data_2G3R
# 
_entry.id   2G3R 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2G3R         
RCSB  RCSB036650   
WWPDB D_1000036650 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2G3R 
_pdbx_database_status.recvd_initial_deposition_date   2006-02-20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lee, J.'        1 
'Botuyan, M.V.'  2 
'Thompson, J.R.' 3 
'Mer, G.'        4 
# 
_citation.id                        primary 
_citation.title                     
'Structural Basis for the Methylation State-Specific Recognition of Histone H4-K20 by 53BP1 and Crb2 in DNA Repair.' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            127 
_citation.page_first                1361 
_citation.page_last                 1373 
_citation.year                      2006 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17190600 
_citation.pdbx_database_id_DOI      10.1016/j.cell.2006.10.043 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Botuyan, M.V.'  1 
primary 'Lee, J.'        2 
primary 'Ward, I.M.'     3 
primary 'Kim, J.E.'      4 
primary 'Thompson, J.R.' 5 
primary 'Chen, J.'       6 
primary 'Mer, G.'        7 
# 
_cell.entry_id           2G3R 
_cell.length_a           55.895 
_cell.length_b           77.834 
_cell.length_c           36.350 
_cell.angle_alpha        90.00 
_cell.angle_beta         121.13 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2G3R 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Tumor suppressor p53-binding protein 1' 13944.780 1   ? ? 
'Tandem tutor domains, residues 1484-1603 (SWS-Q12888)' ? 
2 non-polymer syn 'SULFATE ION'                            96.063    1   ? ? ? ? 
3 water       nat water                                    18.015    170 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'p53-binding protein 1, 53BP1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GHMNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKG
HRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GHMNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKG
HRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   HIS n 
1 3   MET n 
1 4   ASN n 
1 5   SER n 
1 6   PHE n 
1 7   VAL n 
1 8   GLY n 
1 9   LEU n 
1 10  ARG n 
1 11  VAL n 
1 12  VAL n 
1 13  ALA n 
1 14  LYS n 
1 15  TRP n 
1 16  SER n 
1 17  SER n 
1 18  ASN n 
1 19  GLY n 
1 20  TYR n 
1 21  PHE n 
1 22  TYR n 
1 23  SER n 
1 24  GLY n 
1 25  LYS n 
1 26  ILE n 
1 27  THR n 
1 28  ARG n 
1 29  ASP n 
1 30  VAL n 
1 31  GLY n 
1 32  ALA n 
1 33  GLY n 
1 34  LYS n 
1 35  TYR n 
1 36  LYS n 
1 37  LEU n 
1 38  LEU n 
1 39  PHE n 
1 40  ASP n 
1 41  ASP n 
1 42  GLY n 
1 43  TYR n 
1 44  GLU n 
1 45  CYS n 
1 46  ASP n 
1 47  VAL n 
1 48  LEU n 
1 49  GLY n 
1 50  LYS n 
1 51  ASP n 
1 52  ILE n 
1 53  LEU n 
1 54  LEU n 
1 55  CYS n 
1 56  ASP n 
1 57  PRO n 
1 58  ILE n 
1 59  PRO n 
1 60  LEU n 
1 61  ASP n 
1 62  THR n 
1 63  GLU n 
1 64  VAL n 
1 65  THR n 
1 66  ALA n 
1 67  LEU n 
1 68  SER n 
1 69  GLU n 
1 70  ASP n 
1 71  GLU n 
1 72  TYR n 
1 73  PHE n 
1 74  SER n 
1 75  ALA n 
1 76  GLY n 
1 77  VAL n 
1 78  VAL n 
1 79  LYS n 
1 80  GLY n 
1 81  HIS n 
1 82  ARG n 
1 83  LYS n 
1 84  GLU n 
1 85  SER n 
1 86  GLY n 
1 87  GLU n 
1 88  LEU n 
1 89  TYR n 
1 90  TYR n 
1 91  SER n 
1 92  ILE n 
1 93  GLU n 
1 94  LYS n 
1 95  GLU n 
1 96  GLY n 
1 97  GLN n 
1 98  ARG n 
1 99  LYS n 
1 100 TRP n 
1 101 TYR n 
1 102 LYS n 
1 103 ARG n 
1 104 MET n 
1 105 ALA n 
1 106 VAL n 
1 107 ILE n 
1 108 LEU n 
1 109 SER n 
1 110 LEU n 
1 111 GLU n 
1 112 GLN n 
1 113 GLY n 
1 114 ASN n 
1 115 ARG n 
1 116 LEU n 
1 117 ARG n 
1 118 GLU n 
1 119 GLN n 
1 120 TYR n 
1 121 GLY n 
1 122 LEU n 
1 123 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 TP53BP1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pTEV 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TP53B_HUMAN 
_struct_ref.pdbx_db_accession          Q12888 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;NSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRK
ESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
;
_struct_ref.pdbx_align_begin           1484 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2G3R 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 4 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 123 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q12888 
_struct_ref_seq.db_align_beg                  1484 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1603 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1484 
_struct_ref_seq.pdbx_auth_seq_align_end       1603 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2G3R GLY A 1 ? UNP Q12888 ? ? 'CLONING ARTIFACT' 1481 1 
1 2G3R HIS A 2 ? UNP Q12888 ? ? 'CLONING ARTIFACT' 1482 2 
1 2G3R MET A 3 ? UNP Q12888 ? ? 'CLONING ARTIFACT' 1483 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2G3R 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.43 
_exptl_crystal.density_percent_sol   49.31 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    
'2% PEG 400, 0.1MHEPES/Na, 2M ammonium sulfate, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2005-10-27 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97940 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X6A' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X6A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97940 
# 
_reflns.entry_id                     2G3R 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             26.8 
_reflns.d_resolution_high            1.25 
_reflns.number_obs                   32860 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 2G3R 
_refine.ls_number_reflns_obs                     32860 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             26.8 
_refine.ls_d_res_high                            1.25 
_refine.ls_percent_reflns_obs                    93.20 
_refine.ls_R_factor_obs                          0.1964 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19412 
_refine.ls_R_factor_R_free                       0.24146 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1712 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.966 
_refine.correlation_coeff_Fo_to_Fc_free          0.941 
_refine.B_iso_mean                               19.886 
_refine.aniso_B[1][1]                            -0.44 
_refine.aniso_B[2][2]                            0.36 
_refine.aniso_B[3][3]                            -0.08 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -0.15 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ID 1XNI' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.057 
_refine.pdbx_overall_ESU_R_Free                  0.065 
_refine.overall_SU_ML                            0.039 
_refine.overall_SU_B                             1.756 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        951 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         5 
_refine_hist.number_atoms_solvent             170 
_refine_hist.number_atoms_total               1126 
_refine_hist.d_res_high                       1.25 
_refine_hist.d_res_low                        26.8 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.015  0.022  ? 1227 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.736  1.987  ? 1677 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   6.770  5.000  ? 165  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   33.346 23.390 ? 59   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   16.167 15.000 ? 231  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   18.422 15.000 ? 11   'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.120  0.200  ? 170  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.009  0.020  ? 980  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.259  0.200  ? 569  'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.311  0.200  ? 839  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.256  0.200  ? 174  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.231  0.200  ? 41   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.323  0.200  ? 24   'X-RAY DIFFRACTION' ? 
r_mcbond_it              1.115  1.500  ? 747  'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.842  2.000  ? 1204 'X-RAY DIFFRACTION' ? 
r_scbond_it              2.877  3.000  ? 537  'X-RAY DIFFRACTION' ? 
r_scangle_it             4.096  4.500  ? 472  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.25 
_refine_ls_shell.d_res_low                        1.278 
_refine_ls_shell.number_reflns_R_work             1608 
_refine_ls_shell.R_factor_R_work                  0.369 
_refine_ls_shell.percent_reflns_obs               61.92 
_refine_ls_shell.R_factor_R_free                  0.336 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             80 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2G3R 
_struct.title                     'Crystal Structure of 53BP1 tandem tudor domains at 1.2 A resolution' 
_struct.pdbx_descriptor           'Tumor suppressor p53-binding protein 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2G3R 
_struct_keywords.pdbx_keywords   'CELL CYCLE/TRANSCRIPTION' 
_struct_keywords.text            'TANDEM TUDOR DOMAINS, CELL CYCLE-TRANSCRIPTION COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 109 ? ARG A 115 ? SER A 1589 ARG A 1595 1 ? 7 
HELX_P HELX_P2 2 LEU A 116 ? GLY A 121 ? LEU A 1596 GLY A 1601 1 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ASP 56 A . ? ASP 1536 A PRO 57 A ? PRO 1537 A 1 13.49 
2 ASP 56 A . ? ASP 1536 A PRO 57 A ? PRO 1537 A 1 -4.72 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 44  ? LEU A 48  ? GLU A 1524 LEU A 1528 
A 2 LYS A 34  ? PHE A 39  ? LYS A 1514 PHE A 1519 
A 3 PHE A 21  ? GLY A 31  ? PHE A 1501 GLY A 1511 
A 4 ARG A 10  ? LYS A 14  ? ARG A 1490 LYS A 1494 
A 5 ILE A 52  ? LEU A 53  ? ILE A 1532 LEU A 1533 
B 1 GLN A 97  ? LYS A 102 ? GLN A 1577 LYS A 1582 
B 2 GLU A 87  ? LYS A 94  ? GLU A 1567 LYS A 1574 
B 3 PHE A 73  ? GLU A 84  ? PHE A 1553 GLU A 1564 
B 4 GLU A 63  ? LEU A 67  ? GLU A 1543 LEU A 1547 
B 5 VAL A 106 ? ILE A 107 ? VAL A 1586 ILE A 1587 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O CYS A 45 ? O CYS A 1525 N LEU A 37  ? N LEU A 1517 
A 2 3 O LYS A 36 ? O LYS A 1516 N THR A 27  ? N THR A 1507 
A 3 4 O TYR A 22 ? O TYR A 1502 N ALA A 13  ? N ALA A 1493 
A 4 5 N VAL A 12 ? N VAL A 1492 O LEU A 53  ? O LEU A 1533 
B 1 2 O LYS A 99 ? O LYS A 1579 N ILE A 92  ? N ILE A 1572 
B 2 3 O SER A 91 ? O SER A 1571 N LYS A 79  ? N LYS A 1559 
B 3 4 O GLY A 76 ? O GLY A 1556 N VAL A 64  ? N VAL A 1544 
B 4 5 N THR A 65 ? N THR A 1545 O ILE A 107 ? O ILE A 1587 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    8 
_struct_site.details              'BINDING SITE FOR RESIDUE SO4 A 201' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 8 HOH C .  ? HOH A 50   . ? 1_555 ? 
2 AC1 8 HOH C .  ? HOH A 134  . ? 1_555 ? 
3 AC1 8 LYS A 79 ? LYS A 1559 . ? 1_555 ? 
4 AC1 8 LYS A 83 ? LYS A 1563 . ? 2_656 ? 
5 AC1 8 GLU A 84 ? GLU A 1564 . ? 2_656 ? 
6 AC1 8 SER A 85 ? SER A 1565 . ? 2_656 ? 
7 AC1 8 GLY A 86 ? GLY A 1566 . ? 2_656 ? 
8 AC1 8 ARG A 98 ? ARG A 1578 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2G3R 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2G3R 
_atom_sites.fract_transf_matrix[1][1]   0.017891 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.010805 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012848 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.032138 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 5   ? 11.783 -14.353 25.532 1.00 30.81 ? 1485 SER A N   1 
ATOM   2    C CA  . SER A 1 5   ? 10.599 -14.225 24.635 1.00 30.31 ? 1485 SER A CA  1 
ATOM   3    C C   . SER A 1 5   ? 10.532 -12.859 23.955 1.00 29.68 ? 1485 SER A C   1 
ATOM   4    O O   . SER A 1 5   ? 11.323 -11.950 24.253 1.00 30.03 ? 1485 SER A O   1 
ATOM   5    C CB  . SER A 1 5   ? 9.305  -14.483 25.415 1.00 30.81 ? 1485 SER A CB  1 
ATOM   6    O OG  . SER A 1 5   ? 9.015  -13.406 26.293 1.00 32.81 ? 1485 SER A OG  1 
ATOM   7    N N   . PHE A 1 6   ? 9.578  -12.726 23.037 1.00 27.79 ? 1486 PHE A N   1 
ATOM   8    C CA  . PHE A 1 6   ? 9.374  -11.478 22.323 1.00 26.38 ? 1486 PHE A CA  1 
ATOM   9    C C   . PHE A 1 6   ? 8.245  -10.644 22.919 1.00 24.74 ? 1486 PHE A C   1 
ATOM   10   O O   . PHE A 1 6   ? 7.983  -9.540  22.446 1.00 23.34 ? 1486 PHE A O   1 
ATOM   11   C CB  . PHE A 1 6   ? 9.125  -11.734 20.828 1.00 27.77 ? 1486 PHE A CB  1 
ATOM   12   C CG  . PHE A 1 6   ? 10.276 -12.408 20.124 1.00 28.88 ? 1486 PHE A CG  1 
ATOM   13   C CD1 . PHE A 1 6   ? 10.098 -13.634 19.499 1.00 31.57 ? 1486 PHE A CD1 1 
ATOM   14   C CD2 . PHE A 1 6   ? 11.538 -11.816 20.094 1.00 30.51 ? 1486 PHE A CD2 1 
ATOM   15   C CE1 . PHE A 1 6   ? 11.165 -14.273 18.859 1.00 32.91 ? 1486 PHE A CE1 1 
ATOM   16   C CE2 . PHE A 1 6   ? 12.616 -12.444 19.462 1.00 32.38 ? 1486 PHE A CE2 1 
ATOM   17   C CZ  . PHE A 1 6   ? 12.421 -13.677 18.835 1.00 32.55 ? 1486 PHE A CZ  1 
ATOM   18   N N   . VAL A 1 7   ? 7.566  -11.161 23.935 1.00 22.61 ? 1487 VAL A N   1 
ATOM   19   C CA  . VAL A 1 7   ? 6.438  -10.461 24.553 1.00 21.10 ? 1487 VAL A CA  1 
ATOM   20   C C   . VAL A 1 7   ? 6.910  -9.164  25.202 1.00 20.23 ? 1487 VAL A C   1 
ATOM   21   O O   . VAL A 1 7   ? 7.874  -9.150  25.972 1.00 20.79 ? 1487 VAL A O   1 
ATOM   22   C CB  . VAL A 1 7   ? 5.647  -11.355 25.562 1.00 22.04 ? 1487 VAL A CB  1 
ATOM   23   C CG1 . VAL A 1 7   ? 4.596  -10.525 26.317 1.00 22.47 ? 1487 VAL A CG1 1 
ATOM   24   C CG2 . VAL A 1 7   ? 4.988  -12.509 24.835 1.00 22.85 ? 1487 VAL A CG2 1 
ATOM   25   N N   . GLY A 1 8   ? 6.249  -8.060  24.854 1.00 18.10 ? 1488 GLY A N   1 
ATOM   26   C CA  . GLY A 1 8   ? 6.553  -6.782  25.433 1.00 17.06 ? 1488 GLY A CA  1 
ATOM   27   C C   . GLY A 1 8   ? 7.411  -5.940  24.514 1.00 17.64 ? 1488 GLY A C   1 
ATOM   28   O O   . GLY A 1 8   ? 7.592  -4.739  24.758 1.00 19.25 ? 1488 GLY A O   1 
ATOM   29   N N   A LEU A 1 9   ? 7.925  -6.555  23.450 0.50 16.11 ? 1489 LEU A N   1 
ATOM   30   N N   B LEU A 1 9   ? 7.983  -6.540  23.469 0.50 16.80 ? 1489 LEU A N   1 
ATOM   31   C CA  A LEU A 1 9   ? 8.775  -5.828  22.516 0.50 15.75 ? 1489 LEU A CA  1 
ATOM   32   C CA  B LEU A 1 9   ? 8.851  -5.732  22.606 0.50 16.73 ? 1489 LEU A CA  1 
ATOM   33   C C   A LEU A 1 9   ? 7.989  -4.908  21.583 0.50 14.87 ? 1489 LEU A C   1 
ATOM   34   C C   B LEU A 1 9   ? 8.122  -4.986  21.495 0.50 15.46 ? 1489 LEU A C   1 
ATOM   35   O O   A LEU A 1 9   ? 6.858  -5.207  21.176 0.50 13.94 ? 1489 LEU A O   1 
ATOM   36   O O   B LEU A 1 9   ? 7.159  -5.479  20.895 0.50 14.49 ? 1489 LEU A O   1 
ATOM   37   C CB  A LEU A 1 9   ? 9.611  -6.786  21.668 0.50 16.12 ? 1489 LEU A CB  1 
ATOM   38   C CB  B LEU A 1 9   ? 10.077 -6.484  22.068 0.50 18.53 ? 1489 LEU A CB  1 
ATOM   39   C CG  A LEU A 1 9   ? 10.814 -7.518  22.308 0.50 18.22 ? 1489 LEU A CG  1 
ATOM   40   C CG  B LEU A 1 9   ? 10.030 -7.889  21.467 0.50 20.91 ? 1489 LEU A CG  1 
ATOM   41   C CD1 A LEU A 1 9   ? 11.369 -8.471  21.257 0.50 20.34 ? 1489 LEU A CD1 1 
ATOM   42   C CD1 B LEU A 1 9   ? 9.917  -7.847  19.972 0.50 22.43 ? 1489 LEU A CD1 1 
ATOM   43   C CD2 A LEU A 1 9   ? 11.922 -6.598  22.830 0.50 20.50 ? 1489 LEU A CD2 1 
ATOM   44   C CD2 B LEU A 1 9   ? 11.277 -8.651  21.895 0.50 20.64 ? 1489 LEU A CD2 1 
ATOM   45   N N   . ARG A 1 10  ? 8.592  -3.770  21.257 1.00 14.83 ? 1490 ARG A N   1 
ATOM   46   C CA  . ARG A 1 10  ? 8.072  -2.907  20.207 1.00 15.71 ? 1490 ARG A CA  1 
ATOM   47   C C   . ARG A 1 10  ? 8.557  -3.385  18.877 1.00 15.60 ? 1490 ARG A C   1 
ATOM   48   O O   . ARG A 1 10  ? 9.722  -3.722  18.664 1.00 16.80 ? 1490 ARG A O   1 
ATOM   49   C CB  . ARG A 1 10  ? 8.568  -1.484  20.380 1.00 17.89 ? 1490 ARG A CB  1 
ATOM   50   C CG  . ARG A 1 10  ? 7.794  -0.680  21.290 1.00 21.42 ? 1490 ARG A CG  1 
ATOM   51   C CD  . ARG A 1 10  ? 7.985  0.766   20.857 1.00 23.49 ? 1490 ARG A CD  1 
ATOM   52   N NE  . ARG A 1 10  ? 6.882  1.532   21.407 1.00 21.03 ? 1490 ARG A NE  1 
ATOM   53   C CZ  . ARG A 1 10  ? 5.765  1.791   20.738 1.00 24.84 ? 1490 ARG A CZ  1 
ATOM   54   N NH1 . ARG A 1 10  ? 5.600  1.299   19.507 1.00 27.82 ? 1490 ARG A NH1 1 
ATOM   55   N NH2 . ARG A 1 10  ? 4.808  2.511   21.301 1.00 28.92 ? 1490 ARG A NH2 1 
ATOM   56   N N   . VAL A 1 11  ? 7.616  -3.436  17.954 1.00 13.04 ? 1491 VAL A N   1 
ATOM   57   C CA  . VAL A 1 11  ? 7.865  -3.982  16.631 1.00 13.61 ? 1491 VAL A CA  1 
ATOM   58   C C   . VAL A 1 11  ? 7.118  -3.133  15.582 1.00 12.82 ? 1491 VAL A C   1 
ATOM   59   O O   . VAL A 1 11  ? 6.356  -2.237  15.958 1.00 13.53 ? 1491 VAL A O   1 
ATOM   60   C CB  . VAL A 1 11  ? 7.379  -5.456  16.572 1.00 14.32 ? 1491 VAL A CB  1 
ATOM   61   C CG1 . VAL A 1 11  ? 8.115  -6.341  17.571 1.00 14.42 ? 1491 VAL A CG1 1 
ATOM   62   C CG2 . VAL A 1 11  ? 5.871  -5.573  16.799 1.00 13.66 ? 1491 VAL A CG2 1 
ATOM   63   N N   . VAL A 1 12  ? 7.328  -3.469  14.305 1.00 13.57 ? 1492 VAL A N   1 
ATOM   64   C CA  . VAL A 1 12  ? 6.526  -2.884  13.241 1.00 13.40 ? 1492 VAL A CA  1 
ATOM   65   C C   . VAL A 1 12  ? 5.943  -4.074  12.505 1.00 13.34 ? 1492 VAL A C   1 
ATOM   66   O O   . VAL A 1 12  ? 6.673  -4.929  12.013 1.00 14.80 ? 1492 VAL A O   1 
ATOM   67   C CB  . VAL A 1 12  ? 7.376  -2.002  12.312 1.00 14.69 ? 1492 VAL A CB  1 
ATOM   68   C CG1 . VAL A 1 12  ? 6.530  -1.259  11.320 1.00 17.31 ? 1492 VAL A CG1 1 
ATOM   69   C CG2 . VAL A 1 12  ? 8.237  -0.981  13.167 1.00 16.59 ? 1492 VAL A CG2 1 
ATOM   70   N N   . ALA A 1 13  ? 4.624  -4.162  12.486 1.00 12.49 ? 1493 ALA A N   1 
ATOM   71   C CA  . ALA A 1 13  ? 3.955  -5.409  12.068 1.00 12.20 ? 1493 ALA A CA  1 
ATOM   72   C C   . ALA A 1 13  ? 2.946  -5.179  10.974 1.00 12.31 ? 1493 ALA A C   1 
ATOM   73   O O   . ALA A 1 13  ? 2.243  -4.161  10.955 1.00 12.50 ? 1493 ALA A O   1 
ATOM   74   C CB  . ALA A 1 13  ? 3.285  -6.076  13.262 1.00 13.58 ? 1493 ALA A CB  1 
ATOM   75   N N   . LYS A 1 14  ? 2.831  -6.153  10.060 1.00 13.02 ? 1494 LYS A N   1 
ATOM   76   C CA  . LYS A 1 14  ? 1.925  -5.990  8.939  1.00 13.19 ? 1494 LYS A CA  1 
ATOM   77   C C   . LYS A 1 14  ? 0.480  -6.129  9.330  1.00 14.19 ? 1494 LYS A C   1 
ATOM   78   O O   . LYS A 1 14  ? 0.079  -7.022  10.128 1.00 14.19 ? 1494 LYS A O   1 
ATOM   79   C CB  . LYS A 1 14  ? 2.266  -7.017  7.881  1.00 14.76 ? 1494 LYS A CB  1 
ATOM   80   C CG  . LYS A 1 14  ? 1.501  -6.803  6.559  1.00 16.75 ? 1494 LYS A CG  1 
ATOM   81   C CD  . LYS A 1 14  ? 1.490  -8.124  5.793  1.00 23.82 ? 1494 LYS A CD  1 
ATOM   82   C CE  . LYS A 1 14  ? 2.759  -8.385  5.107  1.00 26.59 ? 1494 LYS A CE  1 
ATOM   83   N NZ  . LYS A 1 14  ? 2.452  -9.209  3.858  1.00 27.10 ? 1494 LYS A NZ  1 
ATOM   84   N N   . TRP A 1 15  ? -0.321 -5.237  8.781  1.00 13.54 ? 1495 TRP A N   1 
ATOM   85   C CA  . TRP A 1 15  ? -1.765 -5.334  8.856  1.00 13.96 ? 1495 TRP A CA  1 
ATOM   86   C C   . TRP A 1 15  ? -2.219 -5.970  7.560  1.00 15.05 ? 1495 TRP A C   1 
ATOM   87   O O   . TRP A 1 15  ? -2.060 -5.384  6.480  1.00 14.32 ? 1495 TRP A O   1 
ATOM   88   C CB  . TRP A 1 15  ? -2.316 -3.914  9.004  1.00 16.52 ? 1495 TRP A CB  1 
ATOM   89   C CG  . TRP A 1 15  ? -3.797 -3.850  9.231  1.00 18.45 ? 1495 TRP A CG  1 
ATOM   90   C CD1 . TRP A 1 15  ? -4.739 -3.514  8.323  1.00 22.57 ? 1495 TRP A CD1 1 
ATOM   91   C CD2 . TRP A 1 15  ? -4.485 -4.155  10.461 1.00 23.13 ? 1495 TRP A CD2 1 
ATOM   92   N NE1 . TRP A 1 15  ? -6.002 -3.595  8.905  1.00 24.68 ? 1495 TRP A NE1 1 
ATOM   93   C CE2 . TRP A 1 15  ? -5.862 -3.960  10.221 1.00 25.22 ? 1495 TRP A CE2 1 
ATOM   94   C CE3 . TRP A 1 15  ? -4.063 -4.523  11.758 1.00 22.66 ? 1495 TRP A CE3 1 
ATOM   95   C CZ2 . TRP A 1 15  ? -6.831 -4.154  11.216 1.00 24.92 ? 1495 TRP A CZ2 1 
ATOM   96   C CZ3 . TRP A 1 15  ? -5.046 -4.722  12.755 1.00 23.64 ? 1495 TRP A CZ3 1 
ATOM   97   C CH2 . TRP A 1 15  ? -6.402 -4.527  12.470 1.00 23.37 ? 1495 TRP A CH2 1 
ATOM   98   N N   A SER A 1 16  ? -2.610 -7.243  7.558  0.70 15.96 ? 1496 SER A N   1 
ATOM   99   N N   B SER A 1 16  ? -2.955 -7.055  7.712  0.30 14.29 ? 1496 SER A N   1 
ATOM   100  C CA  A SER A 1 16  ? -2.673 -8.031  6.294  0.70 17.54 ? 1496 SER A CA  1 
ATOM   101  C CA  B SER A 1 16  ? -3.268 -7.886  6.586  0.30 14.82 ? 1496 SER A CA  1 
ATOM   102  C C   A SER A 1 16  ? -3.663 -7.469  5.257  0.70 17.53 ? 1496 SER A C   1 
ATOM   103  C C   B SER A 1 16  ? -4.204 -7.228  5.573  0.30 14.06 ? 1496 SER A C   1 
ATOM   104  O O   A SER A 1 16  ? -3.453 -7.596  4.051  0.70 17.65 ? 1496 SER A O   1 
ATOM   105  O O   B SER A 1 16  ? -4.062 -7.466  4.383  0.30 13.91 ? 1496 SER A O   1 
ATOM   106  C CB  A SER A 1 16  ? -3.024 -9.503  6.607  0.70 17.53 ? 1496 SER A CB  1 
ATOM   107  C CB  B SER A 1 16  ? -3.796 -9.229  7.066  0.30 14.86 ? 1496 SER A CB  1 
ATOM   108  O OG  A SER A 1 16  ? -4.285 -9.609  7.244  0.70 23.80 ? 1496 SER A OG  1 
ATOM   109  O OG  B SER A 1 16  ? -3.444 -10.263 6.171  0.30 17.64 ? 1496 SER A OG  1 
ATOM   110  N N   A SER A 1 17  ? -4.721 -6.835  5.748  0.50 16.78 ? 1497 SER A N   1 
ATOM   111  N N   B SER A 1 17  ? -5.113 -6.368  6.019  0.50 14.18 ? 1497 SER A N   1 
ATOM   112  C CA  A SER A 1 17  ? -5.795 -6.288  4.915  0.50 17.51 ? 1497 SER A CA  1 
ATOM   113  C CA  B SER A 1 17  ? -6.076 -5.867  5.060  0.50 15.99 ? 1497 SER A CA  1 
ATOM   114  C C   A SER A 1 17  ? -5.397 -5.089  4.046  0.50 16.81 ? 1497 SER A C   1 
ATOM   115  C C   B SER A 1 17  ? -5.316 -5.129  3.953  0.50 15.45 ? 1497 SER A C   1 
ATOM   116  O O   A SER A 1 17  ? -6.157 -4.762  3.108  0.50 15.77 ? 1497 SER A O   1 
ATOM   117  O O   B SER A 1 17  ? -5.649 -5.223  2.745  0.50 13.01 ? 1497 SER A O   1 
ATOM   118  C CB  A SER A 1 17  ? -6.980 -5.874  5.787  0.50 18.05 ? 1497 SER A CB  1 
ATOM   119  C CB  B SER A 1 17  ? -7.104 -4.980  5.750  0.50 16.94 ? 1497 SER A CB  1 
ATOM   120  O OG  A SER A 1 17  ? -7.665 -6.990  6.317  0.50 22.70 ? 1497 SER A OG  1 
ATOM   121  O OG  B SER A 1 17  ? -6.569 -3.766  6.185  0.50 20.58 ? 1497 SER A OG  1 
ATOM   122  N N   . ASN A 1 18  ? -4.281 -4.411  4.349  1.00 15.37 ? 1498 ASN A N   1 
ATOM   123  C CA  . ASN A 1 18  ? -3.766 -3.397  3.460  1.00 16.16 ? 1498 ASN A CA  1 
ATOM   124  C C   . ASN A 1 18  ? -2.289 -3.555  3.091  1.00 15.47 ? 1498 ASN A C   1 
ATOM   125  O O   . ASN A 1 18  ? -1.774 -2.855  2.242  1.00 16.02 ? 1498 ASN A O   1 
ATOM   126  C CB  . ASN A 1 18  ? -4.164 -1.960  3.919  1.00 17.69 ? 1498 ASN A CB  1 
ATOM   127  C CG  . ASN A 1 18  ? -3.376 -1.426  5.112  1.00 19.57 ? 1498 ASN A CG  1 
ATOM   128  O OD1 . ASN A 1 18  ? -3.633 -0.293  5.567  1.00 24.05 ? 1498 ASN A OD1 1 
ATOM   129  N ND2 . ASN A 1 18  ? -2.454 -2.188  5.635  1.00 14.05 ? 1498 ASN A ND2 1 
ATOM   130  N N   . GLY A 1 19  ? -1.580 -4.505  3.712  1.00 13.66 ? 1499 GLY A N   1 
ATOM   131  C CA  . GLY A 1 19  ? -0.182 -4.761  3.379  1.00 15.10 ? 1499 GLY A CA  1 
ATOM   132  C C   . GLY A 1 19  ? 0.803  -3.827  4.063  1.00 13.50 ? 1499 GLY A C   1 
ATOM   133  O O   . GLY A 1 19  ? 2.004  -4.104  3.998  1.00 15.44 ? 1499 GLY A O   1 
ATOM   134  N N   . TYR A 1 20  ? 0.313  -2.801  4.759  1.00 12.86 ? 1500 TYR A N   1 
ATOM   135  C CA  . TYR A 1 20  ? 1.229  -1.865  5.450  1.00 13.07 ? 1500 TYR A CA  1 
ATOM   136  C C   . TYR A 1 20  ? 1.656  -2.382  6.799  1.00 12.79 ? 1500 TYR A C   1 
ATOM   137  O O   . TYR A 1 20  ? 0.893  -3.120  7.448  1.00 13.63 ? 1500 TYR A O   1 
ATOM   138  C CB  . TYR A 1 20  ? 0.613  -0.478  5.577  1.00 13.06 ? 1500 TYR A CB  1 
ATOM   139  C CG  . TYR A 1 20  ? 0.713  0.379   4.315  1.00 12.46 ? 1500 TYR A CG  1 
ATOM   140  C CD1 . TYR A 1 20  ? -0.068 0.107   3.210  1.00 15.03 ? 1500 TYR A CD1 1 
ATOM   141  C CD2 . TYR A 1 20  ? 1.534  1.473   4.261  1.00 13.17 ? 1500 TYR A CD2 1 
ATOM   142  C CE1 . TYR A 1 20  ? 0.033  0.901   2.045  1.00 14.97 ? 1500 TYR A CE1 1 
ATOM   143  C CE2 . TYR A 1 20  ? 1.657  2.243   3.107  1.00 13.29 ? 1500 TYR A CE2 1 
ATOM   144  C CZ  . TYR A 1 20  ? 0.900  1.948   2.048  1.00 13.35 ? 1500 TYR A CZ  1 
ATOM   145  O OH  . TYR A 1 20  ? 0.971  2.737   0.879  1.00 15.72 ? 1500 TYR A OH  1 
ATOM   146  N N   . PHE A 1 21  ? 2.825  -1.974  7.249  1.00 13.91 ? 1501 PHE A N   1 
ATOM   147  C CA  . PHE A 1 21  ? 3.362  -2.327  8.568  1.00 12.53 ? 1501 PHE A CA  1 
ATOM   148  C C   . PHE A 1 21  ? 3.303  -1.098  9.455  1.00 12.68 ? 1501 PHE A C   1 
ATOM   149  O O   . PHE A 1 21  ? 3.674  0.017   9.081  1.00 12.56 ? 1501 PHE A O   1 
ATOM   150  C CB  . PHE A 1 21  ? 4.808  -2.785  8.516  1.00 13.33 ? 1501 PHE A CB  1 
ATOM   151  C CG  . PHE A 1 21  ? 5.113  -4.001  7.687  1.00 13.02 ? 1501 PHE A CG  1 
ATOM   152  C CD1 . PHE A 1 21  ? 4.948  -4.021  6.290  1.00 15.39 ? 1501 PHE A CD1 1 
ATOM   153  C CD2 . PHE A 1 21  ? 5.653  -5.121  8.329  1.00 14.75 ? 1501 PHE A CD2 1 
ATOM   154  C CE1 . PHE A 1 21  ? 5.273  -5.153  5.557  1.00 14.02 ? 1501 PHE A CE1 1 
ATOM   155  C CE2 . PHE A 1 21  ? 6.022  -6.232  7.589  1.00 14.88 ? 1501 PHE A CE2 1 
ATOM   156  C CZ  . PHE A 1 21  ? 5.815  -6.260  6.205  1.00 14.40 ? 1501 PHE A CZ  1 
ATOM   157  N N   . TYR A 1 22  ? 2.822  -1.307  10.670 1.00 12.60 ? 1502 TYR A N   1 
ATOM   158  C CA  . TYR A 1 22  ? 2.529  -0.284  11.697 1.00 12.63 ? 1502 TYR A CA  1 
ATOM   159  C C   . TYR A 1 22  ? 3.251  -0.594  12.986 1.00 13.31 ? 1502 TYR A C   1 
ATOM   160  O O   . TYR A 1 22  ? 3.382  -1.763  13.384 1.00 13.00 ? 1502 TYR A O   1 
ATOM   161  C CB  . TYR A 1 22  ? 1.018  -0.216  11.968 1.00 14.05 ? 1502 TYR A CB  1 
ATOM   162  C CG  . TYR A 1 22  ? 0.192  0.186   10.769 1.00 13.60 ? 1502 TYR A CG  1 
ATOM   163  C CD1 . TYR A 1 22  ? -0.163 -0.744  9.774  1.00 13.15 ? 1502 TYR A CD1 1 
ATOM   164  C CD2 . TYR A 1 22  ? -0.159 1.524   10.568 1.00 14.52 ? 1502 TYR A CD2 1 
ATOM   165  C CE1 . TYR A 1 22  ? -0.934 -0.373  8.666  1.00 13.67 ? 1502 TYR A CE1 1 
ATOM   166  C CE2 . TYR A 1 22  ? -0.889 1.906   9.424  1.00 14.18 ? 1502 TYR A CE2 1 
ATOM   167  C CZ  . TYR A 1 22  ? -1.252 0.949   8.500  1.00 14.11 ? 1502 TYR A CZ  1 
ATOM   168  O OH  . TYR A 1 22  ? -2.023 1.278   7.392  1.00 15.87 ? 1502 TYR A OH  1 
ATOM   169  N N   . SER A 1 23  ? 3.593  0.463   13.733 1.00 13.43 ? 1503 SER A N   1 
ATOM   170  C CA  A SER A 1 23  ? 4.234  0.240   14.998 0.50 13.01 ? 1503 SER A CA  1 
ATOM   171  C CA  B SER A 1 23  ? 4.187  0.344   15.061 0.50 13.34 ? 1503 SER A CA  1 
ATOM   172  C C   . SER A 1 23  ? 3.225  -0.309  16.042 1.00 12.61 ? 1503 SER A C   1 
ATOM   173  O O   . SER A 1 23  ? 2.063  0.033   16.060 1.00 12.75 ? 1503 SER A O   1 
ATOM   174  C CB  A SER A 1 23  ? 4.886  1.543   15.452 0.50 14.25 ? 1503 SER A CB  1 
ATOM   175  C CB  B SER A 1 23  ? 4.555  1.747   15.594 0.50 14.21 ? 1503 SER A CB  1 
ATOM   176  O OG  A SER A 1 23  ? 3.878  2.551   15.458 0.50 14.19 ? 1503 SER A OG  1 
ATOM   177  O OG  B SER A 1 23  ? 5.169  1.656   16.877 0.50 14.98 ? 1503 SER A OG  1 
ATOM   178  N N   . GLY A 1 24  ? 3.727  -1.192  16.904 1.00 12.76 ? 1504 GLY A N   1 
ATOM   179  C CA  . GLY A 1 24  ? 2.890  -1.801  17.944 1.00 13.67 ? 1504 GLY A CA  1 
ATOM   180  C C   . GLY A 1 24  ? 3.807  -2.593  18.848 1.00 12.77 ? 1504 GLY A C   1 
ATOM   181  O O   . GLY A 1 24  ? 5.028  -2.477  18.806 1.00 12.83 ? 1504 GLY A O   1 
ATOM   182  N N   A LYS A 1 25  ? 3.197  -3.380  19.723 0.50 12.88 ? 1505 LYS A N   1 
ATOM   183  N N   B LYS A 1 25  ? 3.184  -3.437  19.643 0.50 13.05 ? 1505 LYS A N   1 
ATOM   184  C CA  A LYS A 1 25  ? 3.929  -4.228  20.677 0.50 12.60 ? 1505 LYS A CA  1 
ATOM   185  C CA  B LYS A 1 25  ? 3.877  -4.206  20.653 0.50 13.11 ? 1505 LYS A CA  1 
ATOM   186  C C   A LYS A 1 25  ? 3.316  -5.629  20.709 0.50 11.78 ? 1505 LYS A C   1 
ATOM   187  C C   B LYS A 1 25  ? 3.398  -5.638  20.558 0.50 12.24 ? 1505 LYS A C   1 
ATOM   188  O O   A LYS A 1 25  ? 2.073  -5.812  20.781 0.50 11.38 ? 1505 LYS A O   1 
ATOM   189  O O   B LYS A 1 25  ? 2.248  -5.880  20.238 0.50 12.49 ? 1505 LYS A O   1 
ATOM   190  C CB  A LYS A 1 25  ? 3.917  -3.674  22.125 0.50 12.63 ? 1505 LYS A CB  1 
ATOM   191  C CB  B LYS A 1 25  ? 3.522  -3.676  22.042 0.50 14.11 ? 1505 LYS A CB  1 
ATOM   192  C CG  A LYS A 1 25  ? 4.544  -2.318  22.342 0.50 12.81 ? 1505 LYS A CG  1 
ATOM   193  C CG  B LYS A 1 25  ? 4.365  -4.276  23.124 0.50 16.99 ? 1505 LYS A CG  1 
ATOM   194  C CD  A LYS A 1 25  ? 4.231  -1.787  23.749 0.50 15.40 ? 1505 LYS A CD  1 
ATOM   195  C CD  B LYS A 1 25  ? 4.320  -3.428  24.380 0.50 21.05 ? 1505 LYS A CD  1 
ATOM   196  C CE  A LYS A 1 25  ? 4.742  -0.351  23.901 0.50 17.71 ? 1505 LYS A CE  1 
ATOM   197  C CE  B LYS A 1 25  ? 2.946  -3.478  25.036 0.50 23.78 ? 1505 LYS A CE  1 
ATOM   198  N NZ  A LYS A 1 25  ? 4.894  0.007   25.332 0.50 19.78 ? 1505 LYS A NZ  1 
ATOM   199  N NZ  B LYS A 1 25  ? 2.615  -4.824  25.590 0.50 24.89 ? 1505 LYS A NZ  1 
ATOM   200  N N   A ILE A 1 26  ? 4.194  -6.629  20.732 0.50 12.68 ? 1506 ILE A N   1 
ATOM   201  N N   B ILE A 1 26  ? 4.277  -6.586  20.871 0.50 12.78 ? 1506 ILE A N   1 
ATOM   202  C CA  A ILE A 1 26  ? 3.696  -7.983  20.903 0.50 12.18 ? 1506 ILE A CA  1 
ATOM   203  C CA  B ILE A 1 26  ? 3.835  -7.970  20.994 0.50 12.69 ? 1506 ILE A CA  1 
ATOM   204  C C   A ILE A 1 26  ? 3.216  -8.129  22.347 0.50 13.20 ? 1506 ILE A C   1 
ATOM   205  C C   B ILE A 1 26  ? 3.251  -8.191  22.410 0.50 13.35 ? 1506 ILE A C   1 
ATOM   206  O O   A ILE A 1 26  ? 3.933  -7.769  23.289 0.50 13.62 ? 1506 ILE A O   1 
ATOM   207  O O   B ILE A 1 26  ? 3.931  -7.937  23.408 0.50 13.89 ? 1506 ILE A O   1 
ATOM   208  C CB  A ILE A 1 26  ? 4.767  -9.041  20.597 0.50 13.35 ? 1506 ILE A CB  1 
ATOM   209  C CB  B ILE A 1 26  ? 5.021  -8.923  20.725 0.50 13.56 ? 1506 ILE A CB  1 
ATOM   210  C CG1 A ILE A 1 26  ? 5.079  -9.063  19.103 0.50 12.29 ? 1506 ILE A CG1 1 
ATOM   211  C CG1 B ILE A 1 26  ? 5.489  -8.805  19.269 0.50 14.49 ? 1506 ILE A CG1 1 
ATOM   212  C CG2 A ILE A 1 26  ? 4.296  -10.437 21.034 0.50 12.38 ? 1506 ILE A CG2 1 
ATOM   213  C CG2 B ILE A 1 26  ? 4.663  -10.382 21.072 0.50 12.14 ? 1506 ILE A CG2 1 
ATOM   214  C CD1 A ILE A 1 26  ? 6.344  -9.845  18.781 0.50 10.59 ? 1506 ILE A CD1 1 
ATOM   215  C CD1 B ILE A 1 26  ? 6.817  -9.487  19.042 0.50 14.27 ? 1506 ILE A CD1 1 
ATOM   216  N N   . THR A 1 27  ? 1.998  -8.623  22.496 1.00 13.12 ? 1507 THR A N   1 
ATOM   217  C CA  . THR A 1 27  ? 1.387  -8.842  23.812 1.00 14.37 ? 1507 THR A CA  1 
ATOM   218  C C   . THR A 1 27  ? 1.218  -10.287 24.241 1.00 14.19 ? 1507 THR A C   1 
ATOM   219  O O   . THR A 1 27  ? 0.944  -10.527 25.409 1.00 14.38 ? 1507 THR A O   1 
ATOM   220  C CB  . THR A 1 27  ? 0.035  -8.156  23.874 1.00 13.79 ? 1507 THR A CB  1 
ATOM   221  O OG1 . THR A 1 27  ? -0.838 -8.715  22.891 1.00 17.02 ? 1507 THR A OG1 1 
ATOM   222  C CG2 . THR A 1 27  ? 0.214  -6.665  23.675 1.00 16.48 ? 1507 THR A CG2 1 
ATOM   223  N N   A ARG A 1 28  ? 1.312  -11.230 23.303 0.50 14.00 ? 1508 ARG A N   1 
ATOM   224  N N   B ARG A 1 28  ? 1.409  -11.237 23.325 0.50 13.90 ? 1508 ARG A N   1 
ATOM   225  C CA  A ARG A 1 28  ? 1.180  -12.650 23.635 0.50 13.61 ? 1508 ARG A CA  1 
ATOM   226  C CA  B ARG A 1 28  ? 1.122  -12.637 23.633 0.50 13.26 ? 1508 ARG A CA  1 
ATOM   227  C C   A ARG A 1 28  ? 1.827  -13.484 22.549 0.50 13.23 ? 1508 ARG A C   1 
ATOM   228  C C   B ARG A 1 28  ? 1.694  -13.546 22.551 0.50 13.10 ? 1508 ARG A C   1 
ATOM   229  O O   A ARG A 1 28  ? 1.836  -13.103 21.372 0.50 12.09 ? 1508 ARG A O   1 
ATOM   230  O O   B ARG A 1 28  ? 1.528  -13.271 21.366 0.50 11.66 ? 1508 ARG A O   1 
ATOM   231  C CB  A ARG A 1 28  ? -0.295 -13.053 23.799 0.50 14.75 ? 1508 ARG A CB  1 
ATOM   232  C CB  B ARG A 1 28  ? -0.402 -12.810 23.762 0.50 14.26 ? 1508 ARG A CB  1 
ATOM   233  C CG  A ARG A 1 28  ? -0.501 -14.290 24.663 0.50 17.13 ? 1508 ARG A CG  1 
ATOM   234  C CG  B ARG A 1 28  ? -0.847 -14.157 24.192 0.50 15.62 ? 1508 ARG A CG  1 
ATOM   235  C CD  A ARG A 1 28  ? -1.886 -14.890 24.475 0.50 19.28 ? 1508 ARG A CD  1 
ATOM   236  C CD  B ARG A 1 28  ? -1.257 -14.955 23.017 0.50 17.08 ? 1508 ARG A CD  1 
ATOM   237  N NE  A ARG A 1 28  ? -2.957 -13.904 24.326 0.50 20.21 ? 1508 ARG A NE  1 
ATOM   238  N NE  B ARG A 1 28  ? -0.889 -16.330 23.256 0.50 18.30 ? 1508 ARG A NE  1 
ATOM   239  C CZ  A ARG A 1 28  ? -3.846 -13.591 25.267 0.50 23.44 ? 1508 ARG A CZ  1 
ATOM   240  C CZ  B ARG A 1 28  ? -1.723 -17.270 23.659 0.50 17.44 ? 1508 ARG A CZ  1 
ATOM   241  N NH1 A ARG A 1 28  ? -3.807 -14.182 26.454 0.50 23.79 ? 1508 ARG A NH1 1 
ATOM   242  N NH1 B ARG A 1 28  ? -3.014 -17.005 23.814 0.50 18.86 ? 1508 ARG A NH1 1 
ATOM   243  N NH2 A ARG A 1 28  ? -4.785 -12.683 25.017 0.50 22.69 ? 1508 ARG A NH2 1 
ATOM   244  N NH2 B ARG A 1 28  ? -1.244 -18.478 23.867 0.50 12.06 ? 1508 ARG A NH2 1 
ATOM   245  N N   . ASP A 1 29  ? 2.363  -14.626 22.948 1.00 12.67 ? 1509 ASP A N   1 
ATOM   246  C CA  . ASP A 1 29  ? 2.808  -15.651 21.998 1.00 12.79 ? 1509 ASP A CA  1 
ATOM   247  C C   . ASP A 1 29  ? 1.617  -16.628 21.821 1.00 11.85 ? 1509 ASP A C   1 
ATOM   248  O O   . ASP A 1 29  ? 1.295  -17.384 22.745 1.00 12.33 ? 1509 ASP A O   1 
ATOM   249  C CB  . ASP A 1 29  ? 4.067  -16.365 22.548 1.00 15.14 ? 1509 ASP A CB  1 
ATOM   250  C CG  . ASP A 1 29  ? 4.492  -17.569 21.702 1.00 16.25 ? 1509 ASP A CG  1 
ATOM   251  O OD1 . ASP A 1 29  ? 3.994  -17.748 20.575 1.00 15.28 ? 1509 ASP A OD1 1 
ATOM   252  O OD2 . ASP A 1 29  ? 5.320  -18.353 22.198 1.00 21.99 ? 1509 ASP A OD2 1 
ATOM   253  N N   . VAL A 1 30  ? 0.945  -16.512 20.671 1.00 11.24 ? 1510 VAL A N   1 
ATOM   254  C CA  . VAL A 1 30  ? -0.264 -17.320 20.298 1.00 11.61 ? 1510 VAL A CA  1 
ATOM   255  C C   . VAL A 1 30  ? 0.097  -18.843 20.033 1.00 10.10 ? 1510 VAL A C   1 
ATOM   256  O O   . VAL A 1 30  ? -0.749 -19.782 20.130 1.00 11.55 ? 1510 VAL A O   1 
ATOM   257  C CB  . VAL A 1 30  ? -1.053 -16.618 19.130 1.00 12.56 ? 1510 VAL A CB  1 
ATOM   258  C CG1 . VAL A 1 30  ? -2.152 -17.509 18.531 1.00 15.60 ? 1510 VAL A CG1 1 
ATOM   259  C CG2 . VAL A 1 30  ? -1.674 -15.270 19.628 1.00 15.81 ? 1510 VAL A CG2 1 
ATOM   260  N N   . GLY A 1 31  ? 1.394  -19.023 19.749 1.00 10.72 ? 1511 GLY A N   1 
ATOM   261  C CA  . GLY A 1 31  ? 2.044  -20.270 19.437 1.00 10.17 ? 1511 GLY A CA  1 
ATOM   262  C C   . GLY A 1 31  ? 2.235  -20.487 17.954 1.00 8.67  ? 1511 GLY A C   1 
ATOM   263  O O   . GLY A 1 31  ? 1.576  -19.870 17.125 1.00 9.66  ? 1511 GLY A O   1 
ATOM   264  N N   . ALA A 1 32  ? 3.165  -21.376 17.655 1.00 10.29 ? 1512 ALA A N   1 
ATOM   265  C CA  . ALA A 1 32  ? 3.362  -21.927 16.321 1.00 10.60 ? 1512 ALA A CA  1 
ATOM   266  C C   . ALA A 1 32  ? 3.681  -20.847 15.304 1.00 12.86 ? 1512 ALA A C   1 
ATOM   267  O O   . ALA A 1 32  ? 3.309  -20.958 14.152 1.00 13.99 ? 1512 ALA A O   1 
ATOM   268  C CB  . ALA A 1 32  ? 2.140  -22.794 15.878 1.00 11.01 ? 1512 ALA A CB  1 
ATOM   269  N N   . GLY A 1 33  ? 4.364  -19.791 15.736 1.00 12.56 ? 1513 GLY A N   1 
ATOM   270  C CA  . GLY A 1 33  ? 4.756  -18.718 14.816 1.00 13.67 ? 1513 GLY A CA  1 
ATOM   271  C C   . GLY A 1 33  ? 3.794  -17.567 14.727 1.00 12.99 ? 1513 GLY A C   1 
ATOM   272  O O   . GLY A 1 33  ? 3.992  -16.676 13.866 1.00 15.62 ? 1513 GLY A O   1 
ATOM   273  N N   . LYS A 1 34  ? 2.778  -17.523 15.581 1.00 14.01 ? 1514 LYS A N   1 
ATOM   274  C CA  . LYS A 1 34  ? 1.759  -16.454 15.592 1.00 14.20 ? 1514 LYS A CA  1 
ATOM   275  C C   . LYS A 1 34  ? 1.882  -15.658 16.886 1.00 13.42 ? 1514 LYS A C   1 
ATOM   276  O O   . LYS A 1 34  ? 2.173  -16.228 17.936 1.00 11.91 ? 1514 LYS A O   1 
ATOM   277  C CB  . LYS A 1 34  ? 0.371  -17.065 15.565 1.00 16.54 ? 1514 LYS A CB  1 
ATOM   278  C CG  . LYS A 1 34  ? -0.632 -16.338 14.722 1.00 21.42 ? 1514 LYS A CG  1 
ATOM   279  C CD  . LYS A 1 34  ? -0.994 -17.304 13.583 1.00 23.94 ? 1514 LYS A CD  1 
ATOM   280  C CE  . LYS A 1 34  ? -2.426 -17.191 13.148 1.00 26.80 ? 1514 LYS A CE  1 
ATOM   281  N NZ  . LYS A 1 34  ? -2.781 -18.284 12.194 1.00 25.49 ? 1514 LYS A NZ  1 
ATOM   282  N N   . TYR A 1 35  ? 1.613  -14.353 16.806 1.00 12.93 ? 1515 TYR A N   1 
ATOM   283  C CA  . TYR A 1 35  ? 1.742  -13.462 17.975 1.00 12.99 ? 1515 TYR A CA  1 
ATOM   284  C C   . TYR A 1 35  ? 0.573  -12.537 18.001 1.00 13.23 ? 1515 TYR A C   1 
ATOM   285  O O   . TYR A 1 35  ? 0.066  -12.162 16.940 1.00 16.07 ? 1515 TYR A O   1 
ATOM   286  C CB  . TYR A 1 35  ? 3.024  -12.609 17.869 1.00 13.69 ? 1515 TYR A CB  1 
ATOM   287  C CG  . TYR A 1 35  ? 4.247  -13.439 17.928 1.00 13.08 ? 1515 TYR A CG  1 
ATOM   288  C CD1 . TYR A 1 35  ? 4.782  -13.997 16.738 1.00 13.88 ? 1515 TYR A CD1 1 
ATOM   289  C CD2 . TYR A 1 35  ? 4.856  -13.718 19.158 1.00 14.76 ? 1515 TYR A CD2 1 
ATOM   290  C CE1 . TYR A 1 35  ? 5.892  -14.802 16.787 1.00 18.50 ? 1515 TYR A CE1 1 
ATOM   291  C CE2 . TYR A 1 35  ? 5.969  -14.547 19.209 1.00 17.10 ? 1515 TYR A CE2 1 
ATOM   292  C CZ  . TYR A 1 35  ? 6.489  -15.080 18.019 1.00 17.72 ? 1515 TYR A CZ  1 
ATOM   293  O OH  . TYR A 1 35  ? 7.594  -15.910 18.057 1.00 22.19 ? 1515 TYR A OH  1 
ATOM   294  N N   . LYS A 1 36  ? 0.136  -12.175 19.199 1.00 12.60 ? 1516 LYS A N   1 
ATOM   295  C CA  . LYS A 1 36  ? -0.853 -11.115 19.353 1.00 13.05 ? 1516 LYS A CA  1 
ATOM   296  C C   . LYS A 1 36  ? -0.137 -9.764  19.365 1.00 12.39 ? 1516 LYS A C   1 
ATOM   297  O O   . LYS A 1 36  ? 0.844  -9.590  20.067 1.00 12.11 ? 1516 LYS A O   1 
ATOM   298  C CB  . LYS A 1 36  ? -1.694 -11.299 20.591 1.00 13.69 ? 1516 LYS A CB  1 
ATOM   299  C CG  . LYS A 1 36  ? -2.900 -10.420 20.513 1.00 19.45 ? 1516 LYS A CG  1 
ATOM   300  C CD  . LYS A 1 36  ? -3.950 -10.821 21.548 1.00 23.71 ? 1516 LYS A CD  1 
ATOM   301  C CE  . LYS A 1 36  ? -4.445 -12.280 21.409 1.00 26.96 ? 1516 LYS A CE  1 
ATOM   302  N NZ  . LYS A 1 36  ? -5.112 -12.596 20.098 1.00 30.24 ? 1516 LYS A NZ  1 
ATOM   303  N N   A LEU A 1 37  ? -0.646 -8.870  18.521 0.50 12.34 ? 1517 LEU A N   1 
ATOM   304  N N   B LEU A 1 37  ? -0.679 -8.814  18.618 0.50 12.92 ? 1517 LEU A N   1 
ATOM   305  C CA  A LEU A 1 37  ? -0.202 -7.492  18.417 0.50 12.96 ? 1517 LEU A CA  1 
ATOM   306  C CA  B LEU A 1 37  ? -0.043 -7.537  18.358 0.50 13.91 ? 1517 LEU A CA  1 
ATOM   307  C C   A LEU A 1 37  ? -1.173 -6.526  19.051 0.50 12.16 ? 1517 LEU A C   1 
ATOM   308  C C   B LEU A 1 37  ? -0.983 -6.402  18.756 0.50 14.01 ? 1517 LEU A C   1 
ATOM   309  O O   A LEU A 1 37  ? -2.377 -6.612  18.872 0.50 10.75 ? 1517 LEU A O   1 
ATOM   310  O O   B LEU A 1 37  ? -2.018 -6.287  18.121 0.50 13.29 ? 1517 LEU A O   1 
ATOM   311  C CB  A LEU A 1 37  ? -0.018 -7.080  16.954 0.50 14.21 ? 1517 LEU A CB  1 
ATOM   312  C CB  B LEU A 1 37  ? 0.205  -7.482  16.848 0.50 15.10 ? 1517 LEU A CB  1 
ATOM   313  C CG  A LEU A 1 37  ? 1.387  -7.199  16.348 0.50 14.04 ? 1517 LEU A CG  1 
ATOM   314  C CG  B LEU A 1 37  ? 1.362  -6.702  16.243 0.50 14.41 ? 1517 LEU A CG  1 
ATOM   315  C CD1 A LEU A 1 37  ? 2.392  -6.128  16.841 0.50 15.25 ? 1517 LEU A CD1 1 
ATOM   316  C CD1 B LEU A 1 37  ? 1.353  -5.262  16.748 0.50 16.69 ? 1517 LEU A CD1 1 
ATOM   317  C CD2 A LEU A 1 37  ? 1.970  -8.608  16.535 0.50 16.08 ? 1517 LEU A CD2 1 
ATOM   318  C CD2 B LEU A 1 37  ? 2.675  -7.399  16.612 0.50 16.46 ? 1517 LEU A CD2 1 
ATOM   319  N N   . LEU A 1 38  ? -0.596 -5.556  19.740 1.00 13.43 ? 1518 LEU A N   1 
ATOM   320  C CA  . LEU A 1 38  ? -1.358 -4.368  20.115 1.00 13.86 ? 1518 LEU A CA  1 
ATOM   321  C C   . LEU A 1 38  ? -0.688 -3.237  19.357 1.00 13.84 ? 1518 LEU A C   1 
ATOM   322  O O   . LEU A 1 38  ? 0.394  -2.817  19.696 1.00 13.92 ? 1518 LEU A O   1 
ATOM   323  C CB  . LEU A 1 38  ? -1.351 -4.137  21.633 1.00 16.47 ? 1518 LEU A CB  1 
ATOM   324  C CG  . LEU A 1 38  ? -1.988 -2.807  22.068 1.00 19.18 ? 1518 LEU A CG  1 
ATOM   325  C CD1 . LEU A 1 38  ? -3.465 -2.742  21.792 1.00 19.19 ? 1518 LEU A CD1 1 
ATOM   326  C CD2 . LEU A 1 38  ? -1.722 -2.569  23.553 1.00 19.43 ? 1518 LEU A CD2 1 
ATOM   327  N N   . PHE A 1 39  ? -1.378 -2.779  18.327 1.00 13.25 ? 1519 PHE A N   1 
ATOM   328  C CA  . PHE A 1 39  ? -0.931 -1.639  17.565 1.00 13.70 ? 1519 PHE A CA  1 
ATOM   329  C C   . PHE A 1 39  ? -1.067 -0.369  18.373 1.00 14.00 ? 1519 PHE A C   1 
ATOM   330  O O   . PHE A 1 39  ? -1.890 -0.266  19.277 1.00 15.03 ? 1519 PHE A O   1 
ATOM   331  C CB  . PHE A 1 39  ? -1.623 -1.541  16.233 1.00 14.48 ? 1519 PHE A CB  1 
ATOM   332  C CG  . PHE A 1 39  ? -1.256 -2.646  15.315 1.00 15.05 ? 1519 PHE A CG  1 
ATOM   333  C CD1 . PHE A 1 39  ? -2.054 -3.751  15.180 1.00 17.93 ? 1519 PHE A CD1 1 
ATOM   334  C CD2 . PHE A 1 39  ? -0.125 -2.566  14.578 1.00 15.71 ? 1519 PHE A CD2 1 
ATOM   335  C CE1 . PHE A 1 39  ? -1.705 -4.791  14.297 1.00 16.59 ? 1519 PHE A CE1 1 
ATOM   336  C CE2 . PHE A 1 39  ? 0.247  -3.577  13.686 1.00 16.80 ? 1519 PHE A CE2 1 
ATOM   337  C CZ  . PHE A 1 39  ? -0.561 -4.705  13.566 1.00 17.51 ? 1519 PHE A CZ  1 
ATOM   338  N N   . ASP A 1 40  ? -0.218 0.600   18.030 1.00 14.97 ? 1520 ASP A N   1 
ATOM   339  C CA  . ASP A 1 40  ? -0.190 1.840   18.800 1.00 16.41 ? 1520 ASP A CA  1 
ATOM   340  C C   . ASP A 1 40  ? -1.508 2.647   18.774 1.00 17.98 ? 1520 ASP A C   1 
ATOM   341  O O   . ASP A 1 40  ? -1.717 3.511   19.621 1.00 19.43 ? 1520 ASP A O   1 
ATOM   342  C CB  . ASP A 1 40  ? 0.994  2.700   18.353 1.00 15.61 ? 1520 ASP A CB  1 
ATOM   343  C CG  . ASP A 1 40  ? 2.311  2.153   18.837 1.00 17.36 ? 1520 ASP A CG  1 
ATOM   344  O OD1 . ASP A 1 40  ? 2.372  1.207   19.628 1.00 19.96 ? 1520 ASP A OD1 1 
ATOM   345  O OD2 . ASP A 1 40  ? 3.339  2.606   18.309 1.00 18.71 ? 1520 ASP A OD2 1 
ATOM   346  N N   A ASP A 1 41  ? -2.378 2.372   17.803 0.70 20.17 ? 1521 ASP A N   1 
ATOM   347  N N   B ASP A 1 41  ? -2.381 2.378   17.806 0.30 19.01 ? 1521 ASP A N   1 
ATOM   348  C CA  A ASP A 1 41  ? -3.715 3.000   17.795 0.70 21.58 ? 1521 ASP A CA  1 
ATOM   349  C CA  B ASP A 1 41  ? -3.736 2.957   17.803 0.30 19.81 ? 1521 ASP A CA  1 
ATOM   350  C C   A ASP A 1 41  ? -4.722 2.212   18.668 0.70 21.55 ? 1521 ASP A C   1 
ATOM   351  C C   B ASP A 1 41  ? -4.542 2.369   18.951 0.30 20.32 ? 1521 ASP A C   1 
ATOM   352  O O   A ASP A 1 41  ? -5.893 2.618   18.877 0.70 21.02 ? 1521 ASP A O   1 
ATOM   353  O O   B ASP A 1 41  ? -5.396 3.031   19.551 0.30 20.55 ? 1521 ASP A O   1 
ATOM   354  C CB  A ASP A 1 41  ? -4.219 3.292   16.358 0.70 23.30 ? 1521 ASP A CB  1 
ATOM   355  C CB  B ASP A 1 41  ? -4.450 2.614   16.495 0.30 19.70 ? 1521 ASP A CB  1 
ATOM   356  C CG  A ASP A 1 41  ? -3.944 2.158   15.363 0.70 23.64 ? 1521 ASP A CG  1 
ATOM   357  C CG  B ASP A 1 41  ? -4.215 1.179   16.075 0.30 19.50 ? 1521 ASP A CG  1 
ATOM   358  O OD1 A ASP A 1 41  ? -3.593 1.034   15.794 0.70 23.82 ? 1521 ASP A OD1 1 
ATOM   359  O OD1 B ASP A 1 41  ? -4.341 0.291   16.927 0.30 17.10 ? 1521 ASP A OD1 1 
ATOM   360  O OD2 A ASP A 1 41  ? -4.123 2.386   14.145 0.70 28.29 ? 1521 ASP A OD2 1 
ATOM   361  O OD2 B ASP A 1 41  ? -3.892 0.935   14.899 0.30 19.36 ? 1521 ASP A OD2 1 
ATOM   362  N N   . GLY A 1 42  ? -4.273 1.100   19.241 1.00 20.62 ? 1522 GLY A N   1 
ATOM   363  C CA  . GLY A 1 42  ? -5.136 0.319   20.115 1.00 22.02 ? 1522 GLY A CA  1 
ATOM   364  C C   . GLY A 1 42  ? -5.844 -0.824  19.385 1.00 21.41 ? 1522 GLY A C   1 
ATOM   365  O O   . GLY A 1 42  ? -6.619 -1.538  20.030 1.00 22.76 ? 1522 GLY A O   1 
ATOM   366  N N   . TYR A 1 43  ? -5.636 -0.972  18.071 1.00 22.62 ? 1523 TYR A N   1 
ATOM   367  C CA  . TYR A 1 43  ? -6.167 -2.121  17.289 1.00 22.62 ? 1523 TYR A CA  1 
ATOM   368  C C   . TYR A 1 43  ? -5.334 -3.362  17.649 1.00 23.07 ? 1523 TYR A C   1 
ATOM   369  O O   . TYR A 1 43  ? -4.120 -3.290  17.905 1.00 19.97 ? 1523 TYR A O   1 
ATOM   370  C CB  . TYR A 1 43  ? -6.070 -1.906  15.751 1.00 24.17 ? 1523 TYR A CB  1 
ATOM   371  C CG  . TYR A 1 43  ? -7.110 -1.009  15.054 1.00 27.19 ? 1523 TYR A CG  1 
ATOM   372  C CD1 . TYR A 1 43  ? -7.125 0.379   15.240 1.00 27.25 ? 1523 TYR A CD1 1 
ATOM   373  C CD2 . TYR A 1 43  ? -8.046 -1.561  14.163 1.00 29.01 ? 1523 TYR A CD2 1 
ATOM   374  C CE1 . TYR A 1 43  ? -8.064 1.199   14.581 1.00 29.24 ? 1523 TYR A CE1 1 
ATOM   375  C CE2 . TYR A 1 43  ? -8.992 -0.760  13.506 1.00 29.39 ? 1523 TYR A CE2 1 
ATOM   376  C CZ  . TYR A 1 43  ? -8.997 0.612   13.717 1.00 28.89 ? 1523 TYR A CZ  1 
ATOM   377  O OH  . TYR A 1 43  ? -9.929 1.386   13.050 1.00 28.80 ? 1523 TYR A OH  1 
ATOM   378  N N   . GLU A 1 44  ? -5.968 -4.518  17.647 1.00 23.98 ? 1524 GLU A N   1 
ATOM   379  C CA  . GLU A 1 44  ? -5.253 -5.745  17.953 1.00 25.76 ? 1524 GLU A CA  1 
ATOM   380  C C   . GLU A 1 44  ? -5.596 -6.825  16.964 1.00 25.76 ? 1524 GLU A C   1 
ATOM   381  O O   . GLU A 1 44  ? -6.757 -6.979  16.556 1.00 26.84 ? 1524 GLU A O   1 
ATOM   382  C CB  . GLU A 1 44  ? -5.559 -6.249  19.356 1.00 26.47 ? 1524 GLU A CB  1 
ATOM   383  C CG  . GLU A 1 44  ? -5.345 -5.250  20.455 1.00 29.75 ? 1524 GLU A CG  1 
ATOM   384  C CD  . GLU A 1 44  ? -5.902 -5.714  21.780 1.00 33.22 ? 1524 GLU A CD  1 
ATOM   385  O OE1 . GLU A 1 44  ? -5.103 -6.150  22.640 1.00 36.38 ? 1524 GLU A OE1 1 
ATOM   386  O OE2 . GLU A 1 44  ? -7.142 -5.656  21.969 1.00 34.20 ? 1524 GLU A OE2 1 
ATOM   387  N N   . CYS A 1 45  ? -4.587 -7.598  16.606 1.00 24.68 ? 1525 CYS A N   1 
ATOM   388  C CA  . CYS A 1 45  ? -4.781 -8.734  15.747 1.00 24.16 ? 1525 CYS A CA  1 
ATOM   389  C C   . CYS A 1 45  ? -3.667 -9.743  15.995 1.00 22.37 ? 1525 CYS A C   1 
ATOM   390  O O   . CYS A 1 45  ? -2.637 -9.436  16.630 1.00 18.94 ? 1525 CYS A O   1 
ATOM   391  C CB  . CYS A 1 45  ? -4.852 -8.290  14.275 1.00 24.58 ? 1525 CYS A CB  1 
ATOM   392  S SG  . CYS A 1 45  ? -3.365 -7.932  13.373 1.00 29.12 ? 1525 CYS A SG  1 
ATOM   393  N N   . ASP A 1 46  ? -3.896 -10.965 15.547 1.00 20.45 ? 1526 ASP A N   1 
ATOM   394  C CA  . ASP A 1 46  ? -2.822 -11.937 15.485 1.00 19.32 ? 1526 ASP A CA  1 
ATOM   395  C C   . ASP A 1 46  ? -2.081 -11.770 14.194 1.00 17.97 ? 1526 ASP A C   1 
ATOM   396  O O   . ASP A 1 46  ? -2.681 -11.517 13.122 1.00 18.09 ? 1526 ASP A O   1 
ATOM   397  C CB  . ASP A 1 46  ? -3.370 -13.342 15.544 1.00 19.08 ? 1526 ASP A CB  1 
ATOM   398  C CG  . ASP A 1 46  ? -3.903 -13.679 16.899 1.00 20.94 ? 1526 ASP A CG  1 
ATOM   399  O OD1 . ASP A 1 46  ? -3.754 -12.861 17.826 1.00 22.49 ? 1526 ASP A OD1 1 
ATOM   400  O OD2 . ASP A 1 46  ? -4.469 -14.771 17.035 1.00 21.77 ? 1526 ASP A OD2 1 
ATOM   401  N N   . VAL A 1 47  ? -0.753 -11.857 14.272 1.00 15.23 ? 1527 VAL A N   1 
ATOM   402  C CA  . VAL A 1 47  ? 0.120  -11.675 13.142 1.00 14.85 ? 1527 VAL A CA  1 
ATOM   403  C C   . VAL A 1 47  ? 1.159  -12.779 13.105 1.00 14.33 ? 1527 VAL A C   1 
ATOM   404  O O   . VAL A 1 47  ? 1.685  -13.174 14.143 1.00 13.91 ? 1527 VAL A O   1 
ATOM   405  C CB  . VAL A 1 47  ? 0.839  -10.269 13.222 1.00 16.26 ? 1527 VAL A CB  1 
ATOM   406  C CG1 . VAL A 1 47  ? 1.723  -10.002 12.003 1.00 16.03 ? 1527 VAL A CG1 1 
ATOM   407  C CG2 . VAL A 1 47  ? -0.200 -9.181  13.383 1.00 17.72 ? 1527 VAL A CG2 1 
ATOM   408  N N   A LEU A 1 48  ? 1.479  -13.289 11.919 0.50 14.95 ? 1528 LEU A N   1 
ATOM   409  N N   B LEU A 1 48  ? 1.486  -13.235 11.909 0.50 14.68 ? 1528 LEU A N   1 
ATOM   410  C CA  A LEU A 1 48  ? 2.550  -14.283 11.785 0.50 15.27 ? 1528 LEU A CA  1 
ATOM   411  C CA  B LEU A 1 48  ? 2.557  -14.193 11.702 0.50 14.73 ? 1528 LEU A CA  1 
ATOM   412  C C   A LEU A 1 48  ? 3.913  -13.632 11.983 0.50 14.88 ? 1528 LEU A C   1 
ATOM   413  C C   B LEU A 1 48  ? 3.913  -13.568 12.038 0.50 14.58 ? 1528 LEU A C   1 
ATOM   414  O O   A LEU A 1 48  ? 4.165  -12.511 11.521 0.50 13.83 ? 1528 LEU A O   1 
ATOM   415  O O   B LEU A 1 48  ? 4.156  -12.378 11.738 0.50 13.54 ? 1528 LEU A O   1 
ATOM   416  C CB  A LEU A 1 48  ? 2.542  -14.964 10.414 0.50 16.53 ? 1528 LEU A CB  1 
ATOM   417  C CB  B LEU A 1 48  ? 2.555  -14.628 10.241 0.50 15.60 ? 1528 LEU A CB  1 
ATOM   418  C CG  A LEU A 1 48  ? 1.545  -16.072 10.091 0.50 18.68 ? 1528 LEU A CG  1 
ATOM   419  C CG  B LEU A 1 48  ? 1.371  -15.467 9.752  0.50 16.68 ? 1528 LEU A CG  1 
ATOM   420  C CD1 A LEU A 1 48  ? 0.304  -15.483 9.477  0.50 22.82 ? 1528 LEU A CD1 1 
ATOM   421  C CD1 B LEU A 1 48  ? 1.452  -15.536 8.247  0.50 18.19 ? 1528 LEU A CD1 1 
ATOM   422  C CD2 A LEU A 1 48  ? 2.192  -17.026 9.116  0.50 20.20 ? 1528 LEU A CD2 1 
ATOM   423  C CD2 B LEU A 1 48  ? 1.398  -16.869 10.372 0.50 17.16 ? 1528 LEU A CD2 1 
ATOM   424  N N   . GLY A 1 49  ? 4.811  -14.352 12.632 1.00 14.16 ? 1529 GLY A N   1 
ATOM   425  C CA  . GLY A 1 49  ? 6.126  -13.853 12.931 1.00 15.66 ? 1529 GLY A CA  1 
ATOM   426  C C   . GLY A 1 49  ? 6.804  -13.328 11.686 1.00 15.87 ? 1529 GLY A C   1 
ATOM   427  O O   . GLY A 1 49  ? 7.528  -12.332 11.777 1.00 15.31 ? 1529 GLY A O   1 
ATOM   428  N N   . LYS A 1 50  ? 6.567  -13.959 10.526 1.00 16.37 ? 1530 LYS A N   1 
ATOM   429  C CA  . LYS A 1 50  ? 7.195  -13.515 9.269  1.00 18.27 ? 1530 LYS A CA  1 
ATOM   430  C C   . LYS A 1 50  ? 6.776  -12.109 8.856  1.00 18.27 ? 1530 LYS A C   1 
ATOM   431  O O   . LYS A 1 50  ? 7.451  -11.466 8.048  1.00 20.27 ? 1530 LYS A O   1 
ATOM   432  C CB  . LYS A 1 50  ? 6.873  -14.476 8.110  1.00 18.87 ? 1530 LYS A CB  1 
ATOM   433  C CG  . LYS A 1 50  ? 5.426  -14.451 7.655  1.00 21.44 ? 1530 LYS A CG  1 
ATOM   434  C CD  . LYS A 1 50  ? 5.186  -15.274 6.365  1.00 22.02 ? 1530 LYS A CD  1 
ATOM   435  C CE  . LYS A 1 50  ? 5.199  -14.380 5.133  1.00 28.69 ? 1530 LYS A CE  1 
ATOM   436  N NZ  . LYS A 1 50  ? 4.043  -13.424 5.080  1.00 32.61 ? 1530 LYS A NZ  1 
ATOM   437  N N   . ASP A 1 51  ? 5.662  -11.660 9.408  1.00 16.00 ? 1531 ASP A N   1 
ATOM   438  C CA  . ASP A 1 51  ? 5.113  -10.311 9.120  1.00 15.56 ? 1531 ASP A CA  1 
ATOM   439  C C   . ASP A 1 51  ? 5.396  -9.319  10.259 1.00 14.38 ? 1531 ASP A C   1 
ATOM   440  O O   . ASP A 1 51  ? 4.812  -8.245  10.259 1.00 13.86 ? 1531 ASP A O   1 
ATOM   441  C CB  . ASP A 1 51  ? 3.607  -10.373 8.892  1.00 17.50 ? 1531 ASP A CB  1 
ATOM   442  C CG  . ASP A 1 51  ? 3.202  -11.191 7.648  1.00 21.46 ? 1531 ASP A CG  1 
ATOM   443  O OD1 . ASP A 1 51  ? 3.967  -11.217 6.697  1.00 22.92 ? 1531 ASP A OD1 1 
ATOM   444  O OD2 . ASP A 1 51  ? 2.109  -11.796 7.653  1.00 24.84 ? 1531 ASP A OD2 1 
ATOM   445  N N   . ILE A 1 52  ? 6.292  -9.665  11.175 1.00 13.18 ? 1532 ILE A N   1 
ATOM   446  C CA  . ILE A 1 52  ? 6.668  -8.791  12.277 1.00 13.22 ? 1532 ILE A CA  1 
ATOM   447  C C   . ILE A 1 52  ? 8.126  -8.428  12.197 1.00 13.83 ? 1532 ILE A C   1 
ATOM   448  O O   . ILE A 1 52  ? 8.956  -9.344  12.056 1.00 15.65 ? 1532 ILE A O   1 
ATOM   449  C CB  . ILE A 1 52  ? 6.373  -9.492  13.653 1.00 12.82 ? 1532 ILE A CB  1 
ATOM   450  C CG1 . ILE A 1 52  ? 4.881  -9.788  13.815 1.00 14.38 ? 1532 ILE A CG1 1 
ATOM   451  C CG2 . ILE A 1 52  ? 6.889  -8.633  14.780 1.00 14.84 ? 1532 ILE A CG2 1 
ATOM   452  C CD1 . ILE A 1 52  ? 4.548  -10.689 15.039 1.00 14.45 ? 1532 ILE A CD1 1 
ATOM   453  N N   . LEU A 1 53  ? 8.439  -7.128  12.222 1.00 13.99 ? 1533 LEU A N   1 
ATOM   454  C CA  . LEU A 1 53  ? 9.803  -6.639  12.147 1.00 14.22 ? 1533 LEU A CA  1 
ATOM   455  C C   . LEU A 1 53  ? 10.235 -6.145  13.479 1.00 14.61 ? 1533 LEU A C   1 
ATOM   456  O O   . LEU A 1 53  ? 9.597  -5.307  14.085 1.00 14.01 ? 1533 LEU A O   1 
ATOM   457  C CB  . LEU A 1 53  ? 9.919  -5.511  11.101 1.00 15.05 ? 1533 LEU A CB  1 
ATOM   458  C CG  . LEU A 1 53  ? 9.350  -5.817  9.722  1.00 14.82 ? 1533 LEU A CG  1 
ATOM   459  C CD1 . LEU A 1 53  ? 9.249  -4.549  8.881  1.00 14.59 ? 1533 LEU A CD1 1 
ATOM   460  C CD2 . LEU A 1 53  ? 10.203 -6.864  9.042  1.00 16.59 ? 1533 LEU A CD2 1 
ATOM   461  N N   A LEU A 1 54  ? 11.386 -6.626  13.971 0.50 14.92 ? 1534 LEU A N   1 
ATOM   462  N N   B LEU A 1 54  ? 11.309 -6.765  13.950 0.50 15.22 ? 1534 LEU A N   1 
ATOM   463  C CA  A LEU A 1 54  ? 11.941 -6.139  15.250 0.50 17.15 ? 1534 LEU A CA  1 
ATOM   464  C CA  B LEU A 1 54  ? 11.834 -6.476  15.243 0.50 17.25 ? 1534 LEU A CA  1 
ATOM   465  C C   A LEU A 1 54  ? 12.753 -4.874  15.065 0.50 17.30 ? 1534 LEU A C   1 
ATOM   466  C C   B LEU A 1 54  ? 12.847 -5.380  15.015 0.50 17.31 ? 1534 LEU A C   1 
ATOM   467  O O   A LEU A 1 54  ? 13.966 -4.881  15.206 0.50 18.56 ? 1534 LEU A O   1 
ATOM   468  O O   B LEU A 1 54  ? 14.050 -5.618  15.047 0.50 18.76 ? 1534 LEU A O   1 
ATOM   469  C CB  A LEU A 1 54  ? 12.823 -7.203  15.939 0.50 17.52 ? 1534 LEU A CB  1 
ATOM   470  C CB  B LEU A 1 54  ? 12.489 -7.724  15.843 0.50 17.58 ? 1534 LEU A CB  1 
ATOM   471  C CG  A LEU A 1 54  ? 12.136 -8.418  16.555 0.50 19.36 ? 1534 LEU A CG  1 
ATOM   472  C CG  B LEU A 1 54  ? 13.005 -7.434  17.249 0.50 18.14 ? 1534 LEU A CG  1 
ATOM   473  C CD1 A LEU A 1 54  ? 13.027 -8.976  17.671 0.50 20.39 ? 1534 LEU A CD1 1 
ATOM   474  C CD1 B LEU A 1 54  ? 11.873 -7.125  18.211 0.50 20.34 ? 1534 LEU A CD1 1 
ATOM   475  C CD2 A LEU A 1 54  ? 10.755 -8.088  17.091 0.50 23.23 ? 1534 LEU A CD2 1 
ATOM   476  C CD2 B LEU A 1 54  ? 13.860 -8.590  17.739 0.50 18.52 ? 1534 LEU A CD2 1 
ATOM   477  N N   A CYS A 1 55  ? 12.111 -3.777  14.710 0.50 17.68 ? 1535 CYS A N   1 
ATOM   478  N N   B CYS A 1 55  ? 12.358 -4.194  14.671 0.50 17.40 ? 1535 CYS A N   1 
ATOM   479  C CA  A CYS A 1 55  ? 12.859 -2.532  14.641 0.50 17.51 ? 1535 CYS A CA  1 
ATOM   480  C CA  B CYS A 1 55  ? 13.169 -2.997  14.704 0.50 18.32 ? 1535 CYS A CA  1 
ATOM   481  C C   A CYS A 1 55  ? 12.154 -1.408  15.357 0.50 16.91 ? 1535 CYS A C   1 
ATOM   482  C C   B CYS A 1 55  ? 12.372 -1.893  15.370 0.50 17.88 ? 1535 CYS A C   1 
ATOM   483  O O   A CYS A 1 55  ? 11.170 -0.835  14.879 0.50 18.81 ? 1535 CYS A O   1 
ATOM   484  O O   B CYS A 1 55  ? 11.237 -1.583  14.998 0.50 18.90 ? 1535 CYS A O   1 
ATOM   485  C CB  A CYS A 1 55  ? 13.258 -2.181  13.210 0.50 17.86 ? 1535 CYS A CB  1 
ATOM   486  C CB  B CYS A 1 55  ? 13.695 -2.583  13.317 0.50 17.73 ? 1535 CYS A CB  1 
ATOM   487  S SG  A CYS A 1 55  ? 11.916 -2.275  12.100 0.50 16.21 ? 1535 CYS A SG  1 
ATOM   488  S SG  B CYS A 1 55  ? 12.606 -2.718  11.853 0.50 19.27 ? 1535 CYS A SG  1 
ATOM   489  N N   A ASP A 1 56  ? 12.668 -1.137  16.546 0.50 16.70 ? 1536 ASP A N   1 
ATOM   490  N N   B ASP A 1 56  ? 12.943 -1.410  16.460 0.50 17.94 ? 1536 ASP A N   1 
ATOM   491  C CA  A ASP A 1 56  ? 12.248 -0.013  17.361 0.50 15.86 ? 1536 ASP A CA  1 
ATOM   492  C CA  B ASP A 1 56  ? 12.471 -0.207  17.087 0.50 18.48 ? 1536 ASP A CA  1 
ATOM   493  C C   A ASP A 1 56  ? 13.529 0.759   17.665 0.50 16.34 ? 1536 ASP A C   1 
ATOM   494  C C   B ASP A 1 56  ? 13.713 0.578   17.432 0.50 17.46 ? 1536 ASP A C   1 
ATOM   495  O O   A ASP A 1 56  ? 14.170 0.494   18.693 0.50 16.04 ? 1536 ASP A O   1 
ATOM   496  O O   B ASP A 1 56  ? 14.552 0.099   18.212 0.50 16.23 ? 1536 ASP A O   1 
ATOM   497  C CB  A ASP A 1 56  ? 11.675 -0.508  18.677 0.50 16.39 ? 1536 ASP A CB  1 
ATOM   498  C CB  B ASP A 1 56  ? 11.675 -0.437  18.354 0.50 19.34 ? 1536 ASP A CB  1 
ATOM   499  C CG  A ASP A 1 56  ? 11.384 0.621   19.642 0.50 14.91 ? 1536 ASP A CG  1 
ATOM   500  C CG  B ASP A 1 56  ? 11.185 0.859   18.916 0.50 21.52 ? 1536 ASP A CG  1 
ATOM   501  O OD1 A ASP A 1 56  ? 11.312 0.309   20.845 0.50 18.72 ? 1536 ASP A OD1 1 
ATOM   502  O OD1 B ASP A 1 56  ? 10.845 1.731   18.090 0.50 19.66 ? 1536 ASP A OD1 1 
ATOM   503  O OD2 A ASP A 1 56  ? 11.168 1.792   19.181 0.50 14.23 ? 1536 ASP A OD2 1 
ATOM   504  O OD2 B ASP A 1 56  ? 11.158 1.027   20.150 0.50 23.05 ? 1536 ASP A OD2 1 
ATOM   505  N N   . PRO A 1 57  ? 13.888 1.758   16.815 1.00 15.02 ? 1537 PRO A N   1 
ATOM   506  C CA  . PRO A 1 57  ? 13.118 2.421   15.763 1.00 14.91 ? 1537 PRO A CA  1 
ATOM   507  C C   . PRO A 1 57  ? 13.336 1.751   14.410 1.00 14.22 ? 1537 PRO A C   1 
ATOM   508  O O   . PRO A 1 57  ? 14.238 0.910   14.179 1.00 15.06 ? 1537 PRO A O   1 
ATOM   509  C CB  . PRO A 1 57  ? 13.804 3.811   15.669 1.00 15.64 ? 1537 PRO A CB  1 
ATOM   510  C CG  . PRO A 1 57  ? 15.202 3.523   16.088 1.00 17.87 ? 1537 PRO A CG  1 
ATOM   511  C CD  . PRO A 1 57  ? 15.178 2.449   17.085 1.00 16.33 ? 1537 PRO A CD  1 
ATOM   512  N N   . ILE A 1 58  ? 12.517 2.161   13.443 1.00 13.83 ? 1538 ILE A N   1 
ATOM   513  C CA  . ILE A 1 58  ? 12.831 1.805   12.046 1.00 14.95 ? 1538 ILE A CA  1 
ATOM   514  C C   . ILE A 1 58  ? 14.220 2.347   11.625 1.00 15.03 ? 1538 ILE A C   1 
ATOM   515  O O   . ILE A 1 58  ? 14.530 3.487   11.990 1.00 14.39 ? 1538 ILE A O   1 
ATOM   516  C CB  . ILE A 1 58  ? 11.730 2.378   11.097 1.00 14.18 ? 1538 ILE A CB  1 
ATOM   517  C CG1 . ILE A 1 58  ? 10.369 1.752   11.477 1.00 15.20 ? 1538 ILE A CG1 1 
ATOM   518  C CG2 . ILE A 1 58  ? 12.088 2.187   9.643  1.00 14.90 ? 1538 ILE A CG2 1 
ATOM   519  C CD1 . ILE A 1 58  ? 9.226  2.573   10.916 1.00 16.79 ? 1538 ILE A CD1 1 
ATOM   520  N N   . PRO A 1 59  ? 15.049 1.601   10.929 1.00 14.27 ? 1539 PRO A N   1 
ATOM   521  C CA  . PRO A 1 59  ? 16.448 2.003   10.823 1.00 15.25 ? 1539 PRO A CA  1 
ATOM   522  C C   . PRO A 1 59  ? 16.711 3.217   9.984  1.00 13.71 ? 1539 PRO A C   1 
ATOM   523  O O   . PRO A 1 59  ? 15.933 3.557   9.106  1.00 15.11 ? 1539 PRO A O   1 
ATOM   524  C CB  . PRO A 1 59  ? 17.117 0.760   10.237 1.00 16.11 ? 1539 PRO A CB  1 
ATOM   525  C CG  . PRO A 1 59  ? 16.193 -0.353  10.440 1.00 17.35 ? 1539 PRO A CG  1 
ATOM   526  C CD  . PRO A 1 59  ? 14.811 0.211   10.451 1.00 15.54 ? 1539 PRO A CD  1 
ATOM   527  N N   . LEU A 1 60  ? 17.808 3.898   10.310 1.00 14.15 ? 1540 LEU A N   1 
ATOM   528  C CA  . LEU A 1 60  ? 18.311 4.928   9.460  1.00 12.79 ? 1540 LEU A CA  1 
ATOM   529  C C   . LEU A 1 60  ? 18.463 4.404   8.041  1.00 14.33 ? 1540 LEU A C   1 
ATOM   530  O O   . LEU A 1 60  ? 18.778 3.229   7.819  1.00 15.32 ? 1540 LEU A O   1 
ATOM   531  C CB  . LEU A 1 60  ? 19.725 5.390   9.922  1.00 13.94 ? 1540 LEU A CB  1 
ATOM   532  C CG  . LEU A 1 60  ? 19.759 6.001   11.310 1.00 12.88 ? 1540 LEU A CG  1 
ATOM   533  C CD1 . LEU A 1 60  ? 21.246 6.230   11.711 1.00 14.03 ? 1540 LEU A CD1 1 
ATOM   534  C CD2 . LEU A 1 60  ? 18.991 7.310   11.357 1.00 13.33 ? 1540 LEU A CD2 1 
ATOM   535  N N   . ASP A 1 61  ? 18.250 5.287   7.091  1.00 14.15 ? 1541 ASP A N   1 
ATOM   536  C CA  . ASP A 1 61  ? 18.432 5.027   5.662  1.00 16.16 ? 1541 ASP A CA  1 
ATOM   537  C C   . ASP A 1 61  ? 17.332 4.136   5.063  1.00 16.34 ? 1541 ASP A C   1 
ATOM   538  O O   . ASP A 1 61  ? 17.432 3.771   3.884  1.00 22.28 ? 1541 ASP A O   1 
ATOM   539  C CB  . ASP A 1 61  ? 19.882 4.639   5.337  1.00 17.27 ? 1541 ASP A CB  1 
ATOM   540  C CG  . ASP A 1 61  ? 20.832 5.780   5.634  1.00 21.55 ? 1541 ASP A CG  1 
ATOM   541  O OD1 . ASP A 1 61  ? 20.580 6.909   5.149  1.00 23.41 ? 1541 ASP A OD1 1 
ATOM   542  O OD2 . ASP A 1 61  ? 21.825 5.547   6.350  1.00 27.85 ? 1541 ASP A OD2 1 
ATOM   543  N N   . THR A 1 62  ? 16.343 3.785   5.850  1.00 16.00 ? 1542 THR A N   1 
ATOM   544  C CA  . THR A 1 62  ? 15.172 3.012   5.353  1.00 16.27 ? 1542 THR A CA  1 
ATOM   545  C C   . THR A 1 62  ? 14.185 3.934   4.634  1.00 14.12 ? 1542 THR A C   1 
ATOM   546  O O   . THR A 1 62  ? 13.938 5.044   5.086  1.00 14.32 ? 1542 THR A O   1 
ATOM   547  C CB  . THR A 1 62  ? 14.407 2.400   6.566  1.00 13.71 ? 1542 THR A CB  1 
ATOM   548  O OG1 . THR A 1 62  ? 15.258 1.623   7.406  1.00 20.23 ? 1542 THR A OG1 1 
ATOM   549  C CG2 . THR A 1 62  ? 13.218 1.540   6.129  1.00 18.26 ? 1542 THR A CG2 1 
ATOM   550  N N   A GLU A 1 63  ? 13.606 3.422   3.552  0.50 13.44 ? 1543 GLU A N   1 
ATOM   551  N N   B GLU A 1 63  ? 13.645 3.550   3.480  0.50 13.76 ? 1543 GLU A N   1 
ATOM   552  C CA  A GLU A 1 63  ? 12.473 4.054   2.899  0.50 13.21 ? 1543 GLU A CA  1 
ATOM   553  C CA  B GLU A 1 63  ? 12.557 4.346   2.897  0.50 13.50 ? 1543 GLU A CA  1 
ATOM   554  C C   A GLU A 1 63  ? 11.197 3.798   3.679  0.50 12.96 ? 1543 GLU A C   1 
ATOM   555  C C   B GLU A 1 63  ? 11.269 3.886   3.567  0.50 13.11 ? 1543 GLU A C   1 
ATOM   556  O O   A GLU A 1 63  ? 10.867 2.659   3.991  0.50 14.18 ? 1543 GLU A O   1 
ATOM   557  O O   B GLU A 1 63  ? 11.033 2.691   3.686  0.50 12.98 ? 1543 GLU A O   1 
ATOM   558  C CB  A GLU A 1 63  ? 12.334 3.550   1.443  0.50 11.90 ? 1543 GLU A CB  1 
ATOM   559  C CB  B GLU A 1 63  ? 12.477 4.172   1.366  0.50 14.50 ? 1543 GLU A CB  1 
ATOM   560  C CG  A GLU A 1 63  ? 11.453 4.506   0.654  0.50 16.28 ? 1543 GLU A CG  1 
ATOM   561  C CG  B GLU A 1 63  ? 11.396 5.056   0.741  0.50 17.79 ? 1543 GLU A CG  1 
ATOM   562  C CD  A GLU A 1 63  ? 11.090 4.015   -0.702 0.50 15.68 ? 1543 GLU A CD  1 
ATOM   563  C CD  B GLU A 1 63  ? 11.000 4.596   -0.644 0.50 19.96 ? 1543 GLU A CD  1 
ATOM   564  O OE1 A GLU A 1 63  ? 9.874  3.849   -0.954 0.50 17.08 ? 1543 GLU A OE1 1 
ATOM   565  O OE1 B GLU A 1 63  ? 10.388 3.508   -0.790 0.50 18.77 ? 1543 GLU A OE1 1 
ATOM   566  O OE2 A GLU A 1 63  ? 12.021 3.852   -1.530 0.50 18.76 ? 1543 GLU A OE2 1 
ATOM   567  O OE2 B GLU A 1 63  ? 11.358 5.330   -1.602 0.50 20.92 ? 1543 GLU A OE2 1 
ATOM   568  N N   . VAL A 1 64  ? 10.480 4.860   4.004  1.00 13.54 ? 1544 VAL A N   1 
ATOM   569  C CA  . VAL A 1 64  ? 9.259  4.717   4.790  1.00 13.07 ? 1544 VAL A CA  1 
ATOM   570  C C   . VAL A 1 64  ? 8.129  5.513   4.125  1.00 12.39 ? 1544 VAL A C   1 
ATOM   571  O O   . VAL A 1 64  ? 8.376  6.248   3.133  1.00 12.17 ? 1544 VAL A O   1 
ATOM   572  C CB  . VAL A 1 64  ? 9.504  5.198   6.209  1.00 12.83 ? 1544 VAL A CB  1 
ATOM   573  C CG1 . VAL A 1 64  ? 10.580 4.386   6.930  1.00 13.27 ? 1544 VAL A CG1 1 
ATOM   574  C CG2 . VAL A 1 64  ? 9.803  6.671   6.321  1.00 13.23 ? 1544 VAL A CG2 1 
ATOM   575  N N   . THR A 1 65  ? 6.949  5.397   4.702  1.00 12.39 ? 1545 THR A N   1 
ATOM   576  C CA  . THR A 1 65  ? 5.821  6.205   4.319  1.00 12.06 ? 1545 THR A CA  1 
ATOM   577  C C   . THR A 1 65  ? 5.444  7.123   5.499  1.00 12.52 ? 1545 THR A C   1 
ATOM   578  O O   . THR A 1 65  ? 5.196  6.680   6.626  1.00 14.43 ? 1545 THR A O   1 
ATOM   579  C CB  . THR A 1 65  ? 4.626  5.296   3.984  1.00 12.31 ? 1545 THR A CB  1 
ATOM   580  O OG1 . THR A 1 65  ? 5.037  4.469   2.876  1.00 13.48 ? 1545 THR A OG1 1 
ATOM   581  C CG2 . THR A 1 65  ? 3.447  6.069   3.533  1.00 14.03 ? 1545 THR A CG2 1 
ATOM   582  N N   . ALA A 1 66  ? 5.484  8.404   5.187  1.00 12.48 ? 1546 ALA A N   1 
ATOM   583  C CA  . ALA A 1 66  ? 5.220  9.444   6.176  1.00 13.34 ? 1546 ALA A CA  1 
ATOM   584  C C   . ALA A 1 66  ? 3.805  9.944   5.973  1.00 12.68 ? 1546 ALA A C   1 
ATOM   585  O O   . ALA A 1 66  ? 3.350  10.199  4.834  1.00 13.84 ? 1546 ALA A O   1 
ATOM   586  C CB  . ALA A 1 66  ? 6.195  10.573  6.077  1.00 15.54 ? 1546 ALA A CB  1 
ATOM   587  N N   . LEU A 1 67  ? 3.129  10.134  7.098  1.00 13.83 ? 1547 LEU A N   1 
ATOM   588  C CA  . LEU A 1 67  ? 1.736  10.558  7.086  1.00 15.77 ? 1547 LEU A CA  1 
ATOM   589  C C   . LEU A 1 67  ? 1.643  12.046  7.395  1.00 16.13 ? 1547 LEU A C   1 
ATOM   590  O O   . LEU A 1 67  ? 2.128  12.510  8.453  1.00 16.67 ? 1547 LEU A O   1 
ATOM   591  C CB  . LEU A 1 67  ? 0.942  9.752   8.116  1.00 16.91 ? 1547 LEU A CB  1 
ATOM   592  C CG  . LEU A 1 67  ? 1.025  8.223   7.993  1.00 21.87 ? 1547 LEU A CG  1 
ATOM   593  C CD1 . LEU A 1 67  ? -0.010 7.583   8.927  1.00 21.71 ? 1547 LEU A CD1 1 
ATOM   594  C CD2 . LEU A 1 67  ? 0.891  7.715   6.581  1.00 27.25 ? 1547 LEU A CD2 1 
ATOM   595  N N   A SER A 1 68  ? 1.043  12.813  6.491  0.50 16.23 ? 1548 SER A N   1 
ATOM   596  N N   B SER A 1 68  ? 1.044  12.809  6.474  0.50 16.03 ? 1548 SER A N   1 
ATOM   597  C CA  A SER A 1 68  ? 0.849  14.246  6.709  0.50 17.77 ? 1548 SER A CA  1 
ATOM   598  C CA  B SER A 1 68  ? 0.768  14.241  6.669  0.50 17.47 ? 1548 SER A CA  1 
ATOM   599  C C   A SER A 1 68  ? -0.542 14.507  7.330  0.50 18.96 ? 1548 SER A C   1 
ATOM   600  C C   B SER A 1 68  ? -0.478 14.424  7.525  0.50 18.99 ? 1548 SER A C   1 
ATOM   601  O O   A SER A 1 68  ? -1.452 13.693  7.245  0.50 18.40 ? 1548 SER A O   1 
ATOM   602  O O   B SER A 1 68  ? -1.237 13.485  7.771  0.50 19.11 ? 1548 SER A O   1 
ATOM   603  C CB  A SER A 1 68  ? 1.069  15.017  5.401  0.50 18.54 ? 1548 SER A CB  1 
ATOM   604  C CB  B SER A 1 68  ? 0.542  14.961  5.326  0.50 17.52 ? 1548 SER A CB  1 
ATOM   605  O OG  A SER A 1 68  ? 2.388  14.820  4.928  0.50 20.56 ? 1548 SER A OG  1 
ATOM   606  O OG  B SER A 1 68  ? -0.786 14.817  4.842  0.50 17.78 ? 1548 SER A OG  1 
ATOM   607  N N   . GLU A 1 69  ? -0.699 15.662  7.981  1.00 21.10 ? 1549 GLU A N   1 
ATOM   608  C CA  . GLU A 1 69  ? -1.858 15.913  8.845  1.00 24.38 ? 1549 GLU A CA  1 
ATOM   609  C C   . GLU A 1 69  ? -3.228 15.929  8.142  1.00 24.46 ? 1549 GLU A C   1 
ATOM   610  O O   . GLU A 1 69  ? -4.282 15.878  8.816  1.00 27.19 ? 1549 GLU A O   1 
ATOM   611  C CB  . GLU A 1 69  ? -1.652 17.187  9.689  1.00 25.81 ? 1549 GLU A CB  1 
ATOM   612  C CG  . GLU A 1 69  ? -0.980 16.920  11.035 1.00 31.81 ? 1549 GLU A CG  1 
ATOM   613  C CD  . GLU A 1 69  ? 0.496  16.624  10.921 1.00 38.42 ? 1549 GLU A CD  1 
ATOM   614  O OE1 . GLU A 1 69  ? 0.999  15.792  11.714 1.00 39.80 ? 1549 GLU A OE1 1 
ATOM   615  O OE2 . GLU A 1 69  ? 1.161  17.216  10.038 1.00 41.17 ? 1549 GLU A OE2 1 
ATOM   616  N N   A ASP A 1 70  ? -3.216 15.964  6.816  0.30 23.77 ? 1550 ASP A N   1 
ATOM   617  N N   B ASP A 1 70  ? -3.238 16.055  6.808  0.70 24.06 ? 1550 ASP A N   1 
ATOM   618  C CA  A ASP A 1 70  ? -4.432 16.124  6.022  0.30 22.76 ? 1550 ASP A CA  1 
ATOM   619  C CA  B ASP A 1 70  ? -4.504 16.099  6.044  0.70 23.54 ? 1550 ASP A CA  1 
ATOM   620  C C   A ASP A 1 70  ? -4.804 14.839  5.256  0.30 21.99 ? 1550 ASP A C   1 
ATOM   621  C C   B ASP A 1 70  ? -4.773 14.823  5.219  0.70 22.12 ? 1550 ASP A C   1 
ATOM   622  O O   A ASP A 1 70  ? -5.499 14.893  4.222  0.30 21.68 ? 1550 ASP A O   1 
ATOM   623  O O   B ASP A 1 70  ? -5.367 14.857  4.121  0.70 21.35 ? 1550 ASP A O   1 
ATOM   624  C CB  A ASP A 1 70  ? -4.227 17.290  5.050  0.30 22.63 ? 1550 ASP A CB  1 
ATOM   625  C CB  B ASP A 1 70  ? -4.614 17.364  5.170  0.70 24.31 ? 1550 ASP A CB  1 
ATOM   626  C CG  A ASP A 1 70  ? -2.822 17.324  4.482  0.30 22.10 ? 1550 ASP A CG  1 
ATOM   627  C CG  B ASP A 1 70  ? -3.312 17.729  4.449  0.70 24.64 ? 1550 ASP A CG  1 
ATOM   628  O OD1 A ASP A 1 70  ? -2.471 18.288  3.768  0.30 22.44 ? 1550 ASP A OD1 1 
ATOM   629  O OD1 B ASP A 1 70  ? -2.245 17.099  4.678  0.70 25.26 ? 1550 ASP A OD1 1 
ATOM   630  O OD2 A ASP A 1 70  ? -2.069 16.366  4.760  0.30 17.63 ? 1550 ASP A OD2 1 
ATOM   631  O OD2 B ASP A 1 70  ? -3.366 18.686  3.641  0.70 26.99 ? 1550 ASP A OD2 1 
ATOM   632  N N   . GLU A 1 71  ? -4.339 13.694  5.784  1.00 21.45 ? 1551 GLU A N   1 
ATOM   633  C CA  . GLU A 1 71  ? -4.531 12.361  5.181  1.00 21.20 ? 1551 GLU A CA  1 
ATOM   634  C C   . GLU A 1 71  ? -3.854 12.200  3.824  1.00 19.19 ? 1551 GLU A C   1 
ATOM   635  O O   . GLU A 1 71  ? -4.369 11.486  2.954  1.00 19.99 ? 1551 GLU A O   1 
ATOM   636  C CB  . GLU A 1 71  ? -6.004 11.949  5.139  1.00 22.42 ? 1551 GLU A CB  1 
ATOM   637  C CG  . GLU A 1 71  ? -6.602 11.841  6.544  1.00 26.50 ? 1551 GLU A CG  1 
ATOM   638  C CD  . GLU A 1 71  ? -7.983 11.274  6.525  1.00 31.51 ? 1551 GLU A CD  1 
ATOM   639  O OE1 . GLU A 1 71  ? -8.208 10.274  7.240  1.00 35.92 ? 1551 GLU A OE1 1 
ATOM   640  O OE2 . GLU A 1 71  ? -8.836 11.817  5.791  1.00 35.48 ? 1551 GLU A OE2 1 
ATOM   641  N N   . TYR A 1 72  ? -2.742 12.877  3.623  1.00 15.92 ? 1552 TYR A N   1 
ATOM   642  C CA  . TYR A 1 72  ? -1.863 12.560  2.496  1.00 14.55 ? 1552 TYR A CA  1 
ATOM   643  C C   . TYR A 1 72  ? -0.727 11.729  3.021  1.00 13.77 ? 1552 TYR A C   1 
ATOM   644  O O   . TYR A 1 72  ? -0.406 11.724  4.239  1.00 15.01 ? 1552 TYR A O   1 
ATOM   645  C CB  . TYR A 1 72  ? -1.333 13.817  1.778  1.00 15.05 ? 1552 TYR A CB  1 
ATOM   646  C CG  . TYR A 1 72  ? -2.433 14.589  1.081  1.00 15.79 ? 1552 TYR A CG  1 
ATOM   647  C CD1 . TYR A 1 72  ? -3.192 15.540  1.775  1.00 16.11 ? 1552 TYR A CD1 1 
ATOM   648  C CD2 . TYR A 1 72  ? -2.694 14.391  -0.274 1.00 15.57 ? 1552 TYR A CD2 1 
ATOM   649  C CE1 . TYR A 1 72  ? -4.186 16.246  1.145  1.00 17.05 ? 1552 TYR A CE1 1 
ATOM   650  C CE2 . TYR A 1 72  ? -3.700 15.085  -0.907 1.00 15.95 ? 1552 TYR A CE2 1 
ATOM   651  C CZ  . TYR A 1 72  ? -4.456 16.010  -0.192 1.00 16.43 ? 1552 TYR A CZ  1 
ATOM   652  O OH  . TYR A 1 72  ? -5.459 16.719  -0.803 1.00 16.94 ? 1552 TYR A OH  1 
ATOM   653  N N   A PHE A 1 73  ? -0.081 11.030  2.093  0.50 13.40 ? 1553 PHE A N   1 
ATOM   654  N N   B PHE A 1 73  ? -0.108 10.965  2.142  0.50 13.09 ? 1553 PHE A N   1 
ATOM   655  C CA  A PHE A 1 73  ? 1.004  10.068  2.335  0.50 12.98 ? 1553 PHE A CA  1 
ATOM   656  C CA  B PHE A 1 73  ? 1.077  10.194  2.500  0.50 12.46 ? 1553 PHE A CA  1 
ATOM   657  C C   A PHE A 1 73  ? 2.091  10.355  1.328  0.50 12.37 ? 1553 PHE A C   1 
ATOM   658  C C   B PHE A 1 73  ? 2.072  10.207  1.343  0.50 12.18 ? 1553 PHE A C   1 
ATOM   659  O O   A PHE A 1 73  ? 1.791  10.893  0.246  0.50 11.38 ? 1553 PHE A O   1 
ATOM   660  O O   B PHE A 1 73  ? 1.711  10.449  0.196  0.50 10.71 ? 1553 PHE A O   1 
ATOM   661  C CB  A PHE A 1 73  ? 0.494  8.644   2.069  0.50 14.21 ? 1553 PHE A CB  1 
ATOM   662  C CB  B PHE A 1 73  ? 0.701  8.783   3.011  0.50 13.65 ? 1553 PHE A CB  1 
ATOM   663  C CG  A PHE A 1 73  ? -0.614 8.232   2.950  0.50 15.49 ? 1553 PHE A CG  1 
ATOM   664  C CG  B PHE A 1 73  ? -0.050 7.946   2.022  0.50 12.92 ? 1553 PHE A CG  1 
ATOM   665  C CD1 A PHE A 1 73  ? -0.380 7.540   4.129  0.50 18.42 ? 1553 PHE A CD1 1 
ATOM   666  C CD1 B PHE A 1 73  ? -1.418 8.125   1.776  0.50 14.03 ? 1553 PHE A CD1 1 
ATOM   667  C CD2 A PHE A 1 73  ? -1.925 8.533   2.607  0.50 14.33 ? 1553 PHE A CD2 1 
ATOM   668  C CD2 B PHE A 1 73  ? 0.606  6.910   1.374  0.50 13.46 ? 1553 PHE A CD2 1 
ATOM   669  C CE1 A PHE A 1 73  ? -1.450 7.151   4.955  0.50 20.40 ? 1553 PHE A CE1 1 
ATOM   670  C CE1 B PHE A 1 73  ? -2.084 7.314   0.875  0.50 13.94 ? 1553 PHE A CE1 1 
ATOM   671  C CE2 A PHE A 1 73  ? -2.990 8.136   3.417  0.50 16.07 ? 1553 PHE A CE2 1 
ATOM   672  C CE2 B PHE A 1 73  ? -0.071 6.069   0.485  0.50 14.99 ? 1553 PHE A CE2 1 
ATOM   673  C CZ  A PHE A 1 73  ? -2.739 7.462   4.594  0.50 18.55 ? 1553 PHE A CZ  1 
ATOM   674  C CZ  B PHE A 1 73  ? -1.401 6.287   0.219  0.50 14.21 ? 1553 PHE A CZ  1 
ATOM   675  N N   . SER A 1 74  ? 3.331  9.983   1.681  1.00 12.63 ? 1554 SER A N   1 
ATOM   676  C CA  . SER A 1 74  ? 4.400  10.079  0.716  1.00 12.94 ? 1554 SER A CA  1 
ATOM   677  C C   . SER A 1 74  ? 5.560  9.237   1.202  1.00 12.69 ? 1554 SER A C   1 
ATOM   678  O O   . SER A 1 74  ? 5.631  8.901   2.406  1.00 14.22 ? 1554 SER A O   1 
ATOM   679  C CB  . SER A 1 74  ? 4.860  11.525  0.544  1.00 14.18 ? 1554 SER A CB  1 
ATOM   680  O OG  . SER A 1 74  ? 5.286  12.081  1.784  1.00 14.74 ? 1554 SER A OG  1 
ATOM   681  N N   . ALA A 1 75  ? 6.430  8.834   0.283  1.00 12.52 ? 1555 ALA A N   1 
ATOM   682  C CA  . ALA A 1 75  ? 7.662  8.160   0.645  1.00 12.25 ? 1555 ALA A CA  1 
ATOM   683  C C   . ALA A 1 75  ? 8.729  9.137   1.102  1.00 12.75 ? 1555 ALA A C   1 
ATOM   684  O O   . ALA A 1 75  ? 8.818  10.282  0.633  1.00 13.60 ? 1555 ALA A O   1 
ATOM   685  C CB  . ALA A 1 75  ? 8.154  7.353   -0.551 1.00 14.11 ? 1555 ALA A CB  1 
ATOM   686  N N   . GLY A 1 76  ? 9.575  8.664   2.011  1.00 12.87 ? 1556 GLY A N   1 
ATOM   687  C CA  . GLY A 1 76  ? 10.764 9.439   2.417  1.00 14.30 ? 1556 GLY A CA  1 
ATOM   688  C C   . GLY A 1 76  ? 11.787 8.506   3.011  1.00 12.60 ? 1556 GLY A C   1 
ATOM   689  O O   . GLY A 1 76  ? 11.546 7.303   3.149  1.00 13.69 ? 1556 GLY A O   1 
ATOM   690  N N   . VAL A 1 77  ? 12.931 9.050   3.379  1.00 13.41 ? 1557 VAL A N   1 
ATOM   691  C CA  . VAL A 1 77  ? 14.070 8.227   3.871  1.00 13.95 ? 1557 VAL A CA  1 
ATOM   692  C C   . VAL A 1 77  ? 14.375 8.679   5.301  1.00 12.68 ? 1557 VAL A C   1 
ATOM   693  O O   . VAL A 1 77  ? 14.493 9.864   5.585  1.00 12.85 ? 1557 VAL A O   1 
ATOM   694  C CB  . VAL A 1 77  ? 15.303 8.339   2.944  1.00 13.57 ? 1557 VAL A CB  1 
ATOM   695  C CG1 . VAL A 1 77  ? 16.478 7.566   3.574  1.00 14.42 ? 1557 VAL A CG1 1 
ATOM   696  C CG2 . VAL A 1 77  ? 14.936 7.758   1.576  1.00 15.02 ? 1557 VAL A CG2 1 
ATOM   697  N N   . VAL A 1 78  ? 14.495 7.713   6.190  1.00 12.58 ? 1558 VAL A N   1 
ATOM   698  C CA  . VAL A 1 78  ? 14.852 8.050   7.600  1.00 12.74 ? 1558 VAL A CA  1 
ATOM   699  C C   . VAL A 1 78  ? 16.306 8.553   7.673  1.00 11.56 ? 1558 VAL A C   1 
ATOM   700  O O   . VAL A 1 78  ? 17.252 7.860   7.220  1.00 12.85 ? 1558 VAL A O   1 
ATOM   701  C CB  . VAL A 1 78  ? 14.704 6.841   8.494  1.00 12.97 ? 1558 VAL A CB  1 
ATOM   702  C CG1 . VAL A 1 78  ? 15.089 7.150   9.943  1.00 13.67 ? 1558 VAL A CG1 1 
ATOM   703  C CG2 . VAL A 1 78  ? 13.269 6.291   8.441  1.00 13.58 ? 1558 VAL A CG2 1 
ATOM   704  N N   . LYS A 1 79  ? 16.469 9.780   8.154  1.00 11.30 ? 1559 LYS A N   1 
ATOM   705  C CA  . LYS A 1 79  ? 17.800 10.349  8.355  1.00 12.88 ? 1559 LYS A CA  1 
ATOM   706  C C   . LYS A 1 79  ? 18.111 10.645  9.811  1.00 10.39 ? 1559 LYS A C   1 
ATOM   707  O O   . LYS A 1 79  ? 19.286 10.968  10.082 1.00 12.21 ? 1559 LYS A O   1 
ATOM   708  C CB  . LYS A 1 79  ? 17.949 11.608  7.520  1.00 12.61 ? 1559 LYS A CB  1 
ATOM   709  C CG  . LYS A 1 79  ? 17.932 11.331  5.986  1.00 14.50 ? 1559 LYS A CG  1 
ATOM   710  C CD  . LYS A 1 79  ? 19.056 10.421  5.507  1.00 16.63 ? 1559 LYS A CD  1 
ATOM   711  C CE  . LYS A 1 79  ? 18.965 10.232  4.001  1.00 19.73 ? 1559 LYS A CE  1 
ATOM   712  N NZ  . LYS A 1 79  ? 20.102 9.405   3.530  1.00 23.59 ? 1559 LYS A NZ  1 
ATOM   713  N N   . GLY A 1 80  ? 17.178 10.481  10.709 1.00 10.97 ? 1560 GLY A N   1 
ATOM   714  C CA  . GLY A 1 80  ? 17.487 10.709  12.127 1.00 12.55 ? 1560 GLY A CA  1 
ATOM   715  C C   . GLY A 1 80  ? 16.438 10.084  13.018 1.00 11.51 ? 1560 GLY A C   1 
ATOM   716  O O   . GLY A 1 80  ? 15.292 9.863   12.597 1.00 11.62 ? 1560 GLY A O   1 
ATOM   717  N N   . HIS A 1 81  ? 16.855 9.819   14.254 1.00 11.43 ? 1561 HIS A N   1 
ATOM   718  C CA  . HIS A 1 81  ? 15.985 9.461   15.347 1.00 11.31 ? 1561 HIS A CA  1 
ATOM   719  C C   . HIS A 1 81  ? 16.283 10.370  16.493 1.00 11.84 ? 1561 HIS A C   1 
ATOM   720  O O   . HIS A 1 81  ? 17.422 10.658  16.781 1.00 12.15 ? 1561 HIS A O   1 
ATOM   721  C CB  . HIS A 1 81  ? 16.234 8.043   15.861 1.00 12.79 ? 1561 HIS A CB  1 
ATOM   722  C CG  . HIS A 1 81  ? 16.415 6.956   14.824 1.00 13.29 ? 1561 HIS A CG  1 
ATOM   723  N ND1 . HIS A 1 81  ? 15.497 6.537   13.871 1.00 16.42 ? 1561 HIS A ND1 1 
ATOM   724  C CD2 . HIS A 1 81  ? 17.414 6.053   14.814 1.00 11.51 ? 1561 HIS A CD2 1 
ATOM   725  C CE1 . HIS A 1 81  ? 16.009 5.465   13.260 1.00 11.72 ? 1561 HIS A CE1 1 
ATOM   726  N NE2 . HIS A 1 81  ? 17.158 5.157   13.815 1.00 17.16 ? 1561 HIS A NE2 1 
ATOM   727  N N   A ARG A 1 82  ? 15.239 10.775  17.186 0.50 12.95 ? 1562 ARG A N   1 
ATOM   728  N N   B ARG A 1 82  ? 15.281 10.746  17.270 0.50 12.86 ? 1562 ARG A N   1 
ATOM   729  C CA  A ARG A 1 82  ? 15.362 11.606  18.371 0.50 13.18 ? 1562 ARG A CA  1 
ATOM   730  C CA  B ARG A 1 82  ? 15.483 11.590  18.470 0.50 14.01 ? 1562 ARG A CA  1 
ATOM   731  C C   A ARG A 1 82  ? 14.461 11.153  19.474 0.50 12.82 ? 1562 ARG A C   1 
ATOM   732  C C   B ARG A 1 82  ? 14.463 11.201  19.514 0.50 13.13 ? 1562 ARG A C   1 
ATOM   733  O O   A ARG A 1 82  ? 13.330 10.690  19.190 0.50 12.65 ? 1562 ARG A O   1 
ATOM   734  O O   B ARG A 1 82  ? 13.277 11.272  19.190 0.50 12.51 ? 1562 ARG A O   1 
ATOM   735  C CB  A ARG A 1 82  ? 15.038 13.062  18.027 0.50 13.45 ? 1562 ARG A CB  1 
ATOM   736  C CB  B ARG A 1 82  ? 15.326 13.070  18.078 0.50 13.20 ? 1562 ARG A CB  1 
ATOM   737  C CG  A ARG A 1 82  ? 14.953 13.976  19.257 0.50 17.55 ? 1562 ARG A CG  1 
ATOM   738  C CG  B ARG A 1 82  ? 15.800 14.078  19.083 0.50 15.95 ? 1562 ARG A CG  1 
ATOM   739  C CD  A ARG A 1 82  ? 16.299 14.532  19.638 0.50 23.18 ? 1562 ARG A CD  1 
ATOM   740  C CD  B ARG A 1 82  ? 15.432 15.485  18.651 0.50 18.63 ? 1562 ARG A CD  1 
ATOM   741  N NE  A ARG A 1 82  ? 17.372 13.739  19.069 0.50 22.78 ? 1562 ARG A NE  1 
ATOM   742  N NE  B ARG A 1 82  ? 15.973 16.456  19.610 0.50 26.61 ? 1562 ARG A NE  1 
ATOM   743  C CZ  A ARG A 1 82  ? 18.162 14.156  18.095 0.50 23.43 ? 1562 ARG A CZ  1 
ATOM   744  C CZ  B ARG A 1 82  ? 15.356 16.857  20.722 0.50 26.24 ? 1562 ARG A CZ  1 
ATOM   745  N NH1 A ARG A 1 82  ? 18.024 15.374  17.645 0.50 15.49 ? 1562 ARG A NH1 1 
ATOM   746  N NH1 B ARG A 1 82  ? 14.143 16.406  21.021 0.50 27.77 ? 1562 ARG A NH1 1 
ATOM   747  N NH2 A ARG A 1 82  ? 19.102 13.366  17.601 0.50 24.92 ? 1562 ARG A NH2 1 
ATOM   748  N NH2 B ARG A 1 82  ? 15.937 17.737  21.524 0.50 28.41 ? 1562 ARG A NH2 1 
ATOM   749  N N   A LYS A 1 83  ? 14.961 11.352  20.696 0.50 12.03 ? 1563 LYS A N   1 
ATOM   750  N N   B LYS A 1 83  ? 14.918 10.792  20.708 0.50 12.89 ? 1563 LYS A N   1 
ATOM   751  C CA  A LYS A 1 83  ? 14.129 11.251  21.865 0.50 13.77 ? 1563 LYS A CA  1 
ATOM   752  C CA  B LYS A 1 83  ? 14.045 10.544  21.842 0.50 14.53 ? 1563 LYS A CA  1 
ATOM   753  C C   A LYS A 1 83  ? 13.849 12.643  22.361 0.50 15.04 ? 1563 LYS A C   1 
ATOM   754  C C   B LYS A 1 83  ? 13.849 11.863  22.599 0.50 16.37 ? 1563 LYS A C   1 
ATOM   755  O O   A LYS A 1 83  ? 14.775 13.432  22.575 0.50 15.03 ? 1563 LYS A O   1 
ATOM   756  O O   B LYS A 1 83  ? 14.835 12.556  22.967 0.50 15.75 ? 1563 LYS A O   1 
ATOM   757  C CB  A LYS A 1 83  ? 14.918 10.514  22.960 0.50 13.65 ? 1563 LYS A CB  1 
ATOM   758  C CB  B LYS A 1 83  ? 14.705 9.554   22.811 0.50 15.64 ? 1563 LYS A CB  1 
ATOM   759  C CG  A LYS A 1 83  ? 15.181 9.029   22.683 0.50 15.35 ? 1563 LYS A CG  1 
ATOM   760  C CG  B LYS A 1 83  ? 14.683 8.103   22.408 0.50 16.08 ? 1563 LYS A CG  1 
ATOM   761  C CD  A LYS A 1 83  ? 14.015 8.296   22.051 0.50 21.27 ? 1563 LYS A CD  1 
ATOM   762  C CD  B LYS A 1 83  ? 13.298 7.587   22.005 0.50 19.70 ? 1563 LYS A CD  1 
ATOM   763  C CE  A LYS A 1 83  ? 13.205 7.566   23.081 0.50 24.50 ? 1563 LYS A CE  1 
ATOM   764  C CE  B LYS A 1 83  ? 12.352 7.490   23.199 0.50 20.51 ? 1563 LYS A CE  1 
ATOM   765  N NZ  A LYS A 1 83  ? 12.758 8.488   24.134 0.50 24.08 ? 1563 LYS A NZ  1 
ATOM   766  N NZ  B LYS A 1 83  ? 12.769 6.396   24.106 0.50 19.88 ? 1563 LYS A NZ  1 
ATOM   767  N N   A GLU A 1 84  ? 12.568 12.902  22.613 0.50 17.56 ? 1564 GLU A N   1 
ATOM   768  N N   B GLU A 1 84  ? 12.596 12.200  22.900 0.50 18.16 ? 1564 GLU A N   1 
ATOM   769  C CA  A GLU A 1 84  ? 12.123 14.096  23.330 0.50 21.11 ? 1564 GLU A CA  1 
ATOM   770  C CA  B GLU A 1 84  ? 12.344 13.416  23.645 0.50 21.04 ? 1564 GLU A CA  1 
ATOM   771  C C   A GLU A 1 84  ? 10.974 13.701  24.297 0.50 21.78 ? 1564 GLU A C   1 
ATOM   772  C C   B GLU A 1 84  ? 11.098 13.232  24.461 0.50 21.53 ? 1564 GLU A C   1 
ATOM   773  O O   A GLU A 1 84  ? 9.933  13.290  23.807 0.50 21.75 ? 1564 GLU A O   1 
ATOM   774  O O   B GLU A 1 84  ? 10.118 12.587  24.071 0.50 21.33 ? 1564 GLU A O   1 
ATOM   775  C CB  A GLU A 1 84  ? 11.590 15.080  22.298 0.50 21.40 ? 1564 GLU A CB  1 
ATOM   776  C CB  B GLU A 1 84  ? 12.217 14.627  22.714 0.50 20.38 ? 1564 GLU A CB  1 
ATOM   777  C CG  A GLU A 1 84  ? 12.640 15.763  21.463 0.50 22.94 ? 1564 GLU A CG  1 
ATOM   778  C CG  B GLU A 1 84  ? 11.999 15.981  23.396 0.50 24.26 ? 1564 GLU A CG  1 
ATOM   779  C CD  A GLU A 1 84  ? 12.823 17.215  21.875 0.50 26.76 ? 1564 GLU A CD  1 
ATOM   780  C CD  B GLU A 1 84  ? 13.268 16.540  23.997 0.50 26.12 ? 1564 GLU A CD  1 
ATOM   781  O OE1 A GLU A 1 84  ? 12.987 17.476  23.086 0.50 29.74 ? 1564 GLU A OE1 1 
ATOM   782  O OE1 B GLU A 1 84  ? 14.286 16.642  23.274 0.50 28.64 ? 1564 GLU A OE1 1 
ATOM   783  O OE2 A GLU A 1 84  ? 12.800 18.092  20.984 0.50 28.43 ? 1564 GLU A OE2 1 
ATOM   784  O OE2 B GLU A 1 84  ? 13.244 16.888  25.192 0.50 29.23 ? 1564 GLU A OE2 1 
ATOM   785  N N   . SER A 1 85  ? 11.150 13.808  25.633 1.00 23.70 ? 1565 SER A N   1 
ATOM   786  C CA  . SER A 1 85  ? 10.081 13.550  26.609 1.00 24.85 ? 1565 SER A CA  1 
ATOM   787  C C   . SER A 1 85  ? 9.550  12.090  26.607 1.00 26.03 ? 1565 SER A C   1 
ATOM   788  O O   . SER A 1 85  ? 8.343  11.854  26.746 1.00 27.26 ? 1565 SER A O   1 
ATOM   789  C CB  . SER A 1 85  ? 8.941  14.569  26.432 1.00 27.06 ? 1565 SER A CB  1 
ATOM   790  O OG  . SER A 1 85  ? 9.458  15.891  26.271 1.00 29.21 ? 1565 SER A OG  1 
ATOM   791  N N   . GLY A 1 86  ? 10.440 11.116  26.418 1.00 25.02 ? 1566 GLY A N   1 
ATOM   792  C CA  . GLY A 1 86  ? 10.057 9.702   26.386 1.00 24.29 ? 1566 GLY A CA  1 
ATOM   793  C C   . GLY A 1 86  ? 9.431  9.220   25.076 1.00 22.94 ? 1566 GLY A C   1 
ATOM   794  O O   . GLY A 1 86  ? 9.015  8.058   24.961 1.00 26.17 ? 1566 GLY A O   1 
ATOM   795  N N   A GLU A 1 87  ? 9.342  10.112  24.093 0.50 22.03 ? 1567 GLU A N   1 
ATOM   796  N N   B GLU A 1 87  ? 9.419  10.112  24.084 0.50 22.03 ? 1567 GLU A N   1 
ATOM   797  C CA  A GLU A 1 87  ? 8.729  9.791   22.808 0.50 19.54 ? 1567 GLU A CA  1 
ATOM   798  C CA  B GLU A 1 87  ? 8.772  9.876   22.798 0.50 19.50 ? 1567 GLU A CA  1 
ATOM   799  C C   A GLU A 1 87  ? 9.799  9.746   21.719 0.50 17.88 ? 1567 GLU A C   1 
ATOM   800  C C   B GLU A 1 87  ? 9.777  9.859   21.645 0.50 17.83 ? 1567 GLU A C   1 
ATOM   801  O O   A GLU A 1 87  ? 10.823 10.391  21.842 0.50 16.20 ? 1567 GLU A O   1 
ATOM   802  O O   B GLU A 1 87  ? 10.717 10.672  21.638 0.50 16.48 ? 1567 GLU A O   1 
ATOM   803  C CB  A GLU A 1 87  ? 7.641  10.827  22.475 0.50 20.16 ? 1567 GLU A CB  1 
ATOM   804  C CB  B GLU A 1 87  ? 7.727  10.970  22.553 0.50 19.89 ? 1567 GLU A CB  1 
ATOM   805  C CG  A GLU A 1 87  ? 6.515  10.888  23.537 0.50 22.85 ? 1567 GLU A CG  1 
ATOM   806  C CG  B GLU A 1 87  ? 6.803  11.195  23.751 0.50 22.54 ? 1567 GLU A CG  1 
ATOM   807  C CD  A GLU A 1 87  ? 5.895  12.275  23.690 0.50 26.33 ? 1567 GLU A CD  1 
ATOM   808  C CD  B GLU A 1 87  ? 5.339  11.099  23.382 0.50 26.33 ? 1567 GLU A CD  1 
ATOM   809  O OE1 A GLU A 1 87  ? 5.452  12.856  22.679 0.50 28.57 ? 1567 GLU A OE1 1 
ATOM   810  O OE1 B GLU A 1 87  ? 5.027  10.762  22.217 0.50 29.31 ? 1567 GLU A OE1 1 
ATOM   811  O OE2 A GLU A 1 87  ? 5.851  12.790  24.830 0.50 28.09 ? 1567 GLU A OE2 1 
ATOM   812  O OE2 B GLU A 1 87  ? 4.505  11.333  24.274 0.50 28.23 ? 1567 GLU A OE2 1 
ATOM   813  N N   . LEU A 1 88  ? 9.539  8.959   20.692 1.00 15.85 ? 1568 LEU A N   1 
ATOM   814  C CA  . LEU A 1 88  ? 10.447 8.842   19.535 1.00 15.58 ? 1568 LEU A CA  1 
ATOM   815  C C   . LEU A 1 88  ? 9.986  9.722   18.391 1.00 15.08 ? 1568 LEU A C   1 
ATOM   816  O O   . LEU A 1 88  ? 8.807  9.720   18.009 1.00 15.50 ? 1568 LEU A O   1 
ATOM   817  C CB  . LEU A 1 88  ? 10.484 7.411   19.028 1.00 15.59 ? 1568 LEU A CB  1 
ATOM   818  C CG  . LEU A 1 88  ? 11.184 7.131   17.704 1.00 14.36 ? 1568 LEU A CG  1 
ATOM   819  C CD1 . LEU A 1 88  ? 12.705 7.307   17.914 1.00 15.64 ? 1568 LEU A CD1 1 
ATOM   820  C CD2 . LEU A 1 88  ? 10.919 5.714   17.265 1.00 18.09 ? 1568 LEU A CD2 1 
ATOM   821  N N   . TYR A 1 89  ? 10.899 10.463  17.774 1.00 13.68 ? 1569 TYR A N   1 
ATOM   822  C CA  . TYR A 1 89  ? 10.649 11.215  16.527 1.00 13.75 ? 1569 TYR A CA  1 
ATOM   823  C C   . TYR A 1 89  ? 11.622 10.755  15.440 1.00 13.09 ? 1569 TYR A C   1 
ATOM   824  O O   . TYR A 1 89  ? 12.780 10.457  15.741 1.00 12.92 ? 1569 TYR A O   1 
ATOM   825  C CB  . TYR A 1 89  ? 10.833 12.706  16.807 1.00 14.47 ? 1569 TYR A CB  1 
ATOM   826  C CG  . TYR A 1 89  ? 9.879  13.205  17.857 1.00 15.89 ? 1569 TYR A CG  1 
ATOM   827  C CD1 . TYR A 1 89  ? 10.225 13.168  19.180 1.00 16.98 ? 1569 TYR A CD1 1 
ATOM   828  C CD2 . TYR A 1 89  ? 8.605  13.605  17.494 1.00 17.24 ? 1569 TYR A CD2 1 
ATOM   829  C CE1 . TYR A 1 89  ? 9.285  13.607  20.175 1.00 17.59 ? 1569 TYR A CE1 1 
ATOM   830  C CE2 . TYR A 1 89  ? 7.689  14.063  18.456 1.00 20.20 ? 1569 TYR A CE2 1 
ATOM   831  C CZ  . TYR A 1 89  ? 8.037  14.025  19.762 1.00 18.86 ? 1569 TYR A CZ  1 
ATOM   832  O OH  . TYR A 1 89  ? 7.103  14.471  20.710 1.00 20.49 ? 1569 TYR A OH  1 
ATOM   833  N N   . TYR A 1 90  ? 11.131 10.743  14.216 1.00 12.23 ? 1570 TYR A N   1 
ATOM   834  C CA  . TYR A 1 90  ? 11.892 10.415  13.040 1.00 11.23 ? 1570 TYR A CA  1 
ATOM   835  C C   . TYR A 1 90  ? 12.128 11.670  12.253 1.00 12.71 ? 1570 TYR A C   1 
ATOM   836  O O   . TYR A 1 90  ? 11.208 12.470  12.045 1.00 13.26 ? 1570 TYR A O   1 
ATOM   837  C CB  . TYR A 1 90  ? 11.100 9.484   12.126 1.00 13.24 ? 1570 TYR A CB  1 
ATOM   838  C CG  . TYR A 1 90  ? 10.969 8.074   12.655 1.00 13.37 ? 1570 TYR A CG  1 
ATOM   839  C CD1 . TYR A 1 90  ? 9.860  7.644   13.405 1.00 13.58 ? 1570 TYR A CD1 1 
ATOM   840  C CD2 . TYR A 1 90  ? 11.982 7.143   12.424 1.00 13.25 ? 1570 TYR A CD2 1 
ATOM   841  C CE1 . TYR A 1 90  ? 9.749  6.340   13.848 1.00 13.95 ? 1570 TYR A CE1 1 
ATOM   842  C CE2 . TYR A 1 90  ? 11.909 5.860   12.851 1.00 13.71 ? 1570 TYR A CE2 1 
ATOM   843  C CZ  . TYR A 1 90  ? 10.776 5.470   13.552 1.00 14.01 ? 1570 TYR A CZ  1 
ATOM   844  O OH  . TYR A 1 90  ? 10.743 4.157   13.999 1.00 15.37 ? 1570 TYR A OH  1 
ATOM   845  N N   . SER A 1 91  ? 13.345 11.873  11.766 1.00 12.13 ? 1571 SER A N   1 
ATOM   846  C CA  . SER A 1 91  ? 13.612 12.897  10.773 1.00 12.78 ? 1571 SER A CA  1 
ATOM   847  C C   . SER A 1 91  ? 13.606 12.200  9.417  1.00 12.92 ? 1571 SER A C   1 
ATOM   848  O O   . SER A 1 91  ? 14.353 11.245  9.223  1.00 12.71 ? 1571 SER A O   1 
ATOM   849  C CB  . SER A 1 91  ? 14.978 13.531  11.053 1.00 12.66 ? 1571 SER A CB  1 
ATOM   850  O OG  . SER A 1 91  ? 15.310 14.436  10.004 1.00 14.33 ? 1571 SER A OG  1 
ATOM   851  N N   A ILE A 1 92  ? 12.720 12.666  8.524  0.50 12.46 ? 1572 ILE A N   1 
ATOM   852  N N   B ILE A 1 92  ? 12.733 12.656  8.511  0.50 12.53 ? 1572 ILE A N   1 
ATOM   853  C CA  A ILE A 1 92  ? 12.419 12.001  7.266  0.50 13.04 ? 1572 ILE A CA  1 
ATOM   854  C CA  B ILE A 1 92  ? 12.518 11.967  7.251  0.50 13.18 ? 1572 ILE A CA  1 
ATOM   855  C C   A ILE A 1 92  ? 12.798 12.963  6.134  0.50 12.43 ? 1572 ILE A C   1 
ATOM   856  C C   B ILE A 1 92  ? 12.752 12.923  6.089  0.50 12.39 ? 1572 ILE A C   1 
ATOM   857  O O   A ILE A 1 92  ? 12.427 14.156  6.195  0.50 12.72 ? 1572 ILE A O   1 
ATOM   858  O O   B ILE A 1 92  ? 12.231 14.048  6.056  0.50 12.64 ? 1572 ILE A O   1 
ATOM   859  C CB  A ILE A 1 92  ? 10.894 11.655  7.161  0.50 12.82 ? 1572 ILE A CB  1 
ATOM   860  C CB  B ILE A 1 92  ? 11.099 11.366  7.152  0.50 13.58 ? 1572 ILE A CB  1 
ATOM   861  C CG1 A ILE A 1 92  ? 10.490 10.690  8.287  0.50 13.21 ? 1572 ILE A CG1 1 
ATOM   862  C CG1 B ILE A 1 92  ? 10.992 10.175  8.088  0.50 14.40 ? 1572 ILE A CG1 1 
ATOM   863  C CG2 A ILE A 1 92  ? 10.535 11.144  5.723  0.50 13.50 ? 1572 ILE A CG2 1 
ATOM   864  C CG2 B ILE A 1 92  ? 10.818 10.807  5.755  0.50 12.39 ? 1572 ILE A CG2 1 
ATOM   865  C CD1 A ILE A 1 92  ? 11.323 9.362   8.269  0.50 10.67 ? 1572 ILE A CD1 1 
ATOM   866  C CD1 B ILE A 1 92  ? 9.593  9.732   8.320  0.50 17.51 ? 1572 ILE A CD1 1 
ATOM   867  N N   . GLU A 1 93  ? 13.581 12.490  5.156  1.00 12.81 ? 1573 GLU A N   1 
ATOM   868  C CA  . GLU A 1 93  ? 13.994 13.326  4.014  1.00 13.79 ? 1573 GLU A CA  1 
ATOM   869  C C   . GLU A 1 93  ? 13.133 13.014  2.806  1.00 15.40 ? 1573 GLU A C   1 
ATOM   870  O O   . GLU A 1 93  ? 12.965 11.866  2.416  1.00 14.52 ? 1573 GLU A O   1 
ATOM   871  C CB  . GLU A 1 93  ? 15.451 13.072  3.698  1.00 13.88 ? 1573 GLU A CB  1 
ATOM   872  C CG  . GLU A 1 93  ? 16.061 14.069  2.735  1.00 18.84 ? 1573 GLU A CG  1 
ATOM   873  C CD  . GLU A 1 93  ? 17.537 13.876  2.694  1.00 23.09 ? 1573 GLU A CD  1 
ATOM   874  O OE1 . GLU A 1 93  ? 18.002 13.388  1.662  1.00 30.21 ? 1573 GLU A OE1 1 
ATOM   875  O OE2 . GLU A 1 93  ? 18.221 14.158  3.705  1.00 23.84 ? 1573 GLU A OE2 1 
ATOM   876  N N   . LYS A 1 94  ? 12.615 14.066  2.187  1.00 16.06 ? 1574 LYS A N   1 
ATOM   877  C CA  . LYS A 1 94  ? 11.886 13.896  0.922  1.00 17.50 ? 1574 LYS A CA  1 
ATOM   878  C C   . LYS A 1 94  ? 12.380 15.027  0.037  1.00 18.90 ? 1574 LYS A C   1 
ATOM   879  O O   . LYS A 1 94  ? 12.354 16.182  0.448  1.00 17.63 ? 1574 LYS A O   1 
ATOM   880  C CB  . LYS A 1 94  ? 10.379 13.964  1.132  1.00 17.60 ? 1574 LYS A CB  1 
ATOM   881  C CG  . LYS A 1 94  ? 9.531  13.850  -0.188 1.00 17.21 ? 1574 LYS A CG  1 
ATOM   882  C CD  . LYS A 1 94  ? 8.029  14.010  0.115  1.00 18.81 ? 1574 LYS A CD  1 
ATOM   883  C CE  . LYS A 1 94  ? 7.108  13.874  -1.105 1.00 18.02 ? 1574 LYS A CE  1 
ATOM   884  N NZ  . LYS A 1 94  ? 7.437  14.828  -2.194 1.00 19.65 ? 1574 LYS A NZ  1 
ATOM   885  N N   . GLU A 1 95  ? 12.892 14.671  -1.145 1.00 19.43 ? 1575 GLU A N   1 
ATOM   886  C CA  . GLU A 1 95  ? 13.414 15.661  -2.094 1.00 21.23 ? 1575 GLU A CA  1 
ATOM   887  C C   . GLU A 1 95  ? 14.409 16.638  -1.473 1.00 21.14 ? 1575 GLU A C   1 
ATOM   888  O O   . GLU A 1 95  ? 14.396 17.840  -1.773 1.00 22.37 ? 1575 GLU A O   1 
ATOM   889  C CB  . GLU A 1 95  ? 12.251 16.405  -2.761 1.00 21.15 ? 1575 GLU A CB  1 
ATOM   890  C CG  . GLU A 1 95  ? 11.544 15.552  -3.813 1.00 27.40 ? 1575 GLU A CG  1 
ATOM   891  C CD  . GLU A 1 95  ? 10.376 16.257  -4.455 1.00 33.29 ? 1575 GLU A CD  1 
ATOM   892  O OE1 . GLU A 1 95  ? 10.597 17.016  -5.427 1.00 36.36 ? 1575 GLU A OE1 1 
ATOM   893  O OE2 . GLU A 1 95  ? 9.233  16.034  -4.001 1.00 36.18 ? 1575 GLU A OE2 1 
ATOM   894  N N   . GLY A 1 96  ? 15.284 16.123  -0.612 1.00 21.47 ? 1576 GLY A N   1 
ATOM   895  C CA  . GLY A 1 96  ? 16.383 16.914  -0.091 1.00 21.15 ? 1576 GLY A CA  1 
ATOM   896  C C   . GLY A 1 96  ? 16.040 17.702  1.156  1.00 21.08 ? 1576 GLY A C   1 
ATOM   897  O O   . GLY A 1 96  ? 16.918 18.329  1.731  1.00 22.10 ? 1576 GLY A O   1 
ATOM   898  N N   . GLN A 1 97  ? 14.781 17.664  1.584  1.00 20.02 ? 1577 GLN A N   1 
ATOM   899  C CA  . GLN A 1 97  ? 14.331 18.407  2.747  1.00 18.85 ? 1577 GLN A CA  1 
ATOM   900  C C   . GLN A 1 97  ? 13.958 17.427  3.848  1.00 17.10 ? 1577 GLN A C   1 
ATOM   901  O O   . GLN A 1 97  ? 13.323 16.411  3.563  1.00 17.57 ? 1577 GLN A O   1 
ATOM   902  C CB  . GLN A 1 97  ? 13.104 19.252  2.405  1.00 20.28 ? 1577 GLN A CB  1 
ATOM   903  C CG  . GLN A 1 97  ? 12.525 20.043  3.597  1.00 25.48 ? 1577 GLN A CG  1 
ATOM   904  C CD  . GLN A 1 97  ? 12.436 21.547  3.335  1.00 33.22 ? 1577 GLN A CD  1 
ATOM   905  O OE1 . GLN A 1 97  ? 11.378 22.163  3.501  1.00 36.45 ? 1577 GLN A OE1 1 
ATOM   906  N NE2 . GLN A 1 97  ? 13.549 22.140  2.919  1.00 33.81 ? 1577 GLN A NE2 1 
ATOM   907  N N   . ARG A 1 98  ? 14.302 17.774  5.075  1.00 15.68 ? 1578 ARG A N   1 
ATOM   908  C CA  . ARG A 1 98  ? 13.972 16.903  6.213  1.00 15.26 ? 1578 ARG A CA  1 
ATOM   909  C C   . ARG A 1 98  ? 12.840 17.471  7.051  1.00 15.95 ? 1578 ARG A C   1 
ATOM   910  O O   . ARG A 1 98  ? 12.756 18.687  7.241  1.00 18.98 ? 1578 ARG A O   1 
ATOM   911  C CB  . ARG A 1 98  ? 15.210 16.624  7.085  1.00 16.02 ? 1578 ARG A CB  1 
ATOM   912  C CG  . ARG A 1 98  ? 16.330 15.927  6.321  1.00 15.61 ? 1578 ARG A CG  1 
ATOM   913  C CD  . ARG A 1 98  ? 17.475 15.628  7.240  1.00 17.24 ? 1578 ARG A CD  1 
ATOM   914  N NE  . ARG A 1 98  ? 18.556 15.018  6.487  1.00 16.89 ? 1578 ARG A NE  1 
ATOM   915  C CZ  . ARG A 1 98  ? 19.650 14.529  7.055  1.00 15.38 ? 1578 ARG A CZ  1 
ATOM   916  N NH1 . ARG A 1 98  ? 19.781 14.529  8.396  1.00 17.27 ? 1578 ARG A NH1 1 
ATOM   917  N NH2 . ARG A 1 98  ? 20.583 13.993  6.294  1.00 17.80 ? 1578 ARG A NH2 1 
ATOM   918  N N   . LYS A 1 99  ? 11.946 16.614  7.511  1.00 15.29 ? 1579 LYS A N   1 
ATOM   919  C CA  . LYS A 1 99  ? 10.859 17.011  8.386  1.00 14.78 ? 1579 LYS A CA  1 
ATOM   920  C C   . LYS A 1 99  ? 10.757 15.988  9.515  1.00 14.55 ? 1579 LYS A C   1 
ATOM   921  O O   . LYS A 1 99  ? 11.009 14.785  9.272  1.00 14.54 ? 1579 LYS A O   1 
ATOM   922  C CB  . LYS A 1 99  ? 9.563  17.051  7.556  1.00 16.49 ? 1579 LYS A CB  1 
ATOM   923  C CG  . LYS A 1 99  ? 8.364  17.535  8.257  1.00 18.28 ? 1579 LYS A CG  1 
ATOM   924  C CD  . LYS A 1 99  ? 7.290  17.867  7.205  1.00 20.37 ? 1579 LYS A CD  1 
ATOM   925  C CE  . LYS A 1 99  ? 6.131  18.550  7.879  1.00 22.71 ? 1579 LYS A CE  1 
ATOM   926  N NZ  . LYS A 1 99  ? 5.103  18.942  6.904  1.00 25.00 ? 1579 LYS A NZ  1 
ATOM   927  N N   . TRP A 1 100 ? 10.319 16.404  10.696 1.00 14.42 ? 1580 TRP A N   1 
ATOM   928  C CA  . TRP A 1 100 ? 10.129 15.532  11.818 1.00 13.50 ? 1580 TRP A CA  1 
ATOM   929  C C   . TRP A 1 100 ? 8.747  14.904  11.833 1.00 15.04 ? 1580 TRP A C   1 
ATOM   930  O O   . TRP A 1 100 ? 7.757  15.564  11.457 1.00 14.69 ? 1580 TRP A O   1 
ATOM   931  C CB  . TRP A 1 100 ? 10.413 16.300  13.139 1.00 15.06 ? 1580 TRP A CB  1 
ATOM   932  C CG  . TRP A 1 100 ? 11.832 16.662  13.307 1.00 14.35 ? 1580 TRP A CG  1 
ATOM   933  C CD1 . TRP A 1 100 ? 12.409 17.866  13.042 1.00 16.10 ? 1580 TRP A CD1 1 
ATOM   934  C CD2 . TRP A 1 100 ? 12.867 15.795  13.777 1.00 14.77 ? 1580 TRP A CD2 1 
ATOM   935  N NE1 . TRP A 1 100 ? 13.758 17.810  13.335 1.00 16.48 ? 1580 TRP A NE1 1 
ATOM   936  C CE2 . TRP A 1 100 ? 14.061 16.541  13.769 1.00 15.49 ? 1580 TRP A CE2 1 
ATOM   937  C CE3 . TRP A 1 100 ? 12.891 14.475  14.202 1.00 14.10 ? 1580 TRP A CE3 1 
ATOM   938  C CZ2 . TRP A 1 100 ? 15.308 16.009  14.189 1.00 15.65 ? 1580 TRP A CZ2 1 
ATOM   939  C CZ3 . TRP A 1 100 ? 14.127 13.949  14.622 1.00 15.19 ? 1580 TRP A CZ3 1 
ATOM   940  C CH2 . TRP A 1 100 ? 15.313 14.709  14.584 1.00 14.78 ? 1580 TRP A CH2 1 
ATOM   941  N N   . TYR A 1 101 ? 8.649  13.657  12.278 1.00 14.40 ? 1581 TYR A N   1 
ATOM   942  C CA  . TYR A 1 101 ? 7.398  12.945  12.403 1.00 14.13 ? 1581 TYR A CA  1 
ATOM   943  C C   . TYR A 1 101 ? 7.373  12.158  13.674 1.00 15.21 ? 1581 TYR A C   1 
ATOM   944  O O   . TYR A 1 101 ? 8.383  11.539  14.059 1.00 15.02 ? 1581 TYR A O   1 
ATOM   945  C CB  . TYR A 1 101 ? 7.214  11.952  11.254 1.00 15.25 ? 1581 TYR A CB  1 
ATOM   946  C CG  . TYR A 1 101 ? 7.015  12.615  9.904  1.00 13.60 ? 1581 TYR A CG  1 
ATOM   947  C CD1 . TYR A 1 101 ? 8.068  13.033  9.104  1.00 14.24 ? 1581 TYR A CD1 1 
ATOM   948  C CD2 . TYR A 1 101 ? 5.707  12.865  9.438  1.00 14.99 ? 1581 TYR A CD2 1 
ATOM   949  C CE1 . TYR A 1 101 ? 7.842  13.649  7.881  1.00 14.63 ? 1581 TYR A CE1 1 
ATOM   950  C CE2 . TYR A 1 101 ? 5.499  13.497  8.242  1.00 14.35 ? 1581 TYR A CE2 1 
ATOM   951  C CZ  . TYR A 1 101 ? 6.546  13.839  7.477  1.00 14.97 ? 1581 TYR A CZ  1 
ATOM   952  O OH  . TYR A 1 101 ? 6.254  14.448  6.275  1.00 17.45 ? 1581 TYR A OH  1 
ATOM   953  N N   . LYS A 1 102 ? 6.245  12.150  14.357 1.00 16.25 ? 1582 LYS A N   1 
ATOM   954  C CA  . LYS A 1 102 ? 6.039  11.314  15.484 1.00 18.13 ? 1582 LYS A CA  1 
ATOM   955  C C   . LYS A 1 102 ? 6.029  9.850   15.041 1.00 18.04 ? 1582 LYS A C   1 
ATOM   956  O O   . LYS A 1 102 ? 5.750  9.526   13.883 1.00 15.96 ? 1582 LYS A O   1 
ATOM   957  C CB  . LYS A 1 102 ? 4.701  11.715  16.164 1.00 19.23 ? 1582 LYS A CB  1 
ATOM   958  C CG  . LYS A 1 102 ? 4.657  13.160  16.596 1.00 23.74 ? 1582 LYS A CG  1 
ATOM   959  C CD  . LYS A 1 102 ? 3.321  13.441  17.256 1.00 29.55 ? 1582 LYS A CD  1 
ATOM   960  C CE  . LYS A 1 102 ? 3.319  14.854  17.789 1.00 32.36 ? 1582 LYS A CE  1 
ATOM   961  N NZ  . LYS A 1 102 ? 4.419  15.063  18.771 1.00 36.78 ? 1582 LYS A NZ  1 
ATOM   962  N N   . ARG A 1 103 ? 6.256  8.944   15.971 1.00 18.18 ? 1583 ARG A N   1 
ATOM   963  C CA  . ARG A 1 103 ? 6.249  7.552   15.676 1.00 17.40 ? 1583 ARG A CA  1 
ATOM   964  C C   . ARG A 1 103 ? 4.990  7.094   14.919 1.00 17.47 ? 1583 ARG A C   1 
ATOM   965  O O   . ARG A 1 103 ? 5.116  6.335   13.931 1.00 17.97 ? 1583 ARG A O   1 
ATOM   966  C CB  . ARG A 1 103 ? 6.395  6.775   16.990 1.00 17.97 ? 1583 ARG A CB  1 
ATOM   967  C CG  . ARG A 1 103 ? 6.479  5.305   16.742 1.00 16.72 ? 1583 ARG A CG  1 
ATOM   968  C CD  . ARG A 1 103 ? 6.302  4.542   18.050 1.00 17.44 ? 1583 ARG A CD  1 
ATOM   969  N NE  . ARG A 1 103 ? 7.382  4.690   19.015 1.00 18.78 ? 1583 ARG A NE  1 
ATOM   970  C CZ  . ARG A 1 103 ? 8.439  3.909   19.016 1.00 15.11 ? 1583 ARG A CZ  1 
ATOM   971  N NH1 . ARG A 1 103 ? 8.701  3.091   18.022 1.00 19.28 ? 1583 ARG A NH1 1 
ATOM   972  N NH2 . ARG A 1 103 ? 9.343  4.011   19.981 1.00 18.12 ? 1583 ARG A NH2 1 
ATOM   973  N N   A MET A 1 104 ? 3.789  7.476   15.335 0.50 18.08 ? 1584 MET A N   1 
ATOM   974  N N   B MET A 1 104 ? 3.850  7.655   15.317 0.50 18.11 ? 1584 MET A N   1 
ATOM   975  C CA  A MET A 1 104 ? 2.637  6.946   14.605 0.50 18.02 ? 1584 MET A CA  1 
ATOM   976  C CA  B MET A 1 104 ? 2.564  7.295   14.755 0.50 18.21 ? 1584 MET A CA  1 
ATOM   977  C C   A MET A 1 104 ? 2.473  7.492   13.178 0.50 17.63 ? 1584 MET A C   1 
ATOM   978  C C   B MET A 1 104 ? 2.311  7.745   13.327 0.50 17.59 ? 1584 MET A C   1 
ATOM   979  O O   A MET A 1 104 ? 1.666  6.942   12.429 0.50 17.01 ? 1584 MET A O   1 
ATOM   980  O O   B MET A 1 104 ? 1.338  7.369   12.711 0.50 15.74 ? 1584 MET A O   1 
ATOM   981  C CB  A MET A 1 104 ? 1.335  7.086   15.407 0.50 18.05 ? 1584 MET A CB  1 
ATOM   982  C CB  B MET A 1 104 ? 1.490  7.816   15.682 0.50 19.10 ? 1584 MET A CB  1 
ATOM   983  C CG  A MET A 1 104 ? 1.237  6.041   16.503 0.50 21.21 ? 1584 MET A CG  1 
ATOM   984  C CG  B MET A 1 104 ? 1.347  6.900   16.833 0.50 23.87 ? 1584 MET A CG  1 
ATOM   985  S SD  A MET A 1 104 ? -0.331 6.067   17.414 0.50 20.35 ? 1584 MET A SD  1 
ATOM   986  S SD  B MET A 1 104 ? 0.502  5.430   16.242 0.50 31.52 ? 1584 MET A SD  1 
ATOM   987  C CE  A MET A 1 104 ? -1.501 5.605   16.132 0.50 19.25 ? 1584 MET A CE  1 
ATOM   988  C CE  B MET A 1 104 ? -1.088 5.879   16.833 0.50 12.75 ? 1584 MET A CE  1 
ATOM   989  N N   . ALA A 1 105 ? 3.211  8.543   12.807 1.00 15.77 ? 1585 ALA A N   1 
ATOM   990  C CA  . ALA A 1 105 ? 3.130  9.089   11.477 1.00 15.65 ? 1585 ALA A CA  1 
ATOM   991  C C   . ALA A 1 105 ? 4.099  8.438   10.525 1.00 14.77 ? 1585 ALA A C   1 
ATOM   992  O O   . ALA A 1 105 ? 4.241  8.953   9.454  1.00 15.79 ? 1585 ALA A O   1 
ATOM   993  C CB  . ALA A 1 105 ? 3.293  10.635  11.500 1.00 15.68 ? 1585 ALA A CB  1 
ATOM   994  N N   . VAL A 1 106 ? 4.749  7.344   10.934 1.00 13.05 ? 1586 VAL A N   1 
ATOM   995  C CA  . VAL A 1 106 ? 5.666  6.677   10.046 1.00 13.34 ? 1586 VAL A CA  1 
ATOM   996  C C   . VAL A 1 106 ? 5.275  5.198   9.963  1.00 15.26 ? 1586 VAL A C   1 
ATOM   997  O O   . VAL A 1 106 ? 5.130  4.479   11.010 1.00 14.74 ? 1586 VAL A O   1 
ATOM   998  C CB  . VAL A 1 106 ? 7.122  6.802   10.570 1.00 14.76 ? 1586 VAL A CB  1 
ATOM   999  C CG1 . VAL A 1 106 ? 8.072  6.063   9.641  1.00 14.96 ? 1586 VAL A CG1 1 
ATOM   1000 C CG2 . VAL A 1 106 ? 7.484  8.284   10.688 1.00 15.30 ? 1586 VAL A CG2 1 
ATOM   1001 N N   . ILE A 1 107 ? 4.988  4.753   8.736  1.00 13.73 ? 1587 ILE A N   1 
ATOM   1002 C CA  . ILE A 1 107 ? 4.549  3.378   8.490  1.00 13.67 ? 1587 ILE A CA  1 
ATOM   1003 C C   . ILE A 1 107 ? 5.370  2.833   7.349  1.00 13.27 ? 1587 ILE A C   1 
ATOM   1004 O O   . ILE A 1 107 ? 6.146  3.584   6.703  1.00 14.61 ? 1587 ILE A O   1 
ATOM   1005 C CB  . ILE A 1 107 ? 2.991  3.301   8.262  1.00 13.67 ? 1587 ILE A CB  1 
ATOM   1006 C CG1 . ILE A 1 107 ? 2.604  4.038   6.961  1.00 13.89 ? 1587 ILE A CG1 1 
ATOM   1007 C CG2 . ILE A 1 107 ? 2.297  3.912   9.484  1.00 13.72 ? 1587 ILE A CG2 1 
ATOM   1008 C CD1 . ILE A 1 107 ? 1.151  3.923   6.611  1.00 13.77 ? 1587 ILE A CD1 1 
ATOM   1009 N N   . LEU A 1 108 ? 5.222  1.552   7.025  1.00 13.26 ? 1588 LEU A N   1 
ATOM   1010 C CA  . LEU A 1 108 ? 5.939  0.956   5.887  1.00 12.77 ? 1588 LEU A CA  1 
ATOM   1011 C C   . LEU A 1 108 ? 4.938  0.373   4.940  1.00 13.35 ? 1588 LEU A C   1 
ATOM   1012 O O   . LEU A 1 108 ? 4.024  -0.375  5.362  1.00 12.63 ? 1588 LEU A O   1 
ATOM   1013 C CB  . LEU A 1 108 ? 6.825  -0.172  6.403  1.00 13.19 ? 1588 LEU A CB  1 
ATOM   1014 C CG  . LEU A 1 108 ? 7.810  0.198   7.503  1.00 14.48 ? 1588 LEU A CG  1 
ATOM   1015 C CD1 . LEU A 1 108 ? 8.620  -1.020  7.937  1.00 16.60 ? 1588 LEU A CD1 1 
ATOM   1016 C CD2 . LEU A 1 108 ? 8.755  1.294   6.992  1.00 18.07 ? 1588 LEU A CD2 1 
ATOM   1017 N N   . SER A 1 109 ? 5.067  0.685   3.666  1.00 13.34 ? 1589 SER A N   1 
ATOM   1018 C CA  . SER A 1 109 ? 4.285  -0.019  2.676  1.00 13.97 ? 1589 SER A CA  1 
ATOM   1019 C C   . SER A 1 109 ? 4.703  -1.499  2.617  1.00 12.95 ? 1589 SER A C   1 
ATOM   1020 O O   . SER A 1 109 ? 5.688  -1.893  3.262  1.00 12.54 ? 1589 SER A O   1 
ATOM   1021 C CB  . SER A 1 109 ? 4.437  0.673   1.323  1.00 14.68 ? 1589 SER A CB  1 
ATOM   1022 O OG  . SER A 1 109 ? 5.713  0.288   0.869  1.00 15.92 ? 1589 SER A OG  1 
ATOM   1023 N N   . LEU A 1 110 ? 3.954  -2.293  1.856  1.00 12.90 ? 1590 LEU A N   1 
ATOM   1024 C CA  . LEU A 1 110 ? 4.272  -3.707  1.740  1.00 12.79 ? 1590 LEU A CA  1 
ATOM   1025 C C   . LEU A 1 110 ? 5.675  -3.843  1.199  1.00 13.47 ? 1590 LEU A C   1 
ATOM   1026 O O   . LEU A 1 110 ? 6.480  -4.671  1.708  1.00 13.74 ? 1590 LEU A O   1 
ATOM   1027 C CB  . LEU A 1 110 ? 3.296  -4.372  0.755  1.00 13.38 ? 1590 LEU A CB  1 
ATOM   1028 C CG  . LEU A 1 110 ? 3.541  -5.859  0.531  1.00 13.87 ? 1590 LEU A CG  1 
ATOM   1029 C CD1 . LEU A 1 110 ? 3.337  -6.683  1.827  1.00 16.75 ? 1590 LEU A CD1 1 
ATOM   1030 C CD2 . LEU A 1 110 ? 2.593  -6.352  -0.565 1.00 15.93 ? 1590 LEU A CD2 1 
ATOM   1031 N N   A GLU A 1 111 ? 6.018  -3.051  0.190  0.50 14.08 ? 1591 GLU A N   1 
ATOM   1032 N N   B GLU A 1 111 ? 6.020  -3.094  0.162  0.50 13.80 ? 1591 GLU A N   1 
ATOM   1033 C CA  A GLU A 1 111 ? 7.318  -3.142  -0.436 0.50 14.72 ? 1591 GLU A CA  1 
ATOM   1034 C CA  B GLU A 1 111 ? 7.349  -3.155  -0.402 0.50 14.49 ? 1591 GLU A CA  1 
ATOM   1035 C C   A GLU A 1 111 ? 8.447  -2.617  0.462  0.50 14.86 ? 1591 GLU A C   1 
ATOM   1036 C C   B GLU A 1 111 ? 8.394  -2.768  0.666  0.50 14.20 ? 1591 GLU A C   1 
ATOM   1037 O O   A GLU A 1 111 ? 9.590  -3.103  0.378  0.50 14.95 ? 1591 GLU A O   1 
ATOM   1038 O O   B GLU A 1 111 ? 9.405  -3.460  0.908  0.50 12.49 ? 1591 GLU A O   1 
ATOM   1039 C CB  A GLU A 1 111 ? 7.301  -2.434  -1.784 0.50 15.53 ? 1591 GLU A CB  1 
ATOM   1040 C CB  B GLU A 1 111 ? 7.394  -2.209  -1.600 0.50 14.87 ? 1591 GLU A CB  1 
ATOM   1041 C CG  A GLU A 1 111 ? 8.588  -2.602  -2.567 0.50 19.29 ? 1591 GLU A CG  1 
ATOM   1042 C CG  B GLU A 1 111 ? 8.751  -2.127  -2.289 0.50 17.24 ? 1591 GLU A CG  1 
ATOM   1043 C CD  A GLU A 1 111 ? 8.436  -2.301  -4.045 0.50 23.33 ? 1591 GLU A CD  1 
ATOM   1044 C CD  B GLU A 1 111 ? 8.752  -1.253  -3.534 0.50 17.35 ? 1591 GLU A CD  1 
ATOM   1045 O OE1 A GLU A 1 111 ? 7.817  -1.272  -4.382 0.50 24.62 ? 1591 GLU A OE1 1 
ATOM   1046 O OE1 B GLU A 1 111 ? 8.076  -0.201  -3.523 0.50 23.92 ? 1591 GLU A OE1 1 
ATOM   1047 O OE2 A GLU A 1 111 ? 8.963  -3.081  -4.870 0.50 25.55 ? 1591 GLU A OE2 1 
ATOM   1048 O OE2 B GLU A 1 111 ? 9.469  -1.609  -4.498 0.50 22.81 ? 1591 GLU A OE2 1 
ATOM   1049 N N   . GLN A 1 112 ? 8.134  -1.631  1.298  1.00 20.00 ? 1592 GLN A N   1 
ATOM   1050 C CA  . GLN A 1 112 ? 9.109  -1.108  2.263  1.00 20.00 ? 1592 GLN A CA  1 
ATOM   1051 C C   . GLN A 1 112 ? 9.353  -2.044  3.437  1.00 20.00 ? 1592 GLN A C   1 
ATOM   1052 O O   . GLN A 1 112 ? 10.477 -2.228  3.846  1.00 14.97 ? 1592 GLN A O   1 
ATOM   1053 C CB  . GLN A 1 112 ? 8.707  0.278   2.777  1.00 20.00 ? 1592 GLN A CB  1 
ATOM   1054 C CG  . GLN A 1 112 ? 8.701  1.328   1.706  1.00 20.00 ? 1592 GLN A CG  1 
ATOM   1055 C CD  . GLN A 1 112 ? 7.918  2.564   2.092  1.00 20.00 ? 1592 GLN A CD  1 
ATOM   1056 O OE1 . GLN A 1 112 ? 7.129  2.555   3.021  1.00 20.00 ? 1592 GLN A OE1 1 
ATOM   1057 N NE2 . GLN A 1 112 ? 8.132  3.631   1.343  1.00 20.00 ? 1592 GLN A NE2 1 
ATOM   1058 N N   . GLY A 1 113 ? 8.304  -2.640  3.975  1.00 13.71 ? 1593 GLY A N   1 
ATOM   1059 C CA  . GLY A 1 113 ? 8.512  -3.610  5.031  1.00 14.39 ? 1593 GLY A CA  1 
ATOM   1060 C C   . GLY A 1 113 ? 9.112  -4.933  4.580  1.00 15.13 ? 1593 GLY A C   1 
ATOM   1061 O O   . GLY A 1 113 ? 9.905  -5.513  5.321  1.00 14.88 ? 1593 GLY A O   1 
ATOM   1062 N N   . ASN A 1 114 ? 8.712  -5.432  3.423  1.00 15.27 ? 1594 ASN A N   1 
ATOM   1063 C CA  . ASN A 1 114 ? 9.296  -6.652  2.941  1.00 17.18 ? 1594 ASN A CA  1 
ATOM   1064 C C   . ASN A 1 114 ? 10.816 -6.538  2.834  1.00 17.20 ? 1594 ASN A C   1 
ATOM   1065 O O   . ASN A 1 114 ? 11.493 -7.562  3.080  1.00 18.49 ? 1594 ASN A O   1 
ATOM   1066 C CB  . ASN A 1 114 ? 8.667  -7.027  1.593  1.00 18.12 ? 1594 ASN A CB  1 
ATOM   1067 C CG  . ASN A 1 114 ? 7.327  -7.739  1.740  1.00 17.63 ? 1594 ASN A CG  1 
ATOM   1068 O OD1 . ASN A 1 114 ? 6.863  -8.054  2.824  1.00 20.89 ? 1594 ASN A OD1 1 
ATOM   1069 N ND2 . ASN A 1 114 ? 6.672  -7.977  0.588  1.00 21.49 ? 1594 ASN A ND2 1 
ATOM   1070 N N   A ARG A 1 115 ? 11.360 -5.382  2.466  0.80 16.68 ? 1595 ARG A N   1 
ATOM   1071 N N   B ARG A 1 115 ? 11.332 -5.332  2.575  0.20 16.18 ? 1595 ARG A N   1 
ATOM   1072 C CA  A ARG A 1 115 ? 12.817 -5.233  2.281  0.80 16.86 ? 1595 ARG A CA  1 
ATOM   1073 C CA  B ARG A 1 115 ? 12.774 -5.031  2.510  0.20 15.42 ? 1595 ARG A CA  1 
ATOM   1074 C C   A ARG A 1 115 ? 13.571 -5.566  3.558  0.80 17.46 ? 1595 ARG A C   1 
ATOM   1075 C C   B ARG A 1 115 ? 13.520 -5.175  3.845  0.20 14.95 ? 1595 ARG A C   1 
ATOM   1076 O O   A ARG A 1 115 ? 14.749 -5.909  3.545  0.80 18.52 ? 1595 ARG A O   1 
ATOM   1077 O O   B ARG A 1 115 ? 14.752 -5.216  3.866  0.20 13.85 ? 1595 ARG A O   1 
ATOM   1078 C CB  A ARG A 1 115 ? 13.177 -3.796  1.887  0.80 19.01 ? 1595 ARG A CB  1 
ATOM   1079 C CB  B ARG A 1 115 ? 12.989 -3.596  2.005  0.20 15.95 ? 1595 ARG A CB  1 
ATOM   1080 C CG  A ARG A 1 115 ? 12.885 -3.403  0.461  0.80 20.45 ? 1595 ARG A CG  1 
ATOM   1081 C CG  B ARG A 1 115 ? 12.644 -3.366  0.544  0.20 16.28 ? 1595 ARG A CG  1 
ATOM   1082 C CD  A ARG A 1 115 ? 13.265 -1.951  0.282  0.80 25.14 ? 1595 ARG A CD  1 
ATOM   1083 C CD  B ARG A 1 115 ? 13.199 -2.027  0.089  0.20 16.95 ? 1595 ARG A CD  1 
ATOM   1084 N NE  A ARG A 1 115 ? 12.929 -1.484  -1.057 0.80 28.51 ? 1595 ARG A NE  1 
ATOM   1085 N NE  B ARG A 1 115 ? 12.395 -1.411  -0.964 0.20 16.02 ? 1595 ARG A NE  1 
ATOM   1086 C CZ  A ARG A 1 115 ? 12.175 -0.425  -1.320 0.80 28.37 ? 1595 ARG A CZ  1 
ATOM   1087 C CZ  B ARG A 1 115 ? 12.478 -1.709  -2.259 0.20 17.08 ? 1595 ARG A CZ  1 
ATOM   1088 N NH1 A ARG A 1 115 ? 11.678 0.302   -0.321 0.80 27.51 ? 1595 ARG A NH1 1 
ATOM   1089 N NH1 B ARG A 1 115 ? 13.343 -2.620  -2.688 0.20 19.77 ? 1595 ARG A NH1 1 
ATOM   1090 N NH2 A ARG A 1 115 ? 11.920 -0.088  -2.580 0.80 30.69 ? 1595 ARG A NH2 1 
ATOM   1091 N NH2 B ARG A 1 115 ? 11.699 -1.081  -3.128 0.20 18.28 ? 1595 ARG A NH2 1 
ATOM   1092 N N   A LEU A 1 116 ? 12.871 -5.447  4.683  0.50 15.75 ? 1596 LEU A N   1 
ATOM   1093 N N   B LEU A 1 116 ? 12.783 -5.236  4.951  0.50 14.38 ? 1596 LEU A N   1 
ATOM   1094 C CA  A LEU A 1 116 ? 13.506 -5.559  6.002  0.50 15.36 ? 1596 LEU A CA  1 
ATOM   1095 C CA  B LEU A 1 116 ? 13.405 -5.355  6.262  0.50 14.64 ? 1596 LEU A CA  1 
ATOM   1096 C C   A LEU A 1 116 ? 13.345 -6.918  6.670  0.50 15.00 ? 1596 LEU A C   1 
ATOM   1097 C C   B LEU A 1 116 ? 13.271 -6.766  6.840  0.50 14.65 ? 1596 LEU A C   1 
ATOM   1098 O O   A LEU A 1 116 ? 13.949 -7.162  7.718  0.50 14.70 ? 1596 LEU A O   1 
ATOM   1099 O O   B LEU A 1 116 ? 13.763 -7.053  7.933  0.50 13.91 ? 1596 LEU A O   1 
ATOM   1100 C CB  A LEU A 1 116 ? 12.918 -4.507  6.964  0.50 14.25 ? 1596 LEU A CB  1 
ATOM   1101 C CB  B LEU A 1 116 ? 12.791 -4.324  7.205  0.50 13.57 ? 1596 LEU A CB  1 
ATOM   1102 C CG  A LEU A 1 116 ? 13.316 -3.028  6.834  0.50 18.01 ? 1596 LEU A CG  1 
ATOM   1103 C CG  B LEU A 1 116 ? 13.014 -2.872  6.779  0.50 15.59 ? 1596 LEU A CG  1 
ATOM   1104 C CD1 A LEU A 1 116 ? 12.962 -2.446  5.485  0.50 20.10 ? 1596 LEU A CD1 1 
ATOM   1105 C CD1 B LEU A 1 116 ? 12.198 -1.949  7.623  0.50 14.88 ? 1596 LEU A CD1 1 
ATOM   1106 C CD2 A LEU A 1 116 ? 12.729 -2.154  7.955  0.50 17.38 ? 1596 LEU A CD2 1 
ATOM   1107 C CD2 B LEU A 1 116 ? 14.520 -2.524  6.885  0.50 17.55 ? 1596 LEU A CD2 1 
ATOM   1108 N N   A ARG A 1 117 ? 12.507 -7.781  6.113  0.50 15.14 ? 1597 ARG A N   1 
ATOM   1109 N N   B ARG A 1 117 ? 12.613 -7.644  6.098  0.50 14.90 ? 1597 ARG A N   1 
ATOM   1110 C CA  A ARG A 1 117 ? 12.207 -9.039  6.778  0.50 16.10 ? 1597 ARG A CA  1 
ATOM   1111 C CA  B ARG A 1 117 ? 12.381 -9.008  6.543  0.50 16.14 ? 1597 ARG A CA  1 
ATOM   1112 C C   A ARG A 1 117 ? 13.435 -9.926  6.975  0.50 16.10 ? 1597 ARG A C   1 
ATOM   1113 C C   B ARG A 1 117 ? 13.650 -9.794  6.838  0.50 16.22 ? 1597 ARG A C   1 
ATOM   1114 O O   A ARG A 1 117 ? 13.559 -10.591 7.995  0.50 16.61 ? 1597 ARG A O   1 
ATOM   1115 O O   B ARG A 1 117 ? 13.803 -10.389 7.902  0.50 16.40 ? 1597 ARG A O   1 
ATOM   1116 C CB  A ARG A 1 117 ? 11.142 -9.799  6.003  0.50 15.64 ? 1597 ARG A CB  1 
ATOM   1117 C CB  B ARG A 1 117 ? 11.620 -9.761  5.465  0.50 15.49 ? 1597 ARG A CB  1 
ATOM   1118 C CG  A ARG A 1 117 ? 9.772  -9.151  6.057  0.50 18.64 ? 1597 ARG A CG  1 
ATOM   1119 C CG  B ARG A 1 117 ? 10.153 -9.632  5.605  0.50 18.83 ? 1597 ARG A CG  1 
ATOM   1120 C CD  A ARG A 1 117 ? 8.744  -9.911  5.229  0.50 22.19 ? 1597 ARG A CD  1 
ATOM   1121 C CD  B ARG A 1 117 ? 9.451  -10.454 4.533  0.50 22.60 ? 1597 ARG A CD  1 
ATOM   1122 N NE  A ARG A 1 117 ? 9.115  -9.964  3.817  0.50 23.20 ? 1597 ARG A NE  1 
ATOM   1123 N NE  B ARG A 1 117 ? 8.089  -10.769 4.937  0.50 27.13 ? 1597 ARG A NE  1 
ATOM   1124 C CZ  A ARG A 1 117 ? 8.538  -10.752 2.912  0.50 25.50 ? 1597 ARG A CZ  1 
ATOM   1125 C CZ  B ARG A 1 117 ? 7.209  -9.864  5.355  0.50 27.09 ? 1597 ARG A CZ  1 
ATOM   1126 N NH1 A ARG A 1 117 ? 7.549  -11.561 3.264  0.50 25.02 ? 1597 ARG A NH1 1 
ATOM   1127 N NH1 B ARG A 1 117 ? 7.550  -8.582  5.421  0.50 29.59 ? 1597 ARG A NH1 1 
ATOM   1128 N NH2 A ARG A 1 117 ? 8.953  -10.722 1.653  0.50 25.32 ? 1597 ARG A NH2 1 
ATOM   1129 N NH2 B ARG A 1 117 ? 5.991  -10.243 5.707  0.50 28.35 ? 1597 ARG A NH2 1 
ATOM   1130 N N   A GLU A 1 118 ? 14.326 -9.965  5.984  0.50 16.48 ? 1598 GLU A N   1 
ATOM   1131 N N   B GLU A 1 118 ? 14.548 -9.849  5.862  0.50 16.23 ? 1598 GLU A N   1 
ATOM   1132 C CA  A GLU A 1 118 ? 15.563 -10.753 6.128  0.50 17.78 ? 1598 GLU A CA  1 
ATOM   1133 C CA  B GLU A 1 118 ? 15.702 -10.745 5.997  0.50 17.44 ? 1598 GLU A CA  1 
ATOM   1134 C C   A GLU A 1 118 ? 16.264 -10.414 7.442  0.50 17.80 ? 1598 GLU A C   1 
ATOM   1135 C C   B GLU A 1 118 ? 16.508 -10.421 7.258  0.50 17.85 ? 1598 GLU A C   1 
ATOM   1136 O O   A GLU A 1 118 ? 16.527 -11.293 8.272  0.50 17.88 ? 1598 GLU A O   1 
ATOM   1137 O O   B GLU A 1 118 ? 17.016 -11.326 7.915  0.50 18.01 ? 1598 GLU A O   1 
ATOM   1138 C CB  A GLU A 1 118 ? 16.507 -10.466 4.957  0.50 18.51 ? 1598 GLU A CB  1 
ATOM   1139 C CB  B GLU A 1 118 ? 16.568 -10.699 4.734  0.50 18.05 ? 1598 GLU A CB  1 
ATOM   1140 C CG  A GLU A 1 118 ? 17.884 -11.111 5.087  0.50 21.67 ? 1598 GLU A CG  1 
ATOM   1141 C CG  B GLU A 1 118 ? 17.578 -11.825 4.613  0.50 20.91 ? 1598 GLU A CG  1 
ATOM   1142 C CD  A GLU A 1 118 ? 18.962 -10.346 4.327  0.50 25.89 ? 1598 GLU A CD  1 
ATOM   1143 C CD  B GLU A 1 118 ? 18.001 -12.060 3.171  0.50 23.97 ? 1598 GLU A CD  1 
ATOM   1144 O OE1 A GLU A 1 118 ? 19.007 -9.096  4.436  0.50 29.00 ? 1598 GLU A OE1 1 
ATOM   1145 O OE1 B GLU A 1 118 ? 18.003 -11.089 2.379  0.50 26.32 ? 1598 GLU A OE1 1 
ATOM   1146 O OE2 A GLU A 1 118 ? 19.764 -10.996 3.628  0.50 28.07 ? 1598 GLU A OE2 1 
ATOM   1147 O OE2 B GLU A 1 118 ? 18.335 -13.213 2.827  0.50 26.36 ? 1598 GLU A OE2 1 
ATOM   1148 N N   . GLN A 1 119 ? 16.602 -9.137  7.607  1.00 16.93 ? 1599 GLN A N   1 
ATOM   1149 C CA  . GLN A 1 119 ? 17.404 -8.702  8.742  1.00 18.36 ? 1599 GLN A CA  1 
ATOM   1150 C C   . GLN A 1 119 ? 16.602 -8.610  10.031 1.00 17.98 ? 1599 GLN A C   1 
ATOM   1151 O O   . GLN A 1 119 ? 17.130 -8.852  11.123 1.00 19.12 ? 1599 GLN A O   1 
ATOM   1152 C CB  . GLN A 1 119 ? 18.049 -7.352  8.459  1.00 19.63 ? 1599 GLN A CB  1 
ATOM   1153 C CG  . GLN A 1 119 ? 19.498 -7.333  8.062  1.00 26.64 ? 1599 GLN A CG  1 
ATOM   1154 C CD  . GLN A 1 119 ? 20.065 -5.920  8.197  1.00 30.75 ? 1599 GLN A CD  1 
ATOM   1155 O OE1 . GLN A 1 119 ? 19.726 -5.029  7.417  1.00 32.74 ? 1599 GLN A OE1 1 
ATOM   1156 N NE2 . GLN A 1 119 ? 20.897 -5.703  9.216  1.00 35.08 ? 1599 GLN A NE2 1 
ATOM   1157 N N   . TYR A 1 120 ? 15.318 -8.266  9.933  1.00 15.74 ? 1600 TYR A N   1 
ATOM   1158 C CA  . TYR A 1 120 ? 14.561 -7.908  11.133 1.00 15.89 ? 1600 TYR A CA  1 
ATOM   1159 C C   . TYR A 1 120 ? 13.356 -8.778  11.424 1.00 14.82 ? 1600 TYR A C   1 
ATOM   1160 O O   . TYR A 1 120 ? 12.728 -8.634  12.488 1.00 15.42 ? 1600 TYR A O   1 
ATOM   1161 C CB  . TYR A 1 120 ? 14.120 -6.426  11.102 1.00 16.92 ? 1600 TYR A CB  1 
ATOM   1162 C CG  . TYR A 1 120 ? 15.250 -5.463  11.102 1.00 16.56 ? 1600 TYR A CG  1 
ATOM   1163 C CD1 . TYR A 1 120 ? 15.735 -4.944  9.903  1.00 17.01 ? 1600 TYR A CD1 1 
ATOM   1164 C CD2 . TYR A 1 120 ? 15.892 -5.101  12.273 1.00 18.23 ? 1600 TYR A CD2 1 
ATOM   1165 C CE1 . TYR A 1 120 ? 16.818 -4.046  9.865  1.00 18.50 ? 1600 TYR A CE1 1 
ATOM   1166 C CE2 . TYR A 1 120 ? 16.976 -4.226  12.252 1.00 21.48 ? 1600 TYR A CE2 1 
ATOM   1167 C CZ  . TYR A 1 120 ? 17.412 -3.706  11.063 1.00 19.79 ? 1600 TYR A CZ  1 
ATOM   1168 O OH  . TYR A 1 120 ? 18.487 -2.846  11.040 1.00 23.22 ? 1600 TYR A OH  1 
ATOM   1169 N N   . GLY A 1 121 ? 12.994 -9.636  10.501 1.00 14.99 ? 1601 GLY A N   1 
ATOM   1170 C CA  . GLY A 1 121 ? 11.754 -10.356 10.638 1.00 16.55 ? 1601 GLY A CA  1 
ATOM   1171 C C   . GLY A 1 121 ? 11.791 -11.464 11.674 1.00 17.18 ? 1601 GLY A C   1 
ATOM   1172 O O   . GLY A 1 121 ? 12.857 -12.038 11.970 1.00 17.29 ? 1601 GLY A O   1 
ATOM   1173 N N   . LEU A 1 122 ? 10.614 -11.795 12.206 1.00 18.14 ? 1602 LEU A N   1 
ATOM   1174 C CA  . LEU A 1 122 ? 10.478 -12.870 13.210 1.00 20.60 ? 1602 LEU A CA  1 
ATOM   1175 C C   . LEU A 1 122 ? 10.004 -14.190 12.605 1.00 21.49 ? 1602 LEU A C   1 
ATOM   1176 O O   . LEU A 1 122 ? 9.430  -15.059 13.313 1.00 23.25 ? 1602 LEU A O   1 
ATOM   1177 C CB  . LEU A 1 122 ? 9.525  -12.435 14.324 1.00 21.19 ? 1602 LEU A CB  1 
ATOM   1178 C CG  . LEU A 1 122 ? 10.002 -11.314 15.230 1.00 22.18 ? 1602 LEU A CG  1 
ATOM   1179 C CD1 . LEU A 1 122 ? 9.014  -11.158 16.400 1.00 25.65 ? 1602 LEU A CD1 1 
ATOM   1180 C CD2 . LEU A 1 122 ? 11.414 -11.611 15.763 1.00 25.55 ? 1602 LEU A CD2 1 
ATOM   1181 N N   . GLY A 1 123 ? 10.228 -14.357 11.305 1.00 22.69 ? 1603 GLY A N   1 
ATOM   1182 C CA  . GLY A 1 123 ? 9.926  -15.636 10.643 1.00 24.54 ? 1603 GLY A CA  1 
ATOM   1183 C C   . GLY A 1 123 ? 10.887 -16.773 10.951 1.00 25.77 ? 1603 GLY A C   1 
ATOM   1184 O O   . GLY A 1 123 ? 11.810 -16.631 11.765 1.00 27.03 ? 1603 GLY A O   1 
HETATM 1185 S S   . SO4 B 2 .   ? 22.993 11.884  4.183  0.50 25.32 ? 201  SO4 A S   1 
HETATM 1186 O O1  . SO4 B 2 .   ? 23.970 11.921  3.078  0.50 26.84 ? 201  SO4 A O1  1 
HETATM 1187 O O2  . SO4 B 2 .   ? 21.823 12.638  3.758  0.50 28.71 ? 201  SO4 A O2  1 
HETATM 1188 O O3  . SO4 B 2 .   ? 22.694 10.489  4.451  0.50 26.02 ? 201  SO4 A O3  1 
HETATM 1189 O O4  . SO4 B 2 .   ? 23.601 12.473  5.375  0.50 25.99 ? 201  SO4 A O4  1 
HETATM 1190 O O   . HOH C 3 .   ? 3.275  3.177   12.812 1.00 13.69 ? 1    HOH A O   1 
HETATM 1191 O O   . HOH C 3 .   ? 6.546  3.990   13.364 1.00 13.71 ? 2    HOH A O   1 
HETATM 1192 O O   . HOH C 3 .   ? 3.293  12.638  3.501  1.00 16.53 ? 3    HOH A O   1 
HETATM 1193 O O   . HOH C 3 .   ? 7.177  -0.033  17.470 1.00 15.87 ? 4    HOH A O   1 
HETATM 1194 O O   . HOH C 3 .   ? 10.378 15.429  4.407  1.00 21.30 ? 5    HOH A O   1 
HETATM 1195 O O   . HOH C 3 .   ? 0.068  1.737   15.072 1.00 19.70 ? 6    HOH A O   1 
HETATM 1196 O O   . HOH C 3 .   ? 7.834  11.793  2.910  1.00 16.51 ? 7    HOH A O   1 
HETATM 1197 O O   A HOH C 3 .   ? 4.871  15.624  11.636 0.50 14.71 ? 8    HOH A O   1 
HETATM 1198 O O   B HOH C 3 .   ? 5.263  16.017  10.693 0.50 15.07 ? 8    HOH A O   1 
HETATM 1199 O O   . HOH C 3 .   ? -6.178 9.613   2.434  1.00 21.38 ? 9    HOH A O   1 
HETATM 1200 O O   . HOH C 3 .   ? 7.996  14.118  4.261  1.00 19.69 ? 10   HOH A O   1 
HETATM 1201 O O   . HOH C 3 .   ? 9.359  0.811   15.861 1.00 18.13 ? 11   HOH A O   1 
HETATM 1202 O O   . HOH C 3 .   ? 19.244 2.785   12.446 1.00 18.59 ? 12   HOH A O   1 
HETATM 1203 O O   . HOH C 3 .   ? 6.226  9.902   18.980 1.00 24.20 ? 13   HOH A O   1 
HETATM 1204 O O   A HOH C 3 .   ? -1.632 -1.474  -0.206 0.40 14.32 ? 14   HOH A O   1 
HETATM 1205 O O   B HOH C 3 .   ? -1.111 -1.982  -0.791 0.30 19.63 ? 14   HOH A O   1 
HETATM 1206 O O   A HOH C 3 .   ? 12.014 0.104   2.990  0.50 12.57 ? 15   HOH A O   1 
HETATM 1207 O O   B HOH C 3 .   ? 12.759 -0.633  3.990  0.50 20.24 ? 15   HOH A O   1 
HETATM 1208 O O   . HOH C 3 .   ? 4.190  13.854  13.220 1.00 21.64 ? 16   HOH A O   1 
HETATM 1209 O O   . HOH C 3 .   ? 4.648  -18.229 18.169 1.00 24.56 ? 17   HOH A O   1 
HETATM 1210 O O   . HOH C 3 .   ? -1.894 11.062  6.614  1.00 21.31 ? 18   HOH A O   1 
HETATM 1211 O O   . HOH C 3 .   ? 0.770  4.242   12.988 1.00 25.02 ? 19   HOH A O   1 
HETATM 1212 O O   . HOH C 3 .   ? 1.236  -0.597  21.262 1.00 23.45 ? 20   HOH A O   1 
HETATM 1213 O O   . HOH C 3 .   ? 3.590  9.006   18.007 1.00 26.63 ? 21   HOH A O   1 
HETATM 1214 O O   A HOH C 3 .   ? -7.508 -6.785  1.621  0.70 18.12 ? 22   HOH A O   1 
HETATM 1215 O O   B HOH C 3 .   ? -8.215 -6.447  2.283  0.30 13.04 ? 22   HOH A O   1 
HETATM 1216 O O   . HOH C 3 .   ? -6.554 16.290  -3.190 1.00 23.51 ? 23   HOH A O   1 
HETATM 1217 O O   . HOH C 3 .   ? 10.091 -5.313  -1.070 1.00 24.26 ? 24   HOH A O   1 
HETATM 1218 O O   . HOH C 3 .   ? 13.136 3.737   19.840 1.00 24.43 ? 25   HOH A O   1 
HETATM 1219 O O   . HOH C 3 .   ? 0.334  -12.043 9.492  1.00 26.42 ? 26   HOH A O   1 
HETATM 1220 O O   . HOH C 3 .   ? 2.976  4.872   17.227 1.00 27.29 ? 27   HOH A O   1 
HETATM 1221 O O   . HOH C 3 .   ? 7.742  14.470  23.215 1.00 33.46 ? 28   HOH A O   1 
HETATM 1222 O O   . HOH C 3 .   ? -2.798 3.843   7.275  1.00 26.94 ? 29   HOH A O   1 
HETATM 1223 O O   . HOH C 3 .   ? 17.883 15.291  10.628 1.00 27.02 ? 30   HOH A O   1 
HETATM 1224 O O   . HOH C 3 .   ? 10.128 17.635  0.602  1.00 28.77 ? 31   HOH A O   1 
HETATM 1225 O O   A HOH C 3 .   ? 2.473  -15.113 25.756 0.50 22.43 ? 32   HOH A O   1 
HETATM 1226 O O   B HOH C 3 .   ? 3.722  -15.206 25.617 0.50 26.78 ? 32   HOH A O   1 
HETATM 1227 O O   . HOH C 3 .   ? 3.384  4.157   0.717  1.00 25.19 ? 33   HOH A O   1 
HETATM 1228 O O   . HOH C 3 .   ? 5.909  -16.818 10.741 1.00 32.59 ? 34   HOH A O   1 
HETATM 1229 O O   . HOH C 3 .   ? 13.808 16.697  10.332 1.00 19.59 ? 35   HOH A O   1 
HETATM 1230 O O   A HOH C 3 .   ? 6.584  1.323   -1.446 0.40 16.38 ? 36   HOH A O   1 
HETATM 1231 O O   B HOH C 3 .   ? 6.298  2.136   -1.175 0.30 15.62 ? 36   HOH A O   1 
HETATM 1232 O O   . HOH C 3 .   ? 9.280  17.689  3.292  1.00 29.08 ? 37   HOH A O   1 
HETATM 1233 O O   . HOH C 3 .   ? 2.336  14.184  10.580 1.00 33.15 ? 38   HOH A O   1 
HETATM 1234 O O   . HOH C 3 .   ? -3.651 -1.300  0.934  1.00 25.89 ? 39   HOH A O   1 
HETATM 1235 O O   A HOH C 3 .   ? -0.585 -9.585  9.158  0.50 19.83 ? 40   HOH A O   1 
HETATM 1236 O O   B HOH C 3 .   ? -1.562 -9.043  9.746  0.50 20.06 ? 40   HOH A O   1 
HETATM 1237 O O   . HOH C 3 .   ? 14.658 10.999  0.157  1.00 39.79 ? 41   HOH A O   1 
HETATM 1238 O O   . HOH C 3 .   ? 16.714 -0.022  14.744 1.00 23.14 ? 42   HOH A O   1 
HETATM 1239 O O   . HOH C 3 .   ? 8.523  10.813  -2.054 1.00 30.08 ? 43   HOH A O   1 
HETATM 1240 O O   . HOH C 3 .   ? 14.652 0.835   2.601  1.00 22.86 ? 44   HOH A O   1 
HETATM 1241 O O   . HOH C 3 .   ? 12.245 -4.249  19.426 1.00 32.44 ? 45   HOH A O   1 
HETATM 1242 O O   . HOH C 3 .   ? 15.926 20.054  5.622  1.00 31.96 ? 46   HOH A O   1 
HETATM 1243 O O   . HOH C 3 .   ? -3.116 -14.720 11.167 1.00 39.21 ? 47   HOH A O   1 
HETATM 1244 O O   . HOH C 3 .   ? -1.932 -9.043  3.011  1.00 45.45 ? 48   HOH A O   1 
HETATM 1245 O O   . HOH C 3 .   ? 5.237  5.275   0.254  1.00 27.77 ? 49   HOH A O   1 
HETATM 1246 O O   A HOH C 3 .   ? 23.349 8.211   5.495  0.50 26.52 ? 50   HOH A O   1 
HETATM 1247 O O   B HOH C 3 .   ? 23.801 10.843  5.038  0.50 24.95 ? 50   HOH A O   1 
HETATM 1248 O O   . HOH C 3 .   ? 1.331  -8.790  27.399 1.00 40.53 ? 51   HOH A O   1 
HETATM 1249 O O   . HOH C 3 .   ? 17.348 10.673  1.130  1.00 41.43 ? 52   HOH A O   1 
HETATM 1250 O O   A HOH C 3 .   ? 10.811 -13.532 8.818  0.50 34.22 ? 53   HOH A O   1 
HETATM 1251 O O   B HOH C 3 .   ? 9.978  -12.281 7.941  0.50 27.23 ? 53   HOH A O   1 
HETATM 1252 O O   . HOH C 3 .   ? -6.268 1.448   12.330 1.00 35.66 ? 54   HOH A O   1 
HETATM 1253 O O   . HOH C 3 .   ? 21.076 -10.887 10.651 1.00 53.27 ? 55   HOH A O   1 
HETATM 1254 O O   . HOH C 3 .   ? -5.984 -7.273  8.436  1.00 35.28 ? 56   HOH A O   1 
HETATM 1255 O O   . HOH C 3 .   ? -6.467 7.523   4.271  1.00 38.03 ? 57   HOH A O   1 
HETATM 1256 O O   . HOH C 3 .   ? -5.250 -9.163  2.467  1.00 43.95 ? 58   HOH A O   1 
HETATM 1257 O O   . HOH C 3 .   ? 9.231  5.695   22.505 1.00 40.84 ? 59   HOH A O   1 
HETATM 1258 O O   A HOH C 3 .   ? 3.957  16.448  4.983  0.35 19.81 ? 60   HOH A O   1 
HETATM 1259 O O   B HOH C 3 .   ? 3.938  14.729  5.191  0.35 18.77 ? 60   HOH A O   1 
HETATM 1260 O O   C HOH C 3 .   ? 3.982  16.309  6.671  0.30 18.65 ? 60   HOH A O   1 
HETATM 1261 O O   . HOH C 3 .   ? 5.048  -9.481  3.343  1.00 32.55 ? 61   HOH A O   1 
HETATM 1262 O O   A HOH C 3 .   ? 15.180 18.986  10.147 0.70 26.77 ? 62   HOH A O   1 
HETATM 1263 O O   B HOH C 3 .   ? 17.648 18.565  10.237 0.30 28.64 ? 62   HOH A O   1 
HETATM 1264 O O   . HOH C 3 .   ? 18.850 -1.514  8.104  1.00 33.06 ? 63   HOH A O   1 
HETATM 1265 O O   . HOH C 3 .   ? -3.334 -18.926 21.380 1.00 35.22 ? 64   HOH A O   1 
HETATM 1266 O O   . HOH C 3 .   ? -9.277 13.040  3.566  1.00 37.71 ? 65   HOH A O   1 
HETATM 1267 O O   . HOH C 3 .   ? -4.611 2.047   10.146 1.00 43.34 ? 66   HOH A O   1 
HETATM 1268 O O   . HOH C 3 .   ? 11.127 -2.738  22.565 1.00 31.99 ? 67   HOH A O   1 
HETATM 1269 O O   . HOH C 3 .   ? -2.713 -10.863 10.503 1.00 35.20 ? 68   HOH A O   1 
HETATM 1270 O O   . HOH C 3 .   ? 7.744  -16.676 14.491 1.00 36.99 ? 69   HOH A O   1 
HETATM 1271 O O   . HOH C 3 .   ? -8.069 17.234  1.240  1.00 27.92 ? 70   HOH A O   1 
HETATM 1272 O O   . HOH C 3 .   ? 7.634  -18.176 8.805  1.00 49.86 ? 71   HOH A O   1 
HETATM 1273 O O   . HOH C 3 .   ? 12.315 12.264  -2.175 1.00 35.13 ? 72   HOH A O   1 
HETATM 1274 O O   . HOH C 3 .   ? 20.829 -6.390  12.523 1.00 31.12 ? 73   HOH A O   1 
HETATM 1275 O O   . HOH C 3 .   ? 18.167 16.525  16.189 1.00 30.02 ? 74   HOH A O   1 
HETATM 1276 O O   . HOH C 3 .   ? 17.542 -4.746  6.157  1.00 34.07 ? 75   HOH A O   1 
HETATM 1277 O O   . HOH C 3 .   ? -5.339 3.471   5.727  1.00 44.65 ? 76   HOH A O   1 
HETATM 1278 O O   A HOH C 3 .   ? 11.879 4.725   22.172 0.50 23.75 ? 77   HOH A O   1 
HETATM 1279 O O   B HOH C 3 .   ? 11.407 3.346   21.046 0.50 25.01 ? 77   HOH A O   1 
HETATM 1280 O O   A HOH C 3 .   ? 3.117  6.759   19.206 0.50 21.94 ? 78   HOH A O   1 
HETATM 1281 O O   B HOH C 3 .   ? 3.369  5.500   19.398 0.50 27.58 ? 78   HOH A O   1 
HETATM 1282 O O   . HOH C 3 .   ? 0.098  -8.079  2.466  1.00 31.06 ? 79   HOH A O   1 
HETATM 1283 O O   . HOH C 3 .   ? -3.531 9.692   8.134  1.00 41.98 ? 80   HOH A O   1 
HETATM 1284 O O   . HOH C 3 .   ? 0.881  -11.870 5.258  1.00 41.11 ? 81   HOH A O   1 
HETATM 1285 O O   . HOH C 3 .   ? 16.776 -5.203  1.730  1.00 43.02 ? 82   HOH A O   1 
HETATM 1286 O O   . HOH C 3 .   ? 1.558  13.456  13.444 1.00 37.84 ? 83   HOH A O   1 
HETATM 1287 O O   . HOH C 3 .   ? 6.622  -20.054 21.150 1.00 41.61 ? 84   HOH A O   1 
HETATM 1288 O O   A HOH C 3 .   ? 5.949  -11.811 0.860  0.50 32.68 ? 85   HOH A O   1 
HETATM 1289 O O   B HOH C 3 .   ? 4.599  -12.196 2.171  0.50 40.61 ? 85   HOH A O   1 
HETATM 1290 O O   . HOH C 3 .   ? -5.820 -16.053 18.697 1.00 39.14 ? 86   HOH A O   1 
HETATM 1291 O O   . HOH C 3 .   ? 19.740 -8.909  12.090 1.00 37.01 ? 87   HOH A O   1 
HETATM 1292 O O   . HOH C 3 .   ? 16.896 -0.070  6.274  1.00 39.73 ? 88   HOH A O   1 
HETATM 1293 O O   . HOH C 3 .   ? -6.457 -11.920 14.655 1.00 42.00 ? 89   HOH A O   1 
HETATM 1294 O O   A HOH C 3 .   ? 4.719  -9.795  -0.135 0.50 26.56 ? 90   HOH A O   1 
HETATM 1295 O O   B HOH C 3 .   ? 4.249  -10.275 1.054  0.50 32.49 ? 90   HOH A O   1 
HETATM 1296 O O   . HOH C 3 .   ? 13.762 6.568   -1.772 1.00 39.90 ? 91   HOH A O   1 
HETATM 1297 O O   . HOH C 3 .   ? 20.190 0.996   8.731  1.00 27.25 ? 92   HOH A O   1 
HETATM 1298 O O   A HOH C 3 .   ? 22.242 -9.097  9.625  0.50 32.14 ? 93   HOH A O   1 
HETATM 1299 O O   B HOH C 3 .   ? 21.506 -7.890  10.599 0.50 29.35 ? 93   HOH A O   1 
HETATM 1300 O O   . HOH C 3 .   ? 18.722 -1.111  13.086 1.00 31.20 ? 94   HOH A O   1 
HETATM 1301 O O   . HOH C 3 .   ? 7.882  -15.048 22.570 1.00 48.23 ? 95   HOH A O   1 
HETATM 1302 O O   . HOH C 3 .   ? 16.333 -4.960  16.448 1.00 43.94 ? 96   HOH A O   1 
HETATM 1303 O O   . HOH C 3 .   ? 11.066 20.604  22.445 1.00 52.82 ? 97   HOH A O   1 
HETATM 1304 O O   . HOH C 3 .   ? -2.021 0.965   22.158 1.00 48.68 ? 98   HOH A O   1 
HETATM 1305 O O   . HOH C 3 .   ? 3.263  16.045  9.280  1.00 36.60 ? 99   HOH A O   1 
HETATM 1306 O O   . HOH C 3 .   ? 2.610  -18.026 25.574 1.00 47.13 ? 100  HOH A O   1 
HETATM 1307 O O   . HOH C 3 .   ? 8.199  -16.911 20.613 1.00 48.19 ? 101  HOH A O   1 
HETATM 1308 O O   . HOH C 3 .   ? -1.988 4.234   12.094 1.00 37.02 ? 102  HOH A O   1 
HETATM 1309 O O   . HOH C 3 .   ? 15.793 13.397  -0.533 1.00 44.25 ? 103  HOH A O   1 
HETATM 1310 O O   A HOH C 3 .   ? 14.795 -2.827  17.641 0.50 25.91 ? 104  HOH A O   1 
HETATM 1311 O O   B HOH C 3 .   ? 16.076 -2.077  16.386 0.50 26.18 ? 104  HOH A O   1 
HETATM 1312 O O   . HOH C 3 .   ? 10.937 2.102   23.050 1.00 47.63 ? 105  HOH A O   1 
HETATM 1313 O O   A HOH C 3 .   ? -6.332 5.299   19.030 0.50 33.67 ? 106  HOH A O   1 
HETATM 1314 O O   B HOH C 3 .   ? -4.506 6.882   17.217 0.50 38.22 ? 106  HOH A O   1 
HETATM 1315 O O   A HOH C 3 .   ? 4.818  18.085  19.404 0.50 31.65 ? 107  HOH A O   1 
HETATM 1316 O O   B HOH C 3 .   ? 1.908  17.897  18.699 0.50 32.45 ? 107  HOH A O   1 
HETATM 1317 O O   . HOH C 3 .   ? 11.773 2.879   -4.106 1.00 45.44 ? 108  HOH A O   1 
HETATM 1318 O O   . HOH C 3 .   ? 2.012  -10.381 0.892  1.00 39.16 ? 109  HOH A O   1 
HETATM 1319 O O   . HOH C 3 .   ? -4.234 -8.011  10.332 1.00 39.76 ? 110  HOH A O   1 
HETATM 1320 O O   A HOH C 3 .   ? -2.389 -7.923  27.070 0.25 21.08 ? 111  HOH A O   1 
HETATM 1321 O O   B HOH C 3 .   ? -3.327 -5.579  25.444 0.25 23.53 ? 111  HOH A O   1 
HETATM 1322 O O   C HOH C 3 .   ? -3.016 -6.988  25.813 0.50 28.82 ? 111  HOH A O   1 
HETATM 1323 O O   . HOH C 3 .   ? 20.981 -10.090 6.797  1.00 61.40 ? 112  HOH A O   1 
HETATM 1324 O O   . HOH C 3 .   ? -0.445 17.600  -1.277 1.00 65.77 ? 113  HOH A O   1 
HETATM 1325 O O   . HOH C 3 .   ? 12.151 8.298   -0.925 1.00 31.37 ? 114  HOH A O   1 
HETATM 1326 O O   A HOH C 3 .   ? -0.770 10.709  11.787 0.50 34.84 ? 115  HOH A O   1 
HETATM 1327 O O   B HOH C 3 .   ? -1.221 8.757   12.547 0.50 35.07 ? 115  HOH A O   1 
HETATM 1328 O O   . HOH C 3 .   ? 0.000  -8.851  0.000  0.50 33.68 ? 116  HOH A O   1 
HETATM 1329 O O   A HOH C 3 .   ? 6.698  3.048   24.756 0.50 26.01 ? 117  HOH A O   1 
HETATM 1330 O O   B HOH C 3 .   ? 6.033  1.664   25.689 0.50 36.74 ? 117  HOH A O   1 
HETATM 1331 O O   . HOH C 3 .   ? 16.045 -9.859  14.775 1.00 42.36 ? 118  HOH A O   1 
HETATM 1332 O O   A HOH C 3 .   ? 15.729 -12.197 14.547 0.50 28.49 ? 119  HOH A O   1 
HETATM 1333 O O   B HOH C 3 .   ? 15.002 -12.780 16.001 0.50 40.54 ? 119  HOH A O   1 
HETATM 1334 O O   A HOH C 3 .   ? -8.777 -4.334  16.972 0.50 26.09 ? 120  HOH A O   1 
HETATM 1335 O O   B HOH C 3 .   ? -8.686 -5.039  15.560 0.50 35.31 ? 120  HOH A O   1 
HETATM 1336 O O   . HOH C 3 .   ? 3.094  -18.503 28.500 1.00 54.64 ? 121  HOH A O   1 
HETATM 1337 O O   . HOH C 3 .   ? -2.717 5.154   9.716  1.00 35.52 ? 122  HOH A O   1 
HETATM 1338 O O   . HOH C 3 .   ? -5.250 -15.481 13.297 1.00 45.69 ? 123  HOH A O   1 
HETATM 1339 O O   . HOH C 3 .   ? 1.965  18.755  4.951  1.00 49.26 ? 124  HOH A O   1 
HETATM 1340 O O   . HOH C 3 .   ? -0.051 10.005  16.712 1.00 29.31 ? 125  HOH A O   1 
HETATM 1341 O O   . HOH C 3 .   ? 0.495  -12.270 27.407 1.00 48.75 ? 126  HOH A O   1 
HETATM 1342 O O   . HOH C 3 .   ? 17.322 -3.320  3.473  1.00 41.42 ? 127  HOH A O   1 
HETATM 1343 O O   A HOH C 3 .   ? -3.125 3.645   4.225  0.50 27.37 ? 128  HOH A O   1 
HETATM 1344 O O   B HOH C 3 .   ? -2.248 3.571   3.071  0.50 29.43 ? 128  HOH A O   1 
HETATM 1345 O O   . HOH C 3 .   ? 16.475 -7.098  5.400  1.00 23.70 ? 129  HOH A O   1 
HETATM 1346 O O   . HOH C 3 .   ? 14.059 -8.835  3.207  1.00 24.81 ? 130  HOH A O   1 
HETATM 1347 O O   A HOH C 3 .   ? 14.236 18.342  16.953 0.50 32.31 ? 131  HOH A O   1 
HETATM 1348 O O   B HOH C 3 .   ? 12.811 18.281  16.779 0.50 25.24 ? 131  HOH A O   1 
HETATM 1349 O O   . HOH C 3 .   ? 8.685  18.274  21.657 0.50 45.50 ? 132  HOH A O   1 
HETATM 1350 O O   . HOH C 3 .   ? 1.047  17.927  7.272  1.00 40.57 ? 133  HOH A O   1 
HETATM 1351 O O   . HOH C 3 .   ? 23.350 14.874  4.403  1.00 42.71 ? 134  HOH A O   1 
HETATM 1352 O O   . HOH C 3 .   ? 16.758 19.925  8.062  1.00 39.36 ? 135  HOH A O   1 
HETATM 1353 O O   A HOH C 3 .   ? 0.876  -12.793 1.054  0.50 40.21 ? 136  HOH A O   1 
HETATM 1354 O O   B HOH C 3 .   ? 2.903  -12.678 1.154  0.50 39.47 ? 136  HOH A O   1 
HETATM 1355 O O   . HOH C 3 .   ? -1.769 -13.213 28.070 1.00 61.90 ? 137  HOH A O   1 
HETATM 1356 O O   . HOH C 3 .   ? 17.258 -7.923  14.794 1.00 45.01 ? 138  HOH A O   1 
HETATM 1357 O O   . HOH C 3 .   ? -1.992 -12.982 7.785  1.00 52.65 ? 139  HOH A O   1 
HETATM 1358 O O   . HOH C 3 .   ? -3.657 4.135   1.699  1.00 33.76 ? 140  HOH A O   1 
HETATM 1359 O O   . HOH C 3 .   ? 1.333  -0.146  23.790 1.00 43.60 ? 141  HOH A O   1 
HETATM 1360 O O   A HOH C 3 .   ? -2.192 1.438   13.460 0.50 33.52 ? 142  HOH A O   1 
HETATM 1361 O O   B HOH C 3 .   ? -2.135 -0.065  13.405 0.50 23.69 ? 142  HOH A O   1 
HETATM 1362 O O   A HOH C 3 .   ? 8.398  3.431   15.061 0.50 11.66 ? 143  HOH A O   1 
HETATM 1363 O O   B HOH C 3 .   ? 8.536  2.915   15.014 0.50 11.38 ? 143  HOH A O   1 
HETATM 1364 O O   A HOH C 3 .   ? -4.550 6.996   6.122  0.50 29.98 ? 144  HOH A O   1 
HETATM 1365 O O   B HOH C 3 .   ? -3.034 6.173   5.238  0.50 29.69 ? 144  HOH A O   1 
HETATM 1366 O O   . HOH C 3 .   ? 18.417 13.156  15.018 0.50 16.80 ? 145  HOH A O   1 
HETATM 1367 O O   . HOH C 3 .   ? 9.294  20.143  4.419  1.00 41.66 ? 146  HOH A O   1 
HETATM 1368 O O   . HOH C 3 .   ? 12.359 20.798  -7.877 1.00 43.80 ? 147  HOH A O   1 
HETATM 1369 O O   A HOH C 3 .   ? -4.608 0.122   9.064  0.50 26.50 ? 148  HOH A O   1 
HETATM 1370 O O   B HOH C 3 .   ? -6.041 0.388   8.759  0.50 37.85 ? 148  HOH A O   1 
HETATM 1371 O O   A HOH C 3 .   ? -6.190 -18.733 18.659 0.50 26.81 ? 149  HOH A O   1 
HETATM 1372 O O   B HOH C 3 .   ? -8.227 -19.295 17.570 0.50 30.61 ? 149  HOH A O   1 
HETATM 1373 O O   . HOH C 3 .   ? 4.075  15.430  22.912 1.00 50.63 ? 150  HOH A O   1 
HETATM 1374 O O   . HOH C 3 .   ? 16.595 -0.641  3.703  1.00 40.52 ? 151  HOH A O   1 
HETATM 1375 O O   A HOH C 3 .   ? 11.220 16.808  17.541 0.50 28.60 ? 152  HOH A O   1 
HETATM 1376 O O   B HOH C 3 .   ? 11.623 18.170  17.185 0.50 26.11 ? 152  HOH A O   1 
HETATM 1377 O O   . HOH C 3 .   ? 11.577 -4.477  -3.344 1.00 46.79 ? 153  HOH A O   1 
HETATM 1378 O O   . HOH C 3 .   ? 13.244 18.796  -6.131 1.00 54.48 ? 154  HOH A O   1 
HETATM 1379 O O   A HOH C 3 .   ? 7.764  3.720   -2.303 0.50 37.74 ? 155  HOH A O   1 
HETATM 1380 O O   B HOH C 3 .   ? 8.690  5.344   -3.342 0.50 29.70 ? 155  HOH A O   1 
HETATM 1381 O O   . HOH C 3 .   ? -5.225 -18.736 10.851 1.00 57.77 ? 156  HOH A O   1 
HETATM 1382 O O   . HOH C 3 .   ? -3.144 -7.635  22.639 1.00 47.64 ? 157  HOH A O   1 
HETATM 1383 O O   . HOH C 3 .   ? -3.939 13.061  8.691  1.00 38.55 ? 158  HOH A O   1 
HETATM 1384 O O   . HOH C 3 .   ? 9.161  -0.282  24.507 1.00 51.78 ? 159  HOH A O   1 
HETATM 1385 O O   . HOH C 3 .   ? -7.186 17.972  3.557  1.00 58.68 ? 160  HOH A O   1 
HETATM 1386 O O   . HOH C 3 .   ? 4.996  12.010  20.125 1.00 36.78 ? 161  HOH A O   1 
HETATM 1387 O O   . HOH C 3 .   ? 12.247 -7.065  -0.555 1.00 36.68 ? 162  HOH A O   1 
HETATM 1388 O O   . HOH C 3 .   ? 18.522 2.206   15.055 0.50 17.71 ? 163  HOH A O   1 
HETATM 1389 O O   A HOH C 3 .   ? 5.299  5.996   20.781 0.50 18.53 ? 164  HOH A O   1 
HETATM 1390 O O   B HOH C 3 .   ? 6.117  6.832   21.581 0.50 14.35 ? 164  HOH A O   1 
HETATM 1391 O O   . HOH C 3 .   ? 18.367 14.379  17.494 0.50 14.61 ? 165  HOH A O   1 
HETATM 1392 O O   . HOH C 3 .   ? 7.413  7.109   20.795 1.00 26.95 ? 166  HOH A O   1 
HETATM 1393 O O   . HOH C 3 .   ? 4.808  -0.080  19.955 1.00 34.89 ? 167  HOH A O   1 
HETATM 1394 O O   . HOH C 3 .   ? -3.972 -0.417  12.125 1.00 48.89 ? 168  HOH A O   1 
HETATM 1395 O O   . HOH C 3 .   ? 9.610  17.663  19.335 1.00 37.88 ? 169  HOH A O   1 
HETATM 1396 O O   . HOH C 3 .   ? -8.281 -3.521  20.516 1.00 41.69 ? 170  HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   1481 ?    ?   ?   A . n 
A 1 2   HIS 2   1482 ?    ?   ?   A . n 
A 1 3   MET 3   1483 ?    ?   ?   A . n 
A 1 4   ASN 4   1484 ?    ?   ?   A . n 
A 1 5   SER 5   1485 1485 SER SER A . n 
A 1 6   PHE 6   1486 1486 PHE PHE A . n 
A 1 7   VAL 7   1487 1487 VAL VAL A . n 
A 1 8   GLY 8   1488 1488 GLY GLY A . n 
A 1 9   LEU 9   1489 1489 LEU LEU A . n 
A 1 10  ARG 10  1490 1490 ARG ARG A . n 
A 1 11  VAL 11  1491 1491 VAL VAL A . n 
A 1 12  VAL 12  1492 1492 VAL VAL A . n 
A 1 13  ALA 13  1493 1493 ALA ALA A . n 
A 1 14  LYS 14  1494 1494 LYS LYS A . n 
A 1 15  TRP 15  1495 1495 TRP TRP A . n 
A 1 16  SER 16  1496 1496 SER SER A . n 
A 1 17  SER 17  1497 1497 SER SER A . n 
A 1 18  ASN 18  1498 1498 ASN ASN A . n 
A 1 19  GLY 19  1499 1499 GLY GLY A . n 
A 1 20  TYR 20  1500 1500 TYR TYR A . n 
A 1 21  PHE 21  1501 1501 PHE PHE A . n 
A 1 22  TYR 22  1502 1502 TYR TYR A . n 
A 1 23  SER 23  1503 1503 SER SER A . n 
A 1 24  GLY 24  1504 1504 GLY GLY A . n 
A 1 25  LYS 25  1505 1505 LYS LYS A . n 
A 1 26  ILE 26  1506 1506 ILE ILE A . n 
A 1 27  THR 27  1507 1507 THR THR A . n 
A 1 28  ARG 28  1508 1508 ARG ARG A . n 
A 1 29  ASP 29  1509 1509 ASP ASP A . n 
A 1 30  VAL 30  1510 1510 VAL VAL A . n 
A 1 31  GLY 31  1511 1511 GLY GLY A . n 
A 1 32  ALA 32  1512 1512 ALA ALA A . n 
A 1 33  GLY 33  1513 1513 GLY GLY A . n 
A 1 34  LYS 34  1514 1514 LYS LYS A . n 
A 1 35  TYR 35  1515 1515 TYR TYR A . n 
A 1 36  LYS 36  1516 1516 LYS LYS A . n 
A 1 37  LEU 37  1517 1517 LEU LEU A . n 
A 1 38  LEU 38  1518 1518 LEU LEU A . n 
A 1 39  PHE 39  1519 1519 PHE PHE A . n 
A 1 40  ASP 40  1520 1520 ASP ASP A . n 
A 1 41  ASP 41  1521 1521 ASP ASP A . n 
A 1 42  GLY 42  1522 1522 GLY GLY A . n 
A 1 43  TYR 43  1523 1523 TYR TYR A . n 
A 1 44  GLU 44  1524 1524 GLU GLU A . n 
A 1 45  CYS 45  1525 1525 CYS CYS A . n 
A 1 46  ASP 46  1526 1526 ASP ASP A . n 
A 1 47  VAL 47  1527 1527 VAL VAL A . n 
A 1 48  LEU 48  1528 1528 LEU LEU A . n 
A 1 49  GLY 49  1529 1529 GLY GLY A . n 
A 1 50  LYS 50  1530 1530 LYS LYS A . n 
A 1 51  ASP 51  1531 1531 ASP ASP A . n 
A 1 52  ILE 52  1532 1532 ILE ILE A . n 
A 1 53  LEU 53  1533 1533 LEU LEU A . n 
A 1 54  LEU 54  1534 1534 LEU LEU A . n 
A 1 55  CYS 55  1535 1535 CYS CYS A . n 
A 1 56  ASP 56  1536 1536 ASP ASP A . n 
A 1 57  PRO 57  1537 1537 PRO PRO A . n 
A 1 58  ILE 58  1538 1538 ILE ILE A . n 
A 1 59  PRO 59  1539 1539 PRO PRO A . n 
A 1 60  LEU 60  1540 1540 LEU LEU A . n 
A 1 61  ASP 61  1541 1541 ASP ASP A . n 
A 1 62  THR 62  1542 1542 THR THR A . n 
A 1 63  GLU 63  1543 1543 GLU GLU A . n 
A 1 64  VAL 64  1544 1544 VAL VAL A . n 
A 1 65  THR 65  1545 1545 THR THR A . n 
A 1 66  ALA 66  1546 1546 ALA ALA A . n 
A 1 67  LEU 67  1547 1547 LEU LEU A . n 
A 1 68  SER 68  1548 1548 SER SER A . n 
A 1 69  GLU 69  1549 1549 GLU GLU A . n 
A 1 70  ASP 70  1550 1550 ASP ASP A . n 
A 1 71  GLU 71  1551 1551 GLU GLU A . n 
A 1 72  TYR 72  1552 1552 TYR TYR A . n 
A 1 73  PHE 73  1553 1553 PHE PHE A . n 
A 1 74  SER 74  1554 1554 SER SER A . n 
A 1 75  ALA 75  1555 1555 ALA ALA A . n 
A 1 76  GLY 76  1556 1556 GLY GLY A . n 
A 1 77  VAL 77  1557 1557 VAL VAL A . n 
A 1 78  VAL 78  1558 1558 VAL VAL A . n 
A 1 79  LYS 79  1559 1559 LYS LYS A . n 
A 1 80  GLY 80  1560 1560 GLY GLY A . n 
A 1 81  HIS 81  1561 1561 HIS HIS A . n 
A 1 82  ARG 82  1562 1562 ARG ARG A . n 
A 1 83  LYS 83  1563 1563 LYS LYS A . n 
A 1 84  GLU 84  1564 1564 GLU GLU A . n 
A 1 85  SER 85  1565 1565 SER SER A . n 
A 1 86  GLY 86  1566 1566 GLY GLY A . n 
A 1 87  GLU 87  1567 1567 GLU GLU A . n 
A 1 88  LEU 88  1568 1568 LEU LEU A . n 
A 1 89  TYR 89  1569 1569 TYR TYR A . n 
A 1 90  TYR 90  1570 1570 TYR TYR A . n 
A 1 91  SER 91  1571 1571 SER SER A . n 
A 1 92  ILE 92  1572 1572 ILE ILE A . n 
A 1 93  GLU 93  1573 1573 GLU GLU A . n 
A 1 94  LYS 94  1574 1574 LYS LYS A . n 
A 1 95  GLU 95  1575 1575 GLU GLU A . n 
A 1 96  GLY 96  1576 1576 GLY GLY A . n 
A 1 97  GLN 97  1577 1577 GLN GLN A . n 
A 1 98  ARG 98  1578 1578 ARG ARG A . n 
A 1 99  LYS 99  1579 1579 LYS LYS A . n 
A 1 100 TRP 100 1580 1580 TRP TRP A . n 
A 1 101 TYR 101 1581 1581 TYR TYR A . n 
A 1 102 LYS 102 1582 1582 LYS LYS A . n 
A 1 103 ARG 103 1583 1583 ARG ARG A . n 
A 1 104 MET 104 1584 1584 MET MET A . n 
A 1 105 ALA 105 1585 1585 ALA ALA A . n 
A 1 106 VAL 106 1586 1586 VAL VAL A . n 
A 1 107 ILE 107 1587 1587 ILE ILE A . n 
A 1 108 LEU 108 1588 1588 LEU LEU A . n 
A 1 109 SER 109 1589 1589 SER SER A . n 
A 1 110 LEU 110 1590 1590 LEU LEU A . n 
A 1 111 GLU 111 1591 1591 GLU GLU A . n 
A 1 112 GLN 112 1592 1592 GLN GLN A . n 
A 1 113 GLY 113 1593 1593 GLY GLY A . n 
A 1 114 ASN 114 1594 1594 ASN ASN A . n 
A 1 115 ARG 115 1595 1595 ARG ARG A . n 
A 1 116 LEU 116 1596 1596 LEU LEU A . n 
A 1 117 ARG 117 1597 1597 ARG ARG A . n 
A 1 118 GLU 118 1598 1598 GLU GLU A . n 
A 1 119 GLN 119 1599 1599 GLN GLN A . n 
A 1 120 TYR 120 1600 1600 TYR TYR A . n 
A 1 121 GLY 121 1601 1601 GLY GLY A . n 
A 1 122 LEU 122 1602 1602 LEU LEU A . n 
A 1 123 GLY 123 1603 1603 GLY GLY A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 SO4 1   201 1   SO4 SO4 A . 
C 3 HOH 1   1   1   HOH HOH A . 
C 3 HOH 2   2   2   HOH HOH A . 
C 3 HOH 3   3   3   HOH HOH A . 
C 3 HOH 4   4   4   HOH HOH A . 
C 3 HOH 5   5   5   HOH HOH A . 
C 3 HOH 6   6   6   HOH HOH A . 
C 3 HOH 7   7   7   HOH HOH A . 
C 3 HOH 8   8   8   HOH HOH A . 
C 3 HOH 9   9   9   HOH HOH A . 
C 3 HOH 10  10  10  HOH HOH A . 
C 3 HOH 11  11  11  HOH HOH A . 
C 3 HOH 12  12  12  HOH HOH A . 
C 3 HOH 13  13  13  HOH HOH A . 
C 3 HOH 14  14  14  HOH HOH A . 
C 3 HOH 15  15  15  HOH HOH A . 
C 3 HOH 16  16  16  HOH HOH A . 
C 3 HOH 17  17  17  HOH HOH A . 
C 3 HOH 18  18  18  HOH HOH A . 
C 3 HOH 19  19  19  HOH HOH A . 
C 3 HOH 20  20  20  HOH HOH A . 
C 3 HOH 21  21  21  HOH HOH A . 
C 3 HOH 22  22  22  HOH HOH A . 
C 3 HOH 23  23  23  HOH HOH A . 
C 3 HOH 24  24  24  HOH HOH A . 
C 3 HOH 25  25  25  HOH HOH A . 
C 3 HOH 26  26  26  HOH HOH A . 
C 3 HOH 27  27  27  HOH HOH A . 
C 3 HOH 28  28  28  HOH HOH A . 
C 3 HOH 29  29  29  HOH HOH A . 
C 3 HOH 30  30  30  HOH HOH A . 
C 3 HOH 31  31  31  HOH HOH A . 
C 3 HOH 32  32  32  HOH HOH A . 
C 3 HOH 33  33  33  HOH HOH A . 
C 3 HOH 34  34  34  HOH HOH A . 
C 3 HOH 35  35  35  HOH HOH A . 
C 3 HOH 36  36  36  HOH HOH A . 
C 3 HOH 37  37  37  HOH HOH A . 
C 3 HOH 38  38  38  HOH HOH A . 
C 3 HOH 39  39  39  HOH HOH A . 
C 3 HOH 40  40  40  HOH HOH A . 
C 3 HOH 41  41  41  HOH HOH A . 
C 3 HOH 42  42  42  HOH HOH A . 
C 3 HOH 43  43  43  HOH HOH A . 
C 3 HOH 44  44  44  HOH HOH A . 
C 3 HOH 45  45  45  HOH HOH A . 
C 3 HOH 46  46  46  HOH HOH A . 
C 3 HOH 47  47  47  HOH HOH A . 
C 3 HOH 48  48  48  HOH HOH A . 
C 3 HOH 49  49  49  HOH HOH A . 
C 3 HOH 50  50  50  HOH HOH A . 
C 3 HOH 51  51  51  HOH HOH A . 
C 3 HOH 52  52  52  HOH HOH A . 
C 3 HOH 53  53  53  HOH HOH A . 
C 3 HOH 54  54  54  HOH HOH A . 
C 3 HOH 55  55  55  HOH HOH A . 
C 3 HOH 56  56  56  HOH HOH A . 
C 3 HOH 57  57  57  HOH HOH A . 
C 3 HOH 58  58  58  HOH HOH A . 
C 3 HOH 59  59  59  HOH HOH A . 
C 3 HOH 60  60  60  HOH HOH A . 
C 3 HOH 61  61  61  HOH HOH A . 
C 3 HOH 62  62  62  HOH HOH A . 
C 3 HOH 63  63  63  HOH HOH A . 
C 3 HOH 64  64  64  HOH HOH A . 
C 3 HOH 65  65  65  HOH HOH A . 
C 3 HOH 66  66  66  HOH HOH A . 
C 3 HOH 67  67  67  HOH HOH A . 
C 3 HOH 68  68  68  HOH HOH A . 
C 3 HOH 69  69  69  HOH HOH A . 
C 3 HOH 70  70  70  HOH HOH A . 
C 3 HOH 71  71  71  HOH HOH A . 
C 3 HOH 72  72  72  HOH HOH A . 
C 3 HOH 73  73  73  HOH HOH A . 
C 3 HOH 74  74  74  HOH HOH A . 
C 3 HOH 75  75  75  HOH HOH A . 
C 3 HOH 76  76  76  HOH HOH A . 
C 3 HOH 77  77  77  HOH HOH A . 
C 3 HOH 78  78  78  HOH HOH A . 
C 3 HOH 79  79  79  HOH HOH A . 
C 3 HOH 80  80  80  HOH HOH A . 
C 3 HOH 81  81  81  HOH HOH A . 
C 3 HOH 82  82  82  HOH HOH A . 
C 3 HOH 83  83  83  HOH HOH A . 
C 3 HOH 84  84  84  HOH HOH A . 
C 3 HOH 85  85  85  HOH HOH A . 
C 3 HOH 86  86  86  HOH HOH A . 
C 3 HOH 87  87  87  HOH HOH A . 
C 3 HOH 88  88  88  HOH HOH A . 
C 3 HOH 89  89  89  HOH HOH A . 
C 3 HOH 90  90  90  HOH HOH A . 
C 3 HOH 91  91  91  HOH HOH A . 
C 3 HOH 92  92  92  HOH HOH A . 
C 3 HOH 93  93  93  HOH HOH A . 
C 3 HOH 94  94  94  HOH HOH A . 
C 3 HOH 95  95  95  HOH HOH A . 
C 3 HOH 96  96  96  HOH HOH A . 
C 3 HOH 97  97  97  HOH HOH A . 
C 3 HOH 98  98  98  HOH HOH A . 
C 3 HOH 99  99  99  HOH HOH A . 
C 3 HOH 100 100 100 HOH HOH A . 
C 3 HOH 101 101 101 HOH HOH A . 
C 3 HOH 102 102 102 HOH HOH A . 
C 3 HOH 103 103 103 HOH HOH A . 
C 3 HOH 104 104 104 HOH HOH A . 
C 3 HOH 105 105 105 HOH HOH A . 
C 3 HOH 106 106 106 HOH HOH A . 
C 3 HOH 107 107 107 HOH HOH A . 
C 3 HOH 108 108 108 HOH HOH A . 
C 3 HOH 109 109 109 HOH HOH A . 
C 3 HOH 110 110 110 HOH HOH A . 
C 3 HOH 111 111 111 HOH HOH A . 
C 3 HOH 112 112 112 HOH HOH A . 
C 3 HOH 113 113 113 HOH HOH A . 
C 3 HOH 114 114 114 HOH HOH A . 
C 3 HOH 115 115 115 HOH HOH A . 
C 3 HOH 116 116 116 HOH HOH A . 
C 3 HOH 117 117 117 HOH HOH A . 
C 3 HOH 118 118 118 HOH HOH A . 
C 3 HOH 119 119 119 HOH HOH A . 
C 3 HOH 120 120 120 HOH HOH A . 
C 3 HOH 121 121 121 HOH HOH A . 
C 3 HOH 122 122 122 HOH HOH A . 
C 3 HOH 123 123 123 HOH HOH A . 
C 3 HOH 124 124 124 HOH HOH A . 
C 3 HOH 125 125 125 HOH HOH A . 
C 3 HOH 126 126 126 HOH HOH A . 
C 3 HOH 127 127 127 HOH HOH A . 
C 3 HOH 128 128 128 HOH HOH A . 
C 3 HOH 129 129 129 HOH HOH A . 
C 3 HOH 130 130 130 HOH HOH A . 
C 3 HOH 131 131 131 HOH HOH A . 
C 3 HOH 132 132 132 HOH HOH A . 
C 3 HOH 133 133 133 HOH HOH A . 
C 3 HOH 134 134 134 HOH HOH A . 
C 3 HOH 135 135 135 HOH HOH A . 
C 3 HOH 136 136 136 HOH HOH A . 
C 3 HOH 137 137 137 HOH HOH A . 
C 3 HOH 138 138 138 HOH HOH A . 
C 3 HOH 139 139 139 HOH HOH A . 
C 3 HOH 140 140 140 HOH HOH A . 
C 3 HOH 141 141 141 HOH HOH A . 
C 3 HOH 142 142 142 HOH HOH A . 
C 3 HOH 143 143 143 HOH HOH A . 
C 3 HOH 144 144 144 HOH HOH A . 
C 3 HOH 145 145 145 HOH HOH A . 
C 3 HOH 146 146 146 HOH HOH A . 
C 3 HOH 147 147 147 HOH HOH A . 
C 3 HOH 148 148 148 HOH HOH A . 
C 3 HOH 149 149 149 HOH HOH A . 
C 3 HOH 150 150 150 HOH HOH A . 
C 3 HOH 151 151 151 HOH HOH A . 
C 3 HOH 152 152 152 HOH HOH A . 
C 3 HOH 153 153 153 HOH HOH A . 
C 3 HOH 154 154 154 HOH HOH A . 
C 3 HOH 155 155 155 HOH HOH A . 
C 3 HOH 156 156 156 HOH HOH A . 
C 3 HOH 157 157 157 HOH HOH A . 
C 3 HOH 158 158 158 HOH HOH A . 
C 3 HOH 159 159 159 HOH HOH A . 
C 3 HOH 160 160 160 HOH HOH A . 
C 3 HOH 161 161 161 HOH HOH A . 
C 3 HOH 162 162 162 HOH HOH A . 
C 3 HOH 163 163 163 HOH HOH A . 
C 3 HOH 164 164 164 HOH HOH A . 
C 3 HOH 165 165 165 HOH HOH A . 
C 3 HOH 166 166 166 HOH HOH A . 
C 3 HOH 167 167 167 HOH HOH A . 
C 3 HOH 168 168 168 HOH HOH A . 
C 3 HOH 169 169 169 HOH HOH A . 
C 3 HOH 170 170 170 HOH HOH A . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PQS  monomeric 1 
2 software_defined_assembly            PISA dimeric   2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,C 
2 1,2 A,B,C 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
2 'ABSA (A^2)' 1570  ? 
2 MORE         -36   ? 
2 'SSA (A^2)'  12920 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 2_656 -x+1,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 37.1027188968 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 31.1154731755 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     116 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   C 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-01-02 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Derived calculations'      
4 3 'Structure model' 'Version format compliance' 
# 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         6.5910 
_pdbx_refine_tls.origin_y         0.7190 
_pdbx_refine_tls.origin_z         11.6290 
_pdbx_refine_tls.T[1][1]          -0.0460 
_pdbx_refine_tls.T[2][2]          -0.0023 
_pdbx_refine_tls.T[3][3]          -0.0258 
_pdbx_refine_tls.T[1][2]          0.0059 
_pdbx_refine_tls.T[1][3]          0.0061 
_pdbx_refine_tls.T[2][3]          0.0004 
_pdbx_refine_tls.L[1][1]          1.2207 
_pdbx_refine_tls.L[2][2]          1.5968 
_pdbx_refine_tls.L[3][3]          1.2624 
_pdbx_refine_tls.L[1][2]          0.4828 
_pdbx_refine_tls.L[1][3]          0.5216 
_pdbx_refine_tls.L[2][3]          0.3283 
_pdbx_refine_tls.S[1][1]          0.0167 
_pdbx_refine_tls.S[1][2]          -0.0563 
_pdbx_refine_tls.S[1][3]          -0.0657 
_pdbx_refine_tls.S[2][1]          0.0275 
_pdbx_refine_tls.S[2][2]          -0.0010 
_pdbx_refine_tls.S[2][3]          0.0588 
_pdbx_refine_tls.S[3][1]          0.0993 
_pdbx_refine_tls.S[3][2]          -0.0381 
_pdbx_refine_tls.S[3][3]          -0.0157 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
# 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    A 
_pdbx_refine_tls_group.beg_auth_seq_id     1485 
_pdbx_refine_tls_group.beg_label_asym_id   A 
_pdbx_refine_tls_group.beg_label_seq_id    5 
_pdbx_refine_tls_group.end_auth_asym_id    A 
_pdbx_refine_tls_group.end_auth_seq_id     1603 
_pdbx_refine_tls_group.end_label_asym_id   A 
_pdbx_refine_tls_group.end_label_seq_id    123 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.selection_details   ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.2.0005 ? 1 
HKL-2000  'data reduction' .        ? 2 
SCALEPACK 'data scaling'   .        ? 3 
MOLREP    phasing          .        ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 NH1 A ARG 1490 ? ? O A HOH 167  ? ? 1.65 
2 1 NH1 A ARG 1562 ? A O A HOH 74   ? ? 1.86 
3 1 OD1 A ASP 1521 ? B N A TYR 1523 ? ? 2.14 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O   A HOH 74   ? ? 1_555 O A HOH 74 ? ? 2_656 1.48 
2 1 OE2 A GLU 1549 ? ? 1_555 O A HOH 84 ? ? 4_556 2.14 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    SER 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     1565 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             37.47 
_pdbx_validate_torsion.psi             37.68 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY 1481 ? A GLY 1 
2 1 Y 1 A HIS 1482 ? A HIS 2 
3 1 Y 1 A MET 1483 ? A MET 3 
4 1 Y 1 A ASN 1484 ? A ASN 4 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION' SO4 
3 water         HOH 
#