data_2FOL
# 
_entry.id   2FOL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2FOL         
RCSB  RCSB036123   
WWPDB D_1000036123 
# 
_pdbx_database_status.entry_id                        2FOL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2006-01-13 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wang, J.'                             1  
'Tempel, W.'                           2  
'Shen, Y.'                             3  
'Shen, L.'                             4  
'Arrowsmith, C.'                       5  
'Edwards, A.'                          6  
'Sundstrom, M.'                        7  
'Weigelt, J.'                          8  
'Bochkarev, A.'                        9  
'Park, H.'                             10 
'Structural Genomics Consortium (SGC)' 11 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Crystal structure of human RAB1A in complex with GDP'                 'To be Published'          ?  ? ?  ?    ?      ?  ? 
0353 ? ?        ?                         
1       'Real-Space Protein-Model Completion: an Inverse-Kinematics Approach.' 'Acta Crystallogr.,Sect.D' 61 2 13 2005 ABCRE6 DK 
0907-4449 0766 ? 15608370 10.1107/S0907444904025697 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wang, J.'                             1  
primary 'Tempel, W.'                           2  
primary 'Shen, Y.'                             3  
primary 'Shen, L.'                             4  
primary 'Arrowsmith, C.'                       5  
primary 'Edwards, A.'                          6  
primary 'Sundstrom, M.'                        7  
primary 'Weigelt, J.'                          8  
primary 'Bochkarev, A.'                        9  
primary 'Park, H.'                             10 
primary 'Structural Genomics Consortium (SGC)' 11 
1       'van den Bedem, H.'                    12 
1       'Lotan, I.'                            13 
1       'Latombe, J.-C.'                       14 
1       'Deacon, A.M.'                         15 
# 
_cell.length_a           75.790 
_cell.length_b           75.790 
_cell.length_c           49.080 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.entry_id           2FOL 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              6 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 32 2 1' 
_symmetry.Int_Tables_number                154 
_symmetry.entry_id                         2FOL 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Ras-related protein Rab-1A' 21567.354 1 ? ? ? ? 
2 non-polymer syn 'MAGNESIUM ION'              24.305    1 ? ? ? ? 
3 non-polymer syn "GUANOSINE-5'-DIPHOSPHATE"   443.201   1 ? ? ? ? 
4 non-polymer syn 'UNKNOWN ATOM OR ION'        ?         2 ? ? ? ? 
5 water       nat water                        18.015    5 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'YPT1-related protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGLVPRGSPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWD
TAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSL
GIPFLETSAKNATNVEQSFMTMAAEIKKRMG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGLVPRGSPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWD
TAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSL
GIPFLETSAKNATNVEQSFMTMAAEIKKRMG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  PRO n 
1 21  GLU n 
1 22  TYR n 
1 23  ASP n 
1 24  TYR n 
1 25  LEU n 
1 26  PHE n 
1 27  LYS n 
1 28  LEU n 
1 29  LEU n 
1 30  LEU n 
1 31  ILE n 
1 32  GLY n 
1 33  ASP n 
1 34  SER n 
1 35  GLY n 
1 36  VAL n 
1 37  GLY n 
1 38  LYS n 
1 39  SER n 
1 40  CYS n 
1 41  LEU n 
1 42  LEU n 
1 43  LEU n 
1 44  ARG n 
1 45  PHE n 
1 46  ALA n 
1 47  ASP n 
1 48  ASP n 
1 49  THR n 
1 50  TYR n 
1 51  THR n 
1 52  GLU n 
1 53  SER n 
1 54  TYR n 
1 55  ILE n 
1 56  SER n 
1 57  THR n 
1 58  ILE n 
1 59  GLY n 
1 60  VAL n 
1 61  ASP n 
1 62  PHE n 
1 63  LYS n 
1 64  ILE n 
1 65  ARG n 
1 66  THR n 
1 67  ILE n 
1 68  GLU n 
1 69  LEU n 
1 70  ASP n 
1 71  GLY n 
1 72  LYS n 
1 73  THR n 
1 74  ILE n 
1 75  LYS n 
1 76  LEU n 
1 77  GLN n 
1 78  ILE n 
1 79  TRP n 
1 80  ASP n 
1 81  THR n 
1 82  ALA n 
1 83  GLY n 
1 84  GLN n 
1 85  GLU n 
1 86  ARG n 
1 87  PHE n 
1 88  ARG n 
1 89  THR n 
1 90  ILE n 
1 91  THR n 
1 92  SER n 
1 93  SER n 
1 94  TYR n 
1 95  TYR n 
1 96  ARG n 
1 97  GLY n 
1 98  ALA n 
1 99  HIS n 
1 100 GLY n 
1 101 ILE n 
1 102 ILE n 
1 103 VAL n 
1 104 VAL n 
1 105 TYR n 
1 106 ASP n 
1 107 VAL n 
1 108 THR n 
1 109 ASP n 
1 110 GLN n 
1 111 GLU n 
1 112 SER n 
1 113 PHE n 
1 114 ASN n 
1 115 ASN n 
1 116 VAL n 
1 117 LYS n 
1 118 GLN n 
1 119 TRP n 
1 120 LEU n 
1 121 GLN n 
1 122 GLU n 
1 123 ILE n 
1 124 ASP n 
1 125 ARG n 
1 126 TYR n 
1 127 ALA n 
1 128 SER n 
1 129 GLU n 
1 130 ASN n 
1 131 VAL n 
1 132 ASN n 
1 133 LYS n 
1 134 LEU n 
1 135 LEU n 
1 136 VAL n 
1 137 GLY n 
1 138 ASN n 
1 139 LYS n 
1 140 CYS n 
1 141 ASP n 
1 142 LEU n 
1 143 THR n 
1 144 THR n 
1 145 LYS n 
1 146 LYS n 
1 147 VAL n 
1 148 VAL n 
1 149 ASP n 
1 150 TYR n 
1 151 THR n 
1 152 THR n 
1 153 ALA n 
1 154 LYS n 
1 155 GLU n 
1 156 PHE n 
1 157 ALA n 
1 158 ASP n 
1 159 SER n 
1 160 LEU n 
1 161 GLY n 
1 162 ILE n 
1 163 PRO n 
1 164 PHE n 
1 165 LEU n 
1 166 GLU n 
1 167 THR n 
1 168 SER n 
1 169 ALA n 
1 170 LYS n 
1 171 ASN n 
1 172 ALA n 
1 173 THR n 
1 174 ASN n 
1 175 VAL n 
1 176 GLU n 
1 177 GLN n 
1 178 SER n 
1 179 PHE n 
1 180 MET n 
1 181 THR n 
1 182 MET n 
1 183 ALA n 
1 184 ALA n 
1 185 GLU n 
1 186 ILE n 
1 187 LYS n 
1 188 LYS n 
1 189 ARG n 
1 190 MET n 
1 191 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'RAB1A, RAB1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21-CodonPlus (DE3)-RIL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       p28a-LIC 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RAB1A_HUMAN 
_struct_ref.pdbx_db_accession          P62820 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;PEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAH
GIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSF
MTMAAEIKKRMG
;
_struct_ref.pdbx_align_begin           5 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2FOL 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 20 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 191 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P62820 
_struct_ref_seq.db_align_beg                  5 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  176 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       3 
_struct_ref_seq.pdbx_auth_seq_align_end       174 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2FOL MET A 1  ? UNP P62820 ? ? 'CLONING ARTIFACT' -16 1  
1 2FOL GLY A 2  ? UNP P62820 ? ? 'CLONING ARTIFACT' -15 2  
1 2FOL SER A 3  ? UNP P62820 ? ? 'CLONING ARTIFACT' -14 3  
1 2FOL SER A 4  ? UNP P62820 ? ? 'CLONING ARTIFACT' -13 4  
1 2FOL HIS A 5  ? UNP P62820 ? ? 'EXPRESSION TAG'   -12 5  
1 2FOL HIS A 6  ? UNP P62820 ? ? 'EXPRESSION TAG'   -11 6  
1 2FOL HIS A 7  ? UNP P62820 ? ? 'EXPRESSION TAG'   -10 7  
1 2FOL HIS A 8  ? UNP P62820 ? ? 'EXPRESSION TAG'   -9  8  
1 2FOL HIS A 9  ? UNP P62820 ? ? 'EXPRESSION TAG'   -8  9  
1 2FOL HIS A 10 ? UNP P62820 ? ? 'EXPRESSION TAG'   -7  10 
1 2FOL SER A 11 ? UNP P62820 ? ? 'CLONING ARTIFACT' -6  11 
1 2FOL SER A 12 ? UNP P62820 ? ? 'CLONING ARTIFACT' -5  12 
1 2FOL GLY A 13 ? UNP P62820 ? ? 'CLONING ARTIFACT' -4  13 
1 2FOL LEU A 14 ? UNP P62820 ? ? 'CLONING ARTIFACT' -3  14 
1 2FOL VAL A 15 ? UNP P62820 ? ? 'CLONING ARTIFACT' -2  15 
1 2FOL PRO A 16 ? UNP P62820 ? ? 'CLONING ARTIFACT' -1  16 
1 2FOL ARG A 17 ? UNP P62820 ? ? 'CLONING ARTIFACT' 0   17 
1 2FOL GLY A 18 ? UNP P62820 ? ? 'CLONING ARTIFACT' 1   18 
1 2FOL SER A 19 ? UNP P62820 ? ? 'CLONING ARTIFACT' 2   19 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                    ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                   ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                 ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'            ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                   ? 'C3 H7 N O2 S'      121.158 
GDP 'RNA linking'       n "GUANOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O11 P2' 443.201 
GLN 'L-peptide linking' y GLUTAMINE                  ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'            ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                    ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                  ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                      ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                 ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                    ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                     ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                 ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'            ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE              ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                    ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                     ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                  ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                 ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                   ? 'C9 H11 N O3'       181.189 
UNX non-polymer         . 'UNKNOWN ATOM OR ION'      ? ?                   ?       
VAL 'L-peptide linking' y VALINE                     ? 'C5 H11 N O2'       117.146 
# 
_exptl.crystals_number   1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.entry_id          2FOL 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_percent_sol   46.5 
_exptl_crystal.density_Matthews      2.3 
_exptl_crystal.density_meas          ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.pdbx_details    
'25% PEG3350, 0.2M magnesium chloride, 0.1M Tris, pH 8.5, vapor diffusion, sitting drop, temperature 291K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV++' 
_diffrn_detector.pdbx_collection_date   2006-01-09 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU FR-E' 
_diffrn_source.pdbx_wavelength_list        1.5418 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
# 
_reflns.entry_id                     2FOL 
_reflns.d_resolution_low             30.00 
_reflns.d_resolution_high            2.62 
_reflns.number_obs                   5102 
_reflns.percent_possible_obs         100.000 
_reflns.pdbx_Rmerge_I_obs            0.088 
_reflns.pdbx_chi_squared             1.022 
_reflns.pdbx_redundancy              10.600 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_low 
_reflns_shell.d_res_high 
_reflns_shell.number_measured_obs 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.number_unique_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.percent_possible_all 
_reflns_shell.number_unique_all 
_reflns_shell.number_measured_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.71  2.62 494 100.000 0.826 0.544 10.500 ? ? ? ? ? ? 1  1 
2.82  2.71 509 100.000 0.644 0.510 10.700 ? ? ? ? ? ? 2  1 
2.95  2.82 493 100.000 0.423 0.580 10.800 ? ? ? ? ? ? 3  1 
3.11  2.95 502 100.000 0.288 0.644 10.800 ? ? ? ? ? ? 4  1 
3.30  3.11 509 100.000 0.201 0.766 10.800 ? ? ? ? ? ? 5  1 
3.55  3.30 500 100.000 0.135 1.004 10.800 ? ? ? ? ? ? 6  1 
3.91  3.55 508 100.000 0.097 1.321 10.700 ? ? ? ? ? ? 7  1 
4.48  3.91 518 100.000 0.067 1.487 10.700 ? ? ? ? ? ? 8  1 
5.63  4.48 519 100.000 0.055 1.633 10.600 ? ? ? ? ? ? 9  1 
30.00 5.63 550 99.800  0.034 1.689 10.000 ? ? ? ? ? ? 10 1 
# 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.B_iso_mean                               36.747 
_refine.aniso_B[1][1]                            -0.603 
_refine.aniso_B[2][2]                            -0.603 
_refine.aniso_B[3][3]                            0.905 
_refine.aniso_B[1][2]                            -0.302 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.solvent_model_details                    'MASK BULK SOLVENT' 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.ls_d_res_high                            2.631 
_refine.ls_d_res_low                             30.000 
_refine.ls_number_reflns_R_free                  233 
_refine.ls_number_reflns_obs                     5048 
_refine.ls_R_factor_R_work                       0.199 
_refine.ls_R_factor_R_free                       0.2523 
_refine.ls_R_factor_all                          0.201 
_refine.ls_wR_factor_R_work                      0.167 
_refine.ls_wR_factor_R_free                      0.223 
_refine.ls_percent_reflns_obs                    99.980 
_refine.ls_percent_reflns_R_free                 4.616 
_refine.correlation_coeff_Fo_to_Fc               0.953 
_refine.correlation_coeff_Fo_to_Fc_free          0.923 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.347 
_refine.overall_SU_ML                            0.302 
_refine.overall_SU_B                             32.488 
_refine.entry_id                                 2FOL 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'pdb entries 1YZN, 1UKV' 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1240 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         31 
_refine_hist.number_atoms_solvent             5 
_refine_hist.number_atoms_total               1276 
_refine_hist.d_res_high                       2.631 
_refine_hist.d_res_low                        30.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         1289 0.019  0.022  ? 'X-RAY DIFFRACTION' ? 
r_bond_other_d           852  0.002  0.020  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1745 1.397  1.988  ? 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        2087 0.797  3.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   153  4.754  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   57   38.020 25.088 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   235  16.052 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   5    24.925 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           201  0.075  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     1386 0.004  0.020  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       257  0.001  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            302  0.223  0.300  ? 'X-RAY DIFFRACTION' ? 
r_nbd_other              879  0.209  0.300  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          615  0.191  0.500  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_other            655  0.097  0.500  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    66   0.190  0.500  ? 'X-RAY DIFFRACTION' ? 
r_metal_ion_refined      1    0.137  0.500  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   14   0.167  0.300  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     26   0.277  0.300  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 2    0.227  0.500  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              994  0.459  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_other           317  0.069  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             1237 0.599  2.000  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_other          1019 0.268  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              640  0.990  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_other           766  0.287  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             508  1.662  4.500  ? 'X-RAY DIFFRACTION' ? 
r_scangle_other          1068 0.753  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_low 
_refine_ls_shell.d_res_high 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
20 2.699  2.631  369 100.000 356 0.406 0.405 13 0.396 . . . . 'X-RAY DIFFRACTION' 
20 2.772  2.699  342 100.000 324 0.342 0.337 18 0.251 . . . . 'X-RAY DIFFRACTION' 
20 2.852  2.772  357 100.000 343 0.336 0.334 14 0.282 . . . . 'X-RAY DIFFRACTION' 
20 2.938  2.852  330 100.000 312 0.304 0.303 18 0.278 . . . . 'X-RAY DIFFRACTION' 
20 3.034  2.938  335 100.000 315 0.263 0.265 20 0.301 . . . . 'X-RAY DIFFRACTION' 
20 3.139  3.034  310 100.000 292 0.276 0.284 18 0.407 . . . . 'X-RAY DIFFRACTION' 
20 3.256  3.139  301 100.000 293 0.25  0.249 8  0.225 . . . . 'X-RAY DIFFRACTION' 
20 3.388  3.256  290 100.000 277 0.204 0.204 13 0.213 . . . . 'X-RAY DIFFRACTION' 
20 3.536  3.388  289 100.000 276 0.219 0.221 13 0.256 . . . . 'X-RAY DIFFRACTION' 
20 3.706  3.536  271 100.000 258 0.201 0.207 13 0.322 . . . . 'X-RAY DIFFRACTION' 
20 3.903  3.706  264 100.000 249 0.188 0.191 15 0.245 . . . . 'X-RAY DIFFRACTION' 
20 4.136  3.903  251 100.000 241 0.183 0.183 10 0.185 . . . . 'X-RAY DIFFRACTION' 
20 4.415  4.136  222 100.000 210 0.14  0.142 12 0.173 . . . . 'X-RAY DIFFRACTION' 
20 4.761  4.415  227 100.000 214 0.127 0.131 13 0.183 . . . . 'X-RAY DIFFRACTION' 
20 5.202  4.761  193 100.000 184 0.158 0.165 9  0.31  . . . . 'X-RAY DIFFRACTION' 
20 5.794  5.202  187 100.000 178 0.173 0.178 9  0.275 . . . . 'X-RAY DIFFRACTION' 
20 6.649  5.794  166 100.000 159 0.167 0.171 7  0.288 . . . . 'X-RAY DIFFRACTION' 
20 8.046  6.649  145 100.000 140 0.186 0.189 5  0.275 . . . . 'X-RAY DIFFRACTION' 
20 10.990 8.046  119 100.000 116 0.122 0.124 3  0.34  . . . . 'X-RAY DIFFRACTION' 
20 30.000 10.990 81  98.765  78  0.216 0.211 2  0.015 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2FOL 
_struct.title                     'Crystal structure of human RAB1A in complex with GDP' 
_struct.pdbx_descriptor           'Ras-related protein Rab-1A' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.text            
;G-PROTEIN, RAB, GTP ANALOGUE, STRUCTURAL GENOMICS, STRUCT URAL GENOMICS CONSORTIUM, SGC, Structural Genomics Consortium, PROTEIN TRANSPORT
;
_struct_keywords.entry_id        2FOL 
_struct_keywords.pdbx_keywords   'PROTEIN TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 5 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'not known' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 37  ? ASP A 48  ? GLY A 20  ASP A 31  1 ? 12 
HELX_P HELX_P2 2 ASP A 109 ? ASN A 115 ? ASP A 92  ASN A 98  1 ? 7  
HELX_P HELX_P3 3 ASN A 115 ? TYR A 126 ? ASN A 98  TYR A 109 1 ? 12 
HELX_P HELX_P4 4 ASP A 149 ? GLY A 161 ? ASP A 132 GLY A 144 1 ? 13 
HELX_P HELX_P5 5 ASN A 174 ? MET A 190 ? ASN A 157 MET A 173 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B MG . MG ? ? ? 1_555 F HOH .  O   ? ? A MG 202 A HOH 301 1_555 ? ? ? ? ? ? ? 1.853 ? 
metalc2 metalc ? ? B MG . MG ? ? ? 1_555 F HOH .  O   ? ? A MG 202 A HOH 302 1_555 ? ? ? ? ? ? ? 2.083 ? 
metalc3 metalc ? ? B MG . MG ? ? ? 1_555 F HOH .  O   ? ? A MG 202 A HOH 306 1_555 ? ? ? ? ? ? ? 2.317 ? 
metalc4 metalc ? ? B MG . MG ? ? ? 1_555 A SER 39 OG  ? ? A MG 202 A SER 22  1_555 ? ? ? ? ? ? ? 2.175 ? 
metalc5 metalc ? ? B MG . MG ? ? ? 1_555 C GDP .  O1B ? ? A MG 202 A GDP 201 1_555 ? ? ? ? ? ? ? 2.698 ? 
metalc6 metalc ? ? B MG . MG ? ? ? 1_555 C GDP .  O3B ? ? A MG 202 A GDP 201 1_555 ? ? ? ? ? ? ? 2.225 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   6 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 63  ? LEU A 69  ? LYS A 46  LEU A 52  
A 2 LYS A 72  ? TRP A 79  ? LYS A 55  TRP A 62  
A 3 TYR A 24  ? GLY A 32  ? TYR A 7   GLY A 15  
A 4 GLY A 100 ? ASP A 106 ? GLY A 83  ASP A 89  
A 5 ASN A 132 ? ASN A 138 ? ASN A 115 ASN A 121 
A 6 PHE A 164 ? GLU A 166 ? PHE A 147 GLU A 149 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LYS A 63  ? N LYS A 46  O ILE A 78  ? O ILE A 61  
A 2 3 O LYS A 75  ? O LYS A 58  N PHE A 26  ? N PHE A 9   
A 3 4 N LEU A 29  ? N LEU A 12  O ILE A 102 ? O ILE A 85  
A 4 5 N ILE A 101 ? N ILE A 84  O ASN A 132 ? O ASN A 115 
A 5 6 N LEU A 135 ? N LEU A 118 O LEU A 165 ? O LEU A 148 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 202'  
AC2 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE GDP A 201' 
AC3 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE UNX A 401' 
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE UNX A 402' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  SER A 39  ? SER A 22  . ? 1_555 ? 
2  AC1 5  GDP C .   ? GDP A 201 . ? 1_555 ? 
3  AC1 5  HOH F .   ? HOH A 301 . ? 1_555 ? 
4  AC1 5  HOH F .   ? HOH A 302 . ? 1_555 ? 
5  AC1 5  HOH F .   ? HOH A 306 . ? 1_555 ? 
6  AC2 21 ASP A 33  ? ASP A 16  . ? 1_555 ? 
7  AC2 21 SER A 34  ? SER A 17  . ? 1_555 ? 
8  AC2 21 GLY A 35  ? GLY A 18  . ? 1_555 ? 
9  AC2 21 VAL A 36  ? VAL A 19  . ? 1_555 ? 
10 AC2 21 GLY A 37  ? GLY A 20  . ? 1_555 ? 
11 AC2 21 LYS A 38  ? LYS A 21  . ? 1_555 ? 
12 AC2 21 SER A 39  ? SER A 22  . ? 1_555 ? 
13 AC2 21 CYS A 40  ? CYS A 23  . ? 1_555 ? 
14 AC2 21 TYR A 50  ? TYR A 33  . ? 1_555 ? 
15 AC2 21 GLU A 52  ? GLU A 35  . ? 1_555 ? 
16 AC2 21 ASN A 138 ? ASN A 121 . ? 1_555 ? 
17 AC2 21 LYS A 139 ? LYS A 122 . ? 1_555 ? 
18 AC2 21 ASP A 141 ? ASP A 124 . ? 1_555 ? 
19 AC2 21 LEU A 142 ? LEU A 125 . ? 1_555 ? 
20 AC2 21 SER A 168 ? SER A 151 . ? 1_555 ? 
21 AC2 21 ALA A 169 ? ALA A 152 . ? 1_555 ? 
22 AC2 21 LYS A 170 ? LYS A 153 . ? 1_555 ? 
23 AC2 21 MG  B .   ? MG  A 202 . ? 1_555 ? 
24 AC2 21 HOH F .   ? HOH A 301 . ? 1_555 ? 
25 AC2 21 HOH F .   ? HOH A 302 . ? 1_555 ? 
26 AC2 21 HOH F .   ? HOH A 306 . ? 1_555 ? 
27 AC3 2  ASP A 109 ? ASP A 92  . ? 1_555 ? 
28 AC3 2  ASP A 109 ? ASP A 92  . ? 5_555 ? 
29 AC4 6  GLY A 59  ? GLY A 42  . ? 1_555 ? 
30 AC4 6  VAL A 60  ? VAL A 43  . ? 1_555 ? 
31 AC4 6  ALA A 98  ? ALA A 81  . ? 3_455 ? 
32 AC4 6  HIS A 99  ? HIS A 82  . ? 3_455 ? 
33 AC4 6  SER A 128 ? SER A 111 . ? 3_455 ? 
34 AC4 6  ARG A 189 ? ARG A 172 . ? 3_455 ? 
# 
_atom_sites.entry_id                    2FOL 
_atom_sites.fract_transf_matrix[1][1]   0.01319 
_atom_sites.fract_transf_matrix[1][2]   0.00762 
_atom_sites.fract_transf_matrix[1][3]   0.00000 
_atom_sites.fract_transf_matrix[2][1]   0.00000 
_atom_sites.fract_transf_matrix[2][2]   0.01524 
_atom_sites.fract_transf_matrix[2][3]   0.00000 
_atom_sites.fract_transf_matrix[3][1]   0.00000 
_atom_sites.fract_transf_matrix[3][2]   0.00000 
_atom_sites.fract_transf_matrix[3][3]   0.02038 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
X  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . TYR A 1 22  ? -34.365 35.431 10.028  1.00 39.90 ? 5   TYR A N     1 
ATOM   2    C  CA    . TYR A 1 22  ? -33.257 34.667 9.346   1.00 39.69 ? 5   TYR A CA    1 
ATOM   3    C  C     . TYR A 1 22  ? -32.666 35.436 8.185   1.00 39.43 ? 5   TYR A C     1 
ATOM   4    O  O     . TYR A 1 22  ? -33.365 36.190 7.504   1.00 39.63 ? 5   TYR A O     1 
ATOM   5    C  CB    . TYR A 1 22  ? -33.739 33.315 8.836   1.00 39.94 ? 5   TYR A CB    1 
ATOM   6    C  CG    . TYR A 1 22  ? -34.169 32.392 9.930   1.00 40.36 ? 5   TYR A CG    1 
ATOM   7    C  CD1   . TYR A 1 22  ? -33.227 31.707 10.727  1.00 40.75 ? 5   TYR A CD1   1 
ATOM   8    C  CD2   . TYR A 1 22  ? -35.521 32.185 10.180  1.00 41.11 ? 5   TYR A CD2   1 
ATOM   9    C  CE1   . TYR A 1 22  ? -33.656 30.826 11.760  1.00 40.89 ? 5   TYR A CE1   1 
ATOM   10   C  CE2   . TYR A 1 22  ? -35.957 31.330 11.194  1.00 40.57 ? 5   TYR A CE2   1 
ATOM   11   C  CZ    . TYR A 1 22  ? -35.041 30.659 11.979  1.00 40.90 ? 5   TYR A CZ    1 
ATOM   12   O  OH    . TYR A 1 22  ? -35.541 29.829 12.965  1.00 41.09 ? 5   TYR A OH    1 
ATOM   13   N  N     . ASP A 1 23  ? -31.374 35.232 7.970   1.00 39.04 ? 6   ASP A N     1 
ATOM   14   C  CA    . ASP A 1 23  ? -30.640 35.899 6.923   1.00 39.14 ? 6   ASP A CA    1 
ATOM   15   C  C     . ASP A 1 23  ? -30.595 35.013 5.680   1.00 38.90 ? 6   ASP A C     1 
ATOM   16   O  O     . ASP A 1 23  ? -30.622 35.513 4.557   1.00 38.20 ? 6   ASP A O     1 
ATOM   17   C  CB    . ASP A 1 23  ? -29.216 36.212 7.412   1.00 39.45 ? 6   ASP A CB    1 
ATOM   18   C  CG    . ASP A 1 23  ? -29.175 37.353 8.443   1.00 39.79 ? 6   ASP A CG    1 
ATOM   19   O  OD1   . ASP A 1 23  ? -29.113 38.534 8.030   1.00 38.81 ? 6   ASP A OD1   1 
ATOM   20   O  OD2   . ASP A 1 23  ? -29.182 37.058 9.662   1.00 40.94 ? 6   ASP A OD2   1 
ATOM   21   N  N     . TYR A 1 24  ? -30.511 33.698 5.916   1.00 39.13 ? 7   TYR A N     1 
ATOM   22   C  CA    . TYR A 1 24  ? -30.525 32.676 4.879   1.00 39.23 ? 7   TYR A CA    1 
ATOM   23   C  C     . TYR A 1 24  ? -31.120 31.378 5.414   1.00 39.14 ? 7   TYR A C     1 
ATOM   24   O  O     . TYR A 1 24  ? -31.182 31.149 6.612   1.00 38.37 ? 7   TYR A O     1 
ATOM   25   C  CB    . TYR A 1 24  ? -29.117 32.325 4.406   1.00 39.47 ? 7   TYR A CB    1 
ATOM   26   C  CG    . TYR A 1 24  ? -28.227 33.475 4.009   1.00 39.89 ? 7   TYR A CG    1 
ATOM   27   C  CD1   . TYR A 1 24  ? -27.275 34.009 4.903   1.00 40.03 ? 7   TYR A CD1   1 
ATOM   28   C  CD2   . TYR A 1 24  ? -28.298 34.013 2.731   1.00 40.35 ? 7   TYR A CD2   1 
ATOM   29   C  CE1   . TYR A 1 24  ? -26.429 35.062 4.519   1.00 40.06 ? 7   TYR A CE1   1 
ATOM   30   C  CE2   . TYR A 1 24  ? -27.466 35.071 2.337   1.00 40.39 ? 7   TYR A CE2   1 
ATOM   31   C  CZ    . TYR A 1 24  ? -26.535 35.588 3.223   1.00 40.28 ? 7   TYR A CZ    1 
ATOM   32   O  OH    . TYR A 1 24  ? -25.741 36.638 2.794   1.00 40.38 ? 7   TYR A OH    1 
ATOM   33   N  N     . LEU A 1 25  ? -31.548 30.539 4.483   1.00 39.72 ? 8   LEU A N     1 
ATOM   34   C  CA    . LEU A 1 25  ? -31.936 29.164 4.755   1.00 40.00 ? 8   LEU A CA    1 
ATOM   35   C  C     . LEU A 1 25  ? -31.031 28.295 3.892   1.00 40.08 ? 8   LEU A C     1 
ATOM   36   O  O     . LEU A 1 25  ? -31.110 28.359 2.666   1.00 39.31 ? 8   LEU A O     1 
ATOM   37   C  CB    . LEU A 1 25  ? -33.406 28.887 4.383   1.00 40.29 ? 8   LEU A CB    1 
ATOM   38   C  CG    . LEU A 1 25  ? -33.766 27.365 4.407   1.00 40.49 ? 8   LEU A CG    1 
ATOM   39   C  CD1   . LEU A 1 25  ? -33.543 26.788 5.821   1.00 42.06 ? 8   LEU A CD1   1 
ATOM   40   C  CD2   . LEU A 1 25  ? -35.177 27.050 3.922   1.00 40.03 ? 8   LEU A CD2   1 
ATOM   41   N  N     . PHE A 1 26  ? -30.168 27.495 4.530   1.00 40.61 ? 9   PHE A N     1 
ATOM   42   C  CA    . PHE A 1 26  ? -29.213 26.666 3.789   1.00 40.90 ? 9   PHE A CA    1 
ATOM   43   C  C     . PHE A 1 26  ? -29.579 25.195 3.888   1.00 41.09 ? 9   PHE A C     1 
ATOM   44   O  O     . PHE A 1 26  ? -29.702 24.601 4.986   1.00 40.95 ? 9   PHE A O     1 
ATOM   45   C  CB    . PHE A 1 26  ? -27.740 26.925 4.214   1.00 40.84 ? 9   PHE A CB    1 
ATOM   46   C  CG    . PHE A 1 26  ? -27.181 28.300 3.769   1.00 41.13 ? 9   PHE A CG    1 
ATOM   47   C  CD1   . PHE A 1 26  ? -26.033 28.812 4.348   1.00 41.08 ? 9   PHE A CD1   1 
ATOM   48   C  CD2   . PHE A 1 26  ? -27.822 29.080 2.795   1.00 41.13 ? 9   PHE A CD2   1 
ATOM   49   C  CE1   . PHE A 1 26  ? -25.522 30.055 3.943   1.00 40.96 ? 9   PHE A CE1   1 
ATOM   50   C  CE2   . PHE A 1 26  ? -27.309 30.329 2.417   1.00 40.38 ? 9   PHE A CE2   1 
ATOM   51   C  CZ    . PHE A 1 26  ? -26.176 30.803 2.987   1.00 40.01 ? 9   PHE A CZ    1 
ATOM   52   N  N     . LYS A 1 27  ? -29.729 24.619 2.707   1.00 41.34 ? 10  LYS A N     1 
ATOM   53   C  CA    . LYS A 1 27  ? -30.222 23.269 2.530   1.00 41.74 ? 10  LYS A CA    1 
ATOM   54   C  C     . LYS A 1 27  ? -29.040 22.324 2.249   1.00 41.55 ? 10  LYS A C     1 
ATOM   55   O  O     . LYS A 1 27  ? -28.451 22.355 1.165   1.00 41.40 ? 10  LYS A O     1 
ATOM   56   C  CB    . LYS A 1 27  ? -31.215 23.290 1.383   1.00 41.84 ? 10  LYS A CB    1 
ATOM   57   C  CG    . LYS A 1 27  ? -32.376 22.427 1.567   1.00 42.80 ? 10  LYS A CG    1 
ATOM   58   C  CD    . LYS A 1 27  ? -33.418 22.665 0.483   1.00 42.95 ? 10  LYS A CD    1 
ATOM   59   C  CE    . LYS A 1 27  ? -34.280 23.890 0.776   1.00 43.93 ? 10  LYS A CE    1 
ATOM   60   N  NZ    . LYS A 1 27  ? -35.639 23.721 0.122   1.00 45.12 ? 10  LYS A NZ    1 
ATOM   61   N  N     . LEU A 1 28  ? -28.699 21.512 3.261   1.00 41.80 ? 11  LEU A N     1 
ATOM   62   C  CA    . LEU A 1 28  ? -27.509 20.639 3.259   1.00 41.79 ? 11  LEU A CA    1 
ATOM   63   C  C     . LEU A 1 28  ? -27.882 19.164 3.102   1.00 41.67 ? 11  LEU A C     1 
ATOM   64   O  O     . LEU A 1 28  ? -29.009 18.761 3.363   1.00 41.33 ? 11  LEU A O     1 
ATOM   65   C  CB    . LEU A 1 28  ? -26.717 20.807 4.563   1.00 41.89 ? 11  LEU A CB    1 
ATOM   66   C  CG    . LEU A 1 28  ? -25.738 21.973 4.753   1.00 42.66 ? 11  LEU A CG    1 
ATOM   67   C  CD1   . LEU A 1 28  ? -26.275 23.261 4.188   1.00 43.58 ? 11  LEU A CD1   1 
ATOM   68   C  CD2   . LEU A 1 28  ? -25.427 22.123 6.232   1.00 41.48 ? 11  LEU A CD2   1 
ATOM   69   N  N     . LEU A 1 29  ? -26.897 18.357 2.716   1.00 42.00 ? 12  LEU A N     1 
ATOM   70   C  CA    . LEU A 1 29  ? -27.114 16.956 2.369   1.00 42.02 ? 12  LEU A CA    1 
ATOM   71   C  C     . LEU A 1 29  ? -25.855 16.110 2.682   1.00 42.04 ? 12  LEU A C     1 
ATOM   72   O  O     . LEU A 1 29  ? -24.758 16.423 2.214   1.00 42.26 ? 12  LEU A O     1 
ATOM   73   C  CB    . LEU A 1 29  ? -27.473 16.894 0.873   1.00 41.92 ? 12  LEU A CB    1 
ATOM   74   C  CG    . LEU A 1 29  ? -27.841 15.575 0.205   1.00 42.08 ? 12  LEU A CG    1 
ATOM   75   C  CD1   . LEU A 1 29  ? -29.059 15.038 0.857   1.00 42.28 ? 12  LEU A CD1   1 
ATOM   76   C  CD2   . LEU A 1 29  ? -28.063 15.727 -1.335  1.00 41.85 ? 12  LEU A CD2   1 
ATOM   77   N  N     . LEU A 1 30  ? -26.025 15.047 3.474   1.00 42.23 ? 13  LEU A N     1 
ATOM   78   C  CA    . LEU A 1 30  ? -24.918 14.118 3.819   1.00 42.27 ? 13  LEU A CA    1 
ATOM   79   C  C     . LEU A 1 30  ? -24.869 12.852 2.914   1.00 42.37 ? 13  LEU A C     1 
ATOM   80   O  O     . LEU A 1 30  ? -25.809 12.039 2.914   1.00 42.28 ? 13  LEU A O     1 
ATOM   81   C  CB    . LEU A 1 30  ? -25.024 13.651 5.288   1.00 42.23 ? 13  LEU A CB    1 
ATOM   82   C  CG    . LEU A 1 30  ? -24.994 14.634 6.481   1.00 42.28 ? 13  LEU A CG    1 
ATOM   83   C  CD1   . LEU A 1 30  ? -24.771 13.858 7.776   1.00 42.34 ? 13  LEU A CD1   1 
ATOM   84   C  CD2   . LEU A 1 30  ? -23.922 15.680 6.359   1.00 42.22 ? 13  LEU A CD2   1 
ATOM   85   N  N     . ILE A 1 31  ? -23.766 12.683 2.172   1.00 42.53 ? 14  ILE A N     1 
ATOM   86   C  CA    . ILE A 1 31  ? -23.524 11.452 1.386   1.00 42.09 ? 14  ILE A CA    1 
ATOM   87   C  C     . ILE A 1 31  ? -22.409 10.651 2.060   1.00 41.81 ? 14  ILE A C     1 
ATOM   88   O  O     . ILE A 1 31  ? -21.688 11.178 2.887   1.00 41.30 ? 14  ILE A O     1 
ATOM   89   C  CB    . ILE A 1 31  ? -22.999 11.696 -0.076  1.00 42.15 ? 14  ILE A CB    1 
ATOM   90   C  CG1   . ILE A 1 31  ? -23.306 13.063 -0.652  1.00 42.54 ? 14  ILE A CG1   1 
ATOM   91   C  CG2   . ILE A 1 31  ? -23.576 10.696 -0.995  1.00 42.98 ? 14  ILE A CG2   1 
ATOM   92   C  CD1   . ILE A 1 31  ? -22.479 13.338 -1.948  1.00 41.33 ? 14  ILE A CD1   1 
ATOM   93   N  N     . GLY A 1 32  ? -22.253 9.388  1.663   1.00 41.88 ? 15  GLY A N     1 
ATOM   94   C  CA    . GLY A 1 32  ? -21.135 8.547  2.121   1.00 42.13 ? 15  GLY A CA    1 
ATOM   95   C  C     . GLY A 1 32  ? -21.527 7.092  2.306   1.00 42.24 ? 15  GLY A C     1 
ATOM   96   O  O     . GLY A 1 32  ? -22.702 6.763  2.339   1.00 42.59 ? 15  GLY A O     1 
ATOM   97   N  N     . ASP A 1 33  ? -20.543 6.208  2.420   1.00 42.62 ? 16  ASP A N     1 
ATOM   98   C  CA    . ASP A 1 33  ? -20.823 4.782  2.686   1.00 42.67 ? 16  ASP A CA    1 
ATOM   99   C  C     . ASP A 1 33  ? -21.506 4.590  4.059   1.00 42.94 ? 16  ASP A C     1 
ATOM   100  O  O     . ASP A 1 33  ? -21.388 5.436  4.970   1.00 42.83 ? 16  ASP A O     1 
ATOM   101  C  CB    . ASP A 1 33  ? -19.523 3.925  2.676   1.00 42.58 ? 16  ASP A CB    1 
ATOM   102  C  CG    . ASP A 1 33  ? -18.912 3.734  1.276   1.00 41.39 ? 16  ASP A CG    1 
ATOM   103  O  OD1   . ASP A 1 33  ? -19.427 4.297  0.300   1.00 41.85 ? 16  ASP A OD1   1 
ATOM   104  O  OD2   . ASP A 1 33  ? -17.901 3.005  1.176   1.00 38.48 ? 16  ASP A OD2   1 
ATOM   105  N  N     . SER A 1 34  ? -22.199 3.458  4.196   1.00 43.30 ? 17  SER A N     1 
ATOM   106  C  CA    . SER A 1 34  ? -22.819 3.057  5.458   1.00 43.54 ? 17  SER A CA    1 
ATOM   107  C  C     . SER A 1 34  ? -21.776 2.752  6.528   1.00 43.74 ? 17  SER A C     1 
ATOM   108  O  O     . SER A 1 34  ? -20.711 2.189  6.241   1.00 43.77 ? 17  SER A O     1 
ATOM   109  C  CB    . SER A 1 34  ? -23.633 1.795  5.257   1.00 43.62 ? 17  SER A CB    1 
ATOM   110  O  OG    . SER A 1 34  ? -24.521 1.954  4.186   1.00 44.71 ? 17  SER A OG    1 
ATOM   111  N  N     . GLY A 1 35  ? -22.105 3.088  7.771   1.00 43.70 ? 18  GLY A N     1 
ATOM   112  C  CA    . GLY A 1 35  ? -21.223 2.806  8.895   1.00 43.27 ? 18  GLY A CA    1 
ATOM   113  C  C     . GLY A 1 35  ? -20.164 3.868  9.079   1.00 43.10 ? 18  GLY A C     1 
ATOM   114  O  O     . GLY A 1 35  ? -19.242 3.692  9.884   1.00 43.80 ? 18  GLY A O     1 
ATOM   115  N  N     . VAL A 1 36  ? -20.292 4.978  8.357   1.00 42.49 ? 19  VAL A N     1 
ATOM   116  C  CA    . VAL A 1 36  ? -19.335 6.066  8.478   1.00 41.94 ? 19  VAL A CA    1 
ATOM   117  C  C     . VAL A 1 36  ? -19.729 6.989  9.615   1.00 41.33 ? 19  VAL A C     1 
ATOM   118  O  O     . VAL A 1 36  ? -18.879 7.606  10.219  1.00 41.30 ? 19  VAL A O     1 
ATOM   119  C  CB    . VAL A 1 36  ? -19.174 6.823  7.133   1.00 41.82 ? 19  VAL A CB    1 
ATOM   120  C  CG1   . VAL A 1 36  ? -18.710 5.831  6.026   1.00 41.41 ? 19  VAL A CG1   1 
ATOM   121  C  CG2   . VAL A 1 36  ? -20.474 7.519  6.726   1.00 41.50 ? 19  VAL A CG2   1 
ATOM   122  N  N     . GLY A 1 37  ? -21.015 7.064  9.919   1.00 41.05 ? 20  GLY A N     1 
ATOM   123  C  CA    . GLY A 1 37  ? -21.490 7.917  11.007  1.00 41.42 ? 20  GLY A CA    1 
ATOM   124  C  C     . GLY A 1 37  ? -22.310 9.152  10.596  1.00 41.31 ? 20  GLY A C     1 
ATOM   125  O  O     . GLY A 1 37  ? -22.440 10.117 11.371  1.00 41.04 ? 20  GLY A O     1 
ATOM   126  N  N     . LYS A 1 38  ? -22.875 9.141  9.398   1.00 41.17 ? 21  LYS A N     1 
ATOM   127  C  CA    . LYS A 1 38  ? -23.626 10.308 8.939   1.00 41.44 ? 21  LYS A CA    1 
ATOM   128  C  C     . LYS A 1 38  ? -24.787 10.580 9.861   1.00 41.56 ? 21  LYS A C     1 
ATOM   129  O  O     . LYS A 1 38  ? -25.044 11.729 10.222  1.00 41.33 ? 21  LYS A O     1 
ATOM   130  C  CB    . LYS A 1 38  ? -24.165 10.110 7.525   1.00 41.50 ? 21  LYS A CB    1 
ATOM   131  C  CG    . LYS A 1 38  ? -23.091 9.869  6.436   1.00 41.53 ? 21  LYS A CG    1 
ATOM   132  C  CD    . LYS A 1 38  ? -23.691 9.203  5.189   1.00 40.86 ? 21  LYS A CD    1 
ATOM   133  C  CE    . LYS A 1 38  ? -24.169 7.836  5.530   1.00 39.42 ? 21  LYS A CE    1 
ATOM   134  N  NZ    . LYS A 1 38  ? -24.753 7.222  4.414   1.00 38.93 ? 21  LYS A NZ    1 
ATOM   135  N  N     . SER A 1 39  ? -25.507 9.518  10.217  1.00 41.82 ? 22  SER A N     1 
ATOM   136  C  CA    . SER A 1 39  ? -26.655 9.622  11.109  1.00 42.22 ? 22  SER A CA    1 
ATOM   137  C  C     . SER A 1 39  ? -26.237 10.060 12.523  1.00 42.30 ? 22  SER A C     1 
ATOM   138  O  O     . SER A 1 39  ? -26.969 10.799 13.208  1.00 42.14 ? 22  SER A O     1 
ATOM   139  C  CB    . SER A 1 39  ? -27.402 8.292  11.166  1.00 42.38 ? 22  SER A CB    1 
ATOM   140  O  OG    . SER A 1 39  ? -27.811 7.890  9.863   1.00 43.42 ? 22  SER A OG    1 
ATOM   141  N  N     . CYS A 1 40  ? -25.067 9.608  12.960  1.00 42.43 ? 23  CYS A N     1 
ATOM   142  C  CA    . CYS A 1 40  ? -24.549 10.020 14.255  1.00 42.44 ? 23  CYS A CA    1 
ATOM   143  C  C     . CYS A 1 40  ? -24.217 11.505 14.249  1.00 42.74 ? 23  CYS A C     1 
ATOM   144  O  O     . CYS A 1 40  ? -24.596 12.234 15.172  1.00 42.83 ? 23  CYS A O     1 
ATOM   145  C  CB    . CYS A 1 40  ? -23.301 9.225  14.620  1.00 42.51 ? 23  CYS A CB    1 
ATOM   146  S  SG    . CYS A 1 40  ? -23.638 7.604  15.218  1.00 40.83 ? 23  CYS A SG    1 
ATOM   147  N  N     . LEU A 1 41  ? -23.500 11.939 13.206  1.00 42.75 ? 24  LEU A N     1 
ATOM   148  C  CA    . LEU A 1 41  ? -23.080 13.332 13.070  1.00 42.83 ? 24  LEU A CA    1 
ATOM   149  C  C     . LEU A 1 41  ? -24.269 14.257 13.080  1.00 42.86 ? 24  LEU A C     1 
ATOM   150  O  O     . LEU A 1 41  ? -24.358 15.176 13.894  1.00 42.86 ? 24  LEU A O     1 
ATOM   151  C  CB    . LEU A 1 41  ? -22.320 13.528 11.763  1.00 43.17 ? 24  LEU A CB    1 
ATOM   152  C  CG    . LEU A 1 41  ? -20.868 13.047 11.703  1.00 43.65 ? 24  LEU A CG    1 
ATOM   153  C  CD1   . LEU A 1 41  ? -20.356 13.010 10.236  1.00 42.96 ? 24  LEU A CD1   1 
ATOM   154  C  CD2   . LEU A 1 41  ? -19.984 13.948 12.631  1.00 43.55 ? 24  LEU A CD2   1 
ATOM   155  N  N     . LEU A 1 42  ? -25.184 13.998 12.150  1.00 43.16 ? 25  LEU A N     1 
ATOM   156  C  CA    . LEU A 1 42  ? -26.453 14.740 12.027  1.00 42.78 ? 25  LEU A CA    1 
ATOM   157  C  C     . LEU A 1 42  ? -27.252 14.812 13.337  1.00 42.44 ? 25  LEU A C     1 
ATOM   158  O  O     . LEU A 1 42  ? -27.773 15.859 13.660  1.00 43.31 ? 25  LEU A O     1 
ATOM   159  C  CB    . LEU A 1 42  ? -27.316 14.123 10.915  1.00 42.65 ? 25  LEU A CB    1 
ATOM   160  C  CG    . LEU A 1 42  ? -28.699 14.745 10.727  1.00 43.45 ? 25  LEU A CG    1 
ATOM   161  C  CD1   . LEU A 1 42  ? -28.632 16.298 10.675  1.00 42.49 ? 25  LEU A CD1   1 
ATOM   162  C  CD2   . LEU A 1 42  ? -29.385 14.150 9.472   1.00 43.13 ? 25  LEU A CD2   1 
ATOM   163  N  N     . LEU A 1 43  ? -27.354 13.720 14.084  1.00 41.95 ? 26  LEU A N     1 
ATOM   164  C  CA    . LEU A 1 43  ? -28.145 13.745 15.332  1.00 41.82 ? 26  LEU A CA    1 
ATOM   165  C  C     . LEU A 1 43  ? -27.367 14.451 16.461  1.00 41.51 ? 26  LEU A C     1 
ATOM   166  O  O     . LEU A 1 43  ? -27.950 15.130 17.310  1.00 41.03 ? 26  LEU A O     1 
ATOM   167  C  CB    . LEU A 1 43  ? -28.596 12.321 15.743  1.00 41.63 ? 26  LEU A CB    1 
ATOM   168  C  CG    . LEU A 1 43  ? -29.619 11.619 14.809  1.00 41.18 ? 26  LEU A CG    1 
ATOM   169  C  CD1   . LEU A 1 43  ? -29.893 10.203 15.237  1.00 39.54 ? 26  LEU A CD1   1 
ATOM   170  C  CD2   . LEU A 1 43  ? -30.945 12.391 14.692  1.00 40.49 ? 26  LEU A CD2   1 
ATOM   171  N  N     . ARG A 1 44  ? -26.052 14.278 16.457  1.00 41.39 ? 27  ARG A N     1 
ATOM   172  C  CA    . ARG A 1 44  ? -25.195 14.985 17.371  1.00 41.43 ? 27  ARG A CA    1 
ATOM   173  C  C     . ARG A 1 44  ? -25.366 16.485 17.143  1.00 41.35 ? 27  ARG A C     1 
ATOM   174  O  O     . ARG A 1 44  ? -25.663 17.252 18.068  1.00 41.31 ? 27  ARG A O     1 
ATOM   175  C  CB    . ARG A 1 44  ? -23.724 14.567 17.139  1.00 41.57 ? 27  ARG A CB    1 
ATOM   176  C  CG    . ARG A 1 44  ? -22.640 15.537 17.690  1.00 41.43 ? 27  ARG A CG    1 
ATOM   177  C  CD    . ARG A 1 44  ? -22.700 15.641 19.198  1.00 41.62 ? 27  ARG A CD    1 
ATOM   178  N  NE    . ARG A 1 44  ? -22.183 14.447 19.853  1.00 41.33 ? 27  ARG A NE    1 
ATOM   179  C  CZ    . ARG A 1 44  ? -22.446 14.097 21.112  1.00 40.94 ? 27  ARG A CZ    1 
ATOM   180  N  NH1   . ARG A 1 44  ? -23.225 14.829 21.908  1.00 40.92 ? 27  ARG A NH1   1 
ATOM   181  N  NH2   . ARG A 1 44  ? -21.921 12.999 21.577  1.00 41.19 ? 27  ARG A NH2   1 
ATOM   182  N  N     . PHE A 1 45  ? -25.182 16.888 15.897  1.00 41.47 ? 28  PHE A N     1 
ATOM   183  C  CA    . PHE A 1 45  ? -25.223 18.280 15.534  1.00 41.15 ? 28  PHE A CA    1 
ATOM   184  C  C     . PHE A 1 45  ? -26.576 18.911 15.776  1.00 40.80 ? 28  PHE A C     1 
ATOM   185  O  O     . PHE A 1 45  ? -26.653 19.993 16.328  1.00 41.22 ? 28  PHE A O     1 
ATOM   186  C  CB    . PHE A 1 45  ? -24.846 18.474 14.073  1.00 41.77 ? 28  PHE A CB    1 
ATOM   187  C  CG    . PHE A 1 45  ? -25.031 19.894 13.607  1.00 42.43 ? 28  PHE A CG    1 
ATOM   188  C  CD1   . PHE A 1 45  ? -24.341 20.941 14.244  1.00 42.69 ? 28  PHE A CD1   1 
ATOM   189  C  CD2   . PHE A 1 45  ? -25.920 20.199 12.556  1.00 43.57 ? 28  PHE A CD2   1 
ATOM   190  C  CE1   . PHE A 1 45  ? -24.507 22.243 13.839  1.00 42.52 ? 28  PHE A CE1   1 
ATOM   191  C  CE2   . PHE A 1 45  ? -26.095 21.505 12.141  1.00 43.11 ? 28  PHE A CE2   1 
ATOM   192  C  CZ    . PHE A 1 45  ? -25.381 22.542 12.784  1.00 42.84 ? 28  PHE A CZ    1 
ATOM   193  N  N     . ALA A 1 46  ? -27.632 18.239 15.349  1.00 40.09 ? 29  ALA A N     1 
ATOM   194  C  CA    . ALA A 1 46  ? -28.998 18.726 15.539  1.00 39.66 ? 29  ALA A CA    1 
ATOM   195  C  C     . ALA A 1 46  ? -29.486 18.619 16.972  1.00 39.10 ? 29  ALA A C     1 
ATOM   196  O  O     . ALA A 1 46  ? -30.057 19.539 17.491  1.00 38.79 ? 29  ALA A O     1 
ATOM   197  C  CB    . ALA A 1 46  ? -29.938 17.951 14.646  1.00 38.96 ? 29  ALA A CB    1 
ATOM   198  N  N     . ASP A 1 47  ? -29.269 17.474 17.602  1.00 39.43 ? 30  ASP A N     1 
ATOM   199  C  CA    . ASP A 1 47  ? -29.945 17.140 18.889  1.00 39.52 ? 30  ASP A CA    1 
ATOM   200  C  C     . ASP A 1 47  ? -29.031 16.997 20.105  1.00 39.48 ? 30  ASP A C     1 
ATOM   201  O  O     . ASP A 1 47  ? -29.482 17.001 21.251  1.00 38.84 ? 30  ASP A O     1 
ATOM   202  C  CB    . ASP A 1 47  ? -30.747 15.849 18.687  1.00 39.31 ? 30  ASP A CB    1 
ATOM   203  C  CG    . ASP A 1 47  ? -31.707 15.963 17.527  1.00 38.70 ? 30  ASP A CG    1 
ATOM   204  O  OD1   . ASP A 1 47  ? -31.976 14.974 16.842  1.00 37.37 ? 30  ASP A OD1   1 
ATOM   205  O  OD2   . ASP A 1 47  ? -32.180 17.081 17.289  1.00 38.49 ? 30  ASP A OD2   1 
ATOM   206  N  N     . ASP A 1 48  ? -27.746 16.872 19.844  1.00 39.99 ? 31  ASP A N     1 
ATOM   207  C  CA    . ASP A 1 48  ? -26.795 16.665 20.887  1.00 40.40 ? 31  ASP A CA    1 
ATOM   208  C  C     . ASP A 1 48  ? -27.010 15.295 21.534  1.00 40.67 ? 31  ASP A C     1 
ATOM   209  O  O     . ASP A 1 48  ? -26.850 15.127 22.751  1.00 41.42 ? 31  ASP A O     1 
ATOM   210  C  CB    . ASP A 1 48  ? -26.900 17.771 21.921  1.00 40.60 ? 31  ASP A CB    1 
ATOM   211  C  CG    . ASP A 1 48  ? -25.641 17.909 22.734  1.00 41.87 ? 31  ASP A CG    1 
ATOM   212  O  OD1   . ASP A 1 48  ? -24.552 17.957 22.121  1.00 45.20 ? 31  ASP A OD1   1 
ATOM   213  O  OD2   . ASP A 1 48  ? -25.727 17.952 23.981  1.00 43.85 ? 31  ASP A OD2   1 
ATOM   214  N  N     . THR A 1 49  ? -27.378 14.315 20.721  1.00 40.55 ? 32  THR A N     1 
ATOM   215  C  CA    . THR A 1 49  ? -27.566 12.977 21.198  1.00 40.56 ? 32  THR A CA    1 
ATOM   216  C  C     . THR A 1 49  ? -26.492 12.138 20.541  1.00 40.80 ? 32  THR A C     1 
ATOM   217  O  O     . THR A 1 49  ? -25.803 12.609 19.634  1.00 41.09 ? 32  THR A O     1 
ATOM   218  C  CB    . THR A 1 49  ? -28.975 12.443 20.849  1.00 40.57 ? 32  THR A CB    1 
ATOM   219  O  OG1   . THR A 1 49  ? -29.197 12.541 19.442  1.00 41.69 ? 32  THR A OG1   1 
ATOM   220  C  CG2   . THR A 1 49  ? -30.076 13.244 21.572  1.00 40.35 ? 32  THR A CG2   1 
ATOM   221  N  N     . TYR A 1 50  ? -26.308 10.917 21.041  1.00 40.84 ? 33  TYR A N     1 
ATOM   222  C  CA    . TYR A 1 50  ? -25.403 9.932  20.436  1.00 40.84 ? 33  TYR A CA    1 
ATOM   223  C  C     . TYR A 1 50  ? -25.635 8.597  21.127  1.00 40.96 ? 33  TYR A C     1 
ATOM   224  O  O     . TYR A 1 50  ? -25.813 8.555  22.342  1.00 41.32 ? 33  TYR A O     1 
ATOM   225  C  CB    . TYR A 1 50  ? -23.901 10.349 20.506  1.00 40.56 ? 33  TYR A CB    1 
ATOM   226  C  CG    . TYR A 1 50  ? -22.951 9.255  20.022  1.00 40.22 ? 33  TYR A CG    1 
ATOM   227  C  CD1   . TYR A 1 50  ? -22.772 9.018  18.683  1.00 40.05 ? 33  TYR A CD1   1 
ATOM   228  C  CD2   . TYR A 1 50  ? -22.262 8.456  20.915  1.00 38.97 ? 33  TYR A CD2   1 
ATOM   229  C  CE1   . TYR A 1 50  ? -21.927 7.992  18.234  1.00 40.84 ? 33  TYR A CE1   1 
ATOM   230  C  CE2   . TYR A 1 50  ? -21.415 7.438  20.479  1.00 39.50 ? 33  TYR A CE2   1 
ATOM   231  C  CZ    . TYR A 1 50  ? -21.252 7.208  19.136  1.00 40.21 ? 33  TYR A CZ    1 
ATOM   232  O  OH    . TYR A 1 50  ? -20.412 6.189  18.662  1.00 40.46 ? 33  TYR A OH    1 
ATOM   233  N  N     . THR A 1 51  ? -25.648 7.518  20.335  1.00 41.12 ? 34  THR A N     1 
ATOM   234  C  CA    . THR A 1 51  ? -25.804 6.173  20.839  1.00 41.38 ? 34  THR A CA    1 
ATOM   235  C  C     . THR A 1 51  ? -25.064 5.130  19.914  1.00 41.95 ? 34  THR A C     1 
ATOM   236  O  O     . THR A 1 51  ? -25.115 5.194  18.676  1.00 42.04 ? 34  THR A O     1 
ATOM   237  C  CB    . THR A 1 51  ? -27.308 5.868  21.045  1.00 41.08 ? 34  THR A CB    1 
ATOM   238  O  OG1   . THR A 1 51  ? -27.480 4.512  21.440  1.00 40.70 ? 34  THR A OG1   1 
ATOM   239  C  CG2   . THR A 1 51  ? -28.116 6.156  19.775  1.00 40.79 ? 34  THR A CG2   1 
ATOM   240  N  N     . GLU A 1 52  ? -24.338 4.203  20.536  1.00 42.69 ? 35  GLU A N     1 
ATOM   241  C  CA    . GLU A 1 52  ? -23.625 3.133  19.802  1.00 42.98 ? 35  GLU A CA    1 
ATOM   242  C  C     . GLU A 1 52  ? -24.623 2.280  19.023  1.00 43.16 ? 35  GLU A C     1 
ATOM   243  O  O     . GLU A 1 52  ? -24.289 1.579  18.047  1.00 42.85 ? 35  GLU A O     1 
ATOM   244  C  CB    . GLU A 1 52  ? -22.885 2.243  20.803  1.00 43.30 ? 35  GLU A CB    1 
ATOM   245  C  CG    . GLU A 1 52  ? -21.787 2.945  21.554  1.00 44.69 ? 35  GLU A CG    1 
ATOM   246  C  CD    . GLU A 1 52  ? -20.719 3.510  20.619  1.00 47.28 ? 35  GLU A CD    1 
ATOM   247  O  OE1   . GLU A 1 52  ? -20.509 2.944  19.511  1.00 48.87 ? 35  GLU A OE1   1 
ATOM   248  O  OE2   . GLU A 1 52  ? -20.087 4.525  20.989  1.00 49.41 ? 35  GLU A OE2   1 
ATOM   249  N  N     . SER A 1 53  ? -25.858 2.357  19.507  1.00 43.30 ? 36  SER A N     1 
ATOM   250  C  CA    . SER A 1 53  ? -26.989 1.643  18.994  1.00 43.38 ? 36  SER A CA    1 
ATOM   251  C  C     . SER A 1 53  ? -27.184 1.882  17.487  1.00 43.51 ? 36  SER A C     1 
ATOM   252  O  O     . SER A 1 53  ? -26.966 2.974  16.973  1.00 43.68 ? 36  SER A O     1 
ATOM   253  C  CB    . SER A 1 53  ? -28.221 2.084  19.787  1.00 43.19 ? 36  SER A CB    1 
ATOM   254  O  OG    . SER A 1 53  ? -29.225 1.124  19.738  1.00 43.77 ? 36  SER A OG    1 
ATOM   255  N  N     . TYR A 1 54  ? -27.600 0.832  16.804  1.00 43.86 ? 37  TYR A N     1 
ATOM   256  C  CA    . TYR A 1 54  ? -27.738 0.825  15.364  1.00 43.78 ? 37  TYR A CA    1 
ATOM   257  C  C     . TYR A 1 54  ? -28.908 1.641  14.899  1.00 43.84 ? 37  TYR A C     1 
ATOM   258  O  O     . TYR A 1 54  ? -30.054 1.360  15.267  1.00 43.38 ? 37  TYR A O     1 
ATOM   259  C  CB    . TYR A 1 54  ? -27.918 -0.614 14.885  1.00 43.91 ? 37  TYR A CB    1 
ATOM   260  C  CG    . TYR A 1 54  ? -28.390 -0.764 13.451  1.00 44.02 ? 37  TYR A CG    1 
ATOM   261  C  CD1   . TYR A 1 54  ? -27.498 -0.615 12.382  1.00 44.28 ? 37  TYR A CD1   1 
ATOM   262  C  CD2   . TYR A 1 54  ? -29.718 -1.092 13.166  1.00 43.76 ? 37  TYR A CD2   1 
ATOM   263  C  CE1   . TYR A 1 54  ? -27.919 -0.769 11.072  1.00 44.08 ? 37  TYR A CE1   1 
ATOM   264  C  CE2   . TYR A 1 54  ? -30.155 -1.250 11.869  1.00 44.03 ? 37  TYR A CE2   1 
ATOM   265  C  CZ    . TYR A 1 54  ? -29.254 -1.091 10.813  1.00 44.76 ? 37  TYR A CZ    1 
ATOM   266  O  OH    . TYR A 1 54  ? -29.686 -1.263 9.492   1.00 44.68 ? 37  TYR A OH    1 
ATOM   267  N  N     . ILE A 1 55  ? -28.603 2.649  14.065  1.00 44.11 ? 38  ILE A N     1 
ATOM   268  C  CA    . ILE A 1 55  ? -29.626 3.508  13.410  1.00 43.88 ? 38  ILE A CA    1 
ATOM   269  C  C     . ILE A 1 55  ? -29.919 3.031  11.989  1.00 43.68 ? 38  ILE A C     1 
ATOM   270  O  O     . ILE A 1 55  ? -29.079 3.143  11.091  1.00 43.34 ? 38  ILE A O     1 
ATOM   271  C  CB    . ILE A 1 55  ? -29.213 5.028  13.358  1.00 43.89 ? 38  ILE A CB    1 
ATOM   272  C  CG1   . ILE A 1 55  ? -29.074 5.596  14.771  1.00 44.15 ? 38  ILE A CG1   1 
ATOM   273  C  CG2   . ILE A 1 55  ? -30.205 5.838  12.537  1.00 43.83 ? 38  ILE A CG2   1 
ATOM   274  C  CD1   . ILE A 1 55  ? -29.984 4.901  15.823  1.00 45.80 ? 38  ILE A CD1   1 
ATOM   275  N  N     . SER A 1 56  ? -31.116 2.463  11.837  1.00 43.65 ? 39  SER A N     1 
ATOM   276  C  CA    . SER A 1 56  ? -31.707 2.115  10.545  1.00 43.14 ? 39  SER A CA    1 
ATOM   277  C  C     . SER A 1 56  ? -32.018 3.416  9.801   1.00 42.79 ? 39  SER A C     1 
ATOM   278  O  O     . SER A 1 56  ? -31.717 3.552  8.622   1.00 42.42 ? 39  SER A O     1 
ATOM   279  C  CB    . SER A 1 56  ? -32.999 1.324  10.791  1.00 43.10 ? 39  SER A CB    1 
ATOM   280  O  OG    . SER A 1 56  ? -33.663 0.973  9.598   1.00 43.63 ? 39  SER A OG    1 
ATOM   281  N  N     . THR A 1 57  ? -32.598 4.375  10.539  1.00 42.56 ? 40  THR A N     1 
ATOM   282  C  CA    . THR A 1 57  ? -33.095 5.655  9.997   1.00 41.85 ? 40  THR A CA    1 
ATOM   283  C  C     . THR A 1 57  ? -33.272 6.638  11.136  1.00 41.43 ? 40  THR A C     1 
ATOM   284  O  O     . THR A 1 57  ? -33.554 6.221  12.255  1.00 41.31 ? 40  THR A O     1 
ATOM   285  C  CB    . THR A 1 57  ? -34.497 5.473  9.318   1.00 41.71 ? 40  THR A CB    1 
ATOM   286  O  OG1   . THR A 1 57  ? -34.943 6.707  8.761   1.00 40.13 ? 40  THR A OG1   1 
ATOM   287  C  CG2   . THR A 1 57  ? -35.550 4.979  10.339  1.00 42.07 ? 40  THR A CG2   1 
ATOM   288  N  N     . ILE A 1 58  ? -33.141 7.938  10.847  1.00 41.14 ? 41  ILE A N     1 
ATOM   289  C  CA    . ILE A 1 58  ? -33.382 9.004  11.857  1.00 40.67 ? 41  ILE A CA    1 
ATOM   290  C  C     . ILE A 1 58  ? -34.882 9.336  12.104  1.00 40.21 ? 41  ILE A C     1 
ATOM   291  O  O     . ILE A 1 58  ? -35.174 10.305 12.769  1.00 40.41 ? 41  ILE A O     1 
ATOM   292  C  CB    . ILE A 1 58  ? -32.592 10.339 11.524  1.00 40.76 ? 41  ILE A CB    1 
ATOM   293  C  CG1   . ILE A 1 58  ? -33.106 10.972 10.212  1.00 40.58 ? 41  ILE A CG1   1 
ATOM   294  C  CG2   . ILE A 1 58  ? -31.049 10.079 11.504  1.00 40.28 ? 41  ILE A CG2   1 
ATOM   295  C  CD1   . ILE A 1 58  ? -32.463 12.274 9.860   1.00 40.31 ? 41  ILE A CD1   1 
ATOM   296  N  N     . GLY A 1 59  ? -35.813 8.549  11.552  1.00 39.94 ? 42  GLY A N     1 
ATOM   297  C  CA    . GLY A 1 59  ? -37.281 8.675  11.850  1.00 39.96 ? 42  GLY A CA    1 
ATOM   298  C  C     . GLY A 1 59  ? -38.062 9.867  11.283  1.00 39.92 ? 42  GLY A C     1 
ATOM   299  O  O     . GLY A 1 59  ? -39.323 9.974  11.415  1.00 39.62 ? 42  GLY A O     1 
ATOM   300  N  N     . VAL A 1 60  ? -37.323 10.762 10.647  1.00 40.15 ? 43  VAL A N     1 
ATOM   301  C  CA    . VAL A 1 60  ? -37.852 12.020 10.196  1.00 40.14 ? 43  VAL A CA    1 
ATOM   302  C  C     . VAL A 1 60  ? -37.167 12.356 8.890   1.00 40.37 ? 43  VAL A C     1 
ATOM   303  O  O     . VAL A 1 60  ? -36.016 12.000 8.683   1.00 40.07 ? 43  VAL A O     1 
ATOM   304  C  CB    . VAL A 1 60  ? -37.654 13.124 11.280  1.00 39.70 ? 43  VAL A CB    1 
ATOM   305  C  CG1   . VAL A 1 60  ? -38.776 13.045 12.298  1.00 39.33 ? 43  VAL A CG1   1 
ATOM   306  C  CG2   . VAL A 1 60  ? -36.312 12.968 11.973  1.00 38.09 ? 43  VAL A CG2   1 
ATOM   307  N  N     . ASP A 1 61  ? -37.907 13.017 8.002   1.00 41.03 ? 44  ASP A N     1 
ATOM   308  C  CA    . ASP A 1 61  ? -37.425 13.355 6.661   1.00 41.39 ? 44  ASP A CA    1 
ATOM   309  C  C     . ASP A 1 61  ? -36.125 14.182 6.687   1.00 41.80 ? 44  ASP A C     1 
ATOM   310  O  O     . ASP A 1 61  ? -35.270 14.063 5.795   1.00 41.84 ? 44  ASP A O     1 
ATOM   311  C  CB    . ASP A 1 61  ? -38.528 14.106 5.904   1.00 41.35 ? 44  ASP A CB    1 
ATOM   312  C  CG    . ASP A 1 61  ? -39.752 13.231 5.643   1.00 42.94 ? 44  ASP A CG    1 
ATOM   313  O  OD1   . ASP A 1 61  ? -39.620 11.985 5.781   1.00 43.44 ? 44  ASP A OD1   1 
ATOM   314  O  OD2   . ASP A 1 61  ? -40.847 13.775 5.293   1.00 45.01 ? 44  ASP A OD2   1 
ATOM   315  N  N     . PHE A 1 62  ? -35.976 15.014 7.716   1.00 42.16 ? 45  PHE A N     1 
ATOM   316  C  CA    . PHE A 1 62  ? -34.841 15.911 7.805   1.00 42.10 ? 45  PHE A CA    1 
ATOM   317  C  C     . PHE A 1 62  ? -34.748 16.554 9.184   1.00 42.62 ? 45  PHE A C     1 
ATOM   318  O  O     . PHE A 1 62  ? -35.623 16.406 10.045  1.00 42.22 ? 45  PHE A O     1 
ATOM   319  C  CB    . PHE A 1 62  ? -34.973 16.995 6.753   1.00 41.92 ? 45  PHE A CB    1 
ATOM   320  C  CG    . PHE A 1 62  ? -36.264 17.679 6.793   1.00 41.62 ? 45  PHE A CG    1 
ATOM   321  C  CD1   . PHE A 1 62  ? -36.474 18.720 7.662   1.00 42.03 ? 45  PHE A CD1   1 
ATOM   322  C  CD2   . PHE A 1 62  ? -37.299 17.261 5.991   1.00 41.92 ? 45  PHE A CD2   1 
ATOM   323  C  CE1   . PHE A 1 62  ? -37.699 19.353 7.714   1.00 42.69 ? 45  PHE A CE1   1 
ATOM   324  C  CE2   . PHE A 1 62  ? -38.516 17.878 6.032   1.00 42.31 ? 45  PHE A CE2   1 
ATOM   325  C  CZ    . PHE A 1 62  ? -38.724 18.932 6.893   1.00 42.71 ? 45  PHE A CZ    1 
ATOM   326  N  N     . LYS A 1 63  ? -33.661 17.264 9.387   1.00 43.47 ? 46  LYS A N     1 
ATOM   327  C  CA    . LYS A 1 63  ? -33.464 17.996 10.606  1.00 44.20 ? 46  LYS A CA    1 
ATOM   328  C  C     . LYS A 1 63  ? -33.342 19.464 10.254  1.00 44.31 ? 46  LYS A C     1 
ATOM   329  O  O     . LYS A 1 63  ? -32.896 19.808 9.174   1.00 43.84 ? 46  LYS A O     1 
ATOM   330  C  CB    . LYS A 1 63  ? -32.212 17.492 11.343  1.00 43.88 ? 46  LYS A CB    1 
ATOM   331  C  CG    . LYS A 1 63  ? -32.301 16.004 11.811  1.00 43.43 ? 46  LYS A CG    1 
ATOM   332  C  CD    . LYS A 1 63  ? -33.529 15.751 12.689  1.00 42.52 ? 46  LYS A CD    1 
ATOM   333  C  CE    . LYS A 1 63  ? -33.254 14.723 13.795  1.00 42.76 ? 46  LYS A CE    1 
ATOM   334  N  NZ    . LYS A 1 63  ? -34.310 14.785 14.891  1.00 41.64 ? 46  LYS A NZ    1 
ATOM   335  N  N     . ILE A 1 64  ? -33.807 20.309 11.170  1.00 45.32 ? 47  ILE A N     1 
ATOM   336  C  CA    . ILE A 1 64  ? -33.689 21.763 11.069  1.00 45.87 ? 47  ILE A CA    1 
ATOM   337  C  C     . ILE A 1 64  ? -32.794 22.247 12.219  1.00 46.35 ? 47  ILE A C     1 
ATOM   338  O  O     . ILE A 1 64  ? -32.945 21.800 13.359  1.00 46.08 ? 47  ILE A O     1 
ATOM   339  C  CB    . ILE A 1 64  ? -35.082 22.496 11.128  1.00 45.71 ? 47  ILE A CB    1 
ATOM   340  C  CG1   . ILE A 1 64  ? -35.762 22.490 9.738   1.00 45.99 ? 47  ILE A CG1   1 
ATOM   341  C  CG2   . ILE A 1 64  ? -34.900 23.929 11.619  1.00 45.43 ? 47  ILE A CG2   1 
ATOM   342  C  CD1   . ILE A 1 64  ? -37.189 23.240 9.642   1.00 46.21 ? 47  ILE A CD1   1 
ATOM   343  N  N     . ARG A 1 65  ? -31.838 23.134 11.913  1.00 47.24 ? 48  ARG A N     1 
ATOM   344  C  CA    . ARG A 1 65  ? -31.055 23.762 12.969  1.00 47.34 ? 48  ARG A CA    1 
ATOM   345  C  C     . ARG A 1 65  ? -30.616 25.169 12.648  1.00 47.19 ? 48  ARG A C     1 
ATOM   346  O  O     . ARG A 1 65  ? -30.169 25.439 11.544  1.00 47.28 ? 48  ARG A O     1 
ATOM   347  C  CB    . ARG A 1 65  ? -29.825 22.937 13.322  1.00 47.56 ? 48  ARG A CB    1 
ATOM   348  C  CG    . ARG A 1 65  ? -29.253 23.398 14.676  1.00 48.02 ? 48  ARG A CG    1 
ATOM   349  C  CD    . ARG A 1 65  ? -27.925 22.882 14.900  1.00 48.95 ? 48  ARG A CD    1 
ATOM   350  N  NE    . ARG A 1 65  ? -27.039 23.941 15.362  1.00 50.20 ? 48  ARG A NE    1 
ATOM   351  C  CZ    . ARG A 1 65  ? -26.336 23.906 16.478  1.00 49.99 ? 48  ARG A CZ    1 
ATOM   352  N  NH1   . ARG A 1 65  ? -26.389 22.851 17.276  1.00 50.43 ? 48  ARG A NH1   1 
ATOM   353  N  NH2   . ARG A 1 65  ? -25.555 24.929 16.780  1.00 50.63 ? 48  ARG A NH2   1 
ATOM   354  N  N     . THR A 1 66  ? -30.731 26.053 13.643  1.00 47.13 ? 49  THR A N     1 
ATOM   355  C  CA    . THR A 1 66  ? -30.312 27.435 13.507  1.00 47.22 ? 49  THR A CA    1 
ATOM   356  C  C     . THR A 1 66  ? -28.910 27.655 14.132  1.00 47.46 ? 49  THR A C     1 
ATOM   357  O  O     . THR A 1 66  ? -28.520 27.011 15.115  1.00 47.73 ? 49  THR A O     1 
ATOM   358  C  CB    . THR A 1 66  ? -31.358 28.408 14.098  1.00 46.99 ? 49  THR A CB    1 
ATOM   359  O  OG1   . THR A 1 66  ? -32.634 28.150 13.501  1.00 47.18 ? 49  THR A OG1   1 
ATOM   360  C  CG2   . THR A 1 66  ? -30.982 29.832 13.809  1.00 46.76 ? 49  THR A CG2   1 
ATOM   361  N  N     . ILE A 1 67  ? -28.156 28.549 13.500  1.00 47.66 ? 50  ILE A N     1 
ATOM   362  C  CA    . ILE A 1 67  ? -26.827 28.919 13.912  1.00 47.37 ? 50  ILE A CA    1 
ATOM   363  C  C     . ILE A 1 67  ? -26.681 30.414 13.657  1.00 47.87 ? 50  ILE A C     1 
ATOM   364  O  O     . ILE A 1 67  ? -27.432 30.972 12.867  1.00 47.87 ? 50  ILE A O     1 
ATOM   365  C  CB    . ILE A 1 67  ? -25.782 28.162 13.112  1.00 47.00 ? 50  ILE A CB    1 
ATOM   366  C  CG1   . ILE A 1 67  ? -25.937 28.445 11.603  1.00 46.61 ? 50  ILE A CG1   1 
ATOM   367  C  CG2   . ILE A 1 67  ? -25.905 26.692 13.398  1.00 46.18 ? 50  ILE A CG2   1 
ATOM   368  C  CD1   . ILE A 1 67  ? -24.714 28.089 10.755  1.00 46.14 ? 50  ILE A CD1   1 
ATOM   369  N  N     . GLU A 1 68  ? -25.747 31.060 14.355  1.00 48.49 ? 51  GLU A N     1 
ATOM   370  C  CA    . GLU A 1 68  ? -25.400 32.462 14.103  1.00 48.73 ? 51  GLU A CA    1 
ATOM   371  C  C     . GLU A 1 68  ? -24.069 32.380 13.400  1.00 48.77 ? 51  GLU A C     1 
ATOM   372  O  O     . GLU A 1 68  ? -23.328 31.452 13.650  1.00 48.80 ? 51  GLU A O     1 
ATOM   373  C  CB    . GLU A 1 68  ? -25.262 33.230 15.414  1.00 49.10 ? 51  GLU A CB    1 
ATOM   374  C  CG    . GLU A 1 68  ? -26.525 33.233 16.309  1.00 50.81 ? 51  GLU A CG    1 
ATOM   375  C  CD    . GLU A 1 68  ? -27.448 34.463 16.067  1.00 53.82 ? 51  GLU A CD    1 
ATOM   376  O  OE1   . GLU A 1 68  ? -28.437 34.312 15.292  1.00 54.89 ? 51  GLU A OE1   1 
ATOM   377  O  OE2   . GLU A 1 68  ? -27.182 35.574 16.647  1.00 54.04 ? 51  GLU A OE2   1 
ATOM   378  N  N     . LEU A 1 69  ? -23.760 33.316 12.510  1.00 49.09 ? 52  LEU A N     1 
ATOM   379  C  CA    . LEU A 1 69  ? -22.489 33.268 11.754  1.00 49.21 ? 52  LEU A CA    1 
ATOM   380  C  C     . LEU A 1 69  ? -22.204 34.613 11.116  1.00 49.28 ? 52  LEU A C     1 
ATOM   381  O  O     . LEU A 1 69  ? -22.992 35.099 10.299  1.00 49.20 ? 52  LEU A O     1 
ATOM   382  C  CB    . LEU A 1 69  ? -22.558 32.190 10.655  1.00 49.48 ? 52  LEU A CB    1 
ATOM   383  C  CG    . LEU A 1 69  ? -21.296 31.795 9.853   1.00 49.48 ? 52  LEU A CG    1 
ATOM   384  C  CD1   . LEU A 1 69  ? -20.218 31.107 10.717  1.00 49.07 ? 52  LEU A CD1   1 
ATOM   385  C  CD2   . LEU A 1 69  ? -21.697 30.865 8.691   1.00 49.58 ? 52  LEU A CD2   1 
ATOM   386  N  N     . ASP A 1 70  ? -21.083 35.225 11.504  1.00 49.32 ? 53  ASP A N     1 
ATOM   387  C  CA    . ASP A 1 70  ? -20.671 36.537 10.956  1.00 49.09 ? 53  ASP A CA    1 
ATOM   388  C  C     . ASP A 1 70  ? -21.798 37.578 11.023  1.00 48.48 ? 53  ASP A C     1 
ATOM   389  O  O     . ASP A 1 70  ? -21.957 38.433 10.139  1.00 48.06 ? 53  ASP A O     1 
ATOM   390  C  CB    . ASP A 1 70  ? -20.105 36.372 9.516   1.00 49.65 ? 53  ASP A CB    1 
ATOM   391  C  CG    . ASP A 1 70  ? -18.587 35.999 9.511   1.00 50.92 ? 53  ASP A CG    1 
ATOM   392  O  OD1   . ASP A 1 70  ? -18.229 34.888 9.003   1.00 50.68 ? 53  ASP A OD1   1 
ATOM   393  O  OD2   . ASP A 1 70  ? -17.766 36.825 10.041  1.00 52.34 ? 53  ASP A OD2   1 
ATOM   394  N  N     . GLY A 1 71  ? -22.560 37.495 12.106  1.00 48.05 ? 54  GLY A N     1 
ATOM   395  C  CA    . GLY A 1 71  ? -23.659 38.408 12.357  1.00 47.86 ? 54  GLY A CA    1 
ATOM   396  C  C     . GLY A 1 71  ? -24.949 37.924 11.742  1.00 47.49 ? 54  GLY A C     1 
ATOM   397  O  O     . GLY A 1 71  ? -25.993 38.569 11.894  1.00 47.33 ? 54  GLY A O     1 
ATOM   398  N  N     . LYS A 1 72  ? -24.888 36.781 11.055  1.00 47.01 ? 55  LYS A N     1 
ATOM   399  C  CA    . LYS A 1 72  ? -26.029 36.310 10.284  1.00 46.76 ? 55  LYS A CA    1 
ATOM   400  C  C     . LYS A 1 72  ? -26.661 35.139 10.951  1.00 46.23 ? 55  LYS A C     1 
ATOM   401  O  O     . LYS A 1 72  ? -25.973 34.203 11.333  1.00 46.33 ? 55  LYS A O     1 
ATOM   402  C  CB    . LYS A 1 72  ? -25.614 35.908 8.871   1.00 46.37 ? 55  LYS A CB    1 
ATOM   403  C  CG    . LYS A 1 72  ? -24.812 36.951 8.155   1.00 46.31 ? 55  LYS A CG    1 
ATOM   404  C  CD    . LYS A 1 72  ? -25.656 38.133 7.698   1.00 46.20 ? 55  LYS A CD    1 
ATOM   405  C  CE    . LYS A 1 72  ? -24.759 39.294 7.346   1.00 46.04 ? 55  LYS A CE    1 
ATOM   406  N  NZ    . LYS A 1 72  ? -23.420 38.811 6.889   1.00 45.47 ? 55  LYS A NZ    1 
ATOM   407  N  N     . THR A 1 73  ? -27.981 35.200 11.103  1.00 45.74 ? 56  THR A N     1 
ATOM   408  C  CA    . THR A 1 73  ? -28.739 34.079 11.593  1.00 45.38 ? 56  THR A CA    1 
ATOM   409  C  C     . THR A 1 73  ? -29.048 33.208 10.368  1.00 45.14 ? 56  THR A C     1 
ATOM   410  O  O     . THR A 1 73  ? -29.485 33.714 9.327   1.00 44.88 ? 56  THR A O     1 
ATOM   411  C  CB    . THR A 1 73  ? -30.032 34.537 12.287  1.00 45.39 ? 56  THR A CB    1 
ATOM   412  O  OG1   . THR A 1 73  ? -29.739 35.587 13.218  1.00 44.99 ? 56  THR A OG1   1 
ATOM   413  C  CG2   . THR A 1 73  ? -30.687 33.370 13.027  1.00 45.64 ? 56  THR A CG2   1 
ATOM   414  N  N     . ILE A 1 74  ? -28.789 31.913 10.479  1.00 45.04 ? 57  ILE A N     1 
ATOM   415  C  CA    . ILE A 1 74  ? -28.957 31.004 9.348   1.00 45.21 ? 57  ILE A CA    1 
ATOM   416  C  C     . ILE A 1 74  ? -29.625 29.702 9.751   1.00 45.03 ? 57  ILE A C     1 
ATOM   417  O  O     . ILE A 1 74  ? -29.111 28.989 10.564  1.00 44.51 ? 57  ILE A O     1 
ATOM   418  C  CB    . ILE A 1 74  ? -27.595 30.654 8.693   1.00 45.06 ? 57  ILE A CB    1 
ATOM   419  C  CG1   . ILE A 1 74  ? -26.799 31.930 8.417   1.00 44.43 ? 57  ILE A CG1   1 
ATOM   420  C  CG2   . ILE A 1 74  ? -27.811 29.791 7.407   1.00 45.03 ? 57  ILE A CG2   1 
ATOM   421  C  CD1   . ILE A 1 74  ? -25.423 31.692 7.838   1.00 44.71 ? 57  ILE A CD1   1 
ATOM   422  N  N     . LYS A 1 75  ? -30.777 29.415 9.159   1.00 45.66 ? 58  LYS A N     1 
ATOM   423  C  CA    . LYS A 1 75  ? -31.470 28.163 9.380   1.00 45.90 ? 58  LYS A CA    1 
ATOM   424  C  C     . LYS A 1 75  ? -30.827 27.123 8.469   1.00 45.88 ? 58  LYS A C     1 
ATOM   425  O  O     . LYS A 1 75  ? -30.379 27.435 7.348   1.00 46.18 ? 58  LYS A O     1 
ATOM   426  C  CB    . LYS A 1 75  ? -32.975 28.326 9.080   1.00 46.11 ? 58  LYS A CB    1 
ATOM   427  C  CG    . LYS A 1 75  ? -33.889 27.270 9.747   1.00 46.86 ? 58  LYS A CG    1 
ATOM   428  C  CD    . LYS A 1 75  ? -35.337 27.826 10.105  1.00 47.30 ? 58  LYS A CD    1 
ATOM   429  C  CE    . LYS A 1 75  ? -36.141 26.795 11.043  1.00 49.33 ? 58  LYS A CE    1 
ATOM   430  N  NZ    . LYS A 1 75  ? -37.367 27.328 11.870  1.00 49.47 ? 58  LYS A NZ    1 
ATOM   431  N  N     . LEU A 1 76  ? -30.720 25.898 8.952   1.00 45.83 ? 59  LEU A N     1 
ATOM   432  C  CA    . LEU A 1 76  ? -30.178 24.812 8.122   1.00 45.73 ? 59  LEU A CA    1 
ATOM   433  C  C     . LEU A 1 76  ? -31.258 23.761 8.000   1.00 45.97 ? 59  LEU A C     1 
ATOM   434  O  O     . LEU A 1 76  ? -32.036 23.539 8.945   1.00 45.98 ? 59  LEU A O     1 
ATOM   435  C  CB    . LEU A 1 76  ? -28.887 24.200 8.718   1.00 45.40 ? 59  LEU A CB    1 
ATOM   436  C  CG    . LEU A 1 76  ? -27.681 25.154 8.944   1.00 44.10 ? 59  LEU A CG    1 
ATOM   437  C  CD1   . LEU A 1 76  ? -26.635 24.493 9.791   1.00 41.67 ? 59  LEU A CD1   1 
ATOM   438  C  CD2   . LEU A 1 76  ? -27.062 25.663 7.627   1.00 42.18 ? 59  LEU A CD2   1 
ATOM   439  N  N     . GLN A 1 77  ? -31.346 23.157 6.828   1.00 45.93 ? 60  GLN A N     1 
ATOM   440  C  CA    . GLN A 1 77  ? -32.226 22.037 6.635   1.00 46.06 ? 60  GLN A CA    1 
ATOM   441  C  C     . GLN A 1 77  ? -31.361 20.892 6.102   1.00 45.49 ? 60  GLN A C     1 
ATOM   442  O  O     . GLN A 1 77  ? -30.816 20.976 5.009   1.00 45.33 ? 60  GLN A O     1 
ATOM   443  C  CB    . GLN A 1 77  ? -33.339 22.418 5.671   1.00 46.38 ? 60  GLN A CB    1 
ATOM   444  C  CG    . GLN A 1 77  ? -34.525 21.467 5.679   1.00 46.81 ? 60  GLN A CG    1 
ATOM   445  C  CD    . GLN A 1 77  ? -35.602 21.900 4.694   1.00 48.11 ? 60  GLN A CD    1 
ATOM   446  O  OE1   . GLN A 1 77  ? -35.410 22.863 3.914   1.00 50.95 ? 60  GLN A OE1   1 
ATOM   447  N  NE2   . GLN A 1 77  ? -36.748 21.188 4.708   1.00 50.26 ? 60  GLN A NE2   1 
ATOM   448  N  N     . ILE A 1 78  ? -31.225 19.831 6.892   1.00 45.21 ? 61  ILE A N     1 
ATOM   449  C  CA    . ILE A 1 78  ? -30.224 18.767 6.622   1.00 45.11 ? 61  ILE A CA    1 
ATOM   450  C  C     . ILE A 1 78  ? -30.854 17.354 6.360   1.00 45.21 ? 61  ILE A C     1 
ATOM   451  O  O     . ILE A 1 78  ? -31.705 16.894 7.141   1.00 45.15 ? 61  ILE A O     1 
ATOM   452  C  CB    . ILE A 1 78  ? -29.181 18.698 7.820   1.00 44.96 ? 61  ILE A CB    1 
ATOM   453  C  CG1   . ILE A 1 78  ? -28.653 20.119 8.169   1.00 43.75 ? 61  ILE A CG1   1 
ATOM   454  C  CG2   . ILE A 1 78  ? -28.056 17.736 7.490   1.00 44.33 ? 61  ILE A CG2   1 
ATOM   455  C  CD1   . ILE A 1 78  ? -28.348 20.338 9.604   1.00 44.00 ? 61  ILE A CD1   1 
ATOM   456  N  N     . TRP A 1 79  ? -30.423 16.688 5.267   1.00 45.26 ? 62  TRP A N     1 
ATOM   457  C  CA    . TRP A 1 79  ? -30.895 15.319 4.896   1.00 45.17 ? 62  TRP A CA    1 
ATOM   458  C  C     . TRP A 1 79  ? -29.834 14.234 5.147   1.00 45.10 ? 62  TRP A C     1 
ATOM   459  O  O     . TRP A 1 79  ? -28.656 14.534 5.190   1.00 44.85 ? 62  TRP A O     1 
ATOM   460  C  CB    . TRP A 1 79  ? -31.317 15.282 3.420   1.00 45.28 ? 62  TRP A CB    1 
ATOM   461  C  CG    . TRP A 1 79  ? -32.708 15.789 3.179   1.00 45.34 ? 62  TRP A CG    1 
ATOM   462  C  CD1   . TRP A 1 79  ? -33.844 15.035 3.038   1.00 45.85 ? 62  TRP A CD1   1 
ATOM   463  C  CD2   . TRP A 1 79  ? -33.124 17.157 3.075   1.00 45.14 ? 62  TRP A CD2   1 
ATOM   464  N  NE1   . TRP A 1 79  ? -34.937 15.846 2.848   1.00 45.98 ? 62  TRP A NE1   1 
ATOM   465  C  CE2   . TRP A 1 79  ? -34.526 17.155 2.865   1.00 45.77 ? 62  TRP A CE2   1 
ATOM   466  C  CE3   . TRP A 1 79  ? -32.457 18.376 3.135   1.00 45.31 ? 62  TRP A CE3   1 
ATOM   467  C  CZ2   . TRP A 1 79  ? -35.270 18.337 2.710   1.00 45.70 ? 62  TRP A CZ2   1 
ATOM   468  C  CZ3   . TRP A 1 79  ? -33.200 19.550 2.973   1.00 45.89 ? 62  TRP A CZ3   1 
ATOM   469  C  CH2   . TRP A 1 79  ? -34.590 19.517 2.762   1.00 45.64 ? 62  TRP A CH2   1 
ATOM   470  N  N     . ASP A 1 80  ? -30.273 12.974 5.280   1.00 45.37 ? 63  ASP A N     1 
ATOM   471  C  CA    . ASP A 1 80  ? -29.389 11.832 5.589   1.00 45.30 ? 63  ASP A CA    1 
ATOM   472  C  C     . ASP A 1 80  ? -29.945 10.541 5.007   1.00 45.68 ? 63  ASP A C     1 
ATOM   473  O  O     . ASP A 1 80  ? -30.468 10.516 3.890   1.00 46.42 ? 63  ASP A O     1 
ATOM   474  C  CB    . ASP A 1 80  ? -29.236 11.693 7.107   1.00 45.22 ? 63  ASP A CB    1 
ATOM   475  C  CG    . ASP A 1 80  ? -28.596 10.371 7.526   1.00 45.37 ? 63  ASP A CG    1 
ATOM   476  O  OD1   . ASP A 1 80  ? -27.798 9.830  6.752   1.00 47.08 ? 63  ASP A OD1   1 
ATOM   477  O  OD2   . ASP A 1 80  ? -28.881 9.870  8.643   1.00 45.36 ? 63  ASP A OD2   1 
ATOM   478  N  N     . TYR A 1 95  ? -30.791 16.668 -3.833  1.00 49.73 ? 78  TYR A N     1 
ATOM   479  C  CA    . TYR A 1 95  ? -29.538 16.753 -4.599  1.00 49.70 ? 78  TYR A CA    1 
ATOM   480  C  C     . TYR A 1 95  ? -29.444 18.076 -5.389  1.00 49.36 ? 78  TYR A C     1 
ATOM   481  O  O     . TYR A 1 95  ? -28.467 18.828 -5.263  1.00 49.21 ? 78  TYR A O     1 
ATOM   482  C  CB    . TYR A 1 95  ? -29.419 15.549 -5.569  1.00 50.45 ? 78  TYR A CB    1 
ATOM   483  C  CG    . TYR A 1 95  ? -28.378 14.438 -5.196  1.00 51.14 ? 78  TYR A CG    1 
ATOM   484  C  CD1   . TYR A 1 95  ? -27.045 14.756 -4.791  1.00 51.64 ? 78  TYR A CD1   1 
ATOM   485  C  CD2   . TYR A 1 95  ? -28.712 13.064 -5.315  1.00 52.07 ? 78  TYR A CD2   1 
ATOM   486  C  CE1   . TYR A 1 95  ? -26.080 13.709 -4.470  1.00 51.06 ? 78  TYR A CE1   1 
ATOM   487  C  CE2   . TYR A 1 95  ? -27.758 12.020 -4.999  1.00 51.65 ? 78  TYR A CE2   1 
ATOM   488  C  CZ    . TYR A 1 95  ? -26.458 12.357 -4.581  1.00 51.11 ? 78  TYR A CZ    1 
ATOM   489  O  OH    . TYR A 1 95  ? -25.568 11.337 -4.292  1.00 50.73 ? 78  TYR A OH    1 
ATOM   490  N  N     . ARG A 1 96  ? -30.470 18.351 -6.203  1.00 48.91 ? 79  ARG A N     1 
ATOM   491  C  CA    . ARG A 1 96  ? -30.508 19.580 -7.017  1.00 48.40 ? 79  ARG A CA    1 
ATOM   492  C  C     . ARG A 1 96  ? -30.792 20.873 -6.212  1.00 47.75 ? 79  ARG A C     1 
ATOM   493  O  O     . ARG A 1 96  ? -30.392 21.987 -6.623  1.00 47.89 ? 79  ARG A O     1 
ATOM   494  C  CB    . ARG A 1 96  ? -31.523 19.455 -8.150  1.00 48.43 ? 79  ARG A CB    1 
ATOM   495  C  CG    . ARG A 1 96  ? -31.335 20.556 -9.155  1.00 48.94 ? 79  ARG A CG    1 
ATOM   496  C  CD    . ARG A 1 96  ? -32.016 20.294 -10.450 1.00 49.52 ? 79  ARG A CD    1 
ATOM   497  N  NE    . ARG A 1 96  ? -31.560 21.246 -11.467 1.00 49.88 ? 79  ARG A NE    1 
ATOM   498  C  CZ    . ARG A 1 96  ? -32.152 21.419 -12.653 1.00 51.25 ? 79  ARG A CZ    1 
ATOM   499  N  NH1   . ARG A 1 96  ? -33.236 20.701 -12.993 1.00 51.13 ? 79  ARG A NH1   1 
ATOM   500  N  NH2   . ARG A 1 96  ? -31.660 22.319 -13.510 1.00 51.63 ? 79  ARG A NH2   1 
ATOM   501  N  N     . GLY A 1 97  ? -31.481 20.716 -5.083  1.00 46.76 ? 80  GLY A N     1 
ATOM   502  C  CA    . GLY A 1 97  ? -31.845 21.817 -4.238  1.00 45.75 ? 80  GLY A CA    1 
ATOM   503  C  C     . GLY A 1 97  ? -30.924 21.977 -3.068  1.00 45.04 ? 80  GLY A C     1 
ATOM   504  O  O     . GLY A 1 97  ? -31.213 22.765 -2.189  1.00 45.20 ? 80  GLY A O     1 
ATOM   505  N  N     . ALA A 1 98  ? -29.814 21.241 -3.028  1.00 44.28 ? 81  ALA A N     1 
ATOM   506  C  CA    . ALA A 1 98  ? -28.854 21.424 -1.942  1.00 43.78 ? 81  ALA A CA    1 
ATOM   507  C  C     . ALA A 1 98  ? -27.884 22.562 -2.288  1.00 43.38 ? 81  ALA A C     1 
ATOM   508  O  O     . ALA A 1 98  ? -27.473 22.739 -3.457  1.00 42.93 ? 81  ALA A O     1 
ATOM   509  C  CB    . ALA A 1 98  ? -28.105 20.154 -1.648  1.00 43.66 ? 81  ALA A CB    1 
ATOM   510  N  N     . HIS A 1 99  ? -27.564 23.357 -1.263  1.00 42.97 ? 82  HIS A N     1 
ATOM   511  C  CA    . HIS A 1 99  ? -26.615 24.464 -1.386  1.00 42.66 ? 82  HIS A CA    1 
ATOM   512  C  C     . HIS A 1 99  ? -25.226 23.896 -1.249  1.00 42.55 ? 82  HIS A C     1 
ATOM   513  O  O     . HIS A 1 99  ? -24.292 24.319 -1.923  1.00 42.30 ? 82  HIS A O     1 
ATOM   514  C  CB    . HIS A 1 99  ? -26.849 25.515 -0.300  1.00 42.02 ? 82  HIS A CB    1 
ATOM   515  C  CG    . HIS A 1 99  ? -28.152 26.238 -0.430  1.00 40.74 ? 82  HIS A CG    1 
ATOM   516  N  ND1   . HIS A 1 99  ? -28.235 27.564 -0.789  1.00 39.09 ? 82  HIS A ND1   1 
ATOM   517  C  CD2   . HIS A 1 99  ? -29.425 25.817 -0.259  1.00 39.04 ? 82  HIS A CD2   1 
ATOM   518  C  CE1   . HIS A 1 99  ? -29.503 27.932 -0.825  1.00 38.49 ? 82  HIS A CE1   1 
ATOM   519  N  NE2   . HIS A 1 99  ? -30.244 26.890 -0.499  1.00 38.32 ? 82  HIS A NE2   1 
ATOM   520  N  N     . GLY A 1 100 ? -25.112 22.924 -0.351  1.00 42.82 ? 83  GLY A N     1 
ATOM   521  C  CA    . GLY A 1 100 ? -23.862 22.221 -0.095  1.00 42.76 ? 83  GLY A CA    1 
ATOM   522  C  C     . GLY A 1 100 ? -24.137 20.773 0.282   1.00 42.78 ? 83  GLY A C     1 
ATOM   523  O  O     . GLY A 1 100 ? -25.164 20.456 0.896   1.00 43.07 ? 83  GLY A O     1 
ATOM   524  N  N     . ILE A 1 101 ? -23.224 19.895 -0.105  1.00 42.54 ? 84  ILE A N     1 
ATOM   525  C  CA    . ILE A 1 101 ? -23.317 18.475 0.212   1.00 42.40 ? 84  ILE A CA    1 
ATOM   526  C  C     . ILE A 1 101 ? -22.065 18.096 1.012   1.00 42.18 ? 84  ILE A C     1 
ATOM   527  O  O     . ILE A 1 101 ? -20.974 18.597 0.730   1.00 42.16 ? 84  ILE A O     1 
ATOM   528  C  CB    . ILE A 1 101 ? -23.459 17.639 -1.101  1.00 42.34 ? 84  ILE A CB    1 
ATOM   529  C  CG1   . ILE A 1 101 ? -24.880 17.790 -1.645  1.00 42.06 ? 84  ILE A CG1   1 
ATOM   530  C  CG2   . ILE A 1 101 ? -23.143 16.181 -0.860  1.00 42.08 ? 84  ILE A CG2   1 
ATOM   531  C  CD1   . ILE A 1 101 ? -24.981 17.782 -3.127  1.00 42.09 ? 84  ILE A CD1   1 
ATOM   532  N  N     . ILE A 1 102 ? -22.225 17.264 2.030   1.00 41.90 ? 85  ILE A N     1 
ATOM   533  C  CA    . ILE A 1 102 ? -21.087 16.842 2.836   1.00 42.02 ? 85  ILE A CA    1 
ATOM   534  C  C     . ILE A 1 102 ? -20.839 15.388 2.558   1.00 42.25 ? 85  ILE A C     1 
ATOM   535  O  O     . ILE A 1 102 ? -21.771 14.554 2.664   1.00 42.25 ? 85  ILE A O     1 
ATOM   536  C  CB    . ILE A 1 102 ? -21.330 17.023 4.327   1.00 42.16 ? 85  ILE A CB    1 
ATOM   537  C  CG1   . ILE A 1 102 ? -21.719 18.481 4.631   1.00 42.07 ? 85  ILE A CG1   1 
ATOM   538  C  CG2   . ILE A 1 102 ? -20.076 16.645 5.101   1.00 41.98 ? 85  ILE A CG2   1 
ATOM   539  C  CD1   . ILE A 1 102 ? -21.889 18.773 6.090   1.00 41.84 ? 85  ILE A CD1   1 
ATOM   540  N  N     . VAL A 1 103 ? -19.598 15.074 2.169   1.00 42.16 ? 86  VAL A N     1 
ATOM   541  C  CA    . VAL A 1 103 ? -19.248 13.721 1.761   1.00 42.09 ? 86  VAL A CA    1 
ATOM   542  C  C     . VAL A 1 103 ? -18.436 13.133 2.879   1.00 42.20 ? 86  VAL A C     1 
ATOM   543  O  O     . VAL A 1 103 ? -17.289 13.491 3.086   1.00 42.55 ? 86  VAL A O     1 
ATOM   544  C  CB    . VAL A 1 103 ? -18.459 13.667 0.412   1.00 41.85 ? 86  VAL A CB    1 
ATOM   545  C  CG1   . VAL A 1 103 ? -18.185 12.221 0.011   1.00 41.85 ? 86  VAL A CG1   1 
ATOM   546  C  CG2   . VAL A 1 103 ? -19.218 14.361 -0.705  1.00 41.68 ? 86  VAL A CG2   1 
ATOM   547  N  N     . VAL A 1 104 ? -19.061 12.233 3.621   1.00 42.56 ? 87  VAL A N     1 
ATOM   548  C  CA    . VAL A 1 104 ? -18.436 11.623 4.784   1.00 42.30 ? 87  VAL A CA    1 
ATOM   549  C  C     . VAL A 1 104 ? -17.759 10.298 4.405   1.00 42.39 ? 87  VAL A C     1 
ATOM   550  O  O     . VAL A 1 104 ? -18.182 9.586  3.455   1.00 41.96 ? 87  VAL A O     1 
ATOM   551  C  CB    . VAL A 1 104 ? -19.474 11.362 5.942   1.00 42.28 ? 87  VAL A CB    1 
ATOM   552  C  CG1   . VAL A 1 104 ? -18.757 11.029 7.238   1.00 41.81 ? 87  VAL A CG1   1 
ATOM   553  C  CG2   . VAL A 1 104 ? -20.405 12.574 6.130   1.00 41.67 ? 87  VAL A CG2   1 
ATOM   554  N  N     . TYR A 1 105 ? -16.687 10.007 5.144   1.00 42.32 ? 88  TYR A N     1 
ATOM   555  C  CA    . TYR A 1 105 ? -16.006 8.724  5.096   1.00 42.03 ? 88  TYR A CA    1 
ATOM   556  C  C     . TYR A 1 105 ? -15.468 8.460  6.529   1.00 41.72 ? 88  TYR A C     1 
ATOM   557  O  O     . TYR A 1 105 ? -15.645 9.289  7.426   1.00 41.55 ? 88  TYR A O     1 
ATOM   558  C  CB    . TYR A 1 105 ? -14.914 8.709  4.014   1.00 42.10 ? 88  TYR A CB    1 
ATOM   559  C  CG    . TYR A 1 105 ? -13.676 9.413  4.398   1.00 42.19 ? 88  TYR A CG    1 
ATOM   560  C  CD1   . TYR A 1 105 ? -12.585 8.706  4.914   1.00 42.48 ? 88  TYR A CD1   1 
ATOM   561  C  CD2   . TYR A 1 105 ? -13.576 10.793 4.272   1.00 43.35 ? 88  TYR A CD2   1 
ATOM   562  C  CE1   . TYR A 1 105 ? -11.414 9.354  5.290   1.00 42.77 ? 88  TYR A CE1   1 
ATOM   563  C  CE2   . TYR A 1 105 ? -12.398 11.474 4.654   1.00 43.41 ? 88  TYR A CE2   1 
ATOM   564  C  CZ    . TYR A 1 105 ? -11.318 10.742 5.158   1.00 43.03 ? 88  TYR A CZ    1 
ATOM   565  O  OH    . TYR A 1 105 ? -10.161 11.391 5.527   1.00 42.72 ? 88  TYR A OH    1 
ATOM   566  N  N     . ASP A 1 106 ? -14.829 7.316  6.726   1.00 41.46 ? 89  ASP A N     1 
ATOM   567  C  CA    . ASP A 1 106 ? -14.428 6.842  8.050   1.00 41.53 ? 89  ASP A CA    1 
ATOM   568  C  C     . ASP A 1 106 ? -12.931 6.629  8.074   1.00 41.31 ? 89  ASP A C     1 
ATOM   569  O  O     . ASP A 1 106 ? -12.394 5.874  7.286   1.00 41.18 ? 89  ASP A O     1 
ATOM   570  C  CB    . ASP A 1 106 ? -15.199 5.536  8.349   1.00 41.55 ? 89  ASP A CB    1 
ATOM   571  C  CG    . ASP A 1 106 ? -14.746 4.843  9.606   1.00 41.07 ? 89  ASP A CG    1 
ATOM   572  O  OD1   . ASP A 1 106 ? -13.721 5.235  10.171  1.00 41.53 ? 89  ASP A OD1   1 
ATOM   573  O  OD2   . ASP A 1 106 ? -15.423 3.888  10.024  1.00 39.47 ? 89  ASP A OD2   1 
ATOM   574  N  N     . VAL A 1 107 ? -12.254 7.295  8.998   1.00 41.81 ? 90  VAL A N     1 
ATOM   575  C  CA    . VAL A 1 107 ? -10.769 7.252  9.061   1.00 42.12 ? 90  VAL A CA    1 
ATOM   576  C  C     . VAL A 1 107 ? -10.207 5.810  9.288   1.00 42.17 ? 90  VAL A C     1 
ATOM   577  O  O     . VAL A 1 107 ? -9.039  5.535  8.954   1.00 41.59 ? 90  VAL A O     1 
ATOM   578  C  CB    . VAL A 1 107 ? -10.201 8.263  10.154  1.00 42.11 ? 90  VAL A CB    1 
ATOM   579  C  CG1   . VAL A 1 107 ? -10.780 9.670  9.950   1.00 42.07 ? 90  VAL A CG1   1 
ATOM   580  C  CG2   . VAL A 1 107 ? -10.464 7.751  11.598  1.00 41.67 ? 90  VAL A CG2   1 
ATOM   581  N  N     . THR A 1 108 ? -11.068 4.927  9.847   1.00 42.42 ? 91  THR A N     1 
ATOM   582  C  CA    . THR A 1 108 ? -10.747 3.515  10.149  1.00 42.63 ? 91  THR A CA    1 
ATOM   583  C  C     . THR A 1 108 ? -11.156 2.556  9.011   1.00 43.08 ? 91  THR A C     1 
ATOM   584  O  O     . THR A 1 108 ? -10.859 1.331  9.069   1.00 43.23 ? 91  THR A O     1 
ATOM   585  C  CB    . THR A 1 108 ? -11.427 3.019  11.497  1.00 42.34 ? 91  THR A CB    1 
ATOM   586  O  OG1   . THR A 1 108 ? -12.773 2.569  11.257  1.00 41.39 ? 91  THR A OG1   1 
ATOM   587  C  CG2   . THR A 1 108 ? -11.411 4.116  12.556  1.00 41.98 ? 91  THR A CG2   1 
ATOM   588  N  N     . ASP A 1 109 ? -11.831 3.100  7.991   1.00 43.28 ? 92  ASP A N     1 
ATOM   589  C  CA    . ASP A 1 109 ? -12.255 2.306  6.850   1.00 43.63 ? 92  ASP A CA    1 
ATOM   590  C  C     . ASP A 1 109 ? -11.730 2.930  5.554   1.00 43.57 ? 92  ASP A C     1 
ATOM   591  O  O     . ASP A 1 109 ? -12.235 3.922  5.073   1.00 43.66 ? 92  ASP A O     1 
ATOM   592  C  CB    . ASP A 1 109 ? -13.785 2.163  6.828   1.00 44.03 ? 92  ASP A CB    1 
ATOM   593  C  CG    . ASP A 1 109 ? -14.247 0.804  6.276   1.00 45.08 ? 92  ASP A CG    1 
ATOM   594  O  OD1   . ASP A 1 109 ? -13.417 0.100  5.635   1.00 45.26 ? 92  ASP A OD1   1 
ATOM   595  O  OD2   . ASP A 1 109 ? -15.448 0.438  6.515   1.00 46.43 ? 92  ASP A OD2   1 
ATOM   596  N  N     . GLN A 1 110 ? -10.693 2.321  5.011   1.00 43.83 ? 93  GLN A N     1 
ATOM   597  C  CA    . GLN A 1 110 ? -10.038 2.788  3.801   1.00 43.83 ? 93  GLN A CA    1 
ATOM   598  C  C     . GLN A 1 110 ? -10.926 2.595  2.598   1.00 43.76 ? 93  GLN A C     1 
ATOM   599  O  O     . GLN A 1 110 ? -10.809 3.308  1.611   1.00 43.51 ? 93  GLN A O     1 
ATOM   600  C  CB    . GLN A 1 110 ? -8.743  1.996  3.627   1.00 44.14 ? 93  GLN A CB    1 
ATOM   601  C  CG    . GLN A 1 110 ? -8.018  2.190  2.301   1.00 44.25 ? 93  GLN A CG    1 
ATOM   602  C  CD    . GLN A 1 110 ? -7.418  3.563  2.148   1.00 43.34 ? 93  GLN A CD    1 
ATOM   603  O  OE1   . GLN A 1 110 ? -6.467  3.924  2.854   1.00 42.58 ? 93  GLN A OE1   1 
ATOM   604  N  NE2   . GLN A 1 110 ? -7.957  4.338  1.205   1.00 42.74 ? 93  GLN A NE2   1 
ATOM   605  N  N     . GLU A 1 111 ? -11.803 1.605  2.696   1.00 44.15 ? 94  GLU A N     1 
ATOM   606  C  CA    . GLU A 1 111 ? -12.822 1.325  1.686   1.00 44.14 ? 94  GLU A CA    1 
ATOM   607  C  C     . GLU A 1 111 ? -13.749 2.540  1.492   1.00 43.95 ? 94  GLU A C     1 
ATOM   608  O  O     . GLU A 1 111 ? -13.981 3.002  0.374   1.00 43.47 ? 94  GLU A O     1 
ATOM   609  C  CB    . GLU A 1 111 ? -13.608 0.060  2.120   1.00 44.50 ? 94  GLU A CB    1 
ATOM   610  C  CG    . GLU A 1 111 ? -14.929 -0.245 1.389   1.00 44.99 ? 94  GLU A CG    1 
ATOM   611  C  CD    . GLU A 1 111 ? -14.738 -0.457 -0.083  1.00 47.33 ? 94  GLU A CD    1 
ATOM   612  O  OE1   . GLU A 1 111 ? -13.776 0.132  -0.633  1.00 47.94 ? 94  GLU A OE1   1 
ATOM   613  O  OE2   . GLU A 1 111 ? -15.548 -1.214 -0.698  1.00 48.73 ? 94  GLU A OE2   1 
ATOM   614  N  N     . SER A 1 112 ? -14.265 3.064  2.585   1.00 43.89 ? 95  SER A N     1 
ATOM   615  C  CA    . SER A 1 112 ? -15.112 4.240  2.499   1.00 44.19 ? 95  SER A CA    1 
ATOM   616  C  C     . SER A 1 112 ? -14.373 5.471  1.931   1.00 44.37 ? 95  SER A C     1 
ATOM   617  O  O     . SER A 1 112 ? -14.995 6.337  1.298   1.00 44.23 ? 95  SER A O     1 
ATOM   618  C  CB    . SER A 1 112 ? -15.709 4.576  3.873   1.00 44.04 ? 95  SER A CB    1 
ATOM   619  O  OG    . SER A 1 112 ? -14.693 4.822  4.803   1.00 43.40 ? 95  SER A OG    1 
ATOM   620  N  N     . PHE A 1 113 ? -13.065 5.569  2.158   1.00 44.65 ? 96  PHE A N     1 
ATOM   621  C  CA    . PHE A 1 113 ? -12.334 6.710  1.638   1.00 44.65 ? 96  PHE A CA    1 
ATOM   622  C  C     . PHE A 1 113 ? -12.218 6.640  0.143   1.00 44.85 ? 96  PHE A C     1 
ATOM   623  O  O     . PHE A 1 113 ? -12.433 7.633  -0.557  1.00 45.11 ? 96  PHE A O     1 
ATOM   624  C  CB    . PHE A 1 113 ? -10.938 6.809  2.200   1.00 44.95 ? 96  PHE A CB    1 
ATOM   625  C  CG    . PHE A 1 113 ? -10.145 7.979  1.630   1.00 45.03 ? 96  PHE A CG    1 
ATOM   626  C  CD1   . PHE A 1 113 ? -10.571 9.297  1.844   1.00 45.05 ? 96  PHE A CD1   1 
ATOM   627  C  CD2   . PHE A 1 113 ? -9.001  7.768  0.886   1.00 44.50 ? 96  PHE A CD2   1 
ATOM   628  C  CE1   . PHE A 1 113 ? -9.865  10.361 1.332   1.00 44.75 ? 96  PHE A CE1   1 
ATOM   629  C  CE2   . PHE A 1 113 ? -8.294  8.833  0.372   1.00 44.65 ? 96  PHE A CE2   1 
ATOM   630  C  CZ    . PHE A 1 113 ? -8.722  10.132 0.600   1.00 45.02 ? 96  PHE A CZ    1 
ATOM   631  N  N     . ASN A 1 114 ? -11.858 5.481  -0.369  1.00 44.71 ? 97  ASN A N     1 
ATOM   632  C  CA    . ASN A 1 114 ? -11.765 5.352  -1.801  1.00 44.88 ? 97  ASN A CA    1 
ATOM   633  C  C     . ASN A 1 114 ? -13.097 5.701  -2.477  1.00 44.95 ? 97  ASN A C     1 
ATOM   634  O  O     . ASN A 1 114 ? -13.121 6.405  -3.476  1.00 44.87 ? 97  ASN A O     1 
ATOM   635  C  CB    . ASN A 1 114 ? -11.271 3.965  -2.178  1.00 44.85 ? 97  ASN A CB    1 
ATOM   636  C  CG    . ASN A 1 114 ? -9.848  3.731  -1.728  1.00 45.31 ? 97  ASN A CG    1 
ATOM   637  O  OD1   . ASN A 1 114 ? -9.103  4.681  -1.445  1.00 45.01 ? 97  ASN A OD1   1 
ATOM   638  N  ND2   . ASN A 1 114 ? -9.457  2.472  -1.648  1.00 46.39 ? 97  ASN A ND2   1 
ATOM   639  N  N     . ASN A 1 115 ? -14.210 5.260  -1.902  1.00 45.25 ? 98  ASN A N     1 
ATOM   640  C  CA    . ASN A 1 115 ? -15.513 5.532  -2.512  1.00 45.38 ? 98  ASN A CA    1 
ATOM   641  C  C     . ASN A 1 115 ? -15.934 7.001  -2.566  1.00 45.47 ? 98  ASN A C     1 
ATOM   642  O  O     . ASN A 1 115 ? -16.933 7.323  -3.206  1.00 45.78 ? 98  ASN A O     1 
ATOM   643  C  CB    . ASN A 1 115 ? -16.596 4.717  -1.827  1.00 45.54 ? 98  ASN A CB    1 
ATOM   644  C  CG    . ASN A 1 115 ? -16.464 3.264  -2.113  1.00 46.15 ? 98  ASN A CG    1 
ATOM   645  O  OD1   . ASN A 1 115 ? -16.332 2.854  -3.275  1.00 46.17 ? 98  ASN A OD1   1 
ATOM   646  N  ND2   . ASN A 1 115 ? -16.489 2.452  -1.059  1.00 47.95 ? 98  ASN A ND2   1 
ATOM   647  N  N     . VAL A 1 116 ? -15.202 7.889  -1.896  1.00 45.47 ? 99  VAL A N     1 
ATOM   648  C  CA    . VAL A 1 116 ? -15.487 9.317  -2.008  1.00 45.44 ? 99  VAL A CA    1 
ATOM   649  C  C     . VAL A 1 116 ? -15.442 9.706  -3.504  1.00 45.49 ? 99  VAL A C     1 
ATOM   650  O  O     . VAL A 1 116 ? -16.280 10.468 -3.992  1.00 45.63 ? 99  VAL A O     1 
ATOM   651  C  CB    . VAL A 1 116 ? -14.527 10.176 -1.110  1.00 45.29 ? 99  VAL A CB    1 
ATOM   652  C  CG1   . VAL A 1 116 ? -14.421 11.587 -1.609  1.00 45.09 ? 99  VAL A CG1   1 
ATOM   653  C  CG2   . VAL A 1 116 ? -15.013 10.162 0.343   1.00 44.99 ? 99  VAL A CG2   1 
ATOM   654  N  N     . LYS A 1 117 ? -14.502 9.131  -4.231  1.00 45.56 ? 100 LYS A N     1 
ATOM   655  C  CA    . LYS A 1 117 ? -14.382 9.381  -5.655  1.00 45.72 ? 100 LYS A CA    1 
ATOM   656  C  C     . LYS A 1 117 ? -15.737 9.251  -6.394  1.00 45.78 ? 100 LYS A C     1 
ATOM   657  O  O     . LYS A 1 117 ? -16.103 10.119 -7.196  1.00 45.77 ? 100 LYS A O     1 
ATOM   658  C  CB    . LYS A 1 117 ? -13.332 8.438  -6.220  1.00 45.64 ? 100 LYS A CB    1 
ATOM   659  C  CG    . LYS A 1 117 ? -13.209 8.391  -7.723  1.00 46.06 ? 100 LYS A CG    1 
ATOM   660  C  CD    . LYS A 1 117 ? -11.962 7.565  -8.115  1.00 46.30 ? 100 LYS A CD    1 
ATOM   661  C  CE    . LYS A 1 117 ? -12.028 7.028  -9.543  1.00 46.86 ? 100 LYS A CE    1 
ATOM   662  N  NZ    . LYS A 1 117 ? -12.850 5.790  -9.643  1.00 47.94 ? 100 LYS A NZ    1 
ATOM   663  N  N     . GLN A 1 118 ? -16.479 8.177  -6.115  1.00 45.94 ? 101 GLN A N     1 
ATOM   664  C  CA    . GLN A 1 118 ? -17.793 7.950  -6.754  1.00 45.90 ? 101 GLN A CA    1 
ATOM   665  C  C     . GLN A 1 118 ? -18.796 8.968  -6.274  1.00 45.89 ? 101 GLN A C     1 
ATOM   666  O  O     . GLN A 1 118 ? -19.554 9.549  -7.067  1.00 45.81 ? 101 GLN A O     1 
ATOM   667  C  CB    . GLN A 1 118 ? -18.337 6.547  -6.447  1.00 45.92 ? 101 GLN A CB    1 
ATOM   668  C  CG    . GLN A 1 118 ? -17.869 5.477  -7.396  1.00 46.53 ? 101 GLN A CG    1 
ATOM   669  C  CD    . GLN A 1 118 ? -16.369 5.256  -7.345  1.00 47.31 ? 101 GLN A CD    1 
ATOM   670  O  OE1   . GLN A 1 118 ? -15.769 5.258  -6.268  1.00 47.12 ? 101 GLN A OE1   1 
ATOM   671  N  NE2   . GLN A 1 118 ? -15.751 5.051  -8.519  1.00 48.01 ? 101 GLN A NE2   1 
ATOM   672  N  N     . TRP A 1 119 ? -18.790 9.185  -4.961  1.00 45.90 ? 102 TRP A N     1 
ATOM   673  C  CA    . TRP A 1 119 ? -19.739 10.063 -4.321  1.00 45.74 ? 102 TRP A CA    1 
ATOM   674  C  C     . TRP A 1 119 ? -19.675 11.491 -4.847  1.00 45.47 ? 102 TRP A C     1 
ATOM   675  O  O     . TRP A 1 119 ? -20.625 12.210 -4.696  1.00 45.53 ? 102 TRP A O     1 
ATOM   676  C  CB    . TRP A 1 119 ? -19.531 10.056 -2.812  1.00 46.08 ? 102 TRP A CB    1 
ATOM   677  C  CG    . TRP A 1 119 ? -19.924 8.748  -2.067  1.00 46.42 ? 102 TRP A CG    1 
ATOM   678  C  CD1   . TRP A 1 119 ? -19.097 7.947  -1.323  1.00 46.60 ? 102 TRP A CD1   1 
ATOM   679  C  CD2   . TRP A 1 119 ? -21.235 8.150  -1.977  1.00 46.35 ? 102 TRP A CD2   1 
ATOM   680  N  NE1   . TRP A 1 119 ? -19.802 6.892  -0.788  1.00 46.29 ? 102 TRP A NE1   1 
ATOM   681  C  CE2   . TRP A 1 119 ? -21.113 6.991  -1.175  1.00 46.44 ? 102 TRP A CE2   1 
ATOM   682  C  CE3   . TRP A 1 119 ? -22.486 8.474  -2.503  1.00 46.16 ? 102 TRP A CE3   1 
ATOM   683  C  CZ2   . TRP A 1 119 ? -22.202 6.158  -0.891  1.00 46.62 ? 102 TRP A CZ2   1 
ATOM   684  C  CZ3   . TRP A 1 119 ? -23.562 7.650  -2.217  1.00 46.31 ? 102 TRP A CZ3   1 
ATOM   685  C  CH2   . TRP A 1 119 ? -23.415 6.507  -1.419  1.00 46.28 ? 102 TRP A CH2   1 
ATOM   686  N  N     . LEU A 1 120 ? -18.562 11.893 -5.462  1.00 45.54 ? 103 LEU A N     1 
ATOM   687  C  CA    . LEU A 1 120 ? -18.443 13.230 -6.099  1.00 45.81 ? 103 LEU A CA    1 
ATOM   688  C  C     . LEU A 1 120 ? -18.969 13.257 -7.557  1.00 46.16 ? 103 LEU A C     1 
ATOM   689  O  O     . LEU A 1 120 ? -19.433 14.301 -8.048  1.00 45.93 ? 103 LEU A O     1 
ATOM   690  C  CB    . LEU A 1 120 ? -16.991 13.681 -6.092  1.00 45.45 ? 103 LEU A CB    1 
ATOM   691  C  CG    . LEU A 1 120 ? -16.318 13.817 -4.730  1.00 44.77 ? 103 LEU A CG    1 
ATOM   692  C  CD1   . LEU A 1 120 ? -14.807 13.819 -4.884  1.00 44.00 ? 103 LEU A CD1   1 
ATOM   693  C  CD2   . LEU A 1 120 ? -16.796 15.073 -4.031  1.00 43.84 ? 103 LEU A CD2   1 
ATOM   694  N  N     . GLN A 1 121 ? -18.875 12.116 -8.246  1.00 46.74 ? 104 GLN A N     1 
ATOM   695  C  CA    . GLN A 1 121 ? -19.398 11.986 -9.612  1.00 47.40 ? 104 GLN A CA    1 
ATOM   696  C  C     . GLN A 1 121 ? -20.896 12.053 -9.579  1.00 47.86 ? 104 GLN A C     1 
ATOM   697  O  O     . GLN A 1 121 ? -21.531 12.491 -10.531 1.00 47.90 ? 104 GLN A O     1 
ATOM   698  C  CB    . GLN A 1 121 ? -19.000 10.654 -10.222 1.00 47.31 ? 104 GLN A CB    1 
ATOM   699  C  CG    . GLN A 1 121 ? -17.513 10.448 -10.362 1.00 47.63 ? 104 GLN A CG    1 
ATOM   700  C  CD    . GLN A 1 121 ? -17.178 9.051  -10.842 1.00 47.48 ? 104 GLN A CD    1 
ATOM   701  O  OE1   . GLN A 1 121 ? -18.046 8.332  -11.332 1.00 47.03 ? 104 GLN A OE1   1 
ATOM   702  N  NE2   . GLN A 1 121 ? -15.915 8.659  -10.702 1.00 47.42 ? 104 GLN A NE2   1 
ATOM   703  N  N     . GLU A 1 122 ? -21.448 11.557 -8.483  1.00 48.65 ? 105 GLU A N     1 
ATOM   704  C  CA    . GLU A 1 122 ? -22.865 11.679 -8.174  1.00 49.46 ? 105 GLU A CA    1 
ATOM   705  C  C     . GLU A 1 122 ? -23.271 13.141 -8.052  1.00 49.54 ? 105 GLU A C     1 
ATOM   706  O  O     . GLU A 1 122 ? -24.268 13.583 -8.618  1.00 49.20 ? 105 GLU A O     1 
ATOM   707  C  CB    . GLU A 1 122 ? -23.147 11.000 -6.827  1.00 50.23 ? 105 GLU A CB    1 
ATOM   708  C  CG    . GLU A 1 122 ? -23.040 9.469  -6.830  1.00 52.00 ? 105 GLU A CG    1 
ATOM   709  C  CD    . GLU A 1 122 ? -24.342 8.797  -7.200  1.00 54.46 ? 105 GLU A CD    1 
ATOM   710  O  OE1   . GLU A 1 122 ? -24.445 7.556  -7.007  1.00 56.87 ? 105 GLU A OE1   1 
ATOM   711  O  OE2   . GLU A 1 122 ? -25.264 9.508  -7.677  1.00 56.14 ? 105 GLU A OE2   1 
ATOM   712  N  N     . ILE A 1 123 ? -22.496 13.873 -7.266  1.00 50.00 ? 106 ILE A N     1 
ATOM   713  C  CA    . ILE A 1 123 ? -22.718 15.289 -7.076  1.00 50.22 ? 106 ILE A CA    1 
ATOM   714  C  C     . ILE A 1 123 ? -22.644 16.001 -8.432  1.00 50.62 ? 106 ILE A C     1 
ATOM   715  O  O     . ILE A 1 123 ? -23.469 16.864 -8.711  1.00 51.10 ? 106 ILE A O     1 
ATOM   716  C  CB    . ILE A 1 123 ? -21.710 15.902 -6.062  1.00 50.21 ? 106 ILE A CB    1 
ATOM   717  C  CG1   . ILE A 1 123 ? -21.901 15.263 -4.672  1.00 50.25 ? 106 ILE A CG1   1 
ATOM   718  C  CG2   . ILE A 1 123 ? -21.886 17.417 -5.977  1.00 50.08 ? 106 ILE A CG2   1 
ATOM   719  C  CD1   . ILE A 1 123 ? -20.921 15.741 -3.595  1.00 49.82 ? 106 ILE A CD1   1 
ATOM   720  N  N     . ASP A 1 124 ? -21.691 15.630 -9.286  1.00 50.75 ? 107 ASP A N     1 
ATOM   721  C  CA    . ASP A 1 124 ? -21.610 16.261 -10.604 1.00 50.78 ? 107 ASP A CA    1 
ATOM   722  C  C     . ASP A 1 124 ? -22.838 15.940 -11.473 1.00 50.67 ? 107 ASP A C     1 
ATOM   723  O  O     . ASP A 1 124 ? -23.298 16.785 -12.236 1.00 50.72 ? 107 ASP A O     1 
ATOM   724  C  CB    . ASP A 1 124 ? -20.307 15.886 -11.313 1.00 51.12 ? 107 ASP A CB    1 
ATOM   725  C  CG    . ASP A 1 124 ? -19.075 16.541 -10.653 1.00 52.58 ? 107 ASP A CG    1 
ATOM   726  O  OD1   . ASP A 1 124 ? -18.043 16.749 -11.382 1.00 53.37 ? 107 ASP A OD1   1 
ATOM   727  O  OD2   . ASP A 1 124 ? -19.161 16.861 -9.414  1.00 52.39 ? 107 ASP A OD2   1 
ATOM   728  N  N     . ARG A 1 125 ? -23.381 14.733 -11.331 1.00 50.48 ? 108 ARG A N     1 
ATOM   729  C  CA    . ARG A 1 125 ? -24.559 14.322 -12.100 1.00 50.30 ? 108 ARG A CA    1 
ATOM   730  C  C     . ARG A 1 125 ? -25.855 14.949 -11.562 1.00 50.05 ? 108 ARG A C     1 
ATOM   731  O  O     . ARG A 1 125 ? -26.564 15.609 -12.305 1.00 49.90 ? 108 ARG A O     1 
ATOM   732  C  CB    . ARG A 1 125 ? -24.682 12.797 -12.116 1.00 50.23 ? 108 ARG A CB    1 
ATOM   733  C  CG    . ARG A 1 125 ? -25.849 12.272 -12.947 1.00 50.39 ? 108 ARG A CG    1 
ATOM   734  C  CD    . ARG A 1 125 ? -25.724 10.755 -13.184 1.00 50.53 ? 108 ARG A CD    1 
ATOM   735  N  NE    . ARG A 1 125 ? -26.671 10.239 -14.187 1.00 50.76 ? 108 ARG A NE    1 
ATOM   736  C  CZ    . ARG A 1 125 ? -26.780 8.952  -14.535 1.00 50.59 ? 108 ARG A CZ    1 
ATOM   737  N  NH1   . ARG A 1 125 ? -26.016 8.034  -13.948 1.00 50.85 ? 108 ARG A NH1   1 
ATOM   738  N  NH2   . ARG A 1 125 ? -27.660 8.578  -15.463 1.00 49.83 ? 108 ARG A NH2   1 
ATOM   739  N  N     . TYR A 1 126 ? -26.150 14.743 -10.273 1.00 50.04 ? 109 TYR A N     1 
ATOM   740  C  CA    . TYR A 1 126 ? -27.402 15.250 -9.641  1.00 49.91 ? 109 TYR A CA    1 
ATOM   741  C  C     . TYR A 1 126 ? -27.184 16.400 -8.635  1.00 49.88 ? 109 TYR A C     1 
ATOM   742  O  O     . TYR A 1 126 ? -27.398 16.226 -7.434  1.00 50.12 ? 109 TYR A O     1 
ATOM   743  C  CB    . TYR A 1 126 ? -28.113 14.115 -8.902  1.00 50.10 ? 109 TYR A CB    1 
ATOM   744  C  CG    . TYR A 1 126 ? -28.115 12.813 -9.643  1.00 50.51 ? 109 TYR A CG    1 
ATOM   745  C  CD1   . TYR A 1 126 ? -27.224 11.791 -9.302  1.00 50.74 ? 109 TYR A CD1   1 
ATOM   746  C  CD2   . TYR A 1 126 ? -28.998 12.595 -10.693 1.00 50.38 ? 109 TYR A CD2   1 
ATOM   747  C  CE1   . TYR A 1 126 ? -27.227 10.579 -9.993  1.00 50.39 ? 109 TYR A CE1   1 
ATOM   748  C  CE2   . TYR A 1 126 ? -29.008 11.397 -11.384 1.00 50.61 ? 109 TYR A CE2   1 
ATOM   749  C  CZ    . TYR A 1 126 ? -28.127 10.390 -11.029 1.00 50.61 ? 109 TYR A CZ    1 
ATOM   750  O  OH    . TYR A 1 126 ? -28.148 9.195  -11.728 1.00 50.94 ? 109 TYR A OH    1 
ATOM   751  N  N     . ALA A 1 127 ? -26.756 17.569 -9.092  1.00 49.47 ? 110 ALA A N     1 
ATOM   752  C  CA    . ALA A 1 127 ? -26.630 18.694 -8.168  1.00 49.16 ? 110 ALA A CA    1 
ATOM   753  C  C     . ALA A 1 127 ? -26.274 19.956 -8.888  1.00 49.02 ? 110 ALA A C     1 
ATOM   754  O  O     . ALA A 1 127 ? -25.485 19.934 -9.830  1.00 49.05 ? 110 ALA A O     1 
ATOM   755  C  CB    . ALA A 1 127 ? -25.598 18.400 -7.094  1.00 48.98 ? 110 ALA A CB    1 
ATOM   756  N  N     . SER A 1 128 ? -26.874 21.061 -8.445  1.00 48.77 ? 111 SER A N     1 
ATOM   757  C  CA    . SER A 1 128 ? -26.505 22.387 -8.915  1.00 48.31 ? 111 SER A CA    1 
ATOM   758  C  C     . SER A 1 128 ? -24.997 22.411 -9.179  1.00 47.72 ? 111 SER A C     1 
ATOM   759  O  O     . SER A 1 128 ? -24.199 21.922 -8.372  1.00 47.68 ? 111 SER A O     1 
ATOM   760  C  CB    . SER A 1 128 ? -26.903 23.412 -7.864  1.00 48.64 ? 111 SER A CB    1 
ATOM   761  O  OG    . SER A 1 128 ? -28.298 23.269 -7.555  1.00 49.49 ? 111 SER A OG    1 
ATOM   762  N  N     . GLU A 1 129 ? -24.609 22.966 -10.316 1.00 47.07 ? 112 GLU A N     1 
ATOM   763  C  CA    . GLU A 1 129 ? -23.239 22.798 -10.799 1.00 46.61 ? 112 GLU A CA    1 
ATOM   764  C  C     . GLU A 1 129 ? -22.134 23.317 -9.885  1.00 45.81 ? 112 GLU A C     1 
ATOM   765  O  O     . GLU A 1 129 ? -21.009 22.804 -9.945  1.00 45.61 ? 112 GLU A O     1 
ATOM   766  C  CB    . GLU A 1 129 ? -23.063 23.334 -12.247 1.00 46.83 ? 112 GLU A CB    1 
ATOM   767  C  CG    . GLU A 1 129 ? -23.408 24.795 -12.495 1.00 47.23 ? 112 GLU A CG    1 
ATOM   768  C  CD    . GLU A 1 129 ? -22.638 25.352 -13.691 1.00 47.42 ? 112 GLU A CD    1 
ATOM   769  O  OE1   . GLU A 1 129 ? -21.401 25.565 -13.554 1.00 48.18 ? 112 GLU A OE1   1 
ATOM   770  O  OE2   . GLU A 1 129 ? -23.257 25.571 -14.762 1.00 48.54 ? 112 GLU A OE2   1 
ATOM   771  N  N     . ASN A 1 130 ? -22.436 24.305 -9.042  1.00 44.86 ? 113 ASN A N     1 
ATOM   772  C  CA    . ASN A 1 130 ? -21.429 24.821 -8.107  1.00 44.28 ? 113 ASN A CA    1 
ATOM   773  C  C     . ASN A 1 130 ? -21.762 24.543 -6.644  1.00 43.42 ? 113 ASN A C     1 
ATOM   774  O  O     . ASN A 1 130 ? -21.279 25.210 -5.745  1.00 42.63 ? 113 ASN A O     1 
ATOM   775  C  CB    . ASN A 1 130 ? -21.196 26.299 -8.368  1.00 44.09 ? 113 ASN A CB    1 
ATOM   776  C  CG    . ASN A 1 130 ? -20.583 26.543 -9.739  1.00 44.42 ? 113 ASN A CG    1 
ATOM   777  O  OD1   . ASN A 1 130 ? -19.441 26.148 -10.016 1.00 43.54 ? 113 ASN A OD1   1 
ATOM   778  N  ND2   . ASN A 1 130 ? -21.344 27.172 -10.608 1.00 45.40 ? 113 ASN A ND2   1 
ATOM   779  N  N     . VAL A 1 131 ? -22.561 23.512 -6.426  1.00 43.06 ? 114 VAL A N     1 
ATOM   780  C  CA    . VAL A 1 131 ? -22.973 23.129 -5.091  1.00 43.13 ? 114 VAL A CA    1 
ATOM   781  C  C     . VAL A 1 131 ? -21.744 22.951 -4.217  1.00 42.90 ? 114 VAL A C     1 
ATOM   782  O  O     . VAL A 1 131 ? -20.786 22.327 -4.617  1.00 43.00 ? 114 VAL A O     1 
ATOM   783  C  CB    . VAL A 1 131 ? -23.785 21.814 -5.113  1.00 42.96 ? 114 VAL A CB    1 
ATOM   784  C  CG1   . VAL A 1 131 ? -22.926 20.666 -5.616  1.00 42.80 ? 114 VAL A CG1   1 
ATOM   785  C  CG2   . VAL A 1 131 ? -24.343 21.505 -3.739  1.00 42.92 ? 114 VAL A CG2   1 
ATOM   786  N  N     . ASN A 1 132 ? -21.773 23.505 -3.022  1.00 42.75 ? 115 ASN A N     1 
ATOM   787  C  CA    . ASN A 1 132 ? -20.621 23.439 -2.156  1.00 42.76 ? 115 ASN A CA    1 
ATOM   788  C  C     . ASN A 1 132 ? -20.368 22.060 -1.636  1.00 43.29 ? 115 ASN A C     1 
ATOM   789  O  O     . ASN A 1 132 ? -21.305 21.282 -1.445  1.00 44.18 ? 115 ASN A O     1 
ATOM   790  C  CB    . ASN A 1 132 ? -20.768 24.379 -0.991  1.00 42.37 ? 115 ASN A CB    1 
ATOM   791  C  CG    . ASN A 1 132 ? -20.486 25.782 -1.368  1.00 41.14 ? 115 ASN A CG    1 
ATOM   792  O  OD1   . ASN A 1 132 ? -21.398 26.563 -1.505  1.00 39.40 ? 115 ASN A OD1   1 
ATOM   793  N  ND2   . ASN A 1 132 ? -19.206 26.116 -1.563  1.00 38.81 ? 115 ASN A ND2   1 
ATOM   794  N  N     . LYS A 1 133 ? -19.086 21.765 -1.384  1.00 43.37 ? 116 LYS A N     1 
ATOM   795  C  CA    . LYS A 1 133 ? -18.658 20.447 -0.953  1.00 42.86 ? 116 LYS A CA    1 
ATOM   796  C  C     . LYS A 1 133 ? -17.724 20.524 0.239   1.00 42.84 ? 116 LYS A C     1 
ATOM   797  O  O     . LYS A 1 133 ? -16.922 21.432 0.338   1.00 42.86 ? 116 LYS A O     1 
ATOM   798  C  CB    . LYS A 1 133 ? -17.974 19.734 -2.116  1.00 42.85 ? 116 LYS A CB    1 
ATOM   799  C  CG    . LYS A 1 133 ? -18.916 19.451 -3.256  1.00 42.38 ? 116 LYS A CG    1 
ATOM   800  C  CD    . LYS A 1 133 ? -18.297 18.601 -4.363  1.00 42.20 ? 116 LYS A CD    1 
ATOM   801  C  CE    . LYS A 1 133 ? -17.750 19.442 -5.491  1.00 41.91 ? 116 LYS A CE    1 
ATOM   802  N  NZ    . LYS A 1 133 ? -17.886 18.722 -6.789  1.00 41.72 ? 116 LYS A NZ    1 
ATOM   803  N  N     . LEU A 1 134 ? -17.862 19.571 1.153   1.00 42.79 ? 117 LEU A N     1 
ATOM   804  C  CA    . LEU A 1 134 ? -16.946 19.427 2.274   1.00 42.73 ? 117 LEU A CA    1 
ATOM   805  C  C     . LEU A 1 134 ? -16.680 17.947 2.457   1.00 42.67 ? 117 LEU A C     1 
ATOM   806  O  O     . LEU A 1 134 ? -17.602 17.140 2.384   1.00 42.56 ? 117 LEU A O     1 
ATOM   807  C  CB    . LEU A 1 134 ? -17.558 20.003 3.542   1.00 42.71 ? 117 LEU A CB    1 
ATOM   808  C  CG    . LEU A 1 134 ? -16.779 19.777 4.836   1.00 42.58 ? 117 LEU A CG    1 
ATOM   809  C  CD1   . LEU A 1 134 ? -15.469 20.501 4.788   1.00 42.70 ? 117 LEU A CD1   1 
ATOM   810  C  CD2   . LEU A 1 134 ? -17.593 20.254 6.009   1.00 42.39 ? 117 LEU A CD2   1 
ATOM   811  N  N     . LEU A 1 135 ? -15.423 17.593 2.692   1.00 42.90 ? 118 LEU A N     1 
ATOM   812  C  CA    . LEU A 1 135 ? -15.042 16.199 2.957   1.00 42.95 ? 118 LEU A CA    1 
ATOM   813  C  C     . LEU A 1 135 ? -14.866 15.995 4.450   1.00 43.17 ? 118 LEU A C     1 
ATOM   814  O  O     . LEU A 1 135 ? -14.173 16.777 5.121   1.00 43.21 ? 118 LEU A O     1 
ATOM   815  C  CB    . LEU A 1 135 ? -13.740 15.867 2.248   1.00 42.90 ? 118 LEU A CB    1 
ATOM   816  C  CG    . LEU A 1 135 ? -13.165 14.465 2.445   1.00 42.69 ? 118 LEU A CG    1 
ATOM   817  C  CD1   . LEU A 1 135 ? -14.140 13.366 2.011   1.00 40.28 ? 118 LEU A CD1   1 
ATOM   818  C  CD2   . LEU A 1 135 ? -11.843 14.376 1.688   1.00 42.38 ? 118 LEU A CD2   1 
ATOM   819  N  N     . VAL A 1 136 ? -15.479 14.944 4.973   1.00 43.39 ? 119 VAL A N     1 
ATOM   820  C  CA    . VAL A 1 136 ? -15.395 14.661 6.396   1.00 43.76 ? 119 VAL A CA    1 
ATOM   821  C  C     . VAL A 1 136 ? -14.917 13.219 6.696   1.00 44.16 ? 119 VAL A C     1 
ATOM   822  O  O     . VAL A 1 136 ? -15.466 12.241 6.182   1.00 44.81 ? 119 VAL A O     1 
ATOM   823  C  CB    . VAL A 1 136 ? -16.742 14.951 7.078   1.00 43.74 ? 119 VAL A CB    1 
ATOM   824  C  CG1   . VAL A 1 136 ? -16.725 14.538 8.566   1.00 44.37 ? 119 VAL A CG1   1 
ATOM   825  C  CG2   . VAL A 1 136 ? -17.063 16.418 6.949   1.00 43.71 ? 119 VAL A CG2   1 
ATOM   826  N  N     . GLY A 1 137 ? -13.873 13.102 7.508   1.00 44.26 ? 120 GLY A N     1 
ATOM   827  C  CA    . GLY A 1 137 ? -13.385 11.807 7.957   1.00 44.14 ? 120 GLY A CA    1 
ATOM   828  C  C     . GLY A 1 137 ? -13.891 11.618 9.361   1.00 44.23 ? 120 GLY A C     1 
ATOM   829  O  O     . GLY A 1 137 ? -13.274 12.082 10.330  1.00 44.66 ? 120 GLY A O     1 
ATOM   830  N  N     . ASN A 1 138 ? -15.037 10.970 9.479   1.00 44.13 ? 121 ASN A N     1 
ATOM   831  C  CA    . ASN A 1 138 ? -15.643 10.739 10.779  1.00 44.03 ? 121 ASN A CA    1 
ATOM   832  C  C     . ASN A 1 138 ? -14.815 9.724  11.589  1.00 43.98 ? 121 ASN A C     1 
ATOM   833  O  O     . ASN A 1 138 ? -13.937 9.022  11.041  1.00 43.80 ? 121 ASN A O     1 
ATOM   834  C  CB    . ASN A 1 138 ? -17.090 10.251 10.604  1.00 43.86 ? 121 ASN A CB    1 
ATOM   835  C  CG    . ASN A 1 138 ? -17.873 10.237 11.913  1.00 44.11 ? 121 ASN A CG    1 
ATOM   836  O  OD1   . ASN A 1 138 ? -17.686 11.112 12.768  1.00 43.72 ? 121 ASN A OD1   1 
ATOM   837  N  ND2   . ASN A 1 138 ? -18.767 9.239  12.074  1.00 44.16 ? 121 ASN A ND2   1 
ATOM   838  N  N     . LYS A 1 139 ? -15.091 9.666  12.892  1.00 43.88 ? 122 LYS A N     1 
ATOM   839  C  CA    . LYS A 1 139 ? -14.426 8.725  13.808  1.00 43.78 ? 122 LYS A CA    1 
ATOM   840  C  C     . LYS A 1 139 ? -12.934 9.062  13.997  1.00 43.51 ? 122 LYS A C     1 
ATOM   841  O  O     . LYS A 1 139 ? -12.094 8.178  14.095  1.00 43.24 ? 122 LYS A O     1 
ATOM   842  C  CB    . LYS A 1 139 ? -14.618 7.260  13.339  1.00 43.65 ? 122 LYS A CB    1 
ATOM   843  C  CG    . LYS A 1 139 ? -16.087 6.784  13.358  1.00 43.55 ? 122 LYS A CG    1 
ATOM   844  C  CD    . LYS A 1 139 ? -16.274 5.482  12.568  1.00 43.41 ? 122 LYS A CD    1 
ATOM   845  C  CE    . LYS A 1 139 ? -17.623 4.821  12.833  1.00 42.69 ? 122 LYS A CE    1 
ATOM   846  N  NZ    . LYS A 1 139 ? -17.875 3.706  11.907  1.00 40.79 ? 122 LYS A NZ    1 
ATOM   847  N  N     . CYS A 1 140 ? -12.605 10.339 14.069  1.00 43.22 ? 123 CYS A N     1 
ATOM   848  C  CA    . CYS A 1 140 ? -11.234 10.678 14.264  1.00 43.58 ? 123 CYS A CA    1 
ATOM   849  C  C     . CYS A 1 140 ? -10.741 10.100 15.627  1.00 43.41 ? 123 CYS A C     1 
ATOM   850  O  O     . CYS A 1 140 ? -9.530  9.912  15.847  1.00 43.01 ? 123 CYS A O     1 
ATOM   851  C  CB    . CYS A 1 140 ? -11.024 12.191 14.140  1.00 43.62 ? 123 CYS A CB    1 
ATOM   852  S  SG    . CYS A 1 140 ? -11.880 13.203 15.320  1.00 45.27 ? 123 CYS A SG    1 
ATOM   853  N  N     . ASP A 1 141 ? -11.687 9.772  16.506  1.00 43.22 ? 124 ASP A N     1 
ATOM   854  C  CA    . ASP A 1 141 ? -11.356 9.270  17.835  1.00 43.33 ? 124 ASP A CA    1 
ATOM   855  C  C     . ASP A 1 141 ? -10.740 7.851  17.870  1.00 43.55 ? 124 ASP A C     1 
ATOM   856  O  O     . ASP A 1 141 ? -10.003 7.499  18.805  1.00 43.94 ? 124 ASP A O     1 
ATOM   857  C  CB    . ASP A 1 141 ? -12.584 9.355  18.741  1.00 43.22 ? 124 ASP A CB    1 
ATOM   858  C  CG    . ASP A 1 141 ? -13.782 8.661  18.164  1.00 43.12 ? 124 ASP A CG    1 
ATOM   859  O  OD1   . ASP A 1 141 ? -14.302 9.124  17.135  1.00 41.53 ? 124 ASP A OD1   1 
ATOM   860  O  OD2   . ASP A 1 141 ? -14.208 7.646  18.751  1.00 43.88 ? 124 ASP A OD2   1 
ATOM   861  N  N     . LEU A 1 142 ? -11.007 7.048  16.855  1.00 43.64 ? 125 LEU A N     1 
ATOM   862  C  CA    . LEU A 1 142 ? -10.472 5.681  16.799  1.00 43.69 ? 125 LEU A CA    1 
ATOM   863  C  C     . LEU A 1 142 ? -9.021  5.654  16.180  1.00 43.97 ? 125 LEU A C     1 
ATOM   864  O  O     . LEU A 1 142 ? -8.765  5.035  15.140  1.00 44.00 ? 125 LEU A O     1 
ATOM   865  C  CB    . LEU A 1 142 ? -11.469 4.778  16.030  1.00 43.43 ? 125 LEU A CB    1 
ATOM   866  C  CG    . LEU A 1 142 ? -12.924 4.740  16.571  1.00 42.49 ? 125 LEU A CG    1 
ATOM   867  C  CD1   . LEU A 1 142 ? -13.845 4.167  15.535  1.00 41.57 ? 125 LEU A CD1   1 
ATOM   868  C  CD2   . LEU A 1 142 ? -13.073 3.976  17.882  1.00 40.52 ? 125 LEU A CD2   1 
ATOM   869  N  N     . THR A 1 143 ? -8.094  6.327  16.862  1.00 44.21 ? 126 THR A N     1 
ATOM   870  C  CA    . THR A 1 143 ? -6.682  6.492  16.409  1.00 44.14 ? 126 THR A CA    1 
ATOM   871  C  C     . THR A 1 143 ? -5.876  5.191  16.259  1.00 43.99 ? 126 THR A C     1 
ATOM   872  O  O     . THR A 1 143 ? -4.935  5.100  15.443  1.00 43.44 ? 126 THR A O     1 
ATOM   873  C  CB    . THR A 1 143 ? -5.904  7.388  17.410  1.00 44.24 ? 126 THR A CB    1 
ATOM   874  O  OG1   . THR A 1 143 ? -5.945  6.805  18.720  1.00 44.14 ? 126 THR A OG1   1 
ATOM   875  C  CG2   . THR A 1 143 ? -6.503  8.798  17.449  1.00 44.03 ? 126 THR A CG2   1 
ATOM   876  N  N     . THR A 1 144 ? -6.228  4.198  17.065  1.00 44.15 ? 127 THR A N     1 
ATOM   877  C  CA    . THR A 1 144 ? -5.564  2.915  16.992  1.00 44.36 ? 127 THR A CA    1 
ATOM   878  C  C     . THR A 1 144 ? -5.987  2.271  15.719  1.00 44.44 ? 127 THR A C     1 
ATOM   879  O  O     . THR A 1 144 ? -5.224  1.507  15.118  1.00 44.87 ? 127 THR A O     1 
ATOM   880  C  CB    . THR A 1 144 ? -5.913  1.987  18.186  1.00 44.33 ? 127 THR A CB    1 
ATOM   881  O  OG1   . THR A 1 144 ? -5.415  2.567  19.406  1.00 44.19 ? 127 THR A OG1   1 
ATOM   882  C  CG2   . THR A 1 144 ? -5.294  0.568  17.993  1.00 44.27 ? 127 THR A CG2   1 
ATOM   883  N  N     . LYS A 1 145 ? -7.198  2.604  15.285  1.00 44.49 ? 128 LYS A N     1 
ATOM   884  C  CA    . LYS A 1 145 ? -7.787  1.980  14.114  1.00 44.50 ? 128 LYS A CA    1 
ATOM   885  C  C     . LYS A 1 145 ? -7.599  2.823  12.842  1.00 44.46 ? 128 LYS A C     1 
ATOM   886  O  O     . LYS A 1 145 ? -7.840  2.333  11.729  1.00 44.90 ? 128 LYS A O     1 
ATOM   887  C  CB    . LYS A 1 145 ? -9.277  1.691  14.357  1.00 44.65 ? 128 LYS A CB    1 
ATOM   888  C  CG    . LYS A 1 145 ? -9.558  0.749  15.543  1.00 44.90 ? 128 LYS A CG    1 
ATOM   889  C  CD    . LYS A 1 145 ? -9.595  1.501  16.865  1.00 45.92 ? 128 LYS A CD    1 
ATOM   890  C  CE    . LYS A 1 145 ? -10.006 0.613  18.021  1.00 45.84 ? 128 LYS A CE    1 
ATOM   891  N  NZ    . LYS A 1 145 ? -11.459 0.275  17.983  1.00 46.19 ? 128 LYS A NZ    1 
ATOM   892  N  N     . LYS A 1 146 ? -7.138  4.067  13.006  1.00 44.10 ? 129 LYS A N     1 
ATOM   893  C  CA    . LYS A 1 146 ? -7.009  5.014  11.879  1.00 43.73 ? 129 LYS A CA    1 
ATOM   894  C  C     . LYS A 1 146 ? -6.056  4.502  10.794  1.00 43.53 ? 129 LYS A C     1 
ATOM   895  O  O     . LYS A 1 146 ? -4.880  4.294  11.040  1.00 43.59 ? 129 LYS A O     1 
ATOM   896  C  CB    . LYS A 1 146 ? -6.570  6.389  12.389  1.00 43.47 ? 129 LYS A CB    1 
ATOM   897  C  CG    . LYS A 1 146 ? -6.685  7.497  11.360  1.00 43.47 ? 129 LYS A CG    1 
ATOM   898  C  CD    . LYS A 1 146 ? -6.870  8.873  12.029  1.00 43.11 ? 129 LYS A CD    1 
ATOM   899  C  CE    . LYS A 1 146 ? -6.581  10.012 11.064  1.00 42.51 ? 129 LYS A CE    1 
ATOM   900  N  NZ    . LYS A 1 146 ? -6.547  11.322 11.747  1.00 41.79 ? 129 LYS A NZ    1 
ATOM   901  N  N     . VAL A 1 147 ? -6.606  4.281  9.606   1.00 43.41 ? 130 VAL A N     1 
ATOM   902  C  CA    . VAL A 1 147 ? -5.856  3.782  8.472   1.00 43.12 ? 130 VAL A CA    1 
ATOM   903  C  C     . VAL A 1 147 ? -5.772  4.855  7.372   1.00 43.39 ? 130 VAL A C     1 
ATOM   904  O  O     . VAL A 1 147 ? -4.858  4.806  6.538   1.00 43.81 ? 130 VAL A O     1 
ATOM   905  C  CB    . VAL A 1 147 ? -6.499  2.521  7.892   1.00 43.09 ? 130 VAL A CB    1 
ATOM   906  C  CG1   . VAL A 1 147 ? -6.699  1.459  8.996   1.00 42.88 ? 130 VAL A CG1   1 
ATOM   907  C  CG2   . VAL A 1 147 ? -7.811  2.861  7.213   1.00 42.27 ? 130 VAL A CG2   1 
ATOM   908  N  N     . VAL A 1 148 ? -6.707  5.824  7.367   1.00 43.19 ? 131 VAL A N     1 
ATOM   909  C  CA    . VAL A 1 148 ? -6.686  6.919  6.374   1.00 42.63 ? 131 VAL A CA    1 
ATOM   910  C  C     . VAL A 1 148 ? -5.922  8.116  6.933   1.00 42.73 ? 131 VAL A C     1 
ATOM   911  O  O     . VAL A 1 148 ? -6.476  8.928  7.691   1.00 43.11 ? 131 VAL A O     1 
ATOM   912  C  CB    . VAL A 1 148 ? -8.122  7.388  5.947   1.00 42.55 ? 131 VAL A CB    1 
ATOM   913  C  CG1   . VAL A 1 148 ? -8.031  8.502  4.902   1.00 41.34 ? 131 VAL A CG1   1 
ATOM   914  C  CG2   . VAL A 1 148 ? -8.956  6.215  5.418   1.00 41.80 ? 131 VAL A CG2   1 
ATOM   915  N  N     . ASP A 1 149 ? -4.647  8.230  6.564   1.00 42.43 ? 132 ASP A N     1 
ATOM   916  C  CA    . ASP A 1 149 ? -3.821  9.343  7.032   1.00 42.01 ? 132 ASP A CA    1 
ATOM   917  C  C     . ASP A 1 149 ? -4.472  10.679 6.741   1.00 41.44 ? 132 ASP A C     1 
ATOM   918  O  O     . ASP A 1 149 ? -4.824  10.981 5.604   1.00 40.84 ? 132 ASP A O     1 
ATOM   919  C  CB    . ASP A 1 149 ? -2.397  9.294  6.412   1.00 42.23 ? 132 ASP A CB    1 
ATOM   920  C  CG    . ASP A 1 149 ? -1.544  8.162  6.996   1.00 42.86 ? 132 ASP A CG    1 
ATOM   921  O  OD1   . ASP A 1 149 ? -2.115  7.392  7.801   1.00 45.03 ? 132 ASP A OD1   1 
ATOM   922  O  OD2   . ASP A 1 149 ? -0.327  8.035  6.664   1.00 41.68 ? 132 ASP A OD2   1 
ATOM   923  N  N     . TYR A 1 150 ? -4.633  11.472 7.797   1.00 41.25 ? 133 TYR A N     1 
ATOM   924  C  CA    . TYR A 1 150 ? -5.113  12.855 7.683   1.00 41.34 ? 133 TYR A CA    1 
ATOM   925  C  C     . TYR A 1 150 ? -4.471  13.580 6.521   1.00 41.20 ? 133 TYR A C     1 
ATOM   926  O  O     . TYR A 1 150 ? -5.144  14.225 5.710   1.00 40.68 ? 133 TYR A O     1 
ATOM   927  C  CB    . TYR A 1 150 ? -4.769  13.646 8.958   1.00 41.04 ? 133 TYR A CB    1 
ATOM   928  C  CG    . TYR A 1 150 ? -5.037  15.118 8.809   1.00 40.58 ? 133 TYR A CG    1 
ATOM   929  C  CD1   . TYR A 1 150 ? -6.267  15.649 9.134   1.00 40.34 ? 133 TYR A CD1   1 
ATOM   930  C  CD2   . TYR A 1 150 ? -4.076  15.965 8.310   1.00 40.40 ? 133 TYR A CD2   1 
ATOM   931  C  CE1   . TYR A 1 150 ? -6.527  16.989 8.990   1.00 40.63 ? 133 TYR A CE1   1 
ATOM   932  C  CE2   . TYR A 1 150 ? -4.327  17.303 8.144   1.00 40.56 ? 133 TYR A CE2   1 
ATOM   933  C  CZ    . TYR A 1 150 ? -5.552  17.810 8.488   1.00 40.70 ? 133 TYR A CZ    1 
ATOM   934  O  OH    . TYR A 1 150 ? -5.799  19.142 8.337   1.00 40.84 ? 133 TYR A OH    1 
ATOM   935  N  N     . THR A 1 151 ? -3.146  13.481 6.473   1.00 41.39 ? 134 THR A N     1 
ATOM   936  C  CA    . THR A 1 151 ? -2.347  14.253 5.536   1.00 41.67 ? 134 THR A CA    1 
ATOM   937  C  C     . THR A 1 151 ? -2.709  13.891 4.082   1.00 41.72 ? 134 THR A C     1 
ATOM   938  O  O     . THR A 1 151 ? -2.695  14.751 3.176   1.00 41.40 ? 134 THR A O     1 
ATOM   939  C  CB    . THR A 1 151 ? -0.827  14.032 5.791   1.00 41.50 ? 134 THR A CB    1 
ATOM   940  O  OG1   . THR A 1 151 ? -0.486  12.697 5.415   1.00 42.25 ? 134 THR A OG1   1 
ATOM   941  C  CG2   . THR A 1 151 ? -0.470  14.254 7.284   1.00 41.06 ? 134 THR A CG2   1 
ATOM   942  N  N     . THR A 1 152 ? -3.052  12.622 3.868   1.00 42.04 ? 135 THR A N     1 
ATOM   943  C  CA    . THR A 1 152 ? -3.324  12.133 2.510   1.00 41.95 ? 135 THR A CA    1 
ATOM   944  C  C     . THR A 1 152 ? -4.786  12.402 2.102   1.00 41.98 ? 135 THR A C     1 
ATOM   945  O  O     . THR A 1 152 ? -5.079  12.554 0.917   1.00 41.96 ? 135 THR A O     1 
ATOM   946  C  CB    . THR A 1 152 ? -2.846  10.644 2.314   1.00 42.11 ? 135 THR A CB    1 
ATOM   947  O  OG1   . THR A 1 152 ? -3.131  9.877  3.492   1.00 41.75 ? 135 THR A OG1   1 
ATOM   948  C  CG2   . THR A 1 152 ? -1.273  10.596 2.011   1.00 40.90 ? 135 THR A CG2   1 
ATOM   949  N  N     . ALA A 1 153 ? -5.682  12.495 3.087   1.00 41.92 ? 136 ALA A N     1 
ATOM   950  C  CA    . ALA A 1 153 ? -7.046  12.932 2.828   1.00 41.85 ? 136 ALA A CA    1 
ATOM   951  C  C     . ALA A 1 153 ? -7.022  14.428 2.561   1.00 41.81 ? 136 ALA A C     1 
ATOM   952  O  O     . ALA A 1 153 ? -7.697  14.912 1.687   1.00 41.78 ? 136 ALA A O     1 
ATOM   953  C  CB    . ALA A 1 153 ? -7.939  12.625 4.007   1.00 41.55 ? 136 ALA A CB    1 
ATOM   954  N  N     . LYS A 1 154 ? -6.231  15.163 3.325   1.00 42.17 ? 137 LYS A N     1 
ATOM   955  C  CA    . LYS A 1 154 ? -6.162  16.608 3.161   1.00 42.26 ? 137 LYS A CA    1 
ATOM   956  C  C     . LYS A 1 154 ? -5.632  16.953 1.793   1.00 42.27 ? 137 LYS A C     1 
ATOM   957  O  O     . LYS A 1 154 ? -6.139  17.843 1.120   1.00 42.16 ? 137 LYS A O     1 
ATOM   958  C  CB    . LYS A 1 154 ? -5.255  17.209 4.235   1.00 42.48 ? 137 LYS A CB    1 
ATOM   959  C  CG    . LYS A 1 154 ? -4.838  18.664 3.998   1.00 42.75 ? 137 LYS A CG    1 
ATOM   960  C  CD    . LYS A 1 154 ? -6.038  19.633 3.994   1.00 43.73 ? 137 LYS A CD    1 
ATOM   961  C  CE    . LYS A 1 154 ? -5.558  21.115 4.002   1.00 43.90 ? 137 LYS A CE    1 
ATOM   962  N  NZ    . LYS A 1 154 ? -6.700  22.080 4.014   1.00 44.55 ? 137 LYS A NZ    1 
ATOM   963  N  N     . GLU A 1 155 ? -4.602  16.225 1.389   1.00 42.69 ? 138 GLU A N     1 
ATOM   964  C  CA    . GLU A 1 155 ? -3.903  16.469 0.138   1.00 42.45 ? 138 GLU A CA    1 
ATOM   965  C  C     . GLU A 1 155 ? -4.857  16.276 -1.038  1.00 42.09 ? 138 GLU A C     1 
ATOM   966  O  O     . GLU A 1 155 ? -4.795  16.971 -2.054  1.00 41.51 ? 138 GLU A O     1 
ATOM   967  C  CB    . GLU A 1 155 ? -2.706  15.536 0.087   1.00 42.61 ? 138 GLU A CB    1 
ATOM   968  C  CG    . GLU A 1 155 ? -1.792  15.759 -1.073  1.00 43.83 ? 138 GLU A CG    1 
ATOM   969  C  CD    . GLU A 1 155 ? -2.083  14.818 -2.227  1.00 46.31 ? 138 GLU A CD    1 
ATOM   970  O  OE1   . GLU A 1 155 ? -3.280  14.425 -2.406  1.00 48.30 ? 138 GLU A OE1   1 
ATOM   971  O  OE2   . GLU A 1 155 ? -1.108  14.470 -2.950  1.00 46.52 ? 138 GLU A OE2   1 
ATOM   972  N  N     . PHE A 1 156 ? -5.761  15.334 -0.838  1.00 42.13 ? 139 PHE A N     1 
ATOM   973  C  CA    . PHE A 1 156 ? -6.866  15.031 -1.741  1.00 42.14 ? 139 PHE A CA    1 
ATOM   974  C  C     . PHE A 1 156 ? -7.911  16.151 -1.829  1.00 42.09 ? 139 PHE A C     1 
ATOM   975  O  O     . PHE A 1 156 ? -8.199  16.642 -2.916  1.00 42.62 ? 139 PHE A O     1 
ATOM   976  C  CB    . PHE A 1 156 ? -7.531  13.758 -1.231  1.00 42.40 ? 139 PHE A CB    1 
ATOM   977  C  CG    . PHE A 1 156 ? -8.666  13.292 -2.041  1.00 42.28 ? 139 PHE A CG    1 
ATOM   978  C  CD1   . PHE A 1 156 ? -8.545  13.138 -3.415  1.00 43.10 ? 139 PHE A CD1   1 
ATOM   979  C  CD2   . PHE A 1 156 ? -9.845  12.930 -1.430  1.00 43.05 ? 139 PHE A CD2   1 
ATOM   980  C  CE1   . PHE A 1 156 ? -9.604  12.661 -4.180  1.00 43.09 ? 139 PHE A CE1   1 
ATOM   981  C  CE2   . PHE A 1 156 ? -10.916 12.451 -2.183  1.00 43.85 ? 139 PHE A CE2   1 
ATOM   982  C  CZ    . PHE A 1 156 ? -10.790 12.313 -3.565  1.00 43.24 ? 139 PHE A CZ    1 
ATOM   983  N  N     . ALA A 1 157 ? -8.487  16.547 -0.689  1.00 41.73 ? 140 ALA A N     1 
ATOM   984  C  CA    . ALA A 1 157 ? -9.486  17.642 -0.660  1.00 41.32 ? 140 ALA A CA    1 
ATOM   985  C  C     . ALA A 1 157 ? -8.896  18.916 -1.257  1.00 40.71 ? 140 ALA A C     1 
ATOM   986  O  O     . ALA A 1 157 ? -9.579  19.673 -1.928  1.00 41.06 ? 140 ALA A O     1 
ATOM   987  C  CB    . ALA A 1 157 ? -9.969  17.894 0.753   1.00 40.94 ? 140 ALA A CB    1 
ATOM   988  N  N     . ASP A 1 158 ? -7.620  19.146 -1.010  1.00 40.01 ? 141 ASP A N     1 
ATOM   989  C  CA    . ASP A 1 158 ? -6.975  20.288 -1.563  1.00 39.42 ? 141 ASP A CA    1 
ATOM   990  C  C     . ASP A 1 158 ? -6.960  20.131 -3.043  1.00 38.85 ? 141 ASP A C     1 
ATOM   991  O  O     . ASP A 1 158 ? -7.416  21.004 -3.762  1.00 38.60 ? 141 ASP A O     1 
ATOM   992  C  CB    . ASP A 1 158 ? -5.565  20.423 -1.006  1.00 39.49 ? 141 ASP A CB    1 
ATOM   993  C  CG    . ASP A 1 158 ? -5.549  21.104 0.349   1.00 39.80 ? 141 ASP A CG    1 
ATOM   994  O  OD1   . ASP A 1 158 ? -4.454  21.381 0.871   1.00 40.90 ? 141 ASP A OD1   1 
ATOM   995  O  OD2   . ASP A 1 158 ? -6.639  21.371 0.895   1.00 39.66 ? 141 ASP A OD2   1 
ATOM   996  N  N     . SER A 1 159 ? -6.471  18.992 -3.504  1.00 38.47 ? 142 SER A N     1 
ATOM   997  C  CA    . SER A 1 159 ? -6.421  18.722 -4.931  1.00 38.26 ? 142 SER A CA    1 
ATOM   998  C  C     . SER A 1 159 ? -7.763  19.040 -5.614  1.00 38.38 ? 142 SER A C     1 
ATOM   999  O  O     . SER A 1 159 ? -7.786  19.508 -6.752  1.00 38.45 ? 142 SER A O     1 
ATOM   1000 C  CB    . SER A 1 159 ? -6.031  17.269 -5.188  1.00 38.00 ? 142 SER A CB    1 
ATOM   1001 O  OG    . SER A 1 159 ? -7.122  16.402 -4.963  1.00 37.51 ? 142 SER A OG    1 
ATOM   1002 N  N     . LEU A 1 160 ? -8.871  18.788 -4.916  1.00 38.42 ? 143 LEU A N     1 
ATOM   1003 C  CA    . LEU A 1 160 ? -10.201 19.080 -5.444  1.00 38.64 ? 143 LEU A CA    1 
ATOM   1004 C  C     . LEU A 1 160 ? -10.675 20.507 -5.105  1.00 38.88 ? 143 LEU A C     1 
ATOM   1005 O  O     . LEU A 1 160 ? -11.672 20.978 -5.643  1.00 38.94 ? 143 LEU A O     1 
ATOM   1006 C  CB    . LEU A 1 160 ? -11.215 18.042 -4.930  1.00 38.45 ? 143 LEU A CB    1 
ATOM   1007 C  CG    . LEU A 1 160 ? -10.913 16.569 -5.297  1.00 37.81 ? 143 LEU A CG    1 
ATOM   1008 C  CD1   . LEU A 1 160 ? -11.835 15.584 -4.561  1.00 36.53 ? 143 LEU A CD1   1 
ATOM   1009 C  CD2   . LEU A 1 160 ? -11.008 16.372 -6.793  1.00 37.12 ? 143 LEU A CD2   1 
ATOM   1010 N  N     . GLY A 1 161 ? -9.958  21.190 -4.226  1.00 39.30 ? 144 GLY A N     1 
ATOM   1011 C  CA    . GLY A 1 161 ? -10.311 22.553 -3.845  1.00 39.65 ? 144 GLY A CA    1 
ATOM   1012 C  C     . GLY A 1 161 ? -11.407 22.563 -2.810  1.00 39.99 ? 144 GLY A C     1 
ATOM   1013 O  O     . GLY A 1 161 ? -12.165 23.521 -2.700  1.00 40.16 ? 144 GLY A O     1 
ATOM   1014 N  N     . ILE A 1 162 ? -11.473 21.490 -2.032  1.00 40.70 ? 145 ILE A N     1 
ATOM   1015 C  CA    . ILE A 1 162 ? -12.525 21.298 -1.026  1.00 40.92 ? 145 ILE A CA    1 
ATOM   1016 C  C     . ILE A 1 162 ? -11.993 21.503 0.379   1.00 40.97 ? 145 ILE A C     1 
ATOM   1017 O  O     . ILE A 1 162 ? -10.812 21.212 0.649   1.00 40.88 ? 145 ILE A O     1 
ATOM   1018 C  CB    . ILE A 1 162 ? -13.066 19.861 -1.088  1.00 40.86 ? 145 ILE A CB    1 
ATOM   1019 C  CG1   . ILE A 1 162 ? -13.737 19.618 -2.393  1.00 40.75 ? 145 ILE A CG1   1 
ATOM   1020 C  CG2   . ILE A 1 162 ? -14.097 19.598 -0.008  1.00 41.11 ? 145 ILE A CG2   1 
ATOM   1021 C  CD1   . ILE A 1 162 ? -14.378 18.299 -2.410  1.00 41.49 ? 145 ILE A CD1   1 
ATOM   1022 N  N     . PRO A 1 163 ? -12.850 22.008 1.282   1.00 41.11 ? 146 PRO A N     1 
ATOM   1023 C  CA    . PRO A 1 163 ? -12.468 22.026 2.687   1.00 41.43 ? 146 PRO A CA    1 
ATOM   1024 C  C     . PRO A 1 163 ? -12.556 20.609 3.236   1.00 41.77 ? 146 PRO A C     1 
ATOM   1025 O  O     . PRO A 1 163 ? -13.366 19.799 2.737   1.00 41.90 ? 146 PRO A O     1 
ATOM   1026 C  CB    . PRO A 1 163 ? -13.490 22.959 3.350   1.00 41.01 ? 146 PRO A CB    1 
ATOM   1027 C  CG    . PRO A 1 163 ? -14.640 23.002 2.431   1.00 41.53 ? 146 PRO A CG    1 
ATOM   1028 C  CD    . PRO A 1 163 ? -14.174 22.597 1.050   1.00 41.27 ? 146 PRO A CD    1 
ATOM   1029 N  N     . PHE A 1 164 ? -11.709 20.319 4.236   1.00 41.98 ? 147 PHE A N     1 
ATOM   1030 C  CA    . PHE A 1 164 ? -11.604 19.001 4.843   1.00 41.96 ? 147 PHE A CA    1 
ATOM   1031 C  C     . PHE A 1 164 ? -11.514 19.085 6.356   1.00 42.20 ? 147 PHE A C     1 
ATOM   1032 O  O     . PHE A 1 164 ? -10.659 19.797 6.891   1.00 42.11 ? 147 PHE A O     1 
ATOM   1033 C  CB    . PHE A 1 164 ? -10.369 18.290 4.314   1.00 41.77 ? 147 PHE A CB    1 
ATOM   1034 C  CG    . PHE A 1 164 ? -9.956  17.098 5.137   1.00 41.63 ? 147 PHE A CG    1 
ATOM   1035 C  CD1   . PHE A 1 164 ? -10.779 15.996 5.242   1.00 41.02 ? 147 PHE A CD1   1 
ATOM   1036 C  CD2   . PHE A 1 164 ? -8.752  17.081 5.789   1.00 40.31 ? 147 PHE A CD2   1 
ATOM   1037 C  CE1   . PHE A 1 164 ? -10.400 14.911 5.978   1.00 40.98 ? 147 PHE A CE1   1 
ATOM   1038 C  CE2   . PHE A 1 164 ? -8.390  16.005 6.516   1.00 41.04 ? 147 PHE A CE2   1 
ATOM   1039 C  CZ    . PHE A 1 164 ? -9.217  14.908 6.604   1.00 40.69 ? 147 PHE A CZ    1 
ATOM   1040 N  N     . LEU A 1 165 ? -12.396 18.347 7.037   1.00 42.54 ? 148 LEU A N     1 
ATOM   1041 C  CA    . LEU A 1 165 ? -12.399 18.285 8.500   1.00 42.64 ? 148 LEU A CA    1 
ATOM   1042 C  C     . LEU A 1 165 ? -12.516 16.845 9.006   1.00 42.56 ? 148 LEU A C     1 
ATOM   1043 O  O     . LEU A 1 165 ? -13.240 16.039 8.427   1.00 42.34 ? 148 LEU A O     1 
ATOM   1044 C  CB    . LEU A 1 165 ? -13.572 19.085 9.074   1.00 42.75 ? 148 LEU A CB    1 
ATOM   1045 C  CG    . LEU A 1 165 ? -13.400 20.589 9.142   1.00 44.01 ? 148 LEU A CG    1 
ATOM   1046 C  CD1   . LEU A 1 165 ? -14.116 21.339 7.975   1.00 44.55 ? 148 LEU A CD1   1 
ATOM   1047 C  CD2   . LEU A 1 165 ? -13.925 21.074 10.504  1.00 45.97 ? 148 LEU A CD2   1 
ATOM   1048 N  N     . GLU A 1 166 ? -11.822 16.552 10.108  1.00 42.56 ? 149 GLU A N     1 
ATOM   1049 C  CA    . GLU A 1 166 ? -11.967 15.276 10.810  1.00 42.48 ? 149 GLU A CA    1 
ATOM   1050 C  C     . GLU A 1 166 ? -12.900 15.442 11.998  1.00 42.66 ? 149 GLU A C     1 
ATOM   1051 O  O     . GLU A 1 166 ? -12.813 16.431 12.733  1.00 42.91 ? 149 GLU A O     1 
ATOM   1052 C  CB    . GLU A 1 166 ? -10.621 14.774 11.263  1.00 42.23 ? 149 GLU A CB    1 
ATOM   1053 C  CG    . GLU A 1 166 ? -9.796  14.263 10.116  1.00 42.11 ? 149 GLU A CG    1 
ATOM   1054 C  CD    . GLU A 1 166 ? -8.542  13.614 10.578  1.00 41.88 ? 149 GLU A CD    1 
ATOM   1055 O  OE1   . GLU A 1 166 ? -7.973  14.118 11.568  1.00 42.26 ? 149 GLU A OE1   1 
ATOM   1056 O  OE2   . GLU A 1 166 ? -8.117  12.607 9.960   1.00 40.04 ? 149 GLU A OE2   1 
ATOM   1057 N  N     . THR A 1 167 ? -13.803 14.488 12.182  1.00 42.73 ? 150 THR A N     1 
ATOM   1058 C  CA    . THR A 1 167 ? -14.825 14.637 13.195  1.00 42.83 ? 150 THR A CA    1 
ATOM   1059 C  C     . THR A 1 167 ? -15.009 13.404 14.086  1.00 43.29 ? 150 THR A C     1 
ATOM   1060 O  O     . THR A 1 167 ? -14.512 12.317 13.818  1.00 43.94 ? 150 THR A O     1 
ATOM   1061 C  CB    . THR A 1 167 ? -16.178 14.970 12.540  1.00 42.78 ? 150 THR A CB    1 
ATOM   1062 O  OG1   . THR A 1 167 ? -16.609 13.855 11.767  1.00 42.51 ? 150 THR A OG1   1 
ATOM   1063 C  CG2   . THR A 1 167 ? -16.054 16.181 11.629  1.00 42.08 ? 150 THR A CG2   1 
ATOM   1064 N  N     . SER A 1 168 ? -15.724 13.605 15.165  1.00 43.45 ? 151 SER A N     1 
ATOM   1065 C  CA    . SER A 1 168 ? -16.078 12.542 16.045  1.00 43.32 ? 151 SER A CA    1 
ATOM   1066 C  C     . SER A 1 168 ? -17.510 12.833 16.508  1.00 43.72 ? 151 SER A C     1 
ATOM   1067 O  O     . SER A 1 168 ? -17.737 13.725 17.340  1.00 43.66 ? 151 SER A O     1 
ATOM   1068 C  CB    . SER A 1 168 ? -15.123 12.494 17.235  1.00 43.21 ? 151 SER A CB    1 
ATOM   1069 O  OG    . SER A 1 168 ? -15.456 11.439 18.114  1.00 42.85 ? 151 SER A OG    1 
ATOM   1070 N  N     . ALA A 1 169 ? -18.487 12.113 15.930  1.00 43.92 ? 152 ALA A N     1 
ATOM   1071 C  CA    . ALA A 1 169 ? -19.874 12.188 16.404  1.00 43.56 ? 152 ALA A CA    1 
ATOM   1072 C  C     . ALA A 1 169 ? -19.933 11.697 17.848  1.00 43.76 ? 152 ALA A C     1 
ATOM   1073 O  O     . ALA A 1 169 ? -20.747 12.185 18.630  1.00 44.26 ? 152 ALA A O     1 
ATOM   1074 C  CB    . ALA A 1 169 ? -20.780 11.374 15.544  1.00 43.56 ? 152 ALA A CB    1 
ATOM   1075 N  N     . LYS A 1 170 ? -19.053 10.741 18.198  1.00 43.49 ? 153 LYS A N     1 
ATOM   1076 C  CA    . LYS A 1 170 ? -18.998 10.161 19.550  1.00 42.98 ? 153 LYS A CA    1 
ATOM   1077 C  C     . LYS A 1 170 ? -18.544 11.187 20.572  1.00 42.60 ? 153 LYS A C     1 
ATOM   1078 O  O     . LYS A 1 170 ? -19.257 11.455 21.518  1.00 42.38 ? 153 LYS A O     1 
ATOM   1079 C  CB    . LYS A 1 170 ? -18.073 8.929  19.582  1.00 43.06 ? 153 LYS A CB    1 
ATOM   1080 C  CG    . LYS A 1 170 ? -17.908 8.272  20.973  1.00 42.79 ? 153 LYS A CG    1 
ATOM   1081 C  CD    . LYS A 1 170 ? -17.058 7.030  20.886  1.00 42.60 ? 153 LYS A CD    1 
ATOM   1082 C  CE    . LYS A 1 170 ? -16.570 6.587  22.231  1.00 42.02 ? 153 LYS A CE    1 
ATOM   1083 N  NZ    . LYS A 1 170 ? -15.766 5.337  22.122  1.00 42.27 ? 153 LYS A NZ    1 
ATOM   1084 N  N     . ASN A 1 171 ? -17.368 11.763 20.378  1.00 42.23 ? 154 ASN A N     1 
ATOM   1085 C  CA    . ASN A 1 171 ? -16.844 12.713 21.343  1.00 42.21 ? 154 ASN A CA    1 
ATOM   1086 C  C     . ASN A 1 171 ? -17.344 14.129 21.150  1.00 42.38 ? 154 ASN A C     1 
ATOM   1087 O  O     . ASN A 1 171 ? -17.116 15.001 22.011  1.00 42.65 ? 154 ASN A O     1 
ATOM   1088 C  CB    . ASN A 1 171 ? -15.326 12.684 21.324  1.00 42.09 ? 154 ASN A CB    1 
ATOM   1089 C  CG    . ASN A 1 171 ? -14.783 11.428 21.935  1.00 41.08 ? 154 ASN A CG    1 
ATOM   1090 O  OD1   . ASN A 1 171 ? -15.528 10.652 22.486  1.00 38.49 ? 154 ASN A OD1   1 
ATOM   1091 N  ND2   . ASN A 1 171 ? -13.477 11.225 21.844  1.00 41.92 ? 154 ASN A ND2   1 
ATOM   1092 N  N     . ALA A 1 172 ? -18.056 14.354 20.045  1.00 42.66 ? 155 ALA A N     1 
ATOM   1093 C  CA    . ALA A 1 172 ? -18.571 15.688 19.687  1.00 42.56 ? 155 ALA A CA    1 
ATOM   1094 C  C     . ALA A 1 172 ? -17.396 16.594 19.301  1.00 42.59 ? 155 ALA A C     1 
ATOM   1095 O  O     . ALA A 1 172 ? -17.254 17.672 19.819  1.00 43.28 ? 155 ALA A O     1 
ATOM   1096 C  CB    . ALA A 1 172 ? -19.380 16.290 20.847  1.00 42.00 ? 155 ALA A CB    1 
ATOM   1097 N  N     . THR A 1 173 ? -16.552 16.135 18.390  1.00 42.53 ? 156 THR A N     1 
ATOM   1098 C  CA    . THR A 1 173 ? -15.357 16.870 18.030  1.00 42.51 ? 156 THR A CA    1 
ATOM   1099 C  C     . THR A 1 173 ? -15.441 17.315 16.582  1.00 42.41 ? 156 THR A C     1 
ATOM   1100 O  O     . THR A 1 173 ? -15.654 16.509 15.696  1.00 42.45 ? 156 THR A O     1 
ATOM   1101 C  CB    . THR A 1 173 ? -14.059 16.022 18.290  1.00 42.62 ? 156 THR A CB    1 
ATOM   1102 O  OG1   . THR A 1 173 ? -13.892 15.839 19.702  1.00 41.66 ? 156 THR A OG1   1 
ATOM   1103 C  CG2   . THR A 1 173 ? -12.802 16.714 17.697  1.00 42.61 ? 156 THR A CG2   1 
ATOM   1104 N  N     . ASN A 1 174 ? -15.276 18.618 16.378  1.00 42.59 ? 157 ASN A N     1 
ATOM   1105 C  CA    . ASN A 1 174 ? -15.369 19.265 15.082  1.00 42.74 ? 157 ASN A CA    1 
ATOM   1106 C  C     . ASN A 1 174 ? -16.753 19.230 14.440  1.00 42.66 ? 157 ASN A C     1 
ATOM   1107 O  O     . ASN A 1 174 ? -16.924 19.748 13.351  1.00 42.78 ? 157 ASN A O     1 
ATOM   1108 C  CB    . ASN A 1 174 ? -14.331 18.690 14.110  1.00 42.76 ? 157 ASN A CB    1 
ATOM   1109 C  CG    . ASN A 1 174 ? -12.983 19.375 14.220  1.00 43.37 ? 157 ASN A CG    1 
ATOM   1110 O  OD1   . ASN A 1 174 ? -12.703 20.092 15.188  1.00 43.22 ? 157 ASN A OD1   1 
ATOM   1111 N  ND2   . ASN A 1 174 ? -12.128 19.150 13.217  1.00 44.63 ? 157 ASN A ND2   1 
ATOM   1112 N  N     . VAL A 1 175 ? -17.743 18.652 15.107  1.00 42.78 ? 158 VAL A N     1 
ATOM   1113 C  CA    . VAL A 1 175 ? -19.040 18.432 14.460  1.00 43.07 ? 158 VAL A CA    1 
ATOM   1114 C  C     . VAL A 1 175 ? -19.660 19.752 14.085  1.00 43.66 ? 158 VAL A C     1 
ATOM   1115 O  O     . VAL A 1 175 ? -20.216 19.908 13.016  1.00 43.74 ? 158 VAL A O     1 
ATOM   1116 C  CB    . VAL A 1 175 ? -20.017 17.603 15.345  1.00 42.97 ? 158 VAL A CB    1 
ATOM   1117 C  CG1   . VAL A 1 175 ? -21.422 17.638 14.779  1.00 42.21 ? 158 VAL A CG1   1 
ATOM   1118 C  CG2   . VAL A 1 175 ? -19.521 16.183 15.462  1.00 41.90 ? 158 VAL A CG2   1 
ATOM   1119 N  N     . GLU A 1 176 ? -19.529 20.720 14.949  1.00 44.54 ? 159 GLU A N     1 
ATOM   1120 C  CA    . GLU A 1 176 ? -20.084 21.994 14.658  1.00 45.44 ? 159 GLU A CA    1 
ATOM   1121 C  C     . GLU A 1 176 ? -19.148 22.786 13.769  1.00 45.31 ? 159 GLU A C     1 
ATOM   1122 O  O     . GLU A 1 176 ? -19.616 23.479 12.881  1.00 45.30 ? 159 GLU A O     1 
ATOM   1123 C  CB    . GLU A 1 176 ? -20.395 22.730 15.937  1.00 45.83 ? 159 GLU A CB    1 
ATOM   1124 C  CG    . GLU A 1 176 ? -21.670 23.516 15.820  1.00 49.17 ? 159 GLU A CG    1 
ATOM   1125 C  CD    . GLU A 1 176 ? -22.586 23.314 17.022  1.00 52.93 ? 159 GLU A CD    1 
ATOM   1126 O  OE1   . GLU A 1 176 ? -23.466 22.384 16.976  1.00 55.35 ? 159 GLU A OE1   1 
ATOM   1127 O  OE2   . GLU A 1 176 ? -22.401 24.065 18.016  1.00 54.83 ? 159 GLU A OE2   1 
ATOM   1128 N  N     . GLN A 1 177 ? -17.828 22.693 13.989  1.00 45.47 ? 160 GLN A N     1 
ATOM   1129 C  CA    . GLN A 1 177 ? -16.895 23.326 13.059  1.00 45.74 ? 160 GLN A CA    1 
ATOM   1130 C  C     . GLN A 1 177 ? -17.321 22.940 11.628  1.00 45.28 ? 160 GLN A C     1 
ATOM   1131 O  O     . GLN A 1 177 ? -17.415 23.807 10.776  1.00 45.55 ? 160 GLN A O     1 
ATOM   1132 C  CB    . GLN A 1 177 ? -15.411 22.956 13.338  1.00 46.05 ? 160 GLN A CB    1 
ATOM   1133 C  CG    . GLN A 1 177 ? -14.571 24.063 14.137  1.00 47.24 ? 160 GLN A CG    1 
ATOM   1134 C  CD    . GLN A 1 177 ? -13.049 23.608 14.581  1.00 48.64 ? 160 GLN A CD    1 
ATOM   1135 O  OE1   . GLN A 1 177 ? -12.517 22.549 14.142  1.00 52.73 ? 160 GLN A OE1   1 
ATOM   1136 N  NE2   . GLN A 1 177 ? -12.389 24.446 15.458  1.00 50.26 ? 160 GLN A NE2   1 
ATOM   1137 N  N     . SER A 1 178 ? -17.638 21.658 11.395  1.00 44.59 ? 161 SER A N     1 
ATOM   1138 C  CA    . SER A 1 178 ? -18.011 21.131 10.046  1.00 44.45 ? 161 SER A CA    1 
ATOM   1139 C  C     . SER A 1 178 ? -19.176 21.799 9.328   1.00 44.03 ? 161 SER A C     1 
ATOM   1140 O  O     . SER A 1 178 ? -19.086 22.125 8.134   1.00 43.67 ? 161 SER A O     1 
ATOM   1141 C  CB    . SER A 1 178 ? -18.367 19.643 10.133  1.00 44.32 ? 161 SER A CB    1 
ATOM   1142 O  OG    . SER A 1 178 ? -17.254 18.873 10.527  1.00 46.02 ? 161 SER A OG    1 
ATOM   1143 N  N     . PHE A 1 179 ? -20.296 21.920 10.033  1.00 43.78 ? 162 PHE A N     1 
ATOM   1144 C  CA    . PHE A 1 179 ? -21.494 22.513 9.477   1.00 43.69 ? 162 PHE A CA    1 
ATOM   1145 C  C     . PHE A 1 179 ? -21.291 24.015 9.328   1.00 43.74 ? 162 PHE A C     1 
ATOM   1146 O  O     . PHE A 1 179 ? -21.700 24.613 8.330   1.00 43.75 ? 162 PHE A O     1 
ATOM   1147 C  CB    . PHE A 1 179 ? -22.696 22.171 10.352  1.00 43.27 ? 162 PHE A CB    1 
ATOM   1148 C  CG    . PHE A 1 179 ? -23.124 20.727 10.240  1.00 43.47 ? 162 PHE A CG    1 
ATOM   1149 C  CD1   . PHE A 1 179 ? -22.785 19.799 11.221  1.00 43.60 ? 162 PHE A CD1   1 
ATOM   1150 C  CD2   . PHE A 1 179 ? -23.845 20.277 9.119   1.00 43.14 ? 162 PHE A CD2   1 
ATOM   1151 C  CE1   . PHE A 1 179 ? -23.184 18.446 11.107  1.00 42.97 ? 162 PHE A CE1   1 
ATOM   1152 C  CE2   . PHE A 1 179 ? -24.235 18.938 9.010   1.00 43.11 ? 162 PHE A CE2   1 
ATOM   1153 C  CZ    . PHE A 1 179 ? -23.905 18.028 10.017  1.00 42.57 ? 162 PHE A CZ    1 
ATOM   1154 N  N     . MET A 1 180 ? -20.615 24.598 10.317  1.00 43.84 ? 163 MET A N     1 
ATOM   1155 C  CA    . MET A 1 180 ? -20.208 26.005 10.296  1.00 43.89 ? 163 MET A CA    1 
ATOM   1156 C  C     . MET A 1 180 ? -19.338 26.312 9.084   1.00 43.48 ? 163 MET A C     1 
ATOM   1157 O  O     . MET A 1 180 ? -19.527 27.321 8.421   1.00 43.45 ? 163 MET A O     1 
ATOM   1158 C  CB    . MET A 1 180 ? -19.396 26.312 11.547  1.00 44.20 ? 163 MET A CB    1 
ATOM   1159 C  CG    . MET A 1 180 ? -20.169 26.186 12.827  1.00 45.61 ? 163 MET A CG    1 
ATOM   1160 S  SD    . MET A 1 180 ? -21.158 27.624 13.058  1.00 48.08 ? 163 MET A SD    1 
ATOM   1161 C  CE    . MET A 1 180 ? -19.881 28.825 13.532  1.00 47.11 ? 163 MET A CE    1 
ATOM   1162 N  N     . THR A 1 181 ? -18.357 25.448 8.841   1.00 43.05 ? 164 THR A N     1 
ATOM   1163 C  CA    . THR A 1 181 ? -17.467 25.565 7.696   1.00 43.15 ? 164 THR A CA    1 
ATOM   1164 C  C     . THR A 1 181 ? -18.282 25.465 6.395   1.00 43.17 ? 164 THR A C     1 
ATOM   1165 O  O     . THR A 1 181 ? -17.990 26.171 5.402   1.00 43.25 ? 164 THR A O     1 
ATOM   1166 C  CB    . THR A 1 181 ? -16.372 24.439 7.698   1.00 42.95 ? 164 THR A CB    1 
ATOM   1167 O  OG1   . THR A 1 181 ? -15.612 24.513 8.899   1.00 43.03 ? 164 THR A OG1   1 
ATOM   1168 C  CG2   . THR A 1 181 ? -15.426 24.562 6.495   1.00 42.49 ? 164 THR A CG2   1 
ATOM   1169 N  N     . MET A 1 182 ? -19.302 24.601 6.398   1.00 43.08 ? 165 MET A N     1 
ATOM   1170 C  CA    . MET A 1 182 ? -20.173 24.458 5.226   1.00 42.81 ? 165 MET A CA    1 
ATOM   1171 C  C     . MET A 1 182 ? -21.007 25.758 4.970   1.00 42.44 ? 165 MET A C     1 
ATOM   1172 O  O     . MET A 1 182 ? -20.967 26.320 3.863   1.00 41.95 ? 165 MET A O     1 
ATOM   1173 C  CB    . MET A 1 182 ? -21.045 23.203 5.349   1.00 42.85 ? 165 MET A CB    1 
ATOM   1174 C  CG    . MET A 1 182 ? -22.035 23.013 4.186   1.00 43.32 ? 165 MET A CG    1 
ATOM   1175 S  SD    . MET A 1 182 ? -21.281 23.098 2.563   1.00 43.90 ? 165 MET A SD    1 
ATOM   1176 C  CE    . MET A 1 182 ? -21.009 21.330 2.246   1.00 45.76 ? 165 MET A CE    1 
ATOM   1177 N  N     . ALA A 1 183 ? -21.731 26.233 5.990   1.00 42.20 ? 166 ALA A N     1 
ATOM   1178 C  CA    . ALA A 1 183 ? -22.395 27.542 5.910   1.00 42.06 ? 166 ALA A CA    1 
ATOM   1179 C  C     . ALA A 1 183 ? -21.413 28.557 5.317   1.00 42.06 ? 166 ALA A C     1 
ATOM   1180 O  O     . ALA A 1 183 ? -21.698 29.189 4.295   1.00 42.67 ? 166 ALA A O     1 
ATOM   1181 C  CB    . ALA A 1 183 ? -22.832 27.989 7.276   1.00 41.79 ? 166 ALA A CB    1 
ATOM   1182 N  N     . ALA A 1 184 ? -20.248 28.687 5.955   1.00 41.53 ? 167 ALA A N     1 
ATOM   1183 C  CA    . ALA A 1 184 ? -19.208 29.626 5.523   1.00 41.28 ? 167 ALA A CA    1 
ATOM   1184 C  C     . ALA A 1 184 ? -18.950 29.559 4.028   1.00 40.90 ? 167 ALA A C     1 
ATOM   1185 O  O     . ALA A 1 184 ? -18.861 30.581 3.367   1.00 40.70 ? 167 ALA A O     1 
ATOM   1186 C  CB    . ALA A 1 184 ? -17.910 29.359 6.282   1.00 40.87 ? 167 ALA A CB    1 
ATOM   1187 N  N     . GLU A 1 185 ? -18.839 28.349 3.504   1.00 40.82 ? 168 GLU A N     1 
ATOM   1188 C  CA    . GLU A 1 185 ? -18.488 28.174 2.124   1.00 41.00 ? 168 GLU A CA    1 
ATOM   1189 C  C     . GLU A 1 185 ? -19.642 28.569 1.188   1.00 40.69 ? 168 GLU A C     1 
ATOM   1190 O  O     . GLU A 1 185 ? -19.417 29.112 0.111   1.00 40.46 ? 168 GLU A O     1 
ATOM   1191 C  CB    . GLU A 1 185 ? -18.051 26.740 1.869   1.00 41.25 ? 168 GLU A CB    1 
ATOM   1192 C  CG    . GLU A 1 185 ? -16.867 26.681 0.934   1.00 43.99 ? 168 GLU A CG    1 
ATOM   1193 C  CD    . GLU A 1 185 ? -15.653 27.349 1.563   1.00 46.71 ? 168 GLU A CD    1 
ATOM   1194 O  OE1   . GLU A 1 185 ? -15.296 26.887 2.658   1.00 51.06 ? 168 GLU A OE1   1 
ATOM   1195 O  OE2   . GLU A 1 185 ? -15.075 28.332 1.010   1.00 46.80 ? 168 GLU A OE2   1 
ATOM   1196 N  N     . ILE A 1 186 ? -20.871 28.300 1.623   1.00 40.75 ? 169 ILE A N     1 
ATOM   1197 C  CA    . ILE A 1 186 ? -22.077 28.618 0.856   1.00 40.60 ? 169 ILE A CA    1 
ATOM   1198 C  C     . ILE A 1 186 ? -22.296 30.130 0.830   1.00 40.97 ? 169 ILE A C     1 
ATOM   1199 O  O     . ILE A 1 186 ? -22.512 30.727 -0.237  1.00 41.10 ? 169 ILE A O     1 
ATOM   1200 C  CB    . ILE A 1 186 ? -23.318 27.952 1.473   1.00 40.45 ? 169 ILE A CB    1 
ATOM   1201 C  CG1   . ILE A 1 186 ? -23.184 26.433 1.474   1.00 40.21 ? 169 ILE A CG1   1 
ATOM   1202 C  CG2   . ILE A 1 186 ? -24.539 28.314 0.693   1.00 40.56 ? 169 ILE A CG2   1 
ATOM   1203 C  CD1   . ILE A 1 186 ? -24.401 25.720 2.049   1.00 40.05 ? 169 ILE A CD1   1 
ATOM   1204 N  N     . LYS A 1 187 ? -22.230 30.739 2.021   1.00 41.02 ? 170 LYS A N     1 
ATOM   1205 C  CA    . LYS A 1 187 ? -22.362 32.178 2.190   1.00 40.64 ? 170 LYS A CA    1 
ATOM   1206 C  C     . LYS A 1 187 ? -21.279 32.880 1.419   1.00 40.45 ? 170 LYS A C     1 
ATOM   1207 O  O     . LYS A 1 187 ? -21.464 34.012 1.005   1.00 40.77 ? 170 LYS A O     1 
ATOM   1208 C  CB    . LYS A 1 187 ? -22.248 32.534 3.666   1.00 40.76 ? 170 LYS A CB    1 
ATOM   1209 C  CG    . LYS A 1 187 ? -22.454 34.015 4.009   1.00 40.94 ? 170 LYS A CG    1 
ATOM   1210 C  CD    . LYS A 1 187 ? -22.592 34.170 5.527   1.00 41.10 ? 170 LYS A CD    1 
ATOM   1211 C  CE    . LYS A 1 187 ? -22.443 35.606 5.986   1.00 42.17 ? 170 LYS A CE    1 
ATOM   1212 N  NZ    . LYS A 1 187 ? -21.050 36.191 5.812   1.00 44.04 ? 170 LYS A NZ    1 
ATOM   1213 N  N     . LYS A 1 188 ? -20.139 32.213 1.243   1.00 40.09 ? 171 LYS A N     1 
ATOM   1214 C  CA    . LYS A 1 188 ? -19.043 32.748 0.437   1.00 39.99 ? 171 LYS A CA    1 
ATOM   1215 C  C     . LYS A 1 188 ? -19.401 32.885 -1.087  1.00 39.58 ? 171 LYS A C     1 
ATOM   1216 O  O     . LYS A 1 188 ? -19.138 33.918 -1.677  1.00 38.97 ? 171 LYS A O     1 
ATOM   1217 C  CB    . LYS A 1 188 ? -17.803 31.896 0.627   1.00 39.95 ? 171 LYS A CB    1 
ATOM   1218 C  CG    . LYS A 1 188 ? -16.529 32.528 0.139   1.00 40.17 ? 171 LYS A CG    1 
ATOM   1219 C  CD    . LYS A 1 188 ? -15.368 31.569 0.357   1.00 40.76 ? 171 LYS A CD    1 
ATOM   1220 C  CE    . LYS A 1 188 ? -14.111 31.932 -0.461  1.00 41.58 ? 171 LYS A CE    1 
ATOM   1221 N  NZ    . LYS A 1 188 ? -13.167 30.747 -0.535  1.00 42.82 ? 171 LYS A NZ    1 
ATOM   1222 N  N     . ARG A 1 189 ? -20.013 31.855 -1.697  1.00 39.63 ? 172 ARG A N     1 
ATOM   1223 C  CA    . ARG A 1 189 ? -20.500 31.936 -3.127  1.00 39.43 ? 172 ARG A CA    1 
ATOM   1224 C  C     . ARG A 1 189 ? -21.598 32.960 -3.355  1.00 38.96 ? 172 ARG A C     1 
ATOM   1225 O  O     . ARG A 1 189 ? -21.880 33.316 -4.502  1.00 39.42 ? 172 ARG A O     1 
ATOM   1226 C  CB    . ARG A 1 189 ? -21.094 30.628 -3.598  1.00 39.32 ? 172 ARG A CB    1 
ATOM   1227 C  CG    . ARG A 1 189 ? -20.166 29.630 -4.108  1.00 39.56 ? 172 ARG A CG    1 
ATOM   1228 C  CD    . ARG A 1 189 ? -20.840 28.269 -3.979  1.00 41.29 ? 172 ARG A CD    1 
ATOM   1229 N  NE    . ARG A 1 189 ? -21.979 28.059 -4.899  1.00 43.50 ? 172 ARG A NE    1 
ATOM   1230 C  CZ    . ARG A 1 189 ? -23.124 27.390 -4.599  1.00 43.86 ? 172 ARG A CZ    1 
ATOM   1231 N  NH1   . ARG A 1 189 ? -23.353 26.883 -3.394  1.00 43.30 ? 172 ARG A NH1   1 
ATOM   1232 N  NH2   . ARG A 1 189 ? -24.071 27.248 -5.523  1.00 44.29 ? 172 ARG A NH2   1 
ATOM   1233 N  N     . MET A 1 190 ? -22.250 33.398 -2.284  1.00 38.38 ? 173 MET A N     1 
ATOM   1234 C  CA    . MET A 1 190 ? -23.314 34.385 -2.387  1.00 37.76 ? 173 MET A CA    1 
ATOM   1235 C  C     . MET A 1 190 ? -22.766 35.775 -1.975  1.00 37.43 ? 173 MET A C     1 
ATOM   1236 O  O     . MET A 1 190 ? -21.597 36.164 -2.312  1.00 36.83 ? 173 MET A O     1 
ATOM   1237 C  CB    . MET A 1 190 ? -24.500 33.920 -1.512  1.00 37.69 ? 173 MET A CB    1 
ATOM   1238 C  CG    . MET A 1 190 ? -24.850 32.349 -1.702  1.00 37.08 ? 173 MET A CG    1 
ATOM   1239 S  SD    . MET A 1 190 ? -26.348 31.687 -0.799  1.00 35.90 ? 173 MET A SD    1 
ATOM   1240 C  CE    . MET A 1 190 ? -26.364 30.007 -1.286  1.00 36.26 ? 173 MET A CE    1 
HETATM 1241 MG MG    . MG  B 2 .   ? -27.251 6.038  8.870   1.00 44.40 ? 202 MG  A MG    1 
HETATM 1242 P  PB    . GDP C 3 .   ? -24.264 5.886  8.538   1.00 58.56 ? 201 GDP A PB    1 
HETATM 1243 O  O1B   . GDP C 3 .   ? -25.039 4.604  8.296   1.00 61.53 ? 201 GDP A O1B   1 
HETATM 1244 O  O2B   . GDP C 3 .   ? -23.257 6.150  7.419   1.00 56.31 ? 201 GDP A O2B   1 
HETATM 1245 O  O3B   . GDP C 3 .   ? -25.273 7.018  8.593   1.00 59.45 ? 201 GDP A O3B   1 
HETATM 1246 O  O3A   . GDP C 3 .   ? -23.450 5.637  9.905   1.00 56.95 ? 201 GDP A O3A   1 
HETATM 1247 P  PA    . GDP C 3 .   ? -24.120 5.731  11.338  1.00 55.67 ? 201 GDP A PA    1 
HETATM 1248 O  O1A   . GDP C 3 .   ? -25.413 4.965  11.412  1.00 55.52 ? 201 GDP A O1A   1 
HETATM 1249 O  O2A   . GDP C 3 .   ? -24.363 7.170  11.686  1.00 57.82 ? 201 GDP A O2A   1 
HETATM 1250 O  "O5'" . GDP C 3 .   ? -22.983 5.209  12.353  1.00 56.79 ? 201 GDP A "O5'" 1 
HETATM 1251 C  "C5'" . GDP C 3 .   ? -22.282 4.005  12.120  1.00 59.15 ? 201 GDP A "C5'" 1 
HETATM 1252 C  "C4'" . GDP C 3 .   ? -21.854 3.347  13.435  1.00 61.79 ? 201 GDP A "C4'" 1 
HETATM 1253 O  "O4'" . GDP C 3 .   ? -20.547 3.827  13.773  1.00 62.74 ? 201 GDP A "O4'" 1 
HETATM 1254 C  "C3'" . GDP C 3 .   ? -22.800 3.590  14.648  1.00 63.43 ? 201 GDP A "C3'" 1 
HETATM 1255 O  "O3'" . GDP C 3 .   ? -23.450 2.388  15.141  1.00 62.24 ? 201 GDP A "O3'" 1 
HETATM 1256 C  "C2'" . GDP C 3 .   ? -21.932 4.239  15.726  1.00 64.97 ? 201 GDP A "C2'" 1 
HETATM 1257 O  "O2'" . GDP C 3 .   ? -21.920 3.517  16.979  1.00 66.74 ? 201 GDP A "O2'" 1 
HETATM 1258 C  "C1'" . GDP C 3 .   ? -20.534 4.334  15.123  1.00 65.67 ? 201 GDP A "C1'" 1 
HETATM 1259 N  N9    . GDP C 3 .   ? -20.087 5.749  15.072  1.00 66.23 ? 201 GDP A N9    1 
HETATM 1260 C  C8    . GDP C 3 .   ? -20.670 6.762  14.392  1.00 66.38 ? 201 GDP A C8    1 
HETATM 1261 N  N7    . GDP C 3 .   ? -19.967 7.904  14.563  1.00 66.24 ? 201 GDP A N7    1 
HETATM 1262 C  C5    . GDP C 3 .   ? -18.930 7.601  15.352  1.00 66.02 ? 201 GDP A C5    1 
HETATM 1263 C  C6    . GDP C 3 .   ? -17.808 8.325  15.918  1.00 66.08 ? 201 GDP A C6    1 
HETATM 1264 O  O6    . GDP C 3 .   ? -17.701 9.523  15.660  1.00 66.32 ? 201 GDP A O6    1 
HETATM 1265 N  N1    . GDP C 3 .   ? -16.924 7.680  16.692  1.00 66.45 ? 201 GDP A N1    1 
HETATM 1266 C  C2    . GDP C 3 .   ? -17.056 6.367  16.956  1.00 66.18 ? 201 GDP A C2    1 
HETATM 1267 N  N2    . GDP C 3 .   ? -16.167 5.724  17.730  1.00 66.20 ? 201 GDP A N2    1 
HETATM 1268 N  N3    . GDP C 3 .   ? -18.070 5.648  16.459  1.00 66.43 ? 201 GDP A N3    1 
HETATM 1269 C  C4    . GDP C 3 .   ? -19.009 6.204  15.673  1.00 66.19 ? 201 GDP A C4    1 
HETATM 1270 X  UNK   . UNX D 4 .   ? -16.678 0.014  8.186   0.01 2.00  ? 401 UNX A UNK   1 
HETATM 1271 X  UNK   . UNX E 4 .   ? -41.347 10.592 11.535  0.02 2.00  ? 402 UNX A UNK   1 
HETATM 1272 O  O     . HOH F 5 .   ? -27.434 5.161  10.492  1.00 44.62 ? 301 HOH A O     1 
HETATM 1273 O  O     . HOH F 5 .   ? -27.862 7.335  7.359   1.00 39.15 ? 302 HOH A O     1 
HETATM 1274 O  O     . HOH F 5 .   ? -25.056 11.241 17.670  1.00 44.90 ? 303 HOH A O     1 
HETATM 1275 O  O     . HOH F 5 .   ? -22.370 29.715 -7.733  1.00 36.46 ? 305 HOH A O     1 
HETATM 1276 O  O     . HOH F 5 .   ? -27.098 4.789  6.924   1.00 43.58 ? 306 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -16 ?   ?   ?   A . n 
A 1 2   GLY 2   -15 ?   ?   ?   A . n 
A 1 3   SER 3   -14 ?   ?   ?   A . n 
A 1 4   SER 4   -13 ?   ?   ?   A . n 
A 1 5   HIS 5   -12 ?   ?   ?   A . n 
A 1 6   HIS 6   -11 ?   ?   ?   A . n 
A 1 7   HIS 7   -10 ?   ?   ?   A . n 
A 1 8   HIS 8   -9  ?   ?   ?   A . n 
A 1 9   HIS 9   -8  ?   ?   ?   A . n 
A 1 10  HIS 10  -7  ?   ?   ?   A . n 
A 1 11  SER 11  -6  ?   ?   ?   A . n 
A 1 12  SER 12  -5  ?   ?   ?   A . n 
A 1 13  GLY 13  -4  ?   ?   ?   A . n 
A 1 14  LEU 14  -3  ?   ?   ?   A . n 
A 1 15  VAL 15  -2  ?   ?   ?   A . n 
A 1 16  PRO 16  -1  ?   ?   ?   A . n 
A 1 17  ARG 17  0   ?   ?   ?   A . n 
A 1 18  GLY 18  1   ?   ?   ?   A . n 
A 1 19  SER 19  2   ?   ?   ?   A . n 
A 1 20  PRO 20  3   ?   ?   ?   A . n 
A 1 21  GLU 21  4   ?   ?   ?   A . n 
A 1 22  TYR 22  5   5   TYR TYR A . n 
A 1 23  ASP 23  6   6   ASP ASP A . n 
A 1 24  TYR 24  7   7   TYR TYR A . n 
A 1 25  LEU 25  8   8   LEU LEU A . n 
A 1 26  PHE 26  9   9   PHE PHE A . n 
A 1 27  LYS 27  10  10  LYS LYS A . n 
A 1 28  LEU 28  11  11  LEU LEU A . n 
A 1 29  LEU 29  12  12  LEU LEU A . n 
A 1 30  LEU 30  13  13  LEU LEU A . n 
A 1 31  ILE 31  14  14  ILE ILE A . n 
A 1 32  GLY 32  15  15  GLY GLY A . n 
A 1 33  ASP 33  16  16  ASP ASP A . n 
A 1 34  SER 34  17  17  SER SER A . n 
A 1 35  GLY 35  18  18  GLY GLY A . n 
A 1 36  VAL 36  19  19  VAL VAL A . n 
A 1 37  GLY 37  20  20  GLY GLY A . n 
A 1 38  LYS 38  21  21  LYS LYS A . n 
A 1 39  SER 39  22  22  SER SER A . n 
A 1 40  CYS 40  23  23  CYS CYS A . n 
A 1 41  LEU 41  24  24  LEU LEU A . n 
A 1 42  LEU 42  25  25  LEU LEU A . n 
A 1 43  LEU 43  26  26  LEU LEU A . n 
A 1 44  ARG 44  27  27  ARG ARG A . n 
A 1 45  PHE 45  28  28  PHE PHE A . n 
A 1 46  ALA 46  29  29  ALA ALA A . n 
A 1 47  ASP 47  30  30  ASP ASP A . n 
A 1 48  ASP 48  31  31  ASP ASP A . n 
A 1 49  THR 49  32  32  THR THR A . n 
A 1 50  TYR 50  33  33  TYR TYR A . n 
A 1 51  THR 51  34  34  THR THR A . n 
A 1 52  GLU 52  35  35  GLU GLU A . n 
A 1 53  SER 53  36  36  SER SER A . n 
A 1 54  TYR 54  37  37  TYR TYR A . n 
A 1 55  ILE 55  38  38  ILE ILE A . n 
A 1 56  SER 56  39  39  SER SER A . n 
A 1 57  THR 57  40  40  THR THR A . n 
A 1 58  ILE 58  41  41  ILE ILE A . n 
A 1 59  GLY 59  42  42  GLY GLY A . n 
A 1 60  VAL 60  43  43  VAL VAL A . n 
A 1 61  ASP 61  44  44  ASP ASP A . n 
A 1 62  PHE 62  45  45  PHE PHE A . n 
A 1 63  LYS 63  46  46  LYS LYS A . n 
A 1 64  ILE 64  47  47  ILE ILE A . n 
A 1 65  ARG 65  48  48  ARG ARG A . n 
A 1 66  THR 66  49  49  THR THR A . n 
A 1 67  ILE 67  50  50  ILE ILE A . n 
A 1 68  GLU 68  51  51  GLU GLU A . n 
A 1 69  LEU 69  52  52  LEU LEU A . n 
A 1 70  ASP 70  53  53  ASP ASP A . n 
A 1 71  GLY 71  54  54  GLY GLY A . n 
A 1 72  LYS 72  55  55  LYS LYS A . n 
A 1 73  THR 73  56  56  THR THR A . n 
A 1 74  ILE 74  57  57  ILE ILE A . n 
A 1 75  LYS 75  58  58  LYS LYS A . n 
A 1 76  LEU 76  59  59  LEU LEU A . n 
A 1 77  GLN 77  60  60  GLN GLN A . n 
A 1 78  ILE 78  61  61  ILE ILE A . n 
A 1 79  TRP 79  62  62  TRP TRP A . n 
A 1 80  ASP 80  63  63  ASP ASP A . n 
A 1 81  THR 81  64  ?   ?   ?   A . n 
A 1 82  ALA 82  65  ?   ?   ?   A . n 
A 1 83  GLY 83  66  ?   ?   ?   A . n 
A 1 84  GLN 84  67  ?   ?   ?   A . n 
A 1 85  GLU 85  68  ?   ?   ?   A . n 
A 1 86  ARG 86  69  ?   ?   ?   A . n 
A 1 87  PHE 87  70  ?   ?   ?   A . n 
A 1 88  ARG 88  71  ?   ?   ?   A . n 
A 1 89  THR 89  72  ?   ?   ?   A . n 
A 1 90  ILE 90  73  ?   ?   ?   A . n 
A 1 91  THR 91  74  ?   ?   ?   A . n 
A 1 92  SER 92  75  ?   ?   ?   A . n 
A 1 93  SER 93  76  ?   ?   ?   A . n 
A 1 94  TYR 94  77  ?   ?   ?   A . n 
A 1 95  TYR 95  78  78  TYR TYR A . n 
A 1 96  ARG 96  79  79  ARG ARG A . n 
A 1 97  GLY 97  80  80  GLY GLY A . n 
A 1 98  ALA 98  81  81  ALA ALA A . n 
A 1 99  HIS 99  82  82  HIS HIS A . n 
A 1 100 GLY 100 83  83  GLY GLY A . n 
A 1 101 ILE 101 84  84  ILE ILE A . n 
A 1 102 ILE 102 85  85  ILE ILE A . n 
A 1 103 VAL 103 86  86  VAL VAL A . n 
A 1 104 VAL 104 87  87  VAL VAL A . n 
A 1 105 TYR 105 88  88  TYR TYR A . n 
A 1 106 ASP 106 89  89  ASP ASP A . n 
A 1 107 VAL 107 90  90  VAL VAL A . n 
A 1 108 THR 108 91  91  THR THR A . n 
A 1 109 ASP 109 92  92  ASP ASP A . n 
A 1 110 GLN 110 93  93  GLN GLN A . n 
A 1 111 GLU 111 94  94  GLU GLU A . n 
A 1 112 SER 112 95  95  SER SER A . n 
A 1 113 PHE 113 96  96  PHE PHE A . n 
A 1 114 ASN 114 97  97  ASN ASN A . n 
A 1 115 ASN 115 98  98  ASN ASN A . n 
A 1 116 VAL 116 99  99  VAL VAL A . n 
A 1 117 LYS 117 100 100 LYS LYS A . n 
A 1 118 GLN 118 101 101 GLN GLN A . n 
A 1 119 TRP 119 102 102 TRP TRP A . n 
A 1 120 LEU 120 103 103 LEU LEU A . n 
A 1 121 GLN 121 104 104 GLN GLN A . n 
A 1 122 GLU 122 105 105 GLU GLU A . n 
A 1 123 ILE 123 106 106 ILE ILE A . n 
A 1 124 ASP 124 107 107 ASP ASP A . n 
A 1 125 ARG 125 108 108 ARG ARG A . n 
A 1 126 TYR 126 109 109 TYR TYR A . n 
A 1 127 ALA 127 110 110 ALA ALA A . n 
A 1 128 SER 128 111 111 SER SER A . n 
A 1 129 GLU 129 112 112 GLU GLU A . n 
A 1 130 ASN 130 113 113 ASN ASN A . n 
A 1 131 VAL 131 114 114 VAL VAL A . n 
A 1 132 ASN 132 115 115 ASN ASN A . n 
A 1 133 LYS 133 116 116 LYS LYS A . n 
A 1 134 LEU 134 117 117 LEU LEU A . n 
A 1 135 LEU 135 118 118 LEU LEU A . n 
A 1 136 VAL 136 119 119 VAL VAL A . n 
A 1 137 GLY 137 120 120 GLY GLY A . n 
A 1 138 ASN 138 121 121 ASN ASN A . n 
A 1 139 LYS 139 122 122 LYS LYS A . n 
A 1 140 CYS 140 123 123 CYS CYS A . n 
A 1 141 ASP 141 124 124 ASP ASP A . n 
A 1 142 LEU 142 125 125 LEU LEU A . n 
A 1 143 THR 143 126 126 THR THR A . n 
A 1 144 THR 144 127 127 THR THR A . n 
A 1 145 LYS 145 128 128 LYS LYS A . n 
A 1 146 LYS 146 129 129 LYS LYS A . n 
A 1 147 VAL 147 130 130 VAL VAL A . n 
A 1 148 VAL 148 131 131 VAL VAL A . n 
A 1 149 ASP 149 132 132 ASP ASP A . n 
A 1 150 TYR 150 133 133 TYR TYR A . n 
A 1 151 THR 151 134 134 THR THR A . n 
A 1 152 THR 152 135 135 THR THR A . n 
A 1 153 ALA 153 136 136 ALA ALA A . n 
A 1 154 LYS 154 137 137 LYS LYS A . n 
A 1 155 GLU 155 138 138 GLU GLU A . n 
A 1 156 PHE 156 139 139 PHE PHE A . n 
A 1 157 ALA 157 140 140 ALA ALA A . n 
A 1 158 ASP 158 141 141 ASP ASP A . n 
A 1 159 SER 159 142 142 SER SER A . n 
A 1 160 LEU 160 143 143 LEU LEU A . n 
A 1 161 GLY 161 144 144 GLY GLY A . n 
A 1 162 ILE 162 145 145 ILE ILE A . n 
A 1 163 PRO 163 146 146 PRO PRO A . n 
A 1 164 PHE 164 147 147 PHE PHE A . n 
A 1 165 LEU 165 148 148 LEU LEU A . n 
A 1 166 GLU 166 149 149 GLU GLU A . n 
A 1 167 THR 167 150 150 THR THR A . n 
A 1 168 SER 168 151 151 SER SER A . n 
A 1 169 ALA 169 152 152 ALA ALA A . n 
A 1 170 LYS 170 153 153 LYS LYS A . n 
A 1 171 ASN 171 154 154 ASN ASN A . n 
A 1 172 ALA 172 155 155 ALA ALA A . n 
A 1 173 THR 173 156 156 THR THR A . n 
A 1 174 ASN 174 157 157 ASN ASN A . n 
A 1 175 VAL 175 158 158 VAL VAL A . n 
A 1 176 GLU 176 159 159 GLU GLU A . n 
A 1 177 GLN 177 160 160 GLN GLN A . n 
A 1 178 SER 178 161 161 SER SER A . n 
A 1 179 PHE 179 162 162 PHE PHE A . n 
A 1 180 MET 180 163 163 MET MET A . n 
A 1 181 THR 181 164 164 THR THR A . n 
A 1 182 MET 182 165 165 MET MET A . n 
A 1 183 ALA 183 166 166 ALA ALA A . n 
A 1 184 ALA 184 167 167 ALA ALA A . n 
A 1 185 GLU 185 168 168 GLU GLU A . n 
A 1 186 ILE 186 169 169 ILE ILE A . n 
A 1 187 LYS 187 170 170 LYS LYS A . n 
A 1 188 LYS 188 171 171 LYS LYS A . n 
A 1 189 ARG 189 172 172 ARG ARG A . n 
A 1 190 MET 190 173 173 MET MET A . n 
A 1 191 GLY 191 174 ?   ?   ?   A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MG  1 202 202 MG  MG  A . 
C 3 GDP 1 201 201 GDP GDP A . 
D 4 UNX 1 401 401 UNX UNX A . 
E 4 UNX 1 402 402 UNX UNX A . 
F 5 HOH 1 301 301 HOH HOH A . 
F 5 HOH 2 302 302 HOH HOH A . 
F 5 HOH 3 303 303 HOH HOH A . 
F 5 HOH 4 305 305 HOH HOH A . 
F 5 HOH 5 306 306 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    UNX 
_pdbx_struct_special_symmetry.auth_seq_id     401 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   D 
_pdbx_struct_special_symmetry.label_comp_id   UNX 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? F HOH .  ? A HOH 301 ? 1_555 MG ? B MG . ? A MG 202 ? 1_555 O   ? F HOH .  ? A HOH 302 ? 1_555 154.3 ? 
2  O   ? F HOH .  ? A HOH 301 ? 1_555 MG ? B MG . ? A MG 202 ? 1_555 O   ? F HOH .  ? A HOH 306 ? 1_555 119.1 ? 
3  O   ? F HOH .  ? A HOH 302 ? 1_555 MG ? B MG . ? A MG 202 ? 1_555 O   ? F HOH .  ? A HOH 306 ? 1_555 75.3  ? 
4  O   ? F HOH .  ? A HOH 301 ? 1_555 MG ? B MG . ? A MG 202 ? 1_555 OG  ? A SER 39 ? A SER 22  ? 1_555 88.7  ? 
5  O   ? F HOH .  ? A HOH 302 ? 1_555 MG ? B MG . ? A MG 202 ? 1_555 OG  ? A SER 39 ? A SER 22  ? 1_555 74.1  ? 
6  O   ? F HOH .  ? A HOH 306 ? 1_555 MG ? B MG . ? A MG 202 ? 1_555 OG  ? A SER 39 ? A SER 22  ? 1_555 149.2 ? 
7  O   ? F HOH .  ? A HOH 301 ? 1_555 MG ? B MG . ? A MG 202 ? 1_555 O1B ? C GDP .  ? A GDP 201 ? 1_555 90.9  ? 
8  O   ? F HOH .  ? A HOH 302 ? 1_555 MG ? B MG . ? A MG 202 ? 1_555 O1B ? C GDP .  ? A GDP 201 ? 1_555 114.7 ? 
9  O   ? F HOH .  ? A HOH 306 ? 1_555 MG ? B MG . ? A MG 202 ? 1_555 O1B ? C GDP .  ? A GDP 201 ? 1_555 58.7  ? 
10 OG  ? A SER 39 ? A SER 22  ? 1_555 MG ? B MG . ? A MG 202 ? 1_555 O1B ? C GDP .  ? A GDP 201 ? 1_555 139.5 ? 
11 O   ? F HOH .  ? A HOH 301 ? 1_555 MG ? B MG . ? A MG 202 ? 1_555 O3B ? C GDP .  ? A GDP 201 ? 1_555 113.9 ? 
12 O   ? F HOH .  ? A HOH 302 ? 1_555 MG ? B MG . ? A MG 202 ? 1_555 O3B ? C GDP .  ? A GDP 201 ? 1_555 84.0  ? 
13 O   ? F HOH .  ? A HOH 306 ? 1_555 MG ? B MG . ? A MG 202 ? 1_555 O3B ? C GDP .  ? A GDP 201 ? 1_555 94.3  ? 
14 OG  ? A SER 39 ? A SER 22  ? 1_555 MG ? B MG . ? A MG 202 ? 1_555 O3B ? C GDP .  ? A GDP 201 ? 1_555 84.9  ? 
15 O1B ? C GDP .  ? A GDP 201 ? 1_555 MG ? B MG . ? A MG 202 ? 1_555 O3B ? C GDP .  ? A GDP 201 ? 1_555 58.6  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-01-31 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_software.classification'       
2 4 'Structure model' '_software.contact_author'       
3 4 'Structure model' '_software.contact_author_email' 
4 4 'Structure model' '_software.date'                 
5 4 'Structure model' '_software.language'             
6 4 'Structure model' '_software.location'             
7 4 'Structure model' '_software.name'                 
8 4 'Structure model' '_software.type'                 
9 4 'Structure model' '_software.version'              
# 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          . 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         -20.8949 
_pdbx_refine_tls.origin_y         16.5437 
_pdbx_refine_tls.origin_z         5.9051 
_pdbx_refine_tls.T[1][1]          0.1055 
_pdbx_refine_tls.T[2][2]          0.1480 
_pdbx_refine_tls.T[3][3]          0.0975 
_pdbx_refine_tls.T[1][2]          -0.0740 
_pdbx_refine_tls.T[1][3]          -0.0405 
_pdbx_refine_tls.T[2][3]          -0.1592 
_pdbx_refine_tls.L[1][1]          3.6219 
_pdbx_refine_tls.L[2][2]          3.4933 
_pdbx_refine_tls.L[3][3]          1.2636 
_pdbx_refine_tls.L[1][2]          -0.2086 
_pdbx_refine_tls.L[1][3]          -0.2542 
_pdbx_refine_tls.L[2][3]          -1.0124 
_pdbx_refine_tls.S[1][1]          -0.0599 
_pdbx_refine_tls.S[2][2]          0.1536 
_pdbx_refine_tls.S[3][3]          -0.0937 
_pdbx_refine_tls.S[1][2]          0.5078 
_pdbx_refine_tls.S[1][3]          -0.3102 
_pdbx_refine_tls.S[2][3]          -0.1911 
_pdbx_refine_tls.S[2][1]          -0.0694 
_pdbx_refine_tls.S[3][1]          -0.0182 
_pdbx_refine_tls.S[3][2]          0.0678 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 22 A 190 ALL A 5   A 173 'X-RAY DIFFRACTION' ? 
2 1 C 1  B 1   ALL A 201 A 202 'X-RAY DIFFRACTION' ? 
# 
_phasing.method   mr 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO       .               ?               package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu       'data reduction'  
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?       ? 1 
SCALEPACK   .               ?               package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu       'data scaling'    
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?       ? 2 
PHASER      .               ?               program 'R. J. Read'         cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/      ?       ? 3 
REFMAC      refmac_5.2.0019 24/04/2001      program 'Murshudov, G.N.'    ccp4@dl.ac.uk               refinement        
http://www.ccp4.ac.uk/main.html                  Fortran ? 4 
PDB_EXTRACT 1.700           'Jul. 11, 2005' package PDB                  sw-help@rcsb.rutgers.edu    'data extraction' 
http://pdb.rutgers.edu/software/                 C++     ? 5 
# 
loop_
_pdbx_database_remark.id 
_pdbx_database_remark.text 
300 
;BIOMOLECULE: 1                                                       
REMARK 300 THIS ENTRY CONTAINS THE CRYSTALLOGRAPHIC ASYMMETRIC UNIT             
REMARK 300 WHICH CONSISTS OF 1 CHAIN(S). THE BIOLOGICAL UNIT OF THIS
PROTEIN IS UNKNOWN.
;
42  
;MOLPROBITY STRUCTURE VALIDATION
 PROGRAMS    : MOLPROBITY  (KING, REDUCE, AND PROBE)
 AUTHORS     : I.W.DAVIS,J.M.WORD
 URL         : HTTP://KINEMAGE.BIOCHEM.DUKE.EDU/MOLPROBITY/
 AUTHORS     : J.S.RICHARDSON,W.B.ARENDALL,D.C.RICHARDSON
 REFERENCE   : NEW TOOLS AND DATA FOR IMPROVING
             : STRUCTURES, USING ALL-ATOM CONTACTS
             : METHODS IN ENZYMOLOGY. 2003;374:385-412.
MOLPROBITY OUTPUT SCORES:
 ALL-ATOM CLASHSCORE     :  18.17  (0.00 B<40)
 BAD ROTAMERS            :   6.6%    9/137    (TARGET  0-1%)
 RAMACHANDRAN OUTLIERS   :   0.0%    0/151    (TARGET  0.2%)
 RAMACHANDRAN FAVORED    :  95.4%  144/151    (TARGET 98.0%)
;
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OD2 A ASP 92 ? ? UNK A UNX 401 ? ? 2.12 
2 1 O   A GLY 42 ? ? UNK A UNX 402 ? ? 2.12 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CG 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            GLN 
_pdbx_validate_rmsd_bond.auth_seq_id_1             160 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            CD 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            GLN 
_pdbx_validate_rmsd_bond.auth_seq_id_2             160 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.649 
_pdbx_validate_rmsd_bond.bond_target_value         1.506 
_pdbx_validate_rmsd_bond.bond_deviation            0.143 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.023 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 TYR A 33  ? ? -170.29 138.85 
2 1 LEU A 52  ? ? -164.13 118.73 
3 1 TYR A 109 ? ? -109.80 66.94  
4 1 ALA A 110 ? ? -174.03 140.91 
5 1 SER A 111 ? ? -34.71  134.25 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -16 ? A MET 1   
2  1 Y 1 A GLY -15 ? A GLY 2   
3  1 Y 1 A SER -14 ? A SER 3   
4  1 Y 1 A SER -13 ? A SER 4   
5  1 Y 1 A HIS -12 ? A HIS 5   
6  1 Y 1 A HIS -11 ? A HIS 6   
7  1 Y 1 A HIS -10 ? A HIS 7   
8  1 Y 1 A HIS -9  ? A HIS 8   
9  1 Y 1 A HIS -8  ? A HIS 9   
10 1 Y 1 A HIS -7  ? A HIS 10  
11 1 Y 1 A SER -6  ? A SER 11  
12 1 Y 1 A SER -5  ? A SER 12  
13 1 Y 1 A GLY -4  ? A GLY 13  
14 1 Y 1 A LEU -3  ? A LEU 14  
15 1 Y 1 A VAL -2  ? A VAL 15  
16 1 Y 1 A PRO -1  ? A PRO 16  
17 1 Y 1 A ARG 0   ? A ARG 17  
18 1 Y 1 A GLY 1   ? A GLY 18  
19 1 Y 1 A SER 2   ? A SER 19  
20 1 Y 1 A PRO 3   ? A PRO 20  
21 1 Y 1 A GLU 4   ? A GLU 21  
22 1 Y 1 A THR 64  ? A THR 81  
23 1 Y 1 A ALA 65  ? A ALA 82  
24 1 Y 1 A GLY 66  ? A GLY 83  
25 1 Y 1 A GLN 67  ? A GLN 84  
26 1 Y 1 A GLU 68  ? A GLU 85  
27 1 Y 1 A ARG 69  ? A ARG 86  
28 1 Y 1 A PHE 70  ? A PHE 87  
29 1 Y 1 A ARG 71  ? A ARG 88  
30 1 Y 1 A THR 72  ? A THR 89  
31 1 Y 1 A ILE 73  ? A ILE 90  
32 1 Y 1 A THR 74  ? A THR 91  
33 1 Y 1 A SER 75  ? A SER 92  
34 1 Y 1 A SER 76  ? A SER 93  
35 1 Y 1 A TYR 77  ? A TYR 94  
36 1 Y 1 A GLY 174 ? A GLY 191 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION'            MG  
3 "GUANOSINE-5'-DIPHOSPHATE" GDP 
4 'UNKNOWN ATOM OR ION'      UNX 
5 water                      HOH 
#