . ILE D  1 59  ? 47.242 52.279 51.735  1.00 26.31 ? 59   ILE D CG1 1 
ATOM   4278  C  CG2 . ILE D  1 59  ? 48.924 53.982 52.637  1.00 23.60 ? 59   ILE D CG2 1 
ATOM   4279  C  CD1 . ILE D  1 59  ? 46.208 52.462 52.817  1.00 28.36 ? 59   ILE D CD1 1 
ATOM   4280  N  N   . LYS D  1 60  ? 51.783 52.118 52.204  1.00 28.28 ? 60   LYS D N   1 
ATOM   4281  C  CA  . LYS D  1 60  ? 53.130 52.598 52.503  1.00 29.12 ? 60   LYS D CA  1 
ATOM   4282  C  C   . LYS D  1 60  ? 54.040 52.468 51.286  1.00 26.93 ? 60   LYS D C   1 
ATOM   4283  O  O   . LYS D  1 60  ? 54.825 53.365 50.990  1.00 26.77 ? 60   LYS D O   1 
ATOM   4284  C  CB  . LYS D  1 60  ? 53.730 51.819 53.680  1.00 32.68 ? 60   LYS D CB  1 
ATOM   4285  C  CG  . LYS D  1 60  ? 52.967 51.974 54.993  1.00 36.92 ? 60   LYS D CG  1 
ATOM   4286  C  CD  . LYS D  1 60  ? 53.700 51.295 56.140  1.00 37.89 ? 60   LYS D CD  1 
ATOM   4287  C  CE  . LYS D  1 60  ? 52.868 51.328 57.410  1.00 43.81 ? 60   LYS D CE  1 
ATOM   4288  N  NZ  . LYS D  1 60  ? 53.477 50.504 58.501  1.00 47.66 ? 60   LYS D NZ  1 
ATOM   4289  N  N   . ARG D  1 61  ? 53.940 51.345 50.583  1.00 27.31 ? 61   ARG D N   1 
ATOM   4290  C  CA  . ARG D  1 61  ? 54.755 51.124 49.395  1.00 27.14 ? 61   ARG D CA  1 
ATOM   4291  C  C   . ARG D  1 61  ? 54.450 52.253 48.401  1.00 28.99 ? 61   ARG D C   1 
ATOM   4292  O  O   . ARG D  1 61  ? 55.350 52.994 47.973  1.00 28.45 ? 61   ARG D O   1 
ATOM   4293  C  CB  . ARG D  1 61  ? 54.423 49.758 48.783  1.00 26.21 ? 61   ARG D CB  1 
ATOM   4294  C  CG  . ARG D  1 61  ? 55.327 49.328 47.634  1.00 24.99 ? 61   ARG D CG  1 
ATOM   4295  C  CD  . ARG D  1 61  ? 56.775 49.331 48.063  1.00 26.52 ? 61   ARG D CD  1 
ATOM   4296  N  NE  . ARG D  1 61  ? 57.697 49.061 46.963  1.00 29.35 ? 61   ARG D NE  1 
ATOM   4297  C  CZ  . ARG D  1 61  ? 59.011 49.253 47.046  1.00 32.96 ? 61   ARG D CZ  1 
ATOM   4298  N  NH1 . ARG D  1 61  ? 59.535 49.712 48.173  1.00 32.67 ? 61   ARG D NH1 1 
ATOM   4299  N  NH2 . ARG D  1 61  ? 59.803 49.003 46.009  1.00 35.86 ? 61   ARG D NH2 1 
ATOM   4300  N  N   . ILE D  1 62  ? 53.172 52.385 48.059  1.00 26.84 ? 62   ILE D N   1 
ATOM   4301  C  CA  . ILE D  1 62  ? 52.707 53.414 47.133  1.00 26.48 ? 62   ILE D CA  1 
ATOM   4302  C  C   . ILE D  1 62  ? 53.228 54.809 47.502  1.00 26.88 ? 62   ILE D C   1 
ATOM   4303  O  O   . ILE D  1 62  ? 53.814 55.502 46.662  1.00 26.16 ? 62   ILE D O   1 
ATOM   4304  C  CB  . ILE D  1 62  ? 51.167 53.447 47.098  1.00 25.85 ? 62   ILE D CB  1 
ATOM   4305  C  CG1 . ILE D  1 62  ? 50.641 52.095 46.600  1.00 25.72 ? 62   ILE D CG1 1 
ATOM   4306  C  CG2 . ILE D  1 62  ? 50.685 54.596 46.222  1.00 25.12 ? 62   ILE D CG2 1 
ATOM   4307  C  CD1 . ILE D  1 62  ? 49.132 52.010 46.501  1.00 25.02 ? 62   ILE D CD1 1 
ATOM   4308  N  N   . LEU D  1 63  ? 53.006 55.223 48.750  1.00 25.51 ? 63   LEU D N   1 
ATOM   4309  C  CA  . LEU D  1 63  ? 53.470 56.534 49.219  1.00 23.30 ? 63   LEU D CA  1 
ATOM   4310  C  C   . LEU D  1 63  ? 54.984 56.689 49.020  1.00 23.43 ? 63   LEU D C   1 
ATOM   4311  O  O   . LEU D  1 63  ? 55.460 57.741 48.594  1.00 23.18 ? 63   LEU D O   1 
ATOM   4312  C  CB  . LEU D  1 63  ? 53.138 56.710 50.701  1.00 17.40 ? 63   LEU D CB  1 
ATOM   4313  C  CG  . LEU D  1 63  ? 51.973 57.567 51.209  1.00 19.10 ? 63   LEU D CG  1 
ATOM   4314  C  CD1 . LEU D  1 63  ? 51.191 58.193 50.082  1.00 17.28 ? 63   LEU D CD1 1 
ATOM   4315  C  CD2 . LEU D  1 63  ? 51.075 56.693 52.067  1.00 20.14 ? 63   LEU D CD2 1 
ATOM   4316  N  N   . PHE D  1 64  ? 55.732 55.632 49.326  1.00 24.04 ? 64   PHE D N   1 
ATOM   4317  C  CA  . PHE D  1 64  ? 57.188 55.653 49.194  1.00 26.39 ? 64   PHE D CA  1 
ATOM   4318  C  C   . PHE D  1 64  ? 57.643 55.822 47.750  1.00 26.81 ? 64   PHE D C   1 
ATOM   4319  O  O   . PHE D  1 64  ? 58.648 56.477 47.472  1.00 27.42 ? 64   PHE D O   1 
ATOM   4320  C  CB  . PHE D  1 64  ? 57.787 54.363 49.762  1.00 24.37 ? 64   PHE D CB  1 
ATOM   4321  C  CG  . PHE D  1 64  ? 59.237 54.175 49.427  1.00 22.27 ? 64   PHE D CG  1 
ATOM   4322  C  CD1 . PHE D  1 64  ? 60.194 55.062 49.905  1.00 21.82 ? 64   PHE D CD1 1 
ATOM   4323  C  CD2 . PHE D  1 64  ? 59.643 53.126 48.607  1.00 20.73 ? 64   PHE D CD2 1 
ATOM   4324  C  CE1 . PHE D  1 64  ? 61.546 54.906 49.566  1.00 22.41 ? 64   PHE D CE1 1 
ATOM   4325  C  CE2 . PHE D  1 64  ? 60.983 52.962 48.264  1.00 19.75 ? 64   PHE D CE2 1 
ATOM   4326  C  CZ  . PHE D  1 64  ? 61.938 53.852 48.742  1.00 20.94 ? 64   PHE D CZ  1 
ATOM   4327  N  N   . LEU D  1 65  ? 56.897 55.203 46.842  1.00 29.11 ? 65   LEU D N   1 
ATOM   4328  C  CA  . LEU D  1 65  ? 57.181 55.248 45.415  1.00 26.56 ? 65   LEU D CA  1 
ATOM   4329  C  C   . LEU D  1 65  ? 56.632 56.538 44.815  1.00 28.61 ? 65   LEU D C   1 
ATOM   4330  O  O   . LEU D  1 65  ? 56.719 56.754 43.605  1.00 32.62 ? 65   LEU D O   1 
ATOM   4331  C  CB  . LEU D  1 65  ? 56.548 54.029 44.738  1.00 21.54 ? 65   LEU D CB  1 
ATOM   4332  C  CG  . LEU D  1 65  ? 57.439 52.871 44.266  1.00 19.81 ? 65   LEU D CG  1 
ATOM   4333  C  CD1 . LEU D  1 65  ? 58.677 52.692 45.154  1.00 13.42 ? 65   LEU D CD1 1 
ATOM   4334  C  CD2 . LEU D  1 65  ? 56.581 51.601 44.221  1.00 19.57 ? 65   LEU D CD2 1 
ATOM   4335  N  N   . GLU D  1 66  ? 56.056 57.381 45.672  1.00 30.06 ? 66   GLU D N   1 
ATOM   4336  C  CA  . GLU D  1 66  ? 55.498 58.675 45.270  1.00 30.19 ? 66   GLU D CA  1 
ATOM   4337  C  C   . GLU D  1 66  ? 54.226 58.601 44.413  1.00 29.04 ? 66   GLU D C   1 
ATOM   4338  O  O   . GLU D  1 66  ? 54.052 59.360 43.461  1.00 28.82 ? 66   GLU D O   1 
ATOM   4339  C  CB  . GLU D  1 66  ? 56.587 59.505 44.568  1.00 32.36 ? 66   GLU D CB  1 
ATOM   4340  C  CG  . GLU D  1 66  ? 57.639 60.073 45.533  1.00 39.81 ? 66   GLU D CG  1 
ATOM   4341  C  CD  . GLU D  1 66  ? 58.883 60.643 44.840  1.00 45.37 ? 66   GLU D CD  1 
ATOM   4342  O  OE1 . GLU D  1 66  ? 58.778 61.103 43.677  1.00 49.64 ? 66   GLU D OE1 1 
ATOM   4343  O  OE2 . GLU D  1 66  ? 59.968 60.648 45.472  1.00 43.65 ? 66   GLU D OE2 1 
ATOM   4344  N  N   . GLY D  1 67  ? 53.337 57.679 44.767  1.00 29.78 ? 67   GLY D N   1 
ATOM   4345  C  CA  . GLY D  1 67  ? 52.081 57.529 44.052  1.00 27.11 ? 67   GLY D CA  1 
ATOM   4346  C  C   . GLY D  1 67  ? 50.943 57.946 44.968  1.00 28.15 ? 67   GLY D C   1 
ATOM   4347  O  O   . GLY D  1 67  ? 51.166 58.242 46.143  1.00 27.05 ? 67   GLY D O   1 
ATOM   4348  N  N   . LEU D  1 68  ? 49.721 57.977 44.448  1.00 29.30 ? 68   LEU D N   1 
ATOM   4349  C  CA  . LEU D  1 68  ? 48.570 58.366 45.258  1.00 29.29 ? 68   LEU D CA  1 
ATOM   4350  C  C   . LEU D  1 68  ? 47.716 57.165 45.619  1.00 29.35 ? 68   LEU D C   1 
ATOM   4351  O  O   . LEU D  1 68  ? 46.955 56.672 44.791  1.00 30.64 ? 68   LEU D O   1 
ATOM   4352  C  CB  . LEU D  1 68  ? 47.709 59.363 44.499  1.00 30.30 ? 68   LEU D CB  1 
ATOM   4353  C  CG  . LEU D  1 68  ? 48.444 60.638 44.110  1.00 33.86 ? 68   LEU D CG  1 
ATOM   4354  C  CD1 . LEU D  1 68  ? 47.505 61.530 43.305  1.00 32.91 ? 68   LEU D CD1 1 
ATOM   4355  C  CD2 . LEU D  1 68  ? 48.944 61.338 45.365  1.00 28.41 ? 68   LEU D CD2 1 
ATOM   4356  N  N   . PRO D  1 69  ? 47.829 56.678 46.862  1.00 29.04 ? 69   PRO D N   1 
ATOM   4357  C  CA  . PRO D  1 69  ? 47.033 55.520 47.283  1.00 28.98 ? 69   PRO D CA  1 
ATOM   4358  C  C   . PRO D  1 69  ? 45.579 55.841 47.026  1.00 29.21 ? 69   PRO D C   1 
ATOM   4359  O  O   . PRO D  1 69  ? 45.134 56.940 47.333  1.00 31.19 ? 69   PRO D O   1 
ATOM   4360  C  CB  . PRO D  1 69  ? 47.327 55.418 48.778  1.00 28.66 ? 69   PRO D CB  1 
ATOM   4361  C  CG  . PRO D  1 69  ? 48.718 55.999 48.897  1.00 30.09 ? 69   PRO D CG  1 
ATOM   4362  C  CD  . PRO D  1 69  ? 48.640 57.196 47.977  1.00 29.53 ? 69   PRO D CD  1 
ATOM   4363  N  N   . ASN D  1 70  ? 44.832 54.916 46.443  1.00 29.55 ? 70   ASN D N   1 
ATOM   4364  C  CA  . ASN D  1 70  ? 43.427 55.208 46.210  1.00 32.54 ? 70   ASN D CA  1 
ATOM   4365  C  C   . ASN D  1 70  ? 42.527 54.387 47.114  1.00 33.44 ? 70   ASN D C   1 
ATOM   4366  O  O   . ASN D  1 70  ? 42.406 53.171 46.948  1.00 33.96 ? 70   ASN D O   1 
ATOM   4367  C  CB  . ASN D  1 70  ? 43.044 54.974 44.750  1.00 32.01 ? 70   ASN D CB  1 
ATOM   4368  C  CG  . ASN D  1 70  ? 41.540 55.072 44.524  1.00 36.54 ? 70   ASN D CG  1 
ATOM   4369  O  OD1 . ASN D  1 70  ? 40.847 55.859 45.178  1.00 38.74 ? 70   ASN D OD1 1 
ATOM   4370  N  ND2 . ASN D  1 70  ? 41.030 54.279 43.588  1.00 38.85 ? 70   ASN D ND2 1 
ATOM   4371  N  N   . LEU D  1 71  ? 41.905 55.055 48.080  1.00 32.22 ? 71   LEU D N   1 
ATOM   4372  C  CA  . LEU D  1 71  ? 41.008 54.370 48.997  1.00 33.21 ? 71   LEU D CA  1 
ATOM   4373  C  C   . LEU D  1 71  ? 39.560 54.766 48.722  1.00 35.70 ? 71   LEU D C   1 
ATOM   4374  O  O   . LEU D  1 71  ? 38.654 54.388 49.461  1.00 37.39 ? 71   LEU D O   1 
ATOM   4375  C  CB  . LEU D  1 71  ? 41.379 54.694 50.448  1.00 28.94 ? 71   LEU D CB  1 
ATOM   4376  C  CG  . LEU D  1 71  ? 42.726 54.137 50.930  1.00 28.21 ? 71   LEU D CG  1 
ATOM   4377  C  CD1 . LEU D  1 71  ? 43.866 54.994 50.387  1.00 27.55 ? 71   LEU D CD1 1 
ATOM   4378  C  CD2 . LEU D  1 71  ? 42.768 54.112 52.455  1.00 28.16 ? 71   LEU D CD2 1 
ATOM   4379  N  N   . GLN D  1 72  ? 39.346 55.503 47.633  1.00 37.59 ? 72   GLN D N   1 
ATOM   4380  C  CA  . GLN D  1 72  ? 38.013 55.982 47.275  1.00 37.94 ? 72   GLN D CA  1 
ATOM   4381  C  C   . GLN D  1 72  ? 37.092 54.962 46.611  1.00 39.35 ? 72   GLN D C   1 
ATOM   4382  O  O   . GLN D  1 72  ? 35.904 54.926 46.900  1.00 40.22 ? 72   GLN D O   1 
ATOM   4383  C  CB  . GLN D  1 72  ? 38.129 57.223 46.372  1.00 35.62 ? 72   GLN D CB  1 
ATOM   4384  C  CG  . GLN D  1 72  ? 36.790 57.857 46.006  1.00 31.32 ? 72   GLN D CG  1 
ATOM   4385  C  CD  . GLN D  1 72  ? 36.076 58.462 47.207  1.00 33.72 ? 72   GLN D CD  1 
ATOM   4386  O  OE1 . GLN D  1 72  ? 36.393 59.577 47.640  1.00 32.44 ? 72   GLN D OE1 1 
ATOM   4387  N  NE2 . GLN D  1 72  ? 35.116 57.721 47.763  1.00 30.20 ? 72   GLN D NE2 1 
ATOM   4388  N  N   . GLU D  1 73  ? 37.628 54.135 45.723  1.00 43.10 ? 73   GLU D N   1 
ATOM   4389  C  CA  . GLU D  1 73  ? 36.793 53.163 45.025  1.00 46.47 ? 73   GLU D CA  1 
ATOM   4390  C  C   . GLU D  1 73  ? 36.683 51.810 45.709  1.00 45.57 ? 73   GLU D C   1 
ATOM   4391  O  O   . GLU D  1 73  ? 37.680 51.111 45.920  1.00 48.68 ? 73   GLU D O   1 
ATOM   4392  C  CB  . GLU D  1 73  ? 37.282 53.017 43.580  1.00 52.18 ? 73   GLU D CB  1 
ATOM   4393  C  CG  . GLU D  1 73  ? 36.917 54.240 42.729  1.00 61.06 ? 73   GLU D CG  1 
ATOM   4394  C  CD  . GLU D  1 73  ? 37.927 54.544 41.630  1.00 68.45 ? 73   GLU D CD  1 
ATOM   4395  O  OE1 . GLU D  1 73  ? 38.051 53.729 40.683  1.00 71.64 ? 73   GLU D OE1 1 
ATOM   4396  O  OE2 . GLU D  1 73  ? 38.596 55.605 41.719  1.00 68.18 ? 73   GLU D OE2 1 
ATOM   4397  N  N   . LEU D  1 74  ? 35.446 51.462 46.053  1.00 42.16 ? 74   LEU D N   1 
ATOM   4398  C  CA  . LEU D  1 74  ? 35.116 50.213 46.735  1.00 38.69 ? 74   LEU D CA  1 
ATOM   4399  C  C   . LEU D  1 74  ? 34.371 49.270 45.774  1.00 38.88 ? 74   LEU D C   1 
ATOM   4400  O  O   . LEU D  1 74  ? 33.298 49.608 45.253  1.00 37.09 ? 74   LEU D O   1 
ATOM   4401  C  CB  . LEU D  1 74  ? 34.226 50.518 47.946  1.00 36.77 ? 74   LEU D CB  1 
ATOM   4402  C  CG  . LEU D  1 74  ? 34.157 49.521 49.108  1.00 36.67 ? 74   LEU D CG  1 
ATOM   4403  C  CD1 . LEU D  1 74  ? 32.883 49.776 49.909  1.00 32.25 ? 74   LEU D CD1 1 
ATOM   4404  C  CD2 . LEU D  1 74  ? 34.175 48.094 48.586  1.00 38.98 ? 74   LEU D CD2 1 
ATOM   4405  N  N   . GLY D  1 75  ? 34.932 48.082 45.561  1.00 36.52 ? 75   GLY D N   1 
ATOM   4406  C  CA  . GLY D  1 75  ? 34.322 47.123 44.658  1.00 34.77 ? 75   GLY D CA  1 
ATOM   4407  C  C   . GLY D  1 75  ? 33.044 46.484 45.160  1.00 34.80 ? 75   GLY D C   1 
ATOM   4408  O  O   . GLY D  1 75  ? 32.538 46.829 46.227  1.00 32.56 ? 75   GLY D O   1 
ATOM   4409  N  N   . LYS D  1 76  ? 32.521 45.539 44.384  1.00 36.01 ? 76   LYS D N   1 
ATOM   4410  C  CA  . LYS D  1 76  ? 31.289 44.854 44.751  1.00 38.52 ? 76   LYS D CA  1 
ATOM   4411  C  C   . LYS D  1 76  ? 31.506 43.840 45.870  1.00 38.11 ? 76   LYS D C   1 
ATOM   4412  O  O   . LYS D  1 76  ? 32.182 42.825 45.691  1.00 36.91 ? 76   LYS D O   1 
ATOM   4413  C  CB  . LYS D  1 76  ? 30.688 44.147 43.530  1.00 43.56 ? 76   LYS D CB  1 
ATOM   4414  C  CG  . LYS D  1 76  ? 29.410 43.372 43.828  1.00 45.95 ? 76   LYS D CG  1 
ATOM   4415  C  CD  . LYS D  1 76  ? 28.287 44.309 44.249  1.00 51.21 ? 76   LYS D CD  1 
ATOM   4416  C  CE  . LYS D  1 76  ? 27.161 43.551 44.943  1.00 53.18 ? 76   LYS D CE  1 
ATOM   4417  N  NZ  . LYS D  1 76  ? 26.749 42.343 44.182  1.00 56.53 ? 76   LYS D NZ  1 
ATOM   4418  N  N   . LEU D  1 77  ? 30.915 44.127 47.024  1.00 36.80 ? 77   LEU D N   1 
ATOM   4419  C  CA  . LEU D  1 77  ? 31.008 43.264 48.196  1.00 33.27 ? 77   LEU D CA  1 
ATOM   4420  C  C   . LEU D  1 77  ? 30.130 42.034 48.016  1.00 31.29 ? 77   LEU D C   1 
ATOM   4421  O  O   . LEU D  1 77  ? 28.953 42.155 47.688  1.00 32.47 ? 77   LEU D O   1 
ATOM   4422  C  CB  . LEU D  1 77  ? 30.534 44.029 49.436  1.00 32.81 ? 77   LEU D CB  1 
ATOM   4423  C  CG  . LEU D  1 77  ? 31.544 44.505 50.483  1.00 35.08 ? 77   LEU D CG  1 
ATOM   4424  C  CD1 . LEU D  1 77  ? 32.743 45.177 49.826  1.00 28.42 ? 77   LEU D CD1 1 
ATOM   4425  C  CD2 . LEU D  1 77  ? 30.832 45.445 51.448  1.00 29.18 ? 77   LEU D CD2 1 
ATOM   4426  N  N   . LEU D  1 78  ? 30.698 40.854 48.236  1.00 29.00 ? 78   LEU D N   1 
ATOM   4427  C  CA  . LEU D  1 78  ? 29.942 39.608 48.125  1.00 26.42 ? 78   LEU D CA  1 
ATOM   4428  C  C   . LEU D  1 78  ? 29.466 39.196 49.522  1.00 25.19 ? 78   LEU D C   1 
ATOM   4429  O  O   . LEU D  1 78  ? 30.185 38.515 50.253  1.00 25.77 ? 78   LEU D O   1 
ATOM   4430  C  CB  . LEU D  1 78  ? 30.820 38.495 47.539  1.00 23.80 ? 78   LEU D CB  1 
ATOM   4431  C  CG  . LEU D  1 78  ? 31.571 38.821 46.246  1.00 25.31 ? 78   LEU D CG  1 
ATOM   4432  C  CD1 . LEU D  1 78  ? 32.341 37.592 45.760  1.00 22.16 ? 78   LEU D CD1 1 
ATOM   4433  C  CD2 . LEU D  1 78  ? 30.576 39.293 45.186  1.00 25.56 ? 78   LEU D CD2 1 
ATOM   4434  N  N   . ILE D  1 79  ? 28.260 39.606 49.895  1.00 22.81 ? 79   ILE D N   1 
ATOM   4435  C  CA  . ILE D  1 79  ? 27.734 39.262 51.209  1.00 25.78 ? 79   ILE D CA  1 
ATOM   4436  C  C   . ILE D  1 79  ? 26.752 38.094 51.187  1.00 26.06 ? 79   ILE D C   1 
ATOM   4437  O  O   . ILE D  1 79  ? 25.795 38.097 50.414  1.00 28.38 ? 79   ILE D O   1 
ATOM   4438  C  CB  . ILE D  1 79  ? 27.045 40.475 51.850  1.00 27.73 ? 79   ILE D CB  1 
ATOM   4439  C  CG1 . ILE D  1 79  ? 28.011 41.658 51.836  1.00 26.73 ? 79   ILE D CG1 1 
ATOM   4440  C  CG2 . ILE D  1 79  ? 26.592 40.139 53.279  1.00 25.85 ? 79   ILE D CG2 1 
ATOM   4441  C  CD1 . ILE D  1 79  ? 29.376 41.331 52.431  1.00 27.49 ? 79   ILE D CD1 1 
ATOM   4442  N  N   . GLY D  1 80  ? 26.993 37.103 52.046  1.00 26.34 ? 80   GLY D N   1 
ATOM   4443  C  CA  . GLY D  1 80  ? 26.123 35.940 52.112  1.00 26.33 ? 80   GLY D CA  1 
ATOM   4444  C  C   . GLY D  1 80  ? 25.086 36.035 53.213  1.00 28.52 ? 80   GLY D C   1 
ATOM   4445  O  O   . GLY D  1 80  ? 25.174 36.901 54.081  1.00 32.35 ? 80   GLY D O   1 
ATOM   4446  N  N   . GLU D  1 81  ? 24.105 35.139 53.190  1.00 29.92 ? 81   GLU D N   1 
ATOM   4447  C  CA  . GLU D  1 81  ? 23.037 35.148 54.185  1.00 31.19 ? 81   GLU D CA  1 
ATOM   4448  C  C   . GLU D  1 81  ? 23.128 33.999 55.184  1.00 30.96 ? 81   GLU D C   1 
ATOM   4449  O  O   . GLU D  1 81  ? 22.376 33.945 56.155  1.00 33.87 ? 81   GLU D O   1 
ATOM   4450  C  CB  . GLU D  1 81  ? 21.677 35.100 53.486  1.00 34.30 ? 81   GLU D CB  1 
ATOM   4451  C  CG  . GLU D  1 81  ? 21.477 36.196 52.443  1.00 41.44 ? 81   GLU D CG  1 
ATOM   4452  C  CD  . GLU D  1 81  ? 20.142 36.082 51.723  1.00 44.74 ? 81   GLU D CD  1 
ATOM   4453  O  OE1 . GLU D  1 81  ? 19.898 36.875 50.786  1.00 47.42 ? 81   GLU D OE1 1 
ATOM   4454  O  OE2 . GLU D  1 81  ? 19.336 35.201 52.095  1.00 47.09 ? 81   GLU D OE2 1 
ATOM   4455  N  N   . HIS D  1 82  ? 24.041 33.072 54.943  1.00 31.38 ? 82   HIS D N   1 
ATOM   4456  C  CA  . HIS D  1 82  ? 24.206 31.935 55.835  1.00 32.00 ? 82   HIS D CA  1 
ATOM   4457  C  C   . HIS D  1 82  ? 25.619 31.394 55.659  1.00 31.89 ? 82   HIS D C   1 
ATOM   4458  O  O   . HIS D  1 82  ? 26.251 31.615 54.626  1.00 33.19 ? 82   HIS D O   1 
ATOM   4459  C  CB  . HIS D  1 82  ? 23.149 30.863 55.535  1.00 30.73 ? 82   HIS D CB  1 
ATOM   4460  C  CG  . HIS D  1 82  ? 23.232 30.304 54.152  1.00 35.73 ? 82   HIS D CG  1 
ATOM   4461  N  ND1 . HIS D  1 82  ? 24.158 29.348 53.791  1.00 39.82 ? 82   HIS D ND1 1 
ATOM   4462  C  CD2 . HIS D  1 82  ? 22.513 30.574 53.037  1.00 36.18 ? 82   HIS D CD2 1 
ATOM   4463  C  CE1 . HIS D  1 82  ? 24.002 29.050 52.512  1.00 39.32 ? 82   HIS D CE1 1 
ATOM   4464  N  NE2 . HIS D  1 82  ? 23.011 29.780 52.031  1.00 39.74 ? 82   HIS D NE2 1 
ATOM   4465  N  N   . THR D  1 83  ? 26.104 30.687 56.671  1.00 30.84 ? 83   THR D N   1 
ATOM   4466  C  CA  . THR D  1 83  ? 27.457 30.160 56.676  1.00 31.54 ? 83   THR D CA  1 
ATOM   4467  C  C   . THR D  1 83  ? 28.025 29.638 55.360  1.00 31.85 ? 83   THR D C   1 
ATOM   4468  O  O   . THR D  1 83  ? 28.986 30.196 54.824  1.00 32.21 ? 83   THR D O   1 
ATOM   4469  C  CB  . THR D  1 83  ? 27.614 29.054 57.739  1.00 32.06 ? 83   THR D CB  1 
ATOM   4470  O  OG1 . THR D  1 83  ? 27.195 29.557 59.021  1.00 31.90 ? 83   THR D OG1 1 
ATOM   4471  C  CG2 . THR D  1 83  ? 29.076 28.609 57.816  1.00 24.63 ? 83   THR D CG2 1 
ATOM   4472  N  N   . LYS D  1 84  ? 27.436 28.578 54.831  1.00 31.05 ? 84   LYS D N   1 
ATOM   4473  C  CA  . LYS D  1 84  ? 27.962 27.996 53.610  1.00 30.46 ? 84   LYS D CA  1 
ATOM   4474  C  C   . LYS D  1 84  ? 28.138 29.014 52.489  1.00 29.53 ? 84   LYS D C   1 
ATOM   4475  O  O   . LYS D  1 84  ? 29.150 28.989 51.789  1.00 29.03 ? 84   LYS D O   1 
ATOM   4476  C  CB  . LYS D  1 84  ? 27.077 26.828 53.163  1.00 32.70 ? 84   LYS D CB  1 
ATOM   4477  C  CG  . LYS D  1 84  ? 27.705 25.922 52.107  1.00 35.33 ? 84   LYS D CG  1 
ATOM   4478  C  CD  . LYS D  1 84  ? 26.911 24.633 51.989  1.00 37.63 ? 84   LYS D CD  1 
ATOM   4479  C  CE  . LYS D  1 84  ? 27.514 23.659 50.989  1.00 42.53 ? 84   LYS D CE  1 
ATOM   4480  N  NZ  . LYS D  1 84  ? 26.811 22.329 51.049  1.00 45.04 ? 84   LYS D NZ  1 
ATOM   4481  N  N   . GLU D  1 85  ? 27.171 29.915 52.328  1.00 28.73 ? 85   GLU D N   1 
ATOM   4482  C  CA  . GLU D  1 85  ? 27.243 30.927 51.275  1.00 27.75 ? 85   GLU D CA  1 
ATOM   4483  C  C   . GLU D  1 85  ? 28.357 31.937 51.567  1.00 29.00 ? 85   GLU D C   1 
ATOM   4484  O  O   . GLU D  1 85  ? 29.101 32.343 50.669  1.00 29.55 ? 85   GLU D O   1 
ATOM   4485  C  CB  . GLU D  1 85  ? 25.897 31.646 51.142  1.00 28.28 ? 85   GLU D CB  1 
ATOM   4486  C  CG  . GLU D  1 85  ? 25.857 32.639 49.995  1.00 32.98 ? 85   GLU D CG  1 
ATOM   4487  C  CD  . GLU D  1 85  ? 24.464 33.183 49.724  1.00 39.80 ? 85   GLU D CD  1 
ATOM   4488  O  OE1 . GLU D  1 85  ? 23.929 33.930 50.573  1.00 40.98 ? 85   GLU D OE1 1 
ATOM   4489  O  OE2 . GLU D  1 85  ? 23.902 32.860 48.654  1.00 45.59 ? 85   GLU D OE2 1 
ATOM   4490  N  N   . MET D  1 86  ? 28.466 32.326 52.835  1.00 27.95 ? 86   MET D N   1 
ATOM   4491  C  CA  . MET D  1 86  ? 29.475 33.268 53.291  1.00 26.35 ? 86   MET D CA  1 
ATOM   4492  C  C   . MET D  1 86  ? 30.872 32.696 53.081  1.00 27.20 ? 86   MET D C   1 
ATOM   4493  O  O   . MET D  1 86  ? 31.790 33.403 52.666  1.00 26.33 ? 86   MET D O   1 
ATOM   4494  C  CB  . MET D  1 86  ? 29.237 33.580 54.767  1.00 27.37 ? 86   MET D CB  1 
ATOM   4495  C  CG  . MET D  1 86  ? 27.902 34.282 55.013  1.00 27.05 ? 86   MET D CG  1 
ATOM   4496  S  SD  . MET D  1 86  ? 27.314 34.180 56.705  1.00 26.08 ? 86   MET D SD  1 
ATOM   4497  C  CE  . MET D  1 86  ? 28.676 35.054 57.587  1.00 26.78 ? 86   MET D CE  1 
ATOM   4498  N  N   . LEU D  1 87  ? 31.036 31.410 53.363  1.00 30.07 ? 87   LEU D N   1 
ATOM   4499  C  CA  . LEU D  1 87  ? 32.330 30.758 53.172  1.00 30.81 ? 87   LEU D CA  1 
ATOM   4500  C  C   . LEU D  1 87  ? 32.658 30.736 51.675  1.00 32.67 ? 87   LEU D C   1 
ATOM   4501  O  O   . LEU D  1 87  ? 33.798 31.002 51.279  1.00 34.62 ? 87   LEU D O   1 
ATOM   4502  C  CB  . LEU D  1 87  ? 32.286 29.330 53.733  1.00 29.47 ? 87   LEU D CB  1 
ATOM   4503  C  CG  . LEU D  1 87  ? 33.014 28.920 55.029  1.00 30.76 ? 87   LEU D CG  1 
ATOM   4504  C  CD1 . LEU D  1 87  ? 32.984 30.004 56.084  1.00 29.94 ? 87   LEU D CD1 1 
ATOM   4505  C  CD2 . LEU D  1 87  ? 32.360 27.647 55.554  1.00 28.90 ? 87   LEU D CD2 1 
ATOM   4506  N  N   . GLU D  1 88  ? 31.657 30.446 50.843  1.00 33.04 ? 88   GLU D N   1 
ATOM   4507  C  CA  . GLU D  1 88  ? 31.870 30.390 49.399  1.00 34.68 ? 88   GLU D CA  1 
ATOM   4508  C  C   . GLU D  1 88  ? 32.119 31.771 48.813  1.00 34.31 ? 88   GLU D C   1 
ATOM   4509  O  O   . GLU D  1 88  ? 32.844 31.911 47.823  1.00 32.49 ? 88   GLU D O   1 
ATOM   4510  C  CB  . GLU D  1 88  ? 30.686 29.713 48.694  1.00 37.27 ? 88   GLU D CB  1 
ATOM   4511  C  CG  . GLU D  1 88  ? 30.610 28.208 48.957  1.00 48.61 ? 88   GLU D CG  1 
ATOM   4512  C  CD  . GLU D  1 88  ? 29.646 27.463 48.030  1.00 56.46 ? 88   GLU D CD  1 
ATOM   4513  O  OE1 . GLU D  1 88  ? 29.914 27.389 46.808  1.00 61.11 ? 88   GLU D OE1 1 
ATOM   4514  O  OE2 . GLU D  1 88  ? 28.620 26.942 48.523  1.00 61.50 ? 88   GLU D OE2 1 
ATOM   4515  N  N   . CYS D  1 89  ? 31.527 32.792 49.425  1.00 33.33 ? 89   CYS D N   1 
ATOM   4516  C  CA  . CYS D  1 89  ? 31.729 34.159 48.961  1.00 34.03 ? 89   CYS D CA  1 
ATOM   4517  C  C   . CYS D  1 89  ? 33.171 34.625 49.220  1.00 34.70 ? 89   CYS D C   1 
ATOM   4518  O  O   . CYS D  1 89  ? 33.777 35.286 48.371  1.00 34.27 ? 89   CYS D O   1 
ATOM   4519  C  CB  . CYS D  1 89  ? 30.751 35.117 49.652  1.00 36.09 ? 89   CYS D CB  1 
ATOM   4520  S  SG  . CYS D  1 89  ? 29.016 35.029 49.097  1.00 37.18 ? 89   CYS D SG  1 
ATOM   4521  N  N   . ASP D  1 90  ? 33.719 34.287 50.389  1.00 35.04 ? 90   ASP D N   1 
ATOM   4522  C  CA  . ASP D  1 90  ? 35.087 34.687 50.721  1.00 35.24 ? 90   ASP D CA  1 
ATOM   4523  C  C   . ASP D  1 90  ? 36.081 33.980 49.818  1.00 34.92 ? 90   ASP D C   1 
ATOM   4524  O  O   . ASP D  1 90  ? 37.062 34.581 49.384  1.00 34.95 ? 90   ASP D O   1 
ATOM   4525  C  CB  . ASP D  1 90  ? 35.442 34.359 52.177  1.00 37.36 ? 90   ASP D CB  1 
ATOM   4526  C  CG  . ASP D  1 90  ? 34.581 35.107 53.185  1.00 41.90 ? 90   ASP D CG  1 
ATOM   4527  O  OD1 . ASP D  1 90  ? 34.140 36.243 52.891  1.00 42.18 ? 90   ASP D OD1 1 
ATOM   4528  O  OD2 . ASP D  1 90  ? 34.362 34.557 54.288  1.00 44.06 ? 90   ASP D OD2 1 
ATOM   4529  N  N   . LEU D  1 91  ? 35.832 32.700 49.546  1.00 33.56 ? 91   LEU D N   1 
ATOM   4530  C  CA  . LEU D  1 91  ? 36.722 31.919 48.693  1.00 32.53 ? 91   LEU D CA  1 
ATOM   4531  C  C   . LEU D  1 91  ? 36.748 32.513 47.284  1.00 35.32 ? 91   LEU D C   1 
ATOM   4532  O  O   . LEU D  1 91  ? 37.793 32.564 46.630  1.00 35.45 ? 91   LEU D O   1 
ATOM   4533  C  CB  . LEU D  1 91  ? 36.262 30.461 48.651  1.00 31.20 ? 91   LEU D CB  1 
ATOM   4534  C  CG  . LEU D  1 91  ? 37.061 29.481 47.785  1.00 30.08 ? 91   LEU D CG  1 
ATOM   4535  C  CD1 . LEU D  1 91  ? 38.524 29.506 48.176  1.00 31.50 ? 91   LEU D CD1 1 
ATOM   4536  C  CD2 . LEU D  1 91  ? 36.500 28.081 47.947  1.00 28.19 ? 91   LEU D CD2 1 
ATOM   4537  N  N   . LYS D  1 92  ? 35.595 32.974 46.819  1.00 36.36 ? 92   LYS D N   1 
ATOM   4538  C  CA  . LYS D  1 92  ? 35.521 33.570 45.497  1.00 38.69 ? 92   LYS D CA  1 
ATOM   4539  C  C   . LYS D  1 92  ? 36.407 34.813 45.458  1.00 38.09 ? 92   LYS D C   1 
ATOM   4540  O  O   . LYS D  1 92  ? 37.180 34.999 44.518  1.00 39.49 ? 92   LYS D O   1 
ATOM   4541  C  CB  . LYS D  1 92  ? 34.075 33.944 45.164  1.00 42.83 ? 92   LYS D CB  1 
ATOM   4542  C  CG  . LYS D  1 92  ? 33.835 34.347 43.708  1.00 44.52 ? 92   LYS D CG  1 
ATOM   4543  C  CD  . LYS D  1 92  ? 32.355 34.602 43.472  1.00 46.14 ? 92   LYS D CD  1 
ATOM   4544  C  CE  . LYS D  1 92  ? 32.068 35.060 42.055  1.00 47.80 ? 92   LYS D CE  1 
ATOM   4545  N  NZ  . LYS D  1 92  ? 30.648 35.508 41.940  1.00 47.63 ? 92   LYS D NZ  1 
ATOM   4546  N  N   . LEU D  1 93  ? 36.294 35.654 46.484  1.00 35.83 ? 93   LEU D N   1 
ATOM   4547  C  CA  . LEU D  1 93  ? 37.090 36.878 46.570  1.00 32.76 ? 93   LEU D CA  1 
ATOM   4548  C  C   . LEU D  1 93  ? 38.572 36.562 46.456  1.00 32.03 ? 93   LEU D C   1 
ATOM   4549  O  O   . LEU D  1 93  ? 39.269 37.092 45.594  1.00 33.39 ? 93   LEU D O   1 
ATOM   4550  C  CB  . LEU D  1 93  ? 36.847 37.587 47.898  1.00 31.62 ? 93   LEU D CB  1 
ATOM   4551  C  CG  . LEU D  1 93  ? 36.435 39.056 47.802  1.00 33.52 ? 93   LEU D CG  1 
ATOM   4552  C  CD1 . LEU D  1 93  ? 36.644 39.734 49.158  1.00 31.18 ? 93   LEU D CD1 1 
ATOM   4553  C  CD2 . LEU D  1 93  ? 37.259 39.754 46.732  1.00 35.49 ? 93   LEU D CD2 1 
ATOM   4554  N  N   . GLU D  1 94  ? 39.048 35.703 47.346  1.00 31.38 ? 94   GLU D N   1 
ATOM   4555  C  CA  . GLU D  1 94  ? 40.441 35.295 47.360  1.00 33.44 ? 94   GLU D CA  1 
ATOM   4556  C  C   . GLU D  1 94  ? 40.904 34.806 45.993  1.00 34.20 ? 94   GLU D C   1 
ATOM   4557  O  O   . GLU D  1 94  ? 41.954 35.220 45.496  1.00 35.30 ? 94   GLU D O   1 
ATOM   4558  C  CB  . GLU D  1 94  ? 40.652 34.196 48.407  1.00 33.44 ? 94   GLU D CB  1 
ATOM   4559  C  CG  . GLU D  1 94  ? 40.467 34.670 49.847  1.00 36.26 ? 94   GLU D CG  1 
ATOM   4560  C  CD  . GLU D  1 94  ? 41.486 35.727 50.273  1.00 39.65 ? 94   GLU D CD  1 
ATOM   4561  O  OE1 . GLU D  1 94  ? 41.453 36.157 51.449  1.00 38.38 ? 94   GLU D OE1 1 
ATOM   4562  O  OE2 . GLU D  1 94  ? 42.321 36.130 49.434  1.00 45.04 ? 94   GLU D OE2 1 
ATOM   4563  N  N   . GLN D  1 95  ? 40.115 33.936 45.375  1.00 35.36 ? 95   GLN D N   1 
ATOM   4564  C  CA  . GLN D  1 95  ? 40.483 33.421 44.067  1.00 35.66 ? 95   GLN D CA  1 
ATOM   4565  C  C   . GLN D  1 95  ? 40.537 34.552 43.053  1.00 36.75 ? 95   GLN D C   1 
ATOM   4566  O  O   . GLN D  1 95  ? 41.570 34.777 42.429  1.00 41.96 ? 95   GLN D O   1 
ATOM   4567  C  CB  . GLN D  1 95  ? 39.490 32.356 43.618  1.00 33.13 ? 95   GLN D CB  1 
ATOM   4568  C  CG  . GLN D  1 95  ? 39.555 31.107 44.455  1.00 35.37 ? 95   GLN D CG  1 
ATOM   4569  C  CD  . GLN D  1 95  ? 38.422 30.151 44.166  1.00 38.89 ? 95   GLN D CD  1 
ATOM   4570  O  OE1 . GLN D  1 95  ? 37.274 30.565 43.969  1.00 40.97 ? 95   GLN D OE1 1 
ATOM   4571  N  NE2 . GLN D  1 95  ? 38.730 28.860 44.161  1.00 38.52 ? 95   GLN D NE2 1 
ATOM   4572  N  N   . ALA D  1 96  ? 39.431 35.273 42.901  1.00 36.34 ? 96   ALA D N   1 
ATOM   4573  C  CA  . ALA D  1 96  ? 39.367 36.382 41.956  1.00 34.45 ? 96   ALA D CA  1 
ATOM   4574  C  C   . ALA D  1 96  ? 40.543 37.339 42.116  1.00 35.32 ? 96   ALA D C   1 
ATOM   4575  O  O   . ALA D  1 96  ? 40.926 38.028 41.171  1.00 37.77 ? 96   ALA D O   1 
ATOM   4576  C  CB  . ALA D  1 96  ? 38.072 37.127 42.128  1.00 31.44 ? 96   ALA D CB  1 
ATOM   4577  N  N   . GLY D  1 97  ? 41.129 37.374 43.307  1.00 34.95 ? 97   GLY D N   1 
ATOM   4578  C  CA  . GLY D  1 97  ? 42.250 38.266 43.531  1.00 34.28 ? 97   GLY D CA  1 
ATOM   4579  C  C   . GLY D  1 97  ? 43.604 37.653 43.243  1.00 35.91 ? 97   GLY D C   1 
ATOM   4580  O  O   . GLY D  1 97  ? 44.577 38.371 43.015  1.00 37.49 ? 97   GLY D O   1 
ATOM   4581  N  N   . LEU D  1 98  ? 43.678 36.328 43.253  1.00 38.24 ? 98   LEU D N   1 
ATOM   4582  C  CA  . LEU D  1 98  ? 44.939 35.635 43.004  1.00 39.95 ? 98   LEU D CA  1 
ATOM   4583  C  C   . LEU D  1 98  ? 45.573 36.026 41.662  1.00 41.73 ? 98   LEU D C   1 
ATOM   4584  O  O   . LEU D  1 98  ? 46.777 36.282 41.588  1.00 42.70 ? 98   LEU D O   1 
ATOM   4585  C  CB  . LEU D  1 98  ? 44.712 34.127 43.062  1.00 40.26 ? 98   LEU D CB  1 
ATOM   4586  C  CG  . LEU D  1 98  ? 45.909 33.260 43.458  1.00 44.34 ? 98   LEU D CG  1 
ATOM   4587  C  CD1 . LEU D  1 98  ? 46.469 33.715 44.807  1.00 41.91 ? 98   LEU D CD1 1 
ATOM   4588  C  CD2 . LEU D  1 98  ? 45.456 31.804 43.532  1.00 44.74 ? 98   LEU D CD2 1 
ATOM   4589  N  N   . PRO D  1 99  ? 44.772 36.077 40.583  1.00 42.06 ? 99   PRO D N   1 
ATOM   4590  C  CA  . PRO D  1 99  ? 45.322 36.447 39.277  1.00 41.16 ? 99   PRO D CA  1 
ATOM   4591  C  C   . PRO D  1 99  ? 45.998 37.807 39.291  1.00 40.42 ? 99   PRO D C   1 
ATOM   4592  O  O   . PRO D  1 99  ? 47.098 37.966 38.760  1.00 43.26 ? 99   PRO D O   1 
ATOM   4593  C  CB  . PRO D  1 99  ? 44.096 36.430 38.369  1.00 41.27 ? 99   PRO D CB  1 
ATOM   4594  C  CG  . PRO D  1 99  ? 43.268 35.347 38.970  1.00 43.08 ? 99   PRO D CG  1 
ATOM   4595  C  CD  . PRO D  1 99  ? 43.366 35.657 40.449  1.00 42.38 ? 99   PRO D CD  1 
ATOM   4596  N  N   . ASP D  1 100 ? 45.344 38.789 39.898  1.00 39.69 ? 100  ASP D N   1 
ATOM   4597  C  CA  . ASP D  1 100 ? 45.908 40.132 39.953  1.00 39.61 ? 100  ASP D CA  1 
ATOM   4598  C  C   . ASP D  1 100 ? 47.247 40.193 40.679  1.00 39.49 ? 100  ASP D C   1 
ATOM   4599  O  O   . ASP D  1 100 ? 48.142 40.942 40.268  1.00 39.54 ? 100  ASP D O   1 
ATOM   4600  C  CB  . ASP D  1 100 ? 44.916 41.092 40.600  1.00 42.48 ? 100  ASP D CB  1 
ATOM   4601  C  CG  . ASP D  1 100 ? 43.694 41.324 39.735  1.00 44.05 ? 100  ASP D CG  1 
ATOM   4602  O  OD1 . ASP D  1 100 ? 42.811 42.111 40.137  1.00 46.31 ? 100  ASP D OD1 1 
ATOM   4603  O  OD2 . ASP D  1 100 ? 43.623 40.716 38.645  1.00 45.72 ? 100  ASP D OD2 1 
ATOM   4604  N  N   . LEU D  1 101 ? 47.393 39.406 41.746  1.00 35.01 ? 101  LEU D N   1 
ATOM   4605  C  CA  . LEU D  1 101 ? 48.644 39.386 42.501  1.00 32.25 ? 101  LEU D CA  1 
ATOM   4606  C  C   . LEU D  1 101 ? 49.784 38.822 41.658  1.00 32.40 ? 101  LEU D C   1 
ATOM   4607  O  O   . LEU D  1 101 ? 50.905 39.339 41.680  1.00 29.58 ? 101  LEU D O   1 
ATOM   4608  C  CB  . LEU D  1 101 ? 48.494 38.551 43.772  1.00 31.21 ? 101  LEU D CB  1 
ATOM   4609  C  CG  . LEU D  1 101 ? 48.130 39.292 45.058  1.00 27.63 ? 101  LEU D CG  1 
ATOM   4610  C  CD1 . LEU D  1 101 ? 47.714 38.282 46.122  1.00 29.52 ? 101  LEU D CD1 1 
ATOM   4611  C  CD2 . LEU D  1 101 ? 49.309 40.128 45.524  1.00 22.64 ? 101  LEU D CD2 1 
ATOM   4612  N  N   . LYS D  1 102 ? 49.499 37.751 40.923  1.00 32.47 ? 102  LYS D N   1 
ATOM   4613  C  CA  . LYS D  1 102 ? 50.511 37.139 40.071  1.00 31.61 ? 102  LYS D CA  1 
ATOM   4614  C  C   . LYS D  1 102 ? 50.814 38.084 38.900  1.00 31.51 ? 102  LYS D C   1 
ATOM   4615  O  O   . LYS D  1 102 ? 51.961 38.206 38.464  1.00 30.93 ? 102  LYS D O   1 
ATOM   4616  C  CB  . LYS D  1 102 ? 50.016 35.781 39.575  1.00 31.33 ? 102  LYS D CB  1 
ATOM   4617  C  CG  . LYS D  1 102 ? 49.498 34.906 40.702  1.00 31.11 ? 102  LYS D CG  1 
ATOM   4618  C  CD  . LYS D  1 102 ? 49.599 33.418 40.399  1.00 30.48 ? 102  LYS D CD  1 
ATOM   4619  C  CE  . LYS D  1 102 ? 49.109 32.600 41.594  1.00 32.66 ? 102  LYS D CE  1 
ATOM   4620  N  NZ  . LYS D  1 102 ? 49.509 31.167 41.509  1.00 36.70 ? 102  LYS D NZ  1 
ATOM   4621  N  N   . ALA D  1 103 ? 49.784 38.764 38.402  1.00 28.20 ? 103  ALA D N   1 
ATOM   4622  C  CA  . ALA D  1 103 ? 49.979 39.712 37.320  1.00 25.55 ? 103  ALA D CA  1 
ATOM   4623  C  C   . ALA D  1 103 ? 50.938 40.808 37.803  1.00 26.96 ? 103  ALA D C   1 
ATOM   4624  O  O   . ALA D  1 103 ? 51.931 41.113 37.137  1.00 30.01 ? 103  ALA D O   1 
ATOM   4625  C  CB  . ALA D  1 103 ? 48.658 40.322 36.923  1.00 19.58 ? 103  ALA D CB  1 
ATOM   4626  N  N   . ALA D  1 104 ? 50.646 41.383 38.971  1.00 25.44 ? 104  ALA D N   1 
ATOM   4627  C  CA  . ALA D  1 104 ? 51.475 42.450 39.543  1.00 23.44 ? 104  ALA D CA  1 
ATOM   4628  C  C   . ALA D  1 104 ? 52.915 42.005 39.803  1.00 22.11 ? 104  ALA D C   1 
ATOM   4629  O  O   . ALA D  1 104 ? 53.860 42.681 39.397  1.00 20.15 ? 104  ALA D O   1 
ATOM   4630  C  CB  . ALA D  1 104 ? 50.844 42.969 40.825  1.00 20.65 ? 104  ALA D CB  1 
ATOM   4631  N  N   . ILE D  1 105 ? 53.085 40.875 40.480  1.00 21.77 ? 105  ILE D N   1 
ATOM   4632  C  CA  . ILE D  1 105 ? 54.422 40.359 40.758  1.00 23.97 ? 105  ILE D CA  1 
ATOM   4633  C  C   . ILE D  1 105 ? 55.197 40.222 39.442  1.00 26.91 ? 105  ILE D C   1 
ATOM   4634  O  O   . ILE D  1 105 ? 56.350 40.651 39.336  1.00 29.10 ? 105  ILE D O   1 
ATOM   4635  C  CB  . ILE D  1 105 ? 54.356 38.977 41.450  1.00 22.98 ? 105  ILE D CB  1 
ATOM   4636  C  CG1 . ILE D  1 105 ? 53.790 39.123 42.868  1.00 24.50 ? 105  ILE D CG1 1 
ATOM   4637  C  CG2 . ILE D  1 105 ? 55.732 38.347 41.487  1.00 22.86 ? 105  ILE D CG2 1 
ATOM   4638  C  CD1 . ILE D  1 105 ? 53.287 37.815 43.477  1.00 21.38 ? 105  ILE D CD1 1 
ATOM   4639  N  N   . ALA D  1 106 ? 54.553 39.633 38.439  1.00 26.27 ? 106  ALA D N   1 
ATOM   4640  C  CA  . ALA D  1 106 ? 55.183 39.444 37.138  1.00 25.61 ? 106  ALA D CA  1 
ATOM   4641  C  C   . ALA D  1 106 ? 55.636 40.769 36.527  1.00 24.90 ? 106  ALA D C   1 
ATOM   4642  O  O   . ALA D  1 106 ? 56.700 40.841 35.917  1.00 27.11 ? 106  ALA D O   1 
ATOM   4643  C  CB  . ALA D  1 106 ? 54.223 38.735 36.186  1.00 22.53 ? 106  ALA D CB  1 
ATOM   4644  N  N   . TYR D  1 107 ? 54.846 41.821 36.687  1.00 25.13 ? 107  TYR D N   1 
ATOM   4645  C  CA  . TYR D  1 107 ? 55.237 43.098 36.108  1.00 29.23 ? 107  TYR D CA  1 
ATOM   4646  C  C   . TYR D  1 107 ? 56.425 43.725 36.850  1.00 29.69 ? 107  TYR D C   1 
ATOM   4647  O  O   . TYR D  1 107 ? 57.333 44.282 36.232  1.00 29.31 ? 107  TYR D O   1 
ATOM   4648  C  CB  . TYR D  1 107 ? 54.060 44.079 36.101  1.00 31.38 ? 107  TYR D CB  1 
ATOM   4649  C  CG  . TYR D  1 107 ? 54.391 45.345 35.342  1.00 39.38 ? 107  TYR D CG  1 
ATOM   4650  C  CD1 . TYR D  1 107 ? 54.476 45.342 33.948  1.00 39.60 ? 107  TYR D CD1 1 
ATOM   4651  C  CD2 . TYR D  1 107 ? 54.697 46.532 36.016  1.00 42.31 ? 107  TYR D CD2 1 
ATOM   4652  C  CE1 . TYR D  1 107 ? 54.860 46.483 33.242  1.00 40.93 ? 107  TYR D CE1 1 
ATOM   4653  C  CE2 . TYR D  1 107 ? 55.087 47.684 35.316  1.00 41.95 ? 107  TYR D CE2 1 
ATOM   4654  C  CZ  . TYR D  1 107 ? 55.166 47.648 33.930  1.00 44.09 ? 107  TYR D CZ  1 
ATOM   4655  O  OH  . TYR D  1 107 ? 55.560 48.770 33.230  1.00 48.11 ? 107  TYR D OH  1 
ATOM   4656  N  N   . CYS D  1 108 ? 56.415 43.636 38.176  1.00 29.81 ? 108  CYS D N   1 
ATOM   4657  C  CA  . CYS D  1 108 ? 57.495 44.193 38.977  1.00 27.95 ? 108  CYS D CA  1 
ATOM   4658  C  C   . CYS D  1 108 ? 58.805 43.545 38.555  1.00 27.58 ? 108  CYS D C   1 
ATOM   4659  O  O   . CYS D  1 108 ? 59.852 44.194 38.489  1.00 27.27 ? 108  CYS D O   1 
ATOM   4660  C  CB  . CYS D  1 108 ? 57.225 43.939 40.461  1.00 27.83 ? 108  CYS D CB  1 
ATOM   4661  S  SG  . CYS D  1 108 ? 55.753 44.799 41.098  1.00 28.45 ? 108  CYS D SG  1 
ATOM   4662  N  N   . GLU D  1 109 ? 58.735 42.253 38.265  1.00 27.51 ? 109  GLU D N   1 
ATOM   4663  C  CA  . GLU D  1 109 ? 59.904 41.502 37.830  1.00 28.14 ? 109  GLU D CA  1 
ATOM   4664  C  C   . GLU D  1 109 ? 60.402 42.089 36.507  1.00 29.54 ? 109  GLU D C   1 
ATOM   4665  O  O   . GLU D  1 109 ? 61.581 42.378 36.352  1.00 31.31 ? 109  GLU D O   1 
ATOM   4666  C  CB  . GLU D  1 109 ? 59.534 40.021 37.645  1.00 24.99 ? 109  GLU D CB  1 
ATOM   4667  C  CG  . GLU D  1 109 ? 60.703 39.117 37.279  1.00 22.84 ? 109  GLU D CG  1 
ATOM   4668  C  CD  . GLU D  1 109 ? 61.704 38.949 38.405  1.00 25.09 ? 109  GLU D CD  1 
ATOM   4669  O  OE1 . GLU D  1 109 ? 62.816 38.456 38.134  1.00 29.11 ? 109  GLU D OE1 1 
ATOM   4670  O  OE2 . GLU D  1 109 ? 61.390 39.298 39.562  1.00 28.49 ? 109  GLU D OE2 1 
ATOM   4671  N  N   . SER D  1 110 ? 59.488 42.282 35.563  1.00 29.74 ? 110  SER D N   1 
ATOM   4672  C  CA  . SER D  1 110 ? 59.847 42.818 34.260  1.00 29.84 ? 110  SER D CA  1 
ATOM   4673  C  C   . SER D  1 110 ? 60.461 44.221 34.287  1.00 30.34 ? 110  SER D C   1 
ATOM   4674  O  O   . SER D  1 110 ? 61.202 44.580 33.370  1.00 33.24 ? 110  SER D O   1 
ATOM   4675  C  CB  . SER D  1 110 ? 58.626 42.826 33.340  1.00 28.98 ? 110  SER D CB  1 
ATOM   4676  O  OG  . SER D  1 110 ? 57.711 43.843 33.714  1.00 34.22 ? 110  SER D OG  1 
ATOM   4677  N  N   . VAL D  1 111 ? 60.160 45.023 35.306  1.00 27.30 ? 111  VAL D N   1 
ATOM   4678  C  CA  . VAL D  1 111 ? 60.734 46.369 35.358  1.00 26.77 ? 111  VAL D CA  1 
ATOM   4679  C  C   . VAL D  1 111 ? 61.759 46.549 36.469  1.00 27.01 ? 111  VAL D C   1 
ATOM   4680  O  O   . VAL D  1 111 ? 62.150 47.679 36.792  1.00 29.01 ? 111  VAL D O   1 
ATOM   4681  C  CB  . VAL D  1 111 ? 59.656 47.462 35.522  1.00 26.36 ? 111  VAL D CB  1 
ATOM   4682  C  CG1 . VAL D  1 111 ? 58.639 47.358 34.410  1.00 23.17 ? 111  VAL D CG1 1 
ATOM   4683  C  CG2 . VAL D  1 111 ? 59.003 47.355 36.890  1.00 28.15 ? 111  VAL D CG2 1 
ATOM   4684  N  N   . GLY D  1 112 ? 62.184 45.435 37.057  1.00 27.52 ? 112  GLY D N   1 
ATOM   4685  C  CA  . GLY D  1 112 ? 63.182 45.485 38.111  1.00 26.66 ? 112  GLY D CA  1 
ATOM   4686  C  C   . GLY D  1 112 ? 62.758 46.021 39.468  1.00 28.23 ? 112  GLY D C   1 
ATOM   4687  O  O   . GLY D  1 112 ? 63.632 46.373 40.271  1.00 29.55 ? 112  GLY D O   1 
ATOM   4688  N  N   . ASP D  1 113 ? 61.452 46.106 39.743  1.00 27.05 ? 113  ASP D N   1 
ATOM   4689  C  CA  . ASP D  1 113 ? 61.013 46.588 41.053  1.00 24.59 ? 113  ASP D CA  1 
ATOM   4690  C  C   . ASP D  1 113 ? 60.941 45.362 41.950  1.00 23.10 ? 113  ASP D C   1 
ATOM   4691  O  O   . ASP D  1 113 ? 59.871 44.883 42.324  1.00 23.27 ? 113  ASP D O   1 
ATOM   4692  C  CB  . ASP D  1 113 ? 59.646 47.287 40.995  1.00 22.64 ? 113  ASP D CB  1 
ATOM   4693  C  CG  . ASP D  1 113 ? 59.270 47.961 42.338  1.00 27.54 ? 113  ASP D CG  1 
ATOM   4694  O  OD1 . ASP D  1 113 ? 60.014 47.767 43.333  1.00 29.30 ? 113  ASP D OD1 1 
ATOM   4695  O  OD2 . ASP D  1 113 ? 58.236 48.673 42.413  1.00 20.82 ? 113  ASP D OD2 1 
ATOM   4696  N  N   . TYR D  1 114 ? 62.115 44.854 42.287  1.00 24.13 ? 114  TYR D N   1 
ATOM   4697  C  CA  . TYR D  1 114 ? 62.229 43.673 43.113  1.00 24.79 ? 114  TYR D CA  1 
ATOM   4698  C  C   . TYR D  1 114 ? 61.648 43.811 44.519  1.00 25.31 ? 114  TYR D C   1 
ATOM   4699  O  O   . TYR D  1 114 ? 61.063 42.862 45.035  1.00 25.21 ? 114  TYR D O   1 
ATOM   4700  C  CB  . TYR D  1 114 ? 63.690 43.258 43.158  1.00 24.56 ? 114  TYR D CB  1 
ATOM   4701  C  CG  . TYR D  1 114 ? 64.251 43.025 41.770  1.00 28.90 ? 114  TYR D CG  1 
ATOM   4702  C  CD1 . TYR D  1 114 ? 63.632 42.136 40.888  1.00 30.32 ? 114  TYR D CD1 1 
ATOM   4703  C  CD2 . TYR D  1 114 ? 65.410 43.677 41.340  1.00 31.47 ? 114  TYR D CD2 1 
ATOM   4704  C  CE1 . TYR D  1 114 ? 64.152 41.896 39.615  1.00 32.65 ? 114  TYR D CE1 1 
ATOM   4705  C  CE2 . TYR D  1 114 ? 65.942 43.444 40.071  1.00 31.66 ? 114  TYR D CE2 1 
ATOM   4706  C  CZ  . TYR D  1 114 ? 65.311 42.549 39.213  1.00 33.82 ? 114  TYR D CZ  1 
ATOM   4707  O  OH  . TYR D  1 114 ? 65.855 42.279 37.972  1.00 34.19 ? 114  TYR D OH  1 
ATOM   4708  N  N   . ALA D  1 115 ? 61.790 44.977 45.142  1.00 25.15 ? 115  ALA D N   1 
ATOM   4709  C  CA  . ALA D  1 115 ? 61.239 45.149 46.484  1.00 24.08 ? 115  ALA D CA  1 
ATOM   4710  C  C   . ALA D  1 115 ? 59.703 45.137 46.439  1.00 24.94 ? 115  ALA D C   1 
ATOM   4711  O  O   . ALA D  1 115 ? 59.052 44.652 47.370  1.00 25.22 ? 115  ALA D O   1 
ATOM   4712  C  CB  . ALA D  1 115 ? 61.755 46.442 47.120  1.00 20.82 ? 115  ALA D CB  1 
ATOM   4713  N  N   . SER D  1 116 ? 59.116 45.662 45.367  1.00 22.86 ? 116  SER D N   1 
ATOM   4714  C  CA  . SER D  1 116 ? 57.658 45.642 45.265  1.00 23.71 ? 116  SER D CA  1 
ATOM   4715  C  C   . SER D  1 116 ? 57.200 44.198 45.029  1.00 24.59 ? 116  SER D C   1 
ATOM   4716  O  O   . SER D  1 116 ? 56.108 43.804 45.454  1.00 23.75 ? 116  SER D O   1 
ATOM   4717  C  CB  . SER D  1 116 ? 57.168 46.541 44.125  1.00 21.11 ? 116  SER D CB  1 
ATOM   4718  O  OG  . SER D  1 116 ? 57.290 47.911 44.471  1.00 25.26 ? 116  SER D OG  1 
ATOM   4719  N  N   . ARG D  1 117 ? 58.042 43.409 44.361  1.00 23.26 ? 117  ARG D N   1 
ATOM   4720  C  CA  . ARG D  1 117 ? 57.720 42.013 44.097  1.00 22.97 ? 117  ARG D CA  1 
ATOM   4721  C  C   . ARG D  1 117 ? 57.727 41.219 45.408  1.00 26.24 ? 117  ARG D C   1 
ATOM   4722  O  O   . ARG D  1 117 ? 56.901 40.335 45.614  1.00 26.97 ? 117  ARG D O   1 
ATOM   4723  C  CB  . ARG D  1 117 ? 58.731 41.402 43.126  1.00 23.51 ? 117  ARG D CB  1 
ATOM   4724  C  CG  . ARG D  1 117 ? 58.530 39.907 42.952  1.00 26.28 ? 117  ARG D CG  1 
ATOM   4725  C  CD  . ARG D  1 117 ? 59.621 39.220 42.152  1.00 28.14 ? 117  ARG D CD  1 
ATOM   4726  N  NE  . ARG D  1 117 ? 59.500 37.774 42.319  1.00 32.96 ? 117  ARG D NE  1 
ATOM   4727  C  CZ  . ARG D  1 117 ? 59.401 36.898 41.324  1.00 32.51 ? 117  ARG D CZ  1 
ATOM   4728  N  NH1 . ARG D  1 117 ? 59.414 37.314 40.066  1.00 30.83 ? 117  ARG D NH1 1 
ATOM   4729  N  NH2 . ARG D  1 117 ? 59.273 35.603 41.591  1.00 32.31 ? 117  ARG D NH2 1 
ATOM   4730  N  N   . GLU D  1 118 ? 58.678 41.542 46.283  1.00 30.24 ? 118  GLU D N   1 
ATOM   4731  C  CA  . GLU D  1 118 ? 58.819 40.898 47.589  1.00 30.47 ? 118  GLU D CA  1 
ATOM   4732  C  C   . GLU D  1 118 ? 57.558 41.084 48.415  1.00 29.40 ? 118  GLU D C   1 
ATOM   4733  O  O   . GLU D  1 118 ? 57.025 40.142 48.993  1.00 27.03 ? 118  GLU D O   1 
ATOM   4734  C  CB  . GLU D  1 118 ? 59.985 41.520 48.346  1.00 35.37 ? 118  GLU D CB  1 
ATOM   4735  C  CG  . GLU D  1 118 ? 61.339 41.043 47.904  1.00 45.79 ? 118  GLU D CG  1 
ATOM   4736  C  CD  . GLU D  1 118 ? 61.593 39.629 48.348  1.00 51.52 ? 118  GLU D CD  1 
ATOM   4737  O  OE1 . GLU D  1 118 ? 60.854 38.731 47.891  1.00 55.66 ? 118  GLU D OE1 1 
ATOM   4738  O  OE2 . GLU D  1 118 ? 62.523 39.418 49.162  1.00 59.09 ? 118  GLU D OE2 1 
ATOM   4739  N  N   . LEU D  1 119 ? 57.096 42.323 48.485  1.00 29.34 ? 119  LEU D N   1 
ATOM   4740  C  CA  . LEU D  1 119 ? 55.897 42.624 49.234  1.00 29.71 ? 119  LEU D CA  1 
ATOM   4741  C  C   . LEU D  1 119 ? 54.739 41.789 48.702  1.00 30.81 ? 119  LEU D C   1 
ATOM   4742  O  O   . LEU D  1 119 ? 54.158 40.992 49.435  1.00 33.72 ? 119  LEU D O   1 
ATOM   4743  C  CB  . LEU D  1 119 ? 55.577 44.113 49.119  1.00 30.65 ? 119  LEU D CB  1 
ATOM   4744  C  CG  . LEU D  1 119 ? 54.361 44.631 49.883  1.00 29.65 ? 119  LEU D CG  1 
ATOM   4745  C  CD1 . LEU D  1 119 ? 54.356 46.148 49.854  1.00 31.51 ? 119  LEU D CD1 1 
ATOM   4746  C  CD2 . LEU D  1 119 ? 53.094 44.094 49.262  1.00 34.30 ? 119  LEU D CD2 1 
ATOM   4747  N  N   . LEU D  1 120 ? 54.404 41.965 47.428  1.00 31.12 ? 120  LEU D N   1 
ATOM   4748  C  CA  . LEU D  1 120 ? 53.291 41.222 46.843  1.00 31.31 ? 120  LEU D CA  1 
ATOM   4749  C  C   . LEU D  1 120 ? 53.460 39.721 47.068  1.00 31.42 ? 120  LEU D C   1 
ATOM   4750  O  O   . LEU D  1 120 ? 52.493 38.996 47.323  1.00 30.61 ? 120  LEU D O   1 
ATOM   4751  C  CB  . LEU D  1 120 ? 53.175 41.534 45.347  1.00 29.20 ? 120  LEU D CB  1 
ATOM   4752  C  CG  . LEU D  1 120 ? 53.037 43.036 45.040  1.00 32.98 ? 120  LEU D CG  1 
ATOM   4753  C  CD1 . LEU D  1 120 ? 53.087 43.269 43.538  1.00 27.00 ? 120  LEU D CD1 1 
ATOM   4754  C  CD2 . LEU D  1 120 ? 51.739 43.580 45.630  1.00 31.36 ? 120  LEU D CD2 1 
ATOM   4755  N  N   . GLU D  1 121 ? 54.695 39.254 46.999  1.00 31.69 ? 121  GLU D N   1 
ATOM   4756  C  CA  . GLU D  1 121 ? 54.957 37.838 47.190  1.00 34.89 ? 121  GLU D CA  1 
ATOM   4757  C  C   . GLU D  1 121 ? 54.460 37.420 48.571  1.00 35.21 ? 121  GLU D C   1 
ATOM   4758  O  O   . GLU D  1 121 ? 53.758 36.416 48.721  1.00 32.94 ? 121  GLU D O   1 
ATOM   4759  C  CB  . GLU D  1 121 ? 56.453 37.582 47.056  1.00 39.97 ? 121  GLU D CB  1 
ATOM   4760  C  CG  . GLU D  1 121 ? 56.820 36.199 46.586  1.00 49.10 ? 121  GLU D CG  1 
ATOM   4761  C  CD  . GLU D  1 121 ? 58.091 36.216 45.747  1.00 55.78 ? 121  GLU D CD  1 
ATOM   4762  O  OE1 . GLU D  1 121 ? 58.051 36.747 44.613  1.00 57.33 ? 121  GLU D OE1 1 
ATOM   4763  O  OE2 . GLU D  1 121 ? 59.131 35.709 46.223  1.00 58.92 ? 121  GLU D OE2 1 
ATOM   4764  N  N   . ASP D  1 122 ? 54.810 38.217 49.575  1.00 34.60 ? 122  ASP D N   1 
ATOM   4765  C  CA  . ASP D  1 122 ? 54.408 37.943 50.944  1.00 34.48 ? 122  ASP D CA  1 
ATOM   4766  C  C   . ASP D  1 122 ? 52.888 37.936 51.067  1.00 33.84 ? 122  ASP D C   1 
ATOM   4767  O  O   . ASP D  1 122 ? 52.308 36.991 51.603  1.00 35.74 ? 122  ASP D O   1 
ATOM   4768  C  CB  . ASP D  1 122 ? 55.034 38.974 51.884  1.00 38.47 ? 122  ASP D CB  1 
ATOM   4769  C  CG  . ASP D  1 122 ? 56.558 38.834 51.981  1.00 47.14 ? 122  ASP D CG  1 
ATOM   4770  O  OD1 . ASP D  1 122 ? 57.156 38.059 51.189  1.00 49.28 ? 122  ASP D OD1 1 
ATOM   4771  O  OD2 . ASP D  1 122 ? 57.164 39.507 52.852  1.00 51.41 ? 122  ASP D OD2 1 
ATOM   4772  N  N   . ILE D  1 123 ? 52.233 38.976 50.564  1.00 31.04 ? 123  ILE D N   1 
ATOM   4773  C  CA  . ILE D  1 123 ? 50.772 39.028 50.621  1.00 29.33 ? 123  ILE D CA  1 
ATOM   4774  C  C   . ILE D  1 123 ? 50.185 37.793 49.932  1.00 28.20 ? 123  ILE D C   1 
ATOM   4775  O  O   . ILE D  1 123 ? 49.217 37.201 50.406  1.00 28.34 ? 123  ILE D O   1 
ATOM   4776  C  CB  . ILE D  1 123 ? 50.237 40.302 49.933  1.00 28.95 ? 123  ILE D CB  1 
ATOM   4777  C  CG1 . ILE D  1 123 ? 50.581 41.523 50.791  1.00 26.30 ? 123  ILE D CG1 1 
ATOM   4778  C  CG2 . ILE D  1 123 ? 48.738 40.187 49.696  1.00 27.54 ? 123  ILE D CG2 1 
ATOM   4779  C  CD1 . ILE D  1 123 ? 50.144 42.830 50.186  1.00 28.19 ? 123  ILE D CD1 1 
ATOM   4780  N  N   . LEU D  1 124 ? 50.793 37.408 48.816  1.00 28.47 ? 124  LEU D N   1 
ATOM   4781  C  CA  . LEU D  1 124 ? 50.361 36.246 48.050  1.00 27.88 ? 124  LEU D CA  1 
ATOM   4782  C  C   . LEU D  1 124 ? 50.344 34.985 48.891  1.00 29.38 ? 124  LEU D C   1 
ATOM   4783  O  O   . LEU D  1 124 ? 49.381 34.223 48.862  1.00 30.88 ? 124  LEU D O   1 
ATOM   4784  C  CB  . LEU D  1 124 ? 51.299 36.020 46.862  1.00 27.98 ? 124  LEU D CB  1 
ATOM   4785  C  CG  . LEU D  1 124 ? 51.053 34.732 46.071  1.00 22.27 ? 124  LEU D CG  1 
ATOM   4786  C  CD1 . LEU D  1 124 ? 49.615 34.703 45.637  1.00 22.30 ? 124  LEU D CD1 1 
ATOM   4787  C  CD2 . LEU D  1 124 ? 51.969 34.663 44.860  1.00 22.74 ? 124  LEU D CD2 1 
ATOM   4788  N  N   . GLU D  1 125 ? 51.422 34.753 49.629  1.00 30.03 ? 125  GLU D N   1 
ATOM   4789  C  CA  . GLU D  1 125 ? 51.509 33.556 50.448  1.00 33.50 ? 125  GLU D CA  1 
ATOM   4790  C  C   . GLU D  1 125 ? 50.409 33.569 51.485  1.00 33.18 ? 125  GLU D C   1 
ATOM   4791  O  O   . GLU D  1 125 ? 49.831 32.529 51.802  1.00 31.98 ? 125  GLU D O   1 
ATOM   4792  C  CB  . GLU D  1 125 ? 52.883 33.473 51.096  1.00 37.15 ? 125  GLU D CB  1 
ATOM   4793  C  CG  . GLU D  1 125 ? 53.977 33.716 50.068  1.00 48.49 ? 125  GLU D CG  1 
ATOM   4794  C  CD  . GLU D  1 125 ? 55.353 33.338 50.549  1.00 53.61 ? 125  GLU D CD  1 
ATOM   4795  O  OE1 . GLU D  1 125 ? 56.331 33.709 49.864  1.00 58.91 ? 125  GLU D OE1 1 
ATOM   4796  O  OE2 . GLU D  1 125 ? 55.455 32.667 51.598  1.00 58.01 ? 125  GLU D OE2 1 
ATOM   4797  N  N   . SER D  1 126 ? 50.107 34.761 51.991  1.00 32.73 ? 126  SER D N   1 
ATOM   4798  C  CA  . SER D  1 126 ? 49.055 34.931 52.973  1.00 31.38 ? 126  SER D CA  1 
ATOM   4799  C  C   . SER D  1 126 ? 47.698 34.633 52.339  1.00 33.66 ? 126  SER D C   1 
ATOM   4800  O  O   . SER D  1 126 ? 46.818 34.058 52.989  1.00 35.41 ? 126  SER D O   1 
ATOM   4801  C  CB  . SER D  1 126 ? 49.068 36.358 53.516  1.00 32.82 ? 126  SER D CB  1 
ATOM   4802  O  OG  . SER D  1 126 ? 47.926 36.605 54.324  1.00 36.01 ? 126  SER D OG  1 
ATOM   4803  N  N   . GLU D  1 127 ? 47.519 35.019 51.076  1.00 33.99 ? 127  GLU D N   1 
ATOM   4804  C  CA  . GLU D  1 127 ? 46.247 34.755 50.412  1.00 34.80 ? 127  GLU D CA  1 
ATOM   4805  C  C   . GLU D  1 127 ? 46.048 33.273 50.151  1.00 33.43 ? 127  GLU D C   1 
ATOM   4806  O  O   . GLU D  1 127 ? 44.915 32.802 50.123  1.00 31.78 ? 127  GLU D O   1 
ATOM   4807  C  CB  . GLU D  1 127 ? 46.133 35.536 49.098  1.00 37.53 ? 127  GLU D CB  1 
ATOM   4808  C  CG  . GLU D  1 127 ? 46.329 37.047 49.242  1.00 47.56 ? 127  GLU D CG  1 
ATOM   4809  C  CD  . GLU D  1 127 ? 45.343 37.715 50.211  1.00 52.59 ? 127  GLU D CD  1 
ATOM   4810  O  OE1 . GLU D  1 127 ? 45.527 38.917 50.508  1.00 55.61 ? 127  GLU D OE1 1 
ATOM   4811  O  OE2 . GLU D  1 127 ? 44.393 37.022 50.650  1.00 57.66 ? 127  GLU D OE2 1 
ATOM   4812  N  N   . GLU D  1 128 ? 47.128 32.523 49.943  1.00 33.79 ? 128  GLU D N   1 
ATOM   4813  C  CA  . GLU D  1 128 ? 46.961 31.094 49.710  1.00 35.66 ? 128  GLU D CA  1 
ATOM   4814  C  C   . GLU D  1 128 ? 46.565 30.394 51.018  1.00 37.42 ? 128  GLU D C   1 
ATOM   4815  O  O   . GLU D  1 128 ? 45.931 29.338 50.998  1.00 38.30 ? 128  GLU D O   1 
ATOM   4816  C  CB  . GLU D  1 128 ? 48.227 30.477 49.098  1.00 33.32 ? 128  GLU D CB  1 
ATOM   4817  C  CG  . GLU D  1 128 ? 48.514 30.959 47.659  1.00 34.76 ? 128  GLU D CG  1 
ATOM   4818  C  CD  . GLU D  1 128 ? 49.580 30.127 46.928  1.00 38.42 ? 128  GLU D CD  1 
ATOM   4819  O  OE1 . GLU D  1 128 ? 50.533 29.635 47.576  1.00 41.61 ? 128  GLU D OE1 1 
ATOM   4820  O  OE2 . GLU D  1 128 ? 49.479 29.974 45.694  1.00 37.46 ? 128  GLU D OE2 1 
ATOM   4821  N  N   . ASP D  1 129 ? 46.917 30.991 52.157  1.00 39.13 ? 129  ASP D N   1 
ATOM   4822  C  CA  . ASP D  1 129 ? 46.545 30.421 53.453  1.00 38.30 ? 129  ASP D CA  1 
ATOM   4823  C  C   . ASP D  1 129 ? 45.052 30.612 53.689  1.00 36.78 ? 129  ASP D C   1 
ATOM   4824  O  O   . ASP D  1 129 ? 44.365 29.677 54.106  1.00 36.10 ? 129  ASP D O   1 
ATOM   4825  C  CB  . ASP D  1 129 ? 47.330 31.070 54.588  1.00 42.04 ? 129  ASP D CB  1 
ATOM   4826  C  CG  . ASP D  1 129 ? 48.737 30.537 54.690  1.00 46.80 ? 129  ASP D CG  1 
ATOM   4827  O  OD1 . ASP D  1 129 ? 48.913 29.304 54.559  1.00 50.91 ? 129  ASP D OD1 1 
ATOM   4828  O  OD2 . ASP D  1 129 ? 49.667 31.344 54.911  1.00 52.25 ? 129  ASP D OD2 1 
ATOM   4829  N  N   . HIS D  1 130 ? 44.556 31.824 53.436  1.00 34.54 ? 130  HIS D N   1 
ATOM   4830  C  CA  . HIS D  1 130 ? 43.132 32.100 53.576  1.00 32.14 ? 130  HIS D CA  1 
ATOM   4831  C  C   . HIS D  1 130 ? 42.387 31.078 52.720  1.00 31.98 ? 130  HIS D C   1 
ATOM   4832  O  O   . HIS D  1 130 ? 41.456 30.413 53.185  1.00 31.88 ? 130  HIS D O   1 
ATOM   4833  C  CB  . HIS D  1 130 ? 42.787 33.474 53.062  1.00 33.26 ? 130  HIS D CB  1 
ATOM   4834  C  CG  . HIS D  1 130 ? 43.406 34.600 53.908  1.00 40.36 ? 130  HIS D CG  1 
ATOM   4835  N  ND1 . HIS D  1 130 ? 43.238 35.937 53.607  1.00 38.66 ? 130  HIS D ND1 1 
ATOM   4836  C  CD2 . HIS D  1 130 ? 44.181 34.560 55.018  1.00 38.95 ? 130  HIS D CD2 1 
ATOM   4837  C  CE1 . HIS D  1 130 ? 43.882 36.671 54.497  1.00 38.75 ? 130  HIS D CE1 1 
ATOM   4838  N  NE2 . HIS D  1 130 ? 44.462 35.861 55.364  1.00 39.35 ? 130  HIS D NE2 1 
ATOM   4839  N  N   . ILE D  1 131 ? 42.819 30.940 51.468  1.00 31.39 ? 131  ILE D N   1 
ATOM   4840  C  CA  . ILE D  1 131 ? 42.198 29.990 50.548  1.00 30.37 ? 131  ILE D CA  1 
ATOM   4841  C  C   . ILE D  1 131 ? 42.199 28.570 51.130  1.00 28.15 ? 131  ILE D C   1 
ATOM   4842  O  O   . ILE D  1 131 ? 41.147 27.951 51.258  1.00 27.32 ? 131  ILE D O   1 
ATOM   4843  C  CB  . ILE D  1 131 ? 42.918 29.968 49.155  1.00 29.49 ? 131  ILE D CB  1 
ATOM   4844  C  CG1 . ILE D  1 131 ? 42.882 31.360 48.517  1.00 28.45 ? 131  ILE D CG1 1 
ATOM   4845  C  CG2 . ILE D  1 131 ? 42.222 28.987 48.216  1.00 27.76 ? 131  ILE D CG2 1 
ATOM   4846  C  CD1 . ILE D  1 131 ? 43.460 31.417 47.114  1.00 26.78 ? 131  ILE D CD1 1 
ATOM   4847  N  N   . ASP D  1 132 ? 43.368 28.053 51.489  1.00 28.23 ? 132  ASP D N   1 
ATOM   4848  C  CA  . ASP D  1 132 ? 43.429 26.703 52.033  1.00 30.42 ? 132  ASP D CA  1 
ATOM   4849  C  C   . ASP D  1 132 ? 42.420 26.554 53.169  1.00 32.15 ? 132  ASP D C   1 
ATOM   4850  O  O   . ASP D  1 132 ? 41.668 25.572 53.234  1.00 32.81 ? 132  ASP D O   1 
ATOM   4851  C  CB  . ASP D  1 132 ? 44.837 26.385 52.540  1.00 32.07 ? 132  ASP D CB  1 
ATOM   4852  C  CG  . ASP D  1 132 ? 45.006 24.915 52.915  1.00 37.32 ? 132  ASP D CG  1 
ATOM   4853  O  OD1 . ASP D  1 132 ? 44.218 24.073 52.433  1.00 41.15 ? 132  ASP D OD1 1 
ATOM   4854  O  OD2 . ASP D  1 132 ? 45.942 24.592 53.679  1.00 43.27 ? 132  ASP D OD2 1 
ATOM   4855  N  N   . TRP D  1 133 ? 42.387 27.536 54.060  1.00 29.31 ? 133  TRP D N   1 
ATOM   4856  C  CA  . TRP D  1 133 ? 41.456 27.466 55.163  1.00 28.55 ? 133  TRP D CA  1 
ATOM   4857  C  C   . TRP D  1 133 ? 40.007 27.416 54.651  1.00 31.50 ? 133  TRP D C   1 
ATOM   4858  O  O   . TRP D  1 133 ? 39.220 26.552 55.057  1.00 33.41 ? 133  TRP D O   1 
ATOM   4859  C  CB  . TRP D  1 133 ? 41.650 28.661 56.096  1.00 28.33 ? 133  TRP D CB  1 
ATOM   4860  C  CG  . TRP D  1 133 ? 40.777 28.573 57.295  1.00 27.23 ? 133  TRP D CG  1 
ATOM   4861  C  CD1 . TRP D  1 133 ? 40.960 27.774 58.389  1.00 26.18 ? 133  TRP D CD1 1 
ATOM   4862  C  CD2 . TRP D  1 133 ? 39.513 29.213 57.472  1.00 27.93 ? 133  TRP D CD2 1 
ATOM   4863  N  NE1 . TRP D  1 133 ? 39.879 27.870 59.233  1.00 26.69 ? 133  TRP D NE1 1 
ATOM   4864  C  CE2 . TRP D  1 133 ? 38.977 28.748 58.696  1.00 26.67 ? 133  TRP D CE2 1 
ATOM   4865  C  CE3 . TRP D  1 133 ? 38.777 30.135 56.714  1.00 28.23 ? 133  TRP D CE3 1 
ATOM   4866  C  CZ2 . TRP D  1 133 ? 37.743 29.172 59.179  1.00 25.69 ? 133  TRP D CZ2 1 
ATOM   4867  C  CZ3 . TRP D  1 133 ? 37.545 30.560 57.194  1.00 30.13 ? 133  TRP D CZ3 1 
ATOM   4868  C  CH2 . TRP D  1 133 ? 37.040 30.077 58.418  1.00 30.03 ? 133  TRP D CH2 1 
ATOM   4869  N  N   . LEU D  1 134 ? 39.652 28.334 53.755  1.00 30.64 ? 134  LEU D N   1 
ATOM   4870  C  CA  . LEU D  1 134 ? 38.297 28.368 53.216  1.00 30.00 ? 134  LEU D CA  1 
ATOM   4871  C  C   . LEU D  1 134 ? 37.892 27.046 52.572  1.00 33.93 ? 134  LEU D C   1 
ATOM   4872  O  O   . LEU D  1 134 ? 36.831 26.497 52.882  1.00 35.98 ? 134  LEU D O   1 
ATOM   4873  C  CB  . LEU D  1 134 ? 38.163 29.508 52.205  1.00 25.21 ? 134  LEU D CB  1 
ATOM   4874  C  CG  . LEU D  1 134 ? 38.202 30.891 52.861  1.00 26.71 ? 134  LEU D CG  1 
ATOM   4875  C  CD1 . LEU D  1 134 ? 38.445 31.974 51.828  1.00 22.55 ? 134  LEU D CD1 1 
ATOM   4876  C  CD2 . LEU D  1 134 ? 36.893 31.126 53.612  1.00 25.51 ? 134  LEU D CD2 1 
ATOM   4877  N  N   . GLU D  1 135 ? 38.734 26.525 51.683  1.00 36.74 ? 135  GLU D N   1 
ATOM   4878  C  CA  . GLU D  1 135 ? 38.420 25.268 51.008  1.00 38.89 ? 135  GLU D CA  1 
ATOM   4879  C  C   . GLU D  1 135 ? 38.241 24.160 52.029  1.00 38.15 ? 135  GLU D C   1 
ATOM   4880  O  O   . GLU D  1 135 ? 37.348 23.330 51.899  1.00 40.54 ? 135  GLU D O   1 
ATOM   4881  C  CB  . GLU D  1 135 ? 39.527 24.892 50.022  1.00 41.82 ? 135  GLU D CB  1 
ATOM   4882  C  CG  . GLU D  1 135 ? 39.793 25.971 48.983  1.00 50.04 ? 135  GLU D CG  1 
ATOM   4883  C  CD  . GLU D  1 135 ? 40.913 25.617 48.018  1.00 52.18 ? 135  GLU D CD  1 
ATOM   4884  O  OE1 . GLU D  1 135 ? 41.952 25.080 48.471  1.00 52.81 ? 135  GLU D OE1 1 
ATOM   4885  O  OE2 . GLU D  1 135 ? 40.755 25.899 46.808  1.00 52.94 ? 135  GLU D OE2 1 
ATOM   4886  N  N   . THR D  1 136 ? 39.085 24.160 53.054  1.00 36.57 ? 136  THR D N   1 
ATOM   4887  C  CA  . THR D  1 136 ? 39.015 23.146 54.096  1.00 34.24 ? 136  THR D CA  1 
ATOM   4888  C  C   . THR D  1 136 ? 37.693 23.172 54.872  1.00 32.11 ? 136  THR D C   1 
ATOM   4889  O  O   . THR D  1 136 ? 37.097 22.119 55.128  1.00 28.34 ? 136  THR D O   1 
ATOM   4890  C  CB  . THR D  1 136 ? 40.200 23.300 55.071  1.00 34.39 ? 136  THR D CB  1 
ATOM   4891  O  OG1 . THR D  1 136 ? 41.407 22.940 54.392  1.00 35.05 ? 136  THR D OG1 1 
ATOM   4892  C  CG2 . THR D  1 136 ? 40.028 22.406 56.289  1.00 35.65 ? 136  THR D CG2 1 
ATOM   4893  N  N   . GLN D  1 137 ? 37.234 24.364 55.247  1.00 29.22 ? 137  GLN D N   1 
ATOM   4894  C  CA  . GLN D  1 137 ? 35.981 24.464 55.982  1.00 28.46 ? 137  GLN D CA  1 
ATOM   4895  C  C   . GLN D  1 137 ? 34.851 23.879 55.148  1.00 27.03 ? 137  GLN D C   1 
ATOM   4896  O  O   . GLN D  1 137 ? 34.041 23.089 55.646  1.00 25.90 ? 137  GLN D O   1 
ATOM   4897  C  CB  . GLN D  1 137 ? 35.645 25.923 56.327  1.00 29.85 ? 137  GLN D CB  1 
ATOM   4898  C  CG  . GLN D  1 137 ? 36.730 26.657 57.086  1.00 30.78 ? 137  GLN D CG  1 
ATOM   4899  C  CD  . GLN D  1 137 ? 37.364 25.804 58.165  1.00 29.92 ? 137  GLN D CD  1 
ATOM   4900  O  OE1 . GLN D  1 137 ? 38.566 25.545 58.131  1.00 33.13 ? 137  GLN D OE1 1 
ATOM   4901  N  NE2 . GLN D  1 137 ? 36.562 25.361 59.125  1.00 24.13 ? 137  GLN D NE2 1 
ATOM   4902  N  N   . LEU D  1 138 ? 34.793 24.259 53.876  1.00 25.19 ? 138  LEU D N   1 
ATOM   4903  C  CA  . LEU D  1 138 ? 33.732 23.757 53.018  1.00 25.31 ? 138  LEU D CA  1 
ATOM   4904  C  C   . LEU D  1 138 ? 33.781 22.240 52.907  1.00 27.75 ? 138  LEU D C   1 
ATOM   4905  O  O   . LEU D  1 138 ? 32.732 21.591 52.883  1.00 30.95 ? 138  LEU D O   1 
ATOM   4906  C  CB  . LEU D  1 138 ? 33.804 24.415 51.643  1.00 23.55 ? 138  LEU D CB  1 
ATOM   4907  C  CG  . LEU D  1 138 ? 33.405 25.899 51.671  1.00 27.39 ? 138  LEU D CG  1 
ATOM   4908  C  CD1 . LEU D  1 138 ? 33.842 26.591 50.386  1.00 26.37 ? 138  LEU D CD1 1 
ATOM   4909  C  CD2 . LEU D  1 138 ? 31.895 26.024 51.879  1.00 21.81 ? 138  LEU D CD2 1 
ATOM   4910  N  N   . ASP D  1 139 ? 34.984 21.669 52.853  1.00 26.73 ? 139  ASP D N   1 
ATOM   4911  C  CA  . ASP D  1 139 ? 35.119 20.217 52.772  1.00 28.47 ? 139  ASP D CA  1 
ATOM   4912  C  C   . ASP D  1 139 ? 34.647 19.600 54.070  1.00 31.07 ? 139  ASP D C   1 
ATOM   4913  O  O   . ASP D  1 139 ? 33.985 18.561 54.075  1.00 33.88 ? 139  ASP D O   1 
ATOM   4914  C  CB  . ASP D  1 139 ? 36.571 19.798 52.556  1.00 34.49 ? 139  ASP D CB  1 
ATOM   4915  C  CG  . ASP D  1 139 ? 37.061 20.085 51.156  1.00 41.69 ? 139  ASP D CG  1 
ATOM   4916  O  OD1 . ASP D  1 139 ? 36.285 19.847 50.202  1.00 43.56 ? 139  ASP D OD1 1 
ATOM   4917  O  OD2 . ASP D  1 139 ? 38.225 20.534 51.012  1.00 45.17 ? 139  ASP D OD2 1 
ATOM   4918  N  N   . LEU D  1 140 ? 35.014 20.238 55.179  1.00 31.83 ? 140  LEU D N   1 
ATOM   4919  C  CA  . LEU D  1 140 ? 34.639 19.756 56.497  1.00 28.29 ? 140  LEU D CA  1 
ATOM   4920  C  C   . LEU D  1 140 ? 33.123 19.690 56.590  1.00 27.57 ? 140  LEU D C   1 
ATOM   4921  O  O   . LEU D  1 140 ? 32.563 18.725 57.110  1.00 27.00 ? 140  LEU D O   1 
ATOM   4922  C  CB  . LEU D  1 140 ? 35.221 20.679 57.565  1.00 27.24 ? 140  LEU D CB  1 
ATOM   4923  C  CG  . LEU D  1 140 ? 36.311 20.091 58.475  1.00 29.99 ? 140  LEU D CG  1 
ATOM   4924  C  CD1 . LEU D  1 140 ? 37.198 19.127 57.715  1.00 27.72 ? 140  LEU D CD1 1 
ATOM   4925  C  CD2 . LEU D  1 140 ? 37.139 21.232 59.070  1.00 28.91 ? 140  LEU D CD2 1 
ATOM   4926  N  N   . ILE D  1 141 ? 32.454 20.702 56.062  1.00 26.94 ? 141  ILE D N   1 
ATOM   4927  C  CA  . ILE D  1 141 ? 30.999 20.712 56.088  1.00 29.79 ? 141  ILE D CA  1 
ATOM   4928  C  C   . ILE D  1 141 ? 30.456 19.503 55.338  1.00 31.56 ? 141  ILE D C   1 
ATOM   4929  O  O   . ILE D  1 141 ? 29.467 18.900 55.753  1.00 32.45 ? 141  ILE D O   1 
ATOM   4930  C  CB  . ILE D  1 141 ? 30.429 21.998 55.459  1.00 29.09 ? 141  ILE D CB  1 
ATOM   4931  C  CG1 . ILE D  1 141 ? 30.695 23.187 56.393  1.00 27.82 ? 141  ILE D CG1 1 
ATOM   4932  C  CG2 . ILE D  1 141 ? 28.941 21.835 55.197  1.00 26.17 ? 141  ILE D CG2 1 
ATOM   4933  C  CD1 . ILE D  1 141 ? 30.241 24.527 55.839  1.00 25.70 ? 141  ILE D CD1 1 
ATOM   4934  N  N   . ASP D  1 142 ? 31.100 19.140 54.236  1.00 33.91 ? 142  ASP D N   1 
ATOM   4935  C  CA  . ASP D  1 142 ? 30.646 17.989 53.470  1.00 38.44 ? 142  ASP D CA  1 
ATOM   4936  C  C   . ASP D  1 142 ? 30.965 16.680 54.181  1.00 38.58 ? 142  ASP D C   1 
ATOM   4937  O  O   . ASP D  1 142 ? 30.180 15.736 54.130  1.00 39.97 ? 142  ASP D O   1 
ATOM   4938  C  CB  . ASP D  1 142 ? 31.277 17.975 52.073  1.00 44.72 ? 142  ASP D CB  1 
ATOM   4939  C  CG  . ASP D  1 142 ? 30.600 18.946 51.111  1.00 53.43 ? 142  ASP D CG  1 
ATOM   4940  O  OD1 . ASP D  1 142 ? 29.349 18.910 51.005  1.00 55.56 ? 142  ASP D OD1 1 
ATOM   4941  O  OD2 . ASP D  1 142 ? 31.320 19.740 50.455  1.00 57.40 ? 142  ASP D OD2 1 
ATOM   4942  N  N   . LYS D  1 143 ? 32.109 16.623 54.852  1.00 37.62 ? 143  LYS D N   1 
ATOM   4943  C  CA  . LYS D  1 143 ? 32.500 15.404 55.547  1.00 36.57 ? 143  LYS D CA  1 
ATOM   4944  C  C   . LYS D  1 143 ? 31.687 15.103 56.810  1.00 35.58 ? 143  LYS D C   1 
ATOM   4945  O  O   . LYS D  1 143 ? 31.313 13.955 57.041  1.00 35.37 ? 143  LYS D O   1 
ATOM   4946  C  CB  . LYS D  1 143 ? 33.991 15.450 55.907  1.00 39.43 ? 143  LYS D CB  1 
ATOM   4947  C  CG  . LYS D  1 143 ? 34.940 15.591 54.717  1.00 39.74 ? 143  LYS D CG  1 
ATOM   4948  C  CD  . LYS D  1 143 ? 36.357 15.168 55.100  1.00 38.18 ? 143  LYS D CD  1 
ATOM   4949  C  CE  . LYS D  1 143 ? 37.379 15.583 54.042  1.00 38.44 ? 143  LYS D CE  1 
ATOM   4950  N  NZ  . LYS D  1 143 ? 37.012 15.145 52.673  1.00 39.40 ? 143  LYS D NZ  1 
ATOM   4951  N  N   . ILE D  1 144 ? 31.413 16.124 57.622  1.00 34.16 ? 144  ILE D N   1 
ATOM   4952  C  CA  . ILE D  1 144 ? 30.674 15.921 58.865  1.00 31.93 ? 144  ILE D CA  1 
ATOM   4953  C  C   . ILE D  1 144 ? 29.228 16.393 58.853  1.00 31.68 ? 144  ILE D C   1 
ATOM   4954  O  O   . ILE D  1 144 ? 28.407 15.876 59.605  1.00 32.80 ? 144  ILE D O   1 
ATOM   4955  C  CB  . ILE D  1 144 ? 31.399 16.587 60.069  1.00 30.23 ? 144  ILE D CB  1 
ATOM   4956  C  CG1 . ILE D  1 144 ? 31.331 18.117 59.967  1.00 28.25 ? 144  ILE D CG1 1 
ATOM   4957  C  CG2 . ILE D  1 144 ? 32.856 16.132 60.098  1.00 29.53 ? 144  ILE D CG2 1 
ATOM   4958  C  CD1 . ILE D  1 144 ? 32.098 18.859 61.075  1.00 19.47 ? 144  ILE D CD1 1 
ATOM   4959  N  N   . GLY D  1 145 ? 28.913 17.373 58.012  1.00 31.77 ? 145  GLY D N   1 
ATOM   4960  C  CA  . GLY D  1 145 ? 27.547 17.866 57.945  1.00 28.75 ? 145  GLY D CA  1 
ATOM   4961  C  C   . GLY D  1 145 ? 27.369 19.263 58.511  1.00 30.10 ? 145  GLY D C   1 
ATOM   4962  O  O   . GLY D  1 145 ? 28.002 19.632 59.506  1.00 31.79 ? 145  GLY D O   1 
ATOM   4963  N  N   . LEU D  1 146 ? 26.491 20.042 57.886  1.00 28.79 ? 146  LEU D N   1 
ATOM   4964  C  CA  . LEU D  1 146 ? 26.246 21.405 58.323  1.00 29.78 ? 146  LEU D CA  1 
ATOM   4965  C  C   . LEU D  1 146 ? 25.962 21.519 59.820  1.00 32.04 ? 146  LEU D C   1 
ATOM   4966  O  O   . LEU D  1 146 ? 26.591 22.326 60.517  1.00 32.97 ? 146  LEU D O   1 
ATOM   4967  C  CB  . LEU D  1 146 ? 25.091 22.014 57.535  1.00 27.02 ? 146  LEU D CB  1 
ATOM   4968  C  CG  . LEU D  1 146 ? 24.981 23.539 57.668  1.00 28.03 ? 146  LEU D CG  1 
ATOM   4969  C  CD1 . LEU D  1 146 ? 26.286 24.201 57.220  1.00 27.69 ? 146  LEU D CD1 1 
ATOM   4970  C  CD2 . LEU D  1 146 ? 23.819 24.038 56.829  1.00 25.15 ? 146  LEU D CD2 1 
ATOM   4971  N  N   . GLU D  1 147 ? 25.024 20.716 60.316  1.00 32.54 ? 147  GLU D N   1 
ATOM   4972  C  CA  . GLU D  1 147 ? 24.678 20.756 61.732  1.00 35.11 ? 147  GLU D CA  1 
ATOM   4973  C  C   . GLU D  1 147 ? 25.884 20.531 62.652  1.00 34.65 ? 147  GLU D C   1 
ATOM   4974  O  O   . GLU D  1 147 ? 26.126 21.335 63.564  1.00 32.89 ? 147  GLU D O   1 
ATOM   4975  C  CB  . GLU D  1 147 ? 23.576 19.743 62.033  1.00 37.20 ? 147  GLU D CB  1 
ATOM   4976  C  CG  . GLU D  1 147 ? 22.250 20.117 61.407  1.00 46.26 ? 147  GLU D CG  1 
ATOM   4977  C  CD  . GLU D  1 147 ? 21.161 19.086 61.662  1.00 56.15 ? 147  GLU D CD  1 
ATOM   4978  O  OE1 . GLU D  1 147 ? 20.886 18.770 62.846  1.00 62.60 ? 147  GLU D OE1 1 
ATOM   4979  O  OE2 . GLU D  1 147 ? 20.573 18.592 60.676  1.00 60.71 ? 147  GLU D OE2 1 
ATOM   4980  N  N   . ASN D  1 148 ? 26.641 19.457 62.420  1.00 32.90 ? 148  ASN D N   1 
ATOM   4981  C  CA  . ASN D  1 148 ? 27.820 19.195 63.241  1.00 30.75 ? 148  ASN D CA  1 
ATOM   4982  C  C   . ASN D  1 148 ? 28.855 20.313 63.071  1.00 29.83 ? 148  ASN D C   1 
ATOM   4983  O  O   . ASN D  1 148 ? 29.428 20.802 64.055  1.00 27.45 ? 148  ASN D O   1 
ATOM   4984  C  CB  . ASN D  1 148 ? 28.464 17.856 62.878  1.00 33.48 ? 148  ASN D CB  1 
ATOM   4985  C  CG  . ASN D  1 148 ? 27.794 16.673 63.558  1.00 36.90 ? 148  ASN D CG  1 
ATOM   4986  O  OD1 . ASN D  1 148 ? 27.417 16.741 64.728  1.00 36.86 ? 148  ASN D OD1 1 
ATOM   4987  N  ND2 . ASN D  1 148 ? 27.663 15.570 62.830  1.00 40.28 ? 148  ASN D ND2 1 
ATOM   4988  N  N   . TYR D  1 149 ? 29.092 20.724 61.828  1.00 27.13 ? 149  TYR D N   1 
ATOM   4989  C  CA  . TYR D  1 149 ? 30.063 21.775 61.591  1.00 26.01 ? 149  TYR D CA  1 
ATOM   4990  C  C   . TYR D  1 149 ? 29.665 23.004 62.388  1.00 26.40 ? 149  TYR D C   1 
ATOM   4991  O  O   . TYR D  1 149 ? 30.482 23.582 63.099  1.00 23.83 ? 149  TYR D O   1 
ATOM   4992  C  CB  . TYR D  1 149 ? 30.142 22.149 60.108  1.00 27.84 ? 149  TYR D CB  1 
ATOM   4993  C  CG  . TYR D  1 149 ? 31.194 23.216 59.831  1.00 25.88 ? 149  TYR D CG  1 
ATOM   4994  C  CD1 . TYR D  1 149 ? 32.560 22.906 59.868  1.00 24.30 ? 149  TYR D CD1 1 
ATOM   4995  C  CD2 . TYR D  1 149 ? 30.825 24.542 59.582  1.00 24.92 ? 149  TYR D CD2 1 
ATOM   4996  C  CE1 . TYR D  1 149 ? 33.535 23.884 59.671  1.00 22.60 ? 149  TYR D CE1 1 
ATOM   4997  C  CE2 . TYR D  1 149 ? 31.794 25.540 59.378  1.00 28.48 ? 149  TYR D CE2 1 
ATOM   4998  C  CZ  . TYR D  1 149 ? 33.148 25.201 59.425  1.00 29.04 ? 149  TYR D CZ  1 
ATOM   4999  O  OH  . TYR D  1 149 ? 34.111 26.177 59.234  1.00 27.60 ? 149  TYR D OH  1 
ATOM   5000  N  N   . LEU D  1 150 ? 28.403 23.403 62.268  1.00 27.06 ? 150  LEU D N   1 
ATOM   5001  C  CA  . LEU D  1 150 ? 27.939 24.575 62.986  1.00 29.42 ? 150  LEU D CA  1 
ATOM   5002  C  C   . LEU D  1 150 ? 28.046 24.388 64.499  1.00 32.06 ? 150  LEU D C   1 
ATOM   5003  O  O   . LEU D  1 150 ? 28.459 25.309 65.216  1.00 31.96 ? 150  LEU D O   1 
ATOM   5004  C  CB  . LEU D  1 150 ? 26.502 24.919 62.584  1.00 29.12 ? 150  LEU D CB  1 
ATOM   5005  C  CG  . LEU D  1 150 ? 26.354 25.471 61.163  1.00 30.87 ? 150  LEU D CG  1 
ATOM   5006  C  CD1 . LEU D  1 150 ? 24.936 25.973 60.953  1.00 28.88 ? 150  LEU D CD1 1 
ATOM   5007  C  CD2 . LEU D  1 150 ? 27.351 26.611 60.941  1.00 29.26 ? 150  LEU D CD2 1 
ATOM   5008  N  N   . GLN D  1 151 ? 27.679 23.206 64.988  1.00 31.44 ? 151  GLN D N   1 
ATOM   5009  C  CA  . GLN D  1 151 ? 27.770 22.945 66.417  1.00 29.40 ? 151  GLN D CA  1 
ATOM   5010  C  C   . GLN D  1 151 ? 29.182 23.194 66.900  1.00 30.56 ? 151  GLN D C   1 
ATOM   5011  O  O   . GLN D  1 151 ? 29.390 23.864 67.907  1.00 33.39 ? 151  GLN D O   1 
ATOM   5012  C  CB  . GLN D  1 151 ? 27.417 21.499 66.749  1.00 28.35 ? 151  GLN D CB  1 
ATOM   5013  C  CG  . GLN D  1 151 ? 27.778 21.123 68.178  1.00 26.87 ? 151  GLN D CG  1 
ATOM   5014  C  CD  . GLN D  1 151 ? 27.519 19.665 68.502  1.00 28.69 ? 151  GLN D CD  1 
ATOM   5015  O  OE1 . GLN D  1 151 ? 27.971 18.763 67.788  1.00 28.27 ? 151  GLN D OE1 1 
ATOM   5016  N  NE2 . GLN D  1 151 ? 26.799 19.424 69.593  1.00 26.30 ? 151  GLN D NE2 1 
ATOM   5017  N  N   . SER D  1 152 ? 30.155 22.656 66.173  1.00 30.31 ? 152  SER D N   1 
ATOM   5018  C  CA  . SER D  1 152 ? 31.545 22.788 66.578  1.00 30.95 ? 152  SER D CA  1 
ATOM   5019  C  C   . SER D  1 152 ? 32.140 24.176 66.438  1.00 30.44 ? 152  SER D C   1 
ATOM   5020  O  O   . SER D  1 152 ? 33.266 24.416 66.870  1.00 32.35 ? 152  SER D O   1 
ATOM   5021  C  CB  . SER D  1 152 ? 32.411 21.758 65.838  1.00 32.19 ? 152  SER D CB  1 
ATOM   5022  O  OG  . SER D  1 152 ? 32.231 21.839 64.441  1.00 39.60 ? 152  SER D OG  1 
ATOM   5023  N  N   . GLN D  1 153 ? 31.385 25.098 65.858  1.00 32.18 ? 153  GLN D N   1 
ATOM   5024  C  CA  . GLN D  1 153 ? 31.868 26.464 65.683  1.00 33.29 ? 153  GLN D CA  1 
ATOM   5025  C  C   . GLN D  1 153 ? 31.292 27.381 66.750  1.00 33.87 ? 153  GLN D C   1 
ATOM   5026  O  O   . GLN D  1 153 ? 31.567 28.574 66.760  1.00 33.37 ? 153  GLN D O   1 
ATOM   5027  C  CB  . GLN D  1 153 ? 31.467 26.995 64.305  1.00 35.32 ? 153  GLN D CB  1 
ATOM   5028  C  CG  . GLN D  1 153 ? 32.037 26.218 63.135  1.00 36.29 ? 153  GLN D CG  1 
ATOM   5029  C  CD  . GLN D  1 153 ? 33.545 26.233 63.132  1.00 38.64 ? 153  GLN D CD  1 
ATOM   5030  O  OE1 . GLN D  1 153 ? 34.161 27.291 63.269  1.00 41.60 ? 153  GLN D OE1 1 
ATOM   5031  N  NE2 . GLN D  1 153 ? 34.154 25.062 62.973  1.00 37.45 ? 153  GLN D NE2 1 
ATOM   5032  N  N   . MET D  1 154 ? 30.490 26.823 67.648  1.00 38.49 ? 154  MET D N   1 
ATOM   5033  C  CA  . MET D  1 154 ? 29.859 27.613 68.696  1.00 45.01 ? 154  MET D CA  1 
ATOM   5034  C  C   . MET D  1 154 ? 30.823 28.157 69.729  1.00 51.46 ? 154  MET D C   1 
ATOM   5035  O  O   . MET D  1 154 ? 30.968 29.373 69.858  1.00 54.50 ? 154  MET D O   1 
ATOM   5036  C  CB  . MET D  1 154 ? 28.777 26.797 69.397  1.00 42.03 ? 154  MET D CB  1 
ATOM   5037  C  CG  . MET D  1 154 ? 27.464 26.754 68.649  1.00 40.12 ? 154  MET D CG  1 
ATOM   5038  S  SD  . MET D  1 154 ? 26.382 25.515 69.348  1.00 39.29 ? 154  MET D SD  1 
ATOM   5039  C  CE  . MET D  1 154 ? 26.208 26.151 71.021  1.00 43.43 ? 154  MET D CE  1 
ATOM   5040  N  N   . ASP D  1 155 ? 31.471 27.263 70.470  1.00 57.92 ? 155  ASP D N   1 
ATOM   5041  C  CA  . ASP D  1 155 ? 32.419 27.679 71.502  1.00 64.86 ? 155  ASP D CA  1 
ATOM   5042  C  C   . ASP D  1 155 ? 33.864 27.568 71.021  1.00 67.53 ? 155  ASP D C   1 
ATOM   5043  O  O   . ASP D  1 155 ? 34.086 26.932 69.963  1.00 68.31 ? 155  ASP D O   1 
ATOM   5044  C  CB  . ASP D  1 155 ? 32.222 26.838 72.774  1.00 68.39 ? 155  ASP D CB  1 
ATOM   5045  C  CG  . ASP D  1 155 ? 30.903 27.140 73.481  1.00 72.70 ? 155  ASP D CG  1 
ATOM   5046  O  OD1 . ASP D  1 155 ? 30.729 28.290 73.950  1.00 73.75 ? 155  ASP D OD1 1 
ATOM   5047  O  OD2 . ASP D  1 155 ? 30.041 26.233 73.566  1.00 72.39 ? 155  ASP D OD2 1 
ATOM   5048  O  OXT . ASP D  1 155 ? 34.757 28.115 71.711  1.00 69.90 ? 155  ASP D OXT 1 
ATOM   5049  N  N   . MET E  1 1   ? 42.379 79.002 121.758 1.00 46.04 ? 1    MET E N   1 
ATOM   5050  C  CA  . MET E  1 1   ? 43.187 80.103 122.352 1.00 47.79 ? 1    MET E CA  1 
ATOM   5051  C  C   . MET E  1 1   ? 42.858 81.426 121.656 1.00 47.66 ? 1    MET E C   1 
ATOM   5052  O  O   . MET E  1 1   ? 43.046 81.571 120.446 1.00 49.07 ? 1    MET E O   1 
ATOM   5053  C  CB  . MET E  1 1   ? 44.673 79.774 122.207 1.00 49.46 ? 1    MET E CB  1 
ATOM   5054  C  CG  . MET E  1 1   ? 45.586 80.633 123.060 1.00 54.17 ? 1    MET E CG  1 
ATOM   5055  S  SD  . MET E  1 1   ? 47.302 80.077 122.976 1.00 60.69 ? 1    MET E SD  1 
ATOM   5056  C  CE  . MET E  1 1   ? 47.973 81.158 121.665 1.00 60.35 ? 1    MET E CE  1 
ATOM   5057  N  N   . LYS E  1 2   ? 42.361 82.394 122.416 1.00 46.85 ? 2    LYS E N   1 
ATOM   5058  C  CA  . LYS E  1 2   ? 42.000 83.683 121.835 1.00 46.11 ? 2    LYS E CA  1 
ATOM   5059  C  C   . LYS E  1 2   ? 43.231 84.456 121.379 1.00 43.36 ? 2    LYS E C   1 
ATOM   5060  O  O   . LYS E  1 2   ? 44.094 84.792 122.185 1.00 42.38 ? 2    LYS E O   1 
ATOM   5061  C  CB  . LYS E  1 2   ? 41.209 84.517 122.846 1.00 47.39 ? 2    LYS E CB  1 
ATOM   5062  C  CG  . LYS E  1 2   ? 40.353 85.603 122.205 1.00 51.38 ? 2    LYS E CG  1 
ATOM   5063  C  CD  . LYS E  1 2   ? 39.323 86.143 123.192 1.00 54.65 ? 2    LYS E CD  1 
ATOM   5064  C  CE  . LYS E  1 2   ? 38.292 87.030 122.501 1.00 57.78 ? 2    LYS E CE  1 
ATOM   5065  N  NZ  . LYS E  1 2   ? 37.271 87.579 123.448 1.00 58.96 ? 2    LYS E NZ  1 
ATOM   5066  N  N   . GLY E  1 3   ? 43.304 84.739 120.082 1.00 41.36 ? 3    GLY E N   1 
ATOM   5067  C  CA  . GLY E  1 3   ? 44.438 85.473 119.550 1.00 39.68 ? 3    GLY E CA  1 
ATOM   5068  C  C   . GLY E  1 3   ? 44.175 86.961 119.401 1.00 39.46 ? 3    GLY E C   1 
ATOM   5069  O  O   . GLY E  1 3   ? 43.091 87.447 119.724 1.00 37.99 ? 3    GLY E O   1 
ATOM   5070  N  N   . ASP E  1 4   ? 45.174 87.684 118.907 1.00 39.63 ? 4    ASP E N   1 
ATOM   5071  C  CA  . ASP E  1 4   ? 45.063 89.123 118.711 1.00 41.41 ? 4    ASP E CA  1 
ATOM   5072  C  C   . ASP E  1 4   ? 44.032 89.415 117.625 1.00 41.17 ? 4    ASP E C   1 
ATOM   5073  O  O   . ASP E  1 4   ? 44.061 88.812 116.555 1.00 42.09 ? 4    ASP E O   1 
ATOM   5074  C  CB  . ASP E  1 4   ? 46.414 89.690 118.292 1.00 47.49 ? 4    ASP E CB  1 
ATOM   5075  C  CG  . ASP E  1 4   ? 46.597 91.129 118.718 1.00 54.48 ? 4    ASP E CG  1 
ATOM   5076  O  OD1 . ASP E  1 4   ? 47.069 91.346 119.859 1.00 56.30 ? 4    ASP E OD1 1 
ATOM   5077  O  OD2 . ASP E  1 4   ? 46.261 92.037 117.918 1.00 58.00 ? 4    ASP E OD2 1 
ATOM   5078  N  N   . LYS E  1 5   ? 43.126 90.347 117.899 1.00 40.96 ? 5    LYS E N   1 
ATOM   5079  C  CA  . LYS E  1 5   ? 42.079 90.704 116.949 1.00 40.25 ? 5    LYS E CA  1 
ATOM   5080  C  C   . LYS E  1 5   ? 42.650 91.289 115.661 1.00 39.87 ? 5    LYS E C   1 
ATOM   5081  O  O   . LYS E  1 5   ? 42.127 91.043 114.573 1.00 39.35 ? 5    LYS E O   1 
ATOM   5082  C  CB  . LYS E  1 5   ? 41.115 91.707 117.582 1.00 42.29 ? 5    LYS E CB  1 
ATOM   5083  C  CG  . LYS E  1 5   ? 39.939 92.084 116.690 1.00 47.72 ? 5    LYS E CG  1 
ATOM   5084  C  CD  . LYS E  1 5   ? 39.093 93.186 117.317 1.00 49.41 ? 5    LYS E CD  1 
ATOM   5085  C  CE  . LYS E  1 5   ? 38.050 93.715 116.342 1.00 49.07 ? 5    LYS E CE  1 
ATOM   5086  N  NZ  . LYS E  1 5   ? 37.360 94.917 116.901 1.00 46.94 ? 5    LYS E NZ  1 
ATOM   5087  N  N   . ILE E  1 6   ? 43.720 92.065 115.778 1.00 39.05 ? 6    ILE E N   1 
ATOM   5088  C  CA  . ILE E  1 6   ? 44.331 92.659 114.597 1.00 37.69 ? 6    ILE E CA  1 
ATOM   5089  C  C   . ILE E  1 6   ? 45.107 91.619 113.790 1.00 34.67 ? 6    ILE E C   1 
ATOM   5090  O  O   . ILE E  1 6   ? 45.183 91.716 112.567 1.00 33.27 ? 6    ILE E O   1 
ATOM   5091  C  CB  . ILE E  1 6   ? 45.265 93.817 114.980 1.00 38.82 ? 6    ILE E CB  1 
ATOM   5092  C  CG1 . ILE E  1 6   ? 44.459 94.923 115.664 1.00 42.05 ? 6    ILE E CG1 1 
ATOM   5093  C  CG2 . ILE E  1 6   ? 45.930 94.378 113.745 1.00 37.59 ? 6    ILE E CG2 1 
ATOM   5094  C  CD1 . ILE E  1 6   ? 45.315 96.075 116.165 1.00 47.59 ? 6    ILE E CD1 1 
ATOM   5095  N  N   . VAL E  1 7   ? 45.673 90.628 114.476 1.00 33.04 ? 7    VAL E N   1 
ATOM   5096  C  CA  . VAL E  1 7   ? 46.420 89.556 113.818 1.00 32.31 ? 7    VAL E CA  1 
ATOM   5097  C  C   . VAL E  1 7   ? 45.449 88.730 112.968 1.00 34.22 ? 7    VAL E C   1 
ATOM   5098  O  O   . VAL E  1 7   ? 45.746 88.368 111.819 1.00 33.47 ? 7    VAL E O   1 
ATOM   5099  C  CB  . VAL E  1 7   ? 47.090 88.607 114.850 1.00 32.41 ? 7    VAL E CB  1 
ATOM   5100  C  CG1 . VAL E  1 7   ? 47.554 87.328 114.156 1.00 31.56 ? 7    VAL E CG1 1 
ATOM   5101  C  CG2 . VAL E  1 7   ? 48.275 89.296 115.514 1.00 28.44 ? 7    VAL E CG2 1 
ATOM   5102  N  N   . ILE E  1 8   ? 44.289 88.434 113.546 1.00 31.30 ? 8    ILE E N   1 
ATOM   5103  C  CA  . ILE E  1 8   ? 43.271 87.664 112.856 1.00 31.92 ? 8    ILE E CA  1 
ATOM   5104  C  C   . ILE E  1 8   ? 42.739 88.458 111.667 1.00 34.60 ? 8    ILE E C   1 
ATOM   5105  O  O   . ILE E  1 8   ? 42.458 87.899 110.604 1.00 34.21 ? 8    ILE E O   1 
ATOM   5106  C  CB  . ILE E  1 8   ? 42.131 87.307 113.821 1.00 30.73 ? 8    ILE E CB  1 
ATOM   5107  C  CG1 . ILE E  1 8   ? 42.636 86.270 114.830 1.00 34.64 ? 8    ILE E CG1 1 
ATOM   5108  C  CG2 . ILE E  1 8   ? 40.948 86.757 113.064 1.00 30.65 ? 8    ILE E CG2 1 
ATOM   5109  C  CD1 . ILE E  1 8   ? 41.638 85.922 115.918 1.00 35.41 ? 8    ILE E CD1 1 
ATOM   5110  N  N   . GLN E  1 9   ? 42.600 89.767 111.850 1.00 37.32 ? 9    GLN E N   1 
ATOM   5111  C  CA  . GLN E  1 9   ? 42.127 90.629 110.780 1.00 37.63 ? 9    GLN E CA  1 
ATOM   5112  C  C   . GLN E  1 9   ? 43.134 90.555 109.643 1.00 37.23 ? 9    GLN E C   1 
ATOM   5113  O  O   . GLN E  1 9   ? 42.754 90.433 108.484 1.00 37.30 ? 9    GLN E O   1 
ATOM   5114  C  CB  . GLN E  1 9   ? 41.991 92.066 111.276 1.00 40.19 ? 9    GLN E CB  1 
ATOM   5115  C  CG  . GLN E  1 9   ? 40.711 92.321 112.049 1.00 46.49 ? 9    GLN E CG  1 
ATOM   5116  C  CD  . GLN E  1 9   ? 40.648 93.725 112.634 1.00 50.82 ? 9    GLN E CD  1 
ATOM   5117  O  OE1 . GLN E  1 9   ? 41.097 94.689 112.013 1.00 48.97 ? 9    GLN E OE1 1 
ATOM   5118  N  NE2 . GLN E  1 9   ? 40.073 93.846 113.831 1.00 54.12 ? 9    GLN E NE2 1 
ATOM   5119  N  N   . HIS E  1 10  ? 44.419 90.629 109.979 1.00 37.44 ? 10   HIS E N   1 
ATOM   5120  C  CA  . HIS E  1 10  ? 45.480 90.540 108.977 1.00 38.10 ? 10   HIS E CA  1 
ATOM   5121  C  C   . HIS E  1 10  ? 45.355 89.193 108.258 1.00 36.96 ? 10   HIS E C   1 
ATOM   5122  O  O   . HIS E  1 10  ? 45.227 89.137 107.033 1.00 35.40 ? 10   HIS E O   1 
ATOM   5123  C  CB  . HIS E  1 10  ? 46.851 90.632 109.648 1.00 40.25 ? 10   HIS E CB  1 
ATOM   5124  C  CG  . HIS E  1 10  ? 47.382 92.026 109.770 1.00 45.10 ? 10   HIS E CG  1 
ATOM   5125  N  ND1 . HIS E  1 10  ? 47.903 92.720 108.698 1.00 47.58 ? 10   HIS E ND1 1 
ATOM   5126  C  CD2 . HIS E  1 10  ? 47.515 92.840 110.845 1.00 45.70 ? 10   HIS E CD2 1 
ATOM   5127  C  CE1 . HIS E  1 10  ? 48.338 93.899 109.108 1.00 48.56 ? 10   HIS E CE1 1 
ATOM   5128  N  NE2 . HIS E  1 10  ? 48.114 93.997 110.407 1.00 48.05 ? 10   HIS E NE2 1 
ATOM   5129  N  N   . LEU E  1 11  ? 45.400 88.116 109.041 1.00 34.55 ? 11   LEU E N   1 
ATOM   5130  C  CA  . LEU E  1 11  ? 45.268 86.757 108.534 1.00 30.15 ? 11   LEU E CA  1 
ATOM   5131  C  C   . LEU E  1 11  ? 44.077 86.631 107.581 1.00 30.05 ? 11   LEU E C   1 
ATOM   5132  O  O   . LEU E  1 11  ? 44.209 86.113 106.470 1.00 29.67 ? 11   LEU E O   1 
ATOM   5133  C  CB  . LEU E  1 11  ? 45.087 85.795 109.709 1.00 28.29 ? 11   LEU E CB  1 
ATOM   5134  C  CG  . LEU E  1 11  ? 46.258 84.916 110.146 1.00 28.18 ? 11   LEU E CG  1 
ATOM   5135  C  CD1 . LEU E  1 11  ? 47.553 85.656 110.037 1.00 24.98 ? 11   LEU E CD1 1 
ATOM   5136  C  CD2 . LEU E  1 11  ? 46.016 84.447 111.573 1.00 30.97 ? 11   LEU E CD2 1 
ATOM   5137  N  N   . ASN E  1 12  ? 42.912 87.103 108.018 1.00 31.03 ? 12   ASN E N   1 
ATOM   5138  C  CA  . ASN E  1 12  ? 41.705 87.035 107.192 1.00 32.66 ? 12   ASN E CA  1 
ATOM   5139  C  C   . ASN E  1 12  ? 41.867 87.741 105.841 1.00 35.46 ? 12   ASN E C   1 
ATOM   5140  O  O   . ASN E  1 12  ? 41.350 87.281 104.819 1.00 34.55 ? 12   ASN E O   1 
ATOM   5141  C  CB  . ASN E  1 12  ? 40.521 87.634 107.941 1.00 30.22 ? 12   ASN E CB  1 
ATOM   5142  C  CG  . ASN E  1 12  ? 39.452 86.599 108.261 1.00 36.56 ? 12   ASN E CG  1 
ATOM   5143  O  OD1 . ASN E  1 12  ? 39.106 85.765 107.413 1.00 42.56 ? 12   ASN E OD1 1 
ATOM   5144  N  ND2 . ASN E  1 12  ? 38.913 86.651 109.479 1.00 33.35 ? 12   ASN E ND2 1 
ATOM   5145  N  N   . LYS E  1 13  ? 42.584 88.860 105.843 1.00 36.94 ? 13   LYS E N   1 
ATOM   5146  C  CA  . LYS E  1 13  ? 42.822 89.610 104.622 1.00 37.68 ? 13   LYS E CA  1 
ATOM   5147  C  C   . LYS E  1 13  ? 43.684 88.796 103.677 1.00 37.35 ? 13   LYS E C   1 
ATOM   5148  O  O   . LYS E  1 13  ? 43.376 88.662 102.493 1.00 36.84 ? 13   LYS E O   1 
ATOM   5149  C  CB  . LYS E  1 13  ? 43.530 90.929 104.926 1.00 41.91 ? 13   LYS E CB  1 
ATOM   5150  C  CG  . LYS E  1 13  ? 43.941 91.668 103.662 1.00 47.99 ? 13   LYS E CG  1 
ATOM   5151  C  CD  . LYS E  1 13  ? 44.492 93.038 103.957 1.00 49.88 ? 13   LYS E CD  1 
ATOM   5152  C  CE  . LYS E  1 13  ? 44.741 93.789 102.671 1.00 50.76 ? 13   LYS E CE  1 
ATOM   5153  N  NZ  . LYS E  1 13  ? 45.354 95.111 102.972 1.00 56.92 ? 13   LYS E NZ  1 
ATOM   5154  N  N   . ILE E  1 14  ? 44.778 88.262 104.205 1.00 37.58 ? 14   ILE E N   1 
ATOM   5155  C  CA  . ILE E  1 14  ? 45.684 87.455 103.404 1.00 36.62 ? 14   ILE E CA  1 
ATOM   5156  C  C   . ILE E  1 14  ? 44.922 86.265 102.835 1.00 35.77 ? 14   ILE E C   1 
ATOM   5157  O  O   . ILE E  1 14  ? 45.205 85.804 101.729 1.00 35.76 ? 14   ILE E O   1 
ATOM   5158  C  CB  . ILE E  1 14  ? 46.898 86.974 104.243 1.00 35.75 ? 14   ILE E CB  1 
ATOM   5159  C  CG1 . ILE E  1 14  ? 47.774 88.176 104.598 1.00 32.05 ? 14   ILE E CG1 1 
ATOM   5160  C  CG2 . ILE E  1 14  ? 47.716 85.954 103.460 1.00 36.63 ? 14   ILE E CG2 1 
ATOM   5161  C  CD1 . ILE E  1 14  ? 49.102 87.805 105.192 1.00 37.09 ? 14   ILE E CD1 1 
ATOM   5162  N  N   . LEU E  1 15  ? 43.939 85.784 103.591 1.00 35.42 ? 15   LEU E N   1 
ATOM   5163  C  CA  . LEU E  1 15  ? 43.120 84.662 103.153 1.00 33.85 ? 15   LEU E CA  1 
ATOM   5164  C  C   . LEU E  1 15  ? 42.377 85.050 101.871 1.00 34.64 ? 15   LEU E C   1 
ATOM   5165  O  O   . LEU E  1 15  ? 42.310 84.279 100.912 1.00 33.31 ? 15   LEU E O   1 
ATOM   5166  C  CB  . LEU E  1 15  ? 42.124 84.291 104.248 1.00 30.73 ? 15   LEU E CB  1 
ATOM   5167  C  CG  . LEU E  1 15  ? 41.175 83.137 103.930 1.00 31.31 ? 15   LEU E CG  1 
ATOM   5168  C  CD1 . LEU E  1 15  ? 41.963 81.933 103.451 1.00 30.02 ? 15   LEU E CD1 1 
ATOM   5169  C  CD2 . LEU E  1 15  ? 40.368 82.790 105.170 1.00 30.74 ? 15   LEU E CD2 1 
ATOM   5170  N  N   . GLY E  1 16  ? 41.821 86.254 101.859 1.00 35.15 ? 16   GLY E N   1 
ATOM   5171  C  CA  . GLY E  1 16  ? 41.114 86.713 100.680 1.00 37.22 ? 16   GLY E CA  1 
ATOM   5172  C  C   . GLY E  1 16  ? 42.044 86.703 99.478  1.00 38.51 ? 16   GLY E C   1 
ATOM   5173  O  O   . GLY E  1 16  ? 41.662 86.235 98.402  1.00 38.89 ? 16   GLY E O   1 
ATOM   5174  N  N   . ASN E  1 17  ? 43.262 87.217 99.661  1.00 37.74 ? 17   ASN E N   1 
ATOM   5175  C  CA  . ASN E  1 17  ? 44.262 87.258 98.588  1.00 38.41 ? 17   ASN E CA  1 
ATOM   5176  C  C   . ASN E  1 17  ? 44.439 85.871 97.969  1.00 38.42 ? 17   ASN E C   1 
ATOM   5177  O  O   . ASN E  1 17  ? 44.303 85.699 96.756  1.00 35.60 ? 17   ASN E O   1 
ATOM   5178  C  CB  . ASN E  1 17  ? 45.632 87.739 99.115  1.00 35.70 ? 17   ASN E CB  1 
ATOM   5179  C  CG  . ASN E  1 17  ? 45.696 89.252 99.342  1.00 36.54 ? 17   ASN E CG  1 
ATOM   5180  O  OD1 . ASN E  1 17  ? 46.691 89.768 99.860  1.00 32.63 ? 17   ASN E OD1 1 
ATOM   5181  N  ND2 . ASN E  1 17  ? 44.639 89.966 98.952  1.00 37.61 ? 17   ASN E ND2 1 
ATOM   5182  N  N   . GLU E  1 18  ? 44.733 84.885 98.814  1.00 39.70 ? 18   GLU E N   1 
ATOM   5183  C  CA  . GLU E  1 18  ? 44.953 83.522 98.342  1.00 40.87 ? 18   GLU E CA  1 
ATOM   5184  C  C   . GLU E  1 18  ? 43.763 83.013 97.541  1.00 39.59 ? 18   GLU E C   1 
ATOM   5185  O  O   . GLU E  1 18  ? 43.922 82.495 96.435  1.00 40.02 ? 18   GLU E O   1 
ATOM   5186  C  CB  . GLU E  1 18  ? 45.212 82.582 99.530  1.00 40.06 ? 18   GLU E CB  1 
ATOM   5187  C  CG  . GLU E  1 18  ? 46.372 83.008 100.421 1.00 41.30 ? 18   GLU E CG  1 
ATOM   5188  C  CD  . GLU E  1 18  ? 47.723 82.905 99.735  1.00 42.42 ? 18   GLU E CD  1 
ATOM   5189  O  OE1 . GLU E  1 18  ? 48.642 83.655 100.132 1.00 39.12 ? 18   GLU E OE1 1 
ATOM   5190  O  OE2 . GLU E  1 18  ? 47.872 82.072 98.810  1.00 44.99 ? 18   GLU E OE2 1 
ATOM   5191  N  N   . LEU E  1 19  ? 42.570 83.143 98.108  1.00 40.14 ? 19   LEU E N   1 
ATOM   5192  C  CA  . LEU E  1 19  ? 41.360 82.684 97.439  1.00 39.34 ? 19   LEU E CA  1 
ATOM   5193  C  C   . LEU E  1 19  ? 41.295 83.234 96.013  1.00 39.56 ? 19   LEU E C   1 
ATOM   5194  O  O   . LEU E  1 19  ? 40.884 82.528 95.087  1.00 40.18 ? 19   LEU E O   1 
ATOM   5195  C  CB  . LEU E  1 19  ? 40.131 83.104 98.249  1.00 37.40 ? 19   LEU E CB  1 
ATOM   5196  C  CG  . LEU E  1 19  ? 40.082 82.466 99.646  1.00 35.32 ? 19   LEU E CG  1 
ATOM   5197  C  CD1 . LEU E  1 19  ? 38.938 83.055 100.444 1.00 35.83 ? 19   LEU E CD1 1 
ATOM   5198  C  CD2 . LEU E  1 19  ? 39.927 80.962 99.522  1.00 31.51 ? 19   LEU E CD2 1 
ATOM   5199  N  N   . ILE E  1 20  ? 41.712 84.487 95.841  1.00 37.04 ? 20   ILE E N   1 
ATOM   5200  C  CA  . ILE E  1 20  ? 41.735 85.124 94.527  1.00 36.05 ? 20   ILE E CA  1 
ATOM   5201  C  C   . ILE E  1 20  ? 42.715 84.350 93.629  1.00 34.41 ? 20   ILE E C   1 
ATOM   5202  O  O   . ILE E  1 20  ? 42.385 83.956 92.515  1.00 34.94 ? 20   ILE E O   1 
ATOM   5203  C  CB  . ILE E  1 20  ? 42.197 86.610 94.644  1.00 37.25 ? 20   ILE E CB  1 
ATOM   5204  C  CG1 . ILE E  1 20  ? 41.179 87.400 95.467  1.00 37.74 ? 20   ILE E CG1 1 
ATOM   5205  C  CG2 . ILE E  1 20  ? 42.367 87.240 93.260  1.00 35.28 ? 20   ILE E CG2 1 
ATOM   5206  C  CD1 . ILE E  1 20  ? 41.586 88.834 95.740  1.00 38.96 ? 20   ILE E CD1 1 
ATOM   5207  N  N   . ALA E  1 21  ? 43.920 84.128 94.138  1.00 32.86 ? 21   ALA E N   1 
ATOM   5208  C  CA  . ALA E  1 21  ? 44.950 83.407 93.408  1.00 32.29 ? 21   ALA E CA  1 
ATOM   5209  C  C   . ALA E  1 21  ? 44.455 82.044 92.944  1.00 32.36 ? 21   ALA E C   1 
ATOM   5210  O  O   . ALA E  1 21  ? 44.634 81.679 91.788  1.00 32.95 ? 21   ALA E O   1 
ATOM   5211  C  CB  . ALA E  1 21  ? 46.181 83.238 94.284  1.00 30.30 ? 21   ALA E CB  1 
ATOM   5212  N  N   . ILE E  1 22  ? 43.833 81.296 93.849  1.00 34.48 ? 22   ILE E N   1 
ATOM   5213  C  CA  . ILE E  1 22  ? 43.317 79.969 93.528  1.00 35.01 ? 22   ILE E CA  1 
ATOM   5214  C  C   . ILE E  1 22  ? 42.520 79.983 92.228  1.00 36.64 ? 22   ILE E C   1 
ATOM   5215  O  O   . ILE E  1 22  ? 42.831 79.242 91.287  1.00 35.73 ? 22   ILE E O   1 
ATOM   5216  C  CB  . ILE E  1 22  ? 42.384 79.443 94.640  1.00 35.49 ? 22   ILE E CB  1 
ATOM   5217  C  CG1 . ILE E  1 22  ? 43.126 79.406 95.967  1.00 33.08 ? 22   ILE E CG1 1 
ATOM   5218  C  CG2 . ILE E  1 22  ? 41.864 78.047 94.283  1.00 33.39 ? 22   ILE E CG2 1 
ATOM   5219  C  CD1 . ILE E  1 22  ? 42.223 79.077 97.134  1.00 37.61 ? 22   ILE E CD1 1 
ATOM   5220  N  N   . ASN E  1 23  ? 41.494 80.832 92.190  1.00 35.54 ? 23   ASN E N   1 
ATOM   5221  C  CA  . ASN E  1 23  ? 40.620 80.948 91.029  1.00 37.83 ? 23   ASN E CA  1 
ATOM   5222  C  C   . ASN E  1 23  ? 41.344 81.430 89.780  1.00 38.27 ? 23   ASN E C   1 
ATOM   5223  O  O   . ASN E  1 23  ? 41.191 80.853 88.699  1.00 39.16 ? 23   ASN E O   1 
ATOM   5224  C  CB  . ASN E  1 23  ? 39.456 81.889 91.352  1.00 40.49 ? 23   ASN E CB  1 
ATOM   5225  C  CG  . ASN E  1 23  ? 38.572 81.356 92.471  1.00 42.67 ? 23   ASN E CG  1 
ATOM   5226  O  OD1 . ASN E  1 23  ? 39.066 80.799 93.453  1.00 42.51 ? 23   ASN E OD1 1 
ATOM   5227  N  ND2 . ASN E  1 23  ? 37.264 81.538 92.335  1.00 40.80 ? 23   ASN E ND2 1 
ATOM   5228  N  N   . GLN E  1 24  ? 42.137 82.486 89.927  1.00 38.06 ? 24   GLN E N   1 
ATOM   5229  C  CA  . GLN E  1 24  ? 42.866 83.040 88.796  1.00 35.42 ? 24   GLN E CA  1 
ATOM   5230  C  C   . GLN E  1 24  ? 43.793 82.006 88.165  1.00 36.61 ? 24   GLN E C   1 
ATOM   5231  O  O   . GLN E  1 24  ? 43.800 81.827 86.945  1.00 37.26 ? 24   GLN E O   1 
ATOM   5232  C  CB  . GLN E  1 24  ? 43.668 84.261 89.240  1.00 33.60 ? 24   GLN E CB  1 
ATOM   5233  C  CG  . GLN E  1 24  ? 44.539 84.857 88.147  1.00 33.98 ? 24   GLN E CG  1 
ATOM   5234  C  CD  . GLN E  1 24  ? 45.013 86.254 88.471  1.00 29.86 ? 24   GLN E CD  1 
ATOM   5235  O  OE1 . GLN E  1 24  ? 46.105 86.659 88.071  1.00 26.26 ? 24   GLN E OE1 1 
ATOM   5236  N  NE2 . GLN E  1 24  ? 44.184 87.009 89.190  1.00 29.80 ? 24   GLN E NE2 1 
ATOM   5237  N  N   . TYR E  1 25  ? 44.569 81.319 88.996  1.00 36.54 ? 25   TYR E N   1 
ATOM   5238  C  CA  . TYR E  1 25  ? 45.498 80.314 88.494  1.00 36.57 ? 25   TYR E CA  1 
ATOM   5239  C  C   . TYR E  1 25  ? 44.771 79.098 87.928  1.00 35.89 ? 25   TYR E C   1 
ATOM   5240  O  O   . TYR E  1 25  ? 45.232 78.486 86.958  1.00 32.63 ? 25   TYR E O   1 
ATOM   5241  C  CB  . TYR E  1 25  ? 46.467 79.884 89.605  1.00 35.65 ? 25   TYR E CB  1 
ATOM   5242  C  CG  . TYR E  1 25  ? 47.323 81.022 90.129  1.00 38.57 ? 25   TYR E CG  1 
ATOM   5243  C  CD1 . TYR E  1 25  ? 48.253 80.821 91.162  1.00 39.65 ? 25   TYR E CD1 1 
ATOM   5244  C  CD2 . TYR E  1 25  ? 47.181 82.312 89.612  1.00 42.46 ? 25   TYR E CD2 1 
ATOM   5245  C  CE1 . TYR E  1 25  ? 49.013 81.882 91.662  1.00 41.86 ? 25   TYR E CE1 1 
ATOM   5246  C  CE2 . TYR E  1 25  ? 47.926 83.375 90.103  1.00 44.43 ? 25   TYR E CE2 1 
ATOM   5247  C  CZ  . TYR E  1 25  ? 48.835 83.159 91.122  1.00 45.02 ? 25   TYR E CZ  1 
ATOM   5248  O  OH  . TYR E  1 25  ? 49.539 84.241 91.592  1.00 47.93 ? 25   TYR E OH  1 
ATOM   5249  N  N   . PHE E  1 26  ? 43.627 78.759 88.516  1.00 34.12 ? 26   PHE E N   1 
ATOM   5250  C  CA  . PHE E  1 26  ? 42.890 77.605 88.038  1.00 33.50 ? 26   PHE E CA  1 
ATOM   5251  C  C   . PHE E  1 26  ? 42.318 77.867 86.653  1.00 34.75 ? 26   PHE E C   1 
ATOM   5252  O  O   . PHE E  1 26  ? 42.343 76.991 85.777  1.00 34.38 ? 26   PHE E O   1 
ATOM   5253  C  CB  . PHE E  1 26  ? 41.755 77.235 88.985  1.00 31.36 ? 26   PHE E CB  1 
ATOM   5254  C  CG  . PHE E  1 26  ? 41.326 75.812 88.846  1.00 35.31 ? 26   PHE E CG  1 
ATOM   5255  C  CD1 . PHE E  1 26  ? 41.958 74.810 89.582  1.00 39.02 ? 26   PHE E CD1 1 
ATOM   5256  C  CD2 . PHE E  1 26  ? 40.364 75.452 87.909  1.00 34.73 ? 26   PHE E CD2 1 
ATOM   5257  C  CE1 . PHE E  1 26  ? 41.638 73.455 89.380  1.00 42.61 ? 26   PHE E CE1 1 
ATOM   5258  C  CE2 . PHE E  1 26  ? 40.035 74.104 87.697  1.00 39.45 ? 26   PHE E CE2 1 
ATOM   5259  C  CZ  . PHE E  1 26  ? 40.673 73.101 88.433  1.00 39.00 ? 26   PHE E CZ  1 
ATOM   5260  N  N   . LEU E  1 27  ? 41.793 79.070 86.453  1.00 32.86 ? 27   LEU E N   1 
ATOM   5261  C  CA  . LEU E  1 27  ? 41.237 79.411 85.159  1.00 32.85 ? 27   LEU E CA  1 
ATOM   5262  C  C   . LEU E  1 27  ? 42.383 79.414 84.149  1.00 35.51 ? 27   LEU E C   1 
ATOM   5263  O  O   . LEU E  1 27  ? 42.290 78.793 83.086  1.00 37.44 ? 27   LEU E O   1 
ATOM   5264  C  CB  . LEU E  1 27  ? 40.578 80.785 85.207  1.00 31.50 ? 27   LEU E CB  1 
ATOM   5265  C  CG  . LEU E  1 27  ? 39.940 81.222 83.886  1.00 29.37 ? 27   LEU E CG  1 
ATOM   5266  C  CD1 . LEU E  1 27  ? 38.855 80.231 83.475  1.00 25.10 ? 27   LEU E CD1 1 
ATOM   5267  C  CD2 . LEU E  1 27  ? 39.373 82.613 84.048  1.00 27.71 ? 27   LEU E CD2 1 
ATOM   5268  N  N   . HIS E  1 28  ? 43.465 80.112 84.486  1.00 33.94 ? 28   HIS E N   1 
ATOM   5269  C  CA  . HIS E  1 28  ? 44.622 80.169 83.604  1.00 33.69 ? 28   HIS E CA  1 
ATOM   5270  C  C   . HIS E  1 28  ? 45.085 78.740 83.284  1.00 33.66 ? 28   HIS E C   1 
ATOM   5271  O  O   . HIS E  1 28  ? 45.455 78.424 82.147  1.00 33.89 ? 28   HIS E O   1 
ATOM   5272  C  CB  . HIS E  1 28  ? 45.777 80.950 84.266  1.00 31.99 ? 28   HIS E CB  1 
ATOM   5273  C  CG  . HIS E  1 28  ? 45.575 82.436 84.310  1.00 28.84 ? 28   HIS E CG  1 
ATOM   5274  N  ND1 . HIS E  1 28  ? 44.544 83.073 83.652  1.00 28.27 ? 28   HIS E ND1 1 
ATOM   5275  C  CD2 . HIS E  1 28  ? 46.296 83.413 84.914  1.00 26.91 ? 28   HIS E CD2 1 
ATOM   5276  C  CE1 . HIS E  1 28  ? 44.639 84.377 83.847  1.00 27.11 ? 28   HIS E CE1 1 
ATOM   5277  N  NE2 . HIS E  1 28  ? 45.694 84.609 84.610  1.00 26.99 ? 28   HIS E NE2 1 
ATOM   5278  N  N   . ALA E  1 29  ? 45.065 77.879 84.296  1.00 33.04 ? 29   ALA E N   1 
ATOM   5279  C  CA  . ALA E  1 29  ? 45.491 76.501 84.116  1.00 31.73 ? 29   ALA E CA  1 
ATOM   5280  C  C   . ALA E  1 29  ? 44.635 75.808 83.072  1.00 30.91 ? 29   ALA E C   1 
ATOM   5281  O  O   . ALA E  1 29  ? 45.152 75.250 82.112  1.00 31.55 ? 29   ALA E O   1 
ATOM   5282  C  CB  . ALA E  1 29  ? 45.416 75.746 85.435  1.00 31.66 ? 29   ALA E CB  1 
ATOM   5283  N  N   . ARG E  1 30  ? 43.322 75.844 83.247  1.00 31.05 ? 30   ARG E N   1 
ATOM   5284  C  CA  . ARG E  1 30  ? 42.466 75.180 82.282  1.00 33.39 ? 30   ARG E CA  1 
ATOM   5285  C  C   . ARG E  1 30  ? 42.520 75.825 80.906  1.00 33.31 ? 30   ARG E C   1 
ATOM   5286  O  O   . ARG E  1 30  ? 42.255 75.164 79.907  1.00 33.31 ? 30   ARG E O   1 
ATOM   5287  C  CB  . ARG E  1 30  ? 41.024 75.112 82.789  1.00 34.12 ? 30   ARG E CB  1 
ATOM   5288  C  CG  . ARG E  1 30  ? 40.856 74.243 84.039  1.00 37.54 ? 30   ARG E CG  1 
ATOM   5289  C  CD  . ARG E  1 30  ? 41.828 73.066 84.058  1.00 39.38 ? 30   ARG E CD  1 
ATOM   5290  N  NE  . ARG E  1 30  ? 41.562 72.154 85.169  1.00 49.09 ? 30   ARG E NE  1 
ATOM   5291  C  CZ  . ARG E  1 30  ? 42.488 71.419 85.790  1.00 51.39 ? 30   ARG E CZ  1 
ATOM   5292  N  NH1 . ARG E  1 30  ? 43.763 71.486 85.419  1.00 50.63 ? 30   ARG E NH1 1 
ATOM   5293  N  NH2 . ARG E  1 30  ? 42.135 70.605 86.781  1.00 49.83 ? 30   ARG E NH2 1 
ATOM   5294  N  N   . MET E  1 31  ? 42.878 77.107 80.856  1.00 33.49 ? 31   MET E N   1 
ATOM   5295  C  CA  . MET E  1 31  ? 42.980 77.826 79.587  1.00 34.19 ? 31   MET E CA  1 
ATOM   5296  C  C   . MET E  1 31  ? 44.191 77.343 78.788  1.00 35.03 ? 31   MET E C   1 
ATOM   5297  O  O   . MET E  1 31  ? 44.089 77.084 77.582  1.00 33.63 ? 31   MET E O   1 
ATOM   5298  C  CB  . MET E  1 31  ? 43.092 79.330 79.835  1.00 35.43 ? 31   MET E CB  1 
ATOM   5299  C  CG  . MET E  1 31  ? 41.813 79.982 80.341  1.00 35.01 ? 31   MET E CG  1 
ATOM   5300  S  SD  . MET E  1 31  ? 42.058 81.760 80.585  1.00 40.21 ? 31   MET E SD  1 
ATOM   5301  C  CE  . MET E  1 31  ? 42.185 82.325 78.866  1.00 39.37 ? 31   MET E CE  1 
ATOM   5302  N  N   . TYR E  1 32  ? 45.335 77.240 79.464  1.00 33.86 ? 32   TYR E N   1 
ATOM   5303  C  CA  . TYR E  1 32  ? 46.563 76.755 78.842  1.00 34.40 ? 32   TYR E CA  1 
ATOM   5304  C  C   . TYR E  1 32  ? 46.293 75.328 78.376  1.00 36.25 ? 32   TYR E C   1 
ATOM   5305  O  O   . TYR E  1 32  ? 46.567 74.966 77.230  1.00 35.64 ? 32   TYR E O   1 
ATOM   5306  C  CB  . TYR E  1 32  ? 47.701 76.740 79.862  1.00 33.34 ? 32   TYR E CB  1 
ATOM   5307  C  CG  . TYR E  1 32  ? 48.237 78.105 80.230  1.00 34.44 ? 32   TYR E CG  1 
ATOM   5308  C  CD1 . TYR E  1 32  ? 48.515 78.430 81.556  1.00 34.70 ? 32   TYR E CD1 1 
ATOM   5309  C  CD2 . TYR E  1 32  ? 48.516 79.056 79.249  1.00 36.31 ? 32   TYR E CD2 1 
ATOM   5310  C  CE1 . TYR E  1 32  ? 49.062 79.667 81.895  1.00 33.53 ? 32   TYR E CE1 1 
ATOM   5311  C  CE2 . TYR E  1 32  ? 49.063 80.292 79.580  1.00 35.05 ? 32   TYR E CE2 1 
ATOM   5312  C  CZ  . TYR E  1 32  ? 49.336 80.587 80.902  1.00 33.01 ? 32   TYR E CZ  1 
ATOM   5313  O  OH  . TYR E  1 32  ? 49.901 81.796 81.230  1.00 35.95 ? 32   TYR E OH  1 
ATOM   5314  N  N   . GLU E  1 33  ? 45.761 74.524 79.291  1.00 38.30 ? 33   GLU E N   1 
ATOM   5315  C  CA  . GLU E  1 33  ? 45.419 73.137 79.015  1.00 40.29 ? 33   GLU E CA  1 
ATOM   5316  C  C   . GLU E  1 33  ? 44.547 73.129 77.752  1.00 41.08 ? 33   GLU E C   1 
ATOM   5317  O  O   . GLU E  1 33  ? 44.738 72.313 76.850  1.00 42.97 ? 33   GLU E O   1 
ATOM   5318  C  CB  . GLU E  1 33  ? 44.624 72.567 80.192  1.00 45.55 ? 33   GLU E CB  1 
ATOM   5319  C  CG  . GLU E  1 33  ? 45.163 71.279 80.818  1.00 52.66 ? 33   GLU E CG  1 
ATOM   5320  C  CD  . GLU E  1 33  ? 46.069 71.517 82.032  1.00 53.70 ? 33   GLU E CD  1 
ATOM   5321  O  OE1 . GLU E  1 33  ? 47.262 71.842 81.849  1.00 54.50 ? 33   GLU E OE1 1 
ATOM   5322  O  OE2 . GLU E  1 33  ? 45.581 71.377 83.174  1.00 53.78 ? 33   GLU E OE2 1 
ATOM   5323  N  N   . ASP E  1 34  ? 43.603 74.066 77.698  1.00 38.34 ? 34   ASP E N   1 
ATOM   5324  C  CA  . ASP E  1 34  ? 42.667 74.202 76.581  1.00 35.42 ? 34   ASP E CA  1 
ATOM   5325  C  C   . ASP E  1 34  ? 43.312 74.607 75.256  1.00 32.77 ? 34   ASP E C   1 
ATOM   5326  O  O   . ASP E  1 34  ? 42.762 74.328 74.191  1.00 31.30 ? 34   ASP E O   1 
ATOM   5327  C  CB  . ASP E  1 34  ? 41.584 75.224 76.946  1.00 39.34 ? 34   ASP E CB  1 
ATOM   5328  C  CG  . ASP E  1 34  ? 40.514 75.352 75.882  1.00 42.70 ? 34   ASP E CG  1 
ATOM   5329  O  OD1 . ASP E  1 34  ? 39.824 74.342 75.603  1.00 44.36 ? 34   ASP E OD1 1 
ATOM   5330  O  OD2 . ASP E  1 34  ? 40.358 76.468 75.330  1.00 44.04 ? 34   ASP E OD2 1 
ATOM   5331  N  N   . TRP E  1 35  ? 44.459 75.279 75.319  1.00 30.00 ? 35   TRP E N   1 
ATOM   5332  C  CA  . TRP E  1 35  ? 45.154 75.710 74.107  1.00 26.98 ? 35   TRP E CA  1 
ATOM   5333  C  C   . TRP E  1 35  ? 46.193 74.700 73.656  1.00 25.57 ? 35   TRP E C   1 
ATOM   5334  O  O   . TRP E  1 35  ? 46.854 74.905 72.638  1.00 25.71 ? 35   TRP E O   1 
ATOM   5335  C  CB  . TRP E  1 35  ? 45.864 77.062 74.307  1.00 25.58 ? 35   TRP E CB  1 
ATOM   5336  C  CG  . TRP E  1 35  ? 44.948 78.238 74.382  1.00 23.95 ? 35   TRP E CG  1 
ATOM   5337  C  CD1 . TRP E  1 35  ? 43.774 78.398 73.714  1.00 22.93 ? 35   TRP E CD1 1 
ATOM   5338  C  CD2 . TRP E  1 35  ? 45.142 79.434 75.152  1.00 21.37 ? 35   TRP E CD2 1 
ATOM   5339  N  NE1 . TRP E  1 35  ? 43.220 79.618 74.020  1.00 25.27 ? 35   TRP E NE1 1 
ATOM   5340  C  CE2 . TRP E  1 35  ? 44.039 80.275 74.899  1.00 20.50 ? 35   TRP E CE2 1 
ATOM   5341  C  CE3 . TRP E  1 35  ? 46.140 79.874 76.029  1.00 20.99 ? 35   TRP E CE3 1 
ATOM   5342  C  CZ2 . TRP E  1 35  ? 43.901 81.535 75.491  1.00 19.22 ? 35   TRP E CZ2 1 
ATOM   5343  C  CZ3 . TRP E  1 35  ? 46.005 81.131 76.619  1.00 21.68 ? 35   TRP E CZ3 1 
ATOM   5344  C  CH2 . TRP E  1 35  ? 44.891 81.946 76.346  1.00 20.66 ? 35   TRP E CH2 1 
ATOM   5345  N  N   . GLY E  1 36  ? 46.351 73.623 74.416  1.00 24.42 ? 36   GLY E N   1 
ATOM   5346  C  CA  . GLY E  1 36  ? 47.335 72.617 74.054  1.00 23.88 ? 36   GLY E CA  1 
ATOM   5347  C  C   . GLY E  1 36  ? 48.686 72.911 74.671  1.00 25.68 ? 36   GLY E C   1 
ATOM   5348  O  O   . GLY E  1 36  ? 49.687 72.255 74.368  1.00 26.85 ? 36   GLY E O   1 
ATOM   5349  N  N   . LEU E  1 37  ? 48.720 73.909 75.543  1.00 26.46 ? 37   LEU E N   1 
ATOM   5350  C  CA  . LEU E  1 37  ? 49.953 74.273 76.217  1.00 29.41 ? 37   LEU E CA  1 
ATOM   5351  C  C   . LEU E  1 37  ? 50.068 73.483 77.533  1.00 31.63 ? 37   LEU E C   1 
ATOM   5352  O  O   . LEU E  1 37  ? 49.931 74.040 78.630  1.00 30.25 ? 37   LEU E O   1 
ATOM   5353  C  CB  . LEU E  1 37  ? 49.967 75.786 76.461  1.00 25.35 ? 37   LEU E CB  1 
ATOM   5354  C  CG  . LEU E  1 37  ? 49.947 76.578 75.150  1.00 22.61 ? 37   LEU E CG  1 
ATOM   5355  C  CD1 . LEU E  1 37  ? 49.804 78.056 75.421  1.00 25.84 ? 37   LEU E CD1 1 
ATOM   5356  C  CD2 . LEU E  1 37  ? 51.225 76.305 74.383  1.00 19.44 ? 37   LEU E CD2 1 
ATOM   5357  N  N   . GLU E  1 38  ? 50.327 72.181 77.394  1.00 33.04 ? 38   GLU E N   1 
ATOM   5358  C  CA  . GLU E  1 38  ? 50.453 71.250 78.519  1.00 38.46 ? 38   GLU E CA  1 
ATOM   5359  C  C   . GLU E  1 38  ? 51.374 71.674 79.660  1.00 37.11 ? 38   GLU E C   1 
ATOM   5360  O  O   . GLU E  1 38  ? 50.951 71.731 80.810  1.00 38.93 ? 38   GLU E O   1 
ATOM   5361  C  CB  . GLU E  1 38  ? 50.911 69.877 78.021  1.00 43.75 ? 38   GLU E CB  1 
ATOM   5362  C  CG  . GLU E  1 38  ? 49.900 69.132 77.170  1.00 55.39 ? 38   GLU E CG  1 
ATOM   5363  C  CD  . GLU E  1 38  ? 50.393 67.744 76.775  1.00 63.89 ? 38   GLU E CD  1 
ATOM   5364  O  OE1 . GLU E  1 38  ? 51.520 67.642 76.231  1.00 65.49 ? 38   GLU E OE1 1 
ATOM   5365  O  OE2 . GLU E  1 38  ? 49.652 66.758 77.006  1.00 67.36 ? 38   GLU E OE2 1 
ATOM   5366  N  N   . LYS E  1 39  ? 52.637 71.941 79.354  1.00 35.89 ? 39   LYS E N   1 
ATOM   5367  C  CA  . LYS E  1 39  ? 53.582 72.348 80.390  1.00 36.89 ? 39   LYS E CA  1 
ATOM   5368  C  C   . LYS E  1 39  ? 53.072 73.504 81.254  1.00 34.63 ? 39   LYS E C   1 
ATOM   5369  O  O   . LYS E  1 39  ? 53.120 73.451 82.485  1.00 30.23 ? 39   LYS E O   1 
ATOM   5370  C  CB  . LYS E  1 39  ? 54.922 72.741 79.760  1.00 39.97 ? 39   LYS E CB  1 
ATOM   5371  C  CG  . LYS E  1 39  ? 55.752 71.561 79.294  1.00 46.25 ? 39   LYS E CG  1 
ATOM   5372  C  CD  . LYS E  1 39  ? 57.232 71.808 79.563  1.00 52.75 ? 39   LYS E CD  1 
ATOM   5373  C  CE  . LYS E  1 39  ? 58.046 70.539 79.343  1.00 59.14 ? 39   LYS E CE  1 
ATOM   5374  N  NZ  . LYS E  1 39  ? 59.455 70.673 79.819  1.00 60.70 ? 39   LYS E NZ  1 
ATOM   5375  N  N   . LEU E  1 40  ? 52.579 74.545 80.594  1.00 31.78 ? 40   LEU E N   1 
ATOM   5376  C  CA  . LEU E  1 40  ? 52.078 75.723 81.274  1.00 31.42 ? 40   LEU E CA  1 
ATOM   5377  C  C   . LEU E  1 40  ? 50.861 75.412 82.135  1.00 32.99 ? 40   LEU E C   1 
ATOM   5378  O  O   . LEU E  1 40  ? 50.755 75.855 83.284  1.00 32.26 ? 40   LEU E O   1 
ATOM   5379  C  CB  . LEU E  1 40  ? 51.720 76.774 80.233  1.00 29.49 ? 40   LEU E CB  1 
ATOM   5380  C  CG  . LEU E  1 40  ? 52.270 78.180 80.406  1.00 25.69 ? 40   LEU E CG  1 
ATOM   5381  C  CD1 . LEU E  1 40  ? 53.630 78.162 81.095  1.00 27.34 ? 40   LEU E CD1 1 
ATOM   5382  C  CD2 . LEU E  1 40  ? 52.360 78.797 79.029  1.00 25.12 ? 40   LEU E CD2 1 
ATOM   5383  N  N   . GLY E  1 41  ? 49.933 74.655 81.566  1.00 33.75 ? 41   GLY E N   1 
ATOM   5384  C  CA  . GLY E  1 41  ? 48.734 74.310 82.296  1.00 33.75 ? 41   GLY E CA  1 
ATOM   5385  C  C   . GLY E  1 41  ? 49.070 73.475 83.508  1.00 34.67 ? 41   GLY E C   1 
ATOM   5386  O  O   . GLY E  1 41  ? 48.465 73.632 84.568  1.00 36.65 ? 41   GLY E O   1 
ATOM   5387  N  N   . LYS E  1 42  ? 50.039 72.582 83.351  1.00 33.52 ? 42   LYS E N   1 
ATOM   5388  C  CA  . LYS E  1 42  ? 50.445 71.720 84.443  1.00 35.00 ? 42   LYS E CA  1 
ATOM   5389  C  C   . LYS E  1 42  ? 51.027 72.579 85.563  1.00 36.41 ? 42   LYS E C   1 
ATOM   5390  O  O   . LYS E  1 42  ? 50.619 72.465 86.715  1.00 37.18 ? 42   LYS E O   1 
ATOM   5391  C  CB  . LYS E  1 42  ? 51.474 70.705 83.946  1.00 35.33 ? 42   LYS E CB  1 
ATOM   5392  C  CG  . LYS E  1 42  ? 51.846 69.646 84.958  1.00 39.62 ? 42   LYS E CG  1 
ATOM   5393  C  CD  . LYS E  1 42  ? 52.891 68.695 84.384  1.00 46.47 ? 42   LYS E CD  1 
ATOM   5394  C  CE  . LYS E  1 42  ? 53.342 67.659 85.417  1.00 50.12 ? 42   LYS E CE  1 
ATOM   5395  N  NZ  . LYS E  1 42  ? 54.208 66.596 84.814  1.00 51.01 ? 42   LYS E NZ  1 
ATOM   5396  N  N   . HIS E  1 43  ? 51.967 73.455 85.226  1.00 38.12 ? 43   HIS E N   1 
ATOM   5397  C  CA  . HIS E  1 43  ? 52.571 74.313 86.235  1.00 40.71 ? 43   HIS E CA  1 
ATOM   5398  C  C   . HIS E  1 43  ? 51.508 75.180 86.906  1.00 40.94 ? 43   HIS E C   1 
ATOM   5399  O  O   . HIS E  1 43  ? 51.365 75.163 88.132  1.00 39.09 ? 43   HIS E O   1 
ATOM   5400  C  CB  . HIS E  1 43  ? 53.642 75.219 85.618  1.00 42.11 ? 43   HIS E CB  1 
ATOM   5401  C  CG  . HIS E  1 43  ? 54.490 75.919 86.636  1.00 48.24 ? 43   HIS E CG  1 
ATOM   5402  N  ND1 . HIS E  1 43  ? 55.662 75.382 87.126  1.00 49.41 ? 43   HIS E ND1 1 
ATOM   5403  C  CD2 . HIS E  1 43  ? 54.305 77.085 87.302  1.00 50.87 ? 43   HIS E CD2 1 
ATOM   5404  C  CE1 . HIS E  1 43  ? 56.161 76.185 88.050  1.00 51.09 ? 43   HIS E CE1 1 
ATOM   5405  N  NE2 . HIS E  1 43  ? 55.356 77.225 88.177  1.00 51.73 ? 43   HIS E NE2 1 
ATOM   5406  N  N   . GLU E  1 44  ? 50.769 75.938 86.100  1.00 41.54 ? 44   GLU E N   1 
ATOM   5407  C  CA  . GLU E  1 44  ? 49.717 76.806 86.625  1.00 42.49 ? 44   GLU E CA  1 
ATOM   5408  C  C   . GLU E  1 44  ? 48.748 76.040 87.510  1.00 41.35 ? 44   GLU E C   1 
ATOM   5409  O  O   . GLU E  1 44  ? 48.192 76.588 88.460  1.00 40.26 ? 44   GLU E O   1 
ATOM   5410  C  CB  . GLU E  1 44  ? 48.951 77.468 85.484  1.00 44.05 ? 44   GLU E CB  1 
ATOM   5411  C  CG  . GLU E  1 44  ? 49.663 78.669 84.941  1.00 50.46 ? 44   GLU E CG  1 
ATOM   5412  C  CD  . GLU E  1 44  ? 49.884 79.712 86.010  1.00 53.30 ? 44   GLU E CD  1 
ATOM   5413  O  OE1 . GLU E  1 44  ? 48.889 80.336 86.441  1.00 54.84 ? 44   GLU E OE1 1 
ATOM   5414  O  OE2 . GLU E  1 44  ? 51.048 79.895 86.426  1.00 54.83 ? 44   GLU E OE2 1 
ATOM   5415  N  N   . TYR E  1 45  ? 48.536 74.773 87.188  1.00 41.12 ? 45   TYR E N   1 
ATOM   5416  C  CA  . TYR E  1 45  ? 47.651 73.950 87.984  1.00 41.50 ? 45   TYR E CA  1 
ATOM   5417  C  C   . TYR E  1 45  ? 48.262 73.839 89.380  1.00 42.47 ? 45   TYR E C   1 
ATOM   5418  O  O   . TYR E  1 45  ? 47.597 74.112 90.384  1.00 42.95 ? 45   TYR E O   1 
ATOM   5419  C  CB  . TYR E  1 45  ? 47.495 72.570 87.347  1.00 42.77 ? 45   TYR E CB  1 
ATOM   5420  C  CG  . TYR E  1 45  ? 46.666 71.635 88.179  1.00 44.68 ? 45   TYR E CG  1 
ATOM   5421  C  CD1 . TYR E  1 45  ? 47.270 70.661 88.971  1.00 45.50 ? 45   TYR E CD1 1 
ATOM   5422  C  CD2 . TYR E  1 45  ? 45.284 71.778 88.245  1.00 45.77 ? 45   TYR E CD2 1 
ATOM   5423  C  CE1 . TYR E  1 45  ? 46.524 69.859 89.815  1.00 46.49 ? 45   TYR E CE1 1 
ATOM   5424  C  CE2 . TYR E  1 45  ? 44.524 70.978 89.089  1.00 49.77 ? 45   TYR E CE2 1 
ATOM   5425  C  CZ  . TYR E  1 45  ? 45.153 70.022 89.875  1.00 48.20 ? 45   TYR E CZ  1 
ATOM   5426  O  OH  . TYR E  1 45  ? 44.417 69.255 90.748  1.00 52.64 ? 45   TYR E OH  1 
ATOM   5427  N  N   . HIS E  1 46  ? 49.536 73.459 89.440  1.00 41.82 ? 46   HIS E N   1 
ATOM   5428  C  CA  . HIS E  1 46  ? 50.226 73.338 90.717  1.00 43.17 ? 46   HIS E CA  1 
ATOM   5429  C  C   . HIS E  1 46  ? 50.232 74.653 91.487  1.00 40.90 ? 46   HIS E C   1 
ATOM   5430  O  O   . HIS E  1 46  ? 49.929 74.661 92.673  1.00 39.67 ? 46   HIS E O   1 
ATOM   5431  C  CB  . HIS E  1 46  ? 51.650 72.839 90.506  1.00 48.31 ? 46   HIS E CB  1 
ATOM   5432  C  CG  . HIS E  1 46  ? 51.727 71.381 90.172  1.00 59.00 ? 46   HIS E CG  1 
ATOM   5433  N  ND1 . HIS E  1 46  ? 50.866 70.775 89.280  1.00 62.14 ? 46   HIS E ND1 1 
ATOM   5434  C  CD2 . HIS E  1 46  ? 52.580 70.413 90.587  1.00 63.24 ? 46   HIS E CD2 1 
ATOM   5435  C  CE1 . HIS E  1 46  ? 51.186 69.498 89.160  1.00 63.19 ? 46   HIS E CE1 1 
ATOM   5436  N  NE2 . HIS E  1 46  ? 52.222 69.252 89.942  1.00 65.17 ? 46   HIS E NE2 1 
ATOM   5437  N  N   . GLU E  1 47  ? 50.567 75.760 90.826  1.00 39.39 ? 47   GLU E N   1 
ATOM   5438  C  CA  . GLU E  1 47  ? 50.559 77.059 91.503  1.00 39.95 ? 47   GLU E CA  1 
ATOM   5439  C  C   . GLU E  1 47  ? 49.214 77.236 92.185  1.00 40.07 ? 47   GLU E C   1 
ATOM   5440  O  O   . GLU E  1 47  ? 49.111 77.877 93.230  1.00 42.49 ? 47   GLU E O   1 
ATOM   5441  C  CB  . GLU E  1 47  ? 50.736 78.218 90.517  1.00 40.32 ? 47   GLU E CB  1 
ATOM   5442  C  CG  . GLU E  1 47  ? 52.116 78.345 89.908  1.00 47.51 ? 47   GLU E CG  1 
ATOM   5443  C  CD  . GLU E  1 47  ? 53.193 78.642 90.938  1.00 49.24 ? 47   GLU E CD  1 
ATOM   5444  O  OE1 . GLU E  1 47  ? 53.340 77.842 91.887  1.00 47.98 ? 47   GLU E OE1 1 
ATOM   5445  O  OE2 . GLU E  1 47  ? 53.896 79.671 90.790  1.00 51.61 ? 47   GLU E OE2 1 
ATOM   5446  N  N   . SER E  1 48  ? 48.181 76.654 91.586  1.00 38.44 ? 48   SER E N   1 
ATOM   5447  C  CA  . SER E  1 48  ? 46.837 76.770 92.117  1.00 36.01 ? 48   SER E CA  1 
ATOM   5448  C  C   . SER E  1 48  ? 46.648 75.928 93.376  1.00 35.98 ? 48   SER E C   1 
ATOM   5449  O  O   . SER E  1 48  ? 46.126 76.413 94.380  1.00 33.98 ? 48   SER E O   1 
ATOM   5450  C  CB  . SER E  1 48  ? 45.828 76.367 91.051  1.00 34.00 ? 48   SER E CB  1 
ATOM   5451  O  OG  . SER E  1 48  ? 44.529 76.787 91.421  1.00 39.93 ? 48   SER E OG  1 
ATOM   5452  N  N   . ILE E  1 49  ? 47.065 74.667 93.327  1.00 35.10 ? 49   ILE E N   1 
ATOM   5453  C  CA  . ILE E  1 49  ? 46.934 73.813 94.496  1.00 34.91 ? 49   ILE E CA  1 
ATOM   5454  C  C   . ILE E  1 49  ? 47.753 74.446 95.619  1.00 35.56 ? 49   ILE E C   1 
ATOM   5455  O  O   . ILE E  1 49  ? 47.368 74.416 96.784  1.00 37.61 ? 49   ILE E O   1 
ATOM   5456  C  CB  . ILE E  1 49  ? 47.424 72.364 94.199  1.00 34.01 ? 49   ILE E CB  1 
ATOM   5457  C  CG1 . ILE E  1 49  ? 46.316 71.564 93.496  1.00 35.60 ? 49   ILE E CG1 1 
ATOM   5458  C  CG2 . ILE E  1 49  ? 47.753 71.640 95.490  1.00 31.24 ? 49   ILE E CG2 1 
ATOM   5459  C  CD1 . ILE E  1 49  ? 45.790 72.187 92.225  1.00 35.91 ? 49   ILE E CD1 1 
ATOM   5460  N  N   . ASP E  1 50  ? 48.879 75.039 95.254  1.00 35.63 ? 50   ASP E N   1 
ATOM   5461  C  CA  . ASP E  1 50  ? 49.744 75.703 96.220  1.00 38.30 ? 50   ASP E CA  1 
ATOM   5462  C  C   . ASP E  1 50  ? 48.946 76.733 97.018  1.00 39.37 ? 50   ASP E C   1 
ATOM   5463  O  O   . ASP E  1 50  ? 48.983 76.757 98.254  1.00 39.62 ? 50   ASP E O   1 
ATOM   5464  C  CB  . ASP E  1 50  ? 50.882 76.416 95.484  1.00 41.15 ? 50   ASP E CB  1 
ATOM   5465  C  CG  . ASP E  1 50  ? 52.229 75.767 95.717  1.00 43.25 ? 50   ASP E CG  1 
ATOM   5466  O  OD1 . ASP E  1 50  ? 52.297 74.514 95.715  1.00 41.95 ? 50   ASP E OD1 1 
ATOM   5467  O  OD2 . ASP E  1 50  ? 53.220 76.517 95.894  1.00 44.42 ? 50   ASP E OD2 1 
ATOM   5468  N  N   . GLU E  1 51  ? 48.224 77.580 96.292  1.00 37.47 ? 51   GLU E N   1 
ATOM   5469  C  CA  . GLU E  1 51  ? 47.424 78.632 96.898  1.00 35.27 ? 51   GLU E CA  1 
ATOM   5470  C  C   . GLU E  1 51  ? 46.305 78.039 97.725  1.00 33.58 ? 51   GLU E C   1 
ATOM   5471  O  O   . GLU E  1 51  ? 45.835 78.655 98.682  1.00 33.25 ? 51   GLU E O   1 
ATOM   5472  C  CB  . GLU E  1 51  ? 46.841 79.542 95.816  1.00 36.74 ? 51   GLU E CB  1 
ATOM   5473  C  CG  . GLU E  1 51  ? 47.895 80.150 94.914  1.00 41.00 ? 51   GLU E CG  1 
ATOM   5474  C  CD  . GLU E  1 51  ? 48.947 80.927 95.682  1.00 41.85 ? 51   GLU E CD  1 
ATOM   5475  O  OE1 . GLU E  1 51  ? 48.801 81.077 96.914  1.00 44.93 ? 51   GLU E OE1 1 
ATOM   5476  O  OE2 . GLU E  1 51  ? 49.930 81.374 95.057  1.00 46.40 ? 51   GLU E OE2 1 
ATOM   5477  N  N   . MET E  1 52  ? 45.860 76.847 97.346  1.00 32.78 ? 52   MET E N   1 
ATOM   5478  C  CA  . MET E  1 52  ? 44.788 76.188 98.076  1.00 33.24 ? 52   MET E CA  1 
ATOM   5479  C  C   . MET E  1 52  ? 45.322 75.749 99.426  1.00 32.76 ? 52   MET E C   1 
ATOM   5480  O  O   . MET E  1 52  ? 44.625 75.825 100.435 1.00 31.87 ? 52   MET E O   1 
ATOM   5481  C  CB  . MET E  1 52  ? 44.254 74.994 97.277  1.00 35.49 ? 52   MET E CB  1 
ATOM   5482  C  CG  . MET E  1 52  ? 43.319 75.411 96.137  1.00 41.83 ? 52   MET E CG  1 
ATOM   5483  S  SD  . MET E  1 52  ? 42.638 74.068 95.113  1.00 46.96 ? 52   MET E SD  1 
ATOM   5484  C  CE  . MET E  1 52  ? 43.029 74.696 93.442  1.00 49.19 ? 52   MET E CE  1 
ATOM   5485  N  N   . LYS E  1 53  ? 46.579 75.315 99.438  1.00 32.91 ? 53   LYS E N   1 
ATOM   5486  C  CA  . LYS E  1 53  ? 47.227 74.878 100.662 1.00 33.82 ? 53   LYS E CA  1 
ATOM   5487  C  C   . LYS E  1 53  ? 47.446 76.080 101.572 1.00 34.04 ? 53   LYS E C   1 
ATOM   5488  O  O   . LYS E  1 53  ? 47.263 75.992 102.792 1.00 34.76 ? 53   LYS E O   1 
ATOM   5489  C  CB  . LYS E  1 53  ? 48.556 74.203 100.333 1.00 36.17 ? 53   LYS E CB  1 
ATOM   5490  C  CG  . LYS E  1 53  ? 48.397 72.935 99.496  1.00 37.27 ? 53   LYS E CG  1 
ATOM   5491  C  CD  . LYS E  1 53  ? 49.743 72.260 99.276  1.00 40.00 ? 53   LYS E CD  1 
ATOM   5492  C  CE  . LYS E  1 53  ? 49.613 71.018 98.415  1.00 41.79 ? 53   LYS E CE  1 
ATOM   5493  N  NZ  . LYS E  1 53  ? 50.933 70.360 98.201  1.00 43.42 ? 53   LYS E NZ  1 
ATOM   5494  N  N   . HIS E  1 54  ? 47.855 77.196 100.974 1.00 32.62 ? 54   HIS E N   1 
ATOM   5495  C  CA  . HIS E  1 54  ? 48.056 78.435 101.713 1.00 31.43 ? 54   HIS E CA  1 
ATOM   5496  C  C   . HIS E  1 54  ? 46.810 78.834 102.424 1.00 30.97 ? 54   HIS E C   1 
ATOM   5497  O  O   . HIS E  1 54  ? 46.817 79.114 103.620 1.00 29.76 ? 54   HIS E O   1 
ATOM   5498  C  CB  . HIS E  1 54  ? 48.438 79.563 100.764 1.00 30.50 ? 54   HIS E CB  1 
ATOM   5499  C  CG  . HIS E  1 54  ? 49.886 79.420 100.223 1.00 32.67 ? 54   HIS E CG  1 
ATOM   5500  N  ND1 . HIS E  1 54  ? 50.455 80.352 99.381  1.00 31.37 ? 54   HIS E ND1 1 
ATOM   5501  C  CD2 . HIS E  1 54  ? 50.831 78.472 100.431 1.00 30.51 ? 54   HIS E CD2 1 
ATOM   5502  C  CE1 . HIS E  1 54  ? 51.693 79.984 99.097  1.00 33.45 ? 54   HIS E CE1 1 
ATOM   5503  N  NE2 . HIS E  1 54  ? 51.946 78.848 99.722  1.00 29.13 ? 54   HIS E NE2 1 
ATOM   5504  N  N   . ALA E  1 55  ? 45.719 78.866 101.665 1.00 31.67 ? 55   ALA E N   1 
ATOM   5505  C  CA  . ALA E  1 55  ? 44.418 79.233 102.190 1.00 32.57 ? 55   ALA E CA  1 
ATOM   5506  C  C   . ALA E  1 55  ? 44.046 78.301 103.333 1.00 33.80 ? 55   ALA E C   1 
ATOM   5507  O  O   . ALA E  1 55  ? 43.554 78.735 104.381 1.00 33.93 ? 55   ALA E O   1 
ATOM   5508  C  CB  . ALA E  1 55  ? 43.381 79.150 101.086 1.00 31.55 ? 55   ALA E CB  1 
ATOM   5509  N  N   . ASP E  1 56  ? 44.294 77.014 103.132 1.00 34.62 ? 56   ASP E N   1 
ATOM   5510  C  CA  . ASP E  1 56  ? 43.973 76.026 104.146 1.00 35.70 ? 56   ASP E CA  1 
ATOM   5511  C  C   . ASP E  1 56  ? 44.715 76.292 105.454 1.00 35.49 ? 56   ASP E C   1 
ATOM   5512  O  O   . ASP E  1 56  ? 44.132 76.172 106.530 1.00 39.17 ? 56   ASP E O   1 
ATOM   5513  C  CB  . ASP E  1 56  ? 44.297 74.618 103.631 1.00 36.65 ? 56   ASP E CB  1 
ATOM   5514  C  CG  . ASP E  1 56  ? 43.798 73.529 104.561 1.00 35.69 ? 56   ASP E CG  1 
ATOM   5515  O  OD1 . ASP E  1 56  ? 42.748 73.737 105.194 1.00 35.81 ? 56   ASP E OD1 1 
ATOM   5516  O  OD2 . ASP E  1 56  ? 44.439 72.461 104.648 1.00 38.49 ? 56   ASP E OD2 1 
ATOM   5517  N  N   . LYS E  1 57  ? 45.988 76.662 105.369 1.00 31.01 ? 57   LYS E N   1 
ATOM   5518  C  CA  . LYS E  1 57  ? 46.771 76.921 106.569 1.00 30.89 ? 57   LYS E CA  1 
ATOM   5519  C  C   . LYS E  1 57  ? 46.238 78.118 107.338 1.00 30.74 ? 57   LYS E C   1 
ATOM   5520  O  O   . LYS E  1 57  ? 46.108 78.076 108.563 1.00 31.28 ? 57   LYS E O   1 
ATOM   5521  C  CB  . LYS E  1 57  ? 48.236 77.161 106.209 1.00 35.92 ? 57   LYS E CB  1 
ATOM   5522  C  CG  . LYS E  1 57  ? 48.936 75.946 105.631 1.00 44.96 ? 57   LYS E CG  1 
ATOM   5523  C  CD  . LYS E  1 57  ? 50.363 76.274 105.204 1.00 51.13 ? 57   LYS E CD  1 
ATOM   5524  C  CE  . LYS E  1 57  ? 51.049 75.048 104.616 1.00 55.40 ? 57   LYS E CE  1 
ATOM   5525  N  NZ  . LYS E  1 57  ? 50.281 74.500 103.452 1.00 59.10 ? 57   LYS E NZ  1 
ATOM   5526  N  N   . LEU E  1 58  ? 45.944 79.192 106.614 1.00 29.17 ? 58   LEU E N   1 
ATOM   5527  C  CA  . LEU E  1 58  ? 45.425 80.403 107.225 1.00 25.68 ? 58   LEU E CA  1 
ATOM   5528  C  C   . LEU E  1 58  ? 44.093 80.093 107.904 1.00 26.35 ? 58   LEU E C   1 
ATOM   5529  O  O   . LEU E  1 58  ? 43.863 80.472 109.056 1.00 26.48 ? 58   LEU E O   1 
ATOM   5530  C  CB  . LEU E  1 58  ? 45.245 81.486 106.158 1.00 23.19 ? 58   LEU E CB  1 
ATOM   5531  C  CG  . LEU E  1 58  ? 46.533 82.009 105.510 1.00 22.80 ? 58   LEU E CG  1 
ATOM   5532  C  CD1 . LEU E  1 58  ? 46.202 82.897 104.311 1.00 21.93 ? 58   LEU E CD1 1 
ATOM   5533  C  CD2 . LEU E  1 58  ? 47.342 82.783 106.540 1.00 21.72 ? 58   LEU E CD2 1 
ATOM   5534  N  N   . ILE E  1 59  ? 43.216 79.395 107.193 1.00 25.78 ? 59   ILE E N   1 
ATOM   5535  C  CA  . ILE E  1 59  ? 41.925 79.047 107.756 1.00 28.99 ? 59   ILE E CA  1 
ATOM   5536  C  C   . ILE E  1 59  ? 42.121 78.370 109.111 1.00 30.70 ? 59   ILE E C   1 
ATOM   5537  O  O   . ILE E  1 59  ? 41.546 78.790 110.119 1.00 31.57 ? 59   ILE E O   1 
ATOM   5538  C  CB  . ILE E  1 59  ? 41.141 78.099 106.810 1.00 30.13 ? 59   ILE E CB  1 
ATOM   5539  C  CG1 . ILE E  1 59  ? 40.778 78.853 105.533 1.00 28.57 ? 59   ILE E CG1 1 
ATOM   5540  C  CG2 . ILE E  1 59  ? 39.870 77.571 107.499 1.00 25.86 ? 59   ILE E CG2 1 
ATOM   5541  C  CD1 . ILE E  1 59  ? 39.998 78.026 104.546 1.00 33.55 ? 59   ILE E CD1 1 
ATOM   5542  N  N   . LYS E  1 60  ? 42.945 77.328 109.133 1.00 30.42 ? 60   LYS E N   1 
ATOM   5543  C  CA  . LYS E  1 60  ? 43.190 76.599 110.362 1.00 31.95 ? 60   LYS E CA  1 
ATOM   5544  C  C   . LYS E  1 60  ? 43.752 77.485 111.456 1.00 31.33 ? 60   LYS E C   1 
ATOM   5545  O  O   . LYS E  1 60  ? 43.321 77.395 112.603 1.00 33.77 ? 60   LYS E O   1 
ATOM   5546  C  CB  . LYS E  1 60  ? 44.107 75.401 110.093 1.00 34.55 ? 60   LYS E CB  1 
ATOM   5547  C  CG  . LYS E  1 60  ? 43.350 74.228 109.467 1.00 39.45 ? 60   LYS E CG  1 
ATOM   5548  C  CD  . LYS E  1 60  ? 44.244 73.049 109.096 1.00 42.23 ? 60   LYS E CD  1 
ATOM   5549  C  CE  . LYS E  1 60  ? 44.950 73.266 107.759 1.00 43.39 ? 60   LYS E CE  1 
ATOM   5550  N  NZ  . LYS E  1 60  ? 45.623 72.019 107.287 1.00 43.70 ? 60   LYS E NZ  1 
ATOM   5551  N  N   . ARG E  1 61  ? 44.696 78.354 111.103 1.00 30.85 ? 61   ARG E N   1 
ATOM   5552  C  CA  . ARG E  1 61  ? 45.299 79.262 112.076 1.00 27.58 ? 61   ARG E CA  1 
ATOM   5553  C  C   . ARG E  1 61  ? 44.242 80.215 112.628 1.00 29.01 ? 61   ARG E C   1 
ATOM   5554  O  O   . ARG E  1 61  ? 44.210 80.492 113.828 1.00 29.86 ? 61   ARG E O   1 
ATOM   5555  C  CB  . ARG E  1 61  ? 46.427 80.068 111.429 1.00 26.16 ? 61   ARG E CB  1 
ATOM   5556  C  CG  . ARG E  1 61  ? 47.158 81.005 112.387 1.00 26.22 ? 61   ARG E CG  1 
ATOM   5557  C  CD  . ARG E  1 61  ? 47.769 80.238 113.539 1.00 22.85 ? 61   ARG E CD  1 
ATOM   5558  N  NE  . ARG E  1 61  ? 48.399 81.115 114.522 1.00 23.63 ? 61   ARG E NE  1 
ATOM   5559  C  CZ  . ARG E  1 61  ? 48.989 80.683 115.639 1.00 23.40 ? 61   ARG E CZ  1 
ATOM   5560  N  NH1 . ARG E  1 61  ? 49.024 79.388 115.917 1.00 20.90 ? 61   ARG E NH1 1 
ATOM   5561  N  NH2 . ARG E  1 61  ? 49.566 81.540 116.470 1.00 24.37 ? 61   ARG E NH2 1 
ATOM   5562  N  N   . ILE E  1 62  ? 43.379 80.716 111.748 1.00 27.25 ? 62   ILE E N   1 
ATOM   5563  C  CA  . ILE E  1 62  ? 42.321 81.633 112.157 1.00 24.46 ? 62   ILE E CA  1 
ATOM   5564  C  C   . ILE E  1 62  ? 41.377 80.947 113.139 1.00 25.00 ? 62   ILE E C   1 
ATOM   5565  O  O   . ILE E  1 62  ? 41.013 81.515 114.177 1.00 23.16 ? 62   ILE E O   1 
ATOM   5566  C  CB  . ILE E  1 62  ? 41.515 82.116 110.939 1.00 22.58 ? 62   ILE E CB  1 
ATOM   5567  C  CG1 . ILE E  1 62  ? 42.393 83.024 110.073 1.00 21.05 ? 62   ILE E CG1 1 
ATOM   5568  C  CG2 . ILE E  1 62  ? 40.253 82.845 111.390 1.00 21.47 ? 62   ILE E CG2 1 
ATOM   5569  C  CD1 . ILE E  1 62  ? 41.702 83.493 108.813 1.00 13.91 ? 62   ILE E CD1 1 
ATOM   5570  N  N   . LEU E  1 63  ? 40.982 79.725 112.795 1.00 24.64 ? 63   LEU E N   1 
ATOM   5571  C  CA  . LEU E  1 63  ? 40.089 78.931 113.629 1.00 24.07 ? 63   LEU E CA  1 
ATOM   5572  C  C   . LEU E  1 63  ? 40.699 78.716 115.011 1.00 25.10 ? 63   LEU E C   1 
ATOM   5573  O  O   . LEU E  1 63  ? 40.014 78.872 116.029 1.00 25.53 ? 63   LEU E O   1 
ATOM   5574  C  CB  . LEU E  1 63  ? 39.831 77.578 112.966 1.00 23.93 ? 63   LEU E CB  1 
ATOM   5575  C  CG  . LEU E  1 63  ? 38.476 77.216 112.345 1.00 20.07 ? 63   LEU E CG  1 
ATOM   5576  C  CD1 . LEU E  1 63  ? 37.608 78.434 112.092 1.00 15.22 ? 63   LEU E CD1 1 
ATOM   5577  C  CD2 . LEU E  1 63  ? 38.761 76.454 111.060 1.00 21.91 ? 63   LEU E CD2 1 
ATOM   5578  N  N   . PHE E  1 64  ? 41.983 78.360 115.049 1.00 25.95 ? 64   PHE E N   1 
ATOM   5579  C  CA  . PHE E  1 64  ? 42.664 78.133 116.321 1.00 28.25 ? 64   PHE E CA  1 
ATOM   5580  C  C   . PHE E  1 64  ? 42.656 79.404 117.162 1.00 27.92 ? 64   PHE E C   1 
ATOM   5581  O  O   . PHE E  1 64  ? 42.384 79.361 118.360 1.00 30.50 ? 64   PHE E O   1 
ATOM   5582  C  CB  . PHE E  1 64  ? 44.108 77.667 116.092 1.00 30.18 ? 64   PHE E CB  1 
ATOM   5583  C  CG  . PHE E  1 64  ? 44.910 77.524 117.365 1.00 33.37 ? 64   PHE E CG  1 
ATOM   5584  C  CD1 . PHE E  1 64  ? 44.428 76.756 118.429 1.00 33.47 ? 64   PHE E CD1 1 
ATOM   5585  C  CD2 . PHE E  1 64  ? 46.134 78.182 117.513 1.00 31.80 ? 64   PHE E CD2 1 
ATOM   5586  C  CE1 . PHE E  1 64  ? 45.154 76.650 119.630 1.00 32.83 ? 64   PHE E CE1 1 
ATOM   5587  C  CE2 . PHE E  1 64  ? 46.865 78.084 118.704 1.00 29.99 ? 64   PHE E CE2 1 
ATOM   5588  C  CZ  . PHE E  1 64  ? 46.372 77.318 119.765 1.00 32.25 ? 64   PHE E CZ  1 
ATOM   5589  N  N   . LEU E  1 65  ? 42.946 80.533 116.522 1.00 29.17 ? 65   LEU E N   1 
ATOM   5590  C  CA  . LEU E  1 65  ? 42.972 81.833 117.186 1.00 27.60 ? 65   LEU E CA  1 
ATOM   5591  C  C   . LEU E  1 65  ? 41.561 82.293 117.516 1.00 29.14 ? 65   LEU E C   1 
ATOM   5592  O  O   . LEU E  1 65  ? 41.356 83.405 117.999 1.00 28.29 ? 65   LEU E O   1 
ATOM   5593  C  CB  . LEU E  1 65  ? 43.662 82.858 116.290 1.00 26.49 ? 65   LEU E CB  1 
ATOM   5594  C  CG  . LEU E  1 65  ? 45.128 83.190 116.601 1.00 26.82 ? 65   LEU E CG  1 
ATOM   5595  C  CD1 . LEU E  1 65  ? 45.917 81.947 116.946 1.00 23.47 ? 65   LEU E CD1 1 
ATOM   5596  C  CD2 . LEU E  1 65  ? 45.729 83.899 115.392 1.00 28.37 ? 65   LEU E CD2 1 
ATOM   5597  N  N   . GLU E  1 66  ? 40.594 81.427 117.231 1.00 31.57 ? 66   GLU E N   1 
ATOM   5598  C  CA  . GLU E  1 66  ? 39.188 81.689 117.513 1.00 33.41 ? 66   GLU E CA  1 
ATOM   5599  C  C   . GLU E  1 66  ? 38.541 82.876 116.804 1.00 33.66 ? 66   GLU E C   1 
ATOM   5600  O  O   . GLU E  1 66  ? 37.836 83.667 117.432 1.00 33.39 ? 66   GLU E O   1 
ATOM   5601  C  CB  . GLU E  1 66  ? 38.991 81.816 119.026 1.00 36.49 ? 66   GLU E CB  1 
ATOM   5602  C  CG  . GLU E  1 66  ? 39.118 80.479 119.766 1.00 45.63 ? 66   GLU E CG  1 
ATOM   5603  C  CD  . GLU E  1 66  ? 39.145 80.629 121.288 1.00 50.53 ? 66   GLU E CD  1 
ATOM   5604  O  OE1 . GLU E  1 66  ? 38.493 81.562 121.814 1.00 52.95 ? 66   GLU E OE1 1 
ATOM   5605  O  OE2 . GLU E  1 66  ? 39.806 79.800 121.960 1.00 50.45 ? 66   GLU E OE2 1 
ATOM   5606  N  N   . GLY E  1 67  ? 38.772 82.989 115.496 1.00 32.71 ? 67   GLY E N   1 
ATOM   5607  C  CA  . GLY E  1 67  ? 38.167 84.059 114.716 1.00 32.00 ? 67   GLY E CA  1 
ATOM   5608  C  C   . GLY E  1 67  ? 37.251 83.452 113.659 1.00 34.38 ? 67   GLY E C   1 
ATOM   5609  O  O   . GLY E  1 67  ? 37.120 82.229 113.590 1.00 33.47 ? 67   GLY E O   1 
ATOM   5610  N  N   . LEU E  1 68  ? 36.599 84.277 112.842 1.00 34.75 ? 68   LEU E N   1 
ATOM   5611  C  CA  . LEU E  1 68  ? 35.738 83.736 111.795 1.00 33.58 ? 68   LEU E CA  1 
ATOM   5612  C  C   . LEU E  1 68  ? 36.421 83.900 110.455 1.00 35.32 ? 68   LEU E C   1 
ATOM   5613  O  O   . LEU E  1 68  ? 36.640 85.024 110.000 1.00 38.12 ? 68   LEU E O   1 
ATOM   5614  C  CB  . LEU E  1 68  ? 34.391 84.454 111.736 1.00 32.82 ? 68   LEU E CB  1 
ATOM   5615  C  CG  . LEU E  1 68  ? 33.446 84.343 112.929 1.00 33.90 ? 68   LEU E CG  1 
ATOM   5616  C  CD1 . LEU E  1 68  ? 33.316 82.890 113.339 1.00 29.51 ? 68   LEU E CD1 1 
ATOM   5617  C  CD2 . LEU E  1 68  ? 33.979 85.187 114.081 1.00 34.96 ? 68   LEU E CD2 1 
ATOM   5618  N  N   . PRO E  1 69  ? 36.783 82.782 109.806 1.00 35.34 ? 69   PRO E N   1 
ATOM   5619  C  CA  . PRO E  1 69  ? 37.447 82.832 108.496 1.00 34.12 ? 69   PRO E CA  1 
ATOM   5620  C  C   . PRO E  1 69  ? 36.475 83.389 107.462 1.00 34.26 ? 69   PRO E C   1 
ATOM   5621  O  O   . PRO E  1 69  ? 35.279 83.092 107.508 1.00 32.71 ? 69   PRO E O   1 
ATOM   5622  C  CB  . PRO E  1 69  ? 37.780 81.369 108.215 1.00 33.69 ? 69   PRO E CB  1 
ATOM   5623  C  CG  . PRO E  1 69  ? 37.882 80.760 109.593 1.00 34.09 ? 69   PRO E CG  1 
ATOM   5624  C  CD  . PRO E  1 69  ? 36.726 81.400 110.315 1.00 33.06 ? 69   PRO E CD  1 
ATOM   5625  N  N   . ASN E  1 70  ? 36.977 84.191 106.530 1.00 37.16 ? 70   ASN E N   1 
ATOM   5626  C  CA  . ASN E  1 70  ? 36.112 84.761 105.498 1.00 38.51 ? 70   ASN E CA  1 
ATOM   5627  C  C   . ASN E  1 70  ? 36.391 84.165 104.117 1.00 37.88 ? 70   ASN E C   1 
ATOM   5628  O  O   . ASN E  1 70  ? 37.335 84.558 103.436 1.00 36.30 ? 70   ASN E O   1 
ATOM   5629  C  CB  . ASN E  1 70  ? 36.287 86.279 105.436 1.00 39.97 ? 70   ASN E CB  1 
ATOM   5630  C  CG  . ASN E  1 70  ? 35.257 86.951 104.545 1.00 42.63 ? 70   ASN E CG  1 
ATOM   5631  O  OD1 . ASN E  1 70  ? 34.732 86.345 103.610 1.00 46.32 ? 70   ASN E OD1 1 
ATOM   5632  N  ND2 . ASN E  1 70  ? 34.976 88.218 104.821 1.00 44.81 ? 70   ASN E ND2 1 
ATOM   5633  N  N   . LEU E  1 71  ? 35.578 83.198 103.718 1.00 39.60 ? 71   LEU E N   1 
ATOM   5634  C  CA  . LEU E  1 71  ? 35.722 82.578 102.406 1.00 40.83 ? 71   LEU E CA  1 
ATOM   5635  C  C   . LEU E  1 71  ? 34.703 83.305 101.543 1.00 43.00 ? 71   LEU E C   1 
ATOM   5636  O  O   . LEU E  1 71  ? 34.595 83.060 100.343 1.00 43.78 ? 71   LEU E O   1 
ATOM   5637  C  CB  . LEU E  1 71  ? 35.362 81.086 102.462 1.00 38.82 ? 71   LEU E CB  1 
ATOM   5638  C  CG  . LEU E  1 71  ? 36.249 80.023 103.129 1.00 36.63 ? 71   LEU E CG  1 
ATOM   5639  C  CD1 . LEU E  1 71  ? 37.283 79.515 102.142 1.00 33.88 ? 71   LEU E CD1 1 
ATOM   5640  C  CD2 . LEU E  1 71  ? 36.890 80.580 104.381 1.00 33.21 ? 71   LEU E CD2 1 
ATOM   5641  N  N   . GLN E  1 72  ? 33.957 84.207 102.177 1.00 46.22 ? 72   GLN E N   1 
ATOM   5642  C  CA  . GLN E  1 72  ? 32.913 84.968 101.499 1.00 50.43 ? 72   GLN E CA  1 
ATOM   5643  C  C   . GLN E  1 72  ? 33.418 85.958 100.448 1.00 52.10 ? 72   GLN E C   1 
ATOM   5644  O  O   . GLN E  1 72  ? 33.186 85.765 99.257  1.00 54.37 ? 72   GLN E O   1 
ATOM   5645  C  CB  . GLN E  1 72  ? 32.036 85.697 102.527 1.00 50.06 ? 72   GLN E CB  1 
ATOM   5646  C  CG  . GLN E  1 72  ? 30.819 86.389 101.912 1.00 50.60 ? 72   GLN E CG  1 
ATOM   5647  C  CD  . GLN E  1 72  ? 29.868 85.414 101.231 1.00 48.24 ? 72   GLN E CD  1 
ATOM   5648  O  OE1 . GLN E  1 72  ? 29.085 84.726 101.890 1.00 46.62 ? 72   GLN E OE1 1 
ATOM   5649  N  NE2 . GLN E  1 72  ? 29.942 85.346 99.904  1.00 47.36 ? 72   GLN E NE2 1 
ATOM   5650  N  N   . GLU E  1 73  ? 34.102 87.013 100.877 1.00 54.34 ? 73   GLU E N   1 
ATOM   5651  C  CA  . GLU E  1 73  ? 34.606 88.004 99.929  1.00 56.53 ? 73   GLU E CA  1 
ATOM   5652  C  C   . GLU E  1 73  ? 35.691 87.462 98.999  1.00 55.26 ? 73   GLU E C   1 
ATOM   5653  O  O   . GLU E  1 73  ? 36.625 86.768 99.424  1.00 54.93 ? 73   GLU E O   1 
ATOM   5654  C  CB  . GLU E  1 73  ? 35.152 89.226 100.661 1.00 60.78 ? 73   GLU E CB  1 
ATOM   5655  C  CG  . GLU E  1 73  ? 34.126 89.975 101.480 1.00 65.83 ? 73   GLU E CG  1 
ATOM   5656  C  CD  . GLU E  1 73  ? 34.718 91.220 102.102 1.00 70.64 ? 73   GLU E CD  1 
ATOM   5657  O  OE1 . GLU E  1 73  ? 34.037 91.857 102.935 1.00 74.39 ? 73   GLU E OE1 1 
ATOM   5658  O  OE2 . GLU E  1 73  ? 35.871 91.562 101.750 1.00 72.51 ? 73   GLU E OE2 1 
ATOM   5659  N  N   . LEU E  1 74  ? 35.554 87.802 97.724  1.00 52.12 ? 74   LEU E N   1 
ATOM   5660  C  CA  . LEU E  1 74  ? 36.486 87.381 96.697  1.00 49.10 ? 74   LEU E CA  1 
ATOM   5661  C  C   . LEU E  1 74  ? 36.827 88.638 95.905  1.00 48.98 ? 74   LEU E C   1 
ATOM   5662  O  O   . LEU E  1 74  ? 35.936 89.300 95.377  1.00 49.96 ? 74   LEU E O   1 
ATOM   5663  C  CB  . LEU E  1 74  ? 35.814 86.332 95.807  1.00 48.88 ? 74   LEU E CB  1 
ATOM   5664  C  CG  . LEU E  1 74  ? 36.691 85.474 94.897  1.00 48.54 ? 74   LEU E CG  1 
ATOM   5665  C  CD1 . LEU E  1 74  ? 36.840 86.124 93.538  1.00 49.79 ? 74   LEU E CD1 1 
ATOM   5666  C  CD2 . LEU E  1 74  ? 38.039 85.254 95.574  1.00 48.74 ? 74   LEU E CD2 1 
ATOM   5667  N  N   . GLY E  1 75  ? 38.111 88.974 95.838  1.00 47.28 ? 75   GLY E N   1 
ATOM   5668  C  CA  . GLY E  1 75  ? 38.526 90.168 95.127  1.00 42.84 ? 75   GLY E CA  1 
ATOM   5669  C  C   . GLY E  1 75  ? 38.545 90.035 93.623  1.00 43.46 ? 75   GLY E C   1 
ATOM   5670  O  O   . GLY E  1 75  ? 38.197 89.002 93.060  1.00 42.95 ? 75   GLY E O   1 
ATOM   5671  N  N   . LYS E  1 76  ? 38.973 91.100 92.965  1.00 45.04 ? 76   LYS E N   1 
ATOM   5672  C  CA  . LYS E  1 76  ? 39.040 91.124 91.513  1.00 48.82 ? 76   LYS E CA  1 
ATOM   5673  C  C   . LYS E  1 76  ? 40.097 90.188 90.926  1.00 48.79 ? 76   LYS E C   1 
ATOM   5674  O  O   . LYS E  1 76  ? 41.295 90.358 91.169  1.00 49.40 ? 76   LYS E O   1 
ATOM   5675  C  CB  . LYS E  1 76  ? 39.309 92.555 91.036  1.00 50.30 ? 76   LYS E CB  1 
ATOM   5676  C  CG  . LYS E  1 76  ? 39.414 92.719 89.527  1.00 54.59 ? 76   LYS E CG  1 
ATOM   5677  C  CD  . LYS E  1 76  ? 39.640 94.179 89.170  1.00 60.46 ? 76   LYS E CD  1 
ATOM   5678  C  CE  . LYS E  1 76  ? 39.890 94.379 87.681  1.00 64.38 ? 76   LYS E CE  1 
ATOM   5679  N  NZ  . LYS E  1 76  ? 40.169 95.818 87.351  1.00 65.19 ? 76   LYS E NZ  1 
ATOM   5680  N  N   . LEU E  1 77  ? 39.645 89.201 90.154  1.00 46.92 ? 77   LEU E N   1 
ATOM   5681  C  CA  . LEU E  1 77  ? 40.559 88.276 89.494  1.00 45.49 ? 77   LEU E CA  1 
ATOM   5682  C  C   . LEU E  1 77  ? 41.120 89.033 88.300  1.00 44.05 ? 77   LEU E C   1 
ATOM   5683  O  O   . LEU E  1 77  ? 40.407 89.807 87.667  1.00 43.90 ? 77   LEU E O   1 
ATOM   5684  C  CB  . LEU E  1 77  ? 39.823 87.045 88.964  1.00 45.15 ? 77   LEU E CB  1 
ATOM   5685  C  CG  . LEU E  1 77  ? 39.035 86.139 89.902  1.00 44.69 ? 77   LEU E CG  1 
ATOM   5686  C  CD1 . LEU E  1 77  ? 38.414 85.022 89.085  1.00 41.75 ? 77   LEU E CD1 1 
ATOM   5687  C  CD2 . LEU E  1 77  ? 39.954 85.576 90.975  1.00 46.59 ? 77   LEU E CD2 1 
ATOM   5688  N  N   . LEU E  1 78  ? 42.394 88.818 87.999  1.00 43.72 ? 78   LEU E N   1 
ATOM   5689  C  CA  . LEU E  1 78  ? 43.025 89.469 86.860  1.00 40.98 ? 78   LEU E CA  1 
ATOM   5690  C  C   . LEU E  1 78  ? 43.179 88.415 85.780  1.00 41.16 ? 78   LEU E C   1 
ATOM   5691  O  O   . LEU E  1 78  ? 44.191 87.711 85.727  1.00 41.59 ? 78   LEU E O   1 
ATOM   5692  C  CB  . LEU E  1 78  ? 44.402 90.014 87.237  1.00 39.65 ? 78   LEU E CB  1 
ATOM   5693  C  CG  . LEU E  1 78  ? 44.456 91.064 88.349  1.00 40.65 ? 78   LEU E CG  1 
ATOM   5694  C  CD1 . LEU E  1 78  ? 45.889 91.592 88.480  1.00 39.08 ? 78   LEU E CD1 1 
ATOM   5695  C  CD2 . LEU E  1 78  ? 43.495 92.198 88.034  1.00 39.94 ? 78   LEU E CD2 1 
ATOM   5696  N  N   . ILE E  1 79  ? 42.171 88.298 84.923  1.00 40.46 ? 79   ILE E N   1 
ATOM   5697  C  CA  . ILE E  1 79  ? 42.216 87.310 83.853  1.00 41.65 ? 79   ILE E CA  1 
ATOM   5698  C  C   . ILE E  1 79  ? 42.838 87.859 82.567  1.00 40.74 ? 79   ILE E C   1 
ATOM   5699  O  O   . ILE E  1 79  ? 42.510 88.964 82.128  1.00 39.75 ? 79   ILE E O   1 
ATOM   5700  C  CB  . ILE E  1 79  ? 40.809 86.782 83.535  1.00 42.05 ? 79   ILE E CB  1 
ATOM   5701  C  CG1 . ILE E  1 79  ? 40.036 86.572 84.836  1.00 39.51 ? 79   ILE E CG1 1 
ATOM   5702  C  CG2 . ILE E  1 79  ? 40.911 85.471 82.754  1.00 41.49 ? 79   ILE E CG2 1 
ATOM   5703  C  CD1 . ILE E  1 79  ? 40.779 85.716 85.841  1.00 42.10 ? 79   ILE E CD1 1 
ATOM   5704  N  N   . GLY E  1 80  ? 43.744 87.083 81.978  1.00 40.21 ? 80   GLY E N   1 
ATOM   5705  C  CA  . GLY E  1 80  ? 44.388 87.499 80.749  1.00 40.21 ? 80   GLY E CA  1 
ATOM   5706  C  C   . GLY E  1 80  ? 43.752 86.808 79.560  1.00 41.42 ? 80   GLY E C   1 
ATOM   5707  O  O   . GLY E  1 80  ? 42.988 85.852 79.723  1.00 42.02 ? 80   GLY E O   1 
ATOM   5708  N  N   . GLU E  1 81  ? 44.054 87.287 78.360  1.00 42.13 ? 81   GLU E N   1 
ATOM   5709  C  CA  . GLU E  1 81  ? 43.502 86.681 77.155  1.00 43.36 ? 81   GLU E CA  1 
ATOM   5710  C  C   . GLU E  1 81  ? 44.554 85.917 76.358  1.00 42.84 ? 81   GLU E C   1 
ATOM   5711  O  O   . GLU E  1 81  ? 44.224 85.071 75.524  1.00 43.22 ? 81   GLU E O   1 
ATOM   5712  C  CB  . GLU E  1 81  ? 42.856 87.747 76.276  1.00 44.06 ? 81   GLU E CB  1 
ATOM   5713  C  CG  . GLU E  1 81  ? 41.511 88.209 76.788  1.00 46.11 ? 81   GLU E CG  1 
ATOM   5714  C  CD  . GLU E  1 81  ? 41.005 89.423 76.048  1.00 49.07 ? 81   GLU E CD  1 
ATOM   5715  O  OE1 . GLU E  1 81  ? 39.855 89.832 76.299  1.00 49.99 ? 81   GLU E OE1 1 
ATOM   5716  O  OE2 . GLU E  1 81  ? 41.762 89.975 75.218  1.00 53.35 ? 81   GLU E OE2 1 
ATOM   5717  N  N   . HIS E  1 82  ? 45.822 86.215 76.608  1.00 41.30 ? 82   HIS E N   1 
ATOM   5718  C  CA  . HIS E  1 82  ? 46.886 85.518 75.908  1.00 40.69 ? 82   HIS E CA  1 
ATOM   5719  C  C   . HIS E  1 82  ? 48.016 85.231 76.883  1.00 38.01 ? 82   HIS E C   1 
ATOM   5720  O  O   . HIS E  1 82  ? 48.151 85.918 77.889  1.00 37.98 ? 82   HIS E O   1 
ATOM   5721  C  CB  . HIS E  1 82  ? 47.358 86.335 74.697  1.00 42.15 ? 82   HIS E CB  1 
ATOM   5722  C  CG  . HIS E  1 82  ? 47.944 87.670 75.039  1.00 46.38 ? 82   HIS E CG  1 
ATOM   5723  N  ND1 . HIS E  1 82  ? 49.215 87.818 75.554  1.00 48.78 ? 82   HIS E ND1 1 
ATOM   5724  C  CD2 . HIS E  1 82  ? 47.455 88.924 74.880  1.00 48.56 ? 82   HIS E CD2 1 
ATOM   5725  C  CE1 . HIS E  1 82  ? 49.486 89.104 75.691  1.00 48.60 ? 82   HIS E CE1 1 
ATOM   5726  N  NE2 . HIS E  1 82  ? 48.434 89.797 75.290  1.00 51.79 ? 82   HIS E NE2 1 
ATOM   5727  N  N   . THR E  1 83  ? 48.807 84.205 76.583  1.00 36.31 ? 83   THR E N   1 
ATOM   5728  C  CA  . THR E  1 83  ? 49.907 83.775 77.443  1.00 34.73 ? 83   THR E CA  1 
ATOM   5729  C  C   . THR E  1 83  ? 50.680 84.870 78.151  1.00 36.12 ? 83   THR E C   1 
ATOM   5730  O  O   . THR E  1 83  ? 50.690 84.915 79.379  1.00 37.68 ? 83   THR E O   1 
ATOM   5731  C  CB  . THR E  1 83  ? 50.921 82.914 76.677  1.00 33.68 ? 83   THR E CB  1 
ATOM   5732  O  OG1 . THR E  1 83  ? 50.249 81.789 76.093  1.00 37.77 ? 83   THR E OG1 1 
ATOM   5733  C  CG2 . THR E  1 83  ? 52.007 82.416 77.621  1.00 26.20 ? 83   THR E CG2 1 
ATOM   5734  N  N   . LYS E  1 84  ? 51.332 85.747 77.393  1.00 35.31 ? 84   LYS E N   1 
ATOM   5735  C  CA  . LYS E  1 84  ? 52.114 86.812 78.004  1.00 35.52 ? 84   LYS E CA  1 
ATOM   5736  C  C   . LYS E  1 84  ? 51.309 87.651 78.997  1.00 33.76 ? 84   LYS E C   1 
ATOM   5737  O  O   . LYS E  1 84  ? 51.792 87.981 80.084  1.00 30.74 ? 84   LYS E O   1 
ATOM   5738  C  CB  . LYS E  1 84  ? 52.712 87.718 76.931  1.00 38.10 ? 84   LYS E CB  1 
ATOM   5739  C  CG  . LYS E  1 84  ? 53.621 88.800 77.506  1.00 44.98 ? 84   LYS E CG  1 
ATOM   5740  C  CD  . LYS E  1 84  ? 54.308 89.603 76.414  1.00 48.80 ? 84   LYS E CD  1 
ATOM   5741  C  CE  . LYS E  1 84  ? 55.212 90.672 77.005  1.00 50.31 ? 84   LYS E CE  1 
ATOM   5742  N  NZ  . LYS E  1 84  ? 55.862 91.471 75.922  1.00 55.73 ? 84   LYS E NZ  1 
ATOM   5743  N  N   . GLU E  1 85  ? 50.083 87.996 78.625  1.00 33.65 ? 85   GLU E N   1 
ATOM   5744  C  CA  . GLU E  1 85  ? 49.237 88.800 79.496  1.00 34.97 ? 85   GLU E CA  1 
ATOM   5745  C  C   . GLU E  1 85  ? 48.928 88.021 80.769  1.00 33.98 ? 85   GLU E C   1 
ATOM   5746  O  O   . GLU E  1 85  ? 48.953 88.573 81.870  1.00 34.61 ? 85   GLU E O   1 
ATOM   5747  C  CB  . GLU E  1 85  ? 47.947 89.170 78.767  1.00 37.23 ? 85   GLU E CB  1 
ATOM   5748  C  CG  . GLU E  1 85  ? 47.072 90.147 79.515  1.00 44.23 ? 85   GLU E CG  1 
ATOM   5749  C  CD  . GLU E  1 85  ? 45.904 90.625 78.680  1.00 50.00 ? 85   GLU E CD  1 
ATOM   5750  O  OE1 . GLU E  1 85  ? 45.033 91.338 79.225  1.00 51.98 ? 85   GLU E OE1 1 
ATOM   5751  O  OE2 . GLU E  1 85  ? 45.860 90.291 77.474  1.00 54.17 ? 85   GLU E OE2 1 
ATOM   5752  N  N   . MET E  1 86  ? 48.654 86.729 80.606  1.00 32.93 ? 86   MET E N   1 
ATOM   5753  C  CA  . MET E  1 86  ? 48.355 85.841 81.726  1.00 32.44 ? 86   MET E CA  1 
ATOM   5754  C  C   . MET E  1 86  ? 49.511 85.736 82.711  1.00 31.85 ? 86   MET E C   1 
ATOM   5755  O  O   . MET E  1 86  ? 49.291 85.658 83.908  1.00 30.98 ? 86   MET E O   1 
ATOM   5756  C  CB  . MET E  1 86  ? 47.974 84.454 81.206  1.00 30.20 ? 86   MET E CB  1 
ATOM   5757  C  CG  . MET E  1 86  ? 46.555 84.410 80.670  1.00 30.52 ? 86   MET E CG  1 
ATOM   5758  S  SD  . MET E  1 86  ? 46.282 83.162 79.404  1.00 32.87 ? 86   MET E SD  1 
ATOM   5759  C  CE  . MET E  1 86  ? 46.115 81.645 80.419  1.00 27.12 ? 86   MET E CE  1 
ATOM   5760  N  N   . LEU E  1 87  ? 50.741 85.721 82.213  1.00 35.62 ? 87   LEU E N   1 
ATOM   5761  C  CA  . LEU E  1 87  ? 51.896 85.655 83.100  1.00 37.26 ? 87   LEU E CA  1 
ATOM   5762  C  C   . LEU E  1 87  ? 51.977 86.971 83.877  1.00 38.73 ? 87   LEU E C   1 
ATOM   5763  O  O   . LEU E  1 87  ? 52.206 86.969 85.093  1.00 41.01 ? 87   LEU E O   1 
ATOM   5764  C  CB  . LEU E  1 87  ? 53.204 85.455 82.310  1.00 36.35 ? 87   LEU E CB  1 
ATOM   5765  C  CG  . LEU E  1 87  ? 53.654 84.070 81.823  1.00 35.87 ? 87   LEU E CG  1 
ATOM   5766  C  CD1 . LEU E  1 87  ? 53.611 83.082 82.968  1.00 33.38 ? 87   LEU E CD1 1 
ATOM   5767  C  CD2 . LEU E  1 87  ? 52.773 83.592 80.712  1.00 39.33 ? 87   LEU E CD2 1 
ATOM   5768  N  N   . GLU E  1 88  ? 51.781 88.089 83.177  1.00 37.64 ? 88   GLU E N   1 
ATOM   5769  C  CA  . GLU E  1 88  ? 51.854 89.402 83.812  1.00 38.58 ? 88   GLU E CA  1 
ATOM   5770  C  C   . GLU E  1 88  ? 50.814 89.526 84.913  1.00 38.46 ? 88   GLU E C   1 
ATOM   5771  O  O   . GLU E  1 88  ? 51.139 89.908 86.034  1.00 41.33 ? 88   GLU E O   1 
ATOM   5772  C  CB  . GLU E  1 88  ? 51.675 90.509 82.775  1.00 38.86 ? 88   GLU E CB  1 
ATOM   5773  C  CG  . GLU E  1 88  ? 52.746 90.480 81.690  1.00 46.00 ? 88   GLU E CG  1 
ATOM   5774  C  CD  . GLU E  1 88  ? 52.554 91.545 80.614  1.00 51.60 ? 88   GLU E CD  1 
ATOM   5775  O  OE1 . GLU E  1 88  ? 51.459 91.608 80.006  1.00 51.72 ? 88   GLU E OE1 1 
ATOM   5776  O  OE2 . GLU E  1 88  ? 53.511 92.315 80.371  1.00 54.94 ? 88   GLU E OE2 1 
ATOM   5777  N  N   . CYS E  1 89  ? 49.568 89.188 84.597  1.00 37.42 ? 89   CYS E N   1 
ATOM   5778  C  CA  . CYS E  1 89  ? 48.490 89.236 85.577  1.00 35.86 ? 89   CYS E CA  1 
ATOM   5779  C  C   . CYS E  1 89  ? 48.842 88.461 86.841  1.00 36.25 ? 89   CYS E C   1 
ATOM   5780  O  O   . CYS E  1 89  ? 48.527 88.898 87.947  1.00 39.03 ? 89   CYS E O   1 
ATOM   5781  C  CB  . CYS E  1 89  ? 47.208 88.643 84.995  1.00 35.75 ? 89   CYS E CB  1 
ATOM   5782  S  SG  . CYS E  1 89  ? 46.400 89.668 83.775  1.00 41.10 ? 89   CYS E SG  1 
ATOM   5783  N  N   . ASP E  1 90  ? 49.477 87.304 86.675  1.00 35.52 ? 90   ASP E N   1 
ATOM   5784  C  CA  . ASP E  1 90  ? 49.851 86.474 87.813  1.00 37.70 ? 90   ASP E CA  1 
ATOM   5785  C  C   . ASP E  1 90  ? 50.999 87.098 88.596  1.00 38.49 ? 90   ASP E C   1 
ATOM   5786  O  O   . ASP E  1 90  ? 50.998 87.075 89.829  1.00 38.44 ? 90   ASP E O   1 
ATOM   5787  C  CB  . ASP E  1 90  ? 50.235 85.054 87.362  1.00 38.78 ? 90   ASP E CB  1 
ATOM   5788  C  CG  . ASP E  1 90  ? 49.024 84.223 86.900  1.00 42.69 ? 90   ASP E CG  1 
ATOM   5789  O  OD1 . ASP E  1 90  ? 47.876 84.509 87.318  1.00 42.74 ? 90   ASP E OD1 1 
ATOM   5790  O  OD2 . ASP E  1 90  ? 49.227 83.262 86.126  1.00 44.16 ? 90   ASP E OD2 1 
ATOM   5791  N  N   . LEU E  1 91  ? 51.977 87.656 87.887  1.00 37.87 ? 91   LEU E N   1 
ATOM   5792  C  CA  . LEU E  1 91  ? 53.110 88.291 88.554  1.00 38.09 ? 91   LEU E CA  1 
ATOM   5793  C  C   . LEU E  1 91  ? 52.581 89.489 89.333  1.00 38.48 ? 91   LEU E C   1 
ATOM   5794  O  O   . LEU E  1 91  ? 52.955 89.716 90.488  1.00 37.18 ? 91   LEU E O   1 
ATOM   5795  C  CB  . LEU E  1 91  ? 54.144 88.769 87.533  1.00 37.64 ? 91   LEU E CB  1 
ATOM   5796  C  CG  . LEU E  1 91  ? 55.413 89.405 88.110  1.00 34.71 ? 91   LEU E CG  1 
ATOM   5797  C  CD1 . LEU E  1 91  ? 56.283 88.348 88.795  1.00 33.71 ? 91   LEU E CD1 1 
ATOM   5798  C  CD2 . LEU E  1 91  ? 56.179 90.072 86.992  1.00 32.52 ? 91   LEU E CD2 1 
ATOM   5799  N  N   . LYS E  1 92  ? 51.705 90.250 88.687  1.00 37.68 ? 92   LYS E N   1 
ATOM   5800  C  CA  . LYS E  1 92  ? 51.107 91.419 89.303  1.00 40.49 ? 92   LYS E CA  1 
ATOM   5801  C  C   . LYS E  1 92  ? 50.424 91.021 90.614  1.00 43.68 ? 92   LYS E C   1 
ATOM   5802  O  O   . LYS E  1 92  ? 50.673 91.618 91.662  1.00 44.29 ? 92   LYS E O   1 
ATOM   5803  C  CB  . LYS E  1 92  ? 50.092 92.051 88.347  1.00 40.65 ? 92   LYS E CB  1 
ATOM   5804  C  CG  . LYS E  1 92  ? 49.427 93.308 88.895  1.00 44.85 ? 92   LYS E CG  1 
ATOM   5805  C  CD  . LYS E  1 92  ? 48.534 93.992 87.862  1.00 48.71 ? 92   LYS E CD  1 
ATOM   5806  C  CE  . LYS E  1 92  ? 49.333 94.626 86.714  1.00 51.30 ? 92   LYS E CE  1 
ATOM   5807  N  NZ  . LYS E  1 92  ? 49.963 93.633 85.791  1.00 50.24 ? 92   LYS E NZ  1 
ATOM   5808  N  N   . LEU E  1 93  ? 49.579 89.996 90.549  1.00 44.90 ? 93   LEU E N   1 
ATOM   5809  C  CA  . LEU E  1 93  ? 48.852 89.508 91.716  1.00 45.05 ? 93   LEU E CA  1 
ATOM   5810  C  C   . LEU E  1 93  ? 49.788 89.045 92.836  1.00 45.51 ? 93   LEU E C   1 
ATOM   5811  O  O   . LEU E  1 93  ? 49.558 89.351 94.003  1.00 46.44 ? 93   LEU E O   1 
ATOM   5812  C  CB  . LEU E  1 93  ? 47.922 88.363 91.292  1.00 46.90 ? 93   LEU E CB  1 
ATOM   5813  C  CG  . LEU E  1 93  ? 46.924 87.762 92.287  1.00 46.84 ? 93   LEU E CG  1 
ATOM   5814  C  CD1 . LEU E  1 93  ? 47.649 86.862 93.281  1.00 50.97 ? 93   LEU E CD1 1 
ATOM   5815  C  CD2 . LEU E  1 93  ? 46.171 88.890 92.995  1.00 48.55 ? 93   LEU E CD2 1 
ATOM   5816  N  N   . GLU E  1 94  ? 50.835 88.309 92.483  1.00 46.28 ? 94   GLU E N   1 
ATOM   5817  C  CA  . GLU E  1 94  ? 51.794 87.812 93.463  1.00 49.46 ? 94   GLU E CA  1 
ATOM   5818  C  C   . GLU E  1 94  ? 52.620 88.924 94.103  1.00 51.34 ? 94   GLU E C   1 
ATOM   5819  O  O   . GLU E  1 94  ? 53.190 88.734 95.180  1.00 51.68 ? 94   GLU E O   1 
ATOM   5820  C  CB  . GLU E  1 94  ? 52.742 86.796 92.819  1.00 49.50 ? 94   GLU E CB  1 
ATOM   5821  C  CG  . GLU E  1 94  ? 52.126 85.426 92.589  1.00 53.62 ? 94   GLU E CG  1 
ATOM   5822  C  CD  . GLU E  1 94  ? 51.952 84.632 93.873  1.00 54.67 ? 94   GLU E CD  1 
ATOM   5823  O  OE1 . GLU E  1 94  ? 51.241 83.602 93.850  1.00 51.66 ? 94   GLU E OE1 1 
ATOM   5824  O  OE2 . GLU E  1 94  ? 52.532 85.038 94.901  1.00 56.32 ? 94   GLU E OE2 1 
ATOM   5825  N  N   . GLN E  1 95  ? 52.723 90.063 93.420  1.00 51.94 ? 95   GLN E N   1 
ATOM   5826  C  CA  . GLN E  1 95  ? 53.499 91.187 93.935  1.00 53.54 ? 95   GLN E CA  1 
ATOM   5827  C  C   . GLN E  1 95  ? 52.651 92.127 94.779  1.00 55.55 ? 95   GLN E C   1 
ATOM   5828  O  O   . GLN E  1 95  ? 53.087 92.580 95.842  1.00 56.59 ? 95   GLN E O   1 
ATOM   5829  C  CB  . GLN E  1 95  ? 54.154 91.957 92.787  1.00 51.66 ? 95   GLN E CB  1 
ATOM   5830  C  CG  . GLN E  1 95  ? 55.163 91.122 92.020  1.00 53.34 ? 95   GLN E CG  1 
ATOM   5831  C  CD  . GLN E  1 95  ? 55.846 91.883 90.901  1.00 52.58 ? 95   GLN E CD  1 
ATOM   5832  O  OE1 . GLN E  1 95  ? 55.201 92.613 90.139  1.00 50.44 ? 95   GLN E OE1 1 
ATOM   5833  N  NE2 . GLN E  1 95  ? 57.160 91.699 90.783  1.00 52.27 ? 95   GLN E NE2 1 
ATOM   5834  N  N   . ALA E  1 96  ? 51.440 92.417 94.308  1.00 56.49 ? 96   ALA E N   1 
ATOM   5835  C  CA  . ALA E  1 96  ? 50.526 93.288 95.039  1.00 56.42 ? 96   ALA E CA  1 
ATOM   5836  C  C   . ALA E  1 96  ? 50.018 92.526 96.252  1.00 57.16 ? 96   ALA E C   1 
ATOM   5837  O  O   . ALA E  1 96  ? 49.040 92.923 96.882  1.00 59.01 ? 96   ALA E O   1 
ATOM   5838  C  CB  . ALA E  1 96  ? 49.358 93.701 94.152  1.00 54.57 ? 96   ALA E CB  1 
ATOM   5839  N  N   . GLY E  1 97  ? 50.693 91.424 96.566  1.00 58.21 ? 97   GLY E N   1 
ATOM   5840  C  CA  . GLY E  1 97  ? 50.316 90.608 97.703  1.00 57.13 ? 97   GLY E CA  1 
ATOM   5841  C  C   . GLY E  1 97  ? 51.407 90.574 98.754  1.00 57.30 ? 97   GLY E C   1 
ATOM   5842  O  O   . GLY E  1 97  ? 51.128 90.389 99.940  1.00 57.51 ? 97   GLY E O   1 
ATOM   5843  N  N   . LEU E  1 98  ? 52.654 90.752 98.328  1.00 57.07 ? 98   LEU E N   1 
ATOM   5844  C  CA  . LEU E  1 98  ? 53.774 90.737 99.263  1.00 57.32 ? 98   LEU E CA  1 
ATOM   5845  C  C   . LEU E  1 98  ? 53.656 91.807 100.351 1.00 55.66 ? 98   LEU E C   1 
ATOM   5846  O  O   . LEU E  1 98  ? 53.749 91.505 101.536 1.00 52.70 ? 98   LEU E O   1 
ATOM   5847  C  CB  . LEU E  1 98  ? 55.108 90.906 98.525  1.00 58.04 ? 98   LEU E CB  1 
ATOM   5848  C  CG  . LEU E  1 98  ? 55.645 89.738 97.692  1.00 59.24 ? 98   LEU E CG  1 
ATOM   5849  C  CD1 . LEU E  1 98  ? 57.085 90.040 97.286  1.00 58.06 ? 98   LEU E CD1 1 
ATOM   5850  C  CD2 . LEU E  1 98  ? 55.593 88.447 98.490  1.00 57.33 ? 98   LEU E CD2 1 
ATOM   5851  N  N   . PRO E  1 99  ? 53.456 93.075 99.961  1.00 55.52 ? 99   PRO E N   1 
ATOM   5852  C  CA  . PRO E  1 99  ? 53.339 94.117 100.981 1.00 55.86 ? 99   PRO E CA  1 
ATOM   5853  C  C   . PRO E  1 99  ? 52.419 93.702 102.127 1.00 55.34 ? 99   PRO E C   1 
ATOM   5854  O  O   . PRO E  1 99  ? 52.686 94.015 103.290 1.00 55.66 ? 99   PRO E O   1 
ATOM   5855  C  CB  . PRO E  1 99  ? 52.801 95.305 100.189 1.00 54.62 ? 99   PRO E CB  1 
ATOM   5856  C  CG  . PRO E  1 99  ? 53.501 95.143 98.884  1.00 55.98 ? 99   PRO E CG  1 
ATOM   5857  C  CD  . PRO E  1 99  ? 53.340 93.656 98.611  1.00 56.44 ? 99   PRO E CD  1 
ATOM   5858  N  N   . ASP E  1 100 ? 51.344 92.990 101.803 1.00 54.18 ? 100  ASP E N   1 
ATOM   5859  C  CA  . ASP E  1 100 ? 50.415 92.551 102.836 1.00 53.90 ? 100  ASP E CA  1 
ATOM   5860  C  C   . ASP E  1 100 ? 51.043 91.466 103.713 1.00 51.77 ? 100  ASP E C   1 
ATOM   5861  O  O   . ASP E  1 100 ? 50.911 91.502 104.939 1.00 51.65 ? 100  ASP E O   1 
ATOM   5862  C  CB  . ASP E  1 100 ? 49.103 92.056 102.214 1.00 57.11 ? 100  ASP E CB  1 
ATOM   5863  C  CG  . ASP E  1 100 ? 48.287 93.185 101.588 1.00 59.82 ? 100  ASP E CG  1 
ATOM   5864  O  OD1 . ASP E  1 100 ? 48.178 94.260 102.213 1.00 63.15 ? 100  ASP E OD1 1 
ATOM   5865  O  OD2 . ASP E  1 100 ? 47.744 92.997 100.477 1.00 63.19 ? 100  ASP E OD2 1 
ATOM   5866  N  N   . LEU E  1 101 ? 51.733 90.513 103.088 1.00 47.11 ? 101  LEU E N   1 
ATOM   5867  C  CA  . LEU E  1 101 ? 52.398 89.442 103.822 1.00 43.17 ? 101  LEU E CA  1 
ATOM   5868  C  C   . LEU E  1 101 ? 53.435 90.012 104.790 1.00 43.38 ? 101  LEU E C   1 
ATOM   5869  O  O   . LEU E  1 101 ? 53.537 89.582 105.941 1.00 43.30 ? 101  LEU E O   1 
ATOM   5870  C  CB  . LEU E  1 101 ? 53.098 88.491 102.854 1.00 40.62 ? 101  LEU E CB  1 
ATOM   5871  C  CG  . LEU E  1 101 ? 52.304 87.301 102.313 1.00 41.32 ? 101  LEU E CG  1 
ATOM   5872  C  CD1 . LEU E  1 101 ? 53.090 86.628 101.200 1.00 39.16 ? 101  LEU E CD1 1 
ATOM   5873  C  CD2 . LEU E  1 101 ? 52.012 86.317 103.447 1.00 39.65 ? 101  LEU E CD2 1 
ATOM   5874  N  N   . LYS E  1 102 ? 54.203 90.985 104.313 1.00 42.43 ? 102  LYS E N   1 
ATOM   5875  C  CA  . LYS E  1 102 ? 55.241 91.606 105.119 1.00 39.78 ? 102  LYS E CA  1 
ATOM   5876  C  C   . LYS E  1 102 ? 54.688 92.511 106.204 1.00 37.93 ? 102  LYS E C   1 
ATOM   5877  O  O   . LYS E  1 102 ? 55.245 92.579 107.298 1.00 36.05 ? 102  LYS E O   1 
ATOM   5878  C  CB  . LYS E  1 102 ? 56.199 92.377 104.217 1.00 40.44 ? 102  LYS E CB  1 
ATOM   5879  C  CG  . LYS E  1 102 ? 57.021 91.456 103.332 1.00 40.18 ? 102  LYS E CG  1 
ATOM   5880  C  CD  . LYS E  1 102 ? 58.045 92.209 102.513 1.00 40.66 ? 102  LYS E CD  1 
ATOM   5881  C  CE  . LYS E  1 102 ? 58.843 91.242 101.660 1.00 42.78 ? 102  LYS E CE  1 
ATOM   5882  N  NZ  . LYS E  1 102 ? 59.810 91.975 100.809 1.00 50.64 ? 102  LYS E NZ  1 
ATOM   5883  N  N   . ALA E  1 103 ? 53.594 93.203 105.900 1.00 36.07 ? 103  ALA E N   1 
ATOM   5884  C  CA  . ALA E  1 103 ? 52.961 94.083 106.873 1.00 33.36 ? 103  ALA E CA  1 
ATOM   5885  C  C   . ALA E  1 103 ? 52.395 93.206 107.987 1.00 36.32 ? 103  ALA E C   1 
ATOM   5886  O  O   . ALA E  1 103 ? 52.306 93.625 109.146 1.00 39.92 ? 103  ALA E O   1 
ATOM   5887  C  CB  . ALA E  1 103 ? 51.852 94.857 106.221 1.00 27.77 ? 103  ALA E CB  1 
ATOM   5888  N  N   . ALA E  1 104 ? 52.018 91.982 107.628 1.00 33.57 ? 104  ALA E N   1 
ATOM   5889  C  CA  . ALA E  1 104 ? 51.456 91.039 108.585 1.00 31.76 ? 104  ALA E CA  1 
ATOM   5890  C  C   . ALA E  1 104 ? 52.549 90.413 109.454 1.00 31.29 ? 104  ALA E C   1 
ATOM   5891  O  O   . ALA E  1 104 ? 52.394 90.301 110.671 1.00 31.71 ? 104  ALA E O   1 
ATOM   5892  C  CB  . ALA E  1 104 ? 50.676 89.959 107.848 1.00 30.22 ? 104  ALA E CB  1 
ATOM   5893  N  N   . ILE E  1 105 ? 53.652 90.001 108.836 1.00 29.32 ? 105  ILE E N   1 
ATOM   5894  C  CA  . ILE E  1 105 ? 54.756 89.415 109.595 1.00 29.15 ? 105  ILE E CA  1 
ATOM   5895  C  C   . ILE E  1 105 ? 55.220 90.464 110.617 1.00 30.77 ? 105  ILE E C   1 
ATOM   5896  O  O   . ILE E  1 105 ? 55.384 90.177 111.811 1.00 29.76 ? 105  ILE E O   1 
ATOM   5897  C  CB  . ILE E  1 105 ? 55.941 89.042 108.659 1.00 28.28 ? 105  ILE E CB  1 
ATOM   5898  C  CG1 . ILE E  1 105 ? 55.537 87.881 107.749 1.00 26.74 ? 105  ILE E CG1 1 
ATOM   5899  C  CG2 . ILE E  1 105 ? 57.183 88.669 109.477 1.00 23.04 ? 105  ILE E CG2 1 
ATOM   5900  C  CD1 . ILE E  1 105 ? 56.481 87.675 106.571 1.00 26.02 ? 105  ILE E CD1 1 
ATOM   5901  N  N   . ALA E  1 106 ? 55.414 91.684 110.126 1.00 29.58 ? 106  ALA E N   1 
ATOM   5902  C  CA  . ALA E  1 106 ? 55.843 92.795 110.955 1.00 27.92 ? 106  ALA E CA  1 
ATOM   5903  C  C   . ALA E  1 106 ? 54.885 92.981 112.115 1.00 28.98 ? 106  ALA E C   1 
ATOM   5904  O  O   . ALA E  1 106 ? 55.313 93.212 113.246 1.00 30.52 ? 106  ALA E O   1 
ATOM   5905  C  CB  . ALA E  1 106 ? 55.898 94.065 110.130 1.00 27.03 ? 106  ALA E CB  1 
ATOM   5906  N  N   . TYR E  1 107 ? 53.588 92.877 111.842 1.00 28.46 ? 107  TYR E N   1 
ATOM   5907  C  CA  . TYR E  1 107 ? 52.607 93.065 112.897 1.00 29.96 ? 107  TYR E CA  1 
ATOM   5908  C  C   . TYR E  1 107 ? 52.699 91.966 113.949 1.00 32.44 ? 107  TYR E C   1 
ATOM   5909  O  O   . TYR E  1 107 ? 52.730 92.242 115.151 1.00 34.18 ? 107  TYR E O   1 
ATOM   5910  C  CB  . TYR E  1 107 ? 51.185 93.101 112.338 1.00 32.47 ? 107  TYR E CB  1 
ATOM   5911  C  CG  . TYR E  1 107 ? 50.202 93.488 113.407 1.00 35.31 ? 107  TYR E CG  1 
ATOM   5912  C  CD1 . TYR E  1 107 ? 50.062 94.820 113.795 1.00 36.18 ? 107  TYR E CD1 1 
ATOM   5913  C  CD2 . TYR E  1 107 ? 49.528 92.513 114.143 1.00 38.17 ? 107  TYR E CD2 1 
ATOM   5914  C  CE1 . TYR E  1 107 ? 49.290 95.173 114.899 1.00 39.74 ? 107  TYR E CE1 1 
ATOM   5915  C  CE2 . TYR E  1 107 ? 48.754 92.851 115.250 1.00 40.24 ? 107  TYR E CE2 1 
ATOM   5916  C  CZ  . TYR E  1 107 ? 48.642 94.183 115.627 1.00 42.56 ? 107  TYR E CZ  1 
ATOM   5917  O  OH  . TYR E  1 107 ? 47.908 94.522 116.746 1.00 47.31 ? 107  TYR E OH  1 
ATOM   5918  N  N   . CYS E  1 108 ? 52.737 90.717 113.502 1.00 31.43 ? 108  CYS E N   1 
ATOM   5919  C  CA  . CYS E  1 108 ? 52.830 89.609 114.438 1.00 32.13 ? 108  CYS E CA  1 
ATOM   5920  C  C   . CYS E  1 108 ? 54.017 89.816 115.380 1.00 32.47 ? 108  CYS E C   1 
ATOM   5921  O  O   . CYS E  1 108 ? 53.936 89.513 116.574 1.00 30.27 ? 108  CYS E O   1 
ATOM   5922  C  CB  . CYS E  1 108 ? 52.959 88.293 113.672 1.00 33.15 ? 108  CYS E CB  1 
ATOM   5923  S  SG  . CYS E  1 108 ? 51.433 87.838 112.806 1.00 35.57 ? 108  CYS E SG  1 
ATOM   5924  N  N   . GLU E  1 109 ? 55.113 90.339 114.836 1.00 33.29 ? 109  GLU E N   1 
ATOM   5925  C  CA  . GLU E  1 109 ? 56.310 90.624 115.626 1.00 33.90 ? 109  GLU E CA  1 
ATOM   5926  C  C   . GLU E  1 109 ? 55.965 91.572 116.761 1.00 34.21 ? 109  GLU E C   1 
ATOM   5927  O  O   . GLU E  1 109 ? 56.323 91.336 117.915 1.00 32.70 ? 109  GLU E O   1 
ATOM   5928  C  CB  . GLU E  1 109 ? 57.371 91.316 114.771 1.00 32.80 ? 109  GLU E CB  1 
ATOM   5929  C  CG  . GLU E  1 109 ? 58.484 90.436 114.330 1.00 34.94 ? 109  GLU E CG  1 
ATOM   5930  C  CD  . GLU E  1 109 ? 59.260 89.845 115.491 1.00 35.36 ? 109  GLU E CD  1 
ATOM   5931  O  OE1 . GLU E  1 109 ? 59.899 90.613 116.247 1.00 35.07 ? 109  GLU E OE1 1 
ATOM   5932  O  OE2 . GLU E  1 109 ? 59.232 88.606 115.644 1.00 35.82 ? 109  GLU E OE2 1 
ATOM   5933  N  N   . SER E  1 110 ? 55.273 92.653 116.410 1.00 33.83 ? 110  SER E N   1 
ATOM   5934  C  CA  . SER E  1 110 ? 54.909 93.676 117.372 1.00 36.31 ? 110  SER E CA  1 
ATOM   5935  C  C   . SER E  1 110 ? 54.046 93.171 118.511 1.00 34.97 ? 110  SER E C   1 
ATOM   5936  O  O   . SER E  1 110 ? 54.190 93.644 119.636 1.00 37.10 ? 110  SER E O   1 
ATOM   5937  C  CB  . SER E  1 110 ? 54.197 94.834 116.675 1.00 40.29 ? 110  SER E CB  1 
ATOM   5938  O  OG  . SER E  1 110 ? 52.858 94.491 116.361 1.00 48.30 ? 110  SER E OG  1 
ATOM   5939  N  N   . VAL E  1 111 ? 53.155 92.220 118.243 1.00 33.15 ? 111  VAL E N   1 
ATOM   5940  C  CA  . VAL E  1 111 ? 52.297 91.710 119.315 1.00 32.64 ? 111  VAL E CA  1 
ATOM   5941  C  C   . VAL E  1 111 ? 52.723 90.345 119.847 1.00 30.63 ? 111  VAL E C   1 
ATOM   5942  O  O   . VAL E  1 111 ? 51.980 89.691 120.573 1.00 33.24 ? 111  VAL E O   1 
ATOM   5943  C  CB  . VAL E  1 111 ? 50.809 91.644 118.876 1.00 32.34 ? 111  VAL E CB  1 
ATOM   5944  C  CG1 . VAL E  1 111 ? 50.476 92.862 118.025 1.00 33.19 ? 111  VAL E CG1 1 
ATOM   5945  C  CG2 . VAL E  1 111 ? 50.520 90.347 118.141 1.00 31.01 ? 111  VAL E CG2 1 
ATOM   5946  N  N   . GLY E  1 112 ? 53.919 89.913 119.476 1.00 30.50 ? 112  GLY E N   1 
ATOM   5947  C  CA  . GLY E  1 112 ? 54.421 88.640 119.952 1.00 28.85 ? 112  GLY E CA  1 
ATOM   5948  C  C   . GLY E  1 112 ? 53.749 87.378 119.447 1.00 31.56 ? 112  GLY E C   1 
ATOM   5949  O  O   . GLY E  1 112 ? 53.919 86.320 120.059 1.00 31.08 ? 112  GLY E O   1 
ATOM   5950  N  N   . ASP E  1 113 ? 52.979 87.456 118.359 1.00 34.88 ? 113  ASP E N   1 
ATOM   5951  C  CA  . ASP E  1 113 ? 52.347 86.238 117.838 1.00 34.19 ? 113  ASP E CA  1 
ATOM   5952  C  C   . ASP E  1 113 ? 53.331 85.578 116.886 1.00 31.51 ? 113  ASP E C   1 
ATOM   5953  O  O   . ASP E  1 113 ? 53.170 85.601 115.667 1.00 32.36 ? 113  ASP E O   1 
ATOM   5954  C  CB  . ASP E  1 113 ? 51.033 86.533 117.113 1.00 35.31 ? 113  ASP E CB  1 
ATOM   5955  C  CG  . ASP E  1 113 ? 50.321 85.253 116.675 1.00 37.80 ? 113  ASP E CG  1 
ATOM   5956  O  OD1 . ASP E  1 113 ? 50.635 84.178 117.233 1.00 41.34 ? 113  ASP E OD1 1 
ATOM   5957  O  OD2 . ASP E  1 113 ? 49.446 85.312 115.789 1.00 35.14 ? 113  ASP E OD2 1 
ATOM   5958  N  N   . TYR E  1 114 ? 54.355 84.986 117.483 1.00 29.02 ? 114  TYR E N   1 
ATOM   5959  C  CA  . TYR E  1 114 ? 55.432 84.335 116.768 1.00 27.47 ? 114  TYR E CA  1 
ATOM   5960  C  C   . TYR E  1 114 ? 55.042 83.145 115.905 1.00 27.24 ? 114  TYR E C   1 
ATOM   5961  O  O   . TYR E  1 114 ? 55.616 82.941 114.838 1.00 28.40 ? 114  TYR E O   1 
ATOM   5962  C  CB  . TYR E  1 114 ? 56.505 83.942 117.781 1.00 26.34 ? 114  TYR E CB  1 
ATOM   5963  C  CG  . TYR E  1 114 ? 57.021 85.138 118.575 1.00 29.05 ? 114  TYR E CG  1 
ATOM   5964  C  CD1 . TYR E  1 114 ? 57.713 86.176 117.935 1.00 28.36 ? 114  TYR E CD1 1 
ATOM   5965  C  CD2 . TYR E  1 114 ? 56.836 85.225 119.963 1.00 26.98 ? 114  TYR E CD2 1 
ATOM   5966  C  CE1 . TYR E  1 114 ? 58.217 87.268 118.654 1.00 29.32 ? 114  TYR E CE1 1 
ATOM   5967  C  CE2 . TYR E  1 114 ? 57.335 86.313 120.696 1.00 26.04 ? 114  TYR E CE2 1 
ATOM   5968  C  CZ  . TYR E  1 114 ? 58.031 87.331 120.034 1.00 30.95 ? 114  TYR E CZ  1 
ATOM   5969  O  OH  . TYR E  1 114 ? 58.578 88.386 120.741 1.00 26.85 ? 114  TYR E OH  1 
ATOM   5970  N  N   . ALA E  1 115 ? 54.070 82.361 116.346 1.00 27.84 ? 115  ALA E N   1 
ATOM   5971  C  CA  . ALA E  1 115 ? 53.659 81.199 115.572 1.00 27.06 ? 115  ALA E CA  1 
ATOM   5972  C  C   . ALA E  1 115 ? 53.012 81.646 114.262 1.00 29.86 ? 115  ALA E C   1 
ATOM   5973  O  O   . ALA E  1 115 ? 53.302 81.094 113.203 1.00 33.74 ? 115  ALA E O   1 
ATOM   5974  C  CB  . ALA E  1 115 ? 52.698 80.333 116.386 1.00 25.54 ? 115  ALA E CB  1 
ATOM   5975  N  N   . SER E  1 116 ? 52.138 82.643 114.317 1.00 29.31 ? 116  SER E N   1 
ATOM   5976  C  CA  . SER E  1 116 ? 51.517 83.126 113.091 1.00 29.11 ? 116  SER E CA  1 
ATOM   5977  C  C   . SER E  1 116 ? 52.593 83.707 112.185 1.00 31.56 ? 116  SER E C   1 
ATOM   5978  O  O   . SER E  1 116 ? 52.491 83.625 110.959 1.00 33.09 ? 116  SER E O   1 
ATOM   5979  C  CB  . SER E  1 116 ? 50.479 84.195 113.395 1.00 28.87 ? 116  SER E CB  1 
ATOM   5980  O  OG  . SER E  1 116 ? 49.398 83.632 114.112 1.00 35.72 ? 116  SER E OG  1 
ATOM   5981  N  N   . ARG E  1 117 ? 53.627 84.297 112.783 1.00 29.80 ? 117  ARG E N   1 
ATOM   5982  C  CA  . ARG E  1 117 ? 54.707 84.857 111.985 1.00 30.05 ? 117  ARG E CA  1 
ATOM   5983  C  C   . ARG E  1 117 ? 55.385 83.767 111.154 1.00 32.98 ? 117  ARG E C   1 
ATOM   5984  O  O   . ARG E  1 117 ? 55.736 83.989 109.994 1.00 34.11 ? 117  ARG E O   1 
ATOM   5985  C  CB  . ARG E  1 117 ? 55.762 85.537 112.861 1.00 29.12 ? 117  ARG E CB  1 
ATOM   5986  C  CG  . ARG E  1 117 ? 57.065 85.749 112.095 1.00 26.66 ? 117  ARG E CG  1 
ATOM   5987  C  CD  . ARG E  1 117 ? 58.044 86.711 112.738 1.00 26.08 ? 117  ARG E CD  1 
ATOM   5988  N  NE  . ARG E  1 117 ? 59.137 86.965 111.805 1.00 26.16 ? 117  ARG E NE  1 
ATOM   5989  C  CZ  . ARG E  1 117 ? 60.029 87.942 111.920 1.00 26.09 ? 117  ARG E CZ  1 
ATOM   5990  N  NH1 . ARG E  1 117 ? 59.976 88.776 112.941 1.00 23.04 ? 117  ARG E NH1 1 
ATOM   5991  N  NH2 . ARG E  1 117 ? 60.966 88.100 110.994 1.00 29.46 ? 117  ARG E NH2 1 
ATOM   5992  N  N   . GLU E  1 118 ? 55.583 82.597 111.757 1.00 34.53 ? 118  GLU E N   1 
ATOM   5993  C  CA  . GLU E  1 118 ? 56.222 81.485 111.062 1.00 34.72 ? 118  GLU E CA  1 
ATOM   5994  C  C   . GLU E  1 118 ? 55.329 81.001 109.931 1.00 33.97 ? 118  GLU E C   1 
ATOM   5995  O  O   . GLU E  1 118 ? 55.809 80.625 108.864 1.00 35.27 ? 118  GLU E O   1 
ATOM   5996  C  CB  . GLU E  1 118 ? 56.504 80.327 112.025 1.00 35.05 ? 118  GLU E CB  1 
ATOM   5997  C  CG  . GLU E  1 118 ? 57.497 80.673 113.093 1.00 44.59 ? 118  GLU E CG  1 
ATOM   5998  C  CD  . GLU E  1 118 ? 58.766 81.258 112.511 1.00 52.83 ? 118  GLU E CD  1 
ATOM   5999  O  OE1 . GLU E  1 118 ? 59.483 80.517 111.803 1.00 57.02 ? 118  GLU E OE1 1 
ATOM   6000  O  OE2 . GLU E  1 118 ? 59.042 82.459 112.749 1.00 57.66 ? 118  GLU E OE2 1 
ATOM   6001  N  N   . LEU E  1 119 ? 54.024 81.010 110.160 1.00 32.06 ? 119  LEU E N   1 
ATOM   6002  C  CA  . LEU E  1 119 ? 53.112 80.559 109.129 1.00 29.48 ? 119  LEU E CA  1 
ATOM   6003  C  C   . LEU E  1 119 ? 53.286 81.474 107.927 1.00 28.00 ? 119  LEU E C   1 
ATOM   6004  O  O   . LEU E  1 119 ? 53.540 81.012 106.821 1.00 24.56 ? 119  LEU E O   1 
ATOM   6005  C  CB  . LEU E  1 119 ? 51.674 80.633 109.628 1.00 31.18 ? 119  LEU E CB  1 
ATOM   6006  C  CG  . LEU E  1 119 ? 50.621 79.874 108.818 1.00 35.49 ? 119  LEU E CG  1 
ATOM   6007  C  CD1 . LEU E  1 119 ? 49.237 80.278 109.318 1.00 37.27 ? 119  LEU E CD1 1 
ATOM   6008  C  CD2 . LEU E  1 119 ? 50.752 80.172 107.333 1.00 37.14 ? 119  LEU E CD2 1 
ATOM   6009  N  N   . LEU E  1 120 ? 53.158 82.776 108.159 1.00 28.75 ? 120  LEU E N   1 
ATOM   6010  C  CA  . LEU E  1 120 ? 53.275 83.762 107.092 1.00 29.91 ? 120  LEU E CA  1 
ATOM   6011  C  C   . LEU E  1 120 ? 54.613 83.687 106.372 1.00 32.00 ? 120  LEU E C   1 
ATOM   6012  O  O   . LEU E  1 120 ? 54.658 83.747 105.143 1.00 33.90 ? 120  LEU E O   1 
ATOM   6013  C  CB  . LEU E  1 120 ? 53.054 85.173 107.645 1.00 28.86 ? 120  LEU E CB  1 
ATOM   6014  C  CG  . LEU E  1 120 ? 51.727 85.438 108.379 1.00 28.35 ? 120  LEU E CG  1 
ATOM   6015  C  CD1 . LEU E  1 120 ? 51.684 86.897 108.806 1.00 22.40 ? 120  LEU E CD1 1 
ATOM   6016  C  CD2 . LEU E  1 120 ? 50.528 85.097 107.487 1.00 21.03 ? 120  LEU E CD2 1 
ATOM   6017  N  N   . GLU E  1 121 ? 55.700 83.553 107.130 1.00 34.23 ? 121  GLU E N   1 
ATOM   6018  C  CA  . GLU E  1 121 ? 57.035 83.456 106.538 1.00 36.12 ? 121  GLU E CA  1 
ATOM   6019  C  C   . GLU E  1 121 ? 57.105 82.336 105.509 1.00 35.84 ? 121  GLU E C   1 
ATOM   6020  O  O   . GLU E  1 121 ? 57.623 82.523 104.409 1.00 33.93 ? 121  GLU E O   1 
ATOM   6021  C  CB  . GLU E  1 121 ? 58.082 83.197 107.609 1.00 37.05 ? 121  GLU E CB  1 
ATOM   6022  C  CG  . GLU E  1 121 ? 58.613 84.434 108.274 1.00 45.14 ? 121  GLU E CG  1 
ATOM   6023  C  CD  . GLU E  1 121 ? 59.736 84.100 109.233 1.00 50.80 ? 121  GLU E CD  1 
ATOM   6024  O  OE1 . GLU E  1 121 ? 60.505 83.172 108.908 1.00 55.53 ? 121  GLU E OE1 1 
ATOM   6025  O  OE2 . GLU E  1 121 ? 59.859 84.754 110.293 1.00 52.79 ? 121  GLU E OE2 1 
ATOM   6026  N  N   . ASP E  1 122 ? 56.588 81.169 105.880 1.00 36.82 ? 122  ASP E N   1 
ATOM   6027  C  CA  . ASP E  1 122 ? 56.579 80.022 104.984 1.00 36.19 ? 122  ASP E CA  1 
ATOM   6028  C  C   . ASP E  1 122 ? 55.860 80.341 103.684 1.00 33.16 ? 122  ASP E C   1 
ATOM   6029  O  O   . ASP E  1 122 ? 56.425 80.174 102.609 1.00 31.59 ? 122  ASP E O   1 
ATOM   6030  C  CB  . ASP E  1 122 ? 55.916 78.809 105.647 1.00 40.81 ? 122  ASP E CB  1 
ATOM   6031  C  CG  . ASP E  1 122 ? 56.768 78.209 106.759 1.00 51.20 ? 122  ASP E CG  1 
ATOM   6032  O  OD1 . ASP E  1 122 ? 57.999 78.447 106.761 1.00 57.67 ? 122  ASP E OD1 1 
ATOM   6033  O  OD2 . ASP E  1 122 ? 56.213 77.489 107.623 1.00 54.17 ? 122  ASP E OD2 1 
ATOM   6034  N  N   . ILE E  1 123 ? 54.620 80.808 103.761 1.00 32.23 ? 123  ILE E N   1 
ATOM   6035  C  CA  . ILE E  1 123 ? 53.928 81.097 102.521 1.00 32.52 ? 123  ILE E CA  1 
ATOM   6036  C  C   . ILE E  1 123 ? 54.650 82.248 101.818 1.00 31.32 ? 123  ILE E C   1 
ATOM   6037  O  O   . ILE E  1 123 ? 54.642 82.335 100.596 1.00 28.80 ? 123  ILE E O   1 
ATOM   6038  C  CB  . ILE E  1 123 ? 52.374 81.352 102.731 1.00 34.27 ? 123  ILE E CB  1 
ATOM   6039  C  CG1 . ILE E  1 123 ? 51.974 82.739 102.258 1.00 36.11 ? 123  ILE E CG1 1 
ATOM   6040  C  CG2 . ILE E  1 123 ? 51.968 81.143 104.175 1.00 32.35 ? 123  ILE E CG2 1 
ATOM   6041  C  CD1 . ILE E  1 123 ? 50.472 82.897 102.186 1.00 37.81 ? 123  ILE E CD1 1 
ATOM   6042  N  N   . LEU E  1 124 ? 55.323 83.101 102.579 1.00 31.56 ? 124  LEU E N   1 
ATOM   6043  C  CA  . LEU E  1 124 ? 56.069 84.197 101.960 1.00 33.85 ? 124  LEU E CA  1 
ATOM   6044  C  C   . LEU E  1 124 ? 57.182 83.632 101.079 1.00 35.52 ? 124  LEU E C   1 
ATOM   6045  O  O   . LEU E  1 124 ? 57.319 84.008 99.916  1.00 38.90 ? 124  LEU E O   1 
ATOM   6046  C  CB  . LEU E  1 124 ? 56.699 85.116 103.018 1.00 33.78 ? 124  LEU E CB  1 
ATOM   6047  C  CG  . LEU E  1 124 ? 57.637 86.201 102.462 1.00 29.75 ? 124  LEU E CG  1 
ATOM   6048  C  CD1 . LEU E  1 124 ? 56.927 86.988 101.391 1.00 31.01 ? 124  LEU E CD1 1 
ATOM   6049  C  CD2 . LEU E  1 124 ? 58.082 87.131 103.562 1.00 30.41 ? 124  LEU E CD2 1 
ATOM   6050  N  N   . GLU E  1 125 ? 57.984 82.732 101.638 1.00 35.51 ? 125  GLU E N   1 
ATOM   6051  C  CA  . GLU E  1 125 ? 59.071 82.129 100.887 1.00 36.87 ? 125  GLU E CA  1 
ATOM   6052  C  C   . GLU E  1 125 ? 58.532 81.428 99.647  1.00 36.30 ? 125  GLU E C   1 
ATOM   6053  O  O   . GLU E  1 125 ? 59.195 81.374 98.620  1.00 37.32 ? 125  GLU E O   1 
ATOM   6054  C  CB  . GLU E  1 125 ? 59.842 81.147 101.775 1.00 39.14 ? 125  GLU E CB  1 
ATOM   6055  C  CG  . GLU E  1 125 ? 60.522 81.828 102.957 1.00 48.02 ? 125  GLU E CG  1 
ATOM   6056  C  CD  . GLU E  1 125 ? 61.305 80.867 103.838 1.00 55.44 ? 125  GLU E CD  1 
ATOM   6057  O  OE1 . GLU E  1 125 ? 60.678 80.003 104.494 1.00 58.04 ? 125  GLU E OE1 1 
ATOM   6058  O  OE2 . GLU E  1 125 ? 62.554 80.975 103.877 1.00 59.50 ? 125  GLU E OE2 1 
ATOM   6059  N  N   . SER E  1 126 ? 57.323 80.894 99.737  1.00 36.75 ? 126  SER E N   1 
ATOM   6060  C  CA  . SER E  1 126 ? 56.723 80.222 98.597  1.00 37.88 ? 126  SER E CA  1 
ATOM   6061  C  C   . SER E  1 126 ? 56.335 81.259 97.544  1.00 37.82 ? 126  SER E C   1 
ATOM   6062  O  O   . SER E  1 126 ? 56.489 81.035 96.342  1.00 37.55 ? 126  SER E O   1 
ATOM   6063  C  CB  . SER E  1 126 ? 55.485 79.440 99.037  1.00 39.14 ? 126  SER E CB  1 
ATOM   6064  O  OG  . SER E  1 126 ? 54.776 78.950 97.909  1.00 44.92 ? 126  SER E OG  1 
ATOM   6065  N  N   . GLU E  1 127 ? 55.827 82.396 98.003  1.00 37.85 ? 127  GLU E N   1 
ATOM   6066  C  CA  . GLU E  1 127 ? 55.423 83.466 97.103  1.00 38.54 ? 127  GLU E CA  1 
ATOM   6067  C  C   . GLU E  1 127 ? 56.593 84.004 96.292  1.00 39.60 ? 127  GLU E C   1 
ATOM   6068  O  O   . GLU E  1 127 ? 56.453 84.246 95.094  1.00 39.42 ? 127  GLU E O   1 
ATOM   6069  C  CB  . GLU E  1 127 ? 54.767 84.603 97.881  1.00 38.64 ? 127  GLU E CB  1 
ATOM   6070  C  CG  . GLU E  1 127 ? 53.582 84.158 98.736  1.00 49.64 ? 127  GLU E CG  1 
ATOM   6071  C  CD  . GLU E  1 127 ? 52.530 83.370 97.956  1.00 55.60 ? 127  GLU E CD  1 
ATOM   6072  O  OE1 . GLU E  1 127 ? 52.670 83.267 96.720  1.00 58.50 ? 127  GLU E OE1 1 
ATOM   6073  O  OE2 . GLU E  1 127 ? 51.567 82.873 98.582  1.00 59.26 ? 127  GLU E OE2 1 
ATOM   6074  N  N   . GLU E  1 128 ? 57.750 84.195 96.921  1.00 40.17 ? 128  GLU E N   1 
ATOM   6075  C  CA  . GLU E  1 128 ? 58.895 84.710 96.180  1.00 39.44 ? 128  GLU E CA  1 
ATOM   6076  C  C   . GLU E  1 128 ? 59.315 83.726 95.089  1.00 42.15 ? 128  GLU E C   1 
ATOM   6077  O  O   . GLU E  1 128 ? 59.831 84.137 94.047  1.00 40.64 ? 128  GLU E O   1 
ATOM   6078  C  CB  . GLU E  1 128 ? 60.060 85.019 97.120  1.00 35.99 ? 128  GLU E CB  1 
ATOM   6079  C  CG  . GLU E  1 128 ? 59.774 86.180 98.078  1.00 37.05 ? 128  GLU E CG  1 
ATOM   6080  C  CD  . GLU E  1 128 ? 61.036 86.729 98.740  1.00 39.98 ? 128  GLU E CD  1 
ATOM   6081  O  OE1 . GLU E  1 128 ? 61.973 85.942 98.990  1.00 45.06 ? 128  GLU E OE1 1 
ATOM   6082  O  OE2 . GLU E  1 128 ? 61.097 87.942 99.026  1.00 38.97 ? 128  GLU E OE2 1 
ATOM   6083  N  N   . ASP E  1 129 ? 59.074 82.432 95.318  1.00 45.14 ? 129  ASP E N   1 
ATOM   6084  C  CA  . ASP E  1 129 ? 59.403 81.407 94.322  1.00 48.28 ? 129  ASP E CA  1 
ATOM   6085  C  C   . ASP E  1 129 ? 58.394 81.379 93.184  1.00 47.50 ? 129  ASP E C   1 
ATOM   6086  O  O   . ASP E  1 129 ? 58.724 80.994 92.062  1.00 48.62 ? 129  ASP E O   1 
ATOM   6087  C  CB  . ASP E  1 129 ? 59.497 80.025 94.955  1.00 50.26 ? 129  ASP E CB  1 
ATOM   6088  C  CG  . ASP E  1 129 ? 60.723 79.883 95.817  1.00 59.03 ? 129  ASP E CG  1 
ATOM   6089  O  OD1 . ASP E  1 129 ? 61.723 80.591 95.535  1.00 60.41 ? 129  ASP E OD1 1 
ATOM   6090  O  OD2 . ASP E  1 129 ? 60.695 79.067 96.767  1.00 64.52 ? 129  ASP E OD2 1 
ATOM   6091  N  N   . HIS E  1 130 ? 57.159 81.771 93.471  1.00 46.10 ? 130  HIS E N   1 
ATOM   6092  C  CA  . HIS E  1 130 ? 56.166 81.832 92.438  1.00 43.97 ? 130  HIS E CA  1 
ATOM   6093  C  C   . HIS E  1 130 ? 56.522 82.993 91.561  1.00 43.21 ? 130  HIS E C   1 
ATOM   6094  O  O   . HIS E  1 130 ? 56.408 82.933 90.333  1.00 43.20 ? 130  HIS E O   1 
ATOM   6095  C  CB  . HIS E  1 130 ? 54.779 82.064 93.017  1.00 43.60 ? 130  HIS E CB  1 
ATOM   6096  C  CG  . HIS E  1 130 ? 54.197 80.847 93.783  1.00 47.27 ? 130  HIS E CG  1 
ATOM   6097  N  ND1 . HIS E  1 130 ? 53.050 80.913 94.551  1.00 46.75 ? 130  HIS E ND1 1 
ATOM   6098  C  CD2 . HIS E  1 130 ? 54.623 79.563 93.858  1.00 46.13 ? 130  HIS E CD2 1 
ATOM   6099  C  CE1 . HIS E  1 130 ? 52.796 79.723 95.065  1.00 45.82 ? 130  HIS E CE1 1 
ATOM   6100  N  NE2 . HIS E  1 130 ? 53.734 78.886 94.660  1.00 45.67 ? 130  HIS E NE2 1 
ATOM   6101  N  N   . ILE E  1 131 ? 57.001 84.058 92.202  1.00 43.04 ? 131  ILE E N   1 
ATOM   6102  C  CA  . ILE E  1 131 ? 57.404 85.278 91.506  1.00 43.97 ? 131  ILE E CA  1 
ATOM   6103  C  C   . ILE E  1 131 ? 58.668 85.042 90.691  1.00 41.46 ? 131  ILE E C   1 
ATOM   6104  O  O   . ILE E  1 131 ? 58.852 85.643 89.634  1.00 39.42 ? 131  ILE E O   1 
ATOM   6105  C  CB  . ILE E  1 131 ? 57.675 86.449 92.495  1.00 45.39 ? 131  ILE E CB  1 
ATOM   6106  C  CG1 . ILE E  1 131 ? 56.404 86.778 93.290  1.00 48.00 ? 131  ILE E CG1 1 
ATOM   6107  C  CG2 . ILE E  1 131 ? 58.139 87.687 91.720  1.00 47.72 ? 131  ILE E CG2 1 
ATOM   6108  C  CD1 . ILE E  1 131 ? 56.519 87.998 94.209  1.00 46.00 ? 131  ILE E CD1 1 
ATOM   6109  N  N   . ASP E  1 132 ? 59.539 84.174 91.194  1.00 40.20 ? 132  ASP E N   1 
ATOM   6110  C  CA  . ASP E  1 132 ? 60.779 83.864 90.502  1.00 40.67 ? 132  ASP E CA  1 
ATOM   6111  C  C   . ASP E  1 132 ? 60.425 83.203 89.173  1.00 40.21 ? 132  ASP E C   1 
ATOM   6112  O  O   . ASP E  1 132 ? 60.781 83.706 88.102  1.00 39.78 ? 132  ASP E O   1 
ATOM   6113  C  CB  . ASP E  1 132 ? 61.642 82.930 91.365  1.00 43.98 ? 132  ASP E CB  1 
ATOM   6114  C  CG  . ASP E  1 132 ? 63.057 82.747 90.817  1.00 45.52 ? 132  ASP E CG  1 
ATOM   6115  O  OD1 . ASP E  1 132 ? 63.681 83.744 90.397  1.00 46.32 ? 132  ASP E OD1 1 
ATOM   6116  O  OD2 . ASP E  1 132 ? 63.553 81.600 90.824  1.00 49.00 ? 132  ASP E OD2 1 
ATOM   6117  N  N   . TRP E  1 133 ? 59.704 82.088 89.242  1.00 36.56 ? 133  TRP E N   1 
ATOM   6118  C  CA  . TRP E  1 133 ? 59.310 81.377 88.037  1.00 36.44 ? 133  TRP E CA  1 
ATOM   6119  C  C   . TRP E  1 133 ? 58.660 82.341 87.042  1.00 37.79 ? 133  TRP E C   1 
ATOM   6120  O  O   . TRP E  1 133 ? 59.097 82.448 85.895  1.00 41.70 ? 133  TRP E O   1 
ATOM   6121  C  CB  . TRP E  1 133 ? 58.334 80.256 88.381  1.00 35.68 ? 133  TRP E CB  1 
ATOM   6122  C  CG  . TRP E  1 133 ? 57.945 79.425 87.201  1.00 36.29 ? 133  TRP E CG  1 
ATOM   6123  C  CD1 . TRP E  1 133 ? 58.675 78.424 86.620  1.00 37.25 ? 133  TRP E CD1 1 
ATOM   6124  C  CD2 . TRP E  1 133 ? 56.733 79.527 86.444  1.00 35.81 ? 133  TRP E CD2 1 
ATOM   6125  N  NE1 . TRP E  1 133 ? 57.989 77.896 85.551  1.00 34.93 ? 133  TRP E NE1 1 
ATOM   6126  C  CE2 . TRP E  1 133 ? 56.795 78.555 85.422  1.00 33.34 ? 133  TRP E CE2 1 
ATOM   6127  C  CE3 . TRP E  1 133 ? 55.598 80.345 86.534  1.00 37.37 ? 133  TRP E CE3 1 
ATOM   6128  C  CZ2 . TRP E  1 133 ? 55.768 78.379 84.496  1.00 32.92 ? 133  TRP E CZ2 1 
ATOM   6129  C  CZ3 . TRP E  1 133 ? 54.573 80.167 85.611  1.00 36.74 ? 133  TRP E CZ3 1 
ATOM   6130  C  CH2 . TRP E  1 133 ? 54.666 79.190 84.606  1.00 35.29 ? 133  TRP E CH2 1 
ATOM   6131  N  N   . LEU E  1 134 ? 57.622 83.045 87.477  1.00 35.27 ? 134  LEU E N   1 
ATOM   6132  C  CA  . LEU E  1 134 ? 56.949 83.991 86.598  1.00 35.08 ? 134  LEU E CA  1 
ATOM   6133  C  C   . LEU E  1 134 ? 57.926 84.930 85.890  1.00 37.25 ? 134  LEU E C   1 
ATOM   6134  O  O   . LEU E  1 134 ? 57.932 84.999 84.662  1.00 41.12 ? 134  LEU E O   1 
ATOM   6135  C  CB  . LEU E  1 134 ? 55.918 84.808 87.379  1.00 33.79 ? 134  LEU E CB  1 
ATOM   6136  C  CG  . LEU E  1 134 ? 54.735 84.009 87.944  1.00 35.17 ? 134  LEU E CG  1 
ATOM   6137  C  CD1 . LEU E  1 134 ? 53.975 84.861 88.946  1.00 34.03 ? 134  LEU E CD1 1 
ATOM   6138  C  CD2 . LEU E  1 134 ? 53.821 83.547 86.812  1.00 32.37 ? 134  LEU E CD2 1 
ATOM   6139  N  N   . GLU E  1 135 ? 58.755 85.651 86.643  1.00 38.53 ? 135  GLU E N   1 
ATOM   6140  C  CA  . GLU E  1 135 ? 59.712 86.576 86.022  1.00 40.43 ? 135  GLU E CA  1 
ATOM   6141  C  C   . GLU E  1 135 ? 60.588 85.816 85.026  1.00 40.10 ? 135  GLU E C   1 
ATOM   6142  O  O   . GLU E  1 135 ? 60.840 86.275 83.912  1.00 39.93 ? 135  GLU E O   1 
ATOM   6143  C  CB  . GLU E  1 135 ? 60.613 87.226 87.079  1.00 42.44 ? 135  GLU E CB  1 
ATOM   6144  C  CG  . GLU E  1 135 ? 59.875 87.962 88.184  1.00 48.36 ? 135  GLU E CG  1 
ATOM   6145  C  CD  . GLU E  1 135 ? 60.805 88.445 89.291  1.00 49.65 ? 135  GLU E CD  1 
ATOM   6146  O  OE1 . GLU E  1 135 ? 61.684 87.660 89.715  1.00 51.01 ? 135  GLU E OE1 1 
ATOM   6147  O  OE2 . GLU E  1 135 ? 60.648 89.601 89.745  1.00 50.33 ? 135  GLU E OE2 1 
ATOM   6148  N  N   . THR E  1 136 ? 61.048 84.645 85.450  1.00 39.29 ? 136  THR E N   1 
ATOM   6149  C  CA  . THR E  1 136 ? 61.898 83.799 84.629  1.00 37.71 ? 136  THR E CA  1 
ATOM   6150  C  C   . THR E  1 136 ? 61.270 83.546 83.259  1.00 37.15 ? 136  THR E C   1 
ATOM   6151  O  O   . THR E  1 136 ? 61.961 83.575 82.237  1.00 35.94 ? 136  THR E O   1 
ATOM   6152  C  CB  . THR E  1 136 ? 62.143 82.444 85.329  1.00 38.23 ? 136  THR E CB  1 
ATOM   6153  O  OG1 . THR E  1 136 ? 62.794 82.669 86.584  1.00 40.31 ? 136  THR E OG1 1 
ATOM   6154  C  CG2 . THR E  1 136 ? 63.009 81.535 84.471  1.00 37.93 ? 136  THR E CG2 1 
ATOM   6155  N  N   . GLN E  1 137 ? 59.962 83.297 83.243  1.00 35.33 ? 137  GLN E N   1 
ATOM   6156  C  CA  . GLN E  1 137 ? 59.257 83.030 81.995  1.00 34.83 ? 137  GLN E CA  1 
ATOM   6157  C  C   . GLN E  1 137 ? 59.157 84.291 81.155  1.00 33.83 ? 137  GLN E C   1 
ATOM   6158  O  O   . GLN E  1 137 ? 59.449 84.275 79.959  1.00 35.51 ? 137  GLN E O   1 
ATOM   6159  C  CB  . GLN E  1 137 ? 57.847 82.494 82.270  1.00 32.69 ? 137  GLN E CB  1 
ATOM   6160  C  CG  . GLN E  1 137 ? 57.799 81.431 83.348  1.00 34.72 ? 137  GLN E CG  1 
ATOM   6161  C  CD  . GLN E  1 137 ? 58.691 80.246 83.042  1.00 34.39 ? 137  GLN E CD  1 
ATOM   6162  O  OE1 . GLN E  1 137 ? 59.367 79.724 83.929  1.00 38.38 ? 137  GLN E OE1 1 
ATOM   6163  N  NE2 . GLN E  1 137 ? 58.691 79.806 81.789  1.00 31.10 ? 137  GLN E NE2 1 
ATOM   6164  N  N   . LEU E  1 138 ? 58.741 85.385 81.778  1.00 31.28 ? 138  LEU E N   1 
ATOM   6165  C  CA  . LEU E  1 138 ? 58.601 86.632 81.053  1.00 33.74 ? 138  LEU E CA  1 
ATOM   6166  C  C   . LEU E  1 138 ? 59.890 87.005 80.327  1.00 37.09 ? 138  LEU E C   1 
ATOM   6167  O  O   . LEU E  1 138 ? 59.863 87.415 79.162  1.00 37.27 ? 138  LEU E O   1 
ATOM   6168  C  CB  . LEU E  1 138 ? 58.185 87.748 82.010  1.00 30.68 ? 138  LEU E CB  1 
ATOM   6169  C  CG  . LEU E  1 138 ? 56.712 87.718 82.422  1.00 31.08 ? 138  LEU E CG  1 
ATOM   6170  C  CD1 . LEU E  1 138 ? 56.451 88.722 83.543  1.00 30.09 ? 138  LEU E CD1 1 
ATOM   6171  C  CD2 . LEU E  1 138 ? 55.853 88.025 81.209  1.00 25.82 ? 138  LEU E CD2 1 
ATOM   6172  N  N   . ASP E  1 139 ? 61.018 86.852 81.010  1.00 40.18 ? 139  ASP E N   1 
ATOM   6173  C  CA  . ASP E  1 139 ? 62.308 87.177 80.419  1.00 43.94 ? 139  ASP E CA  1 
ATOM   6174  C  C   . ASP E  1 139 ? 62.602 86.178 79.300  1.00 41.92 ? 139  ASP E C   1 
ATOM   6175  O  O   . ASP E  1 139 ? 63.143 86.530 78.251  1.00 43.03 ? 139  ASP E O   1 
ATOM   6176  C  CB  . ASP E  1 139 ? 63.403 87.105 81.488  1.00 55.11 ? 139  ASP E CB  1 
ATOM   6177  C  CG  . ASP E  1 139 ? 64.691 87.815 81.066  1.00 66.87 ? 139  ASP E CG  1 
ATOM   6178  O  OD1 . ASP E  1 139 ? 64.951 87.915 79.842  1.00 71.46 ? 139  ASP E OD1 1 
ATOM   6179  O  OD2 . ASP E  1 139 ? 65.450 88.262 81.963  1.00 72.47 ? 139  ASP E OD2 1 
ATOM   6180  N  N   . LEU E  1 140 ? 62.230 84.926 79.530  1.00 38.98 ? 140  LEU E N   1 
ATOM   6181  C  CA  . LEU E  1 140 ? 62.448 83.873 78.557  1.00 35.47 ? 140  LEU E CA  1 
ATOM   6182  C  C   . LEU E  1 140 ? 61.724 84.217 77.259  1.00 35.82 ? 140  LEU E C   1 
ATOM   6183  O  O   . LEU E  1 140 ? 62.284 84.088 76.171  1.00 36.64 ? 140  LEU E O   1 
ATOM   6184  C  CB  . LEU E  1 140 ? 61.950 82.547 79.129  1.00 31.70 ? 140  LEU E CB  1 
ATOM   6185  C  CG  . LEU E  1 140 ? 62.902 81.343 79.095  1.00 34.16 ? 140  LEU E CG  1 
ATOM   6186  C  CD1 . LEU E  1 140 ? 64.359 81.785 79.150  1.00 30.61 ? 140  LEU E CD1 1 
ATOM   6187  C  CD2 . LEU E  1 140 ? 62.572 80.420 80.274  1.00 30.23 ? 140  LEU E CD2 1 
ATOM   6188  N  N   . ILE E  1 141 ? 60.482 84.669 77.377  1.00 35.71 ? 141  ILE E N   1 
ATOM   6189  C  CA  . ILE E  1 141 ? 59.696 85.040 76.204  1.00 35.76 ? 141  ILE E CA  1 
ATOM   6190  C  C   . ILE E  1 141 ? 60.468 86.037 75.332  1.00 38.77 ? 141  ILE E C   1 
ATOM   6191  O  O   . ILE E  1 141 ? 60.373 86.009 74.106  1.00 39.92 ? 141  ILE E O   1 
ATOM   6192  C  CB  . ILE E  1 141 ? 58.331 85.666 76.624  1.00 32.20 ? 141  ILE E CB  1 
ATOM   6193  C  CG1 . ILE E  1 141 ? 57.343 84.560 77.008  1.00 26.80 ? 141  ILE E CG1 1 
ATOM   6194  C  CG2 . ILE E  1 141 ? 57.759 86.520 75.504  1.00 29.78 ? 141  ILE E CG2 1 
ATOM   6195  C  CD1 . ILE E  1 141 ? 55.940 85.081 77.346  1.00 23.83 ? 141  ILE E CD1 1 
ATOM   6196  N  N   . ASP E  1 142 ? 61.242 86.910 75.968  1.00 40.90 ? 142  ASP E N   1 
ATOM   6197  C  CA  . ASP E  1 142 ? 62.011 87.909 75.237  1.00 43.35 ? 142  ASP E CA  1 
ATOM   6198  C  C   . ASP E  1 142 ? 63.382 87.428 74.764  1.00 41.34 ? 142  ASP E C   1 
ATOM   6199  O  O   . ASP E  1 142 ? 64.036 88.096 73.969  1.00 39.56 ? 142  ASP E O   1 
ATOM   6200  C  CB  . ASP E  1 142 ? 62.172 89.172 76.091  1.00 49.64 ? 142  ASP E CB  1 
ATOM   6201  C  CG  . ASP E  1 142 ? 60.890 89.994 76.164  1.00 55.15 ? 142  ASP E CG  1 
ATOM   6202  O  OD1 . ASP E  1 142 ? 59.884 89.502 76.728  1.00 60.46 ? 142  ASP E OD1 1 
ATOM   6203  O  OD2 . ASP E  1 142 ? 60.885 91.133 75.647  1.00 57.16 ? 142  ASP E OD2 1 
ATOM   6204  N  N   . LYS E  1 143 ? 63.816 86.270 75.248  1.00 40.56 ? 143  LYS E N   1 
ATOM   6205  C  CA  . LYS E  1 143 ? 65.110 85.733 74.855  1.00 39.14 ? 143  LYS E CA  1 
ATOM   6206  C  C   . LYS E  1 143 ? 65.015 84.779 73.671  1.00 38.03 ? 143  LYS E C   1 
ATOM   6207  O  O   . LYS E  1 143 ? 65.837 84.833 72.756  1.00 37.79 ? 143  LYS E O   1 
ATOM   6208  C  CB  . LYS E  1 143 ? 65.776 85.014 76.036  1.00 37.93 ? 143  LYS E CB  1 
ATOM   6209  C  CG  . LYS E  1 143 ? 66.377 85.951 77.081  1.00 43.49 ? 143  LYS E CG  1 
ATOM   6210  C  CD  . LYS E  1 143 ? 67.117 85.173 78.172  1.00 45.34 ? 143  LYS E CD  1 
ATOM   6211  C  CE  . LYS E  1 143 ? 68.040 86.067 79.005  1.00 44.89 ? 143  LYS E CE  1 
ATOM   6212  N  NZ  . LYS E  1 143 ? 67.322 87.053 79.850  1.00 42.84 ? 143  LYS E NZ  1 
ATOM   6213  N  N   . ILE E  1 144 ? 64.015 83.904 73.689  1.00 37.19 ? 144  ILE E N   1 
ATOM   6214  C  CA  . ILE E  1 144 ? 63.850 82.925 72.621  1.00 33.75 ? 144  ILE E CA  1 
ATOM   6215  C  C   . ILE E  1 144 ? 62.664 83.254 71.726  1.00 34.67 ? 144  ILE E C   1 
ATOM   6216  O  O   . ILE E  1 144 ? 62.474 82.618 70.690  1.00 37.54 ? 144  ILE E O   1 
ATOM   6217  C  CB  . ILE E  1 144 ? 63.644 81.501 73.195  1.00 32.58 ? 144  ILE E CB  1 
ATOM   6218  C  CG1 . ILE E  1 144 ? 62.279 81.415 73.885  1.00 34.81 ? 144  ILE E CG1 1 
ATOM   6219  C  CG2 . ILE E  1 144 ? 64.743 81.170 74.201  1.00 22.88 ? 144  ILE E CG2 1 
ATOM   6220  C  CD1 . ILE E  1 144 ? 61.915 80.018 74.368  1.00 36.65 ? 144  ILE E CD1 1 
ATOM   6221  N  N   . GLY E  1 145 ? 61.868 84.244 72.126  1.00 33.34 ? 145  GLY E N   1 
ATOM   6222  C  CA  . GLY E  1 145 ? 60.701 84.624 71.341  1.00 31.37 ? 145  GLY E CA  1 
ATOM   6223  C  C   . GLY E  1 145 ? 59.421 83.891 71.733  1.00 30.29 ? 145  GLY E C   1 
ATOM   6224  O  O   . GLY E  1 145 ? 59.457 82.734 72.173  1.00 31.34 ? 145  GLY E O   1 
ATOM   6225  N  N   . LEU E  1 146 ? 58.283 84.557 71.567  1.00 25.79 ? 146  LEU E N   1 
ATOM   6226  C  CA  . LEU E  1 146 ? 56.998 83.964 71.916  1.00 24.97 ? 146  LEU E CA  1 
ATOM   6227  C  C   . LEU E  1 146 ? 56.737 82.619 71.226  1.00 27.24 ? 146  LEU E C   1 
ATOM   6228  O  O   . LEU E  1 146 ? 56.377 81.635 71.879  1.00 28.41 ? 146  LEU E O   1 
ATOM   6229  C  CB  . LEU E  1 146 ? 55.876 84.940 71.584  1.00 20.65 ? 146  LEU E CB  1 
ATOM   6230  C  CG  . LEU E  1 146 ? 54.493 84.516 72.066  1.00 22.98 ? 146  LEU E CG  1 
ATOM   6231  C  CD1 . LEU E  1 146 ? 54.511 84.348 73.583  1.00 19.76 ? 146  LEU E CD1 1 
ATOM   6232  C  CD2 . LEU E  1 146 ? 53.463 85.554 71.637  1.00 18.85 ? 146  LEU E CD2 1 
ATOM   6233  N  N   . GLU E  1 147 ? 56.914 82.576 69.907  1.00 29.13 ? 147  GLU E N   1 
ATOM   6234  C  CA  . GLU E  1 147 ? 56.698 81.350 69.141  1.00 30.09 ? 147  GLU E CA  1 
ATOM   6235  C  C   . GLU E  1 147 ? 57.502 80.178 69.730  1.00 30.46 ? 147  GLU E C   1 
ATOM   6236  O  O   . GLU E  1 147 ? 56.961 79.082 69.922  1.00 29.87 ? 147  GLU E O   1 
ATOM   6237  C  CB  . GLU E  1 147 ? 57.082 81.555 67.672  1.00 31.48 ? 147  GLU E CB  1 
ATOM   6238  C  CG  . GLU E  1 147 ? 56.399 82.736 66.988  1.00 41.56 ? 147  GLU E CG  1 
ATOM   6239  C  CD  . GLU E  1 147 ? 56.783 84.086 67.603  1.00 51.26 ? 147  GLU E CD  1 
ATOM   6240  O  OE1 . GLU E  1 147 ? 57.999 84.371 67.755  1.00 51.67 ? 147  GLU E OE1 1 
ATOM   6241  O  OE2 . GLU E  1 147 ? 55.863 84.871 67.935  1.00 57.02 ? 147  GLU E OE2 1 
ATOM   6242  N  N   . ASN E  1 148 ? 58.785 80.400 70.012  1.00 28.97 ? 148  ASN E N   1 
ATOM   6243  C  CA  . ASN E  1 148 ? 59.602 79.342 70.588  1.00 29.65 ? 148  ASN E CA  1 
ATOM   6244  C  C   . ASN E  1 148 ? 59.143 79.026 71.998  1.00 30.80 ? 148  ASN E C   1 
ATOM   6245  O  O   . ASN E  1 148 ? 59.088 77.860 72.391  1.00 29.86 ? 148  ASN E O   1 
ATOM   6246  C  CB  . ASN E  1 148 ? 61.083 79.726 70.631  1.00 31.52 ? 148  ASN E CB  1 
ATOM   6247  C  CG  . ASN E  1 148 ? 61.805 79.421 69.330  1.00 34.87 ? 148  ASN E CG  1 
ATOM   6248  O  OD1 . ASN E  1 148 ? 61.371 78.568 68.548  1.00 36.11 ? 148  ASN E OD1 1 
ATOM   6249  N  ND2 . ASN E  1 148 ? 62.924 80.105 69.100  1.00 33.05 ? 148  ASN E ND2 1 
ATOM   6250  N  N   . TYR E  1 149 ? 58.805 80.059 72.765  1.00 32.45 ? 149  TYR E N   1 
ATOM   6251  C  CA  . TYR E  1 149 ? 58.377 79.829 74.133  1.00 32.87 ? 149  TYR E CA  1 
ATOM   6252  C  C   . TYR E  1 149 ? 57.126 78.968 74.168  1.00 33.13 ? 149  TYR E C   1 
ATOM   6253  O  O   . TYR E  1 149 ? 57.066 77.977 74.896  1.00 33.53 ? 149  TYR E O   1 
ATOM   6254  C  CB  . TYR E  1 149 ? 58.113 81.143 74.867  1.00 32.65 ? 149  TYR E CB  1 
ATOM   6255  C  CG  . TYR E  1 149 ? 57.690 80.899 76.300  1.00 33.29 ? 149  TYR E CG  1 
ATOM   6256  C  CD1 . TYR E  1 149 ? 58.594 80.400 77.238  1.00 30.66 ? 149  TYR E CD1 1 
ATOM   6257  C  CD2 . TYR E  1 149 ? 56.367 81.102 76.701  1.00 31.67 ? 149  TYR E CD2 1 
ATOM   6258  C  CE1 . TYR E  1 149 ? 58.191 80.103 78.535  1.00 29.89 ? 149  TYR E CE1 1 
ATOM   6259  C  CE2 . TYR E  1 149 ? 55.955 80.809 77.994  1.00 31.61 ? 149  TYR E CE2 1 
ATOM   6260  C  CZ  . TYR E  1 149 ? 56.869 80.307 78.903  1.00 31.56 ? 149  TYR E CZ  1 
ATOM   6261  O  OH  . TYR E  1 149 ? 56.450 79.980 80.169  1.00 32.84 ? 149  TYR E OH  1 
ATOM   6262  N  N   . LEU E  1 150 ? 56.123 79.353 73.387  1.00 32.08 ? 150  LEU E N   1 
ATOM   6263  C  CA  . LEU E  1 150 ? 54.888 78.586 73.335  1.00 32.02 ? 150  LEU E CA  1 
ATOM   6264  C  C   . LEU E  1 150 ? 55.181 77.157 72.875  1.00 32.38 ? 150  LEU E C   1 
ATOM   6265  O  O   . LEU E  1 150 ? 54.691 76.190 73.463  1.00 34.47 ? 150  LEU E O   1 
ATOM   6266  C  CB  . LEU E  1 150 ? 53.886 79.240 72.380  1.00 29.67 ? 150  LEU E CB  1 
ATOM   6267  C  CG  . LEU E  1 150 ? 53.247 80.553 72.828  1.00 27.60 ? 150  LEU E CG  1 
ATOM   6268  C  CD1 . LEU E  1 150 ? 52.259 80.984 71.771  1.00 26.74 ? 150  LEU E CD1 1 
ATOM   6269  C  CD2 . LEU E  1 150 ? 52.541 80.373 74.167  1.00 23.62 ? 150  LEU E CD2 1 
ATOM   6270  N  N   . GLN E  1 151 ? 55.975 77.021 71.820  1.00 30.15 ? 151  GLN E N   1 
ATOM   6271  C  CA  . GLN E  1 151 ? 56.303 75.695 71.329  1.00 29.91 ? 151  GLN E CA  1 
ATOM   6272  C  C   . GLN E  1 151 ? 56.792 74.847 72.496  1.00 30.78 ? 151  GLN E C   1 
ATOM   6273  O  O   . GLN E  1 151 ? 56.325 73.728 72.692  1.00 31.38 ? 151  GLN E O   1 
ATOM   6274  C  CB  . GLN E  1 151 ? 57.395 75.765 70.254  1.00 29.03 ? 151  GLN E CB  1 
ATOM   6275  C  CG  . GLN E  1 151 ? 57.871 74.400 69.783  1.00 27.63 ? 151  GLN E CG  1 
ATOM   6276  C  CD  . GLN E  1 151 ? 59.023 74.478 68.803  1.00 29.92 ? 151  GLN E CD  1 
ATOM   6277  O  OE1 . GLN E  1 151 ? 60.026 75.147 69.059  1.00 31.84 ? 151  GLN E OE1 1 
ATOM   6278  N  NE2 . GLN E  1 151 ? 58.895 73.778 67.676  1.00 28.69 ? 151  GLN E NE2 1 
ATOM   6279  N  N   . SER E  1 152 ? 57.721 75.401 73.275  1.00 30.47 ? 152  SER E N   1 
ATOM   6280  C  CA  . SER E  1 152 ? 58.311 74.697 74.410  1.00 31.01 ? 152  SER E CA  1 
ATOM   6281  C  C   . SER E  1 152 ? 57.315 74.216 75.436  1.00 33.55 ? 152  SER E C   1 
ATOM   6282  O  O   . SER E  1 152 ? 57.554 73.214 76.111  1.00 31.75 ? 152  SER E O   1 
ATOM   6283  C  CB  . SER E  1 152 ? 59.325 75.588 75.117  1.00 30.98 ? 152  SER E CB  1 
ATOM   6284  O  OG  . SER E  1 152 ? 60.451 75.810 74.296  1.00 37.47 ? 152  SER E OG  1 
ATOM   6285  N  N   . GLN E  1 153 ? 56.202 74.937 75.544  1.00 36.53 ? 153  GLN E N   1 
ATOM   6286  C  CA  . GLN E  1 153 ? 55.157 74.638 76.517  1.00 38.46 ? 153  GLN E CA  1 
ATOM   6287  C  C   . GLN E  1 153 ? 54.138 73.604 76.066  1.00 40.90 ? 153  GLN E C   1 
ATOM   6288  O  O   . GLN E  1 153 ? 53.427 73.038 76.893  1.00 41.71 ? 153  GLN E O   1 
ATOM   6289  C  CB  . GLN E  1 153 ? 54.429 75.929 76.899  1.00 37.88 ? 153  GLN E CB  1 
ATOM   6290  C  CG  . GLN E  1 153 ? 55.350 77.033 77.404  1.00 38.86 ? 153  GLN E CG  1 
ATOM   6291  C  CD  . GLN E  1 153 ? 56.255 76.548 78.515  1.00 40.25 ? 153  GLN E CD  1 
ATOM   6292  O  OE1 . GLN E  1 153 ? 55.790 75.954 79.486  1.00 42.50 ? 153  GLN E OE1 1 
ATOM   6293  N  NE2 . GLN E  1 153 ? 57.555 76.795 78.378  1.00 38.51 ? 153  GLN E NE2 1 
ATOM   6294  N  N   . MET E  1 154 ? 54.061 73.358 74.763  1.00 45.28 ? 154  MET E N   1 
ATOM   6295  C  CA  . MET E  1 154 ? 53.110 72.388 74.227  1.00 49.96 ? 154  MET E CA  1 
ATOM   6296  C  C   . MET E  1 154 ? 53.256 71.027 74.869  1.00 53.26 ? 154  MET E C   1 
ATOM   6297  O  O   . MET E  1 154 ? 52.329 70.511 75.487  1.00 55.53 ? 154  MET E O   1 
ATOM   6298  C  CB  . MET E  1 154 ? 53.310 72.201 72.732  1.00 49.45 ? 154  MET E CB  1 
ATOM   6299  C  CG  . MET E  1 154 ? 53.101 73.418 71.896  1.00 49.43 ? 154  MET E CG  1 
ATOM   6300  S  SD  . MET E  1 154 ? 53.425 72.936 70.213  1.00 49.66 ? 154  MET E SD  1 
ATOM   6301  C  CE  . MET E  1 154 ? 51.879 72.250 69.776  1.00 45.79 ? 154  MET E CE  1 
ATOM   6302  N  N   . ASP E  1 155 ? 54.429 70.436 74.697  1.00 58.40 ? 155  ASP E N   1 
ATOM   6303  C  CA  . ASP E  1 155 ? 54.692 69.117 75.243  1.00 64.97 ? 155  ASP E CA  1 
ATOM   6304  C  C   . ASP E  1 155 ? 55.245 69.235 76.663  1.00 66.98 ? 155  ASP E C   1 
ATOM   6305  O  O   . ASP E  1 155 ? 54.531 68.823 77.606  1.00 68.97 ? 155  ASP E O   1 
ATOM   6306  C  CB  . ASP E  1 155 ? 55.680 68.388 74.329  1.00 69.07 ? 155  ASP E CB  1 
ATOM   6307  C  CG  . ASP E  1 155 ? 55.633 66.885 74.493  1.00 72.24 ? 155  ASP E CG  1 
ATOM   6308  O  OD1 . ASP E  1 155 ? 56.017 66.393 75.577  1.00 75.45 ? 155  ASP E OD1 1 
ATOM   6309  O  OD2 . ASP E  1 155 ? 55.210 66.200 73.533  1.00 71.71 ? 155  ASP E OD2 1 
ATOM   6310  O  OXT . ASP E  1 155 ? 56.375 69.752 76.818  1.00 67.87 ? 155  ASP E OXT 1 
ATOM   6311  N  N   . MET F  1 1   ? 34.899 74.391 69.798  1.00 47.11 ? 1    MET F N   1 
ATOM   6312  C  CA  . MET F  1 1   ? 33.660 74.459 68.975  1.00 47.70 ? 1    MET F CA  1 
ATOM   6313  C  C   . MET F  1 1   ? 32.621 75.385 69.619  1.00 46.78 ? 1    MET F C   1 
ATOM   6314  O  O   . MET F  1 1   ? 32.309 75.259 70.802  1.00 47.18 ? 1    MET F O   1 
ATOM   6315  C  CB  . MET F  1 1   ? 33.093 73.052 68.804  1.00 49.62 ? 1    MET F CB  1 
ATOM   6316  C  CG  . MET F  1 1   ? 31.910 72.979 67.863  1.00 55.83 ? 1    MET F CG  1 
ATOM   6317  S  SD  . MET F  1 1   ? 31.439 71.274 67.523  1.00 62.01 ? 1    MET F SD  1 
ATOM   6318  C  CE  . MET F  1 1   ? 30.828 70.746 69.152  1.00 59.78 ? 1    MET F CE  1 
ATOM   6319  N  N   . LYS F  1 2   ? 32.092 76.321 68.835  1.00 46.45 ? 2    LYS F N   1 
ATOM   6320  C  CA  . LYS F  1 2   ? 31.103 77.280 69.332  1.00 46.33 ? 2    LYS F CA  1 
ATOM   6321  C  C   . LYS F  1 2   ? 29.820 76.620 69.824  1.00 43.61 ? 2    LYS F C   1 
ATOM   6322  O  O   . LYS F  1 2   ? 29.099 76.002 69.047  1.00 42.66 ? 2    LYS F O   1 
ATOM   6323  C  CB  . LYS F  1 2   ? 30.755 78.296 68.241  1.00 48.69 ? 2    LYS F CB  1 
ATOM   6324  C  CG  . LYS F  1 2   ? 29.742 79.337 68.684  1.00 53.99 ? 2    LYS F CG  1 
ATOM   6325  C  CD  . LYS F  1 2   ? 29.379 80.281 67.548  1.00 58.88 ? 2    LYS F CD  1 
ATOM   6326  C  CE  . LYS F  1 2   ? 28.209 81.184 67.929  1.00 61.61 ? 2    LYS F CE  1 
ATOM   6327  N  NZ  . LYS F  1 2   ? 27.853 82.149 66.845  1.00 64.77 ? 2    LYS F NZ  1 
ATOM   6328  N  N   . GLY F  1 3   ? 29.531 76.774 71.113  1.00 41.62 ? 3    GLY F N   1 
ATOM   6329  C  CA  . GLY F  1 3   ? 28.332 76.176 71.673  1.00 39.47 ? 3    GLY F CA  1 
ATOM   6330  C  C   . GLY F  1 3   ? 27.135 77.107 71.751  1.00 38.90 ? 3    GLY F C   1 
ATOM   6331  O  O   . GLY F  1 3   ? 27.210 78.277 71.375  1.00 37.39 ? 3    GLY F O   1 
ATOM   6332  N  N   . ASP F  1 4   ? 26.020 76.577 72.240  1.00 39.50 ? 4    ASP F N   1 
ATOM   6333  C  CA  . ASP F  1 4   ? 24.797 77.354 72.379  1.00 41.08 ? 4    ASP F CA  1 
ATOM   6334  C  C   . ASP F  1 4   ? 25.043 78.405 73.454  1.00 40.33 ? 4    ASP F C   1 
ATOM   6335  O  O   . ASP F  1 4   ? 25.578 78.095 74.513  1.00 40.73 ? 4    ASP F O   1 
ATOM   6336  C  CB  . ASP F  1 4   ? 23.654 76.440 72.802  1.00 47.06 ? 4    ASP F CB  1 
ATOM   6337  C  CG  . ASP F  1 4   ? 22.323 76.874 72.239  1.00 52.94 ? 4    ASP F CG  1 
ATOM   6338  O  OD1 . ASP F  1 4   ? 22.095 76.650 71.028  1.00 54.28 ? 4    ASP F OD1 1 
ATOM   6339  O  OD2 . ASP F  1 4   ? 21.509 77.442 73.004  1.00 57.98 ? 4    ASP F OD2 1 
ATOM   6340  N  N   . LYS F  1 5   ? 24.649 79.645 73.191  1.00 40.94 ? 5    LYS F N   1 
ATOM   6341  C  CA  . LYS F  1 5   ? 24.868 80.721 74.152  1.00 39.32 ? 5    LYS F CA  1 
ATOM   6342  C  C   . LYS F  1 5   ? 24.087 80.531 75.453  1.00 38.41 ? 5    LYS F C   1 
ATOM   6343  O  O   . LYS F  1 5   ? 24.578 80.857 76.532  1.00 37.05 ? 5    LYS F O   1 
ATOM   6344  C  CB  . LYS F  1 5   ? 24.510 82.071 73.531  1.00 40.31 ? 5    LYS F CB  1 
ATOM   6345  C  CG  . LYS F  1 5   ? 24.883 83.257 74.414  1.00 46.87 ? 5    LYS F CG  1 
ATOM   6346  C  CD  . LYS F  1 5   ? 24.392 84.590 73.850  1.00 49.49 ? 5    LYS F CD  1 
ATOM   6347  C  CE  . LYS F  1 5   ? 24.733 85.743 74.792  1.00 48.63 ? 5    LYS F CE  1 
ATOM   6348  N  NZ  . LYS F  1 5   ? 24.262 85.472 76.180  1.00 46.95 ? 5    LYS F NZ  1 
ATOM   6349  N  N   . ILE F  1 6   ? 22.872 80.006 75.360  1.00 37.49 ? 6    ILE F N   1 
ATOM   6350  C  CA  . ILE F  1 6   ? 22.076 79.796 76.561  1.00 36.48 ? 6    ILE F CA  1 
ATOM   6351  C  C   . ILE F  1 6   ? 22.608 78.615 77.374  1.00 34.15 ? 6    ILE F C   1 
ATOM   6352  O  O   . ILE F  1 6   ? 22.571 78.645 78.609  1.00 31.25 ? 6    ILE F O   1 
ATOM   6353  C  CB  . ILE F  1 6   ? 20.601 79.562 76.219  1.00 37.74 ? 6    ILE F CB  1 
ATOM   6354  C  CG1 . ILE F  1 6   ? 20.067 80.740 75.404  1.00 39.96 ? 6    ILE F CG1 1 
ATOM   6355  C  CG2 . ILE F  1 6   ? 19.797 79.439 77.487  1.00 37.08 ? 6    ILE F CG2 1 
ATOM   6356  C  CD1 . ILE F  1 6   ? 18.638 80.542 74.925  1.00 45.54 ? 6    ILE F CD1 1 
ATOM   6357  N  N   . VAL F  1 7   ? 23.099 77.587 76.678  1.00 31.35 ? 7    VAL F N   1 
ATOM   6358  C  CA  . VAL F  1 7   ? 23.675 76.405 77.326  1.00 31.50 ? 7    VAL F CA  1 
ATOM   6359  C  C   . VAL F  1 7   ? 24.890 76.827 78.165  1.00 32.32 ? 7    VAL F C   1 
ATOM   6360  O  O   . VAL F  1 7   ? 25.109 76.321 79.275  1.00 31.20 ? 7    VAL F O   1 
ATOM   6361  C  CB  . VAL F  1 7   ? 24.158 75.355 76.282  1.00 32.92 ? 7    VAL F CB  1 
ATOM   6362  C  CG1 . VAL F  1 7   ? 25.085 74.343 76.957  1.00 30.87 ? 7    VAL F CG1 1 
ATOM   6363  C  CG2 . VAL F  1 7   ? 22.965 74.637 75.652  1.00 29.24 ? 7    VAL F CG2 1 
ATOM   6364  N  N   . ILE F  1 8   ? 25.683 77.748 77.619  1.00 30.46 ? 8    ILE F N   1 
ATOM   6365  C  CA  . ILE F  1 8   ? 26.860 78.249 78.310  1.00 30.53 ? 8    ILE F CA  1 
ATOM   6366  C  C   . ILE F  1 8   ? 26.456 79.128 79.490  1.00 31.46 ? 8    ILE F C   1 
ATOM   6367  O  O   . ILE F  1 8   ? 27.124 79.145 80.515  1.00 32.59 ? 8    ILE F O   1 
ATOM   6368  C  CB  . ILE F  1 8   ? 27.754 79.042 77.354  1.00 31.18 ? 8    ILE F CB  1 
ATOM   6369  C  CG1 . ILE F  1 8   ? 28.345 78.093 76.308  1.00 35.17 ? 8    ILE F CG1 1 
ATOM   6370  C  CG2 . ILE F  1 8   ? 28.872 79.715 78.116  1.00 32.94 ? 8    ILE F CG2 1 
ATOM   6371  C  CD1 . ILE F  1 8   ? 29.199 78.778 75.270  1.00 34.57 ? 8    ILE F CD1 1 
ATOM   6372  N  N   . GLN F  1 9   ? 25.360 79.862 79.348  1.00 34.87 ? 9    GLN F N   1 
ATOM   6373  C  CA  . GLN F  1 9   ? 24.894 80.704 80.437  1.00 36.17 ? 9    GLN F CA  1 
ATOM   6374  C  C   . GLN F  1 9   ? 24.495 79.790 81.584  1.00 36.09 ? 9    GLN F C   1 
ATOM   6375  O  O   . GLN F  1 9   ? 24.705 80.123 82.748  1.00 37.07 ? 9    GLN F O   1 
ATOM   6376  C  CB  . GLN F  1 9   ? 23.685 81.533 80.012  1.00 38.33 ? 9    GLN F CB  1 
ATOM   6377  C  CG  . GLN F  1 9   ? 23.979 82.565 78.956  1.00 43.82 ? 9    GLN F CG  1 
ATOM   6378  C  CD  . GLN F  1 9   ? 22.795 83.486 78.714  1.00 48.42 ? 9    GLN F CD  1 
ATOM   6379  O  OE1 . GLN F  1 9   ? 21.698 83.038 78.376  1.00 49.64 ? 9    GLN F OE1 1 
ATOM   6380  N  NE2 . GLN F  1 9   ? 23.013 84.782 78.888  1.00 52.84 ? 9    GLN F NE2 1 
ATOM   6381  N  N   . HIS F  1 10  ? 23.911 78.642 81.248  1.00 34.97 ? 10   HIS F N   1 
ATOM   6382  C  CA  . HIS F  1 10  ? 23.497 77.670 82.257  1.00 36.50 ? 10   HIS F CA  1 
ATOM   6383  C  C   . HIS F  1 10  ? 24.733 77.111 82.948  1.00 35.15 ? 10   HIS F C   1 
ATOM   6384  O  O   . HIS F  1 10  ? 24.814 77.107 84.175  1.00 34.63 ? 10   HIS F O   1 
ATOM   6385  C  CB  . HIS F  1 10  ? 22.718 76.524 81.615  1.00 39.78 ? 10   HIS F CB  1 
ATOM   6386  C  CG  . HIS F  1 10  ? 21.238 76.741 81.576  1.00 45.12 ? 10   HIS F CG  1 
ATOM   6387  N  ND1 . HIS F  1 10  ? 20.448 76.679 82.706  1.00 47.26 ? 10   HIS F ND1 1 
ATOM   6388  C  CD2 . HIS F  1 10  ? 20.397 76.982 80.541  1.00 46.77 ? 10   HIS F CD2 1 
ATOM   6389  C  CE1 . HIS F  1 10  ? 19.184 76.867 82.367  1.00 47.38 ? 10   HIS F CE1 1 
ATOM   6390  N  NE2 . HIS F  1 10  ? 19.126 77.054 81.059  1.00 49.21 ? 10   HIS F NE2 1 
ATOM   6391  N  N   . LEU F  1 11  ? 25.684 76.631 82.150  1.00 33.06 ? 11   LEU F N   1 
ATOM   6392  C  CA  . LEU F  1 11  ? 26.934 76.088 82.667  1.00 30.09 ? 11   LEU F CA  1 
ATOM   6393  C  C   . LEU F  1 11  ? 27.596 77.069 83.644  1.00 30.66 ? 11   LEU F C   1 
ATOM   6394  O  O   . LEU F  1 11  ? 28.017 76.686 84.746  1.00 27.67 ? 11   LEU F O   1 
ATOM   6395  C  CB  . LEU F  1 11  ? 27.877 75.781 81.502  1.00 28.87 ? 11   LEU F CB  1 
ATOM   6396  C  CG  . LEU F  1 11  ? 27.889 74.352 80.948  1.00 27.61 ? 11   LEU F CG  1 
ATOM   6397  C  CD1 . LEU F  1 11  ? 26.544 73.713 81.081  1.00 24.47 ? 11   LEU F CD1 1 
ATOM   6398  C  CD2 . LEU F  1 11  ? 28.340 74.384 79.498  1.00 28.30 ? 11   LEU F CD2 1 
ATOM   6399  N  N   . ASN F  1 12  ? 27.695 78.335 83.248  1.00 30.87 ? 12   ASN F N   1 
ATOM   6400  C  CA  . ASN F  1 12  ? 28.290 79.337 84.130  1.00 32.45 ? 12   ASN F CA  1 
ATOM   6401  C  C   . ASN F  1 12  ? 27.461 79.476 85.414  1.00 34.89 ? 12   ASN F C   1 
ATOM   6402  O  O   . ASN F  1 12  ? 27.998 79.702 86.503  1.00 34.12 ? 12   ASN F O   1 
ATOM   6403  C  CB  . ASN F  1 12  ? 28.379 80.680 83.420  1.00 28.99 ? 12   ASN F CB  1 
ATOM   6404  C  CG  . ASN F  1 12  ? 29.772 80.963 82.894  1.00 33.17 ? 12   ASN F CG  1 
ATOM   6405  O  OD1 . ASN F  1 12  ? 30.769 80.754 83.600  1.00 37.60 ? 12   ASN F OD1 1 
ATOM   6406  N  ND2 . ASN F  1 12  ? 29.855 81.456 81.658  1.00 28.46 ? 12   ASN F ND2 1 
ATOM   6407  N  N   . LYS F  1 13  ? 26.148 79.334 85.264  1.00 35.69 ? 13   LYS F N   1 
ATOM   6408  C  CA  . LYS F  1 13  ? 25.208 79.413 86.371  1.00 34.61 ? 13   LYS F CA  1 
ATOM   6409  C  C   . LYS F  1 13  ? 25.546 78.308 87.366  1.00 34.47 ? 13   LYS F C   1 
ATOM   6410  O  O   . LYS F  1 13  ? 25.903 78.567 88.514  1.00 34.38 ? 13   LYS F O   1 
ATOM   6411  C  CB  . LYS F  1 13  ? 23.783 79.234 85.830  1.00 37.69 ? 13   LYS F CB  1 
ATOM   6412  C  CG  . LYS F  1 13  ? 22.692 79.011 86.867  1.00 41.78 ? 13   LYS F CG  1 
ATOM   6413  C  CD  . LYS F  1 13  ? 22.391 80.264 87.670  1.00 44.60 ? 13   LYS F CD  1 
ATOM   6414  C  CE  . LYS F  1 13  ? 21.324 79.992 88.714  1.00 43.92 ? 13   LYS F CE  1 
ATOM   6415  N  NZ  . LYS F  1 13  ? 21.155 81.142 89.638  1.00 47.69 ? 13   LYS F NZ  1 
ATOM   6416  N  N   . ILE F  1 14  ? 25.439 77.066 86.917  1.00 35.38 ? 14   ILE F N   1 
ATOM   6417  C  CA  . ILE F  1 14  ? 25.737 75.936 87.784  1.00 35.18 ? 14   ILE F CA  1 
ATOM   6418  C  C   . ILE F  1 14  ? 27.159 76.062 88.353  1.00 34.47 ? 14   ILE F C   1 
ATOM   6419  O  O   . ILE F  1 14  ? 27.407 75.707 89.507  1.00 33.78 ? 14   ILE F O   1 
ATOM   6420  C  CB  . ILE F  1 14  ? 25.567 74.591 87.016  1.00 34.02 ? 14   ILE F CB  1 
ATOM   6421  C  CG1 . ILE F  1 14  ? 26.341 74.651 85.705  1.00 37.62 ? 14   ILE F CG1 1 
ATOM   6422  C  CG2 . ILE F  1 14  ? 24.084 74.314 86.734  1.00 25.68 ? 14   ILE F CG2 1 
ATOM   6423  C  CD1 . ILE F  1 14  ? 26.070 73.497 84.779  1.00 44.95 ? 14   ILE F CD1 1 
ATOM   6424  N  N   . LEU F  1 15  ? 28.083 76.588 87.553  1.00 34.40 ? 15   LEU F N   1 
ATOM   6425  C  CA  . LEU F  1 15  ? 29.465 76.761 87.999  1.00 34.66 ? 15   LEU F CA  1 
ATOM   6426  C  C   . LEU F  1 15  ? 29.533 77.624 89.263  1.00 35.45 ? 15   LEU F C   1 
ATOM   6427  O  O   . LEU F  1 15  ? 30.228 77.296 90.229  1.00 34.89 ? 15   LEU F O   1 
ATOM   6428  C  CB  . LEU F  1 15  ? 30.310 77.404 86.894  1.00 32.19 ? 15   LEU F CB  1 
ATOM   6429  C  CG  . LEU F  1 15  ? 31.777 77.615 87.279  1.00 31.57 ? 15   LEU F CG  1 
ATOM   6430  C  CD1 . LEU F  1 15  ? 32.379 76.291 87.742  1.00 32.54 ? 15   LEU F CD1 1 
ATOM   6431  C  CD2 . LEU F  1 15  ? 32.549 78.167 86.103  1.00 28.78 ? 15   LEU F CD2 1 
ATOM   6432  N  N   . GLY F  1 16  ? 28.816 78.738 89.251  1.00 35.32 ? 16   GLY F N   1 
ATOM   6433  C  CA  . GLY F  1 16  ? 28.810 79.595 90.415  1.00 36.73 ? 16   GLY F CA  1 
ATOM   6434  C  C   . GLY F  1 16  ? 28.319 78.842 91.640  1.00 38.45 ? 16   GLY F C   1 
ATOM   6435  O  O   . GLY F  1 16  ? 28.818 79.076 92.742  1.00 40.92 ? 16   GLY F O   1 
ATOM   6436  N  N   . ASN F  1 17  ? 27.344 77.946 91.453  1.00 37.78 ? 17   ASN F N   1 
ATOM   6437  C  CA  . ASN F  1 17  ? 26.780 77.149 92.553  1.00 37.88 ? 17   ASN F CA  1 
ATOM   6438  C  C   . ASN F  1 17  ? 27.864 76.288 93.199  1.00 38.37 ? 17   ASN F C   1 
ATOM   6439  O  O   . ASN F  1 17  ? 28.026 76.282 94.423  1.00 37.09 ? 17   ASN F O   1 
ATOM   6440  C  CB  . ASN F  1 17  ? 25.655 76.217 92.051  1.00 37.11 ? 17   ASN F CB  1 
ATOM   6441  C  CG  . ASN F  1 17  ? 24.317 76.939 91.814  1.00 38.19 ? 17   ASN F CG  1 
ATOM   6442  O  OD1 . ASN F  1 17  ? 23.387 76.358 91.249  1.00 35.53 ? 17   ASN F OD1 1 
ATOM   6443  N  ND2 . ASN F  1 17  ? 24.215 78.194 92.252  1.00 38.24 ? 17   ASN F ND2 1 
ATOM   6444  N  N   . GLU F  1 18  ? 28.597 75.559 92.360  1.00 38.64 ? 18   GLU F N   1 
ATOM   6445  C  CA  . GLU F  1 18  ? 29.662 74.674 92.818  1.00 38.37 ? 18   GLU F CA  1 
ATOM   6446  C  C   . GLU F  1 18  ? 30.713 75.444 93.607  1.00 37.92 ? 18   GLU F C   1 
ATOM   6447  O  O   . GLU F  1 18  ? 31.080 75.050 94.714  1.00 39.31 ? 18   GLU F O   1 
ATOM   6448  C  CB  . GLU F  1 18  ? 30.313 73.966 91.623  1.00 36.66 ? 18   GLU F CB  1 
ATOM   6449  C  CG  . GLU F  1 18  ? 29.326 73.187 90.756  1.00 35.90 ? 18   GLU F CG  1 
ATOM   6450  C  CD  . GLU F  1 18  ? 28.753 71.958 91.447  1.00 37.21 ? 18   GLU F CD  1 
ATOM   6451  O  OE1 . GLU F  1 18  ? 27.739 71.421 90.949  1.00 34.11 ? 18   GLU F OE1 1 
ATOM   6452  O  OE2 . GLU F  1 18  ? 29.321 71.551 92.475  1.00 41.06 ? 18   GLU F OE2 1 
ATOM   6453  N  N   . LEU F  1 19  ? 31.189 76.541 93.027  1.00 37.72 ? 19   LEU F N   1 
ATOM   6454  C  CA  . LEU F  1 19  ? 32.198 77.372 93.673  1.00 36.35 ? 19   LEU F CA  1 
ATOM   6455  C  C   . LEU F  1 19  ? 31.773 77.698 95.106  1.00 37.25 ? 19   LEU F C   1 
ATOM   6456  O  O   . LEU F  1 19  ? 32.600 77.667 96.025  1.00 37.08 ? 19   LEU F O   1 
ATOM   6457  C  CB  . LEU F  1 19  ? 32.420 78.648 92.854  1.00 33.32 ? 19   LEU F CB  1 
ATOM   6458  C  CG  . LEU F  1 19  ? 33.052 78.409 91.473  1.00 30.50 ? 19   LEU F CG  1 
ATOM   6459  C  CD1 . LEU F  1 19  ? 33.074 79.707 90.693  1.00 31.77 ? 19   LEU F CD1 1 
ATOM   6460  C  CD2 . LEU F  1 19  ? 34.465 77.863 91.624  1.00 24.43 ? 19   LEU F CD2 1 
ATOM   6461  N  N   . ILE F  1 20  ? 30.487 77.995 95.293  1.00 35.07 ? 20   ILE F N   1 
ATOM   6462  C  CA  . ILE F  1 20  ? 29.951 78.285 96.620  1.00 35.09 ? 20   ILE F CA  1 
ATOM   6463  C  C   . ILE F  1 20  ? 30.131 77.029 97.490  1.00 34.36 ? 20   ILE F C   1 
ATOM   6464  O  O   . ILE F  1 20  ? 30.687 77.083 98.590  1.00 34.40 ? 20   ILE F O   1 
ATOM   6465  C  CB  . ILE F  1 20  ? 28.433 78.642 96.552  1.00 35.37 ? 20   ILE F CB  1 
ATOM   6466  C  CG1 . ILE F  1 20  ? 28.240 79.981 95.845  1.00 37.24 ? 20   ILE F CG1 1 
ATOM   6467  C  CG2 . ILE F  1 20  ? 27.835 78.707 97.956  1.00 33.58 ? 20   ILE F CG2 1 
ATOM   6468  C  CD1 . ILE F  1 20  ? 26.786 80.423 95.750  1.00 38.34 ? 20   ILE F CD1 1 
ATOM   6469  N  N   . ALA F  1 21  ? 29.656 75.900 96.977  1.00 33.08 ? 21   ALA F N   1 
ATOM   6470  C  CA  . ALA F  1 21  ? 29.757 74.625 97.672  1.00 31.42 ? 21   ALA F CA  1 
ATOM   6471  C  C   . ALA F  1 21  ? 31.187 74.389 98.135  1.00 31.59 ? 21   ALA F C   1 
ATOM   6472  O  O   . ALA F  1 21  ? 31.419 74.023 99.283  1.00 31.30 ? 21   ALA F O   1 
ATOM   6473  C  CB  . ALA F  1 21  ? 29.318 73.498 96.752  1.00 28.68 ? 21   ALA F CB  1 
ATOM   6474  N  N   . ILE F  1 22  ? 32.141 74.601 97.232  1.00 32.56 ? 22   ILE F N   1 
ATOM   6475  C  CA  . ILE F  1 22  ? 33.550 74.408 97.545  1.00 32.62 ? 22   ILE F CA  1 
ATOM   6476  C  C   . ILE F  1 22  ? 33.898 75.125 98.844  1.00 34.42 ? 22   ILE F C   1 
ATOM   6477  O  O   . ILE F  1 22  ? 34.365 74.505 99.803  1.00 36.37 ? 22   ILE F O   1 
ATOM   6478  C  CB  . ILE F  1 22  ? 34.457 74.977 96.433  1.00 32.70 ? 22   ILE F CB  1 
ATOM   6479  C  CG1 . ILE F  1 22  ? 34.083 74.363 95.093  1.00 32.49 ? 22   ILE F CG1 1 
ATOM   6480  C  CG2 . ILE F  1 22  ? 35.928 74.690 96.742  1.00 28.46 ? 22   ILE F CG2 1 
ATOM   6481  C  CD1 . ILE F  1 22  ? 34.875 74.943 93.934  1.00 37.16 ? 22   ILE F CD1 1 
ATOM   6482  N  N   . ASN F  1 23  ? 33.660 76.433 98.870  1.00 32.60 ? 23   ASN F N   1 
ATOM   6483  C  CA  . ASN F  1 23  ? 33.971 77.239 100.038 1.00 34.45 ? 23   ASN F CA  1 
ATOM   6484  C  C   . ASN F  1 23  ? 33.222 76.833 101.294 1.00 34.66 ? 23   ASN F C   1 
ATOM   6485  O  O   . ASN F  1 23  ? 33.825 76.695 102.355 1.00 36.16 ? 23   ASN F O   1 
ATOM   6486  C  CB  . ASN F  1 23  ? 33.710 78.717 99.737  1.00 37.16 ? 23   ASN F CB  1 
ATOM   6487  C  CG  . ASN F  1 23  ? 34.717 79.295 98.758  1.00 38.62 ? 23   ASN F CG  1 
ATOM   6488  O  OD1 . ASN F  1 23  ? 35.135 78.622 97.811  1.00 39.38 ? 23   ASN F OD1 1 
ATOM   6489  N  ND2 . ASN F  1 23  ? 35.103 80.547 98.971  1.00 37.07 ? 23   ASN F ND2 1 
ATOM   6490  N  N   . GLN F  1 24  ? 31.913 76.631 101.176 1.00 34.67 ? 24   GLN F N   1 
ATOM   6491  C  CA  . GLN F  1 24  ? 31.095 76.264 102.327 1.00 32.53 ? 24   GLN F CA  1 
ATOM   6492  C  C   . GLN F  1 24  ? 31.553 74.974 103.005 1.00 34.26 ? 24   GLN F C   1 
ATOM   6493  O  O   . GLN F  1 24  ? 31.682 74.905 104.234 1.00 32.44 ? 24   GLN F O   1 
ATOM   6494  C  CB  . GLN F  1 24  ? 29.628 76.139 101.905 1.00 30.44 ? 24   GLN F CB  1 
ATOM   6495  C  CG  . GLN F  1 24  ? 28.688 75.755 103.045 1.00 33.98 ? 24   GLN F CG  1 
ATOM   6496  C  CD  . GLN F  1 24  ? 27.222 75.938 102.700 1.00 33.38 ? 24   GLN F CD  1 
ATOM   6497  O  OE1 . GLN F  1 24  ? 26.368 75.181 103.157 1.00 32.93 ? 24   GLN F OE1 1 
ATOM   6498  N  NE2 . GLN F  1 24  ? 26.920 76.957 101.902 1.00 37.31 ? 24   GLN F NE2 1 
ATOM   6499  N  N   . TYR F  1 25  ? 31.816 73.954 102.199 1.00 36.20 ? 25   TYR F N   1 
ATOM   6500  C  CA  . TYR F  1 25  ? 32.234 72.664 102.729 1.00 35.94 ? 25   TYR F CA  1 
ATOM   6501  C  C   . TYR F  1 25  ? 33.654 72.676 103.276 1.00 35.29 ? 25   TYR F C   1 
ATOM   6502  O  O   . TYR F  1 25  ? 33.954 71.980 104.252 1.00 32.70 ? 25   TYR F O   1 
ATOM   6503  C  CB  . TYR F  1 25  ? 32.076 71.592 101.645 1.00 36.37 ? 25   TYR F CB  1 
ATOM   6504  C  CG  . TYR F  1 25  ? 30.650 71.496 101.122 1.00 39.79 ? 25   TYR F CG  1 
ATOM   6505  C  CD1 . TYR F  1 25  ? 30.330 70.698 100.013 1.00 39.32 ? 25   TYR F CD1 1 
ATOM   6506  C  CD2 . TYR F  1 25  ? 29.623 72.233 101.722 1.00 41.28 ? 25   TYR F CD2 1 
ATOM   6507  C  CE1 . TYR F  1 25  ? 29.019 70.647 99.520  1.00 40.78 ? 25   TYR F CE1 1 
ATOM   6508  C  CE2 . TYR F  1 25  ? 28.321 72.194 101.237 1.00 42.54 ? 25   TYR F CE2 1 
ATOM   6509  C  CZ  . TYR F  1 25  ? 28.022 71.407 100.141 1.00 41.67 ? 25   TYR F CZ  1 
ATOM   6510  O  OH  . TYR F  1 25  ? 26.729 71.410 99.676  1.00 40.42 ? 25   TYR F OH  1 
ATOM   6511  N  N   . PHE F  1 26  ? 34.528 73.471 102.666 1.00 33.69 ? 26   PHE F N   1 
ATOM   6512  C  CA  . PHE F  1 26  ? 35.900 73.516 103.139 1.00 33.81 ? 26   PHE F CA  1 
ATOM   6513  C  C   . PHE F  1 26  ? 35.964 74.180 104.510 1.00 35.36 ? 26   PHE F C   1 
ATOM   6514  O  O   . PHE F  1 26  ? 36.750 73.784 105.380 1.00 33.44 ? 26   PHE F O   1 
ATOM   6515  C  CB  . PHE F  1 26  ? 36.795 74.278 102.172 1.00 32.61 ? 26   PHE F CB  1 
ATOM   6516  C  CG  . PHE F  1 26  ? 38.241 73.949 102.335 1.00 36.44 ? 26   PHE F CG  1 
ATOM   6517  C  CD1 . PHE F  1 26  ? 38.825 72.930 101.580 1.00 41.06 ? 26   PHE F CD1 1 
ATOM   6518  C  CD2 . PHE F  1 26  ? 39.004 74.584 103.307 1.00 34.92 ? 26   PHE F CD2 1 
ATOM   6519  C  CE1 . PHE F  1 26  ? 40.158 72.546 101.801 1.00 43.08 ? 26   PHE F CE1 1 
ATOM   6520  C  CE2 . PHE F  1 26  ? 40.333 74.208 103.535 1.00 38.23 ? 26   PHE F CE2 1 
ATOM   6521  C  CZ  . PHE F  1 26  ? 40.912 73.188 102.784 1.00 37.66 ? 26   PHE F CZ  1 
ATOM   6522  N  N   . LEU F  1 27  ? 35.136 75.198 104.701 1.00 34.29 ? 27   LEU F N   1 
ATOM   6523  C  CA  . LEU F  1 27  ? 35.108 75.888 105.975 1.00 34.10 ? 27   LEU F CA  1 
ATOM   6524  C  C   . LEU F  1 27  ? 34.485 74.947 107.004 1.00 35.41 ? 27   LEU F C   1 
ATOM   6525  O  O   . LEU F  1 27  ? 35.003 74.788 108.112 1.00 36.39 ? 27   LEU F O   1 
ATOM   6526  C  CB  . LEU F  1 27  ? 34.287 77.170 105.865 1.00 32.98 ? 27   LEU F CB  1 
ATOM   6527  C  CG  . LEU F  1 27  ? 34.111 77.948 107.170 1.00 31.00 ? 27   LEU F CG  1 
ATOM   6528  C  CD1 . LEU F  1 27  ? 35.458 78.414 107.682 1.00 26.21 ? 27   LEU F CD1 1 
ATOM   6529  C  CD2 . LEU F  1 27  ? 33.189 79.122 106.923 1.00 30.74 ? 27   LEU F CD2 1 
ATOM   6530  N  N   . HIS F  1 28  ? 33.375 74.316 106.635 1.00 32.75 ? 28   HIS F N   1 
ATOM   6531  C  CA  . HIS F  1 28  ? 32.715 73.395 107.546 1.00 32.82 ? 28   HIS F CA  1 
ATOM   6532  C  C   . HIS F  1 28  ? 33.661 72.246 107.903 1.00 32.61 ? 28   HIS F C   1 
ATOM   6533  O  O   . HIS F  1 28  ? 33.666 71.756 109.038 1.00 31.82 ? 28   HIS F O   1 
ATOM   6534  C  CB  . HIS F  1 28  ? 31.422 72.842 106.916 1.00 31.96 ? 28   HIS F CB  1 
ATOM   6535  C  CG  . HIS F  1 28  ? 30.273 73.808 106.930 1.00 29.42 ? 28   HIS F CG  1 
ATOM   6536  N  ND1 . HIS F  1 28  ? 29.082 73.556 106.280 1.00 29.38 ? 28   HIS F ND1 1 
ATOM   6537  C  CD2 . HIS F  1 28  ? 30.132 75.020 107.518 1.00 27.61 ? 28   HIS F CD2 1 
ATOM   6538  C  CE1 . HIS F  1 28  ? 28.259 74.572 106.466 1.00 28.54 ? 28   HIS F CE1 1 
ATOM   6539  N  NE2 . HIS F  1 28  ? 28.871 75.473 107.215 1.00 28.91 ? 28   HIS F NE2 1 
ATOM   6540  N  N   . ALA F  1 29  ? 34.463 71.821 106.932 1.00 32.59 ? 29   ALA F N   1 
ATOM   6541  C  CA  . ALA F  1 29  ? 35.401 70.728 107.152 1.00 31.83 ? 29   ALA F CA  1 
ATOM   6542  C  C   . ALA F  1 29  ? 36.449 71.125 108.178 1.00 31.06 ? 29   ALA F C   1 
ATOM   6543  O  O   . ALA F  1 29  ? 36.672 70.418 109.159 1.00 32.19 ? 29   ALA F O   1 
ATOM   6544  C  CB  . ALA F  1 29  ? 36.072 70.333 105.840 1.00 31.57 ? 29   ALA F CB  1 
ATOM   6545  N  N   . ARG F  1 30  ? 37.096 72.260 107.963 1.00 31.83 ? 30   ARG F N   1 
ATOM   6546  C  CA  . ARG F  1 30  ? 38.112 72.698 108.904 1.00 32.04 ? 30   ARG F CA  1 
ATOM   6547  C  C   . ARG F  1 30  ? 37.528 72.999 110.269 1.00 31.62 ? 30   ARG F C   1 
ATOM   6548  O  O   . ARG F  1 30  ? 38.234 72.926 111.272 1.00 31.93 ? 30   ARG F O   1 
ATOM   6549  C  CB  . ARG F  1 30  ? 38.857 73.911 108.354 1.00 32.32 ? 30   ARG F CB  1 
ATOM   6550  C  CG  . ARG F  1 30  ? 40.137 73.537 107.610 1.00 35.61 ? 30   ARG F CG  1 
ATOM   6551  C  CD  . ARG F  1 30  ? 40.025 72.190 106.915 1.00 38.00 ? 30   ARG F CD  1 
ATOM   6552  N  NE  . ARG F  1 30  ? 41.237 71.865 106.165 1.00 50.31 ? 30   ARG F NE  1 
ATOM   6553  C  CZ  . ARG F  1 30  ? 41.467 70.697 105.560 1.00 53.84 ? 30   ARG F CZ  1 
ATOM   6554  N  NH1 . ARG F  1 30  ? 40.563 69.723 105.617 1.00 52.72 ? 30   ARG F NH1 1 
ATOM   6555  N  NH2 . ARG F  1 30  ? 42.599 70.509 104.883 1.00 52.94 ? 30   ARG F NH2 1 
ATOM   6556  N  N   . MET F  1 31  ? 36.238 73.325 110.312 1.00 31.10 ? 31   MET F N   1 
ATOM   6557  C  CA  . MET F  1 31  ? 35.576 73.615 111.580 1.00 32.58 ? 31   MET F CA  1 
ATOM   6558  C  C   . MET F  1 31  ? 35.384 72.328 112.383 1.00 34.12 ? 31   MET F C   1 
ATOM   6559  O  O   . MET F  1 31  ? 35.629 72.301 113.591 1.00 34.09 ? 31   MET F O   1 
ATOM   6560  C  CB  . MET F  1 31  ? 34.228 74.288 111.339 1.00 34.16 ? 31   MET F CB  1 
ATOM   6561  C  CG  . MET F  1 31  ? 34.322 75.745 110.909 1.00 32.71 ? 31   MET F CG  1 
ATOM   6562  S  SD  . MET F  1 31  ? 32.678 76.427 110.580 1.00 35.45 ? 31   MET F SD  1 
ATOM   6563  C  CE  . MET F  1 31  ? 31.964 76.403 112.244 1.00 33.99 ? 31   MET F CE  1 
ATOM   6564  N  N   . TYR F  1 32  ? 34.936 71.272 111.708 1.00 33.25 ? 32   TYR F N   1 
ATOM   6565  C  CA  . TYR F  1 32  ? 34.754 69.973 112.345 1.00 33.80 ? 32   TYR F CA  1 
ATOM   6566  C  C   . TYR F  1 32  ? 36.130 69.525 112.814 1.00 35.86 ? 32   TYR F C   1 
ATOM   6567  O  O   . TYR F  1 32  ? 36.327 69.189 113.983 1.00 35.81 ? 32   TYR F O   1 
ATOM   6568  C  CB  . TYR F  1 32  ? 34.223 68.949 111.344 1.00 32.55 ? 32   TYR F CB  1 
ATOM   6569  C  CG  . TYR F  1 32  ? 32.782 69.141 110.946 1.00 34.02 ? 32   TYR F CG  1 
ATOM   6570  C  CD1 . TYR F  1 32  ? 32.395 69.068 109.607 1.00 34.60 ? 32   TYR F CD1 1 
ATOM   6571  C  CD2 . TYR F  1 32  ? 31.792 69.336 111.908 1.00 33.97 ? 32   TYR F CD2 1 
ATOM   6572  C  CE1 . TYR F  1 32  ? 31.058 69.176 109.240 1.00 33.37 ? 32   TYR F CE1 1 
ATOM   6573  C  CE2 . TYR F  1 32  ? 30.456 69.445 111.549 1.00 33.15 ? 32   TYR F CE2 1 
ATOM   6574  C  CZ  . TYR F  1 32  ? 30.096 69.358 110.217 1.00 33.64 ? 32   TYR F CZ  1 
ATOM   6575  O  OH  . TYR F  1 32  ? 28.771 69.402 109.861 1.00 36.55 ? 32   TYR F OH  1 
ATOM   6576  N  N   . GLU F  1 33  ? 37.074 69.512 111.876 1.00 38.59 ? 33   GLU F N   1 
ATOM   6577  C  CA  . GLU F  1 33  ? 38.451 69.129 112.162 1.00 40.85 ? 33   GLU F CA  1 
ATOM   6578  C  C   . GLU F  1 33  ? 38.864 69.860 113.446 1.00 40.53 ? 33   GLU F C   1 
ATOM   6579  O  O   . GLU F  1 33  ? 39.370 69.251 114.392 1.00 42.55 ? 33   GLU F O   1 
ATOM   6580  C  CB  . GLU F  1 33  ? 39.361 69.563 111.004 1.00 46.13 ? 33   GLU F CB  1 
ATOM   6581  C  CG  . GLU F  1 33  ? 40.286 68.480 110.419 1.00 52.97 ? 33   GLU F CG  1 
ATOM   6582  C  CD  . GLU F  1 33  ? 39.709 67.786 109.173 1.00 55.89 ? 33   GLU F CD  1 
ATOM   6583  O  OE1 . GLU F  1 33  ? 38.676 67.091 109.287 1.00 57.10 ? 33   GLU F OE1 1 
ATOM   6584  O  OE2 . GLU F  1 33  ? 40.294 67.934 108.077 1.00 55.79 ? 33   GLU F OE2 1 
ATOM   6585  N  N   . ASP F  1 34  ? 38.611 71.166 113.475 1.00 37.48 ? 34   ASP F N   1 
ATOM   6586  C  CA  . ASP F  1 34  ? 38.957 72.011 114.617 1.00 35.01 ? 34   ASP F CA  1 
ATOM   6587  C  C   . ASP F  1 34  ? 38.252 71.636 115.915 1.00 32.70 ? 34   ASP F C   1 
ATOM   6588  O  O   . ASP F  1 34  ? 38.820 71.792 116.987 1.00 34.58 ? 34   ASP F O   1 
ATOM   6589  C  CB  . ASP F  1 34  ? 38.656 73.475 114.296 1.00 37.31 ? 34   ASP F CB  1 
ATOM   6590  C  CG  . ASP F  1 34  ? 39.160 74.420 115.365 1.00 38.97 ? 34   ASP F CG  1 
ATOM   6591  O  OD1 . ASP F  1 34  ? 40.397 74.492 115.555 1.00 39.83 ? 34   ASP F OD1 1 
ATOM   6592  O  OD2 . ASP F  1 34  ? 38.322 75.091 116.015 1.00 39.64 ? 34   ASP F OD2 1 
ATOM   6593  N  N   . TRP F  1 35  ? 37.012 71.170 115.826 1.00 30.20 ? 35   TRP F N   1 
ATOM   6594  C  CA  . TRP F  1 35  ? 36.277 70.779 117.022 1.00 27.77 ? 35   TRP F CA  1 
ATOM   6595  C  C   . TRP F  1 35  ? 36.664 69.369 117.433 1.00 27.99 ? 35   TRP F C   1 
ATOM   6596  O  O   . TRP F  1 35  ? 36.148 68.836 118.414 1.00 29.29 ? 35   TRP F O   1 
ATOM   6597  C  CB  . TRP F  1 35  ? 34.763 70.814 116.791 1.00 24.53 ? 35   TRP F CB  1 
ATOM   6598  C  CG  . TRP F  1 35  ? 34.186 72.173 116.673 1.00 24.02 ? 35   TRP F CG  1 
ATOM   6599  C  CD1 . TRP F  1 35  ? 34.625 73.303 117.294 1.00 24.00 ? 35   TRP F CD1 1 
ATOM   6600  C  CD2 . TRP F  1 35  ? 33.028 72.549 115.922 1.00 20.64 ? 35   TRP F CD2 1 
ATOM   6601  N  NE1 . TRP F  1 35  ? 33.811 74.362 116.977 1.00 24.88 ? 35   TRP F NE1 1 
ATOM   6602  C  CE2 . TRP F  1 35  ? 32.822 73.929 116.136 1.00 19.68 ? 35   TRP F CE2 1 
ATOM   6603  C  CE3 . TRP F  1 35  ? 32.145 71.853 115.090 1.00 22.02 ? 35   TRP F CE3 1 
ATOM   6604  C  CZ2 . TRP F  1 35  ? 31.768 74.634 115.548 1.00 17.90 ? 35   TRP F CZ2 1 
ATOM   6605  C  CZ3 . TRP F  1 35  ? 31.089 72.553 114.502 1.00 23.74 ? 35   TRP F CZ3 1 
ATOM   6606  C  CH2 . TRP F  1 35  ? 30.913 73.932 114.736 1.00 20.70 ? 35   TRP F CH2 1 
ATOM   6607  N  N   . GLY F  1 36  ? 37.563 68.758 116.676 1.00 27.04 ? 36   GLY F N   1 
ATOM   6608  C  CA  . GLY F  1 36  ? 37.966 67.405 117.002 1.00 28.85 ? 36   GLY F CA  1 
ATOM   6609  C  C   . GLY F  1 36  ? 37.018 66.366 116.437 1.00 30.85 ? 36   GLY F C   1 
ATOM   6610  O  O   . GLY F  1 36  ? 37.076 65.192 116.820 1.00 33.19 ? 36   GLY F O   1 
ATOM   6611  N  N   . LEU F  1 37  ? 36.135 66.785 115.533 1.00 30.56 ? 37   LEU F N   1 
ATOM   6612  C  CA  . LEU F  1 37  ? 35.207 65.853 114.914 1.00 33.06 ? 37   LEU F CA  1 
ATOM   6613  C  C   . LEU F  1 37  ? 35.843 65.253 113.649 1.00 35.87 ? 37   LEU F C   1 
ATOM   6614  O  O   . LEU F  1 37  ? 35.414 65.535 112.524 1.00 36.99 ? 37   LEU F O   1 
ATOM   6615  C  CB  . LEU F  1 37  ? 33.884 66.554 114.570 1.00 32.44 ? 37   LEU F CB  1 
ATOM   6616  C  CG  . LEU F  1 37  ? 32.888 66.901 115.690 1.00 31.42 ? 37   LEU F CG  1 
ATOM   6617  C  CD1 . LEU F  1 37  ? 32.749 65.731 116.652 1.00 27.16 ? 37   LEU F CD1 1 
ATOM   6618  C  CD2 . LEU F  1 37  ? 33.357 68.112 116.436 1.00 35.06 ? 37   LEU F CD2 1 
ATOM   6619  N  N   . GLU F  1 38  ? 36.867 64.421 113.848 1.00 38.00 ? 38   GLU F N   1 
ATOM   6620  C  CA  . GLU F  1 38  ? 37.594 63.771 112.753 1.00 41.62 ? 38   GLU F CA  1 
ATOM   6621  C  C   . GLU F  1 38  ? 36.737 63.259 111.588 1.00 39.84 ? 38   GLU F C   1 
ATOM   6622  O  O   . GLU F  1 38  ? 36.898 63.702 110.456 1.00 40.56 ? 38   GLU F O   1 
ATOM   6623  C  CB  . GLU F  1 38  ? 38.444 62.607 113.288 1.00 46.45 ? 38   GLU F CB  1 
ATOM   6624  C  CG  . GLU F  1 38  ? 39.929 62.918 113.488 1.00 56.87 ? 38   GLU F CG  1 
ATOM   6625  C  CD  . GLU F  1 38  ? 40.225 63.679 114.776 1.00 64.73 ? 38   GLU F CD  1 
ATOM   6626  O  OE1 . GLU F  1 38  ? 40.170 63.064 115.871 1.00 65.32 ? 38   GLU F OE1 1 
ATOM   6627  O  OE2 . GLU F  1 38  ? 40.513 64.896 114.688 1.00 68.29 ? 38   GLU F OE2 1 
ATOM   6628  N  N   . LYS F  1 39  ? 35.837 62.322 111.854 1.00 38.52 ? 39   LYS F N   1 
ATOM   6629  C  CA  . LYS F  1 39  ? 35.002 61.773 110.792 1.00 39.44 ? 39   LYS F CA  1 
ATOM   6630  C  C   . LYS F  1 39  ? 34.279 62.823 109.948 1.00 37.82 ? 39   LYS F C   1 
ATOM   6631  O  O   . LYS F  1 39  ? 34.422 62.858 108.723 1.00 35.60 ? 39   LYS F O   1 
ATOM   6632  C  CB  . LYS F  1 39  ? 33.978 60.795 111.372 1.00 42.10 ? 39   LYS F CB  1 
ATOM   6633  C  CG  . LYS F  1 39  ? 34.571 59.469 111.781 1.00 44.53 ? 39   LYS F CG  1 
ATOM   6634  C  CD  . LYS F  1 39  ? 33.581 58.339 111.561 1.00 49.49 ? 39   LYS F CD  1 
ATOM   6635  C  CE  . LYS F  1 39  ? 34.234 56.997 111.858 1.00 55.79 ? 39   LYS F CE  1 
ATOM   6636  N  NZ  . LYS F  1 39  ? 33.354 55.834 111.546 1.00 58.33 ? 39   LYS F NZ  1 
ATOM   6637  N  N   . LEU F  1 40  ? 33.495 63.667 110.605 1.00 34.64 ? 40   LEU F N   1 
ATOM   6638  C  CA  . LEU F  1 40  ? 32.755 64.703 109.909 1.00 33.58 ? 40   LEU F CA  1 
ATOM   6639  C  C   . LEU F  1 40  ? 33.690 65.520 109.027 1.00 34.35 ? 40   LEU F C   1 
ATOM   6640  O  O   . LEU F  1 40  ? 33.426 65.740 107.838 1.00 33.25 ? 40   LEU F O   1 
ATOM   6641  C  CB  . LEU F  1 40  ? 32.083 65.619 110.924 1.00 32.77 ? 40   LEU F CB  1 
ATOM   6642  C  CG  . LEU F  1 40  ? 30.563 65.618 110.991 1.00 31.02 ? 40   LEU F CG  1 
ATOM   6643  C  CD1 . LEU F  1 40  ? 30.015 64.226 110.759 1.00 33.69 ? 40   LEU F CD1 1 
ATOM   6644  C  CD2 . LEU F  1 40  ? 30.148 66.135 112.352 1.00 32.54 ? 40   LEU F CD2 1 
ATOM   6645  N  N   . GLY F  1 41  ? 34.788 65.965 109.624 1.00 33.01 ? 41   GLY F N   1 
ATOM   6646  C  CA  . GLY F  1 41  ? 35.738 66.770 108.892 1.00 33.52 ? 41   GLY F CA  1 
ATOM   6647  C  C   . GLY F  1 41  ? 36.269 66.082 107.657 1.00 34.68 ? 41   GLY F C   1 
ATOM   6648  O  O   . GLY F  1 41  ? 36.446 66.711 106.612 1.00 36.72 ? 41   GLY F O   1 
ATOM   6649  N  N   . LYS F  1 42  ? 36.525 64.786 107.760 1.00 34.37 ? 42   LYS F N   1 
ATOM   6650  C  CA  . LYS F  1 42  ? 37.058 64.073 106.620 1.00 37.03 ? 42   LYS F CA  1 
ATOM   6651  C  C   . LYS F  1 42  ? 36.018 63.958 105.514 1.00 38.08 ? 42   LYS F C   1 
ATOM   6652  O  O   . LYS F  1 42  ? 36.329 64.143 104.341 1.00 40.37 ? 42   LYS F O   1 
ATOM   6653  C  CB  . LYS F  1 42  ? 37.545 62.686 107.030 1.00 37.41 ? 42   LYS F CB  1 
ATOM   6654  C  CG  . LYS F  1 42  ? 38.735 62.243 106.215 1.00 40.22 ? 42   LYS F CG  1 
ATOM   6655  C  CD  . LYS F  1 42  ? 39.180 60.847 106.563 1.00 46.98 ? 42   LYS F CD  1 
ATOM   6656  C  CE  . LYS F  1 42  ? 38.267 59.796 105.960 1.00 49.04 ? 42   LYS F CE  1 
ATOM   6657  N  NZ  . LYS F  1 42  ? 38.853 58.443 106.182 1.00 52.77 ? 42   LYS F NZ  1 
ATOM   6658  N  N   . HIS F  1 43  ? 34.779 63.664 105.880 1.00 39.23 ? 43   HIS F N   1 
ATOM   6659  C  CA  . HIS F  1 43  ? 33.736 63.538 104.876 1.00 40.85 ? 43   HIS F CA  1 
ATOM   6660  C  C   . HIS F  1 43  ? 33.521 64.887 104.199 1.00 40.07 ? 43   HIS F C   1 
ATOM   6661  O  O   . HIS F  1 43  ? 33.587 64.987 102.974 1.00 37.69 ? 43   HIS F O   1 
ATOM   6662  C  CB  . HIS F  1 43  ? 32.436 63.035 105.515 1.00 42.58 ? 43   HIS F CB  1 
ATOM   6663  C  CG  . HIS F  1 43  ? 31.475 62.438 104.533 1.00 47.48 ? 43   HIS F CG  1 
ATOM   6664  N  ND1 . HIS F  1 43  ? 30.737 63.201 103.651 1.00 50.96 ? 43   HIS F ND1 1 
ATOM   6665  C  CD2 . HIS F  1 43  ? 31.148 61.148 104.277 1.00 46.77 ? 43   HIS F CD2 1 
ATOM   6666  C  CE1 . HIS F  1 43  ? 29.998 62.407 102.895 1.00 48.91 ? 43   HIS F CE1 1 
ATOM   6667  N  NE2 . HIS F  1 43  ? 30.229 61.156 103.254 1.00 48.84 ? 43   HIS F NE2 1 
ATOM   6668  N  N   . GLU F  1 44  ? 33.284 65.924 104.998 1.00 41.12 ? 44   GLU F N   1 
ATOM   6669  C  CA  . GLU F  1 44  ? 33.072 67.266 104.461 1.00 42.96 ? 44   GLU F CA  1 
ATOM   6670  C  C   . GLU F  1 44  ? 34.240 67.702 103.597 1.00 42.04 ? 44   GLU F C   1 
ATOM   6671  O  O   . GLU F  1 44  ? 34.074 68.485 102.663 1.00 40.92 ? 44   GLU F O   1 
ATOM   6672  C  CB  . GLU F  1 44  ? 32.876 68.274 105.591 1.00 45.00 ? 44   GLU F CB  1 
ATOM   6673  C  CG  . GLU F  1 44  ? 31.521 68.169 106.228 1.00 50.95 ? 44   GLU F CG  1 
ATOM   6674  C  CD  . GLU F  1 44  ? 30.416 68.442 105.238 1.00 53.04 ? 44   GLU F CD  1 
ATOM   6675  O  OE1 . GLU F  1 44  ? 30.182 69.631 104.932 1.00 55.92 ? 44   GLU F OE1 1 
ATOM   6676  O  OE2 . GLU F  1 44  ? 29.798 67.466 104.756 1.00 52.97 ? 44   GLU F OE2 1 
ATOM   6677  N  N   . TYR F  1 45  ? 35.426 67.207 103.925 1.00 41.56 ? 45   TYR F N   1 
ATOM   6678  C  CA  . TYR F  1 45  ? 36.602 67.547 103.151 1.00 41.53 ? 45   TYR F CA  1 
ATOM   6679  C  C   . TYR F  1 45  ? 36.449 66.955 101.755 1.00 41.87 ? 45   TYR F C   1 
ATOM   6680  O  O   . TYR F  1 45  ? 36.562 67.673 100.753 1.00 42.53 ? 45   TYR F O   1 
ATOM   6681  C  CB  . TYR F  1 45  ? 37.868 67.012 103.819 1.00 43.46 ? 45   TYR F CB  1 
ATOM   6682  C  CG  . TYR F  1 45  ? 39.101 67.261 102.989 1.00 44.92 ? 45   TYR F CG  1 
ATOM   6683  C  CD1 . TYR F  1 45  ? 39.582 66.288 102.115 1.00 46.49 ? 45   TYR F CD1 1 
ATOM   6684  C  CD2 . TYR F  1 45  ? 39.736 68.498 103.013 1.00 45.52 ? 45   TYR F CD2 1 
ATOM   6685  C  CE1 . TYR F  1 45  ? 40.658 66.541 101.279 1.00 46.98 ? 45   TYR F CE1 1 
ATOM   6686  C  CE2 . TYR F  1 45  ? 40.816 68.763 102.180 1.00 49.19 ? 45   TYR F CE2 1 
ATOM   6687  C  CZ  . TYR F  1 45  ? 41.268 67.781 101.312 1.00 48.45 ? 45   TYR F CZ  1 
ATOM   6688  O  OH  . TYR F  1 45  ? 42.303 68.053 100.446 1.00 52.35 ? 45   TYR F OH  1 
ATOM   6689  N  N   . HIS F  1 46  ? 36.179 65.652 101.684 1.00 39.13 ? 46   HIS F N   1 
ATOM   6690  C  CA  . HIS F  1 46  ? 36.000 65.014 100.389 1.00 39.87 ? 46   HIS F CA  1 
ATOM   6691  C  C   . HIS F  1 46  ? 34.853 65.674 99.623  1.00 37.92 ? 46   HIS F C   1 
ATOM   6692  O  O   . HIS F  1 46  ? 35.021 66.018 98.459  1.00 36.87 ? 46   HIS F O   1 
ATOM   6693  C  CB  . HIS F  1 46  ? 35.770 63.508 100.545 1.00 41.99 ? 46   HIS F CB  1 
ATOM   6694  C  CG  . HIS F  1 46  ? 36.930 62.788 101.168 1.00 51.38 ? 46   HIS F CG  1 
ATOM   6695  N  ND1 . HIS F  1 46  ? 38.242 63.136 100.920 1.00 54.02 ? 46   HIS F ND1 1 
ATOM   6696  C  CD2 . HIS F  1 46  ? 36.977 61.745 102.033 1.00 53.57 ? 46   HIS F CD2 1 
ATOM   6697  C  CE1 . HIS F  1 46  ? 39.045 62.343 101.609 1.00 52.84 ? 46   HIS F CE1 1 
ATOM   6698  N  NE2 . HIS F  1 46  ? 38.303 61.490 102.292 1.00 52.80 ? 46   HIS F NE2 1 
ATOM   6699  N  N   . GLU F  1 47  ? 33.703 65.874 100.262 1.00 36.47 ? 47   GLU F N   1 
ATOM   6700  C  CA  . GLU F  1 47  ? 32.588 66.537 99.582  1.00 39.36 ? 47   GLU F CA  1 
ATOM   6701  C  C   . GLU F  1 47  ? 33.085 67.820 98.928  1.00 40.18 ? 47   GLU F C   1 
ATOM   6702  O  O   . GLU F  1 47  ? 32.561 68.254 97.901  1.00 42.20 ? 47   GLU F O   1 
ATOM   6703  C  CB  . GLU F  1 47  ? 31.474 66.916 100.560 1.00 41.43 ? 47   GLU F CB  1 
ATOM   6704  C  CG  . GLU F  1 47  ? 30.736 65.747 101.174 1.00 50.48 ? 47   GLU F CG  1 
ATOM   6705  C  CD  . GLU F  1 47  ? 30.046 64.875 100.139 1.00 52.84 ? 47   GLU F CD  1 
ATOM   6706  O  OE1 . GLU F  1 47  ? 30.746 64.330 99.257  1.00 53.56 ? 47   GLU F OE1 1 
ATOM   6707  O  OE2 . GLU F  1 47  ? 28.803 64.732 100.217 1.00 56.51 ? 47   GLU F OE2 1 
ATOM   6708  N  N   . SER F  1 48  ? 34.106 68.420 99.529  1.00 38.80 ? 48   SER F N   1 
ATOM   6709  C  CA  . SER F  1 48  ? 34.658 69.665 99.026  1.00 36.59 ? 48   SER F CA  1 
ATOM   6710  C  C   . SER F  1 48  ? 35.533 69.454 97.787  1.00 36.70 ? 48   SER F C   1 
ATOM   6711  O  O   . SER F  1 48  ? 35.409 70.187 96.803  1.00 34.93 ? 48   SER F O   1 
ATOM   6712  C  CB  . SER F  1 48  ? 35.453 70.348 100.133 1.00 34.37 ? 48   SER F CB  1 
ATOM   6713  O  OG  . SER F  1 48  ? 35.565 71.734 99.879  1.00 37.87 ? 48   SER F OG  1 
ATOM   6714  N  N   . ILE F  1 49  ? 36.417 68.460 97.837  1.00 35.44 ? 49   ILE F N   1 
ATOM   6715  C  CA  . ILE F  1 49  ? 37.283 68.164 96.700  1.00 33.81 ? 49   ILE F CA  1 
ATOM   6716  C  C   . ILE F  1 49  ? 36.391 67.722 95.541  1.00 35.45 ? 49   ILE F C   1 
ATOM   6717  O  O   . ILE F  1 49  ? 36.724 67.899 94.371  1.00 39.71 ? 49   ILE F O   1 
ATOM   6718  C  CB  . ILE F  1 49  ? 38.326 67.051 97.052  1.00 31.84 ? 49   ILE F CB  1 
ATOM   6719  C  CG1 . ILE F  1 49  ? 39.580 67.670 97.692  1.00 34.36 ? 49   ILE F CG1 1 
ATOM   6720  C  CG2 . ILE F  1 49  ? 38.771 66.327 95.800  1.00 24.33 ? 49   ILE F CG2 1 
ATOM   6721  C  CD1 . ILE F  1 49  ? 39.324 68.553 98.892  1.00 34.56 ? 49   ILE F CD1 1 
ATOM   6722  N  N   . ASP F  1 50  ? 35.242 67.160 95.885  1.00 34.88 ? 50   ASP F N   1 
ATOM   6723  C  CA  . ASP F  1 50  ? 34.270 66.703 94.902  1.00 36.33 ? 50   ASP F CA  1 
ATOM   6724  C  C   . ASP F  1 50  ? 33.750 67.894 94.090  1.00 37.66 ? 50   ASP F C   1 
ATOM   6725  O  O   . ASP F  1 50  ? 33.788 67.896 92.856  1.00 38.53 ? 50   ASP F O   1 
ATOM   6726  C  CB  . ASP F  1 50  ? 33.098 66.040 95.631  1.00 39.07 ? 50   ASP F CB  1 
ATOM   6727  C  CG  . ASP F  1 50  ? 33.061 64.534 95.445  1.00 41.82 ? 50   ASP F CG  1 
ATOM   6728  O  OD1 . ASP F  1 50  ? 34.136 63.916 95.269  1.00 41.65 ? 50   ASP F OD1 1 
ATOM   6729  O  OD2 . ASP F  1 50  ? 31.943 63.970 95.489  1.00 43.01 ? 50   ASP F OD2 1 
ATOM   6730  N  N   . GLU F  1 51  ? 33.266 68.903 94.809  1.00 36.26 ? 51   GLU F N   1 
ATOM   6731  C  CA  . GLU F  1 51  ? 32.706 70.113 94.230  1.00 34.31 ? 51   GLU F CA  1 
ATOM   6732  C  C   . GLU F  1 51  ? 33.761 70.801 93.380  1.00 33.90 ? 51   GLU F C   1 
ATOM   6733  O  O   . GLU F  1 51  ? 33.445 71.497 92.412  1.00 34.49 ? 51   GLU F O   1 
ATOM   6734  C  CB  . GLU F  1 51  ? 32.184 71.050 95.308  1.00 35.90 ? 51   GLU F CB  1 
ATOM   6735  C  CG  . GLU F  1 51  ? 31.164 70.419 96.247  1.00 39.13 ? 51   GLU F CG  1 
ATOM   6736  C  CD  . GLU F  1 51  ? 29.932 69.932 95.494  1.00 37.87 ? 51   GLU F CD  1 
ATOM   6737  O  OE1 . GLU F  1 51  ? 29.869 70.140 94.259  1.00 41.94 ? 51   GLU F OE1 1 
ATOM   6738  O  OE2 . GLU F  1 51  ? 29.029 69.360 96.135  1.00 41.22 ? 51   GLU F OE2 1 
ATOM   6739  N  N   . MET F  1 52  ? 35.023 70.602 93.742  1.00 33.56 ? 52   MET F N   1 
ATOM   6740  C  CA  . MET F  1 52  ? 36.120 71.198 92.996  1.00 33.31 ? 52   MET F CA  1 
ATOM   6741  C  C   . MET F  1 52  ? 36.204 70.497 91.650  1.00 31.85 ? 52   MET F C   1 
ATOM   6742  O  O   . MET F  1 52  ? 36.397 71.132 90.618  1.00 30.54 ? 52   MET F O   1 
ATOM   6743  C  CB  . MET F  1 52  ? 37.430 71.056 93.779  1.00 35.25 ? 52   MET F CB  1 
ATOM   6744  C  CG  . MET F  1 52  ? 37.525 72.029 94.961  1.00 42.38 ? 52   MET F CG  1 
ATOM   6745  S  SD  . MET F  1 52  ? 39.032 71.954 95.995  1.00 46.26 ? 52   MET F SD  1 
ATOM   6746  C  CE  . MET F  1 52  ? 38.277 71.998 97.644  1.00 48.09 ? 52   MET F CE  1 
ATOM   6747  N  N   . LYS F  1 53  ? 36.029 69.181 91.671  1.00 31.87 ? 53   LYS F N   1 
ATOM   6748  C  CA  . LYS F  1 53  ? 36.066 68.384 90.455  1.00 31.96 ? 53   LYS F CA  1 
ATOM   6749  C  C   . LYS F  1 53  ? 34.896 68.748 89.556  1.00 31.43 ? 53   LYS F C   1 
ATOM   6750  O  O   . LYS F  1 53  ? 35.016 68.752 88.328  1.00 32.00 ? 53   LYS F O   1 
ATOM   6751  C  CB  . LYS F  1 53  ? 36.021 66.901 90.803  1.00 33.78 ? 53   LYS F CB  1 
ATOM   6752  C  CG  . LYS F  1 53  ? 37.239 66.437 91.602  1.00 36.46 ? 53   LYS F CG  1 
ATOM   6753  C  CD  . LYS F  1 53  ? 37.138 64.959 91.942  1.00 39.64 ? 53   LYS F CD  1 
ATOM   6754  C  CE  . LYS F  1 53  ? 38.418 64.438 92.563  1.00 43.03 ? 53   LYS F CE  1 
ATOM   6755  N  NZ  . LYS F  1 53  ? 38.306 62.986 92.871  1.00 45.47 ? 53   LYS F NZ  1 
ATOM   6756  N  N   . HIS F  1 54  ? 33.759 69.049 90.172  1.00 29.95 ? 54   HIS F N   1 
ATOM   6757  C  CA  . HIS F  1 54  ? 32.572 69.450 89.418  1.00 29.57 ? 54   HIS F CA  1 
ATOM   6758  C  C   . HIS F  1 54  ? 32.850 70.767 88.715  1.00 29.22 ? 54   HIS F C   1 
ATOM   6759  O  O   . HIS F  1 54  ? 32.611 70.905 87.516  1.00 28.25 ? 54   HIS F O   1 
ATOM   6760  C  CB  . HIS F  1 54  ? 31.404 69.649 90.355  1.00 29.56 ? 54   HIS F CB  1 
ATOM   6761  C  CG  . HIS F  1 54  ? 30.827 68.324 90.872  1.00 33.17 ? 54   HIS F CG  1 
ATOM   6762  N  ND1 . HIS F  1 54  ? 29.757 68.261 91.741  1.00 31.27 ? 54   HIS F ND1 1 
ATOM   6763  C  CD2 . HIS F  1 54  ? 31.190 67.042 90.623  1.00 31.24 ? 54   HIS F CD2 1 
ATOM   6764  C  CE1 . HIS F  1 54  ? 29.486 66.995 92.005  1.00 32.17 ? 54   HIS F CE1 1 
ATOM   6765  N  NE2 . HIS F  1 54  ? 30.340 66.235 91.338  1.00 28.52 ? 54   HIS F NE2 1 
ATOM   6766  N  N   . ALA F  1 55  ? 33.356 71.733 89.476  1.00 29.73 ? 55   ALA F N   1 
ATOM   6767  C  CA  . ALA F  1 55  ? 33.680 73.048 88.943  1.00 30.25 ? 55   ALA F CA  1 
ATOM   6768  C  C   . ALA F  1 55  ? 34.675 72.900 87.800  1.00 31.08 ? 55   ALA F C   1 
ATOM   6769  O  O   . ALA F  1 55  ? 34.559 73.556 86.766  1.00 31.64 ? 55   ALA F O   1 
ATOM   6770  C  CB  . ALA F  1 55  ? 34.265 73.919 90.040  1.00 28.02 ? 55   ALA F CB  1 
ATOM   6771  N  N   . ASP F  1 56  ? 35.650 72.021 87.992  1.00 32.60 ? 56   ASP F N   1 
ATOM   6772  C  CA  . ASP F  1 56  ? 36.665 71.778 86.981  1.00 32.61 ? 56   ASP F CA  1 
ATOM   6773  C  C   . ASP F  1 56  ? 36.043 71.288 85.682  1.00 32.59 ? 56   ASP F C   1 
ATOM   6774  O  O   . ASP F  1 56  ? 36.401 71.756 84.601  1.00 33.06 ? 56   ASP F O   1 
ATOM   6775  C  CB  . ASP F  1 56  ? 37.676 70.749 87.487  1.00 32.98 ? 56   ASP F CB  1 
ATOM   6776  C  CG  . ASP F  1 56  ? 38.866 70.604 86.563  1.00 32.93 ? 56   ASP F CG  1 
ATOM   6777  O  OD1 . ASP F  1 56  ? 39.089 71.517 85.747  1.00 33.67 ? 56   ASP F OD1 1 
ATOM   6778  O  OD2 . ASP F  1 56  ? 39.589 69.590 86.658  1.00 36.47 ? 56   ASP F OD2 1 
ATOM   6779  N  N   . LYS F  1 57  ? 35.111 70.348 85.789  1.00 30.67 ? 57   LYS F N   1 
ATOM   6780  C  CA  . LYS F  1 57  ? 34.458 69.802 84.610  1.00 31.02 ? 57   LYS F CA  1 
ATOM   6781  C  C   . LYS F  1 57  ? 33.717 70.870 83.813  1.00 31.24 ? 57   LYS F C   1 
ATOM   6782  O  O   . LYS F  1 57  ? 33.825 70.928 82.586  1.00 33.01 ? 57   LYS F O   1 
ATOM   6783  C  CB  . LYS F  1 57  ? 33.468 68.712 85.005  1.00 36.10 ? 57   LYS F CB  1 
ATOM   6784  C  CG  . LYS F  1 57  ? 34.081 67.449 85.572  1.00 43.52 ? 57   LYS F CG  1 
ATOM   6785  C  CD  . LYS F  1 57  ? 33.001 66.378 85.738  1.00 50.67 ? 57   LYS F CD  1 
ATOM   6786  C  CE  . LYS F  1 57  ? 33.542 65.126 86.408  1.00 54.99 ? 57   LYS F CE  1 
ATOM   6787  N  NZ  . LYS F  1 57  ? 34.011 65.407 87.798  1.00 60.71 ? 57   LYS F NZ  1 
ATOM   6788  N  N   . LEU F  1 58  ? 32.951 71.701 84.513  1.00 29.07 ? 58   LEU F N   1 
ATOM   6789  C  CA  . LEU F  1 58  ? 32.178 72.759 83.876  1.00 26.02 ? 58   LEU F CA  1 
ATOM   6790  C  C   . LEU F  1 58  ? 33.119 73.754 83.216  1.00 26.25 ? 58   LEU F C   1 
ATOM   6791  O  O   . LEU F  1 58  ? 32.896 74.180 82.086  1.00 27.10 ? 58   LEU F O   1 
ATOM   6792  C  CB  . LEU F  1 58  ? 31.310 73.471 84.918  1.00 26.03 ? 58   LEU F CB  1 
ATOM   6793  C  CG  . LEU F  1 58  ? 30.284 72.601 85.656  1.00 26.24 ? 58   LEU F CG  1 
ATOM   6794  C  CD1 . LEU F  1 58  ? 29.775 73.322 86.899  1.00 26.04 ? 58   LEU F CD1 1 
ATOM   6795  C  CD2 . LEU F  1 58  ? 29.137 72.260 84.720  1.00 25.90 ? 58   LEU F CD2 1 
ATOM   6796  N  N   . ILE F  1 59  ? 34.176 74.128 83.922  1.00 26.43 ? 59   ILE F N   1 
ATOM   6797  C  CA  . ILE F  1 59  ? 35.129 75.070 83.365  1.00 29.09 ? 59   ILE F CA  1 
ATOM   6798  C  C   . ILE F  1 59  ? 35.596 74.564 82.001  1.00 29.79 ? 59   ILE F C   1 
ATOM   6799  O  O   . ILE F  1 59  ? 35.472 75.269 80.996  1.00 31.76 ? 59   ILE F O   1 
ATOM   6800  C  CB  . ILE F  1 59  ? 36.354 75.262 84.309  1.00 29.79 ? 59   ILE F CB  1 
ATOM   6801  C  CG1 . ILE F  1 59  ? 35.890 75.902 85.612  1.00 26.51 ? 59   ILE F CG1 1 
ATOM   6802  C  CG2 . ILE F  1 59  ? 37.421 76.154 83.653  1.00 24.34 ? 59   ILE F CG2 1 
ATOM   6803  C  CD1 . ILE F  1 59  ? 37.024 76.242 86.529  1.00 33.34 ? 59   ILE F CD1 1 
ATOM   6804  N  N   . LYS F  1 60  ? 36.112 73.339 81.966  1.00 29.34 ? 60   LYS F N   1 
ATOM   6805  C  CA  . LYS F  1 60  ? 36.599 72.763 80.720  1.00 30.03 ? 60   LYS F CA  1 
ATOM   6806  C  C   . LYS F  1 60  ? 35.521 72.763 79.652  1.00 30.00 ? 60   LYS F C   1 
ATOM   6807  O  O   . LYS F  1 60  ? 35.781 73.146 78.514  1.00 33.09 ? 60   LYS F O   1 
ATOM   6808  C  CB  . LYS F  1 60  ? 37.096 71.335 80.943  1.00 32.60 ? 60   LYS F CB  1 
ATOM   6809  C  CG  . LYS F  1 60  ? 38.305 71.225 81.870  1.00 38.11 ? 60   LYS F CG  1 
ATOM   6810  C  CD  . LYS F  1 60  ? 38.662 69.760 82.119  1.00 42.68 ? 60   LYS F CD  1 
ATOM   6811  C  CE  . LYS F  1 60  ? 39.665 69.598 83.256  1.00 45.34 ? 60   LYS F CE  1 
ATOM   6812  N  NZ  . LYS F  1 60  ? 39.892 68.158 83.606  1.00 43.87 ? 60   LYS F NZ  1 
ATOM   6813  N  N   . ARG F  1 61  ? 34.312 72.342 80.019  1.00 28.60 ? 61   ARG F N   1 
ATOM   6814  C  CA  . ARG F  1 61  ? 33.194 72.296 79.079  1.00 25.61 ? 61   ARG F CA  1 
ATOM   6815  C  C   . ARG F  1 61  ? 32.901 73.680 78.506  1.00 26.52 ? 61   ARG F C   1 
ATOM   6816  O  O   . ARG F  1 61  ? 32.705 73.831 77.301  1.00 26.57 ? 61   ARG F O   1 
ATOM   6817  C  CB  . ARG F  1 61  ? 31.935 71.754 79.761  1.00 24.92 ? 61   ARG F CB  1 
ATOM   6818  C  CG  . ARG F  1 61  ? 30.760 71.547 78.808  1.00 24.47 ? 61   ARG F CG  1 
ATOM   6819  C  CD  . ARG F  1 61  ? 31.115 70.518 77.756  1.00 23.03 ? 61   ARG F CD  1 
ATOM   6820  N  NE  . ARG F  1 61  ? 30.151 70.477 76.660  1.00 25.60 ? 61   ARG F NE  1 
ATOM   6821  C  CZ  . ARG F  1 61  ? 30.318 69.755 75.551  1.00 26.21 ? 61   ARG F CZ  1 
ATOM   6822  N  NH1 . ARG F  1 61  ? 31.411 69.022 75.393  1.00 24.70 ? 61   ARG F NH1 1 
ATOM   6823  N  NH2 . ARG F  1 61  ? 29.391 69.753 74.601  1.00 22.54 ? 61   ARG F NH2 1 
ATOM   6824  N  N   . ILE F  1 62  ? 32.862 74.687 79.373  1.00 25.36 ? 62   ILE F N   1 
ATOM   6825  C  CA  . ILE F  1 62  ? 32.604 76.052 78.938  1.00 22.58 ? 62   ILE F CA  1 
ATOM   6826  C  C   . ILE F  1 62  ? 33.702 76.500 77.978  1.00 23.72 ? 62   ILE F C   1 
ATOM   6827  O  O   . ILE F  1 62  ? 33.432 77.051 76.899  1.00 21.89 ? 62   ILE F O   1 
ATOM   6828  C  CB  . ILE F  1 62  ? 32.582 77.015 80.135  1.00 21.29 ? 62   ILE F CB  1 
ATOM   6829  C  CG1 . ILE F  1 62  ? 31.359 76.725 81.008  1.00 21.23 ? 62   ILE F CG1 1 
ATOM   6830  C  CG2 . ILE F  1 62  ? 32.586 78.472 79.644  1.00 18.65 ? 62   ILE F CG2 1 
ATOM   6831  C  CD1 . ILE F  1 62  ? 31.255 77.641 82.220  1.00 17.06 ? 62   ILE F CD1 1 
ATOM   6832  N  N   . LEU F  1 63  ? 34.945 76.265 78.387  1.00 23.49 ? 63   LEU F N   1 
ATOM   6833  C  CA  . LEU F  1 63  ? 36.106 76.636 77.588  1.00 23.40 ? 63   LEU F CA  1 
ATOM   6834  C  C   . LEU F  1 63  ? 36.021 76.023 76.192  1.00 23.61 ? 63   LEU F C   1 
ATOM   6835  O  O   . LEU F  1 63  ? 36.281 76.697 75.191  1.00 22.69 ? 63   LEU F O   1 
ATOM   6836  C  CB  . LEU F  1 63  ? 37.375 76.169 78.296  1.00 22.48 ? 63   LEU F CB  1 
ATOM   6837  C  CG  . LEU F  1 63  ? 38.400 77.176 78.834  1.00 20.97 ? 63   LEU F CG  1 
ATOM   6838  C  CD1 . LEU F  1 63  ? 37.809 78.565 79.042  1.00 15.34 ? 63   LEU F CD1 1 
ATOM   6839  C  CD2 . LEU F  1 63  ? 38.955 76.608 80.128  1.00 21.91 ? 63   LEU F CD2 1 
ATOM   6840  N  N   . PHE F  1 64  ? 35.642 74.748 76.130  1.00 25.62 ? 64   PHE F N   1 
ATOM   6841  C  CA  . PHE F  1 64  ? 35.516 74.045 74.856  1.00 28.10 ? 64   PHE F CA  1 
ATOM   6842  C  C   . PHE F  1 64  ? 34.419 74.669 74.002  1.00 28.26 ? 64   PHE F C   1 
ATOM   6843  O  O   . PHE F  1 64  ? 34.597 74.864 72.803  1.00 30.81 ? 64   PHE F O   1 
ATOM   6844  C  CB  . PHE F  1 64  ? 35.209 72.561 75.090  1.00 29.86 ? 64   PHE F CB  1 
ATOM   6845  C  CG  . PHE F  1 64  ? 34.915 71.793 73.824  1.00 33.66 ? 64   PHE F CG  1 
ATOM   6846  C  CD1 . PHE F  1 64  ? 35.813 71.815 72.751  1.00 33.46 ? 64   PHE F CD1 1 
ATOM   6847  C  CD2 . PHE F  1 64  ? 33.733 71.061 73.695  1.00 32.20 ? 64   PHE F CD2 1 
ATOM   6848  C  CE1 . PHE F  1 64  ? 35.536 71.121 71.564  1.00 30.91 ? 64   PHE F CE1 1 
ATOM   6849  C  CE2 . PHE F  1 64  ? 33.447 70.366 72.518  1.00 30.79 ? 64   PHE F CE2 1 
ATOM   6850  C  CZ  . PHE F  1 64  ? 34.351 70.398 71.450  1.00 32.59 ? 64   PHE F CZ  1 
ATOM   6851  N  N   . LEU F  1 65  ? 33.292 74.985 74.636  1.00 29.76 ? 65   LEU F N   1 
ATOM   6852  C  CA  . LEU F  1 65  ? 32.144 75.589 73.965  1.00 28.84 ? 65   LEU F CA  1 
ATOM   6853  C  C   . LEU F  1 65  ? 32.428 77.037 73.623  1.00 30.73 ? 65   LEU F C   1 
ATOM   6854  O  O   . LEU F  1 65  ? 31.550 77.767 73.160  1.00 29.44 ? 65   LEU F O   1 
ATOM   6855  C  CB  . LEU F  1 65  ? 30.906 75.494 74.858  1.00 29.26 ? 65   LEU F CB  1 
ATOM   6856  C  CG  . LEU F  1 65  ? 29.925 74.344 74.590  1.00 31.97 ? 65   LEU F CG  1 
ATOM   6857  C  CD1 . LEU F  1 65  ? 30.641 73.111 74.041  1.00 29.84 ? 65   LEU F CD1 1 
ATOM   6858  C  CD2 . LEU F  1 65  ? 29.187 74.027 75.887  1.00 32.57 ? 65   LEU F CD2 1 
ATOM   6859  N  N   . GLU F  1 66  ? 33.667 77.446 73.875  1.00 33.86 ? 66   GLU F N   1 
ATOM   6860  C  CA  . GLU F  1 66  ? 34.124 78.794 73.574  1.00 35.00 ? 66   GLU F CA  1 
ATOM   6861  C  C   . GLU F  1 66  ? 33.456 79.945 74.335  1.00 33.95 ? 66   GLU F C   1 
ATOM   6862  O  O   . GLU F  1 66  ? 33.233 81.019 73.776  1.00 33.53 ? 66   GLU F O   1 
ATOM   6863  C  CB  . GLU F  1 66  ? 34.026 79.019 72.067  1.00 36.45 ? 66   GLU F CB  1 
ATOM   6864  C  CG  . GLU F  1 66  ? 35.036 78.182 71.290  1.00 46.04 ? 66   GLU F CG  1 
ATOM   6865  C  CD  . GLU F  1 66  ? 34.799 78.194 69.787  1.00 51.37 ? 66   GLU F CD  1 
ATOM   6866  O  OE1 . GLU F  1 66  ? 34.497 79.274 69.233  1.00 54.90 ? 66   GLU F OE1 1 
ATOM   6867  O  OE2 . GLU F  1 66  ? 34.928 77.121 69.156  1.00 53.75 ? 66   GLU F OE2 1 
ATOM   6868  N  N   . GLY F  1 67  ? 33.152 79.722 75.610  1.00 31.30 ? 67   GLY F N   1 
ATOM   6869  C  CA  . GLY F  1 67  ? 32.555 80.770 76.419  1.00 31.38 ? 67   GLY F CA  1 
ATOM   6870  C  C   . GLY F  1 67  ? 33.564 81.236 77.457  1.00 33.42 ? 67   GLY F C   1 
ATOM   6871  O  O   . GLY F  1 67  ? 34.694 80.746 77.490  1.00 31.78 ? 67   GLY F O   1 
ATOM   6872  N  N   . LEU F  1 68  ? 33.184 82.184 78.307  1.00 34.35 ? 68   LEU F N   1 
ATOM   6873  C  CA  . LEU F  1 68  ? 34.105 82.651 79.334  1.00 33.84 ? 68   LEU F CA  1 
ATOM   6874  C  C   . LEU F  1 68  ? 33.647 82.188 80.700  1.00 34.90 ? 68   LEU F C   1 
ATOM   6875  O  O   . LEU F  1 68  ? 32.586 82.597 81.171  1.00 36.17 ? 68   LEU F O   1 
ATOM   6876  C  CB  . LEU F  1 68  ? 34.192 84.168 79.328  1.00 34.07 ? 68   LEU F CB  1 
ATOM   6877  C  CG  . LEU F  1 68  ? 34.753 84.775 78.047  1.00 35.87 ? 68   LEU F CG  1 
ATOM   6878  C  CD1 . LEU F  1 68  ? 34.660 86.284 78.140  1.00 39.34 ? 68   LEU F CD1 1 
ATOM   6879  C  CD2 . LEU F  1 68  ? 36.191 84.339 77.849  1.00 33.14 ? 68   LEU F CD2 1 
ATOM   6880  N  N   . PRO F  1 69  ? 34.433 81.311 81.351  1.00 35.33 ? 69   PRO F N   1 
ATOM   6881  C  CA  . PRO F  1 69  ? 34.063 80.816 82.682  1.00 34.27 ? 69   PRO F CA  1 
ATOM   6882  C  C   . PRO F  1 69  ? 34.056 81.982 83.658  1.00 36.21 ? 69   PRO F C   1 
ATOM   6883  O  O   . PRO F  1 69  ? 34.911 82.870 83.576  1.00 34.48 ? 69   PRO F O   1 
ATOM   6884  C  CB  . PRO F  1 69  ? 35.167 79.810 83.002  1.00 33.65 ? 69   PRO F CB  1 
ATOM   6885  C  CG  . PRO F  1 69  ? 35.614 79.335 81.641  1.00 33.16 ? 69   PRO F CG  1 
ATOM   6886  C  CD  . PRO F  1 69  ? 35.636 80.621 80.848  1.00 33.76 ? 69   PRO F CD  1 
ATOM   6887  N  N   . ASN F  1 70  ? 33.093 81.982 84.577  1.00 39.39 ? 70   ASN F N   1 
ATOM   6888  C  CA  . ASN F  1 70  ? 32.979 83.055 85.568  1.00 40.14 ? 70   ASN F CA  1 
ATOM   6889  C  C   . ASN F  1 70  ? 33.346 82.580 86.973  1.00 39.86 ? 70   ASN F C   1 
ATOM   6890  O  O   . ASN F  1 70  ? 32.485 82.135 87.727  1.00 38.77 ? 70   ASN F O   1 
ATOM   6891  C  CB  . ASN F  1 70  ? 31.549 83.601 85.584  1.00 39.57 ? 70   ASN F CB  1 
ATOM   6892  C  CG  . ASN F  1 70  ? 31.374 84.769 86.542  1.00 39.93 ? 70   ASN F CG  1 
ATOM   6893  O  OD1 . ASN F  1 70  ? 32.077 84.885 87.547  1.00 42.77 ? 70   ASN F OD1 1 
ATOM   6894  N  ND2 . ASN F  1 70  ? 30.412 85.629 86.243  1.00 41.04 ? 70   ASN F ND2 1 
ATOM   6895  N  N   . LEU F  1 71  ? 34.622 82.660 87.327  1.00 42.27 ? 71   LEU F N   1 
ATOM   6896  C  CA  . LEU F  1 71  ? 35.029 82.248 88.665  1.00 44.51 ? 71   LEU F CA  1 
ATOM   6897  C  C   . LEU F  1 71  ? 35.016 83.508 89.514  1.00 46.19 ? 71   LEU F C   1 
ATOM   6898  O  O   . LEU F  1 71  ? 35.447 83.502 90.666  1.00 46.41 ? 71   LEU F O   1 
ATOM   6899  C  CB  . LEU F  1 71  ? 36.441 81.651 88.661  1.00 42.69 ? 71   LEU F CB  1 
ATOM   6900  C  CG  . LEU F  1 71  ? 36.819 80.544 87.674  1.00 41.09 ? 71   LEU F CG  1 
ATOM   6901  C  CD1 . LEU F  1 71  ? 37.972 79.756 88.261  1.00 41.48 ? 71   LEU F CD1 1 
ATOM   6902  C  CD2 . LEU F  1 71  ? 35.655 79.621 87.426  1.00 43.84 ? 71   LEU F CD2 1 
ATOM   6903  N  N   . GLN F  1 72  ? 34.507 84.588 88.928  1.00 49.62 ? 72   GLN F N   1 
ATOM   6904  C  CA  . GLN F  1 72  ? 34.452 85.878 89.604  1.00 53.59 ? 72   GLN F CA  1 
ATOM   6905  C  C   . GLN F  1 72  ? 33.320 86.047 90.618  1.00 55.09 ? 72   GLN F C   1 
ATOM   6906  O  O   . GLN F  1 72  ? 33.524 86.633 91.679  1.00 56.64 ? 72   GLN F O   1 
ATOM   6907  C  CB  . GLN F  1 72  ? 34.378 87.012 88.575  1.00 54.15 ? 72   GLN F CB  1 
ATOM   6908  C  CG  . GLN F  1 72  ? 34.478 88.394 89.209  1.00 54.68 ? 72   GLN F CG  1 
ATOM   6909  C  CD  . GLN F  1 72  ? 35.802 88.605 89.922  1.00 53.74 ? 72   GLN F CD  1 
ATOM   6910  O  OE1 . GLN F  1 72  ? 36.826 88.859 89.289  1.00 55.29 ? 72   GLN F OE1 1 
ATOM   6911  N  NE2 . GLN F  1 72  ? 35.789 88.485 91.246  1.00 52.16 ? 72   GLN F NE2 1 
ATOM   6912  N  N   . GLU F  1 73  ? 32.127 85.557 90.306  1.00 57.11 ? 73   GLU F N   1 
ATOM   6913  C  CA  . GLU F  1 73  ? 31.025 85.704 91.250  1.00 59.43 ? 73   GLU F CA  1 
ATOM   6914  C  C   . GLU F  1 73  ? 30.906 84.528 92.211  1.00 58.67 ? 73   GLU F C   1 
ATOM   6915  O  O   . GLU F  1 73  ? 31.038 83.357 91.828  1.00 58.13 ? 73   GLU F O   1 
ATOM   6916  C  CB  . GLU F  1 73  ? 29.703 85.916 90.515  1.00 62.85 ? 73   GLU F CB  1 
ATOM   6917  C  CG  . GLU F  1 73  ? 29.672 87.195 89.703  1.00 69.12 ? 73   GLU F CG  1 
ATOM   6918  C  CD  . GLU F  1 73  ? 28.289 87.508 89.182  1.00 73.78 ? 73   GLU F CD  1 
ATOM   6919  O  OE1 . GLU F  1 73  ? 28.158 88.455 88.373  1.00 77.21 ? 73   GLU F OE1 1 
ATOM   6920  O  OE2 . GLU F  1 73  ? 27.331 86.810 89.586  1.00 75.55 ? 73   GLU F OE2 1 
ATOM   6921  N  N   . LEU F  1 74  ? 30.655 84.869 93.468  1.00 55.30 ? 74   LEU F N   1 
ATOM   6922  C  CA  . LEU F  1 74  ? 30.523 83.900 94.537  1.00 51.73 ? 74   LEU F CA  1 
ATOM   6923  C  C   . LEU F  1 74  ? 29.316 84.339 95.364  1.00 51.56 ? 74   LEU F C   1 
ATOM   6924  O  O   . LEU F  1 74  ? 29.324 85.411 95.975  1.00 52.67 ? 74   LEU F O   1 
ATOM   6925  C  CB  . LEU F  1 74  ? 31.807 83.911 95.373  1.00 51.01 ? 74   LEU F CB  1 
ATOM   6926  C  CG  . LEU F  1 74  ? 32.055 82.821 96.414  1.00 50.27 ? 74   LEU F CG  1 
ATOM   6927  C  CD1 . LEU F  1 74  ? 31.353 83.165 97.714  1.00 50.53 ? 74   LEU F CD1 1 
ATOM   6928  C  CD2 . LEU F  1 74  ? 31.591 81.483 95.855  1.00 50.71 ? 74   LEU F CD2 1 
ATOM   6929  N  N   . GLY F  1 75  ? 28.275 83.511 95.368  1.00 49.16 ? 75   GLY F N   1 
ATOM   6930  C  CA  . GLY F  1 75  ? 27.066 83.840 96.095  1.00 43.47 ? 75   GLY F CA  1 
ATOM   6931  C  C   . GLY F  1 75  ? 27.155 83.675 97.592  1.00 43.00 ? 75   GLY F C   1 
ATOM   6932  O  O   . GLY F  1 75  ? 28.211 83.391 98.150  1.00 41.44 ? 75   GLY F O   1 
ATOM   6933  N  N   . LYS F  1 76  ? 26.021 83.854 98.249  1.00 44.68 ? 76   LYS F N   1 
ATOM   6934  C  CA  . LYS F  1 76  ? 25.958 83.728 99.695  1.00 48.72 ? 76   LYS F CA  1 
ATOM   6935  C  C   . LYS F  1 76  ? 26.457 82.353 100.138 1.00 48.82 ? 76   LYS F C   1 
ATOM   6936  O  O   . LYS F  1 76  ? 26.163 81.336 99.510  1.00 49.28 ? 76   LYS F O   1 
ATOM   6937  C  CB  . LYS F  1 76  ? 24.515 83.934 100.185 1.00 50.70 ? 76   LYS F CB  1 
ATOM   6938  C  CG  . LYS F  1 76  ? 24.379 84.190 101.686 1.00 54.77 ? 76   LYS F CG  1 
ATOM   6939  C  CD  . LYS F  1 76  ? 25.001 85.533 102.075 1.00 60.22 ? 76   LYS F CD  1 
ATOM   6940  C  CE  . LYS F  1 76  ? 24.901 85.805 103.575 1.00 62.32 ? 76   LYS F CE  1 
ATOM   6941  N  NZ  . LYS F  1 76  ? 25.675 84.820 104.395 1.00 66.46 ? 76   LYS F NZ  1 
ATOM   6942  N  N   . LEU F  1 77  ? 27.224 82.342 101.220 1.00 48.27 ? 77   LEU F N   1 
ATOM   6943  C  CA  . LEU F  1 77  ? 27.747 81.109 101.783 1.00 46.61 ? 77   LEU F CA  1 
ATOM   6944  C  C   . LEU F  1 77  ? 26.898 80.835 103.015 1.00 45.11 ? 77   LEU F C   1 
ATOM   6945  O  O   . LEU F  1 77  ? 26.730 81.713 103.857 1.00 47.02 ? 77   LEU F O   1 
ATOM   6946  C  CB  . LEU F  1 77  ? 29.202 81.299 102.205 1.00 45.61 ? 77   LEU F CB  1 
ATOM   6947  C  CG  . LEU F  1 77  ? 30.209 80.264 101.720 1.00 44.20 ? 77   LEU F CG  1 
ATOM   6948  C  CD1 . LEU F  1 77  ? 30.240 80.260 100.196 1.00 43.30 ? 77   LEU F CD1 1 
ATOM   6949  C  CD2 . LEU F  1 77  ? 31.575 80.590 102.290 1.00 42.20 ? 77   LEU F CD2 1 
ATOM   6950  N  N   . LEU F  1 78  ? 26.353 79.631 103.119 1.00 43.48 ? 78   LEU F N   1 
ATOM   6951  C  CA  . LEU F  1 78  ? 25.532 79.285 104.270 1.00 40.94 ? 78   LEU F CA  1 
ATOM   6952  C  C   . LEU F  1 78  ? 26.380 78.598 105.324 1.00 41.10 ? 78   LEU F C   1 
ATOM   6953  O  O   . LEU F  1 78  ? 26.476 77.369 105.354 1.00 41.08 ? 78   LEU F O   1 
ATOM   6954  C  CB  . LEU F  1 78  ? 24.388 78.369 103.848 1.00 40.54 ? 78   LEU F CB  1 
ATOM   6955  C  CG  . LEU F  1 78  ? 23.420 78.977 102.833 1.00 41.73 ? 78   LEU F CG  1 
ATOM   6956  C  CD1 . LEU F  1 78  ? 22.217 78.049 102.650 1.00 42.50 ? 78   LEU F CD1 1 
ATOM   6957  C  CD2 . LEU F  1 78  ? 22.968 80.347 103.316 1.00 41.91 ? 78   LEU F CD2 1 
ATOM   6958  N  N   . ILE F  1 79  ? 26.995 79.399 106.190 1.00 41.72 ? 79   ILE F N   1 
ATOM   6959  C  CA  . ILE F  1 79  ? 27.851 78.868 107.246 1.00 42.68 ? 79   ILE F CA  1 
ATOM   6960  C  C   . ILE F  1 79  ? 27.105 78.603 108.553 1.00 42.59 ? 79   ILE F C   1 
ATOM   6961  O  O   . ILE F  1 79  ? 26.487 79.504 109.119 1.00 43.16 ? 79   ILE F O   1 
ATOM   6962  C  CB  . ILE F  1 79  ? 29.010 79.830 107.547 1.00 42.14 ? 79   ILE F CB  1 
ATOM   6963  C  CG1 . ILE F  1 79  ? 29.627 80.317 106.234 1.00 39.94 ? 79   ILE F CG1 1 
ATOM   6964  C  CG2 . ILE F  1 79  ? 30.043 79.133 108.441 1.00 42.02 ? 79   ILE F CG2 1 
ATOM   6965  C  CD1 . ILE F  1 79  ? 30.045 79.197 105.300 1.00 41.32 ? 79   ILE F CD1 1 
ATOM   6966  N  N   . GLY F  1 80  ? 27.168 77.364 109.029 1.00 42.39 ? 80   GLY F N   1 
ATOM   6967  C  CA  . GLY F  1 80  ? 26.497 77.028 110.269 1.00 43.88 ? 80   GLY F CA  1 
ATOM   6968  C  C   . GLY F  1 80  ? 27.402 77.348 111.441 1.00 45.12 ? 80   GLY F C   1 
ATOM   6969  O  O   . GLY F  1 80  ? 28.574 77.679 111.244 1.00 45.98 ? 80   GLY F O   1 
ATOM   6970  N  N   . GLU F  1 81  ? 26.868 77.269 112.657 1.00 44.60 ? 81   GLU F N   1 
ATOM   6971  C  CA  . GLU F  1 81  ? 27.672 77.534 113.844 1.00 46.61 ? 81   GLU F CA  1 
ATOM   6972  C  C   . GLU F  1 81  ? 27.901 76.258 114.648 1.00 46.23 ? 81   GLU F C   1 
ATOM   6973  O  O   . GLU F  1 81  ? 28.892 76.134 115.371 1.00 48.40 ? 81   GLU F O   1 
ATOM   6974  C  CB  . GLU F  1 81  ? 27.007 78.585 114.728 1.00 47.28 ? 81   GLU F CB  1 
ATOM   6975  C  CG  . GLU F  1 81  ? 26.963 79.958 114.105 1.00 51.79 ? 81   GLU F CG  1 
ATOM   6976  C  CD  . GLU F  1 81  ? 26.581 81.025 115.103 1.00 54.56 ? 81   GLU F CD  1 
ATOM   6977  O  OE1 . GLU F  1 81  ? 25.520 80.887 115.751 1.00 59.17 ? 81   GLU F OE1 1 
ATOM   6978  O  OE2 . GLU F  1 81  ? 27.342 82.002 115.240 1.00 56.26 ? 81   GLU F OE2 1 
ATOM   6979  N  N   . HIS F  1 82  ? 26.977 75.312 114.523 1.00 43.82 ? 82   HIS F N   1 
ATOM   6980  C  CA  . HIS F  1 82  ? 27.091 74.042 115.224 1.00 41.51 ? 82   HIS F CA  1 
ATOM   6981  C  C   . HIS F  1 82  ? 26.707 72.941 114.243 1.00 38.34 ? 82   HIS F C   1 
ATOM   6982  O  O   . HIS F  1 82  ? 26.014 73.203 113.264 1.00 36.60 ? 82   HIS F O   1 
ATOM   6983  C  CB  . HIS F  1 82  ? 26.187 74.036 116.459 1.00 41.68 ? 82   HIS F CB  1 
ATOM   6984  C  CG  . HIS F  1 82  ? 24.739 74.235 116.151 1.00 44.32 ? 82   HIS F CG  1 
ATOM   6985  N  ND1 . HIS F  1 82  ? 23.963 73.262 115.557 1.00 46.34 ? 82   HIS F ND1 1 
ATOM   6986  C  CD2 . HIS F  1 82  ? 23.921 75.295 116.358 1.00 45.73 ? 82   HIS F CD2 1 
ATOM   6987  C  CE1 . HIS F  1 82  ? 22.729 73.713 115.414 1.00 47.79 ? 82   HIS F CE1 1 
ATOM   6988  N  NE2 . HIS F  1 82  ? 22.677 74.945 115.892 1.00 48.92 ? 82   HIS F NE2 1 
ATOM   6989  N  N   . THR F  1 83  ? 27.156 71.718 114.511 1.00 35.96 ? 83   THR F N   1 
ATOM   6990  C  CA  . THR F  1 83  ? 26.908 70.583 113.625 1.00 34.62 ? 83   THR F CA  1 
ATOM   6991  C  C   . THR F  1 83  ? 25.565 70.505 112.914 1.00 35.45 ? 83   THR F C   1 
ATOM   6992  O  O   . THR F  1 83  ? 25.517 70.671 111.699 1.00 38.12 ? 83   THR F O   1 
ATOM   6993  C  CB  . THR F  1 83  ? 27.131 69.251 114.342 1.00 33.61 ? 83   THR F CB  1 
ATOM   6994  O  OG1 . THR F  1 83  ? 28.420 69.268 114.968 1.00 36.59 ? 83   THR F OG1 1 
ATOM   6995  C  CG2 . THR F  1 83  ? 27.070 68.093 113.344 1.00 27.21 ? 83   THR F CG2 1 
ATOM   6996  N  N   . LYS F  1 84  ? 24.480 70.253 113.640 1.00 34.43 ? 84   LYS F N   1 
ATOM   6997  C  CA  . LYS F  1 84  ? 23.183 70.141 112.985 1.00 35.56 ? 84   LYS F CA  1 
ATOM   6998  C  C   . LYS F  1 84  ? 22.848 71.304 112.050 1.00 35.57 ? 84   LYS F C   1 
ATOM   6999  O  O   . LYS F  1 84  ? 22.219 71.116 111.005 1.00 32.61 ? 84   LYS F O   1 
ATOM   7000  C  CB  . LYS F  1 84  ? 22.059 69.988 113.999 1.00 38.18 ? 84   LYS F CB  1 
ATOM   7001  C  CG  . LYS F  1 84  ? 20.712 69.832 113.300 1.00 47.37 ? 84   LYS F CG  1 
ATOM   7002  C  CD  . LYS F  1 84  ? 19.566 69.588 114.255 1.00 51.78 ? 84   LYS F CD  1 
ATOM   7003  C  CE  . LYS F  1 84  ? 18.265 69.453 113.486 1.00 53.86 ? 84   LYS F CE  1 
ATOM   7004  N  NZ  . LYS F  1 84  ? 17.110 69.282 114.415 1.00 60.34 ? 84   LYS F NZ  1 
ATOM   7005  N  N   . GLU F  1 85  ? 23.265 72.506 112.426 1.00 36.40 ? 85   GLU F N   1 
ATOM   7006  C  CA  . GLU F  1 85  ? 23.003 73.685 111.610 1.00 37.32 ? 85   GLU F CA  1 
ATOM   7007  C  C   . GLU F  1 85  ? 23.812 73.580 110.318 1.00 36.09 ? 85   GLU F C   1 
ATOM   7008  O  O   . GLU F  1 85  ? 23.301 73.833 109.228 1.00 36.34 ? 85   GLU F O   1 
ATOM   7009  C  CB  . GLU F  1 85  ? 23.398 74.936 112.392 1.00 39.68 ? 85   GLU F CB  1 
ATOM   7010  C  CG  . GLU F  1 85  ? 22.968 76.243 111.782 1.00 44.44 ? 85   GLU F CG  1 
ATOM   7011  C  CD  . GLU F  1 85  ? 23.331 77.411 112.673 1.00 51.61 ? 85   GLU F CD  1 
ATOM   7012  O  OE1 . GLU F  1 85  ? 22.867 77.433 113.836 1.00 55.49 ? 85   GLU F OE1 1 
ATOM   7013  O  OE2 . GLU F  1 85  ? 24.087 78.301 112.222 1.00 54.23 ? 85   GLU F OE2 1 
ATOM   7014  N  N   . MET F  1 86  ? 25.076 73.191 110.459 1.00 35.36 ? 86   MET F N   1 
ATOM   7015  C  CA  . MET F  1 86  ? 25.988 73.033 109.328 1.00 35.26 ? 86   MET F CA  1 
ATOM   7016  C  C   . MET F  1 86  ? 25.490 71.988 108.343 1.00 33.66 ? 86   MET F C   1 
ATOM   7017  O  O   . MET F  1 86  ? 25.610 72.162 107.143 1.00 33.96 ? 86   MET F O   1 
ATOM   7018  C  CB  . MET F  1 86  ? 27.384 72.660 109.835 1.00 34.77 ? 86   MET F CB  1 
ATOM   7019  C  CG  . MET F  1 86  ? 28.094 73.824 110.521 1.00 35.43 ? 86   MET F CG  1 
ATOM   7020  S  SD  . MET F  1 86  ? 29.315 73.312 111.741 1.00 36.35 ? 86   MET F SD  1 
ATOM   7021  C  CE  . MET F  1 86  ? 30.683 72.789 110.689 1.00 34.92 ? 86   MET F CE  1 
ATOM   7022  N  N   . LEU F  1 87  ? 24.935 70.900 108.854 1.00 35.49 ? 87   LEU F N   1 
ATOM   7023  C  CA  . LEU F  1 87  ? 24.400 69.851 107.997 1.00 35.85 ? 87   LEU F CA  1 
ATOM   7024  C  C   . LEU F  1 87  ? 23.194 70.404 107.239 1.00 36.38 ? 87   LEU F C   1 
ATOM   7025  O  O   . LEU F  1 87  ? 23.066 70.201 106.027 1.00 36.25 ? 87   LEU F O   1 
ATOM   7026  C  CB  . LEU F  1 87  ? 23.978 68.641 108.842 1.00 35.03 ? 87   LEU F CB  1 
ATOM   7027  C  CG  . LEU F  1 87  ? 24.944 67.462 109.006 1.00 34.57 ? 87   LEU F CG  1 
ATOM   7028  C  CD1 . LEU F  1 87  ? 26.374 67.931 109.049 1.00 36.85 ? 87   LEU F CD1 1 
ATOM   7029  C  CD2 . LEU F  1 87  ? 24.592 66.714 110.281 1.00 34.46 ? 87   LEU F CD2 1 
ATOM   7030  N  N   . GLU F  1 88  ? 22.319 71.113 107.951 1.00 36.61 ? 88   GLU F N   1 
ATOM   7031  C  CA  . GLU F  1 88  ? 21.127 71.677 107.326 1.00 38.84 ? 88   GLU F CA  1 
ATOM   7032  C  C   . GLU F  1 88  ? 21.495 72.685 106.249 1.00 39.04 ? 88   GLU F C   1 
ATOM   7033  O  O   . GLU F  1 88  ? 20.864 72.723 105.196 1.00 41.98 ? 88   GLU F O   1 
ATOM   7034  C  CB  . GLU F  1 88  ? 20.218 72.319 108.378 1.00 39.39 ? 88   GLU F CB  1 
ATOM   7035  C  CG  . GLU F  1 88  ? 19.636 71.298 109.349 1.00 46.14 ? 88   GLU F CG  1 
ATOM   7036  C  CD  . GLU F  1 88  ? 18.782 71.914 110.449 1.00 50.30 ? 88   GLU F CD  1 
ATOM   7037  O  OE1 . GLU F  1 88  ? 19.250 72.865 111.122 1.00 50.91 ? 88   GLU F OE1 1 
ATOM   7038  O  OE2 . GLU F  1 88  ? 17.645 71.430 110.648 1.00 52.90 ? 88   GLU F OE2 1 
ATOM   7039  N  N   . CYS F  1 89  ? 22.521 73.491 106.507 1.00 37.82 ? 89   CYS F N   1 
ATOM   7040  C  CA  . CYS F  1 89  ? 22.976 74.472 105.531 1.00 36.39 ? 89   CYS F CA  1 
ATOM   7041  C  C   . CYS F  1 89  ? 23.490 73.794 104.264 1.00 37.27 ? 89   CYS F C   1 
ATOM   7042  O  O   . CYS F  1 89  ? 23.213 74.253 103.158 1.00 41.03 ? 89   CYS F O   1 
ATOM   7043  C  CB  . CYS F  1 89  ? 24.095 75.332 106.113 1.00 35.99 ? 89   CYS F CB  1 
ATOM   7044  S  SG  . CYS F  1 89  ? 23.543 76.566 107.283 1.00 38.18 ? 89   CYS F SG  1 
ATOM   7045  N  N   . ASP F  1 90  ? 24.251 72.714 104.421 1.00 35.22 ? 90   ASP F N   1 
ATOM   7046  C  CA  . ASP F  1 90  ? 24.782 72.006 103.265 1.00 37.66 ? 90   ASP F CA  1 
ATOM   7047  C  C   . ASP F  1 90  ? 23.653 71.314 102.503 1.00 38.92 ? 90   ASP F C   1 
ATOM   7048  O  O   . ASP F  1 90  ? 23.684 71.236 101.272 1.00 38.54 ? 90   ASP F O   1 
ATOM   7049  C  CB  . ASP F  1 90  ? 25.841 70.972 103.683 1.00 38.34 ? 90   ASP F CB  1 
ATOM   7050  C  CG  . ASP F  1 90  ? 27.106 71.613 104.275 1.00 41.10 ? 90   ASP F CG  1 
ATOM   7051  O  OD1 . ASP F  1 90  ? 27.417 72.783 103.953 1.00 41.84 ? 90   ASP F OD1 1 
ATOM   7052  O  OD2 . ASP F  1 90  ? 27.806 70.932 105.055 1.00 41.12 ? 90   ASP F OD2 1 
ATOM   7053  N  N   . LEU F  1 91  ? 22.654 70.815 103.229 1.00 39.11 ? 91   LEU F N   1 
ATOM   7054  C  CA  . LEU F  1 91  ? 21.524 70.141 102.589 1.00 39.96 ? 91   LEU F CA  1 
ATOM   7055  C  C   . LEU F  1 91  ? 20.727 71.163 101.796 1.00 41.08 ? 91   LEU F C   1 
ATOM   7056  O  O   . LEU F  1 91  ? 20.372 70.937 100.638 1.00 41.22 ? 91   LEU F O   1 
ATOM   7057  C  CB  . LEU F  1 91  ? 20.607 69.505 103.633 1.00 39.11 ? 91   LEU F CB  1 
ATOM   7058  C  CG  . LEU F  1 91  ? 19.389 68.741 103.100 1.00 35.37 ? 91   LEU F CG  1 
ATOM   7059  C  CD1 . LEU F  1 91  ? 19.830 67.437 102.441 1.00 33.35 ? 91   LEU F CD1 1 
ATOM   7060  C  CD2 . LEU F  1 91  ? 18.442 68.453 104.247 1.00 32.36 ? 91   LEU F CD2 1 
ATOM   7061  N  N   . LYS F  1 92  ? 20.445 72.287 102.443 1.00 40.90 ? 92   LYS F N   1 
ATOM   7062  C  CA  . LYS F  1 92  ? 19.700 73.368 101.825 1.00 43.97 ? 92   LYS F CA  1 
ATOM   7063  C  C   . LYS F  1 92  ? 20.436 73.835 100.571 1.00 45.97 ? 92   LYS F C   1 
ATOM   7064  O  O   . LYS F  1 92  ? 19.814 74.170 99.562  1.00 47.30 ? 92   LYS F O   1 
ATOM   7065  C  CB  . LYS F  1 92  ? 19.550 74.520 102.824 1.00 45.53 ? 92   LYS F CB  1 
ATOM   7066  C  CG  . LYS F  1 92  ? 18.848 75.755 102.289 1.00 50.66 ? 92   LYS F CG  1 
ATOM   7067  C  CD  . LYS F  1 92  ? 18.498 76.708 103.430 1.00 56.43 ? 92   LYS F CD  1 
ATOM   7068  C  CE  . LYS F  1 92  ? 18.086 78.086 102.915 1.00 60.33 ? 92   LYS F CE  1 
ATOM   7069  N  NZ  . LYS F  1 92  ? 16.955 78.022 101.943 1.00 61.60 ? 92   LYS F NZ  1 
ATOM   7070  N  N   . LEU F  1 93  ? 21.765 73.834 100.641 1.00 46.79 ? 93   LEU F N   1 
ATOM   7071  C  CA  . LEU F  1 93  ? 22.615 74.252 99.530  1.00 45.27 ? 93   LEU F CA  1 
ATOM   7072  C  C   . LEU F  1 93  ? 22.533 73.253 98.374  1.00 45.11 ? 93   LEU F C   1 
ATOM   7073  O  O   . LEU F  1 93  ? 22.372 73.648 97.218  1.00 43.89 ? 93   LEU F O   1 
ATOM   7074  C  CB  . LEU F  1 93  ? 24.060 74.390 100.024 1.00 46.19 ? 93   LEU F CB  1 
ATOM   7075  C  CG  . LEU F  1 93  ? 25.158 74.961 99.124  1.00 45.13 ? 93   LEU F CG  1 
ATOM   7076  C  CD1 . LEU F  1 93  ? 25.561 73.944 98.073  1.00 48.70 ? 93   LEU F CD1 1 
ATOM   7077  C  CD2 . LEU F  1 93  ? 24.662 76.251 98.493  1.00 49.11 ? 93   LEU F CD2 1 
ATOM   7078  N  N   . GLU F  1 94  ? 22.644 71.965 98.690  1.00 44.97 ? 94   GLU F N   1 
ATOM   7079  C  CA  . GLU F  1 94  ? 22.572 70.912 97.679  1.00 48.56 ? 94   GLU F CA  1 
ATOM   7080  C  C   . GLU F  1 94  ? 21.189 70.779 97.044  1.00 50.04 ? 94   GLU F C   1 
ATOM   7081  O  O   . GLU F  1 94  ? 21.045 70.160 95.990  1.00 50.01 ? 94   GLU F O   1 
ATOM   7082  C  CB  . GLU F  1 94  ? 22.968 69.564 98.285  1.00 49.86 ? 94   GLU F CB  1 
ATOM   7083  C  CG  . GLU F  1 94  ? 24.454 69.414 98.566  1.00 55.47 ? 94   GLU F CG  1 
ATOM   7084  C  CD  . GLU F  1 94  ? 25.252 69.042 97.328  1.00 56.42 ? 94   GLU F CD  1 
ATOM   7085  O  OE1 . GLU F  1 94  ? 24.932 67.998 96.727  1.00 58.66 ? 94   GLU F OE1 1 
ATOM   7086  O  OE2 . GLU F  1 94  ? 26.195 69.781 96.961  1.00 54.67 ? 94   GLU F OE2 1 
ATOM   7087  N  N   . GLN F  1 95  ? 20.169 71.322 97.702  1.00 50.52 ? 95   GLN F N   1 
ATOM   7088  C  CA  . GLN F  1 95  ? 18.816 71.230 97.172  1.00 51.28 ? 95   GLN F CA  1 
ATOM   7089  C  C   . GLN F  1 95  ? 18.437 72.424 96.306  1.00 53.35 ? 95   GLN F C   1 
ATOM   7090  O  O   . GLN F  1 95  ? 17.730 72.273 95.309  1.00 54.77 ? 95   GLN F O   1 
ATOM   7091  C  CB  . GLN F  1 95  ? 17.810 71.054 98.310  1.00 48.46 ? 95   GLN F CB  1 
ATOM   7092  C  CG  . GLN F  1 95  ? 17.963 69.725 99.028  1.00 48.75 ? 95   GLN F CG  1 
ATOM   7093  C  CD  . GLN F  1 95  ? 16.890 69.479 100.070 1.00 48.54 ? 95   GLN F CD  1 
ATOM   7094  O  OE1 . GLN F  1 95  ? 16.616 70.335 100.917 1.00 47.34 ? 95   GLN F OE1 1 
ATOM   7095  N  NE2 . GLN F  1 95  ? 16.285 68.296 100.024 1.00 48.68 ? 95   GLN F NE2 1 
ATOM   7096  N  N   . ALA F  1 96  ? 18.912 73.608 96.680  1.00 54.39 ? 96   ALA F N   1 
ATOM   7097  C  CA  . ALA F  1 96  ? 18.621 74.815 95.914  1.00 54.26 ? 96   ALA F CA  1 
ATOM   7098  C  C   . ALA F  1 96  ? 19.310 74.734 94.563  1.00 55.33 ? 96   ALA F C   1 
ATOM   7099  O  O   . ALA F  1 96  ? 18.965 75.470 93.638  1.00 57.48 ? 96   ALA F O   1 
ATOM   7100  C  CB  . ALA F  1 96  ? 19.103 76.045 96.665  1.00 52.78 ? 96   ALA F CB  1 
ATOM   7101  N  N   . GLY F  1 97  ? 20.278 73.827 94.452  1.00 55.84 ? 97   GLY F N   1 
ATOM   7102  C  CA  . GLY F  1 97  ? 21.016 73.678 93.212  1.00 55.21 ? 97   GLY F CA  1 
ATOM   7103  C  C   . GLY F  1 97  ? 20.429 72.693 92.223  1.00 56.25 ? 97   GLY F C   1 
ATOM   7104  O  O   . GLY F  1 97  ? 20.597 72.853 91.011  1.00 56.70 ? 97   GLY F O   1 
ATOM   7105  N  N   . LEU F  1 98  ? 19.741 71.673 92.727  1.00 56.49 ? 98   LEU F N   1 
ATOM   7106  C  CA  . LEU F  1 98  ? 19.144 70.657 91.860  1.00 56.63 ? 98   LEU F CA  1 
ATOM   7107  C  C   . LEU F  1 98  ? 18.207 71.217 90.790  1.00 55.51 ? 98   LEU F C   1 
ATOM   7108  O  O   . LEU F  1 98  ? 18.314 70.858 89.621  1.00 52.42 ? 98   LEU F O   1 
ATOM   7109  C  CB  . LEU F  1 98  ? 18.410 69.611 92.707  1.00 56.70 ? 98   LEU F CB  1 
ATOM   7110  C  CG  . LEU F  1 98  ? 19.257 68.479 93.311  1.00 57.33 ? 98   LEU F CG  1 
ATOM   7111  C  CD1 . LEU F  1 98  ? 19.030 67.199 92.525  1.00 54.44 ? 98   LEU F CD1 1 
ATOM   7112  C  CD2 . LEU F  1 98  ? 20.738 68.862 93.319  1.00 56.17 ? 98   LEU F CD2 1 
ATOM   7113  N  N   . PRO F  1 99  ? 17.276 72.103 91.173  1.00 55.68 ? 99   PRO F N   1 
ATOM   7114  C  CA  . PRO F  1 99  ? 16.375 72.647 90.158  1.00 56.16 ? 99   PRO F CA  1 
ATOM   7115  C  C   . PRO F  1 99  ? 17.169 73.200 88.983  1.00 55.95 ? 99   PRO F C   1 
ATOM   7116  O  O   . PRO F  1 99  ? 16.823 72.977 87.820  1.00 57.00 ? 99   PRO F O   1 
ATOM   7117  C  CB  . PRO F  1 99  ? 15.623 73.738 90.917  1.00 54.87 ? 99   PRO F CB  1 
ATOM   7118  C  CG  . PRO F  1 99  ? 15.550 73.180 92.291  1.00 55.77 ? 99   PRO F CG  1 
ATOM   7119  C  CD  . PRO F  1 99  ? 16.957 72.659 92.498  1.00 56.58 ? 99   PRO F CD  1 
ATOM   7120  N  N   . ASP F  1 100 ? 18.247 73.913 89.292  1.00 54.42 ? 100  ASP F N   1 
ATOM   7121  C  CA  . ASP F  1 100 ? 19.069 74.499 88.246  1.00 53.82 ? 100  ASP F CA  1 
ATOM   7122  C  C   . ASP F  1 100 ? 19.672 73.432 87.330  1.00 51.81 ? 100  ASP F C   1 
ATOM   7123  O  O   . ASP F  1 100 ? 19.643 73.581 86.104  1.00 50.76 ? 100  ASP F O   1 
ATOM   7124  C  CB  . ASP F  1 100 ? 20.156 75.379 88.867  1.00 56.28 ? 100  ASP F CB  1 
ATOM   7125  C  CG  . ASP F  1 100 ? 19.579 76.599 89.583  1.00 59.33 ? 100  ASP F CG  1 
ATOM   7126  O  OD1 . ASP F  1 100 ? 20.368 77.441 90.068  1.00 61.90 ? 100  ASP F OD1 1 
ATOM   7127  O  OD2 . ASP F  1 100 ? 18.334 76.714 89.664  1.00 61.77 ? 100  ASP F OD2 1 
ATOM   7128  N  N   . LEU F  1 101 ? 20.199 72.359 87.920  1.00 47.78 ? 101  LEU F N   1 
ATOM   7129  C  CA  . LEU F  1 101 ? 20.778 71.259 87.150  1.00 45.03 ? 101  LEU F CA  1 
ATOM   7130  C  C   . LEU F  1 101 ? 19.735 70.633 86.225  1.00 44.83 ? 101  LEU F C   1 
ATOM   7131  O  O   . LEU F  1 101 ? 20.007 70.334 85.061  1.00 45.27 ? 101  LEU F O   1 
ATOM   7132  C  CB  . LEU F  1 101 ? 21.310 70.177 88.087  1.00 43.87 ? 101  LEU F CB  1 
ATOM   7133  C  CG  . LEU F  1 101 ? 22.722 70.347 88.642  1.00 45.07 ? 101  LEU F CG  1 
ATOM   7134  C  CD1 . LEU F  1 101 ? 22.945 69.379 89.802  1.00 42.77 ? 101  LEU F CD1 1 
ATOM   7135  C  CD2 . LEU F  1 101 ? 23.729 70.113 87.521  1.00 44.80 ? 101  LEU F CD2 1 
ATOM   7136  N  N   . LYS F  1 102 ? 18.537 70.427 86.756  1.00 43.80 ? 102  LYS F N   1 
ATOM   7137  C  CA  . LYS F  1 102 ? 17.464 69.834 85.983  1.00 40.89 ? 102  LYS F CA  1 
ATOM   7138  C  C   . LYS F  1 102 ? 17.006 70.776 84.889  1.00 38.75 ? 102  LYS F C   1 
ATOM   7139  O  O   . LYS F  1 102 ? 16.727 70.346 83.770  1.00 37.82 ? 102  LYS F O   1 
ATOM   7140  C  CB  . LYS F  1 102 ? 16.310 69.463 86.909  1.00 41.06 ? 102  LYS F CB  1 
ATOM   7141  C  CG  . LYS F  1 102 ? 16.715 68.374 87.880  1.00 43.16 ? 102  LYS F CG  1 
ATOM   7142  C  CD  . LYS F  1 102 ? 15.551 67.795 88.658  1.00 45.77 ? 102  LYS F CD  1 
ATOM   7143  C  CE  . LYS F  1 102 ? 16.015 66.550 89.395  1.00 47.20 ? 102  LYS F CE  1 
ATOM   7144  N  NZ  . LYS F  1 102 ? 14.903 65.856 90.088  1.00 54.33 ? 102  LYS F NZ  1 
ATOM   7145  N  N   . ALA F  1 103 ? 16.944 72.063 85.210  1.00 35.87 ? 103  ALA F N   1 
ATOM   7146  C  CA  . ALA F  1 103 ? 16.538 73.064 84.236  1.00 32.82 ? 103  ALA F CA  1 
ATOM   7147  C  C   . ALA F  1 103 ? 17.603 73.140 83.137  1.00 34.61 ? 103  ALA F C   1 
ATOM   7148  O  O   . ALA F  1 103 ? 17.309 73.514 81.995  1.00 38.27 ? 103  ALA F O   1 
ATOM   7149  C  CB  . ALA F  1 103 ? 16.389 74.409 84.910  1.00 27.97 ? 103  ALA F CB  1 
ATOM   7150  N  N   . ALA F  1 104 ? 18.838 72.781 83.485  1.00 30.09 ? 104  ALA F N   1 
ATOM   7151  C  CA  . ALA F  1 104 ? 19.943 72.807 82.533  1.00 27.47 ? 104  ALA F CA  1 
ATOM   7152  C  C   . ALA F  1 104 ? 19.952 71.539 81.670  1.00 27.70 ? 104  ALA F C   1 
ATOM   7153  O  O   . ALA F  1 104 ? 20.166 71.601 80.458  1.00 25.95 ? 104  ALA F O   1 
ATOM   7154  C  CB  . ALA F  1 104 ? 21.258 72.955 83.276  1.00 23.48 ? 104  ALA F CB  1 
ATOM   7155  N  N   . ILE F  1 105 ? 19.730 70.388 82.293  1.00 27.59 ? 105  ILE F N   1 
ATOM   7156  C  CA  . ILE F  1 105 ? 19.683 69.134 81.548  1.00 28.60 ? 105  ILE F CA  1 
ATOM   7157  C  C   . ILE F  1 105 ? 18.537 69.278 80.538  1.00 31.39 ? 105  ILE F C   1 
ATOM   7158  O  O   . ILE F  1 105 ? 18.676 68.944 79.354  1.00 31.74 ? 105  ILE F O   1 
ATOM   7159  C  CB  . ILE F  1 105 ? 19.404 67.930 82.499  1.00 27.54 ? 105  ILE F CB  1 
ATOM   7160  C  CG1 . ILE F  1 105 ? 20.659 67.623 83.321  1.00 26.70 ? 105  ILE F CG1 1 
ATOM   7161  C  CG2 . ILE F  1 105 ? 18.966 66.693 81.704  1.00 21.70 ? 105  ILE F CG2 1 
ATOM   7162  C  CD1 . ILE F  1 105 ? 20.387 66.737 84.522  1.00 28.52 ? 105  ILE F CD1 1 
ATOM   7163  N  N   . ALA F  1 106 ? 17.412 69.796 81.026  1.00 30.55 ? 106  ALA F N   1 
ATOM   7164  C  CA  . ALA F  1 106 ? 16.236 70.008 80.203  1.00 28.72 ? 106  ALA F CA  1 
ATOM   7165  C  C   . ALA F  1 106 ? 16.586 70.890 79.022  1.00 29.03 ? 106  ALA F C   1 
ATOM   7166  O  O   . ALA F  1 106 ? 16.189 70.607 77.893  1.00 29.67 ? 106  ALA F O   1 
ATOM   7167  C  CB  . ALA F  1 106 ? 15.140 70.664 81.018  1.00 27.81 ? 106  ALA F CB  1 
ATOM   7168  N  N   . TYR F  1 107 ? 17.338 71.955 79.277  1.00 28.61 ? 107  TYR F N   1 
ATOM   7169  C  CA  . TYR F  1 107 ? 17.694 72.866 78.201  1.00 30.20 ? 107  TYR F CA  1 
ATOM   7170  C  C   . TYR F  1 107 ? 18.612 72.229 77.163  1.00 31.70 ? 107  TYR F C   1 
ATOM   7171  O  O   . TYR F  1 107 ? 18.377 72.353 75.959  1.00 32.21 ? 107  TYR F O   1 
ATOM   7172  C  CB  . TYR F  1 107 ? 18.358 74.134 78.740  1.00 32.46 ? 107  TYR F CB  1 
ATOM   7173  C  CG  . TYR F  1 107 ? 18.477 75.165 77.659  1.00 35.71 ? 107  TYR F CG  1 
ATOM   7174  C  CD1 . TYR F  1 107 ? 17.373 75.930 77.282  1.00 36.97 ? 107  TYR F CD1 1 
ATOM   7175  C  CD2 . TYR F  1 107 ? 19.642 75.269 76.898  1.00 39.14 ? 107  TYR F CD2 1 
ATOM   7176  C  CE1 . TYR F  1 107 ? 17.417 76.761 76.164  1.00 39.23 ? 107  TYR F CE1 1 
ATOM   7177  C  CE2 . TYR F  1 107 ? 19.700 76.096 75.777  1.00 40.37 ? 107  TYR F CE2 1 
ATOM   7178  C  CZ  . TYR F  1 107 ? 18.582 76.836 75.413  1.00 42.08 ? 107  TYR F CZ  1 
ATOM   7179  O  OH  . TYR F  1 107 ? 18.620 77.621 74.279  1.00 46.43 ? 107  TYR F OH  1 
ATOM   7180  N  N   . CYS F  1 108 ? 19.660 71.549 77.617  1.00 31.06 ? 108  CYS F N   1 
ATOM   7181  C  CA  . CYS F  1 108 ? 20.579 70.911 76.683  1.00 32.26 ? 108  CYS F CA  1 
ATOM   7182  C  C   . CYS F  1 108 ? 19.797 69.994 75.735  1.00 32.88 ? 108  CYS F C   1 
ATOM   7183  O  O   . CYS F  1 108 ? 20.077 69.947 74.533  1.00 31.36 ? 108  CYS F O   1 
ATOM   7184  C  CB  . CYS F  1 108 ? 21.655 70.133 77.448  1.00 32.49 ? 108  CYS F CB  1 
ATOM   7185  S  SG  . CYS F  1 108 ? 22.765 71.205 78.418  1.00 37.63 ? 108  CYS F SG  1 
ATOM   7186  N  N   . GLU F  1 109 ? 18.811 69.283 76.283  1.00 32.67 ? 109  GLU F N   1 
ATOM   7187  C  CA  . GLU F  1 109 ? 17.957 68.397 75.495  1.00 33.85 ? 109  GLU F CA  1 
ATOM   7188  C  C   . GLU F  1 109 ? 17.240 69.192 74.413  1.00 33.84 ? 109  GLU F C   1 
ATOM   7189  O  O   . GLU F  1 109 ? 17.163 68.764 73.262  1.00 33.48 ? 109  GLU F O   1 
ATOM   7190  C  CB  . GLU F  1 109 ? 16.880 67.760 76.374  1.00 34.59 ? 109  GLU F CB  1 
ATOM   7191  C  CG  . GLU F  1 109 ? 17.089 66.312 76.713  1.00 37.18 ? 109  GLU F CG  1 
ATOM   7192  C  CD  . GLU F  1 109 ? 16.981 65.386 75.517  1.00 37.74 ? 109  GLU F CD  1 
ATOM   7193  O  OE1 . GLU F  1 109 ? 15.995 65.502 74.754  1.00 40.08 ? 109  GLU F OE1 1 
ATOM   7194  O  OE2 . GLU F  1 109 ? 17.875 64.528 75.349  1.00 35.56 ? 109  GLU F OE2 1 
ATOM   7195  N  N   . SER F  1 110 ? 16.704 70.346 74.795  1.00 33.20 ? 110  SER F N   1 
ATOM   7196  C  CA  . SER F  1 110 ? 15.962 71.169 73.856  1.00 36.45 ? 110  SER F CA  1 
ATOM   7197  C  C   . SER F  1 110 ? 16.813 71.670 72.700  1.00 36.83 ? 110  SER F C   1 
ATOM   7198  O  O   . SER F  1 110 ? 16.331 71.737 71.569  1.00 39.05 ? 110  SER F O   1 
ATOM   7199  C  CB  . SER F  1 110 ? 15.307 72.352 74.573  1.00 38.47 ? 110  SER F CB  1 
ATOM   7200  O  OG  . SER F  1 110 ? 16.266 73.321 74.955  1.00 45.52 ? 110  SER F OG  1 
ATOM   7201  N  N   . VAL F  1 111 ? 18.071 72.015 72.960  1.00 35.21 ? 111  VAL F N   1 
ATOM   7202  C  CA  . VAL F  1 111 ? 18.921 72.497 71.874  1.00 34.22 ? 111  VAL F CA  1 
ATOM   7203  C  C   . VAL F  1 111 ? 19.880 71.437 71.345  1.00 33.20 ? 111  VAL F C   1 
ATOM   7204  O  O   . VAL F  1 111 ? 20.818 71.748 70.617  1.00 36.01 ? 111  VAL F O   1 
ATOM   7205  C  CB  . VAL F  1 111 ? 19.735 73.740 72.290  1.00 33.78 ? 111  VAL F CB  1 
ATOM   7206  C  CG1 . VAL F  1 111 ? 18.818 74.738 72.978  1.00 33.53 ? 111  VAL F CG1 1 
ATOM   7207  C  CG2 . VAL F  1 111 ? 20.909 73.341 73.167  1.00 33.25 ? 111  VAL F CG2 1 
ATOM   7208  N  N   . GLY F  1 112 ? 19.649 70.185 71.719  1.00 32.17 ? 112  GLY F N   1 
ATOM   7209  C  CA  . GLY F  1 112 ? 20.498 69.107 71.247  1.00 28.97 ? 112  GLY F CA  1 
ATOM   7210  C  C   . GLY F  1 112 ? 21.945 69.070 71.717  1.00 30.51 ? 112  GLY F C   1 
ATOM   7211  O  O   . GLY F  1 112 ? 22.790 68.495 71.018  1.00 29.52 ? 112  GLY F O   1 
ATOM   7212  N  N   . ASP F  1 113 ? 22.266 69.676 72.863  1.00 31.51 ? 113  ASP F N   1 
ATOM   7213  C  CA  . ASP F  1 113 ? 23.650 69.611 73.342  1.00 30.03 ? 113  ASP F CA  1 
ATOM   7214  C  C   . ASP F  1 113 ? 23.737 68.411 74.270  1.00 29.39 ? 113  ASP F C   1 
ATOM   7215  O  O   . ASP F  1 113 ? 23.910 68.537 75.483  1.00 31.09 ? 113  ASP F O   1 
ATOM   7216  C  CB  . ASP F  1 113 ? 24.068 70.868 74.098  1.00 30.28 ? 113  ASP F CB  1 
ATOM   7217  C  CG  . ASP F  1 113 ? 25.551 70.847 74.461  1.00 33.98 ? 113  ASP F CG  1 
ATOM   7218  O  OD1 . ASP F  1 113 ? 26.223 69.844 74.131  1.00 39.44 ? 113  ASP F OD1 1 
ATOM   7219  O  OD2 . ASP F  1 113 ? 26.055 71.817 75.065  1.00 32.80 ? 113  ASP F OD2 1 
ATOM   7220  N  N   . TYR F  1 114 ? 23.611 67.240 73.668  1.00 27.68 ? 114  TYR F N   1 
ATOM   7221  C  CA  . TYR F  1 114 ? 23.627 65.984 74.381  1.00 27.06 ? 114  TYR F CA  1 
ATOM   7222  C  C   . TYR F  1 114 ? 24.853 65.731 75.236  1.00 26.47 ? 114  TYR F C   1 
ATOM   7223  O  O   . TYR F  1 114 ? 24.737 65.184 76.331  1.00 27.70 ? 114  TYR F O   1 
ATOM   7224  C  CB  . TYR F  1 114 ? 23.425 64.859 73.376  1.00 28.22 ? 114  TYR F CB  1 
ATOM   7225  C  CG  . TYR F  1 114 ? 22.162 65.052 72.552  1.00 32.30 ? 114  TYR F CG  1 
ATOM   7226  C  CD1 . TYR F  1 114 ? 20.904 65.072 73.166  1.00 32.16 ? 114  TYR F CD1 1 
ATOM   7227  C  CD2 . TYR F  1 114 ? 22.219 65.188 71.159  1.00 30.00 ? 114  TYR F CD2 1 
ATOM   7228  C  CE1 . TYR F  1 114 ? 19.734 65.215 72.418  1.00 33.86 ? 114  TYR F CE1 1 
ATOM   7229  C  CE2 . TYR F  1 114 ? 21.058 65.330 70.401  1.00 31.49 ? 114  TYR F CE2 1 
ATOM   7230  C  CZ  . TYR F  1 114 ? 19.816 65.339 71.036  1.00 35.19 ? 114  TYR F CZ  1 
ATOM   7231  O  OH  . TYR F  1 114 ? 18.655 65.439 70.294  1.00 34.87 ? 114  TYR F OH  1 
ATOM   7232  N  N   . ALA F  1 115 ? 26.024 66.128 74.756  1.00 27.29 ? 115  ALA F N   1 
ATOM   7233  C  CA  . ALA F  1 115 ? 27.245 65.902 75.522  1.00 27.76 ? 115  ALA F CA  1 
ATOM   7234  C  C   . ALA F  1 115 ? 27.226 66.719 76.812  1.00 29.59 ? 115  ALA F C   1 
ATOM   7235  O  O   . ALA F  1 115 ? 27.606 66.220 77.863  1.00 31.54 ? 115  ALA F O   1 
ATOM   7236  C  CB  . ALA F  1 115 ? 28.475 66.246 74.682  1.00 27.27 ? 115  ALA F CB  1 
ATOM   7237  N  N   . SER F  1 116 ? 26.788 67.973 76.744  1.00 30.08 ? 116  SER F N   1 
ATOM   7238  C  CA  . SER F  1 116 ? 26.712 68.790 77.950  1.00 30.95 ? 116  SER F CA  1 
ATOM   7239  C  C   . SER F  1 116 ? 25.684 68.167 78.891  1.00 31.25 ? 116  SER F C   1 
ATOM   7240  O  O   . SER F  1 116 ? 25.811 68.265 80.112  1.00 31.15 ? 116  SER F O   1 
ATOM   7241  C  CB  . SER F  1 116 ? 26.298 70.224 77.618  1.00 31.71 ? 116  SER F CB  1 
ATOM   7242  O  OG  . SER F  1 116 ? 27.327 70.887 76.907  1.00 36.95 ? 116  SER F OG  1 
ATOM   7243  N  N   . ARG F  1 117 ? 24.668 67.522 78.322  1.00 29.41 ? 117  ARG F N   1 
ATOM   7244  C  CA  . ARG F  1 117 ? 23.652 66.877 79.142  1.00 29.54 ? 117  ARG F CA  1 
ATOM   7245  C  C   . ARG F  1 117 ? 24.246 65.729 79.958  1.00 31.44 ? 117  ARG F C   1 
ATOM   7246  O  O   . ARG F  1 117 ? 23.900 65.547 81.125  1.00 32.10 ? 117  ARG F O   1 
ATOM   7247  C  CB  . ARG F  1 117 ? 22.501 66.339 78.291  1.00 27.64 ? 117  ARG F CB  1 
ATOM   7248  C  CG  . ARG F  1 117 ? 21.562 65.493 79.121  1.00 26.04 ? 117  ARG F CG  1 
ATOM   7249  C  CD  . ARG F  1 117 ? 20.321 64.993 78.399  1.00 27.37 ? 117  ARG F CD  1 
ATOM   7250  N  NE  . ARG F  1 117 ? 19.639 64.050 79.278  1.00 27.20 ? 117  ARG F NE  1 
ATOM   7251  C  CZ  . ARG F  1 117 ? 18.329 63.845 79.312  1.00 24.96 ? 117  ARG F CZ  1 
ATOM   7252  N  NH1 . ARG F  1 117 ? 17.529 64.513 78.506  1.00 22.17 ? 117  ARG F NH1 1 
ATOM   7253  N  NH2 . ARG F  1 117 ? 17.818 62.984 80.184  1.00 27.32 ? 117  ARG F NH2 1 
ATOM   7254  N  N   . GLU F  1 118 ? 25.124 64.944 79.340  1.00 32.64 ? 118  GLU F N   1 
ATOM   7255  C  CA  . GLU F  1 118 ? 25.760 63.836 80.043  1.00 33.17 ? 118  GLU F CA  1 
ATOM   7256  C  C   . GLU F  1 118 ? 26.634 64.367 81.182  1.00 33.15 ? 118  GLU F C   1 
ATOM   7257  O  O   . GLU F  1 118 ? 26.753 63.735 82.232  1.00 35.40 ? 118  GLU F O   1 
ATOM   7258  C  CB  . GLU F  1 118 ? 26.620 62.996 79.088  1.00 34.16 ? 118  GLU F CB  1 
ATOM   7259  C  CG  . GLU F  1 118 ? 25.840 62.042 78.203  1.00 42.58 ? 118  GLU F CG  1 
ATOM   7260  C  CD  . GLU F  1 118 ? 25.008 61.047 79.004  1.00 51.73 ? 118  GLU F CD  1 
ATOM   7261  O  OE1 . GLU F  1 118 ? 25.585 60.339 79.865  1.00 56.97 ? 118  GLU F OE1 1 
ATOM   7262  O  OE2 . GLU F  1 118 ? 23.776 60.969 78.776  1.00 53.64 ? 118  GLU F OE2 1 
ATOM   7263  N  N   . LEU F  1 119 ? 27.242 65.532 80.981  1.00 30.41 ? 119  LEU F N   1 
ATOM   7264  C  CA  . LEU F  1 119 ? 28.093 66.105 82.011  1.00 27.81 ? 119  LEU F CA  1 
ATOM   7265  C  C   . LEU F  1 119 ? 27.228 66.423 83.221  1.00 27.09 ? 119  LEU F C   1 
ATOM   7266  O  O   . LEU F  1 119 ? 27.532 66.019 84.340  1.00 26.59 ? 119  LEU F O   1 
ATOM   7267  C  CB  . LEU F  1 119 ? 28.755 67.387 81.508  1.00 28.91 ? 119  LEU F CB  1 
ATOM   7268  C  CG  . LEU F  1 119 ? 29.999 67.880 82.257  1.00 33.09 ? 119  LEU F CG  1 
ATOM   7269  C  CD1 . LEU F  1 119 ? 30.291 69.319 81.847  1.00 35.09 ? 119  LEU F CD1 1 
ATOM   7270  C  CD2 . LEU F  1 119 ? 29.794 67.808 83.766  1.00 38.21 ? 119  LEU F CD2 1 
ATOM   7271  N  N   . LEU F  1 120 ? 26.145 67.153 82.991  1.00 27.17 ? 120  LEU F N   1 
ATOM   7272  C  CA  . LEU F  1 120 ? 25.255 67.526 84.077  1.00 28.05 ? 120  LEU F CA  1 
ATOM   7273  C  C   . LEU F  1 120 ? 24.647 66.297 84.753  1.00 31.84 ? 120  LEU F C   1 
ATOM   7274  O  O   . LEU F  1 120 ? 24.591 66.233 85.984  1.00 33.00 ? 120  LEU F O   1 
ATOM   7275  C  CB  . LEU F  1 120 ? 24.149 68.440 83.554  1.00 26.02 ? 120  LEU F CB  1 
ATOM   7276  C  CG  . LEU F  1 120 ? 24.580 69.714 82.817  1.00 24.43 ? 120  LEU F CG  1 
ATOM   7277  C  CD1 . LEU F  1 120 ? 23.336 70.462 82.386  1.00 22.07 ? 120  LEU F CD1 1 
ATOM   7278  C  CD2 . LEU F  1 120 ? 25.461 70.592 83.704  1.00 19.34 ? 120  LEU F CD2 1 
ATOM   7279  N  N   . GLU F  1 121 ? 24.197 65.325 83.957  1.00 33.89 ? 121  GLU F N   1 
ATOM   7280  C  CA  . GLU F  1 121 ? 23.603 64.108 84.514  1.00 35.79 ? 121  GLU F CA  1 
ATOM   7281  C  C   . GLU F  1 121 ? 24.525 63.493 85.557  1.00 34.18 ? 121  GLU F C   1 
ATOM   7282  O  O   . GLU F  1 121 ? 24.078 63.078 86.619  1.00 32.45 ? 121  GLU F O   1 
ATOM   7283  C  CB  . GLU F  1 121 ? 23.318 63.074 83.418  1.00 38.48 ? 121  GLU F CB  1 
ATOM   7284  C  CG  . GLU F  1 121 ? 22.208 63.465 82.451  1.00 47.41 ? 121  GLU F CG  1 
ATOM   7285  C  CD  . GLU F  1 121 ? 21.659 62.279 81.651  1.00 52.49 ? 121  GLU F CD  1 
ATOM   7286  O  OE1 . GLU F  1 121 ? 22.443 61.575 80.970  1.00 52.47 ? 121  GLU F OE1 1 
ATOM   7287  O  OE2 . GLU F  1 121 ? 20.429 62.053 81.701  1.00 55.13 ? 121  GLU F OE2 1 
ATOM   7288  N  N   . ASP F  1 122 ? 25.817 63.441 85.253  1.00 34.97 ? 122  ASP F N   1 
ATOM   7289  C  CA  . ASP F  1 122 ? 26.791 62.878 86.182  1.00 34.34 ? 122  ASP F CA  1 
ATOM   7290  C  C   . ASP F  1 122 ? 26.869 63.731 87.437  1.00 31.79 ? 122  ASP F C   1 
ATOM   7291  O  O   . ASP F  1 122 ? 26.715 63.221 88.544  1.00 33.19 ? 122  ASP F O   1 
ATOM   7292  C  CB  . ASP F  1 122 ? 28.171 62.775 85.522  1.00 37.72 ? 122  ASP F CB  1 
ATOM   7293  C  CG  . ASP F  1 122 ? 28.167 61.866 84.290  1.00 47.60 ? 122  ASP F CG  1 
ATOM   7294  O  OD1 . ASP F  1 122 ? 27.119 61.224 84.018  1.00 51.82 ? 122  ASP F OD1 1 
ATOM   7295  O  OD2 . ASP F  1 122 ? 29.209 61.789 83.594  1.00 49.38 ? 122  ASP F OD2 1 
ATOM   7296  N  N   . ILE F  1 123 ? 27.100 65.029 87.272  1.00 30.11 ? 123  ILE F N   1 
ATOM   7297  C  CA  . ILE F  1 123 ? 27.180 65.924 88.421  1.00 29.57 ? 123  ILE F CA  1 
ATOM   7298  C  C   . ILE F  1 123 ? 25.896 65.731 89.225  1.00 30.56 ? 123  ILE F C   1 
ATOM   7299  O  O   . ILE F  1 123 ? 25.915 65.685 90.453  1.00 28.72 ? 123  ILE F O   1 
ATOM   7300  C  CB  . ILE F  1 123 ? 27.332 67.415 87.970  1.00 30.80 ? 123  ILE F CB  1 
ATOM   7301  C  CG1 . ILE F  1 123 ? 28.699 67.618 87.315  1.00 29.82 ? 123  ILE F CG1 1 
ATOM   7302  C  CG2 . ILE F  1 123 ? 27.206 68.365 89.157  1.00 29.87 ? 123  ILE F CG2 1 
ATOM   7303  C  CD1 . ILE F  1 123 ? 29.018 69.052 87.024  1.00 29.18 ? 123  ILE F CD1 1 
ATOM   7304  N  N   . LEU F  1 124 ? 24.781 65.574 88.521  1.00 31.91 ? 124  LEU F N   1 
ATOM   7305  C  CA  . LEU F  1 124 ? 23.494 65.376 89.175  1.00 33.54 ? 124  LEU F CA  1 
ATOM   7306  C  C   . LEU F  1 124 ? 23.477 64.135 90.057  1.00 35.22 ? 124  LEU F C   1 
ATOM   7307  O  O   . LEU F  1 124 ? 23.128 64.207 91.237  1.00 38.59 ? 124  LEU F O   1 
ATOM   7308  C  CB  . LEU F  1 124 ? 22.374 65.263 88.134  1.00 33.92 ? 124  LEU F CB  1 
ATOM   7309  C  CG  . LEU F  1 124 ? 20.964 65.107 88.707  1.00 30.57 ? 124  LEU F CG  1 
ATOM   7310  C  CD1 . LEU F  1 124 ? 20.708 66.211 89.708  1.00 33.39 ? 124  LEU F CD1 1 
ATOM   7311  C  CD2 . LEU F  1 124 ? 19.943 65.165 87.602  1.00 30.52 ? 124  LEU F CD2 1 
ATOM   7312  N  N   . GLU F  1 125 ? 23.852 62.995 89.491  1.00 35.12 ? 125  GLU F N   1 
ATOM   7313  C  CA  . GLU F  1 125 ? 23.851 61.762 90.256  1.00 37.61 ? 125  GLU F CA  1 
ATOM   7314  C  C   . GLU F  1 125 ? 24.695 61.883 91.517  1.00 37.68 ? 125  GLU F C   1 
ATOM   7315  O  O   . GLU F  1 125 ? 24.395 61.253 92.521  1.00 39.69 ? 125  GLU F O   1 
ATOM   7316  C  CB  . GLU F  1 125 ? 24.315 60.599 89.377  1.00 39.62 ? 125  GLU F CB  1 
ATOM   7317  C  CG  . GLU F  1 125 ? 23.343 60.334 88.228  1.00 47.35 ? 125  GLU F CG  1 
ATOM   7318  C  CD  . GLU F  1 125 ? 23.790 59.225 87.289  1.00 55.49 ? 125  GLU F CD  1 
ATOM   7319  O  OE1 . GLU F  1 125 ? 24.802 59.407 86.571  1.00 58.20 ? 125  GLU F OE1 1 
ATOM   7320  O  OE2 . GLU F  1 125 ? 23.123 58.165 87.267  1.00 59.80 ? 125  GLU F OE2 1 
ATOM   7321  N  N   . SER F  1 126 ? 25.740 62.700 91.479  1.00 38.45 ? 126  SER F N   1 
ATOM   7322  C  CA  . SER F  1 126 ? 26.572 62.883 92.662  1.00 40.51 ? 126  SER F CA  1 
ATOM   7323  C  C   . SER F  1 126 ? 25.804 63.698 93.689  1.00 40.77 ? 126  SER F C   1 
ATOM   7324  O  O   . SER F  1 126 ? 25.798 63.376 94.877  1.00 40.09 ? 126  SER F O   1 
ATOM   7325  C  CB  . SER F  1 126 ? 27.871 63.612 92.309  1.00 43.29 ? 126  SER F CB  1 
ATOM   7326  O  OG  . SER F  1 126 ? 28.734 62.780 91.549  1.00 48.87 ? 126  SER F OG  1 
ATOM   7327  N  N   . GLU F  1 127 ? 25.158 64.758 93.217  1.00 40.35 ? 127  GLU F N   1 
ATOM   7328  C  CA  . GLU F  1 127 ? 24.379 65.640 94.070  1.00 41.26 ? 127  GLU F CA  1 
ATOM   7329  C  C   . GLU F  1 127 ? 23.321 64.875 94.858  1.00 42.18 ? 127  GLU F C   1 
ATOM   7330  O  O   . GLU F  1 127 ? 23.146 65.120 96.050  1.00 41.74 ? 127  GLU F O   1 
ATOM   7331  C  CB  . GLU F  1 127 ? 23.722 66.738 93.236  1.00 41.71 ? 127  GLU F CB  1 
ATOM   7332  C  CG  . GLU F  1 127 ? 24.698 67.472 92.332  1.00 52.65 ? 127  GLU F CG  1 
ATOM   7333  C  CD  . GLU F  1 127 ? 25.870 68.073 93.098  1.00 58.76 ? 127  GLU F CD  1 
ATOM   7334  O  OE1 . GLU F  1 127 ? 25.929 67.906 94.335  1.00 62.28 ? 127  GLU F OE1 1 
ATOM   7335  O  OE2 . GLU F  1 127 ? 26.737 68.712 92.465  1.00 61.10 ? 127  GLU F OE2 1 
ATOM   7336  N  N   . GLU F  1 128 ? 22.607 63.950 94.217  1.00 41.90 ? 128  GLU F N   1 
ATOM   7337  C  CA  . GLU F  1 128 ? 21.592 63.199 94.948  1.00 40.38 ? 128  GLU F CA  1 
ATOM   7338  C  C   . GLU F  1 128 ? 22.249 62.296 95.990  1.00 42.11 ? 128  GLU F C   1 
ATOM   7339  O  O   . GLU F  1 128 ? 21.598 61.838 96.925  1.00 40.89 ? 128  GLU F O   1 
ATOM   7340  C  CB  . GLU F  1 128 ? 20.716 62.387 93.995  1.00 36.96 ? 128  GLU F CB  1 
ATOM   7341  C  CG  . GLU F  1 128 ? 19.846 63.252 93.081  1.00 38.40 ? 128  GLU F CG  1 
ATOM   7342  C  CD  . GLU F  1 128 ? 18.745 62.457 92.385  1.00 41.01 ? 128  GLU F CD  1 
ATOM   7343  O  OE1 . GLU F  1 128 ? 18.992 61.288 92.026  1.00 45.64 ? 128  GLU F OE1 1 
ATOM   7344  O  OE2 . GLU F  1 128 ? 17.636 62.993 92.184  1.00 41.38 ? 128  GLU F OE2 1 
ATOM   7345  N  N   . ASP F  1 129 ? 23.550 62.058 95.833  1.00 45.20 ? 129  ASP F N   1 
ATOM   7346  C  CA  . ASP F  1 129 ? 24.306 61.240 96.783  1.00 47.54 ? 129  ASP F CA  1 
ATOM   7347  C  C   . ASP F  1 129 ? 24.799 62.072 97.958  1.00 46.67 ? 129  ASP F C   1 
ATOM   7348  O  O   . ASP F  1 129 ? 24.869 61.582 99.085  1.00 48.96 ? 129  ASP F O   1 
ATOM   7349  C  CB  . ASP F  1 129 ? 25.482 60.569 96.093  1.00 50.15 ? 129  ASP F CB  1 
ATOM   7350  C  CG  . ASP F  1 129 ? 25.177 59.142 95.725  1.00 55.74 ? 129  ASP F CG  1 
ATOM   7351  O  OD1 . ASP F  1 129 ? 24.004 58.855 95.371  1.00 56.77 ? 129  ASP F OD1 1 
ATOM   7352  O  OD2 . ASP F  1 129 ? 26.108 58.312 95.785  1.00 60.02 ? 129  ASP F OD2 1 
ATOM   7353  N  N   . HIS F  1 130 ? 25.159 63.323 97.688  1.00 44.68 ? 130  HIS F N   1 
ATOM   7354  C  CA  . HIS F  1 130 ? 25.579 64.223 98.735  1.00 40.34 ? 130  HIS F CA  1 
ATOM   7355  C  C   . HIS F  1 130 ? 24.378 64.476 99.602  1.00 39.41 ? 130  HIS F C   1 
ATOM   7356  O  O   . HIS F  1 130 ? 24.469 64.557 100.826 1.00 39.75 ? 130  HIS F O   1 
ATOM   7357  C  CB  . HIS F  1 130 ? 26.071 65.543 98.166  1.00 39.99 ? 130  HIS F CB  1 
ATOM   7358  C  CG  . HIS F  1 130 ? 27.410 65.436 97.406  1.00 44.18 ? 130  HIS F CG  1 
ATOM   7359  N  ND1 . HIS F  1 130 ? 27.891 66.439 96.589  1.00 41.74 ? 130  HIS F ND1 1 
ATOM   7360  C  CD2 . HIS F  1 130 ? 28.347 64.458 97.390  1.00 43.61 ? 130  HIS F CD2 1 
ATOM   7361  C  CE1 . HIS F  1 130 ? 29.067 66.085 96.104  1.00 40.91 ? 130  HIS F CE1 1 
ATOM   7362  N  NE2 . HIS F  1 130 ? 29.368 64.888 96.575  1.00 43.59 ? 130  HIS F NE2 1 
ATOM   7363  N  N   . ILE F  1 131 ? 23.219 64.593 98.957  1.00 38.67 ? 131  ILE F N   1 
ATOM   7364  C  CA  . ILE F  1 131 ? 21.968 64.839 99.665  1.00 39.73 ? 131  ILE F CA  1 
ATOM   7365  C  C   . ILE F  1 131 ? 21.558 63.608 100.460 1.00 38.33 ? 131  ILE F C   1 
ATOM   7366  O  O   . ILE F  1 131 ? 21.027 63.719 101.564 1.00 36.53 ? 131  ILE F O   1 
ATOM   7367  C  CB  . ILE F  1 131 ? 20.803 65.188 98.695  1.00 40.55 ? 131  ILE F CB  1 
ATOM   7368  C  CG1 . ILE F  1 131 ? 21.091 66.505 97.963  1.00 44.00 ? 131  ILE F CG1 1 
ATOM   7369  C  CG2 . ILE F  1 131 ? 19.487 65.312 99.480  1.00 43.23 ? 131  ILE F CG2 1 
ATOM   7370  C  CD1 . ILE F  1 131 ? 19.948 66.997 97.054  1.00 39.28 ? 131  ILE F CD1 1 
ATOM   7371  N  N   . ASP F  1 132 ? 21.794 62.434 99.889  1.00 38.99 ? 132  ASP F N   1 
ATOM   7372  C  CA  . ASP F  1 132 ? 21.435 61.194 100.561 1.00 40.59 ? 132  ASP F CA  1 
ATOM   7373  C  C   . ASP F  1 132 ? 22.191 61.121 101.884 1.00 39.53 ? 132  ASP F C   1 
ATOM   7374  O  O   . ASP F  1 132 ? 21.576 61.018 102.953 1.00 36.77 ? 132  ASP F O   1 
ATOM   7375  C  CB  . ASP F  1 132 ? 21.774 59.991 99.668  1.00 42.21 ? 132  ASP F CB  1 
ATOM   7376  C  CG  . ASP F  1 132 ? 21.244 58.673 100.221 1.00 43.32 ? 132  ASP F CG  1 
ATOM   7377  O  OD1 . ASP F  1 132 ? 20.140 58.657 100.811 1.00 43.95 ? 132  ASP F OD1 1 
ATOM   7378  O  OD2 . ASP F  1 132 ? 21.929 57.644 100.047 1.00 46.73 ? 132  ASP F OD2 1 
ATOM   7379  N  N   . TRP F  1 133 ? 23.518 61.201 101.809 1.00 36.38 ? 133  TRP F N   1 
ATOM   7380  C  CA  . TRP F  1 133 ? 24.342 61.149 103.004 1.00 36.63 ? 133  TRP F CA  1 
ATOM   7381  C  C   . TRP F  1 133 ? 23.878 62.187 104.020 1.00 37.53 ? 133  TRP F C   1 
ATOM   7382  O  O   . TRP F  1 133 ? 23.621 61.856 105.175 1.00 41.28 ? 133  TRP F O   1 
ATOM   7383  C  CB  . TRP F  1 133 ? 25.811 61.399 102.667 1.00 36.02 ? 133  TRP F CB  1 
ATOM   7384  C  CG  . TRP F  1 133 ? 26.710 61.331 103.882 1.00 39.47 ? 133  TRP F CG  1 
ATOM   7385  C  CD1 . TRP F  1 133 ? 27.155 60.201 104.521 1.00 38.35 ? 133  TRP F CD1 1 
ATOM   7386  C  CD2 . TRP F  1 133 ? 27.226 62.441 104.631 1.00 39.69 ? 133  TRP F CD2 1 
ATOM   7387  N  NE1 . TRP F  1 133 ? 27.913 60.542 105.618 1.00 34.96 ? 133  TRP F NE1 1 
ATOM   7388  C  CE2 . TRP F  1 133 ? 27.972 61.908 105.709 1.00 37.55 ? 133  TRP F CE2 1 
ATOM   7389  C  CE3 . TRP F  1 133 ? 27.132 63.833 104.496 1.00 40.27 ? 133  TRP F CE3 1 
ATOM   7390  C  CZ2 . TRP F  1 133 ? 28.616 62.720 106.645 1.00 36.94 ? 133  TRP F CZ2 1 
ATOM   7391  C  CZ3 . TRP F  1 133 ? 27.776 64.639 105.427 1.00 39.74 ? 133  TRP F CZ3 1 
ATOM   7392  C  CH2 . TRP F  1 133 ? 28.508 64.079 106.488 1.00 38.13 ? 133  TRP F CH2 1 
ATOM   7393  N  N   . LEU F  1 134 ? 23.774 63.442 103.597 1.00 36.52 ? 134  LEU F N   1 
ATOM   7394  C  CA  . LEU F  1 134 ? 23.340 64.500 104.502 1.00 36.35 ? 134  LEU F CA  1 
ATOM   7395  C  C   . LEU F  1 134 ? 22.016 64.173 105.200 1.00 37.39 ? 134  LEU F C   1 
ATOM   7396  O  O   . LEU F  1 134 ? 21.901 64.330 106.418 1.00 40.04 ? 134  LEU F O   1 
ATOM   7397  C  CB  . LEU F  1 134 ? 23.223 65.833 103.752 1.00 35.22 ? 134  LEU F CB  1 
ATOM   7398  C  CG  . LEU F  1 134 ? 24.539 66.497 103.318 1.00 35.14 ? 134  LEU F CG  1 
ATOM   7399  C  CD1 . LEU F  1 134 ? 24.257 67.625 102.347 1.00 34.92 ? 134  LEU F CD1 1 
ATOM   7400  C  CD2 . LEU F  1 134 ? 25.284 67.026 104.533 1.00 34.98 ? 134  LEU F CD2 1 
ATOM   7401  N  N   . GLU F  1 135 ? 21.021 63.713 104.447 1.00 37.27 ? 135  GLU F N   1 
ATOM   7402  C  CA  . GLU F  1 135 ? 19.723 63.387 105.043 1.00 38.62 ? 135  GLU F CA  1 
ATOM   7403  C  C   . GLU F  1 135 ? 19.852 62.253 106.053 1.00 38.04 ? 135  GLU F C   1 
ATOM   7404  O  O   . GLU F  1 135 ? 19.109 62.184 107.032 1.00 38.45 ? 135  GLU F O   1 
ATOM   7405  C  CB  . GLU F  1 135 ? 18.718 62.986 103.961 1.00 40.74 ? 135  GLU F CB  1 
ATOM   7406  C  CG  . GLU F  1 135 ? 18.471 64.061 102.920 1.00 46.75 ? 135  GLU F CG  1 
ATOM   7407  C  CD  . GLU F  1 135 ? 17.446 63.644 101.883 1.00 48.88 ? 135  GLU F CD  1 
ATOM   7408  O  OE1 . GLU F  1 135 ? 17.550 62.507 101.367 1.00 50.03 ? 135  GLU F OE1 1 
ATOM   7409  O  OE2 . GLU F  1 135 ? 16.546 64.459 101.578 1.00 50.96 ? 135  GLU F OE2 1 
ATOM   7410  N  N   . THR F  1 136 ? 20.798 61.360 105.802 1.00 36.70 ? 136  THR F N   1 
ATOM   7411  C  CA  . THR F  1 136 ? 21.034 60.228 106.683 1.00 35.63 ? 136  THR F CA  1 
ATOM   7412  C  C   . THR F  1 136 ? 21.529 60.715 108.042 1.00 34.38 ? 136  THR F C   1 
ATOM   7413  O  O   . THR F  1 136 ? 21.027 60.296 109.081 1.00 33.14 ? 136  THR F O   1 
ATOM   7414  C  CB  . THR F  1 136 ? 22.105 59.288 106.099 1.00 36.02 ? 136  THR F CB  1 
ATOM   7415  O  OG1 . THR F  1 136 ? 21.797 58.995 104.733 1.00 39.94 ? 136  THR F OG1 1 
ATOM   7416  C  CG2 . THR F  1 136 ? 22.161 57.995 106.885 1.00 36.51 ? 136  THR F CG2 1 
ATOM   7417  N  N   . GLN F  1 137 ? 22.525 61.597 108.021 1.00 34.08 ? 137  GLN F N   1 
ATOM   7418  C  CA  . GLN F  1 137 ? 23.106 62.130 109.247 1.00 31.74 ? 137  GLN F CA  1 
ATOM   7419  C  C   . GLN F  1 137 ? 22.036 62.810 110.076 1.00 30.07 ? 137  GLN F C   1 
ATOM   7420  O  O   . GLN F  1 137 ? 21.926 62.564 111.277 1.00 31.60 ? 137  GLN F O   1 
ATOM   7421  C  CB  . GLN F  1 137 ? 24.216 63.141 108.935 1.00 28.86 ? 137  GLN F CB  1 
ATOM   7422  C  CG  . GLN F  1 137 ? 25.184 62.681 107.870 1.00 29.57 ? 137  GLN F CG  1 
ATOM   7423  C  CD  . GLN F  1 137 ? 25.660 61.267 108.101 1.00 30.60 ? 137  GLN F CD  1 
ATOM   7424  O  OE1 . GLN F  1 137 ? 25.526 60.406 107.228 1.00 33.66 ? 137  GLN F OE1 1 
ATOM   7425  N  NE2 . GLN F  1 137 ? 26.218 61.012 109.277 1.00 27.94 ? 137  GLN F NE2 1 
ATOM   7426  N  N   . LEU F  1 138 ? 21.250 63.663 109.434 1.00 26.16 ? 138  LEU F N   1 
ATOM   7427  C  CA  . LEU F  1 138 ? 20.204 64.382 110.137 1.00 28.01 ? 138  LEU F CA  1 
ATOM   7428  C  C   . LEU F  1 138 ? 19.242 63.438 110.853 1.00 31.17 ? 138  LEU F C   1 
ATOM   7429  O  O   . LEU F  1 138 ? 18.813 63.714 111.980 1.00 31.83 ? 138  LEU F O   1 
ATOM   7430  C  CB  . LEU F  1 138 ? 19.448 65.278 109.162 1.00 25.02 ? 138  LEU F CB  1 
ATOM   7431  C  CG  . LEU F  1 138 ? 20.204 66.560 108.817 1.00 26.19 ? 138  LEU F CG  1 
ATOM   7432  C  CD1 . LEU F  1 138 ? 19.633 67.193 107.554 1.00 25.74 ? 138  LEU F CD1 1 
ATOM   7433  C  CD2 . LEU F  1 138 ? 20.131 67.511 110.011 1.00 21.98 ? 138  LEU F CD2 1 
ATOM   7434  N  N   . ASP F  1 139 ? 18.915 62.320 110.209 1.00 31.56 ? 139  ASP F N   1 
ATOM   7435  C  CA  . ASP F  1 139 ? 18.007 61.352 110.805 1.00 34.65 ? 139  ASP F CA  1 
ATOM   7436  C  C   . ASP F  1 139 ? 18.709 60.564 111.904 1.00 33.93 ? 139  ASP F C   1 
ATOM   7437  O  O   . ASP F  1 139 ? 18.080 60.166 112.888 1.00 35.34 ? 139  ASP F O   1 
ATOM   7438  C  CB  . ASP F  1 139 ? 17.454 60.395 109.740 1.00 44.15 ? 139  ASP F CB  1 
ATOM   7439  C  CG  . ASP F  1 139 ? 16.618 61.111 108.674 1.00 51.56 ? 139  ASP F CG  1 
ATOM   7440  O  OD1 . ASP F  1 139 ? 15.979 60.416 107.844 1.00 53.77 ? 139  ASP F OD1 1 
ATOM   7441  O  OD2 . ASP F  1 139 ? 16.605 62.366 108.663 1.00 56.45 ? 139  ASP F OD2 1 
ATOM   7442  N  N   . LEU F  1 140 ? 20.009 60.328 111.743 1.00 32.29 ? 140  LEU F N   1 
ATOM   7443  C  CA  . LEU F  1 140 ? 20.753 59.608 112.764 1.00 31.49 ? 140  LEU F CA  1 
ATOM   7444  C  C   . LEU F  1 140 ? 20.748 60.462 114.026 1.00 33.65 ? 140  LEU F C   1 
ATOM   7445  O  O   . LEU F  1 140 ? 20.541 59.957 115.133 1.00 35.18 ? 140  LEU F O   1 
ATOM   7446  C  CB  . LEU F  1 140 ? 22.198 59.348 112.332 1.00 29.42 ? 140  LEU F CB  1 
ATOM   7447  C  CG  . LEU F  1 140 ? 22.577 58.002 111.687 1.00 32.28 ? 140  LEU F CG  1 
ATOM   7448  C  CD1 . LEU F  1 140 ? 21.758 56.877 112.309 1.00 26.01 ? 140  LEU F CD1 1 
ATOM   7449  C  CD2 . LEU F  1 140 ? 22.340 58.050 110.196 1.00 34.08 ? 140  LEU F CD2 1 
ATOM   7450  N  N   . ILE F  1 141 ? 20.967 61.762 113.858 1.00 33.11 ? 141  ILE F N   1 
ATOM   7451  C  CA  . ILE F  1 141 ? 20.980 62.668 114.998 1.00 34.70 ? 141  ILE F CA  1 
ATOM   7452  C  C   . ILE F  1 141 ? 19.696 62.509 115.812 1.00 37.41 ? 141  ILE F C   1 
ATOM   7453  O  O   . ILE F  1 141 ? 19.728 62.530 117.042 1.00 37.97 ? 141  ILE F O   1 
ATOM   7454  C  CB  . ILE F  1 141 ? 21.144 64.152 114.543 1.00 31.73 ? 141  ILE F CB  1 
ATOM   7455  C  CG1 . ILE F  1 141 ? 22.615 64.435 114.223 1.00 26.79 ? 141  ILE F CG1 1 
ATOM   7456  C  CG2 . ILE F  1 141 ? 20.649 65.111 115.623 1.00 28.13 ? 141  ILE F CG2 1 
ATOM   7457  C  CD1 . ILE F  1 141 ? 22.899 65.890 113.855 1.00 24.91 ? 141  ILE F CD1 1 
ATOM   7458  N  N   . ASP F  1 142 ? 18.572 62.333 115.127 1.00 38.86 ? 142  ASP F N   1 
ATOM   7459  C  CA  . ASP F  1 142 ? 17.297 62.176 115.814 1.00 40.75 ? 142  ASP F CA  1 
ATOM   7460  C  C   . ASP F  1 142 ? 17.016 60.763 116.302 1.00 39.00 ? 142  ASP F C   1 
ATOM   7461  O  O   . ASP F  1 142 ? 16.063 60.551 117.044 1.00 38.57 ? 142  ASP F O   1 
ATOM   7462  C  CB  . ASP F  1 142 ? 16.143 62.636 114.918 1.00 46.37 ? 142  ASP F CB  1 
ATOM   7463  C  CG  . ASP F  1 142 ? 15.757 64.089 115.165 1.00 52.41 ? 142  ASP F CG  1 
ATOM   7464  O  OD1 . ASP F  1 142 ? 16.544 65.000 114.808 1.00 53.41 ? 142  ASP F OD1 1 
ATOM   7465  O  OD2 . ASP F  1 142 ? 14.664 64.318 115.732 1.00 54.59 ? 142  ASP F OD2 1 
ATOM   7466  N  N   . LYS F  1 143 ? 17.838 59.801 115.900 1.00 38.38 ? 143  LYS F N   1 
ATOM   7467  C  CA  . LYS F  1 143 ? 17.627 58.418 116.315 1.00 37.62 ? 143  LYS F CA  1 
ATOM   7468  C  C   . LYS F  1 143 ? 18.518 57.973 117.461 1.00 36.36 ? 143  LYS F C   1 
ATOM   7469  O  O   . LYS F  1 143 ? 18.086 57.214 118.326 1.00 37.39 ? 143  LYS F O   1 
ATOM   7470  C  CB  . LYS F  1 143 ? 17.806 57.466 115.121 1.00 36.24 ? 143  LYS F CB  1 
ATOM   7471  C  CG  . LYS F  1 143 ? 16.655 57.546 114.136 1.00 39.26 ? 143  LYS F CG  1 
ATOM   7472  C  CD  . LYS F  1 143 ? 16.829 56.656 112.916 1.00 38.03 ? 143  LYS F CD  1 
ATOM   7473  C  CE  . LYS F  1 143 ? 15.636 56.824 111.973 1.00 36.02 ? 143  LYS F CE  1 
ATOM   7474  N  NZ  . LYS F  1 143 ? 15.889 56.243 110.625 1.00 39.15 ? 143  LYS F NZ  1 
ATOM   7475  N  N   . ILE F  1 144 ? 19.760 58.440 117.466 1.00 35.68 ? 144  ILE F N   1 
ATOM   7476  C  CA  . ILE F  1 144 ? 20.698 58.064 118.515 1.00 33.65 ? 144  ILE F CA  1 
ATOM   7477  C  C   . ILE F  1 144 ? 21.009 59.246 119.422 1.00 33.92 ? 144  ILE F C   1 
ATOM   7478  O  O   . ILE F  1 144 ? 21.578 59.069 120.497 1.00 37.06 ? 144  ILE F O   1 
ATOM   7479  C  CB  . ILE F  1 144 ? 22.028 57.537 117.924 1.00 33.29 ? 144  ILE F CB  1 
ATOM   7480  C  CG1 . ILE F  1 144 ? 22.797 58.688 117.260 1.00 33.84 ? 144  ILE F CG1 1 
ATOM   7481  C  CG2 . ILE F  1 144 ? 21.747 56.434 116.902 1.00 25.87 ? 144  ILE F CG2 1 
ATOM   7482  C  CD1 . ILE F  1 144 ? 24.174 58.292 116.747 1.00 33.95 ? 144  ILE F CD1 1 
ATOM   7483  N  N   . GLY F  1 145 ? 20.637 60.449 118.985 1.00 32.57 ? 145  GLY F N   1 
ATOM   7484  C  CA  . GLY F  1 145 ? 20.898 61.644 119.775 1.00 30.40 ? 145  GLY F CA  1 
ATOM   7485  C  C   . GLY F  1 145 ? 22.166 62.400 119.379 1.00 29.55 ? 145  GLY F C   1 
ATOM   7486  O  O   . GLY F  1 145 ? 23.164 61.810 118.944 1.00 29.03 ? 145  GLY F O   1 
ATOM   7487  N  N   . LEU F  1 146 ? 22.138 63.717 119.539 1.00 25.74 ? 146  LEU F N   1 
ATOM   7488  C  CA  . LEU F  1 146 ? 23.287 64.536 119.186 1.00 25.99 ? 146  LEU F CA  1 
ATOM   7489  C  C   . LEU F  1 146 ? 24.587 64.079 119.859 1.00 28.03 ? 146  LEU F C   1 
ATOM   7490  O  O   . LEU F  1 146 ? 25.580 63.789 119.181 1.00 31.15 ? 146  LEU F O   1 
ATOM   7491  C  CB  . LEU F  1 146 ? 23.010 65.991 119.538 1.00 20.23 ? 146  LEU F CB  1 
ATOM   7492  C  CG  . LEU F  1 146 ? 24.044 66.959 118.979 1.00 22.85 ? 146  LEU F CG  1 
ATOM   7493  C  CD1 . LEU F  1 146 ? 24.152 66.770 117.470 1.00 20.26 ? 146  LEU F CD1 1 
ATOM   7494  C  CD2 . LEU F  1 146 ? 23.648 68.377 119.327 1.00 19.85 ? 146  LEU F CD2 1 
ATOM   7495  N  N   . GLU F  1 147 ? 24.580 64.014 121.189 1.00 29.53 ? 147  GLU F N   1 
ATOM   7496  C  CA  . GLU F  1 147 ? 25.757 63.594 121.947 1.00 29.18 ? 147  GLU F CA  1 
ATOM   7497  C  C   . GLU F  1 147 ? 26.320 62.269 121.434 1.00 28.70 ? 147  GLU F C   1 
ATOM   7498  O  O   . GLU F  1 147 ? 27.533 62.117 121.274 1.00 28.52 ? 147  GLU F O   1 
ATOM   7499  C  CB  . GLU F  1 147 ? 25.413 63.478 123.428 1.00 30.29 ? 147  GLU F CB  1 
ATOM   7500  C  CG  . GLU F  1 147 ? 24.837 64.754 124.020 1.00 37.55 ? 147  GLU F CG  1 
ATOM   7501  C  CD  . GLU F  1 147 ? 24.760 64.697 125.541 1.00 47.07 ? 147  GLU F CD  1 
ATOM   7502  O  OE1 . GLU F  1 147 ? 24.129 63.749 126.068 1.00 50.98 ? 147  GLU F OE1 1 
ATOM   7503  O  OE2 . GLU F  1 147 ? 25.330 65.592 126.212 1.00 46.76 ? 147  GLU F OE2 1 
ATOM   7504  N  N   . ASN F  1 148 ? 25.440 61.309 121.176 1.00 29.13 ? 148  ASN F N   1 
ATOM   7505  C  CA  . ASN F  1 148 ? 25.876 60.024 120.661 1.00 29.50 ? 148  ASN F CA  1 
ATOM   7506  C  C   . ASN F  1 148 ? 26.388 60.169 119.237 1.00 30.61 ? 148  ASN F C   1 
ATOM   7507  O  O   . ASN F  1 148 ? 27.412 59.584 118.875 1.00 29.04 ? 148  ASN F O   1 
ATOM   7508  C  CB  . ASN F  1 148 ? 24.728 59.020 120.691 1.00 31.64 ? 148  ASN F CB  1 
ATOM   7509  C  CG  . ASN F  1 148 ? 24.818 58.070 121.869 1.00 36.27 ? 148  ASN F CG  1 
ATOM   7510  O  OD1 . ASN F  1 148 ? 25.713 58.191 122.719 1.00 37.25 ? 148  ASN F OD1 1 
ATOM   7511  N  ND2 . ASN F  1 148 ? 23.891 57.114 121.930 1.00 35.98 ? 148  ASN F ND2 1 
ATOM   7512  N  N   . TYR F  1 149 ? 25.681 60.958 118.429 1.00 33.07 ? 149  TYR F N   1 
ATOM   7513  C  CA  . TYR F  1 149 ? 26.074 61.156 117.037 1.00 32.08 ? 149  TYR F CA  1 
ATOM   7514  C  C   . TYR F  1 149 ? 27.400 61.895 116.932 1.00 31.39 ? 149  TYR F C   1 
ATOM   7515  O  O   . TYR F  1 149 ? 28.198 61.643 116.022 1.00 28.05 ? 149  TYR F O   1 
ATOM   7516  C  CB  . TYR F  1 149 ? 25.009 61.937 116.263 1.00 31.05 ? 149  TYR F CB  1 
ATOM   7517  C  CG  . TYR F  1 149 ? 25.453 62.224 114.845 1.00 32.82 ? 149  TYR F CG  1 
ATOM   7518  C  CD1 . TYR F  1 149 ? 25.505 61.206 113.890 1.00 31.70 ? 149  TYR F CD1 1 
ATOM   7519  C  CD2 . TYR F  1 149 ? 25.890 63.500 114.474 1.00 31.67 ? 149  TYR F CD2 1 
ATOM   7520  C  CE1 . TYR F  1 149 ? 25.985 61.450 112.606 1.00 29.92 ? 149  TYR F CE1 1 
ATOM   7521  C  CE2 . TYR F  1 149 ? 26.371 63.752 113.194 1.00 31.64 ? 149  TYR F CE2 1 
ATOM   7522  C  CZ  . TYR F  1 149 ? 26.417 62.723 112.268 1.00 31.36 ? 149  TYR F CZ  1 
ATOM   7523  O  OH  . TYR F  1 149 ? 26.907 62.965 111.009 1.00 32.89 ? 149  TYR F OH  1 
ATOM   7524  N  N   . LEU F  1 150 ? 27.620 62.829 117.848 1.00 30.16 ? 150  LEU F N   1 
ATOM   7525  C  CA  . LEU F  1 150 ? 28.863 63.577 117.840 1.00 31.29 ? 150  LEU F CA  1 
ATOM   7526  C  C   . LEU F  1 150 ? 29.982 62.649 118.287 1.00 31.77 ? 150  LEU F C   1 
ATOM   7527  O  O   . LEU F  1 150 ? 31.042 62.588 117.659 1.00 34.04 ? 150  LEU F O   1 
ATOM   7528  C  CB  . LEU F  1 150 ? 28.777 64.788 118.771 1.00 28.25 ? 150  LEU F CB  1 
ATOM   7529  C  CG  . LEU F  1 150 ? 27.976 65.985 118.263 1.00 26.74 ? 150  LEU F CG  1 
ATOM   7530  C  CD1 . LEU F  1 150 ? 28.180 67.123 119.231 1.00 26.17 ? 150  LEU F CD1 1 
ATOM   7531  C  CD2 . LEU F  1 150 ? 28.450 66.404 116.874 1.00 25.02 ? 150  LEU F CD2 1 
ATOM   7532  N  N   . GLN F  1 151 ? 29.742 61.920 119.371 1.00 30.29 ? 151  GLN F N   1 
ATOM   7533  C  CA  . GLN F  1 151 ? 30.742 60.999 119.876 1.00 30.11 ? 151  GLN F CA  1 
ATOM   7534  C  C   . GLN F  1 151 ? 31.276 60.135 118.743 1.00 30.38 ? 151  GLN F C   1 
ATOM   7535  O  O   . GLN F  1 151 ? 32.489 60.021 118.559 1.00 29.60 ? 151  GLN F O   1 
ATOM   7536  C  CB  . GLN F  1 151 ? 30.153 60.089 120.962 1.00 30.99 ? 151  GLN F CB  1 
ATOM   7537  C  CG  . GLN F  1 151 ? 31.093 58.959 121.374 1.00 32.33 ? 151  GLN F CG  1 
ATOM   7538  C  CD  . GLN F  1 151 ? 30.484 58.007 122.387 1.00 36.28 ? 151  GLN F CD  1 
ATOM   7539  O  OE1 . GLN F  1 151 ? 29.404 57.454 122.165 1.00 39.62 ? 151  GLN F OE1 1 
ATOM   7540  N  NE2 . GLN F  1 151 ? 31.184 57.796 123.503 1.00 36.29 ? 151  GLN F NE2 1 
ATOM   7541  N  N   . SER F  1 152 ? 30.367 59.545 117.973 1.00 29.72 ? 152  SER F N   1 
ATOM   7542  C  CA  . SER F  1 152 ? 30.773 58.654 116.898 1.00 32.49 ? 152  SER F CA  1 
ATOM   7543  C  C   . SER F  1 152 ? 31.518 59.320 115.755 1.00 33.59 ? 152  SER F C   1 
ATOM   7544  O  O   . SER F  1 152 ? 32.074 58.633 114.901 1.00 32.27 ? 152  SER F O   1 
ATOM   7545  C  CB  . SER F  1 152 ? 29.561 57.888 116.363 1.00 33.98 ? 152  SER F CB  1 
ATOM   7546  O  OG  . SER F  1 152 ? 28.580 58.771 115.861 1.00 44.48 ? 152  SER F OG  1 
ATOM   7547  N  N   . GLN F  1 153 ? 31.549 60.651 115.748 1.00 36.02 ? 153  GLN F N   1 
ATOM   7548  C  CA  . GLN F  1 153 ? 32.241 61.399 114.695 1.00 37.19 ? 153  GLN F CA  1 
ATOM   7549  C  C   . GLN F  1 153 ? 33.662 61.776 115.097 1.00 38.84 ? 153  GLN F C   1 
ATOM   7550  O  O   . GLN F  1 153 ? 34.435 62.271 114.278 1.00 38.29 ? 153  GLN F O   1 
ATOM   7551  C  CB  . GLN F  1 153 ? 31.469 62.678 114.351 1.00 36.47 ? 153  GLN F CB  1 
ATOM   7552  C  CG  . GLN F  1 153 ? 30.077 62.439 113.791 1.00 36.68 ? 153  GLN F CG  1 
ATOM   7553  C  CD  . GLN F  1 153 ? 30.099 61.472 112.636 1.00 35.68 ? 153  GLN F CD  1 
ATOM   7554  O  OE1 . GLN F  1 153 ? 30.932 61.591 111.741 1.00 36.27 ? 153  GLN F OE1 1 
ATOM   7555  N  NE2 . GLN F  1 153 ? 29.184 60.508 112.643 1.00 33.73 ? 153  GLN F NE2 1 
ATOM   7556  N  N   . MET F  1 154 ? 34.000 61.535 116.357 1.00 42.16 ? 154  MET F N   1 
ATOM   7557  C  CA  . MET F  1 154 ? 35.317 61.862 116.883 1.00 46.56 ? 154  MET F CA  1 
ATOM   7558  C  C   . MET F  1 154 ? 36.482 61.173 116.191 1.00 49.98 ? 154  MET F C   1 
ATOM   7559  O  O   . MET F  1 154 ? 37.407 61.840 115.738 1.00 52.31 ? 154  MET F O   1 
ATOM   7560  C  CB  . MET F  1 154 ? 35.372 61.557 118.375 1.00 47.57 ? 154  MET F CB  1 
ATOM   7561  C  CG  . MET F  1 154 ? 34.525 62.483 119.220 1.00 47.06 ? 154  MET F CG  1 
ATOM   7562  S  SD  . MET F  1 154 ? 34.798 62.159 120.952 1.00 46.00 ? 154  MET F SD  1 
ATOM   7563  C  CE  . MET F  1 154 ? 36.428 62.809 121.133 1.00 48.33 ? 154  MET F CE  1 
ATOM   7564  N  N   . ASP F  1 155 ? 36.456 59.846 116.126 1.00 54.13 ? 155  ASP F N   1 
ATOM   7565  C  CA  . ASP F  1 155 ? 37.536 59.102 115.474 1.00 60.11 ? 155  ASP F CA  1 
ATOM   7566  C  C   . ASP F  1 155 ? 37.206 58.793 114.014 1.00 62.62 ? 155  ASP F C   1 
ATOM   7567  O  O   . ASP F  1 155 ? 37.997 59.197 113.126 1.00 64.38 ? 155  ASP F O   1 
ATOM   7568  C  CB  . ASP F  1 155 ? 37.822 57.791 116.222 1.00 62.22 ? 155  ASP F CB  1 
ATOM   7569  C  CG  . ASP F  1 155 ? 38.653 58.000 117.485 1.00 66.80 ? 155  ASP F CG  1 
ATOM   7570  O  OD1 . ASP F  1 155 ? 38.225 58.768 118.379 1.00 68.03 ? 155  ASP F OD1 1 
ATOM   7571  O  OD2 . ASP F  1 155 ? 39.738 57.384 117.587 1.00 68.33 ? 155  ASP F OD2 1 
ATOM   7572  O  OXT . ASP F  1 155 ? 36.163 58.143 113.774 1.00 63.49 ? 155  ASP F OXT 1 
ATOM   7573  N  N   . MET G  1 1   ? 80.717 78.147 123.347 1.00 50.46 ? 1    MET G N   1 
ATOM   7574  C  CA  . MET G  1 1   ? 80.664 79.577 122.922 1.00 51.25 ? 1    MET G CA  1 
ATOM   7575  C  C   . MET G  1 1   ? 79.981 80.427 124.002 1.00 50.47 ? 1    MET G C   1 
ATOM   7576  O  O   . MET G  1 1   ? 78.846 80.150 124.393 1.00 51.12 ? 1    MET G O   1 
ATOM   7577  C  CB  . MET G  1 1   ? 79.907 79.685 121.595 1.00 51.66 ? 1    MET G CB  1 
ATOM   7578  C  CG  . MET G  1 1   ? 80.082 81.020 120.882 1.00 53.34 ? 1    MET G CG  1 
ATOM   7579  S  SD  . MET G  1 1   ? 79.417 80.999 119.197 1.00 50.64 ? 1    MET G SD  1 
ATOM   7580  C  CE  . MET G  1 1   ? 77.725 81.547 119.481 1.00 52.10 ? 1    MET G CE  1 
ATOM   7581  N  N   . LYS G  1 2   ? 80.677 81.452 124.486 1.00 48.96 ? 2    LYS G N   1 
ATOM   7582  C  CA  . LYS G  1 2   ? 80.138 82.321 125.530 1.00 48.19 ? 2    LYS G CA  1 
ATOM   7583  C  C   . LYS G  1 2   ? 78.823 82.947 125.097 1.00 46.78 ? 2    LYS G C   1 
ATOM   7584  O  O   . LYS G  1 2   ? 78.776 83.674 124.109 1.00 47.60 ? 2    LYS G O   1 
ATOM   7585  C  CB  . LYS G  1 2   ? 81.119 83.446 125.857 1.00 51.69 ? 2    LYS G CB  1 
ATOM   7586  C  CG  . LYS G  1 2   ? 82.536 83.004 126.195 1.00 57.56 ? 2    LYS G CG  1 
ATOM   7587  C  CD  . LYS G  1 2   ? 83.436 84.230 126.366 1.00 62.03 ? 2    LYS G CD  1 
ATOM   7588  C  CE  . LYS G  1 2   ? 84.894 83.855 126.618 1.00 63.29 ? 2    LYS G CE  1 
ATOM   7589  N  NZ  . LYS G  1 2   ? 85.744 85.072 126.800 1.00 60.90 ? 2    LYS G NZ  1 
ATOM   7590  N  N   . GLY G  1 3   ? 77.756 82.672 125.839 1.00 43.68 ? 3    GLY G N   1 
ATOM   7591  C  CA  . GLY G  1 3   ? 76.466 83.236 125.495 1.00 40.93 ? 3    GLY G CA  1 
ATOM   7592  C  C   . GLY G  1 3   ? 76.119 84.436 126.355 1.00 40.59 ? 3    GLY G C   1 
ATOM   7593  O  O   . GLY G  1 3   ? 76.932 84.899 127.147 1.00 40.51 ? 3    GLY G O   1 
ATOM   7594  N  N   . ASP G  1 4   ? 74.905 84.945 126.194 1.00 40.89 ? 4    ASP G N   1 
ATOM   7595  C  CA  . ASP G  1 4   ? 74.446 86.088 126.966 1.00 40.75 ? 4    ASP G CA  1 
ATOM   7596  C  C   . ASP G  1 4   ? 73.950 85.577 128.317 1.00 42.35 ? 4    ASP G C   1 
ATOM   7597  O  O   . ASP G  1 4   ? 73.177 84.613 128.377 1.00 42.53 ? 4    ASP G O   1 
ATOM   7598  C  CB  . ASP G  1 4   ? 73.306 86.784 126.233 1.00 41.26 ? 4    ASP G CB  1 
ATOM   7599  C  CG  . ASP G  1 4   ? 72.858 88.053 126.924 1.00 45.61 ? 4    ASP G CG  1 
ATOM   7600  O  OD1 . ASP G  1 4   ? 73.427 89.128 126.621 1.00 47.60 ? 4    ASP G OD1 1 
ATOM   7601  O  OD2 . ASP G  1 4   ? 71.942 87.971 127.777 1.00 46.49 ? 4    ASP G OD2 1 
ATOM   7602  N  N   . LYS G  1 5   ? 74.392 86.223 129.394 1.00 41.00 ? 5    LYS G N   1 
ATOM   7603  C  CA  . LYS G  1 5   ? 74.001 85.830 130.742 1.00 39.52 ? 5    LYS G CA  1 
ATOM   7604  C  C   . LYS G  1 5   ? 72.482 85.857 130.928 1.00 37.22 ? 5    LYS G C   1 
ATOM   7605  O  O   . LYS G  1 5   ? 71.899 84.909 131.462 1.00 33.84 ? 5    LYS G O   1 
ATOM   7606  C  CB  . LYS G  1 5   ? 74.667 86.749 131.774 1.00 44.98 ? 5    LYS G CB  1 
ATOM   7607  C  CG  . LYS G  1 5   ? 74.370 86.363 133.221 1.00 50.19 ? 5    LYS G CG  1 
ATOM   7608  C  CD  . LYS G  1 5   ? 74.951 87.349 134.230 1.00 54.62 ? 5    LYS G CD  1 
ATOM   7609  C  CE  . LYS G  1 5   ? 74.558 86.938 135.651 1.00 57.92 ? 5    LYS G CE  1 
ATOM   7610  N  NZ  . LYS G  1 5   ? 75.040 87.883 136.702 1.00 61.01 ? 5    LYS G NZ  1 
ATOM   7611  N  N   . ILE G  1 6   ? 71.841 86.938 130.492 1.00 34.95 ? 6    ILE G N   1 
ATOM   7612  C  CA  . ILE G  1 6   ? 70.392 87.048 130.619 1.00 35.04 ? 6    ILE G CA  1 
ATOM   7613  C  C   . ILE G  1 6   ? 69.689 86.023 129.728 1.00 34.34 ? 6    ILE G C   1 
ATOM   7614  O  O   . ILE G  1 6   ? 68.629 85.501 130.090 1.00 34.78 ? 6    ILE G O   1 
ATOM   7615  C  CB  . ILE G  1 6   ? 69.891 88.470 130.268 1.00 36.83 ? 6    ILE G CB  1 
ATOM   7616  C  CG1 . ILE G  1 6   ? 70.236 89.447 131.396 1.00 35.64 ? 6    ILE G CG1 1 
ATOM   7617  C  CG2 . ILE G  1 6   ? 68.387 88.460 130.079 1.00 37.54 ? 6    ILE G CG2 1 
ATOM   7618  C  CD1 . ILE G  1 6   ? 71.711 89.674 131.588 1.00 41.12 ? 6    ILE G CD1 1 
ATOM   7619  N  N   . VAL G  1 7   ? 70.272 85.735 128.565 1.00 31.90 ? 7    VAL G N   1 
ATOM   7620  C  CA  . VAL G  1 7   ? 69.693 84.741 127.664 1.00 30.03 ? 7    VAL G CA  1 
ATOM   7621  C  C   . VAL G  1 7   ? 69.718 83.366 128.337 1.00 29.15 ? 7    VAL G C   1 
ATOM   7622  O  O   . VAL G  1 7   ? 68.760 82.594 128.232 1.00 28.58 ? 7    VAL G O   1 
ATOM   7623  C  CB  . VAL G  1 7   ? 70.472 84.651 126.340 1.00 32.16 ? 7    VAL G CB  1 
ATOM   7624  C  CG1 . VAL G  1 7   ? 70.123 83.349 125.621 1.00 31.79 ? 7    VAL G CG1 1 
ATOM   7625  C  CG2 . VAL G  1 7   ? 70.122 85.838 125.450 1.00 29.63 ? 7    VAL G CG2 1 
ATOM   7626  N  N   . ILE G  1 8   ? 70.822 83.064 129.019 1.00 26.52 ? 8    ILE G N   1 
ATOM   7627  C  CA  . ILE G  1 8   ? 70.970 81.796 129.724 1.00 24.33 ? 8    ILE G CA  1 
ATOM   7628  C  C   . ILE G  1 8   ? 69.937 81.686 130.849 1.00 27.23 ? 8    ILE G C   1 
ATOM   7629  O  O   . ILE G  1 8   ? 69.481 80.585 131.184 1.00 26.79 ? 8    ILE G O   1 
ATOM   7630  C  CB  . ILE G  1 8   ? 72.349 81.665 130.397 1.00 26.00 ? 8    ILE G CB  1 
ATOM   7631  C  CG1 . ILE G  1 8   ? 73.480 81.930 129.393 1.00 23.38 ? 8    ILE G CG1 1 
ATOM   7632  C  CG2 . ILE G  1 8   ? 72.466 80.279 131.039 1.00 24.48 ? 8    ILE G CG2 1 
ATOM   7633  C  CD1 . ILE G  1 8   ? 73.769 80.798 128.448 1.00 20.60 ? 8    ILE G CD1 1 
ATOM   7634  N  N   . GLN G  1 9   ? 69.583 82.818 131.454 1.00 28.81 ? 9    GLN G N   1 
ATOM   7635  C  CA  . GLN G  1 9   ? 68.619 82.791 132.548 1.00 31.87 ? 9    GLN G CA  1 
ATOM   7636  C  C   . GLN G  1 9   ? 67.237 82.486 132.004 1.00 33.03 ? 9    GLN G C   1 
ATOM   7637  O  O   . GLN G  1 9   ? 66.481 81.727 132.611 1.00 36.91 ? 9    GLN G O   1 
ATOM   7638  C  CB  . GLN G  1 9   ? 68.605 84.120 133.307 1.00 33.26 ? 9    GLN G CB  1 
ATOM   7639  C  CG  . GLN G  1 9   ? 69.985 84.600 133.710 1.00 36.68 ? 9    GLN G CG  1 
ATOM   7640  C  CD  . GLN G  1 9   ? 69.958 85.608 134.850 1.00 41.60 ? 9    GLN G CD  1 
ATOM   7641  O  OE1 . GLN G  1 9   ? 69.071 86.462 134.933 1.00 40.39 ? 9    GLN G OE1 1 
ATOM   7642  N  NE2 . GLN G  1 9   ? 70.952 85.520 135.729 1.00 45.98 ? 9    GLN G NE2 1 
ATOM   7643  N  N   . HIS G  1 10  ? 66.903 83.071 130.859 1.00 33.99 ? 10   HIS G N   1 
ATOM   7644  C  CA  . HIS G  1 10  ? 65.604 82.804 130.249 1.00 33.30 ? 10   HIS G CA  1 
ATOM   7645  C  C   . HIS G  1 10  ? 65.523 81.317 129.954 1.00 30.52 ? 10   HIS G C   1 
ATOM   7646  O  O   . HIS G  1 10  ? 64.538 80.665 130.296 1.00 29.68 ? 10   HIS G O   1 
ATOM   7647  C  CB  . HIS G  1 10  ? 65.447 83.595 128.959 1.00 34.46 ? 10   HIS G CB  1 
ATOM   7648  C  CG  . HIS G  1 10  ? 65.046 85.016 129.176 1.00 35.99 ? 10   HIS G CG  1 
ATOM   7649  N  ND1 . HIS G  1 10  ? 63.797 85.369 129.638 1.00 38.66 ? 10   HIS G ND1 1 
ATOM   7650  C  CD2 . HIS G  1 10  ? 65.729 86.172 129.010 1.00 36.80 ? 10   HIS G CD2 1 
ATOM   7651  C  CE1 . HIS G  1 10  ? 63.727 86.683 129.747 1.00 37.86 ? 10   HIS G CE1 1 
ATOM   7652  N  NE2 . HIS G  1 10  ? 64.886 87.194 129.372 1.00 38.82 ? 10   HIS G NE2 1 
ATOM   7653  N  N   . LEU G  1 11  ? 66.570 80.790 129.322 1.00 27.30 ? 11   LEU G N   1 
ATOM   7654  C  CA  . LEU G  1 11  ? 66.630 79.376 128.997 1.00 27.64 ? 11   LEU G CA  1 
ATOM   7655  C  C   . LEU G  1 11  ? 66.403 78.526 130.252 1.00 27.84 ? 11   LEU G C   1 
ATOM   7656  O  O   . LEU G  1 11  ? 65.632 77.568 130.217 1.00 26.34 ? 11   LEU G O   1 
ATOM   7657  C  CB  . LEU G  1 11  ? 67.979 79.047 128.358 1.00 26.79 ? 11   LEU G CB  1 
ATOM   7658  C  CG  . LEU G  1 11  ? 68.073 78.990 126.827 1.00 31.40 ? 11   LEU G CG  1 
ATOM   7659  C  CD1 . LEU G  1 11  ? 66.965 79.797 126.158 1.00 27.43 ? 11   LEU G CD1 1 
ATOM   7660  C  CD2 . LEU G  1 11  ? 69.463 79.483 126.412 1.00 30.01 ? 11   LEU G CD2 1 
ATOM   7661  N  N   . ASN G  1 12  ? 67.067 78.866 131.358 1.00 30.18 ? 12   ASN G N   1 
ATOM   7662  C  CA  . ASN G  1 12  ? 66.868 78.106 132.601 1.00 32.32 ? 12   ASN G CA  1 
ATOM   7663  C  C   . ASN G  1 12  ? 65.429 78.260 133.078 1.00 31.72 ? 12   ASN G C   1 
ATOM   7664  O  O   . ASN G  1 12  ? 64.836 77.313 133.602 1.00 33.07 ? 12   ASN G O   1 
ATOM   7665  C  CB  . ASN G  1 12  ? 67.817 78.563 133.715 1.00 29.78 ? 12   ASN G CB  1 
ATOM   7666  C  CG  . ASN G  1 12  ? 69.159 77.842 133.674 1.00 31.94 ? 12   ASN G CG  1 
ATOM   7667  O  OD1 . ASN G  1 12  ? 69.215 76.615 133.538 1.00 31.79 ? 12   ASN G OD1 1 
ATOM   7668  N  ND2 . ASN G  1 12  ? 70.245 78.600 133.803 1.00 29.25 ? 12   ASN G ND2 1 
ATOM   7669  N  N   . LYS G  1 13  ? 64.868 79.451 132.891 1.00 29.64 ? 13   LYS G N   1 
ATOM   7670  C  CA  . LYS G  1 13  ? 63.491 79.697 133.295 1.00 31.70 ? 13   LYS G CA  1 
ATOM   7671  C  C   . LYS G  1 13  ? 62.587 78.744 132.508 1.00 31.03 ? 13   LYS G C   1 
ATOM   7672  O  O   . LYS G  1 13  ? 61.764 78.031 133.087 1.00 31.99 ? 13   LYS G O   1 
ATOM   7673  C  CB  . LYS G  1 13  ? 63.100 81.154 133.003 1.00 35.01 ? 13   LYS G CB  1 
ATOM   7674  C  CG  . LYS G  1 13  ? 61.684 81.556 133.444 1.00 35.26 ? 13   LYS G CG  1 
ATOM   7675  C  CD  . LYS G  1 13  ? 61.567 81.584 134.962 1.00 41.10 ? 13   LYS G CD  1 
ATOM   7676  C  CE  . LYS G  1 13  ? 60.255 82.214 135.434 1.00 43.51 ? 13   LYS G CE  1 
ATOM   7677  N  NZ  . LYS G  1 13  ? 59.071 81.349 135.184 1.00 46.40 ? 13   LYS G NZ  1 
ATOM   7678  N  N   . ILE G  1 14  ? 62.746 78.732 131.186 1.00 28.66 ? 14   ILE G N   1 
ATOM   7679  C  CA  . ILE G  1 14  ? 61.941 77.861 130.335 1.00 26.49 ? 14   ILE G CA  1 
ATOM   7680  C  C   . ILE G  1 14  ? 62.173 76.409 130.737 1.00 26.25 ? 14   ILE G C   1 
ATOM   7681  O  O   . ILE G  1 14  ? 61.218 75.634 130.862 1.00 24.30 ? 14   ILE G O   1 
ATOM   7682  C  CB  . ILE G  1 14  ? 62.298 78.033 128.842 1.00 24.12 ? 14   ILE G CB  1 
ATOM   7683  C  CG1 . ILE G  1 14  ? 62.193 79.506 128.447 1.00 22.30 ? 14   ILE G CG1 1 
ATOM   7684  C  CG2 . ILE G  1 14  ? 61.333 77.231 127.979 1.00 26.29 ? 14   ILE G CG2 1 
ATOM   7685  C  CD1 . ILE G  1 14  ? 60.803 80.084 128.625 1.00 19.26 ? 14   ILE G CD1 1 
ATOM   7686  N  N   . LEU G  1 15  ? 63.437 76.049 130.957 1.00 24.40 ? 15   LEU G N   1 
ATOM   7687  C  CA  . LEU G  1 15  ? 63.776 74.683 131.350 1.00 24.89 ? 15   LEU G CA  1 
ATOM   7688  C  C   . LEU G  1 15  ? 63.048 74.291 132.628 1.00 25.40 ? 15   LEU G C   1 
ATOM   7689  O  O   . LEU G  1 15  ? 62.568 73.162 132.755 1.00 26.05 ? 15   LEU G O   1 
ATOM   7690  C  CB  . LEU G  1 15  ? 65.288 74.525 131.558 1.00 22.89 ? 15   LEU G CB  1 
ATOM   7691  C  CG  . LEU G  1 15  ? 65.702 73.147 132.099 1.00 22.08 ? 15   LEU G CG  1 
ATOM   7692  C  CD1 . LEU G  1 15  ? 65.107 72.061 131.220 1.00 23.28 ? 15   LEU G CD1 1 
ATOM   7693  C  CD2 . LEU G  1 15  ? 67.219 73.014 132.151 1.00 17.55 ? 15   LEU G CD2 1 
ATOM   7694  N  N   . GLY G  1 16  ? 62.973 75.227 133.572 1.00 25.59 ? 16   GLY G N   1 
ATOM   7695  C  CA  . GLY G  1 16  ? 62.298 74.961 134.831 1.00 22.48 ? 16   GLY G CA  1 
ATOM   7696  C  C   . GLY G  1 16  ? 60.855 74.568 134.608 1.00 24.78 ? 16   GLY G C   1 
ATOM   7697  O  O   . GLY G  1 16  ? 60.367 73.616 135.219 1.00 24.76 ? 16   GLY G O   1 
ATOM   7698  N  N   . ASN G  1 17  ? 60.174 75.300 133.724 1.00 25.92 ? 17   ASN G N   1 
ATOM   7699  C  CA  . ASN G  1 17  ? 58.771 75.037 133.397 1.00 26.45 ? 17   ASN G CA  1 
ATOM   7700  C  C   . ASN G  1 17  ? 58.600 73.655 132.778 1.00 27.89 ? 17   ASN G C   1 
ATOM   7701  O  O   . ASN G  1 17  ? 57.631 72.947 133.077 1.00 28.38 ? 17   ASN G O   1 
ATOM   7702  C  CB  . ASN G  1 17  ? 58.243 76.081 132.407 1.00 25.78 ? 17   ASN G CB  1 
ATOM   7703  C  CG  . ASN G  1 17  ? 58.143 77.471 133.008 1.00 27.37 ? 17   ASN G CG  1 
ATOM   7704  O  OD1 . ASN G  1 17  ? 58.087 78.461 132.283 1.00 26.55 ? 17   ASN G OD1 1 
ATOM   7705  N  ND2 . ASN G  1 17  ? 58.107 77.551 134.337 1.00 31.28 ? 17   ASN G ND2 1 
ATOM   7706  N  N   . GLU G  1 18  ? 59.545 73.278 131.917 1.00 28.69 ? 18   GLU G N   1 
ATOM   7707  C  CA  . GLU G  1 18  ? 59.497 71.986 131.233 1.00 29.48 ? 18   GLU G CA  1 
ATOM   7708  C  C   . GLU G  1 18  ? 59.566 70.811 132.189 1.00 28.40 ? 18   GLU G C   1 
ATOM   7709  O  O   . GLU G  1 18  ? 58.748 69.892 132.102 1.00 28.97 ? 18   GLU G O   1 
ATOM   7710  C  CB  . GLU G  1 18  ? 60.621 71.907 130.192 1.00 29.55 ? 18   GLU G CB  1 
ATOM   7711  C  CG  . GLU G  1 18  ? 60.550 72.951 129.106 1.00 34.80 ? 18   GLU G CG  1 
ATOM   7712  C  CD  . GLU G  1 18  ? 59.367 72.768 128.158 1.00 37.79 ? 18   GLU G CD  1 
ATOM   7713  O  OE1 . GLU G  1 18  ? 59.165 73.645 127.295 1.00 40.78 ? 18   GLU G OE1 1 
ATOM   7714  O  OE2 . GLU G  1 18  ? 58.636 71.755 128.294 1.00 42.57 ? 18   GLU G OE2 1 
ATOM   7715  N  N   . LEU G  1 19  ? 60.525 70.847 133.109 1.00 29.77 ? 19   LEU G N   1 
ATOM   7716  C  CA  . LEU G  1 19  ? 60.687 69.760 134.072 1.00 28.46 ? 19   LEU G CA  1 
ATOM   7717  C  C   . LEU G  1 19  ? 59.384 69.511 134.824 1.00 29.06 ? 19   LEU G C   1 
ATOM   7718  O  O   . LEU G  1 19  ? 59.039 68.356 135.097 1.00 32.00 ? 19   LEU G O   1 
ATOM   7719  C  CB  . LEU G  1 19  ? 61.833 70.082 135.031 1.00 25.35 ? 19   LEU G CB  1 
ATOM   7720  C  CG  . LEU G  1 19  ? 63.171 70.216 134.293 1.00 22.27 ? 19   LEU G CG  1 
ATOM   7721  C  CD1 . LEU G  1 19  ? 64.208 70.815 135.198 1.00 22.47 ? 19   LEU G CD1 1 
ATOM   7722  C  CD2 . LEU G  1 19  ? 63.619 68.856 133.790 1.00 22.39 ? 19   LEU G CD2 1 
ATOM   7723  N  N   . ILE G  1 20  ? 58.658 70.589 135.134 1.00 27.88 ? 20   ILE G N   1 
ATOM   7724  C  CA  . ILE G  1 20  ? 57.362 70.494 135.820 1.00 27.93 ? 20   ILE G CA  1 
ATOM   7725  C  C   . ILE G  1 20  ? 56.349 69.781 134.913 1.00 28.70 ? 20   ILE G C   1 
ATOM   7726  O  O   . ILE G  1 20  ? 55.679 68.835 135.336 1.00 32.93 ? 20   ILE G O   1 
ATOM   7727  C  CB  . ILE G  1 20  ? 56.768 71.894 136.158 1.00 26.70 ? 20   ILE G CB  1 
ATOM   7728  C  CG1 . ILE G  1 20  ? 57.686 72.656 137.116 1.00 29.84 ? 20   ILE G CG1 1 
ATOM   7729  C  CG2 . ILE G  1 20  ? 55.399 71.739 136.785 1.00 20.70 ? 20   ILE G CG2 1 
ATOM   7730  C  CD1 . ILE G  1 20  ? 57.176 74.047 137.458 1.00 27.88 ? 20   ILE G CD1 1 
ATOM   7731  N  N   . ALA G  1 21  ? 56.229 70.248 133.671 1.00 26.39 ? 21   ALA G N   1 
ATOM   7732  C  CA  . ALA G  1 21  ? 55.299 69.649 132.718 1.00 24.15 ? 21   ALA G CA  1 
ATOM   7733  C  C   . ALA G  1 21  ? 55.565 68.149 132.602 1.00 23.89 ? 21   ALA G C   1 
ATOM   7734  O  O   . ALA G  1 21  ? 54.636 67.349 132.488 1.00 23.85 ? 21   ALA G O   1 
ATOM   7735  C  CB  . ALA G  1 21  ? 55.451 70.317 131.356 1.00 24.23 ? 21   ALA G CB  1 
ATOM   7736  N  N   . ILE G  1 22  ? 56.839 67.775 132.644 1.00 23.46 ? 22   ILE G N   1 
ATOM   7737  C  CA  . ILE G  1 22  ? 57.241 66.378 132.549 1.00 23.46 ? 22   ILE G CA  1 
ATOM   7738  C  C   . ILE G  1 22  ? 56.603 65.493 133.619 1.00 26.28 ? 22   ILE G C   1 
ATOM   7739  O  O   . ILE G  1 22  ? 55.933 64.504 133.293 1.00 27.84 ? 22   ILE G O   1 
ATOM   7740  C  CB  . ILE G  1 22  ? 58.784 66.225 132.661 1.00 24.53 ? 22   ILE G CB  1 
ATOM   7741  C  CG1 . ILE G  1 22  ? 59.468 66.884 131.463 1.00 21.66 ? 22   ILE G CG1 1 
ATOM   7742  C  CG2 . ILE G  1 22  ? 59.170 64.744 132.726 1.00 20.58 ? 22   ILE G CG2 1 
ATOM   7743  C  CD1 . ILE G  1 22  ? 60.979 66.899 131.581 1.00 23.28 ? 22   ILE G CD1 1 
ATOM   7744  N  N   . ASN G  1 23  ? 56.814 65.835 134.890 1.00 26.14 ? 23   ASN G N   1 
ATOM   7745  C  CA  . ASN G  1 23  ? 56.273 65.022 135.981 1.00 26.94 ? 23   ASN G CA  1 
ATOM   7746  C  C   . ASN G  1 23  ? 54.757 65.040 136.020 1.00 28.11 ? 23   ASN G C   1 
ATOM   7747  O  O   . ASN G  1 23  ? 54.112 64.012 136.240 1.00 27.39 ? 23   ASN G O   1 
ATOM   7748  C  CB  . ASN G  1 23  ? 56.806 65.498 137.329 1.00 28.41 ? 23   ASN G CB  1 
ATOM   7749  C  CG  . ASN G  1 23  ? 58.313 65.436 137.413 1.00 29.50 ? 23   ASN G CG  1 
ATOM   7750  O  OD1 . ASN G  1 23  ? 58.972 64.885 136.530 1.00 31.99 ? 23   ASN G OD1 1 
ATOM   7751  N  ND2 . ASN G  1 23  ? 58.871 65.996 138.483 1.00 25.94 ? 23   ASN G ND2 1 
ATOM   7752  N  N   . GLN G  1 24  ? 54.185 66.218 135.818 1.00 28.59 ? 24   GLN G N   1 
ATOM   7753  C  CA  . GLN G  1 24  ? 52.744 66.345 135.844 1.00 29.37 ? 24   GLN G CA  1 
ATOM   7754  C  C   . GLN G  1 24  ? 52.091 65.484 134.755 1.00 28.80 ? 24   GLN G C   1 
ATOM   7755  O  O   . GLN G  1 24  ? 51.142 64.747 135.021 1.00 27.89 ? 24   GLN G O   1 
ATOM   7756  C  CB  . GLN G  1 24  ? 52.359 67.816 135.686 1.00 28.78 ? 24   GLN G CB  1 
ATOM   7757  C  CG  . GLN G  1 24  ? 50.862 68.067 135.656 1.00 31.21 ? 24   GLN G CG  1 
ATOM   7758  C  CD  . GLN G  1 24  ? 50.523 69.540 135.760 1.00 33.17 ? 24   GLN G CD  1 
ATOM   7759  O  OE1 . GLN G  1 24  ? 49.575 70.012 135.136 1.00 34.79 ? 24   GLN G OE1 1 
ATOM   7760  N  NE2 . GLN G  1 24  ? 51.294 70.274 136.558 1.00 32.83 ? 24   GLN G NE2 1 
ATOM   7761  N  N   . TYR G  1 25  ? 52.602 65.552 133.532 1.00 29.19 ? 25   TYR G N   1 
ATOM   7762  C  CA  . TYR G  1 25  ? 52.002 64.763 132.465 1.00 29.00 ? 25   TYR G CA  1 
ATOM   7763  C  C   . TYR G  1 25  ? 52.272 63.272 132.651 1.00 27.70 ? 25   TYR G C   1 
ATOM   7764  O  O   . TYR G  1 25  ? 51.408 62.435 132.366 1.00 26.73 ? 25   TYR G O   1 
ATOM   7765  C  CB  . TYR G  1 25  ? 52.507 65.229 131.091 1.00 28.35 ? 25   TYR G CB  1 
ATOM   7766  C  CG  . TYR G  1 25  ? 52.235 66.692 130.794 1.00 30.63 ? 25   TYR G CG  1 
ATOM   7767  C  CD1 . TYR G  1 25  ? 51.368 67.440 131.593 1.00 33.54 ? 25   TYR G CD1 1 
ATOM   7768  C  CD2 . TYR G  1 25  ? 52.864 67.339 129.727 1.00 31.60 ? 25   TYR G CD2 1 
ATOM   7769  C  CE1 . TYR G  1 25  ? 51.138 68.796 131.343 1.00 32.17 ? 25   TYR G CE1 1 
ATOM   7770  C  CE2 . TYR G  1 25  ? 52.638 68.692 129.467 1.00 31.78 ? 25   TYR G CE2 1 
ATOM   7771  C  CZ  . TYR G  1 25  ? 51.777 69.410 130.281 1.00 32.65 ? 25   TYR G CZ  1 
ATOM   7772  O  OH  . TYR G  1 25  ? 51.557 70.742 130.044 1.00 34.71 ? 25   TYR G OH  1 
ATOM   7773  N  N   . PHE G  1 26  ? 53.461 62.930 133.133 1.00 25.37 ? 26   PHE G N   1 
ATOM   7774  C  CA  . PHE G  1 26  ? 53.766 61.527 133.322 1.00 24.45 ? 26   PHE G CA  1 
ATOM   7775  C  C   . PHE G  1 26  ? 52.834 60.927 134.369 1.00 25.10 ? 26   PHE G C   1 
ATOM   7776  O  O   . PHE G  1 26  ? 52.244 59.864 134.155 1.00 26.55 ? 26   PHE G O   1 
ATOM   7777  C  CB  . PHE G  1 26  ? 55.205 61.333 133.752 1.00 22.34 ? 26   PHE G CB  1 
ATOM   7778  C  CG  . PHE G  1 26  ? 55.707 59.955 133.491 1.00 25.99 ? 26   PHE G CG  1 
ATOM   7779  C  CD1 . PHE G  1 26  ? 56.157 59.599 132.221 1.00 28.17 ? 26   PHE G CD1 1 
ATOM   7780  C  CD2 . PHE G  1 26  ? 55.679 58.990 134.492 1.00 26.38 ? 26   PHE G CD2 1 
ATOM   7781  C  CE1 . PHE G  1 26  ? 56.576 58.288 131.948 1.00 33.20 ? 26   PHE G CE1 1 
ATOM   7782  C  CE2 . PHE G  1 26  ? 56.094 57.679 134.235 1.00 33.99 ? 26   PHE G CE2 1 
ATOM   7783  C  CZ  . PHE G  1 26  ? 56.546 57.323 132.957 1.00 32.44 ? 26   PHE G CZ  1 
ATOM   7784  N  N   . LEU G  1 27  ? 52.708 61.608 135.507 1.00 24.45 ? 27   LEU G N   1 
ATOM   7785  C  CA  . LEU G  1 27  ? 51.820 61.148 136.568 1.00 21.30 ? 27   LEU G CA  1 
ATOM   7786  C  C   . LEU G  1 27  ? 50.415 61.050 135.982 1.00 21.00 ? 27   LEU G C   1 
ATOM   7787  O  O   . LEU G  1 27  ? 49.809 59.979 136.027 1.00 22.23 ? 27   LEU G O   1 
ATOM   7788  C  CB  . LEU G  1 27  ? 51.823 62.128 137.749 1.00 20.95 ? 27   LEU G CB  1 
ATOM   7789  C  CG  . LEU G  1 27  ? 50.965 61.748 138.967 1.00 19.34 ? 27   LEU G CG  1 
ATOM   7790  C  CD1 . LEU G  1 27  ? 51.384 60.404 139.513 1.00 19.98 ? 27   LEU G CD1 1 
ATOM   7791  C  CD2 . LEU G  1 27  ? 51.134 62.784 140.041 1.00 19.88 ? 27   LEU G CD2 1 
ATOM   7792  N  N   . HIS G  1 28  ? 49.901 62.151 135.426 1.00 18.07 ? 28   HIS G N   1 
ATOM   7793  C  CA  . HIS G  1 28  ? 48.563 62.129 134.835 1.00 21.62 ? 28   HIS G CA  1 
ATOM   7794  C  C   . HIS G  1 28  ? 48.427 60.947 133.866 1.00 24.29 ? 28   HIS G C   1 
ATOM   7795  O  O   . HIS G  1 28  ? 47.432 60.214 133.888 1.00 22.75 ? 28   HIS G O   1 
ATOM   7796  C  CB  . HIS G  1 28  ? 48.261 63.414 134.057 1.00 20.93 ? 28   HIS G CB  1 
ATOM   7797  C  CG  . HIS G  1 28  ? 47.999 64.612 134.915 1.00 24.52 ? 28   HIS G CG  1 
ATOM   7798  N  ND1 . HIS G  1 28  ? 47.493 64.522 136.193 1.00 26.30 ? 28   HIS G ND1 1 
ATOM   7799  C  CD2 . HIS G  1 28  ? 48.138 65.936 134.658 1.00 25.85 ? 28   HIS G CD2 1 
ATOM   7800  C  CE1 . HIS G  1 28  ? 47.334 65.737 136.689 1.00 26.12 ? 28   HIS G CE1 1 
ATOM   7801  N  NE2 . HIS G  1 28  ? 47.717 66.614 135.777 1.00 27.03 ? 28   HIS G NE2 1 
ATOM   7802  N  N   . ALA G  1 29  ? 49.433 60.771 133.011 1.00 27.08 ? 29   ALA G N   1 
ATOM   7803  C  CA  . ALA G  1 29  ? 49.423 59.698 132.030 1.00 26.27 ? 29   ALA G CA  1 
ATOM   7804  C  C   . ALA G  1 29  ? 49.231 58.353 132.712 1.00 27.73 ? 29   ALA G C   1 
ATOM   7805  O  O   . ALA G  1 29  ? 48.345 57.581 132.344 1.00 30.74 ? 29   ALA G O   1 
ATOM   7806  C  CB  . ALA G  1 29  ? 50.711 59.706 131.241 1.00 24.84 ? 29   ALA G CB  1 
ATOM   7807  N  N   . ARG G  1 30  ? 50.050 58.069 133.715 1.00 27.52 ? 30   ARG G N   1 
ATOM   7808  C  CA  . ARG G  1 30  ? 49.929 56.800 134.412 1.00 27.46 ? 30   ARG G CA  1 
ATOM   7809  C  C   . ARG G  1 30  ? 48.629 56.684 135.206 1.00 27.55 ? 30   ARG G C   1 
ATOM   7810  O  O   . ARG G  1 30  ? 48.188 55.577 135.528 1.00 27.27 ? 30   ARG G O   1 
ATOM   7811  C  CB  . ARG G  1 30  ? 51.152 56.588 135.296 1.00 26.86 ? 30   ARG G CB  1 
ATOM   7812  C  CG  . ARG G  1 30  ? 52.396 56.263 134.467 1.00 32.92 ? 30   ARG G CG  1 
ATOM   7813  C  CD  . ARG G  1 30  ? 52.230 54.909 133.783 1.00 35.34 ? 30   ARG G CD  1 
ATOM   7814  N  NE  . ARG G  1 30  ? 53.344 54.546 132.906 1.00 39.45 ? 30   ARG G NE  1 
ATOM   7815  C  CZ  . ARG G  1 30  ? 53.500 54.975 131.655 1.00 38.97 ? 30   ARG G CZ  1 
ATOM   7816  N  NH1 . ARG G  1 30  ? 52.616 55.799 131.105 1.00 40.79 ? 30   ARG G NH1 1 
ATOM   7817  N  NH2 . ARG G  1 30  ? 54.542 54.566 130.945 1.00 35.43 ? 30   ARG G NH2 1 
ATOM   7818  N  N   . MET G  1 31  ? 48.007 57.823 135.507 1.00 27.48 ? 31   MET G N   1 
ATOM   7819  C  CA  . MET G  1 31  ? 46.735 57.822 136.230 1.00 27.53 ? 31   MET G CA  1 
ATOM   7820  C  C   . MET G  1 31  ? 45.604 57.385 135.296 1.00 28.73 ? 31   MET G C   1 
ATOM   7821  O  O   . MET G  1 31  ? 44.819 56.495 135.651 1.00 30.59 ? 31   MET G O   1 
ATOM   7822  C  CB  . MET G  1 31  ? 46.439 59.207 136.812 1.00 26.03 ? 31   MET G CB  1 
ATOM   7823  C  CG  . MET G  1 31  ? 47.192 59.489 138.102 1.00 25.41 ? 31   MET G CG  1 
ATOM   7824  S  SD  . MET G  1 31  ? 46.908 61.140 138.766 1.00 28.76 ? 31   MET G SD  1 
ATOM   7825  C  CE  . MET G  1 31  ? 45.126 61.090 139.061 1.00 22.73 ? 31   MET G CE  1 
ATOM   7826  N  N   . TYR G  1 32  ? 45.523 58.007 134.115 1.00 25.72 ? 32   TYR G N   1 
ATOM   7827  C  CA  . TYR G  1 32  ? 44.507 57.653 133.120 1.00 26.10 ? 32   TYR G CA  1 
ATOM   7828  C  C   . TYR G  1 32  ? 44.645 56.165 132.834 1.00 28.61 ? 32   TYR G C   1 
ATOM   7829  O  O   . TYR G  1 32  ? 43.673 55.405 132.833 1.00 28.23 ? 32   TYR G O   1 
ATOM   7830  C  CB  . TYR G  1 32  ? 44.739 58.411 131.817 1.00 23.71 ? 32   TYR G CB  1 
ATOM   7831  C  CG  . TYR G  1 32  ? 44.414 59.881 131.883 1.00 24.45 ? 32   TYR G CG  1 
ATOM   7832  C  CD1 . TYR G  1 32  ? 45.310 60.836 131.395 1.00 22.42 ? 32   TYR G CD1 1 
ATOM   7833  C  CD2 . TYR G  1 32  ? 43.202 60.326 132.410 1.00 26.29 ? 32   TYR G CD2 1 
ATOM   7834  C  CE1 . TYR G  1 32  ? 45.003 62.194 131.430 1.00 21.69 ? 32   TYR G CE1 1 
ATOM   7835  C  CE2 . TYR G  1 32  ? 42.891 61.688 132.446 1.00 25.97 ? 32   TYR G CE2 1 
ATOM   7836  C  CZ  . TYR G  1 32  ? 43.799 62.607 131.952 1.00 21.94 ? 32   TYR G CZ  1 
ATOM   7837  O  OH  . TYR G  1 32  ? 43.495 63.942 131.967 1.00 29.02 ? 32   TYR G OH  1 
ATOM   7838  N  N   . GLU G  1 33  ? 45.882 55.763 132.585 1.00 30.58 ? 33   GLU G N   1 
ATOM   7839  C  CA  . GLU G  1 33  ? 46.201 54.376 132.299 1.00 33.06 ? 33   GLU G CA  1 
ATOM   7840  C  C   . GLU G  1 33  ? 45.671 53.489 133.423 1.00 30.17 ? 33   GLU G C   1 
ATOM   7841  O  O   . GLU G  1 33  ? 45.058 52.461 133.173 1.00 25.95 ? 33   GLU G O   1 
ATOM   7842  C  CB  . GLU G  1 33  ? 47.708 54.246 132.186 1.00 39.94 ? 33   GLU G CB  1 
ATOM   7843  C  CG  . GLU G  1 33  ? 48.213 52.988 131.555 1.00 47.70 ? 33   GLU G CG  1 
ATOM   7844  C  CD  . GLU G  1 33  ? 49.710 53.070 131.349 1.00 56.23 ? 33   GLU G CD  1 
ATOM   7845  O  OE1 . GLU G  1 33  ? 50.158 54.061 130.721 1.00 58.84 ? 33   GLU G OE1 1 
ATOM   7846  O  OE2 . GLU G  1 33  ? 50.435 52.161 131.816 1.00 60.04 ? 33   GLU G OE2 1 
ATOM   7847  N  N   . ASP G  1 34  ? 45.896 53.907 134.663 1.00 32.05 ? 34   ASP G N   1 
ATOM   7848  C  CA  . ASP G  1 34  ? 45.439 53.147 135.829 1.00 30.99 ? 34   ASP G CA  1 
ATOM   7849  C  C   . ASP G  1 34  ? 43.917 53.080 135.940 1.00 29.07 ? 34   ASP G C   1 
ATOM   7850  O  O   . ASP G  1 34  ? 43.384 52.148 136.541 1.00 27.61 ? 34   ASP G O   1 
ATOM   7851  C  CB  . ASP G  1 34  ? 46.021 53.747 137.110 1.00 31.68 ? 34   ASP G CB  1 
ATOM   7852  C  CG  . ASP G  1 34  ? 45.489 53.078 138.357 1.00 34.34 ? 34   ASP G CG  1 
ATOM   7853  O  OD1 . ASP G  1 34  ? 45.662 51.844 138.502 1.00 35.24 ? 34   ASP G OD1 1 
ATOM   7854  O  OD2 . ASP G  1 34  ? 44.897 53.792 139.198 1.00 36.91 ? 34   ASP G OD2 1 
ATOM   7855  N  N   . TRP G  1 35  ? 43.223 54.067 135.369 1.00 28.01 ? 35   TRP G N   1 
ATOM   7856  C  CA  . TRP G  1 35  ? 41.757 54.091 135.394 1.00 25.96 ? 35   TRP G CA  1 
ATOM   7857  C  C   . TRP G  1 35  ? 41.172 53.320 134.218 1.00 26.78 ? 35   TRP G C   1 
ATOM   7858  O  O   . TRP G  1 35  ? 39.963 53.085 134.166 1.00 28.54 ? 35   TRP G O   1 
ATOM   7859  C  CB  . TRP G  1 35  ? 41.213 55.523 135.330 1.00 24.17 ? 35   TRP G CB  1 
ATOM   7860  C  CG  . TRP G  1 35  ? 41.349 56.299 136.586 1.00 26.22 ? 35   TRP G CG  1 
ATOM   7861  C  CD1 . TRP G  1 35  ? 41.226 55.822 137.858 1.00 27.10 ? 35   TRP G CD1 1 
ATOM   7862  C  CD2 . TRP G  1 35  ? 41.599 57.707 136.706 1.00 24.00 ? 35   TRP G CD2 1 
ATOM   7863  N  NE1 . TRP G  1 35  ? 41.384 56.845 138.766 1.00 26.32 ? 35   TRP G NE1 1 
ATOM   7864  C  CE2 . TRP G  1 35  ? 41.614 58.012 138.088 1.00 22.76 ? 35   TRP G CE2 1 
ATOM   7865  C  CE3 . TRP G  1 35  ? 41.808 58.739 135.785 1.00 22.60 ? 35   TRP G CE3 1 
ATOM   7866  C  CZ2 . TRP G  1 35  ? 41.832 59.302 138.570 1.00 15.82 ? 35   TRP G CZ2 1 
ATOM   7867  C  CZ3 . TRP G  1 35  ? 42.024 60.030 136.267 1.00 22.26 ? 35   TRP G CZ3 1 
ATOM   7868  C  CH2 . TRP G  1 35  ? 42.034 60.296 137.647 1.00 18.80 ? 35   TRP G CH2 1 
ATOM   7869  N  N   . GLY G  1 36  ? 42.020 52.945 133.263 1.00 25.56 ? 36   GLY G N   1 
ATOM   7870  C  CA  . GLY G  1 36  ? 41.528 52.214 132.111 1.00 24.17 ? 36   GLY G CA  1 
ATOM   7871  C  C   . GLY G  1 36  ? 41.192 53.140 130.960 1.00 27.23 ? 36   GLY G C   1 
ATOM   7872  O  O   . GLY G  1 36  ? 40.470 52.767 130.028 1.00 26.53 ? 36   GLY G O   1 
ATOM   7873  N  N   . LEU G  1 37  ? 41.705 54.364 131.034 1.00 28.67 ? 37   LEU G N   1 
ATOM   7874  C  CA  . LEU G  1 37  ? 41.495 55.346 129.984 1.00 28.60 ? 37   LEU G CA  1 
ATOM   7875  C  C   . LEU G  1 37  ? 42.736 55.320 129.083 1.00 30.41 ? 37   LEU G C   1 
ATOM   7876  O  O   . LEU G  1 37  ? 43.483 56.300 129.004 1.00 31.62 ? 37   LEU G O   1 
ATOM   7877  C  CB  . LEU G  1 37  ? 41.277 56.745 130.590 1.00 25.42 ? 37   LEU G CB  1 
ATOM   7878  C  CG  . LEU G  1 37  ? 39.907 57.095 131.210 1.00 25.31 ? 37   LEU G CG  1 
ATOM   7879  C  CD1 . LEU G  1 37  ? 38.839 56.167 130.638 1.00 27.82 ? 37   LEU G CD1 1 
ATOM   7880  C  CD2 . LEU G  1 37  ? 39.920 56.950 132.697 1.00 23.78 ? 37   LEU G CD2 1 
ATOM   7881  N  N   . GLU G  1 38  ? 42.935 54.184 128.411 1.00 31.48 ? 38   GLU G N   1 
ATOM   7882  C  CA  . GLU G  1 38  ? 44.076 53.951 127.515 1.00 36.05 ? 38   GLU G CA  1 
ATOM   7883  C  C   . GLU G  1 38  ? 44.388 55.031 126.479 1.00 34.36 ? 38   GLU G C   1 
ATOM   7884  O  O   . GLU G  1 38  ? 45.531 55.475 126.359 1.00 35.62 ? 38   GLU G O   1 
ATOM   7885  C  CB  . GLU G  1 38  ? 43.911 52.614 126.770 1.00 41.91 ? 38   GLU G CB  1 
ATOM   7886  C  CG  . GLU G  1 38  ? 44.192 51.354 127.599 1.00 53.92 ? 38   GLU G CG  1 
ATOM   7887  C  CD  . GLU G  1 38  ? 42.950 50.788 128.283 1.00 62.39 ? 38   GLU G CD  1 
ATOM   7888  O  OE1 . GLU G  1 38  ? 42.355 51.497 129.122 1.00 67.32 ? 38   GLU G OE1 1 
ATOM   7889  O  OE2 . GLU G  1 38  ? 42.570 49.630 127.982 1.00 64.82 ? 38   GLU G OE2 1 
ATOM   7890  N  N   . LYS G  1 39  ? 43.385 55.429 125.708 1.00 33.07 ? 39   LYS G N   1 
ATOM   7891  C  CA  . LYS G  1 39  ? 43.577 56.445 124.680 1.00 33.34 ? 39   LYS G CA  1 
ATOM   7892  C  C   . LYS G  1 39  ? 44.049 57.756 125.315 1.00 29.45 ? 39   LYS G C   1 
ATOM   7893  O  O   . LYS G  1 39  ? 45.000 58.392 124.852 1.00 27.80 ? 39   LYS G O   1 
ATOM   7894  C  CB  . LYS G  1 39  ? 42.263 56.661 123.914 1.00 37.41 ? 39   LYS G CB  1 
ATOM   7895  C  CG  . LYS G  1 39  ? 42.390 57.524 122.665 1.00 44.66 ? 39   LYS G CG  1 
ATOM   7896  C  CD  . LYS G  1 39  ? 41.032 57.751 122.004 1.00 49.81 ? 39   LYS G CD  1 
ATOM   7897  C  CE  . LYS G  1 39  ? 41.114 58.753 120.849 1.00 52.46 ? 39   LYS G CE  1 
ATOM   7898  N  NZ  . LYS G  1 39  ? 39.751 59.209 120.402 1.00 55.17 ? 39   LYS G NZ  1 
ATOM   7899  N  N   . LEU G  1 40  ? 43.393 58.139 126.399 1.00 25.97 ? 40   LEU G N   1 
ATOM   7900  C  CA  . LEU G  1 40  ? 43.729 59.364 127.100 1.00 24.10 ? 40   LEU G CA  1 
ATOM   7901  C  C   . LEU G  1 40  ? 45.110 59.222 127.720 1.00 23.25 ? 40   LEU G C   1 
ATOM   7902  O  O   . LEU G  1 40  ? 45.900 60.177 127.754 1.00 23.15 ? 40   LEU G O   1 
ATOM   7903  C  CB  . LEU G  1 40  ? 42.676 59.625 128.172 1.00 26.38 ? 40   LEU G CB  1 
ATOM   7904  C  CG  . LEU G  1 40  ? 42.362 61.051 128.615 1.00 26.33 ? 40   LEU G CG  1 
ATOM   7905  C  CD1 . LEU G  1 40  ? 42.294 61.996 127.433 1.00 28.46 ? 40   LEU G CD1 1 
ATOM   7906  C  CD2 . LEU G  1 40  ? 41.036 61.018 129.343 1.00 25.61 ? 40   LEU G CD2 1 
ATOM   7907  N  N   . GLY G  1 41  ? 45.404 58.020 128.203 1.00 22.10 ? 41   GLY G N   1 
ATOM   7908  C  CA  . GLY G  1 41  ? 46.699 57.770 128.810 1.00 23.87 ? 41   GLY G CA  1 
ATOM   7909  C  C   . GLY G  1 41  ? 47.838 57.848 127.811 1.00 26.29 ? 41   GLY G C   1 
ATOM   7910  O  O   . GLY G  1 41  ? 48.862 58.486 128.055 1.00 26.31 ? 41   GLY G O   1 
ATOM   7911  N  N   . LYS G  1 42  ? 47.665 57.193 126.672 1.00 30.29 ? 42   LYS G N   1 
ATOM   7912  C  CA  . LYS G  1 42  ? 48.695 57.196 125.646 1.00 32.10 ? 42   LYS G CA  1 
ATOM   7913  C  C   . LYS G  1 42  ? 48.983 58.623 125.159 1.00 29.85 ? 42   LYS G C   1 
ATOM   7914  O  O   . LYS G  1 42  ? 50.128 58.990 124.928 1.00 30.08 ? 42   LYS G O   1 
ATOM   7915  C  CB  . LYS G  1 42  ? 48.264 56.298 124.481 1.00 36.72 ? 42   LYS G CB  1 
ATOM   7916  C  CG  . LYS G  1 42  ? 49.277 56.209 123.346 1.00 44.66 ? 42   LYS G CG  1 
ATOM   7917  C  CD  . LYS G  1 42  ? 48.671 55.518 122.127 1.00 51.27 ? 42   LYS G CD  1 
ATOM   7918  C  CE  . LYS G  1 42  ? 49.520 55.735 120.876 1.00 55.82 ? 42   LYS G CE  1 
ATOM   7919  N  NZ  . LYS G  1 42  ? 48.897 55.106 119.672 1.00 59.11 ? 42   LYS G NZ  1 
ATOM   7920  N  N   . HIS G  1 43  ? 47.950 59.437 125.011 1.00 28.99 ? 43   HIS G N   1 
ATOM   7921  C  CA  . HIS G  1 43  ? 48.178 60.799 124.561 1.00 30.58 ? 43   HIS G CA  1 
ATOM   7922  C  C   . HIS G  1 43  ? 48.912 61.623 125.629 1.00 31.49 ? 43   HIS G C   1 
ATOM   7923  O  O   . HIS G  1 43  ? 49.845 62.359 125.317 1.00 32.33 ? 43   HIS G O   1 
ATOM   7924  C  CB  . HIS G  1 43  ? 46.854 61.459 124.185 1.00 32.85 ? 43   HIS G CB  1 
ATOM   7925  C  CG  . HIS G  1 43  ? 47.019 62.736 123.426 1.00 38.89 ? 43   HIS G CG  1 
ATOM   7926  N  ND1 . HIS G  1 43  ? 47.533 63.881 123.999 1.00 42.36 ? 43   HIS G ND1 1 
ATOM   7927  C  CD2 . HIS G  1 43  ? 46.784 63.037 122.128 1.00 39.93 ? 43   HIS G CD2 1 
ATOM   7928  C  CE1 . HIS G  1 43  ? 47.610 64.832 123.085 1.00 43.71 ? 43   HIS G CE1 1 
ATOM   7929  N  NE2 . HIS G  1 43  ? 47.161 64.345 121.941 1.00 45.07 ? 43   HIS G NE2 1 
ATOM   7930  N  N   . GLU G  1 44  ? 48.500 61.508 126.889 1.00 33.19 ? 44   GLU G N   1 
ATOM   7931  C  CA  . GLU G  1 44  ? 49.176 62.244 127.963 1.00 33.42 ? 44   GLU G CA  1 
ATOM   7932  C  C   . GLU G  1 44  ? 50.629 61.795 128.065 1.00 31.07 ? 44   GLU G C   1 
ATOM   7933  O  O   . GLU G  1 44  ? 51.513 62.579 128.411 1.00 29.12 ? 44   GLU G O   1 
ATOM   7934  C  CB  . GLU G  1 44  ? 48.479 62.009 129.305 1.00 34.77 ? 44   GLU G CB  1 
ATOM   7935  C  CG  . GLU G  1 44  ? 47.508 63.100 129.679 1.00 41.56 ? 44   GLU G CG  1 
ATOM   7936  C  CD  . GLU G  1 44  ? 48.204 64.390 130.068 1.00 46.07 ? 44   GLU G CD  1 
ATOM   7937  O  OE1 . GLU G  1 44  ? 48.879 64.415 131.119 1.00 48.12 ? 44   GLU G OE1 1 
ATOM   7938  O  OE2 . GLU G  1 44  ? 48.081 65.383 129.323 1.00 50.98 ? 44   GLU G OE2 1 
ATOM   7939  N  N   . TYR G  1 45  ? 50.866 60.524 127.757 1.00 30.63 ? 45   TYR G N   1 
ATOM   7940  C  CA  . TYR G  1 45  ? 52.206 59.964 127.806 1.00 31.97 ? 45   TYR G CA  1 
ATOM   7941  C  C   . TYR G  1 45  ? 53.107 60.660 126.799 1.00 33.10 ? 45   TYR G C   1 
ATOM   7942  O  O   . TYR G  1 45  ? 54.214 61.075 127.140 1.00 34.68 ? 45   TYR G O   1 
ATOM   7943  C  CB  . TYR G  1 45  ? 52.162 58.469 127.510 1.00 34.57 ? 45   TYR G CB  1 
ATOM   7944  C  CG  . TYR G  1 45  ? 53.516 57.804 127.500 1.00 37.07 ? 45   TYR G CG  1 
ATOM   7945  C  CD1 . TYR G  1 45  ? 54.230 57.596 128.683 1.00 39.27 ? 45   TYR G CD1 1 
ATOM   7946  C  CD2 . TYR G  1 45  ? 54.095 57.398 126.302 1.00 38.01 ? 45   TYR G CD2 1 
ATOM   7947  C  CE1 . TYR G  1 45  ? 55.497 56.994 128.663 1.00 41.19 ? 45   TYR G CE1 1 
ATOM   7948  C  CE2 . TYR G  1 45  ? 55.347 56.803 126.270 1.00 40.05 ? 45   TYR G CE2 1 
ATOM   7949  C  CZ  . TYR G  1 45  ? 56.045 56.602 127.447 1.00 41.95 ? 45   TYR G CZ  1 
ATOM   7950  O  OH  . TYR G  1 45  ? 57.290 56.012 127.386 1.00 44.43 ? 45   TYR G OH  1 
ATOM   7951  N  N   . HIS G  1 46  ? 52.638 60.794 125.561 1.00 33.66 ? 46   HIS G N   1 
ATOM   7952  C  CA  . HIS G  1 46  ? 53.434 61.460 124.537 1.00 33.98 ? 46   HIS G CA  1 
ATOM   7953  C  C   . HIS G  1 46  ? 53.689 62.904 124.896 1.00 31.21 ? 46   HIS G C   1 
ATOM   7954  O  O   . HIS G  1 46  ? 54.775 63.416 124.640 1.00 31.42 ? 46   HIS G O   1 
ATOM   7955  C  CB  . HIS G  1 46  ? 52.754 61.389 123.174 1.00 41.81 ? 46   HIS G CB  1 
ATOM   7956  C  CG  . HIS G  1 46  ? 52.827 60.038 122.543 1.00 51.51 ? 46   HIS G CG  1 
ATOM   7957  N  ND1 . HIS G  1 46  ? 52.393 59.791 121.258 1.00 57.03 ? 46   HIS G ND1 1 
ATOM   7958  C  CD2 . HIS G  1 46  ? 53.267 58.852 123.027 1.00 54.96 ? 46   HIS G CD2 1 
ATOM   7959  C  CE1 . HIS G  1 46  ? 52.562 58.511 120.978 1.00 59.35 ? 46   HIS G CE1 1 
ATOM   7960  N  NE2 . HIS G  1 46  ? 53.090 57.919 122.035 1.00 59.10 ? 46   HIS G NE2 1 
ATOM   7961  N  N   . GLU G  1 47  ? 52.689 63.565 125.477 1.00 28.10 ? 47   GLU G N   1 
ATOM   7962  C  CA  . GLU G  1 47  ? 52.853 64.950 125.892 1.00 28.63 ? 47   GLU G CA  1 
ATOM   7963  C  C   . GLU G  1 47  ? 54.035 64.977 126.838 1.00 27.78 ? 47   GLU G C   1 
ATOM   7964  O  O   . GLU G  1 47  ? 54.846 65.895 126.815 1.00 30.14 ? 47   GLU G O   1 
ATOM   7965  C  CB  . GLU G  1 47  ? 51.620 65.449 126.639 1.00 36.16 ? 47   GLU G CB  1 
ATOM   7966  C  CG  . GLU G  1 47  ? 50.363 65.517 125.803 1.00 46.99 ? 47   GLU G CG  1 
ATOM   7967  C  CD  . GLU G  1 47  ? 50.500 66.479 124.638 1.00 53.60 ? 47   GLU G CD  1 
ATOM   7968  O  OE1 . GLU G  1 47  ? 51.489 66.344 123.874 1.00 51.38 ? 47   GLU G OE1 1 
ATOM   7969  O  OE2 . GLU G  1 47  ? 49.617 67.361 124.488 1.00 57.56 ? 47   GLU G OE2 1 
ATOM   7970  N  N   . SER G  1 48  ? 54.130 63.954 127.677 1.00 26.98 ? 48   SER G N   1 
ATOM   7971  C  CA  . SER G  1 48  ? 55.221 63.869 128.631 1.00 25.54 ? 48   SER G CA  1 
ATOM   7972  C  C   . SER G  1 48  ? 56.558 63.752 127.918 1.00 24.45 ? 48   SER G C   1 
ATOM   7973  O  O   . SER G  1 48  ? 57.492 64.502 128.206 1.00 24.63 ? 48   SER G O   1 
ATOM   7974  C  CB  . SER G  1 48  ? 55.028 62.667 129.540 1.00 26.15 ? 48   SER G CB  1 
ATOM   7975  O  OG  . SER G  1 48  ? 55.993 62.671 130.570 1.00 31.45 ? 48   SER G OG  1 
ATOM   7976  N  N   . ILE G  1 49  ? 56.648 62.809 126.984 1.00 23.24 ? 49   ILE G N   1 
ATOM   7977  C  CA  . ILE G  1 49  ? 57.879 62.602 126.239 1.00 21.70 ? 49   ILE G CA  1 
ATOM   7978  C  C   . ILE G  1 49  ? 58.279 63.856 125.455 1.00 25.39 ? 49   ILE G C   1 
ATOM   7979  O  O   . ILE G  1 49  ? 59.471 64.157 125.336 1.00 26.36 ? 49   ILE G O   1 
ATOM   7980  C  CB  . ILE G  1 49  ? 57.748 61.422 125.274 1.00 20.11 ? 49   ILE G CB  1 
ATOM   7981  C  CG1 . ILE G  1 49  ? 57.256 60.180 126.025 1.00 25.08 ? 49   ILE G CG1 1 
ATOM   7982  C  CG2 . ILE G  1 49  ? 59.102 61.102 124.671 1.00 21.19 ? 49   ILE G CG2 1 
ATOM   7983  C  CD1 . ILE G  1 49  ? 58.280 59.575 127.003 1.00 27.67 ? 49   ILE G CD1 1 
ATOM   7984  N  N   . ASP G  1 50  ? 57.302 64.588 124.920 1.00 25.14 ? 50   ASP G N   1 
ATOM   7985  C  CA  . ASP G  1 50  ? 57.612 65.813 124.186 1.00 26.51 ? 50   ASP G CA  1 
ATOM   7986  C  C   . ASP G  1 50  ? 58.318 66.806 125.108 1.00 28.57 ? 50   ASP G C   1 
ATOM   7987  O  O   . ASP G  1 50  ? 59.352 67.377 124.742 1.00 28.50 ? 50   ASP G O   1 
ATOM   7988  C  CB  . ASP G  1 50  ? 56.344 66.472 123.644 1.00 31.03 ? 50   ASP G CB  1 
ATOM   7989  C  CG  . ASP G  1 50  ? 55.731 65.706 122.496 1.00 36.48 ? 50   ASP G CG  1 
ATOM   7990  O  OD1 . ASP G  1 50  ? 56.474 64.986 121.793 1.00 37.36 ? 50   ASP G OD1 1 
ATOM   7991  O  OD2 . ASP G  1 50  ? 54.502 65.841 122.286 1.00 41.39 ? 50   ASP G OD2 1 
ATOM   7992  N  N   . GLU G  1 51  ? 57.738 67.020 126.290 1.00 27.35 ? 51   GLU G N   1 
ATOM   7993  C  CA  . GLU G  1 51  ? 58.299 67.922 127.293 1.00 30.77 ? 51   GLU G CA  1 
ATOM   7994  C  C   . GLU G  1 51  ? 59.714 67.482 127.643 1.00 30.01 ? 51   GLU G C   1 
ATOM   7995  O  O   . GLU G  1 51  ? 60.598 68.311 127.883 1.00 28.34 ? 51   GLU G O   1 
ATOM   7996  C  CB  . GLU G  1 51  ? 57.427 67.960 128.560 1.00 37.72 ? 51   GLU G CB  1 
ATOM   7997  C  CG  . GLU G  1 51  ? 55.969 68.346 128.327 1.00 42.88 ? 51   GLU G CG  1 
ATOM   7998  C  CD  . GLU G  1 51  ? 55.832 69.715 127.666 1.00 46.57 ? 51   GLU G CD  1 
ATOM   7999  O  OE1 . GLU G  1 51  ? 56.864 70.362 127.394 1.00 52.78 ? 51   GLU G OE1 1 
ATOM   8000  O  OE2 . GLU G  1 51  ? 54.688 70.143 127.411 1.00 50.03 ? 51   GLU G OE2 1 
ATOM   8001  N  N   . MET G  1 52  ? 59.933 66.170 127.662 1.00 28.46 ? 52   MET G N   1 
ATOM   8002  C  CA  . MET G  1 52  ? 61.254 65.638 127.955 1.00 26.74 ? 52   MET G CA  1 
ATOM   8003  C  C   . MET G  1 52  ? 62.218 66.086 126.864 1.00 27.18 ? 52   MET G C   1 
ATOM   8004  O  O   . MET G  1 52  ? 63.355 66.462 127.141 1.00 28.21 ? 52   MET G O   1 
ATOM   8005  C  CB  . MET G  1 52  ? 61.208 64.110 128.043 1.00 26.90 ? 52   MET G CB  1 
ATOM   8006  C  CG  . MET G  1 52  ? 60.659 63.596 129.378 1.00 29.63 ? 52   MET G CG  1 
ATOM   8007  S  SD  . MET G  1 52  ? 60.661 61.788 129.594 1.00 30.59 ? 52   MET G SD  1 
ATOM   8008  C  CE  . MET G  1 52  ? 58.970 61.518 130.065 1.00 30.32 ? 52   MET G CE  1 
ATOM   8009  N  N   . LYS G  1 53  ? 61.755 66.068 125.618 1.00 28.83 ? 53   LYS G N   1 
ATOM   8010  C  CA  . LYS G  1 53  ? 62.590 66.482 124.496 1.00 26.97 ? 53   LYS G CA  1 
ATOM   8011  C  C   . LYS G  1 53  ? 62.838 67.983 124.512 1.00 27.49 ? 53   LYS G C   1 
ATOM   8012  O  O   . LYS G  1 53  ? 63.898 68.441 124.068 1.00 27.88 ? 53   LYS G O   1 
ATOM   8013  C  CB  . LYS G  1 53  ? 61.950 66.066 123.180 1.00 28.44 ? 53   LYS G CB  1 
ATOM   8014  C  CG  . LYS G  1 53  ? 61.907 64.565 122.972 1.00 28.53 ? 53   LYS G CG  1 
ATOM   8015  C  CD  . LYS G  1 53  ? 61.185 64.249 121.680 1.00 32.76 ? 53   LYS G CD  1 
ATOM   8016  C  CE  . LYS G  1 53  ? 60.966 62.766 121.497 1.00 33.54 ? 53   LYS G CE  1 
ATOM   8017  N  NZ  . LYS G  1 53  ? 60.157 62.522 120.273 1.00 38.18 ? 53   LYS G NZ  1 
ATOM   8018  N  N   . HIS G  1 54  ? 61.861 68.750 125.000 1.00 26.22 ? 54   HIS G N   1 
ATOM   8019  C  CA  . HIS G  1 54  ? 62.031 70.200 125.113 1.00 25.76 ? 54   HIS G CA  1 
ATOM   8020  C  C   . HIS G  1 54  ? 63.113 70.489 126.116 1.00 24.30 ? 54   HIS G C   1 
ATOM   8021  O  O   . HIS G  1 54  ? 63.953 71.368 125.925 1.00 26.10 ? 54   HIS G O   1 
ATOM   8022  C  CB  . HIS G  1 54  ? 60.762 70.880 125.541 1.00 27.98 ? 54   HIS G CB  1 
ATOM   8023  C  CG  . HIS G  1 54  ? 59.678 70.887 124.450 1.00 32.42 ? 54   HIS G CG  1 
ATOM   8024  N  ND1 . HIS G  1 54  ? 58.397 71.342 124.679 1.00 31.17 ? 54   HIS G ND1 1 
ATOM   8025  C  CD2 . HIS G  1 54  ? 59.716 70.503 123.152 1.00 32.26 ? 54   HIS G CD2 1 
ATOM   8026  C  CE1 . HIS G  1 54  ? 57.691 71.237 123.566 1.00 31.02 ? 54   HIS G CE1 1 
ATOM   8027  N  NE2 . HIS G  1 54  ? 58.469 70.731 122.625 1.00 31.55 ? 54   HIS G NE2 1 
ATOM   8028  N  N   . ALA G  1 55  ? 63.070 69.749 127.221 1.00 22.35 ? 55   ALA G N   1 
ATOM   8029  C  CA  . ALA G  1 55  ? 64.045 69.890 128.292 1.00 18.96 ? 55   ALA G CA  1 
ATOM   8030  C  C   . ALA G  1 55  ? 65.417 69.580 127.741 1.00 19.60 ? 55   ALA G C   1 
ATOM   8031  O  O   . ALA G  1 55  ? 66.375 70.304 127.997 1.00 20.88 ? 55   ALA G O   1 
ATOM   8032  C  CB  . ALA G  1 55  ? 63.718 68.935 129.416 1.00 17.62 ? 55   ALA G CB  1 
ATOM   8033  N  N   . ASP G  1 56  ? 65.503 68.500 126.971 1.00 21.45 ? 56   ASP G N   1 
ATOM   8034  C  CA  . ASP G  1 56  ? 66.763 68.075 126.375 1.00 23.68 ? 56   ASP G CA  1 
ATOM   8035  C  C   . ASP G  1 56  ? 67.364 69.187 125.506 1.00 26.20 ? 56   ASP G C   1 
ATOM   8036  O  O   . ASP G  1 56  ? 68.537 69.545 125.679 1.00 25.74 ? 56   ASP G O   1 
ATOM   8037  C  CB  . ASP G  1 56  ? 66.535 66.801 125.550 1.00 24.94 ? 56   ASP G CB  1 
ATOM   8038  C  CG  . ASP G  1 56  ? 67.823 66.039 125.265 1.00 27.92 ? 56   ASP G CG  1 
ATOM   8039  O  OD1 . ASP G  1 56  ? 68.778 66.155 126.060 1.00 30.47 ? 56   ASP G OD1 1 
ATOM   8040  O  OD2 . ASP G  1 56  ? 67.873 65.302 124.252 1.00 30.74 ? 56   ASP G OD2 1 
ATOM   8041  N  N   . LYS G  1 57  ? 66.563 69.741 124.590 1.00 25.29 ? 57   LYS G N   1 
ATOM   8042  C  CA  . LYS G  1 57  ? 67.034 70.810 123.705 1.00 26.26 ? 57   LYS G CA  1 
ATOM   8043  C  C   . LYS G  1 57  ? 67.573 71.991 124.495 1.00 27.27 ? 57   LYS G C   1 
ATOM   8044  O  O   . LYS G  1 57  ? 68.641 72.527 124.181 1.00 29.80 ? 57   LYS G O   1 
ATOM   8045  C  CB  . LYS G  1 57  ? 65.915 71.319 122.791 1.00 28.12 ? 57   LYS G CB  1 
ATOM   8046  C  CG  . LYS G  1 57  ? 65.479 70.366 121.697 1.00 34.79 ? 57   LYS G CG  1 
ATOM   8047  C  CD  . LYS G  1 57  ? 64.496 71.068 120.759 1.00 42.70 ? 57   LYS G CD  1 
ATOM   8048  C  CE  . LYS G  1 57  ? 63.897 70.117 119.716 1.00 45.54 ? 57   LYS G CE  1 
ATOM   8049  N  NZ  . LYS G  1 57  ? 62.926 69.147 120.308 1.00 44.66 ? 57   LYS G NZ  1 
ATOM   8050  N  N   . LEU G  1 58  ? 66.822 72.409 125.510 1.00 26.52 ? 58   LEU G N   1 
ATOM   8051  C  CA  . LEU G  1 58  ? 67.225 73.536 126.344 1.00 24.05 ? 58   LEU G CA  1 
ATOM   8052  C  C   . LEU G  1 58  ? 68.555 73.259 127.027 1.00 24.35 ? 58   LEU G C   1 
ATOM   8053  O  O   . LEU G  1 58  ? 69.467 74.086 126.980 1.00 23.69 ? 58   LEU G O   1 
ATOM   8054  C  CB  . LEU G  1 58  ? 66.154 73.812 127.391 1.00 23.95 ? 58   LEU G CB  1 
ATOM   8055  C  CG  . LEU G  1 58  ? 64.840 74.305 126.792 1.00 25.61 ? 58   LEU G CG  1 
ATOM   8056  C  CD1 . LEU G  1 58  ? 63.765 74.309 127.861 1.00 23.62 ? 58   LEU G CD1 1 
ATOM   8057  C  CD2 . LEU G  1 58  ? 65.044 75.705 126.190 1.00 21.57 ? 58   LEU G CD2 1 
ATOM   8058  N  N   . ILE G  1 59  ? 68.659 72.090 127.656 1.00 22.72 ? 59   ILE G N   1 
ATOM   8059  C  CA  . ILE G  1 59  ? 69.878 71.701 128.345 1.00 25.18 ? 59   ILE G CA  1 
ATOM   8060  C  C   . ILE G  1 59  ? 71.083 71.800 127.411 1.00 26.63 ? 59   ILE G C   1 
ATOM   8061  O  O   . ILE G  1 59  ? 72.074 72.459 127.741 1.00 28.07 ? 59   ILE G O   1 
ATOM   8062  C  CB  . ILE G  1 59  ? 69.767 70.257 128.911 1.00 25.80 ? 59   ILE G CB  1 
ATOM   8063  C  CG1 . ILE G  1 59  ? 68.677 70.206 129.990 1.00 22.49 ? 59   ILE G CG1 1 
ATOM   8064  C  CG2 . ILE G  1 59  ? 71.103 69.809 129.510 1.00 19.09 ? 59   ILE G CG2 1 
ATOM   8065  C  CD1 . ILE G  1 59  ? 68.487 68.825 130.591 1.00 23.68 ? 59   ILE G CD1 1 
ATOM   8066  N  N   . LYS G  1 60  ? 70.995 71.155 126.250 1.00 26.96 ? 60   LYS G N   1 
ATOM   8067  C  CA  . LYS G  1 60  ? 72.080 71.179 125.267 1.00 27.52 ? 60   LYS G CA  1 
ATOM   8068  C  C   . LYS G  1 60  ? 72.444 72.607 124.884 1.00 27.79 ? 60   LYS G C   1 
ATOM   8069  O  O   . LYS G  1 60  ? 73.623 72.956 124.820 1.00 28.86 ? 60   LYS G O   1 
ATOM   8070  C  CB  . LYS G  1 60  ? 71.675 70.430 123.995 1.00 31.43 ? 60   LYS G CB  1 
ATOM   8071  C  CG  . LYS G  1 60  ? 71.430 68.946 124.182 1.00 35.93 ? 60   LYS G CG  1 
ATOM   8072  C  CD  . LYS G  1 60  ? 70.959 68.308 122.896 1.00 38.92 ? 60   LYS G CD  1 
ATOM   8073  C  CE  . LYS G  1 60  ? 70.473 66.892 123.146 1.00 43.89 ? 60   LYS G CE  1 
ATOM   8074  N  NZ  . LYS G  1 60  ? 69.765 66.339 121.957 1.00 47.20 ? 60   LYS G NZ  1 
ATOM   8075  N  N   . ARG G  1 61  ? 71.426 73.424 124.613 1.00 24.92 ? 61   ARG G N   1 
ATOM   8076  C  CA  . ARG G  1 61  ? 71.643 74.817 124.233 1.00 23.34 ? 61   ARG G CA  1 
ATOM   8077  C  C   . ARG G  1 61  ? 72.390 75.563 125.335 1.00 23.21 ? 61   ARG G C   1 
ATOM   8078  O  O   . ARG G  1 61  ? 73.368 76.263 125.071 1.00 25.57 ? 61   ARG G O   1 
ATOM   8079  C  CB  . ARG G  1 61  ? 70.300 75.502 123.942 1.00 22.42 ? 61   ARG G CB  1 
ATOM   8080  C  CG  . ARG G  1 61  ? 70.407 76.956 123.492 1.00 21.67 ? 61   ARG G CG  1 
ATOM   8081  C  CD  . ARG G  1 61  ? 71.229 77.080 122.226 1.00 22.34 ? 61   ARG G CD  1 
ATOM   8082  N  NE  . ARG G  1 61  ? 71.334 78.458 121.743 1.00 22.93 ? 61   ARG G NE  1 
ATOM   8083  C  CZ  . ARG G  1 61  ? 72.099 78.822 120.713 1.00 23.67 ? 61   ARG G CZ  1 
ATOM   8084  N  NH1 . ARG G  1 61  ? 72.815 77.911 120.070 1.00 21.01 ? 61   ARG G NH1 1 
ATOM   8085  N  NH2 . ARG G  1 61  ? 72.159 80.092 120.325 1.00 24.17 ? 61   ARG G NH2 1 
ATOM   8086  N  N   . ILE G  1 62  ? 71.939 75.409 126.573 1.00 22.79 ? 62   ILE G N   1 
ATOM   8087  C  CA  . ILE G  1 62  ? 72.598 76.075 127.690 1.00 24.12 ? 62   ILE G CA  1 
ATOM   8088  C  C   . ILE G  1 62  ? 74.051 75.625 127.849 1.00 25.21 ? 62   ILE G C   1 
ATOM   8089  O  O   . ILE G  1 62  ? 74.920 76.453 128.134 1.00 23.90 ? 62   ILE G O   1 
ATOM   8090  C  CB  . ILE G  1 62  ? 71.834 75.845 129.003 1.00 24.45 ? 62   ILE G CB  1 
ATOM   8091  C  CG1 . ILE G  1 62  ? 70.426 76.443 128.877 1.00 26.61 ? 62   ILE G CG1 1 
ATOM   8092  C  CG2 . ILE G  1 62  ? 72.601 76.462 130.164 1.00 20.66 ? 62   ILE G CG2 1 
ATOM   8093  C  CD1 . ILE G  1 62  ? 69.580 76.304 130.107 1.00 30.38 ? 62   ILE G CD1 1 
ATOM   8094  N  N   . LEU G  1 63  ? 74.322 74.329 127.674 1.00 25.26 ? 63   LEU G N   1 
ATOM   8095  C  CA  . LEU G  1 63  ? 75.702 73.839 127.772 1.00 25.83 ? 63   LEU G CA  1 
ATOM   8096  C  C   . LEU G  1 63  ? 76.531 74.458 126.652 1.00 26.71 ? 63   LEU G C   1 
ATOM   8097  O  O   . LEU G  1 63  ? 77.693 74.806 126.856 1.00 28.04 ? 63   LEU G O   1 
ATOM   8098  C  CB  . LEU G  1 63  ? 75.796 72.316 127.628 1.00 23.57 ? 63   LEU G CB  1 
ATOM   8099  C  CG  . LEU G  1 63  ? 75.638 71.347 128.801 1.00 25.68 ? 63   LEU G CG  1 
ATOM   8100  C  CD1 . LEU G  1 63  ? 76.295 71.922 130.073 1.00 20.67 ? 63   LEU G CD1 1 
ATOM   8101  C  CD2 . LEU G  1 63  ? 74.174 71.077 129.020 1.00 26.41 ? 63   LEU G CD2 1 
ATOM   8102  N  N   . PHE G  1 64  ? 75.937 74.581 125.466 1.00 27.17 ? 64   PHE G N   1 
ATOM   8103  C  CA  . PHE G  1 64  ? 76.648 75.157 124.330 1.00 29.35 ? 64   PHE G CA  1 
ATOM   8104  C  C   . PHE G  1 64  ? 76.991 76.624 124.573 1.00 30.16 ? 64   PHE G C   1 
ATOM   8105  O  O   . PHE G  1 64  ? 78.069 77.088 124.188 1.00 32.02 ? 64   PHE G O   1 
ATOM   8106  C  CB  . PHE G  1 64  ? 75.832 75.040 123.035 1.00 26.00 ? 64   PHE G CB  1 
ATOM   8107  C  CG  . PHE G  1 64  ? 76.437 75.804 121.883 1.00 29.15 ? 64   PHE G CG  1 
ATOM   8108  C  CD1 . PHE G  1 64  ? 77.745 75.538 121.466 1.00 27.86 ? 64   PHE G CD1 1 
ATOM   8109  C  CD2 . PHE G  1 64  ? 75.730 76.837 121.257 1.00 28.08 ? 64   PHE G CD2 1 
ATOM   8110  C  CE1 . PHE G  1 64  ? 78.343 76.293 120.446 1.00 28.02 ? 64   PHE G CE1 1 
ATOM   8111  C  CE2 . PHE G  1 64  ? 76.321 77.597 120.237 1.00 24.45 ? 64   PHE G CE2 1 
ATOM   8112  C  CZ  . PHE G  1 64  ? 77.626 77.327 119.833 1.00 25.82 ? 64   PHE G CZ  1 
ATOM   8113  N  N   . LEU G  1 65  ? 76.063 77.354 125.189 1.00 29.06 ? 65   LEU G N   1 
ATOM   8114  C  CA  . LEU G  1 65  ? 76.280 78.761 125.495 1.00 29.47 ? 65   LEU G CA  1 
ATOM   8115  C  C   . LEU G  1 65  ? 77.225 78.903 126.687 1.00 30.26 ? 65   LEU G C   1 
ATOM   8116  O  O   . LEU G  1 65  ? 77.515 80.015 127.128 1.00 31.36 ? 65   LEU G O   1 
ATOM   8117  C  CB  . LEU G  1 65  ? 74.949 79.440 125.813 1.00 28.64 ? 65   LEU G CB  1 
ATOM   8118  C  CG  . LEU G  1 65  ? 74.154 80.109 124.691 1.00 30.41 ? 65   LEU G CG  1 
ATOM   8119  C  CD1 . LEU G  1 65  ? 74.779 79.822 123.324 1.00 27.87 ? 65   LEU G CD1 1 
ATOM   8120  C  CD2 . LEU G  1 65  ? 72.714 79.620 124.768 1.00 30.13 ? 65   LEU G CD2 1 
ATOM   8121  N  N   . GLU G  1 66  ? 77.693 77.767 127.203 1.00 29.79 ? 66   GLU G N   1 
ATOM   8122  C  CA  . GLU G  1 66  ? 78.606 77.732 128.339 1.00 28.89 ? 66   GLU G CA  1 
ATOM   8123  C  C   . GLU G  1 66  ? 77.950 78.145 129.655 1.00 28.60 ? 66   GLU G C   1 
ATOM   8124  O  O   . GLU G  1 66  ? 78.567 78.804 130.492 1.00 27.76 ? 66   GLU G O   1 
ATOM   8125  C  CB  . GLU G  1 66  ? 79.829 78.607 128.064 1.00 31.22 ? 66   GLU G CB  1 
ATOM   8126  C  CG  . GLU G  1 66  ? 80.785 78.017 127.041 1.00 40.18 ? 66   GLU G CG  1 
ATOM   8127  C  CD  . GLU G  1 66  ? 81.968 78.929 126.739 1.00 45.34 ? 66   GLU G CD  1 
ATOM   8128  O  OE1 . GLU G  1 66  ? 82.442 79.619 127.672 1.00 50.02 ? 66   GLU G OE1 1 
ATOM   8129  O  OE2 . GLU G  1 66  ? 82.434 78.942 125.574 1.00 46.62 ? 66   GLU G OE2 1 
ATOM   8130  N  N   . GLY G  1 67  ? 76.699 77.740 129.840 1.00 26.54 ? 67   GLY G N   1 
ATOM   8131  C  CA  . GLY G  1 67  ? 75.993 78.054 131.066 1.00 26.28 ? 67   GLY G CA  1 
ATOM   8132  C  C   . GLY G  1 67  ? 75.799 76.811 131.911 1.00 28.03 ? 67   GLY G C   1 
ATOM   8133  O  O   . GLY G  1 67  ? 76.349 75.751 131.607 1.00 31.80 ? 67   GLY G O   1 
ATOM   8134  N  N   . LEU G  1 68  ? 75.021 76.923 132.980 1.00 28.82 ? 68   LEU G N   1 
ATOM   8135  C  CA  . LEU G  1 68  ? 74.786 75.769 133.837 1.00 28.69 ? 68   LEU G CA  1 
ATOM   8136  C  C   . LEU G  1 68  ? 73.311 75.413 133.922 1.00 27.87 ? 68   LEU G C   1 
ATOM   8137  O  O   . LEU G  1 68  ? 72.530 76.113 134.559 1.00 26.73 ? 68   LEU G O   1 
ATOM   8138  C  CB  . LEU G  1 68  ? 75.316 76.034 135.239 1.00 27.26 ? 68   LEU G CB  1 
ATOM   8139  C  CG  . LEU G  1 68  ? 76.797 76.372 135.322 1.00 25.59 ? 68   LEU G CG  1 
ATOM   8140  C  CD1 . LEU G  1 68  ? 77.145 76.650 136.769 1.00 25.86 ? 68   LEU G CD1 1 
ATOM   8141  C  CD2 . LEU G  1 68  ? 77.626 75.232 134.778 1.00 22.81 ? 68   LEU G CD2 1 
ATOM   8142  N  N   . PRO G  1 69  ? 72.907 74.319 133.263 1.00 27.76 ? 69   PRO G N   1 
ATOM   8143  C  CA  . PRO G  1 69  ? 71.495 73.931 133.316 1.00 26.52 ? 69   PRO G CA  1 
ATOM   8144  C  C   . PRO G  1 69  ? 71.121 73.750 134.779 1.00 27.47 ? 69   PRO G C   1 
ATOM   8145  O  O   . PRO G  1 69  ? 71.961 73.365 135.586 1.00 28.17 ? 69   PRO G O   1 
ATOM   8146  C  CB  . PRO G  1 69  ? 71.465 72.605 132.558 1.00 26.89 ? 69   PRO G CB  1 
ATOM   8147  C  CG  . PRO G  1 69  ? 72.649 72.699 131.627 1.00 27.27 ? 69   PRO G CG  1 
ATOM   8148  C  CD  . PRO G  1 69  ? 73.704 73.366 132.466 1.00 25.94 ? 69   PRO G CD  1 
ATOM   8149  N  N   . ASN G  1 70  ? 69.870 74.028 135.120 1.00 29.72 ? 70   ASN G N   1 
ATOM   8150  C  CA  . ASN G  1 70  ? 69.412 73.888 136.498 1.00 31.53 ? 70   ASN G CA  1 
ATOM   8151  C  C   . ASN G  1 70  ? 68.252 72.901 136.569 1.00 31.77 ? 70   ASN G C   1 
ATOM   8152  O  O   . ASN G  1 70  ? 67.112 73.261 136.291 1.00 32.52 ? 70   ASN G O   1 
ATOM   8153  C  CB  . ASN G  1 70  ? 68.950 75.243 137.022 1.00 33.22 ? 70   ASN G CB  1 
ATOM   8154  C  CG  . ASN G  1 70  ? 68.515 75.191 138.469 1.00 35.71 ? 70   ASN G CG  1 
ATOM   8155  O  OD1 . ASN G  1 70  ? 67.973 74.181 138.939 1.00 36.47 ? 70   ASN G OD1 1 
ATOM   8156  N  ND2 . ASN G  1 70  ? 68.730 76.290 139.184 1.00 37.77 ? 70   ASN G ND2 1 
ATOM   8157  N  N   . LEU G  1 71  ? 68.532 71.658 136.936 1.00 33.66 ? 71   LEU G N   1 
ATOM   8158  C  CA  . LEU G  1 71  ? 67.473 70.653 137.028 1.00 34.78 ? 71   LEU G CA  1 
ATOM   8159  C  C   . LEU G  1 71  ? 67.111 70.455 138.492 1.00 35.69 ? 71   LEU G C   1 
ATOM   8160  O  O   . LEU G  1 71  ? 66.292 69.599 138.830 1.00 35.27 ? 71   LEU G O   1 
ATOM   8161  C  CB  . LEU G  1 71  ? 67.939 69.310 136.442 1.00 35.36 ? 71   LEU G CB  1 
ATOM   8162  C  CG  . LEU G  1 71  ? 68.549 69.232 135.035 1.00 36.22 ? 71   LEU G CG  1 
ATOM   8163  C  CD1 . LEU G  1 71  ? 68.397 67.810 134.528 1.00 38.06 ? 71   LEU G CD1 1 
ATOM   8164  C  CD2 . LEU G  1 71  ? 67.848 70.177 134.079 1.00 40.62 ? 71   LEU G CD2 1 
ATOM   8165  N  N   . GLN G  1 72  ? 67.728 71.266 139.347 1.00 36.88 ? 72   GLN G N   1 
ATOM   8166  C  CA  . GLN G  1 72  ? 67.536 71.190 140.789 1.00 38.52 ? 72   GLN G CA  1 
ATOM   8167  C  C   . GLN G  1 72  ? 66.233 71.784 141.330 1.00 41.06 ? 72   GLN G C   1 
ATOM   8168  O  O   . GLN G  1 72  ? 65.714 71.328 142.355 1.00 40.48 ? 72   GLN G O   1 
ATOM   8169  C  CB  . GLN G  1 72  ? 68.724 71.852 141.496 1.00 34.97 ? 72   GLN G CB  1 
ATOM   8170  C  CG  . GLN G  1 72  ? 68.663 71.752 143.011 1.00 34.92 ? 72   GLN G CG  1 
ATOM   8171  C  CD  . GLN G  1 72  ? 68.765 70.322 143.509 1.00 34.44 ? 72   GLN G CD  1 
ATOM   8172  O  OE1 . GLN G  1 72  ? 69.853 69.742 143.548 1.00 36.92 ? 72   GLN G OE1 1 
ATOM   8173  N  NE2 . GLN G  1 72  ? 67.627 69.740 143.884 1.00 32.49 ? 72   GLN G NE2 1 
ATOM   8174  N  N   . GLU G  1 73  ? 65.701 72.797 140.657 1.00 43.67 ? 73   GLU G N   1 
ATOM   8175  C  CA  . GLU G  1 73  ? 64.474 73.419 141.134 1.00 46.67 ? 73   GLU G CA  1 
ATOM   8176  C  C   . GLU G  1 73  ? 63.220 72.943 140.410 1.00 47.01 ? 73   GLU G C   1 
ATOM   8177  O  O   . GLU G  1 73  ? 63.075 73.089 139.192 1.00 47.82 ? 73   GLU G O   1 
ATOM   8178  C  CB  . GLU G  1 73  ? 64.614 74.939 141.070 1.00 50.09 ? 73   GLU G CB  1 
ATOM   8179  C  CG  . GLU G  1 73  ? 65.805 75.414 141.893 1.00 56.64 ? 73   GLU G CG  1 
ATOM   8180  C  CD  . GLU G  1 73  ? 65.890 76.912 142.009 1.00 61.64 ? 73   GLU G CD  1 
ATOM   8181  O  OE1 . GLU G  1 73  ? 64.885 77.528 142.428 1.00 65.63 ? 73   GLU G OE1 1 
ATOM   8182  O  OE2 . GLU G  1 73  ? 66.963 77.471 141.688 1.00 62.08 ? 73   GLU G OE2 1 
ATOM   8183  N  N   . LEU G  1 74  ? 62.318 72.356 141.188 1.00 45.11 ? 74   LEU G N   1 
ATOM   8184  C  CA  . LEU G  1 74  ? 61.079 71.823 140.662 1.00 42.21 ? 74   LEU G CA  1 
ATOM   8185  C  C   . LEU G  1 74  ? 59.914 72.637 141.221 1.00 42.24 ? 74   LEU G C   1 
ATOM   8186  O  O   . LEU G  1 74  ? 59.667 72.638 142.430 1.00 42.51 ? 74   LEU G O   1 
ATOM   8187  C  CB  . LEU G  1 74  ? 60.966 70.348 141.061 1.00 41.72 ? 74   LEU G CB  1 
ATOM   8188  C  CG  . LEU G  1 74  ? 60.081 69.399 140.246 1.00 41.11 ? 74   LEU G CG  1 
ATOM   8189  C  CD1 . LEU G  1 74  ? 58.826 69.061 141.020 1.00 40.87 ? 74   LEU G CD1 1 
ATOM   8190  C  CD2 . LEU G  1 74  ? 59.759 70.026 138.896 1.00 41.37 ? 74   LEU G CD2 1 
ATOM   8191  N  N   . GLY G  1 75  ? 59.212 73.339 140.334 1.00 40.04 ? 75   GLY G N   1 
ATOM   8192  C  CA  . GLY G  1 75  ? 58.087 74.156 140.748 1.00 34.06 ? 75   GLY G CA  1 
ATOM   8193  C  C   . GLY G  1 75  ? 56.888 73.328 141.150 1.00 33.51 ? 75   GLY G C   1 
ATOM   8194  O  O   . GLY G  1 75  ? 56.926 72.100 141.132 1.00 33.95 ? 75   GLY G O   1 
ATOM   8195  N  N   . LYS G  1 76  ? 55.808 74.006 141.504 1.00 32.33 ? 76   LYS G N   1 
ATOM   8196  C  CA  . LYS G  1 76  ? 54.590 73.336 141.928 1.00 35.48 ? 76   LYS G CA  1 
ATOM   8197  C  C   . LYS G  1 76  ? 53.847 72.583 140.802 1.00 36.12 ? 76   LYS G C   1 
ATOM   8198  O  O   . LYS G  1 76  ? 53.397 73.186 139.817 1.00 36.85 ? 76   LYS G O   1 
ATOM   8199  C  CB  . LYS G  1 76  ? 53.661 74.373 142.578 1.00 36.56 ? 76   LYS G CB  1 
ATOM   8200  C  CG  . LYS G  1 76  ? 52.377 73.806 143.166 1.00 40.61 ? 76   LYS G CG  1 
ATOM   8201  C  CD  . LYS G  1 76  ? 52.667 72.791 144.269 1.00 45.66 ? 76   LYS G CD  1 
ATOM   8202  C  CE  . LYS G  1 76  ? 51.377 72.246 144.837 1.00 45.29 ? 76   LYS G CE  1 
ATOM   8203  N  NZ  . LYS G  1 76  ? 50.471 73.393 145.130 1.00 50.56 ? 76   LYS G NZ  1 
ATOM   8204  N  N   . LEU G  1 77  ? 53.727 71.266 140.943 1.00 33.43 ? 77   LEU G N   1 
ATOM   8205  C  CA  . LEU G  1 77  ? 53.000 70.476 139.954 1.00 31.38 ? 77   LEU G CA  1 
ATOM   8206  C  C   . LEU G  1 77  ? 51.513 70.706 140.234 1.00 32.25 ? 77   LEU G C   1 
ATOM   8207  O  O   . LEU G  1 77  ? 51.118 70.878 141.386 1.00 32.77 ? 77   LEU G O   1 
ATOM   8208  C  CB  . LEU G  1 77  ? 53.292 68.969 140.099 1.00 30.08 ? 77   LEU G CB  1 
ATOM   8209  C  CG  . LEU G  1 77  ? 54.674 68.336 139.890 1.00 28.68 ? 77   LEU G CG  1 
ATOM   8210  C  CD1 . LEU G  1 77  ? 55.487 69.166 138.899 1.00 28.08 ? 77   LEU G CD1 1 
ATOM   8211  C  CD2 . LEU G  1 77  ? 55.400 68.244 141.205 1.00 28.79 ? 77   LEU G CD2 1 
ATOM   8212  N  N   . LEU G  1 78  ? 50.690 70.710 139.191 1.00 31.27 ? 78   LEU G N   1 
ATOM   8213  C  CA  . LEU G  1 78  ? 49.256 70.898 139.365 1.00 29.57 ? 78   LEU G CA  1 
ATOM   8214  C  C   . LEU G  1 78  ? 48.581 69.559 139.113 1.00 30.73 ? 78   LEU G C   1 
ATOM   8215  O  O   . LEU G  1 78  ? 48.090 69.303 138.014 1.00 33.49 ? 78   LEU G O   1 
ATOM   8216  C  CB  . LEU G  1 78  ? 48.714 71.925 138.370 1.00 27.37 ? 78   LEU G CB  1 
ATOM   8217  C  CG  . LEU G  1 78  ? 49.415 73.282 138.264 1.00 28.53 ? 78   LEU G CG  1 
ATOM   8218  C  CD1 . LEU G  1 78  ? 48.735 74.113 137.180 1.00 27.27 ? 78   LEU G CD1 1 
ATOM   8219  C  CD2 . LEU G  1 78  ? 49.372 74.004 139.601 1.00 27.66 ? 78   LEU G CD2 1 
ATOM   8220  N  N   . ILE G  1 79  ? 48.555 68.701 140.124 1.00 31.62 ? 79   ILE G N   1 
ATOM   8221  C  CA  . ILE G  1 79  ? 47.934 67.385 139.976 1.00 33.85 ? 79   ILE G CA  1 
ATOM   8222  C  C   . ILE G  1 79  ? 46.413 67.417 140.109 1.00 33.46 ? 79   ILE G C   1 
ATOM   8223  O  O   . ILE G  1 79  ? 45.869 68.139 140.941 1.00 36.49 ? 79   ILE G O   1 
ATOM   8224  C  CB  . ILE G  1 79  ? 48.500 66.389 141.013 1.00 33.10 ? 79   ILE G CB  1 
ATOM   8225  C  CG1 . ILE G  1 79  ? 50.027 66.408 140.950 1.00 30.24 ? 79   ILE G CG1 1 
ATOM   8226  C  CG2 . ILE G  1 79  ? 47.977 64.976 140.730 1.00 31.74 ? 79   ILE G CG2 1 
ATOM   8227  C  CD1 . ILE G  1 79  ? 50.578 66.140 139.561 1.00 27.28 ? 79   ILE G CD1 1 
ATOM   8228  N  N   . GLY G  1 80  ? 45.732 66.633 139.280 1.00 32.79 ? 80   GLY G N   1 
ATOM   8229  C  CA  . GLY G  1 80  ? 44.283 66.576 139.338 1.00 31.63 ? 80   GLY G CA  1 
ATOM   8230  C  C   . GLY G  1 80  ? 43.824 65.262 139.944 1.00 32.20 ? 80   GLY G C   1 
ATOM   8231  O  O   . GLY G  1 80  ? 44.632 64.356 140.159 1.00 31.53 ? 80   GLY G O   1 
ATOM   8232  N  N   . GLU G  1 81  ? 42.530 65.144 140.218 1.00 32.36 ? 81   GLU G N   1 
ATOM   8233  C  CA  . GLU G  1 81  ? 42.004 63.917 140.811 1.00 32.90 ? 81   GLU G CA  1 
ATOM   8234  C  C   . GLU G  1 81  ? 41.047 63.210 139.859 1.00 30.78 ? 81   GLU G C   1 
ATOM   8235  O  O   . GLU G  1 81  ? 40.705 62.046 140.056 1.00 27.84 ? 81   GLU G O   1 
ATOM   8236  C  CB  . GLU G  1 81  ? 41.297 64.231 142.134 1.00 31.27 ? 81   GLU G CB  1 
ATOM   8237  C  CG  . GLU G  1 81  ? 42.197 64.908 143.151 1.00 35.39 ? 81   GLU G CG  1 
ATOM   8238  C  CD  . GLU G  1 81  ? 41.473 65.275 144.438 1.00 38.67 ? 81   GLU G CD  1 
ATOM   8239  O  OE1 . GLU G  1 81  ? 40.378 65.870 144.353 1.00 38.29 ? 81   GLU G OE1 1 
ATOM   8240  O  OE2 . GLU G  1 81  ? 42.003 64.981 145.533 1.00 38.19 ? 81   GLU G OE2 1 
ATOM   8241  N  N   . HIS G  1 82  ? 40.618 63.925 138.826 1.00 32.43 ? 82   HIS G N   1 
ATOM   8242  C  CA  . HIS G  1 82  ? 39.706 63.369 137.835 1.00 33.17 ? 82   HIS G CA  1 
ATOM   8243  C  C   . HIS G  1 82  ? 39.954 64.029 136.480 1.00 32.78 ? 82   HIS G C   1 
ATOM   8244  O  O   . HIS G  1 82  ? 40.415 65.173 136.414 1.00 32.70 ? 82   HIS G O   1 
ATOM   8245  C  CB  . HIS G  1 82  ? 38.242 63.539 138.289 1.00 34.44 ? 82   HIS G CB  1 
ATOM   8246  C  CG  . HIS G  1 82  ? 37.843 64.954 138.575 1.00 37.46 ? 82   HIS G CG  1 
ATOM   8247  N  ND1 . HIS G  1 82  ? 37.162 65.735 137.665 1.00 39.26 ? 82   HIS G ND1 1 
ATOM   8248  C  CD2 . HIS G  1 82  ? 38.016 65.725 139.677 1.00 38.58 ? 82   HIS G CD2 1 
ATOM   8249  C  CE1 . HIS G  1 82  ? 36.931 66.924 138.195 1.00 41.26 ? 82   HIS G CE1 1 
ATOM   8250  N  NE2 . HIS G  1 82  ? 37.440 66.944 139.415 1.00 39.59 ? 82   HIS G NE2 1 
ATOM   8251  N  N   . THR G  1 83  ? 39.659 63.287 135.413 1.00 30.98 ? 83   THR G N   1 
ATOM   8252  C  CA  . THR G  1 83  ? 39.860 63.730 134.035 1.00 29.63 ? 83   THR G CA  1 
ATOM   8253  C  C   . THR G  1 83  ? 39.656 65.212 133.727 1.00 27.24 ? 83   THR G C   1 
ATOM   8254  O  O   . THR G  1 83  ? 40.596 65.898 133.326 1.00 25.17 ? 83   THR G O   1 
ATOM   8255  C  CB  . THR G  1 83  ? 38.979 62.920 133.059 1.00 33.08 ? 83   THR G CB  1 
ATOM   8256  O  OG1 . THR G  1 83  ? 39.283 61.522 133.180 1.00 31.63 ? 83   THR G OG1 1 
ATOM   8257  C  CG2 . THR G  1 83  ? 39.234 63.369 131.621 1.00 32.62 ? 83   THR G CG2 1 
ATOM   8258  N  N   . LYS G  1 84  ? 38.438 65.710 133.896 1.00 27.59 ? 84   LYS G N   1 
ATOM   8259  C  CA  . LYS G  1 84  ? 38.177 67.113 133.590 1.00 29.53 ? 84   LYS G CA  1 
ATOM   8260  C  C   . LYS G  1 84  ? 39.141 68.056 134.302 1.00 29.81 ? 84   LYS G C   1 
ATOM   8261  O  O   . LYS G  1 84  ? 39.562 69.067 133.733 1.00 30.34 ? 84   LYS G O   1 
ATOM   8262  C  CB  . LYS G  1 84  ? 36.726 67.485 133.924 1.00 27.93 ? 84   LYS G CB  1 
ATOM   8263  C  CG  . LYS G  1 84  ? 36.365 68.944 133.608 1.00 26.67 ? 84   LYS G CG  1 
ATOM   8264  C  CD  . LYS G  1 84  ? 34.851 69.149 133.578 1.00 29.40 ? 84   LYS G CD  1 
ATOM   8265  C  CE  . LYS G  1 84  ? 34.476 70.618 133.517 1.00 29.72 ? 84   LYS G CE  1 
ATOM   8266  N  NZ  . LYS G  1 84  ? 35.176 71.302 132.398 1.00 36.76 ? 84   LYS G NZ  1 
ATOM   8267  N  N   . GLU G  1 85  ? 39.499 67.715 135.536 1.00 30.36 ? 85   GLU G N   1 
ATOM   8268  C  CA  . GLU G  1 85  ? 40.418 68.529 136.332 1.00 29.43 ? 85   GLU G CA  1 
ATOM   8269  C  C   . GLU G  1 85  ? 41.851 68.454 135.788 1.00 27.24 ? 85   GLU G C   1 
ATOM   8270  O  O   . GLU G  1 85  ? 42.515 69.471 135.595 1.00 27.56 ? 85   GLU G O   1 
ATOM   8271  C  CB  . GLU G  1 85  ? 40.387 68.048 137.776 1.00 29.73 ? 85   GLU G CB  1 
ATOM   8272  C  CG  . GLU G  1 85  ? 40.933 69.035 138.770 1.00 32.86 ? 85   GLU G CG  1 
ATOM   8273  C  CD  . GLU G  1 85  ? 40.682 68.587 140.194 1.00 37.49 ? 85   GLU G CD  1 
ATOM   8274  O  OE1 . GLU G  1 85  ? 41.180 67.503 140.576 1.00 38.90 ? 85   GLU G OE1 1 
ATOM   8275  O  OE2 . GLU G  1 85  ? 39.983 69.314 140.928 1.00 38.12 ? 85   GLU G OE2 1 
ATOM   8276  N  N   . MET G  1 86  ? 42.315 67.236 135.539 1.00 25.62 ? 86   MET G N   1 
ATOM   8277  C  CA  . MET G  1 86  ? 43.652 67.010 135.013 1.00 23.56 ? 86   MET G CA  1 
ATOM   8278  C  C   . MET G  1 86  ? 43.859 67.771 133.708 1.00 24.40 ? 86   MET G C   1 
ATOM   8279  O  O   . MET G  1 86  ? 44.902 68.397 133.507 1.00 22.77 ? 86   MET G O   1 
ATOM   8280  C  CB  . MET G  1 86  ? 43.864 65.508 134.828 1.00 20.49 ? 86   MET G CB  1 
ATOM   8281  C  CG  . MET G  1 86  ? 43.980 64.798 136.161 1.00 16.99 ? 86   MET G CG  1 
ATOM   8282  S  SD  . MET G  1 86  ? 43.499 63.081 136.130 1.00 25.29 ? 86   MET G SD  1 
ATOM   8283  C  CE  . MET G  1 86  ? 44.937 62.353 135.262 1.00 20.66 ? 86   MET G CE  1 
ATOM   8284  N  N   . LEU G  1 87  ? 42.863 67.728 132.825 1.00 25.87 ? 87   LEU G N   1 
ATOM   8285  C  CA  . LEU G  1 87  ? 42.944 68.457 131.563 1.00 24.71 ? 87   LEU G CA  1 
ATOM   8286  C  C   . LEU G  1 87  ? 43.134 69.949 131.870 1.00 26.45 ? 87   LEU G C   1 
ATOM   8287  O  O   . LEU G  1 87  ? 44.011 70.605 131.294 1.00 27.49 ? 87   LEU G O   1 
ATOM   8288  C  CB  . LEU G  1 87  ? 41.663 68.253 130.731 1.00 23.46 ? 87   LEU G CB  1 
ATOM   8289  C  CG  . LEU G  1 87  ? 41.497 67.157 129.651 1.00 23.12 ? 87   LEU G CG  1 
ATOM   8290  C  CD1 . LEU G  1 87  ? 42.733 66.279 129.508 1.00 18.03 ? 87   LEU G CD1 1 
ATOM   8291  C  CD2 . LEU G  1 87  ? 40.282 66.312 129.999 1.00 21.35 ? 87   LEU G CD2 1 
ATOM   8292  N  N   . GLU G  1 88  ? 42.327 70.478 132.791 1.00 28.29 ? 88   GLU G N   1 
ATOM   8293  C  CA  . GLU G  1 88  ? 42.409 71.894 133.149 1.00 31.36 ? 88   GLU G CA  1 
ATOM   8294  C  C   . GLU G  1 88  ? 43.717 72.265 133.833 1.00 32.96 ? 88   GLU G C   1 
ATOM   8295  O  O   . GLU G  1 88  ? 44.133 73.424 133.778 1.00 34.09 ? 88   GLU G O   1 
ATOM   8296  C  CB  . GLU G  1 88  ? 41.242 72.298 134.052 1.00 33.56 ? 88   GLU G CB  1 
ATOM   8297  C  CG  . GLU G  1 88  ? 39.869 72.035 133.458 1.00 40.12 ? 88   GLU G CG  1 
ATOM   8298  C  CD  . GLU G  1 88  ? 38.734 72.332 134.435 1.00 45.71 ? 88   GLU G CD  1 
ATOM   8299  O  OE1 . GLU G  1 88  ? 38.888 72.049 135.647 1.00 49.09 ? 88   GLU G OE1 1 
ATOM   8300  O  OE2 . GLU G  1 88  ? 37.681 72.834 133.988 1.00 47.51 ? 88   GLU G OE2 1 
ATOM   8301  N  N   . CYS G  1 89  ? 44.363 71.300 134.486 1.00 33.21 ? 89   CYS G N   1 
ATOM   8302  C  CA  . CYS G  1 89  ? 45.636 71.577 135.149 1.00 34.95 ? 89   CYS G CA  1 
ATOM   8303  C  C   . CYS G  1 89  ? 46.725 71.686 134.099 1.00 36.57 ? 89   CYS G C   1 
ATOM   8304  O  O   . CYS G  1 89  ? 47.590 72.566 134.162 1.00 36.75 ? 89   CYS G O   1 
ATOM   8305  C  CB  . CYS G  1 89  ? 45.998 70.462 136.120 1.00 34.74 ? 89   CYS G CB  1 
ATOM   8306  S  SG  . CYS G  1 89  ? 44.977 70.433 137.579 1.00 39.29 ? 89   CYS G SG  1 
ATOM   8307  N  N   . ASP G  1 90  ? 46.687 70.770 133.136 1.00 37.21 ? 90   ASP G N   1 
ATOM   8308  C  CA  . ASP G  1 90  ? 47.661 70.770 132.058 1.00 37.75 ? 90   ASP G CA  1 
ATOM   8309  C  C   . ASP G  1 90  ? 47.490 72.064 131.276 1.00 36.03 ? 90   ASP G C   1 
ATOM   8310  O  O   . ASP G  1 90  ? 48.465 72.690 130.878 1.00 35.60 ? 90   ASP G O   1 
ATOM   8311  C  CB  . ASP G  1 90  ? 47.448 69.543 131.161 1.00 38.25 ? 90   ASP G CB  1 
ATOM   8312  C  CG  . ASP G  1 90  ? 47.886 68.236 131.837 1.00 41.18 ? 90   ASP G CG  1 
ATOM   8313  O  OD1 . ASP G  1 90  ? 48.175 68.246 133.059 1.00 40.39 ? 90   ASP G OD1 1 
ATOM   8314  O  OD2 . ASP G  1 90  ? 47.942 67.194 131.145 1.00 42.22 ? 90   ASP G OD2 1 
ATOM   8315  N  N   . LEU G  1 91  ? 46.240 72.475 131.083 1.00 37.05 ? 91   LEU G N   1 
ATOM   8316  C  CA  . LEU G  1 91  ? 45.946 73.708 130.357 1.00 36.61 ? 91   LEU G CA  1 
ATOM   8317  C  C   . LEU G  1 91  ? 46.513 74.919 131.101 1.00 37.39 ? 91   LEU G C   1 
ATOM   8318  O  O   . LEU G  1 91  ? 47.218 75.730 130.503 1.00 39.40 ? 91   LEU G O   1 
ATOM   8319  C  CB  . LEU G  1 91  ? 44.436 73.856 130.161 1.00 34.85 ? 91   LEU G CB  1 
ATOM   8320  C  CG  . LEU G  1 91  ? 43.965 75.029 129.303 1.00 34.65 ? 91   LEU G CG  1 
ATOM   8321  C  CD1 . LEU G  1 91  ? 44.744 75.065 127.989 1.00 35.42 ? 91   LEU G CD1 1 
ATOM   8322  C  CD2 . LEU G  1 91  ? 42.468 74.895 129.042 1.00 30.47 ? 91   LEU G CD2 1 
ATOM   8323  N  N   . LYS G  1 92  ? 46.212 75.046 132.396 1.00 36.93 ? 92   LYS G N   1 
ATOM   8324  C  CA  . LYS G  1 92  ? 46.745 76.162 133.184 1.00 38.20 ? 92   LYS G CA  1 
ATOM   8325  C  C   . LYS G  1 92  ? 48.260 76.192 132.988 1.00 35.98 ? 92   LYS G C   1 
ATOM   8326  O  O   . LYS G  1 92  ? 48.845 77.247 132.732 1.00 36.23 ? 92   LYS G O   1 
ATOM   8327  C  CB  . LYS G  1 92  ? 46.467 75.990 134.686 1.00 42.95 ? 92   LYS G CB  1 
ATOM   8328  C  CG  . LYS G  1 92  ? 45.002 75.839 135.104 1.00 51.62 ? 92   LYS G CG  1 
ATOM   8329  C  CD  . LYS G  1 92  ? 44.906 75.536 136.618 1.00 55.52 ? 92   LYS G CD  1 
ATOM   8330  C  CE  . LYS G  1 92  ? 43.520 75.051 137.061 1.00 53.61 ? 92   LYS G CE  1 
ATOM   8331  N  NZ  . LYS G  1 92  ? 42.467 76.095 136.917 1.00 53.29 ? 92   LYS G NZ  1 
ATOM   8332  N  N   . LEU G  1 93  ? 48.883 75.021 133.111 1.00 34.23 ? 93   LEU G N   1 
ATOM   8333  C  CA  . LEU G  1 93  ? 50.327 74.887 132.955 1.00 31.42 ? 93   LEU G CA  1 
ATOM   8334  C  C   . LEU G  1 93  ? 50.804 75.454 131.630 1.00 30.96 ? 93   LEU G C   1 
ATOM   8335  O  O   . LEU G  1 93  ? 51.549 76.436 131.604 1.00 29.94 ? 93   LEU G O   1 
ATOM   8336  C  CB  . LEU G  1 93  ? 50.752 73.417 133.033 1.00 29.23 ? 93   LEU G CB  1 
ATOM   8337  C  CG  . LEU G  1 93  ? 51.815 73.068 134.081 1.00 29.00 ? 93   LEU G CG  1 
ATOM   8338  C  CD1 . LEU G  1 93  ? 52.579 71.808 133.665 1.00 20.70 ? 93   LEU G CD1 1 
ATOM   8339  C  CD2 . LEU G  1 93  ? 52.772 74.238 134.236 1.00 26.63 ? 93   LEU G CD2 1 
ATOM   8340  N  N   . GLU G  1 94  ? 50.370 74.838 130.534 1.00 29.91 ? 94   GLU G N   1 
ATOM   8341  C  CA  . GLU G  1 94  ? 50.782 75.277 129.209 1.00 37.08 ? 94   GLU G CA  1 
ATOM   8342  C  C   . GLU G  1 94  ? 50.580 76.783 129.024 1.00 39.38 ? 94   GLU G C   1 
ATOM   8343  O  O   . GLU G  1 94  ? 51.432 77.471 128.456 1.00 40.65 ? 94   GLU G O   1 
ATOM   8344  C  CB  . GLU G  1 94  ? 50.013 74.511 128.123 1.00 39.43 ? 94   GLU G CB  1 
ATOM   8345  C  CG  . GLU G  1 94  ? 50.164 72.985 128.140 1.00 41.59 ? 94   GLU G CG  1 
ATOM   8346  C  CD  . GLU G  1 94  ? 51.564 72.492 127.776 1.00 46.59 ? 94   GLU G CD  1 
ATOM   8347  O  OE1 . GLU G  1 94  ? 51.662 71.476 127.065 1.00 45.82 ? 94   GLU G OE1 1 
ATOM   8348  O  OE2 . GLU G  1 94  ? 52.562 73.127 128.213 1.00 48.47 ? 94   GLU G OE2 1 
ATOM   8349  N  N   . GLN G  1 95  ? 49.459 77.304 129.507 1.00 40.33 ? 95   GLN G N   1 
ATOM   8350  C  CA  . GLN G  1 95  ? 49.208 78.731 129.376 1.00 42.18 ? 95   GLN G CA  1 
ATOM   8351  C  C   . GLN G  1 95  ? 50.226 79.562 130.157 1.00 43.80 ? 95   GLN G C   1 
ATOM   8352  O  O   . GLN G  1 95  ? 50.871 80.444 129.587 1.00 46.43 ? 95   GLN G O   1 
ATOM   8353  C  CB  . GLN G  1 95  ? 47.788 79.070 129.833 1.00 40.69 ? 95   GLN G CB  1 
ATOM   8354  C  CG  . GLN G  1 95  ? 46.725 78.438 128.957 1.00 45.03 ? 95   GLN G CG  1 
ATOM   8355  C  CD  . GLN G  1 95  ? 45.321 78.875 129.320 1.00 47.15 ? 95   GLN G CD  1 
ATOM   8356  O  OE1 . GLN G  1 95  ? 44.880 78.725 130.462 1.00 47.29 ? 95   GLN G OE1 1 
ATOM   8357  N  NE2 . GLN G  1 95  ? 44.605 79.413 128.342 1.00 48.08 ? 95   GLN G NE2 1 
ATOM   8358  N  N   . ALA G  1 96  ? 50.382 79.275 131.449 1.00 43.56 ? 96   ALA G N   1 
ATOM   8359  C  CA  . ALA G  1 96  ? 51.323 80.018 132.291 1.00 42.99 ? 96   ALA G CA  1 
ATOM   8360  C  C   . ALA G  1 96  ? 52.733 80.083 131.706 1.00 43.90 ? 96   ALA G C   1 
ATOM   8361  O  O   . ALA G  1 96  ? 53.504 80.981 132.043 1.00 43.12 ? 96   ALA G O   1 
ATOM   8362  C  CB  . ALA G  1 96  ? 51.378 79.403 133.673 1.00 41.51 ? 96   ALA G CB  1 
ATOM   8363  N  N   . GLY G  1 97  ? 53.063 79.134 130.832 1.00 44.53 ? 97   GLY G N   1 
ATOM   8364  C  CA  . GLY G  1 97  ? 54.386 79.100 130.231 1.00 44.72 ? 97   GLY G CA  1 
ATOM   8365  C  C   . GLY G  1 97  ? 54.560 79.986 129.009 1.00 46.26 ? 97   GLY G C   1 
ATOM   8366  O  O   . GLY G  1 97  ? 55.689 80.355 128.660 1.00 46.78 ? 97   GLY G O   1 
ATOM   8367  N  N   . LEU G  1 98  ? 53.453 80.331 128.354 1.00 45.08 ? 98   LEU G N   1 
ATOM   8368  C  CA  . LEU G  1 98  ? 53.516 81.180 127.169 1.00 42.90 ? 98   LEU G CA  1 
ATOM   8369  C  C   . LEU G  1 98  ? 54.184 82.533 127.403 1.00 41.09 ? 98   LEU G C   1 
ATOM   8370  O  O   . LEU G  1 98  ? 55.027 82.952 126.615 1.00 41.49 ? 98   LEU G O   1 
ATOM   8371  C  CB  . LEU G  1 98  ? 52.121 81.390 126.585 1.00 41.88 ? 98   LEU G CB  1 
ATOM   8372  C  CG  . LEU G  1 98  ? 51.610 80.238 125.717 1.00 43.08 ? 98   LEU G CG  1 
ATOM   8373  C  CD1 . LEU G  1 98  ? 50.341 80.670 124.980 1.00 42.14 ? 98   LEU G CD1 1 
ATOM   8374  C  CD2 . LEU G  1 98  ? 52.683 79.846 124.710 1.00 39.39 ? 98   LEU G CD2 1 
ATOM   8375  N  N   . PRO G  1 99  ? 53.818 83.237 128.483 1.00 39.96 ? 99   PRO G N   1 
ATOM   8376  C  CA  . PRO G  1 99  ? 54.448 84.537 128.730 1.00 41.11 ? 99   PRO G CA  1 
ATOM   8377  C  C   . PRO G  1 99  ? 55.973 84.435 128.860 1.00 41.52 ? 99   PRO G C   1 
ATOM   8378  O  O   . PRO G  1 99  ? 56.709 85.332 128.424 1.00 40.95 ? 99   PRO G O   1 
ATOM   8379  C  CB  . PRO G  1 99  ? 53.784 84.998 130.026 1.00 40.03 ? 99   PRO G CB  1 
ATOM   8380  C  CG  . PRO G  1 99  ? 52.428 84.395 129.929 1.00 39.13 ? 99   PRO G CG  1 
ATOM   8381  C  CD  . PRO G  1 99  ? 52.742 82.993 129.456 1.00 39.94 ? 99   PRO G CD  1 
ATOM   8382  N  N   . ASP G  1 100 ? 56.449 83.346 129.459 1.00 40.33 ? 100  ASP G N   1 
ATOM   8383  C  CA  . ASP G  1 100 ? 57.888 83.162 129.621 1.00 40.07 ? 100  ASP G CA  1 
ATOM   8384  C  C   . ASP G  1 100 ? 58.575 82.923 128.280 1.00 37.58 ? 100  ASP G C   1 
ATOM   8385  O  O   . ASP G  1 100 ? 59.646 83.473 128.029 1.00 39.41 ? 100  ASP G O   1 
ATOM   8386  C  CB  . ASP G  1 100 ? 58.185 81.999 130.574 1.00 41.88 ? 100  ASP G CB  1 
ATOM   8387  C  CG  . ASP G  1 100 ? 57.664 82.252 131.975 1.00 43.38 ? 100  ASP G CG  1 
ATOM   8388  O  OD1 . ASP G  1 100 ? 57.788 83.401 132.451 1.00 44.31 ? 100  ASP G OD1 1 
ATOM   8389  O  OD2 . ASP G  1 100 ? 57.139 81.307 132.605 1.00 44.75 ? 100  ASP G OD2 1 
ATOM   8390  N  N   . LEU G  1 101 ? 57.956 82.111 127.424 1.00 33.34 ? 101  LEU G N   1 
ATOM   8391  C  CA  . LEU G  1 101 ? 58.509 81.808 126.105 1.00 30.42 ? 101  LEU G CA  1 
ATOM   8392  C  C   . LEU G  1 101 ? 58.561 83.026 125.192 1.00 29.35 ? 101  LEU G C   1 
ATOM   8393  O  O   . LEU G  1 101 ? 59.565 83.272 124.520 1.00 28.53 ? 101  LEU G O   1 
ATOM   8394  C  CB  . LEU G  1 101 ? 57.688 80.714 125.419 1.00 30.79 ? 101  LEU G CB  1 
ATOM   8395  C  CG  . LEU G  1 101 ? 58.085 79.258 125.663 1.00 29.93 ? 101  LEU G CG  1 
ATOM   8396  C  CD1 . LEU G  1 101 ? 56.970 78.332 125.183 1.00 27.46 ? 101  LEU G CD1 1 
ATOM   8397  C  CD2 . LEU G  1 101 ? 59.397 78.961 124.943 1.00 25.24 ? 101  LEU G CD2 1 
ATOM   8398  N  N   . LYS G  1 102 ? 57.470 83.782 125.152 1.00 29.42 ? 102  LYS G N   1 
ATOM   8399  C  CA  . LYS G  1 102 ? 57.415 84.965 124.305 1.00 29.80 ? 102  LYS G CA  1 
ATOM   8400  C  C   . LYS G  1 102 ? 58.345 86.042 124.841 1.00 30.82 ? 102  LYS G C   1 
ATOM   8401  O  O   . LYS G  1 102 ? 58.892 86.840 124.076 1.00 30.42 ? 102  LYS G O   1 
ATOM   8402  C  CB  . LYS G  1 102 ? 55.974 85.458 124.201 1.00 27.95 ? 102  LYS G CB  1 
ATOM   8403  C  CG  . LYS G  1 102 ? 55.068 84.345 123.692 1.00 28.52 ? 102  LYS G CG  1 
ATOM   8404  C  CD  . LYS G  1 102 ? 53.813 84.831 123.006 1.00 31.33 ? 102  LYS G CD  1 
ATOM   8405  C  CE  . LYS G  1 102 ? 53.100 83.639 122.368 1.00 37.17 ? 102  LYS G CE  1 
ATOM   8406  N  NZ  . LYS G  1 102 ? 51.916 84.032 121.555 1.00 41.77 ? 102  LYS G NZ  1 
ATOM   8407  N  N   . ALA G  1 103 ? 58.547 86.040 126.157 1.00 31.70 ? 103  ALA G N   1 
ATOM   8408  C  CA  . ALA G  1 103 ? 59.447 86.997 126.787 1.00 28.94 ? 103  ALA G CA  1 
ATOM   8409  C  C   . ALA G  1 103 ? 60.887 86.565 126.494 1.00 29.36 ? 103  ALA G C   1 
ATOM   8410  O  O   . ALA G  1 103 ? 61.785 87.406 126.390 1.00 30.48 ? 103  ALA G O   1 
ATOM   8411  C  CB  . ALA G  1 103 ? 59.215 87.025 128.272 1.00 24.68 ? 103  ALA G CB  1 
ATOM   8412  N  N   . ALA G  1 104 ? 61.102 85.254 126.366 1.00 24.60 ? 104  ALA G N   1 
ATOM   8413  C  CA  . ALA G  1 104 ? 62.435 84.728 126.082 1.00 24.95 ? 104  ALA G CA  1 
ATOM   8414  C  C   . ALA G  1 104 ? 62.784 85.002 124.621 1.00 26.80 ? 104  ALA G C   1 
ATOM   8415  O  O   . ALA G  1 104 ? 63.885 85.469 124.305 1.00 25.58 ? 104  ALA G O   1 
ATOM   8416  C  CB  . ALA G  1 104 ? 62.483 83.232 126.354 1.00 24.30 ? 104  ALA G CB  1 
ATOM   8417  N  N   . ILE G  1 105 ? 61.837 84.710 123.733 1.00 25.61 ? 105  ILE G N   1 
ATOM   8418  C  CA  . ILE G  1 105 ? 62.035 84.935 122.309 1.00 27.64 ? 105  ILE G CA  1 
ATOM   8419  C  C   . ILE G  1 105 ? 62.342 86.416 122.078 1.00 31.51 ? 105  ILE G C   1 
ATOM   8420  O  O   . ILE G  1 105 ? 63.298 86.764 121.378 1.00 33.47 ? 105  ILE G O   1 
ATOM   8421  C  CB  . ILE G  1 105 ? 60.770 84.523 121.510 1.00 28.94 ? 105  ILE G CB  1 
ATOM   8422  C  CG1 . ILE G  1 105 ? 60.604 82.995 121.561 1.00 28.56 ? 105  ILE G CG1 1 
ATOM   8423  C  CG2 . ILE G  1 105 ? 60.857 85.031 120.074 1.00 20.21 ? 105  ILE G CG2 1 
ATOM   8424  C  CD1 . ILE G  1 105 ? 59.220 82.483 121.139 1.00 24.31 ? 105  ILE G CD1 1 
ATOM   8425  N  N   . ALA G  1 106 ? 61.541 87.287 122.685 1.00 32.34 ? 106  ALA G N   1 
ATOM   8426  C  CA  . ALA G  1 106 ? 61.736 88.726 122.534 1.00 31.95 ? 106  ALA G CA  1 
ATOM   8427  C  C   . ALA G  1 106 ? 63.111 89.171 123.021 1.00 32.24 ? 106  ALA G C   1 
ATOM   8428  O  O   . ALA G  1 106 ? 63.710 90.080 122.443 1.00 34.15 ? 106  ALA G O   1 
ATOM   8429  C  CB  . ALA G  1 106 ? 60.647 89.489 123.279 1.00 28.39 ? 106  ALA G CB  1 
ATOM   8430  N  N   . TYR G  1 107 ? 63.621 88.538 124.072 1.00 32.40 ? 107  TYR G N   1 
ATOM   8431  C  CA  . TYR G  1 107 ? 64.933 88.929 124.585 1.00 34.98 ? 107  TYR G CA  1 
ATOM   8432  C  C   . TYR G  1 107 ? 66.056 88.477 123.651 1.00 35.08 ? 107  TYR G C   1 
ATOM   8433  O  O   . TYR G  1 107 ? 67.034 89.202 123.430 1.00 34.29 ? 107  TYR G O   1 
ATOM   8434  C  CB  . TYR G  1 107 ? 65.186 88.359 125.984 1.00 36.39 ? 107  TYR G CB  1 
ATOM   8435  C  CG  . TYR G  1 107 ? 66.452 88.917 126.574 1.00 39.68 ? 107  TYR G CG  1 
ATOM   8436  C  CD1 . TYR G  1 107 ? 66.471 90.186 127.158 1.00 41.37 ? 107  TYR G CD1 1 
ATOM   8437  C  CD2 . TYR G  1 107 ? 67.661 88.237 126.435 1.00 45.17 ? 107  TYR G CD2 1 
ATOM   8438  C  CE1 . TYR G  1 107 ? 67.668 90.767 127.581 1.00 43.33 ? 107  TYR G CE1 1 
ATOM   8439  C  CE2 . TYR G  1 107 ? 68.866 88.808 126.847 1.00 45.86 ? 107  TYR G CE2 1 
ATOM   8440  C  CZ  . TYR G  1 107 ? 68.864 90.072 127.418 1.00 47.93 ? 107  TYR G CZ  1 
ATOM   8441  O  OH  . TYR G  1 107 ? 70.064 90.635 127.816 1.00 54.49 ? 107  TYR G OH  1 
ATOM   8442  N  N   . CYS G  1 108 ? 65.921 87.275 123.103 1.00 33.31 ? 108  CYS G N   1 
ATOM   8443  C  CA  . CYS G  1 108 ? 66.933 86.774 122.196 1.00 33.11 ? 108  CYS G CA  1 
ATOM   8444  C  C   . CYS G  1 108 ? 67.041 87.690 120.976 1.00 32.41 ? 108  CYS G C   1 
ATOM   8445  O  O   . CYS G  1 108 ? 68.143 87.966 120.505 1.00 30.94 ? 108  CYS G O   1 
ATOM   8446  C  CB  . CYS G  1 108 ? 66.609 85.333 121.795 1.00 35.50 ? 108  CYS G CB  1 
ATOM   8447  S  SG  . CYS G  1 108 ? 66.794 84.149 123.183 1.00 38.93 ? 108  CYS G SG  1 
ATOM   8448  N  N   . GLU G  1 109 ? 65.906 88.175 120.476 1.00 31.81 ? 109  GLU G N   1 
ATOM   8449  C  CA  . GLU G  1 109 ? 65.916 89.091 119.331 1.00 33.22 ? 109  GLU G CA  1 
ATOM   8450  C  C   . GLU G  1 109 ? 66.740 90.308 119.699 1.00 34.33 ? 109  GLU G C   1 
ATOM   8451  O  O   . GLU G  1 109 ? 67.656 90.693 118.977 1.00 34.08 ? 109  GLU G O   1 
ATOM   8452  C  CB  . GLU G  1 109 ? 64.509 89.594 118.991 1.00 32.92 ? 109  GLU G CB  1 
ATOM   8453  C  CG  . GLU G  1 109 ? 63.861 88.995 117.759 1.00 36.39 ? 109  GLU G CG  1 
ATOM   8454  C  CD  . GLU G  1 109 ? 64.624 89.270 116.481 1.00 37.47 ? 109  GLU G CD  1 
ATOM   8455  O  OE1 . GLU G  1 109 ? 64.797 90.453 116.116 1.00 37.69 ? 109  GLU G OE1 1 
ATOM   8456  O  OE2 . GLU G  1 109 ? 65.048 88.290 115.834 1.00 38.74 ? 109  GLU G OE2 1 
ATOM   8457  N  N   . SER G  1 110 ? 66.404 90.908 120.837 1.00 34.83 ? 110  SER G N   1 
ATOM   8458  C  CA  . SER G  1 110 ? 67.078 92.115 121.291 1.00 36.60 ? 110  SER G CA  1 
ATOM   8459  C  C   . SER G  1 110 ? 68.576 91.995 121.490 1.00 37.24 ? 110  SER G C   1 
ATOM   8460  O  O   . SER G  1 110 ? 69.280 92.995 121.396 1.00 41.51 ? 110  SER G O   1 
ATOM   8461  C  CB  . SER G  1 110 ? 66.442 92.637 122.583 1.00 38.86 ? 110  SER G CB  1 
ATOM   8462  O  OG  . SER G  1 110 ? 66.728 91.791 123.681 1.00 45.10 ? 110  SER G OG  1 
ATOM   8463  N  N   . VAL G  1 111 ? 69.083 90.797 121.766 1.00 35.71 ? 111  VAL G N   1 
ATOM   8464  C  CA  . VAL G  1 111 ? 70.525 90.661 121.966 1.00 34.37 ? 111  VAL G CA  1 
ATOM   8465  C  C   . VAL G  1 111 ? 71.234 89.957 120.817 1.00 33.47 ? 111  VAL G C   1 
ATOM   8466  O  O   . VAL G  1 111 ? 72.439 89.700 120.885 1.00 31.14 ? 111  VAL G O   1 
ATOM   8467  C  CB  . VAL G  1 111 ? 70.844 89.910 123.260 1.00 36.11 ? 111  VAL G CB  1 
ATOM   8468  C  CG1 . VAL G  1 111 ? 70.316 90.688 124.449 1.00 36.02 ? 111  VAL G CG1 1 
ATOM   8469  C  CG2 . VAL G  1 111 ? 70.244 88.516 123.205 1.00 37.37 ? 111  VAL G CG2 1 
ATOM   8470  N  N   . GLY G  1 112 ? 70.483 89.636 119.769 1.00 34.33 ? 112  GLY G N   1 
ATOM   8471  C  CA  . GLY G  1 112 ? 71.067 88.979 118.615 1.00 33.34 ? 112  GLY G CA  1 
ATOM   8472  C  C   . GLY G  1 112 ? 71.316 87.484 118.724 1.00 33.69 ? 112  GLY G C   1 
ATOM   8473  O  O   . GLY G  1 112 ? 72.081 86.941 117.920 1.00 36.73 ? 112  GLY G O   1 
ATOM   8474  N  N   . ASP G  1 113 ? 70.712 86.812 119.705 1.00 32.68 ? 113  ASP G N   1 
ATOM   8475  C  CA  . ASP G  1 113 ? 70.900 85.367 119.824 1.00 31.35 ? 113  ASP G CA  1 
ATOM   8476  C  C   . ASP G  1 113 ? 69.762 84.756 119.029 1.00 30.08 ? 113  ASP G C   1 
ATOM   8477  O  O   . ASP G  1 113 ? 68.760 84.296 119.575 1.00 30.73 ? 113  ASP G O   1 
ATOM   8478  C  CB  . ASP G  1 113 ? 70.830 84.888 121.273 1.00 31.34 ? 113  ASP G CB  1 
ATOM   8479  C  CG  . ASP G  1 113 ? 71.138 83.397 121.400 1.00 36.82 ? 113  ASP G CG  1 
ATOM   8480  O  OD1 . ASP G  1 113 ? 70.805 82.641 120.459 1.00 42.89 ? 113  ASP G OD1 1 
ATOM   8481  O  OD2 . ASP G  1 113 ? 71.702 82.966 122.429 1.00 38.88 ? 113  ASP G OD2 1 
ATOM   8482  N  N   . TYR G  1 114 ? 69.935 84.753 117.720 1.00 29.36 ? 114  TYR G N   1 
ATOM   8483  C  CA  . TYR G  1 114 ? 68.922 84.251 116.822 1.00 29.51 ? 114  TYR G CA  1 
ATOM   8484  C  C   . TYR G  1 114 ? 68.699 82.745 116.839 1.00 28.13 ? 114  TYR G C   1 
ATOM   8485  O  O   . TYR G  1 114 ? 67.577 82.296 116.618 1.00 29.20 ? 114  TYR G O   1 
ATOM   8486  C  CB  . TYR G  1 114 ? 69.246 84.750 115.424 1.00 27.51 ? 114  TYR G CB  1 
ATOM   8487  C  CG  . TYR G  1 114 ? 69.337 86.261 115.378 1.00 30.26 ? 114  TYR G CG  1 
ATOM   8488  C  CD1 . TYR G  1 114 ? 68.207 87.053 115.601 1.00 31.37 ? 114  TYR G CD1 1 
ATOM   8489  C  CD2 . TYR G  1 114 ? 70.548 86.902 115.091 1.00 31.48 ? 114  TYR G CD2 1 
ATOM   8490  C  CE1 . TYR G  1 114 ? 68.277 88.450 115.528 1.00 32.37 ? 114  TYR G CE1 1 
ATOM   8491  C  CE2 . TYR G  1 114 ? 70.633 88.300 115.018 1.00 30.67 ? 114  TYR G CE2 1 
ATOM   8492  C  CZ  . TYR G  1 114 ? 69.492 89.067 115.230 1.00 34.07 ? 114  TYR G CZ  1 
ATOM   8493  O  OH  . TYR G  1 114 ? 69.549 90.438 115.084 1.00 33.01 ? 114  TYR G OH  1 
ATOM   8494  N  N   . ALA G  1 115 ? 69.745 81.966 117.107 1.00 27.29 ? 115  ALA G N   1 
ATOM   8495  C  CA  . ALA G  1 115 ? 69.605 80.509 117.151 1.00 25.20 ? 115  ALA G CA  1 
ATOM   8496  C  C   . ALA G  1 115 ? 68.759 80.112 118.357 1.00 26.69 ? 115  ALA G C   1 
ATOM   8497  O  O   . ALA G  1 115 ? 67.868 79.259 118.250 1.00 25.59 ? 115  ALA G O   1 
ATOM   8498  C  CB  . ALA G  1 115 ? 70.971 79.838 117.221 1.00 22.82 ? 115  ALA G CB  1 
ATOM   8499  N  N   . SER G  1 116 ? 69.025 80.730 119.507 1.00 27.73 ? 116  SER G N   1 
ATOM   8500  C  CA  . SER G  1 116 ? 68.241 80.419 120.699 1.00 28.93 ? 116  SER G CA  1 
ATOM   8501  C  C   . SER G  1 116 ? 66.781 80.747 120.395 1.00 29.34 ? 116  SER G C   1 
ATOM   8502  O  O   . SER G  1 116 ? 65.872 79.989 120.770 1.00 31.16 ? 116  SER G O   1 
ATOM   8503  C  CB  . SER G  1 116 ? 68.716 81.232 121.907 1.00 29.23 ? 116  SER G CB  1 
ATOM   8504  O  OG  . SER G  1 116 ? 70.012 80.832 122.321 1.00 30.18 ? 116  SER G OG  1 
ATOM   8505  N  N   . ARG G  1 117 ? 66.564 81.866 119.701 1.00 25.85 ? 117  ARG G N   1 
ATOM   8506  C  CA  . ARG G  1 117 ? 65.218 82.288 119.333 1.00 25.76 ? 117  ARG G CA  1 
ATOM   8507  C  C   . ARG G  1 117 ? 64.500 81.219 118.497 1.00 29.38 ? 117  ARG G C   1 
ATOM   8508  O  O   . ARG G  1 117 ? 63.319 80.921 118.739 1.00 26.30 ? 117  ARG G O   1 
ATOM   8509  C  CB  . ARG G  1 117 ? 65.273 83.593 118.543 1.00 28.24 ? 117  ARG G CB  1 
ATOM   8510  C  CG  . ARG G  1 117 ? 63.902 84.161 118.131 1.00 27.28 ? 117  ARG G CG  1 
ATOM   8511  C  CD  . ARG G  1 117 ? 64.095 85.524 117.499 1.00 29.25 ? 117  ARG G CD  1 
ATOM   8512  N  NE  . ARG G  1 117 ? 62.853 86.263 117.293 1.00 29.42 ? 117  ARG G NE  1 
ATOM   8513  C  CZ  . ARG G  1 117 ? 61.868 85.846 116.516 1.00 28.99 ? 117  ARG G CZ  1 
ATOM   8514  N  NH1 . ARG G  1 117 ? 61.989 84.689 115.884 1.00 30.56 ? 117  ARG G NH1 1 
ATOM   8515  N  NH2 . ARG G  1 117 ? 60.782 86.592 116.357 1.00 21.90 ? 117  ARG G NH2 1 
ATOM   8516  N  N   . GLU G  1 118 ? 65.207 80.648 117.517 1.00 28.64 ? 118  GLU G N   1 
ATOM   8517  C  CA  . GLU G  1 118 ? 64.608 79.620 116.674 1.00 30.23 ? 118  GLU G CA  1 
ATOM   8518  C  C   . GLU G  1 118 ? 64.292 78.414 117.533 1.00 28.44 ? 118  GLU G C   1 
ATOM   8519  O  O   . GLU G  1 118 ? 63.289 77.740 117.323 1.00 25.90 ? 118  GLU G O   1 
ATOM   8520  C  CB  . GLU G  1 118 ? 65.546 79.203 115.536 1.00 34.06 ? 118  GLU G CB  1 
ATOM   8521  C  CG  . GLU G  1 118 ? 65.835 80.287 114.508 1.00 46.10 ? 118  GLU G CG  1 
ATOM   8522  C  CD  . GLU G  1 118 ? 64.578 80.967 113.954 1.00 52.85 ? 118  GLU G CD  1 
ATOM   8523  O  OE1 . GLU G  1 118 ? 63.981 81.809 114.665 1.00 52.12 ? 118  GLU G OE1 1 
ATOM   8524  O  OE2 . GLU G  1 118 ? 64.191 80.661 112.802 1.00 59.42 ? 118  GLU G OE2 1 
ATOM   8525  N  N   . LEU G  1 119 ? 65.153 78.148 118.509 1.00 28.59 ? 119  LEU G N   1 
ATOM   8526  C  CA  . LEU G  1 119 ? 64.937 77.020 119.400 1.00 29.00 ? 119  LEU G CA  1 
ATOM   8527  C  C   . LEU G  1 119 ? 63.625 77.228 120.149 1.00 29.76 ? 119  LEU G C   1 
ATOM   8528  O  O   . LEU G  1 119 ? 62.736 76.372 120.115 1.00 29.28 ? 119  LEU G O   1 
ATOM   8529  C  CB  . LEU G  1 119 ? 66.076 76.910 120.413 1.00 30.28 ? 119  LEU G CB  1 
ATOM   8530  C  CG  . LEU G  1 119 ? 66.252 75.569 121.133 1.00 29.79 ? 119  LEU G CG  1 
ATOM   8531  C  CD1 . LEU G  1 119 ? 66.998 75.796 122.448 1.00 30.45 ? 119  LEU G CD1 1 
ATOM   8532  C  CD2 . LEU G  1 119 ? 64.907 74.939 121.420 1.00 34.51 ? 119  LEU G CD2 1 
ATOM   8533  N  N   . LEU G  1 120 ? 63.506 78.373 120.819 1.00 30.35 ? 120  LEU G N   1 
ATOM   8534  C  CA  . LEU G  1 120 ? 62.308 78.676 121.592 1.00 29.58 ? 120  LEU G CA  1 
ATOM   8535  C  C   . LEU G  1 120 ? 61.080 78.731 120.700 1.00 32.77 ? 120  LEU G C   1 
ATOM   8536  O  O   . LEU G  1 120 ? 59.987 78.352 121.127 1.00 34.89 ? 120  LEU G O   1 
ATOM   8537  C  CB  . LEU G  1 120 ? 62.476 80.001 122.332 1.00 28.30 ? 120  LEU G CB  1 
ATOM   8538  C  CG  . LEU G  1 120 ? 63.785 80.164 123.116 1.00 29.91 ? 120  LEU G CG  1 
ATOM   8539  C  CD1 . LEU G  1 120 ? 63.894 81.591 123.647 1.00 25.79 ? 120  LEU G CD1 1 
ATOM   8540  C  CD2 . LEU G  1 120 ? 63.844 79.145 124.248 1.00 26.75 ? 120  LEU G CD2 1 
ATOM   8541  N  N   . GLU G  1 121 ? 61.249 79.200 119.462 1.00 35.58 ? 121  GLU G N   1 
ATOM   8542  C  CA  . GLU G  1 121 ? 60.120 79.273 118.529 1.00 35.20 ? 121  GLU G CA  1 
ATOM   8543  C  C   . GLU G  1 121 ? 59.552 77.878 118.283 1.00 34.11 ? 121  GLU G C   1 
ATOM   8544  O  O   . GLU G  1 121 ? 58.338 77.700 118.282 1.00 32.18 ? 121  GLU G O   1 
ATOM   8545  C  CB  . GLU G  1 121 ? 60.532 79.875 117.178 1.00 37.81 ? 121  GLU G CB  1 
ATOM   8546  C  CG  . GLU G  1 121 ? 60.869 81.361 117.192 1.00 41.51 ? 121  GLU G CG  1 
ATOM   8547  C  CD  . GLU G  1 121 ? 60.843 81.982 115.791 1.00 42.94 ? 121  GLU G CD  1 
ATOM   8548  O  OE1 . GLU G  1 121 ? 61.526 81.467 114.875 1.00 40.09 ? 121  GLU G OE1 1 
ATOM   8549  O  OE2 . GLU G  1 121 ? 60.135 82.996 115.608 1.00 43.29 ? 121  GLU G OE2 1 
ATOM   8550  N  N   . ASP G  1 122 ? 60.426 76.892 118.076 1.00 32.93 ? 122  ASP G N   1 
ATOM   8551  C  CA  . ASP G  1 122 ? 59.965 75.527 117.825 1.00 34.21 ? 122  ASP G CA  1 
ATOM   8552  C  C   . ASP G  1 122 ? 59.173 75.031 119.021 1.00 31.18 ? 122  ASP G C   1 
ATOM   8553  O  O   . ASP G  1 122 ? 58.027 74.609 118.891 1.00 31.57 ? 122  ASP G O   1 
ATOM   8554  C  CB  . ASP G  1 122 ? 61.140 74.573 117.555 1.00 38.62 ? 122  ASP G CB  1 
ATOM   8555  C  CG  . ASP G  1 122 ? 61.975 74.984 116.336 1.00 46.84 ? 122  ASP G CG  1 
ATOM   8556  O  OD1 . ASP G  1 122 ? 61.393 75.398 115.300 1.00 47.12 ? 122  ASP G OD1 1 
ATOM   8557  O  OD2 . ASP G  1 122 ? 63.225 74.880 116.415 1.00 50.61 ? 122  ASP G OD2 1 
ATOM   8558  N  N   . ILE G  1 123 ? 59.786 75.092 120.193 1.00 28.71 ? 123  ILE G N   1 
ATOM   8559  C  CA  . ILE G  1 123 ? 59.119 74.654 121.407 1.00 29.16 ? 123  ILE G CA  1 
ATOM   8560  C  C   . ILE G  1 123 ? 57.762 75.351 121.527 1.00 29.84 ? 123  ILE G C   1 
ATOM   8561  O  O   . ILE G  1 123 ? 56.754 74.713 121.810 1.00 27.54 ? 123  ILE G O   1 
ATOM   8562  C  CB  . ILE G  1 123 ? 60.001 74.959 122.637 1.00 29.55 ? 123  ILE G CB  1 
ATOM   8563  C  CG1 . ILE G  1 123 ? 61.313 74.177 122.511 1.00 27.59 ? 123  ILE G CG1 1 
ATOM   8564  C  CG2 . ILE G  1 123 ? 59.260 74.610 123.926 1.00 25.79 ? 123  ILE G CG2 1 
ATOM   8565  C  CD1 . ILE G  1 123 ? 62.274 74.416 123.636 1.00 33.67 ? 123  ILE G CD1 1 
ATOM   8566  N  N   . LEU G  1 124 ? 57.742 76.659 121.294 1.00 31.01 ? 124  LEU G N   1 
ATOM   8567  C  CA  . LEU G  1 124 ? 56.503 77.438 121.354 1.00 34.73 ? 124  LEU G CA  1 
ATOM   8568  C  C   . LEU G  1 124 ? 55.410 76.841 120.469 1.00 35.55 ? 124  LEU G C   1 
ATOM   8569  O  O   . LEU G  1 124 ? 54.270 76.646 120.889 1.00 35.65 ? 124  LEU G O   1 
ATOM   8570  C  CB  . LEU G  1 124 ? 56.769 78.872 120.890 1.00 35.82 ? 124  LEU G CB  1 
ATOM   8571  C  CG  . LEU G  1 124 ? 55.530 79.721 120.605 1.00 34.49 ? 124  LEU G CG  1 
ATOM   8572  C  CD1 . LEU G  1 124 ? 54.638 79.736 121.826 1.00 38.50 ? 124  LEU G CD1 1 
ATOM   8573  C  CD2 . LEU G  1 124 ? 55.946 81.128 120.244 1.00 38.73 ? 124  LEU G CD2 1 
ATOM   8574  N  N   . GLU G  1 125 ? 55.775 76.586 119.223 1.00 36.72 ? 125  GLU G N   1 
ATOM   8575  C  CA  . GLU G  1 125 ? 54.874 76.024 118.243 1.00 37.61 ? 125  GLU G CA  1 
ATOM   8576  C  C   . GLU G  1 125 ? 54.315 74.731 118.817 1.00 35.25 ? 125  GLU G C   1 
ATOM   8577  O  O   . GLU G  1 125 ? 53.138 74.413 118.652 1.00 34.71 ? 125  GLU G O   1 
ATOM   8578  C  CB  . GLU G  1 125 ? 55.664 75.765 116.965 1.00 44.16 ? 125  GLU G CB  1 
ATOM   8579  C  CG  . GLU G  1 125 ? 54.855 75.489 115.723 1.00 51.81 ? 125  GLU G CG  1 
ATOM   8580  C  CD  . GLU G  1 125 ? 55.593 75.956 114.482 1.00 58.77 ? 125  GLU G CD  1 
ATOM   8581  O  OE1 . GLU G  1 125 ? 55.220 75.533 113.364 1.00 63.37 ? 125  GLU G OE1 1 
ATOM   8582  O  OE2 . GLU G  1 125 ? 56.546 76.759 114.631 1.00 59.66 ? 125  GLU G OE2 1 
ATOM   8583  N  N   . SER G  1 126 ? 55.166 73.993 119.511 1.00 30.85 ? 126  SER G N   1 
ATOM   8584  C  CA  . SER G  1 126 ? 54.736 72.749 120.111 1.00 31.07 ? 126  SER G CA  1 
ATOM   8585  C  C   . SER G  1 126 ? 53.781 72.996 121.285 1.00 30.33 ? 126  SER G C   1 
ATOM   8586  O  O   . SER G  1 126 ? 52.813 72.259 121.476 1.00 28.58 ? 126  SER G O   1 
ATOM   8587  C  CB  . SER G  1 126 ? 55.955 71.950 120.579 1.00 32.31 ? 126  SER G CB  1 
ATOM   8588  O  OG  . SER G  1 126 ? 55.558 70.809 121.329 1.00 37.66 ? 126  SER G OG  1 
ATOM   8589  N  N   . GLU G  1 127 ? 54.052 74.028 122.076 1.00 32.22 ? 127  GLU G N   1 
ATOM   8590  C  CA  . GLU G  1 127 ? 53.200 74.332 123.223 1.00 31.93 ? 127  GLU G CA  1 
ATOM   8591  C  C   . GLU G  1 127 ? 51.807 74.728 122.747 1.00 32.30 ? 127  GLU G C   1 
ATOM   8592  O  O   . GLU G  1 127 ? 50.806 74.366 123.375 1.00 31.40 ? 127  GLU G O   1 
ATOM   8593  C  CB  . GLU G  1 127 ? 53.819 75.415 124.110 1.00 29.83 ? 127  GLU G CB  1 
ATOM   8594  C  CG  . GLU G  1 127 ? 55.260 75.148 124.551 1.00 38.65 ? 127  GLU G CG  1 
ATOM   8595  C  CD  . GLU G  1 127 ? 55.415 73.825 125.277 1.00 41.57 ? 127  GLU G CD  1 
ATOM   8596  O  OE1 . GLU G  1 127 ? 54.395 73.175 125.578 1.00 46.65 ? 127  GLU G OE1 1 
ATOM   8597  O  OE2 . GLU G  1 127 ? 56.566 73.425 125.532 1.00 44.99 ? 127  GLU G OE2 1 
ATOM   8598  N  N   . GLU G  1 128 ? 51.719 75.448 121.635 1.00 35.39 ? 128  GLU G N   1 
ATOM   8599  C  CA  . GLU G  1 128 ? 50.408 75.838 121.142 1.00 36.06 ? 128  GLU G CA  1 
ATOM   8600  C  C   . GLU G  1 128 ? 49.605 74.630 120.681 1.00 36.87 ? 128  GLU G C   1 
ATOM   8601  O  O   . GLU G  1 128 ? 48.380 74.640 120.764 1.00 38.80 ? 128  GLU G O   1 
ATOM   8602  C  CB  . GLU G  1 128 ? 50.537 76.899 120.046 1.00 36.38 ? 128  GLU G CB  1 
ATOM   8603  C  CG  . GLU G  1 128 ? 50.892 78.276 120.643 1.00 40.08 ? 128  GLU G CG  1 
ATOM   8604  C  CD  . GLU G  1 128 ? 50.904 79.405 119.625 1.00 43.37 ? 128  GLU G CD  1 
ATOM   8605  O  OE1 . GLU G  1 128 ? 50.317 79.234 118.534 1.00 46.91 ? 128  GLU G OE1 1 
ATOM   8606  O  OE2 . GLU G  1 128 ? 51.489 80.474 119.924 1.00 42.57 ? 128  GLU G OE2 1 
ATOM   8607  N  N   . ASP G  1 129 ? 50.282 73.575 120.225 1.00 39.19 ? 129  ASP G N   1 
ATOM   8608  C  CA  . ASP G  1 129 ? 49.573 72.361 119.809 1.00 40.76 ? 129  ASP G CA  1 
ATOM   8609  C  C   . ASP G  1 129 ? 48.946 71.675 121.023 1.00 38.41 ? 129  ASP G C   1 
ATOM   8610  O  O   . ASP G  1 129 ? 47.798 71.238 120.971 1.00 38.61 ? 129  ASP G O   1 
ATOM   8611  C  CB  . ASP G  1 129 ? 50.502 71.377 119.094 1.00 43.25 ? 129  ASP G CB  1 
ATOM   8612  C  CG  . ASP G  1 129 ? 50.731 71.745 117.649 1.00 47.91 ? 129  ASP G CG  1 
ATOM   8613  O  OD1 . ASP G  1 129 ? 49.797 72.294 117.018 1.00 50.66 ? 129  ASP G OD1 1 
ATOM   8614  O  OD2 . ASP G  1 129 ? 51.838 71.473 117.138 1.00 53.57 ? 129  ASP G OD2 1 
ATOM   8615  N  N   . HIS G  1 130 ? 49.708 71.557 122.105 1.00 36.67 ? 130  HIS G N   1 
ATOM   8616  C  CA  . HIS G  1 130 ? 49.165 70.965 123.323 1.00 36.60 ? 130  HIS G CA  1 
ATOM   8617  C  C   . HIS G  1 130 ? 47.982 71.745 123.794 1.00 35.10 ? 130  HIS G C   1 
ATOM   8618  O  O   . HIS G  1 130 ? 46.903 71.201 124.049 1.00 32.23 ? 130  HIS G O   1 
ATOM   8619  C  CB  . HIS G  1 130 ? 50.225 70.970 124.431 1.00 37.10 ? 130  HIS G CB  1 
ATOM   8620  C  CG  . HIS G  1 130 ? 51.448 70.072 124.147 1.00 43.20 ? 130  HIS G CG  1 
ATOM   8621  N  ND1 . HIS G  1 130 ? 52.644 70.227 124.820 1.00 43.77 ? 130  HIS G ND1 1 
ATOM   8622  C  CD2 . HIS G  1 130 ? 51.639 69.052 123.277 1.00 45.41 ? 130  HIS G CD2 1 
ATOM   8623  C  CE1 . HIS G  1 130 ? 53.517 69.341 124.377 1.00 44.05 ? 130  HIS G CE1 1 
ATOM   8624  N  NE2 . HIS G  1 130 ? 52.933 68.615 123.441 1.00 44.59 ? 130  HIS G NE2 1 
ATOM   8625  N  N   . ILE G  1 131 ? 48.159 73.056 123.912 1.00 33.27 ? 131  ILE G N   1 
ATOM   8626  C  CA  . ILE G  1 131 ? 47.067 73.903 124.352 1.00 32.95 ? 131  ILE G CA  1 
ATOM   8627  C  C   . ILE G  1 131 ? 45.841 73.647 123.489 1.00 32.83 ? 131  ILE G C   1 
ATOM   8628  O  O   . ILE G  1 131 ? 44.727 73.575 123.994 1.00 33.37 ? 131  ILE G O   1 
ATOM   8629  C  CB  . ILE G  1 131 ? 47.440 75.407 124.277 1.00 33.91 ? 131  ILE G CB  1 
ATOM   8630  C  CG1 . ILE G  1 131 ? 48.446 75.749 125.388 1.00 34.07 ? 131  ILE G CG1 1 
ATOM   8631  C  CG2 . ILE G  1 131 ? 46.184 76.267 124.406 1.00 33.67 ? 131  ILE G CG2 1 
ATOM   8632  C  CD1 . ILE G  1 131 ? 48.795 77.233 125.504 1.00 29.07 ? 131  ILE G CD1 1 
ATOM   8633  N  N   . ASP G  1 132 ? 46.046 73.491 122.186 1.00 34.10 ? 132  ASP G N   1 
ATOM   8634  C  CA  . ASP G  1 132 ? 44.930 73.260 121.281 1.00 32.93 ? 132  ASP G CA  1 
ATOM   8635  C  C   . ASP G  1 132 ? 44.219 71.950 121.569 1.00 30.74 ? 132  ASP G C   1 
ATOM   8636  O  O   . ASP G  1 132 ? 42.989 71.915 121.690 1.00 30.48 ? 132  ASP G O   1 
ATOM   8637  C  CB  . ASP G  1 132 ? 45.400 73.283 119.826 1.00 36.29 ? 132  ASP G CB  1 
ATOM   8638  C  CG  . ASP G  1 132 ? 44.236 73.311 118.838 1.00 38.44 ? 132  ASP G CG  1 
ATOM   8639  O  OD1 . ASP G  1 132 ? 43.181 73.894 119.180 1.00 41.31 ? 132  ASP G OD1 1 
ATOM   8640  O  OD2 . ASP G  1 132 ? 44.377 72.768 117.720 1.00 39.38 ? 132  ASP G OD2 1 
ATOM   8641  N  N   . TRP G  1 133 ? 44.990 70.873 121.676 1.00 28.53 ? 133  TRP G N   1 
ATOM   8642  C  CA  . TRP G  1 133 ? 44.408 69.568 121.954 1.00 29.01 ? 133  TRP G CA  1 
ATOM   8643  C  C   . TRP G  1 133 ? 43.605 69.633 123.256 1.00 29.77 ? 133  TRP G C   1 
ATOM   8644  O  O   . TRP G  1 133 ? 42.461 69.180 123.320 1.00 30.74 ? 133  TRP G O   1 
ATOM   8645  C  CB  . TRP G  1 133 ? 45.506 68.512 122.075 1.00 25.98 ? 133  TRP G CB  1 
ATOM   8646  C  CG  . TRP G  1 133 ? 44.978 67.141 122.341 1.00 28.62 ? 133  TRP G CG  1 
ATOM   8647  C  CD1 . TRP G  1 133 ? 44.461 66.266 121.424 1.00 31.68 ? 133  TRP G CD1 1 
ATOM   8648  C  CD2 . TRP G  1 133 ? 44.876 66.491 123.617 1.00 29.03 ? 133  TRP G CD2 1 
ATOM   8649  N  NE1 . TRP G  1 133 ? 44.042 65.111 122.052 1.00 32.17 ? 133  TRP G NE1 1 
ATOM   8650  C  CE2 . TRP G  1 133 ? 44.284 65.225 123.397 1.00 28.71 ? 133  TRP G CE2 1 
ATOM   8651  C  CE3 . TRP G  1 133 ? 45.225 66.857 124.923 1.00 27.92 ? 133  TRP G CE3 1 
ATOM   8652  C  CZ2 . TRP G  1 133 ? 44.034 64.326 124.433 1.00 27.01 ? 133  TRP G CZ2 1 
ATOM   8653  C  CZ3 . TRP G  1 133 ? 44.977 65.960 125.955 1.00 27.51 ? 133  TRP G CZ3 1 
ATOM   8654  C  CH2 . TRP G  1 133 ? 44.385 64.709 125.702 1.00 27.61 ? 133  TRP G CH2 1 
ATOM   8655  N  N   . LEU G  1 134 ? 44.209 70.209 124.291 1.00 30.28 ? 134  LEU G N   1 
ATOM   8656  C  CA  . LEU G  1 134 ? 43.551 70.323 125.582 1.00 29.12 ? 134  LEU G CA  1 
ATOM   8657  C  C   . LEU G  1 134 ? 42.209 71.029 125.474 1.00 30.27 ? 134  LEU G C   1 
ATOM   8658  O  O   . LEU G  1 134 ? 41.180 70.477 125.868 1.00 29.05 ? 134  LEU G O   1 
ATOM   8659  C  CB  . LEU G  1 134 ? 44.458 71.054 126.569 1.00 28.10 ? 134  LEU G CB  1 
ATOM   8660  C  CG  . LEU G  1 134 ? 45.704 70.250 126.958 1.00 28.81 ? 134  LEU G CG  1 
ATOM   8661  C  CD1 . LEU G  1 134 ? 46.645 71.113 127.774 1.00 28.02 ? 134  LEU G CD1 1 
ATOM   8662  C  CD2 . LEU G  1 134 ? 45.292 69.019 127.751 1.00 29.60 ? 134  LEU G CD2 1 
ATOM   8663  N  N   . GLU G  1 135 ? 42.210 72.242 124.931 1.00 31.91 ? 135  GLU G N   1 
ATOM   8664  C  CA  . GLU G  1 135 ? 40.966 72.994 124.791 1.00 33.53 ? 135  GLU G CA  1 
ATOM   8665  C  C   . GLU G  1 135 ? 39.928 72.133 124.092 1.00 32.11 ? 135  GLU G C   1 
ATOM   8666  O  O   . GLU G  1 135 ? 38.775 72.069 124.501 1.00 31.11 ? 135  GLU G O   1 
ATOM   8667  C  CB  . GLU G  1 135 ? 41.181 74.261 123.968 1.00 35.32 ? 135  GLU G CB  1 
ATOM   8668  C  CG  . GLU G  1 135 ? 42.234 75.194 124.508 1.00 40.78 ? 135  GLU G CG  1 
ATOM   8669  C  CD  . GLU G  1 135 ? 42.423 76.420 123.632 1.00 44.16 ? 135  GLU G CD  1 
ATOM   8670  O  OE1 . GLU G  1 135 ? 42.560 76.265 122.397 1.00 49.20 ? 135  GLU G OE1 1 
ATOM   8671  O  OE2 . GLU G  1 135 ? 42.444 77.539 124.182 1.00 47.12 ? 135  GLU G OE2 1 
ATOM   8672  N  N   . THR G  1 136 ? 40.357 71.464 123.033 1.00 31.53 ? 136  THR G N   1 
ATOM   8673  C  CA  . THR G  1 136 ? 39.465 70.618 122.262 1.00 31.26 ? 136  THR G CA  1 
ATOM   8674  C  C   . THR G  1 136 ? 38.829 69.518 123.115 1.00 30.12 ? 136  THR G C   1 
ATOM   8675  O  O   . THR G  1 136 ? 37.639 69.226 122.969 1.00 29.26 ? 136  THR G O   1 
ATOM   8676  C  CB  . THR G  1 136 ? 40.227 70.012 121.080 1.00 29.51 ? 136  THR G CB  1 
ATOM   8677  O  OG1 . THR G  1 136 ? 40.825 71.076 120.335 1.00 33.96 ? 136  THR G OG1 1 
ATOM   8678  C  CG2 . THR G  1 136 ? 39.299 69.246 120.167 1.00 27.93 ? 136  THR G CG2 1 
ATOM   8679  N  N   . GLN G  1 137 ? 39.615 68.919 124.005 1.00 29.26 ? 137  GLN G N   1 
ATOM   8680  C  CA  . GLN G  1 137 ? 39.106 67.861 124.874 1.00 31.02 ? 137  GLN G CA  1 
ATOM   8681  C  C   . GLN G  1 137 ? 38.033 68.418 125.801 1.00 30.45 ? 137  GLN G C   1 
ATOM   8682  O  O   . GLN G  1 137 ? 37.005 67.782 126.034 1.00 31.00 ? 137  GLN G O   1 
ATOM   8683  C  CB  . GLN G  1 137 ? 40.233 67.257 125.721 1.00 31.43 ? 137  GLN G CB  1 
ATOM   8684  C  CG  . GLN G  1 137 ? 41.415 66.785 124.920 1.00 32.87 ? 137  GLN G CG  1 
ATOM   8685  C  CD  . GLN G  1 137 ? 40.985 65.967 123.733 1.00 37.12 ? 137  GLN G CD  1 
ATOM   8686  O  OE1 . GLN G  1 137 ? 40.276 64.963 123.881 1.00 37.49 ? 137  GLN G OE1 1 
ATOM   8687  N  NE2 . GLN G  1 137 ? 41.401 66.391 122.540 1.00 33.63 ? 137  GLN G NE2 1 
ATOM   8688  N  N   . LEU G  1 138 ? 38.279 69.607 126.337 1.00 29.61 ? 138  LEU G N   1 
ATOM   8689  C  CA  . LEU G  1 138 ? 37.318 70.227 127.230 1.00 30.23 ? 138  LEU G CA  1 
ATOM   8690  C  C   . LEU G  1 138 ? 36.022 70.553 126.488 1.00 31.67 ? 138  LEU G C   1 
ATOM   8691  O  O   . LEU G  1 138 ? 34.933 70.303 127.006 1.00 33.17 ? 138  LEU G O   1 
ATOM   8692  C  CB  . LEU G  1 138 ? 37.934 71.474 127.861 1.00 28.20 ? 138  LEU G CB  1 
ATOM   8693  C  CG  . LEU G  1 138 ? 39.029 71.107 128.874 1.00 30.19 ? 138  LEU G CG  1 
ATOM   8694  C  CD1 . LEU G  1 138 ? 39.771 72.351 129.329 1.00 27.89 ? 138  LEU G CD1 1 
ATOM   8695  C  CD2 . LEU G  1 138 ? 38.396 70.389 130.069 1.00 29.27 ? 138  LEU G CD2 1 
ATOM   8696  N  N   . ASP G  1 139 ? 36.135 71.088 125.274 1.00 32.37 ? 139  ASP G N   1 
ATOM   8697  C  CA  . ASP G  1 139 ? 34.955 71.415 124.474 1.00 33.70 ? 139  ASP G CA  1 
ATOM   8698  C  C   . ASP G  1 139 ? 34.173 70.139 124.156 1.00 33.32 ? 139  ASP G C   1 
ATOM   8699  O  O   . ASP G  1 139 ? 32.939 70.114 124.219 1.00 32.93 ? 139  ASP G O   1 
ATOM   8700  C  CB  . ASP G  1 139 ? 35.350 72.099 123.152 1.00 39.14 ? 139  ASP G CB  1 
ATOM   8701  C  CG  . ASP G  1 139 ? 35.743 73.568 123.328 1.00 44.96 ? 139  ASP G CG  1 
ATOM   8702  O  OD1 . ASP G  1 139 ? 35.052 74.295 124.076 1.00 48.05 ? 139  ASP G OD1 1 
ATOM   8703  O  OD2 . ASP G  1 139 ? 36.734 74.007 122.698 1.00 49.54 ? 139  ASP G OD2 1 
ATOM   8704  N  N   . LEU G  1 140 ? 34.909 69.091 123.799 1.00 32.67 ? 140  LEU G N   1 
ATOM   8705  C  CA  . LEU G  1 140 ? 34.332 67.798 123.464 1.00 32.53 ? 140  LEU G CA  1 
ATOM   8706  C  C   . LEU G  1 140 ? 33.508 67.281 124.635 1.00 32.96 ? 140  LEU G C   1 
ATOM   8707  O  O   . LEU G  1 140 ? 32.414 66.747 124.442 1.00 34.61 ? 140  LEU G O   1 
ATOM   8708  C  CB  . LEU G  1 140 ? 35.452 66.803 123.115 1.00 33.01 ? 140  LEU G CB  1 
ATOM   8709  C  CG  . LEU G  1 140 ? 35.656 66.359 121.652 1.00 36.17 ? 140  LEU G CG  1 
ATOM   8710  C  CD1 . LEU G  1 140 ? 35.274 67.464 120.693 1.00 34.97 ? 140  LEU G CD1 1 
ATOM   8711  C  CD2 . LEU G  1 140 ? 37.112 65.947 121.433 1.00 32.32 ? 140  LEU G CD2 1 
ATOM   8712  N  N   . ILE G  1 141 ? 34.025 67.449 125.850 1.00 32.07 ? 141  ILE G N   1 
ATOM   8713  C  CA  . ILE G  1 141 ? 33.310 66.996 127.043 1.00 32.22 ? 141  ILE G CA  1 
ATOM   8714  C  C   . ILE G  1 141 ? 31.960 67.705 127.157 1.00 34.77 ? 141  ILE G C   1 
ATOM   8715  O  O   . ILE G  1 141 ? 30.939 67.069 127.421 1.00 35.25 ? 141  ILE G O   1 
ATOM   8716  C  CB  . ILE G  1 141 ? 34.139 67.240 128.333 1.00 28.82 ? 141  ILE G CB  1 
ATOM   8717  C  CG1 . ILE G  1 141 ? 35.298 66.235 128.405 1.00 25.80 ? 141  ILE G CG1 1 
ATOM   8718  C  CG2 . ILE G  1 141 ? 33.250 67.123 129.561 1.00 26.64 ? 141  ILE G CG2 1 
ATOM   8719  C  CD1 . ILE G  1 141 ? 36.247 66.427 129.599 1.00 22.99 ? 141  ILE G CD1 1 
ATOM   8720  N  N   . ASP G  1 142 ? 31.951 69.018 126.951 1.00 36.56 ? 142  ASP G N   1 
ATOM   8721  C  CA  . ASP G  1 142 ? 30.703 69.766 127.018 1.00 41.82 ? 142  ASP G CA  1 
ATOM   8722  C  C   . ASP G  1 142 ? 29.756 69.403 125.882 1.00 40.78 ? 142  ASP G C   1 
ATOM   8723  O  O   . ASP G  1 142 ? 28.544 69.544 126.007 1.00 40.70 ? 142  ASP G O   1 
ATOM   8724  C  CB  . ASP G  1 142 ? 30.967 71.272 126.973 1.00 49.74 ? 142  ASP G CB  1 
ATOM   8725  C  CG  . ASP G  1 142 ? 31.361 71.837 128.324 1.00 58.53 ? 142  ASP G CG  1 
ATOM   8726  O  OD1 . ASP G  1 142 ? 30.621 71.609 129.311 1.00 61.31 ? 142  ASP G OD1 1 
ATOM   8727  O  OD2 . ASP G  1 142 ? 32.408 72.518 128.398 1.00 65.15 ? 142  ASP G OD2 1 
ATOM   8728  N  N   . LYS G  1 143 ? 30.309 68.934 124.771 1.00 41.31 ? 143  LYS G N   1 
ATOM   8729  C  CA  . LYS G  1 143 ? 29.486 68.586 123.620 1.00 40.07 ? 143  LYS G CA  1 
ATOM   8730  C  C   . LYS G  1 143 ? 28.853 67.201 123.663 1.00 38.51 ? 143  LYS G C   1 
ATOM   8731  O  O   . LYS G  1 143 ? 27.661 67.053 123.410 1.00 39.14 ? 143  LYS G O   1 
ATOM   8732  C  CB  . LYS G  1 143 ? 30.300 68.755 122.325 1.00 39.58 ? 143  LYS G CB  1 
ATOM   8733  C  CG  . LYS G  1 143 ? 30.485 70.219 121.933 1.00 38.92 ? 143  LYS G CG  1 
ATOM   8734  C  CD  . LYS G  1 143 ? 31.504 70.445 120.820 1.00 36.27 ? 143  LYS G CD  1 
ATOM   8735  C  CE  . LYS G  1 143 ? 31.742 71.953 120.643 1.00 34.66 ? 143  LYS G CE  1 
ATOM   8736  N  NZ  . LYS G  1 143 ? 32.928 72.304 119.810 1.00 31.59 ? 143  LYS G NZ  1 
ATOM   8737  N  N   . ILE G  1 144 ? 29.635 66.186 123.995 1.00 36.96 ? 144  ILE G N   1 
ATOM   8738  C  CA  . ILE G  1 144 ? 29.094 64.842 124.011 1.00 33.90 ? 144  ILE G CA  1 
ATOM   8739  C  C   . ILE G  1 144 ? 28.800 64.311 125.409 1.00 34.07 ? 144  ILE G C   1 
ATOM   8740  O  O   . ILE G  1 144 ? 28.101 63.307 125.556 1.00 34.07 ? 144  ILE G O   1 
ATOM   8741  C  CB  . ILE G  1 144 ? 30.043 63.880 123.261 1.00 32.76 ? 144  ILE G CB  1 
ATOM   8742  C  CG1 . ILE G  1 144 ? 31.175 63.402 124.171 1.00 31.90 ? 144  ILE G CG1 1 
ATOM   8743  C  CG2 . ILE G  1 144 ? 30.670 64.611 122.088 1.00 28.89 ? 144  ILE G CG2 1 
ATOM   8744  C  CD1 . ILE G  1 144 ? 32.114 62.385 123.500 1.00 29.32 ? 144  ILE G CD1 1 
ATOM   8745  N  N   . GLY G  1 145 ? 29.324 64.987 126.431 1.00 33.90 ? 145  GLY G N   1 
ATOM   8746  C  CA  . GLY G  1 145 ? 29.098 64.555 127.805 1.00 31.56 ? 145  GLY G CA  1 
ATOM   8747  C  C   . GLY G  1 145 ? 30.251 63.764 128.410 1.00 32.03 ? 145  GLY G C   1 
ATOM   8748  O  O   . GLY G  1 145 ? 30.923 62.990 127.714 1.00 32.79 ? 145  GLY G O   1 
ATOM   8749  N  N   . LEU G  1 146 ? 30.479 63.933 129.711 1.00 29.75 ? 146  LEU G N   1 
ATOM   8750  C  CA  . LEU G  1 146 ? 31.572 63.231 130.372 1.00 26.68 ? 146  LEU G CA  1 
ATOM   8751  C  C   . LEU G  1 146 ? 31.540 61.712 130.184 1.00 28.50 ? 146  LEU G C   1 
ATOM   8752  O  O   . LEU G  1 146 ? 32.572 61.107 129.870 1.00 28.14 ? 146  LEU G O   1 
ATOM   8753  C  CB  . LEU G  1 146 ? 31.598 63.553 131.865 1.00 22.62 ? 146  LEU G CB  1 
ATOM   8754  C  CG  . LEU G  1 146 ? 32.916 63.150 132.545 1.00 21.85 ? 146  LEU G CG  1 
ATOM   8755  C  CD1 . LEU G  1 146 ? 34.088 63.907 131.901 1.00 16.47 ? 146  LEU G CD1 1 
ATOM   8756  C  CD2 . LEU G  1 146 ? 32.843 63.454 134.030 1.00 16.14 ? 146  LEU G CD2 1 
ATOM   8757  N  N   . GLU G  1 147 ? 30.370 61.096 130.371 1.00 29.29 ? 147  GLU G N   1 
ATOM   8758  C  CA  . GLU G  1 147 ? 30.256 59.646 130.224 1.00 29.50 ? 147  GLU G CA  1 
ATOM   8759  C  C   . GLU G  1 147 ? 30.693 59.214 128.829 1.00 29.65 ? 147  GLU G C   1 
ATOM   8760  O  O   . GLU G  1 147 ? 31.605 58.390 128.696 1.00 31.48 ? 147  GLU G O   1 
ATOM   8761  C  CB  . GLU G  1 147 ? 28.826 59.164 130.484 1.00 33.58 ? 147  GLU G CB  1 
ATOM   8762  C  CG  . GLU G  1 147 ? 28.232 59.577 131.819 1.00 38.32 ? 147  GLU G CG  1 
ATOM   8763  C  CD  . GLU G  1 147 ? 28.022 61.084 131.914 1.00 47.89 ? 147  GLU G CD  1 
ATOM   8764  O  OE1 . GLU G  1 147 ? 27.439 61.671 130.968 1.00 45.60 ? 147  GLU G OE1 1 
ATOM   8765  O  OE2 . GLU G  1 147 ? 28.440 61.681 132.935 1.00 52.83 ? 147  GLU G OE2 1 
ATOM   8766  N  N   . ASN G  1 148 ? 30.058 59.764 127.793 1.00 27.88 ? 148  ASN G N   1 
ATOM   8767  C  CA  . ASN G  1 148 ? 30.430 59.413 126.421 1.00 26.83 ? 148  ASN G CA  1 
ATOM   8768  C  C   . ASN G  1 148 ? 31.896 59.729 126.141 1.00 25.45 ? 148  ASN G C   1 
ATOM   8769  O  O   . ASN G  1 148 ? 32.594 58.933 125.507 1.00 25.10 ? 148  ASN G O   1 
ATOM   8770  C  CB  . ASN G  1 148 ? 29.559 60.145 125.395 1.00 29.75 ? 148  ASN G CB  1 
ATOM   8771  C  CG  . ASN G  1 148 ? 28.197 59.491 125.207 1.00 34.16 ? 148  ASN G CG  1 
ATOM   8772  O  OD1 . ASN G  1 148 ? 28.093 58.293 124.939 1.00 34.28 ? 148  ASN G OD1 1 
ATOM   8773  N  ND2 . ASN G  1 148 ? 27.145 60.283 125.338 1.00 37.40 ? 148  ASN G ND2 1 
ATOM   8774  N  N   . TYR G  1 149 ? 32.376 60.876 126.619 1.00 22.63 ? 149  TYR G N   1 
ATOM   8775  C  CA  . TYR G  1 149 ? 33.768 61.229 126.370 1.00 22.20 ? 149  TYR G CA  1 
ATOM   8776  C  C   . TYR G  1 149 ? 34.721 60.227 126.988 1.00 23.01 ? 149  TYR G C   1 
ATOM   8777  O  O   . TYR G  1 149 ? 35.691 59.825 126.355 1.00 23.45 ? 149  TYR G O   1 
ATOM   8778  C  CB  . TYR G  1 149 ? 34.120 62.609 126.919 1.00 19.36 ? 149  TYR G CB  1 
ATOM   8779  C  CG  . TYR G  1 149 ? 35.593 62.934 126.730 1.00 20.90 ? 149  TYR G CG  1 
ATOM   8780  C  CD1 . TYR G  1 149 ? 36.077 63.401 125.501 1.00 18.17 ? 149  TYR G CD1 1 
ATOM   8781  C  CD2 . TYR G  1 149 ? 36.512 62.742 127.772 1.00 21.44 ? 149  TYR G CD2 1 
ATOM   8782  C  CE1 . TYR G  1 149 ? 37.437 63.668 125.314 1.00 21.22 ? 149  TYR G CE1 1 
ATOM   8783  C  CE2 . TYR G  1 149 ? 37.878 63.006 127.598 1.00 21.46 ? 149  TYR G CE2 1 
ATOM   8784  C  CZ  . TYR G  1 149 ? 38.334 63.468 126.368 1.00 25.30 ? 149  TYR G CZ  1 
ATOM   8785  O  OH  . TYR G  1 149 ? 39.680 63.731 126.192 1.00 25.55 ? 149  TYR G OH  1 
ATOM   8786  N  N   . LEU G  1 150 ? 34.459 59.841 128.233 1.00 24.87 ? 150  LEU G N   1 
ATOM   8787  C  CA  . LEU G  1 150 ? 35.324 58.886 128.911 1.00 25.40 ? 150  LEU G CA  1 
ATOM   8788  C  C   . LEU G  1 150 ? 35.224 57.505 128.272 1.00 26.03 ? 150  LEU G C   1 
ATOM   8789  O  O   . LEU G  1 150 ? 36.209 56.769 128.238 1.00 29.56 ? 150  LEU G O   1 
ATOM   8790  C  CB  . LEU G  1 150 ? 34.989 58.815 130.408 1.00 26.69 ? 150  LEU G CB  1 
ATOM   8791  C  CG  . LEU G  1 150 ? 35.410 60.018 131.263 1.00 27.79 ? 150  LEU G CG  1 
ATOM   8792  C  CD1 . LEU G  1 150 ? 35.075 59.772 132.732 1.00 23.33 ? 150  LEU G CD1 1 
ATOM   8793  C  CD2 . LEU G  1 150 ? 36.915 60.255 131.102 1.00 26.78 ? 150  LEU G CD2 1 
ATOM   8794  N  N   . GLN G  1 151 ? 34.047 57.144 127.770 1.00 24.70 ? 151  GLN G N   1 
ATOM   8795  C  CA  . GLN G  1 151 ? 33.900 55.847 127.118 1.00 25.94 ? 151  GLN G CA  1 
ATOM   8796  C  C   . GLN G  1 151 ? 34.827 55.811 125.910 1.00 28.77 ? 151  GLN G C   1 
ATOM   8797  O  O   . GLN G  1 151 ? 35.466 54.798 125.635 1.00 30.62 ? 151  GLN G O   1 
ATOM   8798  C  CB  . GLN G  1 151 ? 32.464 55.631 126.643 1.00 25.02 ? 151  GLN G CB  1 
ATOM   8799  C  CG  . GLN G  1 151 ? 32.319 54.509 125.624 1.00 24.36 ? 151  GLN G CG  1 
ATOM   8800  C  CD  . GLN G  1 151 ? 30.870 54.241 125.241 1.00 30.31 ? 151  GLN G CD  1 
ATOM   8801  O  OE1 . GLN G  1 151 ? 30.107 55.169 124.969 1.00 35.76 ? 151  GLN G OE1 1 
ATOM   8802  N  NE2 . GLN G  1 151 ? 30.488 52.967 125.207 1.00 27.88 ? 151  GLN G NE2 1 
ATOM   8803  N  N   . SER G  1 152 ? 34.889 56.931 125.193 1.00 28.74 ? 152  SER G N   1 
ATOM   8804  C  CA  . SER G  1 152 ? 35.720 57.052 124.003 1.00 29.02 ? 152  SER G CA  1 
ATOM   8805  C  C   . SER G  1 152 ? 37.200 56.908 124.285 1.00 31.60 ? 152  SER G C   1 
ATOM   8806  O  O   . SER G  1 152 ? 37.974 56.586 123.384 1.00 32.36 ? 152  SER G O   1 
ATOM   8807  C  CB  . SER G  1 152 ? 35.489 58.403 123.328 1.00 27.67 ? 152  SER G CB  1 
ATOM   8808  O  OG  . SER G  1 152 ? 34.182 58.480 122.796 1.00 31.15 ? 152  SER G OG  1 
ATOM   8809  N  N   . GLN G  1 153 ? 37.597 57.141 125.530 1.00 32.99 ? 153  GLN G N   1 
ATOM   8810  C  CA  . GLN G  1 153 ? 39.003 57.062 125.880 1.00 37.29 ? 153  GLN G CA  1 
ATOM   8811  C  C   . GLN G  1 153 ? 39.446 55.686 126.363 1.00 40.03 ? 153  GLN G C   1 
ATOM   8812  O  O   . GLN G  1 153 ? 40.624 55.470 126.628 1.00 40.75 ? 153  GLN G O   1 
ATOM   8813  C  CB  . GLN G  1 153 ? 39.334 58.122 126.931 1.00 38.95 ? 153  GLN G CB  1 
ATOM   8814  C  CG  . GLN G  1 153 ? 38.900 59.546 126.554 1.00 41.66 ? 153  GLN G CG  1 
ATOM   8815  C  CD  . GLN G  1 153 ? 39.436 60.007 125.203 1.00 40.38 ? 153  GLN G CD  1 
ATOM   8816  O  OE1 . GLN G  1 153 ? 40.607 59.800 124.883 1.00 41.19 ? 153  GLN G OE1 1 
ATOM   8817  N  NE2 . GLN G  1 153 ? 38.579 60.651 124.413 1.00 37.62 ? 153  GLN G NE2 1 
ATOM   8818  N  N   . MET G  1 154 ? 38.512 54.752 126.485 1.00 44.24 ? 154  MET G N   1 
ATOM   8819  C  CA  . MET G  1 154 ? 38.876 53.408 126.914 1.00 48.89 ? 154  MET G CA  1 
ATOM   8820  C  C   . MET G  1 154 ? 39.492 52.688 125.731 1.00 55.32 ? 154  MET G C   1 
ATOM   8821  O  O   . MET G  1 154 ? 38.981 52.791 124.613 1.00 58.59 ? 154  MET G O   1 
ATOM   8822  C  CB  . MET G  1 154 ? 37.655 52.601 127.329 1.00 44.88 ? 154  MET G CB  1 
ATOM   8823  C  CG  . MET G  1 154 ? 36.789 53.189 128.399 1.00 43.22 ? 154  MET G CG  1 
ATOM   8824  S  SD  . MET G  1 154 ? 35.592 51.909 128.852 1.00 42.18 ? 154  MET G SD  1 
ATOM   8825  C  CE  . MET G  1 154 ? 34.593 51.836 127.368 1.00 42.93 ? 154  MET G CE  1 
ATOM   8826  N  N   . ASP G  1 155 ? 40.576 51.956 125.970 1.00 62.45 ? 155  ASP G N   1 
ATOM   8827  C  CA  . ASP G  1 155 ? 41.227 51.186 124.908 1.00 68.93 ? 155  ASP G CA  1 
ATOM   8828  C  C   . ASP G  1 155 ? 41.845 52.057 123.801 1.00 70.05 ? 155  ASP G C   1 
ATOM   8829  O  O   . ASP G  1 155 ? 41.238 53.088 123.435 1.00 70.88 ? 155  ASP G O   1 
ATOM   8830  C  CB  . ASP G  1 155 ? 40.197 50.204 124.316 1.00 73.97 ? 155  ASP G CB  1 
ATOM   8831  C  CG  . ASP G  1 155 ? 40.747 49.385 123.163 1.00 80.11 ? 155  ASP G CG  1 
ATOM   8832  O  OD1 . ASP G  1 155 ? 40.953 49.953 122.068 1.00 82.83 ? 155  ASP G OD1 1 
ATOM   8833  O  OD2 . ASP G  1 155 ? 40.966 48.166 123.353 1.00 82.97 ? 155  ASP G OD2 1 
ATOM   8834  O  OXT . ASP G  1 155 ? 42.932 51.690 123.295 1.00 69.82 ? 155  ASP G OXT 1 
ATOM   8835  N  N   . MET H  1 1   ? 43.234 48.143 144.634 1.00 56.80 ? 1    MET H N   1 
ATOM   8836  C  CA  . MET H  1 1   ? 43.513 47.286 145.823 1.00 54.51 ? 1    MET H CA  1 
ATOM   8837  C  C   . MET H  1 1   ? 44.331 48.091 146.832 1.00 52.69 ? 1    MET H C   1 
ATOM   8838  O  O   . MET H  1 1   ? 45.401 48.610 146.500 1.00 53.44 ? 1    MET H O   1 
ATOM   8839  C  CB  . MET H  1 1   ? 44.279 46.035 145.383 1.00 58.04 ? 1    MET H CB  1 
ATOM   8840  C  CG  . MET H  1 1   ? 44.426 44.971 146.462 1.00 61.36 ? 1    MET H CG  1 
ATOM   8841  S  SD  . MET H  1 1   ? 45.196 43.434 145.872 1.00 63.57 ? 1    MET H SD  1 
ATOM   8842  C  CE  . MET H  1 1   ? 46.936 43.827 146.050 1.00 63.21 ? 1    MET H CE  1 
ATOM   8843  N  N   . LYS H  1 2   ? 43.824 48.206 148.057 1.00 48.87 ? 2    LYS H N   1 
ATOM   8844  C  CA  . LYS H  1 2   ? 44.513 48.967 149.092 1.00 45.69 ? 2    LYS H CA  1 
ATOM   8845  C  C   . LYS H  1 2   ? 45.762 48.257 149.583 1.00 42.94 ? 2    LYS H C   1 
ATOM   8846  O  O   . LYS H  1 2   ? 45.699 47.108 150.020 1.00 42.50 ? 2    LYS H O   1 
ATOM   8847  C  CB  . LYS H  1 2   ? 43.577 49.229 150.278 1.00 49.79 ? 2    LYS H CB  1 
ATOM   8848  C  CG  . LYS H  1 2   ? 43.128 50.689 150.420 1.00 54.85 ? 2    LYS H CG  1 
ATOM   8849  C  CD  . LYS H  1 2   ? 44.332 51.630 150.554 1.00 60.09 ? 2    LYS H CD  1 
ATOM   8850  C  CE  . LYS H  1 2   ? 43.915 53.105 150.572 1.00 61.92 ? 2    LYS H CE  1 
ATOM   8851  N  NZ  . LYS H  1 2   ? 45.095 54.021 150.508 1.00 58.21 ? 2    LYS H NZ  1 
ATOM   8852  N  N   . GLY H  1 3   ? 46.899 48.944 149.510 1.00 38.16 ? 3    GLY H N   1 
ATOM   8853  C  CA  . GLY H  1 3   ? 48.141 48.349 149.966 1.00 36.00 ? 3    GLY H CA  1 
ATOM   8854  C  C   . GLY H  1 3   ? 48.486 48.811 151.370 1.00 36.73 ? 3    GLY H C   1 
ATOM   8855  O  O   . GLY H  1 3   ? 47.712 49.536 151.994 1.00 38.44 ? 3    GLY H O   1 
ATOM   8856  N  N   . ASP H  1 4   ? 49.644 48.393 151.872 1.00 35.04 ? 4    ASP H N   1 
ATOM   8857  C  CA  . ASP H  1 4   ? 50.085 48.775 153.205 1.00 34.70 ? 4    ASP H CA  1 
ATOM   8858  C  C   . ASP H  1 4   ? 50.655 50.188 153.195 1.00 34.24 ? 4    ASP H C   1 
ATOM   8859  O  O   . ASP H  1 4   ? 51.615 50.472 152.476 1.00 35.38 ? 4    ASP H O   1 
ATOM   8860  C  CB  . ASP H  1 4   ? 51.159 47.812 153.700 1.00 40.02 ? 4    ASP H CB  1 
ATOM   8861  C  CG  . ASP H  1 4   ? 51.585 48.103 155.119 1.00 44.60 ? 4    ASP H CG  1 
ATOM   8862  O  OD1 . ASP H  1 4   ? 50.972 47.519 156.039 1.00 45.84 ? 4    ASP H OD1 1 
ATOM   8863  O  OD2 . ASP H  1 4   ? 52.521 48.921 155.310 1.00 44.84 ? 4    ASP H OD2 1 
ATOM   8864  N  N   . LYS H  1 5   ? 50.062 51.059 154.005 1.00 33.42 ? 5    LYS H N   1 
ATOM   8865  C  CA  . LYS H  1 5   ? 50.466 52.457 154.121 1.00 32.02 ? 5    LYS H CA  1 
ATOM   8866  C  C   . LYS H  1 5   ? 51.975 52.657 154.193 1.00 32.64 ? 5    LYS H C   1 
ATOM   8867  O  O   . LYS H  1 5   ? 52.521 53.561 153.556 1.00 32.41 ? 5    LYS H O   1 
ATOM   8868  C  CB  . LYS H  1 5   ? 49.828 53.075 155.362 1.00 35.31 ? 5    LYS H CB  1 
ATOM   8869  C  CG  . LYS H  1 5   ? 50.230 54.515 155.629 1.00 38.25 ? 5    LYS H CG  1 
ATOM   8870  C  CD  . LYS H  1 5   ? 49.647 54.997 156.940 1.00 40.03 ? 5    LYS H CD  1 
ATOM   8871  C  CE  . LYS H  1 5   ? 49.997 56.445 157.211 1.00 41.73 ? 5    LYS H CE  1 
ATOM   8872  N  NZ  . LYS H  1 5   ? 49.455 56.857 158.535 1.00 42.34 ? 5    LYS H NZ  1 
ATOM   8873  N  N   . ILE H  1 6   ? 52.654 51.823 154.971 1.00 31.74 ? 6    ILE H N   1 
ATOM   8874  C  CA  . ILE H  1 6   ? 54.097 51.957 155.098 1.00 31.46 ? 6    ILE H CA  1 
ATOM   8875  C  C   . ILE H  1 6   ? 54.817 51.409 153.863 1.00 28.82 ? 6    ILE H C   1 
ATOM   8876  O  O   . ILE H  1 6   ? 55.882 51.901 153.495 1.00 26.50 ? 6    ILE H O   1 
ATOM   8877  C  CB  . ILE H  1 6   ? 54.611 51.252 156.386 1.00 34.40 ? 6    ILE H CB  1 
ATOM   8878  C  CG1 . ILE H  1 6   ? 53.931 51.866 157.619 1.00 33.46 ? 6    ILE H CG1 1 
ATOM   8879  C  CG2 . ILE H  1 6   ? 56.130 51.405 156.507 1.00 31.49 ? 6    ILE H CG2 1 
ATOM   8880  C  CD1 . ILE H  1 6   ? 54.355 51.227 158.939 1.00 35.26 ? 6    ILE H CD1 1 
ATOM   8881  N  N   . VAL H  1 7   ? 54.243 50.393 153.222 1.00 27.89 ? 7    VAL H N   1 
ATOM   8882  C  CA  . VAL H  1 7   ? 54.865 49.851 152.020 1.00 28.26 ? 7    VAL H CA  1 
ATOM   8883  C  C   . VAL H  1 7   ? 54.902 50.996 151.014 1.00 29.88 ? 7    VAL H C   1 
ATOM   8884  O  O   . VAL H  1 7   ? 55.917 51.230 150.338 1.00 31.89 ? 7    VAL H O   1 
ATOM   8885  C  CB  . VAL H  1 7   ? 54.052 48.679 151.405 1.00 29.35 ? 7    VAL H CB  1 
ATOM   8886  C  CG1 . VAL H  1 7   ? 54.493 48.447 149.961 1.00 25.97 ? 7    VAL H CG1 1 
ATOM   8887  C  CG2 . VAL H  1 7   ? 54.273 47.391 152.213 1.00 24.04 ? 7    VAL H CG2 1 
ATOM   8888  N  N   . ILE H  1 8   ? 53.791 51.719 150.936 1.00 24.95 ? 8    ILE H N   1 
ATOM   8889  C  CA  . ILE H  1 8   ? 53.680 52.844 150.026 1.00 24.92 ? 8    ILE H CA  1 
ATOM   8890  C  C   . ILE H  1 8   ? 54.664 53.974 150.363 1.00 28.54 ? 8    ILE H C   1 
ATOM   8891  O  O   . ILE H  1 8   ? 55.230 54.601 149.455 1.00 27.82 ? 8    ILE H O   1 
ATOM   8892  C  CB  . ILE H  1 8   ? 52.247 53.380 150.025 1.00 23.59 ? 8    ILE H CB  1 
ATOM   8893  C  CG1 . ILE H  1 8   ? 51.306 52.294 149.501 1.00 22.80 ? 8    ILE H CG1 1 
ATOM   8894  C  CG2 . ILE H  1 8   ? 52.152 54.623 149.159 1.00 26.93 ? 8    ILE H CG2 1 
ATOM   8895  C  CD1 . ILE H  1 8   ? 49.855 52.654 149.600 1.00 19.66 ? 8    ILE H CD1 1 
ATOM   8896  N  N   . GLN H  1 9   ? 54.864 54.234 151.658 1.00 30.02 ? 9    GLN H N   1 
ATOM   8897  C  CA  . GLN H  1 9   ? 55.799 55.275 152.088 1.00 31.68 ? 9    GLN H CA  1 
ATOM   8898  C  C   . GLN H  1 9   ? 57.188 54.883 151.618 1.00 32.80 ? 9    GLN H C   1 
ATOM   8899  O  O   . GLN H  1 9   ? 57.985 55.734 151.214 1.00 33.61 ? 9    GLN H O   1 
ATOM   8900  C  CB  . GLN H  1 9   ? 55.822 55.411 153.612 1.00 34.43 ? 9    GLN H CB  1 
ATOM   8901  C  CG  . GLN H  1 9   ? 54.541 55.949 154.231 1.00 38.89 ? 9    GLN H CG  1 
ATOM   8902  C  CD  . GLN H  1 9   ? 54.628 56.066 155.750 1.00 39.55 ? 9    GLN H CD  1 
ATOM   8903  O  OE1 . GLN H  1 9   ? 53.634 56.371 156.422 1.00 37.94 ? 9    GLN H OE1 1 
ATOM   8904  N  NE2 . GLN H  1 9   ? 55.820 55.824 156.298 1.00 40.19 ? 9    GLN H NE2 1 
ATOM   8905  N  N   . HIS H  1 10  ? 57.482 53.587 151.685 1.00 32.68 ? 10   HIS H N   1 
ATOM   8906  C  CA  . HIS H  1 10  ? 58.782 53.089 151.245 1.00 33.08 ? 10   HIS H CA  1 
ATOM   8907  C  C   . HIS H  1 10  ? 58.895 53.288 149.734 1.00 30.85 ? 10   HIS H C   1 
ATOM   8908  O  O   . HIS H  1 10  ? 59.866 53.878 149.251 1.00 28.35 ? 10   HIS H O   1 
ATOM   8909  C  CB  . HIS H  1 10  ? 58.944 51.607 151.602 1.00 35.45 ? 10   HIS H CB  1 
ATOM   8910  C  CG  . HIS H  1 10  ? 59.480 51.372 152.980 1.00 37.52 ? 10   HIS H CG  1 
ATOM   8911  N  ND1 . HIS H  1 10  ? 60.761 51.723 153.350 1.00 39.14 ? 10   HIS H ND1 1 
ATOM   8912  C  CD2 . HIS H  1 10  ? 58.911 50.819 154.079 1.00 38.29 ? 10   HIS H CD2 1 
ATOM   8913  C  CE1 . HIS H  1 10  ? 60.958 51.398 154.616 1.00 36.29 ? 10   HIS H CE1 1 
ATOM   8914  N  NE2 . HIS H  1 10  ? 59.852 50.847 155.081 1.00 38.04 ? 10   HIS H NE2 1 
ATOM   8915  N  N   . LEU H  1 11  ? 57.896 52.795 149.002 1.00 26.49 ? 11   LEU H N   1 
ATOM   8916  C  CA  . LEU H  1 11  ? 57.857 52.938 147.557 1.00 24.16 ? 11   LEU H CA  1 
ATOM   8917  C  C   . LEU H  1 11  ? 58.043 54.408 147.156 1.00 24.87 ? 11   LEU H C   1 
ATOM   8918  O  O   . LEU H  1 11  ? 58.833 54.723 146.263 1.00 23.56 ? 11   LEU H O   1 
ATOM   8919  C  CB  . LEU H  1 11  ? 56.530 52.400 147.035 1.00 21.38 ? 11   LEU H CB  1 
ATOM   8920  C  CG  . LEU H  1 11  ? 56.495 50.970 146.478 1.00 25.38 ? 11   LEU H CG  1 
ATOM   8921  C  CD1 . LEU H  1 11  ? 57.685 50.141 146.936 1.00 19.37 ? 11   LEU H CD1 1 
ATOM   8922  C  CD2 . LEU H  1 11  ? 55.187 50.323 146.890 1.00 21.26 ? 11   LEU H CD2 1 
ATOM   8923  N  N   . ASN H  1 12  ? 57.323 55.313 147.813 1.00 26.98 ? 12   ASN H N   1 
ATOM   8924  C  CA  . ASN H  1 12  ? 57.469 56.734 147.502 1.00 28.79 ? 12   ASN H CA  1 
ATOM   8925  C  C   . ASN H  1 12  ? 58.913 57.169 147.731 1.00 31.19 ? 12   ASN H C   1 
ATOM   8926  O  O   . ASN H  1 12  ? 59.466 57.951 146.964 1.00 32.32 ? 12   ASN H O   1 
ATOM   8927  C  CB  . ASN H  1 12  ? 56.547 57.590 148.376 1.00 30.06 ? 12   ASN H CB  1 
ATOM   8928  C  CG  . ASN H  1 12  ? 55.205 57.888 147.712 1.00 33.44 ? 12   ASN H CG  1 
ATOM   8929  O  OD1 . ASN H  1 12  ? 55.140 58.189 146.522 1.00 36.47 ? 12   ASN H OD1 1 
ATOM   8930  N  ND2 . ASN H  1 12  ? 54.131 57.832 148.492 1.00 35.61 ? 12   ASN H ND2 1 
ATOM   8931  N  N   . LYS H  1 13  ? 59.535 56.667 148.791 1.00 34.90 ? 13   LYS H N   1 
ATOM   8932  C  CA  . LYS H  1 13  ? 60.908 57.052 149.058 1.00 35.19 ? 13   LYS H CA  1 
ATOM   8933  C  C   . LYS H  1 13  ? 61.848 56.599 147.941 1.00 33.09 ? 13   LYS H C   1 
ATOM   8934  O  O   . LYS H  1 13  ? 62.693 57.370 147.480 1.00 33.54 ? 13   LYS H O   1 
ATOM   8935  C  CB  . LYS H  1 13  ? 61.392 56.492 150.398 1.00 39.90 ? 13   LYS H CB  1 
ATOM   8936  C  CG  . LYS H  1 13  ? 62.772 57.035 150.760 1.00 46.69 ? 13   LYS H CG  1 
ATOM   8937  C  CD  . LYS H  1 13  ? 63.270 56.609 152.127 1.00 52.24 ? 13   LYS H CD  1 
ATOM   8938  C  CE  . LYS H  1 13  ? 64.549 57.375 152.471 1.00 53.78 ? 13   LYS H CE  1 
ATOM   8939  N  NZ  . LYS H  1 13  ? 65.166 56.966 153.769 1.00 55.08 ? 13   LYS H NZ  1 
ATOM   8940  N  N   . ILE H  1 14  ? 61.715 55.352 147.506 1.00 29.05 ? 14   ILE H N   1 
ATOM   8941  C  CA  . ILE H  1 14  ? 62.579 54.858 146.445 1.00 27.90 ? 14   ILE H CA  1 
ATOM   8942  C  C   . ILE H  1 14  ? 62.355 55.715 145.211 1.00 28.22 ? 14   ILE H C   1 
ATOM   8943  O  O   . ILE H  1 14  ? 63.302 56.053 144.497 1.00 29.87 ? 14   ILE H O   1 
ATOM   8944  C  CB  . ILE H  1 14  ? 62.288 53.382 146.094 1.00 26.90 ? 14   ILE H CB  1 
ATOM   8945  C  CG1 . ILE H  1 14  ? 62.370 52.520 147.357 1.00 25.30 ? 14   ILE H CG1 1 
ATOM   8946  C  CG2 . ILE H  1 14  ? 63.315 52.880 145.073 1.00 26.53 ? 14   ILE H CG2 1 
ATOM   8947  C  CD1 . ILE H  1 14  ? 63.710 52.593 148.053 1.00 21.00 ? 14   ILE H CD1 1 
ATOM   8948  N  N   . LEU H  1 15  ? 61.098 56.068 144.970 1.00 26.01 ? 15   LEU H N   1 
ATOM   8949  C  CA  . LEU H  1 15  ? 60.740 56.908 143.835 1.00 26.55 ? 15   LEU H CA  1 
ATOM   8950  C  C   . LEU H  1 15  ? 61.530 58.208 143.882 1.00 28.63 ? 15   LEU H C   1 
ATOM   8951  O  O   . LEU H  1 15  ? 62.090 58.650 142.871 1.00 28.32 ? 15   LEU H O   1 
ATOM   8952  C  CB  . LEU H  1 15  ? 59.243 57.224 143.862 1.00 28.38 ? 15   LEU H CB  1 
ATOM   8953  C  CG  . LEU H  1 15  ? 58.722 58.166 142.773 1.00 29.71 ? 15   LEU H CG  1 
ATOM   8954  C  CD1 . LEU H  1 15  ? 59.098 57.625 141.390 1.00 28.70 ? 15   LEU H CD1 1 
ATOM   8955  C  CD2 . LEU H  1 15  ? 57.213 58.304 142.906 1.00 27.09 ? 15   LEU H CD2 1 
ATOM   8956  N  N   . GLY H  1 16  ? 61.564 58.821 145.064 1.00 28.89 ? 16   GLY H N   1 
ATOM   8957  C  CA  . GLY H  1 16  ? 62.294 60.064 145.234 1.00 29.99 ? 16   GLY H CA  1 
ATOM   8958  C  C   . GLY H  1 16  ? 63.750 59.905 144.844 1.00 32.48 ? 16   GLY H C   1 
ATOM   8959  O  O   . GLY H  1 16  ? 64.339 60.797 144.218 1.00 33.25 ? 16   GLY H O   1 
ATOM   8960  N  N   . ASN H  1 17  ? 64.335 58.766 145.214 1.00 32.35 ? 17   ASN H N   1 
ATOM   8961  C  CA  . ASN H  1 17  ? 65.733 58.493 144.886 1.00 33.77 ? 17   ASN H CA  1 
ATOM   8962  C  C   . ASN H  1 17  ? 65.866 58.375 143.372 1.00 31.35 ? 17   ASN H C   1 
ATOM   8963  O  O   . ASN H  1 17  ? 66.753 58.984 142.779 1.00 31.50 ? 17   ASN H O   1 
ATOM   8964  C  CB  . ASN H  1 17  ? 66.222 57.199 145.564 1.00 33.66 ? 17   ASN H CB  1 
ATOM   8965  C  CG  . ASN H  1 17  ? 66.398 57.346 147.083 1.00 34.26 ? 17   ASN H CG  1 
ATOM   8966  O  OD1 . ASN H  1 17  ? 66.509 56.349 147.800 1.00 35.34 ? 17   ASN H OD1 1 
ATOM   8967  N  ND2 . ASN H  1 17  ? 66.431 58.585 147.571 1.00 30.73 ? 17   ASN H ND2 1 
ATOM   8968  N  N   . GLU H  1 18  ? 64.979 57.603 142.751 1.00 28.55 ? 18   GLU H N   1 
ATOM   8969  C  CA  . GLU H  1 18  ? 65.014 57.442 141.306 1.00 30.05 ? 18   GLU H CA  1 
ATOM   8970  C  C   . GLU H  1 18  ? 64.924 58.795 140.615 1.00 28.80 ? 18   GLU H C   1 
ATOM   8971  O  O   . GLU H  1 18  ? 65.678 59.080 139.678 1.00 25.68 ? 18   GLU H O   1 
ATOM   8972  C  CB  . GLU H  1 18  ? 63.865 56.552 140.823 1.00 28.90 ? 18   GLU H CB  1 
ATOM   8973  C  CG  . GLU H  1 18  ? 63.903 55.128 141.345 1.00 32.29 ? 18   GLU H CG  1 
ATOM   8974  C  CD  . GLU H  1 18  ? 65.198 54.410 141.013 1.00 35.27 ? 18   GLU H CD  1 
ATOM   8975  O  OE1 . GLU H  1 18  ? 65.889 54.835 140.065 1.00 39.45 ? 18   GLU H OE1 1 
ATOM   8976  O  OE2 . GLU H  1 18  ? 65.518 53.410 141.690 1.00 36.41 ? 18   GLU H OE2 1 
ATOM   8977  N  N   . LEU H  1 19  ? 63.997 59.636 141.065 1.00 30.54 ? 19   LEU H N   1 
ATOM   8978  C  CA  . LEU H  1 19  ? 63.820 60.945 140.441 1.00 30.25 ? 19   LEU H CA  1 
ATOM   8979  C  C   . LEU H  1 19  ? 65.100 61.771 140.458 1.00 30.67 ? 19   LEU H C   1 
ATOM   8980  O  O   . LEU H  1 19  ? 65.400 62.470 139.486 1.00 32.83 ? 19   LEU H O   1 
ATOM   8981  C  CB  . LEU H  1 19  ? 62.662 61.697 141.101 1.00 27.62 ? 19   LEU H CB  1 
ATOM   8982  C  CG  . LEU H  1 19  ? 61.296 61.033 140.855 1.00 28.99 ? 19   LEU H CG  1 
ATOM   8983  C  CD1 . LEU H  1 19  ? 60.204 61.889 141.450 1.00 27.45 ? 19   LEU H CD1 1 
ATOM   8984  C  CD2 . LEU H  1 19  ? 61.054 60.849 139.357 1.00 24.42 ? 19   LEU H CD2 1 
ATOM   8985  N  N   . ILE H  1 20  ? 65.863 61.679 141.544 1.00 29.27 ? 20   ILE H N   1 
ATOM   8986  C  CA  . ILE H  1 20  ? 67.128 62.404 141.634 1.00 29.57 ? 20   ILE H CA  1 
ATOM   8987  C  C   . ILE H  1 20  ? 68.076 61.889 140.541 1.00 28.61 ? 20   ILE H C   1 
ATOM   8988  O  O   . ILE H  1 20  ? 68.547 62.657 139.696 1.00 29.22 ? 20   ILE H O   1 
ATOM   8989  C  CB  . ILE H  1 20  ? 67.798 62.200 143.020 1.00 31.86 ? 20   ILE H CB  1 
ATOM   8990  C  CG1 . ILE H  1 20  ? 66.935 62.826 144.122 1.00 34.60 ? 20   ILE H CG1 1 
ATOM   8991  C  CG2 . ILE H  1 20  ? 69.177 62.835 143.039 1.00 31.57 ? 20   ILE H CG2 1 
ATOM   8992  C  CD1 . ILE H  1 20  ? 67.411 62.499 145.539 1.00 30.96 ? 20   ILE H CD1 1 
ATOM   8993  N  N   . ALA H  1 21  ? 68.341 60.586 140.558 1.00 27.84 ? 21   ALA H N   1 
ATOM   8994  C  CA  . ALA H  1 21  ? 69.230 59.961 139.583 1.00 27.71 ? 21   ALA H CA  1 
ATOM   8995  C  C   . ALA H  1 21  ? 68.889 60.353 138.142 1.00 29.60 ? 21   ALA H C   1 
ATOM   8996  O  O   . ALA H  1 21  ? 69.784 60.700 137.363 1.00 30.48 ? 21   ALA H O   1 
ATOM   8997  C  CB  . ALA H  1 21  ? 69.187 58.447 139.736 1.00 24.26 ? 21   ALA H CB  1 
ATOM   8998  N  N   . ILE H  1 22  ? 67.606 60.299 137.785 1.00 27.85 ? 22   ILE H N   1 
ATOM   8999  C  CA  . ILE H  1 22  ? 67.186 60.663 136.435 1.00 24.77 ? 22   ILE H CA  1 
ATOM   9000  C  C   . ILE H  1 22  ? 67.853 61.964 135.995 1.00 27.16 ? 22   ILE H C   1 
ATOM   9001  O  O   . ILE H  1 22  ? 68.572 61.994 134.989 1.00 27.20 ? 22   ILE H O   1 
ATOM   9002  C  CB  . ILE H  1 22  ? 65.681 60.912 136.346 1.00 21.43 ? 22   ILE H CB  1 
ATOM   9003  C  CG1 . ILE H  1 22  ? 64.903 59.650 136.667 1.00 20.46 ? 22   ILE H CG1 1 
ATOM   9004  C  CG2 . ILE H  1 22  ? 65.326 61.406 134.960 1.00 17.52 ? 22   ILE H CG2 1 
ATOM   9005  C  CD1 . ILE H  1 22  ? 63.409 59.906 136.733 1.00 22.00 ? 22   ILE H CD1 1 
ATOM   9006  N  N   . ASN H  1 23  ? 67.599 63.034 136.753 1.00 26.74 ? 23   ASN H N   1 
ATOM   9007  C  CA  . ASN H  1 23  ? 68.150 64.350 136.442 1.00 27.86 ? 23   ASN H CA  1 
ATOM   9008  C  C   . ASN H  1 23  ? 69.678 64.357 136.480 1.00 30.04 ? 23   ASN H C   1 
ATOM   9009  O  O   . ASN H  1 23  ? 70.326 64.880 135.570 1.00 30.16 ? 23   ASN H O   1 
ATOM   9010  C  CB  . ASN H  1 23  ? 67.627 65.401 137.424 1.00 28.48 ? 23   ASN H CB  1 
ATOM   9011  C  CG  . ASN H  1 23  ? 66.127 65.652 137.291 1.00 30.19 ? 23   ASN H CG  1 
ATOM   9012  O  OD1 . ASN H  1 23  ? 65.379 64.810 136.781 1.00 27.18 ? 23   ASN H OD1 1 
ATOM   9013  N  ND2 . ASN H  1 23  ? 65.678 66.810 137.783 1.00 26.22 ? 23   ASN H ND2 1 
ATOM   9014  N  N   . GLN H  1 24  ? 70.262 63.781 137.527 1.00 30.49 ? 24   GLN H N   1 
ATOM   9015  C  CA  . GLN H  1 24  ? 71.715 63.777 137.621 1.00 30.21 ? 24   GLN H CA  1 
ATOM   9016  C  C   . GLN H  1 24  ? 72.327 63.088 136.404 1.00 30.66 ? 24   GLN H C   1 
ATOM   9017  O  O   . GLN H  1 24  ? 73.191 63.653 135.728 1.00 30.39 ? 24   GLN H O   1 
ATOM   9018  C  CB  . GLN H  1 24  ? 72.170 63.099 138.915 1.00 30.21 ? 24   GLN H CB  1 
ATOM   9019  C  CG  . GLN H  1 24  ? 73.685 63.119 139.141 1.00 30.87 ? 24   GLN H CG  1 
ATOM   9020  C  CD  . GLN H  1 24  ? 74.070 62.703 140.551 1.00 29.70 ? 24   GLN H CD  1 
ATOM   9021  O  OE1 . GLN H  1 24  ? 75.149 62.163 140.781 1.00 31.93 ? 24   GLN H OE1 1 
ATOM   9022  N  NE2 . GLN H  1 24  ? 73.191 62.970 141.504 1.00 28.86 ? 24   GLN H NE2 1 
ATOM   9023  N  N   . TYR H  1 25  ? 71.864 61.881 136.104 1.00 30.98 ? 25   TYR H N   1 
ATOM   9024  C  CA  . TYR H  1 25  ? 72.398 61.154 134.959 1.00 31.67 ? 25   TYR H CA  1 
ATOM   9025  C  C   . TYR H  1 25  ? 72.085 61.848 133.629 1.00 31.59 ? 25   TYR H C   1 
ATOM   9026  O  O   . TYR H  1 25  ? 72.882 61.771 132.695 1.00 30.28 ? 25   TYR H O   1 
ATOM   9027  C  CB  . TYR H  1 25  ? 71.879 59.710 134.951 1.00 28.60 ? 25   TYR H CB  1 
ATOM   9028  C  CG  . TYR H  1 25  ? 72.227 58.953 136.216 1.00 31.80 ? 25   TYR H CG  1 
ATOM   9029  C  CD1 . TYR H  1 25  ? 73.018 59.546 137.206 1.00 35.32 ? 25   TYR H CD1 1 
ATOM   9030  C  CD2 . TYR H  1 25  ? 71.731 57.666 136.450 1.00 31.27 ? 25   TYR H CD2 1 
ATOM   9031  C  CE1 . TYR H  1 25  ? 73.304 58.889 138.403 1.00 35.23 ? 25   TYR H CE1 1 
ATOM   9032  C  CE2 . TYR H  1 25  ? 72.012 56.994 137.644 1.00 35.19 ? 25   TYR H CE2 1 
ATOM   9033  C  CZ  . TYR H  1 25  ? 72.800 57.619 138.618 1.00 36.76 ? 25   TYR H CZ  1 
ATOM   9034  O  OH  . TYR H  1 25  ? 73.081 56.996 139.810 1.00 35.04 ? 25   TYR H OH  1 
ATOM   9035  N  N   . PHE H  1 26  ? 70.951 62.540 133.536 1.00 30.30 ? 26   PHE H N   1 
ATOM   9036  C  CA  . PHE H  1 26  ? 70.642 63.208 132.282 1.00 30.46 ? 26   PHE H CA  1 
ATOM   9037  C  C   . PHE H  1 26  ? 71.502 64.446 132.072 1.00 31.47 ? 26   PHE H C   1 
ATOM   9038  O  O   . PHE H  1 26  ? 71.864 64.769 130.942 1.00 35.47 ? 26   PHE H O   1 
ATOM   9039  C  CB  . PHE H  1 26  ? 69.178 63.607 132.188 1.00 29.17 ? 26   PHE H CB  1 
ATOM   9040  C  CG  . PHE H  1 26  ? 68.710 63.757 130.776 1.00 27.67 ? 26   PHE H CG  1 
ATOM   9041  C  CD1 . PHE H  1 26  ? 68.247 62.649 130.067 1.00 30.19 ? 26   PHE H CD1 1 
ATOM   9042  C  CD2 . PHE H  1 26  ? 68.836 64.975 130.116 1.00 27.94 ? 26   PHE H CD2 1 
ATOM   9043  C  CE1 . PHE H  1 26  ? 67.921 62.750 128.708 1.00 33.19 ? 26   PHE H CE1 1 
ATOM   9044  C  CE2 . PHE H  1 26  ? 68.517 65.095 128.763 1.00 31.38 ? 26   PHE H CE2 1 
ATOM   9045  C  CZ  . PHE H  1 26  ? 68.059 63.980 128.051 1.00 33.40 ? 26   PHE H CZ  1 
ATOM   9046  N  N   . LEU H  1 27  ? 71.826 65.147 133.149 1.00 30.12 ? 27   LEU H N   1 
ATOM   9047  C  CA  . LEU H  1 27  ? 72.674 66.325 133.032 1.00 29.59 ? 27   LEU H CA  1 
ATOM   9048  C  C   . LEU H  1 27  ? 74.110 65.867 132.753 1.00 28.75 ? 27   LEU H C   1 
ATOM   9049  O  O   . LEU H  1 27  ? 74.776 66.392 131.858 1.00 29.48 ? 27   LEU H O   1 
ATOM   9050  C  CB  . LEU H  1 27  ? 72.624 67.158 134.319 1.00 31.04 ? 27   LEU H CB  1 
ATOM   9051  C  CG  . LEU H  1 27  ? 73.543 68.386 134.407 1.00 28.65 ? 27   LEU H CG  1 
ATOM   9052  C  CD1 . LEU H  1 27  ? 73.348 69.277 133.195 1.00 28.24 ? 27   LEU H CD1 1 
ATOM   9053  C  CD2 . LEU H  1 27  ? 73.228 69.156 135.679 1.00 29.67 ? 27   LEU H CD2 1 
ATOM   9054  N  N   . HIS H  1 28  ? 74.586 64.892 133.521 1.00 26.64 ? 28   HIS H N   1 
ATOM   9055  C  CA  . HIS H  1 28  ? 75.936 64.374 133.315 1.00 26.42 ? 28   HIS H CA  1 
ATOM   9056  C  C   . HIS H  1 28  ? 76.093 63.881 131.875 1.00 27.91 ? 28   HIS H C   1 
ATOM   9057  O  O   . HIS H  1 28  ? 77.131 64.101 131.239 1.00 29.06 ? 28   HIS H O   1 
ATOM   9058  C  CB  . HIS H  1 28  ? 76.228 63.208 134.267 1.00 25.15 ? 28   HIS H CB  1 
ATOM   9059  C  CG  . HIS H  1 28  ? 76.598 63.628 135.655 1.00 24.91 ? 28   HIS H CG  1 
ATOM   9060  N  ND1 . HIS H  1 28  ? 76.952 64.922 135.974 1.00 23.25 ? 28   HIS H ND1 1 
ATOM   9061  C  CD2 . HIS H  1 28  ? 76.707 62.915 136.801 1.00 23.62 ? 28   HIS H CD2 1 
ATOM   9062  C  CE1 . HIS H  1 28  ? 77.263 64.989 137.256 1.00 23.85 ? 28   HIS H CE1 1 
ATOM   9063  N  NE2 . HIS H  1 28  ? 77.123 63.785 137.780 1.00 28.57 ? 28   HIS H NE2 1 
ATOM   9064  N  N   . ALA H  1 29  ? 75.055 63.212 131.375 1.00 26.17 ? 29   ALA H N   1 
ATOM   9065  C  CA  . ALA H  1 29  ? 75.048 62.668 130.025 1.00 25.20 ? 29   ALA H CA  1 
ATOM   9066  C  C   . ALA H  1 29  ? 75.279 63.735 128.971 1.00 27.38 ? 29   ALA H C   1 
ATOM   9067  O  O   . ALA H  1 29  ? 76.160 63.599 128.119 1.00 28.73 ? 29   ALA H O   1 
ATOM   9068  C  CB  . ALA H  1 29  ? 73.734 61.973 129.754 1.00 24.57 ? 29   ALA H CB  1 
ATOM   9069  N  N   . ARG H  1 30  ? 74.482 64.794 129.016 1.00 27.35 ? 30   ARG H N   1 
ATOM   9070  C  CA  . ARG H  1 30  ? 74.631 65.852 128.035 1.00 27.36 ? 30   ARG H CA  1 
ATOM   9071  C  C   . ARG H  1 30  ? 75.952 66.579 128.200 1.00 26.47 ? 30   ARG H C   1 
ATOM   9072  O  O   . ARG H  1 30  ? 76.460 67.175 127.253 1.00 29.02 ? 30   ARG H O   1 
ATOM   9073  C  CB  . ARG H  1 30  ? 73.460 66.835 128.123 1.00 27.92 ? 30   ARG H CB  1 
ATOM   9074  C  CG  . ARG H  1 30  ? 72.109 66.203 127.792 1.00 32.04 ? 30   ARG H CG  1 
ATOM   9075  C  CD  . ARG H  1 30  ? 72.234 65.188 126.663 1.00 30.14 ? 30   ARG H CD  1 
ATOM   9076  N  NE  . ARG H  1 30  ? 70.944 64.656 126.233 1.00 36.09 ? 30   ARG H NE  1 
ATOM   9077  C  CZ  . ARG H  1 30  ? 70.802 63.530 125.534 1.00 37.72 ? 30   ARG H CZ  1 
ATOM   9078  N  NH1 . ARG H  1 30  ? 71.876 62.820 125.198 1.00 34.13 ? 30   ARG H NH1 1 
ATOM   9079  N  NH2 . ARG H  1 30  ? 69.596 63.118 125.158 1.00 31.90 ? 30   ARG H NH2 1 
ATOM   9080  N  N   . MET H  1 31  ? 76.517 66.528 129.399 1.00 26.30 ? 31   MET H N   1 
ATOM   9081  C  CA  . MET H  1 31  ? 77.795 67.185 129.640 1.00 25.90 ? 31   MET H CA  1 
ATOM   9082  C  C   . MET H  1 31  ? 78.912 66.425 128.935 1.00 26.58 ? 31   MET H C   1 
ATOM   9083  O  O   . MET H  1 31  ? 79.728 67.032 128.231 1.00 24.50 ? 31   MET H O   1 
ATOM   9084  C  CB  . MET H  1 31  ? 78.061 67.285 131.138 1.00 24.15 ? 31   MET H CB  1 
ATOM   9085  C  CG  . MET H  1 31  ? 77.197 68.329 131.805 1.00 21.83 ? 31   MET H CG  1 
ATOM   9086  S  SD  . MET H  1 31  ? 77.418 68.363 133.588 1.00 32.64 ? 31   MET H SD  1 
ATOM   9087  C  CE  . MET H  1 31  ? 79.158 68.789 133.723 1.00 24.61 ? 31   MET H CE  1 
ATOM   9088  N  N   . TYR H  1 32  ? 78.946 65.103 129.117 1.00 26.48 ? 32   TYR H N   1 
ATOM   9089  C  CA  . TYR H  1 32  ? 79.947 64.273 128.454 1.00 28.61 ? 32   TYR H CA  1 
ATOM   9090  C  C   . TYR H  1 32  ? 79.870 64.542 126.953 1.00 30.85 ? 32   TYR H C   1 
ATOM   9091  O  O   . TYR H  1 32  ? 80.885 64.809 126.304 1.00 30.64 ? 32   TYR H O   1 
ATOM   9092  C  CB  . TYR H  1 32  ? 79.681 62.787 128.696 1.00 28.67 ? 32   TYR H CB  1 
ATOM   9093  C  CG  . TYR H  1 32  ? 80.008 62.300 130.087 1.00 31.13 ? 32   TYR H CG  1 
ATOM   9094  C  CD1 . TYR H  1 32  ? 79.041 61.662 130.863 1.00 30.88 ? 32   TYR H CD1 1 
ATOM   9095  C  CD2 . TYR H  1 32  ? 81.282 62.469 130.630 1.00 31.32 ? 32   TYR H CD2 1 
ATOM   9096  C  CE1 . TYR H  1 32  ? 79.329 61.208 132.144 1.00 29.54 ? 32   TYR H CE1 1 
ATOM   9097  C  CE2 . TYR H  1 32  ? 81.582 62.011 131.919 1.00 31.45 ? 32   TYR H CE2 1 
ATOM   9098  C  CZ  . TYR H  1 32  ? 80.593 61.383 132.665 1.00 29.13 ? 32   TYR H CZ  1 
ATOM   9099  O  OH  . TYR H  1 32  ? 80.853 60.930 133.930 1.00 25.41 ? 32   TYR H OH  1 
ATOM   9100  N  N   . GLU H  1 33  ? 78.656 64.474 126.413 1.00 31.64 ? 33   GLU H N   1 
ATOM   9101  C  CA  . GLU H  1 33  ? 78.426 64.703 124.993 1.00 33.91 ? 33   GLU H CA  1 
ATOM   9102  C  C   . GLU H  1 33  ? 78.849 66.095 124.545 1.00 32.72 ? 33   GLU H C   1 
ATOM   9103  O  O   . GLU H  1 33  ? 79.322 66.270 123.430 1.00 34.34 ? 33   GLU H O   1 
ATOM   9104  C  CB  . GLU H  1 33  ? 76.956 64.437 124.657 1.00 37.98 ? 33   GLU H CB  1 
ATOM   9105  C  CG  . GLU H  1 33  ? 76.592 62.956 124.836 1.00 46.36 ? 33   GLU H CG  1 
ATOM   9106  C  CD  . GLU H  1 33  ? 75.109 62.650 124.686 1.00 50.51 ? 33   GLU H CD  1 
ATOM   9107  O  OE1 . GLU H  1 33  ? 74.731 61.470 124.865 1.00 51.79 ? 33   GLU H OE1 1 
ATOM   9108  O  OE2 . GLU H  1 33  ? 74.322 63.577 124.392 1.00 56.16 ? 33   GLU H OE2 1 
ATOM   9109  N  N   . ASP H  1 34  ? 78.705 67.083 125.418 1.00 32.30 ? 34   ASP H N   1 
ATOM   9110  C  CA  . ASP H  1 34  ? 79.105 68.442 125.078 1.00 29.78 ? 34   ASP H CA  1 
ATOM   9111  C  C   . ASP H  1 34  ? 80.622 68.547 125.028 1.00 30.27 ? 34   ASP H C   1 
ATOM   9112  O  O   . ASP H  1 34  ? 81.167 69.460 124.405 1.00 31.66 ? 34   ASP H O   1 
ATOM   9113  C  CB  . ASP H  1 34  ? 78.565 69.428 126.112 1.00 32.81 ? 34   ASP H CB  1 
ATOM   9114  C  CG  . ASP H  1 34  ? 79.132 70.824 125.941 1.00 36.78 ? 34   ASP H CG  1 
ATOM   9115  O  OD1 . ASP H  1 34  ? 78.982 71.395 124.836 1.00 38.95 ? 34   ASP H OD1 1 
ATOM   9116  O  OD2 . ASP H  1 34  ? 79.725 71.351 126.913 1.00 39.12 ? 34   ASP H OD2 1 
ATOM   9117  N  N   . TRP H  1 35  ? 81.305 67.619 125.693 1.00 29.20 ? 35   TRP H N   1 
ATOM   9118  C  CA  . TRP H  1 35  ? 82.762 67.628 125.716 1.00 26.21 ? 35   TRP H CA  1 
ATOM   9119  C  C   . TRP H  1 35  ? 83.349 66.772 124.614 1.00 24.89 ? 35   TRP H C   1 
ATOM   9120  O  O   . TRP H  1 35  ? 84.559 66.766 124.414 1.00 25.20 ? 35   TRP H O   1 
ATOM   9121  C  CB  . TRP H  1 35  ? 83.304 67.124 127.056 1.00 25.93 ? 35   TRP H CB  1 
ATOM   9122  C  CG  . TRP H  1 35  ? 83.168 68.092 128.193 1.00 25.61 ? 35   TRP H CG  1 
ATOM   9123  C  CD1 . TRP H  1 35  ? 83.300 69.448 128.138 1.00 25.63 ? 35   TRP H CD1 1 
ATOM   9124  C  CD2 . TRP H  1 35  ? 82.907 67.767 129.564 1.00 22.69 ? 35   TRP H CD2 1 
ATOM   9125  N  NE1 . TRP H  1 35  ? 83.136 69.992 129.394 1.00 24.28 ? 35   TRP H NE1 1 
ATOM   9126  C  CE2 . TRP H  1 35  ? 82.893 68.981 130.286 1.00 22.74 ? 35   TRP H CE2 1 
ATOM   9127  C  CE3 . TRP H  1 35  ? 82.686 66.569 130.252 1.00 23.19 ? 35   TRP H CE3 1 
ATOM   9128  C  CZ2 . TRP H  1 35  ? 82.664 69.032 131.664 1.00 20.58 ? 35   TRP H CZ2 1 
ATOM   9129  C  CZ3 . TRP H  1 35  ? 82.461 66.619 131.625 1.00 25.83 ? 35   TRP H CZ3 1 
ATOM   9130  C  CH2 . TRP H  1 35  ? 82.452 67.847 132.315 1.00 23.30 ? 35   TRP H CH2 1 
ATOM   9131  N  N   . GLY H  1 36  ? 82.499 66.042 123.904 1.00 23.92 ? 36   GLY H N   1 
ATOM   9132  C  CA  . GLY H  1 36  ? 82.996 65.194 122.837 1.00 24.81 ? 36   GLY H CA  1 
ATOM   9133  C  C   . GLY H  1 36  ? 83.213 63.758 123.265 1.00 26.88 ? 36   GLY H C   1 
ATOM   9134  O  O   . GLY H  1 36  ? 83.633 62.925 122.458 1.00 27.88 ? 36   GLY H O   1 
ATOM   9135  N  N   . LEU H  1 37  ? 82.933 63.463 124.533 1.00 29.54 ? 37   LEU H N   1 
ATOM   9136  C  CA  . LEU H  1 37  ? 83.085 62.108 125.055 1.00 31.50 ? 37   LEU H CA  1 
ATOM   9137  C  C   . LEU H  1 37  ? 81.842 61.272 124.736 1.00 31.54 ? 37   LEU H C   1 
ATOM   9138  O  O   . LEU H  1 37  ? 81.064 60.925 125.627 1.00 31.09 ? 37   LEU H O   1 
ATOM   9139  C  CB  . LEU H  1 37  ? 83.330 62.146 126.572 1.00 33.17 ? 37   LEU H CB  1 
ATOM   9140  C  CG  . LEU H  1 37  ? 84.689 62.644 127.108 1.00 35.69 ? 37   LEU H CG  1 
ATOM   9141  C  CD1 . LEU H  1 37  ? 85.831 62.078 126.259 1.00 34.64 ? 37   LEU H CD1 1 
ATOM   9142  C  CD2 . LEU H  1 37  ? 84.741 64.149 127.083 1.00 38.47 ? 37   LEU H CD2 1 
ATOM   9143  N  N   . GLU H  1 38  ? 81.680 60.939 123.457 1.00 33.34 ? 38   GLU H N   1 
ATOM   9144  C  CA  . GLU H  1 38  ? 80.530 60.169 122.971 1.00 38.43 ? 38   GLU H CA  1 
ATOM   9145  C  C   . GLU H  1 38  ? 80.233 58.850 123.682 1.00 36.77 ? 38   GLU H C   1 
ATOM   9146  O  O   . GLU H  1 38  ? 79.076 58.557 123.999 1.00 35.68 ? 38   GLU H O   1 
ATOM   9147  C  CB  . GLU H  1 38  ? 80.677 59.910 121.467 1.00 44.39 ? 38   GLU H CB  1 
ATOM   9148  C  CG  . GLU H  1 38  ? 80.473 61.159 120.607 1.00 55.76 ? 38   GLU H CG  1 
ATOM   9149  C  CD  . GLU H  1 38  ? 80.884 60.964 119.148 1.00 61.64 ? 38   GLU H CD  1 
ATOM   9150  O  OE1 . GLU H  1 38  ? 82.105 60.860 118.876 1.00 62.45 ? 38   GLU H OE1 1 
ATOM   9151  O  OE2 . GLU H  1 38  ? 79.986 60.915 118.276 1.00 63.58 ? 38   GLU H OE2 1 
ATOM   9152  N  N   . LYS H  1 39  ? 81.268 58.050 123.916 1.00 35.59 ? 39   LYS H N   1 
ATOM   9153  C  CA  . LYS H  1 39  ? 81.114 56.761 124.588 1.00 34.08 ? 39   LYS H CA  1 
ATOM   9154  C  C   . LYS H  1 39  ? 80.400 56.976 125.934 1.00 32.86 ? 39   LYS H C   1 
ATOM   9155  O  O   . LYS H  1 39  ? 79.306 56.453 126.172 1.00 30.71 ? 39   LYS H O   1 
ATOM   9156  C  CB  . LYS H  1 39  ? 82.497 56.137 124.814 1.00 36.75 ? 39   LYS H CB  1 
ATOM   9157  C  CG  . LYS H  1 39  ? 82.523 54.624 124.788 1.00 38.50 ? 39   LYS H CG  1 
ATOM   9158  C  CD  . LYS H  1 39  ? 82.631 54.092 123.370 1.00 42.41 ? 39   LYS H CD  1 
ATOM   9159  C  CE  . LYS H  1 39  ? 82.122 52.656 123.282 1.00 45.95 ? 39   LYS H CE  1 
ATOM   9160  N  NZ  . LYS H  1 39  ? 82.651 51.778 124.371 1.00 47.82 ? 39   LYS H NZ  1 
ATOM   9161  N  N   . LEU H  1 40  ? 81.028 57.767 126.799 1.00 32.46 ? 40   LEU H N   1 
ATOM   9162  C  CA  . LEU H  1 40  ? 80.496 58.097 128.124 1.00 31.37 ? 40   LEU H CA  1 
ATOM   9163  C  C   . LEU H  1 40  ? 79.090 58.698 128.084 1.00 30.00 ? 40   LEU H C   1 
ATOM   9164  O  O   . LEU H  1 40  ? 78.214 58.295 128.848 1.00 29.15 ? 40   LEU H O   1 
ATOM   9165  C  CB  . LEU H  1 40  ? 81.433 59.090 128.809 1.00 31.97 ? 40   LEU H CB  1 
ATOM   9166  C  CG  . LEU H  1 40  ? 82.193 58.683 130.064 1.00 28.43 ? 40   LEU H CG  1 
ATOM   9167  C  CD1 . LEU H  1 40  ? 82.680 57.259 129.981 1.00 30.89 ? 40   LEU H CD1 1 
ATOM   9168  C  CD2 . LEU H  1 40  ? 83.348 59.637 130.224 1.00 28.44 ? 40   LEU H CD2 1 
ATOM   9169  N  N   . GLY H  1 41  ? 78.884 59.681 127.214 1.00 28.50 ? 41   GLY H N   1 
ATOM   9170  C  CA  . GLY H  1 41  ? 77.576 60.303 127.118 1.00 26.43 ? 41   GLY H CA  1 
ATOM   9171  C  C   . GLY H  1 41  ? 76.475 59.300 126.823 1.00 29.62 ? 41   GLY H C   1 
ATOM   9172  O  O   . GLY H  1 41  ? 75.416 59.317 127.452 1.00 29.28 ? 41   GLY H O   1 
ATOM   9173  N  N   . LYS H  1 42  ? 76.724 58.414 125.865 1.00 31.69 ? 42   LYS H N   1 
ATOM   9174  C  CA  . LYS H  1 42  ? 75.740 57.411 125.485 1.00 32.63 ? 42   LYS H CA  1 
ATOM   9175  C  C   . LYS H  1 42  ? 75.412 56.464 126.641 1.00 31.67 ? 42   LYS H C   1 
ATOM   9176  O  O   . LYS H  1 42  ? 74.268 56.035 126.805 1.00 29.83 ? 42   LYS H O   1 
ATOM   9177  C  CB  . LYS H  1 42  ? 76.247 56.626 124.272 1.00 35.55 ? 42   LYS H CB  1 
ATOM   9178  C  CG  . LYS H  1 42  ? 75.235 55.643 123.697 1.00 43.35 ? 42   LYS H CG  1 
ATOM   9179  C  CD  . LYS H  1 42  ? 75.520 55.343 122.223 1.00 51.37 ? 42   LYS H CD  1 
ATOM   9180  C  CE  . LYS H  1 42  ? 75.379 56.606 121.353 1.00 54.68 ? 42   LYS H CE  1 
ATOM   9181  N  NZ  . LYS H  1 42  ? 75.687 56.355 119.911 1.00 55.14 ? 42   LYS H NZ  1 
ATOM   9182  N  N   . HIS H  1 43  ? 76.418 56.139 127.442 1.00 32.68 ? 43   HIS H N   1 
ATOM   9183  C  CA  . HIS H  1 43  ? 76.216 55.255 128.582 1.00 33.28 ? 43   HIS H CA  1 
ATOM   9184  C  C   . HIS H  1 43  ? 75.365 55.953 129.647 1.00 33.49 ? 43   HIS H C   1 
ATOM   9185  O  O   . HIS H  1 43  ? 74.303 55.452 130.023 1.00 34.95 ? 43   HIS H O   1 
ATOM   9186  C  CB  . HIS H  1 43  ? 77.561 54.840 129.184 1.00 36.51 ? 43   HIS H CB  1 
ATOM   9187  C  CG  . HIS H  1 43  ? 77.503 53.549 129.936 1.00 42.94 ? 43   HIS H CG  1 
ATOM   9188  N  ND1 . HIS H  1 43  ? 76.762 53.394 131.089 1.00 46.24 ? 43   HIS H ND1 1 
ATOM   9189  C  CD2 . HIS H  1 43  ? 78.025 52.331 129.656 1.00 43.81 ? 43   HIS H CD2 1 
ATOM   9190  C  CE1 . HIS H  1 43  ? 76.826 52.134 131.483 1.00 46.55 ? 43   HIS H CE1 1 
ATOM   9191  N  NE2 . HIS H  1 43  ? 77.586 51.469 130.631 1.00 46.47 ? 43   HIS H NE2 1 
ATOM   9192  N  N   . GLU H  1 44  ? 75.826 57.104 130.134 1.00 31.32 ? 44   GLU H N   1 
ATOM   9193  C  CA  . GLU H  1 44  ? 75.068 57.843 131.138 1.00 32.81 ? 44   GLU H CA  1 
ATOM   9194  C  C   . GLU H  1 44  ? 73.645 58.026 130.662 1.00 30.29 ? 44   GLU H C   1 
ATOM   9195  O  O   . GLU H  1 44  ? 72.708 57.892 131.438 1.00 29.89 ? 44   GLU H O   1 
ATOM   9196  C  CB  . GLU H  1 44  ? 75.682 59.212 131.391 1.00 35.59 ? 44   GLU H CB  1 
ATOM   9197  C  CG  . GLU H  1 44  ? 76.897 59.173 132.277 1.00 42.97 ? 44   GLU H CG  1 
ATOM   9198  C  CD  . GLU H  1 44  ? 76.546 58.979 133.739 1.00 45.51 ? 44   GLU H CD  1 
ATOM   9199  O  OE1 . GLU H  1 44  ? 75.767 59.797 134.282 1.00 44.46 ? 44   GLU H OE1 1 
ATOM   9200  O  OE2 . GLU H  1 44  ? 77.057 58.012 134.343 1.00 49.80 ? 44   GLU H OE2 1 
ATOM   9201  N  N   . TYR H  1 45  ? 73.490 58.334 129.379 1.00 30.40 ? 45   TYR H N   1 
ATOM   9202  C  CA  . TYR H  1 45  ? 72.168 58.519 128.803 1.00 30.36 ? 45   TYR H CA  1 
ATOM   9203  C  C   . TYR H  1 45  ? 71.295 57.297 129.094 1.00 31.94 ? 45   TYR H C   1 
ATOM   9204  O  O   . TYR H  1 45  ? 70.176 57.429 129.604 1.00 34.14 ? 45   TYR H O   1 
ATOM   9205  C  CB  . TYR H  1 45  ? 72.259 58.726 127.295 1.00 30.37 ? 45   TYR H CB  1 
ATOM   9206  C  CG  . TYR H  1 45  ? 70.907 58.885 126.647 1.00 31.91 ? 45   TYR H CG  1 
ATOM   9207  C  CD1 . TYR H  1 45  ? 70.205 60.086 126.737 1.00 31.78 ? 45   TYR H CD1 1 
ATOM   9208  C  CD2 . TYR H  1 45  ? 70.300 57.811 125.990 1.00 35.21 ? 45   TYR H CD2 1 
ATOM   9209  C  CE1 . TYR H  1 45  ? 68.929 60.211 126.190 1.00 35.59 ? 45   TYR H CE1 1 
ATOM   9210  C  CE2 . TYR H  1 45  ? 69.029 57.922 125.443 1.00 34.19 ? 45   TYR H CE2 1 
ATOM   9211  C  CZ  . TYR H  1 45  ? 68.348 59.124 125.546 1.00 37.18 ? 45   TYR H CZ  1 
ATOM   9212  O  OH  . TYR H  1 45  ? 67.089 59.234 125.004 1.00 40.04 ? 45   TYR H OH  1 
ATOM   9213  N  N   . HIS H  1 46  ? 71.800 56.108 128.784 1.00 31.33 ? 46   HIS H N   1 
ATOM   9214  C  CA  . HIS H  1 46  ? 71.031 54.899 129.040 1.00 34.63 ? 46   HIS H CA  1 
ATOM   9215  C  C   . HIS H  1 46  ? 70.744 54.668 130.523 1.00 33.53 ? 46   HIS H C   1 
ATOM   9216  O  O   . HIS H  1 46  ? 69.636 54.281 130.881 1.00 31.51 ? 46   HIS H O   1 
ATOM   9217  C  CB  . HIS H  1 46  ? 71.732 53.685 128.437 1.00 38.74 ? 46   HIS H CB  1 
ATOM   9218  C  CG  . HIS H  1 46  ? 71.749 53.694 126.942 1.00 47.78 ? 46   HIS H CG  1 
ATOM   9219  N  ND1 . HIS H  1 46  ? 72.237 52.645 126.193 1.00 51.65 ? 46   HIS H ND1 1 
ATOM   9220  C  CD2 . HIS H  1 46  ? 71.344 54.634 126.055 1.00 50.28 ? 46   HIS H CD2 1 
ATOM   9221  C  CE1 . HIS H  1 46  ? 72.132 52.939 124.908 1.00 52.94 ? 46   HIS H CE1 1 
ATOM   9222  N  NE2 . HIS H  1 46  ? 71.593 54.141 124.798 1.00 52.71 ? 46   HIS H NE2 1 
ATOM   9223  N  N   . GLU H  1 47  ? 71.726 54.906 131.387 1.00 32.96 ? 47   GLU H N   1 
ATOM   9224  C  CA  . GLU H  1 47  ? 71.500 54.723 132.813 1.00 34.18 ? 47   GLU H CA  1 
ATOM   9225  C  C   . GLU H  1 47  ? 70.384 55.656 133.267 1.00 33.36 ? 47   GLU H C   1 
ATOM   9226  O  O   . GLU H  1 47  ? 69.586 55.307 134.142 1.00 32.93 ? 47   GLU H O   1 
ATOM   9227  C  CB  . GLU H  1 47  ? 72.780 54.993 133.604 1.00 37.97 ? 47   GLU H CB  1 
ATOM   9228  C  CG  . GLU H  1 47  ? 73.942 54.098 133.189 1.00 48.60 ? 47   GLU H CG  1 
ATOM   9229  C  CD  . GLU H  1 47  ? 73.636 52.600 133.293 1.00 52.75 ? 47   GLU H CD  1 
ATOM   9230  O  OE1 . GLU H  1 47  ? 72.591 52.151 132.762 1.00 55.73 ? 47   GLU H OE1 1 
ATOM   9231  O  OE2 . GLU H  1 47  ? 74.456 51.865 133.894 1.00 54.48 ? 47   GLU H OE2 1 
ATOM   9232  N  N   . SER H  1 48  ? 70.322 56.840 132.662 1.00 32.20 ? 48   SER H N   1 
ATOM   9233  C  CA  . SER H  1 48  ? 69.283 57.804 132.992 1.00 30.20 ? 48   SER H CA  1 
ATOM   9234  C  C   . SER H  1 48  ? 67.935 57.258 132.532 1.00 30.76 ? 48   SER H C   1 
ATOM   9235  O  O   . SER H  1 48  ? 66.954 57.314 133.272 1.00 29.88 ? 48   SER H O   1 
ATOM   9236  C  CB  . SER H  1 48  ? 69.551 59.140 132.303 1.00 29.93 ? 48   SER H CB  1 
ATOM   9237  O  OG  . SER H  1 48  ? 68.484 60.045 132.533 1.00 29.40 ? 48   SER H OG  1 
ATOM   9238  N  N   . ILE H  1 49  ? 67.885 56.722 131.313 1.00 30.88 ? 49   ILE H N   1 
ATOM   9239  C  CA  . ILE H  1 49  ? 66.634 56.175 130.795 1.00 29.91 ? 49   ILE H CA  1 
ATOM   9240  C  C   . ILE H  1 49  ? 66.194 55.023 131.679 1.00 31.42 ? 49   ILE H C   1 
ATOM   9241  O  O   . ILE H  1 49  ? 65.003 54.739 131.788 1.00 34.07 ? 49   ILE H O   1 
ATOM   9242  C  CB  . ILE H  1 49  ? 66.773 55.636 129.359 1.00 29.66 ? 49   ILE H CB  1 
ATOM   9243  C  CG1 . ILE H  1 49  ? 67.240 56.749 128.416 1.00 30.97 ? 49   ILE H CG1 1 
ATOM   9244  C  CG2 . ILE H  1 49  ? 65.429 55.090 128.885 1.00 28.53 ? 49   ILE H CG2 1 
ATOM   9245  C  CD1 . ILE H  1 49  ? 66.270 57.915 128.297 1.00 31.58 ? 49   ILE H CD1 1 
ATOM   9246  N  N   . ASP H  1 50  ? 67.160 54.354 132.301 1.00 29.43 ? 50   ASP H N   1 
ATOM   9247  C  CA  . ASP H  1 50  ? 66.860 53.241 133.182 1.00 29.96 ? 50   ASP H CA  1 
ATOM   9248  C  C   . ASP H  1 50  ? 66.096 53.744 134.397 1.00 30.29 ? 50   ASP H C   1 
ATOM   9249  O  O   . ASP H  1 50  ? 65.041 53.198 134.753 1.00 29.09 ? 50   ASP H O   1 
ATOM   9250  C  CB  . ASP H  1 50  ? 68.146 52.565 133.637 1.00 37.07 ? 50   ASP H CB  1 
ATOM   9251  C  CG  . ASP H  1 50  ? 68.453 51.311 132.848 1.00 43.24 ? 50   ASP H CG  1 
ATOM   9252  O  OD1 . ASP H  1 50  ? 68.487 51.386 131.598 1.00 41.68 ? 50   ASP H OD1 1 
ATOM   9253  O  OD2 . ASP H  1 50  ? 68.661 50.252 133.488 1.00 47.95 ? 50   ASP H OD2 1 
ATOM   9254  N  N   . GLU H  1 51  ? 66.633 54.783 135.033 1.00 28.18 ? 51   GLU H N   1 
ATOM   9255  C  CA  . GLU H  1 51  ? 65.992 55.365 136.208 1.00 27.64 ? 51   GLU H CA  1 
ATOM   9256  C  C   . GLU H  1 51  ? 64.576 55.789 135.862 1.00 25.05 ? 51   GLU H C   1 
ATOM   9257  O  O   . GLU H  1 51  ? 63.648 55.632 136.649 1.00 21.97 ? 51   GLU H O   1 
ATOM   9258  C  CB  . GLU H  1 51  ? 66.806 56.531 136.743 1.00 27.97 ? 51   GLU H CB  1 
ATOM   9259  C  CG  . GLU H  1 51  ? 68.271 56.220 137.000 1.00 30.54 ? 51   GLU H CG  1 
ATOM   9260  C  CD  . GLU H  1 51  ? 68.455 55.078 137.964 1.00 31.05 ? 51   GLU H CD  1 
ATOM   9261  O  OE1 . GLU H  1 51  ? 67.452 54.585 138.523 1.00 39.02 ? 51   GLU H OE1 1 
ATOM   9262  O  OE2 . GLU H  1 51  ? 69.611 54.662 138.178 1.00 35.17 ? 51   GLU H OE2 1 
ATOM   9263  N  N   . MET H  1 52  ? 64.406 56.321 134.662 1.00 24.24 ? 52   MET H N   1 
ATOM   9264  C  CA  . MET H  1 52  ? 63.083 56.731 134.235 1.00 24.99 ? 52   MET H CA  1 
ATOM   9265  C  C   . MET H  1 52  ? 62.130 55.525 134.273 1.00 25.03 ? 52   MET H C   1 
ATOM   9266  O  O   . MET H  1 52  ? 60.993 55.623 134.739 1.00 21.98 ? 52   MET H O   1 
ATOM   9267  C  CB  . MET H  1 52  ? 63.172 57.318 132.831 1.00 24.06 ? 52   MET H CB  1 
ATOM   9268  C  CG  . MET H  1 52  ? 63.906 58.651 132.791 1.00 26.26 ? 52   MET H CG  1 
ATOM   9269  S  SD  . MET H  1 52  ? 63.832 59.461 131.174 1.00 28.38 ? 52   MET H SD  1 
ATOM   9270  C  CE  . MET H  1 52  ? 65.557 59.949 130.970 1.00 30.71 ? 52   MET H CE  1 
ATOM   9271  N  N   . LYS H  1 53  ? 62.612 54.378 133.802 1.00 26.17 ? 53   LYS H N   1 
ATOM   9272  C  CA  . LYS H  1 53  ? 61.806 53.170 133.786 1.00 26.00 ? 53   LYS H CA  1 
ATOM   9273  C  C   . LYS H  1 53  ? 61.532 52.724 135.212 1.00 27.30 ? 53   LYS H C   1 
ATOM   9274  O  O   . LYS H  1 53  ? 60.425 52.292 135.540 1.00 28.18 ? 53   LYS H O   1 
ATOM   9275  C  CB  . LYS H  1 53  ? 62.530 52.077 133.016 1.00 26.63 ? 53   LYS H CB  1 
ATOM   9276  C  CG  . LYS H  1 53  ? 62.732 52.385 131.543 1.00 27.19 ? 53   LYS H CG  1 
ATOM   9277  C  CD  . LYS H  1 53  ? 63.417 51.208 130.880 1.00 31.93 ? 53   LYS H CD  1 
ATOM   9278  C  CE  . LYS H  1 53  ? 63.705 51.461 129.418 1.00 37.49 ? 53   LYS H CE  1 
ATOM   9279  N  NZ  . LYS H  1 53  ? 64.437 50.300 128.824 1.00 40.75 ? 53   LYS H NZ  1 
ATOM   9280  N  N   . HIS H  1 54  ? 62.552 52.822 136.057 1.00 25.74 ? 54   HIS H N   1 
ATOM   9281  C  CA  . HIS H  1 54  ? 62.419 52.472 137.463 1.00 25.01 ? 54   HIS H CA  1 
ATOM   9282  C  C   . HIS H  1 54  ? 61.319 53.274 138.118 1.00 24.98 ? 54   HIS H C   1 
ATOM   9283  O  O   . HIS H  1 54  ? 60.435 52.734 138.797 1.00 24.38 ? 54   HIS H O   1 
ATOM   9284  C  CB  . HIS H  1 54  ? 63.700 52.704 138.203 1.00 25.11 ? 54   HIS H CB  1 
ATOM   9285  C  CG  . HIS H  1 54  ? 64.826 51.745 137.785 1.00 27.87 ? 54   HIS H CG  1 
ATOM   9286  N  ND1 . HIS H  1 54  ? 66.103 51.817 138.303 1.00 24.39 ? 54   HIS H ND1 1 
ATOM   9287  C  CD2 . HIS H  1 54  ? 64.831 50.713 136.905 1.00 26.64 ? 54   HIS H CD2 1 
ATOM   9288  C  CE1 . HIS H  1 54  ? 66.848 50.870 137.759 1.00 25.42 ? 54   HIS H CE1 1 
ATOM   9289  N  NE2 . HIS H  1 54  ? 66.101 50.186 136.908 1.00 24.62 ? 54   HIS H NE2 1 
ATOM   9290  N  N   . ALA H  1 55  ? 61.393 54.590 137.941 1.00 23.63 ? 55   ALA H N   1 
ATOM   9291  C  CA  . ALA H  1 55  ? 60.393 55.486 138.493 1.00 26.17 ? 55   ALA H CA  1 
ATOM   9292  C  C   . ALA H  1 55  ? 59.033 55.079 137.939 1.00 27.40 ? 55   ALA H C   1 
ATOM   9293  O  O   . ALA H  1 55  ? 58.042 55.045 138.669 1.00 30.60 ? 55   ALA H O   1 
ATOM   9294  C  CB  . ALA H  1 55  ? 60.707 56.924 138.114 1.00 25.27 ? 55   ALA H CB  1 
ATOM   9295  N  N   . ASP H  1 56  ? 58.992 54.751 136.652 1.00 27.34 ? 56   ASP H N   1 
ATOM   9296  C  CA  . ASP H  1 56  ? 57.747 54.341 136.021 1.00 29.41 ? 56   ASP H CA  1 
ATOM   9297  C  C   . ASP H  1 56  ? 57.148 53.105 136.712 1.00 29.90 ? 56   ASP H C   1 
ATOM   9298  O  O   . ASP H  1 56  ? 55.948 53.061 136.988 1.00 32.15 ? 56   ASP H O   1 
ATOM   9299  C  CB  . ASP H  1 56  ? 57.980 54.070 134.526 1.00 30.99 ? 56   ASP H CB  1 
ATOM   9300  C  CG  . ASP H  1 56  ? 56.678 53.941 133.746 1.00 33.72 ? 56   ASP H CG  1 
ATOM   9301  O  OD1 . ASP H  1 56  ? 55.652 54.486 134.214 1.00 38.88 ? 56   ASP H OD1 1 
ATOM   9302  O  OD2 . ASP H  1 56  ? 56.675 53.313 132.662 1.00 32.44 ? 56   ASP H OD2 1 
ATOM   9303  N  N   . LYS H  1 57  ? 57.980 52.109 137.004 1.00 29.44 ? 57   LYS H N   1 
ATOM   9304  C  CA  . LYS H  1 57  ? 57.503 50.892 137.663 1.00 28.33 ? 57   LYS H CA  1 
ATOM   9305  C  C   . LYS H  1 57  ? 56.895 51.199 139.024 1.00 26.28 ? 57   LYS H C   1 
ATOM   9306  O  O   . LYS H  1 57  ? 55.882 50.621 139.403 1.00 25.00 ? 57   LYS H O   1 
ATOM   9307  C  CB  . LYS H  1 57  ? 58.645 49.895 137.878 1.00 33.60 ? 57   LYS H CB  1 
ATOM   9308  C  CG  . LYS H  1 57  ? 59.326 49.368 136.631 1.00 40.48 ? 57   LYS H CG  1 
ATOM   9309  C  CD  . LYS H  1 57  ? 60.421 48.391 137.039 1.00 45.57 ? 57   LYS H CD  1 
ATOM   9310  C  CE  . LYS H  1 57  ? 61.323 48.013 135.873 1.00 50.77 ? 57   LYS H CE  1 
ATOM   9311  N  NZ  . LYS H  1 57  ? 62.516 47.231 136.355 1.00 54.97 ? 57   LYS H NZ  1 
ATOM   9312  N  N   . LEU H  1 58  ? 57.541 52.095 139.764 1.00 25.31 ? 58   LEU H N   1 
ATOM   9313  C  CA  . LEU H  1 58  ? 57.081 52.473 141.094 1.00 23.64 ? 58   LEU H CA  1 
ATOM   9314  C  C   . LEU H  1 58  ? 55.783 53.258 141.023 1.00 26.35 ? 58   LEU H C   1 
ATOM   9315  O  O   . LEU H  1 58  ? 54.837 52.960 141.768 1.00 27.27 ? 58   LEU H O   1 
ATOM   9316  C  CB  . LEU H  1 58  ? 58.160 53.286 141.806 1.00 21.56 ? 58   LEU H CB  1 
ATOM   9317  C  CG  . LEU H  1 58  ? 59.410 52.457 142.124 1.00 21.01 ? 58   LEU H CG  1 
ATOM   9318  C  CD1 . LEU H  1 58  ? 60.568 53.364 142.506 1.00 15.91 ? 58   LEU H CD1 1 
ATOM   9319  C  CD2 . LEU H  1 58  ? 59.082 51.458 143.237 1.00 16.54 ? 58   LEU H CD2 1 
ATOM   9320  N  N   . ILE H  1 59  ? 55.734 54.254 140.136 1.00 25.38 ? 59   ILE H N   1 
ATOM   9321  C  CA  . ILE H  1 59  ? 54.523 55.050 139.966 1.00 27.54 ? 59   ILE H CA  1 
ATOM   9322  C  C   . ILE H  1 59  ? 53.338 54.087 139.804 1.00 28.10 ? 59   ILE H C   1 
ATOM   9323  O  O   . ILE H  1 59  ? 52.338 54.193 140.516 1.00 28.84 ? 59   ILE H O   1 
ATOM   9324  C  CB  . ILE H  1 59  ? 54.596 55.949 138.699 1.00 30.65 ? 59   ILE H CB  1 
ATOM   9325  C  CG1 . ILE H  1 59  ? 55.751 56.949 138.817 1.00 29.98 ? 59   ILE H CG1 1 
ATOM   9326  C  CG2 . ILE H  1 59  ? 53.262 56.671 138.484 1.00 25.86 ? 59   ILE H CG2 1 
ATOM   9327  C  CD1 . ILE H  1 59  ? 55.567 57.974 139.878 1.00 35.64 ? 59   ILE H CD1 1 
ATOM   9328  N  N   . LYS H  1 60  ? 53.460 53.140 138.877 1.00 27.36 ? 60   LYS H N   1 
ATOM   9329  C  CA  . LYS H  1 60  ? 52.390 52.170 138.638 1.00 28.83 ? 60   LYS H CA  1 
ATOM   9330  C  C   . LYS H  1 60  ? 52.053 51.357 139.880 1.00 25.96 ? 60   LYS H C   1 
ATOM   9331  O  O   . LYS H  1 60  ? 50.889 51.235 140.255 1.00 24.55 ? 60   LYS H O   1 
ATOM   9332  C  CB  . LYS H  1 60  ? 52.764 51.219 137.495 1.00 31.72 ? 60   LYS H CB  1 
ATOM   9333  C  CG  . LYS H  1 60  ? 52.914 51.909 136.145 1.00 38.44 ? 60   LYS H CG  1 
ATOM   9334  C  CD  . LYS H  1 60  ? 53.149 50.906 135.033 1.00 41.31 ? 60   LYS H CD  1 
ATOM   9335  C  CE  . LYS H  1 60  ? 53.356 51.609 133.707 1.00 47.22 ? 60   LYS H CE  1 
ATOM   9336  N  NZ  . LYS H  1 60  ? 53.660 50.645 132.605 1.00 52.01 ? 60   LYS H NZ  1 
ATOM   9337  N  N   . ARG H  1 61  ? 53.072 50.793 140.515 1.00 26.02 ? 61   ARG H N   1 
ATOM   9338  C  CA  . ARG H  1 61  ? 52.847 50.012 141.718 1.00 25.78 ? 61   ARG H CA  1 
ATOM   9339  C  C   . ARG H  1 61  ? 52.043 50.851 142.714 1.00 27.10 ? 61   ARG H C   1 
ATOM   9340  O  O   . ARG H  1 61  ? 50.980 50.429 143.187 1.00 28.79 ? 61   ARG H O   1 
ATOM   9341  C  CB  . ARG H  1 61  ? 54.178 49.600 142.336 1.00 24.67 ? 61   ARG H CB  1 
ATOM   9342  C  CG  . ARG H  1 61  ? 54.047 48.677 143.531 1.00 24.45 ? 61   ARG H CG  1 
ATOM   9343  C  CD  . ARG H  1 61  ? 53.248 47.449 143.171 1.00 24.61 ? 61   ARG H CD  1 
ATOM   9344  N  NE  . ARG H  1 61  ? 53.138 46.515 144.286 1.00 29.19 ? 61   ARG H NE  1 
ATOM   9345  C  CZ  . ARG H  1 61  ? 52.415 45.402 144.247 1.00 31.12 ? 61   ARG H CZ  1 
ATOM   9346  N  NH1 . ARG H  1 61  ? 51.741 45.090 143.150 1.00 31.91 ? 61   ARG H NH1 1 
ATOM   9347  N  NH2 . ARG H  1 61  ? 52.366 44.599 145.301 1.00 35.61 ? 61   ARG H NH2 1 
ATOM   9348  N  N   . ILE H  1 62  ? 52.541 52.047 143.007 1.00 25.29 ? 62   ILE H N   1 
ATOM   9349  C  CA  . ILE H  1 62  ? 51.873 52.949 143.944 1.00 25.76 ? 62   ILE H CA  1 
ATOM   9350  C  C   . ILE H  1 62  ? 50.407 53.230 143.584 1.00 26.19 ? 62   ILE H C   1 
ATOM   9351  O  O   . ILE H  1 62  ? 49.535 53.176 144.457 1.00 24.57 ? 62   ILE H O   1 
ATOM   9352  C  CB  . ILE H  1 62  ? 52.621 54.290 144.042 1.00 24.96 ? 62   ILE H CB  1 
ATOM   9353  C  CG1 . ILE H  1 62  ? 54.047 54.045 144.542 1.00 26.56 ? 62   ILE H CG1 1 
ATOM   9354  C  CG2 . ILE H  1 62  ? 51.865 55.244 144.959 1.00 24.34 ? 62   ILE H CG2 1 
ATOM   9355  C  CD1 . ILE H  1 62  ? 54.906 55.300 144.624 1.00 27.53 ? 62   ILE H CD1 1 
ATOM   9356  N  N   . LEU H  1 63  ? 50.134 53.537 142.314 1.00 25.33 ? 63   LEU H N   1 
ATOM   9357  C  CA  . LEU H  1 63  ? 48.760 53.814 141.881 1.00 24.19 ? 63   LEU H CA  1 
ATOM   9358  C  C   . LEU H  1 63  ? 47.855 52.598 142.093 1.00 24.47 ? 63   LEU H C   1 
ATOM   9359  O  O   . LEU H  1 63  ? 46.678 52.736 142.438 1.00 24.49 ? 63   LEU H O   1 
ATOM   9360  C  CB  . LEU H  1 63  ? 48.718 54.207 140.396 1.00 20.96 ? 63   LEU H CB  1 
ATOM   9361  C  CG  . LEU H  1 63  ? 48.705 55.668 139.921 1.00 20.49 ? 63   LEU H CG  1 
ATOM   9362  C  CD1 . LEU H  1 63  ? 48.314 56.589 141.049 1.00 17.53 ? 63   LEU H CD1 1 
ATOM   9363  C  CD2 . LEU H  1 63  ? 50.059 56.052 139.378 1.00 22.64 ? 63   LEU H CD2 1 
ATOM   9364  N  N   . PHE H  1 64  ? 48.418 51.410 141.891 1.00 25.98 ? 64   PHE H N   1 
ATOM   9365  C  CA  . PHE H  1 64  ? 47.680 50.156 142.035 1.00 28.21 ? 64   PHE H CA  1 
ATOM   9366  C  C   . PHE H  1 64  ? 47.316 49.873 143.488 1.00 28.98 ? 64   PHE H C   1 
ATOM   9367  O  O   . PHE H  1 64  ? 46.235 49.360 143.779 1.00 30.06 ? 64   PHE H O   1 
ATOM   9368  C  CB  . PHE H  1 64  ? 48.517 48.999 141.469 1.00 29.09 ? 64   PHE H CB  1 
ATOM   9369  C  CG  . PHE H  1 64  ? 47.951 47.639 141.764 1.00 28.92 ? 64   PHE H CG  1 
ATOM   9370  C  CD1 . PHE H  1 64  ? 46.723 47.255 141.242 1.00 27.15 ? 64   PHE H CD1 1 
ATOM   9371  C  CD2 . PHE H  1 64  ? 48.637 46.753 142.598 1.00 27.17 ? 64   PHE H CD2 1 
ATOM   9372  C  CE1 . PHE H  1 64  ? 46.178 46.001 141.549 1.00 29.05 ? 64   PHE H CE1 1 
ATOM   9373  C  CE2 . PHE H  1 64  ? 48.103 45.503 142.910 1.00 24.02 ? 64   PHE H CE2 1 
ATOM   9374  C  CZ  . PHE H  1 64  ? 46.874 45.125 142.387 1.00 26.60 ? 64   PHE H CZ  1 
ATOM   9375  N  N   . LEU H  1 65  ? 48.243 50.203 144.385 1.00 30.03 ? 65   LEU H N   1 
ATOM   9376  C  CA  . LEU H  1 65  ? 48.075 50.020 145.822 1.00 28.33 ? 65   LEU H CA  1 
ATOM   9377  C  C   . LEU H  1 65  ? 47.255 51.172 146.395 1.00 30.81 ? 65   LEU H C   1 
ATOM   9378  O  O   . LEU H  1 65  ? 47.081 51.283 147.611 1.00 34.78 ? 65   LEU H O   1 
ATOM   9379  C  CB  . LEU H  1 65  ? 49.447 49.962 146.493 1.00 24.97 ? 65   LEU H CB  1 
ATOM   9380  C  CG  . LEU H  1 65  ? 49.997 48.592 146.913 1.00 25.49 ? 65   LEU H CG  1 
ATOM   9381  C  CD1 . LEU H  1 65  ? 49.580 47.497 145.937 1.00 24.04 ? 65   LEU H CD1 1 
ATOM   9382  C  CD2 . LEU H  1 65  ? 51.517 48.691 147.025 1.00 27.04 ? 65   LEU H CD2 1 
ATOM   9383  N  N   . GLU H  1 66  ? 46.775 52.031 145.498 1.00 30.49 ? 66   GLU H N   1 
ATOM   9384  C  CA  . GLU H  1 66  ? 45.938 53.187 145.821 1.00 29.83 ? 66   GLU H CA  1 
ATOM   9385  C  C   . GLU H  1 66  ? 46.581 54.283 146.678 1.00 28.40 ? 66   GLU H C   1 
ATOM   9386  O  O   . GLU H  1 66  ? 45.916 54.919 147.493 1.00 29.47 ? 66   GLU H O   1 
ATOM   9387  C  CB  . GLU H  1 66  ? 44.622 52.701 146.449 1.00 31.19 ? 66   GLU H CB  1 
ATOM   9388  C  CG  . GLU H  1 66  ? 43.956 51.580 145.631 1.00 37.83 ? 66   GLU H CG  1 
ATOM   9389  C  CD  . GLU H  1 66  ? 42.599 51.129 146.176 1.00 42.45 ? 66   GLU H CD  1 
ATOM   9390  O  OE1 . GLU H  1 66  ? 42.259 51.500 147.325 1.00 45.51 ? 66   GLU H OE1 1 
ATOM   9391  O  OE2 . GLU H  1 66  ? 41.877 50.392 145.456 1.00 38.13 ? 66   GLU H OE2 1 
ATOM   9392  N  N   . GLY H  1 67  ? 47.878 54.506 146.479 1.00 28.01 ? 67   GLY H N   1 
ATOM   9393  C  CA  . GLY H  1 67  ? 48.585 55.546 147.209 1.00 24.32 ? 67   GLY H CA  1 
ATOM   9394  C  C   . GLY H  1 67  ? 48.752 56.732 146.276 1.00 26.15 ? 67   GLY H C   1 
ATOM   9395  O  O   . GLY H  1 67  ? 48.303 56.684 145.133 1.00 25.43 ? 67   GLY H O   1 
ATOM   9396  N  N   . LEU H  1 68  ? 49.386 57.801 146.741 1.00 27.32 ? 68   LEU H N   1 
ATOM   9397  C  CA  . LEU H  1 68  ? 49.591 58.972 145.893 1.00 27.20 ? 68   LEU H CA  1 
ATOM   9398  C  C   . LEU H  1 68  ? 51.060 59.132 145.539 1.00 27.72 ? 68   LEU H C   1 
ATOM   9399  O  O   . LEU H  1 68  ? 51.851 59.578 146.367 1.00 28.89 ? 68   LEU H O   1 
ATOM   9400  C  CB  . LEU H  1 68  ? 49.127 60.226 146.612 1.00 29.36 ? 68   LEU H CB  1 
ATOM   9401  C  CG  . LEU H  1 68  ? 47.671 60.231 147.054 1.00 31.24 ? 68   LEU H CG  1 
ATOM   9402  C  CD1 . LEU H  1 68  ? 47.385 61.551 147.757 1.00 30.47 ? 68   LEU H CD1 1 
ATOM   9403  C  CD2 . LEU H  1 68  ? 46.765 60.037 145.851 1.00 27.42 ? 68   LEU H CD2 1 
ATOM   9404  N  N   . PRO H  1 69  ? 51.446 58.778 144.302 1.00 27.73 ? 69   PRO H N   1 
ATOM   9405  C  CA  . PRO H  1 69  ? 52.848 58.902 143.885 1.00 26.88 ? 69   PRO H CA  1 
ATOM   9406  C  C   . PRO H  1 69  ? 53.296 60.330 144.106 1.00 27.80 ? 69   PRO H C   1 
ATOM   9407  O  O   . PRO H  1 69  ? 52.554 61.258 143.809 1.00 29.42 ? 69   PRO H O   1 
ATOM   9408  C  CB  . PRO H  1 69  ? 52.806 58.548 142.403 1.00 26.78 ? 69   PRO H CB  1 
ATOM   9409  C  CG  . PRO H  1 69  ? 51.601 57.637 142.294 1.00 27.80 ? 69   PRO H CG  1 
ATOM   9410  C  CD  . PRO H  1 69  ? 50.601 58.330 143.183 1.00 27.86 ? 69   PRO H CD  1 
ATOM   9411  N  N   . ASN H  1 70  ? 54.494 60.518 144.640 1.00 29.75 ? 70   ASN H N   1 
ATOM   9412  C  CA  . ASN H  1 70  ? 54.977 61.872 144.873 1.00 32.48 ? 70   ASN H CA  1 
ATOM   9413  C  C   . ASN H  1 70  ? 56.145 62.203 143.951 1.00 32.62 ? 70   ASN H C   1 
ATOM   9414  O  O   . ASN H  1 70  ? 57.255 61.696 144.125 1.00 31.50 ? 70   ASN H O   1 
ATOM   9415  C  CB  . ASN H  1 70  ? 55.374 62.053 146.346 1.00 30.19 ? 70   ASN H CB  1 
ATOM   9416  C  CG  . ASN H  1 70  ? 56.039 63.402 146.622 1.00 33.43 ? 70   ASN H CG  1 
ATOM   9417  O  OD1 . ASN H  1 70  ? 56.004 64.320 145.797 1.00 34.01 ? 70   ASN H OD1 1 
ATOM   9418  N  ND2 . ASN H  1 70  ? 56.645 63.526 147.800 1.00 34.09 ? 70   ASN H ND2 1 
ATOM   9419  N  N   . LEU H  1 71  ? 55.875 63.054 142.963 1.00 33.09 ? 71   LEU H N   1 
ATOM   9420  C  CA  . LEU H  1 71  ? 56.888 63.476 142.001 1.00 33.30 ? 71   LEU H CA  1 
ATOM   9421  C  C   . LEU H  1 71  ? 57.332 64.900 142.343 1.00 35.32 ? 71   LEU H C   1 
ATOM   9422  O  O   . LEU H  1 71  ? 58.206 65.459 141.685 1.00 38.43 ? 71   LEU H O   1 
ATOM   9423  C  CB  . LEU H  1 71  ? 56.312 63.445 140.577 1.00 31.36 ? 71   LEU H CB  1 
ATOM   9424  C  CG  . LEU H  1 71  ? 55.818 62.143 139.913 1.00 29.39 ? 71   LEU H CG  1 
ATOM   9425  C  CD1 . LEU H  1 71  ? 56.983 61.368 139.368 1.00 30.45 ? 71   LEU H CD1 1 
ATOM   9426  C  CD2 . LEU H  1 71  ? 55.026 61.296 140.896 1.00 28.70 ? 71   LEU H CD2 1 
ATOM   9427  N  N   . GLN H  1 72  ? 56.732 65.472 143.385 1.00 36.90 ? 72   GLN H N   1 
ATOM   9428  C  CA  . GLN H  1 72  ? 57.026 66.840 143.815 1.00 37.05 ? 72   GLN H CA  1 
ATOM   9429  C  C   . GLN H  1 72  ? 58.375 67.043 144.505 1.00 39.65 ? 72   GLN H C   1 
ATOM   9430  O  O   . GLN H  1 72  ? 59.079 68.001 144.206 1.00 39.97 ? 72   GLN H O   1 
ATOM   9431  C  CB  . GLN H  1 72  ? 55.912 67.349 144.745 1.00 36.11 ? 72   GLN H CB  1 
ATOM   9432  C  CG  . GLN H  1 72  ? 56.065 68.815 145.165 1.00 31.45 ? 72   GLN H CG  1 
ATOM   9433  C  CD  . GLN H  1 72  ? 55.866 69.780 144.004 1.00 31.65 ? 72   GLN H CD  1 
ATOM   9434  O  OE1 . GLN H  1 72  ? 54.735 70.122 143.650 1.00 27.50 ? 72   GLN H OE1 1 
ATOM   9435  N  NE2 . GLN H  1 72  ? 56.970 70.210 143.393 1.00 29.50 ? 72   GLN H NE2 1 
ATOM   9436  N  N   . GLU H  1 73  ? 58.730 66.160 145.433 1.00 43.17 ? 73   GLU H N   1 
ATOM   9437  C  CA  . GLU H  1 73  ? 59.993 66.298 146.158 1.00 46.87 ? 73   GLU H CA  1 
ATOM   9438  C  C   . GLU H  1 73  ? 61.201 65.856 145.339 1.00 47.38 ? 73   GLU H C   1 
ATOM   9439  O  O   . GLU H  1 73  ? 61.233 64.739 144.809 1.00 50.90 ? 73   GLU H O   1 
ATOM   9440  C  CB  . GLU H  1 73  ? 59.961 65.490 147.459 1.00 51.62 ? 73   GLU H CB  1 
ATOM   9441  C  CG  . GLU H  1 73  ? 58.740 65.732 148.349 1.00 61.51 ? 73   GLU H CG  1 
ATOM   9442  C  CD  . GLU H  1 73  ? 58.432 67.208 148.572 1.00 65.28 ? 73   GLU H CD  1 
ATOM   9443  O  OE1 . GLU H  1 73  ? 59.375 67.988 148.847 1.00 65.14 ? 73   GLU H OE1 1 
ATOM   9444  O  OE2 . GLU H  1 73  ? 57.238 67.580 148.482 1.00 68.46 ? 73   GLU H OE2 1 
ATOM   9445  N  N   . LEU H  1 74  ? 62.197 66.731 145.245 1.00 43.18 ? 74   LEU H N   1 
ATOM   9446  C  CA  . LEU H  1 74  ? 63.413 66.424 144.505 1.00 39.80 ? 74   LEU H CA  1 
ATOM   9447  C  C   . LEU H  1 74  ? 64.606 66.622 145.438 1.00 39.88 ? 74   LEU H C   1 
ATOM   9448  O  O   . LEU H  1 74  ? 64.867 67.738 145.898 1.00 38.97 ? 74   LEU H O   1 
ATOM   9449  C  CB  . LEU H  1 74  ? 63.553 67.356 143.300 1.00 39.77 ? 74   LEU H CB  1 
ATOM   9450  C  CG  . LEU H  1 74  ? 64.380 66.869 142.103 1.00 40.04 ? 74   LEU H CG  1 
ATOM   9451  C  CD1 . LEU H  1 74  ? 64.810 68.084 141.284 1.00 35.15 ? 74   LEU H CD1 1 
ATOM   9452  C  CD2 . LEU H  1 74  ? 65.605 66.076 142.565 1.00 39.96 ? 74   LEU H CD2 1 
ATOM   9453  N  N   . GLY H  1 75  ? 65.335 65.543 145.705 1.00 38.59 ? 75   GLY H N   1 
ATOM   9454  C  CA  . GLY H  1 75  ? 66.485 65.629 146.587 1.00 36.60 ? 75   GLY H CA  1 
ATOM   9455  C  C   . GLY H  1 75  ? 67.639 66.420 146.012 1.00 35.54 ? 75   GLY H C   1 
ATOM   9456  O  O   . GLY H  1 75  ? 67.535 66.985 144.928 1.00 33.97 ? 75   GLY H O   1 
ATOM   9457  N  N   . LYS H  1 76  ? 68.754 66.459 146.729 1.00 38.38 ? 76   LYS H N   1 
ATOM   9458  C  CA  . LYS H  1 76  ? 69.904 67.207 146.242 1.00 41.61 ? 76   LYS H CA  1 
ATOM   9459  C  C   . LYS H  1 76  ? 70.691 66.487 145.147 1.00 41.10 ? 76   LYS H C   1 
ATOM   9460  O  O   . LYS H  1 76  ? 71.220 65.389 145.345 1.00 40.25 ? 76   LYS H O   1 
ATOM   9461  C  CB  . LYS H  1 76  ? 70.858 67.563 147.385 1.00 44.66 ? 76   LYS H CB  1 
ATOM   9462  C  CG  . LYS H  1 76  ? 72.082 68.303 146.880 1.00 49.71 ? 76   LYS H CG  1 
ATOM   9463  C  CD  . LYS H  1 76  ? 73.097 68.589 147.959 1.00 53.20 ? 76   LYS H CD  1 
ATOM   9464  C  CE  . LYS H  1 76  ? 74.283 69.332 147.354 1.00 57.46 ? 76   LYS H CE  1 
ATOM   9465  N  NZ  . LYS H  1 76  ? 73.833 70.536 146.583 1.00 57.34 ? 76   LYS H NZ  1 
ATOM   9466  N  N   . LEU H  1 77  ? 70.770 67.134 143.992 1.00 39.27 ? 77   LEU H N   1 
ATOM   9467  C  CA  . LEU H  1 77  ? 71.490 66.607 142.845 1.00 36.60 ? 77   LEU H CA  1 
ATOM   9468  C  C   . LEU H  1 77  ? 72.983 66.795 143.057 1.00 35.07 ? 77   LEU H C   1 
ATOM   9469  O  O   . LEU H  1 77  ? 73.425 67.883 143.413 1.00 36.61 ? 77   LEU H O   1 
ATOM   9470  C  CB  . LEU H  1 77  ? 71.075 67.367 141.583 1.00 36.35 ? 77   LEU H CB  1 
ATOM   9471  C  CG  . LEU H  1 77  ? 70.093 66.738 140.595 1.00 37.19 ? 77   LEU H CG  1 
ATOM   9472  C  CD1 . LEU H  1 77  ? 68.875 66.180 141.319 1.00 33.19 ? 77   LEU H CD1 1 
ATOM   9473  C  CD2 . LEU H  1 77  ? 69.706 67.789 139.567 1.00 32.45 ? 77   LEU H CD2 1 
ATOM   9474  N  N   . LEU H  1 78  ? 73.758 65.741 142.831 1.00 33.12 ? 78   LEU H N   1 
ATOM   9475  C  CA  . LEU H  1 78  ? 75.209 65.819 142.972 1.00 29.82 ? 78   LEU H CA  1 
ATOM   9476  C  C   . LEU H  1 78  ? 75.830 65.993 141.584 1.00 27.96 ? 78   LEU H C   1 
ATOM   9477  O  O   . LEU H  1 78  ? 76.103 65.013 140.891 1.00 28.60 ? 78   LEU H O   1 
ATOM   9478  C  CB  . LEU H  1 78  ? 75.752 64.540 143.623 1.00 26.83 ? 78   LEU H CB  1 
ATOM   9479  C  CG  . LEU H  1 78  ? 75.149 64.135 144.975 1.00 27.24 ? 78   LEU H CG  1 
ATOM   9480  C  CD1 . LEU H  1 78  ? 75.856 62.885 145.506 1.00 23.37 ? 78   LEU H CD1 1 
ATOM   9481  C  CD2 . LEU H  1 78  ? 75.274 65.290 145.965 1.00 24.44 ? 78   LEU H CD2 1 
ATOM   9482  N  N   . ILE H  1 79  ? 76.049 67.233 141.165 1.00 25.71 ? 79   ILE H N   1 
ATOM   9483  C  CA  . ILE H  1 79  ? 76.636 67.461 139.850 1.00 28.32 ? 79   ILE H CA  1 
ATOM   9484  C  C   . ILE H  1 79  ? 78.138 67.763 139.872 1.00 27.96 ? 79   ILE H C   1 
ATOM   9485  O  O   . ILE H  1 79  ? 78.589 68.644 140.600 1.00 29.16 ? 79   ILE H O   1 
ATOM   9486  C  CB  . ILE H  1 79  ? 75.894 68.589 139.111 1.00 29.67 ? 79   ILE H CB  1 
ATOM   9487  C  CG1 . ILE H  1 79  ? 74.545 68.070 138.592 1.00 31.32 ? 79   ILE H CG1 1 
ATOM   9488  C  CG2 . ILE H  1 79  ? 76.731 69.073 137.914 1.00 29.12 ? 79   ILE H CG2 1 
ATOM   9489  C  CD1 . ILE H  1 79  ? 73.715 67.316 139.603 1.00 34.24 ? 79   ILE H CD1 1 
ATOM   9490  N  N   . GLY H  1 80  ? 78.904 67.030 139.062 1.00 27.56 ? 80   GLY H N   1 
ATOM   9491  C  CA  . GLY H  1 80  ? 80.345 67.229 139.010 1.00 28.47 ? 80   GLY H CA  1 
ATOM   9492  C  C   . GLY H  1 80  ? 80.797 68.191 137.929 1.00 30.62 ? 80   GLY H C   1 
ATOM   9493  O  O   . GLY H  1 80  ? 79.993 68.618 137.104 1.00 34.81 ? 80   GLY H O   1 
ATOM   9494  N  N   . GLU H  1 81  ? 82.083 68.530 137.917 1.00 32.04 ? 81   GLU H N   1 
ATOM   9495  C  CA  . GLU H  1 81  ? 82.608 69.467 136.922 1.00 34.07 ? 81   GLU H CA  1 
ATOM   9496  C  C   . GLU H  1 81  ? 83.573 68.815 135.934 1.00 33.93 ? 81   GLU H C   1 
ATOM   9497  O  O   . GLU H  1 81  ? 84.007 69.442 134.968 1.00 34.43 ? 81   GLU H O   1 
ATOM   9498  C  CB  . GLU H  1 81  ? 83.309 70.640 137.613 1.00 37.21 ? 81   GLU H CB  1 
ATOM   9499  C  CG  . GLU H  1 81  ? 82.514 71.276 138.745 1.00 44.59 ? 81   GLU H CG  1 
ATOM   9500  C  CD  . GLU H  1 81  ? 83.208 72.494 139.328 1.00 49.25 ? 81   GLU H CD  1 
ATOM   9501  O  OE1 . GLU H  1 81  ? 84.449 72.454 139.488 1.00 52.11 ? 81   GLU H OE1 1 
ATOM   9502  O  OE2 . GLU H  1 81  ? 82.515 73.488 139.636 1.00 52.54 ? 81   GLU H OE2 1 
ATOM   9503  N  N   . HIS H  1 82  ? 83.922 67.562 136.188 1.00 34.55 ? 82   HIS H N   1 
ATOM   9504  C  CA  . HIS H  1 82  ? 84.818 66.833 135.303 1.00 34.65 ? 82   HIS H CA  1 
ATOM   9505  C  C   . HIS H  1 82  ? 84.526 65.346 135.454 1.00 34.10 ? 82   HIS H C   1 
ATOM   9506  O  O   . HIS H  1 82  ? 84.015 64.915 136.484 1.00 34.38 ? 82   HIS H O   1 
ATOM   9507  C  CB  . HIS H  1 82  ? 86.286 67.137 135.627 1.00 35.11 ? 82   HIS H CB  1 
ATOM   9508  C  CG  . HIS H  1 82  ? 86.687 66.784 137.023 1.00 38.81 ? 82   HIS H CG  1 
ATOM   9509  N  ND1 . HIS H  1 82  ? 86.397 67.586 138.105 1.00 38.96 ? 82   HIS H ND1 1 
ATOM   9510  C  CD2 . HIS H  1 82  ? 87.345 65.708 137.516 1.00 41.30 ? 82   HIS H CD2 1 
ATOM   9511  C  CE1 . HIS H  1 82  ? 86.861 67.020 139.205 1.00 42.79 ? 82   HIS H CE1 1 
ATOM   9512  N  NE2 . HIS H  1 82  ? 87.440 65.879 138.876 1.00 42.36 ? 82   HIS H NE2 1 
ATOM   9513  N  N   . THR H  1 83  ? 84.854 64.574 134.423 1.00 33.62 ? 83   THR H N   1 
ATOM   9514  C  CA  . THR H  1 83  ? 84.591 63.141 134.397 1.00 32.87 ? 83   THR H CA  1 
ATOM   9515  C  C   . THR H  1 83  ? 84.754 62.373 135.703 1.00 32.33 ? 83   THR H C   1 
ATOM   9516  O  O   . THR H  1 83  ? 83.792 61.812 136.227 1.00 31.49 ? 83   THR H O   1 
ATOM   9517  C  CB  . THR H  1 83  ? 85.449 62.441 133.321 1.00 32.54 ? 83   THR H CB  1 
ATOM   9518  O  OG1 . THR H  1 83  ? 85.153 62.998 132.030 1.00 32.51 ? 83   THR H OG1 1 
ATOM   9519  C  CG2 . THR H  1 83  ? 85.151 60.953 133.302 1.00 27.40 ? 83   THR H CG2 1 
ATOM   9520  N  N   . LYS H  1 84  ? 85.966 62.348 136.236 1.00 32.98 ? 84   LYS H N   1 
ATOM   9521  C  CA  . LYS H  1 84  ? 86.212 61.596 137.456 1.00 31.60 ? 84   LYS H CA  1 
ATOM   9522  C  C   . LYS H  1 84  ? 85.239 61.949 138.569 1.00 31.38 ? 84   LYS H C   1 
ATOM   9523  O  O   . LYS H  1 84  ? 84.688 61.052 139.213 1.00 33.14 ? 84   LYS H O   1 
ATOM   9524  C  CB  . LYS H  1 84  ? 87.657 61.795 137.917 1.00 33.80 ? 84   LYS H CB  1 
ATOM   9525  C  CG  . LYS H  1 84  ? 88.105 60.828 138.998 1.00 37.21 ? 84   LYS H CG  1 
ATOM   9526  C  CD  . LYS H  1 84  ? 89.615 60.886 139.179 1.00 38.77 ? 84   LYS H CD  1 
ATOM   9527  C  CE  . LYS H  1 84  ? 90.089 59.942 140.278 1.00 45.16 ? 84   LYS H CE  1 
ATOM   9528  N  NZ  . LYS H  1 84  ? 91.580 59.961 140.432 1.00 47.38 ? 84   LYS H NZ  1 
ATOM   9529  N  N   . GLU H  1 85  ? 85.012 63.244 138.791 1.00 28.77 ? 85   GLU H N   1 
ATOM   9530  C  CA  . GLU H  1 85  ? 84.097 63.676 139.846 1.00 27.03 ? 85   GLU H CA  1 
ATOM   9531  C  C   . GLU H  1 85  ? 82.675 63.212 139.537 1.00 26.80 ? 85   GLU H C   1 
ATOM   9532  O  O   . GLU H  1 85  ? 81.955 62.735 140.419 1.00 26.97 ? 85   GLU H O   1 
ATOM   9533  C  CB  . GLU H  1 85  ? 84.134 65.198 139.989 1.00 26.89 ? 85   GLU H CB  1 
ATOM   9534  C  CG  . GLU H  1 85  ? 83.269 65.719 141.122 1.00 29.12 ? 85   GLU H CG  1 
ATOM   9535  C  CD  . GLU H  1 85  ? 83.582 67.162 141.488 1.00 37.38 ? 85   GLU H CD  1 
ATOM   9536  O  OE1 . GLU H  1 85  ? 83.325 68.074 140.663 1.00 38.52 ? 85   GLU H OE1 1 
ATOM   9537  O  OE2 . GLU H  1 85  ? 84.091 67.382 142.609 1.00 42.57 ? 85   GLU H OE2 1 
ATOM   9538  N  N   . MET H  1 86  ? 82.292 63.351 138.273 1.00 26.35 ? 86   MET H N   1 
ATOM   9539  C  CA  . MET H  1 86  ? 80.982 62.950 137.794 1.00 26.55 ? 86   MET H CA  1 
ATOM   9540  C  C   . MET H  1 86  ? 80.772 61.456 138.017 1.00 26.67 ? 86   MET H C   1 
ATOM   9541  O  O   . MET H  1 86  ? 79.696 61.034 138.422 1.00 26.97 ? 86   MET H O   1 
ATOM   9542  C  CB  . MET H  1 86  ? 80.849 63.297 136.305 1.00 27.65 ? 86   MET H CB  1 
ATOM   9543  C  CG  . MET H  1 86  ? 80.806 64.800 136.038 1.00 26.97 ? 86   MET H CG  1 
ATOM   9544  S  SD  . MET H  1 86  ? 81.183 65.289 134.341 1.00 26.89 ? 86   MET H SD  1 
ATOM   9545  C  CE  . MET H  1 86  ? 79.700 64.671 133.449 1.00 26.05 ? 86   MET H CE  1 
ATOM   9546  N  N   . LEU H  1 87  ? 81.792 60.647 137.756 1.00 28.74 ? 87   LEU H N   1 
ATOM   9547  C  CA  . LEU H  1 87  ? 81.654 59.211 137.976 1.00 30.34 ? 87   LEU H CA  1 
ATOM   9548  C  C   . LEU H  1 87  ? 81.498 58.929 139.472 1.00 32.02 ? 87   LEU H C   1 
ATOM   9549  O  O   . LEU H  1 87  ? 80.720 58.056 139.867 1.00 34.92 ? 87   LEU H O   1 
ATOM   9550  C  CB  . LEU H  1 87  ? 82.867 58.445 137.430 1.00 30.37 ? 87   LEU H CB  1 
ATOM   9551  C  CG  . LEU H  1 87  ? 82.898 57.999 135.961 1.00 30.20 ? 87   LEU H CG  1 
ATOM   9552  C  CD1 . LEU H  1 87  ? 82.884 59.189 135.046 1.00 34.52 ? 87   LEU H CD1 1 
ATOM   9553  C  CD2 . LEU H  1 87  ? 84.166 57.203 135.711 1.00 31.51 ? 87   LEU H CD2 1 
ATOM   9554  N  N   . GLU H  1 88  ? 82.225 59.675 140.303 1.00 31.28 ? 88   GLU H N   1 
ATOM   9555  C  CA  . GLU H  1 88  ? 82.159 59.484 141.749 1.00 32.50 ? 88   GLU H CA  1 
ATOM   9556  C  C   . GLU H  1 88  ? 80.849 59.973 142.336 1.00 32.54 ? 88   GLU H C   1 
ATOM   9557  O  O   . GLU H  1 88  ? 80.387 59.465 143.359 1.00 32.14 ? 88   GLU H O   1 
ATOM   9558  C  CB  . GLU H  1 88  ? 83.327 60.187 142.436 1.00 35.44 ? 88   GLU H CB  1 
ATOM   9559  C  CG  . GLU H  1 88  ? 84.653 59.468 142.257 1.00 42.82 ? 88   GLU H CG  1 
ATOM   9560  C  CD  . GLU H  1 88  ? 85.808 60.194 142.919 1.00 49.59 ? 88   GLU H CD  1 
ATOM   9561  O  OE1 . GLU H  1 88  ? 85.992 61.400 142.634 1.00 55.42 ? 88   GLU H OE1 1 
ATOM   9562  O  OE2 . GLU H  1 88  ? 86.534 59.559 143.719 1.00 52.90 ? 88   GLU H OE2 1 
ATOM   9563  N  N   . CYS H  1 89  ? 80.253 60.971 141.696 1.00 33.07 ? 89   CYS H N   1 
ATOM   9564  C  CA  . CYS H  1 89  ? 78.974 61.490 142.156 1.00 33.73 ? 89   CYS H CA  1 
ATOM   9565  C  C   . CYS H  1 89  ? 77.854 60.461 141.931 1.00 34.53 ? 89   CYS H C   1 
ATOM   9566  O  O   . CYS H  1 89  ? 77.003 60.256 142.802 1.00 34.09 ? 89   CYS H O   1 
ATOM   9567  C  CB  . CYS H  1 89  ? 78.640 62.795 141.428 1.00 33.01 ? 89   CYS H CB  1 
ATOM   9568  S  SG  . CYS H  1 89  ? 79.593 64.236 141.992 1.00 36.49 ? 89   CYS H SG  1 
ATOM   9569  N  N   . ASP H  1 90  ? 77.855 59.815 140.766 1.00 34.63 ? 90   ASP H N   1 
ATOM   9570  C  CA  . ASP H  1 90  ? 76.834 58.820 140.465 1.00 35.49 ? 90   ASP H CA  1 
ATOM   9571  C  C   . ASP H  1 90  ? 77.006 57.604 141.356 1.00 35.72 ? 90   ASP H C   1 
ATOM   9572  O  O   . ASP H  1 90  ? 76.023 57.027 141.823 1.00 36.35 ? 90   ASP H O   1 
ATOM   9573  C  CB  . ASP H  1 90  ? 76.895 58.388 138.997 1.00 38.16 ? 90   ASP H CB  1 
ATOM   9574  C  CG  . ASP H  1 90  ? 76.558 59.520 138.035 1.00 44.03 ? 90   ASP H CG  1 
ATOM   9575  O  OD1 . ASP H  1 90  ? 75.833 60.461 138.435 1.00 44.86 ? 90   ASP H OD1 1 
ATOM   9576  O  OD2 . ASP H  1 90  ? 77.004 59.460 136.868 1.00 46.18 ? 90   ASP H OD2 1 
ATOM   9577  N  N   . LEU H  1 91  ? 78.255 57.211 141.596 1.00 34.35 ? 91   LEU H N   1 
ATOM   9578  C  CA  . LEU H  1 91  ? 78.513 56.056 142.448 1.00 34.02 ? 91   LEU H CA  1 
ATOM   9579  C  C   . LEU H  1 91  ? 77.973 56.338 143.853 1.00 35.80 ? 91   LEU H C   1 
ATOM   9580  O  O   . LEU H  1 91  ? 77.364 55.473 144.490 1.00 35.52 ? 91   LEU H O   1 
ATOM   9581  C  CB  . LEU H  1 91  ? 80.014 55.757 142.501 1.00 31.60 ? 91   LEU H CB  1 
ATOM   9582  C  CG  . LEU H  1 91  ? 80.413 54.485 143.258 1.00 30.24 ? 91   LEU H CG  1 
ATOM   9583  C  CD1 . LEU H  1 91  ? 79.643 53.311 142.703 1.00 32.66 ? 91   LEU H CD1 1 
ATOM   9584  C  CD2 . LEU H  1 91  ? 81.910 54.235 143.137 1.00 27.57 ? 91   LEU H CD2 1 
ATOM   9585  N  N   . LYS H  1 92  ? 78.183 57.561 144.328 1.00 35.36 ? 92   LYS H N   1 
ATOM   9586  C  CA  . LYS H  1 92  ? 77.706 57.940 145.647 1.00 37.44 ? 92   LYS H CA  1 
ATOM   9587  C  C   . LYS H  1 92  ? 76.182 57.852 145.714 1.00 36.29 ? 92   LYS H C   1 
ATOM   9588  O  O   . LYS H  1 92  ? 75.629 57.438 146.729 1.00 37.17 ? 92   LYS H O   1 
ATOM   9589  C  CB  . LYS H  1 92  ? 78.165 59.359 145.987 1.00 42.69 ? 92   LYS H CB  1 
ATOM   9590  C  CG  . LYS H  1 92  ? 77.898 59.789 147.429 1.00 45.09 ? 92   LYS H CG  1 
ATOM   9591  C  CD  . LYS H  1 92  ? 78.417 61.198 147.670 1.00 48.63 ? 92   LYS H CD  1 
ATOM   9592  C  CE  . LYS H  1 92  ? 78.136 61.673 149.082 1.00 49.77 ? 92   LYS H CE  1 
ATOM   9593  N  NZ  . LYS H  1 92  ? 78.578 63.088 149.244 1.00 49.95 ? 92   LYS H NZ  1 
ATOM   9594  N  N   . LEU H  1 93  ? 75.508 58.244 144.635 1.00 35.22 ? 93   LEU H N   1 
ATOM   9595  C  CA  . LEU H  1 93  ? 74.045 58.189 144.578 1.00 33.00 ? 93   LEU H CA  1 
ATOM   9596  C  C   . LEU H  1 93  ? 73.581 56.759 144.767 1.00 32.37 ? 93   LEU H C   1 
ATOM   9597  O  O   . LEU H  1 93  ? 72.839 56.442 145.697 1.00 32.69 ? 93   LEU H O   1 
ATOM   9598  C  CB  . LEU H  1 93  ? 73.522 58.672 143.224 1.00 30.09 ? 93   LEU H CB  1 
ATOM   9599  C  CG  . LEU H  1 93  ? 72.748 59.987 143.199 1.00 32.11 ? 93   LEU H CG  1 
ATOM   9600  C  CD1 . LEU H  1 93  ? 71.872 60.040 141.943 1.00 26.47 ? 93   LEU H CD1 1 
ATOM   9601  C  CD2 . LEU H  1 93  ? 71.884 60.100 144.446 1.00 30.42 ? 93   LEU H CD2 1 
ATOM   9602  N  N   . GLU H  1 94  ? 74.023 55.909 143.853 1.00 31.26 ? 94   GLU H N   1 
ATOM   9603  C  CA  . GLU H  1 94  ? 73.682 54.492 143.860 1.00 33.61 ? 94   GLU H CA  1 
ATOM   9604  C  C   . GLU H  1 94  ? 73.915 53.877 145.236 1.00 35.16 ? 94   GLU H C   1 
ATOM   9605  O  O   . GLU H  1 94  ? 73.030 53.222 145.785 1.00 37.53 ? 94   GLU H O   1 
ATOM   9606  C  CB  . GLU H  1 94  ? 74.487 53.742 142.797 1.00 34.47 ? 94   GLU H CB  1 
ATOM   9607  C  CG  . GLU H  1 94  ? 74.242 54.227 141.377 1.00 38.42 ? 94   GLU H CG  1 
ATOM   9608  C  CD  . GLU H  1 94  ? 72.915 53.751 140.819 1.00 42.92 ? 94   GLU H CD  1 
ATOM   9609  O  OE1 . GLU H  1 94  ? 72.183 53.048 141.546 1.00 46.52 ? 94   GLU H OE1 1 
ATOM   9610  O  OE2 . GLU H  1 94  ? 72.609 54.081 139.653 1.00 44.08 ? 94   GLU H OE2 1 
ATOM   9611  N  N   . GLN H  1 95  ? 75.098 54.081 145.800 1.00 36.08 ? 95   GLN H N   1 
ATOM   9612  C  CA  . GLN H  1 95  ? 75.377 53.510 147.108 1.00 36.29 ? 95   GLN H CA  1 
ATOM   9613  C  C   . GLN H  1 95  ? 74.413 54.032 148.170 1.00 36.95 ? 95   GLN H C   1 
ATOM   9614  O  O   . GLN H  1 95  ? 73.850 53.249 148.932 1.00 41.62 ? 95   GLN H O   1 
ATOM   9615  C  CB  . GLN H  1 95  ? 76.823 53.792 147.504 1.00 34.73 ? 95   GLN H CB  1 
ATOM   9616  C  CG  . GLN H  1 95  ? 77.808 53.097 146.598 1.00 37.34 ? 95   GLN H CG  1 
ATOM   9617  C  CD  . GLN H  1 95  ? 79.227 53.565 146.808 1.00 39.61 ? 95   GLN H CD  1 
ATOM   9618  O  OE1 . GLN H  1 95  ? 79.469 54.742 147.088 1.00 40.90 ? 95   GLN H OE1 1 
ATOM   9619  N  NE2 . GLN H  1 95  ? 80.181 52.652 146.651 1.00 37.87 ? 95   GLN H NE2 1 
ATOM   9620  N  N   . ALA H  1 96  ? 74.209 55.344 148.213 1.00 36.46 ? 96   ALA H N   1 
ATOM   9621  C  CA  . ALA H  1 96  ? 73.305 55.944 149.189 1.00 34.86 ? 96   ALA H CA  1 
ATOM   9622  C  C   . ALA H  1 96  ? 71.865 55.468 149.022 1.00 36.41 ? 96   ALA H C   1 
ATOM   9623  O  O   . ALA H  1 96  ? 71.038 55.638 149.922 1.00 38.47 ? 96   ALA H O   1 
ATOM   9624  C  CB  . ALA H  1 96  ? 73.359 57.452 149.088 1.00 32.38 ? 96   ALA H CB  1 
ATOM   9625  N  N   . GLY H  1 97  ? 71.563 54.866 147.876 1.00 36.22 ? 97   GLY H N   1 
ATOM   9626  C  CA  . GLY H  1 97  ? 70.213 54.391 147.640 1.00 35.08 ? 97   GLY H CA  1 
ATOM   9627  C  C   . GLY H  1 97  ? 70.046 52.916 147.922 1.00 37.19 ? 97   GLY H C   1 
ATOM   9628  O  O   . GLY H  1 97  ? 68.929 52.430 148.083 1.00 38.39 ? 97   GLY H O   1 
ATOM   9629  N  N   . LEU H  1 98  ? 71.160 52.199 147.987 1.00 39.86 ? 98   LEU H N   1 
ATOM   9630  C  CA  . LEU H  1 98  ? 71.124 50.765 148.243 1.00 42.23 ? 98   LEU H CA  1 
ATOM   9631  C  C   . LEU H  1 98  ? 70.470 50.422 149.589 1.00 43.73 ? 98   LEU H C   1 
ATOM   9632  O  O   . LEU H  1 98  ? 69.635 49.518 149.671 1.00 45.30 ? 98   LEU H O   1 
ATOM   9633  C  CB  . LEU H  1 98  ? 72.543 50.202 148.184 1.00 43.10 ? 98   LEU H CB  1 
ATOM   9634  C  CG  . LEU H  1 98  ? 72.712 48.852 147.476 1.00 47.80 ? 98   LEU H CG  1 
ATOM   9635  C  CD1 . LEU H  1 98  ? 72.062 48.889 146.088 1.00 44.27 ? 98   LEU H CD1 1 
ATOM   9636  C  CD2 . LEU H  1 98  ? 74.206 48.537 147.365 1.00 47.45 ? 98   LEU H CD2 1 
ATOM   9637  N  N   . PRO H  1 99  ? 70.841 51.137 150.664 1.00 42.78 ? 99   PRO H N   1 
ATOM   9638  C  CA  . PRO H  1 99  ? 70.233 50.834 151.961 1.00 41.85 ? 99   PRO H CA  1 
ATOM   9639  C  C   . PRO H  1 99  ? 68.715 50.911 151.914 1.00 41.38 ? 99   PRO H C   1 
ATOM   9640  O  O   . PRO H  1 99  ? 68.022 50.025 152.417 1.00 43.74 ? 99   PRO H O   1 
ATOM   9641  C  CB  . PRO H  1 99  ? 70.828 51.898 152.880 1.00 41.68 ? 99   PRO H CB  1 
ATOM   9642  C  CG  . PRO H  1 99  ? 72.175 52.133 152.282 1.00 43.64 ? 99   PRO H CG  1 
ATOM   9643  C  CD  . PRO H  1 99  ? 71.879 52.173 150.801 1.00 42.87 ? 99   PRO H CD  1 
ATOM   9644  N  N   . ASP H  1 100 ? 68.201 51.968 151.296 1.00 40.29 ? 100  ASP H N   1 
ATOM   9645  C  CA  . ASP H  1 100 ? 66.761 52.169 151.208 1.00 39.64 ? 100  ASP H CA  1 
ATOM   9646  C  C   . ASP H  1 100 ? 65.998 51.072 150.473 1.00 37.54 ? 100  ASP H C   1 
ATOM   9647  O  O   . ASP H  1 100 ? 64.887 50.718 150.878 1.00 37.13 ? 100  ASP H O   1 
ATOM   9648  C  CB  . ASP H  1 100 ? 66.473 53.532 150.587 1.00 43.09 ? 100  ASP H CB  1 
ATOM   9649  C  CG  . ASP H  1 100 ? 66.859 54.671 151.509 1.00 46.04 ? 100  ASP H CG  1 
ATOM   9650  O  OD1 . ASP H  1 100 ? 66.695 55.846 151.116 1.00 49.40 ? 100  ASP H OD1 1 
ATOM   9651  O  OD2 . ASP H  1 100 ? 67.327 54.385 152.635 1.00 48.09 ? 100  ASP H OD2 1 
ATOM   9652  N  N   . LEU H  1 101 ? 66.582 50.537 149.403 1.00 33.14 ? 101  LEU H N   1 
ATOM   9653  C  CA  . LEU H  1 101 ? 65.942 49.461 148.652 1.00 31.49 ? 101  LEU H CA  1 
ATOM   9654  C  C   . LEU H  1 101 ? 65.902 48.200 149.509 1.00 32.97 ? 101  LEU H C   1 
ATOM   9655  O  O   . LEU H  1 101 ? 64.888 47.492 149.569 1.00 30.54 ? 101  LEU H O   1 
ATOM   9656  C  CB  . LEU H  1 101 ? 66.720 49.164 147.374 1.00 31.63 ? 101  LEU H CB  1 
ATOM   9657  C  CG  . LEU H  1 101 ? 66.313 49.900 146.102 1.00 30.68 ? 101  LEU H CG  1 
ATOM   9658  C  CD1 . LEU H  1 101 ? 67.412 49.747 145.058 1.00 31.49 ? 101  LEU H CD1 1 
ATOM   9659  C  CD2 . LEU H  1 101 ? 64.994 49.355 145.598 1.00 26.83 ? 101  LEU H CD2 1 
ATOM   9660  N  N   . LYS H  1 102 ? 67.023 47.916 150.166 1.00 33.74 ? 102  LYS H N   1 
ATOM   9661  C  CA  . LYS H  1 102 ? 67.110 46.747 151.025 1.00 33.11 ? 102  LYS H CA  1 
ATOM   9662  C  C   . LYS H  1 102 ? 66.143 46.894 152.205 1.00 33.20 ? 102  LYS H C   1 
ATOM   9663  O  O   . LYS H  1 102 ? 65.479 45.929 152.601 1.00 31.95 ? 102  LYS H O   1 
ATOM   9664  C  CB  . LYS H  1 102 ? 68.557 46.561 151.489 1.00 31.51 ? 102  LYS H CB  1 
ATOM   9665  C  CG  . LYS H  1 102 ? 69.476 46.200 150.326 1.00 31.52 ? 102  LYS H CG  1 
ATOM   9666  C  CD  . LYS H  1 102 ? 70.906 45.842 150.730 1.00 28.00 ? 102  LYS H CD  1 
ATOM   9667  C  CE  . LYS H  1 102 ? 71.687 45.418 149.492 1.00 30.59 ? 102  LYS H CE  1 
ATOM   9668  N  NZ  . LYS H  1 102 ? 73.116 45.132 149.763 1.00 35.71 ? 102  LYS H NZ  1 
ATOM   9669  N  N   . ALA H  1 103 ? 66.047 48.106 152.751 1.00 30.94 ? 103  ALA H N   1 
ATOM   9670  C  CA  . ALA H  1 103 ? 65.131 48.355 153.855 1.00 27.62 ? 103  ALA H CA  1 
ATOM   9671  C  C   . ALA H  1 103 ? 63.708 48.095 153.361 1.00 27.57 ? 103  ALA H C   1 
ATOM   9672  O  O   . ALA H  1 103 ? 62.946 47.377 154.004 1.00 31.12 ? 103  ALA H O   1 
ATOM   9673  C  CB  . ALA H  1 103 ? 65.259 49.783 154.327 1.00 21.24 ? 103  ALA H CB  1 
ATOM   9674  N  N   . ALA H  1 104 ? 63.363 48.666 152.206 1.00 25.93 ? 104  ALA H N   1 
ATOM   9675  C  CA  . ALA H  1 104 ? 62.023 48.504 151.630 1.00 22.67 ? 104  ALA H CA  1 
ATOM   9676  C  C   . ALA H  1 104 ? 61.690 47.042 151.327 1.00 20.71 ? 104  ALA H C   1 
ATOM   9677  O  O   . ALA H  1 104 ? 60.612 46.566 151.674 1.00 18.22 ? 104  ALA H O   1 
ATOM   9678  C  CB  . ALA H  1 104 ? 61.887 49.352 150.379 1.00 18.63 ? 104  ALA H CB  1 
ATOM   9679  N  N   . ILE H  1 105 ? 62.604 46.330 150.681 1.00 21.22 ? 105  ILE H N   1 
ATOM   9680  C  CA  . ILE H  1 105 ? 62.370 44.921 150.391 1.00 22.96 ? 105  ILE H CA  1 
ATOM   9681  C  C   . ILE H  1 105 ? 62.045 44.219 151.708 1.00 26.34 ? 105  ILE H C   1 
ATOM   9682  O  O   . ILE H  1 105 ? 61.006 43.560 151.844 1.00 29.68 ? 105  ILE H O   1 
ATOM   9683  C  CB  . ILE H  1 105 ? 63.620 44.260 149.768 1.00 24.25 ? 105  ILE H CB  1 
ATOM   9684  C  CG1 . ILE H  1 105 ? 63.810 44.754 148.326 1.00 26.14 ? 105  ILE H CG1 1 
ATOM   9685  C  CG2 . ILE H  1 105 ? 63.496 42.740 149.821 1.00 23.41 ? 105  ILE H CG2 1 
ATOM   9686  C  CD1 . ILE H  1 105 ? 65.134 44.332 147.694 1.00 23.34 ? 105  ILE H CD1 1 
ATOM   9687  N  N   . ALA H  1 106 ? 62.938 44.376 152.680 1.00 26.41 ? 106  ALA H N   1 
ATOM   9688  C  CA  . ALA H  1 106 ? 62.771 43.762 153.991 1.00 26.84 ? 106  ALA H CA  1 
ATOM   9689  C  C   . ALA H  1 106 ? 61.413 44.063 154.623 1.00 27.19 ? 106  ALA H C   1 
ATOM   9690  O  O   . ALA H  1 106 ? 60.837 43.204 155.287 1.00 29.97 ? 106  ALA H O   1 
ATOM   9691  C  CB  . ALA H  1 106 ? 63.887 44.213 154.921 1.00 27.90 ? 106  ALA H CB  1 
ATOM   9692  N  N   . TYR H  1 107 ? 60.891 45.266 154.424 1.00 26.05 ? 107  TYR H N   1 
ATOM   9693  C  CA  . TYR H  1 107 ? 59.598 45.584 155.010 1.00 30.67 ? 107  TYR H CA  1 
ATOM   9694  C  C   . TYR H  1 107 ? 58.444 44.898 154.261 1.00 31.64 ? 107  TYR H C   1 
ATOM   9695  O  O   . TYR H  1 107 ? 57.480 44.425 154.876 1.00 31.87 ? 107  TYR H O   1 
ATOM   9696  C  CB  . TYR H  1 107 ? 59.363 47.098 155.043 1.00 33.53 ? 107  TYR H CB  1 
ATOM   9697  C  CG  . TYR H  1 107 ? 58.109 47.446 155.809 1.00 42.81 ? 107  TYR H CG  1 
ATOM   9698  C  CD1 . TYR H  1 107 ? 58.038 47.250 157.192 1.00 45.55 ? 107  TYR H CD1 1 
ATOM   9699  C  CD2 . TYR H  1 107 ? 56.962 47.891 155.149 1.00 46.53 ? 107  TYR H CD2 1 
ATOM   9700  C  CE1 . TYR H  1 107 ? 56.854 47.484 157.897 1.00 47.99 ? 107  TYR H CE1 1 
ATOM   9701  C  CE2 . TYR H  1 107 ? 55.768 48.126 155.845 1.00 48.40 ? 107  TYR H CE2 1 
ATOM   9702  C  CZ  . TYR H  1 107 ? 55.724 47.920 157.218 1.00 51.06 ? 107  TYR H CZ  1 
ATOM   9703  O  OH  . TYR H  1 107 ? 54.551 48.145 157.909 1.00 54.97 ? 107  TYR H OH  1 
ATOM   9704  N  N   . CYS H  1 108 ? 58.537 44.847 152.935 1.00 31.54 ? 108  CYS H N   1 
ATOM   9705  C  CA  . CYS H  1 108 ? 57.504 44.210 152.126 1.00 30.55 ? 108  CYS H CA  1 
ATOM   9706  C  C   . CYS H  1 108 ? 57.383 42.741 152.537 1.00 31.74 ? 108  CYS H C   1 
ATOM   9707  O  O   . CYS H  1 108 ? 56.287 42.167 152.581 1.00 30.18 ? 108  CYS H O   1 
ATOM   9708  C  CB  . CYS H  1 108 ? 57.861 44.329 150.640 1.00 29.96 ? 108  CYS H CB  1 
ATOM   9709  S  SG  . CYS H  1 108 ? 57.723 46.029 149.960 1.00 29.54 ? 108  CYS H SG  1 
ATOM   9710  N  N   . GLU H  1 109 ? 58.525 42.142 152.852 1.00 32.27 ? 109  GLU H N   1 
ATOM   9711  C  CA  . GLU H  1 109 ? 58.586 40.746 153.271 1.00 32.01 ? 109  GLU H CA  1 
ATOM   9712  C  C   . GLU H  1 109 ? 57.867 40.564 154.608 1.00 32.60 ? 109  GLU H C   1 
ATOM   9713  O  O   . GLU H  1 109 ? 57.131 39.601 154.800 1.00 33.31 ? 109  GLU H O   1 
ATOM   9714  C  CB  . GLU H  1 109 ? 60.058 40.318 153.397 1.00 30.05 ? 109  GLU H CB  1 
ATOM   9715  C  CG  . GLU H  1 109 ? 60.302 38.883 153.855 1.00 26.20 ? 109  GLU H CG  1 
ATOM   9716  C  CD  . GLU H  1 109 ? 59.930 37.850 152.814 1.00 27.43 ? 109  GLU H CD  1 
ATOM   9717  O  OE1 . GLU H  1 109 ? 60.143 38.104 151.611 1.00 29.61 ? 109  GLU H OE1 1 
ATOM   9718  O  OE2 . GLU H  1 109 ? 59.439 36.768 153.202 1.00 31.41 ? 109  GLU H OE2 1 
ATOM   9719  N  N   . SER H  1 110 ? 58.074 41.505 155.525 1.00 32.82 ? 110  SER H N   1 
ATOM   9720  C  CA  . SER H  1 110 ? 57.461 41.433 156.847 1.00 31.94 ? 110  SER H CA  1 
ATOM   9721  C  C   . SER H  1 110 ? 55.947 41.621 156.855 1.00 32.44 ? 110  SER H C   1 
ATOM   9722  O  O   . SER H  1 110 ? 55.290 41.255 157.831 1.00 34.92 ? 110  SER H O   1 
ATOM   9723  C  CB  . SER H  1 110 ? 58.078 42.476 157.774 1.00 30.82 ? 110  SER H CB  1 
ATOM   9724  O  OG  . SER H  1 110 ? 57.571 43.768 157.476 1.00 33.49 ? 110  SER H OG  1 
ATOM   9725  N  N   . VAL H  1 111 ? 55.385 42.199 155.796 1.00 31.57 ? 111  VAL H N   1 
ATOM   9726  C  CA  . VAL H  1 111 ? 53.937 42.408 155.756 1.00 31.13 ? 111  VAL H CA  1 
ATOM   9727  C  C   . VAL H  1 111 ? 53.249 41.645 154.630 1.00 30.23 ? 111  VAL H C   1 
ATOM   9728  O  O   . VAL H  1 111 ? 52.116 41.961 154.250 1.00 30.97 ? 111  VAL H O   1 
ATOM   9729  C  CB  . VAL H  1 111 ? 53.574 43.902 155.617 1.00 31.86 ? 111  VAL H CB  1 
ATOM   9730  C  CG1 . VAL H  1 111 ? 54.246 44.708 156.711 1.00 31.36 ? 111  VAL H CG1 1 
ATOM   9731  C  CG2 . VAL H  1 111 ? 53.965 44.405 154.241 1.00 32.63 ? 111  VAL H CG2 1 
ATOM   9732  N  N   . GLY H  1 112 ? 53.945 40.655 154.083 1.00 30.53 ? 112  GLY H N   1 
ATOM   9733  C  CA  . GLY H  1 112 ? 53.373 39.846 153.022 1.00 29.30 ? 112  GLY H CA  1 
ATOM   9734  C  C   . GLY H  1 112 ? 53.165 40.493 151.667 1.00 29.28 ? 112  GLY H C   1 
ATOM   9735  O  O   . GLY H  1 112 ? 52.411 39.952 150.855 1.00 30.53 ? 112  GLY H O   1 
ATOM   9736  N  N   . ASP H  1 113 ? 53.795 41.639 151.402 1.00 29.79 ? 113  ASP H N   1 
ATOM   9737  C  CA  . ASP H  1 113 ? 53.630 42.269 150.089 1.00 27.44 ? 113  ASP H CA  1 
ATOM   9738  C  C   . ASP H  1 113 ? 54.751 41.763 149.194 1.00 25.44 ? 113  ASP H C   1 
ATOM   9739  O  O   . ASP H  1 113 ? 55.707 42.473 148.893 1.00 25.10 ? 113  ASP H O   1 
ATOM   9740  C  CB  . ASP H  1 113 ? 53.676 43.804 150.162 1.00 26.01 ? 113  ASP H CB  1 
ATOM   9741  C  CG  . ASP H  1 113 ? 53.292 44.463 148.817 1.00 32.04 ? 113  ASP H CG  1 
ATOM   9742  O  OD1 . ASP H  1 113 ? 53.141 43.720 147.812 1.00 35.51 ? 113  ASP H OD1 1 
ATOM   9743  O  OD2 . ASP H  1 113 ? 53.146 45.708 148.749 1.00 24.54 ? 113  ASP H OD2 1 
ATOM   9744  N  N   . TYR H  1 114 ? 54.617 40.515 148.773 1.00 26.63 ? 114  TYR H N   1 
ATOM   9745  C  CA  . TYR H  1 114 ? 55.607 39.868 147.926 1.00 27.70 ? 114  TYR H CA  1 
ATOM   9746  C  C   . TYR H  1 114 ? 55.760 40.471 146.527 1.00 27.29 ? 114  TYR H C   1 
ATOM   9747  O  O   . TYR H  1 114 ? 56.873 40.587 146.027 1.00 26.06 ? 114  TYR H O   1 
ATOM   9748  C  CB  . TYR H  1 114 ? 55.269 38.386 147.837 1.00 28.01 ? 114  TYR H CB  1 
ATOM   9749  C  CG  . TYR H  1 114 ? 55.175 37.752 149.205 1.00 30.79 ? 114  TYR H CG  1 
ATOM   9750  C  CD1 . TYR H  1 114 ? 56.295 37.679 150.038 1.00 32.15 ? 114  TYR H CD1 1 
ATOM   9751  C  CD2 . TYR H  1 114 ? 53.966 37.235 149.679 1.00 32.65 ? 114  TYR H CD2 1 
ATOM   9752  C  CE1 . TYR H  1 114 ? 56.217 37.106 151.310 1.00 34.96 ? 114  TYR H CE1 1 
ATOM   9753  C  CE2 . TYR H  1 114 ? 53.877 36.656 150.951 1.00 33.84 ? 114  TYR H CE2 1 
ATOM   9754  C  CZ  . TYR H  1 114 ? 55.007 36.595 151.758 1.00 35.25 ? 114  TYR H CZ  1 
ATOM   9755  O  OH  . TYR H  1 114 ? 54.936 36.006 152.997 1.00 34.67 ? 114  TYR H OH  1 
ATOM   9756  N  N   . ALA H  1 115 ? 54.656 40.860 145.896 1.00 27.69 ? 115  ALA H N   1 
ATOM   9757  C  CA  . ALA H  1 115 ? 54.743 41.444 144.564 1.00 26.10 ? 115  ALA H CA  1 
ATOM   9758  C  C   . ALA H  1 115 ? 55.546 42.744 144.621 1.00 26.78 ? 115  ALA H C   1 
ATOM   9759  O  O   . ALA H  1 115 ? 56.342 43.027 143.717 1.00 27.74 ? 115  ALA H O   1 
ATOM   9760  C  CB  . ALA H  1 115 ? 53.346 41.689 143.986 1.00 24.84 ? 115  ALA H CB  1 
ATOM   9761  N  N   . SER H  1 116 ? 55.353 43.538 145.673 1.00 24.89 ? 116  SER H N   1 
ATOM   9762  C  CA  . SER H  1 116 ? 56.123 44.779 145.790 1.00 25.03 ? 116  SER H CA  1 
ATOM   9763  C  C   . SER H  1 116 ? 57.599 44.431 146.024 1.00 25.37 ? 116  SER H C   1 
ATOM   9764  O  O   . SER H  1 116 ? 58.500 45.108 145.516 1.00 25.53 ? 116  SER H O   1 
ATOM   9765  C  CB  . SER H  1 116 ? 55.606 45.648 146.943 1.00 22.24 ? 116  SER H CB  1 
ATOM   9766  O  OG  . SER H  1 116 ? 54.345 46.223 146.632 1.00 23.25 ? 116  SER H OG  1 
ATOM   9767  N  N   . ARG H  1 117 ? 57.854 43.369 146.781 1.00 23.22 ? 117  ARG H N   1 
ATOM   9768  C  CA  . ARG H  1 117 ? 59.231 42.983 147.037 1.00 24.90 ? 117  ARG H CA  1 
ATOM   9769  C  C   . ARG H  1 117 ? 59.912 42.528 145.750 1.00 28.51 ? 117  ARG H C   1 
ATOM   9770  O  O   . ARG H  1 117 ? 61.092 42.805 145.521 1.00 28.44 ? 117  ARG H O   1 
ATOM   9771  C  CB  . ARG H  1 117 ? 59.299 41.859 148.071 1.00 23.68 ? 117  ARG H CB  1 
ATOM   9772  C  CG  . ARG H  1 117 ? 60.616 41.102 148.006 1.00 25.87 ? 117  ARG H CG  1 
ATOM   9773  C  CD  . ARG H  1 117 ? 60.791 40.067 149.103 1.00 28.72 ? 117  ARG H CD  1 
ATOM   9774  N  NE  . ARG H  1 117 ? 61.962 39.243 148.816 1.00 31.99 ? 117  ARG H NE  1 
ATOM   9775  C  CZ  . ARG H  1 117 ? 62.830 38.825 149.728 1.00 32.27 ? 117  ARG H CZ  1 
ATOM   9776  N  NH1 . ARG H  1 117 ? 62.661 39.152 151.001 1.00 31.59 ? 117  ARG H NH1 1 
ATOM   9777  N  NH2 . ARG H  1 117 ? 63.877 38.090 149.363 1.00 33.80 ? 117  ARG H NH2 1 
ATOM   9778  N  N   . GLU H  1 118 ? 59.158 41.818 144.917 1.00 32.16 ? 118  GLU H N   1 
ATOM   9779  C  CA  . GLU H  1 118 ? 59.676 41.307 143.659 1.00 31.60 ? 118  GLU H CA  1 
ATOM   9780  C  C   . GLU H  1 118 ? 60.102 42.489 142.812 1.00 30.04 ? 118  GLU H C   1 
ATOM   9781  O  O   . GLU H  1 118 ? 61.194 42.512 142.261 1.00 30.03 ? 118  GLU H O   1 
ATOM   9782  C  CB  . GLU H  1 118 ? 58.596 40.518 142.933 1.00 36.82 ? 118  GLU H CB  1 
ATOM   9783  C  CG  . GLU H  1 118 ? 59.127 39.325 142.169 1.00 46.43 ? 118  GLU H CG  1 
ATOM   9784  C  CD  . GLU H  1 118 ? 59.552 38.205 143.096 1.00 53.31 ? 118  GLU H CD  1 
ATOM   9785  O  OE1 . GLU H  1 118 ? 60.482 38.418 143.908 1.00 55.25 ? 118  GLU H OE1 1 
ATOM   9786  O  OE2 . GLU H  1 118 ? 58.948 37.110 143.018 1.00 59.46 ? 118  GLU H OE2 1 
ATOM   9787  N  N   . LEU H  1 119 ? 59.227 43.478 142.718 1.00 29.76 ? 119  LEU H N   1 
ATOM   9788  C  CA  . LEU H  1 119 ? 59.519 44.673 141.950 1.00 28.25 ? 119  LEU H CA  1 
ATOM   9789  C  C   . LEU H  1 119 ? 60.818 45.280 142.453 1.00 28.46 ? 119  LEU H C   1 
ATOM   9790  O  O   . LEU H  1 119 ? 61.720 45.572 141.668 1.00 30.82 ? 119  LEU H O   1 
ATOM   9791  C  CB  . LEU H  1 119 ? 58.378 45.680 142.100 1.00 26.88 ? 119  LEU H CB  1 
ATOM   9792  C  CG  . LEU H  1 119 ? 58.453 46.987 141.310 1.00 26.61 ? 119  LEU H CG  1 
ATOM   9793  C  CD1 . LEU H  1 119 ? 57.162 47.774 141.523 1.00 25.31 ? 119  LEU H CD1 1 
ATOM   9794  C  CD2 . LEU H  1 119 ? 59.637 47.810 141.762 1.00 28.02 ? 119  LEU H CD2 1 
ATOM   9795  N  N   . LEU H  1 120 ? 60.915 45.478 143.764 1.00 28.97 ? 120  LEU H N   1 
ATOM   9796  C  CA  . LEU H  1 120 ? 62.118 46.066 144.341 1.00 28.87 ? 120  LEU H CA  1 
ATOM   9797  C  C   . LEU H  1 120 ? 63.373 45.220 144.093 1.00 29.84 ? 120  LEU H C   1 
ATOM   9798  O  O   . LEU H  1 120 ? 64.439 45.764 143.795 1.00 30.70 ? 120  LEU H O   1 
ATOM   9799  C  CB  . LEU H  1 120 ? 61.917 46.316 145.842 1.00 28.16 ? 120  LEU H CB  1 
ATOM   9800  C  CG  . LEU H  1 120 ? 61.262 47.648 146.265 1.00 32.05 ? 120  LEU H CG  1 
ATOM   9801  C  CD1 . LEU H  1 120 ? 60.415 48.225 145.131 1.00 30.75 ? 120  LEU H CD1 1 
ATOM   9802  C  CD2 . LEU H  1 120 ? 60.407 47.429 147.525 1.00 24.40 ? 120  LEU H CD2 1 
ATOM   9803  N  N   . GLU H  1 121 ? 63.266 43.900 144.198 1.00 29.28 ? 121  GLU H N   1 
ATOM   9804  C  CA  . GLU H  1 121 ? 64.446 43.083 143.964 1.00 32.00 ? 121  GLU H CA  1 
ATOM   9805  C  C   . GLU H  1 121 ? 64.961 43.342 142.556 1.00 32.72 ? 121  GLU H C   1 
ATOM   9806  O  O   . GLU H  1 121 ? 66.167 43.492 142.350 1.00 29.42 ? 121  GLU H O   1 
ATOM   9807  C  CB  . GLU H  1 121 ? 64.144 41.593 144.158 1.00 36.15 ? 121  GLU H CB  1 
ATOM   9808  C  CG  . GLU H  1 121 ? 63.906 41.200 145.620 1.00 45.07 ? 121  GLU H CG  1 
ATOM   9809  C  CD  . GLU H  1 121 ? 63.644 39.709 145.805 1.00 47.89 ? 121  GLU H CD  1 
ATOM   9810  O  OE1 . GLU H  1 121 ? 62.766 39.172 145.099 1.00 47.84 ? 121  GLU H OE1 1 
ATOM   9811  O  OE2 . GLU H  1 121 ? 64.309 39.078 146.658 1.00 50.64 ? 121  GLU H OE2 1 
ATOM   9812  N  N   . ASP H  1 122 ? 64.047 43.425 141.592 1.00 32.56 ? 122  ASP H N   1 
ATOM   9813  C  CA  . ASP H  1 122 ? 64.452 43.668 140.214 1.00 34.34 ? 122  ASP H CA  1 
ATOM   9814  C  C   . ASP H  1 122 ? 65.203 44.987 140.102 1.00 33.03 ? 122  ASP H C   1 
ATOM   9815  O  O   . ASP H  1 122 ? 66.318 45.026 139.581 1.00 35.02 ? 122  ASP H O   1 
ATOM   9816  C  CB  . ASP H  1 122 ? 63.243 43.651 139.273 1.00 40.90 ? 122  ASP H CB  1 
ATOM   9817  C  CG  . ASP H  1 122 ? 62.566 42.278 139.210 1.00 49.50 ? 122  ASP H CG  1 
ATOM   9818  O  OD1 . ASP H  1 122 ? 63.266 41.246 139.379 1.00 53.79 ? 122  ASP H OD1 1 
ATOM   9819  O  OD2 . ASP H  1 122 ? 61.336 42.228 138.976 1.00 53.14 ? 122  ASP H OD2 1 
ATOM   9820  N  N   . ILE H  1 123 ? 64.614 46.070 140.594 1.00 30.70 ? 123  ILE H N   1 
ATOM   9821  C  CA  . ILE H  1 123 ? 65.303 47.360 140.543 1.00 29.63 ? 123  ILE H CA  1 
ATOM   9822  C  C   . ILE H  1 123 ? 66.656 47.256 141.261 1.00 29.66 ? 123  ILE H C   1 
ATOM   9823  O  O   . ILE H  1 123 ? 67.654 47.811 140.811 1.00 27.30 ? 123  ILE H O   1 
ATOM   9824  C  CB  . ILE H  1 123 ? 64.457 48.471 141.195 1.00 28.07 ? 123  ILE H CB  1 
ATOM   9825  C  CG1 . ILE H  1 123 ? 63.213 48.723 140.336 1.00 24.98 ? 123  ILE H CG1 1 
ATOM   9826  C  CG2 . ILE H  1 123 ? 65.301 49.730 141.381 1.00 25.72 ? 123  ILE H CG2 1 
ATOM   9827  C  CD1 . ILE H  1 123 ? 62.290 49.781 140.873 1.00 25.76 ? 123  ILE H CD1 1 
ATOM   9828  N  N   . LEU H  1 124 ? 66.682 46.526 142.372 1.00 30.09 ? 124  LEU H N   1 
ATOM   9829  C  CA  . LEU H  1 124 ? 67.910 46.337 143.134 1.00 30.01 ? 124  LEU H CA  1 
ATOM   9830  C  C   . LEU H  1 124 ? 68.986 45.709 142.266 1.00 31.12 ? 124  LEU H C   1 
ATOM   9831  O  O   . LEU H  1 124 ? 70.125 46.164 142.244 1.00 32.58 ? 124  LEU H O   1 
ATOM   9832  C  CB  . LEU H  1 124 ? 67.658 45.421 144.330 1.00 30.49 ? 124  LEU H CB  1 
ATOM   9833  C  CG  . LEU H  1 124 ? 68.908 45.015 145.113 1.00 26.44 ? 124  LEU H CG  1 
ATOM   9834  C  CD1 . LEU H  1 124 ? 69.595 46.259 145.611 1.00 27.42 ? 124  LEU H CD1 1 
ATOM   9835  C  CD2 . LEU H  1 124 ? 68.540 44.111 146.275 1.00 26.16 ? 124  LEU H CD2 1 
ATOM   9836  N  N   . GLU H  1 125 ? 68.623 44.647 141.560 1.00 31.74 ? 125  GLU H N   1 
ATOM   9837  C  CA  . GLU H  1 125 ? 69.580 43.965 140.706 1.00 34.25 ? 125  GLU H CA  1 
ATOM   9838  C  C   . GLU H  1 125 ? 70.109 44.927 139.655 1.00 33.47 ? 125  GLU H C   1 
ATOM   9839  O  O   . GLU H  1 125 ? 71.297 44.919 139.334 1.00 30.07 ? 125  GLU H O   1 
ATOM   9840  C  CB  . GLU H  1 125 ? 68.926 42.738 140.069 1.00 35.39 ? 125  GLU H CB  1 
ATOM   9841  C  CG  . GLU H  1 125 ? 68.329 41.827 141.140 1.00 44.67 ? 125  GLU H CG  1 
ATOM   9842  C  CD  . GLU H  1 125 ? 67.952 40.455 140.639 1.00 49.48 ? 125  GLU H CD  1 
ATOM   9843  O  OE1 . GLU H  1 125 ? 68.864 39.704 140.222 1.00 51.04 ? 125  GLU H OE1 1 
ATOM   9844  O  OE2 . GLU H  1 125 ? 66.740 40.130 140.672 1.00 54.65 ? 125  GLU H OE2 1 
ATOM   9845  N  N   . SER H  1 126 ? 69.227 45.780 139.148 1.00 34.28 ? 126  SER H N   1 
ATOM   9846  C  CA  . SER H  1 126 ? 69.615 46.759 138.147 1.00 33.61 ? 126  SER H CA  1 
ATOM   9847  C  C   . SER H  1 126 ? 70.595 47.758 138.736 1.00 34.23 ? 126  SER H C   1 
ATOM   9848  O  O   . SER H  1 126 ? 71.569 48.136 138.082 1.00 36.82 ? 126  SER H O   1 
ATOM   9849  C  CB  . SER H  1 126 ? 68.388 47.506 137.625 1.00 35.81 ? 126  SER H CB  1 
ATOM   9850  O  OG  . SER H  1 126 ? 68.773 48.615 136.824 1.00 41.85 ? 126  SER H OG  1 
ATOM   9851  N  N   . GLU H  1 127 ? 70.344 48.179 139.973 1.00 34.50 ? 127  GLU H N   1 
ATOM   9852  C  CA  . GLU H  1 127 ? 71.214 49.155 140.626 1.00 34.72 ? 127  GLU H CA  1 
ATOM   9853  C  C   . GLU H  1 127 ? 72.604 48.618 140.925 1.00 34.92 ? 127  GLU H C   1 
ATOM   9854  O  O   . GLU H  1 127 ? 73.553 49.395 140.996 1.00 34.62 ? 127  GLU H O   1 
ATOM   9855  C  CB  . GLU H  1 127 ? 70.583 49.679 141.916 1.00 38.05 ? 127  GLU H CB  1 
ATOM   9856  C  CG  . GLU H  1 127 ? 69.170 50.242 141.757 1.00 47.35 ? 127  GLU H CG  1 
ATOM   9857  C  CD  . GLU H  1 127 ? 69.088 51.478 140.855 1.00 52.35 ? 127  GLU H CD  1 
ATOM   9858  O  OE1 . GLU H  1 127 ? 67.961 52.006 140.671 1.00 56.35 ? 127  GLU H OE1 1 
ATOM   9859  O  OE2 . GLU H  1 127 ? 70.129 51.920 140.347 1.00 57.06 ? 127  GLU H OE2 1 
ATOM   9860  N  N   . GLU H  1 128 ? 72.742 47.309 141.125 1.00 35.34 ? 128  GLU H N   1 
ATOM   9861  C  CA  . GLU H  1 128 ? 74.064 46.760 141.391 1.00 36.32 ? 128  GLU H CA  1 
ATOM   9862  C  C   . GLU H  1 128 ? 74.895 46.746 140.105 1.00 36.99 ? 128  GLU H C   1 
ATOM   9863  O  O   . GLU H  1 128 ? 76.126 46.732 140.158 1.00 36.91 ? 128  GLU H O   1 
ATOM   9864  C  CB  . GLU H  1 128 ? 73.972 45.355 142.010 1.00 36.83 ? 128  GLU H CB  1 
ATOM   9865  C  CG  . GLU H  1 128 ? 73.442 45.359 143.454 1.00 40.58 ? 128  GLU H CG  1 
ATOM   9866  C  CD  . GLU H  1 128 ? 73.678 44.041 144.199 1.00 45.42 ? 128  GLU H CD  1 
ATOM   9867  O  OE1 . GLU H  1 128 ? 73.553 42.961 143.578 1.00 49.01 ? 128  GLU H OE1 1 
ATOM   9868  O  OE2 . GLU H  1 128 ? 73.973 44.081 145.415 1.00 46.63 ? 128  GLU H OE2 1 
ATOM   9869  N  N   . ASP H  1 129 ? 74.222 46.766 138.952 1.00 38.71 ? 129  ASP H N   1 
ATOM   9870  C  CA  . ASP H  1 129 ? 74.915 46.800 137.660 1.00 39.25 ? 129  ASP H CA  1 
ATOM   9871  C  C   . ASP H  1 129 ? 75.490 48.195 137.419 1.00 37.96 ? 129  ASP H C   1 
ATOM   9872  O  O   . ASP H  1 129 ? 76.618 48.333 136.941 1.00 37.27 ? 129  ASP H O   1 
ATOM   9873  C  CB  . ASP H  1 129 ? 73.974 46.416 136.520 1.00 42.87 ? 129  ASP H CB  1 
ATOM   9874  C  CG  . ASP H  1 129 ? 73.874 44.914 136.336 1.00 48.60 ? 129  ASP H CG  1 
ATOM   9875  O  OD1 . ASP H  1 129 ? 74.935 44.252 136.249 1.00 53.00 ? 129  ASP H OD1 1 
ATOM   9876  O  OD2 . ASP H  1 129 ? 72.740 44.390 136.269 1.00 52.45 ? 129  ASP H OD2 1 
ATOM   9877  N  N   . HIS H  1 130 ? 74.705 49.225 137.736 1.00 36.03 ? 130  HIS H N   1 
ATOM   9878  C  CA  . HIS H  1 130 ? 75.172 50.600 137.617 1.00 34.26 ? 130  HIS H CA  1 
ATOM   9879  C  C   . HIS H  1 130 ? 76.435 50.740 138.456 1.00 31.87 ? 130  HIS H C   1 
ATOM   9880  O  O   . HIS H  1 130 ? 77.482 51.206 137.993 1.00 30.55 ? 130  HIS H O   1 
ATOM   9881  C  CB  . HIS H  1 130 ? 74.142 51.591 138.106 1.00 36.87 ? 130  HIS H CB  1 
ATOM   9882  C  CG  . HIS H  1 130 ? 72.861 51.618 137.244 1.00 44.89 ? 130  HIS H CG  1 
ATOM   9883  N  ND1 . HIS H  1 130 ? 71.700 52.232 137.669 1.00 45.59 ? 130  HIS H ND1 1 
ATOM   9884  C  CD2 . HIS H  1 130 ? 72.593 51.130 136.009 1.00 45.56 ? 130  HIS H CD2 1 
ATOM   9885  C  CE1 . HIS H  1 130 ? 70.776 52.124 136.732 1.00 45.92 ? 130  HIS H CE1 1 
ATOM   9886  N  NE2 . HIS H  1 130 ? 71.291 51.460 135.715 1.00 45.63 ? 130  HIS H NE2 1 
ATOM   9887  N  N   . ILE H  1 131 ? 76.336 50.303 139.710 1.00 28.81 ? 131  ILE H N   1 
ATOM   9888  C  CA  . ILE H  1 131 ? 77.470 50.366 140.624 1.00 29.12 ? 131  ILE H CA  1 
ATOM   9889  C  C   . ILE H  1 131 ? 78.686 49.659 140.024 1.00 27.55 ? 131  ILE H C   1 
ATOM   9890  O  O   . ILE H  1 131 ? 79.751 50.254 139.891 1.00 26.19 ? 131  ILE H O   1 
ATOM   9891  C  CB  . ILE H  1 131 ? 77.144 49.717 142.004 1.00 27.24 ? 131  ILE H CB  1 
ATOM   9892  C  CG1 . ILE H  1 131 ? 75.998 50.472 142.682 1.00 26.24 ? 131  ILE H CG1 1 
ATOM   9893  C  CG2 . ILE H  1 131 ? 78.377 49.759 142.905 1.00 26.46 ? 131  ILE H CG2 1 
ATOM   9894  C  CD1 . ILE H  1 131 ? 75.684 50.006 144.088 1.00 25.63 ? 131  ILE H CD1 1 
ATOM   9895  N  N   . ASP H  1 132 ? 78.524 48.393 139.658 1.00 28.34 ? 132  ASP H N   1 
ATOM   9896  C  CA  . ASP H  1 132 ? 79.625 47.633 139.078 1.00 30.25 ? 132  ASP H CA  1 
ATOM   9897  C  C   . ASP H  1 132 ? 80.257 48.424 137.932 1.00 30.99 ? 132  ASP H C   1 
ATOM   9898  O  O   . ASP H  1 132 ? 81.486 48.523 137.821 1.00 30.52 ? 132  ASP H O   1 
ATOM   9899  C  CB  . ASP H  1 132 ? 79.117 46.283 138.570 1.00 32.05 ? 132  ASP H CB  1 
ATOM   9900  C  CG  . ASP H  1 132 ? 80.248 45.339 138.177 1.00 36.08 ? 132  ASP H CG  1 
ATOM   9901  O  OD1 . ASP H  1 132 ? 81.401 45.556 138.617 1.00 37.76 ? 132  ASP H OD1 1 
ATOM   9902  O  OD2 . ASP H  1 132 ? 79.976 44.363 137.439 1.00 38.58 ? 132  ASP H OD2 1 
ATOM   9903  N  N   . TRP H  1 133 ? 79.417 49.003 137.084 1.00 28.68 ? 133  TRP H N   1 
ATOM   9904  C  CA  . TRP H  1 133 ? 79.934 49.772 135.974 1.00 28.81 ? 133  TRP H CA  1 
ATOM   9905  C  C   . TRP H  1 133 ? 80.717 51.007 136.451 1.00 30.95 ? 133  TRP H C   1 
ATOM   9906  O  O   . TRP H  1 133 ? 81.824 51.272 135.972 1.00 33.09 ? 133  TRP H O   1 
ATOM   9907  C  CB  . TRP H  1 133 ? 78.792 50.189 135.052 1.00 28.84 ? 133  TRP H CB  1 
ATOM   9908  C  CG  . TRP H  1 133 ? 79.285 50.880 133.834 1.00 28.94 ? 133  TRP H CG  1 
ATOM   9909  C  CD1 . TRP H  1 133 ? 79.813 50.301 132.715 1.00 27.43 ? 133  TRP H CD1 1 
ATOM   9910  C  CD2 . TRP H  1 133 ? 79.404 52.293 133.652 1.00 29.97 ? 133  TRP H CD2 1 
ATOM   9911  N  NE1 . TRP H  1 133 ? 80.262 51.269 131.849 1.00 29.71 ? 133  TRP H NE1 1 
ATOM   9912  C  CE2 . TRP H  1 133 ? 80.022 52.501 132.399 1.00 29.70 ? 133  TRP H CE2 1 
ATOM   9913  C  CE3 . TRP H  1 133 ? 79.051 53.405 134.427 1.00 30.87 ? 133  TRP H CE3 1 
ATOM   9914  C  CZ2 . TRP H  1 133 ? 80.296 53.774 131.905 1.00 30.09 ? 133  TRP H CZ2 1 
ATOM   9915  C  CZ3 . TRP H  1 133 ? 79.324 54.673 133.936 1.00 31.87 ? 133  TRP H CZ3 1 
ATOM   9916  C  CH2 . TRP H  1 133 ? 79.941 54.847 132.685 1.00 32.63 ? 133  TRP H CH2 1 
ATOM   9917  N  N   . LEU H  1 134 ? 80.155 51.760 137.392 1.00 30.06 ? 134  LEU H N   1 
ATOM   9918  C  CA  . LEU H  1 134 ? 80.825 52.951 137.906 1.00 29.45 ? 134  LEU H CA  1 
ATOM   9919  C  C   . LEU H  1 134 ? 82.155 52.610 138.564 1.00 32.44 ? 134  LEU H C   1 
ATOM   9920  O  O   . LEU H  1 134 ? 83.179 53.239 138.286 1.00 35.69 ? 134  LEU H O   1 
ATOM   9921  C  CB  . LEU H  1 134 ? 79.931 53.664 138.917 1.00 28.07 ? 134  LEU H CB  1 
ATOM   9922  C  CG  . LEU H  1 134 ? 78.666 54.287 138.323 1.00 30.02 ? 134  LEU H CG  1 
ATOM   9923  C  CD1 . LEU H  1 134 ? 77.645 54.539 139.416 1.00 26.69 ? 134  LEU H CD1 1 
ATOM   9924  C  CD2 . LEU H  1 134 ? 79.029 55.576 137.592 1.00 29.05 ? 134  LEU H CD2 1 
ATOM   9925  N  N   . GLU H  1 135 ? 82.144 51.614 139.444 1.00 34.48 ? 135  GLU H N   1 
ATOM   9926  C  CA  . GLU H  1 135 ? 83.367 51.213 140.133 1.00 34.67 ? 135  GLU H CA  1 
ATOM   9927  C  C   . GLU H  1 135 ? 84.414 50.815 139.112 1.00 34.08 ? 135  GLU H C   1 
ATOM   9928  O  O   . GLU H  1 135 ? 85.581 51.145 139.261 1.00 34.75 ? 135  GLU H O   1 
ATOM   9929  C  CB  . GLU H  1 135 ? 83.101 50.043 141.081 1.00 35.53 ? 135  GLU H CB  1 
ATOM   9930  C  CG  . GLU H  1 135 ? 82.075 50.360 142.151 1.00 45.24 ? 135  GLU H CG  1 
ATOM   9931  C  CD  . GLU H  1 135 ? 81.870 49.221 143.139 1.00 49.54 ? 135  GLU H CD  1 
ATOM   9932  O  OE1 . GLU H  1 135 ? 81.708 48.058 142.696 1.00 50.68 ? 135  GLU H OE1 1 
ATOM   9933  O  OE2 . GLU H  1 135 ? 81.855 49.499 144.359 1.00 50.07 ? 135  GLU H OE2 1 
ATOM   9934  N  N   . THR H  1 136 ? 83.983 50.119 138.063 1.00 33.43 ? 136  THR H N   1 
ATOM   9935  C  CA  . THR H  1 136 ? 84.893 49.672 137.017 1.00 31.66 ? 136  THR H CA  1 
ATOM   9936  C  C   . THR H  1 136 ? 85.529 50.834 136.250 1.00 30.47 ? 136  THR H C   1 
ATOM   9937  O  O   . THR H  1 136 ? 86.746 50.835 136.023 1.00 27.68 ? 136  THR H O   1 
ATOM   9938  C  CB  . THR H  1 136 ? 84.165 48.716 136.038 1.00 31.79 ? 136  THR H CB  1 
ATOM   9939  O  OG1 . THR H  1 136 ? 83.825 47.510 136.734 1.00 35.59 ? 136  THR H OG1 1 
ATOM   9940  C  CG2 . THR H  1 136 ? 85.049 48.363 134.847 1.00 30.58 ? 136  THR H CG2 1 
ATOM   9941  N  N   . GLN H  1 137 ? 84.728 51.822 135.852 1.00 27.31 ? 137  GLN H N   1 
ATOM   9942  C  CA  . GLN H  1 137 ? 85.287 52.953 135.122 1.00 27.34 ? 137  GLN H CA  1 
ATOM   9943  C  C   . GLN H  1 137 ? 86.348 53.636 135.980 1.00 27.72 ? 137  GLN H C   1 
ATOM   9944  O  O   . GLN H  1 137 ? 87.428 53.985 135.488 1.00 27.12 ? 137  GLN H O   1 
ATOM   9945  C  CB  . GLN H  1 137 ? 84.208 53.976 134.756 1.00 28.88 ? 137  GLN H CB  1 
ATOM   9946  C  CG  . GLN H  1 137 ? 83.011 53.408 134.024 1.00 30.83 ? 137  GLN H CG  1 
ATOM   9947  C  CD  . GLN H  1 137 ? 83.405 52.454 132.915 1.00 29.33 ? 137  GLN H CD  1 
ATOM   9948  O  OE1 . GLN H  1 137 ? 84.164 52.808 132.018 1.00 26.93 ? 137  GLN H OE1 1 
ATOM   9949  N  NE2 . GLN H  1 137 ? 82.883 51.231 132.974 1.00 29.02 ? 137  GLN H NE2 1 
ATOM   9950  N  N   . LEU H  1 138 ? 86.048 53.823 137.265 1.00 26.54 ? 138  LEU H N   1 
ATOM   9951  C  CA  . LEU H  1 138 ? 86.999 54.478 138.156 1.00 25.60 ? 138  LEU H CA  1 
ATOM   9952  C  C   . LEU H  1 138 ? 88.299 53.691 138.268 1.00 27.17 ? 138  LEU H C   1 
ATOM   9953  O  O   . LEU H  1 138 ? 89.380 54.277 138.308 1.00 30.52 ? 138  LEU H O   1 
ATOM   9954  C  CB  . LEU H  1 138 ? 86.367 54.695 139.532 1.00 21.74 ? 138  LEU H CB  1 
ATOM   9955  C  CG  . LEU H  1 138 ? 85.314 55.816 139.510 1.00 26.62 ? 138  LEU H CG  1 
ATOM   9956  C  CD1 . LEU H  1 138 ? 84.454 55.790 140.769 1.00 24.16 ? 138  LEU H CD1 1 
ATOM   9957  C  CD2 . LEU H  1 138 ? 86.020 57.162 139.350 1.00 19.11 ? 138  LEU H CD2 1 
ATOM   9958  N  N   . ASP H  1 139 ? 88.195 52.367 138.308 1.00 28.17 ? 139  ASP H N   1 
ATOM   9959  C  CA  . ASP H  1 139 ? 89.364 51.501 138.397 1.00 29.46 ? 139  ASP H CA  1 
ATOM   9960  C  C   . ASP H  1 139 ? 90.119 51.586 137.092 1.00 32.10 ? 139  ASP H C   1 
ATOM   9961  O  O   . ASP H  1 139 ? 91.348 51.647 137.066 1.00 34.99 ? 139  ASP H O   1 
ATOM   9962  C  CB  . ASP H  1 139 ? 88.936 50.058 138.633 1.00 36.00 ? 139  ASP H CB  1 
ATOM   9963  C  CG  . ASP H  1 139 ? 88.957 49.680 140.095 1.00 43.59 ? 139  ASP H CG  1 
ATOM   9964  O  OD1 . ASP H  1 139 ? 90.067 49.525 140.645 1.00 52.53 ? 139  ASP H OD1 1 
ATOM   9965  O  OD2 . ASP H  1 139 ? 87.873 49.540 140.698 1.00 47.27 ? 139  ASP H OD2 1 
ATOM   9966  N  N   . LEU H  1 140 ? 89.367 51.578 135.999 1.00 32.00 ? 140  LEU H N   1 
ATOM   9967  C  CA  . LEU H  1 140 ? 89.955 51.664 134.683 1.00 29.37 ? 140  LEU H CA  1 
ATOM   9968  C  C   . LEU H  1 140 ? 90.770 52.956 134.607 1.00 29.90 ? 140  LEU H C   1 
ATOM   9969  O  O   . LEU H  1 140 ? 91.875 52.970 134.064 1.00 31.54 ? 140  LEU H O   1 
ATOM   9970  C  CB  . LEU H  1 140 ? 88.848 51.638 133.634 1.00 27.90 ? 140  LEU H CB  1 
ATOM   9971  C  CG  . LEU H  1 140 ? 88.836 50.506 132.597 1.00 29.90 ? 140  LEU H CG  1 
ATOM   9972  C  CD1 . LEU H  1 140 ? 89.425 49.230 133.153 1.00 25.78 ? 140  LEU H CD1 1 
ATOM   9973  C  CD2 . LEU H  1 140 ? 87.395 50.286 132.134 1.00 27.80 ? 140  LEU H CD2 1 
ATOM   9974  N  N   . ILE H  1 141 ? 90.248 54.038 135.174 1.00 27.55 ? 141  ILE H N   1 
ATOM   9975  C  CA  . ILE H  1 141 ? 90.987 55.296 135.147 1.00 29.19 ? 141  ILE H CA  1 
ATOM   9976  C  C   . ILE H  1 141 ? 92.326 55.162 135.861 1.00 30.80 ? 141  ILE H C   1 
ATOM   9977  O  O   . ILE H  1 141 ? 93.327 55.733 135.428 1.00 30.81 ? 141  ILE H O   1 
ATOM   9978  C  CB  . ILE H  1 141 ? 90.195 56.445 135.795 1.00 29.53 ? 141  ILE H CB  1 
ATOM   9979  C  CG1 . ILE H  1 141 ? 89.033 56.858 134.882 1.00 29.85 ? 141  ILE H CG1 1 
ATOM   9980  C  CG2 . ILE H  1 141 ? 91.111 57.637 136.038 1.00 28.72 ? 141  ILE H CG2 1 
ATOM   9981  C  CD1 . ILE H  1 141 ? 88.124 57.930 135.481 1.00 26.52 ? 141  ILE H CD1 1 
ATOM   9982  N  N   . ASP H  1 142 ? 92.355 54.407 136.953 1.00 34.18 ? 142  ASP H N   1 
ATOM   9983  C  CA  . ASP H  1 142 ? 93.601 54.220 137.690 1.00 38.13 ? 142  ASP H CA  1 
ATOM   9984  C  C   . ASP H  1 142 ? 94.581 53.313 136.956 1.00 37.73 ? 142  ASP H C   1 
ATOM   9985  O  O   . ASP H  1 142 ? 95.782 53.540 136.998 1.00 39.17 ? 142  ASP H O   1 
ATOM   9986  C  CB  . ASP H  1 142 ? 93.339 53.628 139.078 1.00 44.79 ? 142  ASP H CB  1 
ATOM   9987  C  CG  . ASP H  1 142 ? 92.872 54.667 140.083 1.00 52.39 ? 142  ASP H CG  1 
ATOM   9988  O  OD1 . ASP H  1 142 ? 93.460 55.775 140.117 1.00 53.68 ? 142  ASP H OD1 1 
ATOM   9989  O  OD2 . ASP H  1 142 ? 91.925 54.368 140.849 1.00 56.08 ? 142  ASP H OD2 1 
ATOM   9990  N  N   . LYS H  1 143 ? 94.072 52.286 136.287 1.00 36.82 ? 143  LYS H N   1 
ATOM   9991  C  CA  . LYS H  1 143 ? 94.940 51.353 135.580 1.00 37.19 ? 143  LYS H CA  1 
ATOM   9992  C  C   . LYS H  1 143 ? 95.584 51.919 134.313 1.00 36.93 ? 143  LYS H C   1 
ATOM   9993  O  O   . LYS H  1 143 ? 96.768 51.699 134.062 1.00 37.64 ? 143  LYS H O   1 
ATOM   9994  C  CB  . LYS H  1 143 ? 94.165 50.076 135.217 1.00 39.04 ? 143  LYS H CB  1 
ATOM   9995  C  CG  . LYS H  1 143 ? 93.501 49.364 136.397 1.00 39.22 ? 143  LYS H CG  1 
ATOM   9996  C  CD  . LYS H  1 143 ? 92.954 48.004 135.974 1.00 39.51 ? 143  LYS H CD  1 
ATOM   9997  C  CE  . LYS H  1 143 ? 91.978 47.433 137.012 1.00 41.48 ? 143  LYS H CE  1 
ATOM   9998  N  NZ  . LYS H  1 143 ? 92.581 47.203 138.352 1.00 38.96 ? 143  LYS H NZ  1 
ATOM   9999  N  N   . ILE H  1 144 ? 94.810 52.645 133.515 1.00 36.74 ? 144  ILE H N   1 
ATOM   10000 C  CA  . ILE H  1 144 ? 95.325 53.189 132.265 1.00 34.66 ? 144  ILE H CA  1 
ATOM   10001 C  C   . ILE H  1 144 ? 95.658 54.669 132.296 1.00 34.41 ? 144  ILE H C   1 
ATOM   10002 O  O   . ILE H  1 144 ? 96.563 55.106 131.599 1.00 36.14 ? 144  ILE H O   1 
ATOM   10003 C  CB  . ILE H  1 144 ? 94.339 52.930 131.093 1.00 32.60 ? 144  ILE H CB  1 
ATOM   10004 C  CG1 . ILE H  1 144 ? 92.992 53.611 131.364 1.00 28.56 ? 144  ILE H CG1 1 
ATOM   10005 C  CG2 . ILE H  1 144 ? 94.152 51.428 130.908 1.00 30.44 ? 144  ILE H CG2 1 
ATOM   10006 C  CD1 . ILE H  1 144 ? 91.958 53.403 130.269 1.00 20.51 ? 144  ILE H CD1 1 
ATOM   10007 N  N   . GLY H  1 145 ? 94.932 55.439 133.097 1.00 34.80 ? 145  GLY H N   1 
ATOM   10008 C  CA  . GLY H  1 145 ? 95.193 56.866 133.174 1.00 31.46 ? 145  GLY H CA  1 
ATOM   10009 C  C   . GLY H  1 145 ? 94.088 57.713 132.563 1.00 31.99 ? 145  GLY H C   1 
ATOM   10010 O  O   . GLY H  1 145 ? 93.480 57.335 131.555 1.00 32.79 ? 145  GLY H O   1 
ATOM   10011 N  N   . LEU H  1 146 ? 93.837 58.872 133.166 1.00 28.95 ? 146  LEU H N   1 
ATOM   10012 C  CA  . LEU H  1 146 ? 92.797 59.770 132.695 1.00 28.91 ? 146  LEU H CA  1 
ATOM   10013 C  C   . LEU H  1 146 ? 92.871 60.100 131.204 1.00 30.68 ? 146  LEU H C   1 
ATOM   10014 O  O   . LEU H  1 146 ? 91.860 60.012 130.496 1.00 31.87 ? 146  LEU H O   1 
ATOM   10015 C  CB  . LEU H  1 146 ? 92.823 61.064 133.504 1.00 27.99 ? 146  LEU H CB  1 
ATOM   10016 C  CG  . LEU H  1 146 ? 91.558 61.920 133.376 1.00 28.98 ? 146  LEU H CG  1 
ATOM   10017 C  CD1 . LEU H  1 146 ? 90.331 61.105 133.795 1.00 28.19 ? 146  LEU H CD1 1 
ATOM   10018 C  CD2 . LEU H  1 146 ? 91.698 63.164 134.242 1.00 26.08 ? 146  LEU H CD2 1 
ATOM   10019 N  N   . GLU H  1 147 ? 94.053 60.484 130.721 1.00 29.65 ? 147  GLU H N   1 
ATOM   10020 C  CA  . GLU H  1 147 ? 94.198 60.825 129.307 1.00 30.82 ? 147  GLU H CA  1 
ATOM   10021 C  C   . GLU H  1 147 ? 93.747 59.673 128.405 1.00 30.01 ? 147  GLU H C   1 
ATOM   10022 O  O   . GLU H  1 147 ? 92.894 59.863 127.522 1.00 28.50 ? 147  GLU H O   1 
ATOM   10023 C  CB  . GLU H  1 147 ? 95.644 61.212 128.978 1.00 32.54 ? 147  GLU H CB  1 
ATOM   10024 C  CG  . GLU H  1 147 ? 96.177 62.388 129.778 1.00 40.02 ? 147  GLU H CG  1 
ATOM   10025 C  CD  . GLU H  1 147 ? 96.264 62.081 131.272 1.00 49.63 ? 147  GLU H CD  1 
ATOM   10026 O  OE1 . GLU H  1 147 ? 97.005 61.144 131.658 1.00 49.62 ? 147  GLU H OE1 1 
ATOM   10027 O  OE2 . GLU H  1 147 ? 95.585 62.773 132.065 1.00 56.08 ? 147  GLU H OE2 1 
ATOM   10028 N  N   . ASN H  1 148 ? 94.298 58.481 128.625 1.00 27.96 ? 148  ASN H N   1 
ATOM   10029 C  CA  . ASN H  1 148 ? 93.907 57.342 127.809 1.00 28.26 ? 148  ASN H CA  1 
ATOM   10030 C  C   . ASN H  1 148 ? 92.425 57.008 127.985 1.00 27.89 ? 148  ASN H C   1 
ATOM   10031 O  O   . ASN H  1 148 ? 91.705 56.803 127.002 1.00 26.41 ? 148  ASN H O   1 
ATOM   10032 C  CB  . ASN H  1 148 ? 94.743 56.102 128.142 1.00 31.92 ? 148  ASN H CB  1 
ATOM   10033 C  CG  . ASN H  1 148 ? 96.098 56.092 127.444 1.00 35.15 ? 148  ASN H CG  1 
ATOM   10034 O  OD1 . ASN H  1 148 ? 96.264 56.657 126.360 1.00 35.68 ? 148  ASN H OD1 1 
ATOM   10035 N  ND2 . ASN H  1 148 ? 97.068 55.421 128.055 1.00 39.09 ? 148  ASN H ND2 1 
ATOM   10036 N  N   . TYR H  1 149 ? 91.963 56.959 129.233 1.00 25.54 ? 149  TYR H N   1 
ATOM   10037 C  CA  . TYR H  1 149 ? 90.573 56.620 129.474 1.00 24.81 ? 149  TYR H CA  1 
ATOM   10038 C  C   . TYR H  1 149 ? 89.677 57.578 128.721 1.00 26.37 ? 149  TYR H C   1 
ATOM   10039 O  O   . TYR H  1 149 ? 88.732 57.159 128.053 1.00 25.52 ? 149  TYR H O   1 
ATOM   10040 C  CB  . TYR H  1 149 ? 90.228 56.677 130.964 1.00 24.74 ? 149  TYR H CB  1 
ATOM   10041 C  CG  . TYR H  1 149 ? 88.768 56.339 131.239 1.00 23.81 ? 149  TYR H CG  1 
ATOM   10042 C  CD1 . TYR H  1 149 ? 88.314 55.014 131.185 1.00 22.00 ? 149  TYR H CD1 1 
ATOM   10043 C  CD2 . TYR H  1 149 ? 87.839 57.343 131.521 1.00 20.92 ? 149  TYR H CD2 1 
ATOM   10044 C  CE1 . TYR H  1 149 ? 86.976 54.697 131.402 1.00 20.15 ? 149  TYR H CE1 1 
ATOM   10045 C  CE2 . TYR H  1 149 ? 86.493 57.040 131.744 1.00 24.74 ? 149  TYR H CE2 1 
ATOM   10046 C  CZ  . TYR H  1 149 ? 86.066 55.714 131.682 1.00 25.29 ? 149  TYR H CZ  1 
ATOM   10047 O  OH  . TYR H  1 149 ? 84.735 55.406 131.895 1.00 22.80 ? 149  TYR H OH  1 
ATOM   10048 N  N   . LEU H  1 150 ? 89.977 58.868 128.830 1.00 27.61 ? 150  LEU H N   1 
ATOM   10049 C  CA  . LEU H  1 150 ? 89.172 59.867 128.156 1.00 30.83 ? 150  LEU H CA  1 
ATOM   10050 C  C   . LEU H  1 150 ? 89.230 59.702 126.639 1.00 33.57 ? 150  LEU H C   1 
ATOM   10051 O  O   . LEU H  1 150 ? 88.218 59.889 125.954 1.00 34.36 ? 150  LEU H O   1 
ATOM   10052 C  CB  . LEU H  1 150 ? 89.613 61.276 128.566 1.00 31.83 ? 150  LEU H CB  1 
ATOM   10053 C  CG  . LEU H  1 150 ? 89.244 61.676 129.999 1.00 34.68 ? 150  LEU H CG  1 
ATOM   10054 C  CD1 . LEU H  1 150 ? 89.593 63.140 130.230 1.00 34.08 ? 150  LEU H CD1 1 
ATOM   10055 C  CD2 . LEU H  1 150 ? 87.752 61.456 130.231 1.00 33.25 ? 150  LEU H CD2 1 
ATOM   10056 N  N   . GLN H  1 151 ? 90.406 59.353 126.113 1.00 33.12 ? 151  GLN H N   1 
ATOM   10057 C  CA  . GLN H  1 151 ? 90.554 59.147 124.671 1.00 30.53 ? 151  GLN H CA  1 
ATOM   10058 C  C   . GLN H  1 151 ? 89.618 58.028 124.236 1.00 30.76 ? 151  GLN H C   1 
ATOM   10059 O  O   . GLN H  1 151 ? 88.894 58.156 123.252 1.00 33.52 ? 151  GLN H O   1 
ATOM   10060 C  CB  . GLN H  1 151 ? 91.989 58.751 124.324 1.00 29.19 ? 151  GLN H CB  1 
ATOM   10061 C  CG  . GLN H  1 151 ? 92.164 58.261 122.900 1.00 29.23 ? 151  GLN H CG  1 
ATOM   10062 C  CD  . GLN H  1 151 ? 93.583 57.788 122.604 1.00 34.67 ? 151  GLN H CD  1 
ATOM   10063 O  OE1 . GLN H  1 151 ? 94.112 56.902 123.286 1.00 35.57 ? 151  GLN H OE1 1 
ATOM   10064 N  NE2 . GLN H  1 151 ? 94.203 58.374 121.576 1.00 30.97 ? 151  GLN H NE2 1 
ATOM   10065 N  N   . SER H  1 152 ? 89.634 56.935 124.990 1.00 28.44 ? 152  SER H N   1 
ATOM   10066 C  CA  . SER H  1 152 ? 88.808 55.779 124.688 1.00 28.64 ? 152  SER H CA  1 
ATOM   10067 C  C   . SER H  1 152 ? 87.333 56.113 124.676 1.00 29.93 ? 152  SER H C   1 
ATOM   10068 O  O   . SER H  1 152 ? 86.545 55.438 124.015 1.00 30.77 ? 152  SER H O   1 
ATOM   10069 C  CB  . SER H  1 152 ? 89.052 54.682 125.717 1.00 30.46 ? 152  SER H CB  1 
ATOM   10070 O  OG  . SER H  1 152 ? 90.430 54.389 125.809 1.00 33.20 ? 152  SER H OG  1 
ATOM   10071 N  N   . GLN H  1 153 ? 86.966 57.156 125.413 1.00 32.05 ? 153  GLN H N   1 
ATOM   10072 C  CA  . GLN H  1 153 ? 85.575 57.581 125.523 1.00 33.90 ? 153  GLN H CA  1 
ATOM   10073 C  C   . GLN H  1 153 ? 85.132 58.514 124.412 1.00 33.80 ? 153  GLN H C   1 
ATOM   10074 O  O   . GLN H  1 153 ? 83.959 58.869 124.341 1.00 32.62 ? 153  GLN H O   1 
ATOM   10075 C  CB  . GLN H  1 153 ? 85.347 58.288 126.866 1.00 35.43 ? 153  GLN H CB  1 
ATOM   10076 C  CG  . GLN H  1 153 ? 85.682 57.446 128.085 1.00 37.02 ? 153  GLN H CG  1 
ATOM   10077 C  CD  . GLN H  1 153 ? 85.043 56.080 128.014 1.00 39.52 ? 153  GLN H CD  1 
ATOM   10078 O  OE1 . GLN H  1 153 ? 83.856 55.957 127.714 1.00 42.67 ? 153  GLN H OE1 1 
ATOM   10079 N  NE2 . GLN H  1 153 ? 85.825 55.043 128.291 1.00 39.75 ? 153  GLN H NE2 1 
ATOM   10080 N  N   . MET H  1 154 ? 86.060 58.910 123.548 1.00 36.89 ? 154  MET H N   1 
ATOM   10081 C  CA  . MET H  1 154 ? 85.738 59.849 122.480 1.00 42.37 ? 154  MET H CA  1 
ATOM   10082 C  C   . MET H  1 154 ? 84.737 59.392 121.441 1.00 47.55 ? 154  MET H C   1 
ATOM   10083 O  O   . MET H  1 154 ? 83.827 60.147 121.098 1.00 50.05 ? 154  MET H O   1 
ATOM   10084 C  CB  . MET H  1 154 ? 87.010 60.316 121.785 1.00 41.27 ? 154  MET H CB  1 
ATOM   10085 C  CG  . MET H  1 154 ? 87.665 61.502 122.450 1.00 39.03 ? 154  MET H CG  1 
ATOM   10086 S  SD  . MET H  1 154 ? 89.255 61.809 121.706 1.00 39.91 ? 154  MET H SD  1 
ATOM   10087 C  CE  . MET H  1 154 ? 88.736 62.383 120.078 1.00 43.78 ? 154  MET H CE  1 
ATOM   10088 N  N   . ASP H  1 155 ? 84.894 58.177 120.926 1.00 52.18 ? 155  ASP H N   1 
ATOM   10089 C  CA  . ASP H  1 155 ? 83.956 57.679 119.923 1.00 58.48 ? 155  ASP H CA  1 
ATOM   10090 C  C   . ASP H  1 155 ? 83.276 56.383 120.362 1.00 60.67 ? 155  ASP H C   1 
ATOM   10091 O  O   . ASP H  1 155 ? 83.845 55.690 121.237 1.00 62.27 ? 155  ASP H O   1 
ATOM   10092 C  CB  . ASP H  1 155 ? 84.681 57.467 118.586 1.00 62.04 ? 155  ASP H CB  1 
ATOM   10093 C  CG  . ASP H  1 155 ? 85.177 58.771 117.975 1.00 66.70 ? 155  ASP H CG  1 
ATOM   10094 O  OD1 . ASP H  1 155 ? 84.330 59.616 117.598 1.00 67.49 ? 155  ASP H OD1 1 
ATOM   10095 O  OD2 . ASP H  1 155 ? 86.413 58.952 117.875 1.00 65.97 ? 155  ASP H OD2 1 
ATOM   10096 O  OXT . ASP H  1 155 ? 82.187 56.072 119.821 1.00 61.65 ? 155  ASP H OXT 1 
HETATM 10097 FE FE  . FE2 I  2 .   ? 16.229 29.259 106.286 1.00 36.93 ? 1601 FE2 A FE  1 
HETATM 10098 FE FE  . FE2 J  2 .   ? 16.455 31.556 108.853 1.00 55.01 ? 1602 FE2 A FE  1 
HETATM 10099 FE FE  . FE2 K  2 .   ? 27.313 56.073 123.907 1.00 41.04 ? 1603 FE2 A FE  1 
HETATM 10100 MG MG  . MG  L  3 .   ? 16.372 13.167 87.655  1.00 59.66 ? 1701 MG  A MG  1 
HETATM 10101 MG MG  . MG  M  3 .   ? 19.016 34.109 124.180 1.00 56.58 ? 1703 MG  A MG  1 
HETATM 10102 MG MG  . MG  N  3 .   ? 23.213 13.101 112.228 1.00 42.13 ? 1710 MG  A MG  1 
HETATM 10103 C  CHA . HEM O  4 .   ? 22.839 35.951 95.502  1.00 60.23 ? 3001 HEM A CHA 1 
HETATM 10104 C  CHB . HEM O  4 .   ? 19.388 32.507 95.266  1.00 55.99 ? 3001 HEM A CHB 1 
HETATM 10105 C  CHC . HEM O  4 .   ? 15.965 35.926 95.585  1.00 56.26 ? 3001 HEM A CHC 1 
HETATM 10106 C  CHD . HEM O  4 .   ? 19.369 39.343 95.837  1.00 56.13 ? 3001 HEM A CHD 1 
HETATM 10107 C  C1A . HEM O  4 .   ? 22.219 34.704 95.397  1.00 59.85 ? 3001 HEM A C1A 1 
HETATM 10108 C  C2A . HEM O  4 .   ? 22.909 33.433 95.480  1.00 60.00 ? 3001 HEM A C2A 1 
HETATM 10109 C  C3A . HEM O  4 .   ? 21.960 32.443 95.442  1.00 59.50 ? 3001 HEM A C3A 1 
HETATM 10110 C  C4A . HEM O  4 .   ? 20.657 33.128 95.351  1.00 58.67 ? 3001 HEM A C4A 1 
HETATM 10111 C  CMA . HEM O  4 .   ? 22.215 30.938 95.461  1.00 57.06 ? 3001 HEM A CMA 1 
HETATM 10112 C  CAA . HEM O  4 .   ? 24.408 33.281 95.635  1.00 61.62 ? 3001 HEM A CAA 1 
HETATM 10113 C  CBA . HEM O  4 .   ? 24.785 33.244 97.104  1.00 66.29 ? 3001 HEM A CBA 1 
HETATM 10114 C  CGA . HEM O  4 .   ? 26.288 33.199 97.321  1.00 69.44 ? 3001 HEM A CGA 1 
HETATM 10115 O  O1A . HEM O  4 .   ? 26.943 32.281 96.779  1.00 71.12 ? 3001 HEM A O1A 1 
HETATM 10116 O  O2A . HEM O  4 .   ? 26.815 34.080 98.036  1.00 71.51 ? 3001 HEM A O2A 1 
HETATM 10117 C  C1B . HEM O  4 .   ? 18.124 33.130 95.224  1.00 54.42 ? 3001 HEM A C1B 1 
HETATM 10118 C  C2B . HEM O  4 .   ? 16.801 32.461 95.145  1.00 54.36 ? 3001 HEM A C2B 1 
HETATM 10119 C  C3B . HEM O  4 .   ? 15.845 33.426 95.308  1.00 53.27 ? 3001 HEM A C3B 1 
HETATM 10120 C  C4B . HEM O  4 .   ? 16.572 34.679 95.458  1.00 54.44 ? 3001 HEM A C4B 1 
HETATM 10121 C  CMB . HEM O  4 .   ? 16.500 30.973 94.968  1.00 50.54 ? 3001 HEM A CMB 1 
HETATM 10122 C  CAB . HEM O  4 .   ? 14.467 33.224 95.229  1.00 53.13 ? 3001 HEM A CAB 1 
HETATM 10123 C  CBB . HEM O  4 .   ? 13.469 33.903 96.063  1.00 53.77 ? 3001 HEM A CBB 1 
HETATM 10124 C  C1C . HEM O  4 .   ? 16.573 37.160 95.718  1.00 55.32 ? 3001 HEM A C1C 1 
HETATM 10125 C  C2C . HEM O  4 .   ? 15.826 38.388 95.767  1.00 53.73 ? 3001 HEM A C2C 1 
HETATM 10126 C  C3C . HEM O  4 .   ? 16.761 39.387 95.930  1.00 55.76 ? 3001 HEM A C3C 1 
HETATM 10127 C  C4C . HEM O  4 .   ? 18.103 38.719 95.911  1.00 55.37 ? 3001 HEM A C4C 1 
HETATM 10128 C  CMC . HEM O  4 .   ? 14.306 38.483 95.670  1.00 49.97 ? 3001 HEM A CMC 1 
HETATM 10129 C  CAC . HEM O  4 .   ? 16.517 40.762 96.093  1.00 55.81 ? 3001 HEM A CAC 1 
HETATM 10130 C  CBC . HEM O  4 .   ? 15.329 41.335 96.721  1.00 55.93 ? 3001 HEM A CBC 1 
HETATM 10131 C  C1D . HEM O  4 .   ? 20.643 38.740 95.777  1.00 58.22 ? 3001 HEM A C1D 1 
HETATM 10132 C  C2D . HEM O  4 .   ? 21.934 39.432 95.697  1.00 59.38 ? 3001 HEM A C2D 1 
HETATM 10133 C  C3D . HEM O  4 .   ? 22.893 38.465 95.619  1.00 59.59 ? 3001 HEM A C3D 1 
HETATM 10134 C  C4D . HEM O  4 .   ? 22.216 37.188 95.663  1.00 59.23 ? 3001 HEM A C4D 1 
HETATM 10135 C  CMD . HEM O  4 .   ? 22.182 40.930 95.759  1.00 58.60 ? 3001 HEM A CMD 1 
HETATM 10136 C  CAD . HEM O  4 .   ? 24.391 38.659 95.515  1.00 60.06 ? 3001 HEM A CAD 1 
HETATM 10137 C  CBD . HEM O  4 .   ? 24.820 38.825 94.071  1.00 64.19 ? 3001 HEM A CBD 1 
HETATM 10138 C  CGD . HEM O  4 .   ? 26.331 38.904 93.910  1.00 67.40 ? 3001 HEM A CGD 1 
HETATM 10139 O  O1D . HEM O  4 .   ? 26.796 39.107 92.765  1.00 69.12 ? 3001 HEM A O1D 1 
HETATM 10140 O  O2D . HEM O  4 .   ? 27.056 38.761 94.922  1.00 67.67 ? 3001 HEM A O2D 1 
HETATM 10141 N  NA  . HEM O  4 .   ? 20.832 34.524 95.361  1.00 58.82 ? 3001 HEM A NA  1 
HETATM 10142 N  NB  . HEM O  4 .   ? 17.965 34.507 95.385  1.00 54.85 ? 3001 HEM A NB  1 
HETATM 10143 N  NC  . HEM O  4 .   ? 17.961 37.345 95.805  1.00 54.80 ? 3001 HEM A NC  1 
HETATM 10144 N  ND  . HEM O  4 .   ? 20.832 37.355 95.753  1.00 58.60 ? 3001 HEM A ND  1 
HETATM 10145 FE FE  . HEM O  4 .   ? 19.413 35.940 95.577  1.00 56.20 ? 3001 HEM A FE  1 
HETATM 10146 FE FE  . FE2 P  2 .   ? 16.611 40.294 82.341  1.00 55.35 ? 1605 FE2 B FE  1 
HETATM 10147 FE FE  . FE2 Q  2 .   ? 16.185 42.694 84.966  1.00 39.03 ? 1606 FE2 B FE  1 
HETATM 10148 FE FE  . FE2 R  2 .   ? 27.592 15.758 67.330  1.00 43.27 ? 1607 FE2 B FE  1 
HETATM 10149 MG MG  . MG  S  3 .   ? 16.193 58.684 103.426 1.00 54.47 ? 1702 MG  B MG  1 
HETATM 10150 MG MG  . MG  T  3 .   ? 19.389 37.762 66.754  1.00 57.08 ? 1704 MG  B MG  1 
HETATM 10151 FE FE  . FE2 U  2 .   ? 33.431 58.315 64.614  1.00 40.98 ? 1608 FE2 C FE  1 
HETATM 10152 FE FE  . FE2 V  2 .   ? 35.568 61.045 64.656  1.00 54.02 ? 1610 FE2 C FE  1 
HETATM 10153 MG MG  . MG  W  3 .   ? 39.331 75.468 71.324  1.00 50.47 ? 1706 MG  C MG  1 
HETATM 10154 C  CHA . HEM X  4 .   ? 42.554 47.284 63.549  1.00 31.76 ? 3002 HEM C CHA 1 
HETATM 10155 C  CHB . HEM X  4 .   ? 43.879 49.066 59.241  1.00 31.82 ? 3002 HEM C CHB 1 
HETATM 10156 C  CHC . HEM X  4 .   ? 39.274 49.234 57.879  1.00 30.92 ? 3002 HEM C CHC 1 
HETATM 10157 C  CHD . HEM X  4 .   ? 37.905 47.521 62.184  1.00 33.64 ? 3002 HEM C CHD 1 
HETATM 10158 C  C1A . HEM X  4 .   ? 43.344 47.791 62.503  1.00 33.58 ? 3002 HEM C C1A 1 
HETATM 10159 C  C2A . HEM X  4 .   ? 44.802 47.819 62.501  1.00 32.03 ? 3002 HEM C C2A 1 
HETATM 10160 C  C3A . HEM X  4 .   ? 45.169 48.323 61.297  1.00 31.37 ? 3002 HEM C C3A 1 
HETATM 10161 C  C4A . HEM X  4 .   ? 43.936 48.585 60.546  1.00 30.17 ? 3002 HEM C C4A 1 
HETATM 10162 C  CMA . HEM X  4 .   ? 46.609 48.544 60.837  1.00 29.46 ? 3002 HEM C CMA 1 
HETATM 10163 C  CAA . HEM X  4 .   ? 45.714 47.239 63.571  1.00 35.41 ? 3002 HEM C CAA 1 
HETATM 10164 C  CBA . HEM X  4 .   ? 46.046 45.804 63.193  1.00 44.11 ? 3002 HEM C CBA 1 
HETATM 10165 C  CGA . HEM X  4 .   ? 46.751 45.039 64.299  1.00 44.92 ? 3002 HEM C CGA 1 
HETATM 10166 O  O1A . HEM X  4 .   ? 47.802 45.510 64.783  1.00 44.93 ? 3002 HEM C O1A 1 
HETATM 10167 O  O2A . HEM X  4 .   ? 46.252 43.956 64.676  1.00 47.15 ? 3002 HEM C O2A 1 
HETATM 10168 C  C1B . HEM X  4 .   ? 42.747 49.318 58.487  1.00 30.30 ? 3002 HEM C C1B 1 
HETATM 10169 C  C2B . HEM X  4 .   ? 42.726 49.873 57.133  1.00 33.12 ? 3002 HEM C C2B 1 
HETATM 10170 C  C3B . HEM X  4 .   ? 41.433 49.909 56.745  1.00 31.79 ? 3002 HEM C C3B 1 
HETATM 10171 C  C4B . HEM X  4 .   ? 40.655 49.422 57.874  1.00 29.95 ? 3002 HEM C C4B 1 
HETATM 10172 C  CMB . HEM X  4 .   ? 43.878 50.392 56.257  1.00 31.78 ? 3002 HEM C CMB 1 
HETATM 10173 C  CAB . HEM X  4 .   ? 41.046 50.298 55.468  1.00 31.84 ? 3002 HEM C CAB 1 
HETATM 10174 C  CBB . HEM X  4 .   ? 39.807 51.001 55.162  1.00 31.45 ? 3002 HEM C CBB 1 
HETATM 10175 C  C1C . HEM X  4 .   ? 38.483 48.717 58.889  1.00 31.40 ? 3002 HEM C C1C 1 
HETATM 10176 C  C2C . HEM X  4 .   ? 37.040 48.613 58.802  1.00 34.35 ? 3002 HEM C C2C 1 
HETATM 10177 C  C3C . HEM X  4 .   ? 36.625 48.115 60.028  1.00 34.28 ? 3002 HEM C C3C 1 
HETATM 10178 C  C4C . HEM X  4 .   ? 37.846 47.959 60.845  1.00 34.16 ? 3002 HEM C C4C 1 
HETATM 10179 C  CMC . HEM X  4 .   ? 36.193 49.031 57.583  1.00 31.99 ? 3002 HEM C CMC 1 
HETATM 10180 C  CAC . HEM X  4 .   ? 35.337 47.793 60.457  1.00 34.52 ? 3002 HEM C CAC 1 
HETATM 10181 C  CBC . HEM X  4 .   ? 34.097 48.028 59.713  1.00 38.37 ? 3002 HEM C CBC 1 
HETATM 10182 C  C1D . HEM X  4 .   ? 39.046 47.318 62.960  1.00 33.23 ? 3002 HEM C C1D 1 
HETATM 10183 C  C2D . HEM X  4 .   ? 39.064 46.855 64.347  1.00 33.62 ? 3002 HEM C C2D 1 
HETATM 10184 C  C3D . HEM X  4 .   ? 40.358 46.777 64.730  1.00 35.15 ? 3002 HEM C C3D 1 
HETATM 10185 C  C4D . HEM X  4 .   ? 41.159 47.179 63.575  1.00 34.53 ? 3002 HEM C C4D 1 
HETATM 10186 C  CMD . HEM X  4 .   ? 37.866 46.518 65.204  1.00 28.31 ? 3002 HEM C CMD 1 
HETATM 10187 C  CAD . HEM X  4 .   ? 40.821 46.370 66.109  1.00 39.86 ? 3002 HEM C CAD 1 
HETATM 10188 C  CBD . HEM X  4 .   ? 41.521 47.465 66.905  1.00 50.30 ? 3002 HEM C CBD 1 
HETATM 10189 C  CGD . HEM X  4 .   ? 41.668 47.110 68.377  1.00 53.56 ? 3002 HEM C CGD 1 
HETATM 10190 O  O1D . HEM X  4 .   ? 42.419 46.161 68.716  1.00 55.79 ? 3002 HEM C O1D 1 
HETATM 10191 O  O2D . HEM X  4 .   ? 41.016 47.785 69.198  1.00 55.36 ? 3002 HEM C O2D 1 
HETATM 10192 N  NA  . HEM X  4 .   ? 42.821 48.266 61.288  1.00 31.78 ? 3002 HEM C NA  1 
HETATM 10193 N  NB  . HEM X  4 .   ? 41.472 49.066 58.946  1.00 30.80 ? 3002 HEM C NB  1 
HETATM 10194 N  NC  . HEM X  4 .   ? 38.975 48.310 60.122  1.00 32.06 ? 3002 HEM C NC  1 
HETATM 10195 N  ND  . HEM X  4 .   ? 40.333 47.532 62.499  1.00 33.30 ? 3002 HEM C ND  1 
HETATM 10196 FE FE  . HEM X  4 .   ? 40.890 48.288 60.733  1.00 32.87 ? 3002 HEM C FE  1 
HETATM 10197 FE FE  . FE2 Y  2 .   ? 44.930 40.119 51.451  1.00 39.29 ? 1611 FE2 D FE  1 
HETATM 10198 FE FE  . FE2 Z  2 .   ? 42.940 37.395 51.923  1.00 46.29 ? 1612 FE2 D FE  1 
HETATM 10199 MG MG  . MG  AA 3 .   ? 22.371 34.068 46.922  1.00 45.63 ? 1705 MG  D MG  1 
HETATM 10200 MG MG  . MG  BA 3 .   ? 43.068 21.865 50.349  1.00 51.30 ? 1707 MG  D MG  1 
HETATM 10201 MG MG  . MG  CA 3 .   ? 61.088 36.128 47.096  1.00 48.06 ? 1712 MG  D MG  1 
HETATM 10202 FE FE  . FE2 DA 2 .   ? 49.897 82.093 98.306  1.00 43.74 ? 1613 FE2 E FE  1 
HETATM 10203 FE FE  . FE2 EA 2 .   ? 51.491 82.437 95.204  1.00 55.56 ? 1614 FE2 E FE  1 
HETATM 10204 C  CHA . HEM FA 4 .   ? 42.640 70.160 95.585  1.00 54.45 ? 3003 HEM E CHA 1 
HETATM 10205 C  CHB . HEM FA 4 .   ? 40.085 72.597 92.240  1.00 52.52 ? 3003 HEM E CHB 1 
HETATM 10206 C  CHC . HEM FA 4 .   ? 39.046 75.990 95.489  1.00 48.94 ? 3003 HEM E CHC 1 
HETATM 10207 C  CHD . HEM FA 4 .   ? 41.537 73.593 98.870  1.00 52.03 ? 3003 HEM E CHD 1 
HETATM 10208 C  C1A . HEM FA 4 .   ? 42.028 70.486 94.356  1.00 53.40 ? 3003 HEM E C1A 1 
HETATM 10209 C  C2A . HEM FA 4 .   ? 41.912 69.630 93.165  1.00 52.62 ? 3003 HEM E C2A 1 
HETATM 10210 C  C3A . HEM FA 4 .   ? 41.172 70.292 92.249  1.00 52.39 ? 3003 HEM E C3A 1 
HETATM 10211 C  C4A . HEM FA 4 .   ? 40.808 71.568 92.868  1.00 52.38 ? 3003 HEM E C4A 1 
HETATM 10212 C  CMA . HEM FA 4 .   ? 40.757 69.774 90.874  1.00 49.83 ? 3003 HEM E CMA 1 
HETATM 10213 C  CAA . HEM FA 4 .   ? 42.360 68.211 92.959  1.00 53.85 ? 3003 HEM E CAA 1 
HETATM 10214 C  CBA . HEM FA 4 .   ? 41.719 67.282 93.974  1.00 59.15 ? 3003 HEM E CBA 1 
HETATM 10215 C  CGA . HEM FA 4 .   ? 41.937 65.821 93.640  1.00 60.26 ? 3003 HEM E CGA 1 
HETATM 10216 O  O1A . HEM FA 4 .   ? 41.296 65.330 92.682  1.00 58.75 ? 3003 HEM E O1A 1 
HETATM 10217 O  O2A . HEM FA 4 .   ? 42.755 65.174 94.330  1.00 60.08 ? 3003 HEM E O2A 1 
HETATM 10218 C  C1B . HEM FA 4 .   ? 39.667 73.818 92.777  1.00 50.00 ? 3003 HEM E C1B 1 
HETATM 10219 C  C2B . HEM FA 4 .   ? 38.882 74.844 92.075  1.00 49.68 ? 3003 HEM E C2B 1 
HETATM 10220 C  C3B . HEM FA 4 .   ? 38.547 75.767 93.027  1.00 50.83 ? 3003 HEM E C3B 1 
HETATM 10221 C  C4B . HEM FA 4 .   ? 39.155 75.325 94.276  1.00 48.38 ? 3003 HEM E C4B 1 
HETATM 10222 C  CMB . HEM FA 4 .   ? 38.450 74.865 90.609  1.00 44.01 ? 3003 HEM E CMB 1 
HETATM 10223 C  CAB . HEM FA 4 .   ? 37.720 76.878 92.868  1.00 53.18 ? 3003 HEM E CAB 1 
HETATM 10224 C  CBB . HEM FA 4 .   ? 37.787 77.775 91.713  1.00 58.12 ? 3003 HEM E CBB 1 
HETATM 10225 C  C1C . HEM FA 4 .   ? 39.585 75.621 96.720  1.00 48.25 ? 3003 HEM E C1C 1 
HETATM 10226 C  C2C . HEM FA 4 .   ? 39.502 76.431 97.923  1.00 48.78 ? 3003 HEM E C2C 1 
HETATM 10227 C  C3C . HEM FA 4 .   ? 40.138 75.715 98.921  1.00 48.54 ? 3003 HEM E C3C 1 
HETATM 10228 C  C4C . HEM FA 4 .   ? 40.683 74.525 98.276  1.00 49.22 ? 3003 HEM E C4C 1 
HETATM 10229 C  CMC . HEM FA 4 .   ? 38.900 77.844 97.996  1.00 46.64 ? 3003 HEM E CMC 1 
HETATM 10230 C  CAC . HEM FA 4 .   ? 40.197 75.989 100.283 1.00 46.71 ? 3003 HEM E CAC 1 
HETATM 10231 C  CBC . HEM FA 4 .   ? 39.272 76.881 100.959 1.00 47.37 ? 3003 HEM E CBC 1 
HETATM 10232 C  C1D . HEM FA 4 .   ? 42.086 72.440 98.289  1.00 52.18 ? 3003 HEM E C1D 1 
HETATM 10233 C  C2D . HEM FA 4 .   ? 43.047 71.543 98.939  1.00 52.85 ? 3003 HEM E C2D 1 
HETATM 10234 C  C3D . HEM FA 4 .   ? 43.283 70.565 98.035  1.00 54.32 ? 3003 HEM E C3D 1 
HETATM 10235 C  C4D . HEM FA 4 .   ? 42.546 70.862 96.814  1.00 54.56 ? 3003 HEM E C4D 1 
HETATM 10236 C  CMD . HEM FA 4 .   ? 43.700 71.682 100.309 1.00 48.51 ? 3003 HEM E CMD 1 
HETATM 10237 C  CAD . HEM FA 4 .   ? 44.145 69.355 98.253  1.00 56.85 ? 3003 HEM E CAD 1 
HETATM 10238 C  CBD . HEM FA 4 .   ? 45.543 69.646 97.750  1.00 62.33 ? 3003 HEM E CBD 1 
HETATM 10239 C  CGD . HEM FA 4 .   ? 46.441 68.430 97.820  1.00 63.98 ? 3003 HEM E CGD 1 
HETATM 10240 O  O1D . HEM FA 4 .   ? 46.139 67.434 97.126  1.00 64.86 ? 3003 HEM E O1D 1 
HETATM 10241 O  O2D . HEM FA 4 .   ? 47.441 68.473 98.571  1.00 63.84 ? 3003 HEM E O2D 1 
HETATM 10242 N  NA  . HEM FA 4 .   ? 41.288 71.654 94.174  1.00 51.68 ? 3003 HEM E NA  1 
HETATM 10243 N  NB  . HEM FA 4 .   ? 39.845 74.126 94.120  1.00 49.45 ? 3003 HEM E NB  1 
HETATM 10244 N  NC  . HEM FA 4 .   ? 40.323 74.457 96.929  1.00 49.96 ? 3003 HEM E NC  1 
HETATM 10245 N  ND  . HEM FA 4 .   ? 41.808 72.031 96.977  1.00 52.27 ? 3003 HEM E ND  1 
HETATM 10246 FE FE  . HEM FA 4 .   ? 40.829 73.028 95.546  1.00 50.47 ? 3003 HEM E FE  1 
HETATM 10247 FE FE  . FE2 GA 2 .   ? 28.566 69.595 92.723  1.00 37.84 ? 1616 FE2 F FE  1 
HETATM 10248 FE FE  . FE2 HA 2 .   ? 27.311 68.500 95.899  1.00 54.33 ? 1617 FE2 F FE  1 
HETATM 10249 MG MG  . MG  IA 3 .   ? 22.575 58.943 79.287  1.00 34.93 ? 1711 MG  F MG  1 
HETATM 10250 FE FE  . FE2 JA 2 .   ? 57.298 72.046 126.446 1.00 39.47 ? 1618 FE2 G FE  1 
HETATM 10251 FE FE  . FE2 KA 2 .   ? 53.772 71.574 126.590 1.00 51.93 ? 1619 FE2 G FE  1 
HETATM 10252 MG MG  . MG  LA 3 .   ? 39.154 75.663 120.190 1.00 45.19 ? 1708 MG  G MG  1 
HETATM 10253 MG MG  . MG  MA 3 .   ? 42.753 50.800 140.754 1.00 41.60 ? 1709 MG  G MG  1 
HETATM 10254 C  CHA . HEM NA 4 .   ? 62.326 58.684 127.607 1.00 31.59 ? 3004 HEM G CHA 1 
HETATM 10255 C  CHB . HEM NA 4 .   ? 64.340 62.843 128.962 1.00 35.17 ? 3004 HEM G CHB 1 
HETATM 10256 C  CHC . HEM NA 4 .   ? 62.195 62.531 133.232 1.00 31.74 ? 3004 HEM G CHC 1 
HETATM 10257 C  CHD . HEM NA 4 .   ? 60.082 58.440 131.906 1.00 32.92 ? 3004 HEM G CHD 1 
HETATM 10258 C  C1A . HEM NA 4 .   ? 63.090 59.852 127.591 1.00 33.58 ? 3004 HEM G C1A 1 
HETATM 10259 C  C2A . HEM NA 4 .   ? 63.825 60.376 126.454 1.00 34.03 ? 3004 HEM G C2A 1 
HETATM 10260 C  C3A . HEM NA 4 .   ? 64.405 61.525 126.818 1.00 33.19 ? 3004 HEM G C3A 1 
HETATM 10261 C  C4A . HEM NA 4 .   ? 63.958 61.765 128.186 1.00 32.14 ? 3004 HEM G C4A 1 
HETATM 10262 C  CMA . HEM NA 4 .   ? 65.471 62.280 126.055 1.00 27.79 ? 3004 HEM G CMA 1 
HETATM 10263 C  CAA . HEM NA 4 .   ? 63.827 59.778 125.092 1.00 38.65 ? 3004 HEM G CAA 1 
HETATM 10264 C  CBA . HEM NA 4 .   ? 62.588 60.252 124.361 1.00 47.16 ? 3004 HEM G CBA 1 
HETATM 10265 C  CGA . HEM NA 4 .   ? 62.295 59.417 123.136 1.00 49.74 ? 3004 HEM G CGA 1 
HETATM 10266 O  O1A . HEM NA 4 .   ? 63.167 59.346 122.241 1.00 48.83 ? 3004 HEM G O1A 1 
HETATM 10267 O  O2A . HEM NA 4 .   ? 61.192 58.828 123.078 1.00 52.37 ? 3004 HEM G O2A 1 
HETATM 10268 C  C1B . HEM NA 4 .   ? 64.014 63.087 130.299 1.00 35.47 ? 3004 HEM G C1B 1 
HETATM 10269 C  C2B . HEM NA 4 .   ? 64.478 64.233 131.073 1.00 35.59 ? 3004 HEM G C2B 1 
HETATM 10270 C  C3B . HEM NA 4 .   ? 63.834 64.140 132.275 1.00 36.62 ? 3004 HEM G C3B 1 
HETATM 10271 C  C4B . HEM NA 4 .   ? 63.044 62.931 132.231 1.00 32.41 ? 3004 HEM G C4B 1 
HETATM 10272 C  CMB . HEM NA 4 .   ? 65.467 65.319 130.623 1.00 34.83 ? 3004 HEM G CMB 1 
HETATM 10273 C  CAB . HEM NA 4 .   ? 63.826 65.079 133.301 1.00 38.96 ? 3004 HEM G CAB 1 
HETATM 10274 C  CBB . HEM NA 4 .   ? 65.050 65.562 133.902 1.00 46.92 ? 3004 HEM G CBB 1 
HETATM 10275 C  C1C . HEM NA 4 .   ? 61.373 61.427 133.238 1.00 29.84 ? 3004 HEM G C1C 1 
HETATM 10276 C  C2C . HEM NA 4 .   ? 60.584 61.063 134.353 1.00 30.46 ? 3004 HEM G C2C 1 
HETATM 10277 C  C3C . HEM NA 4 .   ? 59.971 59.886 133.992 1.00 31.48 ? 3004 HEM G C3C 1 
HETATM 10278 C  C4C . HEM NA 4 .   ? 60.421 59.572 132.655 1.00 30.62 ? 3004 HEM G C4C 1 
HETATM 10279 C  CMC . HEM NA 4 .   ? 60.448 61.917 135.630 1.00 30.40 ? 3004 HEM G CMC 1 
HETATM 10280 C  CAC . HEM NA 4 .   ? 59.075 59.107 134.723 1.00 32.44 ? 3004 HEM G CAC 1 
HETATM 10281 C  CBC . HEM NA 4 .   ? 58.477 59.521 135.985 1.00 33.61 ? 3004 HEM G CBC 1 
HETATM 10282 C  C1D . HEM NA 4 .   ? 60.505 58.117 130.614 1.00 32.59 ? 3004 HEM G C1D 1 
HETATM 10283 C  C2D . HEM NA 4 .   ? 60.160 56.894 129.879 1.00 32.84 ? 3004 HEM G C2D 1 
HETATM 10284 C  C3D . HEM NA 4 .   ? 60.795 56.960 128.675 1.00 34.07 ? 3004 HEM G C3D 1 
HETATM 10285 C  C4D . HEM NA 4 .   ? 61.511 58.235 128.655 1.00 34.58 ? 3004 HEM G C4D 1 
HETATM 10286 C  CMD . HEM NA 4 .   ? 59.264 55.764 130.349 1.00 30.36 ? 3004 HEM G CMD 1 
HETATM 10287 C  CAD . HEM NA 4 .   ? 60.870 55.888 127.597 1.00 39.07 ? 3004 HEM G CAD 1 
HETATM 10288 C  CBD . HEM NA 4 .   ? 61.547 54.600 128.064 1.00 48.48 ? 3004 HEM G CBD 1 
HETATM 10289 C  CGD . HEM NA 4 .   ? 61.873 53.650 126.920 1.00 49.49 ? 3004 HEM G CGD 1 
HETATM 10290 O  O1D . HEM NA 4 .   ? 62.706 54.020 126.063 1.00 51.18 ? 3004 HEM G O1D 1 
HETATM 10291 O  O2D . HEM NA 4 .   ? 61.297 52.539 126.879 1.00 48.93 ? 3004 HEM G O2D 1 
HETATM 10292 N  NA  . HEM NA 4 .   ? 63.172 60.737 128.659 1.00 32.98 ? 3004 HEM G NA  1 
HETATM 10293 N  NB  . HEM NA 4 .   ? 63.158 62.285 131.028 1.00 32.35 ? 3004 HEM G NB  1 
HETATM 10294 N  NC  . HEM NA 4 .   ? 61.283 60.527 132.196 1.00 31.42 ? 3004 HEM G NC  1 
HETATM 10295 N  ND  . HEM NA 4 .   ? 61.341 58.930 129.864 1.00 32.86 ? 3004 HEM G ND  1 
HETATM 10296 FE FE  . HEM NA 4 .   ? 62.242 60.616 130.424 1.00 34.11 ? 3004 HEM G FE  1 
HETATM 10297 FE FE  . FE2 OA 2 .   ? 67.154 53.153 139.780 1.00 40.00 ? 1621 FE2 H FE  1 
HETATM 10298 FE FE  . FE2 PA 2 .   ? 70.717 53.389 139.273 1.00 43.40 ? 1622 FE2 H FE  1 
HETATM 10299 MG MG  . MG  QA 3 .   ? 62.135 36.023 145.799 0.50 45.91 ? 1713 MG  H MG  1 
HETATM 10300 O  O   . HOH RA 5 .   ? 19.877 19.446 98.245  1.00 11.69 ? 3002 HOH A O   1 
HETATM 10301 O  O   . HOH RA 5 .   ? 6.527  20.973 107.762 1.00 27.06 ? 3003 HOH A O   1 
HETATM 10302 O  O   . HOH RA 5 .   ? 24.549 36.639 119.671 1.00 31.28 ? 3004 HOH A O   1 
HETATM 10303 O  O   . HOH RA 5 .   ? 18.954 14.618 114.999 1.00 31.80 ? 3005 HOH A O   1 
HETATM 10304 O  O   . HOH RA 5 .   ? 4.505  21.899 94.150  1.00 32.88 ? 3006 HOH A O   1 
HETATM 10305 O  O   . HOH RA 5 .   ? 13.600 55.979 103.715 1.00 35.90 ? 3007 HOH A O   1 
HETATM 10306 O  O   . HOH RA 5 .   ? 4.285  8.165  97.569  1.00 26.70 ? 3008 HOH A O   1 
HETATM 10307 O  O   . HOH RA 5 .   ? 20.702 54.003 125.079 1.00 28.70 ? 3009 HOH A O   1 
HETATM 10308 O  O   . HOH RA 5 .   ? 16.823 9.123  102.035 1.00 37.59 ? 3010 HOH A O   1 
HETATM 10309 O  O   . HOH RA 5 .   ? 3.045  21.938 99.470  1.00 36.84 ? 3011 HOH A O   1 
HETATM 10310 O  O   . HOH RA 5 .   ? -1.027 20.447 99.423  1.00 39.76 ? 3012 HOH A O   1 
HETATM 10311 O  O   . HOH RA 5 .   ? 13.777 58.557 105.116 1.00 38.10 ? 3013 HOH A O   1 
HETATM 10312 O  O   . HOH RA 5 .   ? 11.587 10.447 99.564  1.00 35.74 ? 3014 HOH A O   1 
HETATM 10313 O  O   . HOH RA 5 .   ? 3.450  43.613 107.494 1.00 28.19 ? 3015 HOH A O   1 
HETATM 10314 O  O   . HOH RA 5 .   ? 4.543  44.588 111.011 1.00 39.21 ? 3016 HOH A O   1 
HETATM 10315 O  O   . HOH RA 5 .   ? 14.748 52.309 113.925 1.00 41.54 ? 3017 HOH A O   1 
HETATM 10316 O  O   . HOH RA 5 .   ? 8.366  36.070 118.724 1.00 37.97 ? 3018 HOH A O   1 
HETATM 10317 O  O   . HOH RA 5 .   ? 23.167 17.609 110.067 1.00 33.01 ? 3019 HOH A O   1 
HETATM 10318 O  O   . HOH RA 5 .   ? 25.474 39.835 118.754 1.00 36.33 ? 3020 HOH A O   1 
HETATM 10319 O  O   . HOH RA 5 .   ? -3.528 14.607 97.080  1.00 53.04 ? 3021 HOH A O   1 
HETATM 10320 O  O   . HOH RA 5 .   ? 0.846  15.964 96.328  1.00 48.91 ? 3022 HOH A O   1 
HETATM 10321 O  O   . HOH RA 5 .   ? 12.992 30.868 107.617 1.00 38.48 ? 3023 HOH A O   1 
HETATM 10322 O  O   . HOH RA 5 .   ? 8.542  49.794 106.849 1.00 31.32 ? 3024 HOH A O   1 
HETATM 10323 O  O   . HOH RA 5 .   ? 9.874  49.585 103.635 1.00 21.51 ? 3025 HOH A O   1 
HETATM 10324 O  O   . HOH RA 5 .   ? 22.929 35.170 111.829 1.00 50.35 ? 3026 HOH A O   1 
HETATM 10325 O  O   . HOH RA 5 .   ? 9.982  22.187 87.536  1.00 17.35 ? 3027 HOH A O   1 
HETATM 10326 O  O   . HOH RA 5 .   ? 2.353  54.966 109.084 1.00 36.29 ? 3028 HOH A O   1 
HETATM 10327 O  O   . HOH RA 5 .   ? 20.098 19.220 113.774 1.00 41.18 ? 3029 HOH A O   1 
HETATM 10328 O  O   . HOH RA 5 .   ? 17.931 54.961 124.715 1.00 33.47 ? 3030 HOH A O   1 
HETATM 10329 O  O   . HOH RA 5 .   ? 20.976 11.881 112.716 1.00 35.19 ? 3031 HOH A O   1 
HETATM 10330 O  O   . HOH RA 5 .   ? 0.268  44.820 114.643 1.00 34.64 ? 3032 HOH A O   1 
HETATM 10331 O  O   . HOH SA 5 .   ? 19.739 52.464 92.944  1.00 15.35 ? 1705 HOH B O   1 
HETATM 10332 O  O   . HOH SA 5 .   ? 6.439  51.200 83.779  1.00 27.62 ? 1706 HOH B O   1 
HETATM 10333 O  O   . HOH SA 5 .   ? 16.456 50.527 73.254  1.00 21.57 ? 1707 HOH B O   1 
HETATM 10334 O  O   . HOH SA 5 .   ? 23.356 54.061 80.834  1.00 33.56 ? 1708 HOH B O   1 
HETATM 10335 O  O   . HOH SA 5 .   ? 24.466 35.311 71.407  1.00 30.89 ? 1709 HOH B O   1 
HETATM 10336 O  O   . HOH SA 5 .   ? 4.173  63.682 93.467  1.00 24.27 ? 1710 HOH B O   1 
HETATM 10337 O  O   . HOH SA 5 .   ? 8.372  22.119 84.411  1.00 26.32 ? 1711 HOH B O   1 
HETATM 10338 O  O   . HOH SA 5 .   ? 5.234  53.930 98.616  1.00 26.49 ? 1712 HOH B O   1 
HETATM 10339 O  O   . HOH SA 5 .   ? 5.161  57.005 80.153  1.00 23.80 ? 1713 HOH B O   1 
HETATM 10340 O  O   . HOH SA 5 .   ? 14.415 17.131 74.901  1.00 49.55 ? 1714 HOH B O   1 
HETATM 10341 O  O   . HOH SA 5 .   ? 13.824 14.724 86.331  1.00 39.29 ? 1715 HOH B O   1 
HETATM 10342 O  O   . HOH SA 5 .   ? 20.249 32.701 91.251  1.00 58.79 ? 1716 HOH B O   1 
HETATM 10343 O  O   . HOH SA 5 .   ? 16.791 62.738 89.062  1.00 51.58 ? 1717 HOH B O   1 
HETATM 10344 O  O   . HOH SA 5 .   ? 20.885 17.806 65.995  1.00 21.56 ? 1718 HOH B O   1 
HETATM 10345 O  O   . HOH SA 5 .   ? 17.697 14.306 89.754  1.00 51.78 ? 1719 HOH B O   1 
HETATM 10346 O  O   . HOH SA 5 .   ? 1.153  55.677 94.871  1.00 50.07 ? 1720 HOH B O   1 
HETATM 10347 O  O   . HOH SA 5 .   ? 2.629  50.407 92.344  1.00 34.73 ? 1721 HOH B O   1 
HETATM 10348 O  O   . HOH SA 5 .   ? 1.206  42.961 84.186  1.00 63.19 ? 1722 HOH B O   1 
HETATM 10349 O  O   . HOH SA 5 .   ? 22.466 18.689 77.338  1.00 79.18 ? 1723 HOH B O   1 
HETATM 10350 O  O   . HOH SA 5 .   ? 5.994  39.748 90.682  1.00 38.58 ? 1724 HOH B O   1 
HETATM 10351 O  O   . HOH SA 5 .   ? 13.078 47.249 78.877  1.00 90.66 ? 1725 HOH B O   1 
HETATM 10352 O  O   . HOH SA 5 .   ? 13.573 47.463 74.439  1.00 53.62 ? 1726 HOH B O   1 
HETATM 10353 O  O   . HOH SA 5 .   ? 13.472 51.971 79.243  1.00 63.30 ? 1727 HOH B O   1 
HETATM 10354 O  O   . HOH SA 5 .   ? 5.298  67.590 83.342  1.00 41.94 ? 1728 HOH B O   1 
HETATM 10355 O  O   . HOH SA 5 .   ? 19.213 57.036 76.326  1.00 51.09 ? 1729 HOH B O   1 
HETATM 10356 O  O   . HOH SA 5 .   ? -1.662 52.657 90.928  1.00 55.14 ? 1730 HOH B O   1 
HETATM 10357 O  O   . HOH SA 5 .   ? 12.989 41.234 83.550  1.00 36.42 ? 1731 HOH B O   1 
HETATM 10358 O  O   . HOH TA 5 .   ? 33.495 60.670 62.235  1.00 33.48 ? 3003 HOH C O   1 
HETATM 10359 O  O   . HOH TA 5 .   ? 15.820 50.489 57.442  1.00 27.37 ? 3004 HOH C O   1 
HETATM 10360 O  O   . HOH TA 5 .   ? 30.228 56.462 53.267  1.00 17.60 ? 3005 HOH C O   1 
HETATM 10361 O  O   . HOH TA 5 .   ? 18.849 50.865 56.509  1.00 24.98 ? 3006 HOH C O   1 
HETATM 10362 O  O   . HOH TA 5 .   ? 52.665 69.861 55.898  1.00 20.38 ? 3007 HOH C O   1 
HETATM 10363 O  O   . HOH TA 5 .   ? 44.627 68.949 44.513  1.00 44.19 ? 3008 HOH C O   1 
HETATM 10364 O  O   . HOH TA 5 .   ? 9.466  49.938 62.093  1.00 27.72 ? 3009 HOH C O   1 
HETATM 10365 O  O   . HOH TA 5 .   ? 31.828 51.888 52.454  1.00 26.60 ? 3010 HOH C O   1 
HETATM 10366 O  O   . HOH TA 5 .   ? 32.104 63.660 52.440  1.00 23.51 ? 3011 HOH C O   1 
HETATM 10367 O  O   . HOH TA 5 .   ? 35.688 47.032 67.886  1.00 29.44 ? 3012 HOH C O   1 
HETATM 10368 O  O   . HOH TA 5 .   ? 17.765 46.282 56.876  1.00 29.14 ? 3013 HOH C O   1 
HETATM 10369 O  O   . HOH TA 5 .   ? 61.300 62.120 61.566  1.00 33.92 ? 3014 HOH C O   1 
HETATM 10370 O  O   . HOH TA 5 .   ? 57.208 78.620 63.348  1.00 24.03 ? 3015 HOH C O   1 
HETATM 10371 O  O   . HOH TA 5 .   ? 46.894 63.954 48.633  1.00 23.32 ? 3016 HOH C O   1 
HETATM 10372 O  O   . HOH TA 5 .   ? 14.108 44.969 60.816  1.00 51.92 ? 3017 HOH C O   1 
HETATM 10373 O  O   . HOH TA 5 .   ? 20.904 61.949 59.105  1.00 48.34 ? 3018 HOH C O   1 
HETATM 10374 O  O   . HOH TA 5 .   ? 17.543 58.890 57.869  1.00 40.58 ? 3019 HOH C O   1 
HETATM 10375 O  O   . HOH TA 5 .   ? 26.711 54.293 78.121  1.00 52.91 ? 3020 HOH C O   1 
HETATM 10376 O  O   . HOH TA 5 .   ? 47.185 81.756 73.339  1.00 40.92 ? 3021 HOH C O   1 
HETATM 10377 O  O   . HOH TA 5 .   ? 52.997 72.311 55.475  1.00 24.14 ? 3022 HOH C O   1 
HETATM 10378 O  O   . HOH TA 5 .   ? 50.309 73.011 55.538  1.00 19.62 ? 3023 HOH C O   1 
HETATM 10379 O  O   . HOH TA 5 .   ? 63.848 63.000 61.759  1.00 51.29 ? 3024 HOH C O   1 
HETATM 10380 O  O   . HOH TA 5 .   ? 20.552 41.396 60.063  1.00 31.96 ? 3025 HOH C O   1 
HETATM 10381 O  O   . HOH TA 5 .   ? 15.800 47.718 57.773  1.00 43.41 ? 3026 HOH C O   1 
HETATM 10382 O  O   . HOH TA 5 .   ? 19.731 52.195 54.749  1.00 30.10 ? 3027 HOH C O   1 
HETATM 10383 O  O   . HOH TA 5 .   ? 17.301 56.023 52.799  1.00 41.68 ? 3028 HOH C O   1 
HETATM 10384 O  O   . HOH TA 5 .   ? 21.135 60.389 61.171  1.00 41.54 ? 3029 HOH C O   1 
HETATM 10385 O  O   . HOH TA 5 .   ? 30.186 61.905 51.011  1.00 33.66 ? 3030 HOH C O   1 
HETATM 10386 O  O   . HOH TA 5 .   ? 49.461 55.761 60.693  1.00 56.95 ? 3031 HOH C O   1 
HETATM 10387 O  O   . HOH TA 5 .   ? 51.290 52.754 63.760  1.00 38.13 ? 3032 HOH C O   1 
HETATM 10388 O  O   . HOH TA 5 .   ? 58.942 64.705 55.044  1.00 46.24 ? 3033 HOH C O   1 
HETATM 10389 O  O   . HOH TA 5 .   ? 44.839 65.463 60.194  1.00 33.33 ? 3034 HOH C O   1 
HETATM 10390 O  O   . HOH TA 5 .   ? 25.532 42.065 67.211  1.00 39.40 ? 3035 HOH C O   1 
HETATM 10391 O  O   . HOH TA 5 .   ? 21.910 51.145 53.797  1.00 43.74 ? 3036 HOH C O   1 
HETATM 10392 O  O   . HOH TA 5 .   ? 27.824 44.539 47.612  1.00 67.39 ? 3037 HOH C O   1 
HETATM 10393 O  O   . HOH TA 5 .   ? 30.269 54.628 46.830  1.00 45.39 ? 3038 HOH C O   1 
HETATM 10394 O  O   . HOH TA 5 .   ? 50.261 68.393 45.994  1.00 32.34 ? 3039 HOH C O   1 
HETATM 10395 O  O   . HOH TA 5 .   ? 49.617 78.473 58.302  1.00 44.16 ? 3040 HOH C O   1 
HETATM 10396 O  O   . HOH TA 5 .   ? 14.221 49.491 70.446  1.00 43.63 ? 3041 HOH C O   1 
HETATM 10397 O  O   . HOH TA 5 .   ? 24.641 58.214 78.423  1.00 36.49 ? 3042 HOH C O   1 
HETATM 10398 O  O   . HOH TA 5 .   ? 22.561 63.076 77.488  1.00 56.84 ? 3043 HOH C O   1 
HETATM 10399 O  O   . HOH TA 5 .   ? 27.268 58.070 77.299  1.00 51.27 ? 3044 HOH C O   1 
HETATM 10400 O  O   . HOH TA 5 .   ? 29.340 60.317 79.898  1.00 40.55 ? 3045 HOH C O   1 
HETATM 10401 O  O   . HOH TA 5 .   ? 41.471 62.714 69.660  1.00 53.55 ? 3046 HOH C O   1 
HETATM 10402 O  O   . HOH TA 5 .   ? 47.049 69.034 71.542  1.00 35.38 ? 3047 HOH C O   1 
HETATM 10403 O  O   . HOH TA 5 .   ? 44.863 69.366 72.788  1.00 34.75 ? 3048 HOH C O   1 
HETATM 10404 O  O   . HOH TA 5 .   ? 42.939 78.497 63.040  1.00 35.26 ? 3049 HOH C O   1 
HETATM 10405 O  O   . HOH TA 5 .   ? 61.698 78.778 65.171  1.00 38.24 ? 3050 HOH C O   1 
HETATM 10406 O  O   . HOH TA 5 .   ? 64.194 64.963 66.154  1.00 56.55 ? 3051 HOH C O   1 
HETATM 10407 O  O   . HOH TA 5 .   ? 61.800 60.571 64.155  1.00 59.56 ? 3052 HOH C O   1 
HETATM 10408 O  O   . HOH TA 5 .   ? 46.749 72.329 47.535  1.00 41.61 ? 3053 HOH C O   1 
HETATM 10409 O  O   . HOH TA 5 .   ? 43.569 68.874 47.872  1.00 39.16 ? 3054 HOH C O   1 
HETATM 10410 O  O   . HOH TA 5 .   ? 49.041 46.346 62.408  1.00 38.21 ? 3055 HOH C O   1 
HETATM 10411 O  O   . HOH TA 5 .   ? 59.813 58.302 54.607  1.00 37.92 ? 3056 HOH C O   1 
HETATM 10412 O  O   . HOH TA 5 .   ? 59.933 61.432 50.601  1.00 47.26 ? 3057 HOH C O   1 
HETATM 10413 O  O   . HOH TA 5 .   ? 57.778 60.398 50.441  1.00 40.57 ? 3058 HOH C O   1 
HETATM 10414 O  O   . HOH TA 5 .   ? 58.371 62.730 52.294  1.00 54.36 ? 3059 HOH C O   1 
HETATM 10415 O  O   . HOH TA 5 .   ? 52.235 69.122 44.838  1.00 35.43 ? 3060 HOH C O   1 
HETATM 10416 O  O   . HOH UA 5 .   ? 22.440 36.191 48.996  1.00 41.03 ? 1713 HOH D O   1 
HETATM 10417 O  O   . HOH UA 5 .   ? 25.001 27.320 55.277  1.00 24.37 ? 1714 HOH D O   1 
HETATM 10418 O  O   . HOH UA 5 .   ? 37.743 48.274 45.762  1.00 28.44 ? 1715 HOH D O   1 
HETATM 10419 O  O   . HOH UA 5 .   ? 61.421 42.581 31.080  1.00 32.61 ? 1716 HOH D O   1 
HETATM 10420 O  O   . HOH UA 5 .   ? 37.934 51.870 48.691  1.00 23.45 ? 1717 HOH D O   1 
HETATM 10421 O  O   . HOH UA 5 .   ? 45.045 50.709 39.245  1.00 38.32 ? 1718 HOH D O   1 
HETATM 10422 O  O   . HOH UA 5 .   ? 49.530 46.975 59.568  1.00 31.34 ? 1719 HOH D O   1 
HETATM 10423 O  O   . HOH UA 5 .   ? 47.459 43.576 39.025  1.00 30.26 ? 1720 HOH D O   1 
HETATM 10424 O  O   . HOH UA 5 .   ? 52.670 60.143 46.933  1.00 34.31 ? 1721 HOH D O   1 
HETATM 10425 O  O   . HOH UA 5 .   ? 26.673 30.483 71.400  1.00 43.43 ? 1722 HOH D O   1 
HETATM 10426 O  O   . HOH UA 5 .   ? 48.017 54.808 39.934  1.00 26.89 ? 1723 HOH D O   1 
HETATM 10427 O  O   . HOH UA 5 .   ? 25.953 40.864 47.931  1.00 32.39 ? 1724 HOH D O   1 
HETATM 10428 O  O   . HOH UA 5 .   ? 30.914 11.472 55.777  1.00 29.14 ? 1725 HOH D O   1 
HETATM 10429 O  O   . HOH UA 5 .   ? 33.820 42.192 43.790  1.00 24.90 ? 1726 HOH D O   1 
HETATM 10430 O  O   . HOH UA 5 .   ? 30.265 22.437 51.544  1.00 38.45 ? 1727 HOH D O   1 
HETATM 10431 O  O   . HOH UA 5 .   ? 55.020 60.531 48.922  1.00 32.41 ? 1728 HOH D O   1 
HETATM 10432 O  O   . HOH UA 5 .   ? 44.497 36.619 46.431  1.00 48.79 ? 1729 HOH D O   1 
HETATM 10433 O  O   . HOH UA 5 .   ? 50.253 55.013 38.509  1.00 32.09 ? 1730 HOH D O   1 
HETATM 10434 O  O   . HOH UA 5 .   ? 49.376 57.807 41.699  1.00 28.51 ? 1731 HOH D O   1 
HETATM 10435 O  O   . HOH UA 5 .   ? 46.826 47.286 36.024  1.00 32.09 ? 1732 HOH D O   1 
HETATM 10436 O  O   . HOH UA 5 .   ? 42.094 39.607 49.139  1.00 28.71 ? 1733 HOH D O   1 
HETATM 10437 O  O   . HOH UA 5 .   ? 39.636 35.077 54.159  1.00 51.77 ? 1734 HOH D O   1 
HETATM 10438 O  O   . HOH UA 5 .   ? 46.177 59.070 47.585  1.00 31.05 ? 1735 HOH D O   1 
HETATM 10439 O  O   . HOH UA 5 .   ? 50.900 61.791 48.842  1.00 31.53 ? 1736 HOH D O   1 
HETATM 10440 O  O   . HOH UA 5 .   ? 46.815 56.911 40.476  1.00 27.21 ? 1737 HOH D O   1 
HETATM 10441 O  O   . HOH UA 5 .   ? 31.445 52.401 46.185  1.00 37.79 ? 1738 HOH D O   1 
HETATM 10442 O  O   . HOH UA 5 .   ? 38.273 47.254 43.366  1.00 32.95 ? 1739 HOH D O   1 
HETATM 10443 O  O   . HOH UA 5 .   ? 62.937 47.745 44.079  1.00 35.02 ? 1740 HOH D O   1 
HETATM 10444 O  O   . HOH UA 5 .   ? 64.531 36.658 45.563  1.00 39.14 ? 1741 HOH D O   1 
HETATM 10445 O  O   . HOH UA 5 .   ? 25.509 14.893 65.848  1.00 37.35 ? 1742 HOH D O   1 
HETATM 10446 O  O   . HOH UA 5 .   ? 19.813 37.914 63.475  1.00 39.57 ? 1743 HOH D O   1 
HETATM 10447 O  O   . HOH UA 5 .   ? 49.043 28.188 42.043  1.00 47.48 ? 1744 HOH D O   1 
HETATM 10448 O  O   . HOH UA 5 .   ? 48.956 56.137 36.134  1.00 49.07 ? 1745 HOH D O   1 
HETATM 10449 O  O   . HOH UA 5 .   ? 46.440 54.017 28.721  1.00 55.32 ? 1746 HOH D O   1 
HETATM 10450 O  O   . HOH UA 5 .   ? 51.108 57.139 39.669  1.00 29.35 ? 1747 HOH D O   1 
HETATM 10451 O  O   . HOH UA 5 .   ? 45.728 53.907 39.854  1.00 25.40 ? 1748 HOH D O   1 
HETATM 10452 O  O   . HOH UA 5 .   ? 41.895 51.299 44.711  1.00 27.12 ? 1749 HOH D O   1 
HETATM 10453 O  O   . HOH UA 5 .   ? 36.587 23.424 63.757  1.00 69.90 ? 1750 HOH D O   1 
HETATM 10454 O  O   . HOH UA 5 .   ? 56.215 62.517 49.630  1.00 41.16 ? 1751 HOH D O   1 
HETATM 10455 O  O   . HOH UA 5 .   ? 20.273 36.224 47.769  1.00 37.29 ? 1752 HOH D O   1 
HETATM 10456 O  O   . HOH UA 5 .   ? 21.546 33.461 50.866  1.00 45.07 ? 1753 HOH D O   1 
HETATM 10457 O  O   . HOH UA 5 .   ? 27.397 36.643 45.942  1.00 41.38 ? 1754 HOH D O   1 
HETATM 10458 O  O   . HOH UA 5 .   ? 43.058 28.925 43.516  1.00 51.77 ? 1755 HOH D O   1 
HETATM 10459 O  O   . HOH UA 5 .   ? 48.326 30.390 43.575  1.00 49.01 ? 1756 HOH D O   1 
HETATM 10460 O  O   . HOH UA 5 .   ? 49.952 33.935 33.552  1.00 46.15 ? 1757 HOH D O   1 
HETATM 10461 O  O   . HOH UA 5 .   ? 65.576 48.340 35.690  1.00 31.33 ? 1758 HOH D O   1 
HETATM 10462 O  O   . HOH UA 5 .   ? 62.247 35.709 44.792  1.00 20.53 ? 1759 HOH D O   1 
HETATM 10463 O  O   . HOH UA 5 .   ? 41.727 24.006 58.223  1.00 48.34 ? 1760 HOH D O   1 
HETATM 10464 O  O   . HOH UA 5 .   ? 42.512 21.241 52.904  1.00 29.84 ? 1761 HOH D O   1 
HETATM 10465 O  O   . HOH UA 5 .   ? 58.031 58.454 49.039  1.00 56.20 ? 1762 HOH D O   1 
HETATM 10466 O  O   . HOH UA 5 .   ? 58.174 62.809 48.164  1.00 54.06 ? 1763 HOH D O   1 
HETATM 10467 O  O   . HOH UA 5 .   ? 53.725 64.177 49.002  1.00 35.91 ? 1764 HOH D O   1 
HETATM 10468 O  O   . HOH UA 5 .   ? 32.371 22.374 47.835  1.00 42.34 ? 1765 HOH D O   1 
HETATM 10469 O  O   . HOH UA 5 .   ? 36.653 18.211 55.104  1.00 92.25 ? 1766 HOH D O   1 
HETATM 10470 O  O   . HOH UA 5 .   ? 33.202 14.311 50.387  1.00 30.12 ? 1767 HOH D O   1 
HETATM 10471 O  O   . HOH UA 5 .   ? 25.965 17.225 60.767  1.00 28.35 ? 1768 HOH D O   1 
HETATM 10472 O  O   . HOH VA 5 .   ? 52.588 82.844 118.632 1.00 23.12 ? 3004 HOH E O   1 
HETATM 10473 O  O   . HOH VA 5 .   ? 49.051 84.649 96.311  1.00 27.41 ? 3005 HOH E O   1 
HETATM 10474 O  O   . HOH VA 5 .   ? 62.492 91.345 98.979  1.00 41.95 ? 3006 HOH E O   1 
HETATM 10475 O  O   . HOH VA 5 .   ? 45.214 76.592 70.589  1.00 32.37 ? 3007 HOH E O   1 
HETATM 10476 O  O   . HOH VA 5 .   ? 37.040 86.988 113.553 1.00 25.08 ? 3008 HOH E O   1 
HETATM 10477 O  O   . HOH VA 5 .   ? 40.355 85.858 78.697  1.00 21.19 ? 3009 HOH E O   1 
HETATM 10478 O  O   . HOH VA 5 .   ? 39.535 87.789 98.002  1.00 30.42 ? 3010 HOH E O   1 
HETATM 10479 O  O   . HOH VA 5 .   ? 37.237 78.092 117.025 1.00 30.61 ? 3011 HOH E O   1 
HETATM 10480 O  O   . HOH VA 5 .   ? 42.388 74.672 113.184 1.00 28.44 ? 3012 HOH E O   1 
HETATM 10481 O  O   . HOH VA 5 .   ? 48.951 92.784 105.717 1.00 25.97 ? 3013 HOH E O   1 
HETATM 10482 O  O   . HOH VA 5 .   ? 38.549 78.409 74.133  1.00 30.89 ? 3014 HOH E O   1 
HETATM 10483 O  O   . HOH VA 5 .   ? 61.296 75.831 85.622  1.00 40.45 ? 3015 HOH E O   1 
HETATM 10484 O  O   . HOH VA 5 .   ? 49.022 83.299 73.861  1.00 27.32 ? 3016 HOH E O   1 
HETATM 10485 O  O   . HOH VA 5 .   ? 47.650 85.984 118.421 1.00 36.61 ? 3017 HOH E O   1 
HETATM 10486 O  O   . HOH VA 5 .   ? 61.767 78.223 84.435  1.00 21.91 ? 3018 HOH E O   1 
HETATM 10487 O  O   . HOH VA 5 .   ? 49.258 70.331 72.108  1.00 24.99 ? 3019 HOH E O   1 
HETATM 10488 O  O   . HOH VA 5 .   ? 43.652 91.670 76.435  1.00 34.57 ? 3020 HOH E O   1 
HETATM 10489 O  O   . HOH VA 5 .   ? 50.644 94.333 91.502  1.00 35.41 ? 3021 HOH E O   1 
HETATM 10490 O  O   . HOH VA 5 .   ? 39.476 78.193 71.761  1.00 48.18 ? 3022 HOH E O   1 
HETATM 10491 O  O   . HOH VA 5 .   ? 47.160 68.497 85.800  1.00 41.38 ? 3023 HOH E O   1 
HETATM 10492 O  O   . HOH VA 5 .   ? 32.836 82.987 105.518 1.00 22.45 ? 3024 HOH E O   1 
HETATM 10493 O  O   . HOH VA 5 .   ? 42.867 92.411 92.831  1.00 38.27 ? 3025 HOH E O   1 
HETATM 10494 O  O   . HOH VA 5 .   ? 44.094 91.878 82.680  1.00 38.66 ? 3026 HOH E O   1 
HETATM 10495 O  O   . HOH VA 5 .   ? 55.727 96.460 120.352 1.00 37.81 ? 3027 HOH E O   1 
HETATM 10496 O  O   . HOH VA 5 .   ? 64.535 80.988 87.819  1.00 28.76 ? 3028 HOH E O   1 
HETATM 10497 O  O   . HOH VA 5 .   ? 49.581 84.399 71.315  1.00 44.15 ? 3029 HOH E O   1 
HETATM 10498 O  O   . HOH VA 5 .   ? 45.678 83.603 73.036  1.00 39.44 ? 3030 HOH E O   1 
HETATM 10499 O  O   . HOH VA 5 .   ? 39.385 80.608 124.977 1.00 39.14 ? 3031 HOH E O   1 
HETATM 10500 O  O   . HOH VA 5 .   ? 44.618 95.414 108.528 1.00 30.83 ? 3032 HOH E O   1 
HETATM 10501 O  O   . HOH VA 5 .   ? 41.904 98.370 118.085 1.00 42.43 ? 3033 HOH E O   1 
HETATM 10502 O  O   . HOH VA 5 .   ? 47.572 91.194 106.845 1.00 57.07 ? 3034 HOH E O   1 
HETATM 10503 O  O   . HOH VA 5 .   ? 38.029 88.089 102.035 1.00 37.27 ? 3035 HOH E O   1 
HETATM 10504 O  O   . HOH VA 5 .   ? 50.564 64.217 77.555  1.00 40.86 ? 3036 HOH E O   1 
HETATM 10505 O  O   . HOH VA 5 .   ? 55.996 77.963 90.958  1.00 28.40 ? 3037 HOH E O   1 
HETATM 10506 O  O   . HOH VA 5 .   ? 32.581 86.425 108.893 1.00 30.80 ? 3038 HOH E O   1 
HETATM 10507 O  O   . HOH VA 5 .   ? 30.919 82.964 100.900 1.00 70.58 ? 3039 HOH E O   1 
HETATM 10508 O  O   . HOH VA 5 .   ? 36.233 84.577 98.399  1.00 39.58 ? 3040 HOH E O   1 
HETATM 10509 O  O   . HOH VA 5 .   ? 51.436 87.743 97.629  1.00 42.14 ? 3041 HOH E O   1 
HETATM 10510 O  O   . HOH VA 5 .   ? 55.475 89.595 101.191 1.00 73.61 ? 3042 HOH E O   1 
HETATM 10511 O  O   . HOH VA 5 .   ? 60.174 90.332 99.097  1.00 64.94 ? 3043 HOH E O   1 
HETATM 10512 O  O   . HOH VA 5 .   ? 54.334 96.914 96.287  1.00 54.45 ? 3044 HOH E O   1 
HETATM 10513 O  O   . HOH VA 5 .   ? 56.287 98.269 97.724  1.00 40.43 ? 3045 HOH E O   1 
HETATM 10514 O  O   . HOH VA 5 .   ? 57.630 95.394 106.468 1.00 40.53 ? 3046 HOH E O   1 
HETATM 10515 O  O   . HOH VA 5 .   ? 61.037 82.276 111.093 1.00 37.00 ? 3047 HOH E O   1 
HETATM 10516 O  O   . HOH VA 5 .   ? 62.266 79.969 87.250  1.00 44.95 ? 3048 HOH E O   1 
HETATM 10517 O  O   . HOH VA 5 .   ? 62.690 88.624 71.216  1.00 39.67 ? 3049 HOH E O   1 
HETATM 10518 O  O   . HOH VA 5 .   ? 49.746 64.388 109.460 1.00 45.88 ? 3050 HOH E O   1 
HETATM 10519 O  O   . HOH VA 5 .   ? 38.985 76.779 122.624 1.00 45.08 ? 3051 HOH E O   1 
HETATM 10520 O  O   . HOH VA 5 .   ? 36.707 76.463 118.987 1.00 45.17 ? 3052 HOH E O   1 
HETATM 10521 O  O   . HOH VA 5 .   ? 47.870 93.572 77.200  1.00 55.64 ? 3053 HOH E O   1 
HETATM 10522 O  O   . HOH WA 5 .   ? 26.636 71.597 94.761  1.00 28.02 ? 1712 HOH F O   1 
HETATM 10523 O  O   . HOH WA 5 .   ? 29.804 80.081 112.343 1.00 17.66 ? 1713 HOH F O   1 
HETATM 10524 O  O   . HOH WA 5 .   ? 35.117 70.532 120.211 1.00 38.29 ? 1714 HOH F O   1 
HETATM 10525 O  O   . HOH WA 5 .   ? 38.587 72.537 77.851  1.00 27.21 ? 1715 HOH F O   1 
HETATM 10526 O  O   . HOH WA 5 .   ? 20.115 76.065 85.320  1.00 25.47 ? 1716 HOH F O   1 
HETATM 10527 O  O   . HOH WA 5 .   ? 26.114 73.471 72.357  1.00 40.64 ? 1717 HOH F O   1 
HETATM 10528 O  O   . HOH WA 5 .   ? 33.145 82.651 92.708  1.00 38.69 ? 1718 HOH F O   1 
HETATM 10529 O  O   . HOH WA 5 .   ? 39.098 64.349 119.016 1.00 25.00 ? 1719 HOH F O   1 
HETATM 10530 O  O   . HOH WA 5 .   ? 29.892 71.997 117.693 1.00 32.19 ? 1720 HOH F O   1 
HETATM 10531 O  O   . HOH WA 5 .   ? 12.591 72.899 103.108 1.00 44.96 ? 1721 HOH F O   1 
HETATM 10532 O  O   . HOH WA 5 .   ? 15.504 80.332 101.986 1.00 37.56 ? 1722 HOH F O   1 
HETATM 10533 O  O   . HOH WA 5 .   ? 39.814 59.683 110.206 1.00 34.91 ? 1723 HOH F O   1 
HETATM 10534 O  O   . HOH WA 5 .   ? 25.236 83.537 117.033 1.00 34.19 ? 1724 HOH F O   1 
HETATM 10535 O  O   . HOH WA 5 .   ? 30.933 54.361 121.120 1.00 34.93 ? 1725 HOH F O   1 
HETATM 10536 O  O   . HOH WA 5 .   ? 14.516 63.578 91.753  1.00 35.87 ? 1726 HOH F O   1 
HETATM 10537 O  O   . HOH WA 5 .   ? 18.531 67.536 67.837  1.00 31.51 ? 1727 HOH F O   1 
HETATM 10538 O  O   . HOH WA 5 .   ? 17.610 66.793 65.007  1.00 37.77 ? 1728 HOH F O   1 
HETATM 10539 O  O   . HOH WA 5 .   ? 41.443 65.421 105.646 1.00 53.50 ? 1729 HOH F O   1 
HETATM 10540 O  O   . HOH WA 5 .   ? 30.802 83.361 77.353  1.00 30.19 ? 1730 HOH F O   1 
HETATM 10541 O  O   . HOH WA 5 .   ? 36.389 84.928 85.611  1.00 27.59 ? 1731 HOH F O   1 
HETATM 10542 O  O   . HOH WA 5 .   ? 19.054 81.374 92.170  1.00 45.09 ? 1732 HOH F O   1 
HETATM 10543 O  O   . HOH WA 5 .   ? 16.328 65.126 72.001  1.00 38.39 ? 1733 HOH F O   1 
HETATM 10544 O  O   . HOH WA 5 .   ? 16.597 68.969 68.813  1.00 61.56 ? 1734 HOH F O   1 
HETATM 10545 O  O   . HOH WA 5 .   ? 21.055 60.426 78.570  1.00 30.83 ? 1735 HOH F O   1 
HETATM 10546 O  O   . HOH WA 5 .   ? 34.966 78.036 66.247  1.00 32.40 ? 1736 HOH F O   1 
HETATM 10547 O  O   . HOH WA 5 .   ? 23.669 80.295 69.826  1.00 36.81 ? 1737 HOH F O   1 
HETATM 10548 O  O   . HOH WA 5 .   ? 24.701 86.261 81.948  1.00 58.04 ? 1738 HOH F O   1 
HETATM 10549 O  O   . HOH WA 5 .   ? 19.666 80.982 82.593  1.00 28.87 ? 1739 HOH F O   1 
HETATM 10550 O  O   . HOH WA 5 .   ? 45.079 67.957 112.602 1.00 46.63 ? 1740 HOH F O   1 
HETATM 10551 O  O   . HOH WA 5 .   ? 29.109 61.853 100.274 1.00 36.46 ? 1741 HOH F O   1 
HETATM 10552 O  O   . HOH WA 5 .   ? 34.177 68.850 76.758  1.00 37.71 ? 1742 HOH F O   1 
HETATM 10553 O  O   . HOH WA 5 .   ? 23.226 81.038 98.707  1.00 39.77 ? 1743 HOH F O   1 
HETATM 10554 O  O   . HOH WA 5 .   ? 22.341 83.643 113.853 1.00 31.58 ? 1744 HOH F O   1 
HETATM 10555 O  O   . HOH WA 5 .   ? 27.911 70.873 117.036 1.00 26.83 ? 1745 HOH F O   1 
HETATM 10556 O  O   . HOH WA 5 .   ? 23.032 70.915 93.488  1.00 43.43 ? 1746 HOH F O   1 
HETATM 10557 O  O   . HOH WA 5 .   ? 16.814 65.365 91.763  1.00 55.18 ? 1747 HOH F O   1 
HETATM 10558 O  O   . HOH WA 5 .   ? 22.529 60.763 84.827  1.00 68.79 ? 1748 HOH F O   1 
HETATM 10559 O  O   . HOH WA 5 .   ? 23.394 56.735 104.239 1.00 43.70 ? 1749 HOH F O   1 
HETATM 10560 O  O   . HOH WA 5 .   ? 18.396 66.347 112.978 1.00 31.79 ? 1750 HOH F O   1 
HETATM 10561 O  O   . HOH WA 5 .   ? 14.898 53.778 111.464 1.00 48.29 ? 1751 HOH F O   1 
HETATM 10562 O  O   . HOH XA 5 .   ? 55.264 73.574 129.090 1.00 31.68 ? 3005 HOH G O   1 
HETATM 10563 O  O   . HOH XA 5 .   ? 60.458 73.940 137.969 1.00 21.08 ? 3006 HOH G O   1 
HETATM 10564 O  O   . HOH XA 5 .   ? 25.491 57.410 125.495 1.00 26.04 ? 3007 HOH G O   1 
HETATM 10565 O  O   . HOH XA 5 .   ? 72.420 82.788 118.019 1.00 29.00 ? 3008 HOH G O   1 
HETATM 10566 O  O   . HOH XA 5 .   ? 73.176 83.234 133.607 1.00 25.29 ? 3009 HOH G O   1 
HETATM 10567 O  O   . HOH XA 5 .   ? 61.351 83.947 130.568 1.00 30.66 ? 3010 HOH G O   1 
HETATM 10568 O  O   . HOH XA 5 .   ? 63.524 70.180 138.722 1.00 23.27 ? 3011 HOH G O   1 
HETATM 10569 O  O   . HOH XA 5 .   ? 37.846 61.084 135.336 1.00 24.07 ? 3012 HOH G O   1 
HETATM 10570 O  O   . HOH XA 5 .   ? 27.701 61.740 127.985 1.00 28.28 ? 3013 HOH G O   1 
HETATM 10571 O  O   . HOH XA 5 .   ? 75.277 81.716 133.355 1.00 42.21 ? 3014 HOH G O   1 
HETATM 10572 O  O   . HOH XA 5 .   ? 44.227 54.498 142.040 1.00 35.61 ? 3015 HOH G O   1 
HETATM 10573 O  O   . HOH XA 5 .   ? 67.595 84.877 137.954 1.00 44.62 ? 3016 HOH G O   1 
HETATM 10574 O  O   . HOH XA 5 .   ? 45.792 63.157 142.503 1.00 23.04 ? 3017 HOH G O   1 
HETATM 10575 O  O   . HOH XA 5 .   ? 38.732 67.535 144.869 1.00 80.57 ? 3018 HOH G O   1 
HETATM 10576 O  O   . HOH XA 5 .   ? 76.382 88.810 129.001 1.00 34.23 ? 3019 HOH G O   1 
HETATM 10577 O  O   . HOH XA 5 .   ? 61.654 90.032 126.721 1.00 32.08 ? 3020 HOH G O   1 
HETATM 10578 O  O   . HOH XA 5 .   ? 72.001 91.707 115.845 1.00 30.12 ? 3021 HOH G O   1 
HETATM 10579 O  O   . HOH XA 5 .   ? 48.977 83.629 120.324 1.00 39.78 ? 3022 HOH G O   1 
HETATM 10580 O  O   . HOH XA 5 .   ? 69.514 81.012 135.613 1.00 35.08 ? 3023 HOH G O   1 
HETATM 10581 O  O   . HOH XA 5 .   ? 64.763 85.950 133.556 1.00 39.10 ? 3024 HOH G O   1 
HETATM 10582 O  O   . HOH XA 5 .   ? 55.734 76.758 140.007 1.00 35.38 ? 3025 HOH G O   1 
HETATM 10583 O  O   . HOH XA 5 .   ? 49.566 68.905 126.526 1.00 27.86 ? 3026 HOH G O   1 
HETATM 10584 O  O   . HOH XA 5 .   ? 52.451 54.017 127.259 1.00 33.75 ? 3027 HOH G O   1 
HETATM 10585 O  O   . HOH XA 5 .   ? 71.937 74.550 140.095 1.00 46.37 ? 3028 HOH G O   1 
HETATM 10586 O  O   . HOH XA 5 .   ? 71.363 71.357 137.974 1.00 26.88 ? 3029 HOH G O   1 
HETATM 10587 O  O   . HOH XA 5 .   ? 62.959 71.095 144.600 1.00 47.24 ? 3030 HOH G O   1 
HETATM 10588 O  O   . HOH XA 5 .   ? 53.431 75.924 138.711 1.00 31.18 ? 3031 HOH G O   1 
HETATM 10589 O  O   . HOH XA 5 .   ? 41.996 57.508 142.270 1.00 31.49 ? 3032 HOH G O   1 
HETATM 10590 O  O   . HOH XA 5 .   ? 42.291 75.845 132.762 1.00 44.13 ? 3033 HOH G O   1 
HETATM 10591 O  O   . HOH XA 5 .   ? 63.554 75.187 113.301 1.00 43.14 ? 3034 HOH G O   1 
HETATM 10592 O  O   . HOH XA 5 .   ? 39.986 49.894 129.582 1.00 34.68 ? 3035 HOH G O   1 
HETATM 10593 O  O   . HOH XA 5 .   ? 38.600 61.116 146.376 1.00 34.52 ? 3036 HOH G O   1 
HETATM 10594 O  O   . HOH XA 5 .   ? 43.238 69.832 142.905 1.00 38.91 ? 3037 HOH G O   1 
HETATM 10595 O  O   . HOH XA 5 .   ? 45.921 81.872 129.379 1.00 45.92 ? 3038 HOH G O   1 
HETATM 10596 O  O   . HOH XA 5 .   ? 58.086 84.012 114.784 1.00 57.49 ? 3039 HOH G O   1 
HETATM 10597 O  O   . HOH XA 5 .   ? 41.350 65.649 119.334 1.00 37.45 ? 3040 HOH G O   1 
HETATM 10598 O  O   . HOH XA 5 .   ? 42.106 67.746 118.268 1.00 49.89 ? 3041 HOH G O   1 
HETATM 10599 O  O   . HOH XA 5 .   ? 83.131 82.681 122.331 1.00 40.24 ? 3042 HOH G O   1 
HETATM 10600 O  O   . HOH XA 5 .   ? 85.150 80.714 125.769 1.00 44.06 ? 3043 HOH G O   1 
HETATM 10601 O  O   . HOH XA 5 .   ? 75.234 84.159 120.561 1.00 49.24 ? 3044 HOH G O   1 
HETATM 10602 O  O   . HOH XA 5 .   ? 69.192 78.854 137.382 1.00 42.80 ? 3045 HOH G O   1 
HETATM 10603 O  O   . HOH XA 5 .   ? 66.933 79.681 139.762 1.00 36.58 ? 3046 HOH G O   1 
HETATM 10604 O  O   . HOH XA 5 .   ? 57.738 84.250 135.371 1.00 38.13 ? 3047 HOH G O   1 
HETATM 10605 O  O   . HOH XA 5 .   ? 38.183 53.051 135.996 1.00 39.22 ? 3048 HOH G O   1 
HETATM 10606 O  O   . HOH XA 5 .   ? 40.874 48.140 126.831 1.00 51.13 ? 3049 HOH G O   1 
HETATM 10607 O  O   . HOH XA 5 .   ? 53.937 62.856 120.509 1.00 38.08 ? 3050 HOH G O   1 
HETATM 10608 O  O   . HOH XA 5 .   ? 66.371 74.226 144.231 1.00 36.65 ? 3051 HOH G O   1 
HETATM 10609 O  O   . HOH XA 5 .   ? 41.062 68.378 143.204 1.00 14.80 ? 3052 HOH G O   1 
HETATM 10610 O  O   . HOH XA 5 .   ? 38.791 69.331 143.030 1.00 14.49 ? 3053 HOH G O   1 
HETATM 10611 O  O   . HOH XA 5 .   ? 40.034 62.509 145.146 1.00 26.85 ? 3054 HOH G O   1 
HETATM 10612 O  O   . HOH XA 5 .   ? 38.797 59.526 139.337 1.00 30.59 ? 3055 HOH G O   1 
HETATM 10613 O  O   . HOH XA 5 .   ? 35.504 62.142 135.863 1.00 26.70 ? 3056 HOH G O   1 
HETATM 10614 O  O   . HOH XA 5 .   ? 38.698 59.098 136.844 1.00 29.65 ? 3057 HOH G O   1 
HETATM 10615 O  O   . HOH XA 5 .   ? 36.160 64.761 135.486 1.00 26.33 ? 3058 HOH G O   1 
HETATM 10616 O  O   . HOH XA 5 .   ? 34.196 70.599 130.006 1.00 31.09 ? 3059 HOH G O   1 
HETATM 10617 O  O   . HOH XA 5 .   ? 37.190 74.284 131.384 1.00 25.48 ? 3060 HOH G O   1 
HETATM 10618 O  O   . HOH XA 5 .   ? 57.741 90.010 126.071 1.00 35.30 ? 3061 HOH G O   1 
HETATM 10619 O  O   . HOH XA 5 .   ? 62.962 92.132 125.610 1.00 36.28 ? 3062 HOH G O   1 
HETATM 10620 O  O   . HOH XA 5 .   ? 71.558 81.815 115.406 1.00 89.35 ? 3063 HOH G O   1 
HETATM 10621 O  O   . HOH XA 5 .   ? 61.572 71.708 109.765 1.00 36.72 ? 3064 HOH G O   1 
HETATM 10622 O  O   . HOH XA 5 .   ? 49.275 67.809 120.620 1.00 55.35 ? 3065 HOH G O   1 
HETATM 10623 O  O   . HOH XA 5 .   ? 47.214 64.636 127.233 1.00 53.03 ? 3066 HOH G O   1 
HETATM 10624 O  O   . HOH XA 5 .   ? 36.318 72.691 120.409 1.00 32.62 ? 3067 HOH G O   1 
HETATM 10625 O  O   . HOH XA 5 .   ? 29.031 66.517 131.091 1.00 34.32 ? 3068 HOH G O   1 
HETATM 10626 O  O   . HOH XA 5 .   ? 59.195 52.822 128.550 1.00 34.98 ? 3069 HOH G O   1 
HETATM 10627 O  O   . HOH XA 5 .   ? 39.609 53.284 137.971 1.00 63.47 ? 3070 HOH G O   1 
HETATM 10628 O  O   . HOH YA 5 .   ? 88.322 63.801 135.709 1.00 29.16 ? 1714 HOH H O   1 
HETATM 10629 O  O   . HOH YA 5 .   ? 69.088 55.103 141.954 1.00 30.42 ? 1715 HOH H O   1 
HETATM 10630 O  O   . HOH YA 5 .   ? 60.704 65.041 142.359 1.00 22.97 ? 1716 HOH H O   1 
HETATM 10631 O  O   . HOH YA 5 .   ? 63.848 63.346 145.358 1.00 30.27 ? 1717 HOH H O   1 
HETATM 10632 O  O   . HOH YA 5 .   ? 62.862 52.650 152.094 1.00 25.96 ? 1718 HOH H O   1 
HETATM 10633 O  O   . HOH YA 5 .   ? 71.062 63.568 147.463 1.00 21.95 ? 1719 HOH H O   1 
HETATM 10634 O  O   . HOH YA 5 .   ? 57.017 39.886 160.202 1.00 33.68 ? 1720 HOH H O   1 
HETATM 10635 O  O   . HOH YA 5 .   ? 53.078 57.925 151.247 1.00 27.56 ? 1721 HOH H O   1 
HETATM 10636 O  O   . HOH YA 5 .   ? 51.087 46.702 150.272 1.00 27.69 ? 1722 HOH H O   1 
HETATM 10637 O  O   . HOH YA 5 .   ? 57.978 58.121 152.058 1.00 39.83 ? 1723 HOH H O   1 
HETATM 10638 O  O   . HOH YA 5 .   ? 59.053 52.368 131.678 1.00 33.95 ? 1724 HOH H O   1 
HETATM 10639 O  O   . HOH YA 5 .   ? 79.117 59.456 135.300 1.00 23.26 ? 1725 HOH H O   1 
HETATM 10640 O  O   . HOH YA 5 .   ? 98.990 50.661 135.343 1.00 26.93 ? 1726 HOH H O   1 
HETATM 10641 O  O   . HOH YA 5 .   ? 88.917 55.019 143.177 1.00 46.14 ? 1727 HOH H O   1 
HETATM 10642 O  O   . HOH YA 5 .   ? 86.407 47.716 139.534 1.00 70.46 ? 1728 HOH H O   1 
HETATM 10643 O  O   . HOH YA 5 .   ? 81.972 73.826 127.833 1.00 50.36 ? 1729 HOH H O   1 
HETATM 10644 O  O   . HOH YA 5 .   ? 50.129 61.424 143.603 1.00 21.54 ? 1730 HOH H O   1 
HETATM 10645 O  O   . HOH YA 5 .   ? 47.876 60.852 141.860 1.00 27.64 ? 1731 HOH H O   1 
HETATM 10646 O  O   . HOH YA 5 .   ? 45.417 58.774 141.929 1.00 26.88 ? 1732 HOH H O   1 
HETATM 10647 O  O   . HOH YA 5 .   ? 46.103 56.269 143.871 1.00 41.34 ? 1733 HOH H O   1 
HETATM 10648 O  O   . HOH YA 5 .   ? 51.817 55.960 152.530 1.00 29.39 ? 1734 HOH H O   1 
HETATM 10649 O  O   . HOH YA 5 .   ? 49.533 57.851 149.463 1.00 37.86 ? 1735 HOH H O   1 
HETATM 10650 O  O   . HOH YA 5 .   ? 55.102 59.311 151.501 1.00 27.64 ? 1736 HOH H O   1 
HETATM 10651 O  O   . HOH YA 5 .   ? 60.265 54.961 155.036 1.00 29.00 ? 1737 HOH H O   1 
HETATM 10652 O  O   . HOH YA 5 .   ? 75.586 53.232 135.954 1.00 21.46 ? 1738 HOH H O   1 
HETATM 10653 O  O   . HOH YA 5 .   ? 64.346 62.382 147.708 1.00 33.26 ? 1739 HOH H O   1 
HETATM 10654 O  O   . HOH YA 5 .   ? 51.906 41.116 147.053 1.00 41.35 ? 1740 HOH H O   1 
HETATM 10655 O  O   . HOH YA 5 .   ? 84.457 63.670 119.921 1.00 35.72 ? 1741 HOH H O   1 
HETATM 10656 O  O   . HOH YA 5 .   ? 44.560 50.893 141.495 1.00 49.76 ? 1742 HOH H O   1 
HETATM 10657 O  O   . HOH YA 5 .   ? 80.839 72.796 135.495 1.00 25.70 ? 1743 HOH H O   1 
HETATM 10658 O  O   . HOH YA 5 .   ? 82.827 72.720 131.088 1.00 34.03 ? 1744 HOH H O   1 
HETATM 10659 O  O   . HOH YA 5 .   ? 79.621 50.051 146.166 1.00 57.65 ? 1745 HOH H O   1 
HETATM 10660 O  O   . HOH YA 5 .   ? 75.376 44.106 148.303 1.00 56.25 ? 1746 HOH H O   1 
HETATM 10661 O  O   . HOH YA 5 .   ? 49.498 55.967 151.531 1.00 40.32 ? 1747 HOH H O   1 
HETATM 10662 O  O   . HOH YA 5 .   ? 51.914 57.691 154.551 1.00 42.40 ? 1748 HOH H O   1 
HETATM 10663 O  O   . HOH YA 5 .   ? 74.370 55.199 137.112 1.00 40.27 ? 1749 HOH H O   1 
HETATM 10664 O  O   . HOH YA 5 .   ? 76.444 60.327 123.225 1.00 40.75 ? 1750 HOH H O   1 
HETATM 10665 O  O   . HOH YA 5 .   ? 74.550 58.535 116.939 1.00 48.42 ? 1751 HOH H O   1 
HETATM 10666 O  O   . HOH YA 5 .   ? 86.500 65.855 132.019 1.00 39.20 ? 1752 HOH H O   1 
HETATM 10667 O  O   . HOH YA 5 .   ? 90.898 68.400 136.881 1.00 26.02 ? 1753 HOH H O   1 
HETATM 10668 O  O   . HOH YA 5 .   ? 51.561 59.669 150.343 1.00 37.45 ? 1754 HOH H O   1 
HETATM 10669 O  O   . HOH YA 5 .   ? 52.325 69.345 143.978 1.00 51.44 ? 1755 HOH H O   1 
HETATM 10670 O  O   . HOH YA 5 .   ? 81.691 70.252 141.689 1.00 34.51 ? 1756 HOH H O   1 
HETATM 10671 O  O   . HOH YA 5 .   ? 83.599 69.733 143.442 1.00 20.03 ? 1757 HOH H O   1 
HETATM 10672 O  O   . HOH YA 5 .   ? 81.250 61.983 146.250 1.00 48.92 ? 1758 HOH H O   1 
HETATM 10673 O  O   . HOH YA 5 .   ? 82.221 63.252 149.368 1.00 26.82 ? 1759 HOH H O   1 
HETATM 10674 O  O   . HOH YA 5 .   ? 78.029 48.895 148.107 1.00 50.50 ? 1760 HOH H O   1 
HETATM 10675 O  O   . HOH YA 5 .   ? 49.994 44.386 150.067 1.00 48.47 ? 1761 HOH H O   1 
HETATM 10676 O  O   . HOH YA 5 .   ? 52.387 36.490 154.756 1.00 25.97 ? 1762 HOH H O   1 
HETATM 10677 O  O   . HOH YA 5 .   ? 61.208 45.341 158.535 1.00 35.49 ? 1763 HOH H O   1 
HETATM 10678 O  O   . HOH YA 5 .   ? 50.140 35.145 155.991 1.00 39.08 ? 1764 HOH H O   1 
HETATM 10679 O  O   . HOH YA 5 .   ? 61.027 34.549 146.504 1.00 41.02 ? 1765 HOH H O   1 
HETATM 10680 O  O   . HOH YA 5 .   ? 62.983 34.928 144.083 1.00 27.36 ? 1766 HOH H O   1 
HETATM 10681 O  O   . HOH YA 5 .   ? 63.614 35.216 141.627 1.00 46.11 ? 1767 HOH H O   1 
HETATM 10682 O  O   . HOH YA 5 .   ? 69.827 37.140 139.132 1.00 53.27 ? 1768 HOH H O   1 
HETATM 10683 O  O   . HOH YA 5 .   ? 59.149 43.541 138.760 1.00 53.57 ? 1769 HOH H O   1 
HETATM 10684 O  O   . HOH YA 5 .   ? 83.493 46.968 140.659 1.00 33.54 ? 1770 HOH H O   1 
HETATM 10685 O  O   . HOH YA 5 .   ? 82.922 47.633 132.836 1.00 42.83 ? 1771 HOH H O   1 
HETATM 10686 O  O   . HOH YA 5 .   ? 96.089 60.355 142.328 1.00 35.70 ? 1772 HOH H O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   LYS 2   2   2   LYS LYS A . n 
A 1 3   GLY 3   3   3   GLY GLY A . n 
A 1 4   ASP 4   4   4   ASP ASP A . n 
A 1 5   LYS 5   5   5   LYS LYS A . n 
A 1 6   ILE 6   6   6   ILE ILE A . n 
A 1 7   VAL 7   7   7   VAL VAL A . n 
A 1 8   ILE 8   8   8   ILE ILE A . n 
A 1 9   GLN 9   9   9   GLN GLN A . n 
A 1 10  HIS 10  10  10  HIS HIS A . n 
A 1 11  LEU 11  11  11  LEU LEU A . n 
A 1 12  ASN 12  12  12  ASN ASN A . n 
A 1 13  LYS 13  13  13  LYS LYS A . n 
A 1 14  ILE 14  14  14  ILE ILE A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  GLY 16  16  16  GLY GLY A . n 
A 1 17  ASN 17  17  17  ASN ASN A . n 
A 1 18  GLU 18  18  18  GLU GLU A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  ILE 20  20  20  ILE ILE A . n 
A 1 21  ALA 21  21  21  ALA ALA A . n 
A 1 22  ILE 22  22  22  ILE ILE A . n 
A 1 23  ASN 23  23  23  ASN ASN A . n 
A 1 24  GLN 24  24  24  GLN GLN A . n 
A 1 25  TYR 25  25  25  TYR TYR A . n 
A 1 26  PHE 26  26  26  PHE PHE A . n 
A 1 27  LEU 27  27  27  LEU LEU A . n 
A 1 28  HIS 28  28  28  HIS HIS A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  ARG 30  30  30  ARG ARG A . n 
A 1 31  MET 31  31  31  MET MET A . n 
A 1 32  TYR 32  32  32  TYR TYR A . n 
A 1 33  GLU 33  33  33  GLU GLU A . n 
A 1 34  ASP 34  34  34  ASP ASP A . n 
A 1 35  TRP 35  35  35  TRP TRP A . n 
A 1 36  GLY 36  36  36  GLY GLY A . n 
A 1 37  LEU 37  37  37  LEU LEU A . n 
A 1 38  GLU 38  38  38  GLU GLU A . n 
A 1 39  LYS 39  39  39  LYS LYS A . n 
A 1 40  LEU 40  40  40  LEU LEU A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  LYS 42  42  42  LYS LYS A . n 
A 1 43  HIS 43  43  43  HIS HIS A . n 
A 1 44  GLU 44  44  44  GLU GLU A . n 
A 1 45  TYR 45  45  45  TYR TYR A . n 
A 1 46  HIS 46  46  46  HIS HIS A . n 
A 1 47  GLU 47  47  47  GLU GLU A . n 
A 1 48  SER 48  48  48  SER SER A . n 
A 1 49  ILE 49  49  49  ILE ILE A . n 
A 1 50  ASP 50  50  50  ASP ASP A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  MET 52  52  52  MET MET A . n 
A 1 53  LYS 53  53  53  LYS LYS A . n 
A 1 54  HIS 54  54  54  HIS HIS A . n 
A 1 55  ALA 55  55  55  ALA ALA A . n 
A 1 56  ASP 56  56  56  ASP ASP A . n 
A 1 57  LYS 57  57  57  LYS LYS A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  ILE 59  59  59  ILE ILE A . n 
A 1 60  LYS 60  60  60  LYS LYS A . n 
A 1 61  ARG 61  61  61  ARG ARG A . n 
A 1 62  ILE 62  62  62  ILE ILE A . n 
A 1 63  LEU 63  63  63  LEU LEU A . n 
A 1 64  PHE 64  64  64  PHE PHE A . n 
A 1 65  LEU 65  65  65  LEU LEU A . n 
A 1 66  GLU 66  66  66  GLU GLU A . n 
A 1 67  GLY 67  67  67  GLY GLY A . n 
A 1 68  LEU 68  68  68  LEU LEU A . n 
A 1 69  PRO 69  69  69  PRO PRO A . n 
A 1 70  ASN 70  70  70  ASN ASN A . n 
A 1 71  LEU 71  71  71  LEU LEU A . n 
A 1 72  GLN 72  72  72  GLN GLN A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  GLY 75  75  75  GLY GLY A . n 
A 1 76  LYS 76  76  76  LYS LYS A . n 
A 1 77  LEU 77  77  77  LEU LEU A . n 
A 1 78  LEU 78  78  78  LEU LEU A . n 
A 1 79  ILE 79  79  79  ILE ILE A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  HIS 82  82  82  HIS HIS A . n 
A 1 83  THR 83  83  83  THR THR A . n 
A 1 84  LYS 84  84  84  LYS LYS A . n 
A 1 85  GLU 85  85  85  GLU GLU A . n 
A 1 86  MET 86  86  86  MET MET A . n 
A 1 87  LEU 87  87  87  LEU LEU A . n 
A 1 88  GLU 88  88  88  GLU GLU A . n 
A 1 89  CYS 89  89  89  CYS CYS A . n 
A 1 90  ASP 90  90  90  ASP ASP A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  LYS 92  92  92  LYS LYS A . n 
A 1 93  LEU 93  93  93  LEU LEU A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  GLN 95  95  95  GLN GLN A . n 
A 1 96  ALA 96  96  96  ALA ALA A . n 
A 1 97  GLY 97  97  97  GLY GLY A . n 
A 1 98  LEU 98  98  98  LEU LEU A . n 
A 1 99  PRO 99  99  99  PRO PRO A . n 
A 1 100 ASP 100 100 100 ASP ASP A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 LYS 102 102 102 LYS LYS A . n 
A 1 103 ALA 103 103 103 ALA ALA A . n 
A 1 104 ALA 104 104 104 ALA ALA A . n 
A 1 105 ILE 105 105 105 ILE ILE A . n 
A 1 106 ALA 106 106 106 ALA ALA A . n 
A 1 107 TYR 107 107 107 TYR TYR A . n 
A 1 108 CYS 108 108 108 CYS CYS A . n 
A 1 109 GLU 109 109 109 GLU GLU A . n 
A 1 110 SER 110 110 110 SER SER A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 GLY 112 112 112 GLY GLY A . n 
A 1 113 ASP 113 113 113 ASP ASP A . n 
A 1 114 TYR 114 114 114 TYR TYR A . n 
A 1 115 ALA 115 115 115 ALA ALA A . n 
A 1 116 SER 116 116 116 SER SER A . n 
A 1 117 ARG 117 117 117 ARG ARG A . n 
A 1 118 GLU 118 118 118 GLU GLU A . n 
A 1 119 LEU 119 119 119 LEU LEU A . n 
A 1 120 LEU 120 120 120 LEU LEU A . n 
A 1 121 GLU 121 121 121 GLU GLU A . n 
A 1 122 ASP 122 122 122 ASP ASP A . n 
A 1 123 ILE 123 123 123 ILE ILE A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 GLU 125 125 125 GLU GLU A . n 
A 1 126 SER 126 126 126 SER SER A . n 
A 1 127 GLU 127 127 127 GLU GLU A . n 
A 1 128 GLU 128 128 128 GLU GLU A . n 
A 1 129 ASP 129 129 129 ASP ASP A . n 
A 1 130 HIS 130 130 130 HIS HIS A . n 
A 1 131 ILE 131 131 131 ILE ILE A . n 
A 1 132 ASP 132 132 132 ASP ASP A . n 
A 1 133 TRP 133 133 133 TRP TRP A . n 
A 1 134 LEU 134 134 134 LEU LEU A . n 
A 1 135 GLU 135 135 135 GLU GLU A . n 
A 1 136 THR 136 136 136 THR THR A . n 
A 1 137 GLN 137 137 137 GLN GLN A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 ASP 139 139 139 ASP ASP A . n 
A 1 140 LEU 140 140 140 LEU LEU A . n 
A 1 141 ILE 141 141 141 ILE ILE A . n 
A 1 142 ASP 142 142 142 ASP ASP A . n 
A 1 143 LYS 143 143 143 LYS LYS A . n 
A 1 144 ILE 144 144 144 ILE ILE A . n 
A 1 145 GLY 145 145 145 GLY GLY A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 GLU 147 147 147 GLU GLU A . n 
A 1 148 ASN 148 148 148 ASN ASN A . n 
A 1 149 TYR 149 149 149 TYR TYR A . n 
A 1 150 LEU 150 150 150 LEU LEU A . n 
A 1 151 GLN 151 151 151 GLN GLN A . n 
A 1 152 SER 152 152 152 SER SER A . n 
A 1 153 GLN 153 153 153 GLN GLN A . n 
A 1 154 MET 154 154 154 MET MET A . n 
A 1 155 ASP 155 155 155 ASP ASP A . n 
B 1 1   MET 1   1   1   MET MET B . n 
B 1 2   LYS 2   2   2   LYS LYS B . n 
B 1 3   GLY 3   3   3   GLY GLY B . n 
B 1 4   ASP 4   4   4   ASP ASP B . n 
B 1 5   LYS 5   5   5   LYS LYS B . n 
B 1 6   ILE 6   6   6   ILE ILE B . n 
B 1 7   VAL 7   7   7   VAL VAL B . n 
B 1 8   ILE 8   8   8   ILE ILE B . n 
B 1 9   GLN 9   9   9   GLN GLN B . n 
B 1 10  HIS 10  10  10  HIS HIS B . n 
B 1 11  LEU 11  11  11  LEU LEU B . n 
B 1 12  ASN 12  12  12  ASN ASN B . n 
B 1 13  LYS 13  13  13  LYS LYS B . n 
B 1 14  ILE 14  14  14  ILE ILE B . n 
B 1 15  LEU 15  15  15  LEU LEU B . n 
B 1 16  GLY 16  16  16  GLY GLY B . n 
B 1 17  ASN 17  17  17  ASN ASN B . n 
B 1 18  GLU 18  18  18  GLU GLU B . n 
B 1 19  LEU 19  19  19  LEU LEU B . n 
B 1 20  ILE 20  20  20  ILE ILE B . n 
B 1 21  ALA 21  21  21  ALA ALA B . n 
B 1 22  ILE 22  22  22  ILE ILE B . n 
B 1 23  ASN 23  23  23  ASN ASN B . n 
B 1 24  GLN 24  24  24  GLN GLN B . n 
B 1 25  TYR 25  25  25  TYR TYR B . n 
B 1 26  PHE 26  26  26  PHE PHE B . n 
B 1 27  LEU 27  27  27  LEU LEU B . n 
B 1 28  HIS 28  28  28  HIS HIS B . n 
B 1 29  ALA 29  29  29  ALA ALA B . n 
B 1 30  ARG 30  30  30  ARG ARG B . n 
B 1 31  MET 31  31  31  MET MET B . n 
B 1 32  TYR 32  32  32  TYR TYR B . n 
B 1 33  GLU 33  33  33  GLU GLU B . n 
B 1 34  ASP 34  34  34  ASP ASP B . n 
B 1 35  TRP 35  35  35  TRP TRP B . n 
B 1 36  GLY 36  36  36  GLY GLY B . n 
B 1 37  LEU 37  37  37  LEU LEU B . n 
B 1 38  GLU 38  38  38  GLU GLU B . n 
B 1 39  LYS 39  39  39  LYS LYS B . n 
B 1 40  LEU 40  40  40  LEU LEU B . n 
B 1 41  GLY 41  41  41  GLY GLY B . n 
B 1 42  LYS 42  42  42  LYS LYS B . n 
B 1 43  HIS 43  43  43  HIS HIS B . n 
B 1 44  GLU 44  44  44  GLU GLU B . n 
B 1 45  TYR 45  45  45  TYR TYR B . n 
B 1 46  HIS 46  46  46  HIS HIS B . n 
B 1 47  GLU 47  47  47  GLU GLU B . n 
B 1 48  SER 48  48  48  SER SER B . n 
B 1 49  ILE 49  49  49  ILE ILE B . n 
B 1 50  ASP 50  50  50  ASP ASP B . n 
B 1 51  GLU 51  51  51  GLU GLU B . n 
B 1 52  MET 52  52  52  MET MET B . n 
B 1 53  LYS 53  53  53  LYS LYS B . n 
B 1 54  HIS 54  54  54  HIS HIS B . n 
B 1 55  ALA 55  55  55  ALA ALA B . n 
B 1 56  ASP 56  56  56  ASP ASP B . n 
B 1 57  LYS 57  57  57  LYS LYS B . n 
B 1 58  LEU 58  58  58  LEU LEU B . n 
B 1 59  ILE 59  59  59  ILE ILE B . n 
B 1 60  LYS 60  60  60  LYS LYS B . n 
B 1 61  ARG 61  61  61  ARG ARG B . n 
B 1 62  ILE 62  62  62  ILE ILE B . n 
B 1 63  LEU 63  63  63  LEU LEU B . n 
B 1 64  PHE 64  64  64  PHE PHE B . n 
B 1 65  LEU 65  65  65  LEU LEU B . n 
B 1 66  GLU 66  66  66  GLU GLU B . n 
B 1 67  GLY 67  67  67  GLY GLY B . n 
B 1 68  LEU 68  68  68  LEU LEU B . n 
B 1 69  PRO 69  69  69  PRO PRO B . n 
B 1 70  ASN 70  70  70  ASN ASN B . n 
B 1 71  LEU 71  71  71  LEU LEU B . n 
B 1 72  GLN 72  72  72  GLN GLN B . n 
B 1 73  GLU 73  73  73  GLU GLU B . n 
B 1 74  LEU 74  74  74  LEU LEU B . n 
B 1 75  GLY 75  75  75  GLY GLY B . n 
B 1 76  LYS 76  76  76  LYS LYS B . n 
B 1 77  LEU 77  77  77  LEU LEU B . n 
B 1 78  LEU 78  78  78  LEU LEU B . n 
B 1 79  ILE 79  79  79  ILE ILE B . n 
B 1 80  GLY 80  80  80  GLY GLY B . n 
B 1 81  GLU 81  81  81  GLU GLU B . n 
B 1 82  HIS 82  82  82  HIS HIS B . n 
B 1 83  THR 83  83  83  THR THR B . n 
B 1 84  LYS 84  84  84  LYS LYS B . n 
B 1 85  GLU 85  85  85  GLU GLU B . n 
B 1 86  MET 86  86  86  MET MET B . n 
B 1 87  LEU 87  87  87  LEU LEU B . n 
B 1 88  GLU 88  88  88  GLU GLU B . n 
B 1 89  CYS 89  89  89  CYS CYS B . n 
B 1 90  ASP 90  90  90  ASP ASP B . n 
B 1 91  LEU 91  91  91  LEU LEU B . n 
B 1 92  LYS 92  92  92  LYS LYS B . n 
B 1 93  LEU 93  93  93  LEU LEU B . n 
B 1 94  GLU 94  94  94  GLU GLU B . n 
B 1 95  GLN 95  95  95  GLN GLN B . n 
B 1 96  ALA 96  96  96  ALA ALA B . n 
B 1 97  GLY 97  97  97  GLY GLY B . n 
B 1 98  LEU 98  98  98  LEU LEU B . n 
B 1 99  PRO 99  99  99  PRO PRO B . n 
B 1 100 ASP 100 100 100 ASP ASP B . n 
B 1 101 LEU 101 101 101 LEU LEU B . n 
B 1 102 LYS 102 102 102 LYS LYS B . n 
B 1 103 ALA 103 103 103 ALA ALA B . n 
B 1 104 ALA 104 104 104 ALA ALA B . n 
B 1 105 ILE 105 105 105 ILE ILE B . n 
B 1 106 ALA 106 106 106 ALA ALA B . n 
B 1 107 TYR 107 107 107 TYR TYR B . n 
B 1 108 CYS 108 108 108 CYS CYS B . n 
B 1 109 GLU 109 109 109 GLU GLU B . n 
B 1 110 SER 110 110 110 SER SER B . n 
B 1 111 VAL 111 111 111 VAL VAL B . n 
B 1 112 GLY 112 112 112 GLY GLY B . n 
B 1 113 ASP 113 113 113 ASP ASP B . n 
B 1 114 TYR 114 114 114 TYR TYR B . n 
B 1 115 ALA 115 115 115 ALA ALA B . n 
B 1 116 SER 116 116 116 SER SER B . n 
B 1 117 ARG 117 117 117 ARG ARG B . n 
B 1 118 GLU 118 118 118 GLU GLU B . n 
B 1 119 LEU 119 119 119 LEU LEU B . n 
B 1 120 LEU 120 120 120 LEU LEU B . n 
B 1 121 GLU 121 121 121 GLU GLU B . n 
B 1 122 ASP 122 122 122 ASP ASP B . n 
B 1 123 ILE 123 123 123 ILE ILE B . n 
B 1 124 LEU 124 124 124 LEU LEU B . n 
B 1 125 GLU 125 125 125 GLU GLU B . n 
B 1 126 SER 126 126 126 SER SER B . n 
B 1 127 GLU 127 127 127 GLU GLU B . n 
B 1 128 GLU 128 128 128 GLU GLU B . n 
B 1 129 ASP 129 129 129 ASP ASP B . n 
B 1 130 HIS 130 130 130 HIS HIS B . n 
B 1 131 ILE 131 131 131 ILE ILE B . n 
B 1 132 ASP 132 132 132 ASP ASP B . n 
B 1 133 TRP 133 133 133 TRP TRP B . n 
B 1 134 LEU 134 134 134 LEU LEU B . n 
B 1 135 GLU 135 135 135 GLU GLU B . n 
B 1 136 THR 136 136 136 THR THR B . n 
B 1 137 GLN 137 137 137 GLN GLN B . n 
B 1 138 LEU 138 138 138 LEU LEU B . n 
B 1 139 ASP 139 139 139 ASP ASP B . n 
B 1 140 LEU 140 140 140 LEU LEU B . n 
B 1 141 ILE 141 141 141 ILE ILE B . n 
B 1 142 ASP 142 142 142 ASP ASP B . n 
B 1 143 LYS 143 143 143 LYS LYS B . n 
B 1 144 ILE 144 144 144 ILE ILE B . n 
B 1 145 GLY 145 145 145 GLY GLY B . n 
B 1 146 LEU 146 146 146 LEU LEU B . n 
B 1 147 GLU 147 147 147 GLU GLU B . n 
B 1 148 ASN 148 148 148 ASN ASN B . n 
B 1 149 TYR 149 149 149 TYR TYR B . n 
B 1 150 LEU 150 150 150 LEU LEU B . n 
B 1 151 GLN 151 151 151 GLN GLN B . n 
B 1 152 SER 152 152 152 SER SER B . n 
B 1 153 GLN 153 153 153 GLN GLN B . n 
B 1 154 MET 154 154 154 MET MET B . n 
B 1 155 ASP 155 155 155 ASP ASP B . n 
C 1 1   MET 1   1   1   MET MET C . n 
C 1 2   LYS 2   2   2   LYS LYS C . n 
C 1 3   GLY 3   3   3   GLY GLY C . n 
C 1 4   ASP 4   4   4   ASP ASP C . n 
C 1 5   LYS 5   5   5   LYS LYS C . n 
C 1 6   ILE 6   6   6   ILE ILE C . n 
C 1 7   VAL 7   7   7   VAL VAL C . n 
C 1 8   ILE 8   8   8   ILE ILE C . n 
C 1 9   GLN 9   9   9   GLN GLN C . n 
C 1 10  HIS 10  10  10  HIS HIS C . n 
C 1 11  LEU 11  11  11  LEU LEU C . n 
C 1 12  ASN 12  12  12  ASN ASN C . n 
C 1 13  LYS 13  13  13  LYS LYS C . n 
C 1 14  ILE 14  14  14  ILE ILE C . n 
C 1 15  LEU 15  15  15  LEU LEU C . n 
C 1 16  GLY 16  16  16  GLY GLY C . n 
C 1 17  ASN 17  17  17  ASN ASN C . n 
C 1 18  GLU 18  18  18  GLU GLU C . n 
C 1 19  LEU 19  19  19  LEU LEU C . n 
C 1 20  ILE 20  20  20  ILE ILE C . n 
C 1 21  ALA 21  21  21  ALA ALA C . n 
C 1 22  ILE 22  22  22  ILE ILE C . n 
C 1 23  ASN 23  23  23  ASN ASN C . n 
C 1 24  GLN 24  24  24  GLN GLN C . n 
C 1 25  TYR 25  25  25  TYR TYR C . n 
C 1 26  PHE 26  26  26  PHE PHE C . n 
C 1 27  LEU 27  27  27  LEU LEU C . n 
C 1 28  HIS 28  28  28  HIS HIS C . n 
C 1 29  ALA 29  29  29  ALA ALA C . n 
C 1 30  ARG 30  30  30  ARG ARG C . n 
C 1 31  MET 31  31  31  MET MET C . n 
C 1 32  TYR 32  32  32  TYR TYR C . n 
C 1 33  GLU 33  33  33  GLU GLU C . n 
C 1 34  ASP 34  34  34  ASP ASP C . n 
C 1 35  TRP 35  35  35  TRP TRP C . n 
C 1 36  GLY 36  36  36  GLY GLY C . n 
C 1 37  LEU 37  37  37  LEU LEU C . n 
C 1 38  GLU 38  38  38  GLU GLU C . n 
C 1 39  LYS 39  39  39  LYS LYS C . n 
C 1 40  LEU 40  40  40  LEU LEU C . n 
C 1 41  GLY 41  41  41  GLY GLY C . n 
C 1 42  LYS 42  42  42  LYS LYS C . n 
C 1 43  HIS 43  43  43  HIS HIS C . n 
C 1 44  GLU 44  44  44  GLU GLU C . n 
C 1 45  TYR 45  45  45  TYR TYR C . n 
C 1 46  HIS 46  46  46  HIS HIS C . n 
C 1 47  GLU 47  47  47  GLU GLU C . n 
C 1 48  SER 48  48  48  SER SER C . n 
C 1 49  ILE 49  49  49  ILE ILE C . n 
C 1 50  ASP 50  50  50  ASP ASP C . n 
C 1 51  GLU 51  51  51  GLU GLU C . n 
C 1 52  MET 52  52  52  MET MET C . n 
C 1 53  LYS 53  53  53  LYS LYS C . n 
C 1 54  HIS 54  54  54  HIS HIS C . n 
C 1 55  ALA 55  55  55  ALA ALA C . n 
C 1 56  ASP 56  56  56  ASP ASP C . n 
C 1 57  LYS 57  57  57  LYS LYS C . n 
C 1 58  LEU 58  58  58  LEU LEU C . n 
C 1 59  ILE 59  59  59  ILE ILE C . n 
C 1 60  LYS 60  60  60  LYS LYS C . n 
C 1 61  ARG 61  61  61  ARG ARG C . n 
C 1 62  ILE 62  62  62  ILE ILE C . n 
C 1 63  LEU 63  63  63  LEU LEU C . n 
C 1 64  PHE 64  64  64  PHE PHE C . n 
C 1 65  LEU 65  65  65  LEU LEU C . n 
C 1 66  GLU 66  66  66  GLU GLU C . n 
C 1 67  GLY 67  67  67  GLY GLY C . n 
C 1 68  LEU 68  68  68  LEU LEU C . n 
C 1 69  PRO 69  69  69  PRO PRO C . n 
C 1 70  ASN 70  70  70  ASN ASN C . n 
C 1 71  LEU 71  71  71  LEU LEU C . n 
C 1 72  GLN 72  72  72  GLN GLN C . n 
C 1 73  GLU 73  73  73  GLU GLU C . n 
C 1 74  LEU 74  74  74  LEU LEU C . n 
C 1 75  GLY 75  75  75  GLY GLY C . n 
C 1 76  LYS 76  76  76  LYS LYS C . n 
C 1 77  LEU 77  77  77  LEU LEU C . n 
C 1 78  LEU 78  78  78  LEU LEU C . n 
C 1 79  ILE 79  79  79  ILE ILE C . n 
C 1 80  GLY 80  80  80  GLY GLY C . n 
C 1 81  GLU 81  81  81  GLU GLU C . n 
C 1 82  HIS 82  82  82  HIS HIS C . n 
C 1 83  THR 83  83  83  THR THR C . n 
C 1 84  LYS 84  84  84  LYS LYS C . n 
C 1 85  GLU 85  85  85  GLU GLU C . n 
C 1 86  MET 86  86  86  MET MET C . n 
C 1 87  LEU 87  87  87  LEU LEU C . n 
C 1 88  GLU 88  88  88  GLU GLU C . n 
C 1 89  CYS 89  89  89  CYS CYS C . n 
C 1 90  ASP 90  90  90  ASP ASP C . n 
C 1 91  LEU 91  91  91  LEU LEU C . n 
C 1 92  LYS 92  92  92  LYS LYS C . n 
C 1 93  LEU 93  93  93  LEU LEU C . n 
C 1 94  GLU 94  94  94  GLU GLU C . n 
C 1 95  GLN 95  95  95  GLN GLN C . n 
C 1 96  ALA 96  96  96  ALA ALA C . n 
C 1 97  GLY 97  97  97  GLY GLY C . n 
C 1 98  LEU 98  98  98  LEU LEU C . n 
C 1 99  PRO 99  99  99  PRO PRO C . n 
C 1 100 ASP 100 100 100 ASP ASP C . n 
C 1 101 LEU 101 101 101 LEU LEU C . n 
C 1 102 LYS 102 102 102 LYS LYS C . n 
C 1 103 ALA 103 103 103 ALA ALA C . n 
C 1 104 ALA 104 104 104 ALA ALA C . n 
C 1 105 ILE 105 105 105 ILE ILE C . n 
C 1 106 ALA 106 106 106 ALA ALA C . n 
C 1 107 TYR 107 107 107 TYR TYR C . n 
C 1 108 CYS 108 108 108 CYS CYS C . n 
C 1 109 GLU 109 109 109 GLU GLU C . n 
C 1 110 SER 110 110 110 SER SER C . n 
C 1 111 VAL 111 111 111 VAL VAL C . n 
C 1 112 GLY 112 112 112 GLY GLY C . n 
C 1 113 ASP 113 113 113 ASP ASP C . n 
C 1 114 TYR 114 114 114 TYR TYR C . n 
C 1 115 ALA 115 115 115 ALA ALA C . n 
C 1 116 SER 116 116 116 SER SER C . n 
C 1 117 ARG 117 117 117 ARG ARG C . n 
C 1 118 GLU 118 118 118 GLU GLU C . n 
C 1 119 LEU 119 119 119 LEU LEU C . n 
C 1 120 LEU 120 120 120 LEU LEU C . n 
C 1 121 GLU 121 121 121 GLU GLU C . n 
C 1 122 ASP 122 122 122 ASP ASP C . n 
C 1 123 ILE 123 123 123 ILE ILE C . n 
C 1 124 LEU 124 124 124 LEU LEU C . n 
C 1 125 GLU 125 125 125 GLU GLU C . n 
C 1 126 SER 126 126 126 SER SER C . n 
C 1 127 GLU 127 127 127 GLU GLU C . n 
C 1 128 GLU 128 128 128 GLU GLU C . n 
C 1 129 ASP 129 129 129 ASP ASP C . n 
C 1 130 HIS 130 130 130 HIS HIS C . n 
C 1 131 ILE 131 131 131 ILE ILE C . n 
C 1 132 ASP 132 132 132 ASP ASP C . n 
C 1 133 TRP 133 133 133 TRP TRP C . n 
C 1 134 LEU 134 134 134 LEU LEU C . n 
C 1 135 GLU 135 135 135 GLU GLU C . n 
C 1 136 THR 136 136 136 THR THR C . n 
C 1 137 GLN 137 137 137 GLN GLN C . n 
C 1 138 LEU 138 138 138 LEU LEU C . n 
C 1 139 ASP 139 139 139 ASP ASP C . n 
C 1 140 LEU 140 140 140 LEU LEU C . n 
C 1 141 ILE 141 141 141 ILE ILE C . n 
C 1 142 ASP 142 142 142 ASP ASP C . n 
C 1 143 LYS 143 143 143 LYS LYS C . n 
C 1 144 ILE 144 144 144 ILE ILE C . n 
C 1 145 GLY 145 145 145 GLY GLY C . n 
C 1 146 LEU 146 146 146 LEU LEU C . n 
C 1 147 GLU 147 147 147 GLU GLU C . n 
C 1 148 ASN 148 148 148 ASN ASN C . n 
C 1 149 TYR 149 149 149 TYR TYR C . n 
C 1 150 LEU 150 150 150 LEU LEU C . n 
C 1 151 GLN 151 151 151 GLN GLN C . n 
C 1 152 SER 152 152 152 SER SER C . n 
C 1 153 GLN 153 153 153 GLN GLN C . n 
C 1 154 MET 154 154 154 MET MET C . n 
C 1 155 ASP 155 155 155 ASP ASP C . n 
D 1 1   MET 1   1   1   MET MET D . n 
D 1 2   LYS 2   2   2   LYS LYS D . n 
D 1 3   GLY 3   3   3   GLY GLY D . n 
D 1 4   ASP 4   4   4   ASP ASP D . n 
D 1 5   LYS 5   5   5   LYS LYS D . n 
D 1 6   ILE 6   6   6   ILE ILE D . n 
D 1 7   VAL 7   7   7   VAL VAL D . n 
D 1 8   ILE 8   8   8   ILE ILE D . n 
D 1 9   GLN 9   9   9   GLN GLN D . n 
D 1 10  HIS 10  10  10  HIS HIS D . n 
D 1 11  LEU 11  11  11  LEU LEU D . n 
D 1 12  ASN 12  12  12  ASN ASN D . n 
D 1 13  LYS 13  13  13  LYS LYS D . n 
D 1 14  ILE 14  14  14  ILE ILE D . n 
D 1 15  LEU 15  15  15  LEU LEU D . n 
D 1 16  GLY 16  16  16  GLY GLY D . n 
D 1 17  ASN 17  17  17  ASN ASN D . n 
D 1 18  GLU 18  18  18  GLU GLU D . n 
D 1 19  LEU 19  19  19  LEU LEU D . n 
D 1 20  ILE 20  20  20  ILE ILE D . n 
D 1 21  ALA 21  21  21  ALA ALA D . n 
D 1 22  ILE 22  22  22  ILE ILE D . n 
D 1 23  ASN 23  23  23  ASN ASN D . n 
D 1 24  GLN 24  24  24  GLN GLN D . n 
D 1 25  TYR 25  25  25  TYR TYR D . n 
D 1 26  PHE 26  26  26  PHE PHE D . n 
D 1 27  LEU 27  27  27  LEU LEU D . n 
D 1 28  HIS 28  28  28  HIS HIS D . n 
D 1 29  ALA 29  29  29  ALA ALA D . n 
D 1 30  ARG 30  30  30  ARG ARG D . n 
D 1 31  MET 31  31  31  MET MET D . n 
D 1 32  TYR 32  32  32  TYR TYR D . n 
D 1 33  GLU 33  33  33  GLU GLU D . n 
D 1 34  ASP 34  34  34  ASP ASP D . n 
D 1 35  TRP 35  35  35  TRP TRP D . n 
D 1 36  GLY 36  36  36  GLY GLY D . n 
D 1 37  LEU 37  37  37  LEU LEU D . n 
D 1 38  GLU 38  38  38  GLU GLU D . n 
D 1 39  LYS 39  39  39  LYS LYS D . n 
D 1 40  LEU 40  40  40  LEU LEU D . n 
D 1 41  GLY 41  41  41  GLY GLY D . n 
D 1 42  LYS 42  42  42  LYS LYS D . n 
D 1 43  HIS 43  43  43  HIS HIS D . n 
D 1 44  GLU 44  44  44  GLU GLU D . n 
D 1 45  TYR 45  45  45  TYR TYR D . n 
D 1 46  HIS 46  46  46  HIS HIS D . n 
D 1 47  GLU 47  47  47  GLU GLU D . n 
D 1 48  SER 48  48  48  SER SER D . n 
D 1 49  ILE 49  49  49  ILE ILE D . n 
D 1 50  ASP 50  50  50  ASP ASP D . n 
D 1 51  GLU 51  51  51  GLU GLU D . n 
D 1 52  MET 52  52  52  MET MET D . n 
D 1 53  LYS 53  53  53  LYS LYS D . n 
D 1 54  HIS 54  54  54  HIS HIS D . n 
D 1 55  ALA 55  55  55  ALA ALA D . n 
D 1 56  ASP 56  56  56  ASP ASP D . n 
D 1 57  LYS 57  57  57  LYS LYS D . n 
D 1 58  LEU 58  58  58  LEU LEU D . n 
D 1 59  ILE 59  59  59  ILE ILE D . n 
D 1 60  LYS 60  60  60  LYS LYS D . n 
D 1 61  ARG 61  61  61  ARG ARG D . n 
D 1 62  ILE 62  62  62  ILE ILE D . n 
D 1 63  LEU 63  63  63  LEU LEU D . n 
D 1 64  PHE 64  64  64  PHE PHE D . n 
D 1 65  LEU 65  65  65  LEU LEU D . n 
D 1 66  GLU 66  66  66  GLU GLU D . n 
D 1 67  GLY 67  67  67  GLY GLY D . n 
D 1 68  LEU 68  68  68  LEU LEU D . n 
D 1 69  PRO 69  69  69  PRO PRO D . n 
D 1 70  ASN 70  70  70  ASN ASN D . n 
D 1 71  LEU 71  71  71  LEU LEU D . n 
D 1 72  GLN 72  72  72  GLN GLN D . n 
D 1 73  GLU 73  73  73  GLU GLU D . n 
D 1 74  LEU 74  74  74  LEU LEU D . n 
D 1 75  GLY 75  75  75  GLY GLY D . n 
D 1 76  LYS 76  76  76  LYS LYS D . n 
D 1 77  LEU 77  77  77  LEU LEU D . n 
D 1 78  LEU 78  78  78  LEU LEU D . n 
D 1 79  ILE 79  79  79  ILE ILE D . n 
D 1 80  GLY 80  80  80  GLY GLY D . n 
D 1 81  GLU 81  81  81  GLU GLU D . n 
D 1 82  HIS 82  82  82  HIS HIS D . n 
D 1 83  THR 83  83  83  THR THR D . n 
D 1 84  LYS 84  84  84  LYS LYS D . n 
D 1 85  GLU 85  85  85  GLU GLU D . n 
D 1 86  MET 86  86  86  MET MET D . n 
D 1 87  LEU 87  87  87  LEU LEU D . n 
D 1 88  GLU 88  88  88  GLU GLU D . n 
D 1 89  CYS 89  89  89  CYS CYS D . n 
D 1 90  ASP 90  90  90  ASP ASP D . n 
D 1 91  LEU 91  91  91  LEU LEU D . n 
D 1 92  LYS 92  92  92  LYS LYS D . n 
D 1 93  LEU 93  93  93  LEU LEU D . n 
D 1 94  GLU 94  94  94  GLU GLU D . n 
D 1 95  GLN 95  95  95  GLN GLN D . n 
D 1 96  ALA 96  96  96  ALA ALA D . n 
D 1 97  GLY 97  97  97  GLY GLY D . n 
D 1 98  LEU 98  98  98  LEU LEU D . n 
D 1 99  PRO 99  99  99  PRO PRO D . n 
D 1 100 ASP 100 100 100 ASP ASP D . n 
D 1 101 LEU 101 101 101 LEU LEU D . n 
D 1 102 LYS 102 102 102 LYS LYS D . n 
D 1 103 ALA 103 103 103 ALA ALA D . n 
D 1 104 ALA 104 104 104 ALA ALA D . n 
D 1 105 ILE 105 105 105 ILE ILE D . n 
D 1 106 ALA 106 106 106 ALA ALA D . n 
D 1 107 TYR 107 107 107 TYR TYR D . n 
D 1 108 CYS 108 108 108 CYS CYS D . n 
D 1 109 GLU 109 109 109 GLU GLU D . n 
D 1 110 SER 110 110 110 SER SER D . n 
D 1 111 VAL 111 111 111 VAL VAL D . n 
D 1 112 GLY 112 112 112 GLY GLY D . n 
D 1 113 ASP 113 113 113 ASP ASP D . n 
D 1 114 TYR 114 114 114 TYR TYR D . n 
D 1 115 ALA 115 115 115 ALA ALA D . n 
D 1 116 SER 116 116 116 SER SER D . n 
D 1 117 ARG 117 117 117 ARG ARG D . n 
D 1 118 GLU 118 118 118 GLU GLU D . n 
D 1 119 LEU 119 119 119 LEU LEU D . n 
D 1 120 LEU 120 120 120 LEU LEU D . n 
D 1 121 GLU 121 121 121 GLU GLU D . n 
D 1 122 ASP 122 122 122 ASP ASP D . n 
D 1 123 ILE 123 123 123 ILE ILE D . n 
D 1 124 LEU 124 124 124 LEU LEU D . n 
D 1 125 GLU 125 125 125 GLU GLU D . n 
D 1 126 SER 126 126 126 SER SER D . n 
D 1 127 GLU 127 127 127 GLU GLU D . n 
D 1 128 GLU 128 128 128 GLU GLU D . n 
D 1 129 ASP 129 129 129 ASP ASP D . n 
D 1 130 HIS 130 130 130 HIS HIS D . n 
D 1 131 ILE 131 131 131 ILE ILE D . n 
D 1 132 ASP 132 132 132 ASP ASP D . n 
D 1 133 TRP 133 133 133 TRP TRP D . n 
D 1 134 LEU 134 134 134 LEU LEU D . n 
D 1 135 GLU 135 135 135 GLU GLU D . n 
D 1 136 THR 136 136 136 THR THR D . n 
D 1 137 GLN 137 137 137 GLN GLN D . n 
D 1 138 LEU 138 138 138 LEU LEU D . n 
D 1 139 ASP 139 139 139 ASP ASP D . n 
D 1 140 LEU 140 140 140 LEU LEU D . n 
D 1 141 ILE 141 141 141 ILE ILE D . n 
D 1 142 ASP 142 142 142 ASP ASP D . n 
D 1 143 LYS 143 143 143 LYS LYS D . n 
D 1 144 ILE 144 144 144 ILE ILE D . n 
D 1 145 GLY 145 145 145 GLY GLY D . n 
D 1 146 LEU 146 146 146 LEU LEU D . n 
D 1 147 GLU 147 147 147 GLU GLU D . n 
D 1 148 ASN 148 148 148 ASN ASN D . n 
D 1 149 TYR 149 149 149 TYR TYR D . n 
D 1 150 LEU 150 150 150 LEU LEU D . n 
D 1 151 GLN 151 151 151 GLN GLN D . n 
D 1 152 SER 152 152 152 SER SER D . n 
D 1 153 GLN 153 153 153 GLN GLN D . n 
D 1 154 MET 154 154 154 MET MET D . n 
D 1 155 ASP 155 155 155 ASP ASP D . n 
E 1 1   MET 1   1   1   MET MET E . n 
E 1 2   LYS 2   2   2   LYS LYS E . n 
E 1 3   GLY 3   3   3   GLY GLY E . n 
E 1 4   ASP 4   4   4   ASP ASP E . n 
E 1 5   LYS 5   5   5   LYS LYS E . n 
E 1 6   ILE 6   6   6   ILE ILE E . n 
E 1 7   VAL 7   7   7   VAL VAL E . n 
E 1 8   ILE 8   8   8   ILE ILE E . n 
E 1 9   GLN 9   9   9   GLN GLN E . n 
E 1 10  HIS 10  10  10  HIS HIS E . n 
E 1 11  LEU 11  11  11  LEU LEU E . n 
E 1 12  ASN 12  12  12  ASN ASN E . n 
E 1 13  LYS 13  13  13  LYS LYS E . n 
E 1 14  ILE 14  14  14  ILE ILE E . n 
E 1 15  LEU 15  15  15  LEU LEU E . n 
E 1 16  GLY 16  16  16  GLY GLY E . n 
E 1 17  ASN 17  17  17  ASN ASN E . n 
E 1 18  GLU 18  18  18  GLU GLU E . n 
E 1 19  LEU 19  19  19  LEU LEU E . n 
E 1 20  ILE 20  20  20  ILE ILE E . n 
E 1 21  ALA 21  21  21  ALA ALA E . n 
E 1 22  ILE 22  22  22  ILE ILE E . n 
E 1 23  ASN 23  23  23  ASN ASN E . n 
E 1 24  GLN 24  24  24  GLN GLN E . n 
E 1 25  TYR 25  25  25  TYR TYR E . n 
E 1 26  PHE 26  26  26  PHE PHE E . n 
E 1 27  LEU 27  27  27  LEU LEU E . n 
E 1 28  HIS 28  28  28  HIS HIS E . n 
E 1 29  ALA 29  29  29  ALA ALA E . n 
E 1 30  ARG 30  30  30  ARG ARG E . n 
E 1 31  MET 31  31  31  MET MET E . n 
E 1 32  TYR 32  32  32  TYR TYR E . n 
E 1 33  GLU 33  33  33  GLU GLU E . n 
E 1 34  ASP 34  34  34  ASP ASP E . n 
E 1 35  TRP 35  35  35  TRP TRP E . n 
E 1 36  GLY 36  36  36  GLY GLY E . n 
E 1 37  LEU 37  37  37  LEU LEU E . n 
E 1 38  GLU 38  38  38  GLU GLU E . n 
E 1 39  LYS 39  39  39  LYS LYS E . n 
E 1 40  LEU 40  40  40  LEU LEU E . n 
E 1 41  GLY 41  41  41  GLY GLY E . n 
E 1 42  LYS 42  42  42  LYS LYS E . n 
E 1 43  HIS 43  43  43  HIS HIS E . n 
E 1 44  GLU 44  44  44  GLU GLU E . n 
E 1 45  TYR 45  45  45  TYR TYR E . n 
E 1 46  HIS 46  46  46  HIS HIS E . n 
E 1 47  GLU 47  47  47  GLU GLU E . n 
E 1 48  SER 48  48  48  SER SER E . n 
E 1 49  ILE 49  49  49  ILE ILE E . n 
E 1 50  ASP 50  50  50  ASP ASP E . n 
E 1 51  GLU 51  51  51  GLU GLU E . n 
E 1 52  MET 52  52  52  MET MET E . n 
E 1 53  LYS 53  53  53  LYS LYS E . n 
E 1 54  HIS 54  54  54  HIS HIS E . n 
E 1 55  ALA 55  55  55  ALA ALA E . n 
E 1 56  ASP 56  56  56  ASP ASP E . n 
E 1 57  LYS 57  57  57  LYS LYS E . n 
E 1 58  LEU 58  58  58  LEU LEU E . n 
E 1 59  ILE 59  59  59  ILE ILE E . n 
E 1 60  LYS 60  60  60  LYS LYS E . n 
E 1 61  ARG 61  61  61  ARG ARG E . n 
E 1 62  ILE 62  62  62  ILE ILE E . n 
E 1 63  LEU 63  63  63  LEU LEU E . n 
E 1 64  PHE 64  64  64  PHE PHE E . n 
E 1 65  LEU 65  65  65  LEU LEU E . n 
E 1 66  GLU 66  66  66  GLU GLU E . n 
E 1 67  GLY 67  67  67  GLY GLY E . n 
E 1 68  LEU 68  68  68  LEU LEU E . n 
E 1 69  PRO 69  69  69  PRO PRO E . n 
E 1 70  ASN 70  70  70  ASN ASN E . n 
E 1 71  LEU 71  71  71  LEU LEU E . n 
E 1 72  GLN 72  72  72  GLN GLN E . n 
E 1 73  GLU 73  73  73  GLU GLU E . n 
E 1 74  LEU 74  74  74  LEU LEU E . n 
E 1 75  GLY 75  75  75  GLY GLY E . n 
E 1 76  LYS 76  76  76  LYS LYS E . n 
E 1 77  LEU 77  77  77  LEU LEU E . n 
E 1 78  LEU 78  78  78  LEU LEU E . n 
E 1 79  ILE 79  79  79  ILE ILE E . n 
E 1 80  GLY 80  80  80  GLY GLY E . n 
E 1 81  GLU 81  81  81  GLU GLU E . n 
E 1 82  HIS 82  82  82  HIS HIS E . n 
E 1 83  THR 83  83  83  THR THR E . n 
E 1 84  LYS 84  84  84  LYS LYS E . n 
E 1 85  GLU 85