data_2G9A
# 
_entry.id   2G9A 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2G9A         
RCSB  RCSB036849   
WWPDB D_1000036849 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2G99 
_pdbx_database_related.details        'The same complex crystallized in a differrent spacegroup' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2G9A 
_pdbx_database_status.recvd_initial_deposition_date   2006-03-06 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chai, J.' 1 
'Han, Z.'  2 
'Wang, H.' 3 
'Shen, Y.' 4 
# 
_citation.id                        primary 
_citation.title                     
'Structural basis for the specific recognition of methylated histone H3 lysine 4 by the WD-40 protein WDR5' 
_citation.journal_abbrev            'To be published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chai, J.' 1 
primary 'Han, Z.'  2 
primary 'Wang, H.' 3 
primary 'Shen, Y.' 4 
# 
_cell.entry_id           2G9A 
_cell.length_a           46.654 
_cell.length_b           81.192 
_cell.length_c           99.408 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2G9A 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'WD-repeat protein 5' 34101.688 1 ? ? 
;'residues 24-334
;
? 
2 polymer syn 'Histone H3'          1204.424  1 ? ? ?                  ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'BMP2-induced 3-kb gene protein, WD-repeat protein BIG-3, WDR5' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;GPLGSTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLV
SASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDG
SLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIF
ANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
;
;GPLGSTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLV
SASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDG
SLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIF
ANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
;
A ? 
2 'polypeptide(L)' no yes 'ART(MLY)QTAR(MLY)S' ARTKQTARKS B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   LEU n 
1 4   GLY n 
1 5   SER n 
1 6   THR n 
1 7   PRO n 
1 8   VAL n 
1 9   LYS n 
1 10  PRO n 
1 11  ASN n 
1 12  TYR n 
1 13  ALA n 
1 14  LEU n 
1 15  LYS n 
1 16  PHE n 
1 17  THR n 
1 18  LEU n 
1 19  ALA n 
1 20  GLY n 
1 21  HIS n 
1 22  THR n 
1 23  LYS n 
1 24  ALA n 
1 25  VAL n 
1 26  SER n 
1 27  SER n 
1 28  VAL n 
1 29  LYS n 
1 30  PHE n 
1 31  SER n 
1 32  PRO n 
1 33  ASN n 
1 34  GLY n 
1 35  GLU n 
1 36  TRP n 
1 37  LEU n 
1 38  ALA n 
1 39  SER n 
1 40  SER n 
1 41  SER n 
1 42  ALA n 
1 43  ASP n 
1 44  LYS n 
1 45  LEU n 
1 46  ILE n 
1 47  LYS n 
1 48  ILE n 
1 49  TRP n 
1 50  GLY n 
1 51  ALA n 
1 52  TYR n 
1 53  ASP n 
1 54  GLY n 
1 55  LYS n 
1 56  PHE n 
1 57  GLU n 
1 58  LYS n 
1 59  THR n 
1 60  ILE n 
1 61  SER n 
1 62  GLY n 
1 63  HIS n 
1 64  LYS n 
1 65  LEU n 
1 66  GLY n 
1 67  ILE n 
1 68  SER n 
1 69  ASP n 
1 70  VAL n 
1 71  ALA n 
1 72  TRP n 
1 73  SER n 
1 74  SER n 
1 75  ASP n 
1 76  SER n 
1 77  ASN n 
1 78  LEU n 
1 79  LEU n 
1 80  VAL n 
1 81  SER n 
1 82  ALA n 
1 83  SER n 
1 84  ASP n 
1 85  ASP n 
1 86  LYS n 
1 87  THR n 
1 88  LEU n 
1 89  LYS n 
1 90  ILE n 
1 91  TRP n 
1 92  ASP n 
1 93  VAL n 
1 94  SER n 
1 95  SER n 
1 96  GLY n 
1 97  LYS n 
1 98  CYS n 
1 99  LEU n 
1 100 LYS n 
1 101 THR n 
1 102 LEU n 
1 103 LYS n 
1 104 GLY n 
1 105 HIS n 
1 106 SER n 
1 107 ASN n 
1 108 TYR n 
1 109 VAL n 
1 110 PHE n 
1 111 CYS n 
1 112 CYS n 
1 113 ASN n 
1 114 PHE n 
1 115 ASN n 
1 116 PRO n 
1 117 GLN n 
1 118 SER n 
1 119 ASN n 
1 120 LEU n 
1 121 ILE n 
1 122 VAL n 
1 123 SER n 
1 124 GLY n 
1 125 SER n 
1 126 PHE n 
1 127 ASP n 
1 128 GLU n 
1 129 SER n 
1 130 VAL n 
1 131 ARG n 
1 132 ILE n 
1 133 TRP n 
1 134 ASP n 
1 135 VAL n 
1 136 LYS n 
1 137 THR n 
1 138 GLY n 
1 139 LYS n 
1 140 CYS n 
1 141 LEU n 
1 142 LYS n 
1 143 THR n 
1 144 LEU n 
1 145 PRO n 
1 146 ALA n 
1 147 HIS n 
1 148 SER n 
1 149 ASP n 
1 150 PRO n 
1 151 VAL n 
1 152 SER n 
1 153 ALA n 
1 154 VAL n 
1 155 HIS n 
1 156 PHE n 
1 157 ASN n 
1 158 ARG n 
1 159 ASP n 
1 160 GLY n 
1 161 SER n 
1 162 LEU n 
1 163 ILE n 
1 164 VAL n 
1 165 SER n 
1 166 SER n 
1 167 SER n 
1 168 TYR n 
1 169 ASP n 
1 170 GLY n 
1 171 LEU n 
1 172 CYS n 
1 173 ARG n 
1 174 ILE n 
1 175 TRP n 
1 176 ASP n 
1 177 THR n 
1 178 ALA n 
1 179 SER n 
1 180 GLY n 
1 181 GLN n 
1 182 CYS n 
1 183 LEU n 
1 184 LYS n 
1 185 THR n 
1 186 LEU n 
1 187 ILE n 
1 188 ASP n 
1 189 ASP n 
1 190 ASP n 
1 191 ASN n 
1 192 PRO n 
1 193 PRO n 
1 194 VAL n 
1 195 SER n 
1 196 PHE n 
1 197 VAL n 
1 198 LYS n 
1 199 PHE n 
1 200 SER n 
1 201 PRO n 
1 202 ASN n 
1 203 GLY n 
1 204 LYS n 
1 205 TYR n 
1 206 ILE n 
1 207 LEU n 
1 208 ALA n 
1 209 ALA n 
1 210 THR n 
1 211 LEU n 
1 212 ASP n 
1 213 ASN n 
1 214 THR n 
1 215 LEU n 
1 216 LYS n 
1 217 LEU n 
1 218 TRP n 
1 219 ASP n 
1 220 TYR n 
1 221 SER n 
1 222 LYS n 
1 223 GLY n 
1 224 LYS n 
1 225 CYS n 
1 226 LEU n 
1 227 LYS n 
1 228 THR n 
1 229 TYR n 
1 230 THR n 
1 231 GLY n 
1 232 HIS n 
1 233 LYS n 
1 234 ASN n 
1 235 GLU n 
1 236 LYS n 
1 237 TYR n 
1 238 CYS n 
1 239 ILE n 
1 240 PHE n 
1 241 ALA n 
1 242 ASN n 
1 243 PHE n 
1 244 SER n 
1 245 VAL n 
1 246 THR n 
1 247 GLY n 
1 248 GLY n 
1 249 LYS n 
1 250 TRP n 
1 251 ILE n 
1 252 VAL n 
1 253 SER n 
1 254 GLY n 
1 255 SER n 
1 256 GLU n 
1 257 ASP n 
1 258 ASN n 
1 259 LEU n 
1 260 VAL n 
1 261 TYR n 
1 262 ILE n 
1 263 TRP n 
1 264 ASN n 
1 265 LEU n 
1 266 GLN n 
1 267 THR n 
1 268 LYS n 
1 269 GLU n 
1 270 ILE n 
1 271 VAL n 
1 272 GLN n 
1 273 LYS n 
1 274 LEU n 
1 275 GLN n 
1 276 GLY n 
1 277 HIS n 
1 278 THR n 
1 279 ASP n 
1 280 VAL n 
1 281 VAL n 
1 282 ILE n 
1 283 SER n 
1 284 THR n 
1 285 ALA n 
1 286 CYS n 
1 287 HIS n 
1 288 PRO n 
1 289 THR n 
1 290 GLU n 
1 291 ASN n 
1 292 ILE n 
1 293 ILE n 
1 294 ALA n 
1 295 SER n 
1 296 ALA n 
1 297 ALA n 
1 298 LEU n 
1 299 GLU n 
1 300 ASN n 
1 301 ASP n 
1 302 LYS n 
1 303 THR n 
1 304 ILE n 
1 305 LYS n 
1 306 LEU n 
1 307 TRP n 
1 308 LYS n 
1 309 SER n 
1 310 ASP n 
1 311 CYS n 
2 1   ALA n 
2 2   ARG n 
2 3   THR n 
2 4   MLY n 
2 5   GLN n 
2 6   THR n 
2 7   ALA n 
2 8   ARG n 
2 9   MLY n 
2 10  SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'The dimethylated tail of histone H3 is chemically synthesized' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP WDR5_HUMAN P61964 1 
;TPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDD
KTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVS
SSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSV
TGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
;
29 ? 
2 PDB 2G9A       2G9A   2 ? ?  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2G9A A 6 ? 311 ? P61964 29 ? 334 ? 29 334 
2 2 2G9A B 1 ? 10  ? 2G9A   1  ? 10  ? 1  10  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2G9A GLY A 1 ? UNP P61964 ? ? 'CLONING ARTIFACT' 24 1 
1 2G9A PRO A 2 ? UNP P61964 ? ? 'CLONING ARTIFACT' 25 2 
1 2G9A LEU A 3 ? UNP P61964 ? ? 'CLONING ARTIFACT' 26 3 
1 2G9A GLY A 4 ? UNP P61964 ? ? 'CLONING ARTIFACT' 27 4 
1 2G9A SER A 5 ? UNP P61964 ? ? 'CLONING ARTIFACT' 28 5 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE           ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE        ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE          ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE         ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE         ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE        ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE           ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ? 'C6 H15 N2 O2 1' 147.195 
MLY 'L-peptide linking' n N-DIMETHYL-LYSINE ? 'C8 H18 N2 O2'   174.241 
PHE 'L-peptide linking' y PHENYLALANINE     ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE           ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE            ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE         ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN        ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE          ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2G9A 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.67 
_exptl_crystal.density_percent_sol   53.85 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'20% PEG, 0.2M ammonium acetate, 100mM HEPES, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           180 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2005-08-09 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'YALE MIRRORS' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU300' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     2G9A 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   1.0 
_reflns.d_resolution_low             99.0 
_reflns.d_resolution_high            2.7 
_reflns.number_obs                   10817 
_reflns.number_all                   11106 
_reflns.percent_possible_obs         97.4 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.7 
_reflns_shell.d_res_low              2.8 
_reflns_shell.percent_possible_all   95.2 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2G9A 
_refine.ls_number_reflns_obs                     10646 
_refine.ls_number_reflns_all                     10865 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20 
_refine.ls_d_res_high                            2.7 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.234 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.234 
_refine.ls_R_factor_R_free                       0.286 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  864 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB code 1VYH' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2436 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               2436 
_refine_hist.d_res_high                       2.7 
_refine_hist.d_res_low                        20 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.008 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.69  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  2G9A 
_struct.title                     
'Structural basis for the specific recognition of methylated histone H3 lysine 4 by the WD-40 protein WDR5' 
_struct.pdbx_descriptor           'WD-repeat protein 5, Histone H3' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2G9A 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN/DNA BINDING PROTEIN' 
_struct_keywords.text            'WD40 repeat protein, STRUCTURAL PROTEIN-DNA BINDING PROTEIN COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? B THR 3 C ? ? ? 1_555 B MLY 4 N ? ? B THR 3 B MLY 4 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale2 covale ? ? B MLY 4 C ? ? ? 1_555 B GLN 5 N ? ? B MLY 4 B GLN 5 1_555 ? ? ? ? ? ? ? 1.334 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 4 ? 
D ? 4 ? 
E ? 4 ? 
F ? 4 ? 
G ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ALA A 13  ? LEU A 18  ? ALA A 36  LEU A 41  
A 2 ILE A 304 ? LYS A 308 ? ILE A 327 LYS A 331 
A 3 ILE A 292 ? ALA A 297 ? ILE A 315 ALA A 320 
A 4 VAL A 281 ? CYS A 286 ? VAL A 304 CYS A 309 
B 1 VAL A 25  ? PHE A 30  ? VAL A 48  PHE A 53  
B 2 TRP A 36  ? SER A 41  ? TRP A 59  SER A 64  
B 3 LEU A 45  ? GLY A 50  ? LEU A 68  GLY A 73  
B 4 PHE A 56  ? SER A 61  ? PHE A 79  SER A 84  
C 1 ILE A 67  ? TRP A 72  ? ILE A 90  TRP A 95  
C 2 LEU A 78  ? SER A 83  ? LEU A 101 SER A 106 
C 3 LEU A 88  ? ASP A 92  ? LEU A 111 ASP A 115 
C 4 CYS A 98  ? LEU A 102 ? CYS A 121 LEU A 125 
D 1 VAL A 109 ? PHE A 114 ? VAL A 132 PHE A 137 
D 2 LEU A 120 ? SER A 125 ? LEU A 143 SER A 148 
D 3 VAL A 130 ? ASP A 134 ? VAL A 153 ASP A 157 
D 4 CYS A 140 ? LEU A 144 ? CYS A 163 LEU A 167 
E 1 VAL A 151 ? PHE A 156 ? VAL A 174 PHE A 179 
E 2 LEU A 162 ? SER A 167 ? LEU A 185 SER A 190 
E 3 CYS A 172 ? ASP A 176 ? CYS A 195 ASP A 199 
E 4 CYS A 182 ? LEU A 186 ? CYS A 205 LEU A 209 
F 1 VAL A 194 ? PHE A 199 ? VAL A 217 PHE A 222 
F 2 TYR A 205 ? THR A 210 ? TYR A 228 THR A 233 
F 3 THR A 214 ? ASP A 219 ? THR A 237 ASP A 242 
F 4 LYS A 224 ? TYR A 229 ? LYS A 247 TYR A 252 
G 1 ALA A 241 ? SER A 244 ? ALA A 264 SER A 267 
G 2 TRP A 250 ? GLY A 254 ? TRP A 273 GLY A 277 
G 3 VAL A 260 ? ASN A 264 ? VAL A 283 ASN A 287 
G 4 ILE A 270 ? LEU A 274 ? ILE A 293 LEU A 297 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 18  ? N LEU A 41  O ILE A 304 ? O ILE A 327 
A 2 3 O TRP A 307 ? O TRP A 330 N ILE A 293 ? N ILE A 316 
A 3 4 O ALA A 296 ? O ALA A 319 N SER A 283 ? N SER A 306 
B 1 2 N LYS A 29  ? N LYS A 52  O ALA A 38  ? O ALA A 61  
B 2 3 N LEU A 37  ? N LEU A 60  O TRP A 49  ? O TRP A 72  
B 3 4 N ILE A 48  ? N ILE A 71  O GLU A 57  ? O GLU A 80  
C 1 2 N ALA A 71  ? N ALA A 94  O VAL A 80  ? O VAL A 103 
C 2 3 N LEU A 79  ? N LEU A 102 O TRP A 91  ? O TRP A 114 
C 3 4 N ILE A 90  ? N ILE A 113 O LYS A 100 ? O LYS A 123 
D 1 2 N CYS A 111 ? N CYS A 134 O GLY A 124 ? O GLY A 147 
D 2 3 N ILE A 121 ? N ILE A 144 O TRP A 133 ? O TRP A 156 
D 3 4 N VAL A 130 ? N VAL A 153 O LEU A 144 ? O LEU A 167 
E 1 2 N HIS A 155 ? N HIS A 178 O VAL A 164 ? O VAL A 187 
E 2 3 N ILE A 163 ? N ILE A 186 O TRP A 175 ? O TRP A 198 
E 3 4 N ILE A 174 ? N ILE A 197 O LEU A 183 ? O LEU A 206 
F 1 2 N LYS A 198 ? N LYS A 221 O LEU A 207 ? O LEU A 230 
F 2 3 N ALA A 208 ? N ALA A 231 O LYS A 216 ? O LYS A 239 
F 3 4 N LEU A 215 ? N LEU A 238 O TYR A 229 ? O TYR A 252 
G 1 2 N ASN A 242 ? N ASN A 265 O VAL A 252 ? O VAL A 275 
G 2 3 N SER A 253 ? N SER A 276 O TYR A 261 ? O TYR A 284 
G 3 4 N ILE A 262 ? N ILE A 285 O VAL A 271 ? O VAL A 294 
# 
_database_PDB_matrix.entry_id          2G9A 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2G9A 
_atom_sites.fract_transf_matrix[1][1]   0.021434 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012316 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010060 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLY A 1 1   ? 1.484   -11.183 -3.589 1.00 35.67 ? 24  GLY A N   1 
ATOM   2    C CA  . GLY A 1 1   ? 1.791   -9.847  -4.176 1.00 35.92 ? 24  GLY A CA  1 
ATOM   3    C C   . GLY A 1 1   ? 3.141   -9.806  -4.880 1.00 36.38 ? 24  GLY A C   1 
ATOM   4    O O   . GLY A 1 1   ? 3.704   -10.856 -5.162 1.00 35.12 ? 24  GLY A O   1 
ATOM   5    N N   . PRO A 1 2   ? 3.712   -8.603  -5.117 1.00 37.18 ? 25  PRO A N   1 
ATOM   6    C CA  . PRO A 1 2   ? 4.991   -8.281  -5.771 1.00 38.09 ? 25  PRO A CA  1 
ATOM   7    C C   . PRO A 1 2   ? 6.197   -9.202  -5.550 1.00 39.83 ? 25  PRO A C   1 
ATOM   8    O O   . PRO A 1 2   ? 6.978   -9.431  -6.466 1.00 42.78 ? 25  PRO A O   1 
ATOM   9    C CB  . PRO A 1 2   ? 5.246   -6.828  -5.360 1.00 35.69 ? 25  PRO A CB  1 
ATOM   10   C CG  . PRO A 1 2   ? 4.091   -6.450  -4.459 1.00 36.13 ? 25  PRO A CG  1 
ATOM   11   C CD  . PRO A 1 2   ? 2.978   -7.357  -4.850 1.00 36.93 ? 25  PRO A CD  1 
ATOM   12   N N   . LEU A 1 3   ? 6.386   -9.745  -4.354 1.00 38.97 ? 26  LEU A N   1 
ATOM   13   C CA  . LEU A 1 3   ? 7.520   -10.676 -4.168 1.00 39.54 ? 26  LEU A CA  1 
ATOM   14   C C   . LEU A 1 3   ? 7.016   -12.052 -4.551 1.00 40.09 ? 26  LEU A C   1 
ATOM   15   O O   . LEU A 1 3   ? 5.826   -12.315 -4.491 1.00 40.34 ? 26  LEU A O   1 
ATOM   16   C CB  . LEU A 1 3   ? 8.003   -10.665 -2.701 1.00 36.10 ? 26  LEU A CB  1 
ATOM   17   C CG  . LEU A 1 3   ? 8.686   -9.366  -2.214 1.00 37.03 ? 26  LEU A CG  1 
ATOM   18   C CD1 . LEU A 1 3   ? 8.698   -9.347  -0.685 1.00 34.73 ? 26  LEU A CD1 1 
ATOM   19   C CD2 . LEU A 1 3   ? 10.119  -9.222  -2.758 1.00 33.78 ? 26  LEU A CD2 1 
ATOM   20   N N   . GLY A 1 4   ? 7.924   -12.926 -4.947 1.00 40.98 ? 27  GLY A N   1 
ATOM   21   C CA  . GLY A 1 4   ? 7.515   -14.258 -5.355 1.00 42.82 ? 27  GLY A CA  1 
ATOM   22   C C   . GLY A 1 4   ? 6.131   -14.814 -4.976 1.00 43.40 ? 27  GLY A C   1 
ATOM   23   O O   . GLY A 1 4   ? 5.062   -14.255 -5.275 1.00 43.48 ? 27  GLY A O   1 
ATOM   24   N N   . SER A 1 5   ? 6.200   -15.976 -4.341 1.00 41.88 ? 28  SER A N   1 
ATOM   25   C CA  . SER A 1 5   ? 5.082   -16.789 -3.879 1.00 38.52 ? 28  SER A CA  1 
ATOM   26   C C   . SER A 1 5   ? 5.958   -17.922 -3.339 1.00 38.59 ? 28  SER A C   1 
ATOM   27   O O   . SER A 1 5   ? 5.510   -18.876 -2.689 1.00 37.55 ? 28  SER A O   1 
ATOM   28   C CB  . SER A 1 5   ? 4.229   -17.255 -5.072 1.00 35.38 ? 28  SER A CB  1 
ATOM   29   O OG  . SER A 1 5   ? 3.363   -18.313 -4.717 1.00 30.75 ? 28  SER A OG  1 
ATOM   30   N N   . THR A 1 6   ? 7.242   -17.747 -3.656 1.00 38.55 ? 29  THR A N   1 
ATOM   31   C CA  . THR A 1 6   ? 8.351   -18.597 -3.261 1.00 38.00 ? 29  THR A CA  1 
ATOM   32   C C   . THR A 1 6   ? 9.543   -17.641 -3.159 1.00 35.15 ? 29  THR A C   1 
ATOM   33   O O   . THR A 1 6   ? 10.601  -17.901 -3.721 1.00 35.37 ? 29  THR A O   1 
ATOM   34   C CB  . THR A 1 6   ? 8.680   -19.669 -4.322 1.00 40.17 ? 29  THR A CB  1 
ATOM   35   O OG1 . THR A 1 6   ? 7.518   -20.461 -4.586 1.00 45.81 ? 29  THR A OG1 1 
ATOM   36   C CG2 . THR A 1 6   ? 9.780   -20.596 -3.821 1.00 41.15 ? 29  THR A CG2 1 
ATOM   37   N N   . PRO A 1 7   ? 9.373   -16.505 -2.451 1.00 32.99 ? 30  PRO A N   1 
ATOM   38   C CA  . PRO A 1 7   ? 10.421  -15.494 -2.262 1.00 31.13 ? 30  PRO A CA  1 
ATOM   39   C C   . PRO A 1 7   ? 11.488  -15.996 -1.315 1.00 29.94 ? 30  PRO A C   1 
ATOM   40   O O   . PRO A 1 7   ? 11.256  -16.940 -0.575 1.00 30.19 ? 30  PRO A O   1 
ATOM   41   C CB  . PRO A 1 7   ? 9.663   -14.330 -1.650 1.00 32.06 ? 30  PRO A CB  1 
ATOM   42   C CG  . PRO A 1 7   ? 8.696   -15.036 -0.781 1.00 32.58 ? 30  PRO A CG  1 
ATOM   43   C CD  . PRO A 1 7   ? 8.161   -16.111 -1.709 1.00 31.35 ? 30  PRO A CD  1 
ATOM   44   N N   . VAL A 1 8   ? 12.649  -15.357 -1.327 1.00 29.51 ? 31  VAL A N   1 
ATOM   45   C CA  . VAL A 1 8   ? 13.737  -15.761 -0.443 1.00 30.58 ? 31  VAL A CA  1 
ATOM   46   C C   . VAL A 1 8   ? 13.346  -15.497 1.016  1.00 32.12 ? 31  VAL A C   1 
ATOM   47   O O   . VAL A 1 8   ? 13.516  -16.353 1.893  1.00 30.65 ? 31  VAL A O   1 
ATOM   48   C CB  . VAL A 1 8   ? 15.048  -14.993 -0.797 1.00 31.26 ? 31  VAL A CB  1 
ATOM   49   C CG1 . VAL A 1 8   ? 16.034  -15.066 0.362  1.00 28.14 ? 31  VAL A CG1 1 
ATOM   50   C CG2 . VAL A 1 8   ? 15.677  -15.581 -2.077 1.00 27.49 ? 31  VAL A CG2 1 
ATOM   51   N N   . LYS A 1 9   ? 12.816  -14.301 1.253  1.00 33.85 ? 32  LYS A N   1 
ATOM   52   C CA  . LYS A 1 9   ? 12.378  -13.860 2.569  1.00 35.58 ? 32  LYS A CA  1 
ATOM   53   C C   . LYS A 1 9   ? 11.292  -12.831 2.323  1.00 37.55 ? 32  LYS A C   1 
ATOM   54   O O   . LYS A 1 9   ? 11.324  -12.134 1.315  1.00 39.03 ? 32  LYS A O   1 
ATOM   55   C CB  . LYS A 1 9   ? 13.531  -13.190 3.325  1.00 37.05 ? 32  LYS A CB  1 
ATOM   56   C CG  . LYS A 1 9   ? 14.706  -14.102 3.650  1.00 39.61 ? 32  LYS A CG  1 
ATOM   57   C CD  . LYS A 1 9   ? 15.718  -13.375 4.505  1.00 41.03 ? 32  LYS A CD  1 
ATOM   58   C CE  . LYS A 1 9   ? 16.717  -14.349 5.142  1.00 43.49 ? 32  LYS A CE  1 
ATOM   59   N NZ  . LYS A 1 9   ? 17.599  -13.682 6.166  1.00 41.62 ? 32  LYS A NZ  1 
ATOM   60   N N   . PRO A 1 10  ? 10.296  -12.738 3.216  1.00 39.02 ? 33  PRO A N   1 
ATOM   61   C CA  . PRO A 1 10  ? 9.241   -11.740 3.001  1.00 38.49 ? 33  PRO A CA  1 
ATOM   62   C C   . PRO A 1 10  ? 9.598   -10.441 3.741  1.00 39.43 ? 33  PRO A C   1 
ATOM   63   O O   . PRO A 1 10  ? 10.600  -10.396 4.460  1.00 40.26 ? 33  PRO A O   1 
ATOM   64   C CB  . PRO A 1 10  ? 8.008   -12.426 3.577  1.00 38.58 ? 33  PRO A CB  1 
ATOM   65   C CG  . PRO A 1 10  ? 8.561   -13.153 4.744  1.00 38.97 ? 33  PRO A CG  1 
ATOM   66   C CD  . PRO A 1 10  ? 9.870   -13.743 4.207  1.00 39.87 ? 33  PRO A CD  1 
ATOM   67   N N   . ASN A 1 11  ? 8.813   -9.382  3.553  1.00 39.25 ? 34  ASN A N   1 
ATOM   68   C CA  . ASN A 1 11  ? 9.098   -8.127  4.249  1.00 38.60 ? 34  ASN A CA  1 
ATOM   69   C C   . ASN A 1 11  ? 7.899   -7.611  5.031  1.00 36.62 ? 34  ASN A C   1 
ATOM   70   O O   . ASN A 1 11  ? 7.456   -6.483  4.840  1.00 35.54 ? 34  ASN A O   1 
ATOM   71   C CB  . ASN A 1 11  ? 9.586   -7.027  3.288  1.00 40.90 ? 34  ASN A CB  1 
ATOM   72   C CG  . ASN A 1 11  ? 8.553   -6.659  2.211  1.00 43.28 ? 34  ASN A CG  1 
ATOM   73   O OD1 . ASN A 1 11  ? 7.336   -6.627  2.457  1.00 43.88 ? 34  ASN A OD1 1 
ATOM   74   N ND2 . ASN A 1 11  ? 9.048   -6.356  1.013  1.00 42.01 ? 34  ASN A ND2 1 
ATOM   75   N N   . TYR A 1 12  ? 7.376   -8.447  5.917  1.00 35.03 ? 35  TYR A N   1 
ATOM   76   C CA  . TYR A 1 12  ? 6.249   -8.048  6.738  1.00 32.64 ? 35  TYR A CA  1 
ATOM   77   C C   . TYR A 1 12  ? 6.581   -6.742  7.437  1.00 32.63 ? 35  TYR A C   1 
ATOM   78   O O   . TYR A 1 12  ? 7.707   -6.546  7.915  1.00 32.25 ? 35  TYR A O   1 
ATOM   79   C CB  . TYR A 1 12  ? 5.929   -9.128  7.770  1.00 29.08 ? 35  TYR A CB  1 
ATOM   80   C CG  . TYR A 1 12  ? 5.012   -10.182 7.216  1.00 26.80 ? 35  TYR A CG  1 
ATOM   81   C CD1 . TYR A 1 12  ? 5.512   -11.340 6.626  1.00 24.08 ? 35  TYR A CD1 1 
ATOM   82   C CD2 . TYR A 1 12  ? 3.635   -9.977  7.209  1.00 25.28 ? 35  TYR A CD2 1 
ATOM   83   C CE1 . TYR A 1 12  ? 4.661   -12.265 6.030  1.00 23.94 ? 35  TYR A CE1 1 
ATOM   84   C CE2 . TYR A 1 12  ? 2.779   -10.886 6.621  1.00 26.73 ? 35  TYR A CE2 1 
ATOM   85   C CZ  . TYR A 1 12  ? 3.294   -12.024 6.027  1.00 22.88 ? 35  TYR A CZ  1 
ATOM   86   O OH  . TYR A 1 12  ? 2.429   -12.864 5.366  1.00 18.50 ? 35  TYR A OH  1 
ATOM   87   N N   . ALA A 1 13  ? 5.603   -5.843  7.489  1.00 30.51 ? 36  ALA A N   1 
ATOM   88   C CA  . ALA A 1 13  ? 5.809   -4.556  8.127  1.00 28.93 ? 36  ALA A CA  1 
ATOM   89   C C   . ALA A 1 13  ? 4.564   -4.084  8.849  1.00 28.81 ? 36  ALA A C   1 
ATOM   90   O O   . ALA A 1 13  ? 3.444   -4.217  8.355  1.00 29.33 ? 36  ALA A O   1 
ATOM   91   C CB  . ALA A 1 13  ? 6.239   -3.530  7.104  1.00 27.98 ? 36  ALA A CB  1 
ATOM   92   N N   . LEU A 1 14  ? 4.781   -3.513  10.023 1.00 27.66 ? 37  LEU A N   1 
ATOM   93   C CA  . LEU A 1 14  ? 3.700   -3.023  10.852 1.00 27.51 ? 37  LEU A CA  1 
ATOM   94   C C   . LEU A 1 14  ? 2.795   -2.047  10.125 1.00 27.70 ? 37  LEU A C   1 
ATOM   95   O O   . LEU A 1 14  ? 3.276   -1.123  9.476  1.00 28.89 ? 37  LEU A O   1 
ATOM   96   C CB  . LEU A 1 14  ? 4.278   -2.346  12.094 1.00 26.91 ? 37  LEU A CB  1 
ATOM   97   C CG  . LEU A 1 14  ? 3.230   -1.881  13.103 1.00 24.58 ? 37  LEU A CG  1 
ATOM   98   C CD1 . LEU A 1 14  ? 2.356   -3.053  13.501 1.00 23.24 ? 37  LEU A CD1 1 
ATOM   99   C CD2 . LEU A 1 14  ? 3.924   -1.293  14.314 1.00 24.07 ? 37  LEU A CD2 1 
ATOM   100  N N   . LYS A 1 15  ? 1.485   -2.245  10.238 1.00 27.06 ? 38  LYS A N   1 
ATOM   101  C CA  . LYS A 1 15  ? 0.538   -1.336  9.602  1.00 26.26 ? 38  LYS A CA  1 
ATOM   102  C C   . LYS A 1 15  ? -0.449  -0.800  10.617 1.00 23.97 ? 38  LYS A C   1 
ATOM   103  O O   . LYS A 1 15  ? -0.972  0.294   10.448 1.00 23.89 ? 38  LYS A O   1 
ATOM   104  C CB  . LYS A 1 15  ? -0.224  -2.028  8.472  1.00 27.53 ? 38  LYS A CB  1 
ATOM   105  C CG  . LYS A 1 15  ? 0.660   -2.541  7.356  1.00 30.47 ? 38  LYS A CG  1 
ATOM   106  C CD  . LYS A 1 15  ? 1.410   -1.413  6.660  1.00 33.79 ? 38  LYS A CD  1 
ATOM   107  C CE  . LYS A 1 15  ? 2.411   -1.963  5.635  1.00 35.12 ? 38  LYS A CE  1 
ATOM   108  N NZ  . LYS A 1 15  ? 3.363   -0.925  5.122  1.00 35.71 ? 38  LYS A NZ  1 
ATOM   109  N N   . PHE A 1 16  ? -0.707  -1.573  11.668 1.00 22.94 ? 39  PHE A N   1 
ATOM   110  C CA  . PHE A 1 16  ? -1.646  -1.165  12.711 1.00 21.89 ? 39  PHE A CA  1 
ATOM   111  C C   . PHE A 1 16  ? -1.383  -1.815  14.059 1.00 23.28 ? 39  PHE A C   1 
ATOM   112  O O   . PHE A 1 16  ? -0.836  -2.918  14.150 1.00 21.82 ? 39  PHE A O   1 
ATOM   113  C CB  . PHE A 1 16  ? -3.094  -1.480  12.312 1.00 20.10 ? 39  PHE A CB  1 
ATOM   114  C CG  . PHE A 1 16  ? -3.466  -0.989  10.947 1.00 22.03 ? 39  PHE A CG  1 
ATOM   115  C CD1 . PHE A 1 16  ? -3.264  -1.791  9.827  1.00 20.49 ? 39  PHE A CD1 1 
ATOM   116  C CD2 . PHE A 1 16  ? -3.963  0.294   10.768 1.00 21.44 ? 39  PHE A CD2 1 
ATOM   117  C CE1 . PHE A 1 16  ? -3.545  -1.324  8.548  1.00 21.08 ? 39  PHE A CE1 1 
ATOM   118  C CE2 . PHE A 1 16  ? -4.249  0.776   9.476  1.00 23.75 ? 39  PHE A CE2 1 
ATOM   119  C CZ  . PHE A 1 16  ? -4.038  -0.040  8.365  1.00 21.30 ? 39  PHE A CZ  1 
ATOM   120  N N   . THR A 1 17  ? -1.759  -1.098  15.114 1.00 24.24 ? 40  THR A N   1 
ATOM   121  C CA  . THR A 1 17  ? -1.643  -1.610  16.473 1.00 24.17 ? 40  THR A CA  1 
ATOM   122  C C   . THR A 1 17  ? -3.037  -1.366  17.032 1.00 24.36 ? 40  THR A C   1 
ATOM   123  O O   . THR A 1 17  ? -3.537  -0.244  16.983 1.00 24.02 ? 40  THR A O   1 
ATOM   124  C CB  . THR A 1 17  ? -0.582  -0.849  17.312 1.00 23.18 ? 40  THR A CB  1 
ATOM   125  O OG1 . THR A 1 17  ? 0.711   -0.985  16.700 1.00 22.50 ? 40  THR A OG1 1 
ATOM   126  C CG2 . THR A 1 17  ? -0.517  -1.427  18.721 1.00 20.92 ? 40  THR A CG2 1 
ATOM   127  N N   . LEU A 1 18  ? -3.676  -2.420  17.524 1.00 25.10 ? 41  LEU A N   1 
ATOM   128  C CA  . LEU A 1 18  ? -5.026  -2.298  18.052 1.00 26.54 ? 41  LEU A CA  1 
ATOM   129  C C   . LEU A 1 18  ? -4.986  -2.335  19.557 1.00 28.20 ? 41  LEU A C   1 
ATOM   130  O O   . LEU A 1 18  ? -4.277  -3.142  20.133 1.00 29.61 ? 41  LEU A O   1 
ATOM   131  C CB  . LEU A 1 18  ? -5.914  -3.439  17.536 1.00 24.70 ? 41  LEU A CB  1 
ATOM   132  C CG  . LEU A 1 18  ? -5.639  -3.947  16.116 1.00 24.55 ? 41  LEU A CG  1 
ATOM   133  C CD1 . LEU A 1 18  ? -6.818  -4.799  15.681 1.00 22.13 ? 41  LEU A CD1 1 
ATOM   134  C CD2 . LEU A 1 18  ? -5.413  -2.783  15.137 1.00 23.06 ? 41  LEU A CD2 1 
ATOM   135  N N   . ALA A 1 19  ? -5.757  -1.461  20.190 1.00 30.73 ? 42  ALA A N   1 
ATOM   136  C CA  . ALA A 1 19  ? -5.804  -1.404  21.642 1.00 32.34 ? 42  ALA A CA  1 
ATOM   137  C C   . ALA A 1 19  ? -7.228  -1.237  22.151 1.00 33.31 ? 42  ALA A C   1 
ATOM   138  O O   . ALA A 1 19  ? -8.017  -0.468  21.602 1.00 33.93 ? 42  ALA A O   1 
ATOM   139  C CB  . ALA A 1 19  ? -4.933  -0.271  22.141 1.00 33.97 ? 42  ALA A CB  1 
ATOM   140  N N   . GLY A 1 20  ? -7.537  -1.971  23.211 1.00 34.25 ? 43  GLY A N   1 
ATOM   141  C CA  . GLY A 1 20  ? -8.859  -1.930  23.796 1.00 35.47 ? 43  GLY A CA  1 
ATOM   142  C C   . GLY A 1 20  ? -8.994  -2.877  24.947 1.00 35.45 ? 43  GLY A C   1 
ATOM   143  O O   . GLY A 1 20  ? -9.644  -2.576  25.945 1.00 34.18 ? 43  GLY A O   1 
ATOM   144  N N   . HIS A 1 21  ? -8.377  -4.040  24.794 1.00 35.69 ? 44  HIS A N   1 
ATOM   145  C CA  . HIS A 1 21  ? -8.402  -5.030  25.848 1.00 36.82 ? 44  HIS A CA  1 
ATOM   146  C C   . HIS A 1 21  ? -7.655  -4.441  27.035 1.00 37.47 ? 44  HIS A C   1 
ATOM   147  O O   . HIS A 1 21  ? -6.561  -3.888  26.892 1.00 37.67 ? 44  HIS A O   1 
ATOM   148  C CB  . HIS A 1 21  ? -7.742  -6.324  25.385 1.00 36.17 ? 44  HIS A CB  1 
ATOM   149  C CG  . HIS A 1 21  ? -8.597  -7.139  24.465 1.00 36.47 ? 44  HIS A CG  1 
ATOM   150  N ND1 . HIS A 1 21  ? -9.819  -7.650  24.845 1.00 35.59 ? 44  HIS A ND1 1 
ATOM   151  C CD2 . HIS A 1 21  ? -8.397  -7.556  23.193 1.00 35.64 ? 44  HIS A CD2 1 
ATOM   152  C CE1 . HIS A 1 21  ? -10.330 -8.349  23.851 1.00 35.73 ? 44  HIS A CE1 1 
ATOM   153  N NE2 . HIS A 1 21  ? -9.486  -8.309  22.834 1.00 35.05 ? 44  HIS A NE2 1 
ATOM   154  N N   . THR A 1 22  ? -8.264  -4.558  28.207 1.00 36.89 ? 45  THR A N   1 
ATOM   155  C CA  . THR A 1 22  ? -7.691  -4.013  29.424 1.00 35.54 ? 45  THR A CA  1 
ATOM   156  C C   . THR A 1 22  ? -6.778  -5.012  30.110 1.00 35.95 ? 45  THR A C   1 
ATOM   157  O O   . THR A 1 22  ? -6.234  -4.737  31.178 1.00 36.88 ? 45  THR A O   1 
ATOM   158  C CB  . THR A 1 22  ? -8.805  -3.578  30.391 1.00 34.08 ? 45  THR A CB  1 
ATOM   159  O OG1 . THR A 1 22  ? -9.346  -4.725  31.063 1.00 33.41 ? 45  THR A OG1 1 
ATOM   160  C CG2 . THR A 1 22  ? -9.921  -2.891  29.613 1.00 32.42 ? 45  THR A CG2 1 
ATOM   161  N N   . LYS A 1 23  ? -6.614  -6.175  29.492 1.00 36.41 ? 46  LYS A N   1 
ATOM   162  C CA  . LYS A 1 23  ? -5.744  -7.206  30.039 1.00 37.14 ? 46  LYS A CA  1 
ATOM   163  C C   . LYS A 1 23  ? -4.979  -7.917  28.932 1.00 37.55 ? 46  LYS A C   1 
ATOM   164  O O   . LYS A 1 23  ? -4.975  -7.462  27.781 1.00 37.90 ? 46  LYS A O   1 
ATOM   165  C CB  . LYS A 1 23  ? -6.549  -8.219  30.854 1.00 37.82 ? 46  LYS A CB  1 
ATOM   166  C CG  . LYS A 1 23  ? -7.018  -7.673  32.193 1.00 38.44 ? 46  LYS A CG  1 
ATOM   167  C CD  . LYS A 1 23  ? -7.563  -8.760  33.095 1.00 37.97 ? 46  LYS A CD  1 
ATOM   168  C CE  . LYS A 1 23  ? -7.992  -8.160  34.422 1.00 40.88 ? 46  LYS A CE  1 
ATOM   169  N NZ  . LYS A 1 23  ? -8.588  -9.174  35.341 1.00 43.88 ? 46  LYS A NZ  1 
ATOM   170  N N   . ALA A 1 24  ? -4.332  -9.027  29.292 1.00 37.10 ? 47  ALA A N   1 
ATOM   171  C CA  . ALA A 1 24  ? -3.541  -9.822  28.357 1.00 34.64 ? 47  ALA A CA  1 
ATOM   172  C C   . ALA A 1 24  ? -4.396  -10.440 27.270 1.00 34.12 ? 47  ALA A C   1 
ATOM   173  O O   . ALA A 1 24  ? -5.456  -10.996 27.549 1.00 34.53 ? 47  ALA A O   1 
ATOM   174  C CB  . ALA A 1 24  ? -2.816  -10.915 29.106 1.00 32.74 ? 47  ALA A CB  1 
ATOM   175  N N   . VAL A 1 25  ? -3.944  -10.339 26.027 1.00 33.42 ? 48  VAL A N   1 
ATOM   176  C CA  . VAL A 1 25  ? -4.691  -10.941 24.935 1.00 33.18 ? 48  VAL A CA  1 
ATOM   177  C C   . VAL A 1 25  ? -4.266  -12.409 24.879 1.00 33.89 ? 48  VAL A C   1 
ATOM   178  O O   . VAL A 1 25  ? -3.085  -12.732 25.045 1.00 35.37 ? 48  VAL A O   1 
ATOM   179  C CB  . VAL A 1 25  ? -4.393  -10.251 23.590 1.00 32.52 ? 48  VAL A CB  1 
ATOM   180  C CG1 . VAL A 1 25  ? -5.079  -10.998 22.460 1.00 32.45 ? 48  VAL A CG1 1 
ATOM   181  C CG2 . VAL A 1 25  ? -4.889  -8.818  23.630 1.00 30.70 ? 48  VAL A CG2 1 
ATOM   182  N N   . SER A 1 26  ? -5.232  -13.299 24.666 1.00 32.44 ? 49  SER A N   1 
ATOM   183  C CA  . SER A 1 26  ? -4.949  -14.729 24.617 1.00 29.13 ? 49  SER A CA  1 
ATOM   184  C C   . SER A 1 26  ? -4.804  -15.271 23.204 1.00 28.60 ? 49  SER A C   1 
ATOM   185  O O   . SER A 1 26  ? -3.880  -16.038 22.914 1.00 29.50 ? 49  SER A O   1 
ATOM   186  C CB  . SER A 1 26  ? -6.047  -15.488 25.350 1.00 27.94 ? 49  SER A CB  1 
ATOM   187  O OG  . SER A 1 26  ? -7.304  -14.888 25.100 1.00 25.45 ? 49  SER A OG  1 
ATOM   188  N N   . SER A 1 27  ? -5.714  -14.876 22.322 1.00 27.27 ? 50  SER A N   1 
ATOM   189  C CA  . SER A 1 27  ? -5.662  -15.351 20.948 1.00 25.48 ? 50  SER A CA  1 
ATOM   190  C C   . SER A 1 27  ? -6.333  -14.403 19.966 1.00 24.86 ? 50  SER A C   1 
ATOM   191  O O   . SER A 1 27  ? -7.132  -13.548 20.343 1.00 24.63 ? 50  SER A O   1 
ATOM   192  C CB  . SER A 1 27  ? -6.313  -16.728 20.840 1.00 24.39 ? 50  SER A CB  1 
ATOM   193  O OG  . SER A 1 27  ? -7.725  -16.634 20.910 1.00 26.87 ? 50  SER A OG  1 
ATOM   194  N N   . VAL A 1 28  ? -5.985  -14.565 18.700 1.00 24.16 ? 51  VAL A N   1 
ATOM   195  C CA  . VAL A 1 28  ? -6.546  -13.761 17.643 1.00 25.39 ? 51  VAL A CA  1 
ATOM   196  C C   . VAL A 1 28  ? -6.837  -14.697 16.487 1.00 26.03 ? 51  VAL A C   1 
ATOM   197  O O   . VAL A 1 28  ? -6.072  -15.629 16.228 1.00 25.08 ? 51  VAL A O   1 
ATOM   198  C CB  . VAL A 1 28  ? -5.562  -12.689 17.194 1.00 26.68 ? 51  VAL A CB  1 
ATOM   199  C CG1 . VAL A 1 28  ? -5.446  -11.622 18.266 1.00 27.74 ? 51  VAL A CG1 1 
ATOM   200  C CG2 . VAL A 1 28  ? -4.199  -13.322 16.917 1.00 28.51 ? 51  VAL A CG2 1 
ATOM   201  N N   . LYS A 1 29  ? -7.950  -14.454 15.803 1.00 26.77 ? 52  LYS A N   1 
ATOM   202  C CA  . LYS A 1 29  ? -8.351  -15.289 14.674 1.00 26.23 ? 52  LYS A CA  1 
ATOM   203  C C   . LYS A 1 29  ? -9.057  -14.490 13.590 1.00 27.00 ? 52  LYS A C   1 
ATOM   204  O O   . LYS A 1 29  ? -10.025 -13.774 13.857 1.00 27.85 ? 52  LYS A O   1 
ATOM   205  C CB  . LYS A 1 29  ? -9.292  -16.401 15.137 1.00 22.89 ? 52  LYS A CB  1 
ATOM   206  C CG  . LYS A 1 29  ? -8.773  -17.236 16.290 1.00 22.92 ? 52  LYS A CG  1 
ATOM   207  C CD  . LYS A 1 29  ? -7.716  -18.213 15.851 1.00 21.69 ? 52  LYS A CD  1 
ATOM   208  C CE  . LYS A 1 29  ? -7.298  -19.091 17.008 1.00 22.37 ? 52  LYS A CE  1 
ATOM   209  N NZ  . LYS A 1 29  ? -8.470  -19.703 17.662 1.00 19.77 ? 52  LYS A NZ  1 
ATOM   210  N N   . PHE A 1 30  ? -8.565  -14.620 12.365 1.00 27.96 ? 53  PHE A N   1 
ATOM   211  C CA  . PHE A 1 30  ? -9.171  -13.954 11.223 1.00 29.03 ? 53  PHE A CA  1 
ATOM   212  C C   . PHE A 1 30  ? -10.416 -14.767 10.832 1.00 30.01 ? 53  PHE A C   1 
ATOM   213  O O   . PHE A 1 30  ? -10.402 -15.997 10.881 1.00 29.40 ? 53  PHE A O   1 
ATOM   214  C CB  . PHE A 1 30  ? -8.200  -13.925 10.027 1.00 29.50 ? 53  PHE A CB  1 
ATOM   215  C CG  . PHE A 1 30  ? -7.062  -12.945 10.170 1.00 29.67 ? 53  PHE A CG  1 
ATOM   216  C CD1 . PHE A 1 30  ? -5.745  -13.391 10.218 1.00 29.01 ? 53  PHE A CD1 1 
ATOM   217  C CD2 . PHE A 1 30  ? -7.303  -11.572 10.204 1.00 28.65 ? 53  PHE A CD2 1 
ATOM   218  C CE1 . PHE A 1 30  ? -4.684  -12.479 10.292 1.00 28.35 ? 53  PHE A CE1 1 
ATOM   219  C CE2 . PHE A 1 30  ? -6.254  -10.658 10.277 1.00 25.95 ? 53  PHE A CE2 1 
ATOM   220  C CZ  . PHE A 1 30  ? -4.940  -11.111 10.319 1.00 26.68 ? 53  PHE A CZ  1 
ATOM   221  N N   . SER A 1 31  ? -11.492 -14.080 10.463 1.00 30.50 ? 54  SER A N   1 
ATOM   222  C CA  . SER A 1 31  ? -12.720 -14.746 10.024 1.00 30.02 ? 54  SER A CA  1 
ATOM   223  C C   . SER A 1 31  ? -12.386 -15.473 8.717  1.00 30.51 ? 54  SER A C   1 
ATOM   224  O O   . SER A 1 31  ? -11.500 -15.046 7.964  1.00 30.96 ? 54  SER A O   1 
ATOM   225  C CB  . SER A 1 31  ? -13.816 -13.713 9.752  1.00 30.34 ? 54  SER A CB  1 
ATOM   226  O OG  . SER A 1 31  ? -13.448 -12.868 8.665  1.00 28.82 ? 54  SER A OG  1 
ATOM   227  N N   . PRO A 1 32  ? -13.079 -16.581 8.427  1.00 29.58 ? 55  PRO A N   1 
ATOM   228  C CA  . PRO A 1 32  ? -12.785 -17.302 7.187  1.00 30.02 ? 55  PRO A CA  1 
ATOM   229  C C   . PRO A 1 32  ? -12.944 -16.451 5.930  1.00 30.29 ? 55  PRO A C   1 
ATOM   230  O O   . PRO A 1 32  ? -12.225 -16.647 4.952  1.00 31.20 ? 55  PRO A O   1 
ATOM   231  C CB  . PRO A 1 32  ? -13.760 -18.474 7.234  1.00 30.52 ? 55  PRO A CB  1 
ATOM   232  C CG  . PRO A 1 32  ? -13.854 -18.755 8.704  1.00 30.14 ? 55  PRO A CG  1 
ATOM   233  C CD  . PRO A 1 32  ? -13.987 -17.360 9.285  1.00 30.67 ? 55  PRO A CD  1 
ATOM   234  N N   . ASN A 1 33  ? -13.882 -15.507 5.956  1.00 30.76 ? 56  ASN A N   1 
ATOM   235  C CA  . ASN A 1 33  ? -14.114 -14.639 4.803  1.00 30.14 ? 56  ASN A CA  1 
ATOM   236  C C   . ASN A 1 33  ? -13.142 -13.455 4.768  1.00 31.04 ? 56  ASN A C   1 
ATOM   237  O O   . ASN A 1 33  ? -13.291 -12.527 3.969  1.00 27.88 ? 56  ASN A O   1 
ATOM   238  C CB  . ASN A 1 33  ? -15.563 -14.133 4.793  1.00 28.99 ? 56  ASN A CB  1 
ATOM   239  C CG  . ASN A 1 33  ? -15.902 -13.286 6.006  1.00 27.61 ? 56  ASN A CG  1 
ATOM   240  O OD1 . ASN A 1 33  ? -15.026 -12.699 6.634  1.00 27.08 ? 56  ASN A OD1 1 
ATOM   241  N ND2 . ASN A 1 33  ? -17.182 -13.201 6.324  1.00 25.84 ? 56  ASN A ND2 1 
ATOM   242  N N   . GLY A 1 34  ? -12.155 -13.505 5.659  1.00 34.03 ? 57  GLY A N   1 
ATOM   243  C CA  . GLY A 1 34  ? -11.126 -12.481 5.741  1.00 36.72 ? 57  GLY A CA  1 
ATOM   244  C C   . GLY A 1 34  ? -11.519 -11.040 5.996  1.00 38.19 ? 57  GLY A C   1 
ATOM   245  O O   . GLY A 1 34  ? -10.713 -10.144 5.751  1.00 38.21 ? 57  GLY A O   1 
ATOM   246  N N   . GLU A 1 35  ? -12.728 -10.802 6.496  1.00 40.19 ? 58  GLU A N   1 
ATOM   247  C CA  . GLU A 1 35  ? -13.173 -9.434  6.761  1.00 41.72 ? 58  GLU A CA  1 
ATOM   248  C C   . GLU A 1 35  ? -12.958 -8.972  8.200  1.00 39.99 ? 58  GLU A C   1 
ATOM   249  O O   . GLU A 1 35  ? -12.872 -7.773  8.469  1.00 38.37 ? 58  GLU A O   1 
ATOM   250  C CB  . GLU A 1 35  ? -14.654 -9.275  6.392  1.00 45.24 ? 58  GLU A CB  1 
ATOM   251  C CG  . GLU A 1 35  ? -14.913 -9.306  4.890  1.00 52.83 ? 58  GLU A CG  1 
ATOM   252  C CD  . GLU A 1 35  ? -14.249 -8.147  4.150  1.00 57.71 ? 58  GLU A CD  1 
ATOM   253  O OE1 . GLU A 1 35  ? -13.643 -8.385  3.081  1.00 59.94 ? 58  GLU A OE1 1 
ATOM   254  O OE2 . GLU A 1 35  ? -14.341 -6.994  4.632  1.00 58.60 ? 58  GLU A OE2 1 
ATOM   255  N N   . TRP A 1 36  ? -12.856 -9.919  9.124  1.00 37.90 ? 59  TRP A N   1 
ATOM   256  C CA  . TRP A 1 36  ? -12.678 -9.561  10.523 1.00 36.40 ? 59  TRP A CA  1 
ATOM   257  C C   . TRP A 1 36  ? -11.513 -10.229 11.223 1.00 34.26 ? 59  TRP A C   1 
ATOM   258  O O   . TRP A 1 36  ? -10.798 -11.059 10.659 1.00 32.82 ? 59  TRP A O   1 
ATOM   259  C CB  . TRP A 1 36  ? -13.945 -9.889  11.320 1.00 37.44 ? 59  TRP A CB  1 
ATOM   260  C CG  . TRP A 1 36  ? -15.183 -9.382  10.697 1.00 40.55 ? 59  TRP A CG  1 
ATOM   261  C CD1 . TRP A 1 36  ? -16.190 -10.124 10.159 1.00 40.74 ? 59  TRP A CD1 1 
ATOM   262  C CD2 . TRP A 1 36  ? -15.547 -8.009  10.512 1.00 42.55 ? 59  TRP A CD2 1 
ATOM   263  N NE1 . TRP A 1 36  ? -17.163 -9.299  9.647  1.00 42.02 ? 59  TRP A NE1 1 
ATOM   264  C CE2 . TRP A 1 36  ? -16.795 -7.997  9.850  1.00 42.75 ? 59  TRP A CE2 1 
ATOM   265  C CE3 . TRP A 1 36  ? -14.940 -6.788  10.842 1.00 43.91 ? 59  TRP A CE3 1 
ATOM   266  C CZ2 . TRP A 1 36  ? -17.451 -6.806  9.510  1.00 42.10 ? 59  TRP A CZ2 1 
ATOM   267  C CZ3 . TRP A 1 36  ? -15.596 -5.601  10.503 1.00 43.78 ? 59  TRP A CZ3 1 
ATOM   268  C CH2 . TRP A 1 36  ? -16.840 -5.625  9.843  1.00 42.62 ? 59  TRP A CH2 1 
ATOM   269  N N   . LEU A 1 37  ? -11.353 -9.833  12.479 1.00 32.17 ? 60  LEU A N   1 
ATOM   270  C CA  . LEU A 1 37  ? -10.340 -10.371 13.368 1.00 30.19 ? 60  LEU A CA  1 
ATOM   271  C C   . LEU A 1 37  ? -10.987 -10.388 14.737 1.00 28.57 ? 60  LEU A C   1 
ATOM   272  O O   . LEU A 1 37  ? -11.533 -9.377  15.189 1.00 28.33 ? 60  LEU A O   1 
ATOM   273  C CB  . LEU A 1 37  ? -9.101  -9.481  13.421 1.00 30.49 ? 60  LEU A CB  1 
ATOM   274  C CG  . LEU A 1 37  ? -8.051  -10.006 14.409 1.00 30.56 ? 60  LEU A CG  1 
ATOM   275  C CD1 . LEU A 1 37  ? -7.305  -11.182 13.776 1.00 31.26 ? 60  LEU A CD1 1 
ATOM   276  C CD2 . LEU A 1 37  ? -7.081  -8.897  14.781 1.00 29.50 ? 60  LEU A CD2 1 
ATOM   277  N N   . ALA A 1 38  ? -10.966 -11.537 15.390 1.00 27.45 ? 61  ALA A N   1 
ATOM   278  C CA  . ALA A 1 38  ? -11.541 -11.616 16.720 1.00 26.72 ? 61  ALA A CA  1 
ATOM   279  C C   . ALA A 1 38  ? -10.419 -11.898 17.720 1.00 26.45 ? 61  ALA A C   1 
ATOM   280  O O   . ALA A 1 38  ? -9.483  -12.654 17.439 1.00 24.83 ? 61  ALA A O   1 
ATOM   281  C CB  . ALA A 1 38  ? -12.605 -12.712 16.773 1.00 25.90 ? 61  ALA A CB  1 
ATOM   282  N N   . SER A 1 39  ? -10.515 -11.273 18.884 1.00 26.32 ? 62  SER A N   1 
ATOM   283  C CA  . SER A 1 39  ? -9.530  -11.463 19.931 1.00 27.76 ? 62  SER A CA  1 
ATOM   284  C C   . SER A 1 39  ? -10.198 -11.759 21.276 1.00 27.87 ? 62  SER A C   1 
ATOM   285  O O   . SER A 1 39  ? -11.225 -11.174 21.626 1.00 27.44 ? 62  SER A O   1 
ATOM   286  C CB  . SER A 1 39  ? -8.640  -10.218 20.050 1.00 27.91 ? 62  SER A CB  1 
ATOM   287  O OG  . SER A 1 39  ? -9.411  -9.039  20.253 1.00 30.07 ? 62  SER A OG  1 
ATOM   288  N N   . SER A 1 40  ? -9.614  -12.696 22.012 1.00 27.73 ? 63  SER A N   1 
ATOM   289  C CA  . SER A 1 40  ? -10.103 -13.058 23.328 1.00 26.98 ? 63  SER A CA  1 
ATOM   290  C C   . SER A 1 40  ? -9.070  -12.504 24.302 1.00 29.16 ? 63  SER A C   1 
ATOM   291  O O   . SER A 1 40  ? -7.898  -12.329 23.947 1.00 29.11 ? 63  SER A O   1 
ATOM   292  C CB  . SER A 1 40  ? -10.190 -14.574 23.457 1.00 27.82 ? 63  SER A CB  1 
ATOM   293  O OG  . SER A 1 40  ? -9.000  -15.184 22.989 1.00 26.09 ? 63  SER A OG  1 
ATOM   294  N N   . SER A 1 41  ? -9.492  -12.219 25.529 1.00 31.01 ? 64  SER A N   1 
ATOM   295  C CA  . SER A 1 41  ? -8.567  -11.671 26.510 1.00 31.18 ? 64  SER A CA  1 
ATOM   296  C C   . SER A 1 41  ? -8.903  -12.062 27.947 1.00 29.89 ? 64  SER A C   1 
ATOM   297  O O   . SER A 1 41  ? -10.002 -12.524 28.247 1.00 29.69 ? 64  SER A O   1 
ATOM   298  C CB  . SER A 1 41  ? -8.521  -10.145 26.368 1.00 31.37 ? 64  SER A CB  1 
ATOM   299  O OG  . SER A 1 41  ? -7.762  -9.549  27.406 1.00 33.64 ? 64  SER A OG  1 
ATOM   300  N N   . ALA A 1 42  ? -7.925  -11.886 28.826 1.00 30.19 ? 65  ALA A N   1 
ATOM   301  C CA  . ALA A 1 42  ? -8.072  -12.203 30.235 1.00 29.88 ? 65  ALA A CA  1 
ATOM   302  C C   . ALA A 1 42  ? -9.138  -11.283 30.831 1.00 30.20 ? 65  ALA A C   1 
ATOM   303  O O   . ALA A 1 42  ? -9.729  -11.574 31.876 1.00 29.16 ? 65  ALA A O   1 
ATOM   304  C CB  . ALA A 1 42  ? -6.727  -12.011 30.940 1.00 27.97 ? 65  ALA A CB  1 
ATOM   305  N N   . ASP A 1 43  ? -9.386  -10.176 30.139 1.00 30.64 ? 66  ASP A N   1 
ATOM   306  C CA  . ASP A 1 43  ? -10.377 -9.202  30.578 1.00 31.22 ? 66  ASP A CA  1 
ATOM   307  C C   . ASP A 1 43  ? -11.817 -9.694  30.345 1.00 32.55 ? 66  ASP A C   1 
ATOM   308  O O   . ASP A 1 43  ? -12.748 -8.898  30.348 1.00 33.13 ? 66  ASP A O   1 
ATOM   309  C CB  . ASP A 1 43  ? -10.153 -7.869  29.854 1.00 28.73 ? 66  ASP A CB  1 
ATOM   310  C CG  . ASP A 1 43  ? -10.604 -7.910  28.407 1.00 27.22 ? 66  ASP A CG  1 
ATOM   311  O OD1 . ASP A 1 43  ? -10.770 -9.030  27.868 1.00 25.20 ? 66  ASP A OD1 1 
ATOM   312  O OD2 . ASP A 1 43  ? -10.787 -6.826  27.812 1.00 25.19 ? 66  ASP A OD2 1 
ATOM   313  N N   . LYS A 1 44  ? -11.985 -10.998 30.128 1.00 34.43 ? 67  LYS A N   1 
ATOM   314  C CA  . LYS A 1 44  ? -13.309 -11.600 29.930 1.00 37.24 ? 67  LYS A CA  1 
ATOM   315  C C   . LYS A 1 44  ? -14.053 -11.196 28.654 1.00 38.04 ? 67  LYS A C   1 
ATOM   316  O O   . LYS A 1 44  ? -15.234 -11.539 28.491 1.00 38.99 ? 67  LYS A O   1 
ATOM   317  C CB  . LYS A 1 44  ? -14.224 -11.255 31.108 1.00 38.69 ? 67  LYS A CB  1 
ATOM   318  C CG  . LYS A 1 44  ? -13.632 -11.454 32.481 1.00 40.82 ? 67  LYS A CG  1 
ATOM   319  C CD  . LYS A 1 44  ? -14.613 -10.932 33.522 1.00 42.30 ? 67  LYS A CD  1 
ATOM   320  C CE  . LYS A 1 44  ? -14.142 -11.173 34.947 1.00 43.70 ? 67  LYS A CE  1 
ATOM   321  N NZ  . LYS A 1 44  ? -15.167 -10.690 35.916 1.00 44.54 ? 67  LYS A NZ  1 
ATOM   322  N N   . LEU A 1 45  ? -13.385 -10.482 27.752 1.00 37.57 ? 68  LEU A N   1 
ATOM   323  C CA  . LEU A 1 45  ? -14.052 -10.018 26.533 1.00 35.61 ? 68  LEU A CA  1 
ATOM   324  C C   . LEU A 1 45  ? -13.503 -10.506 25.208 1.00 34.59 ? 68  LEU A C   1 
ATOM   325  O O   . LEU A 1 45  ? -12.366 -10.981 25.110 1.00 33.83 ? 68  LEU A O   1 
ATOM   326  C CB  . LEU A 1 45  ? -14.017 -8.497  26.465 1.00 33.85 ? 68  LEU A CB  1 
ATOM   327  C CG  . LEU A 1 45  ? -14.302 -7.674  27.708 1.00 30.58 ? 68  LEU A CG  1 
ATOM   328  C CD1 . LEU A 1 45  ? -13.914 -6.244  27.398 1.00 30.09 ? 68  LEU A CD1 1 
ATOM   329  C CD2 . LEU A 1 45  ? -15.758 -7.793  28.106 1.00 27.95 ? 68  LEU A CD2 1 
ATOM   330  N N   . ILE A 1 46  ? -14.337 -10.340 24.184 1.00 34.34 ? 69  ILE A N   1 
ATOM   331  C CA  . ILE A 1 46  ? -13.989 -10.680 22.810 1.00 32.51 ? 69  ILE A CA  1 
ATOM   332  C C   . ILE A 1 46  ? -14.212 -9.413  22.006 1.00 32.05 ? 69  ILE A C   1 
ATOM   333  O O   . ILE A 1 46  ? -15.203 -8.713  22.206 1.00 28.23 ? 69  ILE A O   1 
ATOM   334  C CB  . ILE A 1 46  ? -14.878 -11.771 22.232 1.00 30.90 ? 69  ILE A CB  1 
ATOM   335  C CG1 . ILE A 1 46  ? -14.616 -13.093 22.945 1.00 28.79 ? 69  ILE A CG1 1 
ATOM   336  C CG2 . ILE A 1 46  ? -14.612 -11.892 20.742 1.00 31.37 ? 69  ILE A CG2 1 
ATOM   337  C CD1 . ILE A 1 46  ? -15.773 -14.049 22.867 1.00 31.05 ? 69  ILE A CD1 1 
ATOM   338  N N   . LYS A 1 47  ? -13.278 -9.111  21.111 1.00 33.40 ? 70  LYS A N   1 
ATOM   339  C CA  . LYS A 1 47  ? -13.391 -7.917  20.297 1.00 34.93 ? 70  LYS A CA  1 
ATOM   340  C C   . LYS A 1 47  ? -13.256 -8.213  18.811 1.00 34.17 ? 70  LYS A C   1 
ATOM   341  O O   . LYS A 1 47  ? -12.479 -9.074  18.409 1.00 36.63 ? 70  LYS A O   1 
ATOM   342  C CB  . LYS A 1 47  ? -12.345 -6.893  20.739 1.00 35.35 ? 70  LYS A CB  1 
ATOM   343  C CG  . LYS A 1 47  ? -12.669 -6.225  22.069 1.00 35.72 ? 70  LYS A CG  1 
ATOM   344  C CD  . LYS A 1 47  ? -11.615 -5.206  22.444 1.00 37.63 ? 70  LYS A CD  1 
ATOM   345  C CE  . LYS A 1 47  ? -11.996 -4.443  23.706 1.00 39.17 ? 70  LYS A CE  1 
ATOM   346  N NZ  . LYS A 1 47  ? -13.207 -3.589  23.519 1.00 38.95 ? 70  LYS A NZ  1 
ATOM   347  N N   . ILE A 1 48  ? -14.032 -7.515  17.991 1.00 32.63 ? 71  ILE A N   1 
ATOM   348  C CA  . ILE A 1 48  ? -13.963 -7.730  16.555 1.00 31.02 ? 71  ILE A CA  1 
ATOM   349  C C   . ILE A 1 48  ? -13.293 -6.506  15.953 1.00 30.35 ? 71  ILE A C   1 
ATOM   350  O O   . ILE A 1 48  ? -13.550 -5.388  16.394 1.00 30.55 ? 71  ILE A O   1 
ATOM   351  C CB  . ILE A 1 48  ? -15.366 -7.880  15.929 1.00 29.80 ? 71  ILE A CB  1 
ATOM   352  C CG1 . ILE A 1 48  ? -16.216 -8.864  16.738 1.00 25.37 ? 71  ILE A CG1 1 
ATOM   353  C CG2 . ILE A 1 48  ? -15.229 -8.347  14.489 1.00 27.84 ? 71  ILE A CG2 1 
ATOM   354  C CD1 . ILE A 1 48  ? -15.748 -10.271 16.682 1.00 23.94 ? 71  ILE A CD1 1 
ATOM   355  N N   . TRP A 1 49  ? -12.434 -6.720  14.957 1.00 29.79 ? 72  TRP A N   1 
ATOM   356  C CA  . TRP A 1 49  ? -11.727 -5.622  14.302 1.00 29.36 ? 72  TRP A CA  1 
ATOM   357  C C   . TRP A 1 49  ? -11.648 -5.875  12.806 1.00 29.72 ? 72  TRP A C   1 
ATOM   358  O O   . TRP A 1 49  ? -11.532 -7.013  12.366 1.00 30.64 ? 72  TRP A O   1 
ATOM   359  C CB  . TRP A 1 49  ? -10.299 -5.479  14.849 1.00 27.38 ? 72  TRP A CB  1 
ATOM   360  C CG  . TRP A 1 49  ? -10.122 -5.836  16.313 1.00 25.35 ? 72  TRP A CG  1 
ATOM   361  C CD1 . TRP A 1 49  ? -10.233 -7.073  16.868 1.00 24.14 ? 72  TRP A CD1 1 
ATOM   362  C CD2 . TRP A 1 49  ? -9.775  -4.949  17.384 1.00 25.47 ? 72  TRP A CD2 1 
ATOM   363  N NE1 . TRP A 1 49  ? -9.976  -7.021  18.215 1.00 24.49 ? 72  TRP A NE1 1 
ATOM   364  C CE2 . TRP A 1 49  ? -9.692  -5.729  18.561 1.00 26.73 ? 72  TRP A CE2 1 
ATOM   365  C CE3 . TRP A 1 49  ? -9.523  -3.571  17.465 1.00 26.08 ? 72  TRP A CE3 1 
ATOM   366  C CZ2 . TRP A 1 49  ? -9.369  -5.174  19.818 1.00 26.11 ? 72  TRP A CZ2 1 
ATOM   367  C CZ3 . TRP A 1 49  ? -9.201  -3.021  18.718 1.00 25.24 ? 72  TRP A CZ3 1 
ATOM   368  C CH2 . TRP A 1 49  ? -9.129  -3.826  19.874 1.00 24.33 ? 72  TRP A CH2 1 
ATOM   369  N N   . GLY A 1 50  ? -11.714 -4.810  12.021 1.00 31.48 ? 73  GLY A N   1 
ATOM   370  C CA  . GLY A 1 50  ? -11.623 -4.961  10.582 1.00 32.34 ? 73  GLY A CA  1 
ATOM   371  C C   . GLY A 1 50  ? -10.272 -5.556  10.256 1.00 32.83 ? 73  GLY A C   1 
ATOM   372  O O   . GLY A 1 50  ? -9.244  -5.109  10.769 1.00 33.98 ? 73  GLY A O   1 
ATOM   373  N N   . ALA A 1 51  ? -10.274 -6.566  9.400  1.00 33.57 ? 74  ALA A N   1 
ATOM   374  C CA  . ALA A 1 51  ? -9.051  -7.253  9.018  1.00 34.63 ? 74  ALA A CA  1 
ATOM   375  C C   . ALA A 1 51  ? -8.025  -6.398  8.281  1.00 35.12 ? 74  ALA A C   1 
ATOM   376  O O   . ALA A 1 51  ? -6.824  -6.560  8.484  1.00 34.47 ? 74  ALA A O   1 
ATOM   377  C CB  . ALA A 1 51  ? -9.399  -8.488  8.176  1.00 34.26 ? 74  ALA A CB  1 
ATOM   378  N N   . TYR A 1 52  ? -8.486  -5.478  7.442  1.00 36.94 ? 75  TYR A N   1 
ATOM   379  C CA  . TYR A 1 52  ? -7.567  -4.656  6.658  1.00 38.02 ? 75  TYR A CA  1 
ATOM   380  C C   . TYR A 1 52  ? -7.242  -3.247  7.168  1.00 39.92 ? 75  TYR A C   1 
ATOM   381  O O   . TYR A 1 52  ? -6.158  -2.725  6.892  1.00 41.34 ? 75  TYR A O   1 
ATOM   382  C CB  . TYR A 1 52  ? -8.078  -4.556  5.220  1.00 36.57 ? 75  TYR A CB  1 
ATOM   383  C CG  . TYR A 1 52  ? -8.561  -5.867  4.645  1.00 35.71 ? 75  TYR A CG  1 
ATOM   384  C CD1 . TYR A 1 52  ? -9.897  -6.252  4.757  1.00 34.69 ? 75  TYR A CD1 1 
ATOM   385  C CD2 . TYR A 1 52  ? -7.680  -6.729  3.994  1.00 37.05 ? 75  TYR A CD2 1 
ATOM   386  C CE1 . TYR A 1 52  ? -10.344 -7.468  4.230  1.00 34.55 ? 75  TYR A CE1 1 
ATOM   387  C CE2 . TYR A 1 52  ? -8.113  -7.945  3.470  1.00 37.07 ? 75  TYR A CE2 1 
ATOM   388  C CZ  . TYR A 1 52  ? -9.444  -8.310  3.589  1.00 35.20 ? 75  TYR A CZ  1 
ATOM   389  O OH  . TYR A 1 52  ? -9.852  -9.518  3.063  1.00 35.37 ? 75  TYR A OH  1 
ATOM   390  N N   . ASP A 1 53  ? -8.167  -2.619  7.889  1.00 40.05 ? 76  ASP A N   1 
ATOM   391  C CA  . ASP A 1 53  ? -7.927  -1.270  8.400  1.00 40.31 ? 76  ASP A CA  1 
ATOM   392  C C   . ASP A 1 53  ? -7.561  -1.267  9.885  1.00 39.98 ? 76  ASP A C   1 
ATOM   393  O O   . ASP A 1 53  ? -7.013  -0.290  10.400 1.00 39.15 ? 76  ASP A O   1 
ATOM   394  C CB  . ASP A 1 53  ? -9.160  -0.382  8.169  1.00 41.75 ? 76  ASP A CB  1 
ATOM   395  C CG  . ASP A 1 53  ? -10.434 -0.974  8.755  1.00 44.41 ? 76  ASP A CG  1 
ATOM   396  O OD1 . ASP A 1 53  ? -10.375 -1.545  9.863  1.00 46.90 ? 76  ASP A OD1 1 
ATOM   397  O OD2 . ASP A 1 53  ? -11.502 -0.855  8.118  1.00 45.20 ? 76  ASP A OD2 1 
ATOM   398  N N   . GLY A 1 54  ? -7.878  -2.368  10.564 1.00 39.25 ? 77  GLY A N   1 
ATOM   399  C CA  . GLY A 1 54  ? -7.595  -2.495  11.981 1.00 38.03 ? 77  GLY A CA  1 
ATOM   400  C C   . GLY A 1 54  ? -8.639  -1.830  12.852 1.00 38.23 ? 77  GLY A C   1 
ATOM   401  O O   . GLY A 1 54  ? -8.566  -1.915  14.075 1.00 36.78 ? 77  GLY A O   1 
ATOM   402  N N   . LYS A 1 55  ? -9.625  -1.189  12.228 1.00 38.60 ? 78  LYS A N   1 
ATOM   403  C CA  . LYS A 1 55  ? -10.676 -0.474  12.957 1.00 40.69 ? 78  LYS A CA  1 
ATOM   404  C C   . LYS A 1 55  ? -11.530 -1.318  13.908 1.00 40.49 ? 78  LYS A C   1 
ATOM   405  O O   . LYS A 1 55  ? -12.081 -2.352  13.516 1.00 39.87 ? 78  LYS A O   1 
ATOM   406  C CB  . LYS A 1 55  ? -11.612 0.253   11.979 1.00 42.94 ? 78  LYS A CB  1 
ATOM   407  C CG  . LYS A 1 55  ? -12.627 1.165   12.676 1.00 47.33 ? 78  LYS A CG  1 
ATOM   408  C CD  . LYS A 1 55  ? -13.869 1.482   11.828 1.00 50.20 ? 78  LYS A CD  1 
ATOM   409  C CE  . LYS A 1 55  ? -13.552 2.235   10.530 1.00 53.48 ? 78  LYS A CE  1 
ATOM   410  N NZ  . LYS A 1 55  ? -12.995 1.358   9.447  1.00 55.34 ? 78  LYS A NZ  1 
ATOM   411  N N   . PHE A 1 56  ? -11.650 -0.857  15.154 1.00 39.67 ? 79  PHE A N   1 
ATOM   412  C CA  . PHE A 1 56  ? -12.456 -1.555  16.152 1.00 40.39 ? 79  PHE A CA  1 
ATOM   413  C C   . PHE A 1 56  ? -13.895 -1.687  15.652 1.00 40.45 ? 79  PHE A C   1 
ATOM   414  O O   . PHE A 1 56  ? -14.415 -0.781  15.001 1.00 41.25 ? 79  PHE A O   1 
ATOM   415  C CB  . PHE A 1 56  ? -12.462 -0.794  17.480 1.00 38.90 ? 79  PHE A CB  1 
ATOM   416  C CG  . PHE A 1 56  ? -13.392 -1.388  18.506 1.00 38.28 ? 79  PHE A CG  1 
ATOM   417  C CD1 . PHE A 1 56  ? -13.056 -2.569  19.176 1.00 38.91 ? 79  PHE A CD1 1 
ATOM   418  C CD2 . PHE A 1 56  ? -14.623 -0.793  18.775 1.00 36.48 ? 79  PHE A CD2 1 
ATOM   419  C CE1 . PHE A 1 56  ? -13.939 -3.148  20.102 1.00 38.72 ? 79  PHE A CE1 1 
ATOM   420  C CE2 . PHE A 1 56  ? -15.507 -1.362  19.695 1.00 36.71 ? 79  PHE A CE2 1 
ATOM   421  C CZ  . PHE A 1 56  ? -15.166 -2.542  20.360 1.00 37.27 ? 79  PHE A CZ  1 
ATOM   422  N N   . GLU A 1 57  ? -14.539 -2.806  15.965 1.00 39.69 ? 80  GLU A N   1 
ATOM   423  C CA  . GLU A 1 57  ? -15.907 -3.029  15.518 1.00 40.21 ? 80  GLU A CA  1 
ATOM   424  C C   . GLU A 1 57  ? -16.893 -3.150  16.684 1.00 40.16 ? 80  GLU A C   1 
ATOM   425  O O   . GLU A 1 57  ? -17.719 -2.262  16.899 1.00 40.46 ? 80  GLU A O   1 
ATOM   426  C CB  . GLU A 1 57  ? -15.976 -4.291  14.649 1.00 40.82 ? 80  GLU A CB  1 
ATOM   427  C CG  . GLU A 1 57  ? -17.353 -4.579  14.057 1.00 40.16 ? 80  GLU A CG  1 
ATOM   428  C CD  . GLU A 1 57  ? -17.705 -3.655  12.899 1.00 40.01 ? 80  GLU A CD  1 
ATOM   429  O OE1 . GLU A 1 57  ? -18.832 -3.773  12.363 1.00 37.01 ? 80  GLU A OE1 1 
ATOM   430  O OE2 . GLU A 1 57  ? -16.847 -2.815  12.529 1.00 38.74 ? 80  GLU A OE2 1 
ATOM   431  N N   . LYS A 1 58  ? -16.809 -4.246  17.430 1.00 38.96 ? 81  LYS A N   1 
ATOM   432  C CA  . LYS A 1 58  ? -17.711 -4.445  18.552 1.00 38.85 ? 81  LYS A CA  1 
ATOM   433  C C   . LYS A 1 58  ? -17.056 -5.251  19.669 1.00 39.45 ? 81  LYS A C   1 
ATOM   434  O O   . LYS A 1 58  ? -16.009 -5.875  19.471 1.00 38.74 ? 81  LYS A O   1 
ATOM   435  C CB  . LYS A 1 58  ? -18.966 -5.186  18.093 1.00 37.77 ? 81  LYS A CB  1 
ATOM   436  C CG  . LYS A 1 58  ? -18.711 -6.655  17.789 1.00 38.95 ? 81  LYS A CG  1 
ATOM   437  C CD  . LYS A 1 58  ? -19.972 -7.388  17.392 1.00 39.51 ? 81  LYS A CD  1 
ATOM   438  C CE  . LYS A 1 58  ? -20.535 -6.807  16.116 1.00 40.53 ? 81  LYS A CE  1 
ATOM   439  N NZ  . LYS A 1 58  ? -21.907 -7.308  15.856 1.00 43.00 ? 81  LYS A NZ  1 
ATOM   440  N N   . THR A 1 59  ? -17.698 -5.239  20.838 1.00 38.66 ? 82  THR A N   1 
ATOM   441  C CA  . THR A 1 59  ? -17.230 -5.977  22.004 1.00 36.19 ? 82  THR A CA  1 
ATOM   442  C C   . THR A 1 59  ? -18.298 -6.976  22.438 1.00 35.66 ? 82  THR A C   1 
ATOM   443  O O   . THR A 1 59  ? -19.327 -6.593  22.987 1.00 36.66 ? 82  THR A O   1 
ATOM   444  C CB  . THR A 1 59  ? -16.909 -5.022  23.187 1.00 34.79 ? 82  THR A CB  1 
ATOM   445  O OG1 . THR A 1 59  ? -15.754 -4.242  22.865 1.00 35.38 ? 82  THR A OG1 1 
ATOM   446  C CG2 . THR A 1 59  ? -16.622 -5.797  24.461 1.00 33.35 ? 82  THR A CG2 1 
ATOM   447  N N   . ILE A 1 60  ? -18.053 -8.254  22.163 1.00 35.16 ? 83  ILE A N   1 
ATOM   448  C CA  . ILE A 1 60  ? -18.962 -9.335  22.542 1.00 34.78 ? 83  ILE A CA  1 
ATOM   449  C C   . ILE A 1 60  ? -18.545 -9.760  23.952 1.00 35.22 ? 83  ILE A C   1 
ATOM   450  O O   . ILE A 1 60  ? -17.363 -9.982  24.206 1.00 33.58 ? 83  ILE A O   1 
ATOM   451  C CB  . ILE A 1 60  ? -18.829 -10.561 21.576 1.00 34.65 ? 83  ILE A CB  1 
ATOM   452  C CG1 . ILE A 1 60  ? -19.203 -10.169 20.148 1.00 34.48 ? 83  ILE A CG1 1 
ATOM   453  C CG2 . ILE A 1 60  ? -19.736 -11.677 22.005 1.00 34.59 ? 83  ILE A CG2 1 
ATOM   454  C CD1 . ILE A 1 60  ? -18.097 -9.483  19.392 1.00 36.24 ? 83  ILE A CD1 1 
ATOM   455  N N   . SER A 1 61  ? -19.506 -9.869  24.868 1.00 37.99 ? 84  SER A N   1 
ATOM   456  C CA  . SER A 1 61  ? -19.191 -10.250 26.251 1.00 39.55 ? 84  SER A CA  1 
ATOM   457  C C   . SER A 1 61  ? -20.221 -11.152 26.931 1.00 38.97 ? 84  SER A C   1 
ATOM   458  O O   . SER A 1 61  ? -21.324 -11.331 26.433 1.00 39.62 ? 84  SER A O   1 
ATOM   459  C CB  . SER A 1 61  ? -18.984 -8.989  27.104 1.00 40.41 ? 84  SER A CB  1 
ATOM   460  O OG  . SER A 1 61  ? -20.134 -8.160  27.101 1.00 41.68 ? 84  SER A OG  1 
ATOM   461  N N   . GLY A 1 62  ? -19.850 -11.710 28.079 1.00 39.22 ? 85  GLY A N   1 
ATOM   462  C CA  . GLY A 1 62  ? -20.758 -12.583 28.799 1.00 40.06 ? 85  GLY A CA  1 
ATOM   463  C C   . GLY A 1 62  ? -20.047 -13.566 29.715 1.00 41.63 ? 85  GLY A C   1 
ATOM   464  O O   . GLY A 1 62  ? -20.615 -14.031 30.711 1.00 40.89 ? 85  GLY A O   1 
ATOM   465  N N   . HIS A 1 63  ? -18.801 -13.889 29.390 1.00 41.37 ? 86  HIS A N   1 
ATOM   466  C CA  . HIS A 1 63  ? -18.043 -14.817 30.213 1.00 42.23 ? 86  HIS A CA  1 
ATOM   467  C C   . HIS A 1 63  ? -17.788 -14.250 31.602 1.00 43.05 ? 86  HIS A C   1 
ATOM   468  O O   . HIS A 1 63  ? -17.574 -13.043 31.765 1.00 42.31 ? 86  HIS A O   1 
ATOM   469  C CB  . HIS A 1 63  ? -16.725 -15.182 29.524 1.00 41.71 ? 86  HIS A CB  1 
ATOM   470  C CG  . HIS A 1 63  ? -16.842 -16.347 28.590 1.00 39.90 ? 86  HIS A CG  1 
ATOM   471  N ND1 . HIS A 1 63  ? -17.178 -17.611 29.020 1.00 38.32 ? 86  HIS A ND1 1 
ATOM   472  C CD2 . HIS A 1 63  ? -16.678 -16.434 27.250 1.00 39.18 ? 86  HIS A CD2 1 
ATOM   473  C CE1 . HIS A 1 63  ? -17.216 -18.430 27.984 1.00 37.61 ? 86  HIS A CE1 1 
ATOM   474  N NE2 . HIS A 1 63  ? -16.917 -17.742 26.900 1.00 38.77 ? 86  HIS A NE2 1 
ATOM   475  N N   . LYS A 1 64  ? -17.817 -15.134 32.597 1.00 43.25 ? 87  LYS A N   1 
ATOM   476  C CA  . LYS A 1 64  ? -17.618 -14.751 33.993 1.00 43.97 ? 87  LYS A CA  1 
ATOM   477  C C   . LYS A 1 64  ? -16.144 -14.611 34.392 1.00 42.75 ? 87  LYS A C   1 
ATOM   478  O O   . LYS A 1 64  ? -15.800 -13.845 35.295 1.00 41.56 ? 87  LYS A O   1 
ATOM   479  C CB  . LYS A 1 64  ? -18.315 -15.770 34.902 1.00 46.52 ? 87  LYS A CB  1 
ATOM   480  C CG  . LYS A 1 64  ? -19.839 -15.723 34.839 1.00 48.48 ? 87  LYS A CG  1 
ATOM   481  C CD  . LYS A 1 64  ? -20.454 -16.919 35.568 1.00 51.49 ? 87  LYS A CD  1 
ATOM   482  C CE  . LYS A 1 64  ? -21.899 -16.645 36.013 1.00 53.70 ? 87  LYS A CE  1 
ATOM   483  N NZ  . LYS A 1 64  ? -22.794 -16.181 34.906 1.00 55.79 ? 87  LYS A NZ  1 
ATOM   484  N N   . LEU A 1 65  ? -15.279 -15.361 33.723 1.00 41.43 ? 88  LEU A N   1 
ATOM   485  C CA  . LEU A 1 65  ? -13.857 -15.299 34.007 1.00 40.55 ? 88  LEU A CA  1 
ATOM   486  C C   . LEU A 1 65  ? -13.064 -15.046 32.730 1.00 40.21 ? 88  LEU A C   1 
ATOM   487  O O   . LEU A 1 65  ? -13.580 -14.449 31.786 1.00 41.16 ? 88  LEU A O   1 
ATOM   488  C CB  . LEU A 1 65  ? -13.400 -16.588 34.690 1.00 40.16 ? 88  LEU A CB  1 
ATOM   489  C CG  . LEU A 1 65  ? -13.865 -16.726 36.146 1.00 38.94 ? 88  LEU A CG  1 
ATOM   490  C CD1 . LEU A 1 65  ? -13.486 -18.085 36.686 1.00 35.64 ? 88  LEU A CD1 1 
ATOM   491  C CD2 . LEU A 1 65  ? -13.244 -15.617 36.992 1.00 36.43 ? 88  LEU A CD2 1 
ATOM   492  N N   . GLY A 1 66  ? -11.815 -15.494 32.696 1.00 39.00 ? 89  GLY A N   1 
ATOM   493  C CA  . GLY A 1 66  ? -10.997 -15.265 31.519 1.00 38.55 ? 89  GLY A CA  1 
ATOM   494  C C   . GLY A 1 66  ? -11.262 -16.193 30.347 1.00 38.28 ? 89  GLY A C   1 
ATOM   495  O O   . GLY A 1 66  ? -11.671 -17.334 30.528 1.00 37.95 ? 89  GLY A O   1 
ATOM   496  N N   . ILE A 1 67  ? -11.028 -15.695 29.137 1.00 37.90 ? 90  ILE A N   1 
ATOM   497  C CA  . ILE A 1 67  ? -11.217 -16.488 27.928 1.00 37.59 ? 90  ILE A CA  1 
ATOM   498  C C   . ILE A 1 67  ? -9.836  -16.812 27.364 1.00 36.53 ? 90  ILE A C   1 
ATOM   499  O O   . ILE A 1 67  ? -9.095  -15.908 27.005 1.00 35.93 ? 90  ILE A O   1 
ATOM   500  C CB  . ILE A 1 67  ? -11.996 -15.705 26.859 1.00 38.34 ? 90  ILE A CB  1 
ATOM   501  C CG1 . ILE A 1 67  ? -13.297 -15.157 27.450 1.00 38.37 ? 90  ILE A CG1 1 
ATOM   502  C CG2 . ILE A 1 67  ? -12.285 -16.612 25.674 1.00 38.44 ? 90  ILE A CG2 1 
ATOM   503  C CD1 . ILE A 1 67  ? -14.032 -14.168 26.537 1.00 37.63 ? 90  ILE A CD1 1 
ATOM   504  N N   . SER A 1 68  ? -9.499  -18.094 27.274 1.00 35.97 ? 91  SER A N   1 
ATOM   505  C CA  . SER A 1 68  ? -8.189  -18.512 26.767 1.00 35.79 ? 91  SER A CA  1 
ATOM   506  C C   . SER A 1 68  ? -8.166  -18.809 25.269 1.00 35.29 ? 91  SER A C   1 
ATOM   507  O O   . SER A 1 68  ? -7.096  -19.004 24.690 1.00 35.72 ? 91  SER A O   1 
ATOM   508  C CB  . SER A 1 68  ? -7.705  -19.768 27.506 1.00 34.62 ? 91  SER A CB  1 
ATOM   509  O OG  . SER A 1 68  ? -7.903  -19.665 28.907 1.00 36.29 ? 91  SER A OG  1 
ATOM   510  N N   . ASP A 1 69  ? -9.334  -18.843 24.638 1.00 34.07 ? 92  ASP A N   1 
ATOM   511  C CA  . ASP A 1 69  ? -9.391  -19.170 23.220 1.00 32.89 ? 92  ASP A CA  1 
ATOM   512  C C   . ASP A 1 69  ? -10.710 -18.712 22.591 1.00 33.45 ? 92  ASP A C   1 
ATOM   513  O O   . ASP A 1 69  ? -11.734 -18.588 23.271 1.00 32.79 ? 92  ASP A O   1 
ATOM   514  C CB  . ASP A 1 69  ? -9.243  -20.693 23.064 1.00 32.78 ? 92  ASP A CB  1 
ATOM   515  C CG  . ASP A 1 69  ? -8.690  -21.110 21.707 1.00 32.49 ? 92  ASP A CG  1 
ATOM   516  O OD1 . ASP A 1 69  ? -8.651  -22.334 21.440 1.00 29.69 ? 92  ASP A OD1 1 
ATOM   517  O OD2 . ASP A 1 69  ? -8.290  -20.222 20.920 1.00 34.34 ? 92  ASP A OD2 1 
ATOM   518  N N   . VAL A 1 70  ? -10.672 -18.460 21.286 1.00 32.59 ? 93  VAL A N   1 
ATOM   519  C CA  . VAL A 1 70  ? -11.852 -18.048 20.544 1.00 30.77 ? 93  VAL A CA  1 
ATOM   520  C C   . VAL A 1 70  ? -11.621 -18.505 19.108 1.00 30.20 ? 93  VAL A C   1 
ATOM   521  O O   . VAL A 1 70  ? -10.521 -18.356 18.580 1.00 29.71 ? 93  VAL A O   1 
ATOM   522  C CB  . VAL A 1 70  ? -12.047 -16.523 20.611 1.00 30.00 ? 93  VAL A CB  1 
ATOM   523  C CG1 . VAL A 1 70  ? -10.828 -15.818 20.054 1.00 31.49 ? 93  VAL A CG1 1 
ATOM   524  C CG2 . VAL A 1 70  ? -13.292 -16.127 19.852 1.00 29.09 ? 93  VAL A CG2 1 
ATOM   525  N N   . ALA A 1 71  ? -12.653 -19.082 18.493 1.00 29.96 ? 94  ALA A N   1 
ATOM   526  C CA  . ALA A 1 71  ? -12.565 -19.598 17.124 1.00 28.26 ? 94  ALA A CA  1 
ATOM   527  C C   . ALA A 1 71  ? -13.820 -19.334 16.287 1.00 28.19 ? 94  ALA A C   1 
ATOM   528  O O   . ALA A 1 71  ? -14.930 -19.257 16.815 1.00 28.58 ? 94  ALA A O   1 
ATOM   529  C CB  . ALA A 1 71  ? -12.298 -21.077 17.171 1.00 26.64 ? 94  ALA A CB  1 
ATOM   530  N N   . TRP A 1 72  ? -13.626 -19.215 14.975 1.00 28.53 ? 95  TRP A N   1 
ATOM   531  C CA  . TRP A 1 72  ? -14.708 -18.956 14.017 1.00 28.23 ? 95  TRP A CA  1 
ATOM   532  C C   . TRP A 1 72  ? -15.264 -20.232 13.384 1.00 29.28 ? 95  TRP A C   1 
ATOM   533  O O   . TRP A 1 72  ? -14.614 -21.277 13.390 1.00 30.49 ? 95  TRP A O   1 
ATOM   534  C CB  . TRP A 1 72  ? -14.218 -18.084 12.852 1.00 26.87 ? 95  TRP A CB  1 
ATOM   535  C CG  . TRP A 1 72  ? -13.751 -16.699 13.188 1.00 26.65 ? 95  TRP A CG  1 
ATOM   536  C CD1 . TRP A 1 72  ? -12.512 -16.330 13.624 1.00 26.16 ? 95  TRP A CD1 1 
ATOM   537  C CD2 . TRP A 1 72  ? -14.521 -15.498 13.105 1.00 26.85 ? 95  TRP A CD2 1 
ATOM   538  N NE1 . TRP A 1 72  ? -12.461 -14.973 13.817 1.00 25.39 ? 95  TRP A NE1 1 
ATOM   539  C CE2 . TRP A 1 72  ? -13.683 -14.437 13.509 1.00 27.40 ? 95  TRP A CE2 1 
ATOM   540  C CE3 . TRP A 1 72  ? -15.840 -15.215 12.730 1.00 25.65 ? 95  TRP A CE3 1 
ATOM   541  C CZ2 . TRP A 1 72  ? -14.124 -13.109 13.550 1.00 26.36 ? 95  TRP A CZ2 1 
ATOM   542  C CZ3 . TRP A 1 72  ? -16.278 -13.906 12.770 1.00 26.03 ? 95  TRP A CZ3 1 
ATOM   543  C CH2 . TRP A 1 72  ? -15.421 -12.864 13.179 1.00 25.83 ? 95  TRP A CH2 1 
ATOM   544  N N   . SER A 1 73  ? -16.467 -20.124 12.822 1.00 29.11 ? 96  SER A N   1 
ATOM   545  C CA  . SER A 1 73  ? -17.108 -21.228 12.110 1.00 27.48 ? 96  SER A CA  1 
ATOM   546  C C   . SER A 1 73  ? -16.804 -20.939 10.641 1.00 27.69 ? 96  SER A C   1 
ATOM   547  O O   . SER A 1 73  ? -16.333 -19.849 10.320 1.00 27.81 ? 96  SER A O   1 
ATOM   548  C CB  . SER A 1 73  ? -18.624 -21.242 12.360 1.00 27.23 ? 96  SER A CB  1 
ATOM   549  O OG  . SER A 1 73  ? -19.248 -20.017 12.001 1.00 26.74 ? 96  SER A OG  1 
ATOM   550  N N   . SER A 1 74  ? -17.064 -21.890 9.750  1.00 28.71 ? 97  SER A N   1 
ATOM   551  C CA  . SER A 1 74  ? -16.775 -21.695 8.326  1.00 29.03 ? 97  SER A CA  1 
ATOM   552  C C   . SER A 1 74  ? -17.477 -20.510 7.658  1.00 29.11 ? 97  SER A C   1 
ATOM   553  O O   . SER A 1 74  ? -16.870 -19.774 6.880  1.00 28.28 ? 97  SER A O   1 
ATOM   554  C CB  . SER A 1 74  ? -17.126 -22.958 7.545  1.00 31.34 ? 97  SER A CB  1 
ATOM   555  O OG  . SER A 1 74  ? -16.353 -24.056 7.970  1.00 33.41 ? 97  SER A OG  1 
ATOM   556  N N   . ASP A 1 75  ? -18.756 -20.330 7.954  1.00 30.06 ? 98  ASP A N   1 
ATOM   557  C CA  . ASP A 1 75  ? -19.519 -19.252 7.346  1.00 31.71 ? 98  ASP A CA  1 
ATOM   558  C C   . ASP A 1 75  ? -19.157 -17.906 7.947  1.00 31.52 ? 98  ASP A C   1 
ATOM   559  O O   . ASP A 1 75  ? -19.773 -16.885 7.625  1.00 33.02 ? 98  ASP A O   1 
ATOM   560  C CB  . ASP A 1 75  ? -21.007 -19.506 7.544  1.00 33.49 ? 98  ASP A CB  1 
ATOM   561  C CG  . ASP A 1 75  ? -21.382 -19.605 9.005  1.00 36.74 ? 98  ASP A CG  1 
ATOM   562  O OD1 . ASP A 1 75  ? -20.534 -19.269 9.858  1.00 38.51 ? 98  ASP A OD1 1 
ATOM   563  O OD2 . ASP A 1 75  ? -22.521 -20.010 9.307  1.00 39.77 ? 98  ASP A OD2 1 
ATOM   564  N N   . SER A 1 76  ? -18.161 -17.903 8.823  1.00 31.05 ? 99  SER A N   1 
ATOM   565  C CA  . SER A 1 76  ? -17.741 -16.675 9.487  1.00 30.57 ? 99  SER A CA  1 
ATOM   566  C C   . SER A 1 76  ? -18.931 -16.052 10.229 1.00 30.11 ? 99  SER A C   1 
ATOM   567  O O   . SER A 1 76  ? -18.947 -14.856 10.476 1.00 31.64 ? 99  SER A O   1 
ATOM   568  C CB  . SER A 1 76  ? -17.177 -15.664 8.468  1.00 28.41 ? 99  SER A CB  1 
ATOM   569  O OG  . SER A 1 76  ? -16.205 -16.256 7.616  1.00 26.29 ? 99  SER A OG  1 
ATOM   570  N N   . ASN A 1 77  ? -19.917 -16.861 10.601 1.00 29.94 ? 100 ASN A N   1 
ATOM   571  C CA  . ASN A 1 77  ? -21.090 -16.338 11.310 1.00 31.20 ? 100 ASN A CA  1 
ATOM   572  C C   . ASN A 1 77  ? -21.116 -16.572 12.810 1.00 32.49 ? 100 ASN A C   1 
ATOM   573  O O   . ASN A 1 77  ? -21.869 -15.907 13.522 1.00 33.50 ? 100 ASN A O   1 
ATOM   574  C CB  . ASN A 1 77  ? -22.380 -16.918 10.737 1.00 28.90 ? 100 ASN A CB  1 
ATOM   575  C CG  . ASN A 1 77  ? -22.688 -16.389 9.371  1.00 28.94 ? 100 ASN A CG  1 
ATOM   576  O OD1 . ASN A 1 77  ? -22.713 -15.172 9.159  1.00 28.47 ? 100 ASN A OD1 1 
ATOM   577  N ND2 . ASN A 1 77  ? -22.929 -17.294 8.424  1.00 26.21 ? 100 ASN A ND2 1 
ATOM   578  N N   . LEU A 1 78  ? -20.317 -17.520 13.292 1.00 33.05 ? 101 LEU A N   1 
ATOM   579  C CA  . LEU A 1 78  ? -20.299 -17.820 14.716 1.00 31.90 ? 101 LEU A CA  1 
ATOM   580  C C   . LEU A 1 78  ? -18.909 -17.875 15.325 1.00 32.42 ? 101 LEU A C   1 
ATOM   581  O O   . LEU A 1 78  ? -17.906 -18.008 14.636 1.00 32.47 ? 101 LEU A O   1 
ATOM   582  C CB  . LEU A 1 78  ? -20.995 -19.157 14.984 1.00 30.97 ? 101 LEU A CB  1 
ATOM   583  C CG  . LEU A 1 78  ? -22.420 -19.372 14.476 1.00 29.54 ? 101 LEU A CG  1 
ATOM   584  C CD1 . LEU A 1 78  ? -22.888 -20.756 14.910 1.00 26.33 ? 101 LEU A CD1 1 
ATOM   585  C CD2 . LEU A 1 78  ? -23.343 -18.291 15.016 1.00 26.25 ? 101 LEU A CD2 1 
ATOM   586  N N   . LEU A 1 79  ? -18.877 -17.784 16.646 1.00 33.47 ? 102 LEU A N   1 
ATOM   587  C CA  . LEU A 1 79  ? -17.644 -17.847 17.405 1.00 33.66 ? 102 LEU A CA  1 
ATOM   588  C C   . LEU A 1 79  ? -17.862 -18.769 18.582 1.00 34.50 ? 102 LEU A C   1 
ATOM   589  O O   . LEU A 1 79  ? -18.976 -18.883 19.103 1.00 35.65 ? 102 LEU A O   1 
ATOM   590  C CB  . LEU A 1 79  ? -17.269 -16.483 17.971 1.00 32.05 ? 102 LEU A CB  1 
ATOM   591  C CG  . LEU A 1 79  ? -16.742 -15.388 17.068 1.00 32.68 ? 102 LEU A CG  1 
ATOM   592  C CD1 . LEU A 1 79  ? -16.362 -14.209 17.940 1.00 31.03 ? 102 LEU A CD1 1 
ATOM   593  C CD2 . LEU A 1 79  ? -15.538 -15.888 16.286 1.00 32.67 ? 102 LEU A CD2 1 
ATOM   594  N N   . VAL A 1 80  ? -16.798 -19.435 19.000 1.00 33.90 ? 103 VAL A N   1 
ATOM   595  C CA  . VAL A 1 80  ? -16.884 -20.279 20.171 1.00 33.88 ? 103 VAL A CA  1 
ATOM   596  C C   . VAL A 1 80  ? -15.694 -19.822 21.015 1.00 33.39 ? 103 VAL A C   1 
ATOM   597  O O   . VAL A 1 80  ? -14.665 -19.414 20.471 1.00 32.05 ? 103 VAL A O   1 
ATOM   598  C CB  . VAL A 1 80  ? -16.812 -21.787 19.807 1.00 34.23 ? 103 VAL A CB  1 
ATOM   599  C CG1 . VAL A 1 80  ? -15.442 -22.140 19.268 1.00 34.54 ? 103 VAL A CG1 1 
ATOM   600  C CG2 . VAL A 1 80  ? -17.173 -22.632 21.030 1.00 33.76 ? 103 VAL A CG2 1 
ATOM   601  N N   . SER A 1 81  ? -15.848 -19.841 22.334 1.00 34.09 ? 104 SER A N   1 
ATOM   602  C CA  . SER A 1 81  ? -14.769 -19.402 23.205 1.00 34.65 ? 104 SER A CA  1 
ATOM   603  C C   . SER A 1 81  ? -14.628 -20.248 24.462 1.00 34.69 ? 104 SER A C   1 
ATOM   604  O O   . SER A 1 81  ? -15.624 -20.673 25.054 1.00 34.49 ? 104 SER A O   1 
ATOM   605  C CB  . SER A 1 81  ? -14.968 -17.928 23.581 1.00 32.94 ? 104 SER A CB  1 
ATOM   606  O OG  . SER A 1 81  ? -16.185 -17.730 24.272 1.00 29.58 ? 104 SER A OG  1 
ATOM   607  N N   . ALA A 1 82  ? -13.374 -20.484 24.848 1.00 35.65 ? 105 ALA A N   1 
ATOM   608  C CA  . ALA A 1 82  ? -13.027 -21.275 26.026 1.00 37.11 ? 105 ALA A CA  1 
ATOM   609  C C   . ALA A 1 82  ? -12.697 -20.334 27.181 1.00 38.16 ? 105 ALA A C   1 
ATOM   610  O O   . ALA A 1 82  ? -11.772 -19.524 27.095 1.00 37.73 ? 105 ALA A O   1 
ATOM   611  C CB  . ALA A 1 82  ? -11.836 -22.169 25.717 1.00 36.63 ? 105 ALA A CB  1 
ATOM   612  N N   . SER A 1 83  ? -13.450 -20.458 28.270 1.00 38.55 ? 106 SER A N   1 
ATOM   613  C CA  . SER A 1 83  ? -13.263 -19.585 29.422 1.00 39.93 ? 106 SER A CA  1 
ATOM   614  C C   . SER A 1 83  ? -12.865 -20.319 30.700 1.00 40.43 ? 106 SER A C   1 
ATOM   615  O O   . SER A 1 83  ? -13.007 -21.540 30.800 1.00 40.94 ? 106 SER A O   1 
ATOM   616  C CB  . SER A 1 83  ? -14.551 -18.789 29.668 1.00 39.84 ? 106 SER A CB  1 
ATOM   617  O OG  . SER A 1 83  ? -14.395 -17.823 30.689 1.00 39.31 ? 106 SER A OG  1 
ATOM   618  N N   . ASP A 1 84  ? -12.355 -19.557 31.667 1.00 40.17 ? 107 ASP A N   1 
ATOM   619  C CA  . ASP A 1 84  ? -11.948 -20.103 32.953 1.00 39.40 ? 107 ASP A CA  1 
ATOM   620  C C   . ASP A 1 84  ? -13.179 -20.307 33.820 1.00 38.41 ? 107 ASP A C   1 
ATOM   621  O O   . ASP A 1 84  ? -13.096 -20.918 34.884 1.00 39.15 ? 107 ASP A O   1 
ATOM   622  C CB  . ASP A 1 84  ? -10.955 -19.169 33.659 1.00 39.73 ? 107 ASP A CB  1 
ATOM   623  C CG  . ASP A 1 84  ? -9.510  -19.432 33.253 1.00 40.32 ? 107 ASP A CG  1 
ATOM   624  O OD1 . ASP A 1 84  ? -8.600  -18.758 33.777 1.00 39.84 ? 107 ASP A OD1 1 
ATOM   625  O OD2 . ASP A 1 84  ? -9.278  -20.318 32.408 1.00 41.52 ? 107 ASP A OD2 1 
ATOM   626  N N   . ASP A 1 85  ? -14.322 -19.794 33.374 1.00 36.64 ? 108 ASP A N   1 
ATOM   627  C CA  . ASP A 1 85  ? -15.542 -19.989 34.135 1.00 36.86 ? 108 ASP A CA  1 
ATOM   628  C C   . ASP A 1 85  ? -16.040 -21.418 33.906 1.00 37.38 ? 108 ASP A C   1 
ATOM   629  O O   . ASP A 1 85  ? -17.181 -21.755 34.211 1.00 37.05 ? 108 ASP A O   1 
ATOM   630  C CB  . ASP A 1 85  ? -16.622 -18.960 33.756 1.00 35.92 ? 108 ASP A CB  1 
ATOM   631  C CG  . ASP A 1 85  ? -16.953 -18.959 32.282 1.00 36.04 ? 108 ASP A CG  1 
ATOM   632  O OD1 . ASP A 1 85  ? -16.744 -19.998 31.619 1.00 34.90 ? 108 ASP A OD1 1 
ATOM   633  O OD2 . ASP A 1 85  ? -17.442 -17.910 31.798 1.00 33.35 ? 108 ASP A OD2 1 
ATOM   634  N N   . LYS A 1 86  ? -15.159 -22.248 33.356 1.00 37.89 ? 109 LYS A N   1 
ATOM   635  C CA  . LYS A 1 86  ? -15.452 -23.655 33.103 1.00 37.97 ? 109 LYS A CA  1 
ATOM   636  C C   . LYS A 1 86  ? -16.405 -23.917 31.938 1.00 37.53 ? 109 LYS A C   1 
ATOM   637  O O   . LYS A 1 86  ? -16.873 -25.044 31.752 1.00 37.62 ? 109 LYS A O   1 
ATOM   638  C CB  . LYS A 1 86  ? -16.006 -24.298 34.381 1.00 36.88 ? 109 LYS A CB  1 
ATOM   639  C CG  . LYS A 1 86  ? -15.075 -24.159 35.579 1.00 39.17 ? 109 LYS A CG  1 
ATOM   640  C CD  . LYS A 1 86  ? -15.610 -24.876 36.813 1.00 40.90 ? 109 LYS A CD  1 
ATOM   641  C CE  . LYS A 1 86  ? -14.672 -24.712 38.002 1.00 40.49 ? 109 LYS A CE  1 
ATOM   642  N NZ  . LYS A 1 86  ? -15.252 -25.318 39.238 1.00 41.84 ? 109 LYS A NZ  1 
ATOM   643  N N   . THR A 1 87  ? -16.682 -22.893 31.140 1.00 37.18 ? 110 THR A N   1 
ATOM   644  C CA  . THR A 1 87  ? -17.598 -23.077 30.025 1.00 37.11 ? 110 THR A CA  1 
ATOM   645  C C   . THR A 1 87  ? -17.081 -22.641 28.668 1.00 38.00 ? 110 THR A C   1 
ATOM   646  O O   . THR A 1 87  ? -15.985 -22.098 28.526 1.00 40.17 ? 110 THR A O   1 
ATOM   647  C CB  . THR A 1 87  ? -18.929 -22.320 30.252 1.00 37.82 ? 110 THR A CB  1 
ATOM   648  O OG1 . THR A 1 87  ? -18.694 -20.905 30.217 1.00 34.90 ? 110 THR A OG1 1 
ATOM   649  C CG2 . THR A 1 87  ? -19.537 -22.697 31.590 1.00 38.58 ? 110 THR A CG2 1 
ATOM   650  N N   . LEU A 1 88  ? -17.911 -22.903 27.672 1.00 37.74 ? 111 LEU A N   1 
ATOM   651  C CA  . LEU A 1 88  ? -17.657 -22.538 26.295 1.00 37.31 ? 111 LEU A CA  1 
ATOM   652  C C   . LEU A 1 88  ? -18.946 -21.829 25.915 1.00 38.31 ? 111 LEU A C   1 
ATOM   653  O O   . LEU A 1 88  ? -20.018 -22.180 26.413 1.00 37.68 ? 111 LEU A O   1 
ATOM   654  C CB  . LEU A 1 88  ? -17.488 -23.788 25.427 1.00 36.17 ? 111 LEU A CB  1 
ATOM   655  C CG  . LEU A 1 88  ? -16.208 -24.618 25.503 1.00 34.32 ? 111 LEU A CG  1 
ATOM   656  C CD1 . LEU A 1 88  ? -16.563 -26.086 25.652 1.00 33.54 ? 111 LEU A CD1 1 
ATOM   657  C CD2 . LEU A 1 88  ? -15.368 -24.379 24.251 1.00 32.27 ? 111 LEU A CD2 1 
ATOM   658  N N   . LYS A 1 89  ? -18.858 -20.827 25.055 1.00 38.10 ? 112 LYS A N   1 
ATOM   659  C CA  . LYS A 1 89  ? -20.061 -20.133 24.644 1.00 38.55 ? 112 LYS A CA  1 
ATOM   660  C C   . LYS A 1 89  ? -20.101 -19.991 23.139 1.00 38.73 ? 112 LYS A C   1 
ATOM   661  O O   . LYS A 1 89  ? -19.074 -19.741 22.512 1.00 39.24 ? 112 LYS A O   1 
ATOM   662  C CB  . LYS A 1 89  ? -20.137 -18.751 25.293 1.00 38.27 ? 112 LYS A CB  1 
ATOM   663  C CG  . LYS A 1 89  ? -20.525 -18.762 26.757 1.00 35.12 ? 112 LYS A CG  1 
ATOM   664  C CD  . LYS A 1 89  ? -20.739 -17.337 27.243 1.00 35.61 ? 112 LYS A CD  1 
ATOM   665  C CE  . LYS A 1 89  ? -21.071 -17.269 28.723 1.00 36.66 ? 112 LYS A CE  1 
ATOM   666  N NZ  . LYS A 1 89  ? -22.299 -18.039 29.076 1.00 38.59 ? 112 LYS A NZ  1 
ATOM   667  N N   . ILE A 1 90  ? -21.285 -20.184 22.561 1.00 38.19 ? 113 ILE A N   1 
ATOM   668  C CA  . ILE A 1 90  ? -21.454 -20.032 21.122 1.00 36.98 ? 113 ILE A CA  1 
ATOM   669  C C   . ILE A 1 90  ? -21.905 -18.578 20.997 1.00 38.14 ? 113 ILE A C   1 
ATOM   670  O O   . ILE A 1 90  ? -22.687 -18.096 21.825 1.00 35.87 ? 113 ILE A O   1 
ATOM   671  C CB  . ILE A 1 90  ? -22.564 -20.956 20.545 1.00 34.50 ? 113 ILE A CB  1 
ATOM   672  C CG1 . ILE A 1 90  ? -22.435 -22.386 21.077 1.00 32.67 ? 113 ILE A CG1 1 
ATOM   673  C CG2 . ILE A 1 90  ? -22.443 -21.006 19.041 1.00 34.10 ? 113 ILE A CG2 1 
ATOM   674  C CD1 . ILE A 1 90  ? -21.407 -23.234 20.380 1.00 29.91 ? 113 ILE A CD1 1 
ATOM   675  N N   . TRP A 1 91  ? -21.400 -17.879 19.981 1.00 40.06 ? 114 TRP A N   1 
ATOM   676  C CA  . TRP A 1 91  ? -21.743 -16.474 19.772 1.00 42.01 ? 114 TRP A CA  1 
ATOM   677  C C   . TRP A 1 91  ? -22.190 -16.170 18.362 1.00 43.54 ? 114 TRP A C   1 
ATOM   678  O O   . TRP A 1 91  ? -21.662 -16.723 17.393 1.00 44.47 ? 114 TRP A O   1 
ATOM   679  C CB  . TRP A 1 91  ? -20.549 -15.564 20.075 1.00 42.23 ? 114 TRP A CB  1 
ATOM   680  C CG  . TRP A 1 91  ? -19.965 -15.757 21.425 1.00 43.49 ? 114 TRP A CG  1 
ATOM   681  C CD1 . TRP A 1 91  ? -18.978 -16.628 21.774 1.00 42.89 ? 114 TRP A CD1 1 
ATOM   682  C CD2 . TRP A 1 91  ? -20.358 -15.088 22.625 1.00 44.02 ? 114 TRP A CD2 1 
ATOM   683  N NE1 . TRP A 1 91  ? -18.730 -16.545 23.122 1.00 44.32 ? 114 TRP A NE1 1 
ATOM   684  C CE2 . TRP A 1 91  ? -19.561 -15.607 23.668 1.00 43.27 ? 114 TRP A CE2 1 
ATOM   685  C CE3 . TRP A 1 91  ? -21.309 -14.101 22.921 1.00 43.83 ? 114 TRP A CE3 1 
ATOM   686  C CZ2 . TRP A 1 91  ? -19.685 -15.169 24.988 1.00 43.74 ? 114 TRP A CZ2 1 
ATOM   687  C CZ3 . TRP A 1 91  ? -21.433 -13.668 24.233 1.00 43.82 ? 114 TRP A CZ3 1 
ATOM   688  C CH2 . TRP A 1 91  ? -20.624 -14.202 25.252 1.00 43.78 ? 114 TRP A CH2 1 
ATOM   689  N N   . ASP A 1 92  ? -23.170 -15.278 18.260 1.00 44.38 ? 115 ASP A N   1 
ATOM   690  C CA  . ASP A 1 92  ? -23.678 -14.839 16.974 1.00 44.45 ? 115 ASP A CA  1 
ATOM   691  C C   . ASP A 1 92  ? -22.877 -13.571 16.733 1.00 44.67 ? 115 ASP A C   1 
ATOM   692  O O   . ASP A 1 92  ? -23.194 -12.529 17.294 1.00 43.86 ? 115 ASP A O   1 
ATOM   693  C CB  . ASP A 1 92  ? -25.162 -14.500 17.072 1.00 44.48 ? 115 ASP A CB  1 
ATOM   694  C CG  . ASP A 1 92  ? -25.756 -14.103 15.738 1.00 45.35 ? 115 ASP A CG  1 
ATOM   695  O OD1 . ASP A 1 92  ? -26.573 -13.155 15.701 1.00 47.05 ? 115 ASP A OD1 1 
ATOM   696  O OD2 . ASP A 1 92  ? -25.414 -14.749 14.727 1.00 44.83 ? 115 ASP A OD2 1 
ATOM   697  N N   . VAL A 1 93  ? -21.823 -13.666 15.930 1.00 45.65 ? 116 VAL A N   1 
ATOM   698  C CA  . VAL A 1 93  ? -20.977 -12.504 15.660 1.00 47.16 ? 116 VAL A CA  1 
ATOM   699  C C   . VAL A 1 93  ? -21.789 -11.322 15.139 1.00 46.57 ? 116 VAL A C   1 
ATOM   700  O O   . VAL A 1 93  ? -21.433 -10.163 15.333 1.00 45.03 ? 116 VAL A O   1 
ATOM   701  C CB  . VAL A 1 93  ? -19.848 -12.841 14.638 1.00 48.57 ? 116 VAL A CB  1 
ATOM   702  C CG1 . VAL A 1 93  ? -20.449 -13.237 13.289 1.00 49.91 ? 116 VAL A CG1 1 
ATOM   703  C CG2 . VAL A 1 93  ? -18.913 -11.641 14.478 1.00 48.97 ? 116 VAL A CG2 1 
ATOM   704  N N   . SER A 1 94  ? -22.897 -11.622 14.484 1.00 47.12 ? 117 SER A N   1 
ATOM   705  C CA  . SER A 1 94  ? -23.735 -10.570 13.947 1.00 46.76 ? 117 SER A CA  1 
ATOM   706  C C   . SER A 1 94  ? -24.424 -9.778  15.060 1.00 45.47 ? 117 SER A C   1 
ATOM   707  O O   . SER A 1 94  ? -24.305 -8.557  15.117 1.00 44.61 ? 117 SER A O   1 
ATOM   708  C CB  . SER A 1 94  ? -24.778 -11.170 13.006 1.00 47.25 ? 117 SER A CB  1 
ATOM   709  O OG  . SER A 1 94  ? -25.517 -10.147 12.370 1.00 47.51 ? 117 SER A OG  1 
ATOM   710  N N   . SER A 1 95  ? -25.135 -10.469 15.948 1.00 43.64 ? 118 SER A N   1 
ATOM   711  C CA  . SER A 1 95  ? -25.838 -9.791  17.028 1.00 44.07 ? 118 SER A CA  1 
ATOM   712  C C   . SER A 1 95  ? -25.019 -9.614  18.304 1.00 44.68 ? 118 SER A C   1 
ATOM   713  O O   . SER A 1 95  ? -25.474 -8.967  19.245 1.00 44.04 ? 118 SER A O   1 
ATOM   714  C CB  . SER A 1 95  ? -27.134 -10.538 17.363 1.00 44.57 ? 118 SER A CB  1 
ATOM   715  O OG  . SER A 1 95  ? -26.883 -11.784 17.989 1.00 43.94 ? 118 SER A OG  1 
ATOM   716  N N   . GLY A 1 96  ? -23.817 -10.189 18.333 1.00 45.88 ? 119 GLY A N   1 
ATOM   717  C CA  . GLY A 1 96  ? -22.970 -10.094 19.511 1.00 46.09 ? 119 GLY A CA  1 
ATOM   718  C C   . GLY A 1 96  ? -23.560 -10.805 20.724 1.00 47.10 ? 119 GLY A C   1 
ATOM   719  O O   . GLY A 1 96  ? -22.967 -10.822 21.808 1.00 47.60 ? 119 GLY A O   1 
ATOM   720  N N   . LYS A 1 97  ? -24.724 -11.414 20.536 1.00 47.22 ? 120 LYS A N   1 
ATOM   721  C CA  . LYS A 1 97  ? -25.415 -12.109 21.616 1.00 47.63 ? 120 LYS A CA  1 
ATOM   722  C C   . LYS A 1 97  ? -24.988 -13.565 21.774 1.00 45.43 ? 120 LYS A C   1 
ATOM   723  O O   . LYS A 1 97  ? -24.574 -14.215 20.812 1.00 43.72 ? 120 LYS A O   1 
ATOM   724  C CB  . LYS A 1 97  ? -26.921 -12.036 21.371 1.00 50.82 ? 120 LYS A CB  1 
ATOM   725  C CG  . LYS A 1 97  ? -27.414 -10.627 21.083 1.00 55.25 ? 120 LYS A CG  1 
ATOM   726  C CD  . LYS A 1 97  ? -28.806 -10.624 20.468 1.00 58.82 ? 120 LYS A CD  1 
ATOM   727  C CE  . LYS A 1 97  ? -29.419 -9.239  20.589 1.00 60.50 ? 120 LYS A CE  1 
ATOM   728  N NZ  . LYS A 1 97  ? -29.404 -8.782  22.021 1.00 61.03 ? 120 LYS A NZ  1 
ATOM   729  N N   . CYS A 1 98  ? -25.105 -14.075 22.996 1.00 43.97 ? 121 CYS A N   1 
ATOM   730  C CA  . CYS A 1 98  ? -24.734 -15.452 23.288 1.00 44.04 ? 121 CYS A CA  1 
ATOM   731  C C   . CYS A 1 98  ? -25.860 -16.434 23.002 1.00 44.00 ? 121 CYS A C   1 
ATOM   732  O O   . CYS A 1 98  ? -26.905 -16.395 23.649 1.00 44.30 ? 121 CYS A O   1 
ATOM   733  C CB  . CYS A 1 98  ? -24.311 -15.598 24.748 1.00 43.21 ? 121 CYS A CB  1 
ATOM   734  S SG  . CYS A 1 98  ? -24.143 -17.325 25.253 1.00 46.59 ? 121 CYS A SG  1 
ATOM   735  N N   . LEU A 1 99  ? -25.625 -17.324 22.039 1.00 43.32 ? 122 LEU A N   1 
ATOM   736  C CA  . LEU A 1 99  ? -26.602 -18.331 21.642 1.00 42.54 ? 122 LEU A CA  1 
ATOM   737  C C   . LEU A 1 99  ? -26.648 -19.528 22.579 1.00 44.16 ? 122 LEU A C   1 
ATOM   738  O O   . LEU A 1 99  ? -27.723 -19.937 23.011 1.00 45.44 ? 122 LEU A O   1 
ATOM   739  C CB  . LEU A 1 99  ? -26.301 -18.817 20.225 1.00 41.78 ? 122 LEU A CB  1 
ATOM   740  C CG  . LEU A 1 99  ? -26.989 -18.109 19.055 1.00 42.85 ? 122 LEU A CG  1 
ATOM   741  C CD1 . LEU A 1 99  ? -26.981 -16.598 19.244 1.00 43.15 ? 122 LEU A CD1 1 
ATOM   742  C CD2 . LEU A 1 99  ? -26.283 -18.497 17.772 1.00 42.70 ? 122 LEU A CD2 1 
ATOM   743  N N   . LYS A 1 100 ? -25.485 -20.092 22.893 1.00 44.62 ? 123 LYS A N   1 
ATOM   744  C CA  . LYS A 1 100 ? -25.413 -21.263 23.771 1.00 44.23 ? 123 LYS A CA  1 
ATOM   745  C C   . LYS A 1 100 ? -24.232 -21.193 24.745 1.00 43.85 ? 123 LYS A C   1 
ATOM   746  O O   . LYS A 1 100 ? -23.195 -20.588 24.439 1.00 44.39 ? 123 LYS A O   1 
ATOM   747  C CB  . LYS A 1 100 ? -25.292 -22.543 22.925 1.00 43.63 ? 123 LYS A CB  1 
ATOM   748  C CG  . LYS A 1 100 ? -26.557 -22.957 22.170 1.00 44.06 ? 123 LYS A CG  1 
ATOM   749  C CD  . LYS A 1 100 ? -27.463 -23.809 23.055 1.00 46.50 ? 123 LYS A CD  1 
ATOM   750  C CE  . LYS A 1 100 ? -28.729 -24.288 22.333 1.00 47.93 ? 123 LYS A CE  1 
ATOM   751  N NZ  . LYS A 1 100 ? -29.807 -23.254 22.245 1.00 47.21 ? 123 LYS A NZ  1 
ATOM   752  N N   . THR A 1 101 ? -24.404 -21.801 25.920 1.00 41.85 ? 124 THR A N   1 
ATOM   753  C CA  . THR A 1 101 ? -23.352 -21.851 26.934 1.00 40.95 ? 124 THR A CA  1 
ATOM   754  C C   . THR A 1 101 ? -23.122 -23.331 27.219 1.00 42.43 ? 124 THR A C   1 
ATOM   755  O O   . THR A 1 101 ? -23.896 -23.969 27.930 1.00 43.11 ? 124 THR A O   1 
ATOM   756  C CB  . THR A 1 101 ? -23.756 -21.125 28.249 1.00 39.02 ? 124 THR A CB  1 
ATOM   757  O OG1 . THR A 1 101 ? -24.024 -19.744 27.975 1.00 37.18 ? 124 THR A OG1 1 
ATOM   758  C CG2 . THR A 1 101 ? -22.631 -21.207 29.281 1.00 35.43 ? 124 THR A CG2 1 
ATOM   759  N N   . LEU A 1 102 ? -22.051 -23.871 26.647 1.00 44.00 ? 125 LEU A N   1 
ATOM   760  C CA  . LEU A 1 102 ? -21.712 -25.281 26.794 1.00 45.54 ? 125 LEU A CA  1 
ATOM   761  C C   . LEU A 1 102 ? -21.126 -25.612 28.165 1.00 47.08 ? 125 LEU A C   1 
ATOM   762  O O   . LEU A 1 102 ? -19.988 -25.241 28.470 1.00 46.38 ? 125 LEU A O   1 
ATOM   763  C CB  . LEU A 1 102 ? -20.724 -25.680 25.698 1.00 44.68 ? 125 LEU A CB  1 
ATOM   764  C CG  . LEU A 1 102 ? -21.041 -25.112 24.312 1.00 43.24 ? 125 LEU A CG  1 
ATOM   765  C CD1 . LEU A 1 102 ? -19.972 -25.540 23.329 1.00 44.60 ? 125 LEU A CD1 1 
ATOM   766  C CD2 . LEU A 1 102 ? -22.403 -25.581 23.858 1.00 42.87 ? 125 LEU A CD2 1 
ATOM   767  N N   . LYS A 1 103 ? -21.917 -26.319 28.978 1.00 47.90 ? 126 LYS A N   1 
ATOM   768  C CA  . LYS A 1 103 ? -21.514 -26.721 30.328 1.00 47.70 ? 126 LYS A CA  1 
ATOM   769  C C   . LYS A 1 103 ? -21.121 -28.194 30.340 1.00 47.14 ? 126 LYS A C   1 
ATOM   770  O O   . LYS A 1 103 ? -21.762 -29.008 29.677 1.00 47.63 ? 126 LYS A O   1 
ATOM   771  C CB  . LYS A 1 103 ? -22.668 -26.507 31.309 1.00 48.67 ? 126 LYS A CB  1 
ATOM   772  C CG  . LYS A 1 103 ? -23.279 -25.118 31.273 1.00 50.80 ? 126 LYS A CG  1 
ATOM   773  C CD  . LYS A 1 103 ? -24.348 -24.967 32.348 1.00 53.16 ? 126 LYS A CD  1 
ATOM   774  C CE  . LYS A 1 103 ? -24.969 -23.577 32.328 1.00 55.28 ? 126 LYS A CE  1 
ATOM   775  N NZ  . LYS A 1 103 ? -23.944 -22.505 32.515 1.00 57.25 ? 126 LYS A NZ  1 
ATOM   776  N N   . GLY A 1 104 ? -20.074 -28.533 31.091 1.00 45.88 ? 127 GLY A N   1 
ATOM   777  C CA  . GLY A 1 104 ? -19.625 -29.915 31.155 1.00 43.12 ? 127 GLY A CA  1 
ATOM   778  C C   . GLY A 1 104 ? -18.256 -30.099 31.788 1.00 42.53 ? 127 GLY A C   1 
ATOM   779  O O   . GLY A 1 104 ? -18.082 -30.954 32.655 1.00 41.69 ? 127 GLY A O   1 
ATOM   780  N N   . HIS A 1 105 ? -17.277 -29.308 31.357 1.00 42.18 ? 128 HIS A N   1 
ATOM   781  C CA  . HIS A 1 105 ? -15.926 -29.402 31.903 1.00 40.95 ? 128 HIS A CA  1 
ATOM   782  C C   . HIS A 1 105 ? -15.903 -29.032 33.381 1.00 40.54 ? 128 HIS A C   1 
ATOM   783  O O   . HIS A 1 105 ? -16.696 -28.206 33.828 1.00 40.72 ? 128 HIS A O   1 
ATOM   784  C CB  . HIS A 1 105 ? -14.980 -28.496 31.121 1.00 40.10 ? 128 HIS A CB  1 
ATOM   785  C CG  . HIS A 1 105 ? -14.629 -29.022 29.764 1.00 39.43 ? 128 HIS A CG  1 
ATOM   786  N ND1 . HIS A 1 105 ? -14.254 -30.332 29.552 1.00 38.82 ? 128 HIS A ND1 1 
ATOM   787  C CD2 . HIS A 1 105 ? -14.539 -28.406 28.562 1.00 38.84 ? 128 HIS A CD2 1 
ATOM   788  C CE1 . HIS A 1 105 ? -13.945 -30.499 28.278 1.00 37.94 ? 128 HIS A CE1 1 
ATOM   789  N NE2 . HIS A 1 105 ? -14.110 -29.345 27.655 1.00 37.79 ? 128 HIS A NE2 1 
ATOM   790  N N   . SER A 1 106 ? -14.995 -29.638 34.138 1.00 39.50 ? 129 SER A N   1 
ATOM   791  C CA  . SER A 1 106 ? -14.925 -29.359 35.563 1.00 40.97 ? 129 SER A CA  1 
ATOM   792  C C   . SER A 1 106 ? -13.833 -28.367 35.927 1.00 41.69 ? 129 SER A C   1 
ATOM   793  O O   . SER A 1 106 ? -13.697 -27.975 37.085 1.00 42.84 ? 129 SER A O   1 
ATOM   794  C CB  . SER A 1 106 ? -14.736 -30.656 36.356 1.00 40.73 ? 129 SER A CB  1 
ATOM   795  O OG  . SER A 1 106 ? -13.506 -31.284 36.047 1.00 42.37 ? 129 SER A OG  1 
ATOM   796  N N   . ASN A 1 107 ? -13.050 -27.958 34.939 1.00 42.10 ? 130 ASN A N   1 
ATOM   797  C CA  . ASN A 1 107 ? -11.991 -26.992 35.185 1.00 41.21 ? 130 ASN A CA  1 
ATOM   798  C C   . ASN A 1 107 ? -11.960 -26.008 34.021 1.00 40.35 ? 130 ASN A C   1 
ATOM   799  O O   . ASN A 1 107 ? -12.882 -25.980 33.205 1.00 40.13 ? 130 ASN A O   1 
ATOM   800  C CB  . ASN A 1 107 ? -10.647 -27.706 35.325 1.00 41.27 ? 130 ASN A CB  1 
ATOM   801  C CG  . ASN A 1 107 ? -9.769  -27.084 36.393 1.00 41.18 ? 130 ASN A CG  1 
ATOM   802  O OD1 . ASN A 1 107 ? -9.649  -25.863 36.477 1.00 41.35 ? 130 ASN A OD1 1 
ATOM   803  N ND2 . ASN A 1 107 ? -9.142  -27.924 37.209 1.00 40.25 ? 130 ASN A ND2 1 
ATOM   804  N N   . TYR A 1 108 ? -10.906 -25.207 33.936 1.00 39.76 ? 131 TYR A N   1 
ATOM   805  C CA  . TYR A 1 108 ? -10.800 -24.225 32.866 1.00 39.83 ? 131 TYR A CA  1 
ATOM   806  C C   . TYR A 1 108 ? -10.898 -24.890 31.497 1.00 38.44 ? 131 TYR A C   1 
ATOM   807  O O   . TYR A 1 108 ? -10.508 -26.042 31.329 1.00 38.03 ? 131 TYR A O   1 
ATOM   808  C CB  . TYR A 1 108 ? -9.469  -23.476 32.959 1.00 43.95 ? 131 TYR A CB  1 
ATOM   809  C CG  . TYR A 1 108 ? -9.111  -22.988 34.345 1.00 49.12 ? 131 TYR A CG  1 
ATOM   810  C CD1 . TYR A 1 108 ? -9.966  -22.139 35.058 1.00 51.63 ? 131 TYR A CD1 1 
ATOM   811  C CD2 . TYR A 1 108 ? -7.914  -23.378 34.949 1.00 50.04 ? 131 TYR A CD2 1 
ATOM   812  C CE1 . TYR A 1 108 ? -9.632  -21.693 36.339 1.00 52.94 ? 131 TYR A CE1 1 
ATOM   813  C CE2 . TYR A 1 108 ? -7.572  -22.940 36.224 1.00 52.52 ? 131 TYR A CE2 1 
ATOM   814  C CZ  . TYR A 1 108 ? -8.433  -22.101 36.915 1.00 53.91 ? 131 TYR A CZ  1 
ATOM   815  O OH  . TYR A 1 108 ? -8.090  -21.681 38.183 1.00 55.38 ? 131 TYR A OH  1 
ATOM   816  N N   . VAL A 1 109 ? -11.445 -24.166 30.525 1.00 36.95 ? 132 VAL A N   1 
ATOM   817  C CA  . VAL A 1 109 ? -11.553 -24.666 29.156 1.00 34.90 ? 132 VAL A CA  1 
ATOM   818  C C   . VAL A 1 109 ? -10.452 -23.884 28.466 1.00 34.96 ? 132 VAL A C   1 
ATOM   819  O O   . VAL A 1 109 ? -10.544 -22.673 28.328 1.00 35.64 ? 132 VAL A O   1 
ATOM   820  C CB  . VAL A 1 109 ? -12.903 -24.316 28.526 1.00 32.96 ? 132 VAL A CB  1 
ATOM   821  C CG1 . VAL A 1 109 ? -13.055 -25.040 27.195 1.00 29.82 ? 132 VAL A CG1 1 
ATOM   822  C CG2 . VAL A 1 109 ? -14.016 -24.683 29.475 1.00 29.43 ? 132 VAL A CG2 1 
ATOM   823  N N   . PHE A 1 110 ? -9.408  -24.580 28.042 1.00 34.47 ? 133 PHE A N   1 
ATOM   824  C CA  . PHE A 1 110 ? -8.248  -23.932 27.452 1.00 34.92 ? 133 PHE A CA  1 
ATOM   825  C C   . PHE A 1 110 ? -8.263  -23.689 25.955 1.00 35.10 ? 133 PHE A C   1 
ATOM   826  O O   . PHE A 1 110 ? -7.681  -22.705 25.478 1.00 35.86 ? 133 PHE A O   1 
ATOM   827  C CB  . PHE A 1 110 ? -7.007  -24.742 27.809 1.00 34.70 ? 133 PHE A CB  1 
ATOM   828  C CG  . PHE A 1 110 ? -5.723  -24.039 27.538 1.00 33.17 ? 133 PHE A CG  1 
ATOM   829  C CD1 . PHE A 1 110 ? -5.190  -23.159 28.471 1.00 34.55 ? 133 PHE A CD1 1 
ATOM   830  C CD2 . PHE A 1 110 ? -5.019  -24.289 26.365 1.00 33.07 ? 133 PHE A CD2 1 
ATOM   831  C CE1 . PHE A 1 110 ? -3.961  -22.540 28.241 1.00 36.32 ? 133 PHE A CE1 1 
ATOM   832  C CE2 . PHE A 1 110 ? -3.789  -23.678 26.119 1.00 33.79 ? 133 PHE A CE2 1 
ATOM   833  C CZ  . PHE A 1 110 ? -3.256  -22.804 27.055 1.00 34.61 ? 133 PHE A CZ  1 
ATOM   834  N N   . CYS A 1 111 ? -8.906  -24.583 25.215 1.00 34.09 ? 134 CYS A N   1 
ATOM   835  C CA  . CYS A 1 111 ? -8.954  -24.461 23.758 1.00 33.31 ? 134 CYS A CA  1 
ATOM   836  C C   . CYS A 1 111 ? -10.289 -24.944 23.189 1.00 31.89 ? 134 CYS A C   1 
ATOM   837  O O   . CYS A 1 111 ? -11.003 -25.718 23.841 1.00 30.90 ? 134 CYS A O   1 
ATOM   838  C CB  . CYS A 1 111 ? -7.792  -25.252 23.143 1.00 32.39 ? 134 CYS A CB  1 
ATOM   839  S SG  . CYS A 1 111 ? -7.619  -26.928 23.819 1.00 32.83 ? 134 CYS A SG  1 
ATOM   840  N N   . CYS A 1 112 ? -10.611 -24.485 21.977 1.00 30.07 ? 135 CYS A N   1 
ATOM   841  C CA  . CYS A 1 112 ? -11.864 -24.849 21.308 1.00 29.49 ? 135 CYS A CA  1 
ATOM   842  C C   . CYS A 1 112 ? -11.764 -24.679 19.786 1.00 28.31 ? 135 CYS A C   1 
ATOM   843  O O   . CYS A 1 112 ? -10.877 -23.986 19.293 1.00 30.45 ? 135 CYS A O   1 
ATOM   844  C CB  . CYS A 1 112 ? -13.007 -23.991 21.857 1.00 28.66 ? 135 CYS A CB  1 
ATOM   845  S SG  . CYS A 1 112 ? -12.750 -22.211 21.657 1.00 33.50 ? 135 CYS A SG  1 
ATOM   846  N N   . ASN A 1 113 ? -12.672 -25.312 19.045 1.00 26.35 ? 136 ASN A N   1 
ATOM   847  C CA  . ASN A 1 113 ? -12.677 -25.226 17.579 1.00 24.46 ? 136 ASN A CA  1 
ATOM   848  C C   . ASN A 1 113 ? -13.960 -25.795 16.967 1.00 24.72 ? 136 ASN A C   1 
ATOM   849  O O   . ASN A 1 113 ? -14.580 -26.688 17.532 1.00 25.23 ? 136 ASN A O   1 
ATOM   850  C CB  . ASN A 1 113 ? -11.487 -26.004 17.010 1.00 21.94 ? 136 ASN A CB  1 
ATOM   851  C CG  . ASN A 1 113 ? -10.325 -25.107 16.598 1.00 22.33 ? 136 ASN A CG  1 
ATOM   852  O OD1 . ASN A 1 113 ? -9.157  -25.527 16.623 1.00 22.00 ? 136 ASN A OD1 1 
ATOM   853  N ND2 . ASN A 1 113 ? -10.636 -23.883 16.193 1.00 18.97 ? 136 ASN A ND2 1 
ATOM   854  N N   . PHE A 1 114 ? -14.370 -25.267 15.820 1.00 25.87 ? 137 PHE A N   1 
ATOM   855  C CA  . PHE A 1 114 ? -15.540 -25.795 15.119 1.00 26.08 ? 137 PHE A CA  1 
ATOM   856  C C   . PHE A 1 114 ? -14.992 -26.818 14.119 1.00 27.39 ? 137 PHE A C   1 
ATOM   857  O O   . PHE A 1 114 ? -13.807 -26.788 13.784 1.00 27.47 ? 137 PHE A O   1 
ATOM   858  C CB  . PHE A 1 114 ? -16.231 -24.721 14.273 1.00 25.68 ? 137 PHE A CB  1 
ATOM   859  C CG  . PHE A 1 114 ? -17.138 -23.800 15.027 1.00 26.97 ? 137 PHE A CG  1 
ATOM   860  C CD1 . PHE A 1 114 ? -16.727 -22.508 15.341 1.00 28.03 ? 137 PHE A CD1 1 
ATOM   861  C CD2 . PHE A 1 114 ? -18.434 -24.190 15.352 1.00 27.35 ? 137 PHE A CD2 1 
ATOM   862  C CE1 . PHE A 1 114 ? -17.593 -21.606 15.964 1.00 28.33 ? 137 PHE A CE1 1 
ATOM   863  C CE2 . PHE A 1 114 ? -19.311 -23.303 15.976 1.00 28.04 ? 137 PHE A CE2 1 
ATOM   864  C CZ  . PHE A 1 114 ? -18.888 -22.003 16.283 1.00 29.15 ? 137 PHE A CZ  1 
ATOM   865  N N   . ASN A 1 115 ? -15.831 -27.727 13.637 1.00 29.78 ? 138 ASN A N   1 
ATOM   866  C CA  . ASN A 1 115 ? -15.364 -28.636 12.592 1.00 31.28 ? 138 ASN A CA  1 
ATOM   867  C C   . ASN A 1 115 ? -15.692 -27.863 11.308 1.00 33.03 ? 138 ASN A C   1 
ATOM   868  O O   . ASN A 1 115 ? -16.368 -26.830 11.356 1.00 31.78 ? 138 ASN A O   1 
ATOM   869  C CB  . ASN A 1 115 ? -16.097 -29.987 12.625 1.00 28.92 ? 138 ASN A CB  1 
ATOM   870  C CG  . ASN A 1 115 ? -17.615 -29.845 12.648 1.00 28.04 ? 138 ASN A CG  1 
ATOM   871  O OD1 . ASN A 1 115 ? -18.340 -30.845 12.596 1.00 24.44 ? 138 ASN A OD1 1 
ATOM   872  N ND2 . ASN A 1 115 ? -18.101 -28.609 12.735 1.00 24.75 ? 138 ASN A ND2 1 
ATOM   873  N N   . PRO A 1 116 ? -15.198 -28.318 10.149 1.00 35.38 ? 139 PRO A N   1 
ATOM   874  C CA  . PRO A 1 116 ? -15.525 -27.561 8.934  1.00 36.85 ? 139 PRO A CA  1 
ATOM   875  C C   . PRO A 1 116 ? -17.026 -27.379 8.700  1.00 38.56 ? 139 PRO A C   1 
ATOM   876  O O   . PRO A 1 116 ? -17.469 -26.305 8.333  1.00 38.93 ? 139 PRO A O   1 
ATOM   877  C CB  . PRO A 1 116 ? -14.856 -28.379 7.838  1.00 35.45 ? 139 PRO A CB  1 
ATOM   878  C CG  . PRO A 1 116 ? -13.623 -28.872 8.530  1.00 35.18 ? 139 PRO A CG  1 
ATOM   879  C CD  . PRO A 1 116 ? -14.163 -29.328 9.873  1.00 35.63 ? 139 PRO A CD  1 
ATOM   880  N N   . GLN A 1 117 ? -17.805 -28.428 8.927  1.00 40.61 ? 140 GLN A N   1 
ATOM   881  C CA  . GLN A 1 117 ? -19.245 -28.377 8.719  1.00 43.05 ? 140 GLN A CA  1 
ATOM   882  C C   . GLN A 1 117 ? -19.959 -27.564 9.791  1.00 43.04 ? 140 GLN A C   1 
ATOM   883  O O   . GLN A 1 117 ? -21.180 -27.462 9.798  1.00 44.43 ? 140 GLN A O   1 
ATOM   884  C CB  . GLN A 1 117 ? -19.792 -29.806 8.668  1.00 47.35 ? 140 GLN A CB  1 
ATOM   885  C CG  . GLN A 1 117 ? -21.284 -29.945 8.438  1.00 53.88 ? 140 GLN A CG  1 
ATOM   886  C CD  . GLN A 1 117 ? -21.645 -31.353 8.031  1.00 57.08 ? 140 GLN A CD  1 
ATOM   887  O OE1 . GLN A 1 117 ? -21.079 -32.318 8.543  1.00 57.93 ? 140 GLN A OE1 1 
ATOM   888  N NE2 . GLN A 1 117 ? -22.589 -31.481 7.109  1.00 55.78 ? 140 GLN A NE2 1 
ATOM   889  N N   . SER A 1 118 ? -19.180 -26.985 10.696 1.00 42.96 ? 141 SER A N   1 
ATOM   890  C CA  . SER A 1 118 ? -19.691 -26.154 11.789 1.00 42.47 ? 141 SER A CA  1 
ATOM   891  C C   . SER A 1 118 ? -20.889 -26.678 12.591 1.00 41.67 ? 141 SER A C   1 
ATOM   892  O O   . SER A 1 118 ? -21.648 -25.887 13.157 1.00 42.45 ? 141 SER A O   1 
ATOM   893  C CB  . SER A 1 118 ? -20.004 -24.745 11.269 1.00 42.06 ? 141 SER A CB  1 
ATOM   894  O OG  . SER A 1 118 ? -18.819 -24.075 10.870 1.00 43.74 ? 141 SER A OG  1 
ATOM   895  N N   . ASN A 1 119 ? -21.068 -27.995 12.648 1.00 39.38 ? 142 ASN A N   1 
ATOM   896  C CA  . ASN A 1 119 ? -22.166 -28.543 13.428 1.00 37.42 ? 142 ASN A CA  1 
ATOM   897  C C   . ASN A 1 119 ? -21.617 -29.109 14.725 1.00 38.17 ? 142 ASN A C   1 
ATOM   898  O O   . ASN A 1 119 ? -22.367 -29.502 15.622 1.00 39.75 ? 142 ASN A O   1 
ATOM   899  C CB  . ASN A 1 119 ? -22.909 -29.636 12.656 1.00 35.85 ? 142 ASN A CB  1 
ATOM   900  C CG  . ASN A 1 119 ? -21.998 -30.741 12.170 1.00 33.53 ? 142 ASN A CG  1 
ATOM   901  O OD1 . ASN A 1 119 ? -21.106 -30.510 11.359 1.00 32.75 ? 142 ASN A OD1 1 
ATOM   902  N ND2 . ASN A 1 119 ? -22.228 -31.956 12.655 1.00 30.69 ? 142 ASN A ND2 1 
ATOM   903  N N   . LEU A 1 120 ? -20.294 -29.135 14.829 1.00 37.40 ? 143 LEU A N   1 
ATOM   904  C CA  . LEU A 1 120 ? -19.644 -29.654 16.022 1.00 36.80 ? 143 LEU A CA  1 
ATOM   905  C C   . LEU A 1 120 ? -18.617 -28.684 16.583 1.00 36.64 ? 143 LEU A C   1 
ATOM   906  O O   . LEU A 1 120 ? -18.076 -27.838 15.864 1.00 37.13 ? 143 LEU A O   1 
ATOM   907  C CB  . LEU A 1 120 ? -18.939 -30.978 15.717 1.00 35.95 ? 143 LEU A CB  1 
ATOM   908  C CG  . LEU A 1 120 ? -19.727 -32.142 15.123 1.00 33.23 ? 143 LEU A CG  1 
ATOM   909  C CD1 . LEU A 1 120 ? -18.816 -33.350 15.082 1.00 32.09 ? 143 LEU A CD1 1 
ATOM   910  C CD2 . LEU A 1 120 ? -20.962 -32.446 15.961 1.00 33.98 ? 143 LEU A CD2 1 
ATOM   911  N N   . ILE A 1 121 ? -18.357 -28.831 17.878 1.00 35.80 ? 144 ILE A N   1 
ATOM   912  C CA  . ILE A 1 121 ? -17.378 -28.025 18.601 1.00 33.72 ? 144 ILE A CA  1 
ATOM   913  C C   . ILE A 1 121 ? -16.481 -29.008 19.347 1.00 33.15 ? 144 ILE A C   1 
ATOM   914  O O   . ILE A 1 121 ? -16.978 -29.930 20.008 1.00 33.59 ? 144 ILE A O   1 
ATOM   915  C CB  . ILE A 1 121 ? -18.039 -27.126 19.679 1.00 33.94 ? 144 ILE A CB  1 
ATOM   916  C CG1 . ILE A 1 121 ? -18.887 -26.033 19.031 1.00 33.36 ? 144 ILE A CG1 1 
ATOM   917  C CG2 . ILE A 1 121 ? -16.958 -26.517 20.579 1.00 32.80 ? 144 ILE A CG2 1 
ATOM   918  C CD1 . ILE A 1 121 ? -18.102 -24.854 18.556 1.00 33.98 ? 144 ILE A CD1 1 
ATOM   919  N N   . VAL A 1 122 ? -15.169 -28.841 19.223 1.00 31.51 ? 145 VAL A N   1 
ATOM   920  C CA  . VAL A 1 122 ? -14.243 -29.697 19.951 1.00 29.43 ? 145 VAL A CA  1 
ATOM   921  C C   . VAL A 1 122 ? -13.668 -28.762 20.996 1.00 27.93 ? 145 VAL A C   1 
ATOM   922  O O   . VAL A 1 122 ? -13.406 -27.600 20.705 1.00 25.33 ? 145 VAL A O   1 
ATOM   923  C CB  . VAL A 1 122 ? -13.106 -30.263 19.051 1.00 30.64 ? 145 VAL A CB  1 
ATOM   924  C CG1 . VAL A 1 122 ? -12.204 -29.144 18.553 1.00 29.90 ? 145 VAL A CG1 1 
ATOM   925  C CG2 . VAL A 1 122 ? -12.295 -31.290 19.829 1.00 30.14 ? 145 VAL A CG2 1 
ATOM   926  N N   . SER A 1 123 ? -13.504 -29.263 22.214 1.00 28.79 ? 146 SER A N   1 
ATOM   927  C CA  . SER A 1 123 ? -12.984 -28.452 23.307 1.00 29.21 ? 146 SER A CA  1 
ATOM   928  C C   . SER A 1 123 ? -11.919 -29.177 24.109 1.00 30.58 ? 146 SER A C   1 
ATOM   929  O O   . SER A 1 123 ? -11.941 -30.405 24.239 1.00 29.27 ? 146 SER A O   1 
ATOM   930  C CB  . SER A 1 123 ? -14.124 -28.033 24.249 1.00 27.82 ? 146 SER A CB  1 
ATOM   931  O OG  . SER A 1 123 ? -14.755 -29.163 24.840 1.00 24.69 ? 146 SER A OG  1 
ATOM   932  N N   . GLY A 1 124 ? -10.990 -28.398 24.649 1.00 32.03 ? 147 GLY A N   1 
ATOM   933  C CA  . GLY A 1 124 ? -9.922  -28.955 25.455 1.00 34.27 ? 147 GLY A CA  1 
ATOM   934  C C   . GLY A 1 124 ? -9.950  -28.246 26.791 1.00 35.49 ? 147 GLY A C   1 
ATOM   935  O O   . GLY A 1 124 ? -10.019 -27.018 26.842 1.00 36.10 ? 147 GLY A O   1 
ATOM   936  N N   . SER A 1 125 ? -9.890  -29.006 27.876 1.00 36.85 ? 148 SER A N   1 
ATOM   937  C CA  . SER A 1 125 ? -9.937  -28.415 29.199 1.00 38.77 ? 148 SER A CA  1 
ATOM   938  C C   . SER A 1 125 ? -8.763  -28.790 30.096 1.00 39.68 ? 148 SER A C   1 
ATOM   939  O O   . SER A 1 125 ? -7.907  -29.597 29.738 1.00 39.31 ? 148 SER A O   1 
ATOM   940  C CB  . SER A 1 125 ? -11.245 -28.823 29.876 1.00 38.96 ? 148 SER A CB  1 
ATOM   941  O OG  . SER A 1 125 ? -11.302 -28.378 31.220 1.00 39.32 ? 148 SER A OG  1 
ATOM   942  N N   . PHE A 1 126 ? -8.741  -28.180 31.274 1.00 40.40 ? 149 PHE A N   1 
ATOM   943  C CA  . PHE A 1 126 ? -7.719  -28.438 32.278 1.00 40.82 ? 149 PHE A CA  1 
ATOM   944  C C   . PHE A 1 126 ? -7.984  -29.833 32.837 1.00 39.05 ? 149 PHE A C   1 
ATOM   945  O O   . PHE A 1 126 ? -7.057  -30.575 33.162 1.00 39.14 ? 149 PHE A O   1 
ATOM   946  C CB  . PHE A 1 126 ? -7.834  -27.414 33.406 1.00 42.75 ? 149 PHE A CB  1 
ATOM   947  C CG  . PHE A 1 126 ? -6.698  -27.454 34.388 1.00 47.43 ? 149 PHE A CG  1 
ATOM   948  C CD1 . PHE A 1 126 ? -5.521  -26.747 34.143 1.00 47.81 ? 149 PHE A CD1 1 
ATOM   949  C CD2 . PHE A 1 126 ? -6.806  -28.192 35.572 1.00 49.07 ? 149 PHE A CD2 1 
ATOM   950  C CE1 . PHE A 1 126 ? -4.471  -26.771 35.066 1.00 49.02 ? 149 PHE A CE1 1 
ATOM   951  C CE2 . PHE A 1 126 ? -5.764  -28.224 36.499 1.00 47.57 ? 149 PHE A CE2 1 
ATOM   952  C CZ  . PHE A 1 126 ? -4.594  -27.512 36.247 1.00 48.40 ? 149 PHE A CZ  1 
ATOM   953  N N   . ASP A 1 127 ? -9.265  -30.184 32.928 1.00 37.12 ? 150 ASP A N   1 
ATOM   954  C CA  . ASP A 1 127 ? -9.683  -31.474 33.459 1.00 34.90 ? 150 ASP A CA  1 
ATOM   955  C C   . ASP A 1 127 ? -9.118  -32.653 32.681 1.00 33.75 ? 150 ASP A C   1 
ATOM   956  O O   . ASP A 1 127 ? -9.350  -33.810 33.028 1.00 33.08 ? 150 ASP A O   1 
ATOM   957  C CB  . ASP A 1 127 ? -11.210 -31.542 33.527 1.00 35.30 ? 150 ASP A CB  1 
ATOM   958  C CG  . ASP A 1 127 ? -11.864 -31.524 32.165 1.00 37.34 ? 150 ASP A CG  1 
ATOM   959  O OD1 . ASP A 1 127 ? -13.035 -31.095 32.088 1.00 37.48 ? 150 ASP A OD1 1 
ATOM   960  O OD2 . ASP A 1 127 ? -11.221 -31.951 31.181 1.00 37.64 ? 150 ASP A OD2 1 
ATOM   961  N N   . GLU A 1 128 ? -8.371  -32.351 31.627 1.00 33.06 ? 151 GLU A N   1 
ATOM   962  C CA  . GLU A 1 128 ? -7.713  -33.370 30.812 1.00 31.80 ? 151 GLU A CA  1 
ATOM   963  C C   . GLU A 1 128 ? -8.609  -34.199 29.917 1.00 30.78 ? 151 GLU A C   1 
ATOM   964  O O   . GLU A 1 128 ? -8.255  -35.302 29.524 1.00 31.86 ? 151 GLU A O   1 
ATOM   965  C CB  . GLU A 1 128 ? -6.904  -34.296 31.712 1.00 30.88 ? 151 GLU A CB  1 
ATOM   966  C CG  . GLU A 1 128 ? -6.489  -33.628 33.003 1.00 29.25 ? 151 GLU A CG  1 
ATOM   967  C CD  . GLU A 1 128 ? -5.589  -34.488 33.822 1.00 28.94 ? 151 GLU A CD  1 
ATOM   968  O OE1 . GLU A 1 128 ? -5.830  -35.719 33.873 1.00 26.99 ? 151 GLU A OE1 1 
ATOM   969  O OE2 . GLU A 1 128 ? -4.647  -33.922 34.412 1.00 29.81 ? 151 GLU A OE2 1 
ATOM   970  N N   . SER A 1 129 ? -9.774  -33.672 29.592 1.00 30.56 ? 152 SER A N   1 
ATOM   971  C CA  . SER A 1 129 ? -10.675 -34.385 28.708 1.00 29.45 ? 152 SER A CA  1 
ATOM   972  C C   . SER A 1 129 ? -10.770 -33.585 27.420 1.00 29.09 ? 152 SER A C   1 
ATOM   973  O O   . SER A 1 129 ? -10.273 -32.462 27.331 1.00 28.24 ? 152 SER A O   1 
ATOM   974  C CB  . SER A 1 129 ? -12.065 -34.495 29.337 1.00 28.37 ? 152 SER A CB  1 
ATOM   975  O OG  . SER A 1 129 ? -12.673 -33.219 29.463 1.00 27.53 ? 152 SER A OG  1 
ATOM   976  N N   . VAL A 1 130 ? -11.378 -34.187 26.413 1.00 30.01 ? 153 VAL A N   1 
ATOM   977  C CA  . VAL A 1 130 ? -11.617 -33.509 25.153 1.00 30.95 ? 153 VAL A CA  1 
ATOM   978  C C   . VAL A 1 130 ? -13.086 -33.801 24.927 1.00 32.54 ? 153 VAL A C   1 
ATOM   979  O O   . VAL A 1 130 ? -13.498 -34.963 24.980 1.00 34.26 ? 153 VAL A O   1 
ATOM   980  C CB  . VAL A 1 130 ? -10.793 -34.086 23.987 1.00 29.28 ? 153 VAL A CB  1 
ATOM   981  C CG1 . VAL A 1 130 ? -11.391 -33.623 22.675 1.00 28.08 ? 153 VAL A CG1 1 
ATOM   982  C CG2 . VAL A 1 130 ? -9.344  -33.605 24.073 1.00 29.56 ? 153 VAL A CG2 1 
ATOM   983  N N   . ARG A 1 131 ? -13.878 -32.750 24.725 1.00 33.12 ? 154 ARG A N   1 
ATOM   984  C CA  . ARG A 1 131 ? -15.312 -32.907 24.495 1.00 32.99 ? 154 ARG A CA  1 
ATOM   985  C C   . ARG A 1 131 ? -15.733 -32.455 23.099 1.00 32.58 ? 154 ARG A C   1 
ATOM   986  O O   . ARG A 1 131 ? -15.190 -31.501 22.538 1.00 32.47 ? 154 ARG A O   1 
ATOM   987  C CB  . ARG A 1 131 ? -16.116 -32.139 25.550 1.00 32.78 ? 154 ARG A CB  1 
ATOM   988  C CG  . ARG A 1 131 ? -16.137 -32.799 26.918 1.00 35.20 ? 154 ARG A CG  1 
ATOM   989  C CD  . ARG A 1 131 ? -16.857 -31.929 27.964 1.00 36.39 ? 154 ARG A CD  1 
ATOM   990  N NE  . ARG A 1 131 ? -16.711 -32.469 29.318 1.00 38.84 ? 154 ARG A NE  1 
ATOM   991  C CZ  . ARG A 1 131 ? -17.569 -33.302 29.900 1.00 38.05 ? 154 ARG A CZ  1 
ATOM   992  N NH1 . ARG A 1 131 ? -18.658 -33.695 29.259 1.00 37.60 ? 154 ARG A NH1 1 
ATOM   993  N NH2 . ARG A 1 131 ? -17.321 -33.765 31.117 1.00 37.08 ? 154 ARG A NH2 1 
ATOM   994  N N   . ILE A 1 132 ? -16.706 -33.170 22.549 1.00 31.82 ? 155 ILE A N   1 
ATOM   995  C CA  . ILE A 1 132 ? -17.257 -32.888 21.232 1.00 30.87 ? 155 ILE A CA  1 
ATOM   996  C C   . ILE A 1 132 ? -18.686 -32.411 21.482 1.00 31.88 ? 155 ILE A C   1 
ATOM   997  O O   . ILE A 1 132 ? -19.493 -33.112 22.098 1.00 30.87 ? 155 ILE A O   1 
ATOM   998  C CB  . ILE A 1 132 ? -17.258 -34.166 20.354 1.00 29.09 ? 155 ILE A CB  1 
ATOM   999  C CG1 . ILE A 1 132 ? -15.826 -34.702 20.241 1.00 27.93 ? 155 ILE A CG1 1 
ATOM   1000 C CG2 . ILE A 1 132 ? -17.838 -33.868 18.980 1.00 27.38 ? 155 ILE A CG2 1 
ATOM   1001 C CD1 . ILE A 1 132 ? -15.673 -35.918 19.357 1.00 27.09 ? 155 ILE A CD1 1 
ATOM   1002 N N   . TRP A 1 133 ? -18.994 -31.210 21.011 1.00 33.52 ? 156 TRP A N   1 
ATOM   1003 C CA  . TRP A 1 133 ? -20.316 -30.653 21.235 1.00 34.79 ? 156 TRP A CA  1 
ATOM   1004 C C   . TRP A 1 133 ? -21.169 -30.481 19.989 1.00 35.57 ? 156 TRP A C   1 
ATOM   1005 O O   . TRP A 1 133 ? -20.664 -30.390 18.866 1.00 34.59 ? 156 TRP A O   1 
ATOM   1006 C CB  . TRP A 1 133 ? -20.195 -29.295 21.924 1.00 36.52 ? 156 TRP A CB  1 
ATOM   1007 C CG  . TRP A 1 133 ? -19.228 -29.269 23.065 1.00 36.97 ? 156 TRP A CG  1 
ATOM   1008 C CD1 . TRP A 1 133 ? -17.867 -29.237 22.988 1.00 36.85 ? 156 TRP A CD1 1 
ATOM   1009 C CD2 . TRP A 1 133 ? -19.553 -29.301 24.456 1.00 37.85 ? 156 TRP A CD2 1 
ATOM   1010 N NE1 . TRP A 1 133 ? -17.323 -29.250 24.247 1.00 37.32 ? 156 TRP A NE1 1 
ATOM   1011 C CE2 . TRP A 1 133 ? -18.335 -29.290 25.168 1.00 36.63 ? 156 TRP A CE2 1 
ATOM   1012 C CE3 . TRP A 1 133 ? -20.759 -29.340 25.173 1.00 37.82 ? 156 TRP A CE3 1 
ATOM   1013 C CZ2 . TRP A 1 133 ? -18.283 -29.319 26.561 1.00 37.00 ? 156 TRP A CZ2 1 
ATOM   1014 C CZ3 . TRP A 1 133 ? -20.708 -29.370 26.556 1.00 37.52 ? 156 TRP A CZ3 1 
ATOM   1015 C CH2 . TRP A 1 133 ? -19.477 -29.359 27.237 1.00 37.56 ? 156 TRP A CH2 1 
ATOM   1016 N N   . ASP A 1 134 ? -22.477 -30.423 20.217 1.00 36.76 ? 157 ASP A N   1 
ATOM   1017 C CA  . ASP A 1 134 ? -23.448 -30.226 19.155 1.00 37.57 ? 157 ASP A CA  1 
ATOM   1018 C C   . ASP A 1 134 ? -23.787 -28.737 19.147 1.00 37.03 ? 157 ASP A C   1 
ATOM   1019 O O   . ASP A 1 134 ? -24.422 -28.237 20.077 1.00 37.33 ? 157 ASP A O   1 
ATOM   1020 C CB  . ASP A 1 134 ? -24.714 -31.022 19.440 1.00 38.53 ? 157 ASP A CB  1 
ATOM   1021 C CG  . ASP A 1 134 ? -25.607 -31.128 18.232 1.00 40.87 ? 157 ASP A CG  1 
ATOM   1022 O OD1 . ASP A 1 134 ? -25.975 -30.085 17.659 1.00 40.26 ? 157 ASP A OD1 1 
ATOM   1023 O OD2 . ASP A 1 134 ? -25.941 -32.266 17.850 1.00 44.78 ? 157 ASP A OD2 1 
ATOM   1024 N N   . VAL A 1 135 ? -23.365 -28.031 18.105 1.00 35.61 ? 158 VAL A N   1 
ATOM   1025 C CA  . VAL A 1 135 ? -23.624 -26.604 18.018 1.00 35.36 ? 158 VAL A CA  1 
ATOM   1026 C C   . VAL A 1 135 ? -25.106 -26.223 18.142 1.00 37.01 ? 158 VAL A C   1 
ATOM   1027 O O   . VAL A 1 135 ? -25.437 -25.265 18.835 1.00 38.74 ? 158 VAL A O   1 
ATOM   1028 C CB  . VAL A 1 135 ? -23.053 -26.016 16.695 1.00 34.46 ? 158 VAL A CB  1 
ATOM   1029 C CG1 . VAL A 1 135 ? -23.491 -24.574 16.531 1.00 33.54 ? 158 VAL A CG1 1 
ATOM   1030 C CG2 . VAL A 1 135 ? -21.526 -26.085 16.701 1.00 33.28 ? 158 VAL A CG2 1 
ATOM   1031 N N   . LYS A 1 136 ? -25.998 -26.967 17.490 1.00 37.75 ? 159 LYS A N   1 
ATOM   1032 C CA  . LYS A 1 136 ? -27.432 -26.656 17.533 1.00 37.57 ? 159 LYS A CA  1 
ATOM   1033 C C   . LYS A 1 136 ? -28.121 -26.954 18.849 1.00 38.28 ? 159 LYS A C   1 
ATOM   1034 O O   . LYS A 1 136 ? -28.877 -26.124 19.347 1.00 38.08 ? 159 LYS A O   1 
ATOM   1035 C CB  . LYS A 1 136 ? -28.189 -27.402 16.433 1.00 37.62 ? 159 LYS A CB  1 
ATOM   1036 C CG  . LYS A 1 136 ? -27.754 -27.073 15.023 1.00 38.11 ? 159 LYS A CG  1 
ATOM   1037 C CD  . LYS A 1 136 ? -28.584 -27.842 13.998 1.00 38.79 ? 159 LYS A CD  1 
ATOM   1038 C CE  . LYS A 1 136 ? -29.983 -27.252 13.802 1.00 37.43 ? 159 LYS A CE  1 
ATOM   1039 N NZ  . LYS A 1 136 ? -30.179 -26.781 12.388 1.00 36.06 ? 159 LYS A NZ  1 
ATOM   1040 N N   . THR A 1 137 ? -27.876 -28.142 19.397 1.00 39.72 ? 160 THR A N   1 
ATOM   1041 C CA  . THR A 1 137 ? -28.499 -28.562 20.651 1.00 41.16 ? 160 THR A CA  1 
ATOM   1042 C C   . THR A 1 137 ? -27.729 -28.069 21.870 1.00 42.96 ? 160 THR A C   1 
ATOM   1043 O O   . THR A 1 137 ? -28.240 -28.128 22.997 1.00 45.58 ? 160 THR A O   1 
ATOM   1044 C CB  . THR A 1 137 ? -28.607 -30.109 20.762 1.00 39.86 ? 160 THR A CB  1 
ATOM   1045 O OG1 . THR A 1 137 ? -27.357 -30.648 21.215 1.00 40.01 ? 160 THR A OG1 1 
ATOM   1046 C CG2 . THR A 1 137 ? -28.957 -30.724 19.410 1.00 38.35 ? 160 THR A CG2 1 
ATOM   1047 N N   . GLY A 1 138 ? -26.503 -27.595 21.647 1.00 43.47 ? 161 GLY A N   1 
ATOM   1048 C CA  . GLY A 1 138 ? -25.688 -27.104 22.748 1.00 43.05 ? 161 GLY A CA  1 
ATOM   1049 C C   . GLY A 1 138 ? -25.377 -28.180 23.777 1.00 42.51 ? 161 GLY A C   1 
ATOM   1050 O O   . GLY A 1 138 ? -24.957 -27.885 24.901 1.00 42.00 ? 161 GLY A O   1 
ATOM   1051 N N   . LYS A 1 139 ? -25.592 -29.435 23.396 1.00 42.43 ? 162 LYS A N   1 
ATOM   1052 C CA  . LYS A 1 139 ? -25.323 -30.549 24.290 1.00 42.67 ? 162 LYS A CA  1 
ATOM   1053 C C   . LYS A 1 139 ? -23.990 -31.209 23.933 1.00 43.02 ? 162 LYS A C   1 
ATOM   1054 O O   . LYS A 1 139 ? -23.475 -31.065 22.818 1.00 43.07 ? 162 LYS A O   1 
ATOM   1055 C CB  . LYS A 1 139 ? -26.464 -31.574 24.227 1.00 43.26 ? 162 LYS A CB  1 
ATOM   1056 C CG  . LYS A 1 139 ? -27.832 -30.996 24.609 1.00 45.68 ? 162 LYS A CG  1 
ATOM   1057 C CD  . LYS A 1 139 ? -28.829 -32.098 25.008 1.00 45.80 ? 162 LYS A CD  1 
ATOM   1058 C CE  . LYS A 1 139 ? -30.163 -31.531 25.527 1.00 45.72 ? 162 LYS A CE  1 
ATOM   1059 N NZ  . LYS A 1 139 ? -31.044 -30.948 24.468 1.00 44.33 ? 162 LYS A NZ  1 
ATOM   1060 N N   . CYS A 1 140 ? -23.434 -31.931 24.896 1.00 41.92 ? 163 CYS A N   1 
ATOM   1061 C CA  . CYS A 1 140 ? -22.162 -32.605 24.716 1.00 39.61 ? 163 CYS A CA  1 
ATOM   1062 C C   . CYS A 1 140 ? -22.371 -34.019 24.175 1.00 37.47 ? 163 CYS A C   1 
ATOM   1063 O O   . CYS A 1 140 ? -23.074 -34.824 24.786 1.00 36.66 ? 163 CYS A O   1 
ATOM   1064 C CB  . CYS A 1 140 ? -21.416 -32.631 26.063 1.00 38.55 ? 163 CYS A CB  1 
ATOM   1065 S SG  . CYS A 1 140 ? -19.888 -33.595 26.109 1.00 39.71 ? 163 CYS A SG  1 
ATOM   1066 N N   . LEU A 1 141 ? -21.746 -34.310 23.033 1.00 36.13 ? 164 LEU A N   1 
ATOM   1067 C CA  . LEU A 1 141 ? -21.840 -35.623 22.387 1.00 34.98 ? 164 LEU A CA  1 
ATOM   1068 C C   . LEU A 1 141 ? -20.892 -36.693 22.938 1.00 36.04 ? 164 LEU A C   1 
ATOM   1069 O O   . LEU A 1 141 ? -21.256 -37.871 23.005 1.00 36.51 ? 164 LEU A O   1 
ATOM   1070 C CB  . LEU A 1 141 ? -21.603 -35.482 20.887 1.00 31.21 ? 164 LEU A CB  1 
ATOM   1071 C CG  . LEU A 1 141 ? -22.618 -34.587 20.183 1.00 29.91 ? 164 LEU A CG  1 
ATOM   1072 C CD1 . LEU A 1 141 ? -22.221 -34.338 18.729 1.00 30.12 ? 164 LEU A CD1 1 
ATOM   1073 C CD2 . LEU A 1 141 ? -23.966 -35.241 20.283 1.00 28.20 ? 164 LEU A CD2 1 
ATOM   1074 N N   . LYS A 1 142 ? -19.680 -36.294 23.321 1.00 36.34 ? 165 LYS A N   1 
ATOM   1075 C CA  . LYS A 1 142 ? -18.702 -37.244 23.855 1.00 35.80 ? 165 LYS A CA  1 
ATOM   1076 C C   . LYS A 1 142 ? -17.713 -36.609 24.812 1.00 35.37 ? 165 LYS A C   1 
ATOM   1077 O O   . LYS A 1 142 ? -17.439 -35.406 24.744 1.00 34.57 ? 165 LYS A O   1 
ATOM   1078 C CB  . LYS A 1 142 ? -17.907 -37.893 22.721 1.00 36.47 ? 165 LYS A CB  1 
ATOM   1079 C CG  . LYS A 1 142 ? -18.699 -38.859 21.867 1.00 40.74 ? 165 LYS A CG  1 
ATOM   1080 C CD  . LYS A 1 142 ? -18.058 -39.025 20.494 1.00 41.02 ? 165 LYS A CD  1 
ATOM   1081 C CE  . LYS A 1 142 ? -18.851 -39.990 19.630 1.00 41.45 ? 165 LYS A CE  1 
ATOM   1082 N NZ  . LYS A 1 142 ? -18.778 -41.379 20.168 1.00 41.15 ? 165 LYS A NZ  1 
ATOM   1083 N N   . THR A 1 143 ? -17.186 -37.433 25.713 1.00 34.32 ? 166 THR A N   1 
ATOM   1084 C CA  . THR A 1 143 ? -16.180 -36.983 26.661 1.00 33.73 ? 166 THR A CA  1 
ATOM   1085 C C   . THR A 1 143 ? -15.014 -37.939 26.520 1.00 32.94 ? 166 THR A C   1 
ATOM   1086 O O   . THR A 1 143 ? -14.992 -39.002 27.136 1.00 34.59 ? 166 THR A O   1 
ATOM   1087 C CB  . THR A 1 143 ? -16.680 -37.022 28.104 1.00 32.94 ? 166 THR A CB  1 
ATOM   1088 O OG1 . THR A 1 143 ? -17.890 -36.265 28.211 1.00 33.37 ? 166 THR A OG1 1 
ATOM   1089 C CG2 . THR A 1 143 ? -15.640 -36.411 29.028 1.00 31.76 ? 166 THR A CG2 1 
ATOM   1090 N N   . LEU A 1 144 ? -14.049 -37.570 25.690 1.00 31.90 ? 167 LEU A N   1 
ATOM   1091 C CA  . LEU A 1 144 ? -12.894 -38.426 25.475 1.00 32.50 ? 167 LEU A CA  1 
ATOM   1092 C C   . LEU A 1 144 ? -11.903 -38.293 26.626 1.00 31.34 ? 167 LEU A C   1 
ATOM   1093 O O   . LEU A 1 144 ? -11.449 -37.198 26.945 1.00 32.50 ? 167 LEU A O   1 
ATOM   1094 C CB  . LEU A 1 144 ? -12.204 -38.064 24.145 1.00 32.62 ? 167 LEU A CB  1 
ATOM   1095 C CG  . LEU A 1 144 ? -13.065 -37.960 22.876 1.00 32.98 ? 167 LEU A CG  1 
ATOM   1096 C CD1 . LEU A 1 144 ? -12.222 -37.424 21.712 1.00 32.06 ? 167 LEU A CD1 1 
ATOM   1097 C CD2 . LEU A 1 144 ? -13.650 -39.323 22.539 1.00 32.15 ? 167 LEU A CD2 1 
ATOM   1098 N N   . PRO A 1 145 ? -11.569 -39.402 27.291 1.00 31.77 ? 168 PRO A N   1 
ATOM   1099 C CA  . PRO A 1 145 ? -10.599 -39.244 28.389 1.00 31.05 ? 168 PRO A CA  1 
ATOM   1100 C C   . PRO A 1 145 ? -9.224  -39.128 27.703 1.00 29.25 ? 168 PRO A C   1 
ATOM   1101 O O   . PRO A 1 145 ? -8.335  -39.953 27.895 1.00 28.08 ? 168 PRO A O   1 
ATOM   1102 C CB  . PRO A 1 145 ? -10.752 -40.542 29.191 1.00 29.37 ? 168 PRO A CB  1 
ATOM   1103 C CG  . PRO A 1 145 ? -12.092 -41.122 28.715 1.00 32.20 ? 168 PRO A CG  1 
ATOM   1104 C CD  . PRO A 1 145 ? -12.125 -40.763 27.255 1.00 29.85 ? 168 PRO A CD  1 
ATOM   1105 N N   . ALA A 1 146 ? -9.091  -38.081 26.897 1.00 27.94 ? 169 ALA A N   1 
ATOM   1106 C CA  . ALA A 1 146 ? -7.904  -37.803 26.092 1.00 28.19 ? 169 ALA A CA  1 
ATOM   1107 C C   . ALA A 1 146 ? -6.507  -37.872 26.713 1.00 26.99 ? 169 ALA A C   1 
ATOM   1108 O O   . ALA A 1 146 ? -5.643  -38.597 26.211 1.00 24.42 ? 169 ALA A O   1 
ATOM   1109 C CB  . ALA A 1 146 ? -8.083  -36.452 25.384 1.00 26.92 ? 169 ALA A CB  1 
ATOM   1110 N N   . HIS A 1 147 ? -6.269  -37.118 27.778 1.00 26.57 ? 170 HIS A N   1 
ATOM   1111 C CA  . HIS A 1 147 ? -4.941  -37.123 28.372 1.00 28.75 ? 170 HIS A CA  1 
ATOM   1112 C C   . HIS A 1 147 ? -4.905  -37.285 29.889 1.00 29.12 ? 170 HIS A C   1 
ATOM   1113 O O   . HIS A 1 147 ? -5.911  -37.606 30.514 1.00 31.07 ? 170 HIS A O   1 
ATOM   1114 C CB  . HIS A 1 147 ? -4.194  -35.849 27.959 1.00 27.37 ? 170 HIS A CB  1 
ATOM   1115 C CG  . HIS A 1 147 ? -4.040  -35.692 26.477 1.00 25.36 ? 170 HIS A CG  1 
ATOM   1116 N ND1 . HIS A 1 147 ? -5.070  -35.278 25.660 1.00 23.78 ? 170 HIS A ND1 1 
ATOM   1117 C CD2 . HIS A 1 147 ? -2.977  -35.907 25.663 1.00 24.44 ? 170 HIS A CD2 1 
ATOM   1118 C CE1 . HIS A 1 147 ? -4.649  -35.243 24.406 1.00 23.40 ? 170 HIS A CE1 1 
ATOM   1119 N NE2 . HIS A 1 147 ? -3.383  -35.620 24.382 1.00 24.27 ? 170 HIS A NE2 1 
ATOM   1120 N N   . SER A 1 148 ? -3.731  -37.069 30.473 1.00 28.44 ? 171 SER A N   1 
ATOM   1121 C CA  . SER A 1 148 ? -3.560  -37.205 31.912 1.00 27.14 ? 171 SER A CA  1 
ATOM   1122 C C   . SER A 1 148 ? -2.975  -35.938 32.499 1.00 26.65 ? 171 SER A C   1 
ATOM   1123 O O   . SER A 1 148 ? -2.308  -35.963 33.524 1.00 27.85 ? 171 SER A O   1 
ATOM   1124 C CB  . SER A 1 148 ? -2.643  -38.381 32.219 1.00 26.42 ? 171 SER A CB  1 
ATOM   1125 O OG  . SER A 1 148 ? -1.406  -38.236 31.544 1.00 26.76 ? 171 SER A OG  1 
ATOM   1126 N N   . ASP A 1 149 ? -3.222  -34.831 31.818 1.00 26.22 ? 172 ASP A N   1 
ATOM   1127 C CA  . ASP A 1 149 ? -2.761  -33.516 32.237 1.00 25.19 ? 172 ASP A CA  1 
ATOM   1128 C C   . ASP A 1 149 ? -3.642  -32.578 31.445 1.00 25.79 ? 172 ASP A C   1 
ATOM   1129 O O   . ASP A 1 149 ? -4.449  -33.032 30.633 1.00 27.39 ? 172 ASP A O   1 
ATOM   1130 C CB  . ASP A 1 149 ? -1.291  -33.290 31.861 1.00 25.26 ? 172 ASP A CB  1 
ATOM   1131 C CG  . ASP A 1 149 ? -0.328  -33.840 32.900 1.00 24.31 ? 172 ASP A CG  1 
ATOM   1132 O OD1 . ASP A 1 149 ? -0.506  -33.522 34.097 1.00 23.06 ? 172 ASP A OD1 1 
ATOM   1133 O OD2 . ASP A 1 149 ? 0.614   -34.577 32.521 1.00 23.51 ? 172 ASP A OD2 1 
ATOM   1134 N N   . PRO A 1 150 ? -3.510  -31.262 31.656 1.00 25.64 ? 173 PRO A N   1 
ATOM   1135 C CA  . PRO A 1 150 ? -4.377  -30.368 30.876 1.00 23.03 ? 173 PRO A CA  1 
ATOM   1136 C C   . PRO A 1 150 ? -4.169  -30.475 29.352 1.00 24.38 ? 173 PRO A C   1 
ATOM   1137 O O   . PRO A 1 150 ? -3.056  -30.709 28.865 1.00 23.39 ? 173 PRO A O   1 
ATOM   1138 C CB  . PRO A 1 150 ? -4.021  -28.985 31.421 1.00 23.34 ? 173 PRO A CB  1 
ATOM   1139 C CG  . PRO A 1 150 ? -3.554  -29.283 32.842 1.00 22.34 ? 173 PRO A CG  1 
ATOM   1140 C CD  . PRO A 1 150 ? -2.723  -30.517 32.657 1.00 21.09 ? 173 PRO A CD  1 
ATOM   1141 N N   . VAL A 1 151 ? -5.262  -30.307 28.612 1.00 25.24 ? 174 VAL A N   1 
ATOM   1142 C CA  . VAL A 1 151 ? -5.255  -30.361 27.155 1.00 23.09 ? 174 VAL A CA  1 
ATOM   1143 C C   . VAL A 1 151 ? -5.062  -28.939 26.622 1.00 23.64 ? 174 VAL A C   1 
ATOM   1144 O O   . VAL A 1 151 ? -5.906  -28.071 26.857 1.00 23.88 ? 174 VAL A O   1 
ATOM   1145 C CB  . VAL A 1 151 ? -6.595  -30.902 26.624 1.00 22.96 ? 174 VAL A CB  1 
ATOM   1146 C CG1 . VAL A 1 151 ? -6.588  -30.912 25.109 1.00 23.06 ? 174 VAL A CG1 1 
ATOM   1147 C CG2 . VAL A 1 151 ? -6.855  -32.287 27.184 1.00 21.10 ? 174 VAL A CG2 1 
ATOM   1148 N N   . SER A 1 152 ? -3.966  -28.718 25.891 1.00 22.84 ? 175 SER A N   1 
ATOM   1149 C CA  . SER A 1 152 ? -3.633  -27.402 25.336 1.00 19.99 ? 175 SER A CA  1 
ATOM   1150 C C   . SER A 1 152 ? -4.185  -27.041 23.955 1.00 18.30 ? 175 SER A C   1 
ATOM   1151 O O   . SER A 1 152 ? -4.195  -25.872 23.593 1.00 15.64 ? 175 SER A O   1 
ATOM   1152 C CB  . SER A 1 152 ? -2.109  -27.227 25.314 1.00 19.95 ? 175 SER A CB  1 
ATOM   1153 O OG  . SER A 1 152 ? -1.473  -28.320 24.674 1.00 15.52 ? 175 SER A OG  1 
ATOM   1154 N N   . ALA A 1 153 ? -4.634  -28.020 23.179 1.00 19.54 ? 176 ALA A N   1 
ATOM   1155 C CA  . ALA A 1 153 ? -5.151  -27.724 21.837 1.00 20.80 ? 176 ALA A CA  1 
ATOM   1156 C C   . ALA A 1 153 ? -6.048  -28.819 21.226 1.00 20.38 ? 176 ALA A C   1 
ATOM   1157 O O   . ALA A 1 153 ? -5.849  -30.018 21.455 1.00 18.73 ? 176 ALA A O   1 
ATOM   1158 C CB  . ALA A 1 153 ? -3.963  -27.412 20.886 1.00 22.00 ? 176 ALA A CB  1 
ATOM   1159 N N   . VAL A 1 154 ? -7.040  -28.385 20.449 1.00 21.35 ? 177 VAL A N   1 
ATOM   1160 C CA  . VAL A 1 154 ? -7.981  -29.293 19.782 1.00 22.44 ? 177 VAL A CA  1 
ATOM   1161 C C   . VAL A 1 154 ? -8.239  -28.765 18.375 1.00 23.97 ? 177 VAL A C   1 
ATOM   1162 O O   . VAL A 1 154 ? -8.543  -27.578 18.200 1.00 23.91 ? 177 VAL A O   1 
ATOM   1163 C CB  . VAL A 1 154 ? -9.328  -29.380 20.535 1.00 20.43 ? 177 VAL A CB  1 
ATOM   1164 C CG1 . VAL A 1 154 ? -9.159  -30.149 21.819 1.00 19.13 ? 177 VAL A CG1 1 
ATOM   1165 C CG2 . VAL A 1 154 ? -9.845  -27.990 20.822 1.00 17.24 ? 177 VAL A CG2 1 
ATOM   1166 N N   . HIS A 1 155 ? -8.148  -29.644 17.378 1.00 25.57 ? 178 HIS A N   1 
ATOM   1167 C CA  . HIS A 1 155 ? -8.333  -29.222 15.989 1.00 26.99 ? 178 HIS A CA  1 
ATOM   1168 C C   . HIS A 1 155 ? -8.935  -30.335 15.111 1.00 27.27 ? 178 HIS A C   1 
ATOM   1169 O O   . HIS A 1 155 ? -8.644  -31.516 15.320 1.00 27.95 ? 178 HIS A O   1 
ATOM   1170 C CB  . HIS A 1 155 ? -6.957  -28.795 15.455 1.00 29.31 ? 178 HIS A CB  1 
ATOM   1171 C CG  . HIS A 1 155 ? -6.992  -28.106 14.131 1.00 29.29 ? 178 HIS A CG  1 
ATOM   1172 N ND1 . HIS A 1 155 ? -7.603  -26.890 13.942 1.00 30.64 ? 178 HIS A ND1 1 
ATOM   1173 C CD2 . HIS A 1 155 ? -6.481  -28.466 12.930 1.00 29.63 ? 178 HIS A CD2 1 
ATOM   1174 C CE1 . HIS A 1 155 ? -7.472  -26.527 12.677 1.00 30.32 ? 178 HIS A CE1 1 
ATOM   1175 N NE2 . HIS A 1 155 ? -6.797  -27.465 12.043 1.00 30.12 ? 178 HIS A NE2 1 
ATOM   1176 N N   . PHE A 1 156 ? -9.775  -29.953 14.144 1.00 27.19 ? 179 PHE A N   1 
ATOM   1177 C CA  . PHE A 1 156 ? -10.400 -30.895 13.199 1.00 26.54 ? 179 PHE A CA  1 
ATOM   1178 C C   . PHE A 1 156 ? -9.665  -30.817 11.862 1.00 27.15 ? 179 PHE A C   1 
ATOM   1179 O O   . PHE A 1 156 ? -9.099  -29.774 11.537 1.00 26.41 ? 179 PHE A O   1 
ATOM   1180 C CB  . PHE A 1 156 ? -11.853 -30.518 12.904 1.00 25.66 ? 179 PHE A CB  1 
ATOM   1181 C CG  . PHE A 1 156 ? -12.835 -30.903 13.967 1.00 24.61 ? 179 PHE A CG  1 
ATOM   1182 C CD1 . PHE A 1 156 ? -13.279 -29.969 14.887 1.00 25.52 ? 179 PHE A CD1 1 
ATOM   1183 C CD2 . PHE A 1 156 ? -13.393 -32.171 13.987 1.00 25.80 ? 179 PHE A CD2 1 
ATOM   1184 C CE1 . PHE A 1 156 ? -14.277 -30.287 15.815 1.00 25.43 ? 179 PHE A CE1 1 
ATOM   1185 C CE2 . PHE A 1 156 ? -14.384 -32.497 14.906 1.00 26.77 ? 179 PHE A CE2 1 
ATOM   1186 C CZ  . PHE A 1 156 ? -14.829 -31.547 15.820 1.00 26.02 ? 179 PHE A CZ  1 
ATOM   1187 N N   . ASN A 1 157 ? -9.692  -31.898 11.079 1.00 28.49 ? 180 ASN A N   1 
ATOM   1188 C CA  . ASN A 1 157 ? -9.054  -31.905 9.755  1.00 29.31 ? 180 ASN A CA  1 
ATOM   1189 C C   . ASN A 1 157 ? -10.053 -31.423 8.683  1.00 30.45 ? 180 ASN A C   1 
ATOM   1190 O O   . ASN A 1 157 ? -11.242 -31.281 8.968  1.00 31.24 ? 180 ASN A O   1 
ATOM   1191 C CB  . ASN A 1 157 ? -8.516  -33.303 9.421  1.00 28.63 ? 180 ASN A CB  1 
ATOM   1192 C CG  . ASN A 1 157 ? -9.590  -34.379 9.471  1.00 28.74 ? 180 ASN A CG  1 
ATOM   1193 O OD1 . ASN A 1 157 ? -10.656 -34.183 10.051 1.00 28.92 ? 180 ASN A OD1 1 
ATOM   1194 N ND2 . ASN A 1 157 ? -9.303  -35.531 8.875  1.00 25.22 ? 180 ASN A ND2 1 
ATOM   1195 N N   . ARG A 1 158 ? -9.576  -31.172 7.461  1.00 32.27 ? 181 ARG A N   1 
ATOM   1196 C CA  . ARG A 1 158 ? -10.418 -30.662 6.360  1.00 32.55 ? 181 ARG A CA  1 
ATOM   1197 C C   . ARG A 1 158 ? -11.873 -31.111 6.322  1.00 32.66 ? 181 ARG A C   1 
ATOM   1198 O O   . ARG A 1 158 ? -12.753 -30.333 5.941  1.00 33.34 ? 181 ARG A O   1 
ATOM   1199 C CB  . ARG A 1 158 ? -9.821  -31.000 4.990  1.00 33.44 ? 181 ARG A CB  1 
ATOM   1200 C CG  . ARG A 1 158 ? -8.359  -31.350 4.987  1.00 38.12 ? 181 ARG A CG  1 
ATOM   1201 C CD  . ARG A 1 158 ? -7.552  -30.422 4.070  1.00 43.04 ? 181 ARG A CD  1 
ATOM   1202 N NE  . ARG A 1 158 ? -7.168  -29.154 4.706  1.00 43.26 ? 181 ARG A NE  1 
ATOM   1203 C CZ  . ARG A 1 158 ? -7.850  -28.012 4.620  1.00 42.63 ? 181 ARG A CZ  1 
ATOM   1204 N NH1 . ARG A 1 158 ? -8.980  -27.943 3.920  1.00 44.77 ? 181 ARG A NH1 1 
ATOM   1205 N NH2 . ARG A 1 158 ? -7.384  -26.924 5.218  1.00 41.59 ? 181 ARG A NH2 1 
ATOM   1206 N N   . ASP A 1 159 ? -12.136 -32.363 6.682  1.00 32.11 ? 182 ASP A N   1 
ATOM   1207 C CA  . ASP A 1 159 ? -13.504 -32.857 6.634  1.00 30.87 ? 182 ASP A CA  1 
ATOM   1208 C C   . ASP A 1 159 ? -14.057 -33.220 7.994  1.00 29.32 ? 182 ASP A C   1 
ATOM   1209 O O   . ASP A 1 159 ? -15.031 -33.954 8.100  1.00 30.58 ? 182 ASP A O   1 
ATOM   1210 C CB  . ASP A 1 159 ? -13.591 -34.056 5.693  1.00 32.12 ? 182 ASP A CB  1 
ATOM   1211 C CG  . ASP A 1 159 ? -12.797 -35.241 6.184  1.00 34.35 ? 182 ASP A CG  1 
ATOM   1212 O OD1 . ASP A 1 159 ? -12.643 -36.202 5.403  1.00 36.47 ? 182 ASP A OD1 1 
ATOM   1213 O OD2 . ASP A 1 159 ? -12.337 -35.220 7.345  1.00 35.89 ? 182 ASP A OD2 1 
ATOM   1214 N N   . GLY A 1 160 ? -13.425 -32.699 9.032  1.00 27.08 ? 183 GLY A N   1 
ATOM   1215 C CA  . GLY A 1 160 ? -13.882 -32.952 10.381 1.00 27.51 ? 183 GLY A CA  1 
ATOM   1216 C C   . GLY A 1 160 ? -14.075 -34.400 10.746 1.00 27.69 ? 183 GLY A C   1 
ATOM   1217 O O   . GLY A 1 160 ? -14.908 -34.719 11.585 1.00 28.81 ? 183 GLY A O   1 
ATOM   1218 N N   . SER A 1 161 ? -13.316 -35.286 10.122 1.00 27.19 ? 184 SER A N   1 
ATOM   1219 C CA  . SER A 1 161 ? -13.426 -36.699 10.441 1.00 28.42 ? 184 SER A CA  1 
ATOM   1220 C C   . SER A 1 161 ? -12.415 -37.073 11.538 1.00 28.50 ? 184 SER A C   1 
ATOM   1221 O O   . SER A 1 161 ? -12.537 -38.119 12.182 1.00 30.11 ? 184 SER A O   1 
ATOM   1222 C CB  . SER A 1 161 ? -13.180 -37.531 9.181  1.00 29.30 ? 184 SER A CB  1 
ATOM   1223 O OG  . SER A 1 161 ? -11.902 -37.253 8.623  1.00 31.17 ? 184 SER A OG  1 
ATOM   1224 N N   . LEU A 1 162 ? -11.421 -36.212 11.749 1.00 27.05 ? 185 LEU A N   1 
ATOM   1225 C CA  . LEU A 1 162 ? -10.396 -36.456 12.756 1.00 27.53 ? 185 LEU A CA  1 
ATOM   1226 C C   . LEU A 1 162 ? -10.161 -35.258 13.664 1.00 27.55 ? 185 LEU A C   1 
ATOM   1227 O O   . LEU A 1 162 ? -10.280 -34.111 13.234 1.00 28.53 ? 185 LEU A O   1 
ATOM   1228 C CB  . LEU A 1 162 ? -9.063  -36.802 12.098 1.00 27.21 ? 185 LEU A CB  1 
ATOM   1229 C CG  . LEU A 1 162 ? -8.912  -38.089 11.299 1.00 28.16 ? 185 LEU A CG  1 
ATOM   1230 C CD1 . LEU A 1 162 ? -7.519  -38.128 10.682 1.00 25.63 ? 185 LEU A CD1 1 
ATOM   1231 C CD2 . LEU A 1 162 ? -9.135  -39.277 12.207 1.00 28.74 ? 185 LEU A CD2 1 
ATOM   1232 N N   . ILE A 1 163 ? -9.812  -35.538 14.918 1.00 24.76 ? 186 ILE A N   1 
ATOM   1233 C CA  . ILE A 1 163 ? -9.511  -34.496 15.890 1.00 22.99 ? 186 ILE A CA  1 
ATOM   1234 C C   . ILE A 1 163 ? -8.100  -34.725 16.425 1.00 24.83 ? 186 ILE A C   1 
ATOM   1235 O O   . ILE A 1 163 ? -7.746  -35.843 16.807 1.00 23.88 ? 186 ILE A O   1 
ATOM   1236 C CB  . ILE A 1 163 ? -10.461 -34.527 17.093 1.00 20.53 ? 186 ILE A CB  1 
ATOM   1237 C CG1 . ILE A 1 163 ? -11.909 -34.361 16.630 1.00 21.23 ? 186 ILE A CG1 1 
ATOM   1238 C CG2 . ILE A 1 163 ? -10.079 -33.424 18.064 1.00 17.42 ? 186 ILE A CG2 1 
ATOM   1239 C CD1 . ILE A 1 163 ? -12.933 -34.533 17.730 1.00 18.39 ? 186 ILE A CD1 1 
ATOM   1240 N N   . VAL A 1 164 ? -7.290  -33.673 16.434 1.00 24.83 ? 187 VAL A N   1 
ATOM   1241 C CA  . VAL A 1 164 ? -5.942  -33.784 16.952 1.00 27.12 ? 187 VAL A CA  1 
ATOM   1242 C C   . VAL A 1 164 ? -5.912  -32.986 18.241 1.00 28.63 ? 187 VAL A C   1 
ATOM   1243 O O   . VAL A 1 164 ? -6.472  -31.883 18.305 1.00 30.96 ? 187 VAL A O   1 
ATOM   1244 C CB  . VAL A 1 164 ? -4.877  -33.203 15.982 1.00 27.48 ? 187 VAL A CB  1 
ATOM   1245 C CG1 . VAL A 1 164 ? -5.065  -31.694 15.820 1.00 28.85 ? 187 VAL A CG1 1 
ATOM   1246 C CG2 . VAL A 1 164 ? -3.484  -33.509 16.514 1.00 25.88 ? 187 VAL A CG2 1 
ATOM   1247 N N   . SER A 1 165 ? -5.270  -33.544 19.264 1.00 27.91 ? 188 SER A N   1 
ATOM   1248 C CA  . SER A 1 165 ? -5.174  -32.873 20.548 1.00 26.92 ? 188 SER A CA  1 
ATOM   1249 C C   . SER A 1 165 ? -3.763  -32.920 21.129 1.00 26.40 ? 188 SER A C   1 
ATOM   1250 O O   . SER A 1 165 ? -2.979  -33.829 20.835 1.00 25.43 ? 188 SER A O   1 
ATOM   1251 C CB  . SER A 1 165 ? -6.157  -33.501 21.538 1.00 26.74 ? 188 SER A CB  1 
ATOM   1252 O OG  . SER A 1 165 ? -5.832  -34.859 21.786 1.00 28.48 ? 188 SER A OG  1 
ATOM   1253 N N   . SER A 1 166 ? -3.457  -31.926 21.962 1.00 26.55 ? 189 SER A N   1 
ATOM   1254 C CA  . SER A 1 166 ? -2.160  -31.821 22.622 1.00 26.63 ? 189 SER A CA  1 
ATOM   1255 C C   . SER A 1 166 ? -2.357  -31.682 24.127 1.00 26.91 ? 189 SER A C   1 
ATOM   1256 O O   . SER A 1 166 ? -3.443  -31.323 24.595 1.00 27.15 ? 189 SER A O   1 
ATOM   1257 C CB  . SER A 1 166 ? -1.395  -30.610 22.095 1.00 25.98 ? 189 SER A CB  1 
ATOM   1258 O OG  . SER A 1 166 ? -2.212  -29.450 22.111 1.00 25.68 ? 189 SER A OG  1 
ATOM   1259 N N   . SER A 1 167 ? -1.304  -31.967 24.883 1.00 26.76 ? 190 SER A N   1 
ATOM   1260 C CA  . SER A 1 167 ? -1.381  -31.871 26.332 1.00 27.14 ? 190 SER A CA  1 
ATOM   1261 C C   . SER A 1 167 ? 0.002   -31.742 26.981 1.00 28.45 ? 190 SER A C   1 
ATOM   1262 O O   . SER A 1 167 ? 1.028   -32.091 26.385 1.00 27.18 ? 190 SER A O   1 
ATOM   1263 C CB  . SER A 1 167 ? -2.108  -33.103 26.890 1.00 24.77 ? 190 SER A CB  1 
ATOM   1264 O OG  . SER A 1 167 ? -2.107  -33.138 28.310 1.00 22.74 ? 190 SER A OG  1 
ATOM   1265 N N   . TYR A 1 168 ? 0.001   -31.214 28.203 1.00 29.81 ? 191 TYR A N   1 
ATOM   1266 C CA  . TYR A 1 168 ? 1.206   -31.045 29.003 1.00 29.47 ? 191 TYR A CA  1 
ATOM   1267 C C   . TYR A 1 168 ? 1.719   -32.436 29.340 1.00 28.96 ? 191 TYR A C   1 
ATOM   1268 O O   . TYR A 1 168 ? 2.845   -32.600 29.821 1.00 28.23 ? 191 TYR A O   1 
ATOM   1269 C CB  . TYR A 1 168 ? 0.869   -30.298 30.289 1.00 32.45 ? 191 TYR A CB  1 
ATOM   1270 C CG  . TYR A 1 168 ? 0.878   -28.801 30.138 1.00 36.85 ? 191 TYR A CG  1 
ATOM   1271 C CD1 . TYR A 1 168 ? 1.926   -28.039 30.652 1.00 38.45 ? 191 TYR A CD1 1 
ATOM   1272 C CD2 . TYR A 1 168 ? -0.147  -28.144 29.465 1.00 38.48 ? 191 TYR A CD2 1 
ATOM   1273 C CE1 . TYR A 1 168 ? 1.954   -26.665 30.504 1.00 40.53 ? 191 TYR A CE1 1 
ATOM   1274 C CE2 . TYR A 1 168 ? -0.132  -26.768 29.307 1.00 41.14 ? 191 TYR A CE2 1 
ATOM   1275 C CZ  . TYR A 1 168 ? 0.923   -26.031 29.834 1.00 42.68 ? 191 TYR A CZ  1 
ATOM   1276 O OH  . TYR A 1 168 ? 0.941   -24.656 29.713 1.00 45.51 ? 191 TYR A OH  1 
ATOM   1277 N N   . ASP A 1 169 ? 0.879   -33.440 29.098 1.00 27.52 ? 192 ASP A N   1 
ATOM   1278 C CA  . ASP A 1 169 ? 1.267   -34.809 29.365 1.00 26.75 ? 192 ASP A CA  1 
ATOM   1279 C C   . ASP A 1 169 ? 2.286   -35.293 28.311 1.00 25.54 ? 192 ASP A C   1 
ATOM   1280 O O   . ASP A 1 169 ? 2.627   -36.473 28.249 1.00 25.69 ? 192 ASP A O   1 
ATOM   1281 C CB  . ASP A 1 169 ? 0.014   -35.704 29.442 1.00 28.06 ? 192 ASP A CB  1 
ATOM   1282 C CG  . ASP A 1 169 ? -0.609  -36.008 28.081 1.00 32.36 ? 192 ASP A CG  1 
ATOM   1283 O OD1 . ASP A 1 169 ? -0.188  -35.419 27.055 1.00 32.67 ? 192 ASP A OD1 1 
ATOM   1284 O OD2 . ASP A 1 169 ? -1.540  -36.855 28.053 1.00 33.04 ? 192 ASP A OD2 1 
ATOM   1285 N N   . GLY A 1 170 ? 2.779   -34.348 27.511 1.00 24.63 ? 193 GLY A N   1 
ATOM   1286 C CA  . GLY A 1 170 ? 3.767   -34.619 26.475 1.00 23.62 ? 193 GLY A CA  1 
ATOM   1287 C C   . GLY A 1 170 ? 3.260   -35.381 25.269 1.00 25.17 ? 193 GLY A C   1 
ATOM   1288 O O   . GLY A 1 170 ? 4.036   -35.789 24.404 1.00 26.86 ? 193 GLY A O   1 
ATOM   1289 N N   . LEU A 1 171 ? 1.948   -35.553 25.185 1.00 25.66 ? 194 LEU A N   1 
ATOM   1290 C CA  . LEU A 1 171 ? 1.354   -36.329 24.104 1.00 24.90 ? 194 LEU A CA  1 
ATOM   1291 C C   . LEU A 1 171 ? 0.508   -35.596 23.064 1.00 25.96 ? 194 LEU A C   1 
ATOM   1292 O O   . LEU A 1 171 ? -0.129  -34.574 23.342 1.00 26.58 ? 194 LEU A O   1 
ATOM   1293 C CB  . LEU A 1 171 ? 0.501   -37.440 24.720 1.00 23.17 ? 194 LEU A CB  1 
ATOM   1294 C CG  . LEU A 1 171 ? 1.000   -38.877 24.908 1.00 22.63 ? 194 LEU A CG  1 
ATOM   1295 C CD1 . LEU A 1 171 ? 2.393   -38.937 25.503 1.00 18.49 ? 194 LEU A CD1 1 
ATOM   1296 C CD2 . LEU A 1 171 ? -0.010  -39.587 25.804 1.00 20.10 ? 194 LEU A CD2 1 
ATOM   1297 N N   . CYS A 1 172 ? 0.506   -36.157 21.860 1.00 27.07 ? 195 CYS A N   1 
ATOM   1298 C CA  . CYS A 1 172 ? -0.287  -35.652 20.743 1.00 27.17 ? 195 CYS A CA  1 
ATOM   1299 C C   . CYS A 1 172 ? -1.219  -36.782 20.348 1.00 25.96 ? 195 CYS A C   1 
ATOM   1300 O O   . CYS A 1 172 ? -0.769  -37.910 20.139 1.00 25.26 ? 195 CYS A O   1 
ATOM   1301 C CB  . CYS A 1 172 ? 0.597   -35.318 19.544 1.00 28.56 ? 195 CYS A CB  1 
ATOM   1302 S SG  . CYS A 1 172 ? 0.856   -33.574 19.319 1.00 33.57 ? 195 CYS A SG  1 
ATOM   1303 N N   . ARG A 1 173 ? -2.511  -36.506 20.241 1.00 26.24 ? 196 ARG A N   1 
ATOM   1304 C CA  . ARG A 1 173 ? -3.425  -37.578 19.858 1.00 27.97 ? 196 ARG A CA  1 
ATOM   1305 C C   . ARG A 1 173 ? -4.403  -37.282 18.734 1.00 29.25 ? 196 ARG A C   1 
ATOM   1306 O O   . ARG A 1 173 ? -4.858  -36.158 18.557 1.00 30.02 ? 196 ARG A O   1 
ATOM   1307 C CB  . ARG A 1 173 ? -4.165  -38.097 21.095 1.00 26.36 ? 196 ARG A CB  1 
ATOM   1308 C CG  . ARG A 1 173 ? -3.334  -39.145 21.825 1.00 25.45 ? 196 ARG A CG  1 
ATOM   1309 C CD  . ARG A 1 173 ? -3.866  -39.549 23.178 1.00 26.47 ? 196 ARG A CD  1 
ATOM   1310 N NE  . ARG A 1 173 ? -3.009  -40.583 23.764 1.00 27.54 ? 196 ARG A NE  1 
ATOM   1311 C CZ  . ARG A 1 173 ? -3.129  -41.074 24.998 1.00 26.54 ? 196 ARG A CZ  1 
ATOM   1312 N NH1 . ARG A 1 173 ? -4.080  -40.640 25.819 1.00 24.43 ? 196 ARG A NH1 1 
ATOM   1313 N NH2 . ARG A 1 173 ? -2.283  -42.004 25.412 1.00 27.51 ? 196 ARG A NH2 1 
ATOM   1314 N N   . ILE A 1 174 ? -4.683  -38.312 17.947 1.00 31.07 ? 197 ILE A N   1 
ATOM   1315 C CA  . ILE A 1 174 ? -5.622  -38.205 16.840 1.00 32.26 ? 197 ILE A CA  1 
ATOM   1316 C C   . ILE A 1 174 ? -6.842  -39.039 17.203 1.00 32.51 ? 197 ILE A C   1 
ATOM   1317 O O   . ILE A 1 174 ? -6.724  -40.201 17.585 1.00 31.61 ? 197 ILE A O   1 
ATOM   1318 C CB  . ILE A 1 174 ? -5.028  -38.729 15.520 1.00 32.61 ? 197 ILE A CB  1 
ATOM   1319 C CG1 . ILE A 1 174 ? -3.970  -37.753 14.989 1.00 34.14 ? 197 ILE A CG1 1 
ATOM   1320 C CG2 . ILE A 1 174 ? -6.140  -38.903 14.493 1.00 32.98 ? 197 ILE A CG2 1 
ATOM   1321 C CD1 . ILE A 1 174 ? -2.715  -37.656 15.825 1.00 33.86 ? 197 ILE A CD1 1 
ATOM   1322 N N   . TRP A 1 175 ? -8.013  -38.433 17.076 1.00 33.36 ? 198 TRP A N   1 
ATOM   1323 C CA  . TRP A 1 175 ? -9.253  -39.098 17.422 1.00 32.35 ? 198 TRP A CA  1 
ATOM   1324 C C   . TRP A 1 175 ? -10.202 -39.205 16.252 1.00 31.45 ? 198 TRP A C   1 
ATOM   1325 O O   . TRP A 1 175 ? -10.244 -38.334 15.384 1.00 31.62 ? 198 TRP A O   1 
ATOM   1326 C CB  . TRP A 1 175 ? -9.935  -38.334 18.566 1.00 34.64 ? 198 TRP A CB  1 
ATOM   1327 C CG  . TRP A 1 175 ? -9.018  -38.096 19.737 1.00 37.09 ? 198 TRP A CG  1 
ATOM   1328 C CD1 . TRP A 1 175 ? -8.041  -37.144 19.837 1.00 36.75 ? 198 TRP A CD1 1 
ATOM   1329 C CD2 . TRP A 1 175 ? -8.915  -38.900 20.918 1.00 38.27 ? 198 TRP A CD2 1 
ATOM   1330 N NE1 . TRP A 1 175 ? -7.330  -37.310 21.001 1.00 37.31 ? 198 TRP A NE1 1 
ATOM   1331 C CE2 . TRP A 1 175 ? -7.844  -38.382 21.684 1.00 38.14 ? 198 TRP A CE2 1 
ATOM   1332 C CE3 . TRP A 1 175 ? -9.618  -40.012 21.401 1.00 37.89 ? 198 TRP A CE3 1 
ATOM   1333 C CZ2 . TRP A 1 175 ? -7.459  -38.939 22.910 1.00 38.32 ? 198 TRP A CZ2 1 
ATOM   1334 C CZ3 . TRP A 1 175 ? -9.235  -40.566 22.618 1.00 38.52 ? 198 TRP A CZ3 1 
ATOM   1335 C CH2 . TRP A 1 175 ? -8.162  -40.027 23.360 1.00 38.35 ? 198 TRP A CH2 1 
ATOM   1336 N N   . ASP A 1 176 ? -10.960 -40.292 16.228 1.00 32.06 ? 199 ASP A N   1 
ATOM   1337 C CA  . ASP A 1 176 ? -11.952 -40.498 15.186 1.00 31.88 ? 199 ASP A CA  1 
ATOM   1338 C C   . ASP A 1 176 ? -13.232 -39.865 15.732 1.00 30.33 ? 199 ASP A C   1 
ATOM   1339 O O   . ASP A 1 176 ? -13.868 -40.404 16.637 1.00 27.96 ? 199 ASP A O   1 
ATOM   1340 C CB  . ASP A 1 176 ? -12.145 -41.996 14.920 1.00 33.81 ? 199 ASP A CB  1 
ATOM   1341 C CG  . ASP A 1 176 ? -13.097 -42.270 13.756 1.00 35.72 ? 199 ASP A CG  1 
ATOM   1342 O OD1 . ASP A 1 176 ? -14.338 -42.291 13.982 1.00 31.68 ? 199 ASP A OD1 1 
ATOM   1343 O OD2 . ASP A 1 176 ? -12.590 -42.455 12.617 1.00 35.48 ? 199 ASP A OD2 1 
ATOM   1344 N N   . THR A 1 177 ? -13.576 -38.704 15.183 1.00 30.16 ? 200 THR A N   1 
ATOM   1345 C CA  . THR A 1 177 ? -14.747 -37.933 15.589 1.00 31.00 ? 200 THR A CA  1 
ATOM   1346 C C   . THR A 1 177 ? -16.039 -38.738 15.736 1.00 32.27 ? 200 THR A C   1 
ATOM   1347 O O   . THR A 1 177 ? -16.844 -38.497 16.646 1.00 31.75 ? 200 THR A O   1 
ATOM   1348 C CB  . THR A 1 177 ? -15.007 -36.805 14.590 1.00 31.03 ? 200 THR A CB  1 
ATOM   1349 O OG1 . THR A 1 177 ? -13.789 -36.087 14.358 1.00 32.09 ? 200 THR A OG1 1 
ATOM   1350 C CG2 . THR A 1 177 ? -16.065 -35.849 15.132 1.00 33.16 ? 200 THR A CG2 1 
ATOM   1351 N N   . ALA A 1 178 ? -16.235 -39.686 14.829 1.00 33.31 ? 201 ALA A N   1 
ATOM   1352 C CA  . ALA A 1 178 ? -17.422 -40.527 14.830 1.00 34.41 ? 201 ALA A CA  1 
ATOM   1353 C C   . ALA A 1 178 ? -17.497 -41.480 16.029 1.00 34.77 ? 201 ALA A C   1 
ATOM   1354 O O   . ALA A 1 178 ? -18.509 -41.518 16.737 1.00 34.55 ? 201 ALA A O   1 
ATOM   1355 C CB  . ALA A 1 178 ? -17.475 -41.324 13.523 1.00 34.67 ? 201 ALA A CB  1 
ATOM   1356 N N   . SER A 1 179 ? -16.426 -42.245 16.247 1.00 35.41 ? 202 SER A N   1 
ATOM   1357 C CA  . SER A 1 179 ? -16.369 -43.222 17.332 1.00 35.17 ? 202 SER A CA  1 
ATOM   1358 C C   . SER A 1 179 ? -15.738 -42.695 18.610 1.00 35.66 ? 202 SER A C   1 
ATOM   1359 O O   . SER A 1 179 ? -15.963 -43.238 19.690 1.00 37.42 ? 202 SER A O   1 
ATOM   1360 C CB  . SER A 1 179 ? -15.591 -44.453 16.872 1.00 35.53 ? 202 SER A CB  1 
ATOM   1361 O OG  . SER A 1 179 ? -14.273 -44.108 16.464 1.00 35.34 ? 202 SER A OG  1 
ATOM   1362 N N   . GLY A 1 180 ? -14.944 -41.642 18.489 1.00 34.47 ? 203 GLY A N   1 
ATOM   1363 C CA  . GLY A 1 180 ? -14.287 -41.100 19.659 1.00 34.50 ? 203 GLY A CA  1 
ATOM   1364 C C   . GLY A 1 180 ? -13.091 -41.952 20.052 1.00 34.72 ? 203 GLY A C   1 
ATOM   1365 O O   . GLY A 1 180 ? -12.461 -41.719 21.080 1.00 34.35 ? 203 GLY A O   1 
ATOM   1366 N N   . GLN A 1 181 ? -12.770 -42.937 19.222 1.00 34.70 ? 204 GLN A N   1 
ATOM   1367 C CA  . GLN A 1 181 ? -11.653 -43.835 19.482 1.00 37.01 ? 204 GLN A CA  1 
ATOM   1368 C C   . GLN A 1 181 ? -10.302 -43.189 19.194 1.00 35.50 ? 204 GLN A C   1 
ATOM   1369 O O   . GLN A 1 181 ? -10.159 -42.488 18.196 1.00 34.68 ? 204 GLN A O   1 
ATOM   1370 C CB  . GLN A 1 181 ? -11.798 -45.077 18.616 1.00 41.82 ? 204 GLN A CB  1 
ATOM   1371 C CG  . GLN A 1 181 ? -10.783 -46.156 18.892 1.00 50.67 ? 204 GLN A CG  1 
ATOM   1372 C CD  . GLN A 1 181 ? -10.557 -47.037 17.684 1.00 56.12 ? 204 GLN A CD  1 
ATOM   1373 O OE1 . GLN A 1 181 ? -11.410 -47.127 16.799 1.00 58.07 ? 204 GLN A OE1 1 
ATOM   1374 N NE2 . GLN A 1 181 ? -9.409  -47.702 17.641 1.00 18.50 ? 204 GLN A NE2 1 
ATOM   1375 N N   . CYS A 1 182 ? -9.320  -43.432 20.065 1.00 34.46 ? 205 CYS A N   1 
ATOM   1376 C CA  . CYS A 1 182 ? -7.963  -42.895 19.907 1.00 32.60 ? 205 CYS A CA  1 
ATOM   1377 C C   . CYS A 1 182 ? -7.279  -43.644 18.768 1.00 30.85 ? 205 CYS A C   1 
ATOM   1378 O O   . CYS A 1 182 ? -6.982  -44.827 18.894 1.00 30.87 ? 205 CYS A O   1 
ATOM   1379 C CB  . CYS A 1 182 ? -7.167  -43.095 21.201 1.00 32.89 ? 205 CYS A CB  1 
ATOM   1380 S SG  . CYS A 1 182 ? -5.455  -42.427 21.215 1.00 34.55 ? 205 CYS A SG  1 
ATOM   1381 N N   . LEU A 1 183 ? -7.017  -42.954 17.665 1.00 29.68 ? 206 LEU A N   1 
ATOM   1382 C CA  . LEU A 1 183 ? -6.403  -43.583 16.499 1.00 29.08 ? 206 LEU A CA  1 
ATOM   1383 C C   . LEU A 1 183 ? -4.888  -43.588 16.459 1.00 29.27 ? 206 LEU A C   1 
ATOM   1384 O O   . LEU A 1 183 ? -4.281  -44.517 15.926 1.00 30.44 ? 206 LEU A O   1 
ATOM   1385 C CB  . LEU A 1 183 ? -6.918  -42.932 15.218 1.00 26.60 ? 206 LEU A CB  1 
ATOM   1386 C CG  . LEU A 1 183 ? -8.418  -43.070 14.998 1.00 26.58 ? 206 LEU A CG  1 
ATOM   1387 C CD1 . LEU A 1 183 ? -8.786  -42.401 13.693 1.00 26.47 ? 206 LEU A CD1 1 
ATOM   1388 C CD2 . LEU A 1 183 ? -8.810  -44.546 14.995 1.00 24.80 ? 206 LEU A CD2 1 
ATOM   1389 N N   . LYS A 1 184 ? -4.268  -42.554 17.006 1.00 28.44 ? 207 LYS A N   1 
ATOM   1390 C CA  . LYS A 1 184 ? -2.821  -42.505 16.978 1.00 27.70 ? 207 LYS A CA  1 
ATOM   1391 C C   . LYS A 1 184 ? -2.249  -41.615 18.066 1.00 27.81 ? 207 LYS A C   1 
ATOM   1392 O O   . LYS A 1 184 ? -2.895  -40.661 18.506 1.00 26.61 ? 207 LYS A O   1 
ATOM   1393 C CB  . LYS A 1 184 ? -2.358  -42.034 15.599 1.00 27.16 ? 207 LYS A CB  1 
ATOM   1394 C CG  . LYS A 1 184 ? -0.877  -42.213 15.352 1.00 27.59 ? 207 LYS A CG  1 
ATOM   1395 C CD  . LYS A 1 184 ? -0.570  -42.250 13.859 1.00 27.28 ? 207 LYS A CD  1 
ATOM   1396 C CE  . LYS A 1 184 ? -1.370  -43.339 13.156 1.00 27.12 ? 207 LYS A CE  1 
ATOM   1397 N NZ  . LYS A 1 184 ? -1.020  -43.447 11.714 1.00 28.42 ? 207 LYS A NZ  1 
ATOM   1398 N N   . THR A 1 185 ? -1.036  -41.941 18.504 1.00 33.41 ? 208 THR A N   1 
ATOM   1399 C CA  . THR A 1 185 ? -0.374  -41.169 19.545 1.00 33.02 ? 208 THR A CA  1 
ATOM   1400 C C   . THR A 1 185 ? 1.033   -40.797 19.110 1.00 33.97 ? 208 THR A C   1 
ATOM   1401 O O   . THR A 1 185 ? 1.869   -41.667 18.892 1.00 34.13 ? 208 THR A O   1 
ATOM   1402 C CB  . THR A 1 185 ? -0.312  -41.964 20.872 1.00 31.55 ? 208 THR A CB  1 
ATOM   1403 O OG1 . THR A 1 185 ? -1.632  -42.385 21.225 1.00 29.89 ? 208 THR A OG1 1 
ATOM   1404 C CG2 . THR A 1 185 ? 0.218   -41.100 22.000 1.00 32.24 ? 208 THR A CG2 1 
ATOM   1405 N N   . LEU A 1 186 ? 1.272   -39.497 18.966 1.00 28.61 ? 209 LEU A N   1 
ATOM   1406 C CA  . LEU A 1 186 ? 2.573   -38.980 18.561 1.00 30.66 ? 209 LEU A CA  1 
ATOM   1407 C C   . LEU A 1 186 ? 3.364   -38.768 19.841 1.00 33.16 ? 209 LEU A C   1 
ATOM   1408 O O   . LEU A 1 186 ? 3.013   -37.940 20.672 1.00 30.13 ? 209 LEU A O   1 
ATOM   1409 C CB  . LEU A 1 186 ? 2.405   -37.669 17.784 1.00 31.19 ? 209 LEU A CB  1 
ATOM   1410 C CG  . LEU A 1 186 ? 1.716   -37.761 16.415 1.00 31.34 ? 209 LEU A CG  1 
ATOM   1411 C CD1 . LEU A 1 186 ? 1.530   -36.356 15.859 1.00 33.11 ? 209 LEU A CD1 1 
ATOM   1412 C CD2 . LEU A 1 186 ? 2.543   -38.614 15.458 1.00 32.45 ? 209 LEU A CD2 1 
ATOM   1413 N N   . ILE A 1 187 ? 4.440   -39.524 19.988 1.00 35.33 ? 210 ILE A N   1 
ATOM   1414 C CA  . ILE A 1 187 ? 5.237   -39.483 21.204 1.00 38.75 ? 210 ILE A CA  1 
ATOM   1415 C C   . ILE A 1 187 ? 6.703   -39.097 20.999 1.00 41.10 ? 210 ILE A C   1 
ATOM   1416 O O   . ILE A 1 187 ? 7.224   -39.156 19.884 1.00 40.90 ? 210 ILE A O   1 
ATOM   1417 C CB  . ILE A 1 187 ? 5.192   -40.883 21.897 1.00 39.89 ? 210 ILE A CB  1 
ATOM   1418 C CG1 . ILE A 1 187 ? 5.926   -40.872 23.234 1.00 39.88 ? 210 ILE A CG1 1 
ATOM   1419 C CG2 . ILE A 1 187 ? 5.879   -41.893 21.031 1.00 39.68 ? 210 ILE A CG2 1 
ATOM   1420 C CD1 . ILE A 1 187 ? 5.183   -40.183 24.335 1.00 42.52 ? 210 ILE A CD1 1 
ATOM   1421 N N   . ASP A 1 188 ? 7.354   -38.715 22.102 1.00 43.95 ? 211 ASP A N   1 
ATOM   1422 C CA  . ASP A 1 188 ? 8.785   -38.347 22.141 1.00 46.68 ? 211 ASP A CA  1 
ATOM   1423 C C   . ASP A 1 188 ? 9.525   -38.968 23.350 1.00 48.04 ? 211 ASP A C   1 
ATOM   1424 O O   . ASP A 1 188 ? 8.929   -39.106 24.425 1.00 47.80 ? 211 ASP A O   1 
ATOM   1425 C CB  . ASP A 1 188 ? 8.944   -36.837 22.237 1.00 48.59 ? 211 ASP A CB  1 
ATOM   1426 C CG  . ASP A 1 188 ? 10.256  -36.439 22.924 1.00 50.28 ? 211 ASP A CG  1 
ATOM   1427 O OD1 . ASP A 1 188 ? 10.283  -35.400 23.605 1.00 50.51 ? 211 ASP A OD1 1 
ATOM   1428 O OD2 . ASP A 1 188 ? 11.279  -37.159 22.799 1.00 51.69 ? 211 ASP A OD2 1 
ATOM   1429 N N   . ASP A 1 189 ? 10.820  -39.272 23.193 1.00 49.12 ? 212 ASP A N   1 
ATOM   1430 C CA  . ASP A 1 189 ? 11.610  -39.876 24.251 1.00 50.35 ? 212 ASP A CA  1 
ATOM   1431 C C   . ASP A 1 189 ? 12.025  -38.874 25.321 1.00 50.17 ? 212 ASP A C   1 
ATOM   1432 O O   . ASP A 1 189 ? 12.852  -39.241 26.199 1.00 51.15 ? 212 ASP A O   1 
ATOM   1433 C CB  . ASP A 1 189 ? 12.839  -40.610 23.635 1.00 51.48 ? 212 ASP A CB  1 
ATOM   1434 C CG  . ASP A 1 189 ? 12.491  -42.008 23.051 1.00 52.56 ? 212 ASP A CG  1 
ATOM   1435 O OD1 . ASP A 1 189 ? 12.184  -42.905 23.839 1.00 53.86 ? 212 ASP A OD1 1 
ATOM   1436 O OD2 . ASP A 1 189 ? 12.524  -42.250 21.820 1.00 54.83 ? 212 ASP A OD2 1 
ATOM   1437 N N   . ASP A 1 190 ? 11.452  -37.658 25.309 1.00 42.25 ? 213 ASP A N   1 
ATOM   1438 C CA  . ASP A 1 190 ? 11.781  -36.707 26.387 1.00 42.11 ? 213 ASP A CA  1 
ATOM   1439 C C   . ASP A 1 190 ? 10.449  -36.289 27.001 1.00 39.86 ? 213 ASP A C   1 
ATOM   1440 O O   . ASP A 1 190 ? 10.354  -36.029 28.206 1.00 39.30 ? 213 ASP A O   1 
ATOM   1441 C CB  . ASP A 1 190 ? 12.585  -35.531 25.851 1.00 46.09 ? 213 ASP A CB  1 
ATOM   1442 C CG  . ASP A 1 190 ? 13.934  -35.981 25.324 1.00 48.87 ? 213 ASP A CG  1 
ATOM   1443 O OD1 . ASP A 1 190 ? 13.923  -36.785 24.359 1.00 50.66 ? 213 ASP A OD1 1 
ATOM   1444 O OD2 . ASP A 1 190 ? 14.987  -35.544 25.861 1.00 50.58 ? 213 ASP A OD2 1 
ATOM   1445 N N   . ASN A 1 191 ? 9.413   -36.252 26.167 1.00 36.97 ? 214 ASN A N   1 
ATOM   1446 C CA  . ASN A 1 191 ? 8.080   -35.917 26.639 1.00 33.29 ? 214 ASN A CA  1 
ATOM   1447 C C   . ASN A 1 191 ? 7.904   -34.493 27.156 1.00 29.56 ? 214 ASN A C   1 
ATOM   1448 O O   . ASN A 1 191 ? 7.343   -34.287 28.235 1.00 29.44 ? 214 ASN A O   1 
ATOM   1449 C CB  . ASN A 1 191 ? 7.652   -36.922 27.728 1.00 35.73 ? 214 ASN A CB  1 
ATOM   1450 C CG  . ASN A 1 191 ? 6.243   -37.483 27.487 1.00 37.85 ? 214 ASN A CG  1 
ATOM   1451 O OD1 . ASN A 1 191 ? 5.970   -38.080 26.434 1.00 40.25 ? 214 ASN A OD1 1 
ATOM   1452 N ND2 . ASN A 1 191 ? 5.344   -37.291 28.459 1.00 39.42 ? 214 ASN A ND2 1 
ATOM   1453 N N   . PRO A 1 192 ? 8.388   -33.490 26.402 1.00 25.60 ? 215 PRO A N   1 
ATOM   1454 C CA  . PRO A 1 192 ? 8.201   -32.127 26.903 1.00 21.97 ? 215 PRO A CA  1 
ATOM   1455 C C   . PRO A 1 192 ? 6.722   -31.801 26.709 1.00 20.34 ? 215 PRO A C   1 
ATOM   1456 O O   . PRO A 1 192 ? 6.087   -32.305 25.777 1.00 20.17 ? 215 PRO A O   1 
ATOM   1457 C CB  . PRO A 1 192 ? 9.111   -31.296 25.999 1.00 22.71 ? 215 PRO A CB  1 
ATOM   1458 C CG  . PRO A 1 192 ? 9.039   -32.029 24.689 1.00 22.34 ? 215 PRO A CG  1 
ATOM   1459 C CD  . PRO A 1 192 ? 9.122   -33.488 25.123 1.00 23.64 ? 215 PRO A CD  1 
ATOM   1460 N N   . PRO A 1 193 ? 6.142   -30.990 27.603 1.00 31.89 ? 216 PRO A N   1 
ATOM   1461 C CA  . PRO A 1 193 ? 4.727   -30.658 27.443 1.00 28.97 ? 216 PRO A CA  1 
ATOM   1462 C C   . PRO A 1 193 ? 4.439   -30.205 26.015 1.00 27.18 ? 216 PRO A C   1 
ATOM   1463 O O   . PRO A 1 193 ? 5.275   -29.568 25.371 1.00 24.53 ? 216 PRO A O   1 
ATOM   1464 C CB  . PRO A 1 193 ? 4.526   -29.534 28.460 1.00 31.01 ? 216 PRO A CB  1 
ATOM   1465 C CG  . PRO A 1 193 ? 5.454   -29.913 29.560 1.00 29.25 ? 216 PRO A CG  1 
ATOM   1466 C CD  . PRO A 1 193 ? 6.703   -30.353 28.809 1.00 31.23 ? 216 PRO A CD  1 
ATOM   1467 N N   . VAL A 1 194 ? 3.265   -30.554 25.511 1.00 26.23 ? 217 VAL A N   1 
ATOM   1468 C CA  . VAL A 1 194 ? 2.899   -30.140 24.169 1.00 25.09 ? 217 VAL A CA  1 
ATOM   1469 C C   . VAL A 1 194 ? 1.948   -28.972 24.393 1.00 24.52 ? 217 VAL A C   1 
ATOM   1470 O O   . VAL A 1 194 ? 0.858   -29.133 24.931 1.00 24.01 ? 217 VAL A O   1 
ATOM   1471 C CB  . VAL A 1 194 ? 2.201   -31.277 23.366 1.00 24.17 ? 217 VAL A CB  1 
ATOM   1472 C CG1 . VAL A 1 194 ? 2.100   -30.883 21.903 1.00 25.15 ? 217 VAL A CG1 1 
ATOM   1473 C CG2 . VAL A 1 194 ? 2.972   -32.568 23.494 1.00 19.03 ? 217 VAL A CG2 1 
ATOM   1474 N N   . SER A 1 195 ? 2.394   -27.784 24.002 1.00 25.61 ? 218 SER A N   1 
ATOM   1475 C CA  . SER A 1 195 ? 1.625   -26.553 24.174 1.00 24.36 ? 218 SER A CA  1 
ATOM   1476 C C   . SER A 1 195 ? 0.662   -26.247 23.017 1.00 23.63 ? 218 SER A C   1 
ATOM   1477 O O   . SER A 1 195 ? -0.373  -25.604 23.214 1.00 21.84 ? 218 SER A O   1 
ATOM   1478 C CB  . SER A 1 195 ? 2.599   -25.398 24.376 1.00 23.11 ? 218 SER A CB  1 
ATOM   1479 O OG  . SER A 1 195 ? 3.698   -25.526 23.490 1.00 24.25 ? 218 SER A OG  1 
ATOM   1480 N N   . PHE A 1 196 ? 1.004   -26.710 21.818 1.00 23.84 ? 219 PHE A N   1 
ATOM   1481 C CA  . PHE A 1 196 ? 0.157   -26.473 20.653 1.00 25.04 ? 219 PHE A CA  1 
ATOM   1482 C C   . PHE A 1 196 ? 0.217   -27.574 19.595 1.00 26.01 ? 219 PHE A C   1 
ATOM   1483 O O   . PHE A 1 196 ? 1.195   -28.314 19.496 1.00 25.14 ? 219 PHE A O   1 
ATOM   1484 C CB  . PHE A 1 196 ? 0.506   -25.142 19.984 1.00 22.85 ? 219 PHE A CB  1 
ATOM   1485 C CG  . PHE A 1 196 ? -0.451  -24.758 18.909 1.00 22.13 ? 219 PHE A CG  1 
ATOM   1486 C CD1 . PHE A 1 196 ? -1.758  -24.384 19.231 1.00 23.01 ? 219 PHE A CD1 1 
ATOM   1487 C CD2 . PHE A 1 196 ? -0.085  -24.843 17.571 1.00 20.88 ? 219 PHE A CD2 1 
ATOM   1488 C CE1 . PHE A 1 196 ? -2.697  -24.102 18.235 1.00 20.55 ? 219 PHE A CE1 1 
ATOM   1489 C CE2 . PHE A 1 196 ? -1.013  -24.564 16.565 1.00 21.05 ? 219 PHE A CE2 1 
ATOM   1490 C CZ  . PHE A 1 196 ? -2.326  -24.194 16.904 1.00 21.27 ? 219 PHE A CZ  1 
ATOM   1491 N N   . VAL A 1 197 ? -0.848  -27.664 18.806 1.00 27.49 ? 220 VAL A N   1 
ATOM   1492 C CA  . VAL A 1 197 ? -0.945  -28.656 17.746 1.00 28.47 ? 220 VAL A CA  1 
ATOM   1493 C C   . VAL A 1 197 ? -2.068  -28.259 16.788 1.00 28.49 ? 220 VAL A C   1 
ATOM   1494 O O   . VAL A 1 197 ? -3.076  -27.685 17.201 1.00 27.95 ? 220 VAL A O   1 
ATOM   1495 C CB  . VAL A 1 197 ? -1.255  -30.035 18.319 1.00 28.22 ? 220 VAL A CB  1 
ATOM   1496 C CG1 . VAL A 1 197 ? -2.610  -30.002 19.003 1.00 30.82 ? 220 VAL A CG1 1 
ATOM   1497 C CG2 . VAL A 1 197 ? -1.243  -31.064 17.224 1.00 28.26 ? 220 VAL A CG2 1 
ATOM   1498 N N   . LYS A 1 198 ? -1.897  -28.587 15.512 1.00 28.70 ? 221 LYS A N   1 
ATOM   1499 C CA  . LYS A 1 198 ? -2.887  -28.239 14.499 1.00 28.10 ? 221 LYS A CA  1 
ATOM   1500 C C   . LYS A 1 198 ? -2.630  -29.055 13.246 1.00 26.56 ? 221 LYS A C   1 
ATOM   1501 O O   . LYS A 1 198 ? -1.491  -29.428 12.981 1.00 25.89 ? 221 LYS A O   1 
ATOM   1502 C CB  . LYS A 1 198 ? -2.774  -26.741 14.180 1.00 30.85 ? 221 LYS A CB  1 
ATOM   1503 C CG  . LYS A 1 198 ? -3.388  -26.285 12.859 1.00 31.96 ? 221 LYS A CG  1 
ATOM   1504 C CD  . LYS A 1 198 ? -2.972  -24.858 12.537 1.00 30.37 ? 221 LYS A CD  1 
ATOM   1505 C CE  . LYS A 1 198 ? -4.118  -23.875 12.698 1.00 32.56 ? 221 LYS A CE  1 
ATOM   1506 N NZ  . LYS A 1 198 ? -3.635  -22.466 12.883 1.00 33.96 ? 221 LYS A NZ  1 
ATOM   1507 N N   . PHE A 1 199 ? -3.689  -29.345 12.493 1.00 25.78 ? 222 PHE A N   1 
ATOM   1508 C CA  . PHE A 1 199 ? -3.565  -30.097 11.250 1.00 26.13 ? 222 PHE A CA  1 
ATOM   1509 C C   . PHE A 1 199 ? -3.101  -29.111 10.178 1.00 28.08 ? 222 PHE A C   1 
ATOM   1510 O O   . PHE A 1 199 ? -3.394  -27.914 10.263 1.00 28.18 ? 222 PHE A O   1 
ATOM   1511 C CB  . PHE A 1 199 ? -4.916  -30.675 10.811 1.00 26.05 ? 222 PHE A CB  1 
ATOM   1512 C CG  . PHE A 1 199 ? -5.259  -32.021 11.413 1.00 25.29 ? 222 PHE A CG  1 
ATOM   1513 C CD1 . PHE A 1 199 ? -6.083  -32.116 12.530 1.00 24.82 ? 222 PHE A CD1 1 
ATOM   1514 C CD2 . PHE A 1 199 ? -4.814  -33.202 10.812 1.00 24.69 ? 222 PHE A CD2 1 
ATOM   1515 C CE1 . PHE A 1 199 ? -6.466  -33.371 13.035 1.00 26.14 ? 222 PHE A CE1 1 
ATOM   1516 C CE2 . PHE A 1 199 ? -5.189  -34.455 11.311 1.00 23.92 ? 222 PHE A CE2 1 
ATOM   1517 C CZ  . PHE A 1 199 ? -6.019  -34.538 12.424 1.00 24.32 ? 222 PHE A CZ  1 
ATOM   1518 N N   . SER A 1 200 ? -2.371  -29.598 9.179  1.00 29.58 ? 223 SER A N   1 
ATOM   1519 C CA  . SER A 1 200 ? -1.925  -28.728 8.095  1.00 32.38 ? 223 SER A CA  1 
ATOM   1520 C C   . SER A 1 200 ? -3.137  -28.515 7.187  1.00 34.37 ? 223 SER A C   1 
ATOM   1521 O O   . SER A 1 200 ? -4.128  -29.243 7.287  1.00 34.69 ? 223 SER A O   1 
ATOM   1522 C CB  . SER A 1 200 ? -0.773  -29.368 7.307  1.00 33.14 ? 223 SER A CB  1 
ATOM   1523 O OG  . SER A 1 200 ? -1.107  -30.655 6.803  1.00 34.37 ? 223 SER A OG  1 
ATOM   1524 N N   . PRO A 1 201 ? -3.087  -27.511 6.298  1.00 35.56 ? 224 PRO A N   1 
ATOM   1525 C CA  . PRO A 1 201 ? -4.244  -27.290 5.423  1.00 35.61 ? 224 PRO A CA  1 
ATOM   1526 C C   . PRO A 1 201 ? -4.562  -28.338 4.359  1.00 35.73 ? 224 PRO A C   1 
ATOM   1527 O O   . PRO A 1 201 ? -5.442  -28.130 3.535  1.00 37.66 ? 224 PRO A O   1 
ATOM   1528 C CB  . PRO A 1 201 ? -3.983  -25.898 4.839  1.00 34.24 ? 224 PRO A CB  1 
ATOM   1529 C CG  . PRO A 1 201 ? -2.501  -25.743 4.925  1.00 34.93 ? 224 PRO A CG  1 
ATOM   1530 C CD  . PRO A 1 201 ? -2.162  -26.366 6.253  1.00 35.93 ? 224 PRO A CD  1 
ATOM   1531 N N   . ASN A 1 202 ? -3.857  -29.458 4.361  1.00 35.98 ? 225 ASN A N   1 
ATOM   1532 C CA  . ASN A 1 202 ? -4.154  -30.514 3.405  1.00 36.24 ? 225 ASN A CA  1 
ATOM   1533 C C   . ASN A 1 202 ? -4.459  -31.776 4.212  1.00 37.10 ? 225 ASN A C   1 
ATOM   1534 O O   . ASN A 1 202 ? -4.824  -32.812 3.663  1.00 39.13 ? 225 ASN A O   1 
ATOM   1535 C CB  . ASN A 1 202 ? -2.978  -30.734 2.449  1.00 37.44 ? 225 ASN A CB  1 
ATOM   1536 C CG  . ASN A 1 202 ? -1.790  -31.398 3.115  1.00 40.25 ? 225 ASN A CG  1 
ATOM   1537 O OD1 . ASN A 1 202 ? -1.805  -31.675 4.318  1.00 41.52 ? 225 ASN A OD1 1 
ATOM   1538 N ND2 . ASN A 1 202 ? -0.747  -31.660 2.330  1.00 39.42 ? 225 ASN A ND2 1 
ATOM   1539 N N   . GLY A 1 203 ? -4.296  -31.665 5.529  1.00 37.70 ? 226 GLY A N   1 
ATOM   1540 C CA  . GLY A 1 203 ? -4.570  -32.763 6.446  1.00 37.79 ? 226 GLY A CA  1 
ATOM   1541 C C   . GLY A 1 203 ? -3.534  -33.867 6.587  1.00 37.61 ? 226 GLY A C   1 
ATOM   1542 O O   . GLY A 1 203 ? -3.709  -34.785 7.385  1.00 38.42 ? 226 GLY A O   1 
ATOM   1543 N N   . LYS A 1 204 ? -2.449  -33.793 5.835  1.00 36.92 ? 227 LYS A N   1 
ATOM   1544 C CA  . LYS A 1 204 ? -1.443  -34.837 5.908  1.00 37.91 ? 227 LYS A CA  1 
ATOM   1545 C C   . LYS A 1 204 ? -0.432  -34.637 7.030  1.00 37.88 ? 227 LYS A C   1 
ATOM   1546 O O   . LYS A 1 204 ? 0.279   -35.573 7.413  1.00 38.84 ? 227 LYS A O   1 
ATOM   1547 C CB  . LYS A 1 204 ? -0.707  -34.943 4.569  1.00 39.80 ? 227 LYS A CB  1 
ATOM   1548 C CG  . LYS A 1 204 ? -1.590  -35.354 3.407  1.00 44.45 ? 227 LYS A CG  1 
ATOM   1549 C CD  . LYS A 1 204 ? -0.808  -35.395 2.102  1.00 47.44 ? 227 LYS A CD  1 
ATOM   1550 C CE  . LYS A 1 204 ? -1.715  -35.739 0.926  1.00 48.90 ? 227 LYS A CE  1 
ATOM   1551 N NZ  . LYS A 1 204 ? -0.975  -35.688 -0.368 1.00 50.73 ? 227 LYS A NZ  1 
ATOM   1552 N N   . TYR A 1 205 ? -0.358  -33.425 7.564  1.00 36.56 ? 228 TYR A N   1 
ATOM   1553 C CA  . TYR A 1 205 ? 0.602   -33.164 8.619  1.00 36.33 ? 228 TYR A CA  1 
ATOM   1554 C C   . TYR A 1 205 ? 0.013   -32.513 9.860  1.00 35.49 ? 228 TYR A C   1 
ATOM   1555 O O   . TYR A 1 205 ? -1.106  -32.003 9.848  1.00 36.42 ? 228 TYR A O   1 
ATOM   1556 C CB  . TYR A 1 205 ? 1.734   -32.295 8.082  1.00 38.41 ? 228 TYR A CB  1 
ATOM   1557 C CG  . TYR A 1 205 ? 2.153   -32.638 6.672  1.00 41.95 ? 228 TYR A CG  1 
ATOM   1558 C CD1 . TYR A 1 205 ? 1.413   -32.183 5.579  1.00 43.17 ? 228 TYR A CD1 1 
ATOM   1559 C CD2 . TYR A 1 205 ? 3.305   -33.393 6.423  1.00 42.23 ? 228 TYR A CD2 1 
ATOM   1560 C CE1 . TYR A 1 205 ? 1.808   -32.461 4.273  1.00 44.07 ? 228 TYR A CE1 1 
ATOM   1561 C CE2 . TYR A 1 205 ? 3.712   -33.677 5.124  1.00 43.02 ? 228 TYR A CE2 1 
ATOM   1562 C CZ  . TYR A 1 205 ? 2.957   -33.204 4.051  1.00 45.42 ? 228 TYR A CZ  1 
ATOM   1563 O OH  . TYR A 1 205 ? 3.354   -33.445 2.751  1.00 47.51 ? 228 TYR A OH  1 
ATOM   1564 N N   . ILE A 1 206 ? 0.785   -32.547 10.937 1.00 33.83 ? 229 ILE A N   1 
ATOM   1565 C CA  . ILE A 1 206 ? 0.380   -31.955 12.200 1.00 31.40 ? 229 ILE A CA  1 
ATOM   1566 C C   . ILE A 1 206 ? 1.515   -31.029 12.618 1.00 29.55 ? 229 ILE A C   1 
ATOM   1567 O O   . ILE A 1 206 ? 2.676   -31.423 12.609 1.00 28.55 ? 229 ILE A O   1 
ATOM   1568 C CB  . ILE A 1 206 ? 0.194   -33.032 13.315 1.00 33.31 ? 229 ILE A CB  1 
ATOM   1569 C CG1 . ILE A 1 206 ? -0.869  -34.061 12.922 1.00 31.62 ? 229 ILE A CG1 1 
ATOM   1570 C CG2 . ILE A 1 206 ? -0.220  -32.363 14.613 1.00 30.88 ? 229 ILE A CG2 1 
ATOM   1571 C CD1 . ILE A 1 206 ? -2.240  -33.484 12.805 1.00 33.33 ? 229 ILE A CD1 1 
ATOM   1572 N N   . LEU A 1 207 ? 1.183   -29.793 12.962 1.00 27.99 ? 230 LEU A N   1 
ATOM   1573 C CA  . LEU A 1 207 ? 2.189   -28.835 13.403 1.00 24.90 ? 230 LEU A CA  1 
ATOM   1574 C C   . LEU A 1 207 ? 2.042   -28.849 14.903 1.00 24.47 ? 230 LEU A C   1 
ATOM   1575 O O   . LEU A 1 207 ? 0.943   -28.620 15.409 1.00 25.60 ? 230 LEU A O   1 
ATOM   1576 C CB  . LEU A 1 207 ? 1.869   -27.430 12.887 1.00 22.90 ? 230 LEU A CB  1 
ATOM   1577 C CG  . LEU A 1 207 ? 3.009   -26.422 12.666 1.00 22.45 ? 230 LEU A CG  1 
ATOM   1578 C CD1 . LEU A 1 207 ? 2.507   -25.027 13.002 1.00 19.75 ? 230 LEU A CD1 1 
ATOM   1579 C CD2 . LEU A 1 207 ? 4.228   -26.763 13.524 1.00 22.49 ? 230 LEU A CD2 1 
ATOM   1580 N N   . ALA A 1 208 ? 3.122   -29.127 15.622 1.00 23.62 ? 231 ALA A N   1 
ATOM   1581 C CA  . ALA A 1 208 ? 3.031   -29.162 17.077 1.00 23.34 ? 231 ALA A CA  1 
ATOM   1582 C C   . ALA A 1 208 ? 4.085   -28.323 17.770 1.00 23.89 ? 231 ALA A C   1 
ATOM   1583 O O   . ALA A 1 208 ? 5.209   -28.190 17.281 1.00 26.34 ? 231 ALA A O   1 
ATOM   1584 C CB  . ALA A 1 208 ? 3.103   -30.585 17.567 1.00 21.61 ? 231 ALA A CB  1 
ATOM   1585 N N   . ALA A 1 209 ? 3.709   -27.760 18.913 1.00 24.08 ? 232 ALA A N   1 
ATOM   1586 C CA  . ALA A 1 209 ? 4.605   -26.930 19.708 1.00 24.21 ? 232 ALA A CA  1 
ATOM   1587 C C   . ALA A 1 209 ? 4.868   -27.548 21.097 1.00 24.61 ? 232 ALA A C   1 
ATOM   1588 O O   . ALA A 1 209 ? 3.934   -27.952 21.801 1.00 24.10 ? 232 ALA A O   1 
ATOM   1589 C CB  . ALA A 1 209 ? 4.008   -25.539 19.855 1.00 23.75 ? 232 ALA A CB  1 
ATOM   1590 N N   . THR A 1 210 ? 6.144   -27.639 21.471 1.00 24.27 ? 233 THR A N   1 
ATOM   1591 C CA  . THR A 1 210 ? 6.533   -28.185 22.772 1.00 25.47 ? 233 THR A CA  1 
ATOM   1592 C C   . THR A 1 210 ? 7.297   -27.134 23.556 1.00 24.48 ? 233 THR A C   1 
ATOM   1593 O O   . THR A 1 210 ? 8.102   -26.390 22.996 1.00 25.67 ? 233 THR A O   1 
ATOM   1594 C CB  . THR A 1 210 ? 7.441   -29.428 22.651 1.00 26.29 ? 233 THR A CB  1 
ATOM   1595 O OG1 . THR A 1 210 ? 8.416   -29.209 21.627 1.00 29.54 ? 233 THR A OG1 1 
ATOM   1596 C CG2 . THR A 1 210 ? 6.624   -30.667 22.335 1.00 26.69 ? 233 THR A CG2 1 
ATOM   1597 N N   . LEU A 1 211 ? 7.051   -27.091 24.858 1.00 23.15 ? 234 LEU A N   1 
ATOM   1598 C CA  . LEU A 1 211 ? 7.696   -26.128 25.724 1.00 22.52 ? 234 LEU A CA  1 
ATOM   1599 C C   . LEU A 1 211 ? 9.188   -26.330 25.918 1.00 24.03 ? 234 LEU A C   1 
ATOM   1600 O O   . LEU A 1 211 ? 9.684   -26.286 27.043 1.00 25.45 ? 234 LEU A O   1 
ATOM   1601 C CB  . LEU A 1 211 ? 7.008   -26.109 27.077 1.00 18.72 ? 234 LEU A CB  1 
ATOM   1602 C CG  . LEU A 1 211 ? 5.570   -25.627 26.980 1.00 18.35 ? 234 LEU A CG  1 
ATOM   1603 C CD1 . LEU A 1 211 ? 4.895   -25.681 28.347 1.00 17.86 ? 234 LEU A CD1 1 
ATOM   1604 C CD2 . LEU A 1 211 ? 5.576   -24.214 26.403 1.00 19.72 ? 234 LEU A CD2 1 
ATOM   1605 N N   . ASP A 1 212 ? 9.899   -26.561 24.820 1.00 25.22 ? 235 ASP A N   1 
ATOM   1606 C CA  . ASP A 1 212 ? 11.345  -26.707 24.864 1.00 26.67 ? 235 ASP A CA  1 
ATOM   1607 C C   . ASP A 1 212 ? 11.851  -25.883 23.685 1.00 27.51 ? 235 ASP A C   1 
ATOM   1608 O O   . ASP A 1 212 ? 12.802  -26.254 22.993 1.00 27.86 ? 235 ASP A O   1 
ATOM   1609 C CB  . ASP A 1 212 ? 11.767  -28.178 24.760 1.00 28.69 ? 235 ASP A CB  1 
ATOM   1610 C CG  . ASP A 1 212 ? 11.480  -28.785 23.397 1.00 33.86 ? 235 ASP A CG  1 
ATOM   1611 O OD1 . ASP A 1 212 ? 10.549  -28.301 22.706 1.00 35.93 ? 235 ASP A OD1 1 
ATOM   1612 O OD2 . ASP A 1 212 ? 12.183  -29.761 23.028 1.00 34.98 ? 235 ASP A OD2 1 
ATOM   1613 N N   . ASN A 1 213 ? 11.177  -24.749 23.476 1.00 28.32 ? 236 ASN A N   1 
ATOM   1614 C CA  . ASN A 1 213 ? 11.510  -23.796 22.417 1.00 27.85 ? 236 ASN A CA  1 
ATOM   1615 C C   . ASN A 1 213 ? 11.593  -24.512 21.065 1.00 28.99 ? 236 ASN A C   1 
ATOM   1616 O O   . ASN A 1 213 ? 12.522  -24.282 20.277 1.00 29.25 ? 236 ASN A O   1 
ATOM   1617 C CB  . ASN A 1 213 ? 12.854  -23.118 22.727 1.00 24.99 ? 236 ASN A CB  1 
ATOM   1618 C CG  . ASN A 1 213 ? 12.994  -22.712 24.196 1.00 23.68 ? 236 ASN A CG  1 
ATOM   1619 O OD1 . ASN A 1 213 ? 12.351  -21.766 24.677 1.00 19.20 ? 236 ASN A OD1 1 
ATOM   1620 N ND2 . ASN A 1 213 ? 13.843  -23.435 24.915 1.00 23.37 ? 236 ASN A ND2 1 
ATOM   1621 N N   . THR A 1 214 ? 10.611  -25.370 20.799 1.00 29.05 ? 237 THR A N   1 
ATOM   1622 C CA  . THR A 1 214 ? 10.599  -26.131 19.560 1.00 29.79 ? 237 THR A CA  1 
ATOM   1623 C C   . THR A 1 214 ? 9.230   -26.301 18.906 1.00 29.21 ? 237 THR A C   1 
ATOM   1624 O O   . THR A 1 214 ? 8.202   -26.422 19.577 1.00 28.90 ? 237 THR A O   1 
ATOM   1625 C CB  . THR A 1 214 ? 11.197  -27.533 19.786 1.00 29.23 ? 237 THR A CB  1 
ATOM   1626 O OG1 . THR A 1 214 ? 12.501  -27.402 20.359 1.00 30.34 ? 237 THR A OG1 1 
ATOM   1627 C CG2 . THR A 1 214 ? 11.305  -28.293 18.472 1.00 30.09 ? 237 THR A CG2 1 
ATOM   1628 N N   . LEU A 1 215 ? 9.246   -26.302 17.578 1.00 29.36 ? 238 LEU A N   1 
ATOM   1629 C CA  . LEU A 1 215 ? 8.054   -26.486 16.767 1.00 30.30 ? 238 LEU A CA  1 
ATOM   1630 C C   . LEU A 1 215 ? 8.317   -27.669 15.847 1.00 32.07 ? 238 LEU A C   1 
ATOM   1631 O O   . LEU A 1 215 ? 9.385   -27.767 15.236 1.00 33.66 ? 238 LEU A O   1 
ATOM   1632 C CB  . LEU A 1 215 ? 7.772   -25.229 15.941 1.00 28.81 ? 238 LEU A CB  1 
ATOM   1633 C CG  . LEU A 1 215 ? 6.703   -24.322 16.539 1.00 24.43 ? 238 LEU A CG  1 
ATOM   1634 C CD1 . LEU A 1 215 ? 6.578   -23.045 15.754 1.00 22.18 ? 238 LEU A CD1 1 
ATOM   1635 C CD2 . LEU A 1 215 ? 5.405   -25.075 16.556 1.00 23.43 ? 238 LEU A CD2 1 
ATOM   1636 N N   . LYS A 1 216 ? 7.349   -28.570 15.737 1.00 33.81 ? 239 LYS A N   1 
ATOM   1637 C CA  . LYS A 1 216 ? 7.545   -29.743 14.898 1.00 35.45 ? 239 LYS A CA  1 
ATOM   1638 C C   . LYS A 1 216 ? 6.479   -29.962 13.839 1.00 35.34 ? 239 LYS A C   1 
ATOM   1639 O O   . LYS A 1 216 ? 5.300   -29.670 14.056 1.00 35.00 ? 239 LYS A O   1 
ATOM   1640 C CB  . LYS A 1 216 ? 7.623   -30.992 15.773 1.00 37.25 ? 239 LYS A CB  1 
ATOM   1641 C CG  . LYS A 1 216 ? 8.893   -31.119 16.585 1.00 39.83 ? 239 LYS A CG  1 
ATOM   1642 C CD  . LYS A 1 216 ? 8.856   -32.395 17.419 1.00 42.80 ? 239 LYS A CD  1 
ATOM   1643 C CE  . LYS A 1 216 ? 10.150  -32.579 18.196 1.00 44.04 ? 239 LYS A CE  1 
ATOM   1644 N NZ  . LYS A 1 216 ? 11.334  -32.475 17.302 1.00 42.97 ? 239 LYS A NZ  1 
ATOM   1645 N N   . LEU A 1 217 ? 6.912   -30.477 12.691 1.00 35.27 ? 240 LEU A N   1 
ATOM   1646 C CA  . LEU A 1 217 ? 6.006   -30.798 11.596 1.00 36.19 ? 240 LEU A CA  1 
ATOM   1647 C C   . LEU A 1 217 ? 5.972   -32.322 11.532 1.00 37.43 ? 240 LEU A C   1 
ATOM   1648 O O   . LEU A 1 217 ? 6.994   -32.963 11.293 1.00 37.71 ? 240 LEU A O   1 
ATOM   1649 C CB  . LEU A 1 217 ? 6.518   -30.231 10.270 1.00 35.27 ? 240 LEU A CB  1 
ATOM   1650 C CG  . LEU A 1 217 ? 5.568   -30.396 9.073  1.00 36.16 ? 240 LEU A CG  1 
ATOM   1651 C CD1 . LEU A 1 217 ? 4.247   -29.682 9.360  1.00 37.20 ? 240 LEU A CD1 1 
ATOM   1652 C CD2 . LEU A 1 217 ? 6.206   -29.835 7.808  1.00 34.13 ? 240 LEU A CD2 1 
ATOM   1653 N N   . TRP A 1 218 ? 4.797   -32.899 11.760 1.00 38.79 ? 241 TRP A N   1 
ATOM   1654 C CA  . TRP A 1 218 ? 4.638   -34.352 11.744 1.00 40.19 ? 241 TRP A CA  1 
ATOM   1655 C C   . TRP A 1 218 ? 3.824   -34.894 10.577 1.00 41.63 ? 241 TRP A C   1 
ATOM   1656 O O   . TRP A 1 218 ? 2.871   -34.255 10.130 1.00 41.17 ? 241 TRP A O   1 
ATOM   1657 C CB  . TRP A 1 218 ? 3.926   -34.837 13.006 1.00 39.74 ? 241 TRP A CB  1 
ATOM   1658 C CG  . TRP A 1 218 ? 4.649   -34.645 14.286 1.00 39.08 ? 241 TRP A CG  1 
ATOM   1659 C CD1 . TRP A 1 218 ? 4.804   -33.479 14.985 1.00 38.27 ? 241 TRP A CD1 1 
ATOM   1660 C CD2 . TRP A 1 218 ? 5.267   -35.663 15.066 1.00 38.84 ? 241 TRP A CD2 1 
ATOM   1661 N NE1 . TRP A 1 218 ? 5.481   -33.713 16.155 1.00 38.35 ? 241 TRP A NE1 1 
ATOM   1662 C CE2 . TRP A 1 218 ? 5.784   -35.052 16.227 1.00 39.23 ? 241 TRP A CE2 1 
ATOM   1663 C CE3 . TRP A 1 218 ? 5.448   -37.041 14.892 1.00 37.66 ? 241 TRP A CE3 1 
ATOM   1664 C CZ2 . TRP A 1 218 ? 6.449   -35.769 17.218 1.00 37.86 ? 241 TRP A CZ2 1 
ATOM   1665 C CZ3 . TRP A 1 218 ? 6.112   -37.756 15.877 1.00 37.21 ? 241 TRP A CZ3 1 
ATOM   1666 C CH2 . TRP A 1 218 ? 6.609   -37.118 17.021 1.00 36.51 ? 241 TRP A CH2 1 
ATOM   1667 N N   . ASP A 1 219 ? 4.210   -36.079 10.103 1.00 42.80 ? 242 ASP A N   1 
ATOM   1668 C CA  . ASP A 1 219 ? 3.478   -36.795 9.058  1.00 45.26 ? 242 ASP A CA  1 
ATOM   1669 C C   . ASP A 1 219 ? 2.710   -37.719 9.990  1.00 46.68 ? 242 ASP A C   1 
ATOM   1670 O O   . ASP A 1 219 ? 3.292   -38.642 10.546 1.00 47.24 ? 242 ASP A O   1 
ATOM   1671 C CB  . ASP A 1 219 ? 4.430   -37.621 8.188  1.00 46.45 ? 242 ASP A CB  1 
ATOM   1672 C CG  . ASP A 1 219 ? 3.711   -38.365 7.069  1.00 47.35 ? 242 ASP A CG  1 
ATOM   1673 O OD1 . ASP A 1 219 ? 2.652   -38.968 7.331  1.00 46.72 ? 242 ASP A OD1 1 
ATOM   1674 O OD2 . ASP A 1 219 ? 4.214   -38.357 5.924  1.00 48.46 ? 242 ASP A OD2 1 
ATOM   1675 N N   . TYR A 1 220 ? 1.420   -37.487 10.188 1.00 48.33 ? 243 TYR A N   1 
ATOM   1676 C CA  . TYR A 1 220 ? 0.711   -38.322 11.147 1.00 51.05 ? 243 TYR A CA  1 
ATOM   1677 C C   . TYR A 1 220 ? 0.386   -39.728 10.688 1.00 50.78 ? 243 TYR A C   1 
ATOM   1678 O O   . TYR A 1 220 ? 0.332   -40.645 11.507 1.00 51.95 ? 243 TYR A O   1 
ATOM   1679 C CB  . TYR A 1 220 ? -0.551  -37.608 11.646 1.00 52.79 ? 243 TYR A CB  1 
ATOM   1680 C CG  . TYR A 1 220 ? -1.828  -38.080 11.019 1.00 53.97 ? 243 TYR A CG  1 
ATOM   1681 C CD1 . TYR A 1 220 ? -2.487  -39.219 11.491 1.00 54.27 ? 243 TYR A CD1 1 
ATOM   1682 C CD2 . TYR A 1 220 ? -2.371  -37.399 9.943  1.00 54.91 ? 243 TYR A CD2 1 
ATOM   1683 C CE1 . TYR A 1 220 ? -3.653  -39.666 10.900 1.00 55.39 ? 243 TYR A CE1 1 
ATOM   1684 C CE2 . TYR A 1 220 ? -3.534  -37.832 9.342  1.00 57.39 ? 243 TYR A CE2 1 
ATOM   1685 C CZ  . TYR A 1 220 ? -4.173  -38.965 9.820  1.00 57.39 ? 243 TYR A CZ  1 
ATOM   1686 O OH  . TYR A 1 220 ? -5.327  -39.384 9.195  1.00 59.45 ? 243 TYR A OH  1 
ATOM   1687 N N   . SER A 1 221 ? 0.164   -39.914 9.396  1.00 49.70 ? 244 SER A N   1 
ATOM   1688 C CA  . SER A 1 221 ? -0.125  -41.256 8.915  1.00 49.69 ? 244 SER A CA  1 
ATOM   1689 C C   . SER A 1 221 ? 1.047   -42.155 9.321  1.00 48.16 ? 244 SER A C   1 
ATOM   1690 O O   . SER A 1 221 ? 0.862   -43.228 9.902  1.00 46.61 ? 244 SER A O   1 
ATOM   1691 C CB  . SER A 1 221 ? -0.273  -41.258 7.393  1.00 51.44 ? 244 SER A CB  1 
ATOM   1692 O OG  . SER A 1 221 ? 0.959   -40.941 6.769  1.00 54.01 ? 244 SER A OG  1 
ATOM   1693 N N   . LYS A 1 222 ? 2.255   -41.687 9.021  1.00 46.81 ? 245 LYS A N   1 
ATOM   1694 C CA  . LYS A 1 222 ? 3.478   -42.407 9.334  1.00 45.36 ? 245 LYS A CA  1 
ATOM   1695 C C   . LYS A 1 222 ? 3.903   -42.229 10.781 1.00 44.06 ? 245 LYS A C   1 
ATOM   1696 O O   . LYS A 1 222 ? 4.638   -43.046 11.319 1.00 45.03 ? 245 LYS A O   1 
ATOM   1697 C CB  . LYS A 1 222 ? 4.596   -41.938 8.407  1.00 45.19 ? 245 LYS A CB  1 
ATOM   1698 C CG  . LYS A 1 222 ? 4.322   -42.290 6.958  1.00 46.88 ? 245 LYS A CG  1 
ATOM   1699 C CD  . LYS A 1 222 ? 5.233   -41.552 5.989  1.00 48.74 ? 245 LYS A CD  1 
ATOM   1700 C CE  . LYS A 1 222 ? 4.784   -41.776 4.540  1.00 48.64 ? 245 LYS A CE  1 
ATOM   1701 N NZ  . LYS A 1 222 ? 5.494   -40.876 3.571  1.00 49.40 ? 245 LYS A NZ  1 
ATOM   1702 N N   . GLY A 1 223 ? 3.428   -41.167 11.416 1.00 42.90 ? 246 GLY A N   1 
ATOM   1703 C CA  . GLY A 1 223 ? 3.800   -40.924 12.795 1.00 42.26 ? 246 GLY A CA  1 
ATOM   1704 C C   . GLY A 1 223 ? 5.291   -40.647 12.878 1.00 41.59 ? 246 GLY A C   1 
ATOM   1705 O O   . GLY A 1 223 ? 6.001   -41.203 13.713 1.00 39.19 ? 246 GLY A O   1 
ATOM   1706 N N   . LYS A 1 224 ? 5.761   -39.785 11.985 1.00 41.96 ? 247 LYS A N   1 
ATOM   1707 C CA  . LYS A 1 224 ? 7.163   -39.408 11.924 1.00 43.53 ? 247 LYS A CA  1 
ATOM   1708 C C   . LYS A 1 224 ? 7.295   -37.889 11.942 1.00 43.16 ? 247 LYS A C   1 
ATOM   1709 O O   . LYS A 1 224 ? 6.426   -37.173 11.432 1.00 42.38 ? 247 LYS A O   1 
ATOM   1710 C CB  . LYS A 1 224 ? 7.806   -39.960 10.644 1.00 45.57 ? 247 LYS A CB  1 
ATOM   1711 C CG  . LYS A 1 224 ? 8.410   -41.345 10.775 1.00 49.10 ? 247 LYS A CG  1 
ATOM   1712 C CD  . LYS A 1 224 ? 7.416   -42.340 11.344 1.00 54.18 ? 247 LYS A CD  1 
ATOM   1713 C CE  . LYS A 1 224 ? 8.018   -43.737 11.482 1.00 57.10 ? 247 LYS A CE  1 
ATOM   1714 N NZ  . LYS A 1 224 ? 8.254   -44.389 10.157 1.00 59.17 ? 247 LYS A NZ  1 
ATOM   1715 N N   . CYS A 1 225 ? 8.388   -37.408 12.530 1.00 41.54 ? 248 CYS A N   1 
ATOM   1716 C CA  . CYS A 1 225 ? 8.657   -35.983 12.603 1.00 40.23 ? 248 CYS A CA  1 
ATOM   1717 C C   . CYS A 1 225 ? 9.488   -35.553 11.390 1.00 39.42 ? 248 CYS A C   1 
ATOM   1718 O O   . CYS A 1 225 ? 10.654  -35.920 11.262 1.00 38.49 ? 248 CYS A O   1 
ATOM   1719 C CB  . CYS A 1 225 ? 9.403   -35.671 13.894 1.00 40.87 ? 248 CYS A CB  1 
ATOM   1720 S SG  . CYS A 1 225 ? 9.745   -33.919 14.131 1.00 42.78 ? 248 CYS A SG  1 
ATOM   1721 N N   . LEU A 1 226 ? 8.880   -34.766 10.508 1.00 38.84 ? 249 LEU A N   1 
ATOM   1722 C CA  . LEU A 1 226 ? 9.538   -34.296 9.288  1.00 38.82 ? 249 LEU A CA  1 
ATOM   1723 C C   . LEU A 1 226 ? 10.415  -33.058 9.440  1.00 38.08 ? 249 LEU A C   1 
ATOM   1724 O O   . LEU A 1 226 ? 11.517  -32.996 8.887  1.00 37.18 ? 249 LEU A O   1 
ATOM   1725 C CB  . LEU A 1 226 ? 8.489   -34.008 8.209  1.00 39.02 ? 249 LEU A CB  1 
ATOM   1726 C CG  . LEU A 1 226 ? 7.756   -35.176 7.549  1.00 39.21 ? 249 LEU A CG  1 
ATOM   1727 C CD1 . LEU A 1 226 ? 7.486   -36.292 8.541  1.00 39.36 ? 249 LEU A CD1 1 
ATOM   1728 C CD2 . LEU A 1 226 ? 6.467   -34.645 6.958  1.00 40.60 ? 249 LEU A CD2 1 
ATOM   1729 N N   . LYS A 1 227 ? 9.919   -32.065 10.173 1.00 36.62 ? 250 LYS A N   1 
ATOM   1730 C CA  . LYS A 1 227 ? 10.663  -30.829 10.350 1.00 34.29 ? 250 LYS A CA  1 
ATOM   1731 C C   . LYS A 1 227 ? 10.682  -30.345 11.781 1.00 33.16 ? 250 LYS A C   1 
ATOM   1732 O O   . LYS A 1 227 ? 9.723   -30.520 12.533 1.00 34.49 ? 250 LYS A O   1 
ATOM   1733 C CB  . LYS A 1 227 ? 10.075  -29.727 9.463  1.00 35.27 ? 250 LYS A CB  1 
ATOM   1734 C CG  . LYS A 1 227 ? 10.056  -30.040 7.972  1.00 38.01 ? 250 LYS A CG  1 
ATOM   1735 C CD  . LYS A 1 227 ? 11.458  -30.281 7.443  1.00 40.97 ? 250 LYS A CD  1 
ATOM   1736 C CE  . LYS A 1 227 ? 11.480  -30.454 5.932  1.00 42.83 ? 250 LYS A CE  1 
ATOM   1737 N NZ  . LYS A 1 227 ? 12.884  -30.568 5.433  1.00 43.82 ? 250 LYS A NZ  1 
ATOM   1738 N N   . THR A 1 228 ? 11.790  -29.714 12.143 1.00 31.79 ? 251 THR A N   1 
ATOM   1739 C CA  . THR A 1 228 ? 11.974  -29.157 13.473 1.00 30.74 ? 251 THR A CA  1 
ATOM   1740 C C   . THR A 1 228 ? 12.354  -27.686 13.340 1.00 30.04 ? 251 THR A C   1 
ATOM   1741 O O   . THR A 1 228 ? 13.425  -27.373 12.825 1.00 31.24 ? 251 THR A O   1 
ATOM   1742 C CB  . THR A 1 228 ? 13.092  -29.904 14.236 1.00 30.26 ? 251 THR A CB  1 
ATOM   1743 O OG1 . THR A 1 228 ? 12.553  -31.094 14.821 1.00 32.14 ? 251 THR A OG1 1 
ATOM   1744 C CG2 . THR A 1 228 ? 13.672  -29.039 15.327 1.00 29.25 ? 251 THR A CG2 1 
ATOM   1745 N N   . TYR A 1 229 ? 11.484  -26.788 13.801 1.00 28.58 ? 252 TYR A N   1 
ATOM   1746 C CA  . TYR A 1 229 ? 11.766  -25.355 13.727 1.00 28.45 ? 252 TYR A CA  1 
ATOM   1747 C C   . TYR A 1 229 ? 12.182  -24.796 15.083 1.00 28.40 ? 252 TYR A C   1 
ATOM   1748 O O   . TYR A 1 229 ? 11.490  -24.994 16.091 1.00 28.14 ? 252 TYR A O   1 
ATOM   1749 C CB  . TYR A 1 229 ? 10.544  -24.603 13.211 1.00 28.36 ? 252 TYR A CB  1 
ATOM   1750 C CG  . TYR A 1 229 ? 9.961   -25.214 11.968 1.00 28.14 ? 252 TYR A CG  1 
ATOM   1751 C CD1 . TYR A 1 229 ? 8.939   -26.152 12.053 1.00 27.87 ? 252 TYR A CD1 1 
ATOM   1752 C CD2 . TYR A 1 229 ? 10.441  -24.865 10.704 1.00 28.03 ? 252 TYR A CD2 1 
ATOM   1753 C CE1 . TYR A 1 229 ? 8.402   -26.727 10.912 1.00 31.02 ? 252 TYR A CE1 1 
ATOM   1754 C CE2 . TYR A 1 229 ? 9.915   -25.432 9.555  1.00 31.08 ? 252 TYR A CE2 1 
ATOM   1755 C CZ  . TYR A 1 229 ? 8.890   -26.366 9.660  1.00 32.85 ? 252 TYR A CZ  1 
ATOM   1756 O OH  . TYR A 1 229 ? 8.340   -26.934 8.522  1.00 32.82 ? 252 TYR A OH  1 
ATOM   1757 N N   . THR A 1 230 ? 13.306  -24.085 15.101 1.00 27.88 ? 253 THR A N   1 
ATOM   1758 C CA  . THR A 1 230 ? 13.820  -23.535 16.346 1.00 27.77 ? 253 THR A CA  1 
ATOM   1759 C C   . THR A 1 230 ? 14.349  -22.119 16.229 1.00 28.15 ? 253 THR A C   1 
ATOM   1760 O O   . THR A 1 230 ? 14.230  -21.473 15.190 1.00 27.64 ? 253 THR A O   1 
ATOM   1761 C CB  . THR A 1 230 ? 14.969  -24.417 16.909 1.00 27.90 ? 253 THR A CB  1 
ATOM   1762 O OG1 . THR A 1 230 ? 16.002  -24.552 15.922 1.00 27.64 ? 253 THR A OG1 1 
ATOM   1763 C CG2 . THR A 1 230 ? 14.452  -25.805 17.304 1.00 27.56 ? 253 THR A CG2 1 
ATOM   1764 N N   . GLY A 1 231 ? 14.938  -21.644 17.320 1.00 29.52 ? 254 GLY A N   1 
ATOM   1765 C CA  . GLY A 1 231 ? 15.511  -20.313 17.329 1.00 31.02 ? 254 GLY A CA  1 
ATOM   1766 C C   . GLY A 1 231 ? 14.765  -19.328 18.194 1.00 31.94 ? 254 GLY A C   1 
ATOM   1767 O O   . GLY A 1 231 ? 15.281  -18.243 18.471 1.00 33.09 ? 254 GLY A O   1 
ATOM   1768 N N   . HIS A 1 232 ? 13.560  -19.698 18.625 1.00 31.99 ? 255 HIS A N   1 
ATOM   1769 C CA  . HIS A 1 232 ? 12.761  -18.810 19.456 1.00 30.93 ? 255 HIS A CA  1 
ATOM   1770 C C   . HIS A 1 232 ? 12.687  -19.260 20.904 1.00 30.52 ? 255 HIS A C   1 
ATOM   1771 O O   . HIS A 1 232 ? 13.338  -20.221 21.305 1.00 29.91 ? 255 HIS A O   1 
ATOM   1772 C CB  . HIS A 1 232 ? 11.350  -18.654 18.882 1.00 30.61 ? 255 HIS A CB  1 
ATOM   1773 C CG  . HIS A 1 232 ? 10.533  -19.905 18.919 1.00 30.56 ? 255 HIS A CG  1 
ATOM   1774 N ND1 . HIS A 1 232 ? 10.915  -21.064 18.275 1.00 30.48 ? 255 HIS A ND1 1 
ATOM   1775 C CD2 . HIS A 1 232 ? 9.334   -20.171 19.493 1.00 30.24 ? 255 HIS A CD2 1 
ATOM   1776 C CE1 . HIS A 1 232 ? 9.986   -21.988 18.448 1.00 30.33 ? 255 HIS A CE1 1 
ATOM   1777 N NE2 . HIS A 1 232 ? 9.015   -21.472 19.183 1.00 29.59 ? 255 HIS A NE2 1 
ATOM   1778 N N   . LYS A 1 233 ? 11.882  -18.545 21.680 1.00 30.48 ? 256 LYS A N   1 
ATOM   1779 C CA  . LYS A 1 233 ? 11.716  -18.813 23.094 1.00 31.05 ? 256 LYS A CA  1 
ATOM   1780 C C   . LYS A 1 233 ? 10.297  -19.227 23.475 1.00 31.63 ? 256 LYS A C   1 
ATOM   1781 O O   . LYS A 1 233 ? 9.375   -18.421 23.417 1.00 32.38 ? 256 LYS A O   1 
ATOM   1782 C CB  . LYS A 1 233 ? 12.105  -17.561 23.883 1.00 32.25 ? 256 LYS A CB  1 
ATOM   1783 C CG  . LYS A 1 233 ? 13.542  -17.523 24.387 1.00 35.21 ? 256 LYS A CG  1 
ATOM   1784 C CD  . LYS A 1 233 ? 13.616  -17.992 25.843 1.00 39.21 ? 256 LYS A CD  1 
ATOM   1785 C CE  . LYS A 1 233 ? 13.168  -19.450 26.004 1.00 41.20 ? 256 LYS A CE  1 
ATOM   1786 N NZ  . LYS A 1 233 ? 12.849  -19.803 27.422 1.00 41.27 ? 256 LYS A NZ  1 
ATOM   1787 N N   . ASN A 1 234 ? 10.119  -20.479 23.872 1.00 31.20 ? 257 ASN A N   1 
ATOM   1788 C CA  . ASN A 1 234 ? 8.804   -20.946 24.289 1.00 32.09 ? 257 ASN A CA  1 
ATOM   1789 C C   . ASN A 1 234 ? 8.953   -22.073 25.298 1.00 32.70 ? 257 ASN A C   1 
ATOM   1790 O O   . ASN A 1 234 ? 9.139   -23.238 24.940 1.00 32.66 ? 257 ASN A O   1 
ATOM   1791 C CB  . ASN A 1 234 ? 7.978   -21.406 23.082 1.00 32.17 ? 257 ASN A CB  1 
ATOM   1792 C CG  . ASN A 1 234 ? 6.514   -21.658 23.435 1.00 31.37 ? 257 ASN A CG  1 
ATOM   1793 O OD1 . ASN A 1 234 ? 5.977   -21.060 24.372 1.00 30.79 ? 257 ASN A OD1 1 
ATOM   1794 N ND2 . ASN A 1 234 ? 5.860   -22.529 22.670 1.00 29.40 ? 257 ASN A ND2 1 
ATOM   1795 N N   . GLU A 1 235 ? 8.881   -21.705 26.570 1.00 34.46 ? 258 GLU A N   1 
ATOM   1796 C CA  . GLU A 1 235 ? 9.015   -22.656 27.662 1.00 34.99 ? 258 GLU A CA  1 
ATOM   1797 C C   . GLU A 1 235 ? 7.889   -22.509 28.659 1.00 35.08 ? 258 GLU A C   1 
ATOM   1798 O O   . GLU A 1 235 ? 7.647   -23.410 29.450 1.00 36.84 ? 258 GLU A O   1 
ATOM   1799 C CB  . GLU A 1 235 ? 10.324  -22.426 28.403 1.00 34.44 ? 258 GLU A CB  1 
ATOM   1800 C CG  . GLU A 1 235 ? 11.561  -22.913 27.690 1.00 38.81 ? 258 GLU A CG  1 
ATOM   1801 C CD  . GLU A 1 235 ? 12.826  -22.597 28.467 1.00 41.27 ? 258 GLU A CD  1 
ATOM   1802 O OE1 . GLU A 1 235 ? 13.906  -23.103 28.088 1.00 42.89 ? 258 GLU A OE1 1 
ATOM   1803 O OE2 . GLU A 1 235 ? 12.742  -21.833 29.457 1.00 43.72 ? 258 GLU A OE2 1 
ATOM   1804 N N   . LYS A 1 236 ? 7.185   -21.383 28.605 1.00 34.71 ? 259 LYS A N   1 
ATOM   1805 C CA  . LYS A 1 236 ? 6.129   -21.112 29.574 1.00 35.22 ? 259 LYS A CA  1 
ATOM   1806 C C   . LYS A 1 236 ? 4.677   -21.011 29.107 1.00 34.41 ? 259 LYS A C   1 
ATOM   1807 O O   . LYS A 1 236 ? 3.769   -21.446 29.814 1.00 33.95 ? 259 LYS A O   1 
ATOM   1808 C CB  . LYS A 1 236 ? 6.496   -19.834 30.335 1.00 36.19 ? 259 LYS A CB  1 
ATOM   1809 C CG  . LYS A 1 236 ? 7.851   -19.908 31.005 1.00 39.22 ? 259 LYS A CG  1 
ATOM   1810 C CD  . LYS A 1 236 ? 8.412   -18.537 31.342 1.00 43.64 ? 259 LYS A CD  1 
ATOM   1811 C CE  . LYS A 1 236 ? 9.798   -18.671 31.975 1.00 46.67 ? 259 LYS A CE  1 
ATOM   1812 N NZ  . LYS A 1 236 ? 10.474  -17.353 32.203 1.00 48.80 ? 259 LYS A NZ  1 
ATOM   1813 N N   . TYR A 1 237 ? 4.439   -20.433 27.937 1.00 33.07 ? 260 TYR A N   1 
ATOM   1814 C CA  . TYR A 1 237 ? 3.064   -20.286 27.476 1.00 30.39 ? 260 TYR A CA  1 
ATOM   1815 C C   . TYR A 1 237 ? 2.709   -21.137 26.286 1.00 29.33 ? 260 TYR A C   1 
ATOM   1816 O O   . TYR A 1 237 ? 3.570   -21.748 25.651 1.00 26.93 ? 260 TYR A O   1 
ATOM   1817 C CB  . TYR A 1 237 ? 2.760   -18.824 27.136 1.00 29.78 ? 260 TYR A CB  1 
ATOM   1818 C CG  . TYR A 1 237 ? 3.103   -17.869 28.254 1.00 29.57 ? 260 TYR A CG  1 
ATOM   1819 C CD1 . TYR A 1 237 ? 4.397   -17.339 28.384 1.00 27.29 ? 260 TYR A CD1 1 
ATOM   1820 C CD2 . TYR A 1 237 ? 2.148   -17.530 29.214 1.00 27.57 ? 260 TYR A CD2 1 
ATOM   1821 C CE1 . TYR A 1 237 ? 4.719   -16.500 29.442 1.00 24.33 ? 260 TYR A CE1 1 
ATOM   1822 C CE2 . TYR A 1 237 ? 2.465   -16.699 30.267 1.00 26.15 ? 260 TYR A CE2 1 
ATOM   1823 C CZ  . TYR A 1 237 ? 3.744   -16.191 30.377 1.00 24.83 ? 260 TYR A CZ  1 
ATOM   1824 O OH  . TYR A 1 237 ? 4.030   -15.379 31.441 1.00 27.32 ? 260 TYR A OH  1 
ATOM   1825 N N   . CYS A 1 238 ? 1.414   -21.164 25.997 1.00 30.10 ? 261 CYS A N   1 
ATOM   1826 C CA  . CYS A 1 238 ? 0.891   -21.910 24.872 1.00 29.82 ? 261 CYS A CA  1 
ATOM   1827 C C   . CYS A 1 238 ? 0.684   -20.945 23.719 1.00 29.74 ? 261 CYS A C   1 
ATOM   1828 O O   . CYS A 1 238 ? -0.378  -20.334 23.579 1.00 29.45 ? 261 CYS A O   1 
ATOM   1829 C CB  . CYS A 1 238 ? -0.414  -22.583 25.256 1.00 29.64 ? 261 CYS A CB  1 
ATOM   1830 S SG  . CYS A 1 238 ? -0.188  -23.934 26.439 1.00 33.44 ? 261 CYS A SG  1 
ATOM   1831 N N   . ILE A 1 239 ? 1.735   -20.808 22.915 1.00 28.79 ? 262 ILE A N   1 
ATOM   1832 C CA  . ILE A 1 239 ? 1.753   -19.931 21.753 1.00 27.01 ? 262 ILE A CA  1 
ATOM   1833 C C   . ILE A 1 239 ? 1.192   -20.684 20.539 1.00 26.63 ? 262 ILE A C   1 
ATOM   1834 O O   . ILE A 1 239 ? 1.678   -21.774 20.219 1.00 23.31 ? 262 ILE A O   1 
ATOM   1835 C CB  . ILE A 1 239 ? 3.207   -19.507 21.438 1.00 26.33 ? 262 ILE A CB  1 
ATOM   1836 C CG1 . ILE A 1 239 ? 3.905   -19.028 22.715 1.00 27.33 ? 262 ILE A CG1 1 
ATOM   1837 C CG2 . ILE A 1 239 ? 3.232   -18.425 20.382 1.00 23.81 ? 262 ILE A CG2 1 
ATOM   1838 C CD1 . ILE A 1 239 ? 3.322   -17.793 23.291 1.00 28.94 ? 262 ILE A CD1 1 
ATOM   1839 N N   . PHE A 1 240 ? 0.174   -20.120 19.874 1.00 25.38 ? 263 PHE A N   1 
ATOM   1840 C CA  . PHE A 1 240 ? -0.385  -20.768 18.679 1.00 25.38 ? 263 PHE A CA  1 
ATOM   1841 C C   . PHE A 1 240 ? 0.698   -20.660 17.608 1.00 24.86 ? 263 PHE A C   1 
ATOM   1842 O O   . PHE A 1 240 ? 1.559   -19.793 17.684 1.00 25.51 ? 263 PHE A O   1 
ATOM   1843 C CB  . PHE A 1 240 ? -1.619  -20.041 18.125 1.00 24.09 ? 263 PHE A CB  1 
ATOM   1844 C CG  . PHE A 1 240 ? -2.780  -19.985 19.062 1.00 22.76 ? 263 PHE A CG  1 
ATOM   1845 C CD1 . PHE A 1 240 ? -2.761  -19.157 20.170 1.00 23.01 ? 263 PHE A CD1 1 
ATOM   1846 C CD2 . PHE A 1 240 ? -3.939  -20.694 18.782 1.00 22.55 ? 263 PHE A CD2 1 
ATOM   1847 C CE1 . PHE A 1 240 ? -3.876  -19.065 21.011 1.00 23.07 ? 263 PHE A CE1 1 
ATOM   1848 C CE2 . PHE A 1 240 ? -5.053  -20.604 19.620 1.00 21.69 ? 263 PHE A CE2 1 
ATOM   1849 C CZ  . PHE A 1 240 ? -5.022  -19.774 20.722 1.00 19.98 ? 263 PHE A CZ  1 
ATOM   1850 N N   . ALA A 1 241 ? 0.638   -21.527 16.608 1.00 23.57 ? 264 ALA A N   1 
ATOM   1851 C CA  . ALA A 1 241 ? 1.596   -21.499 15.511 1.00 22.36 ? 264 ALA A CA  1 
ATOM   1852 C C   . ALA A 1 241 ? 0.753   -21.650 14.244 1.00 21.71 ? 264 ALA A C   1 
ATOM   1853 O O   . ALA A 1 241 ? -0.233  -22.385 14.248 1.00 18.85 ? 264 ALA A O   1 
ATOM   1854 C CB  . ALA A 1 241 ? 2.599   -22.646 15.650 1.00 20.84 ? 264 ALA A CB  1 
ATOM   1855 N N   . ASN A 1 242 ? 1.145   -20.960 13.172 1.00 23.92 ? 265 ASN A N   1 
ATOM   1856 C CA  . ASN A 1 242 ? 0.396   -20.967 11.909 1.00 25.13 ? 265 ASN A CA  1 
ATOM   1857 C C   . ASN A 1 242 ? 1.147   -21.428 10.661 1.00 26.01 ? 265 ASN A C   1 
ATOM   1858 O O   . ASN A 1 242 ? 2.386   -21.487 10.635 1.00 25.76 ? 265 ASN A O   1 
ATOM   1859 C CB  . ASN A 1 242 ? -0.134  -19.560 11.622 1.00 24.88 ? 265 ASN A CB  1 
ATOM   1860 C CG  . ASN A 1 242 ? -0.586  -18.845 12.869 1.00 27.13 ? 265 ASN A CG  1 
ATOM   1861 O OD1 . ASN A 1 242 ? -1.552  -19.248 13.513 1.00 29.93 ? 265 ASN A OD1 1 
ATOM   1862 N ND2 . ASN A 1 242 ? 0.123   -17.783 13.229 1.00 27.11 ? 265 ASN A ND2 1 
ATOM   1863 N N   . PHE A 1 243 ? 0.359   -21.746 9.628  1.00 26.18 ? 266 PHE A N   1 
ATOM   1864 C CA  . PHE A 1 243 ? 0.860   -22.150 8.316  1.00 24.19 ? 266 PHE A CA  1 
ATOM   1865 C C   . PHE A 1 243 ? 0.553   -20.961 7.430  1.00 23.18 ? 266 PHE A C   1 
ATOM   1866 O O   . PHE A 1 243 ? -0.608  -20.576 7.303  1.00 22.11 ? 266 PHE A O   1 
ATOM   1867 C CB  . PHE A 1 243 ? 0.087   -23.337 7.734  1.00 23.30 ? 266 PHE A CB  1 
ATOM   1868 C CG  . PHE A 1 243 ? 0.414   -24.664 8.357  1.00 24.25 ? 266 PHE A CG  1 
ATOM   1869 C CD1 . PHE A 1 243 ? -0.343  -25.157 9.416  1.00 24.35 ? 266 PHE A CD1 1 
ATOM   1870 C CD2 . PHE A 1 243 ? 1.440   -25.457 7.839  1.00 24.11 ? 266 PHE A CD2 1 
ATOM   1871 C CE1 . PHE A 1 243 ? -0.091  -26.425 9.943  1.00 22.49 ? 266 PHE A CE1 1 
ATOM   1872 C CE2 . PHE A 1 243 ? 1.704   -26.724 8.359  1.00 21.81 ? 266 PHE A CE2 1 
ATOM   1873 C CZ  . PHE A 1 243 ? 0.935   -27.210 9.411  1.00 23.18 ? 266 PHE A CZ  1 
ATOM   1874 N N   . SER A 1 244 ? 1.579   -20.373 6.830  1.00 23.87 ? 267 SER A N   1 
ATOM   1875 C CA  . SER A 1 244 ? 1.377   -19.239 5.934  1.00 23.46 ? 267 SER A CA  1 
ATOM   1876 C C   . SER A 1 244 ? 1.438   -19.817 4.522  1.00 24.10 ? 267 SER A C   1 
ATOM   1877 O O   . SER A 1 244 ? 2.304   -20.642 4.216  1.00 23.98 ? 267 SER A O   1 
ATOM   1878 C CB  . SER A 1 244 ? 2.475   -18.201 6.142  1.00 21.97 ? 267 SER A CB  1 
ATOM   1879 O OG  . SER A 1 244 ? 1.994   -16.907 5.867  1.00 17.26 ? 267 SER A OG  1 
ATOM   1880 N N   . VAL A 1 245 ? 0.516   -19.394 3.666  1.00 25.45 ? 268 VAL A N   1 
ATOM   1881 C CA  . VAL A 1 245 ? 0.452   -19.916 2.305  1.00 24.38 ? 268 VAL A CA  1 
ATOM   1882 C C   . VAL A 1 245 ? 0.196   -18.874 1.210  1.00 25.36 ? 268 VAL A C   1 
ATOM   1883 O O   . VAL A 1 245 ? 0.711   -19.007 0.097  1.00 28.42 ? 268 VAL A O   1 
ATOM   1884 C CB  . VAL A 1 245 ? -0.632  -21.005 2.221  1.00 21.80 ? 268 VAL A CB  1 
ATOM   1885 C CG1 . VAL A 1 245 ? -0.180  -22.229 2.980  1.00 19.24 ? 268 VAL A CG1 1 
ATOM   1886 C CG2 . VAL A 1 245 ? -1.935  -20.492 2.838  1.00 18.49 ? 268 VAL A CG2 1 
ATOM   1887 N N   . THR A 1 246 ? -0.589  -17.845 1.528  1.00 24.98 ? 269 THR A N   1 
ATOM   1888 C CA  . THR A 1 246 ? -0.937  -16.785 0.580  1.00 25.04 ? 269 THR A CA  1 
ATOM   1889 C C   . THR A 1 246 ? 0.255   -16.282 -0.236 1.00 25.75 ? 269 THR A C   1 
ATOM   1890 O O   . THR A 1 246 ? 0.187   -16.190 -1.463 1.00 27.06 ? 269 THR A O   1 
ATOM   1891 C CB  . THR A 1 246 ? -1.597  -15.606 1.315  1.00 24.33 ? 269 THR A CB  1 
ATOM   1892 O OG1 . THR A 1 246 ? -0.791  -15.241 2.445  1.00 22.32 ? 269 THR A OG1 1 
ATOM   1893 C CG2 . THR A 1 246 ? -3.004  -15.995 1.784  1.00 21.59 ? 269 THR A CG2 1 
ATOM   1894 N N   . GLY A 1 247 ? 1.332   -15.930 0.450  1.00 27.46 ? 270 GLY A N   1 
ATOM   1895 C CA  . GLY A 1 247 ? 2.537   -15.491 -0.231 1.00 29.21 ? 270 GLY A CA  1 
ATOM   1896 C C   . GLY A 1 247 ? 3.379   -16.750 -0.199 1.00 31.92 ? 270 GLY A C   1 
ATOM   1897 O O   . GLY A 1 247 ? 2.932   -17.800 -0.684 1.00 33.87 ? 270 GLY A O   1 
ATOM   1898 N N   . GLY A 1 248 ? 4.572   -16.686 0.386  1.00 31.08 ? 271 GLY A N   1 
ATOM   1899 C CA  . GLY A 1 248 ? 5.382   -17.893 0.468  1.00 33.07 ? 271 GLY A CA  1 
ATOM   1900 C C   . GLY A 1 248 ? 4.753   -18.989 1.339  1.00 33.75 ? 271 GLY A C   1 
ATOM   1901 O O   . GLY A 1 248 ? 3.567   -18.948 1.682  1.00 35.04 ? 271 GLY A O   1 
ATOM   1902 N N   . LYS A 1 249 ? 5.551   -19.986 1.698  1.00 33.01 ? 272 LYS A N   1 
ATOM   1903 C CA  . LYS A 1 249 ? 5.076   -21.083 2.535  1.00 31.56 ? 272 LYS A CA  1 
ATOM   1904 C C   . LYS A 1 249 ? 5.843   -21.085 3.845  1.00 30.29 ? 272 LYS A C   1 
ATOM   1905 O O   . LYS A 1 249 ? 6.884   -21.729 3.968  1.00 29.67 ? 272 LYS A O   1 
ATOM   1906 C CB  . LYS A 1 249 ? 5.272   -22.412 1.820  1.00 31.40 ? 272 LYS A CB  1 
ATOM   1907 C CG  . LYS A 1 249 ? 4.324   -22.612 0.656  1.00 32.57 ? 272 LYS A CG  1 
ATOM   1908 C CD  . LYS A 1 249 ? 2.894   -22.658 1.143  1.00 33.69 ? 272 LYS A CD  1 
ATOM   1909 C CE  . LYS A 1 249 ? 1.996   -23.283 0.095  1.00 35.98 ? 272 LYS A CE  1 
ATOM   1910 N NZ  . LYS A 1 249 ? 1.893   -22.438 -1.123 1.00 36.48 ? 272 LYS A NZ  1 
ATOM   1911 N N   . TRP A 1 250 ? 5.315   -20.367 4.827  1.00 29.06 ? 273 TRP A N   1 
ATOM   1912 C CA  . TRP A 1 250 ? 5.974   -20.263 6.115  1.00 29.16 ? 273 TRP A CA  1 
ATOM   1913 C C   . TRP A 1 250 ? 5.242   -20.936 7.267  1.00 29.95 ? 273 TRP A C   1 
ATOM   1914 O O   . TRP A 1 250 ? 4.107   -21.405 7.138  1.00 30.40 ? 273 TRP A O   1 
ATOM   1915 C CB  . TRP A 1 250 ? 6.160   -18.789 6.495  1.00 28.14 ? 273 TRP A CB  1 
ATOM   1916 C CG  . TRP A 1 250 ? 6.345   -17.844 5.336  1.00 29.16 ? 273 TRP A CG  1 
ATOM   1917 C CD1 . TRP A 1 250 ? 5.441   -16.929 4.872  1.00 26.98 ? 273 TRP A CD1 1 
ATOM   1918 C CD2 . TRP A 1 250 ? 7.506   -17.709 4.514  1.00 28.60 ? 273 TRP A CD2 1 
ATOM   1919 N NE1 . TRP A 1 250 ? 5.967   -16.234 3.820  1.00 27.59 ? 273 TRP A NE1 1 
ATOM   1920 C CE2 . TRP A 1 250 ? 7.240   -16.690 3.574  1.00 28.09 ? 273 TRP A CE2 1 
ATOM   1921 C CE3 . TRP A 1 250 ? 8.756   -18.350 4.477  1.00 29.09 ? 273 TRP A CE3 1 
ATOM   1922 C CZ2 . TRP A 1 250 ? 8.166   -16.291 2.609  1.00 29.35 ? 273 TRP A CZ2 1 
ATOM   1923 C CZ3 . TRP A 1 250 ? 9.680   -17.958 3.522  1.00 29.84 ? 273 TRP A CZ3 1 
ATOM   1924 C CH2 . TRP A 1 250 ? 9.381   -16.934 2.598  1.00 29.83 ? 273 TRP A CH2 1 
ATOM   1925 N N   . ILE A 1 251 ? 5.940   -20.994 8.398  1.00 29.57 ? 274 ILE A N   1 
ATOM   1926 C CA  . ILE A 1 251 ? 5.390   -21.496 9.651  1.00 27.90 ? 274 ILE A CA  1 
ATOM   1927 C C   . ILE A 1 251 ? 5.579   -20.230 10.486 1.00 27.29 ? 274 ILE A C   1 
ATOM   1928 O O   . ILE A 1 251 ? 6.683   -19.678 10.554 1.00 25.12 ? 274 ILE A O   1 
ATOM   1929 C CB  . ILE A 1 251 ? 6.210   -22.683 10.272 1.00 27.53 ? 274 ILE A CB  1 
ATOM   1930 C CG1 . ILE A 1 251 ? 6.088   -23.945 9.401  1.00 28.62 ? 274 ILE A CG1 1 
ATOM   1931 C CG2 . ILE A 1 251 ? 5.673   -23.017 11.668 1.00 23.98 ? 274 ILE A CG2 1 
ATOM   1932 C CD1 . ILE A 1 251 ? 4.683   -24.540 9.346  1.00 26.51 ? 274 ILE A CD1 1 
ATOM   1933 N N   . VAL A 1 252 ? 4.498   -19.739 11.077 1.00 27.23 ? 275 VAL A N   1 
ATOM   1934 C CA  . VAL A 1 252 ? 4.583   -18.526 11.867 1.00 28.16 ? 275 VAL A CA  1 
ATOM   1935 C C   . VAL A 1 252 ? 4.258   -18.788 13.327 1.00 28.77 ? 275 VAL A C   1 
ATOM   1936 O O   . VAL A 1 252 ? 3.446   -19.652 13.651 1.00 29.75 ? 275 VAL A O   1 
ATOM   1937 C CB  . VAL A 1 252 ? 3.638   -17.440 11.290 1.00 29.01 ? 275 VAL A CB  1 
ATOM   1938 C CG1 . VAL A 1 252 ? 3.549   -16.245 12.235 1.00 28.26 ? 275 VAL A CG1 1 
ATOM   1939 C CG2 . VAL A 1 252 ? 4.158   -16.988 9.927  1.00 29.92 ? 275 VAL A CG2 1 
ATOM   1940 N N   . SER A 1 253 ? 4.912   -18.046 14.212 1.00 28.58 ? 276 SER A N   1 
ATOM   1941 C CA  . SER A 1 253 ? 4.669   -18.212 15.632 1.00 28.87 ? 276 SER A CA  1 
ATOM   1942 C C   . SER A 1 253 ? 5.125   -17.039 16.466 1.00 29.18 ? 276 SER A C   1 
ATOM   1943 O O   . SER A 1 253 ? 6.100   -16.353 16.134 1.00 28.99 ? 276 SER A O   1 
ATOM   1944 C CB  . SER A 1 253 ? 5.357   -19.476 16.150 1.00 29.83 ? 276 SER A CB  1 
ATOM   1945 O OG  . SER A 1 253 ? 5.215   -19.590 17.559 1.00 30.98 ? 276 SER A OG  1 
ATOM   1946 N N   . GLY A 1 254 ? 4.397   -16.821 17.559 1.00 30.47 ? 277 GLY A N   1 
ATOM   1947 C CA  . GLY A 1 254 ? 4.738   -15.760 18.485 1.00 30.11 ? 277 GLY A CA  1 
ATOM   1948 C C   . GLY A 1 254 ? 5.912   -16.299 19.274 1.00 29.36 ? 277 GLY A C   1 
ATOM   1949 O O   . GLY A 1 254 ? 6.349   -17.419 19.026 1.00 28.89 ? 277 GLY A O   1 
ATOM   1950 N N   . SER A 1 255 ? 6.426   -15.529 20.222 1.00 29.53 ? 278 SER A N   1 
ATOM   1951 C CA  . SER A 1 255 ? 7.566   -15.985 21.006 1.00 27.96 ? 278 SER A CA  1 
ATOM   1952 C C   . SER A 1 255 ? 7.561   -15.326 22.373 1.00 27.59 ? 278 SER A C   1 
ATOM   1953 O O   . SER A 1 255 ? 6.726   -14.468 22.657 1.00 27.73 ? 278 SER A O   1 
ATOM   1954 C CB  . SER A 1 255 ? 8.870   -15.662 20.265 1.00 27.10 ? 278 SER A CB  1 
ATOM   1955 O OG  . SER A 1 255 ? 9.992   -16.217 20.923 1.00 23.93 ? 278 SER A OG  1 
ATOM   1956 N N   . GLU A 1 256 ? 8.493   -15.734 23.225 1.00 28.37 ? 279 GLU A N   1 
ATOM   1957 C CA  . GLU A 1 256 ? 8.575   -15.177 24.564 1.00 28.37 ? 279 GLU A CA  1 
ATOM   1958 C C   . GLU A 1 256 ? 9.588   -14.045 24.652 1.00 28.01 ? 279 GLU A C   1 
ATOM   1959 O O   . GLU A 1 256 ? 9.712   -13.385 25.685 1.00 28.05 ? 279 GLU A O   1 
ATOM   1960 C CB  . GLU A 1 256 ? 8.878   -16.289 25.569 1.00 28.03 ? 279 GLU A CB  1 
ATOM   1961 C CG  . GLU A 1 256 ? 7.609   -16.966 26.064 1.00 27.77 ? 279 GLU A CG  1 
ATOM   1962 C CD  . GLU A 1 256 ? 7.821   -18.401 26.489 1.00 29.27 ? 279 GLU A CD  1 
ATOM   1963 O OE1 . GLU A 1 256 ? 8.989   -18.844 26.498 1.00 30.22 ? 279 GLU A OE1 1 
ATOM   1964 O OE2 . GLU A 1 256 ? 6.817   -19.082 26.816 1.00 28.72 ? 279 GLU A OE2 1 
ATOM   1965 N N   . ASP A 1 257 ? 10.300  -13.807 23.556 1.00 28.24 ? 280 ASP A N   1 
ATOM   1966 C CA  . ASP A 1 257 ? 11.255  -12.716 23.523 1.00 25.95 ? 280 ASP A CA  1 
ATOM   1967 C C   . ASP A 1 257 ? 10.598  -11.503 22.846 1.00 26.59 ? 280 ASP A C   1 
ATOM   1968 O O   . ASP A 1 257 ? 11.280  -10.619 22.317 1.00 26.10 ? 280 ASP A O   1 
ATOM   1969 C CB  . ASP A 1 257 ? 12.546  -13.144 22.818 1.00 24.44 ? 280 ASP A CB  1 
ATOM   1970 C CG  . ASP A 1 257 ? 12.318  -13.643 21.415 1.00 26.78 ? 280 ASP A CG  1 
ATOM   1971 O OD1 . ASP A 1 257 ? 11.152  -13.829 21.001 1.00 28.03 ? 280 ASP A OD1 1 
ATOM   1972 O OD2 . ASP A 1 257 ? 13.333  -13.854 20.720 1.00 27.12 ? 280 ASP A OD2 1 
ATOM   1973 N N   . ASN A 1 258 ? 9.259   -11.491 22.881 1.00 25.54 ? 281 ASN A N   1 
ATOM   1974 C CA  . ASN A 1 258 ? 8.426   -10.409 22.345 1.00 24.89 ? 281 ASN A CA  1 
ATOM   1975 C C   . ASN A 1 258 ? 8.412   -10.269 20.824 1.00 25.49 ? 281 ASN A C   1 
ATOM   1976 O O   . ASN A 1 258 ? 7.855   -9.313  20.286 1.00 25.90 ? 281 ASN A O   1 
ATOM   1977 C CB  . ASN A 1 258 ? 8.858   -9.088  22.967 1.00 22.68 ? 281 ASN A CB  1 
ATOM   1978 C CG  . ASN A 1 258 ? 8.976   -9.170  24.470 1.00 24.09 ? 281 ASN A CG  1 
ATOM   1979 O OD1 . ASN A 1 258 ? 9.189   -10.240 25.026 1.00 25.26 ? 281 ASN A OD1 1 
ATOM   1980 N ND2 . ASN A 1 258 ? 8.857   -8.037  25.136 1.00 25.07 ? 281 ASN A ND2 1 
ATOM   1981 N N   . LEU A 1 259 ? 9.008   -11.225 20.129 1.00 25.26 ? 282 LEU A N   1 
ATOM   1982 C CA  . LEU A 1 259 ? 9.055   -11.161 18.679 1.00 25.63 ? 282 LEU A CA  1 
ATOM   1983 C C   . LEU A 1 259 ? 8.116   -12.159 18.018 1.00 26.37 ? 282 LEU A C   1 
ATOM   1984 O O   . LEU A 1 259 ? 7.522   -13.008 18.678 1.00 27.01 ? 282 LEU A O   1 
ATOM   1985 C CB  . LEU A 1 259 ? 10.486  -11.425 18.198 1.00 24.97 ? 282 LEU A CB  1 
ATOM   1986 C CG  . LEU A 1 259 ? 11.589  -10.537 18.778 1.00 21.75 ? 282 LEU A CG  1 
ATOM   1987 C CD1 . LEU A 1 259 ? 12.903  -10.977 18.200 1.00 20.14 ? 282 LEU A CD1 1 
ATOM   1988 C CD2 . LEU A 1 259 ? 11.325  -9.077  18.457 1.00 18.13 ? 282 LEU A CD2 1 
ATOM   1989 N N   . VAL A 1 260 ? 7.984   -12.035 16.703 1.00 26.66 ? 283 VAL A N   1 
ATOM   1990 C CA  . VAL A 1 260 ? 7.158   -12.933 15.911 1.00 26.83 ? 283 VAL A CA  1 
ATOM   1991 C C   . VAL A 1 260 ? 8.134   -13.574 14.933 1.00 28.29 ? 283 VAL A C   1 
ATOM   1992 O O   . VAL A 1 260 ? 8.859   -12.882 14.220 1.00 30.30 ? 283 VAL A O   1 
ATOM   1993 C CB  . VAL A 1 260 ? 6.073   -12.169 15.121 1.00 25.92 ? 283 VAL A CB  1 
ATOM   1994 C CG1 . VAL A 1 260 ? 5.324   -13.128 14.215 1.00 23.76 ? 283 VAL A CG1 1 
ATOM   1995 C CG2 . VAL A 1 260 ? 5.107   -11.497 16.073 1.00 26.39 ? 283 VAL A CG2 1 
ATOM   1996 N N   . TYR A 1 261 ? 8.177   -14.895 14.910 1.00 28.05 ? 284 TYR A N   1 
ATOM   1997 C CA  . TYR A 1 261 ? 9.087   -15.572 14.012 1.00 28.75 ? 284 TYR A CA  1 
ATOM   1998 C C   . TYR A 1 261 ? 8.368   -16.105 12.787 1.00 29.56 ? 284 TYR A C   1 
ATOM   1999 O O   . TYR A 1 261 ? 7.209   -16.505 12.860 1.00 28.96 ? 284 TYR A O   1 
ATOM   2000 C CB  . TYR A 1 261 ? 9.769   -16.728 14.737 1.00 30.66 ? 284 TYR A CB  1 
ATOM   2001 C CG  . TYR A 1 261 ? 10.774  -16.296 15.773 1.00 32.50 ? 284 TYR A CG  1 
ATOM   2002 C CD1 . TYR A 1 261 ? 10.396  -15.519 16.871 1.00 35.13 ? 284 TYR A CD1 1 
ATOM   2003 C CD2 . TYR A 1 261 ? 12.114  -16.640 15.643 1.00 32.06 ? 284 TYR A CD2 1 
ATOM   2004 C CE1 . TYR A 1 261 ? 11.338  -15.089 17.805 1.00 34.63 ? 284 TYR A CE1 1 
ATOM   2005 C CE2 . TYR A 1 261 ? 13.054  -16.224 16.562 1.00 33.03 ? 284 TYR A CE2 1 
ATOM   2006 C CZ  . TYR A 1 261 ? 12.668  -15.447 17.635 1.00 34.59 ? 284 TYR A CZ  1 
ATOM   2007 O OH  . TYR A 1 261 ? 13.639  -15.000 18.501 1.00 37.35 ? 284 TYR A OH  1 
ATOM   2008 N N   . ILE A 1 262 ? 9.065   -16.080 11.655 1.00 30.54 ? 285 ILE A N   1 
ATOM   2009 C CA  . ILE A 1 262 ? 8.551   -16.610 10.397 1.00 30.79 ? 285 ILE A CA  1 
ATOM   2010 C C   . ILE A 1 262 ? 9.664   -17.528 9.896  1.00 30.66 ? 285 ILE A C   1 
ATOM   2011 O O   . ILE A 1 262 ? 10.821  -17.101 9.786  1.00 29.99 ? 285 ILE A O   1 
ATOM   2012 C CB  . ILE A 1 262 ? 8.309   -15.515 9.313  1.00 31.27 ? 285 ILE A CB  1 
ATOM   2013 C CG1 . ILE A 1 262 ? 7.157   -14.591 9.699  1.00 31.08 ? 285 ILE A CG1 1 
ATOM   2014 C CG2 . ILE A 1 262 ? 7.963   -16.176 7.993  1.00 31.21 ? 285 ILE A CG2 1 
ATOM   2015 C CD1 . ILE A 1 262 ? 7.521   -13.564 10.690 1.00 33.20 ? 285 ILE A CD1 1 
ATOM   2016 N N   . TRP A 1 263 ? 9.320   -18.782 9.616  1.00 30.76 ? 286 TRP A N   1 
ATOM   2017 C CA  . TRP A 1 263 ? 10.287  -19.760 9.118  1.00 31.09 ? 286 TRP A CA  1 
ATOM   2018 C C   . TRP A 1 263 ? 9.883   -20.282 7.750  1.00 31.88 ? 286 TRP A C   1 
ATOM   2019 O O   . TRP A 1 263 ? 8.703   -20.308 7.404  1.00 30.73 ? 286 TRP A O   1 
ATOM   2020 C CB  . TRP A 1 263 ? 10.353  -20.991 10.011 1.00 29.58 ? 286 TRP A CB  1 
ATOM   2021 C CG  . TRP A 1 263 ? 10.987  -20.851 11.332 1.00 29.42 ? 286 TRP A CG  1 
ATOM   2022 C CD1 . TRP A 1 263 ? 12.297  -21.063 11.636 1.00 28.76 ? 286 TRP A CD1 1 
ATOM   2023 C CD2 . TRP A 1 263 ? 10.315  -20.623 12.573 1.00 28.87 ? 286 TRP A CD2 1 
ATOM   2024 N NE1 . TRP A 1 263 ? 12.483  -20.997 12.993 1.00 29.75 ? 286 TRP A NE1 1 
ATOM   2025 C CE2 . TRP A 1 263 ? 11.281  -20.723 13.593 1.00 28.93 ? 286 TRP A CE2 1 
ATOM   2026 C CE3 . TRP A 1 263 ? 8.990   -20.342 12.922 1.00 27.01 ? 286 TRP A CE3 1 
ATOM   2027 C CZ2 . TRP A 1 263 ? 10.959  -20.565 14.945 1.00 28.33 ? 286 TRP A CZ2 1 
ATOM   2028 C CZ3 . TRP A 1 263 ? 8.671   -20.183 14.261 1.00 28.20 ? 286 TRP A CZ3 1 
ATOM   2029 C CH2 . TRP A 1 263 ? 9.652   -20.292 15.256 1.00 28.71 ? 286 TRP A CH2 1 
ATOM   2030 N N   . ASN A 1 264 ? 10.878  -20.726 6.990  1.00 33.37 ? 287 ASN A N   1 
ATOM   2031 C CA  . ASN A 1 264 ? 10.648  -21.328 5.682  1.00 33.43 ? 287 ASN A CA  1 
ATOM   2032 C C   . ASN A 1 264 ? 10.213  -22.756 6.044  1.00 34.61 ? 287 ASN A C   1 
ATOM   2033 O O   . ASN A 1 264 ? 10.916  -23.464 6.775  1.00 35.22 ? 287 ASN A O   1 
ATOM   2034 C CB  . ASN A 1 264 ? 11.955  -21.362 4.892  1.00 32.61 ? 287 ASN A CB  1 
ATOM   2035 C CG  . ASN A 1 264 ? 11.800  -22.007 3.533  1.00 31.27 ? 287 ASN A CG  1 
ATOM   2036 O OD1 . ASN A 1 264 ? 11.643  -21.321 2.522  1.00 30.83 ? 287 ASN A OD1 1 
ATOM   2037 N ND2 . ASN A 1 264 ? 11.838  -23.336 3.502  1.00 28.79 ? 287 ASN A ND2 1 
ATOM   2038 N N   . LEU A 1 265 ? 9.056   -23.180 5.551  1.00 35.21 ? 288 LEU A N   1 
ATOM   2039 C CA  . LEU A 1 265 ? 8.553   -24.508 5.882  1.00 36.49 ? 288 LEU A CA  1 
ATOM   2040 C C   . LEU A 1 265 ? 9.482   -25.647 5.468  1.00 37.95 ? 288 LEU A C   1 
ATOM   2041 O O   . LEU A 1 265 ? 9.660   -26.604 6.218  1.00 37.24 ? 288 LEU A O   1 
ATOM   2042 C CB  . LEU A 1 265 ? 7.162   -24.707 5.278  1.00 35.90 ? 288 LEU A CB  1 
ATOM   2043 C CG  . LEU A 1 265 ? 6.387   -25.917 5.805  1.00 36.31 ? 288 LEU A CG  1 
ATOM   2044 C CD1 . LEU A 1 265 ? 4.889   -25.690 5.665  1.00 36.16 ? 288 LEU A CD1 1 
ATOM   2045 C CD2 . LEU A 1 265 ? 6.822   -27.153 5.055  1.00 36.70 ? 288 LEU A CD2 1 
ATOM   2046 N N   . GLN A 1 266 ? 10.077  -25.543 4.284  1.00 40.41 ? 289 GLN A N   1 
ATOM   2047 C CA  . GLN A 1 266 ? 10.984  -26.575 3.801  1.00 40.95 ? 289 GLN A CA  1 
ATOM   2048 C C   . GLN A 1 266 ? 12.372  -26.540 4.430  1.00 39.83 ? 289 GLN A C   1 
ATOM   2049 O O   . GLN A 1 266 ? 12.852  -27.568 4.900  1.00 41.72 ? 289 GLN A O   1 
ATOM   2050 C CB  . GLN A 1 266 ? 11.139  -26.486 2.281  1.00 44.71 ? 289 GLN A CB  1 
ATOM   2051 C CG  . GLN A 1 266 ? 10.201  -27.376 1.485  1.00 50.91 ? 289 GLN A CG  1 
ATOM   2052 C CD  . GLN A 1 266 ? 10.410  -28.861 1.769  1.00 54.87 ? 289 GLN A CD  1 
ATOM   2053 O OE1 . GLN A 1 266 ? 11.541  -29.353 1.779  1.00 55.05 ? 289 GLN A OE1 1 
ATOM   2054 N NE2 . GLN A 1 266 ? 9.313   -29.583 1.989  1.00 56.34 ? 289 GLN A NE2 1 
ATOM   2055 N N   . THR A 1 267 ? 13.014  -25.371 4.445  1.00 37.29 ? 290 THR A N   1 
ATOM   2056 C CA  . THR A 1 267 ? 14.376  -25.250 4.975  1.00 35.18 ? 290 THR A CA  1 
ATOM   2057 C C   . THR A 1 267 ? 14.506  -25.064 6.471  1.00 35.07 ? 290 THR A C   1 
ATOM   2058 O O   . THR A 1 267 ? 15.604  -25.171 7.021  1.00 35.19 ? 290 THR A O   1 
ATOM   2059 C CB  . THR A 1 267 ? 15.136  -24.096 4.306  1.00 34.18 ? 290 THR A CB  1 
ATOM   2060 O OG1 . THR A 1 267 ? 14.641  -22.840 4.788  1.00 34.05 ? 290 THR A OG1 1 
ATOM   2061 C CG2 . THR A 1 267 ? 14.957  -24.164 2.808  1.00 34.95 ? 290 THR A CG2 1 
ATOM   2062 N N   . LYS A 1 268 ? 13.395  -24.763 7.130  1.00 34.81 ? 291 LYS A N   1 
ATOM   2063 C CA  . LYS A 1 268 ? 13.405  -24.581 8.575  1.00 34.73 ? 291 LYS A CA  1 
ATOM   2064 C C   . LYS A 1 268 ? 14.246  -23.393 9.004  1.00 34.57 ? 291 LYS A C   1 
ATOM   2065 O O   . LYS A 1 268 ? 14.530  -23.231 10.188 1.00 34.31 ? 291 LYS A O   1 
ATOM   2066 C CB  . LYS A 1 268 ? 13.921  -25.852 9.258  1.00 34.42 ? 291 LYS A CB  1 
ATOM   2067 C CG  . LYS A 1 268 ? 13.073  -27.077 8.968  1.00 36.00 ? 291 LYS A CG  1 
ATOM   2068 C CD  . LYS A 1 268 ? 13.750  -28.364 9.389  1.00 36.96 ? 291 LYS A CD  1 
ATOM   2069 C CE  . LYS A 1 268 ? 14.913  -28.703 8.471  1.00 38.75 ? 291 LYS A CE  1 
ATOM   2070 N NZ  . LYS A 1 268 ? 15.498  -30.040 8.775  1.00 40.01 ? 291 LYS A NZ  1 
ATOM   2071 N N   . GLU A 1 269 ? 14.645  -22.567 8.043  1.00 34.93 ? 292 GLU A N   1 
ATOM   2072 C CA  . GLU A 1 269 ? 15.439  -21.383 8.345  1.00 34.82 ? 292 GLU A CA  1 
ATOM   2073 C C   . GLU A 1 269 ? 14.496  -20.230 8.677  1.00 33.99 ? 292 GLU A C   1 
ATOM   2074 O O   . GLU A 1 269 ? 13.437  -20.084 8.057  1.00 32.77 ? 292 GLU A O   1 
ATOM   2075 C CB  . GLU A 1 269 ? 16.302  -20.997 7.141  1.00 37.56 ? 292 GLU A CB  1 
ATOM   2076 C CG  . GLU A 1 269 ? 17.324  -22.057 6.716  1.00 43.30 ? 292 GLU A CG  1 
ATOM   2077 C CD  . GLU A 1 269 ? 18.050  -21.695 5.415  1.00 46.09 ? 292 GLU A CD  1 
ATOM   2078 O OE1 . GLU A 1 269 ? 17.375  -21.584 4.359  1.00 45.42 ? 292 GLU A OE1 1 
ATOM   2079 O OE2 . GLU A 1 269 ? 19.294  -21.521 5.451  1.00 45.79 ? 292 GLU A OE2 1 
ATOM   2080 N N   . ILE A 1 270 ? 14.862  -19.425 9.668  1.00 33.62 ? 293 ILE A N   1 
ATOM   2081 C CA  . ILE A 1 270 ? 14.034  -18.281 10.027 1.00 32.78 ? 293 ILE A CA  1 
ATOM   2082 C C   . ILE A 1 270 ? 14.192  -17.342 8.844  1.00 33.06 ? 293 ILE A C   1 
ATOM   2083 O O   . ILE A 1 270 ? 15.296  -17.196 8.323  1.00 34.04 ? 293 ILE A O   1 
ATOM   2084 C CB  . ILE A 1 270 ? 14.545  -17.561 11.310 1.00 30.71 ? 293 ILE A CB  1 
ATOM   2085 C CG1 . ILE A 1 270 ? 14.500  -18.513 12.510 1.00 29.55 ? 293 ILE A CG1 1 
ATOM   2086 C CG2 . ILE A 1 270 ? 13.682  -16.335 11.600 1.00 29.10 ? 293 ILE A CG2 1 
ATOM   2087 C CD1 . ILE A 1 270 ? 14.880  -17.859 13.831 1.00 28.06 ? 293 ILE A CD1 1 
ATOM   2088 N N   . VAL A 1 271 ? 13.107  -16.723 8.395  1.00 33.06 ? 294 VAL A N   1 
ATOM   2089 C CA  . VAL A 1 271 ? 13.218  -15.801 7.267  1.00 32.84 ? 294 VAL A CA  1 
ATOM   2090 C C   . VAL A 1 271 ? 12.921  -14.369 7.711  1.00 32.63 ? 294 VAL A C   1 
ATOM   2091 O O   . VAL A 1 271 ? 13.328  -13.404 7.058  1.00 32.27 ? 294 VAL A O   1 
ATOM   2092 C CB  . VAL A 1 271 ? 12.266  -16.190 6.093  1.00 32.09 ? 294 VAL A CB  1 
ATOM   2093 C CG1 . VAL A 1 271 ? 12.689  -17.515 5.491  1.00 29.12 ? 294 VAL A CG1 1 
ATOM   2094 C CG2 . VAL A 1 271 ? 10.836  -16.268 6.583  1.00 32.44 ? 294 VAL A CG2 1 
ATOM   2095 N N   . GLN A 1 272 ? 12.234  -14.233 8.837  1.00 32.94 ? 295 GLN A N   1 
ATOM   2096 C CA  . GLN A 1 272 ? 11.900  -12.911 9.341  1.00 34.36 ? 295 GLN A CA  1 
ATOM   2097 C C   . GLN A 1 272 ? 11.430  -12.945 10.800 1.00 34.62 ? 295 GLN A C   1 
ATOM   2098 O O   . GLN A 1 272 ? 10.852  -13.936 11.255 1.00 35.75 ? 295 GLN A O   1 
ATOM   2099 C CB  . GLN A 1 272 ? 10.834  -12.293 8.435  1.00 34.31 ? 295 GLN A CB  1 
ATOM   2100 C CG  . GLN A 1 272 ? 10.299  -10.966 8.900  1.00 36.81 ? 295 GLN A CG  1 
ATOM   2101 C CD  . GLN A 1 272 ? 9.610   -10.202 7.781  1.00 38.88 ? 295 GLN A CD  1 
ATOM   2102 O OE1 . GLN A 1 272 ? 8.892   -10.785 6.956  1.00 37.88 ? 295 GLN A OE1 1 
ATOM   2103 N NE2 . GLN A 1 272 ? 9.819   -8.886  7.751  1.00 37.24 ? 295 GLN A NE2 1 
ATOM   2104 N N   . LYS A 1 273 ? 11.709  -11.867 11.529 1.00 34.06 ? 296 LYS A N   1 
ATOM   2105 C CA  . LYS A 1 273 ? 11.320  -11.739 12.933 1.00 34.97 ? 296 LYS A CA  1 
ATOM   2106 C C   . LYS A 1 273 ? 10.724  -10.359 13.159 1.00 34.27 ? 296 LYS A C   1 
ATOM   2107 O O   . LYS A 1 273 ? 11.437  -9.358  13.139 1.00 34.74 ? 296 LYS A O   1 
ATOM   2108 C CB  . LYS A 1 273 ? 12.527  -11.942 13.859 1.00 34.64 ? 296 LYS A CB  1 
ATOM   2109 C CG  . LYS A 1 273 ? 13.010  -13.370 13.916 1.00 35.29 ? 296 LYS A CG  1 
ATOM   2110 C CD  . LYS A 1 273 ? 14.016  -13.601 15.033 1.00 38.62 ? 296 LYS A CD  1 
ATOM   2111 C CE  . LYS A 1 273 ? 15.367  -12.961 14.766 1.00 39.77 ? 296 LYS A CE  1 
ATOM   2112 N NZ  . LYS A 1 273 ? 16.420  -13.524 15.670 1.00 40.61 ? 296 LYS A NZ  1 
ATOM   2113 N N   . LEU A 1 274 ? 9.414   -10.321 13.378 1.00 32.66 ? 297 LEU A N   1 
ATOM   2114 C CA  . LEU A 1 274 ? 8.689   -9.077  13.572 1.00 32.82 ? 297 LEU A CA  1 
ATOM   2115 C C   . LEU A 1 274 ? 8.868   -8.442  14.948 1.00 33.92 ? 297 LEU A C   1 
ATOM   2116 O O   . LEU A 1 274 ? 8.452   -9.000  15.963 1.00 34.32 ? 297 LEU A O   1 
ATOM   2117 C CB  . LEU A 1 274 ? 7.205   -9.327  13.276 1.00 30.72 ? 297 LEU A CB  1 
ATOM   2118 C CG  . LEU A 1 274 ? 6.825   -9.380  11.787 1.00 29.76 ? 297 LEU A CG  1 
ATOM   2119 C CD1 . LEU A 1 274 ? 7.921   -10.044 10.963 1.00 28.15 ? 297 LEU A CD1 1 
ATOM   2120 C CD2 . LEU A 1 274 ? 5.505   -10.099 11.619 1.00 26.98 ? 297 LEU A CD2 1 
ATOM   2121 N N   . GLN A 1 275 ? 9.480   -7.262  14.976 1.00 35.23 ? 298 GLN A N   1 
ATOM   2122 C CA  . GLN A 1 275 ? 9.717   -6.553  16.230 1.00 37.26 ? 298 GLN A CA  1 
ATOM   2123 C C   . GLN A 1 275 ? 8.690   -5.451  16.443 1.00 36.36 ? 298 GLN A C   1 
ATOM   2124 O O   . GLN A 1 275 ? 8.349   -4.734  15.512 1.00 36.82 ? 298 GLN A O   1 
ATOM   2125 C CB  . GLN A 1 275 ? 11.109  -5.935  16.229 1.00 40.90 ? 298 GLN A CB  1 
ATOM   2126 C CG  . GLN A 1 275 ? 11.530  -5.399  17.573 1.00 49.07 ? 298 GLN A CG  1 
ATOM   2127 C CD  . GLN A 1 275 ? 12.842  -4.631  17.515 1.00 54.49 ? 298 GLN A CD  1 
ATOM   2128 O OE1 . GLN A 1 275 ? 13.767  -4.996  16.770 1.00 54.74 ? 298 GLN A OE1 1 
ATOM   2129 N NE2 . GLN A 1 275 ? 12.937  -3.567  18.316 1.00 55.78 ? 298 GLN A NE2 1 
ATOM   2130 N N   . GLY A 1 276 ? 8.204   -5.312  17.672 1.00 35.11 ? 299 GLY A N   1 
ATOM   2131 C CA  . GLY A 1 276 ? 7.223   -4.284  17.958 1.00 31.98 ? 299 GLY A CA  1 
ATOM   2132 C C   . GLY A 1 276 ? 6.542   -4.443  19.304 1.00 31.57 ? 299 GLY A C   1 
ATOM   2133 O O   . GLY A 1 276 ? 6.262   -3.457  19.985 1.00 31.13 ? 299 GLY A O   1 
ATOM   2134 N N   . HIS A 1 277 ? 6.263   -5.684  19.690 1.00 30.71 ? 300 HIS A N   1 
ATOM   2135 C CA  . HIS A 1 277 ? 5.598   -5.947  20.959 1.00 30.10 ? 300 HIS A CA  1 
ATOM   2136 C C   . HIS A 1 277 ? 6.552   -5.765  22.116 1.00 29.94 ? 300 HIS A C   1 
ATOM   2137 O O   . HIS A 1 277 ? 7.761   -5.914  21.954 1.00 31.79 ? 300 HIS A O   1 
ATOM   2138 C CB  . HIS A 1 277 ? 5.034   -7.363  20.978 1.00 28.84 ? 300 HIS A CB  1 
ATOM   2139 C CG  . HIS A 1 277 ? 3.815   -7.531  20.129 1.00 28.02 ? 300 HIS A CG  1 
ATOM   2140 N ND1 . HIS A 1 277 ? 2.585   -7.031  20.493 1.00 28.21 ? 300 HIS A ND1 1 
ATOM   2141 C CD2 . HIS A 1 277 ? 3.647   -8.119  18.921 1.00 27.32 ? 300 HIS A CD2 1 
ATOM   2142 C CE1 . HIS A 1 277 ? 1.704   -7.305  19.542 1.00 27.27 ? 300 HIS A CE1 1 
ATOM   2143 N NE2 . HIS A 1 277 ? 2.323   -7.962  18.581 1.00 26.78 ? 300 HIS A NE2 1 
ATOM   2144 N N   . THR A 1 278 ? 6.010   -5.443  23.284 1.00 28.11 ? 301 THR A N   1 
ATOM   2145 C CA  . THR A 1 278 ? 6.845   -5.243  24.452 1.00 26.64 ? 301 THR A CA  1 
ATOM   2146 C C   . THR A 1 278 ? 6.567   -6.279  25.526 1.00 27.38 ? 301 THR A C   1 
ATOM   2147 O O   . THR A 1 278 ? 6.733   -6.018  26.714 1.00 30.05 ? 301 THR A O   1 
ATOM   2148 C CB  . THR A 1 278 ? 6.623   -3.885  25.052 1.00 25.59 ? 301 THR A CB  1 
ATOM   2149 O OG1 . THR A 1 278 ? 5.298   -3.834  25.601 1.00 28.26 ? 301 THR A OG1 1 
ATOM   2150 C CG2 . THR A 1 278 ? 6.812   -2.809  23.989 1.00 23.01 ? 301 THR A CG2 1 
ATOM   2151 N N   . ASP A 1 279 ? 6.124   -7.452  25.092 1.00 27.17 ? 302 ASP A N   1 
ATOM   2152 C CA  . ASP A 1 279 ? 5.853   -8.568  25.983 1.00 25.84 ? 302 ASP A CA  1 
ATOM   2153 C C   . ASP A 1 279 ? 5.556   -9.794  25.125 1.00 25.78 ? 302 ASP A C   1 
ATOM   2154 O O   . ASP A 1 279 ? 5.217   -9.671  23.948 1.00 26.07 ? 302 ASP A O   1 
ATOM   2155 C CB  . ASP A 1 279 ? 4.679   -8.249  26.906 1.00 25.81 ? 302 ASP A CB  1 
ATOM   2156 C CG  . ASP A 1 279 ? 4.549   -9.246  28.056 1.00 29.30 ? 302 ASP A CG  1 
ATOM   2157 O OD1 . ASP A 1 279 ? 5.549   -9.932  28.372 1.00 30.13 ? 302 ASP A OD1 1 
ATOM   2158 O OD2 . ASP A 1 279 ? 3.452   -9.335  28.663 1.00 31.47 ? 302 ASP A OD2 1 
ATOM   2159 N N   . VAL A 1 280 ? 5.707   -10.974 25.713 1.00 25.11 ? 303 VAL A N   1 
ATOM   2160 C CA  . VAL A 1 280 ? 5.465   -12.231 25.011 1.00 23.96 ? 303 VAL A CA  1 
ATOM   2161 C C   . VAL A 1 280 ? 4.337   -12.163 23.993 1.00 24.46 ? 303 VAL A C   1 
ATOM   2162 O O   . VAL A 1 280 ? 3.263   -11.624 24.268 1.00 24.92 ? 303 VAL A O   1 
ATOM   2163 C CB  . VAL A 1 280 ? 5.124   -13.357 25.995 1.00 23.50 ? 303 VAL A CB  1 
ATOM   2164 C CG1 . VAL A 1 280 ? 4.994   -14.673 25.245 1.00 19.99 ? 303 VAL A CG1 1 
ATOM   2165 C CG2 . VAL A 1 280 ? 6.185   -13.436 27.087 1.00 22.01 ? 303 VAL A CG2 1 
ATOM   2166 N N   . VAL A 1 281 ? 4.597   -12.705 22.808 1.00 24.24 ? 304 VAL A N   1 
ATOM   2167 C CA  . VAL A 1 281 ? 3.594   -12.747 21.745 1.00 23.88 ? 304 VAL A CA  1 
ATOM   2168 C C   . VAL A 1 281 ? 2.934   -14.127 21.846 1.00 22.80 ? 304 VAL A C   1 
ATOM   2169 O O   . VAL A 1 281 ? 3.464   -15.131 21.349 1.00 20.72 ? 304 VAL A O   1 
ATOM   2170 C CB  . VAL A 1 281 ? 4.252   -12.542 20.356 1.00 24.91 ? 304 VAL A CB  1 
ATOM   2171 C CG1 . VAL A 1 281 ? 3.208   -12.564 19.263 1.00 23.63 ? 304 VAL A CG1 1 
ATOM   2172 C CG2 . VAL A 1 281 ? 4.987   -11.212 20.342 1.00 26.06 ? 304 VAL A CG2 1 
ATOM   2173 N N   . ILE A 1 282 ? 1.777   -14.164 22.503 1.00 20.66 ? 305 ILE A N   1 
ATOM   2174 C CA  . ILE A 1 282 ? 1.071   -15.419 22.725 1.00 20.29 ? 305 ILE A CA  1 
ATOM   2175 C C   . ILE A 1 282 ? 0.260   -15.960 21.553 1.00 20.16 ? 305 ILE A C   1 
ATOM   2176 O O   . ILE A 1 282 ? 0.038   -17.163 21.451 1.00 21.03 ? 305 ILE A O   1 
ATOM   2177 C CB  . ILE A 1 282 ? 0.143   -15.327 23.966 1.00 19.45 ? 305 ILE A CB  1 
ATOM   2178 C CG1 . ILE A 1 282 ? -0.082  -16.730 24.527 1.00 18.36 ? 305 ILE A CG1 1 
ATOM   2179 C CG2 . ILE A 1 282 ? -1.199  -14.685 23.593 1.00 16.48 ? 305 ILE A CG2 1 
ATOM   2180 C CD1 . ILE A 1 282 ? -0.932  -16.767 25.746 1.00 20.53 ? 305 ILE A CD1 1 
ATOM   2181 N N   . SER A 1 283 ? -0.190  -15.088 20.668 1.00 19.90 ? 306 SER A N   1 
ATOM   2182 C CA  . SER A 1 283 ? -0.958  -15.556 19.531 1.00 20.67 ? 306 SER A CA  1 
ATOM   2183 C C   . SER A 1 283 ? -0.693  -14.810 18.228 1.00 21.78 ? 306 SER A C   1 
ATOM   2184 O O   . SER A 1 283 ? -0.541  -13.581 18.217 1.00 23.58 ? 306 SER A O   1 
ATOM   2185 C CB  . SER A 1 283 ? -2.448  -15.484 19.841 1.00 19.78 ? 306 SER A CB  1 
ATOM   2186 O OG  . SER A 1 283 ? -3.198  -15.730 18.663 1.00 21.94 ? 306 SER A OG  1 
ATOM   2187 N N   . THR A 1 284 ? -0.621  -15.567 17.136 1.00 20.15 ? 307 THR A N   1 
ATOM   2188 C CA  . THR A 1 284 ? -0.435  -14.999 15.812 1.00 21.00 ? 307 THR A CA  1 
ATOM   2189 C C   . THR A 1 284 ? -1.487  -15.656 14.939 1.00 23.23 ? 307 THR A C   1 
ATOM   2190 O O   . THR A 1 284 ? -2.019  -16.716 15.278 1.00 25.54 ? 307 THR A O   1 
ATOM   2191 C CB  . THR A 1 284 ? 0.967   -15.274 15.198 1.00 19.63 ? 307 THR A CB  1 
ATOM   2192 O OG1 . THR A 1 284 ? 1.256   -16.673 15.238 1.00 22.77 ? 307 THR A OG1 1 
ATOM   2193 C CG2 . THR A 1 284 ? 2.032   -14.517 15.930 1.00 17.80 ? 307 THR A CG2 1 
ATOM   2194 N N   . ALA A 1 285 ? -1.802  -15.022 13.820 1.00 23.38 ? 308 ALA A N   1 
ATOM   2195 C CA  . ALA A 1 285 ? -2.796  -15.553 12.912 1.00 21.95 ? 308 ALA A CA  1 
ATOM   2196 C C   . ALA A 1 285 ? -2.407  -15.096 11.526 1.00 23.37 ? 308 ALA A C   1 
ATOM   2197 O O   . ALA A 1 285 ? -1.854  -14.009 11.358 1.00 24.11 ? 308 ALA A O   1 
ATOM   2198 C CB  . ALA A 1 285 ? -4.182  -15.022 13.278 1.00 19.55 ? 308 ALA A CB  1 
ATOM   2199 N N   . CYS A 1 286 ? -2.671  -15.932 10.530 1.00 23.41 ? 309 CYS A N   1 
ATOM   2200 C CA  . CYS A 1 286 ? -2.346  -15.566 9.162  1.00 23.45 ? 309 CYS A CA  1 
ATOM   2201 C C   . CYS A 1 286 ? -3.628  -15.334 8.376  1.00 23.27 ? 309 CYS A C   1 
ATOM   2202 O O   . CYS A 1 286 ? -4.531  -16.168 8.401  1.00 22.30 ? 309 CYS A O   1 
ATOM   2203 C CB  . CYS A 1 286 ? -1.504  -16.657 8.503  1.00 22.28 ? 309 CYS A CB  1 
ATOM   2204 S SG  . CYS A 1 286 ? 0.158   -16.794 9.181  1.00 24.45 ? 309 CYS A SG  1 
ATOM   2205 N N   . HIS A 1 287 ? -3.705  -14.190 7.692  1.00 24.75 ? 310 HIS A N   1 
ATOM   2206 C CA  . HIS A 1 287 ? -4.880  -13.840 6.893  1.00 25.40 ? 310 HIS A CA  1 
ATOM   2207 C C   . HIS A 1 287 ? -5.145  -14.897 5.821  1.00 26.45 ? 310 HIS A C   1 
ATOM   2208 O O   . HIS A 1 287 ? -4.217  -15.358 5.140  1.00 26.18 ? 310 HIS A O   1 
ATOM   2209 C CB  . HIS A 1 287 ? -4.691  -12.479 6.210  1.00 23.97 ? 310 HIS A CB  1 
ATOM   2210 C CG  . HIS A 1 287 ? -5.917  -11.988 5.503  1.00 24.91 ? 310 HIS A CG  1 
ATOM   2211 N ND1 . HIS A 1 287 ? -6.920  -11.290 6.146  1.00 24.46 ? 310 HIS A ND1 1 
ATOM   2212 C CD2 . HIS A 1 287 ? -6.332  -12.143 4.223  1.00 24.86 ? 310 HIS A CD2 1 
ATOM   2213 C CE1 . HIS A 1 287 ? -7.896  -11.040 5.294  1.00 24.57 ? 310 HIS A CE1 1 
ATOM   2214 N NE2 . HIS A 1 287 ? -7.566  -11.548 4.119  1.00 26.62 ? 310 HIS A NE2 1 
ATOM   2215 N N   . PRO A 1 288 ? -6.422  -15.283 5.653  1.00 26.32 ? 311 PRO A N   1 
ATOM   2216 C CA  . PRO A 1 288 ? -6.856  -16.283 4.674  1.00 26.83 ? 311 PRO A CA  1 
ATOM   2217 C C   . PRO A 1 288 ? -6.520  -16.027 3.196  1.00 25.84 ? 311 PRO A C   1 
ATOM   2218 O O   . PRO A 1 288 ? -6.287  -16.972 2.456  1.00 25.39 ? 311 PRO A O   1 
ATOM   2219 C CB  . PRO A 1 288 ? -8.368  -16.392 4.933  1.00 26.58 ? 311 PRO A CB  1 
ATOM   2220 C CG  . PRO A 1 288 ? -8.732  -15.051 5.471  1.00 26.33 ? 311 PRO A CG  1 
ATOM   2221 C CD  . PRO A 1 288 ? -7.575  -14.790 6.426  1.00 26.73 ? 311 PRO A CD  1 
ATOM   2222 N N   . THR A 1 289 ? -6.485  -14.775 2.752  1.00 27.40 ? 312 THR A N   1 
ATOM   2223 C CA  . THR A 1 289 ? -6.169  -14.528 1.341  1.00 27.85 ? 312 THR A CA  1 
ATOM   2224 C C   . THR A 1 289 ? -5.066  -13.520 1.044  1.00 29.59 ? 312 THR A C   1 
ATOM   2225 O O   . THR A 1 289 ? -4.458  -13.579 -0.016 1.00 29.58 ? 312 THR A O   1 
ATOM   2226 C CB  . THR A 1 289 ? -7.409  -14.098 0.563  1.00 24.97 ? 312 THR A CB  1 
ATOM   2227 O OG1 . THR A 1 289 ? -7.949  -12.916 1.156  1.00 24.54 ? 312 THR A OG1 1 
ATOM   2228 C CG2 . THR A 1 289 ? -8.444  -15.203 0.576  1.00 21.95 ? 312 THR A CG2 1 
ATOM   2229 N N   . GLU A 1 290 ? -4.819  -12.599 1.971  1.00 32.27 ? 313 GLU A N   1 
ATOM   2230 C CA  . GLU A 1 290 ? -3.784  -11.575 1.809  1.00 33.70 ? 313 GLU A CA  1 
ATOM   2231 C C   . GLU A 1 290 ? -2.648  -11.830 2.795  1.00 33.17 ? 313 GLU A C   1 
ATOM   2232 O O   . GLU A 1 290 ? -2.861  -12.430 3.846  1.00 34.88 ? 313 GLU A O   1 
ATOM   2233 C CB  . GLU A 1 290 ? -4.378  -10.187 2.069  1.00 35.71 ? 313 GLU A CB  1 
ATOM   2234 C CG  . GLU A 1 290 ? -5.375  -9.721  1.017  1.00 41.53 ? 313 GLU A CG  1 
ATOM   2235 C CD  . GLU A 1 290 ? -4.699  -9.355  -0.295 1.00 46.00 ? 313 GLU A CD  1 
ATOM   2236 O OE1 . GLU A 1 290 ? -3.883  -8.401  -0.292 1.00 47.32 ? 313 GLU A OE1 1 
ATOM   2237 O OE2 . GLU A 1 290 ? -4.977  -10.019 -1.325 1.00 46.58 ? 313 GLU A OE2 1 
ATOM   2238 N N   . ASN A 1 291 ? -1.440  -11.387 2.473  1.00 31.43 ? 314 ASN A N   1 
ATOM   2239 C CA  . ASN A 1 291 ? -0.334  -11.604 3.401  1.00 31.31 ? 314 ASN A CA  1 
ATOM   2240 C C   . ASN A 1 291 ? -0.435  -10.658 4.592  1.00 31.32 ? 314 ASN A C   1 
ATOM   2241 O O   . ASN A 1 291 ? 0.222   -9.615  4.633  1.00 30.95 ? 314 ASN A O   1 
ATOM   2242 C CB  . ASN A 1 291 ? 1.013   -11.417 2.704  1.00 30.56 ? 314 ASN A CB  1 
ATOM   2243 C CG  . ASN A 1 291 ? 1.184   -12.339 1.513  1.00 30.28 ? 314 ASN A CG  1 
ATOM   2244 O OD1 . ASN A 1 291 ? 0.562   -13.401 1.435  1.00 29.15 ? 314 ASN A OD1 1 
ATOM   2245 N ND2 . ASN A 1 291 ? 2.041   -11.946 0.587  1.00 29.68 ? 314 ASN A ND2 1 
ATOM   2246 N N   . ILE A 1 292 ? -1.279  -11.035 5.551  1.00 30.52 ? 315 ILE A N   1 
ATOM   2247 C CA  . ILE A 1 292 ? -1.501  -10.257 6.768  1.00 30.76 ? 315 ILE A CA  1 
ATOM   2248 C C   . ILE A 1 292 ? -1.323  -11.191 7.963  1.00 30.11 ? 315 ILE A C   1 
ATOM   2249 O O   . ILE A 1 292 ? -1.895  -12.281 7.991  1.00 30.01 ? 315 ILE A O   1 
ATOM   2250 C CB  . ILE A 1 292 ? -2.962  -9.696  6.878  1.00 31.64 ? 315 ILE A CB  1 
ATOM   2251 C CG1 . ILE A 1 292 ? -3.551  -9.367  5.500  1.00 32.86 ? 315 ILE A CG1 1 
ATOM   2252 C CG2 . ILE A 1 292 ? -2.962  -8.443  7.740  1.00 30.83 ? 315 ILE A CG2 1 
ATOM   2253 C CD1 . ILE A 1 292 ? -2.982  -8.148  4.853  1.00 34.68 ? 315 ILE A CD1 1 
ATOM   2254 N N   . ILE A 1 293 ? -0.540  -10.762 8.947  1.00 28.92 ? 316 ILE A N   1 
ATOM   2255 C CA  . ILE A 1 293 ? -0.328  -11.552 10.156 1.00 27.20 ? 316 ILE A CA  1 
ATOM   2256 C C   . ILE A 1 293 ? -0.882  -10.749 11.344 1.00 27.07 ? 316 ILE A C   1 
ATOM   2257 O O   . ILE A 1 293 ? -0.761  -9.520  11.377 1.00 26.65 ? 316 ILE A O   1 
ATOM   2258 C CB  . ILE A 1 293 ? 1.172   -11.833 10.368 1.00 25.92 ? 316 ILE A CB  1 
ATOM   2259 C CG1 . ILE A 1 293 ? 1.672   -12.774 9.279  1.00 21.78 ? 316 ILE A CG1 1 
ATOM   2260 C CG2 . ILE A 1 293 ? 1.418   -12.414 11.754 1.00 23.55 ? 316 ILE A CG2 1 
ATOM   2261 C CD1 . ILE A 1 293 ? 3.141   -13.102 9.398  1.00 24.08 ? 316 ILE A CD1 1 
ATOM   2262 N N   . ALA A 1 294 ? -1.510  -11.428 12.302 1.00 26.13 ? 317 ALA A N   1 
ATOM   2263 C CA  . ALA A 1 294 ? -2.055  -10.738 13.468 1.00 26.86 ? 317 ALA A CA  1 
ATOM   2264 C C   . ALA A 1 294 ? -1.422  -11.326 14.719 1.00 27.75 ? 317 ALA A C   1 
ATOM   2265 O O   . ALA A 1 294 ? -1.578  -12.509 14.996 1.00 29.48 ? 317 ALA A O   1 
ATOM   2266 C CB  . ALA A 1 294 ? -3.581  -10.890 13.523 1.00 24.96 ? 317 ALA A CB  1 
ATOM   2267 N N   . SER A 1 295 ? -0.704  -10.497 15.471 1.00 28.20 ? 318 SER A N   1 
ATOM   2268 C CA  . SER A 1 295 ? -0.033  -10.938 16.695 1.00 25.74 ? 318 SER A CA  1 
ATOM   2269 C C   . SER A 1 295 ? -0.648  -10.276 17.918 1.00 25.14 ? 318 SER A C   1 
ATOM   2270 O O   . SER A 1 295 ? -1.070  -9.125  17.859 1.00 24.28 ? 318 SER A O   1 
ATOM   2271 C CB  . SER A 1 295 ? 1.444   -10.588 16.622 1.00 24.22 ? 318 SER A CB  1 
ATOM   2272 O OG  . SER A 1 295 ? 1.600   -9.214  16.324 1.00 23.30 ? 318 SER A OG  1 
ATOM   2273 N N   . ALA A 1 296 ? -0.703  -11.005 19.027 1.00 25.66 ? 319 ALA A N   1 
ATOM   2274 C CA  . ALA A 1 296 ? -1.267  -10.458 20.260 1.00 25.72 ? 319 ALA A CA  1 
ATOM   2275 C C   . ALA A 1 296 ? -0.330  -10.715 21.448 1.00 26.06 ? 319 ALA A C   1 
ATOM   2276 O O   . ALA A 1 296 ? 0.200   -11.817 21.617 1.00 26.37 ? 319 ALA A O   1 
ATOM   2277 C CB  . ALA A 1 296 ? -2.649  -11.054 20.508 1.00 25.33 ? 319 ALA A CB  1 
ATOM   2278 N N   . ALA A 1 297 ? -0.124  -9.691  22.271 1.00 27.24 ? 320 ALA A N   1 
ATOM   2279 C CA  . ALA A 1 297 ? 0.783   -9.805  23.408 1.00 28.40 ? 320 ALA A CA  1 
ATOM   2280 C C   . ALA A 1 297 ? 0.104   -9.945  24.765 1.00 30.16 ? 320 ALA A C   1 
ATOM   2281 O O   . ALA A 1 297 ? -1.110  -9.763  24.879 1.00 30.33 ? 320 ALA A O   1 
ATOM   2282 C CB  . ALA A 1 297 ? 1.719   -8.624  23.419 1.00 27.75 ? 320 ALA A CB  1 
ATOM   2283 N N   . LEU A 1 298 ? 0.903   -10.254 25.790 1.00 32.00 ? 321 LEU A N   1 
ATOM   2284 C CA  . LEU A 1 298 ? 0.399   -10.444 27.159 1.00 34.05 ? 321 LEU A CA  1 
ATOM   2285 C C   . LEU A 1 298 ? 0.170   -9.151  27.976 1.00 35.92 ? 321 LEU A C   1 
ATOM   2286 O O   . LEU A 1 298 ? 0.549   -8.072  27.520 1.00 35.36 ? 321 LEU A O   1 
ATOM   2287 C CB  . LEU A 1 298 ? 1.320   -11.415 27.893 1.00 32.39 ? 321 LEU A CB  1 
ATOM   2288 C CG  . LEU A 1 298 ? 1.360   -12.770 27.172 1.00 32.49 ? 321 LEU A CG  1 
ATOM   2289 C CD1 . LEU A 1 298 ? 2.298   -13.734 27.869 1.00 31.77 ? 321 LEU A CD1 1 
ATOM   2290 C CD2 . LEU A 1 298 ? -0.040  -13.349 27.127 1.00 32.20 ? 321 LEU A CD2 1 
ATOM   2291 N N   . GLU A 1 299 ? -0.430  -9.264  29.175 1.00 34.46 ? 322 GLU A N   1 
ATOM   2292 C CA  . GLU A 1 299 ? -0.773  -8.080  30.000 1.00 36.78 ? 322 GLU A CA  1 
ATOM   2293 C C   . GLU A 1 299 ? 0.241   -6.979  30.033 1.00 35.81 ? 322 GLU A C   1 
ATOM   2294 O O   . GLU A 1 299 ? -0.125  -5.816  30.123 1.00 36.03 ? 322 GLU A O   1 
ATOM   2295 C CB  . GLU A 1 299 ? -1.129  -8.391  31.478 1.00 39.18 ? 322 GLU A CB  1 
ATOM   2296 C CG  . GLU A 1 299 ? -0.081  -9.046  32.328 1.00 45.68 ? 322 GLU A CG  1 
ATOM   2297 C CD  . GLU A 1 299 ? -0.259  -10.578 32.167 1.00 49.49 ? 322 GLU A CD  1 
ATOM   2298 O OE1 . GLU A 1 299 ? -0.599  -10.975 31.046 1.00 49.11 ? 322 GLU A OE1 1 
ATOM   2299 O OE2 . GLU A 1 299 ? -0.123  -11.337 33.165 1.00 50.17 ? 322 GLU A OE2 1 
ATOM   2300 N N   . ASN A 1 300 ? 1.513   -7.334  29.980 1.00 38.28 ? 323 ASN A N   1 
ATOM   2301 C CA  . ASN A 1 300 ? 2.562   -6.338  30.014 1.00 37.27 ? 323 ASN A CA  1 
ATOM   2302 C C   . ASN A 1 300 ? 2.506   -5.395  28.811 1.00 36.32 ? 323 ASN A C   1 
ATOM   2303 O O   . ASN A 1 300 ? 2.979   -4.261  28.873 1.00 35.20 ? 323 ASN A O   1 
ATOM   2304 C CB  . ASN A 1 300 ? 3.908   -7.045  30.054 1.00 38.82 ? 323 ASN A CB  1 
ATOM   2305 C CG  . ASN A 1 300 ? 4.664   -6.781  31.325 1.00 39.16 ? 323 ASN A CG  1 
ATOM   2306 O OD1 . ASN A 1 300 ? 4.068   -6.563  32.384 1.00 37.21 ? 323 ASN A OD1 1 
ATOM   2307 N ND2 . ASN A 1 300 ? 5.991   -6.813  31.234 1.00 39.10 ? 323 ASN A ND2 1 
ATOM   2308 N N   . ASP A 1 301 ? 1.921   -5.879  27.720 1.00 36.14 ? 324 ASP A N   1 
ATOM   2309 C CA  . ASP A 1 301 ? 1.800   -5.128  26.471 1.00 34.03 ? 324 ASP A CA  1 
ATOM   2310 C C   . ASP A 1 301 ? 0.329   -4.808  26.139 1.00 33.41 ? 324 ASP A C   1 
ATOM   2311 O O   . ASP A 1 301 ? -0.011  -3.659  25.878 1.00 33.45 ? 324 ASP A O   1 
ATOM   2312 C CB  . ASP A 1 301 ? 2.449   -5.950  25.360 1.00 33.71 ? 324 ASP A CB  1 
ATOM   2313 C CG  . ASP A 1 301 ? 2.275   -5.342  23.998 1.00 33.28 ? 324 ASP A CG  1 
ATOM   2314 O OD1 . ASP A 1 301 ? 1.138   -4.979  23.646 1.00 33.25 ? 324 ASP A OD1 1 
ATOM   2315 O OD2 . ASP A 1 301 ? 3.281   -5.252  23.268 1.00 33.86 ? 324 ASP A OD2 1 
ATOM   2316 N N   . LYS A 1 302 ? -0.530  -5.824  26.148 1.00 32.40 ? 325 LYS A N   1 
ATOM   2317 C CA  . LYS A 1 302 ? -1.965  -5.664  25.879 1.00 32.03 ? 325 LYS A CA  1 
ATOM   2318 C C   . LYS A 1 302 ? -2.440  -5.256  24.475 1.00 30.57 ? 325 LYS A C   1 
ATOM   2319 O O   . LYS A 1 302 ? -3.607  -4.916  24.306 1.00 31.28 ? 325 LYS A O   1 
ATOM   2320 C CB  . LYS A 1 302 ? -2.576  -4.678  26.874 1.00 32.52 ? 325 LYS A CB  1 
ATOM   2321 C CG  . LYS A 1 302 ? -2.585  -5.127  28.319 1.00 34.46 ? 325 LYS A CG  1 
ATOM   2322 C CD  . LYS A 1 302 ? -3.200  -4.025  29.177 1.00 32.72 ? 325 LYS A CD  1 
ATOM   2323 C CE  . LYS A 1 302 ? -3.161  -4.366  30.638 1.00 31.14 ? 325 LYS A CE  1 
ATOM   2324 N NZ  . LYS A 1 302 ? -3.719  -3.232  31.414 1.00 36.12 ? 325 LYS A NZ  1 
ATOM   2325 N N   . THR A 1 303 ? -1.578  -5.292  23.469 1.00 28.65 ? 326 THR A N   1 
ATOM   2326 C CA  . THR A 1 303 ? -2.028  -4.898  22.140 1.00 28.07 ? 326 THR A CA  1 
ATOM   2327 C C   . THR A 1 303 ? -2.010  -5.979  21.069 1.00 27.31 ? 326 THR A C   1 
ATOM   2328 O O   . THR A 1 303 ? -1.499  -7.081  21.265 1.00 26.51 ? 326 THR A O   1 
ATOM   2329 C CB  . THR A 1 303 ? -1.209  -3.719  21.584 1.00 28.68 ? 326 THR A CB  1 
ATOM   2330 O OG1 . THR A 1 303 ? 0.159   -4.120  21.439 1.00 29.24 ? 326 THR A OG1 1 
ATOM   2331 C CG2 . THR A 1 303 ? -1.315  -2.502  22.506 1.00 27.29 ? 326 THR A CG2 1 
ATOM   2332 N N   . ILE A 1 304 ? -2.587  -5.629  19.925 1.00 26.20 ? 327 ILE A N   1 
ATOM   2333 C CA  . ILE A 1 304 ? -2.634  -6.505  18.767 1.00 26.93 ? 327 ILE A CA  1 
ATOM   2334 C C   . ILE A 1 304 ? -2.061  -5.695  17.609 1.00 28.26 ? 327 ILE A C   1 
ATOM   2335 O O   . ILE A 1 304 ? -2.428  -4.539  17.403 1.00 29.07 ? 327 ILE A O   1 
ATOM   2336 C CB  . ILE A 1 304 ? -4.075  -6.927  18.419 1.00 25.74 ? 327 ILE A CB  1 
ATOM   2337 C CG1 . ILE A 1 304 ? -4.694  -7.696  19.590 1.00 25.41 ? 327 ILE A CG1 1 
ATOM   2338 C CG2 . ILE A 1 304 ? -4.068  -7.788  17.161 1.00 22.60 ? 327 ILE A CG2 1 
ATOM   2339 C CD1 . ILE A 1 304 ? -6.211  -7.678  19.596 1.00 25.93 ? 327 ILE A CD1 1 
ATOM   2340 N N   . LYS A 1 305 ? -1.145  -6.299  16.864 1.00 29.86 ? 328 LYS A N   1 
ATOM   2341 C CA  . LYS A 1 305 ? -0.526  -5.629  15.729 1.00 30.31 ? 328 LYS A CA  1 
ATOM   2342 C C   . LYS A 1 305 ? -0.759  -6.398  14.418 1.00 30.99 ? 328 LYS A C   1 
ATOM   2343 O O   . LYS A 1 305 ? -0.725  -7.638  14.379 1.00 30.95 ? 328 LYS A O   1 
ATOM   2344 C CB  . LYS A 1 305 ? 0.975   -5.440  15.993 1.00 29.50 ? 328 LYS A CB  1 
ATOM   2345 C CG  . LYS A 1 305 ? 1.303   -4.309  16.963 1.00 29.31 ? 328 LYS A CG  1 
ATOM   2346 C CD  . LYS A 1 305 ? 2.657   -4.518  17.631 1.00 27.17 ? 328 LYS A CD  1 
ATOM   2347 C CE  . LYS A 1 305 ? 3.372   -3.205  17.887 1.00 27.66 ? 328 LYS A CE  1 
ATOM   2348 N NZ  . LYS A 1 305 ? 2.526   -2.157  18.507 1.00 27.49 ? 328 LYS A NZ  1 
ATOM   2349 N N   . LEU A 1 306 ? -1.011  -5.641  13.354 1.00 29.53 ? 329 LEU A N   1 
ATOM   2350 C CA  . LEU A 1 306 ? -1.250  -6.198  12.040 1.00 28.44 ? 329 LEU A CA  1 
ATOM   2351 C C   . LEU A 1 306 ? -0.096  -5.857  11.120 1.00 29.18 ? 329 LEU A C   1 
ATOM   2352 O O   . LEU A 1 306 ? 0.223   -4.695  10.905 1.00 29.81 ? 329 LEU A O   1 
ATOM   2353 C CB  . LEU A 1 306 ? -2.555  -5.649  11.468 1.00 27.72 ? 329 LEU A CB  1 
ATOM   2354 C CG  . LEU A 1 306 ? -3.818  -6.181  12.140 1.00 27.28 ? 329 LEU A CG  1 
ATOM   2355 C CD1 . LEU A 1 306 ? -5.044  -5.479  11.584 1.00 27.20 ? 329 LEU A CD1 1 
ATOM   2356 C CD2 . LEU A 1 306 ? -3.903  -7.669  11.897 1.00 25.90 ? 329 LEU A CD2 1 
ATOM   2357 N N   . TRP A 1 307 ? 0.524   -6.889  10.570 1.00 30.16 ? 330 TRP A N   1 
ATOM   2358 C CA  . TRP A 1 307 ? 1.651   -6.728  9.668  1.00 30.66 ? 330 TRP A CA  1 
ATOM   2359 C C   . TRP A 1 307 ? 1.320   -7.215  8.244  1.00 31.26 ? 330 TRP A C   1 
ATOM   2360 O O   . TRP A 1 307 ? 0.815   -8.321  8.053  1.00 31.30 ? 330 TRP A O   1 
ATOM   2361 C CB  . TRP A 1 307 ? 2.850   -7.502  10.228 1.00 31.23 ? 330 TRP A CB  1 
ATOM   2362 C CG  . TRP A 1 307 ? 2.916   -7.519  11.738 1.00 31.20 ? 330 TRP A CG  1 
ATOM   2363 C CD1 . TRP A 1 307 ? 2.037   -8.120  12.590 1.00 30.92 ? 330 TRP A CD1 1 
ATOM   2364 C CD2 . TRP A 1 307 ? 3.934   -6.939  12.562 1.00 30.18 ? 330 TRP A CD2 1 
ATOM   2365 N NE1 . TRP A 1 307 ? 2.443   -7.955  13.888 1.00 31.33 ? 330 TRP A NE1 1 
ATOM   2366 C CE2 . TRP A 1 307 ? 3.605   -7.234  13.899 1.00 30.58 ? 330 TRP A CE2 1 
ATOM   2367 C CE3 . TRP A 1 307 ? 5.094   -6.201  12.293 1.00 30.18 ? 330 TRP A CE3 1 
ATOM   2368 C CZ2 . TRP A 1 307 ? 4.395   -6.816  14.974 1.00 30.62 ? 330 TRP A CZ2 1 
ATOM   2369 C CZ3 . TRP A 1 307 ? 5.879   -5.787  13.362 1.00 30.25 ? 330 TRP A CZ3 1 
ATOM   2370 C CH2 . TRP A 1 307 ? 5.524   -6.096  14.687 1.00 31.02 ? 330 TRP A CH2 1 
ATOM   2371 N N   . LYS A 1 308 ? 1.603   -6.375  7.252  1.00 31.49 ? 331 LYS A N   1 
ATOM   2372 C CA  . LYS A 1 308 ? 1.347   -6.709  5.851  1.00 32.75 ? 331 LYS A CA  1 
ATOM   2373 C C   . LYS A 1 308 ? 2.649   -6.913  5.081  1.00 31.18 ? 331 LYS A C   1 
ATOM   2374 O O   . LYS A 1 308 ? 3.641   -6.225  5.319  1.00 28.81 ? 331 LYS A O   1 
ATOM   2375 C CB  . LYS A 1 308 ? 0.543   -5.595  5.162  1.00 33.98 ? 331 LYS A CB  1 
ATOM   2376 C CG  . LYS A 1 308 ? -0.957  -5.644  5.434  1.00 40.23 ? 331 LYS A CG  1 
ATOM   2377 C CD  . LYS A 1 308 ? -1.537  -4.317  5.958  1.00 41.78 ? 331 LYS A CD  1 
ATOM   2378 C CE  . LYS A 1 308 ? -1.645  -3.234  4.873  1.00 39.59 ? 331 LYS A CE  1 
ATOM   2379 N NZ  . LYS A 1 308 ? -2.361  -2.020  5.363  1.00 41.34 ? 331 LYS A NZ  1 
ATOM   2380 N N   . SER A 1 309 ? 2.647   -7.846  4.140  1.00 88.88 ? 332 SER A N   1 
ATOM   2381 C CA  . SER A 1 309 ? 3.846   -8.095  3.353  1.00 90.36 ? 332 SER A CA  1 
ATOM   2382 C C   . SER A 1 309 ? 3.504   -8.230  1.887  1.00 90.66 ? 332 SER A C   1 
ATOM   2383 O O   . SER A 1 309 ? 2.340   -8.399  1.527  1.00 91.09 ? 332 SER A O   1 
ATOM   2384 C CB  . SER A 1 309 ? 4.531   -9.373  3.816  1.00 91.16 ? 332 SER A CB  1 
ATOM   2385 O OG  . SER A 1 309 ? 3.657   -10.471 3.635  1.00 21.26 ? 332 SER A OG  1 
ATOM   2386 N N   . ASP A 1 310 ? 4.532   -8.167  1.050  1.00 89.48 ? 333 ASP A N   1 
ATOM   2387 C CA  . ASP A 1 310 ? 4.359   -8.282  -0.387 1.00 88.39 ? 333 ASP A CA  1 
ATOM   2388 C C   . ASP A 1 310 ? 4.442   -9.727  -0.852 1.00 87.51 ? 333 ASP A C   1 
ATOM   2389 O O   . ASP A 1 310 ? 5.422   -10.412 -0.603 1.00 86.35 ? 333 ASP A O   1 
ATOM   2390 C CB  . ASP A 1 310 ? 5.410   -7.442  -1.116 1.00 89.68 ? 333 ASP A CB  1 
ATOM   2391 C CG  . ASP A 1 310 ? 5.110   -5.953  -1.069 1.00 91.28 ? 333 ASP A CG  1 
ATOM   2392 O OD1 . ASP A 1 310 ? 4.058   -5.539  -1.600 1.00 91.74 ? 333 ASP A OD1 1 
ATOM   2393 O OD2 . ASP A 1 310 ? 5.930   -5.199  -0.506 1.00 92.35 ? 333 ASP A OD2 1 
ATOM   2394 N N   . ALA B 2 1   ? -6.311  -19.774 32.512 1.00 45.68 ? 1   ALA B N   1 
ATOM   2395 C CA  . ALA B 2 1   ? -6.124  -18.820 31.427 1.00 46.07 ? 1   ALA B CA  1 
ATOM   2396 C C   . ALA B 2 1   ? -4.812  -19.087 30.708 1.00 45.65 ? 1   ALA B C   1 
ATOM   2397 O O   . ALA B 2 1   ? -3.802  -19.398 31.339 1.00 46.05 ? 1   ALA B O   1 
ATOM   2398 C CB  . ALA B 2 1   ? -6.140  -17.393 31.970 1.00 45.76 ? 1   ALA B CB  1 
ATOM   2399 N N   . ARG B 2 2   ? -4.846  -18.967 29.383 1.00 44.96 ? 2   ARG B N   1 
ATOM   2400 C CA  . ARG B 2 2   ? -3.678  -19.184 28.532 1.00 44.58 ? 2   ARG B CA  1 
ATOM   2401 C C   . ARG B 2 2   ? -2.624  -18.108 28.812 1.00 45.04 ? 2   ARG B C   1 
ATOM   2402 O O   . ARG B 2 2   ? -1.441  -18.270 28.504 1.00 42.77 ? 2   ARG B O   1 
ATOM   2403 C CB  . ARG B 2 2   ? -4.110  -19.127 27.057 1.00 42.88 ? 2   ARG B CB  1 
ATOM   2404 C CG  . ARG B 2 2   ? -2.990  -19.316 26.035 1.00 40.81 ? 2   ARG B CG  1 
ATOM   2405 C CD  . ARG B 2 2   ? -3.468  -18.989 24.620 1.00 37.80 ? 2   ARG B CD  1 
ATOM   2406 N NE  . ARG B 2 2   ? -4.523  -19.893 24.173 1.00 36.07 ? 2   ARG B NE  1 
ATOM   2407 C CZ  . ARG B 2 2   ? -4.319  -21.149 23.793 1.00 36.25 ? 2   ARG B CZ  1 
ATOM   2408 N NH1 . ARG B 2 2   ? -3.092  -21.649 23.800 1.00 34.75 ? 2   ARG B NH1 1 
ATOM   2409 N NH2 . ARG B 2 2   ? -5.343  -21.909 23.413 1.00 37.39 ? 2   ARG B NH2 1 
ATOM   2410 N N   . THR B 2 3   ? -3.078  -17.018 29.418 1.00 46.50 ? 3   THR B N   1 
ATOM   2411 C CA  . THR B 2 3   ? -2.227  -15.883 29.734 1.00 49.65 ? 3   THR B CA  1 
ATOM   2412 C C   . THR B 2 3   ? -1.521  -15.975 31.090 1.00 52.17 ? 3   THR B C   1 
ATOM   2413 O O   . THR B 2 3   ? -0.938  -14.998 31.556 1.00 52.28 ? 3   THR B O   1 
ATOM   2414 C CB  . THR B 2 3   ? -3.052  -14.583 29.686 1.00 49.35 ? 3   THR B CB  1 
ATOM   2415 O OG1 . THR B 2 3   ? -4.141  -14.684 30.611 1.00 50.04 ? 3   THR B OG1 1 
ATOM   2416 C CG2 . THR B 2 3   ? -3.607  -14.347 28.279 1.00 47.55 ? 3   THR B CG2 1 
HETATM 2417 N N   . MLY B 2 4   ? -1.575  -17.146 31.717 1.00 55.53 ? 4   MLY B N   1 
HETATM 2418 C CA  . MLY B 2 4   ? -0.931  -17.367 33.012 1.00 58.49 ? 4   MLY B CA  1 
HETATM 2419 C CB  . MLY B 2 4   ? -1.999  -17.542 34.098 1.00 58.82 ? 4   MLY B CB  1 
HETATM 2420 C CG  . MLY B 2 4   ? -1.707  -16.826 35.409 1.00 60.02 ? 4   MLY B CG  1 
HETATM 2421 C CD  . MLY B 2 4   ? -1.676  -15.312 35.225 1.00 61.72 ? 4   MLY B CD  1 
HETATM 2422 C CE  . MLY B 2 4   ? -1.685  -14.587 36.569 1.00 62.14 ? 4   MLY B CE  1 
HETATM 2423 N NZ  . MLY B 2 4   ? -1.570  -13.086 36.587 1.00 63.44 ? 4   MLY B NZ  1 
HETATM 2424 C CH1 . MLY B 2 4   ? -0.418  -12.408 35.909 1.00 64.20 ? 4   MLY B CH1 1 
HETATM 2425 C CH2 . MLY B 2 4   ? -1.777  -12.302 37.842 1.00 62.92 ? 4   MLY B CH2 1 
HETATM 2426 C C   . MLY B 2 4   ? -0.077  -18.640 32.898 1.00 60.64 ? 4   MLY B C   1 
HETATM 2427 O O   . MLY B 2 4   ? -0.491  -19.607 32.254 1.00 60.46 ? 4   MLY B O   1 
ATOM   2428 N N   . GLN B 2 5   ? 1.104   -18.644 33.519 1.00 63.58 ? 5   GLN B N   1 
ATOM   2429 C CA  . GLN B 2 5   ? 2.005   -19.804 33.454 1.00 66.09 ? 5   GLN B CA  1 
ATOM   2430 C C   . GLN B 2 5   ? 1.589   -20.994 34.335 1.00 67.19 ? 5   GLN B C   1 
ATOM   2431 O O   . GLN B 2 5   ? 2.476   -21.566 35.011 1.00 67.42 ? 5   GLN B O   1 
ATOM   2432 C CB  . GLN B 2 5   ? 3.427   -19.371 33.825 1.00 66.94 ? 5   GLN B CB  1 
ATOM   2433 C CG  . GLN B 2 5   ? 4.011   -18.322 32.900 1.00 69.16 ? 5   GLN B CG  1 
ATOM   2434 C CD  . GLN B 2 5   ? 5.242   -17.651 33.478 1.00 71.14 ? 5   GLN B CD  1 
ATOM   2435 O OE1 . GLN B 2 5   ? 6.272   -18.288 33.693 1.00 72.89 ? 5   GLN B OE1 1 
ATOM   2436 N NE2 . GLN B 2 5   ? 5.137   -16.354 33.740 1.00 71.65 ? 5   GLN B NE2 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   24  24  GLY GLY A . n 
A 1 2   PRO 2   25  25  PRO PRO A . n 
A 1 3   LEU 3   26  26  LEU LEU A . n 
A 1 4   GLY 4   27  27  GLY GLY A . n 
A 1 5   SER 5   28  28  SER SER A . n 
A 1 6   THR 6   29  29  THR THR A . n 
A 1 7   PRO 7   30  30  PRO PRO A . n 
A 1 8   VAL 8   31  31  VAL VAL A . n 
A 1 9   LYS 9   32  32  LYS LYS A . n 
A 1 10  PRO 10  33  33  PRO PRO A . n 
A 1 11  ASN 11  34  34  ASN ASN A . n 
A 1 12  TYR 12  35  35  TYR TYR A . n 
A 1 13  ALA 13  36  36  ALA ALA A . n 
A 1 14  LEU 14  37  37  LEU LEU A . n 
A 1 15  LYS 15  38  38  LYS LYS A . n 
A 1 16  PHE 16  39  39  PHE PHE A . n 
A 1 17  THR 17  40  40  THR THR A . n 
A 1 18  LEU 18  41  41  LEU LEU A . n 
A 1 19  ALA 19  42  42  ALA ALA A . n 
A 1 20  GLY 20  43  43  GLY GLY A . n 
A 1 21  HIS 21  44  44  HIS HIS A . n 
A 1 22  THR 22  45  45  THR THR A . n 
A 1 23  LYS 23  46  46  LYS LYS A . n 
A 1 24  ALA 24  47  47  ALA ALA A . n 
A 1 25  VAL 25  48  48  VAL VAL A . n 
A 1 26  SER 26  49  49  SER SER A . n 
A 1 27  SER 27  50  50  SER SER A . n 
A 1 28  VAL 28  51  51  VAL VAL A . n 
A 1 29  LYS 29  52  52  LYS LYS A . n 
A 1 30  PHE 30  53  53  PHE PHE A . n 
A 1 31  SER 31  54  54  SER SER A . n 
A 1 32  PRO 32  55  55  PRO PRO A . n 
A 1 33  ASN 33  56  56  ASN ASN A . n 
A 1 34  GLY 34  57  57  GLY GLY A . n 
A 1 35  GLU 35  58  58  GLU GLU A . n 
A 1 36  TRP 36  59  59  TRP TRP A . n 
A 1 37  LEU 37  60  60  LEU LEU A . n 
A 1 38  ALA 38  61  61  ALA ALA A . n 
A 1 39  SER 39  62  62  SER SER A . n 
A 1 40  SER 40  63  63  SER SER A . n 
A 1 41  SER 41  64  64  SER SER A . n 
A 1 42  ALA 42  65  65  ALA ALA A . n 
A 1 43  ASP 43  66  66  ASP ASP A . n 
A 1 44  LYS 44  67  67  LYS LYS A . n 
A 1 45  LEU 45  68  68  LEU LEU A . n 
A 1 46  ILE 46  69  69  ILE ILE A . n 
A 1 47  LYS 47  70  70  LYS LYS A . n 
A 1 48  ILE 48  71  71  ILE ILE A . n 
A 1 49  TRP 49  72  72  TRP TRP A . n 
A 1 50  GLY 50  73  73  GLY GLY A . n 
A 1 51  ALA 51  74  74  ALA ALA A . n 
A 1 52  TYR 52  75  75  TYR TYR A . n 
A 1 53  ASP 53  76  76  ASP ASP A . n 
A 1 54  GLY 54  77  77  GLY GLY A . n 
A 1 55  LYS 55  78  78  LYS LYS A . n 
A 1 56  PHE 56  79  79  PHE PHE A . n 
A 1 57  GLU 57  80  80  GLU GLU A . n 
A 1 58  LYS 58  81  81  LYS LYS A . n 
A 1 59  THR 59  82  82  THR THR A . n 
A 1 60  ILE 60  83  83  ILE ILE A . n 
A 1 61  SER 61  84  84  SER SER A . n 
A 1 62  GLY 62  85  85  GLY GLY A . n 
A 1 63  HIS 63  86  86  HIS HIS A . n 
A 1 64  LYS 64  87  87  LYS LYS A . n 
A 1 65  LEU 65  88  88  LEU LEU A . n 
A 1 66  GLY 66  89  89  GLY GLY A . n 
A 1 67  ILE 67  90  90  ILE ILE A . n 
A 1 68  SER 68  91  91  SER SER A . n 
A 1 69  ASP 69  92  92  ASP ASP A . n 
A 1 70  VAL 70  93  93  VAL VAL A . n 
A 1 71  ALA 71  94  94  ALA ALA A . n 
A 1 72  TRP 72  95  95  TRP TRP A . n 
A 1 73  SER 73  96  96  SER SER A . n 
A 1 74  SER 74  97  97  SER SER A . n 
A 1 75  ASP 75  98  98  ASP ASP A . n 
A 1 76  SER 76  99  99  SER SER A . n 
A 1 77  ASN 77  100 100 ASN ASN A . n 
A 1 78  LEU 78  101 101 LEU LEU A . n 
A 1 79  LEU 79  102 102 LEU LEU A . n 
A 1 80  VAL 80  103 103 VAL VAL A . n 
A 1 81  SER 81  104 104 SER SER A . n 
A 1 82  ALA 82  105 105 ALA ALA A . n 
A 1 83  SER 83  106 106 SER SER A . n 
A 1 84  ASP 84  107 107 ASP ASP A . n 
A 1 85  ASP 85  108 108 ASP ASP A . n 
A 1 86  LYS 86  109 109 LYS LYS A . n 
A 1 87  THR 87  110 110 THR THR A . n 
A 1 88  LEU 88  111 111 LEU LEU A . n 
A 1 89  LYS 89  112 112 LYS LYS A . n 
A 1 90  ILE 90  113 113 ILE ILE A . n 
A 1 91  TRP 91  114 114 TRP TRP A . n 
A 1 92  ASP 92  115 115 ASP ASP A . n 
A 1 93  VAL 93  116 116 VAL VAL A . n 
A 1 94  SER 94  117 117 SER SER A . n 
A 1 95  SER 95  118 118 SER SER A . n 
A 1 96  GLY 96  119 119 GLY GLY A . n 
A 1 97  LYS 97  120 120 LYS LYS A . n 
A 1 98  CYS 98  121 121 CYS CYS A . n 
A 1 99  LEU 99  122 122 LEU LEU A . n 
A 1 100 LYS 100 123 123 LYS LYS A . n 
A 1 101 THR 101 124 124 THR THR A . n 
A 1 102 LEU 102 125 125 LEU LEU A . n 
A 1 103 LYS 103 126 126 LYS LYS A . n 
A 1 104 GLY 104 127 127 GLY GLY A . n 
A 1 105 HIS 105 128 128 HIS HIS A . n 
A 1 106 SER 106 129 129 SER SER A . n 
A 1 107 ASN 107 130 130 ASN ASN A . n 
A 1 108 TYR 108 131 131 TYR TYR A . n 
A 1 109 VAL 109 132 132 VAL VAL A . n 
A 1 110 PHE 110 133 133 PHE PHE A . n 
A 1 111 CYS 111 134 134 CYS CYS A . n 
A 1 112 CYS 112 135 135 CYS CYS A . n 
A 1 113 ASN 113 136 136 ASN ASN A . n 
A 1 114 PHE 114 137 137 PHE PHE A . n 
A 1 115 ASN 115 138 138 ASN ASN A . n 
A 1 116 PRO 116 139 139 PRO PRO A . n 
A 1 117 GLN 117 140 140 GLN GLN A . n 
A 1 118 SER 118 141 141 SER SER A . n 
A 1 119 ASN 119 142 142 ASN ASN A . n 
A 1 120 LEU 120 143 143 LEU LEU A . n 
A 1 121 ILE 121 144 144 ILE ILE A . n 
A 1 122 VAL 122 145 145 VAL VAL A . n 
A 1 123 SER 123 146 146 SER SER A . n 
A 1 124 GLY 124 147 147 GLY GLY A . n 
A 1 125 SER 125 148 148 SER SER A . n 
A 1 126 PHE 126 149 149 PHE PHE A . n 
A 1 127 ASP 127 150 150 ASP ASP A . n 
A 1 128 GLU 128 151 151 GLU GLU A . n 
A 1 129 SER 129 152 152 SER SER A . n 
A 1 130 VAL 130 153 153 VAL VAL A . n 
A 1 131 ARG 131 154 154 ARG ARG A . n 
A 1 132 ILE 132 155 155 ILE ILE A . n 
A 1 133 TRP 133 156 156 TRP TRP A . n 
A 1 134 ASP 134 157 157 ASP ASP A . n 
A 1 135 VAL 135 158 158 VAL VAL A . n 
A 1 136 LYS 136 159 159 LYS LYS A . n 
A 1 137 THR 137 160 160 THR THR A . n 
A 1 138 GLY 138 161 161 GLY GLY A . n 
A 1 139 LYS 139 162 162 LYS LYS A . n 
A 1 140 CYS 140 163 163 CYS CYS A . n 
A 1 141 LEU 141 164 164 LEU LEU A . n 
A 1 142 LYS 142 165 165 LYS LYS A . n 
A 1 143 THR 143 166 166 THR THR A . n 
A 1 144 LEU 144 167 167 LEU LEU A . n 
A 1 145 PRO 145 168 168 PRO PRO A . n 
A 1 146 ALA 146 169 169 ALA ALA A . n 
A 1 147 HIS 147 170 170 HIS HIS A . n 
A 1 148 SER 148 171 171 SER SER A . n 
A 1 149 ASP 149 172 172 ASP ASP A . n 
A 1 150 PRO 150 173 173 PRO PRO A . n 
A 1 151 VAL 151 174 174 VAL VAL A . n 
A 1 152 SER 152 175 175 SER SER A . n 
A 1 153 ALA 153 176 176 ALA ALA A . n 
A 1 154 VAL 154 177 177 VAL VAL A . n 
A 1 155 HIS 155 178 178 HIS HIS A . n 
A 1 156 PHE 156 179 179 PHE PHE A . n 
A 1 157 ASN 157 180 180 ASN ASN A . n 
A 1 158 ARG 158 181 181 ARG ARG A . n 
A 1 159 ASP 159 182 182 ASP ASP A . n 
A 1 160 GLY 160 183 183 GLY GLY A . n 
A 1 161 SER 161 184 184 SER SER A . n 
A 1 162 LEU 162 185 185 LEU LEU A . n 
A 1 163 ILE 163 186 186 ILE ILE A . n 
A 1 164 VAL 164 187 187 VAL VAL A . n 
A 1 165 SER 165 188 188 SER SER A . n 
A 1 166 SER 166 189 189 SER SER A . n 
A 1 167 SER 167 190 190 SER SER A . n 
A 1 168 TYR 168 191 191 TYR TYR A . n 
A 1 169 ASP 169 192 192 ASP ASP A . n 
A 1 170 GLY 170 193 193 GLY GLY A . n 
A 1 171 LEU 171 194 194 LEU LEU A . n 
A 1 172 CYS 172 195 195 CYS CYS A . n 
A 1 173 ARG 173 196 196 ARG ARG A . n 
A 1 174 ILE 174 197 197 ILE ILE A . n 
A 1 175 TRP 175 198 198 TRP TRP A . n 
A 1 176 ASP 176 199 199 ASP ASP A . n 
A 1 177 THR 177 200 200 THR THR A . n 
A 1 178 ALA 178 201 201 ALA ALA A . n 
A 1 179 SER 179 202 202 SER SER A . n 
A 1 180 GLY 180 203 203 GLY GLY A . n 
A 1 181 GLN 181 204 204 GLN GLN A . n 
A 1 182 CYS 182 205 205 CYS CYS A . n 
A 1 183 LEU 183 206 206 LEU LEU A . n 
A 1 184 LYS 184 207 207 LYS LYS A . n 
A 1 185 THR 185 208 208 THR THR A . n 
A 1 186 LEU 186 209 209 LEU LEU A . n 
A 1 187 ILE 187 210 210 ILE ILE A . n 
A 1 188 ASP 188 211 211 ASP ASP A . n 
A 1 189 ASP 189 212 212 ASP ASP A . n 
A 1 190 ASP 190 213 213 ASP ASP A . n 
A 1 191 ASN 191 214 214 ASN ASN A . n 
A 1 192 PRO 192 215 215 PRO PRO A . n 
A 1 193 PRO 193 216 216 PRO PRO A . n 
A 1 194 VAL 194 217 217 VAL VAL A . n 
A 1 195 SER 195 218 218 SER SER A . n 
A 1 196 PHE 196 219 219 PHE PHE A . n 
A 1 197 VAL 197 220 220 VAL VAL A . n 
A 1 198 LYS 198 221 221 LYS LYS A . n 
A 1 199 PHE 199 222 222 PHE PHE A . n 
A 1 200 SER 200 223 223 SER SER A . n 
A 1 201 PRO 201 224 224 PRO PRO A . n 
A 1 202 ASN 202 225 225 ASN ASN A . n 
A 1 203 GLY 203 226 226 GLY GLY A . n 
A 1 204 LYS 204 227 227 LYS LYS A . n 
A 1 205 TYR 205 228 228 TYR TYR A . n 
A 1 206 ILE 206 229 229 ILE ILE A . n 
A 1 207 LEU 207 230 230 LEU LEU A . n 
A 1 208 ALA 208 231 231 ALA ALA A . n 
A 1 209 ALA 209 232 232 ALA ALA A . n 
A 1 210 THR 210 233 233 THR THR A . n 
A 1 211 LEU 211 234 234 LEU LEU A . n 
A 1 212 ASP 212 235 235 ASP ASP A . n 
A 1 213 ASN 213 236 236 ASN ASN A . n 
A 1 214 THR 214 237 237 THR THR A . n 
A 1 215 LEU 215 238 238 LEU LEU A . n 
A 1 216 LYS 216 239 239 LYS LYS A . n 
A 1 217 LEU 217 240 240 LEU LEU A . n 
A 1 218 TRP 218 241 241 TRP TRP A . n 
A 1 219 ASP 219 242 242 ASP ASP A . n 
A 1 220 TYR 220 243 243 TYR TYR A . n 
A 1 221 SER 221 244 244 SER SER A . n 
A 1 222 LYS 222 245 245 LYS LYS A . n 
A 1 223 GLY 223 246 246 GLY GLY A . n 
A 1 224 LYS 224 247 247 LYS LYS A . n 
A 1 225 CYS 225 248 248 CYS CYS A . n 
A 1 226 LEU 226 249 249 LEU LEU A . n 
A 1 227 LYS 227 250 250 LYS LYS A . n 
A 1 228 THR 228 251 251 THR THR A . n 
A 1 229 TYR 229 252 252 TYR TYR A . n 
A 1 230 THR 230 253 253 THR THR A . n 
A 1 231 GLY 231 254 254 GLY GLY A . n 
A 1 232 HIS 232 255 255 HIS HIS A . n 
A 1 233 LYS 233 256 256 LYS LYS A . n 
A 1 234 ASN 234 257 257 ASN ASN A . n 
A 1 235 GLU 235 258 258 GLU GLU A . n 
A 1 236 LYS 236 259 259 LYS LYS A . n 
A 1 237 TYR 237 260 260 TYR TYR A . n 
A 1 238 CYS 238 261 261 CYS CYS A . n 
A 1 239 ILE 239 262 262 ILE ILE A . n 
A 1 240 PHE 240 263 263 PHE PHE A . n 
A 1 241 ALA 241 264 264 ALA ALA A . n 
A 1 242 ASN 242 265 265 ASN ASN A . n 
A 1 243 PHE 243 266 266 PHE PHE A . n 
A 1 244 SER 244 267 267 SER SER A . n 
A 1 245 VAL 245 268 268 VAL VAL A . n 
A 1 246 THR 246 269 269 THR THR A . n 
A 1 247 GLY 247 270 270 GLY GLY A . n 
A 1 248 GLY 248 271 271 GLY GLY A . n 
A 1 249 LYS 249 272 272 LYS LYS A . n 
A 1 250 TRP 250 273 273 TRP TRP A . n 
A 1 251 ILE 251 274 274 ILE ILE A . n 
A 1 252 VAL 252 275 275 VAL VAL A . n 
A 1 253 SER 253 276 276 SER SER A . n 
A 1 254 GLY 254 277 277 GLY GLY A . n 
A 1 255 SER 255 278 278 SER SER A . n 
A 1 256 GLU 256 279 279 GLU GLU A . n 
A 1 257 ASP 257 280 280 ASP ASP A . n 
A 1 258 ASN 258 281 281 ASN ASN A . n 
A 1 259 LEU 259 282 282 LEU LEU A . n 
A 1 260 VAL 260 283 283 VAL VAL A . n 
A 1 261 TYR 261 284 284 TYR TYR A . n 
A 1 262 ILE 262 285 285 ILE ILE A . n 
A 1 263 TRP 263 286 286 TRP TRP A . n 
A 1 264 ASN 264 287 287 ASN ASN A . n 
A 1 265 LEU 265 288 288 LEU LEU A . n 
A 1 266 GLN 266 289 289 GLN GLN A . n 
A 1 267 THR 267 290 290 THR THR A . n 
A 1 268 LYS 268 291 291 LYS LYS A . n 
A 1 269 GLU 269 292 292 GLU GLU A . n 
A 1 270 ILE 270 293 293 ILE ILE A . n 
A 1 271 VAL 271 294 294 VAL VAL A . n 
A 1 272 GLN 272 295 295 GLN GLN A . n 
A 1 273 LYS 273 296 296 LYS LYS A . n 
A 1 274 LEU 274 297 297 LEU LEU A . n 
A 1 275 GLN 275 298 298 GLN GLN A . n 
A 1 276 GLY 276 299 299 GLY GLY A . n 
A 1 277 HIS 277 300 300 HIS HIS A . n 
A 1 278 THR 278 301 301 THR THR A . n 
A 1 279 ASP 279 302 302 ASP ASP A . n 
A 1 280 VAL 280 303 303 VAL VAL A . n 
A 1 281 VAL 281 304 304 VAL VAL A . n 
A 1 282 ILE 282 305 305 ILE ILE A . n 
A 1 283 SER 283 306 306 SER SER A . n 
A 1 284 THR 284 307 307 THR THR A . n 
A 1 285 ALA 285 308 308 ALA ALA A . n 
A 1 286 CYS 286 309 309 CYS CYS A . n 
A 1 287 HIS 287 310 310 HIS HIS A . n 
A 1 288 PRO 288 311 311 PRO PRO A . n 
A 1 289 THR 289 312 312 THR THR A . n 
A 1 290 GLU 290 313 313 GLU GLU A . n 
A 1 291 ASN 291 314 314 ASN ASN A . n 
A 1 292 ILE 292 315 315 ILE ILE A . n 
A 1 293 ILE 293 316 316 ILE ILE A . n 
A 1 294 ALA 294 317 317 ALA ALA A . n 
A 1 295 SER 295 318 318 SER SER A . n 
A 1 296 ALA 296 319 319 ALA ALA A . n 
A 1 297 ALA 297 320 320 ALA ALA A . n 
A 1 298 LEU 298 321 321 LEU LEU A . n 
A 1 299 GLU 299 322 322 GLU GLU A . n 
A 1 300 ASN 300 323 323 ASN ASN A . n 
A 1 301 ASP 301 324 324 ASP ASP A . n 
A 1 302 LYS 302 325 325 LYS LYS A . n 
A 1 303 THR 303 326 326 THR THR A . n 
A 1 304 ILE 304 327 327 ILE ILE A . n 
A 1 305 LYS 305 328 328 LYS LYS A . n 
A 1 306 LEU 306 329 329 LEU LEU A . n 
A 1 307 TRP 307 330 330 TRP TRP A . n 
A 1 308 LYS 308 331 331 LYS LYS A . n 
A 1 309 SER 309 332 332 SER SER A . n 
A 1 310 ASP 310 333 333 ASP ASP A . n 
A 1 311 CYS 311 334 ?   ?   ?   A . n 
B 2 1   ALA 1   1   1   ALA ALA B . n 
B 2 2   ARG 2   2   2   ARG ARG B . n 
B 2 3   THR 3   3   3   THR THR B . n 
B 2 4   MLY 4   4   4   MLY LME B . n 
B 2 5   GLN 5   5   5   GLN GLN B . n 
B 2 6   THR 6   6   ?   ?   ?   B . n 
B 2 7   ALA 7   7   ?   ?   ?   B . n 
B 2 8   ARG 8   8   ?   ?   ?   B . n 
B 2 9   MLY 9   9   ?   ?   ?   B . n 
B 2 10  SER 10  10  ?   ?   ?   B . n 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    B 
_pdbx_struct_mod_residue.label_comp_id    MLY 
_pdbx_struct_mod_residue.label_seq_id     4 
_pdbx_struct_mod_residue.auth_asym_id     B 
_pdbx_struct_mod_residue.auth_comp_id     MLY 
_pdbx_struct_mod_residue.auth_seq_id      4 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   LYS 
_pdbx_struct_mod_residue.details          N-DIMETHYL-LYSINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-09-06 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .   ? 1 
SCALEPACK 'data scaling'   .   ? 2 
AMoRE     phasing          .   ? 3 
CNS       refinement       1.1 ? 4 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             C 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             GLY 
_pdbx_validate_rmsd_angle.auth_seq_id_1              24 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             N 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_2              25 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_3              25 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                129.73 
_pdbx_validate_rmsd_angle.angle_target_value         119.30 
_pdbx_validate_rmsd_angle.angle_deviation            10.43 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.50 
_pdbx_validate_rmsd_angle.linker_flag                Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO A 25  ? ? -36.56  -37.57  
2  1 SER A 28  ? ? 177.80  -7.14   
3  1 THR A 29  ? ? -149.01 49.27   
4  1 GLU A 80  ? ? -117.13 -70.24  
5  1 LEU A 88  ? ? -127.33 -152.93 
6  1 SER A 141 ? ? 46.26   26.29   
7  1 ASP A 150 ? ? -59.16  -1.84   
8  1 ARG A 181 ? ? -33.03  -37.30  
9  1 PRO A 224 ? ? -68.14  6.42    
10 1 LEU A 234 ? ? -68.20  46.23   
11 1 VAL A 268 ? ? -137.61 -33.93  
12 1 VAL A 303 ? ? -34.41  133.95  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A CYS 334 ? A CYS 311 
2 1 Y 1 B THR 6   ? B THR 6   
3 1 Y 1 B ALA 7   ? B ALA 7   
4 1 Y 1 B ARG 8   ? B ARG 8   
5 1 Y 1 B MLY 9   ? B MLY 9   
6 1 Y 1 B SER 10  ? B SER 10  
#